2QRNA

Human deoxycytidine kinase dcmp, udp, mg ion product complex
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
241
structure length
228
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Deoxycytidine kinase
publication title Structures of human deoxycytidine kinase product complexes.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 228
sequence length 241
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2007-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qrnA00
2V6IA 3B9QA 1YZQA 3NBFA 1KI2A 2GF0A 4NKRA 1TAGA 2ZJBA 1MKYA 3K0AB 4BRUA 1ETUA 2ZRHA 3PEWA 5DN6A 2WHXA 4DEXA 2ODBA 1RC8A 4KVAA 4QBIA 1E9CA 3EA5A 4HUQA 4FCWA 5TY0A 5CDFA 1QRAA 2PMKA 1W2HA 3RAPR 4DDWA 4WXPA 3NEJA 2FN4A 2JIZD 2D3WA 2QEQA 4PFSA 2VF7A 1E2QA 1KZ7B 1W1WA 4NYIR 2EQBA 2GWHA 1OYWA 4QM7A 3Q7QA 3VR4A 3DKVA 2OFWA 1QHHB 3RSLA 3PUXA 4RZ3A 4MRSA 1YR6A 1QHNA 2ANCA 4PC7A 2WM9B 1XBTA 1KOFA 2REOA 3LH5A 3R8CA 1ZNWA 2P3SA 4D4KA 3IIJA 1JEEA 4MGKR 1VG8A 2JLVA 1QF9A 1Z29A 4W7SA 1XF9A 4DRZA 4AC9A 2CLDX 2AXNA 3LLMA 4X8OA 2VHCA 3OIUA 2GILA 1KY2A 2Z0MA 4B3GA 2CXXA 3EWSA 3ZVRA 4YMUA 1CJVC 4I81A 1YZGA 3B1ZA 4JLJA 2QI9C 3BAFA 4DC9A 2O8DA 1I2DA 2O52A 4B2PA 2F55A 1ZM2A 1CU1A 2H5EA 3AKYA 3U4QA 1R10A 421PA 3KZ1E 2AD5A 1M74A 2IYQA 2W0SA 1G3RA 2JJ1A 4O25A 4Q00A 4OHYA 3DM5A 3N2IA 1Y3AA 4QGHA 2BV3A 1GTVA 1GSIA 2W83A 3U3OA 4PPQA 1CBUA 4QHYA 5HTKA 1GILA 1E6CA 2GCOA 2GVZC 1Q1ZA 2G1KA 5DO9A 4FMDB 4ERNA 5L3QA 3I32A 4B6FA 1G8PA 4CT5A 2QPTA 1Z0KA 2GK7A 4MYCA 3W8RA 4DIDA 2NG1A 2ZS9A 3CKLA 4CF7A 4JYBA 2A5GA 4Q4HA 3SYNA 4C4PA 3GLHA 3Q85A 1FUKA 1S1CA 3W6OA 1JQLB 1S9DA 1T8TA 3ZGXA 1W36C 4D4JA 5J5CA 3NBXX 5JLJA 1RRFA 4L8GA 4PSAA 4Q7MB 1L2TA 4NYMQ 1FX0A 3EPKA 1P60A 2PCJA 3SEAA 5CM8B 1CJUC 1E9EA 4JS0A 4NE2A 2DBYA 4Q1AA 5EP2A 3WMGA 4CVNA 3GLIB 1W36D 3W34A 2F43A 4OQFA 3PJRA 1RYFA 1Z6TA 1R5BA 2P5SA 4BLSA 2ZJYA 5L8VA 4URWR 2QA5A 2CE7A 3BORA 3U6KA 3BFVA 2ZE8A 4EFLA 2FSIA 1X8LA 5K8UA 4UNRA 2GXQA 5F9HA 3LWNA 3W5JA 1M6NA 1RW4A 1MO3A 4A8JA 3ZS8A 2QMUA 4BQSA 4JZKA 1J99A 4BUJA 1E9RA 1P2SA 3HR8A 4HLQB 4TYNA 1AZTA 3O8DA 4MRRA 4N1AA 4PAMA 5LB2A 4AKIA 4WZBE 4CEIA 3T06B 2SHKA 1ZIPA 1ZMXA 5FH9A 1TL7C 4FMBB 1N6KA 3GEHA 3IIMA 3D8BA 3ZJYA 3SFZA 1N5JA 2P6NA 3FVQA 1QVAA 1GKUB 4RCZA 1GUAA 2YWFA 3EG5A 5EUQB 3L0PA 2CL0X 3PV0A 1SVOA 2WJGA 3MUFA 5FTNA 1KO7A 4B47A 1SGWA 4N0EA 5KDDA 1OSNA 1LY1A 4LBYA 4PZYA 2QP9X 1KSGA 5JECA 2OV2A 3H86A 1L4UA 4LRWA 1VMAA 4ZDKA 2GETA 1I2MA 2PX0A 2WTUA 4CEHB 2JJ2A 1VG9B 2J0SA 4KV9A 4KODA 4B2LA 1RYHA 3AUYA 2WWWA 1I4DD 4NPHA 4HZUB 2R2AA 4OK6A 2CLSA 3GFOA 4G5OA 3ZVMA 3BOSA 2HV8A 1JAIA 3N5CA 2D74A 3REGA 4LHVA 5G40A 3OIYA 3ADBA 3MD0A 3X2SA 4RFVA 2ZR7A 3C4JA 1NLZA 4M2LA 3ZQ6A 2JASA 2DFKB 2G3YA 2EU8A 1IXSB 4C2UA 3NKVA 4ILEA 2ZRGA 5JWRA 5JSZA 4BEBA 3B82A 5DGXA 3IBYA 2I4IA 1P2TA 3IEUA 2QT1A 1VG1A 4OQNA 3SJCA 2R65A 3LXXA 1N6OA 4TLCA 4HAZA 4D2IA 721PA 1J70A 2R6FA 2HF8A 4TMXA 3TW8B 4AURA 5FOXA 1KI4A 1KMHA 2K5UA 2ZE7A 3GQBA 5JMTA 5G3ZA 2GJ8A 2HLDD 2HYDA 2UVQA 2FGKA 5KUTA 2ZRKA 2ZJZA 4G5QA 3TQFA 3U60B 3CWQA 4ARZB 3U2QA 2ZJAA 3M1IA 4Q1CA 3PUWA 121PA 1X3SA 3VHXA 3LNCA 2F1IA 1IY1A 1UEIA 1HYQA 1WBDA 3LW7A 3THWA 1KNQA 4EQ6A 1XFAA 2HEIA 4BFTA 4LPSA 2V7QD 3L8ZA 4OK3A 2Q0HA 5DIFA 5KSOA 1OXXK 4JL8A 4TMVA 5FUWA 3OEED 2QMEA 4I4LA 3GLGB 4BFWA 2FFHA 3CIOA 4HUQB 1TU3A 1G4UR 3RRMA 4OQLA 1TQ4A 4C0KA 3N2EA 4LY6A 1JEDA 1G8HA 2ZITA 2VSFA 5BW8A 2ANBA 1WMSA 4D26A 3IHLA 3MWKA 3OF5A 2R6CA 3QG1A 2ZRJA 2QGZA 4ZCIA 3B85A 2XITA 2FZLA 2Z4RA 1OT3A 3E1SA 4TSFD 1V5WA 3R9IA 4LX0A 2OBNA 4B75A 3TGPA 1R7RA 4G01B 5EE3A 3F5FA 4M53A 4L15A 2KI5A 1AKEA 5AUPB 1M34E 3QOFA 4LI0A 5K8TA 3KFXA 1G16A 1M8PA 2ZSEA 2IEZA 2ZRMA 2AK2A 3RC3A 1T8UA 3C41J 5TMPA 1BIFA 1P9WA 2RGCA 1KY3A 1ZW6A 5DLQC 1U94A 1AS3A 4BFVA 4Q7JB 4XSHA 5GVRA 1G1MA 2O8DB 2ZSDA 4FN5A 1BS1A 1NLYA 1N5KA 3AF4A 4QHTA 2ZETA 3U4QB 2WWIA 2BM1A 4O2LA 3ZH9B 1QDEA 5EZ5A 1Z6XA 1KO4A 2NPIA 3FKSA 1XD9A 4DLVA 1G7SA 2J9RA 2WSSA 4LYJA 1NMZA 2VP5A 4IOMA 2OXRA 1OFHA 2DFLA 4IVPA 2PMDA 1JQJC 2PBRA 1NP6A 5M04A 4QNRA 3AVVA 1SXJC 2VP2A 4LCBA 3ZD6A 1P73A 5C46F 2GCOB 1LNZA 4LJ6A 2OCBA 4M1SA 5L3QB 3TE6A 2YZ2A 3MWJA 2ORWA 3I73A 3KB2A 4HDOB 1P62B 1SXJD 5FR1A 5E3HA 5LPNA 4Q4HB 2AR7A 3BC1A 4AD8A 2VF8A 3DDCA 1N5LA 3WNCA 1A1VA 1R6BX 4KVGA 2WAYA 1RKBA 4ZDJA 1OIXA 3QJYA 1YZUA 3BWDD 3T61A 2C9YA 3C16C 1KHTA 2XSZA 5TB5A 1QBKC 4A0GA 3LRPA 3QKRA 3TW4A 4QBHA 2A3RA 3KKNA 1IY0A 4CRWB 1M1YE 1FX0B 3A1TA 5TDHA 2P6RA 3V00A 2WJYA 2ZYTX 2NO7A 2WJJA 3DVLA 1YZTA 3TSWA 2W58A 4GBMA 2ZTSA 3CO5A 2GZHA 1YZKA 3EARA 4OI1A 1GL6A 3ZYCA 2C9OA 2CCKA 3EAQA 5B64A 3M6AA 4MRPA 3MFYA 1SVIA 1BMFD 3BK7A 3Q7PA 2WSMA 3PFIA 4NDZA 1OHHD 2CLCX 3IGFA 4A8JB 4F38A 4IDOA 3V4FA 5AK0A 2C95A 3HPRA 3FMPB 4I1UA 4CYMA 2GEUA 4LJ4A 2OE2A 4CEIB 3AF0A 4ABYA 2QAJA 3TVTA 3PVSA 1U9IC 2WOJA 4TZ6A 1YR8A 1JR3A 4DLTA 1F3OA 1Q1BA 1T0HB 3HJNA 4B3XA 2FGJA 2GXUA 2OLKA 3MJRA 4NCIA 4C0LA 2IXFA 3LV8A 5H68A 3KJEA 1XPUA 1JPJA 1N6RA 1IAQA 3KQUA 1HQYE 1KI7A 1CP2A 1AM4D 2XAUA 2VTKA 1UKVY 2IL1A 4PC3A 5E95A 2FSHA 3OAAA 4JL5A 5EP3A 4ZDWA 2V8OA 1XTJA 2FSFA 3D6TB 5FL3A 3RYTC 4C9BA 1U8YA 3E70C 3KJGA 3QQ5A 4TL8A 3RS3A 1SULA 2WKRA 2WWGA 2QPOA 1E2LA 4N3NA 4TQAA 4KYIB 3PEYA 3NTUA 2NQ2C 2XOKA 2IYWA 4DWJA 4N0DA 3W5IA 5JCZA 5FTMA 1EG7A 2O8FA 2W0MA 4PZLA 4QJ4A 2ZREA 2ZJ8A 3QPWA 1BO6A 3FFAA 1KZGB 1E96A 2CJWA 4IFEA 1DO2A 2RGXA 4FMCB 2FEOA 4KBGA 4D0NA 4DLZA 2CL7X 2ZE6A 1WCV1 3QEJA 4JVSB 2N1BA 2GESA 5EJEA 5C4GB 5CJPA 1J7KA 2RGGA 2YVUA 4OKSA 1GRQA 2A5FA 2BC9A 3LY5A 1KMHB 5DH9A 1GL7A 3PUYA 3SJZA 4A6XA 2IYTA 2IC5A 3DHWC 3VQTA 2QUZA 2WJHA 2FOLA 2PH1A 1OLOA 2HYIC 1E1RD 4KLZA 3THWB 4JVLA 4KFUA 4EQ6B 4LJ9A 4KO8A 4DLXA 1FUUA 1JB1A 3QBVA 3QUSA 4Z8YA 4C0JA 3OFND 2F3RA 4NCHA 4M1WA 1R4AA 1G41A 1KK0A 4J0QA 2AX4A 3U61B 1IQPA 1T4GA 2IWRA 1GAJA 4A36A 4ZCMA 1RPZA 1II0A 1YVDA 2HF9A 1HEIA 3A1UA 2IXEA 1TPZA 1W4BA 2Z4SA 2GKSA 3VR3A 4YXWD 1Z6YA 1OH6A 3FDIA 1B23P 4URVR 1D9ZA 2P5TB 2QZ4A 1NG1A 2BWJA 1DE0A 1G21E 2OLJA 5BYJA 1FNMA 2BVNA 2HXYA 2ZUCA 3W9YA 1XZPA 3PITA 1YU9A 1SXJE 4GFDA 3LVQE 1GNRA 5K8IA 1RRGA 1G3MA 4KXFB 3U3MA 3RS7A 5IRCD 4RD1A 1UM8A 4XWOA 3AGQA 4HI0E 1UJ2A 3I92A 3OEHA 1UFQA 3U7HB 3EIEA 3EPHA 4I99A 5E4FA 1PLJA 4Q01A 4K46A 3DOEA 2V3CC 1A7JA 1N0WA 1DS6A 1ANKA 4KBFA 2XB2A 3EIQA 1XXHA 1B0UA 3EPLA 4Q4JA 5DE3A 4BEJA 3QVUA 1DTSA 2HJVA 4PHHA 3SYLA 2QAGA 4ASUD 2QY9A 3IEVA 3G5UA 5J40A 3RABA 1XJCA 2A5JA 2R6AA 2DY1A 2IYXA 1Z22A 4B3DA 1VG0B 1N2CE 5FOWA 1CTQA 1JJVA 2VSXA 2G9NA 4X8LA 5EZ6B 4JVNA 3TR0A 3O8CA 1UEJA 3DL0A 3CLVA 4R2HA 3B6EA 4CEJA 2ZSBA 3B60A 2A9KA 1N0VC 2OO7A 4ZI3A 2IX3A 1NN0A 3RS2A 1N6IA 1E2JA 5CIWA 4E5UA 5E7IA 1CR2A 2W6JA 2GCPA 5FPYA 5CM9C 3U5ZB 2L0XA 4Q9IA 3GMTA 1QHSA 2RHDA 3FHOA 1Q1QA 1J2JA 1NBMA 3QKRB 2HUPA 1LV7A 4JL6A 1N0UA 3ADKA 2NGRA 4HDCA 1X1RA 2W00A 4MGIR 4RD4A 4OJQA 2EYQA 2J5XA 1VYTA 2KBFA 4Q9JA 2R44A 3UATA 4EPWA 3SC3A 2WPDA 4M1YA 1XWIA 1LFDB 5LD2B 1UDXA 2ZYVX 5FI0B 3GEIA 1E2FA 1E98A 5DI3A 1YR7A 1G17A 1TEXA 2FMXA 3SHFA 5IT5A 3GLFA 2OCPA 2GJAA 3Q5EA 1KAOA 2BKEA 2QTHA 3SS8A 3NXSA 5DN6D 1HA3A 4POAA 3VX3A 4OHVA 4TYWA 1DAHA 1IOZA 1EFRA 4KFRA 2R6GA 2IT1A 1XTKA 4KSBA 4AK9A 4BFYA 1DAIA 1Z28A 1AZSC 1JECA 1NN5A 2WBLC 2QMHA 2ZS7A 5H8WA 1P5ZB 2ZRIA 3R7WA 2CK3A 4NZYA 1OV4A 4B32A 3OIVA 821PA 4JLVA 4LC0A 3CWZA 1NVVR 1EFTA 2CCJA 1YZNA 1AA9A 4LGMA 1IN7A 3ICQB 4KJZA 1U8ZA 4HSEA 1W4RA 2VH5R 1N6PA 4GP6A 5GVSA 2BKUA 3H2YA 4JLDA 1KGDA 1NN1A 2AXPA 4LBVA 3BXZA 2FDCA 3LAWA 1JXMA 3GLIE 1XCGB 2RMKA 3B78A 1KSJA 2Z5FA 4US2R 1OH8A 2CNWA 2VP6A 5C1BA 1KI6B 4EFNA 2QRNA 2GNOA 3TRFA 4UXHA 3CW2A 2CJWB 2JJ1D 1G9XA 1KIMA 1Z0FA 1UKYA 1Q12A 3NDBB 5FFMA 4IW3B 1AGPA 1EFCA 1IBRA 2DHRA 2VHQA 4PXAA 4Q48A 5KNCA 2J0QA 1P61B 1JJ7A 3AKDA 1QG4A 2IEYA 3T1QA 1W0KA 1YKSA 4TLBA 2DCUA 3K09A 1RJ9B 4K81B 5EUMA 4B34A 4EPVA 3NEYA 4PQYA 4W5WA 4WZAE 1R0WA 4ARZA 1EESA 3EXAA 1ZC3A 5HZKA 4JT4A 4BGDA 1VTKA 5SZHB 1XEWX 4TYYA 4MITA 1YZLA 1OYYA 3BE4A 2QENA 4UQOA 4A2QA 2HXSA 5JS7A 4PHFA 4TT3A 4RD3A 4JLKA 1ZAKA 4US0R 5GJWC 2EWWA 3AH8A 4GL2A 5H70A 4MUBA 1YQTA 2MSCB 3GLGA 1KSFX 3UKDA 1WF3A 2HDNB 4V0NA 2IA5A 3X1DA 1ZBDA 2ODWA 2P67A 2VPPA 4Q19A 1Z2AA 2REXB 2V1XA 3C7KA 4XJXA 5AWFC 4U5XA 4DLWA 2P65A 1KK1A 1JALA 2OG2A 4A8JC 2FPLA 2GZAA 3FHCB 4MRNA 5FTJA 2KJQA 3H1TA 1S4QA 2D7DA 1IJEA 3PEVA 2Q9AA 3E5HA 4QG7A 3BB4A 4IOKA 1FQKA 1PV4A 1TQDA 2Q21A 3NHBA 4QFMA 3WBKA 4V0KA 3UMRA 4YDSA 4TZ0A 2LCFA 4FINA 3CX6A 4C2TA 1UKEA 3K0FA 3UG6A 4HLDA 3REFA 4Q1FA 2CHVA 3U3JA 1OXSC 1GVNB 3D7MA 4E07A 3AF3A 3C5HA 3A1WA 4NONA 2GJSA 4RCYA 1NY5A 4NU0A 3CZQA 5JWHA 3QKTA 3ICEA 3SQXA 4B48A 2PX3A 4M22A 5DISB 1L8QA 1NN3A 4QRHA 1XXHB 4TQUS 4Y0VA 1TTTA 4M1OA 4Q4JB 4ZV4A 4U02A 4B73A 4GDFA 1E2IA 2REBA 3PENA 2C98A 2FG5A 2W6IA 4B3BA 2PJZA 2QAGB 2GK6A 5FR2A 2EVWX 3I4LA 1LF0A 2QSZA 2JJ2D 1OXTA 3EWAA 4YDHB 2OSBA 3L2OB 4NCJA 4QGGA 2NOAA 5FUXA 1E3MA 2ZVQX 4JLMA 4OK5A 4A2WA 5JJIA 4CEJB 1KO8A 2MSEB 5A5GA 3UANA 1A2BA 1T91A 4TMWA 3PUZA 3LBNA 4M1MA 1S3GA 3CB4A 2WMOB 1MRNA 1ZVQA 1ZNXA 1BOFA 4YMVA 3RS4A 3NWJA 1E9DA 4PQRA 5J4VA 1XTSA 2ZYUX 5FTKA 5DYGA 5EE1A 4B3FX 2ZR0A 1IN5A 2HT6A 5P21A 2FWRA 2H16A 4MDFA 2ZIAA 3P4YA 5CYOA 1ZU4A 2NPFA 5GADl 2JATA 2PEZA 1P72A 2OFOA 2QN6A 1E2NA 5HR5A 3ZD7A 1DAKA 2CL6X 1ZUIA 2OBMA 4RFSA 1EWRA 1U2RA 1VIAA 1RIFA 1U0JA 5DI3B 3GLFB 1KYIA 4NYJQ 3P1JA 3MJHA 4XTCS 2H7VA 3KXIA 1HE8B 4LBWA 1XRJA 1S3SA 2C77A 1ESMA 1UBEA 2VP0A 5CJ2A 3FKQA 3UWOA 3K0CC 2F3TA 2XNSA 2BBTA 3L0OA 2XTNA 3LQRA 3WMEA 3I5XA 1W48A 5BN4A 4LHZA 3TNFA 4LJAA 3SR0A 1XMSA 3R7WB 1HUQA 2XX3A 3FMFA 2AKAB 3B2EA 1T5LA 4JLOA 3B1XA 1XDBA 2XJ4A 4GOXA 2IS6A 3AVPA 4PPNA 3OZXA 1C1YA 3P20A 1H8HA 2F1RA 4MQBA 3CRRA 1G8FA 2JAQA 3VNVA 2OZEA 4URYR 3GLHE 3M4YA 4M9QA 5IK2A 1OIVA 2C96A 2H92A 1OH7A 1SKYB 1KO5A 1LB1B 4HEJA 4NCNA 4IOLA 1UKZA 3TUZC 4FMDF 1LVGA 1JAHA 2P6UA 2ZQ5A 3MCAA 1MO6A 1BYUA 1XTIA 3ONWA 5EQTA 2FE4A 4R98A 3AB3A 3K9LA 1Z47A 1BYIA 3MWLA 4CIDA 4JJZA 3SE0A 1K8RA 1DAGA 3GPLA 2VHJA 1UADA 4PHGA 2ZE5A 2ZXUA 1XMIA 2KE5A 3J81k 2F7SA 5B30A 1NL3A 2RGEA 3FOZA 4WA7A 2CE2X 4GMXA 3FKSD 3IO3A 5FTLA 2WSSD 4XIGS 2V55B 1TQ6A 4Z8XA 2AFIE 3VMFA 3GFPA 4LWZA 3FHTA 2GXAA 4IFBA 3LD9A 1IM2A 2VQSA 4Y0AA 1G5RA 3QSYA 4R7ZA 2ERYA 4IDQA 3T5DA 3KKOA 2X1VA 4MH0R 3P32A 5FBQB 4HAWA 3KB1A 2GA8A 2ECKA 4M0LA 1UBGA 2JJ8A 3A1VA 2H1LA 1FFHA 3GCGA 3RRZA 5LDDC 4LV5B 1U99A 1LF5A 2ZI6A 1G3UA 3ADCA 4F4CA 4M21A 2AWOA 3RRNA 2J7KA 2XSZD 4I1OA 3WHLA 3TVDA 521PA 4NYIQ 3DKPA 3AVQA 2YJTD 1E2PA 4Q4LA 2WMNB 4BZPA 1X1SA 5A4JA 1GITA 1CULC 4ACBA 4HDQB 3F8TA 2J3EA 5LD2C 5HKKA 4DCNA 3JZMA 2XJ9A 1NJFA 4QGAA 4UNSA 1OPXA 2GVDC 5JJKA 2H18A 2OT3B 4JT2A 1FNNA 4LPKA 5BYKA 5J4YA 3JVUA 1CXZA 2F9LA 3SBDA 5FBWB 3BFXA 2QPAA 4YLGA 2IW3A 4LJ7A 1G5TA 1N5IA 1ZNZA 1WDTA 1QHYA 1E69A 4DVGA 2B8WA 4RY2A 2LKDA 1LTQA 4W5JA 4F93B 2DPXA 4V03A 1ELOA 1Z0JA 3K0FB 1EGAA 4QHSA 1XJ0A 4GZLA 4HB4A 4DLSA 2JGNA 3B7GA 4OQMA 1P4SA 1JR3D 1X8KA 2XXAB 1NG9A 3RWMB 2JEOA 2BJVA 4KHZA 2YWGA 4IDHA 4MYUA 3RS0A 2IUTA 3BJIC 1XMJA 3LW8A 2A5DA 2ODNA 2NMVA 3WYAA 3VU9A 4JLNA 3KKPA 4TYQA 3WP0A 3C14C 4IOJA 4QJ5A 3OESA 2J59A 4DLUA 1Q1EA 2IHBA 5EP4A 1OFTA 3ADDA 1X86B 1NVWQ 4DB4A 1D2EA 3QPUA 3GD7A 1ZRHA 2V4ZA 2XGJA 1DADA 2AL7A 5CYPA 1M2OB 3OAAD 2JDIA 3TIFA 3AUXA 2J45A 5FI1B 4BWYA 1Z08A 4DEYA 1MR3F 3NDPA 3NH9A 1OE0A 4HYYA 4Q9LA 1IN4A 4I1VA 4PPFA 2C78A 4R2IA 5JHGB 1CIPA 2E1RA 5KNBA 3K70B 2CVFA 2IBMA 4GOKA 1U81A 2RKOA 3A6PC 2XOKD 1IHUA 5L3VA 4LYFA 1VECA 2RCNA 1J90A 2EFCB 1CLUA 2EFGA 4NHOA 1G6OA 1GKIA 2OM2A 1COWA 1S2MA 3QXXA 5FPKA 1M7GA 2GJ9A 4WVFA 4B6EA 4PO8A 4OI0A 4RZXA 3K0SA 1G3QA 1FQJA 3TKLA 1FP7A 1TNDA 3AF1A 3PEUA 2ONJA 1QHGA 2BEKA 4D82A 2DFTA 1R5OA 4PTLA 1NIJA 2RGBA 2H57A 3LQQA 4F92B 3CRQA 2A7QA 1KDTA 4M8NE 1R8QA 3OE7A 1ZM9A 4M1KA 4RFSB 1G6HA 4B44A 3I8XA 4M9ZA 1TMKA 3TJZA 3CF2A 1OB5A 2VBCA 2ODEA 4PAOA 5JI2E 2IS2A 2QNRA 1X6VA 3QG5A 3DM9B 4KSCA 1J8YF 2BHRA 1KAGA 4QKQA 4AKHA 1OXUA 2XNDA 2FFBA 2OHFA 3CF6R 1C9KA 4OI2A 4YC7A 4V02A 3A1SA 4OBEA 5IF9A 3EZ2A 2VLIA 4EJSA 2OCYC 2XEXA 5DNYB 4BZQA 2VSOA 4JKIA 2X77A 1Q57A 1TUEA 1GDDA 1TEVA 3UMSA 2GBLA 3RANA 2JLZA 4FD2A 5EE5B 3CPEA 4DDTA 5JEDA 4JSYA 1AJEA 2IF2A 2ZANA 3LBHA 4I1SA 4F91B 3IDQA 3UMFA 1K6MA 1U0LA 3TAHA 2PLRA 3IQWA 1GP2A 2WKQA 5H1YA 4BECA 2NO0A 4YMTA 3QEOA 4P3YA 3OEHD 1E2HA 3NC0C 4OYHA 1XD2A 1T3HA 5FUVA 3TSZA 3BH6A 2QROA 1G291 4MUAA 1U90A 2WZQA 5JJLA 2RGNA 4DSTA 2QAGC 2ATXA 3AVUA 4V0LA 1KI6A 1ZD9A 2OCAA 3QXHA 5AJZA 2ZEJA 3RDPA 5FPHA 4UJ3A 3ASZA 1ZD8A 4Q9KA 1M7BA 4BLOA 4TTPA 1KKLA 4MKHA 3QBTA 5KDLA 2CDNA 2CEAA 5G53C 5AUOB 4Q1DA 3P27A 3TAUA 1Z2CA 2O5VA 4BLRA 5J47A 1ONBA 1RJ9A 2OILA 1MABA 2FEMA 2X2FA 5FL7A 1GRNA 1JR3E 3GEEA 1PUJA 3CPJB 1KK2A 2PT7A 1FMLA 2OAQ1 4S2EA 2W6JD 1T3SA 2ZRDA 1BH2A 2BDTA 1XCMA 1NBMD 2O8BA 4MDEA 1XTQA 4BFSA 5DYIA 3NC1C 3SI7A 1F60A 1P9NA 4F4IA 2ZRLA 3U3KA 1FZQA 1R0XA 1YRAA 2FPKA 3T12A 4QM6A 4A0FA 1EK0A 3RHFA 4DJTA 2G77B 3HWSA 2GEVA 2WPDD 5EXSA 4A1FA 1E1QA 4XWAA 4Q9HA 2N46A 2B92A 3TLXA 4LSGA 4B76A 1W46A 2BMJA 1OKKA 2DFNA 3QI2A 1S8FA 1UBFA 4TTRA 2BMEA 1NIPA 4LHWA 3C8UA 1ZUHA 3AF2A 3BGWA 3QKSA 4QL3A 1VPLA 2IWHA 1GIAA 2AFHE 1Z0AA 2BBOA 2BBWA 3K0EA 4DDUA 1F2UB 3V9PA 4AG6A 3FPAA 3KL4A 3Q9LA 1RFLA 1EFRD 4OL0A 5L3SB 3KQHA 4FCTA 2O0HA 1ZM7A 4WOPA 3G0HA 1WBBA 4YONB 1F5NA 3UXMA 2XB4A 1QHIA 2DYKA 3A37A 3PQCA 2O0JA 3IIKA 2CK3D 5BQ5A 3I1FA 1ZM4A 3VU9B 1VCIA 1W5SA 5TV2A 3HU3A 2J41A 3FMOB 5A0FA 4EPTA 4FMCF 3L43A 1WA5A 3QF4A 1ZIOA 4Q21A 3GJXC 1HE1C 4TL6A 2NIPA 3ZDQA 3CH4B 3DZDA 4IRUB 1Z07A 3W8NA 1SQ5A 4Q4AA 2EW1A 5D3MA 5KTYA 1GM5A 1JPNA 3LBIA 1BKDR 1NI3A 4URUR 2UKDA 4NH0A 3I61A 1RVDA 3S1AA 4E09A 3MLEA 3ND8A 4AG5A 1E0JA 2ZPTX 3QF7A 2Q6TA 5HZHA 1RE0A 4JLPA 4JBYA 2CNWD 4C0BA 5L3RA 4MGZR 1AS2A 1FMJA 2IS1A 3AP1A 3GJ7A 3WY9A 2EWVA 1T3LA 1T9HA 3B13B 2TMKA 2IYRA 2NO1A 3CBQA 1E2MA 2ZM5A 2JLYA 3EC1A 1XP8A 2MMGA 1RRPA 3TQCA 1E79A 1ZUNB 2DWQA 3K09C 3O8BA 3KJIA 5AUQA 5UKDA 2X19A 4PANA 4B2IA 2WVJA 1JNYA 2EFDB 2GXSA 4JBXA 3GJ4A 3UK6A 2JLUA 3QPVA 1W0KD 5GJVC 2ZS8A 5KSPA 3UWKA 2HCBA 3Q5DA 3KQNA 4DSOA 1W47A 1XMVA 4RD0A 1KTVA 4NL4H 3IILA 1D9XA 2P2LA 3L82B 3CM0A 3SJBA 3AM1A 4LV8B 4WIAA 3KFVA 4DCVA 4DLYA 1XXHE 4TT3D 1PJRA 2X8AA 1K5GA 3EZ9A 3THOA 1FW6A 3KXKA 2VA8A 1UPTA 2BCJQ 5ELXA 4JLBA 2CBZA 2W2VA 3SDZA 4ZO4A 4XOIA 4EJSB 2R6DA 1FP6A 2D06A 2OFXA 3WXMA 2ERXA 3WMFA 5FOVA 4AYTA 2J7PA 2IS4A 4IXMA 4GNKA 3IUYA 1DAEA 4NYMR 4D0LB 1MV5A 4Q1EA 3C15C 4V0MA 1Q0UA 3B1YA 5CK5A 1XX6A 1Q44A 5CIQA 1Z06A 2OESA 3A4LA 1CJKC 3W6NA 1TADA 4Q02A 5C4MA 3ZZTA 5J4KA 2Q9CA 3I72A 1XPRA 3EASA 4TLDA 1HURA 2BCGY 4KAXA 1D5CA 1NBME 3Q72A 4HB0A 3GJ6A 4MRVA 4AYXA 2Q9BA 2LKCA 3JVVA 3K1JA 1NLFA 2V1UA 1XD2B 3K9NA 4O0MA 2QQEA 4PR0A 2CCGA 2QL6A 5FBVB 2QBYB 5EXTA 2QTFA 2PZGA 2QRZA 2VRWA 3W3ZB 3IPYA 2V54A 1HV8A 2PEYA 2C04A 2A30A 4PC2A 1D2NA 3U44B 3CNLA 2NTYC 1VCNA 4RD2A 3FWYA 2R9VA 2W6ID 4TQ9A 3NG1A 4FXPA 1Q20A 4AKGA 1H8EA 3GLFE 2YWEA 3L0SA 3AVOA 4LV6A 4B33A 1XEWY 3K70C 3VHLB 2GAAA 1W4AA 4RJLA 2ZRPA 4QJ3A 5KSYA 4Q03A 2WOOA 4C7OA 3R20A 4NP6A 3IPXA 1E9SA 1OJLA 4MYHA 2RH5A 1MABB 3QE0A 4DUGA 2YNMA 2ORVA 3TUIC 3K70D 2OBLA 3CF0A 2QP3A 2D7CA 4XD7A 1GZSA 4JMPA 3VR5A 2W2TA 3KKMA 4IDPA 3ZS9A 2HCJB 1X8JA 1NSFA 1XEXB 3X1XA 3ETLA 2MSDB 4Z1MA 4FWIB 4YMSA 2O8BB 1G3IA 1GFIA 4P4TA 2GF9A 4P31A 2QE7A 4FIDA 3RWOA 3HP1A 1WQ1R 4XWKA 2E87A 5AJXA 4O3MA 2ZVPX 1A4RA 3H0KA 2XTZA 1HH4A 1OH5A 4XVRA 1XU4A 8OHMA 4G3XA 4A0HA 5EP1A 1C4OA 4BASA 1T0JB 4IVRA 4PC6A 4Q7KA 4RKFA 3TH5A 1GWNA 1XTRA 5JCPA 3KUDA 3N70A 2WWYA 2GTPA 3WRXC 2AKYA 4KYUA 1XD8A 2ZU6A 3A4NA 2PLFA 5K8LA 1KDPA 2FU5C 2ZJ2A 1OB2A 2JLXA 1H65A 4U7DA 4HAUA 3W3AA 2NO6A 3JZAA 3QKSB 3NH6A 2Z83A 5DHFA 2FNAA 3L8YA 1KJYA 4XH9B 3GJ3A 3C5CA 3AP2A 4ITRC 1VCMA 4NCKA 2QT0A 4EPYA 4TLAA 2YHSA 1HT1E 5LBIA 4TMTA 4IKEA 2XXAA 2J0UA 1VKJA 5KPDA 3TUJC 1Z5ZA 2R8RA 2ZROA 1CR1A 5J4LA 2IHYA 3CH5A 4D0GA 4F7WA 4W5HA 3AP3A 4IDNA 3A8TA 3WP1B 2ZJ5A 2UZ3A 3QF4B 2ASEA 3VNUA 1H8HD 3SBEA 2Q3FA 1IN8A 3VFDA 2X2EA 3M0EA 5JBQA 4UNPA 5C2JB 3H84A 4HLUA 1CJMA 1G64A 1L4YA 3PR1A 5IK2D 1TF2A 4A92A 1AK2A 1US8A 1NKTA 2WJVA 4Q4AB 5D3MB 1QG2A 2CVHA 3EX7C 4CDGA 3GLGE 3S1AB 4W9MC 5CDFE 1R2QA 4P4UA 4PQFA 3FYHA 5DSZA 1E4VA 3WYGA 5AJYA 4DT1A 1ZCAA 2JLRA 2IXGA 4ON9A 4G1UC 4JKYA 3ZVLA 1XZQA 2ZU0C 5KOYA 5HPYB 1W0JA 1E0SA 3CPHA 4UKDA 4X8HA 1IY2A 4URZR 3O8RA 3ZIAA 3THXA 4YMWA 4IHQA 1AS0A 1NF3A 1TQ2A 1GKYA 4ZKEA 1CR4A 2GAOA 3HYTA 4GT1A 1CJTC 4ZKDA 4JVMA 2OXCA 1W44A 3GFTA 2JA1A 3BD9A 1R5NA 1P75A 2C9CA 3KJHA 4L9WA 2ZJOA 4A0RA 4AKEA 4CW7A 3B5JA 3ND9A 4AYWA 3EA0A 4E03A 6Q21A 3X1YA 3RLFA 2ZRAA 3PCRB 3D31A 2I1QA 1MOZA 4FI3C 4Q5IA 2VIIA 4LUCA 4P0TA 3RSOA 4CGZA 2IUSA 4PSKA 5BWMA 1YR9A 1N6NA 4FWTA 4QBGB 1XEFA 2JIZA 3SU8A 1NKSA 2XZOA 5DHAA 4PC1A 1NVVQ 5HKKD 1QHXA 2CMKA 1GG2A 2WIAA 1E2KA 4M9XA 1FOEB 3CONA 4RZ2A 4EIWA 1MO4A 5KO2A 1CRPA 4PAQA 1E9BA 4A15A 1OW3B 4ESHA 1RRCA 4WBSA 2BEJA 2Q3MA 2J46A 1WXQA 2JLWA 1DELA 1NMYA 1Q21A 2ZSAA 5FBLB 1SVKA 2WJIA 2IUUA 4H9GA 1W5TA 1L7VC 1UBCA 3KXLA 1UF9A 4AIIA 5IHPA 3MRSA 5BN5A 3O47A 2F1JA 5BXQC 4BZXA 2ZSFA 2C2HA 3BB1A 5LB4A 1GRRA 3RRYA 4DSUA 1TF5A 2YYZA 4XVQA 1V43A 4RD6A 2CHGA 5ANRB 1I4LD 4KCGA 3R9XA 1UDWA 4QGFA 4OQXA 5CK4A 1S0UA 1G19A 3F3YA 1O3YA 3VR1A 2ZI7A 3DMNA 3K9GA 1WE2A 3WNDA 5KSZA 3PUVA 2F6RA 3ZVNA 1P3JA 1SVLA 3LX5A 1LS6A 2N42A 4HB2A 1GOTA 3AGPA 4DSNA 1WB9A 2DWOA 2RGDA 5CLQA 2J1LA 3R9WA 3CX8A 3IKJA 2JDID 1KK3A 4BLQA 1HT2E 4C7OB 3FFBA 2YC4C 1TX4B 2IYVA 2A78A 4P4SA 1LS1A 1GL9B 2IYUA 3T5GA 3KDSE 4O2RA 1JR6A 2EYUA 3AEZA 4QNMA 2BIFA 4GRAA 4KFSA 5SZKB 1VHTA 4G5RA 3THYB 2NO9A 3TMKA 3SZRA 1COWD 2GJKA 3LDAA 1II9A 4LK2A 3MMPA 2C8VA 4GSYA 3P26A 2O8CA 3LVRE 1OXVA 3CZPA 4XVUA 1A2KC 1F2TA 4BLPA 1Z8FA 3SJAA 3P4XA 4K8OA 1ZU5A 3GJ0A 4TLEA 1OFIA 5EE9A 4KITB 4D25A 2VP4A 3E2IA 3OE7D 4EPRA 3PIRA 5AR1A 4A6PA 1CRQA 1FTNA 4TL7A 5E7MA 2CHQA 2PJRA 3HR7A 3IHWA 4YQFA 2D2FA 3B1WA 3ZZ0A 1E2GA 2W2XA 2YC2C 1DG1G 3I3SR 4QOSA 2GHIA 4EJSC 1DAMA 2JCSA 1AQUA 3RNLA 1EXMA 1XB2A 2Q3HA 3W6PA 2ATVA 2XNDD 1SVMA 4CT4B 4BLTA 2GBLC 4PX9A 1F2UA 2QQ0A 3LXRA 1IN6A 4EKDA 2Y8EA 4RSGA 4LHXA 4BRWA 5L3SA 1CS4C 3BRWD 3AV0B 2FV8A 4QXAA 2J0UB 5FPTA 3K0CA 5EXXA 1EX6A 2VYFA 4OHZA 5KDOA 2IK8A 2NZJA 3B1VA 1LW7A 2R62A 1VDZA 3R8FA 2WIBA 5SZIA 3NIBA 5CB8A 3SOPA 1SVSA 3HYRA 1E9FA 4TYPA 5B2ZA 2G6BA 5AJVB 2YKGA 1KDOA 2UZIR 1VCOA 4IXNA 3KTAA 5FBRB 3I5YA 1ZD1A 1US8B 3QKUA 3ZLJA 1DARA 2GRJA 1KDRA 2PCLA 2XZPA 4PO1A 2RGNC 4EPXA 3EZFA 2C5LA 2OUKA 4LYHA 1SVWA 4A82A 3MGCA 4R71A 2OAP1 2D4HA 2O8EA 4MKFA 1Z6AA 4Q47A 2LWIA 5KHOC 2VHTA 3F0TA 2B8TA 2FPMA 1U0HC 1YRBA 4LYAA 5TXGA 4DT1B 1M7HA 4EDHA 1F48A 1J8MF 3VKWA 4P32A 3HU1A 4AWXA 2IYYA 4M4SA 4MKIA 3AVXA 3LO5A 1ZC4A 4LHYA 4JSTA 3AKCA 3THXB 3DMDA 2EFEB 2FA9A 1DO0A 3IBGA 2RHMA 4MA4A 1HQCA 1DBSA 1S9HA 3G82C 2DWPA 2KB0A 4JBWA 4Q66C 2HLDA 1DG3A 4B74A 1DVRA 4P33A 4EFMA 1KI9A 4A9AA 1F6BA 2PL3A 3BBPA 3VKHA 3WRYC 3U7GA 2OEPA 4TL9A 4FCVA 3T15A 5FL7D 1VYVA 5HE8A 3U6BA 5JWOA 3GLHB 2GCNA 3QIAA 4HB3A 4URXR 1XJQA 1Z83A 2V7QA 5J4HA 4Q1BA 1EFHA 2ONKA 3X1ZA 4B3CA 3OEEA 3OIWA 4F4JA 5JRJA 1G7CA 3EIHA 4IVQA 4DDVA 3BB3A 4D80A 2BMDA 1HY3A 2IYSA 2PZFA 4Q18A 4ZCLA 5IDVA 2F43B 2I1VB 2FZ4A 1PVOA 4C30A 3ZZUA 1KI3A 5E7JA 4CZ2A 2DR3A 2ZAMA 1JXOA 3Q8XB 3V4RA 3X1WA 1E9AA 2XTMA 3UG7A 4C3ZA 3CRW1 1E1QD 1Z6GA 3T1OA 1KJZA 4UNNA 3KQKA 3NBZC 2VL7A 3NBYC 1CKEA 3GJ5A 4TSFA 5HE9A 1NY6A 1OKKD 3BH0A 4LDJA 1QVRA 1D6JA 1NVXQ 2B6HA 1YHNA 2QGNA 3CNNA 4TWZA 1II8A 4BFZA 1Q3HA 3QXSA 4KI0A 4PO9A 1VYUA 4UNQA 1VHLA 1S1MA 4LC1A 4ACAA 3SN6A 5EE0A 1KJWA 1T6NA 1E32A 5G3YA 2B7BA 2QBYA 4WAUA 1FPMA 2VEDA 3A36A 3DO6A 2I3BA 3QXCA 2GEDA 3D3QA 4DXAA 1AIPA 3EPJA 2IYLD 3U44A 4ZIRA 4NMMA 4KU4A 2VHUA 1JBKA 4IEEA 3KX2A 3WHKA 1SKQA 5B57C 5C18A 4DCTA 1KO1A 2A2ZA 4Z51A 4DLRA 2ZRBA 2J87A 4C0AC 1G4AE 2IF0A 3OHMA 1AKYA 1VIYA 4GP7A 4P4SB 4C0QC 4DHEA 1NNEA 1U8AA 2ZI9A 1PLKA 2QORA 3FE2A 3MG9A 1G18A 4PPGA 5F3WB 2FFAA 3QXJA 1SHKA 1E94E 3EW9A 1SXJA 4JIMA 5EXPA 4L4UA 1Z0DA 4TMKA 1XPOA 4HAVA 4MKGA 3KKQA 1CEEA 1WP9A 3AVYA 5JSZB 4NTZA 2V9PA 3B9PA 1XNJA 1MH1A 3ASYA 1XEXA 1NMXA 3AQ4A 3IO5A 5CITA 4LJ5A 3MSXA 5HCIA 2O8CB 4ZDIA 1S96A 1E79D 4AY2A 1W49A 4B71A 4ZI2A 1F2TB 1AGRA 3CR7A 3EZ7A 4DKXA 3SYKA 5JEEA 1W36B 3K8YA 1IXRC 4HAYA 2F1HA 1ZP6A 2BM0A 4H1UA 1GNPA 621PA 5F9FA 3VKGA 2ZYWX 2AHOA 2KWIA 2WWXA 2JLQA 2D62A 1ODFA 2BBSA 4MGYR 4BE7B 1Y63A 3TSOA 3NVAA 1P7CA 3DOFA 1ZJ6A 3VR2A 1ZM3A 1EFUA 2QMOA 5JZVA 1BMFA 3QNUA 1DEKA 1Q3TA 4TMZA 1OHHA 1IXZA 3K0AA 4JJKA 4D6PA 4XTRA 1DPFA 4QC2A 3A4MA 4D4MA 4PHTA 3QENA 1MT0A 1A5TA 1TF7A 4BFXA 2ORIA 5JRZA 3TBKA 1NJGA 2AWNA 4GI7A 4RZUA 4D81A 4GMDA 1MRSA 3I62A 4BFUA 3ECCA 1N3BA 2GDJA 4G5GA 4A2PA 2QM8A 3AKEA 1PZNA 4WW0A 2RAPA 1NRJB 2J7PD 2ZRNA 1QZXA 4OHWA 4WZ6A 4DIEA 2FSGA 2B21A 3MWYW 4OI4A 4PZZA 1U9IA 1E99A 5FOSA 1K5DA 3MAAC 1ZYUA 5FUYA 1QHHA 2FF7A 2WAXA 2WKPA 4KLNA 5BN3A 1NSTA 4HATA 1AQYA 3Q3JB 4ZPXA 3AVWA 5G41A 3SHWA 1EWQA 4KFTA 4LZZA 5KU1A 3CUEF 3FB4A 2YWHA 1DAFA 1G7TA 3H4MA 3KTAB 2DB3A 3AVTA 4PSVA 1R8SA 1CR0A 1AN0A 1Q22A 4UJ5A 3TR5A 3VAAA 3L0IB 1MO5A 3KUCA 1E4YA 2VO1A 4ESVA 3HDTA 5AUNB 2O8EB 5JHHB 3GJ8A 2O0KA 4FW9A 1SHZA 3WNBA 2H17A 2JLSA 4LOAA 3WBJA 1TU4A 1GNQA 1T5IA 1E0KA 2QM7A 2YOHA 4WXRA 3RS5A 1ZCBA 4IEIA 2QU8A 2ZAOA 1ZNYA 5JI3E 4L9SA 2WV9A 4C0HA 1P6XA 3UIEA 2ZRCA 2KBEA 1O87A 1KNXA 3PXGA 1H8ED 1NVUQ 2YOGA 4Q7LA 4D4LA 4TTQA 1YJ5A 2WWFA 4HUTA 3SFVA 5FOUA 1P9RA 5GJCA 5SZJA 2G88A 4EUNA 4B35A 4OHXA 221PA 4B43A 2AN9A 5DI9A 2ZRFA 4QBFA 1W2GA 2ZUDA 4DUGD 1PLLA 2QTVB 3K53A 1W7AA 1P2VA 3EC2A 3U7EB 1E1RA 4IJMA 3KQLA 1EX7A 4XD7D 5JS8A 4NBSA 2E9SA 5AJWA 4U00A 1PUIA 2P0EA 3BIFA 1FL9A 2AK3A 1CF4A 3BS4A 3OFNA 5HCNA 3VR6A 1G8GA 4HLCA 2ZI5A 4GZMA 4Z1MD 4AI6A 1G8YA 3RVBA 1HTWA 3SNHA 1WRBA 4G0NA 2QE7D 3DZ8A 5JFGA 2YOFA 2G0TA 4RKEA 2ZI3A 3LFUA 3CRMA 2C03A 2Z43A 4BPBA 2V6JA 3CR8A 3GLIA 4YXWA 3QVVA 3UPUA 2QSYA 3PG5A 1KMQA 2HJGA 1DOAA 3HU2A 3T35A 2EFHB 4GOJA 2J0VA 1KKMA 1RZ3A 4V0OA 3WYFA 1Z63A 4R9UC 2PZEA 2FX3A 2KSQA 4M1TA 3CNOA 3RC8A 4LBZA 2WWHA 4M9SA 4RVCA 3I8SA 5TVKA 2WICA 1JI0A 4L5BA 3NHAA 2BMFA 4GPTA 4TN1A 2FJUA 3T1TA 3LX8A 5GJBA 2F9MA 1YE8A 1N6LA 1KSHA 3HPQA 1SZPA 1II8B 1A82A 4JYCA 4DCUA 3BERA 1IONA 1KI1A 3BH7A 5KPJA 3DEFA 2ZR9A 4NYJR 3BFKA 3CRVA 1IJFA 1G5PA 2QP4A 4JLAA 3CX7A 2G83A 3EZ6A 2IYZA 4HLUC 2ZI4A 4Z54A 5CLLA 1G20E 2HT1A 4ZIRB 1FTSA 1N25A 1OIWA 4G5SA 1R0YA 2FH5B 2YV5A 4HAXA 4ASUA 4A4DA 5KNDA 4UXIA 4DBLC 5F98A 2RB4A 1D2MA 4MYTA 4CEHA 1OF1A 2C99A 3IQXA 4X8MA 1ZINA 4HZUA 3U3RA 1KI8A 3QY0A 2MMCA 1P2UA 2BOVA 2BJWA 5TARA 3ZQJA 3SQWA 2G0NA 2D2EA 4OJKA 1G7RA 1OFUX 5FOTA 5FPSA 2XZLA 1SXJB 5CB6A 2AD1A 3VX4A 4LJ8A 2GZDA 1ESNA 2O8FB 5B58C 1N6HA 4DCSA 2NZ8A 1E2EA 3VTKA 3THYA 2A5YB 4HZIA 4II7A 3GP8A 3FTQA 1XCPA 4UXJA 5KYKA 3U7FB 3LLUA 4V0ME 2QG6A 2VP9A 1U98A 2ZUBA 2PT5A 3T34A 1W0JD 1W4CA 4DZZA 4H1VA 3DPUA 5D3QA 3ZIAD 1E2DA 4LJYA 5F2EA 3FMIA 4EAQA 2H8KA 4L16A 3B8HA 4XSGA 2FFQA 4DB2A 1E0AA 3A58B 3K9HA 1Z0IA 2YINC 1UAAA 1SKYE 3W90A 3LA6A 1I4TD 4US1R 4E22A 1Z3IX 1R0ZA 2Z6VA 1TUIA 2G1JA 1D8TA 2RGAA 4C0SA 3TK1A 3T1VA 2B7CA 4S35A 3FGNA
chains in the Genus database with same CATH superfamily
1M2GA 4OJYA 5A71A 4QU9A 1BMDA 5JAHA 2CKMA 3GDHA 2NU7B 1VDMA 2O2GA 2ZJBA 4BRUA 4HFMA 3JRNA 3L79A 1N78A 4LNHA 4OATA 2WHXA 1E3DA 4FOSA 4Y98A 5AI6A 4E7PA 1RC8A 4YO8A 4KR9A 2JBWA 1E9CA 3VZSA 2OGTA 3EA5A 2YFQA 4FCWA 3ROFA 2PMKA 3RAPR 2C57A 4DDWA 1Y1LA 3VRHA 2JIZD 4TTAA 2NTVA 1DIAA 5JFTA 1CZHA 1RABA 1HQKA 2G72A 2VF7A 5BNZA 4C7JA 5HK9A 3JV7A 1CNEA 1O97D 2EQBA 1OYWA 4EQZA 3RVMA 1GPYA 3KEGA 5D2CA 4L5IA 4UMEA 3Q7QA 3F98A 5SY4A 5SV2A 4JQSA 1NF8A 1ODTC 2OFWA 4BY9E 2Z56A 1TYDE 5AKHA 1SNYA 2CB0A 3PUXA 4FFPA 4RZ3A 5KWSA 4WCFB 3JWJA 1NQTA 5GP1A 4ZVTA 1TD1A 2ANCA 3C43A 3IESA 1MD9A 3Q4GA 4ANFA 1PTJA 3PFWO 2OHGA 3IIJA 1JEEA 1A8UA 2OORA 2XZTA 3LLSA 1SCUB 2Q7XA 3QHAA 4KKVA 1NHWA 3B6ZA 3STYA 1ORWA 4RVUA 4ED9A 4F2PA 4W7SA 3WVNA 5JDIC 3ZJ5A 2IY9A 3FTCA 4DRZA 3O83A 5DGHA 2IYNA 4AC9A 5NLLA 1C8VB 1WL8A 1JSCA 1SB8A 3FZGA 3OIUA 2BPOA 2Z0MA 1KY2A 1Y6GA 2BTQB 5BR8B 16PKA 3EWSA 5CCDA 3JQ7A 3HFRA 4I81A 3E7XA 3B1ZA 3TW6A 3MYYA 1GDHA 3WV5A 4DC9A 3UB3A 2O52A 1E6MA 2HMSA 3VSDA 1CU1A 2H5EA 3AKYA 5LDHA 4Z4GA 3A2KA 1GU1A 2YN4A 3KBBA 2VG8A 2RHTA 5M7EA 1M9NA 1R10A 3L0CA 3KZ1E 3SXUB 1IUOA 1RC0A 2IYQA 4O25A 2JJ1A 3RUAA 2J3JA 4QOGA 4MVJM 2BV3A 2DH6A 3L9XA 5B58T 4CFSA 3HM9A 3EB9A 4QT0A 3PJFA 4ID3A 2NV0A 3FSJX 2C84A 5HTKA 5IJ9A 4BMSA 3N86A 1TEZA 1T1IA 2M6RA 3UMMA 2ADOA 1PYDA 2O1WA 5T3UA 1XAGA 1RT9A 2IJGX 2VPZA 3DF7A 2OVFA 3OOYA 4MYCA 4QUAA 4UCXA 2NG1A 5LZ8A 3VJMA 4CQLB 4HL6A 4N49A 2V5AA 4O4LB 3WAJA 3G7SA 2GD6A 5K3BA 2NP7A 3W6OA 1RWQA 2BZ0A 1YL5A 1T8TA 1IOVA 1EFDN 3PZBA 4D4JA 3IKTA 5ALVA 3NBXX 1M0WA 2EJUA 4YP1A 3IV6A 1RRFA 3E1GA 2D0DA 3K1ZA 4L8GA 4PSAA 4NYMQ 4F3YA 3AYZB 4BATA 3EPKA 1BQEA 1X3LA 2HZBA 3JALB 4XLTA 1CJUC 1E9EA 1HDRA 1MMFB 4FU0A 3W34A 1SXPA 1VKRA 1NXWA 2F43A 2PZMA 1EB9A 3IUNA 3O75A 2IEIA 1YCFA 4N82A 2IXDA 4XQEA 4I3HA 4BLSA 1B73A 4W99A 5A5FA 3LCUA 4URWR 4ZVLA 3BORA 2CE7A 4IIJF 4OHFA 2OA0A 1UQRA 1YASA 1WDLA 1BD3A 1M8GA 3VAYA 1E5QA 4MI6A 1BX3A 4BMVA 1JQ3A 4YYEA 2CUTA 1FMFA 4RNDB 2EZUA 2C7BA 3SYMA 5F9HA 2J9FA 4JJ4A 3W5JA 2EFJA 1JU4A 1POXA 2AFIA 1EM6A 1SIOA 2QMUA 3JQ8A 4BUJA 5J2TA 4G1VA 3EXG1 2WU3A 5LA6A 4TYNA 4IIVA 1D6SA 1Y8QB 2FRDC 3V4OA 3L7OA 1Y7PA 3T06B 2A9FA 1QLHA 1TL7C 3K8OE 4INPA 4FMBB 4FB5A 1J2TA 2FEKA 3GEHA 3IIMA 3D8BA 4RCVA 3UWDA 3VTZA 5CB4B 2XXBA 1N4DA 4MUXA 3ET5A 1IVNA 2Y0BA 2O2IA 1QVAA 2QN9A 3FVQA 3PHCA 2QVBA 3QLJA 4DBZA 4MYSA 4CL0A 3PJDA 1A69A 5JNVA 1GUAA 1NZFA 2PJDA 3L0PA 3O03A 3C1TA 3IVGA 4LZPA 3L1JA 4YRFA 1JVNA 4UTVA 3LG2A 4N0EA 4P86A 1UXKA 1LY1A 5HF9A 3UN1A 2QP9X 1XU9A 1U0GA 2PANA 3IAUA 1B1AA 2IVZA 5K4GA 1E3WB 2E48A 3LK6A 4CEHB 2JJ2A 4Q9AA 1DCKA 3FG9A 4KODA 4B2LA 1RYHA 3F1LA 1I4DD 5DLEA 5JD3A 4NPHA 2OCDA 2PD4A 1ZX1A 1GKLA 4MVWA 1BXGA 2HV8A 1Y6RA 5TX7A 4YJ2A 3AUJB 3G02A 3HCNA 1QJCA 4F97A 2P2ZA 5IMBA 3ADBA 3MD0A 3Q3GE 3K0HA 3X2SA 1M67A 5U4QA 1QU2A 1X80B 1GPJA 3NNDA 2DFKB 4QDUA 4YRAA 2PA3A 4JROA 1K86A 1PR3A 3OKPA 5ELLA 5FJJA 3UJHA 4C2UA 2ZRGA 1CYDA 2HJRA 2I2BA 6ADHA 1GZ6A 3I9V1 5B1DA 2JIRA 4L02A 1A9SA 5DGXA 2FN8A 3K2EA 2CFCA 5K99A 2QT1A 3OFSA 3FNIA 4OQNA 5K03A 3DDNA 4D2IA 4HAZA 2ID9A 1EUQA 1YZVA 2HF8A 2RSLA 4TMXA 3F5DA 5E9JA 1JIQA 4Y9DA 2ZE7A 3DCIA 1AG9A 2VZ8A 3Q0EA 4V3BA 3MT7A 3OZAA 2PX2A 5G3ZA 4Z4QA 4B45A 1DCFA 4YP5A 1Z5NA 2HYDA 3X1JA 4EATA 5B2EA 3VC3A 3PIIA 5T6MA 5KUTA 5IS2A 4PRYA 5HDBB 1K7FB 1TAUA 2WNHA 4ARZB 3IA7A 4RVFA 1K3TA 1FRFS 3M1IA 4YV1A 3PTZA 4Q1CA 121PA 1BU5A 1UP7A 5AVRA 1IY1A 1U4SA 4FZ5A 3SJ7A 1WBDA 3K15A 4OMDA 3LW7A 1KNQA 1TPYA 1ZH2A 2OUIA 3HSSA 5EZYF 2WA2A 1C50A 2BMAA 4Q4DA 1EHIA 2V7QD 4LPSA 4R6XA 5DIFA 4AJLA 4CV2A 5KSOA 4K03A 1PJ2A 3RC7A 1GQSA 2XUGA 2QMEA 1E60A 4JX9A 1JZSA 3S3TA 2Y2VA 2IEAA 3QVXA 4FZRA 2IUEA 3B51X 4OQLA 1TQ4A 4C0KA 4UUAA 1HYGA 3RGWS 4XFJA 3RS8A 1G8HA 5EJ8A 1QAQA 4MV6A 1L7DA 4JY7A 4C6SA 1CIVA 1J24A 2EG9A 2VSFA 1JHPA 3GDOA 3N2NA 4P4LA 3N8DA 1WMSA 4PIPA 5D1HA 3OF5A 1QOQB 1K4KA 5DWQA 4X64B 1NOKA 4G23A 2AOTB 3M81A 3T4PA 3WDMA 2AYYA 2AS0A 3RJZA 3L05A 2WJ6A 2Z4RA 3GVIA 1OT3A 3GRYA 1NR7A 3Q3HA 1KOJA 3EPPA 2QRPA 4ND7A 2ZBFA 4PS0A 3X43A 2O6HA 1O6CA 5J1SB 3ZQUA 1E7SA 1T3GA 4DWVA 4L15A 2KI5A 3DH0A 5JYCA 3ZEIA 1M34E 2RGWA 1XDUA 4LI0A 5K8TA 3Q5GA 2QJRA 1N5OX 3KFXA 1G16A 4PZ0A 5G4KB 4AY5A 1OFGA 1T5OA 2ZFUA 2R6R1 2AK2A 4M0MA 2GM9A 3N8NA 3RC3A 1C30B 1P9WA 2W90A 1XE3A 4G36A 1KZYC 2VQ3A 8ADHA 4JUDX 2I6QA 4CG2A 8ABPA 2A4KA 2WVAA 5GVRA 4D9HA 2B34A 5AI5A 5ALMA 2I91A 4LXTA 5KVVA 1JHOA 1BS1A 1LPAB 1WNTA 1NLYA 1X1CA 4LYEA 4RGVA 2ZETA 4XLLA 1UM9B 4RHXA 5EJ9A 2WWIA 1K75A 1PQPA 3T38A 5AM2A 3P0FA 1WPRA 4IIDA 4LMRA 1KVTA 1VPWA 1VJGA 1DRUA 3CRZA 1XD9A 4NV1A 1G7SA 1YO6A 3V2GA 5HBGA 3BTUA 3VO1A 1BX0A 1ZH0A 4BWFB 4IVPA 4Y6LA 3BTSA 3B1JA 4II3A 5F73A 1Z26A 1DUIA 2ORYA 1PS9A 2IOHA 3BCUA 4UBJA 5E7QA 3AVVA 4RF5A 3ZD6A 5IW8A 5FCDA 5TMDA 1E4EB 3ID6C 5L3QB 2O0MA 1PJQA 2I3DA 1OTYA 2YZ2A 3CZMA 1XU7A 4FFLA 5KC8A 3UPTA 3PKZA 4QEKA 2OVBA 4DJFC 1SXJD 2PFSA 5FR1A 3CUUA 3KJQA 3TD2A 4Q4HB 4ABTA 2O5RA 4AD8A 4HNSA 3DDCA 1QV6A 4MS4A 5J2UF 3S4YA 1DXHA 3DCJA 2YFKA 3DR5A 3QJYA 4N5MA 5DNWA 3TMYA 3C16C 1Z36A 1DT5A 4M9UA 5K3FB 1DBVO 2O3TA 3RC9A 3T9CA 5KX5A 5T4EA 3WJAA 3QE4A 4JXXA 2WHYA 5BNIA 1OUMA 3RYFA 5F33A 1BSVA 1IY9A 4WLOA 2P9QA 2RC5A 1MG5A 3PBKA 1L5GB 2ZYTX 1A9OA 5LQSA 1SCBA 3UVEA 2NO7A 5GONA 2WJJA 3RC2A 3LZCA 4ZODA 1XQ6A 4QD3A 4GBMA 4DYVA 1I13A 1LLUA 1EUYA 2ZYSA 3GLIA 4OI1A 2MCFA 2ZT5A 4RESA 5D84A 4EG1A 3REQA 1KEZA 5JS1A 3VR2D 4QJIA 3IP9A 1K66A 1SVIA 3ETHA 3IQHX 3Q0TA 5EJ6A 1BMFD 3OQOA 1ULBA 4CQMD 2WSMA 3PFIA 3S2ZA 4QUHA 1OHHD 4LAFA 1I36A 4OMFG 4A8JB 2GNPA 1JG7A 1U8FO 1AQIA 3CO0S 4KXQA 4DDMA 5AK0A 1KU6A 2C95A 2R00C 4MW4A 4EF6A 1UZAA 3FMPB 4HF7A 1XMQB 1JH9A 2N3ZA 2I7XA 4CEIB 2HW8A 2GYWA 2RDMA 3AF0A 5FX2A 4ABYA 4FNMA 2Z8XA 2QTGA 1V5EA 3PVSA 4N5IX 2IHKA 1RPAA 3BXHA 1Q1BA 1QZTA 2VK2A 4J8PA 1O0BA 2FGJA 2D13A 3NCTA 5IVHA 2H1RA 2OLKA 4WCFC 3RYIA 3QYFA 2IXFA 4RH1A 2NZWA 1SBHA 3P0EA 4PZPA 3PX7A 3R2JA 1I2BA 5H68A 3B6IA 3BDVA 5JJCA 5JO0A 2RK6A 2R6HA 5IAOA 2Q3LA 5FNVA 3UENA 3AZPA 2XBMA 1AM4D 1IFXA 4N9QA 2VTKA 3T1HB 1QIJA 4ZRDA 2FZEA 2XYHA 1YQ9A 5E95A 5EP3A 1Y8RA 2BHSA 5EZQA 2O3UA 4E46A 1JFLA 3WV4A 1YDEA 1U8YA 3FDZA 3FTEA 4GVXA 8LDHA 3KJGA 3QQ5A 2JFGA 3INRA 2CKDA 4KO4S 2A1IA 1E2LA 3AFNA 4TQAA 4X6UA 3PEYA 1PG5A 3T4UA 3Q12A 2C9ZA 4DSAA 3N0XA 5KQSA 2XBLA 3GBPA 1ZJYA 4NICA 4PZLA 4DG8A 1EK2A 1W1IA 3WHIA 3AM5A 1LSSA 3FFAA 1FDTA 1T5DX 1KZGB 5G2OA 3RASA 3ROPA 4MW9A 3TLAA 1DO2A 2RGXA 4J07A 1C0EA 4RADA 4KBGA 3OEWA 3TRDA 3LOUA 2GESA 2GN4A 4MIEA 1AZLA 5IKOA 3ZJTA 1UP4A 2YIVX 5KNLA 2BC9A 3LY5A 1KMHB 2BFBA 3QP9A 3WLLA 3PUYA 4AJ9A 2F64A 3HYSA 1H4SA 5K9ZA 3I1JA 4PLHA 2QLFA 1SIUA 1I6WA 3F5QA 1G8MA 2CVPA 1MX3A 3B2NA 1CQZA 1I4EB 4B40A 5EIXA 2PWPA 3ISJA 4NU8X 3FUTA 5I4KA 4YRIA 2PK3A 5THQA 2HYIC 3GBVA 3VO2A 1MIOA 3HJAA 4YDQA 3IAXA 1EYZA 3OU2A 2VCYA 1FUUA 3PTLA 3QBVA 1NBOA 4Z8YA 5J23A 4PG7A 1RQPA 3VR6D 3LBAA 3AJAA 1SC4A 1UL1X 1LKZA 3CVOA 3GVCA 4J0QA 5EVJA 3RI3A 2NP6A 2IWRA 2ZBRA 1GAJA 4ZVNA 1LDMA 4DFDA 3D4IA 4FQ8A 3H8SA 1TYBE 1YOVB 1ENPA 3QOWA 1KU0A 1XN1A 2DHQA 4U0KA 1Z5WA 2IEBA 2F3SA 4D92A 2F17A 1B23P 2VYQA 3B2QA 3L06A 1D9ZA 2C88A 1YL6A 2WFZA 1EDEA 4KMMA 2DP4E 1TKAA 3ICCA 2G8NA 1GV1A 2XDQA 2I6SA 3TQOA 4C43A 4NAUA 2HXYA 2ZUCA 5A4DA 1XZPA 4WE3A 2QVGA 1SXJE 3FKJA 3SIXA 1X1QA 1H6AA 1L5MA 1QE3A 2YCLA 3DULA 1GNRA 2HIGA 2X0KA 3LC2O 2ZXEA 3W4IA 2Q2NA 2DHDA 4ER7A 2VK4A 4XPZA 1G3MA 3WX0A 4CI9A 3U3MA 2VPQA 2BEWA 2R8BA 2XMQA 1WUTA 3LP8A 4XWOA 2JGLA 5JNTA 4HI0E 2G06A 2XAAA 1L4HA 1UJ2A 5A06A 3PHBE 2E7ZA 3B9RA 2QXTA 1Q1NA 1WW2A 1PF7E 1LD3A 3QYAA 3P8ZA 3KQYA 3U7HB 4AMYA 1KJNA 5FUQA 2CLEB 1ZOLA 2DT8A 4KZPA 4IXDA 3U37A 2WDZA 3TO5A 1RXCA 1U7OA 2YJ5A 1N2GA 3VXKA 1N0WA 4AUMA 1DNPA 3HRIA 1DS6A 4KBFA 4P54A 2AYZA 4BV2A 5BWBA 1U28A 1RHRA 1Z7EA 3DSRA 3VKUA 2VYND 4Q4JA 1XQ9A 2A9JA 4RM3A 3PPIA 1E1CB 1RRKA 1ZXLA 4H7PA 4R84A 3CVJA 1QRUA 4MAFA 3INGA 3M4NA 4M0DA 5H5JA 3IX7A 1N2XA 3OU6A 2ZXFA 3O8OA 4XEUA 3A27A 3IMCA 4MW1A 4IHAA 2WSBA 4YJHA 3VZQA 3G5UA 3ANTA 2CNLA 1H1DA 3ZXUB 2IYXA 3EJWA 1JLMA 1N2CE 3EDOA 5BRJA 3H17A 2G9NA 5JY6A 4X8LA 2JNWA 4YT4A 3O8CA 1QFSA 3I9MA 3CLVA 1Q0ZA 4HDRA 2A9KA 2DKNA 3K5IA 1TTPB 2H2WA 2JH9A 1T9GS 5CH5A 1VBNA 2B4QA 3ODGA 5H82A 3RR2A 1CR2A 1V26A 2BFEB 5FPYA 4YGXB 1BWQA 2L0XA 2P75A 3B3FA 5DTEA 1JSLA 2O1SA 4QTXA 4U5QA 1RQGA 3CU5A 1SAYA 3KYDA 1J2JA 1S7GA 4BHTA 3QKRB 1P1JA 3DL4A 2BY4A 2HUPA 1LV7A 1PW7A 3H5AA 3LPMA 4EKEA 2VDKB 4R0VA 1SKUA 1WIWA 2NGRA 4UUBA 4KXYA 1X1RA 2W00A 3AONB 3D5EA 5SY9A 4XIFA 3W6UA 3ZY2A 1RLUA 4NS4A 1IRXA 4Y67A 3UW1A 1EXVA 4GE3A 1H66A 4RC9A 2CHUA 1LTKA 4V1CB 3GMSA 1LV8A 2NZYA 2Q07A 3L9WA 3N74A 2Q6IA 4IZ6A 4RF3A 4CLRB 5JT1A 1LFDB 2BGGA 1SZCA 5FAKA 5EHGA 3UXHA 4E30A 2M1XA 2ZYVX 4AP6A 2WU8A 1EAMA 3GEIA 1E2FA 4KQFA 4YCDA 5DI3A 4FKBA 3TL2A 3PXBA 1SBYA 3SHFA 5IT5A 4EGSA 1L9KA 4TVSA 5FA6A 2PGIA 3K6SA 1PT7A 3SS8A 3PJGA 3L92A 5DN6D 1HA3A 2HGZA 1W52X 1G2PA 2YWRA 3C3WA 3VX3A 4OHVA 2J9GA 4NULA 4R68A 1IOZA 4TYWA 2E5FA 3A04A 1P7ZA 4KI7A 4KFRA 4MHTA 1KETA 1RBYA 3A1EA 2FETA 2J8ZA 4D99A 4OL9A 2V6FA 4AK9A 1QS0B 5DOZA 1DAIA 1Z28A 2PT6A 3RTEA 1AO0A 5J3JA 5H8WA 1P5ZB 2ZRIA 2O06A 2X5NA 3GRAA 3OZRA 3OZSA 3SQDA 2HQSA 2G5PA 4JP1A 5HZKA 4BQOA 4DARA 2FYTA 2XNCA 4WBNB 3BJMA 3Q1LA 1V11A 4DZRA 1C9YA 2FP3A 4GZ6A 4OJNA 3KZNA 2C20A 4KJZA 5K0LA 3QRWA 1W4RA 2DPMA 3FUUA 3VR5H 2NTJA 2P2SA 4QYMA 1KGDA 1NN1A 2AXPA 2NSLA 1WQ4A 3EBOA 3U13A 4F5DA 4WASA 2B6NA 2PSSA 3CRNA 1XCGB 4DMHA 2QNBA 2PUHA 5FNZA 4EB6A 4YX9A 1OH8A 4MWGA 2NV2B 2VP6A 4OGWA 3OSUA 2DPLA 4GXRA 5C1BA 5EJ5A 1PS8A 2CZQA 1X9GA 3ESQA 3TRFA 4P0QB 3UMCA 1H2ZA 4UXHA 1QH0A 3VSBA 3FAKA 3CW2A 3ZGOA 1VB3A 3V33A 2R66A 1H93A 1P3Y1 4B0OA 1UKYA 1WDMA 3NDBB 3QUQA 3KK0A 2EBHX 3IMEA 3ZHYA 3E84A 4M9CA 3S2UA 3ZY3A 3ZHVA 3FF4A 1JJ7A 4G4SP 3T5MA 1ACLA 3VU3A 2XF2A 3AKDA 3OOEA 4YCNA 3M82A 1XQ1A 4TLBA 1L3IA 1M6VB 1SCDA 3K09A 2DE0X 2QR3A 2ZRQA 4FWBA 4B34A 3RUIA 4PQYA 2XUZA 4WZAE 5JASA 1TIBA 3EZLA 3KPVA 4U9HS 5EEHA 2CBGA 1XI2A 1ZWKA 4YDSA 1GGHA 2NAPA 4RXTA 1U5CA 1YI0A 3GP3A 4AZ3A 4CETA 1TA4A 3JSAA 4UQOA 4A2QA 3F4BA 5JS7A 2D2XA 3A7EA 3QLEA 4P7BA 1ZK3A 2QB5A 3JU3A 3AHDA 1RAIA 4JLKA 2JAPA 3VOAA 5GJWC 2EWWA 4GL2A 1SBNE 2QJTA 1RPTA 1QCCA 1K68A 2VZLA 2WM8A 3IEKA 1G98A 1N9GA 1O97C 3D4BA 2HHCA 1H1LB 1N3LA 5K0CA 1EBUA 2FZWA 3EXFA 1QGUA 4MVXA 4R2WA 4MWBA 4MR7B 2P67A 2P11A 4Q19A 5FOQA 3C7KA 2ENWA 1ZBQA 2ZSUA 1TRHA 8ATCA 1CEYA 2LRHA 3ZHRA 5I45A 1XKXA 2YBDA 4PIMA 5CBKA 2RFLA 2X23A 4PLVA 2PHZA 2I6UA 2OG2A 3GT0A 4R40A 5T5QA 4A8JC 2QJWA 3P9KA 4A3SA 5FTJA 4O5AA 1Q7GA 1NVDA 3AV3A 1IJEA 1TMOA 3CH7A 4MQ6A 1FQKA 3C6KA 2DMRA 1O6GA 1VJRA 2WC1A 2WZCA 2C9MA 2FPIA 1NQAO 5JCXA 3GAAA 1BFKA 1M2WA 1S2OA 1VL0A 2C97A 3FSGD 1PGPA 3NYWA 3N8GA 4QFMA 2GTHA 2INGX 3RCBA 3OKFA 4TZ0A 4FINA 1QX4A 1EFKA 1Z6PA 2DQZA 4HLDA 3UG6A 1PYGA 1LU9A 2C8KA 3GF4A 4MULA 2IE8A 1PEYA 1E1YA 1OXSC 2ONCA 1GVNB 1IEXA 1Y1TA 3E58A 3QQPA 1ONPA 3DE5X 2PTGA 4RCYA 4NONA 3WGLA 1SK9A 4L8LA 5DYNA 1OZ0A 5DLYA 1AHPA 4IIJB 3KELA 2O4CA 1NN3A 5IKEA 1E7QA 4YP7A 3LIPA 4FHZA 1N8TA 3P9SA 1FBTA 4MPDA 1P8JA 4M1OA 5DBOA 2JGDA 4U02A 4GQIA 4ZV4A 3T5PA 2VTBA 5EFZA 3ZGLA 2D5BA 3K1TA 3LT2A 4YUVA 4EA9A 2PJZA 5FR2A 2C42A 4E4TA 4J0JA 4KXWA 1LF0A 4WESB 1OAOA 4E5YA 1PW5A 2BFOA 4DR7B 1YHZA 5H81A 4M0UA 1NI5A 5FUXA 2W37A 4A0QA 4N47A 3OKAA 1ECPA 3BHNA 1LX7A 4QARA 3R0JA 3T7EA 2UDPA 2WK1A 3EEBA 1AHHA 2MSEB 3UQZA 5A5GA 2A9PA 4BP8A 3VAZA 1WVGA 5JQGF 2PL9A 5A0TA 1RAGA 3UANA 1A2BA 4RJIA 4TMWA 4M1MA 5AKGA 4YMVA 3CB4A 2WMOB 1Y9DA 1ZVQA 1ZNXA 1BOFA 2AOWA 4KQGA 5DGIA 2LCQA 3NWJA 1U8TA 1LPOA 3NTLA 3QFFA 4PQRA 5FLEX 2E6UX 1SD5A 2NU6A 5TPZA 5FTKA 4DBVO 5FDFA 4WUVA 2ZR0A 2BGWA 4BN0A 2ET6A 2HT6A 2QAIA 5K8VA 3U09A 1PK9A 2Q3EA 4LGYA 4WY8A 1A8PA 4J03A 4ZVMA 3ILVA 5JUWA 1XTUA 5GADl 2GK3A 1KEEA 1L7EA 2V7WA 5TS2A 2WAOA 3OPYI 1B0ZA 1IAVA 3R3ZA 3V4ZA 1NDHA 3HCAA 5LMCA 1LJ8A 3OLWA 1JXQA 1MRZA 1QLWA 1ZUIA 3G49A 2QMYA 1U2RA 1M6EX 3PE3A 5TE9A 4BGVA 4FR2A 1VIAA 2Q5QA 5F7OA 1U0JA 5JH7A 1EP9A 2YR0A 4Z7NB 4KMOA 5LZ9A 4ER6A 4JNCA 3GLFB 3NVKI 3P1JA 1J49A 4LN1A 2QRVB 1MUUA 1ZY2A 3DMRA 2RI1A 4UU0A 2Q5JA 1UFOA 2VP0A 3KQQA 5CJ2A 4KOEC 5JSQA 5EG5A 2XVAA 4DV0B 4OCZA 2HQ1A 2JCXA 3D6VA 5DM60 4XKJA 1Q84A 1PP4A 3MMXA 1GAXA 3K2QA 4WWHA 2BBTA 3CSUA 4PLZA 1AGNA 2G71A 2PQ0A 1W48A 1N36B 2CXPA 3O95A 1ODKA 4LVUA 3QVJA 4DEVA 3HBNA 3R7WB 3H1PA 4KV7A 4AAYA 3HY6A 1AVTA 2LW7A 2AEMA 4N18A 1A5AB 4N8SA 3B1XA 4IGAA 1GYRA 3A9WA 1PGNA 4GOXA 1FVFA 1JS1X 3MGKA 1KS9A 4HRVA 1CK4A 4PLFA 4S24A 4ZHQF 4GIBA 4O2AF 5EZYB 3RVDA 1H8HA 4MQBA 4RK6A 3VNVA 2OZEA 1T9BA 2Z5LA 3GLHE 3M4YA 4M9QA 2RJOA 3EOBI 1OIVA 2C96A 1SO8A 3PD7A 4Y2JA 1PZFA 1LB1B 2WWRA 2KLBA 1GADO 4IOLA 4GBJA 5CLJA 2X9VA 3DV0B 3DZIA 4OJTA 3MD9A 4YBRA 1REQB 1WW8A 3PF8A 4J0CA 1JBQA 3UGKA 1BYUA 3EUFA 5DOVA 4XXHA 3TLMA 3UGJA 3ZHUA 1B8PA 1M72A 3ZU6A 2VBIA 3QELB 5F76A 1VCHA 2EGHA 3EWIA 4AO6A 5REQA 4C29A 3F9RA 5J59A 1YRQA 3AXTA 1DKQA 4CIDA 4B87A 4JJZA 3DBHA 4BYGA 3IEIA 4FSXA 5C3MA 4V2IA 2KE5A 3F4KA 1ZEJA 1I24A 2Y0DA 5B30A 2GHRA 1XNQB 1NL3A 2MTBA 3UAYA 4J9UE 4EG6A 2A88A 1NTRA 2HDOA 3FKSD 5FTLA 4L0QA 4HNAB 2ZIGA 1TQ6A 5M29A 3B5IA 1C0IA 4CXMA 3GFPA 3MRXA 4OBXA 3R0ZA 2H4XA 4DCJA 4EY6A 3FHTA 1IM2A 4F4HA 4HJXA 2J5RA 1KYZA 1NWHA 3FZEA 4KIUA 4Y0AA 3K16A 1OC2A 4LXGA 3LUGA 1QU3A 4P53A 1D1QA 3AFOA 3P32A 5BMVF 1V1MB 2G70A 1U5BB 2QSUA 3KB1A 1NYRA 1JKXA 2GA8A 3HLKA 4J76A 4ZZ0A 5HHTA 3TQHA 5K09A 5KJFA 2OK8A 1ATZA 2VUHB 2JJ8A 4QU5A 2H1LA 5JYDA 3RRZA 3GCGA 3NHPA 5EJFA 4ILKA 3C85A 2ZI6A 3PXXA 1G3UA 6ABPA 3FSRA 2X3YA 3ADCA 2J7KA 4I1OA 3WHLA 1WABA 2C9BA 3KKLA 4NYIQ 521PA 3LXUX 3DKPA 2HHLA 2G9RA 3AFGA 1XSEA 1W4LA 2ISSD 2QTNA 2WMNB 2QUKA 4LOLA 1U3WA 3WLRA 5A4JA 1O54A 3RSSA 1HF3A 1SC6A 3KXDA 3Q6IA 4MAMA 1CULC 1YMUA 2E89A 1CY1A 4AJ1A 5KYVA 1KAMA 3F8TA 2BZGA 2XKAA 5DN9A 1JW9B 5T3YA 2HB6A 2ORED 2H4WA 3ORQA 1RHJA 3OIFA 1GNSA 3HU5A 4CNQA 1NRXA 2GSWA 2XJ9A 4H1WA 1X2EA 5JJKA 4HNHA 1GPUA 1RJEA 2NUTB 4DREA 1PJSA 4WECA 2F9LA 1W8DA 4EI9A 5FBWB 4YPVA 1YD7A 2QPAA 4JC8A 1URPA 2IW3A 4A03A 3P5BA 4LRSB 4IRXA 2Q8PA 2HREA 3WIOA 2QYSA 4PNHA 1FUYB 1ZRNA 2Q4EA 1TGYA 3WKCA 1G60A 4F3TA 1N8NA 3QMMA 5ERYA 5DM1A 2DPXA 2CFOA 4KIFA 4PZAA 5GQSA 4BNGA 3JRWA 3GA5A 4WNCA 3WKEA 4Z53A 1T2UA 4AS2A 1EGAA 4ESOA 1N5DA 5IASA 3A3PA 4DLSA 4OQMA 1JIIA 3CTPA 3A32A 1O9GA 2FRDA 2WA1A 1HLGA 2B4AA 4F6RB 3WJ7A 4KHZA 1FP4A 1G6KA 1HL3A 1QYXA 4P7GA 2K87A 4BC0A 2QVZX 4JLNA 1U02A 4RIGA 3DWIA 2ZYDA 3WE7A 1A9PA 1M2VA 2EGUA 4QJ5A 3W06A 1F7UA 4ESEA 1IXKA 2J59A 1D2GA 2QTTA 1Q1EA 2QW0X 1ZN8A 3U7IA 3NXKA 3CCBA 3ADDA 2AE2A 1PQWA 1WTCA 3D4LA 2D1YA 3P9IA 3QPUA 3V4LA 3WKBA 2NSJA 2V4ZA 1E3SA 1M2OB 4UC0A 2DUUA 2J45A 3AUXA 1TCUA 4OYLA 4Y7DA 5CVVA 5EPUA 3WGYA 1OE0A 2DG2A 4HYYA 5AW7A 3E8MA 4JOSA 5HM6A 5KC9A 1V2GA 1BRMA 1L8AA 4RJJA 2QKYA 4AN0A 5KNBA 3O7WA 4IIFA 3ONVA 1R9JA 1RYEA 2IBMA 1U81A 1RJWA 1Q77A 1IHUA 3LQ1A 2RCNA 5C8YA 5JVDA 2EFCB 4BMDA 4U3JA 3FNBA 5JXHA 2EFGA 4NHOA 2IU3A 4WZBB 5FPKA 1FX1A 1CFZA 1RI5A 4M1EA 1YDMA 1H5UA 4QQKA 5E1MA 2WYIA 2LDBA 3CPSA 4TVBA 4D9GA 4NWIA 5AICA 4L27A 2NVUA 4D57A 3CCCA 1J6UA 4F9GA 4Z9XA 1J09A 1WXWA 1SU7A 2VAMA 5KTKA 2ALJA 2DFTA 5C8DA 4DLLA 1NIJA 2RGBA 3CT6A 3LQQA 1TKCA 4F92B 3CRQA 1KDTA 5AI4A 4M46A 4M1KA 1W85B 1KR5A 1ZICA 3PVZA 1YH3A 2XVYA 1TMKA 4UBLA 2ZBQA 3TJZA 3GLIB 4LRTB 1LPSA 5JI2E 1TFUA 1NQWA 1FIUA 1X6VA 2V4UA 3O7MA 4IJWA 2R0QC 2UUAB 4NXNB 3QG5A 1T1GA 5AXBA 4OQEA 3L7KA 2V74B 4OV6B 4BO1A 2JBAB 4PLTA 1XYVA 1UT8A 1FMTA 1KAGA 5A9TA 1IWPB 1N7IA 2NZ2A 4G63A 2XNDA 3KWLA 4YC7A 1VMIA 1G42A 2NYAA 3EH1A 4V02A 3A1SA 3QGMA 5DGTA 5ECGC 4G5FA 4OBEA 5JS6A 2C5AA 4ALJA 1HTBA 2VRCD 3ITEA 2FXVA 1T36B 4JI5B 2JVKA 4RTNA 2ZDGA 1GHTA 2X77A 5HW0A 3KETA 2R5NA 1TUEA 5A3SA 1TEVA 1V3VA 3QPAA 3RANA 2R85A 4FD2A 1WPXA 1NI4A 4GZ5A 4R3NA 4ZEWA 4DDTA 2BHNA 3HO8A 5TC4A 4R1UA 3GYGA 4JSYA 3WWOA 3Q7RA 3R5XA 1F6DA 1OR8A 2VQDA 3BXEA 4JI0B 2NXWA 1KBOA 2ZANA 4I1SA 1O57A 4P35A 1V6CA 2CXTA 1RHUA 2W6OA 2M6LA 4MCHA 3VPBA 4DQXA 3ECSA 2CNOA 2D59A 2D5CA 5DCYA 5BN5B 1HOTA 1K6MA 1HSZA 3DEJA 2EG5A 5JS2A 3WLEA 2PLRA 4LYYA 1GP2A 5D6OA 5H1YA 4BECA 1N1EA 2F90A 3A0UA 3HB7A 3OTHA 4PBRA 1QK3A 2H0RA 3P7MA 3NC0C 4OXIA 3JYNA 3OTGA 3DMGA 2RAFA 2UAGA 1LA2A 3DFIA 4MV3A 3ZWQA 2Y92A 4HDKA 2B98A 2JS7A 3IVRA 2XQIA 1JFSA 1FFBA 2ATXA 5DNVA 2FMKA 4LDPA 1I6LA 2PWBA 1C1XA 1KI6A 1LQTA 2FQYA 2P5YA 4TZKA 2W6PA 3NATA 3F1KA 1KFCB 3RDPA 1S89A 3HABA 1CUDA 3GFGA 5FPHA 4QUEA 4KIWA 1I1NA 3PGVA 3GT4A 2VQEB 1JKJB 1F2DA 2JK0A 1M7BA 1PI3A 2XYVA 4P3PA 3AM3A 3HI6A 4BLOA 2HJHA 3ND7A 3N39C 1V25A 4XR9A 4OAOA 1ORIA 1THMA 2CJPA 3D1VA 3IUJA 4R9RA 5G53C 5AM3A 4ZU1X 2AKEA 4I5FA 3KVNA 3P27A 4UDXX 5EWJA 3DE1X 5AW9A 3CMCO 2O5VA 3ZE0B 2QM0A 5J47A 2X2FA 1RJ9A 2XA9A 1MABA 1V35A 1VI2A 1GRNA 4DZTA 5CD1A 5CNMA 4KR2A 3QU7A 1FMLA 4KC0A 4E5NA 4I3FA 4FDMA 1PR4A 2JAXA 4QSMA 1RAEA 2BLNA 3NP9A 3WRYA 3WXBA 4QFBA 4CKWB 1BH2A 1R16A 1GZ4A 2BDTA 1XCMA 3ZV7A 2W2QA 1ZGBA 4JDUA 2HPZA 4NECA 1IEQA 3PFBA 4MVJA 3R1IA 4RGYA 4XB1A 2O8BA 4XQCA 4ZOLF 1F6WA 4LVCA 1XTQA 4ODIA 4EG0A 4HTAA 4PF1A 5GOTA 3AINA 1VMKA 2G7ZA 3MBOA 5AMXA 3WRVA 3O91A 1XAJA 4S3MA 4C7BA 1CF2O 2DFPA 1I51A 2PL1A 5DTMA 4QLOA 1DJQA 2ZRLA 1Y4DE 4G8DA 3V1KA 4CM8B 5LUBA 2PKRA 1XHEA 3F9CA 4PGGA 5FWXA 2OQVA 3RK0A 2FPKA 4X6XA 4LWOA 4QM6A 1TK3A 3Q6NA 2G77B 4LXUA 5KYNA 1YNSA 2AC4A 3G13A 1ISSA 3MAJA 1NXTA 3GG9A 2I5PO 4XWAA 2BH9A 4H0NA 5T67A 1SUBA 2N46A 3BGSA 4A1FA 4NBLA 3TLXA 5K1ZA 4C6HA 3KEFA 2CL5A 2X22A 2JL1A 5BNFA 3QI2A 3EMDA 3OE1A 3EFHA 3NWBA 2HA3A 3MAGA 5TF4A 4BCDA 3R4VA 1E77A 2PV0A 3QKSA 1JA0A 4FGSA 4J2TA 4QL3A 2IWHA 5GZ6A 2AOUA 4MVJG 3M1YA 3TCKA 2WYHA 1O94A 3KL4A 1RFLA 3I83A 4BP9A 1YB2A 2JFPA 1JSZA 3CLTC 4FT4A 5K3AA 1RVV1 1T5HX 1U8CB 4YONB 1F5NA 3TGLA 3NNSA 4NZNA 3ZCQA 1SG0A 2XB4A 2W8BB 1QHIA 3NJRA 2DYKA 3QFRA 5DMHA 3TNJA 5L4SA 1ZDMA 4XM0A 1U3CA 5BQ5A 1Q83A 3VU9B 4XGQA 5ALHA 5TV2A 2QTWB 5A0FA 4EPTA 1R50A 1K63A 3C24A 3L1VA 3NM4A 1NDUA 4OD0A 2WRZA 4Z4IA 4MO9A 4CCYB 1G0OA 1ZW1A 1X1DA 4G89A 4ZGWA 1DRKA 1HE1C 1PFKA