2QRNA

Human deoxycytidine kinase dcmp, udp, mg ion product complex
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
241
structure length
228
Chain Sequence
b'RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
publication title Structures of human deoxycytidine kinase product complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 81
structure length 228
sequence length 241
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2007-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qrnA00
2GCOB 1CJTC 1UBCA 1N5JA 4XH9B 4Q1DA 1BOFA 2JLXA 2ZRMA 2EFEB 3AEZA 2ZJAA 1G6HA 3TNFA 4ASUA 2XTMA 5GJWC 4PAMA 4B3BA 3QPWA 3BH0A 3M4YA 4Q02A 2VP2A 3QNUA 3SS8A 3IHWA 4TL6A 2WBLC 4WVFA 1U90A 3T1VA 3PV0A 3TQFA 3THWA 2R6GA 4JKIA 1R0WA 1G19A 2WOOA 2PLRA 4AY2A 4B3GA 3ZGXA 4G5QA 2BM0A 2WPDD 4DSUA 1QBKC 5FOWA 1GILA 2RHMA 5TY0A 4BZPA 3AVUA 1D5CA 3R9XA 3BK7A 4I1OA 4LPKA 4NCIA 3W6NA 4BWYA 4Q9LA 2WJGA 3GJ0A 1KI4A 1G18A 1ZM3A 4A8JC 3L8ZA 1AK2A 1ZMXA 3QY0A 1E9BA 2IUSA 3VFDA 1RYHA 1E9FA 3HU1A 3TK1A 4ZCIA 3D7MA 3O8BA 1NVWQ 1DBSA 2VF7A 1VECA 4MYUA 3IO5A 3TAHA 1UFQA 2DWQA 2H1LA 2ZYVX 2JLZA 5FFMA 4C30A 3L0OA 3P1JA 1T8TA 2ZR9A 1JJVA 1B0UA 2H8KA 4UQOA 5FTKA 2OILA 1F48A 4U00A 1ZIOA 5TDHA 1DARA 1RFLA 2FPLA 3CPHA 1Z0KA 4MGYR 2PZGA 3U5ZB 3FHTA 1XMSA 4PQFA 4DXAA 2OBNA 5F98A 5KDDA 4A6PA 1P75A 4F4CA 1VG0B 1OXUA 4RCZA 3IUYA 2O8CB 1AQYA 2WWFA 3B78A 3REGA 1XPUA 4U02A 2QROA 3FKSA 4F91B 1G16A 2OBLA 3KXLA 2ATVA 2DFLA 2GESA 3CM0A 4PXAA 2F1JA 3M6AA 4M0LA 3GPLA 2XB4A 2OEPA 4HATA 1K8RA 1R5BA 3U7EB 3ZS8A 1X8LA 3B1WA 2PLFA 4C0AC 2HLDA 1E2GA 621PA 4NYMR 2JJ8A 3THWB 5J4YA 1HUQA 1ZM4A 2BV3A 4MYHA 1OYWA 2PL3A 3KKPA 1FMLA 2CNWA 3NH9A 3WXMA 4C2TA 1C9KA 4ACAA 4I99A 1IOZA 3C5HA 3IBGA 1Y3AA 3X1DA 2BCJQ 2ZJ5A 4JZKA 4BFVA 3ND9A 4PSVA 3LX5A 5GADl 3GJ5A 2OFWA 5ELXA 5SZJA 2BBOA 3REFA 3RDPA 4P33A 4GT1A 1W0JA 4US1R 1DE0A 3KKQA 4K81B 1P4SA 5JRJA 1C4OA 1G8FA 4HLUC 4PTLA 4QKQA 1W1WA 1NJFA 4TYWA 4IOLA 2QAGC 1TU4A 3NC1C 2K5UA 1KAOA 2NO7A 3BB3A 3MSXA 4NMMA 2C96A 4FWIB 2YKGA 4WOPA 3FYHA 1DADA 3D8BA 2QM7A 1F3OA 1M7HA 3MWJA 3LH5A 1IN7A 2X2EA 3T1OA 4AYWA 4PANA 3P4XA 2AKYA 3AP3A 1YZKA 4Q9IA 4PC1A 1WB9A 2ONJA 2Z43A 3QKUA 1KK1A 1Z0FA 4NYIQ 3TH5A 3PR1A 1XXHE 1ZP6A 3NWJA 3HPQA 3RHFA 4YONB 4UJ5A 5F2EA 4GDFA 2YOGA 3SJAA 4QC2A 4PFSA 2P6NA 4R98A 4OK6A 3ZD6A 4N0EA 1VYUA 5TMPA 4NONA 4DDUA 2Q0HA 1E2KA 2ZRNA 1WBDA 2P65A 1DOAA 4UNQA 2OT3B 4A4DA 4BGDA 2JEOA 1FUUA 5JRZA 4XVQA 1A5TA 4G01B 2GBLC 3B1ZA 1UPTA 3LX8A 4TT3D 5EJEA 4B74A 3HU3A 1EFRA 2FFBA 5FPYA 4ZCLA 4AKIA 2OESA 4PC3A 4YMSA 4JBXA 3OAAD 4EUNA 2ZYUX 3CX6A 4C0LA 2YOFA 2DWPA 4JJKA 1Q20A 1XD8A 2R6FA 5FPTA 2IYRA 2B7BA 1XFAA 1YE8A 2V7QA 4YMUA 3NTUA 4DHEA 4LJ7A 1A2KC 1S9HA 1Z2AA 5DIFA 2R44A 4JBYA 5LD2B 3IDQA 4TLDA 4NKRA 2ZE5A 3KJIA 2AK2A 1LNZA 1DO0A 2RGNA 4HLCA 2P0EA 2JJ1A 3EARA 3GLGA 2WKQA 3KB2A 4N3NA 4Q1EA 4BZXA 5CB6A 4LRWA 2P2LA 2A30A 2XEXA 1PVOA 5JEEA 1EG7A 2OLJA 3CX8A 2QTHA 3UK6A 1NVXQ 3WNDA 5LB2A 2J3EA 4B33A 1ZC3A 2ZJ2A 1DEKA 3GEHA 1GRQA 1KY3A 1P2UA 4HAZA 3SC3A 4OHWA 4IOMA 3LQQA 5FUYA 2R2AA 1GUAA 4XWOA 1XXHA 4A6XA 3SNHA 2IF0A 3RSOA 4WZ6A 4DDTA 4PR0A 4RD1A 4O2RA 4EQ6A 1T8UA 4LJ9A 1HV8A 3TR5A 4P4TA 2J5XA 3VR5A 4D2IA 2XZOA 4TMKA 2BC9A 1P60A 5B2ZA 2D06A 4WA7A 4B2PA 1XZPA 2W2TA 4TLCA 3IEUA 4US2R 3IQXA 4GFDA 2Q21A 3K70C 121PA 4GL2A 1KHTA 5EUMA 5TVKA 3GLIA 3E5HA 2AR7A 2ZJZA 2AK3A 3THYA 1WBBA 4KFSA 4HAVA 2ZSFA 3G82C 4A0HA 1UADA 1SHKA 2DR3A 4W5JA 2ORVA 2IBMA 2WPDA 1GNPA 2QPAA 4GP6A 4ZI2A 4X8LA 4G0NA 5JJKA 3UIEA 1WF3A 4BFTA 3GFPA 2KE5A 3I73A 4P0TA 1IN4A 2RGCA 3KUDA 4O3MA 1KI8A 4BZQA 5FBQB 1T3HA 4DDWA 5FOVA 1XEWX 1EX6A 2OE2A 3GLGB 1UDXA 3LA6A 1OW3B 3MUFA 3A1UA 1MO3A 3UG6A 1U2RA 2IYQA 4DCUA 4M1YA 1JNYA 1KI3A 2ZAMA 1JPNA 1KDTA 1IN8A 4QHTA 1Z0DA 4URUR 4YDHB 4D81A 1OB2A 3QKTA 4LY6A 2V8OA 3CWZA 4DLWA 3CNLA 4NL4H 1MH1A 3PG5A 4Q18A 3WY9A 521PA 3B1VA 4AYXA 3Q85A 3VHXA 4LYJA 1Q21A 3U6KA 3DO6A 3AV0B 4QBIA 1IN5A 3AGPA 5FL7D 4LC1A 1JBKA 1XXHB 2PBRA 4QGHA 2VH5R 1MO5A 3NDPA 3PUXA 4B2LA 2DFNA 1G3IA 2A5YB 3EIHA 4JT4A 3RRYA 3TR0A 3TUZC 4MKIA 2RGDA 4EQ6B 1GVNB 1JQJC 1OXSC 2OXRA 3NBZC 4TSFD 2ZIAA 1KSGA 1BIFA 3FHOA 2GDJA 4LCBA 2QQEA 4URZR 5LB4A 1ODFA 1ZUNB 1MOZA 1Z22A 1E9AA 4HZUA 4BEJA 3I8XA 3ADDA 3GJ6A 3RC3A 1XEWY 3K8YA 5B30A 3GLIB 4EFLA 2EWWA 2W6JD 1DG3A 1E2HA 1Z6XA 4PX9A 5AR1A 1SVMA 1Z5ZA 3THYB 1NNEA 3TSWA 2NIPA 4Q19A 3ZQJA 4FWTA 5KDLA 4MQBA 1Z0AA 2A5GA 4YMTA 3C14C 1G7TA 5CIWA 3T35A 1OT3A 5H68A 2GZHA 1E9EA 4HAYA 4B3FX 4GZLA 4YLGA 4B32A 3PIRA 3AH8A 3SBDA 2OFOA 2OAP1 5KO2A 4ZDKA 1E1RD 4AK9A 4A2QA 2REXB 4D26A 1KI6A 5FOXA 3CF6R 1F2TA 1XEXA 4RY2A 1VCMA 3AUYA 3IHLA 4FINA 2ZSAA 3CZPA 4RFSA 4ZV4A 1G7CA 2Z4SA 1IY2A 3UMFA 3TLXA 4HUTA 5AK0A 2WKRA 3VAAA 1ZNWA 3FPAA 5M04A 1N6RA 3CBQA 5JJLA 3R9WA 3L8YA 1NMZA 4G5GA 2EQBA 1JEDA 3KUCA 1YZLA 4UNPA 4WXRA 1ZCAA 1EWRA 2QTVB 5AUQA 5BYKA 2CCKA 2EW1A 1D2MA 1GRNA 1KAGA 5BXQC 3HU2A 1SZPA 2YVUA 2HYIC 4IVRA 1K6MA 2C03A 4BFSA 2OHFA 1SULA 1KIMA 4YDSA 3LW7A 4B3XA 3RS4A 1XRJA 2BBSA 2O0HA 2RHDA 3CPJB 5DSZA 3SYLA 4HZUB 1NSTA 1YVDA 5KPJA 3ZZTA 2YV5A 4MKGA 4WIAA 1II0A 5FOSA 2FMXA 2VHUA 2ZI7A 3B5JA 2WJYA 4URYR 3EX7C 1DG1G 4OK5A 4TT3A 4F7WA 2FH5B 2G9NA 1NVVQ 1H8HD 3HP1A 3QXXA 4QBFA 4MRPA 1P6XA 3SOPA 1ANKA 2QP9X 5IT5A 1E0JA 3NBYC 1W0KD 3OAAA 4JLDA 1FX0A 1LF0A 4NDZA 2ANCA 3QG1A 4IDQA 5JWOA 4DBLC 1R0ZA 4L8GA 3TW4A 2ZSDA 4IDHA 2N46A 1GAJA 1P7CA 4V0ME 5JJIA 3CR8A 1GITA 1HTWA 1T0HB 1KJYA 4M53A 4ZKDA 4ZKEA 2NZ8A 3OE7D 4V0KA 1SXJE 5JZVA 5LPNA 3DZDA 3DM9B 1KMHA 4QGGA 1NG9A 1KI6B 1U8AA 1F2TB 1XEXB 4O2LA 3U7HB 1II8A 2HJVA 2MSDB 4RZ3A 1WP9A 1VYTA 3RLFA 4RFSB 1OXTA 1KY2A 5LD2C 1E4YA 1TEXA 1BKDR 2GZDA 2ZPTX 1CR0A 1NL3A 2VF8A 2IXEA 3I3SR 3KKMA 1OXVA 1P9RA 1W2GA 4JYBA 2F1IA 3C16C 1U0JA 3CB4A 2XITA 4B44A 1MRSA 3KKNA 5G53C 1XTKA 1V43A 2QNRA 4LJ5A 1E9RA 3QBTA 5DHAA 4LJYA 4Q1BA 5IHPA 1NIPA 1R4AA 2ANBA 3AKDA 3K0EA 4JMPA 1US8A 1W5TA 4Q01A 5KU1A 4DUGD 4OHXA 4EPTA 2A5JA 3LBIA 1CJMA 3H4MA 4MRVA 3T61A 2O8DA 4NYJQ 5SZKB 2Z0MA 3W8NA 4D82A 3BD9A 1KZGB 2OCAA 3EWAA 2IS2A 3B9PA 2WM9B 3LBNA 4KLNA 1V5WA 2TMKA 4NCNA 1XMIA 5CLLA 1DAKA 2R6CA 1N0WA 3JVUA 2C9YA 1Z47A 1IHUA 2QT1A 2ZJ8A 4FN5A 4MGKR 1HQCA 4N0DA 4RD3A 4DLYA 1UJ2A 1E4VA 2JLQA 1XDBA 2ZS7A 3MGCA 5E3HA 1NN0A 4EJSA 2DB3A 2IYSA 5HTKA 1XCPA 2W6ID 3THOA 1KO7A 1FX0B 1U8ZA 4LBYA 3OHMA 1RVDA 1W46A 3WP1B 3QENA 3T5GA 2IUTA 4KVAA 4YXWA 3AF3A 3BFVA 3PJRA 4L9SA 1W4AA 4PO1A 3MRSA 2ERXA 1RRCA 4V0MA 1UEIA 2CBZA 4ON9A 1IJFA 2FSFA 2HT1A 1KMHB 4DCSA 4TZ6A 3S1AA 2WWGA 2JA1A 5DI3A 3THXA 2J0VA 2A5DA 2ZRLA 3GLFE 1CEEA 5KHOC 1II8B 2G1KA 2ZS9A 2H17A 2IYXA 1ZCBA 4TTQA 3QIAA 1E96A 1XJ0A 3AVQA 5E7MA 3BS4A 4NE2A 3IGFA 1M74A 1L2TA 2C98A 2O52A 1AZSC 1D8TA 4NH0A 2KBFA 4XTCS 1E2LA 2QMEA 2GZAA 1BO6A 2V6JA 3SJBA 1E2QA 5TXGA 5KNDA 4QM6A 5JCZA 3IILA 1U9IA 4G5RA 4LBVA 2QRZA 1TUEA 3AVPA 1US8B 1OSNA 5GVRA 5FBRB 3ZH9B 5CDFA 2O8DB 5IRCD 2G1JA 4JS0A 5FL7A 1KO5A 3P32A 1GKIA 3EXAA 3ZIAD 1DAEA 2ZREA 3NIBA 1SQ5A 1W49A 1FOEB 4EIWA 3KFVA 1W48A 3FFBA 2CVHA 4ZDIA 1YU9A 5JCPA 2QA5A 4P31A 3CKLA 4TSFA 1T9HA 3DKPA 4LBWA 3U4QA 3F5FA 2BMEA 5G3YA 2QMOA 1OH8A 3W34A 4HUQA 2J7KA 5FBWB 5EXSA 4EJSB 1Z08A 3RRMA 5JMTA 3K9LA 1PLJA 1E2EA 1KNXA 4MUBA 4TYNA 4JL8A 4DCNA 2W6JA 3P4YA 4BLTA 1DAIA 2F3TA 2FSIA 2UZ3A 3I72A 5EP2A 2IYVA 3TGPA 4QHYA 4HB2A 1PUIA 3QKRA 2EYQA 4TL7A 1FNMA 3BXZA 5K8UA 2GAAA 5LBIA 1PZNA 3VU9A 4GI7A 4OHVA 3A6PC 1KK0A 3AF0A 4O0MA 3TJZA 2N42A 2IX3A 1YR8A 4KODA 3S1AB 2EYUA 5DI3B 1JXOA 1TF5A 4HEJA 3THXB 2PEYA 2ZRCA 2ZYTX 4QNRA 1Z07A 3H84A 2ZVQX 3RC8A 4LDJA 2ATXA 2GILA 4Z1MD 1E1RA 1ZVQA 4DB4A 3WHKA 1GDDA 3SR0A 4BPBA 5B64A 2MSCB 1ZUHA 4EPVA 3CUEF 6Q21A 1G4UR 3CZQA 3FGNA 2I3BA 1YZGA 1NMYA 1WDTA 5BW8A 4UXIA 1I2DA 3P26A 1OKKA 3AF2A 2W83A 1QHSA 3VX4A 1NVUQ 2GVZC 4MKHA 4IXMA 4A0FA 4B76A 3IBYA 3FB4A 1P2VA 2XJ4A 5G3ZA 3G5UA 2WHXA 2ZTSA 2QRNA 5EE1A 3LV8A 2VP4A 2UZIR 5JSZA 1ZAKA 3WMEA 4CW7A 4HI0E 3A1VA 4MITA 2ZRGA 3LDAA 1G8GA 4R9UC 3NBFA 4D0GA 3ZQ6A 1KYIA 4HAWA 3U4QB 1YZUA 3QQ5A 3R8CA 1U99A 2IA5A 3A4NA 1KI1A 4HUQB 1RRFA 4Q47A 1UKYA 2J7PD 2BCGY 1G41A 1JI0A 3IIMA 4QL3A 2ZSBA 2ZRBA 1Z6AA 1QZXA 2ZI5A 2KJQA 1XCGB 1K5DA 3BB1A 1F2UA 3VR6A 5KSYA 1H8HA 1GSIA 3SQWA 2Y8EA 3QKRB 2BMFA 1QHXA 3N2IA 1W0KA 2REOA 3VU9B 1KOFA 3BERA 2Z5FA 3PCRB 1XMJA 2QY9A 5A5GA 1EESA 4Q7MB 3BB4A 2GNOA 4TYQA 4I1SA 4RFVA 2XTZA 4XWAA 1QG4A 2FGJA 2O0JA 3OE7A 2D7CA 1T6NA 4NHOA 1LW7A 5JWHA 3H0KA 1TL7C 2CLSA 3BC1A 4PHHA 1HEIA 3JZMA 2CLCX 1GG2A 5TV2A 3BAFA 1SKYE 4BLSA 2YWHA 2YC4C 5EZ5A 3I92A 5FBLB 4C0QC 3VKGA 5GJBA 2D4HA 5KTYA 4OL0A 5L3RA 4HAUA 5CIQA 1U8YA 3GMTA 1R10A 3A37A 4KBGA 4FMCB 5JSZB 2FOLA 1YJ5A 4RJLA 2O8BA 2WWYA 3A4MA 1KDOA 1SVKA 3HWSA 4L4UA 4DUGA 2O5VA 2PEZA 2ZE6A 3I62A 5ANRB 3QEJA 2GXSA 5FUXA 1QF9A 4M9QA 4KFTA 3VR4A 1AN0A 1QHIA 2KWIA 1M7GA 4GP7A 4L5BA 1LS6A 4LOAA 5IK2D 3UWOA 4U7DA 3AVVA 2ZYWX 1E69A 3PUZA 3EPLA 2FSGA 2B21A 3K9HA 2HXYA 3VHLB 1HYQA 4GSYA 4M1KA 2V3CC 1QVRA 1F2UB 1A82A 4OQLA 2ZRJA 3B13B 3CPEA 3DL0A 4DLTA 1NVVR 2W6IA 5D3QA 2IUUA 4TMVA 4A15A 1CF4A 3CH4B 4D4MA 4DSNA 4DDVA 1Q1ZA 1TPZA 2QMUA 3AB3A 2JJ2D 1R0YA 3FMFA 4BEBA 5KYKA 4CEIB 1IXZA 4EPYA 1MV5A 4LJ4A 1UAAA 5FL3A 4Z51A 5DYGA 1TF7A 2CMKA 2V6IA 1XEFA 4MGZR 1D2EA 2C99A 1GNRA 4JT2A 3SE0A 4QRHA 3AF4A 3EA5A 1ESMA 4RKFA 1TX4B 5FOUA 2CEAA 3TQCA 1Z06A 1KI2A 4DZZA 2CJWA 3O8CA 1HT1E 2CE7A 2VRWA 3KJEA 3K53A 4MYCA 2GVDC 4M9XA 1NLZA 1OYYA 4D6PA 3TMKA 4PHTA 1SVIA 3Q7PA 4R7ZA 3LAWA 2O8BB 3BGWA 2OLKA 1DPFA 5CLQA 4JSYA 1XZQA 5JEDA 2OM2A 3LNCA 5KNBA 4NTZA 2ZE8A 1Z3IX 1ONBA 3NG1A 4LBZA 4OKSA 3ZIAA 1SKQA 5F9HA 3VR2A 4NYJR 1YRBA 3KXKA 1MT0A 4R71A 4TMZA 1UBGA 3CH5A 5EP4A 2GCPA 1ZNZA 2GHIA 3AKYA 1ZU4A 1AM4D 4I4LA 3SZRA 3CRVA 4JVLA 5FUVA 3PUWA 1HE1C 4E5UA 2D7DA 4DLVA 5UKDA 2F1HA 1N2CE 2CHQA 3NEJA 4Q1FA 3DDCA 2RGXA 4L9WA 2D2EA 1E0KA 3QUSA 1M6NA 2W00A 1KI7A 4M2LA 4EAQA 3I5YA 2OCYC 4ZIRA 1ZM2A 5JS8A 1KO4A 4M1WA 1T0JB 3AKEA 1ZNXA 2EFGA 3AGQA 2DPXA 4R2HA 4EJSC 2EFCB 4CT5A 2ZE7A 2GF9A 4GBMA 3KJHA 3GJ3A 3GEIA 2V9PA 1DAMA 1G64A 1KTVA 1Y63A 1H8ED 3E70C 2J0UA 2JIZD 2WSSD 2QI9C 2YINC 2C9CA 2NG1A 1ZM7A 3IKJA 3B82A 2JDID 1GWNA 1LS1A 2YC2C 4Z1MA 3KL4A 2CJWB 1VYVA 2WJJA 4CIDA 4V02A 2H16A 4LV6A 1SKYB 2J0SA 3R8FA 2CE2X 1YR7A 1AS2A 3Q8XB 2YOHA 1N5KA 3NXSA 4Q9JA 5AJYA 2G0TA 4MUAA 2IYYA 1E98A 4Q7JB 2MMGA 4I1VA 2WVJA 4AURA 1NP6A 4FMDB 1KNQA 3N5CA 3ZVLA 4FXPA 1LV7A 2QG6A 2AKAB 5J4LA 3U7FB 3RRNA 1XBTA 2J0QA 3G0HA 4XTRA 2E1RA 4QGFA 1N6PA 3B9QA 1KMQA 5CM8B 3U3RA 5K8TA 2WKPA 1IY0A 2IYWA 3MLEA 1U9IC 3FVQA 1BS1A 5E7IA 4FCVA 1MKYA 4BLRA 3EZ6A 4QXAA 1RPZA 3I32A 1E9SA 1U0LA 4JL6A 4PPQA 1NLFA 2F9LA 3V4FA 1JR6A 3EPKA 1X1RA 5FI1B 1FUKA 3FMOB 4LYAA 5SZHB 3LW8A 3H1TA 4QBHA 3V9PA 2J7PA 3LO5A 1XTQA 1KO1A 1SVWA 4ARZA 2FFHA 1XWIA 4FIDA 2P6UA 1F6BA 1W4BA 2REBA 4ZIRB 3U7GA 1UKEA 2OZEA 3QVUA 4QGAA 2Q3MA 2P5TB 3ZVNA 1T3LA 2AXNA 1ZD9A 1JALA 4BFWA 2J87A 4WBSA 1AKEA 821PA 1CJUC 4KSCA 3LLUA 5J4KA 5F9FA 4Q4HA 1XTRA 3VR3A 2J0UB 4JLAA 5FUWA 4NCKA 4GNKA 4JJZA 4ZDJA 2CK3D 3C5CA 5C4MA 1KSFX 1ZNYA 1W7AA 4IXNA 2ZRIA 3QKSA 4NBSA 2IYUA 3MG9A 4G5SA 3BFKA 721PA 5C46F 1FL9A 2Z83A 4DSTA 1SXJD 4EKDA 3NHAA 1CRPA 4LYFA 2X2FA 2D62A 1IQPA 1RKBA 2ZEJA 2GK6A 4EPRA 3LQRA 2IS1A 3ASZA 4KO8A 1J70A 4DLUA 3EC2A 4XOIA 4DB2A 3CR7A 4Z54A 3BORA 1EFCA 1NBME 3IO3A 5BYJA 4BRUA 3UKDA 4C3ZA 4A82A 1YQTA 3ZZUA 4E03A 3ADCA 5D3MA 2OCPA 4R2IA 3GJXC 3JZAA 3QXHA 1Z2CA 2IWRA 2PX3A 3TKLA 2QM8A 1IJEA 8OHMA 2ZRDA 3TRFA 2WIAA 2ZI3A 1IONA 1VKJA 4M21A 2WICA 2WSMA 3PEVA 5FPSA 2VO1A 2ZAOA 5IK2A 1BH2A 2PT5A 1FTSA 2ZS8A 2R6AA 1W4CA 1PUJA 2ZUBA 5FH9A 5JHHB 2W2VA 2V4ZA 2W0MA 4ARZB 2ZRKA 1VG9B 3RS3A 3TUJC 2ODNA 3MMPA 2OCBA 5P21A 2AFIE 4ABYA 3AVWA 1G4AE 4YXWD 5B57C 2V1UA 2QQ0A 4Q7KA 2JGNA 2GTPA 2O8FA 2XOKD 5HPYB 1OJLA 1ZUIA 3L0IB 2NPFA 3FWYA 1K5GA 1R6BX 3U60B 1OF1A 1Z28A 3MWKA 4PZLA 5AUPB 3QF4A 4W9MC 2IS6A 4PPFA 4LJAA 4Q4HB 1M34E 3DKVA 2JJ2A 2CXXA 3K70D 3UMRA 1G1MA 1N25A 1TMKA 3LVRE 2FEMA 3QKSB 3KJGA 2JLWA 4IFBA 5FR2A 3VQTA 3BJIC 1SVLA 1TQ2A 3WBKA 1J90A 1OFUX 4RD0A 3W5IA 4LZZA 4AKEA 3DMDA 1GKYA 3NBXX 2XSZD 2C5LA 4CRWB 1T3SA 2A9KA 4LHYA 1D9XA 4A36A 1R7RA 1NSFA 1YZNA 2LKCA 3AUXA 4A9AA 2WAXA 5FTMA 1VPLA 221PA 3L43A 4JBWA 1OKKD 2OFXA 2QPTA 1LFDB 2F43A 2QZ4A 3FTQA 3O47A 4LPSA 4XD7D 1L4UA 3BWDD 1UEJA 4K8OA 2F3RA 4TMTA 4A8JA 3AKCA 3T1TA 3B6EA 3KB1A 1XB2A 2GJAA 2YJTD 5D3MB 3CO5A 2WJVA 2GXAA 4X8MA 3OIVA 3KQKA 4DEXA 1S3SA 5DE3A 4OK3A 3GJ8A 5C4GB 2QSYA 4IVPA 2BJWA 3IIJA 3QG5A 2OXCA 4LGMA 2VSOA 1AS3A 4P32A 1J7KA 1KO8A 1QHHA 4XJXA 3V00A 5H8WA 1LB1B 3KQLA 5CYOA 4PZZA 3LXRA 4URWR 3SYNA 1NG1A 1S4QA 3C4JA 4FCTA 2XZLA 3C15C 3K1JA 1GNQA 1GTVA 2ODWA 5DNYB 3KFXA 4HB3A 5H70A 1DO2A 3OEED 3WP0A 1CU1A 2VP0A 2O8FB 2Q9AA 3AVTA 3KX2A 1VTKA 2X19A 4NCJA 3T15A 1F5NA 4A0GA 4P4UA 2CHGA 3QF4B 1ZM9A 3AF1A 2PZFA 2H92A 1X8KA 1HH4A 4JLBA 3ZZ0A 1KSJA 4YMWA 4UNSA 3UWKA 2WMOB 4TTPA 5AJXA 4ZDWA 1L4YA 2B92A 1G3UA 2EVWX 5CB8A 4D0NA 1KK3A 1H8EA 2GXQA 3VR1A 1Z6TA 4Z8XA 1E2DA 4TLEA 4Q4AA 2WJIA 2PMDA 1G5TA 3AVXA 2JIZA 1RRGA 1JR3E 2WSSA 1BMFD 1JXMA 4M8NE 4DLSA 5HCNA 3RS7A 1SVSA 2WWIA 1J2JA 5J40A 1M7BA 2JDIA 1TQDA 1TTTA 2B8WA 1XCMA 3ZD7A 5EXXA 1E2FA 2WWWA 4BASA 4LC0A 3O8RA 1NN1A 4CT4B 2F43B 1UBEA 5GVSA 2ZROA 2A5FA 1D6JA 4FW9A 3KDSE 4GMXA 3ZDQA 3CNNA 4A8JB 3CLVA 4OQXA 3FHCB 4A2WA 3QXSA 1XJQA 4HLUA 2N1BA 4OI4A 4S2EA 1MO6A 3U61B 1WCV1 4BRWA 2QAGA 2QBYA 1YR9A 2G6BA 3RWMB 2HV8A 1FQJA 2J46A 2QL6A 1GM5A 4PPNA 2FDCA 4RSGA 2GXUA 5JI2E 4YC7A 4D4LA 1QHHB 1EFHA 2FG5A 2LKDA 4ZO4A 2JAQA 1PLKA 3CRW1 4YMVA 2BBWA 3W9YA 2WOJA 2HT6A 4LJ6A 2DWOA 4B3DA 4X8HA 2EU8A 2Q3HA 3UMSA 3Q5EA 2FZ4A 1G6OA 2JLUA 3QI2A 4ESHA 4TL8A 4MYTA 1KJWA 1GIAA 2KB0A 4LUCA 3PEYA 3NEYA 3QJYA 4LV8B 2PMKA 3VMFA 1EK0A 3SHFA 2PJRA 3NKVA 4M1SA 1P61B 2R8RA 1XMVA 1QDEA 1U81A 5JS7A 2HDNB 3CRQA 4XVUA 2GBLA 4QJ4A 4LHWA 3Q9LA 3U3KA 4Q03A 3NH6A 1CJKC 1GKUB 3PVSA 2P67A 4Q4AB 4OHZA 3T1QA 3SI7A 4BFUA 2CK3A 2HCBA 5EUQB 5FI0B 3QSYA 3OFND 2PCLA 4B71A 3SJCA 1SXJA 1XTJA 2RGAA 2F9MA 4UJ3A 4W5WA 4IEIA 3DVLA 5G41A 4D4JA 1PLLA 4GRAA 2CL7X 3SN6A 3EZ2A 4B75A 4M4SA 4DLRA 2QMHA 4L15A 3HYRA 2ZUDA 4Q7LA 1P5ZB 4AI6A 3OIYA 2ZSEA 2RGNC 1NKTA 3QOFA 2QAGB 5CYPA 2QBYB 3GFTA 3F0TA 3EPJA 2NO6A 2KSQA 3C41J 4Q9KA 4TWZA 2FSHA 4NPHA 4DC9A 2AD5A 1G20E 4HSEA 3WNCA 5FR1A 4KI0A 4KYUA 4KSBA 1E9CA 1Q3TA 2C2HA 4FD2A 2GWHA 3NVAA 3QXCA 1R5NA 4ITRC 3A58B 2ZI6A 4JLNA 2GF0A 1WMSA 2R9VA 4D80A 1JEEA 3W6OA 1RE0A 2FV8A 2F6RA 1NMXA 1Q1EA 2DY1A 1N6IA 2X77A 4RVCA 5HR5A 4W5HA 4FCWA 4IJMA 1E3MA 1KSHA 4CF7A 5HKKD 1HY3A 2AWNA 1N6LA 5J4VA 3ZVMA 4NCHA 4OQFA 1VCIA 2ZETA 2NTYC 5FTNA 2IEZA 2ZR0A 2C95A 1QG2A 1IXSB 1UKZA 2Q6TA 3NHBA 4JLKA 3SJZA 1ZD8A 1NN5A 3QPUA 4IKEA 4DLXA 5IDVA 1N5IA 1AGPA 2NO1A 2WV9A 2XOKA 4Y0AA 4YQFA 2JCSA 3HR7A 3OEHD 1OFHA 1QVAA 1KZ7B 2QAJA 1J8YF 3MWYW 3ECCA 1TF2A 2ODEA 1KDRA 3A1TA 2EFHB 3FMIA 4F38A 1MO4A 3ZYCA 5L3SA 1AZTA 5J47A 2VP9A 5AJWA 1WE2A 1MRNA 2OBMA 4QFMA 1SXJB 4B3CA 3DHWC 3X2SA 2IF2A 4XSHA 2XNDD 2QTFA 1KKMA 1GRRA 1SVOA 2XSZA 4DEYA 2VQSA 1CR4A 4OI2A 3GLFA 2HEIA 2AHOA 4NU0A 4L16A 1D9ZA 3WNBA 1TUIA 2QP4A 5H1YA 1FP7A 2JLRA 4MRRA 1ELOA 3TSOA 3SBEA 4Q00A 1OIVA 2BEJA 2AN9A 2VHJA 2ZJYA 5DO9A 4XD7A 3UATA 4TTRA 1AQUA 2ZVPX 1Q44A 3NC0C 1S3GA 4UNNA 5KSOA 5FPKA 4F4IA 2BM1A 2HCJB 3TVDA 5IF9A 1ESNA 2BHRA 1XNJA 2HF8A 2YWGA 4RD6A 3MWLA 1P3JA 1CR2A 3PITA 2GJSA 3H86A 4JLVA 2BMDA 3GEEA 4TN1A 3RNLA 4UNRA 2ERYA 1DAHA 2FE4A 2FU5C 2J45A 3EIQA 3HR8A 3GFOA 3ASYA 2CL0X 3NDBB 4V0LA 2XXAA 1NI3A 3L0SA 1FNNA 4FMCF 3W90A 2GKSA 4AG5A 1CIPA 3PEWA 1C1YA 3LVQE 3PXGA 2QGNA 2G0NA 4PC7A 3VKWA 1IAQA 1A4RA 3I1FA 2ZRAA 3EAQA 2RKOA 3L2OB 1NY6A 3ZLJA 1XTIA 1ZYUA 2BEKA 5EE0A 4DT1A 3AQ4A 3OEEA 3BRWD 3N70A 3U3OA 4MKFA 3N2EA 4E09A 5KOYA 1Z0IA 2IXGA 2JASA 5HCIA 2NO0A 3D3QA 4HYYA 4DIEA 2ZI4A 1TADA 1XD2A 2JLSA 1Q22A 2LCFA 3CRMA 3EIEA 5A4JA 4URXR 3AM1A 5BN4A 4G5OA 2VP5A 4HB4A 3VTKA 5F3WB 2CL6X 1OH5A 5L3SB 3K70B 1OXXK 4EFMA 4GOKA 3Q5DA 4AC9A 2QGZA 2BKUA 4CEIA 1E32A 1T5LA 4QBGB 4C0HA 1B23P 2ORIA 1VG8A 2V54A 1XPRA 2VA8A 4DJTA 2ECKA 2P3SA 4KFUA 3GLFB 1BMFA 5EE5B 3GQBA 1TU3A 4TL9A 2I1VB 2DFTA 3QBVA 4H9GA 2ZXUA 1KJZA 4C9BA 3IQWA 5KDOA 2H18A 1W36D 2ZI9A 3WYGA 2BMJA 1EXMA 4QM7A 2IC5A 1WA5A 1OH6A 4IRUB 1XTSA 2QENA 4QJ3A 1U98A 3K0CA 1N6NA 4QJ5A 3CONA 1W4RA 3I61A 4EPWA 1NF3A 1YR6A 3EPHA 1CULC 3Q3JB 4TZ0A 2XXAB 2RCNA 2BJVA 2B6HA 4OI1A 5BN3A 1BYUA 4S35A 4Q4JA 4RZXA 3EZ7A 4Q9HA 1RZ3A 2JATA 3DOFA 5EP3A 5EXTA 1UBFA 2VYFA 4N1AA 4TMWA 2YWEA 4C0SA 4MRSA 4DT1B 1OIWA 2ZQ5A 3IPXA 2OV2A 3RANA 4ZI3A 1QHYA 2I4IA 3SDZA 3WBJA 4PAQA 3CF2A 3T06B 5CJPA 4OJKA 1XD2B 1JAHA 2BDTA 3BH7A 2YHSA 3RABA 1GOTA 3RS5A 1HT2E 3EWSA 4LV5B 4I81A 2CCGA 4LHZA 3BBPA 2W2XA 4IDPA 421PA 1ZU5A 3TW8B 1RW4A 3OF5A 3W5JA 2VLIA 1YZTA 3C8UA 3KXIA 3TVTA 4B2IA 3T34A 3R9IA 2F55A 3WYAA 5CITA 2HXSA 2RAPA 1P9WA 1R8QA 5KNCA 3LY5A 1G5RA 1VCNA 3OFNA 3TBKA 4B35A 3C7KA 4BECA 4II7A 2IEYA 3B2EA 4LX0A 4V03A 3JVVA 3X1ZA 3FDIA 1Q1BA 2BIFA 3CIOA 2GAOA 2ZANA 5DGXA 1F60A 1RC8A 4F92B 3LRPA 3B85A 3HJNA 4ACBA 3PQCA 3P20A 3I4LA 3SFVA 2IYLD 1R2QA 4KITB 2W58A 4PSAA 2VBCA 1N3BA 2XJ9A 2IWHA 3IPYA 4B6EA 1NBMD 1T4GA 3AP2A 1N6HA 1E99A 1G8YA 1LTQA 1M2OB 1S1CA 4LK2A 1OHHD 5SZIA 3M1IA 2QEQA 4IOJA 5JFGA 3GLGE 2RB4A 3SQXA 4B43A 2D74A 4FMDF 5AUOB 3CWQA 1MR3F 1VHTA 4V0OA 3DM5A 2BVNA 2OO7A 3ADBA 1XJCA 3FMPB 4IDOA 2WJHA 4Q4JB 2B8TA 3RS0A 2R65A 4KYIB 1IN6A 3ZJYA 2XX3A 5HZKA 4KVGA 2F1RA 2FWRA 3DOEA 2BWJA 3RAPR 2WMNB 5EP1A 4AWXA 4RCYA 2Z6VA 1CBUA 5HKKA 2C04A 1RRPA 1X6VA 1XD9A 3WMFA 5BN5A 2XZPA 3P27A 4DLZA 1T5IA 5DHFA 1YHNA 2QT0A 4PZYA 4HZIA 2PJZA 5JWRA 3GD7A 3U2QA 3FE2A 3X1XA 2FFAA 2A2ZA 4BE7B 3OEHA 4JYCA 4OBEA 2J9RA 4LHVA 2FGKA 3EC1A 3MJRA 4D4KA 3UPUA 1S96A 2RGGA 4LSGA 4RD4A 3TAUA 5HE8A 4FMBB 4GOXA 4LI0A 3W6PA 5C2JB 2NMVA 1E0AA 2ZRHA 4JLMA 1VHLA 1FP6A 2ASEA 2L0XA 4U5XA 5DISB 2FN4A 3ICQB 1RYFA 4XWKA 2ZRPA 1TAGA 3GLIE 3BIFA 1N0VC 2XNDA 1NN3A 2YZ2A 1N6KA 1HA3A 1NY5A 4AIIA 1GL9B 4W7SA 4A92A 1XPOA 1S0UA 1SXJC 3CF0A 4PPGA 4CZ2A 1OFIA 1WXQA 4RZUA 1L7VC 1II9A 2FPKA 3K0SA 2O8EA 4FI3C 1W2HA 1X1SA 3PENA 3KTAA 4RKEA 4BQSA 3GLHE 2QE7D 3K09A 4Q1AA 4AKHA 2MSEB 2ZUCA 3WHLA 5FPHA 1KI9A 2G83A 1P2SA 3ADKA 2D2FA 1JECA 4C0BA 3KQNA 1OV4A 3VX3A 1IBRA 3BOSA 2XGJA 1DTSA 3MFYA 2IXFA 5K8LA 1FFHA 2EWVA 1H65A 1XP8A 1CS4C 1DELA 1VIAA 1X8JA 1YRAA 2NPIA 3OIWA 2RMKA 1CLUA 1MABA 1ZRHA 3LLMA 4CVNA 3J81k 5JBQA 2FEOA 3SHWA 4BFZA 1Z83A 4O25A 4Q1CA 3F3YA 1UF9A 3FKQA 1J8MF 1FZQA 3TIFA 3UANA 4MDFA 2DYKA 1CR1A 3SFZA 5EZ6B 1SGWA 2VHCA 2G3YA 3SU8A 3T12A 4C4PA 4WZBE 4CEJA 5FBVB 1JPJA 2R6DA 2VPPA 5BQ5A 1EX7A 4AKGA 2NQ2C 2O0KA 1J99A 4BFYA 1P72A 1TQ6A 4POAA 2ODBA 4B34A 4NZYA 4PC2A 3X1YA 2OSBA 3RVBA 2IT1A 1JR3D 4Q66C 2C77A 1OLOA 2FX3A 3D31A 5J4HA 3CNOA 4HAXA 4PQRA 5KSPA 3W3ZB 2PH1A 4GZMA 1YKSA 4HDOB 3DPUA 5E95A 4TLAA 4PO8A 4WAUA 5L3VA 1D2NA 4IOKA 4M22A 1S2MA 1N0UA 4C7OA 3W8RA 1ETUA 3PUVA 4UKDA 1U94A 3KZ1E 2ZM5A 5DN6D 1Z6YA 1G8HA 2O8EB 1AA9A 2FF7A 2GEUA 2QORA 5L8VA 3B60A 3KTAB 1ZIPA 4P3YA 3MAAC 2EFDB 4DKXA 1SHZA 4OYHA 4J0QA 2IYTA 1G9XA 3MJHA 3GLHA 3V4RA 1R8SA 4HLQB 4DCTA 1CP2A 4TYPA 5FTJA 5GJCA 3EW9A 2E87A 1GL7A 1UM8A 5KSZA 1E79D 2WWXA 5HE9A 3FOZA 1FMJA 4HLDA 1VG1A 2DBYA 1DAFA 3MD0A 1MABB 1VMAA 1YZQA 1G3RA 3VNVA 1FQKA 1T91A 5CK4A 4RZ2A 4WXPA 3PFIA 4KAXA 4TLBA 2XB2A 1P62B 2OAQ1 4H1UA 5EQTA 4DWJA 2DCUA 4CGZA 2F7SA 2NGRA 3CRRA 3R20A 1XU4A 2GJ8A 1IM2A 4OQMA 1ZBDA 4CEJB 2GRJA 3FFAA 5E7JA 5TARA 2GJ9A 1NLYA 3Q7QA 1I4DD 1WQ1R 1JAIA 2NOAA 4XVRA 4F4JA 2A3RA 3PEUA 3A1WA 4CYMA 2AD1A 4IVQA 1COWD 1AS0A 1P2TA 4K46A 5JHGB 1E1QD 3A1SA 2AFHE 5KPDA 2CDNA 2FFQA 3B1YA 3EA0A 4E07A 4TQUS 5JECA 1Z8FA 4TQ9A 4KLZA 2FZLA 2W0SA 3UXMA 1TQ4A 1OPXA 4M1OA 3E1SA 4JLOA 4QHSA 2NO9A 1TEVA 4C7OB 1FW6A 4HDCA 1W36B 1KDPA 3U6BA 4D25A 4LYHA 2FPMA 1X86B 3MCAA 1ZINA 1E9DA 4KBFA 1Q3HA 3RYTC 2UKDA 3TUIC 4A1FA 3W3AA 1NBMA 2GA8A 5HZHA 3ETLA 4BFXA 2RGBA 5C18A 3GLHB 3TE6A 1QRAA 2Q9BA 4AD8A 5FOTA 2CHVA 3K0FA 3AVYA 1OHHA 1X3SA 5EE3A 1BYIA 3GJ4A 1G7SA 4IW3B 1S1MA 1I4TD 3K0CC 1VDZA 2QUZA 2AXPA 2IYZA 4EDHA 5FTLA 2FNAA 1ZJ6A 4CDGA 2VSXA 2IS4A 4GPTA 3SEAA 1L8QA 1Z63A 2KI5A 1JB1A 3EZ9A 5K8IA 1EFTA 4OJQA 1QHNA 4JVSB 1LF5A 1RIFA 2J1LA 2D3WA 2YNMA 4M9SA 2NZJA 4OHYA 3B8HA 2E9SA 4B47A 4BUJA 1PJRA 4DRZA 1GP2A 4ZCMA 4QOSA 1Z6GA 4JIMA 4RD2A 5DI9A 4C0JA 2VP6A 4DVGA 3QEOA 2WAYA 3IIKA 2GK7A 1M8PA 2WWHA 3A8TA 1JQLB 2IL1A 1O87A 2HJGA 1WRBA 4Q4LA 1EGAA 2QU8A 3A36A 2GEVA 4ASUD 2C9OA 2DFKB 3EZFA 1Q0UA 2DHRA 4KCGA 1DVRA 1XX6A 2PZEA 4JSTA 4XSGA 1AGRA 4NYMQ 4WW0A 3CW2A 4I1UA 1GZSA 4JLJA 3DEFA 3OIUA 3GJ7A 2HYDA 4IEEA 2JLVA 2ZJBA 3EASA 1G17A 5DLQC 4DSOA 3DZ8A 3HDTA 1VIYA 4D0LB 1KKLA 1W47A 2QPOA 3DMNA 4CEHA 1XF9A 2QP3A 3ONWA 2C8VA 2GJKA 4PHGA 2OUKA 2P6RA 1G3QA 3K0FB 4UXJA 2QE7A 3LBHA 4X8OA 3CX7A 1G7RA 2HF9A 3K0AA 4PAOA 5JI3E 5DYIA 3ZS9A 4JLPA 5G40A 5GJVC 1OFTA 4PQYA 5AJZA 1EWQA 1UDWA 4V0NA 4JKYA 3QVVA 2C78A 2ZITA 3Q72A 1G8PA 3LD9A 3WYFA 4F93B 1PV4A 4TMXA 3I5XA 3B1XA 1OIXA 2J41A 4LWZA 4B48A 4GMDA 3SYKA 2GCNA 4KJZA 4QG7A 1HQYE 1LY1A 5CK5A 5CDFE 1A7JA 3O8DA 3GCGA 3U3MA 3OZXA 1Z29A 5KUTA 3HPRA 1HURA 1Z0JA 4NYIR 4US0R 2H7VA 1P9NA 2I1QA 3QXJA 3FKSD 1W5SA 5DH9A 4GOJA 4MH0R 4KV9A 1JJ7A 3RS2A 4ERNA 1A2BA 1HE8B 4G3XA 4PC6A 4JVMA 4BLPA 4A2PA 4KU4A 4MGIR 1NIJA 1ZW6A 4P4SA 5LDDC 1E6CA 2ZU6A 3VKHA 3WRYC 5AUNB 1R5OA 1AJEA 2CVFA 1N6OA 2HLDD 4ZPXA 2P5SA 2IHBA 1JR3A 4URVR 4JVNA 2H57A 2LWIA 1FTNA 2KBEA 2VIIA 2OG2A 4AG6A 4A0RA 2CNWD 1ZD1A 2Q3FA 4TYYA 2G88A 1QHGA 1U0HC 2HUPA 4DCVA 5L3QA 4CEHB 2AX4A 2VHTA 2RGEA 3IEVA 2ONKA 2X8AA 5DN6A 3QPVA 1NRJB 3R7WA 2SHKA 1W0JD 5E4FA 3L0PA 4EFNA 1A1VA 3WMGA 1G291 4LHXA 3K0AB 2BKEA 2MMCA 1IXRC 1G21E 2CLDX 4WZAE 2WTUA 1I2MA 3M0EA 2VSFA 3H2YA 3A4LA 3BFXA 2X1VA 3KKOA 2H5EA 1Q1QA 3K09C 1FPMA 2FA9A 1Q12A 1CXZA 4OQNA 1E79A 4Q5IA 2XAUA 2PT7A 2QN6A 4HDQB 1Q57A 5EXPA 4Z8YA 3U44A 5TB5A 1ZC4A 1CTQA 2J59A 4OI0A 3L82B 4Q21A 3KQHA 1AKYA 2GETA 2VEDA 2ORWA 1RJ9A 1DAGA 3AVOA 2CCJA 3ZVRA 3T5DA 1NKSA 2R62A 2UVQA 1O3YA 5EE9A 4KXFB 1G5PA 3LXXA 3AP1A 3B7GA 1N5LA 4PSKA 5AWFC 2ZJOA 4B73A 4BLOA 2BBTA 2RH5A 4P4SB 3RSLA 3UG7A 4Q48A 2GEDA 2BOVA 1E94E 2GCOA 1COWA 4EPXA 2ZR7A 1E2MA 1E1QA 3E2IA 3OESA 4MDEA 1CKEA 4MA4A 3RWOA 3ICEA 1UKVY 2Z4RA 1E2IA 2WZQA 1EFRD 1I4LD 2B7CA 2PCJA 2JLYA 3PUYA 3I8SA 4E22A 1E2PA 2V55B 1EFUA 2FJUA 4M1TA 4M1MA 5CM9C 4C2UA 4QNMA 4TQAA 5J5CA 2PX0A 1NJGA 4KFRA 5L3QB 1KGDA 1E2JA 2ZU0C 5BWMA 3HYTA 2V7QD 4UXHA 3QE0A 1GL6A 3R7WB 3WRXC 3LWNA 4JL5A 3ND8A 1W44A 2Q9CA 1E2NA 1OH7A 3K9GA 4HB0A 4G1UC 4BLQA 1S8FA 3RRZA 5B58C 1W36C 1OE0A 2YWFA 3LFUA 4KHZA 3D6TB 1CJVC 2IK8A 3BH6A 4IFEA 3GP8A 4Y0VA 4XIGS 3BE4A 2JJ1D 2VHQA 2AWOA 5A0FA 4DIDA 2VL7A 2V1XA 4C0KA 1E0SA 4NP6A 3U3JA 1CRQA 2A7QA 1IY1A 3X1WA 1G3MA 1KK2A 2AL7A 3U44B 2IHYA 2QSZA 2XTNA 2VTKA 4ILEA 1VCOA 4B6FA 5JLJA 3EG5A 2XNSA 2ZRFA 2YYZA 1P73A 1TNDA 1RJ9B 3QF7A 1AIPA 4IDNA 5AJVB 5C1BA 4H1VA 4ESVA 1OB5A 2G77B 1M1YE 4LJ8A 4PO9A 3F8TA 4PHFA 3K9NA 4IHQA 1DS6A 2WIBA 5CJ2A 3TSZA 3VNUA 2A78A 4AYTA 1LVGA 4M9ZA 1S9DA 2IW3A 2O8CA 4MRNA 1GFIA 1R0XA 3KQUA
chains in the Genus database with same CATH superfamily
5AKKA 1CJTC 1SG6A 2XOEA 1WD7A 2JFUA 4Q1DA 3TTSA 2JLXA 2V4UA 4N03A 1H3FA 2EFEB 3T7CA 1G6HA 1TYEB 5IC5A 2D2IA 1DIBA 1LVHA 4PAMA 1MXHA 4RKYA 3DE5X 2VP2A 3M9XA 5T4BA 2ZBUA 5CG2A 1S7GA 4UPVA 2AW5A 2GSWA 3PYLA 2OZVA 2W70A 2WTEA 1FS6A 2W22A 3UEOA 5I3ZA 1WPQA 3WYEA 1U90A 1XZBA 3K5IA 1SCNE 2F3QA 3L01A 3MJVA 4YEDA 3VNQA 4ENUA 4KO2S 4AJ4A 5ADVA 4JKIA 4QWWA 1G19A 2C2GA 1F6WA 3E3AA 1C3OB 3M2TA 4B3GA 1QVZA 2PGNA 4WASA 2DLCX 3UFXA 1S2DA 2I76A 4NATA 5AI6A 1PX0A 4OX9B 3LP6A 1JLRA 4D0SA 2VK8A 3UGQA 1GAWA 4J1TC 2AG5A 4EELA 3AVUA 4UM9D 1YVEI 3NU1A 1X7YB 4BNZA 2OV8A 1ACLA 3PNKA 4LOKA 4BWYA 1FSZA 3GJ0A 1ZM3A 1QR2A 5GMOA 1SCBA 1SBZA 1ECJA 1MOPA 4U7JA 3H83A 1GQYA 3AOGA 3GLVA 3NTRA 3PGVA 4M38A 5AJTA 2IUSA 1RYHA 3DVQX 3HU1A 2E5WA 3DOUA 4K6CA 3D7MA 2Q07A 4BQOA 5C7IO 3OM1A 4BO4A 1U8XX 1SUIA 1T8PA 1DBSA 1I2ZA 2HU5A 2NV2B 2VDWB 2VF7A 1C7JA 2H1LA 3IO5A 2CFTA 2WMDA 4KX3A 2R6ZA 4MIOA 2JVKA 2OOKA 4MROA 5F35A 4DG8A 4HBGA 4NBTA 5KIAA 3PU6A 5CVEA 5TIIA 2IU3A 3ADPA 3P1JA 3GAZA 1T8TA 1WBJB 4BP8A 3MMXA 5JIBA 2Z57A 1JKIA 2JBAB 1WY5A 3IOBA 3OTOB 3KK0A 2H52A 2IY7A 4DLNA 3IL2A 2C94A 1UP7A 3P94A 4UEOA 3RGGA 5IM4A 4PQFA 1RXEA 2XCLA 3P7MA 3H9EO 1M1YA 3TZ6A 3ZCVA 1J6UA 4F4CA 4WCFA 1X14A 3EVAA 3M9WA 1YRHA 3B52X 1JHRA 5T5QA 3HYNA 4AAYA 3LWZA 1SRQA 3DLBA 1XHEA 1PT6A 4F91B 3CKMA 4GC9A 4HDKA 1CW2B 3KXLA 1NRWA 2ATVA 1EP2B 2X9VA 2VUSA 5CG1A 3RFUA 2F1JA 3EGCA 3IOMA 3F67A 3DZGA 3R7SA 5JNSA 5HILA 3NGLA 3HBJA 1X7WA 4M0LA 4NF2A 4WGFA 2P77A 2DTEA 4PGAA 2XB4A 1YZYA 2J3MA 1Z6PA 1HDEA 3HKCA 1X8LA 5D6OA 4MWGA 4N01A 4YCSA 4XPZA 2AMVA 2IEDA 4EUEA 621PA 4EENA 1M6HA 2OB1A 3JAWB 5JVDA 1MC4A 6ABPA 1SD1A 2ZZMA 2ZKIA 4YGXB 5AHRA 1SZDA 4TKZA 4MYHA 1OYWA 3KKPA 3WK8A 1PG5A 4GQAA 4XJTA 3STTA 4R4JA 1IOZA 4L9AA 3X1DA 2W42A 3T4XA 4BFVA 1YWGO 4DMRA 2W93A 3ND9A 3QMVA 1DBWA 4L6CA 2ID8A 4C2AA 1DCMA 1XHFA 4C3UA 3Q2OA 3REFA 3RDPA 4US1R 1DE0A 3KKQA 3AR7A 1P4SA 5KCZA 2QS9A 4PS1A 1G8FA 3PEEA 5A05A 3C6YA 5IAOA 1PW7A 3PGKA 4TYWA 2PQMA 3NC1C 4G0MA 2CKDA 2NO7A 3IV6A 5E8RA 5FV7A 2JHPA 5JFTA 5M2QA 2XGSA 1V6CA 1XMOB 1WXWA 3FYHA 2BHTA 1G60A 2D5LA 4YO8A 1VJ1A 2IY9A 2HHCA 3IXQA 3P4XA 1DRJA 4PANA 4WXYB 1WTCA 2UYGA 1YZKA 1FEZA 3B3AA 2OB2A 4JWTA 2QZPA 5ILGA 1BFDA 2QRKA 4L08A 2YHIB 4Z7NB 4OXXA 5A3JA 3KPJA 2Z43A 2NVBA 1KK1A 3F97A 3OX2A 1RR6A 1Z0FA 4HVCA 2COUA 5KWSA 2Y0CA 4EMTA 3JQBA 3ML1A 5LZ8A 5F4ZA 5JNWA 3RC2A 3EIUA 4CN9A 3WGUA 4KR3A 1AA6A 1QIFA 1DT3A 4D44A 1UBMS 4O4JB 1WZEA 1WD5A 3EGWA 3OHPA 4CFSA 4S3MA 3SJAA 2HHJA 4R98A 4KH1A 3ZD6A 2F59A 5BWNA 3V8VA 4AO8A 1CZRA 2F17A 4F2HA 5TMPA 1L5LA 4DT1A 1LFAA 2CNBA 3FR7A 4FNGA 4ZRNA 4DDUA 1DT5A 2CV0A 2OBBA 2PWYA 1WBDA 1DOAA 1TRKA 1V26A 5CDYA 3MC1A 2JAWA 3JARA 2OT3B 1QIDA 3PNMA 2WU0A 1KDYA 2JEOA 3R5JA 5JRZA 2VATA 1W88B 5HZMA 5J2TB 1UPTA 3LX8A 4TT3D 3WRWA 1EFRA 3WJ1A 1S01A 2UVDA 5K4GA 5CBKA 3AG5A 5GPBA 4UE3S 2YV4A 2O2EA 1MMFB 2X1HA 3VDXA 3CX6A 4BJ1A 5H3HA 4C0LA 4YUYA 2YOFA 5EFOA 4JJKA 1RWWA 4QDUA 4RANA 2SKCA 1AB6A 1XFAA 2B7BA 2V59A 5HKLA 1XRQA 4HDRA 4AWBA 2Q4RA 3ZIDA 4DHEA 2VQFB 3IUEA 4LJ7A 3WGYA 3DVRX 5IDXA 4MXDA 3TTTA 5JQGA 4JXZA 1TLFA 1V3VA 5HNKA 1R6AA 3M7IA 1IULA 5KNDA 1NTOA 4NKRA 3CLHA 2ZE5A 3HDQA 3VJRA 2XCSB 3N6VA 3MQ2A 3VKUA 4JT9A 1M73E 1ZCJA 2ODPA 3Q8MA 2RGNA 2P0EA 1DNPA 1K88A 2FX2A 3ST7A 3COZA 3BTUA 1BXKA 3FD8A 4XB1A 3VYSB 2ZBGA 3QE9Y 3UTCA 1ST3A 1PVOA 5E3IA 3H1PA 4O3FA 1JIQA 3MVEA 3BM5A 1NUSA 1G4HA 2OLJA 1W52X 4ZEXA 4RHCA 1GZ3A 3WNDA 5EVJA 5AI8A 4DR3B 4B33A 4ZOEA 1GRQA 1P2UA 2XB8A 1N32B 3BXPA 3E15A 2IV3A 2BGMA 1N7JA 4NBLA 1QONA 4F06A 5KJEA 2XNJA 4P34A 2EG9A 4H35A 3LL4A 2R85A 1UFOA 3DE6X 4YDRA 4EABA 1IIBA 1OLSB 1TU0A 4RD1A 3NETA 2VPZA 4O2RA 2H3HA 5E6SB 4N82A 4O8CA 4RENA 1U7PA 4XIIA 4BMZA 4DXDA 3KG2A 3AR5A 2OSVA 3GJTA 4Z7QB 4HP8A 4N5HX 2C7OA 4BV9A 4P4TA 5K0ZA 4TMKA 3PIIA 2XZOA 1P60A 1ZUNA 3OKPA 3BD7A 4B2PA 1DV1A 1PT5A 2DSNA 4NSNA 2B36A 1Z25A 3WLLA 3IEUA 3L9XA 4D4GA 4BVBA 1NLUA 5BNZA 3QMWA 5BQFA 2RE8A 1SU6A 3A05A 1IQ0A 3AOEA 4GL2A 1D6NA 5EUMA 4PRKA 3E5HA 1I13A 1Z2DA 1GLVA 2AR7A 2ZJZA 5E1OA 2AK3A 3THYA 4HAVA 1BX0A 4PYNA 3DQQA 3QVJA 3SZGA 3WGGA 1UADA 2DR3A 2ORVA 1BGWA 4U4AA 2NZUG 4R68A 4NAUA 1HDXA 2PFKA 1FE8A 2HWYA 3I04A 4KQ6A 3ETDA 2XV1A 3FZGA 2I7TA 4Y2VA 1GNPA 1V48A 1RI4A 1VHQA 3GUCA 4G0NA 1EI9A 4JX8A 3UIEA 2BGNA 1O0SA 5HGJA 4ZMSA 1IN4A 2RGCA 3RSCA 5BNTA 1KI8A 4ZQGA 2H9IA 4BZQA 4O3MA 4CMAA 4NU5A 2D1RA 1M75A 4KR2A 1XEWX 2OE2A 4I3HA 2PQ0A 1WCIB 2H1RA 1DLJA 1PO7A 4J49A 1K27A 3FNQA 2EQAA 3V6MA 4M1YA 3KZKA 4HRAA 1RZUA 3Q7TA 1JPNA 2HRRA 5F73A 2P78A 3U4GA 4H7HA 5KNDD 4K2HA 2I66A 2DXIA 2V8OA 4KP7A 3M83A 3V2UA 3CNLA 4EAAA 2Z1NA 1DMSA 4KPUB 521PA 4BBJA 1UQRA 3B1VA 5C7YA 1Q21A 3DO6A 2R7MA 5FL7D 1IN5A 3OMWA 1B6RA 3P2KA 4LC1A 4R7TA 1LDGA 4G0ZA 2W8BB 3OFJA 3IA7A 3OOHA 4CUKA 1Y1QA 3EIHA 3EOZA 5DOVA 1SUBA 4D9MA 2NU7A 1ZRMA 2XXJA 3AUAA 3JQEA 4KWEA 4BFCA 2IOFK 4LY3A 3USCS 3DDZX 2ECOA 2OXRA 1RFGE 1MIHA 2CLMB 2V6MA 1LJUA 1VJ5A 1BIFA 3NBZC 4WZBA 3FHOA 1O54A 4LCBA 2QQEA 5C7LO 2XUFA 4YN3A 3I6IA 4BVFA 3PJGA 1WNTA 1Z35A 1QO9A 5CX1A 3UJ3X 1K7FB 4F5ZA 5K0SA 1K92A 3W8FA 3MIZA 4ZV9A 4JK3A 4UHDA 3CZCA 4BEJA 2AI3A 1L4GA 3ZW8A 1R9JA 4L1KA 2EERA 5DPMA 1L5OA 5B30A 3T7EA 1JE0A 2FP3A 3BMQB 1E2HA 3DT9A 4PX9A 2A1TS 2PH7A 3V5NA 2VCYA 4Q93A 5EPOA 3ZY4A 1S6YA 1XR3A 4FWTA 4RV5A 3C1AA 5KDLA 3DTVA 3GEDA 2X0FA 1H2EA 4BE9A 4HY3A 4YMTA 5CIWA 3H1AA 3I9V1 4N7JA 1TKAA 2GZHA 1E9EA 4EG5A 4BV2A 4N41A 3DHNA 4ZYTA 5TEWA 3IKMB 2P2CA 4KSYA 4U2EA 1I6MA 4AY3A 3R6WA 3SBDA 2OFOA 1DGQA 2OAP1 1SURA 3PC4A 1BCRA 4H60A 2MSKA 1MJHA 1GNVA 3KWMA 4L4YA 1QO0D 5K05A 3KPYA 1GPDG 1FRQA 1CZUA 3KYCA 1U8CB 4FINA 2V74B 1J0DA 4XUGB 3AU8A 2ZSAA 3I01A 4RFSA 1M9NA 1SBYA 3U9LA 3ISVA 4K28A 2GBPA 2Z4SA 3DT8A 1E1CB 3OIDA 3JYHA 1T2VA 2X13A 3FDXA 3P9CA 4P92A 5C5DA 5AK0A 5M04A 2AF3C 4H4EA 4WK2B 1BU8A 2YJ3A 3N7TA 2P69A 2GZSA 2ZTHA 1WP4A 1HGXA 1KE1A 3DAYA 4AW9A 3LU1A 3BXHA 4DANA 2K7ZA 1CUHA 5LBIA 1PL8A 1RLMA 4YXFA 1PJCA 5ICFA 3NS7A 1PWYE 1D2MA 3D8HA 3D1JA 4AJNA 2NSLA 1R6VA 4LF6B 1K6MA 4BFSA 4PG6A 2PGOA 6YASA 3T9EA 5JH7F 5KWJA 1X70A 1SOUA 1ZI9A 3N3AC 4B3XA 5JASA 2NU6A 2BBSA 1C7QA 2A86A 4NZNA 3VOSA 2RHDA 3NM4A 1L7PA 1OZ0A 5KPJA 1A0OA 1L5NA 3UJPA 1D7OA 1NBWB 3KUXA 4MKGA 5FNZA 1II0A 3DV2A 4OHRA 4Y2UA 5FOSA 3EXHC 4Q9AA 5DGTA 2AFHA 3G3EA 2OG1A 3KLPX 2QBYA 1AKWA 2FSVC 3E9ZA 3AX6A 3MW8A 3VR6D 2ZR8A 3AU9A 3VH4A 2OWDA 3ESZA 3QXXA 5AVKA 3PQFA 1ZN8A 2X0JA 4MRPA 1ANKA 3EY9A 3L5OA 3NHUA 3NBYC 4FYXA 4NDZA 5IUKC 4DILA 2ANCA 3OP4A 3KU1A 3V6LA 2DY0A 4ZAWA 4X61A 2VDPB 2OCLA 4R40A 1GAJA 2J3JA 2Q3DA 1XL0A 3DCIA 1H0HA 1KJYA 4FGWA 1QP7A 1KETA 4DSAA 4ZKEA 1SXJE 3MTJA 2A92A 4DXHA 2H29A 3FDFA 4MCIA 5DHTA 5BSRA 4DAEA 1D5WA 1NG9A 1WUIS 4PNHA 3AFGA 3AERA 4G0VA 1XEXB 4O2LA 5TC4A 1XQYA 2ODAA 1OI2A 2RGRA 4EY4A 3EUFA 2RHJA 2WUFA 2LTAA 1B8PA 1TZBA 3II6X 5LD2C 2HIGA 3UJBA 3FCUB 4AF6A 2ZPTX 1CR0A 1NL3A 3BE8A 4UMVA 5TGDA 4TZTA 2Q29A 3H4TA 4IZ6A 3KKKA 1NULA 1P9RA 2XDWA 4CQLB 1XLTC 2JLAA 1RQGA 4Z4IA 1NDUA 3ENNA 3KKNA 1V43A 2G40A 2IPLA 4PGGA 2ZUTA 4WBNA 1YOVB 3H87A 2N1MA 5LQCA 1ZG3A 1R4AA 4JMPA 1QIIA 4MR8B 1B6TA 1US8A 1W5TA 3K9QO 5KU1A 1A97A 3DEYX 1E1MA 4UARA 4EPTA 3EISA 2Y71A 1AX9A 2J85A 3BICA 1J2YA 3BQ9A 4NYJQ 2XECA 4GMKA 3V2IA 4D82A 4ZHQB 2VRCA 5FXMA 3EWAA 2FEPA 4MQFB 3VR4D 3G9XA 1JMKC 1M2VA 1Q16A 2QE6A 2XW6A 4XVHA 3T9CA 3IPAA 5ESXA 3UBTA 3AHIA 2VZ0A 1XMIA 5CLLA 4RD3A 1QJ4A 3V8NA 1HQCA 2O2HA 1RXSA 3AESA 2QZSA 1VRWA 4R9VA 1RWQA 1FYFA 1XDBA 1DCKA 5JAZA 1QO7A 3TI7A 4IIJA 3VSBA 1DRUA 3TKYA 1NN0A 4CNQA 3F5QA 2DB3A 3FVVA 3QYJA 2GM5A 2PIDA 3AM3A 1P77A 3D6NB 1XCPA 1QKIA 1TVKA 2DZDA 4U7WA 1KO7A 1V47A 2VDVE 1FX0B 4G25A 4PFKA 4AP9A 1XRNA 3ZHYA 1UAYA 2A3NA 4H0FA 1QYCA 2JH3A 2ZWVA 4FJ2A 3MRSA 1E7QA 1SH7A 4MAAA 4GUAA 2DH5A 2ERXA 4OL9A 4ZTBA 4BMNA 1RRCA 1UEIA 2CBZA 2CLFB 4OAQA 4ON9A 4P53A 3REQA 2BH9A 3SKXA 1KMHB 4GPIB 5HJ7A 1Z6QA 3S1AA 3C3EA 3QUTA 5DI3A 4B3SB 1LI7A 4OHUA 4JC5A 2ZRLA 4NENA 1X77A 2VKTA 4LZLA 1OX6A 2JI7A 4KGXA 4RY9A 2VOEA 5AOVA 2Z3VA 1GEGA 1RYDA 5JC8A 3QIAA 2LNDA 4Y3UA 3AVQA 3L0ZA 1E1KA 1CETA 2P35A 2CHEA 1M74A 2C98A 3IGFA 3V1YA 1BVHA 1EUDB 3D7SA 4BNKA 4KXUA 5FUBA 7MHTA 2KBFA 1VGRA 3AYZB 1I3MA 2GM3A 2QMEA 3FLMA 3FPGA 4NV1A 4QUBA 4RKRA 1BO6A 2JB9A 2V6JA 4DMKA 1IHPA 5F4BA 3SJBA 1V11B 1JJAA 5TXGA 2CXOA 4LMAA 4QM6A 4W9NA 1EUCA 3QBEA 4RBNA 4LBVA 3JWHA 2V7WA 2DT5A 1U7OA 4U6NA 4BYMA 3QRWA 3IKTA 3PFFA 3ZH9B 2QMYA 2HWWA 4DHWA 4ZQHA 1LI4A 4HX9A 1GKIA 3H16A 5DN9A 3ZIAD 5IT9A 3NIBA 3CNQS 3KSUA 2XVZA 3G5MA 1UBRS 1ZITA 3TRHA 3W2EA 1ULUA 3LCRA 1FCJA 3FFBA 2CVHA 3LZDA 1SQGA 3MM4A 2I6FA 4I19A 4X9XA 3JQRA 1B42A 3QITA 5H0IA 3MQ4A 5IM5A 5AHKA 3TI9A 4YI3A 3U4QA 3F5FA 2H85A 3KSZO 1V7CA 3HO1A 1S4MA 1YQUA 4HUQA 2J7KA 3D02A 4C03A 4MW9A 2WWTA 1P6QA 5EXSA 4RAOA 5AKLA 5LLSA 5B55A 2AUNA 1PLJA 1RDFA 1WVMA 1YBAA 2AX3A 2CN1A 2J9ZB 2YV2A 1V2HE 3AXSA 3PIDA 4WDQA 5DOZA 5G4LA 4DCNA 3L8CA 2GHQA 3JX9A 4I6JA 5ALMA 3UK0A 5JARA 3GB9A 3HJUA 3UHAA 4LYYA 2F3TA 3HJHA 1YE3A 2UZ3A 3CLSD 1A9QA 2IYVA 1HL3A 3TZEA 5IS2A 4NOLA 4B3TB 2JAOA 4DA9A 3QLVC 5K8UA 2YW2A 4NCBA 1PZNA 2HUNA 1M8KA 4OHVA 3TJZA 2B30A 4HDSA 1N4DA 4HXEB 1LV8A 4KODA 3LS2A 2GYUA 1TF5A 4ENPA 4W99A 3ZTYA 3HGTA 2HRBA 4CJXA 3R41A 4OLBA 1LRJA 1QE0A 2FFJA 2XUJA 1EXNA 3OFKA 1W581 4RDCA 4II2A 3IV9A 4IIGA 7REQA 2QZZA 1URPA 3QOYA 4Z1MD 3MD9A 5B64A 1UBHS 1PYGA 3OQIA 4OXYA 1Y48E 1J8FA 4ZT5A 2NPOA 2XLBA 1FVOA 2E5FA 3FGNA 2Q7OE 2LZ0A 3UAYA 3HNPA 5E4TA 4KWCA 4UXIA 5CURA 3L06A 1PFVA 3AF2A 2J9FB 3FGOA 4GZ5A 2ZBQA 1V4NA 2BP7B 4NJEA 2I4RA 1XRPA 2Q62A 3KV1A 3FB4A 2BMAA 3E9RA 3ESAA 2XJ4A 2P9YA 2X5OA 2XKJE 5LUAA 3L4KA 2R8XA 5C80A 2QRNA 3ZWQA 5JSZA 1RPAA 5C1DA 5I45A 3RU3A 3U4MA 1IIRA 1V45E 4HI0E 2GXAA 1PQ4A 1NPYA 4MITA 5KVSA 1ADYA 1QORA 3LDAA 5LU8A 4WA8A 5CVDA 4J0JA 1YASA 4IS3A 3UWSA 3KSDO 2P2DA 3TN7A 4V1CI 2N0SA 4DW8A 2J5RA 1RQLA 1U99A 3A4NA 1KI1A 3KC2A 3KFLA 3OT4A 3K05A 3VR5D 4Q47A 2Q7DA 1IRIA 4EYGA 3SKYA 2VK2A 4IPTA 4GOOD 4QL3A 1QF7A 4D96A 4CETA 1S3FA 2FPSA 2YWCA 3PNBA 4RTNA 4W63A 1ZICA 4D92A 1XCGB 4YRZA 5BMVA 3BB1A 1ADGA 5D2CA 2ZBRA 1F2UA 5KSYA 1BHJA 4EYEA 1VMEA 2ZTVA 1H8HA 3OOWA 2WYUA 4NNOA 3SQWA 4GKKB 5YASA 2WYIA 1K68A 3EYWA 1GNLA 1QHXA 4MR7B 1W0KA 4TRRA 1E3QA 1PEKE 2FVXA 1GTG1 2C9DA 1KOFA 3MGKA 2WE8A 3BERA 3UH1A 3VU9B 3VR3D 3PCRB 1TIKA 4ZAFA 5A5GA 1OXMA 2C5FA 4MNTA 4F84A 2VUTA 2XZTA 4YJ2A 4TYQA 3M5DA 4I1SA 4EA6A 2VJLA 1T9GS 2GMWA 5KSWB 3F3KA 4UBKA 5JWHA 1LW7A 1UPBA 3H0KA 3SSAA 1TL7C 3C1OA 4BGIA 3LXMA 3NZEA 2XTJA 4NQZA 5DP2A 3R2JA 1AXGA 4N3AA 4HNTA 3O3OB 1G21B 4PHHA 4WZAB 3JZMA 3H05A 2P90A 4X1IB 1CERA 3WO0A 5HQ3B 1PJ4A 3E1GA 5TV2A 1QHFA 1SKYE 4G8DA 3SZOA 3CRZA 1XZNA 4W5RA 2V9CA 3DVAB 3I92A 2CBXA 1MQ9A 3P9IA 4C0QC 2R6HA 1M5RA 1EMDA 3MWFA 3VKGA 5GJBA 4L51A 4F6RA 2H4HA 5JROA 2O7VA 2Y99A 5KTYA 1F5SA 4OL0A 5SY9A 3JQAD 1MAVA 1MVOA 3WLIA 4IUDS 3DCYA 2H00A 3DE0X 4QU9A 2R751 3D5EA 2FOLA 4PPYA 2VJYA 4YLEA 1ZUD1 1VE6A 3JD1A 3K0BA 1SVKA 2H4ZA 3K92A 4J8PA 3NMUF 5AXAA 4UU7A 4I4CA 2JI6A 4M7RA 5DM0A 3GP3A 1MEEA 5DX8A 5T57A 4DJDC 4ZTUB 3EEYA 3I62A 5K6RA 3HU5A 2GXSA 4XSVA 1YB5A 5TPWB 5CTAA 5IK2D 4U7DA 2ZYWX 3PL1A 4P3PA 4PLZA 4RGVA 4F9EA 1E4EB 2XQGA 4QJIA 4QXQA 1J20A 1DJLA 5GY7A 2HXYA 5AICA 4O4JF 3RRBA 2DFVA 4Y9TA 2VG8A 4ZZ3A 4M1KA 3LP8A 3MWEA 3N7AA 3TLEA 4UVEA 3GBPA 1KEVA 4C6RA 1VE7A 2A9RA 3I30X 4BMXA 3FSGD 2IUUA 5JDIA 2RHTA 5ILQA 1GPAA 3BGDA 4FLFA 2JFNA 3IQGX 3K2QA 3AHEA 2AV6A 1E6LA 3HFGA 1OTXA 3L7JA 3BK2A 1EPUA 2QMUA 1HYGA 2D0PB 3AB3A 1ZH2A 1YDFA 2XE8A 3FMFA 3DLIA 4BEBA 4OQZA 3U4AA 1M10A 3ZWMA 2B7LA 4IX9A 4KEAA 1Z13A 4HN4B 2XT9A 2ACEA 1UBOS 3PUHA 1H2AS 1SAYA 3K8OE 4Z51A 1PDWA 4MRMA 2VDJA 2V6IA 3E7WA 3UQZA 4HKTA 1SUDA 4J4BA 4MGZR 5J5VA 2ZWMA 4AZWA 4YRGA 1GNRA 4FW8A 1OR8A 2XMGA 4JT2A 4QRHA 3SE0A 1T13A 3E5NA 1Q17A 5FOUA 1XVUA 4OKNA 2XRZA 4LRSB 3NPMA 1VJCA 2CJWA 2V4MA 5FFNA 1MUUA 1YMQA 4G9BA 3G8DA 3EEOA 4KR9A 1CR6A 3K8ZA 5EPUA 3K53A 2VHVA 4BATA 2IE0A 5A3SA 1OYYA 4D6PA 1PE0A 2BFDB 4PHTA 4J03A 1EX9A 2WZBA 1V1RA 1RM5A 3GWGA 3UHJA 7YASA 3LWDA 5CLQA 3STVA 4JSYA 2BSXA 2RH4A 1XZQA 5C9ZA 2OM2A 2WQ6A 4NTZA 1XMPA 2VLBA 1F8YA 1ONBA 3QIVA 1XAJA 5EIAA 5EIWA 3DHEA 5ERYA 1OPRA 5F9HA 4CV3A 3RIGA 3VR2A 1YRBA 3KXKA 4IM7A 3K0HA 2H3EA 2BEVB 4B3HA 1MT0A 3LDUA 5LP6C 2QYHA 2HBRA 4L02A 4R71A 4TMZA 1UBGA 3ZPXA 3SQXA 5CD9A 4XX0B 3AKYA 4GI5A 4C78A 2WU8A 5CFOA 2YYAA 2ZVDA 4RK5A 2K87A 2EJCA 4DLVA 4ND4A 5UKDA 1XP5A 1RHKA 2JRCA 5FHQA 4Q1FA 2C4UA 3DDCA 1RJEA 3QWAA 2RGXA 3A25A 2GFQA 4L9WA 3ZUGA 3ESCA 3QUSA 2W00A 5C34B 4RTSA 3QE2A 3K5HA 1CZNA 3G88A 4M1WA 4RXTA 4EGAA 4YJHA 4AUKA 1LSSA 4O02B 1EA5A 3WRYA 4E13A 1TK2A 4EJSC 1BCSB 4LFBB 3KJHA 1DKOA 4ZOLA 2OHGA 2P9FA 3WGMA 1MP0A 1SJ9A 5KC8A 4X64B 3F46A 1QYRA 1XVAA 4L9RA 4D5EA 1XYVA 3L02A 1MRZA 2A9QA 1U11A 2X6TA 3STHA 1VC2A 2JIZD 1WV1A 1G38A 1NW7A 2BRUC 2I3AA 3LUDA 3OICA 3IKJA 1Z16A 4CM4B 1T10A 1SQFA 5JCOA 2CZGA 3VISA 1CQZA 1L7OA 2LDBA 2YC2C 4CR8A 8ABPA 4JC4A 4V3BA 1R0CA 1QRUA 2EIHA 2EL7A 2PV0A 2H16A 2ZYDA 4L75A 3S40A 4LV6A 1SKYB 1W5EA 1FYEA 2X41A 3D0QA 4X1YA 1YR7A 3TB6A 1GDTA 5C4IA 3Q8XB 2PIAA 1N5KA 2YOHA 4Y6PA 5AJYA 1EJBA 2GO7A 3NWOA 3O0TA 5FLYA 4BO3A 2IYYA 2CV1A 2EKDA 3ZWKA 1TXGA 1A7AA 4L8WB 5EKSA 4PRLA 1HF3A 1FZTA 4M6WB 4B3JA 4EG1A 3PKJA 4FXPA 3U7FB 4FHGA 1PK7A 2ADMA 4PONA 4QXMA 4NS4A 2ZBVA 1BE6A 3RRNA 3O75A 4XTRA 4TMYA 3G0HA 4N7BA 1N6PA 2I99A 1KMQA 5DHQA 3U3RA 3CKKA 3FNBA 3PLRA 1O9HA 1JVBA 2IYWA 3RKSA 2O8NA 4B6SA 4JJ7A 5ITSA 1RP7A 4QXAA 2C3YA 1X1BA 4UD6A 4DABA 1RPZA 2L17A 1A69A 2Q6IA 2Y66A 5HF5A 4PPQA 1YFLA 5JAIA 2CWWA 5AVZA 4PYMA 4BGEA 2X2OA 3VOBA 1AD2A 5K99A 1H1DA 1X1RA 5T6BA 4G89A 1FUKA 3FMOB 1ORRA 5SZHB 5CXQA 3LLSA 3H1TA 3F78A 3KOWA 1PSDA 2RHHA 3Q8KA 1JA1A 2H8GA 3VO2A 2J7PA 3GEBA 1KO1A 3ZE8A 1E9VA 1JA9A 3G1WA 1J0CA 1L9XA 1SVWA 2GD6A 1XWIA 4ARZA 3UATA 5ELLA 1N2CA 4YV7A 2R8BA 4QGAA 5D51S 2QN1A 2IYOA 2PGIA 1U2DA 3OSZA 2CXHA 2BKVA 4WOJA 3VV3A 1NXQA 2I6TA 4JB2A 1T3LA 2AXNA 2E3JA 1ZD9A 4CHGA 4EA9A 4WBSA 5KOJA 1DKUA 1R8YA 4KNVA 1A27A 1QS0B 1XTRA 5KKCA 4H3SA 1RM4A 4GNKA 2OENG 4NCKA 4KHPB 2HRQA 4IEFB 5DM1A 2GN9A 5AW9A 2Z4TA 4G5HA 1I7PA 3QKSA 4I08A 5AW2A 2FW7A 1IY9A 3D7NA 4QOIA 5F5NA 5C46F 4DSTA 3QUCA 1GYQA 4WN9B 1C9EA 3ETHA 5EMKA 4YCDA 4EKDA 2UAGA 1DKNA 1CUIA 5EZYA 2X2FA 3ZC3A 1NGSA 1KYYA 2GBGA 4C06A 1JR4A 4MVYA 1RKBA 1VBMA 2GK6A 4GC5A 4GM1A 3W7AA 1IEVA 1A9RA 1NRIA 4OQDA 4E2YA 4AX8A 3KT3A 2IS1A 1UJ4A 4UU8A 1JJBA 3PE6A 1DXOA 1O2DA 2CB0A 2VC2B 3T8YA 4DB2A 3TJRA 3CR7A 1YS7A 2BGTA 1C7EA 1EFCA 1NBME 1RIIA 5FBKA 2QUIA 1LTKA 4C3ZA 4ZTZB 4XM2A 2GCGA 4AT1A 2GRAA 2NUTA 3IRVA 4GZ6A 3L79A 4ZALA 4H18A 2GEFA 5AI9A 3GJXC 3WQHA 1CUDA 1ZKDA 3OQ1A 2PX3A 1E92A 4HQLA 3AM4A 1EZZA 2QM8A 4R31A 3TZCA 2I4TA 1T4DA 5CD1A 1GQFA 1HQDA 5A4IS 4TKMA 1Z62A 1QGAA 1JFSA 3GCZA 5JISA 1ZHFA 3OURA 4XM0A 2H59A 3LVBA 1OX4B 3LP5A 2ZS8A 4M1QA 4MKZA 3VXKA 1TO6A 4I66A 4RKQA 5JHHB 2W2VA 4HF7A 1J8QA 3DCJA 3FYCA 4MQMA 1N2GA 1HRDA 1VG9B 2XIJA 2O3JA 4LVOA 3MMPA 4UZSA 4H3KB 2FKNA 2AFIE 3RS3A 1P5RA 2E4VA 5LMZA 1PVDA 3ZE9A 2W6QA 2B82A 4Q7KA 2XOKD 4NI5A 3L0IB 2NPFA 2HA5A 3RKUA 4A2CA 2UDPA 5HPYB 5JS6A 1K5GA 2FW8A 5AUPB 4PZLA 3VOAA 4O1IA 1DBRA 4W7IA 5G1PA 4BFLA 4W9MC 1SKAA 1SU8A 3FCXA 3FPHA 4Q4HB 3JQQA 3L77A 3ER9A 2H63A 2HA7A 2JJ2A 3I6MA 4U2DA 4M9CA 4CM3A 3K70D 4OB7A 1TMKA 1FQOA 1NBEA 2OP0A 1EK2A 5TEVA 1YRWA 2JLWA 4JJ6A 4N40A 4IFBA 3AJDA 3IR7A 4PG5A 5IMBA 3VQTA 4AX4A 1SVLA 4DADA 2EF0A 1J90A 3PRKE 1XGKA 5DKFA 4LZZA 4AKEA 1E3WB 1GKYA 1RVV1 3H9UA 1WU8A 3MMZA 3OLYA 1B8VA 2CD7A 3I9JA 1M6VA 2A9KA 4H7FA 3TXXA 3OTHA 1R7RA 4GX1A 2FRDC 2WINI 1VPLA 5B7PA 3ZJTA 4LPSA 3O47A 2QZ4A 2BDUA 3KEGA 4J1SA 4TMTA 2NT3A 4JI8B 2F3RA 1ATZA 5J43A 3CPSA 3B6EA 2PRIA 2YJTD 2BFPA 4RTOA 5C1OA 1WB4A 4HUJA 1SHUX 2WJVA 5AW3A 1TKCA 2VTVA 3O4JA 5HQJA 1I32A 1XA0A 5DXJA 1PJLA 2X8JB 2PAFA 4RA9A 1DIAA 2ORED 2HMAA 4KN6A 1H5QA 4QXPA 1UPAA 3FUTA 3CJTA 3V00A 1E6MA 4FE7A 3V4OA 2FCRA 4ZYVA 1LB1B 2G5PA 1ATIA 1TYDE 4RESA 1WDWB 3DUFA 4KXNA 4URWR 2ZTMA 5C35A 4U63A 2HREA 3GZNA 1S4QA 4FGLA 4FCTA 2XZLA 5EIHA 1BHSA 1U3GA 1VKHA 1GNQA 1GTVA 3C15C 4ZHQF 5LSAA 1Z2OX 1XRMA 1ODTC 1V1MA 3QLJA 1QDLB 2DBVO 1FW8A 4BO5A 3HADA 3FZYA 3UB2A 1CU1A 1G59A 2O8FB 3H6HA 4PCLA 2BL4A 3AVTA 4LQ4A 2F3PA 3A6JA 3H17A 3LVFO 1F5NA 1T24A 2C0CA 4N3CA 1MGPA 4WBXC 3IPRA 4AJJA 5A1TA 3Q3VA 4CPDA 3F9IA 1NR1A 3R7NA 4KR0A 1KSJA 3AUTA 3UWKA 2YXDA 2YFKA 4AFNA 1Z12A 4G0YA 4MVJE 4QGSA 4LMBA 4FE3A 1NOKA 2B92A 4UBOA 5BUZA 4E5PA 1H8EA 4J2OA 5EJ8A 2PBFA 3DB2A 1DZ3A 4XPIA 3ZH2A 3AVXA 3U4IA 5KYUB 2WSSA 4KYVA 1MGOA 4NJOA 1PP4A 1ADBA 4DLSA 3NX4A 1FMCA 1JVNA 4KO1S 4BNGA 2AN1A 4I8XA 2JDIA 1ACJA 2O2YA 2B8WA 4YDQA 2APJA 2FXIA 1YGPA 4PZDA 4I2VA 2W6MA 4RADA 3EGDB 4ONEA 4CT4B 2F43B 2I8CA 2ZKLA 2E18A 1GCOA 3B6MA 4G4JA 3KDSE 4OMUA 4ZVNA 3CNNA 4NC9A 3TDNA 2HN9A 3CLVA 5AVJA 1DQSA 4BJHB 1C0KA 4EX6A 1Z2PX 1QV9A 2N1BA 3U09A 5BSGA 5I47A 4QTXA 1YBMA 1FXSA 2DX7A 4OBXA 16PKA 2A0UA 1EVIA 2BCEA 1GUZA 1R3UA 2H1FA 2XA9A 1KHHA 1YR9A 2G6BA 4W1RA 3U0BA 3RWMB 2J46A 4RSGA 1GUYA 1G2PA 3HDYA 1C1DA 2BGGA 4D4LA 1GFWA 5B5SA 1A4IA 2JAQA 3A9WA 3K6JA 1KBOA 1EBUA 3AFMA 3TLMA 5F23A 3O9ZA 2BBWA 3KJZA 3I58A 3P2OA 5C32A 2HT6A 3WOHA 3U56A 1EUQA 4NZZA 2XVYA 4LJ6A 3B38A 3M2PA 1CB7A 2BTQA 2EU8A 2R4QA 4X8HA 2Q3HA 2PGAA 4FUQA 1G6OA 2NSJA 3D0RA 4ESHA 4K5QA 4TL8A 3A3NA 3HSYA 2QXYA 2VFAA 1Z7YA 4FEAA 3QJYA 3VHRA 3GIDA 1WZNA 4LV8B 3N9IA 5ALQA 9ATCA 2GPJA 1FSFA 4R6WA 3SHFA 5IBRA 4DMHA 2FN3A 4M1SA 1E1LA 2D0DA 3HMKA 1MIOA 3RBAA 1A3CA 1ZGBA 3NOOA 4HWRA 2I7VA 1QDEA 2QUJA 4D3SA 4RVUA 4GXNA 3QPCA 2WLSA 5EIEA 4XVUA 3GF4A 5ESWA 1RMTA 3U3KA 5LQAA 1IPEA 4OHZA 4RQBA 2P67A 3QY9A 4Q4AB 3VDQA 3CLSC 3SI7A 2H1WA 3AKZA 1HG1A 2CK3A 2GH1A 4F72A 5EUQB 3BA6A 5KNCD 3QSYA 5JS1A 1F2VA 3KOXA 3EA4A 3PNVA 1DBVO 2QI9F 5HM6A 3DEAA 3EMDA 2PCLA 1SXJA 2RGAA 2F9MA 2GLXA 3ON5A 4W5WA 3NVKI 2YDYA 1TA0A 4CLXA 2AZMA 2B9VA 4JI4B 5G41A 4BMOB 1PLLA 4GRAA 2JK0A 3GLUA 4OCZA 5GTDA 3SN6A 4E46A 4R3NA 3PLNA 1DXYA 1ONOA 1YJQA 2C4KA 4NFLA 4HO1X 2BI4A 4GVLA