2QRNA

Human deoxycytidine kinase dcmp, udp, mg ion product complex
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
241
structure length
228
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
publication title Structures of human deoxycytidine kinase product complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 81
structure length 228
sequence length 241
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2007-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qrnA00
1DARA 2G88A 4JL6A 1F6BA 1U81A 1E9FA 1MRNA 1R4AA 3T1TA 4CGZA 1MOZA 3LFUA 2YWGA 1R7RA 1UBCA 2GZDA 5FUVA 2IWRA 4N0DA 2YOHA 4LPSA 4M1WA 5CDFA 4X8OA 2FFBA 4QOSA 3CRVA 2RGXA 3FTQA 2IK8A 4S35A 4RD3A 1VIYA 4HZUB 4HSEA 4UNQA 1ZM9A 2VQSA 3V9PA 2JLYA 4TL8A 2GEUA 2GXQA 1XRJA 5TXGA 4B2IA 3MJRA 1GAJA 4OHXA 5L3QA 4DLXA 3EZ9A 1P2UA 4MRSA 3QJYA 5DNYB 1OH8A 2AL7A 3QXCA 1KZ7B 4FN5A 3W9YA 3E5HA 1Z28A 3AP1A 1FNMA 2RGNA 3HU2A 2A7QA 3I32A 3QBVA 3RDPA 2MMGA 3RVBA 1EESA 5IK2D 2JA1A 3HYRA 1QZXA 4LJ4A 2GEDA 2BDTA 1AQUA 4ZIRB 4FMBB 1N6PA 3QXXA 4GT1A 2Q3HA 2EW1A 4WW0A 5FBVB 3PIRA 5F9HA 2FV8A 3PR1A 2Z43A 2UZIR 2ZQ5A 2JLRA 2CCJA 3B9PA 1W2GA 5H1YA 1R2QA 4Q47A 2F43A 2R62A 5FFMA 3EWSA 5FPYA 1U8AA 2BIFA 1T3LA 2OV2A 1R5OA 4QGAA 4RZ3A 4L4UA 3R20A 4M53A 121PA 3IIKA 3NIBA 4MKIA 1Z06A 2CJWB 4MH0R 1L4UA 4HLUC 2G9NA 3BWDD 1F2TA 2Z6VA 1L7VC 2WAXA 2GESA 2XTZA 1IBRA 4KU4A 4CT5A 5GJWC 3Q7QA 1OW3B 1RRFA 2DFLA 4M1OA 2B7BA 2RKOA 3MRSA 4LI0A 4PXAA 2A30A 2QP4A 1Z83A 2OBNA 3DEFA 4Q4JA 3K0FB 1NJGA 4NCNA 3GJ6A 1IJEA 4EPVA 3X1YA 2OSBA 2QQ0A 3CWQA 3KXIA 4YXWA 4URVR 5B57C 4MUAA 2QU8A 1Y3AA 1VG8A 4TLDA 5FBQB 3AVVA 1XD2A 2HEIA 3VTKA 2C95A 2GRJA 3QKTA 1ZD9A 5DYGA 2ZSBA 3IEUA 2WSSD 1P6XA 4MDFA 4LC0A 5K8UA 4ZDKA 1DBSA 1KHTA 4WXRA 2F3RA 3CX6A 1XU4A 3RHFA 3U7FB 4YMWA 4LHYA 1MV5A 4PQYA 1KSGA 3E1SA 2JAQA 5JMTA 1E2EA 4OKSA 1HQYE 3PEYA 2PZGA 2JLVA 4HAYA 3VKHA 2QMEA 1CULC 2IBMA 3MG9A 3CBQA 5KHOC 2GAOA 4IOJA 2H57A 4Q4AB 2CBZA 4DCTA 5JCZA 3L8ZA 4ACAA 3UKDA 5L3SB 5L8VA 4WOPA 3U44B 2QGZA 3DDCA 3KKPA 1G3QA 2ZR9A 4MQBA 1XPUA 1XNJA 3AVWA 1NN3A 1EWQA 2Q21A 1G9XA 2ZE7A 5HR5A 2JLQA 2FG5A 4AIIA 4QBIA 4B3XA 1NMXA 2VIIA 2J0SA 3BE4A 3I8XA 1N5LA 2GXUA 1XX6A 4V03A 2VPPA 4TN1A 1W0JD 2BMFA 4IDNA 3SJAA 5M04A 1NY5A 3EWAA 3MGCA 3TH5A 1ZC3A 4EPRA 1N5JA 1TL7C 1UFQA 3NXSA 4OJKA 1QRAA 4Q00A 1W4RA 2V54A 2ZANA 1GILA 3SR0A 3SE0A 4IVPA 4LC1A 4A4DA 2VLIA 3PQCA 4TMXA 5A4JA 2R9VA 2FSHA 2RGAA 2ASEA 1JPNA 5KNCA 2WWXA 1GIAA 5FTMA 3KB2A 2JDID 2KI5A 2ZRGA 3X2SA 5FOSA 3FVQA 1KI1A 3DKVA 4WAUA 4FWIB 5J4LA 3H4MA 2V1XA 2OZEA 1GITA 3UMSA 1UM8A 3IHWA 2EQBA 2QP3A 4OHVA 1PLLA 2QE7A 3C5HA 5B2ZA 3VU9B 1CF4A 3G0HA 1N6OA 3CW2A 3L0IB 3SBEA 2GK6A 1SXJA 4JLPA 3T1OA 1S4QA 4Z1MA 4M22A 3CPJB 5HE8A 5GADl 4TQUS 2JJ1A 2ZSFA 2IYXA 1G64A 1OHHD 2OG2A 4QC2A 4B34A 5LDDC 1GRRA 4WA7A 2RAPA 2CCKA 1YRBA 3W90A 4ZV4A 1YJ5A 2ZI7A 2LKDA 2UZ3A 2VRWA 1NVVQ 4CEIB 3CRQA 1WF3A 621PA 1QG2A 1SHZA 3HU1A 1ZM4A 5HCIA 5DN6A 5BYKA 5JRZA 1II8A 4BUJA 1G6OA 2O0JA 5TDHA 2VP6A 2J46A 3A1UA 3QNUA 1G7TA 1XMIA 3OF5A 2ZI4A 4BGDA 1E1RD 5FL7D 4LJ5A 1E4VA 1NNEA 5FBWB 2W6JD 2XNDD 1E0AA 3M4YA 3LX8A 1N2CE 3T34A 3BJIC 2C99A 2ORWA 4GZMA 1GKUB 2AFIE 2ZTSA 2ZS8A 3T35A 1PLJA 1XTIA 3K0SA 4FI3C 3QKSA 3AM1A 1E2GA 1E1QD 1CR1A 2EYUA 3K0AB 2XZPA 2IL1A 4LJYA 3VR1A 1GVNB 4FCVA 4LY6A 5IK2A 5CB8A 1N0WA 4M9XA 1KOFA 2ZI9A 5ANRB 4LHWA 4JLBA 2NO9A 1XTQA 3R9XA 3PENA 2KJQA 4DDTA 4JVMA 1W5TA 1E9AA 2ZRAA 3LY5A 3VX3A 2WJYA 4CEHA 4IEEA 1X8JA 1ZBDA 3CNNA 3GFOA 5DIFA 3CPHA 3U61B 2NGRA 3ASYA 3FWYA 3RRZA 1ZC4A 4XJXA 2ZS7A 4D25A 4TL9A 1OFUX 1SVWA 4QBFA 1DS6A 2R8RA 4LBYA 4HUQB 2CK3D 4XH9B 5KUTA 4AKEA 2X77A 4Q18A 2JLWA 1T8TA 1S9DA 3KL4A 1UKEA 1OB2A 3GFTA 3EZFA 3K0CA 4DXAA 2OESA 2OO7A 4C7OA 3MAAC 2XSZD 1YHNA 4IKEA 1EFRD 2BMDA 3CF2A 3MD0A 2VHUA 4ESVA 1MT0A 1GL6A 2WJVA 1ZP6A 3EZ6A 4ON9A 5LB2A 5J4HA 5FOWA 4PO1A 1YVDA 1HURA 1ZCBA 1ZNYA 5SZJA 4KJZA 1H8HD 3MWLA 3ZLJA 3G5UA 2ODNA 3M6AA 1SZPA 2GDJA 3MWKA 4US2R 3SYLA 2ODEA 3AUYA 3K9LA 2VF8A 2F6RA 4V0NA 1LS1A 3OAAA 3ASZA 1BKDR 3IQXA 3OIWA 3WHKA 721PA 2QAGC 4OQLA 2CL6X 4UXHA 1GKYA 1MABA 1N0VC 4JVSB 2ZJ5A 2WSSA 5FUWA 2ZVQX 3NBYC 1IY1A 4A82A 4C0BA 2C77A 2GXSA 1NSTA 1W47A 2JEOA 2ZIAA 5CYOA 1ANKA 3GP8A 4PQRA 4DT1B 3I3SR 2X8AA 4URWR 4BFVA 5JWOA 4BASA 1U8ZA 3PVSA 2J45A 4U02A 4C2TA 1HEIA 4M9ZA 2XZLA 1YKSA 1E96A 2A78A 3ZS9A 4HAWA 1NIJA 3PUXA 4NCKA 1RVDA 4OI2A 3DMNA 5CM9C 3PG5A 4LHXA 2XJ9A 2FZLA 4ZCMA 1SQ5A 1GKIA 5BWMA 1FQJA 3NBXX 1A82A 2IYSA 4EAQA 2ZSDA 1KI3A 1TAGA 4IJMA 1KTVA 2QPTA 2YNMA 1SVOA 1G4UR 2UVQA 4FMDB 4JS0A 2GBLC 1GFIA 2OAQ1 3BORA 1HQCA 2HDNB 3JZMA 1BYIA 2IYVA 4E09A 5A5GA 4AYXA 4PSVA 2FNAA 3JVUA 4ZCLA 3AGPA 4EFLA 1ZVQA 2BCJQ 3UMRA 3SC3A 3CZQA 1JQLB 5EP1A 3GD7A 1XEXB 2WIAA 5JWRA 3CRW1 5E4FA 1KSJA 1XCMA 2RHMA 3AKDA 5DI9A 1T0JB 2AXPA 4Q9LA 3U5ZB 1VYUA 4DSUA 2HLDA 1T3HA 2ZETA 1TX4B 1U9IA 1Q1QA 2NTYC 2FZ4A 4NBSA 5FL3A 1FTNA 2FX3A 1ETUA 4B33A 3THXB 4LUCA 1XPRA 4AG5A 1ZM3A 2WJHA 1QVRA 2ZITA 1DTSA 1Z8FA 3QG5A 5FTJA 1DAEA 4C9BA 1IXSB 1WB9A 3N5CA 4G5GA 4TL7A 1KJYA 5JHGB 2ZYTX 1Z47A 4CEJA 1XTJA 4N1AA 1Z0DA 2RGGA 5AWFC 1Q44A 2MSEB 4ERNA 4NPHA 4D82A 1KYIA 4M9SA 5H68A 3W8RA 1OHHA 5JEEA 2P6NA 2WM9B 4P4SB 4BLTA 2G6BA 4KITB 1N5IA 2O0KA 3K70C 3FMOB 3QI2A 1GM5A 3NDPA 1Q12A 1X8LA 2V3CC 2CXXA 2EU8A 5DI3A 1ZNWA 4DC9A 2V55B 2WJGA 2IUTA 3RRNA 1G16A 3DM9B 1IOZA 4P0TA 1B23P 3UIEA 1JR3D 2QT0A 1E0SA 2DFTA 3QKUA 4FMDF 4BFUA 4L15A 1FP6A 3ND8A 5DO9A 2YZ2A 3A4MA 3TNFA 5KSYA 2P67A 2Q0HA 3DZDA 1HE1C 4C0KA 4DEYA 2W0MA 2FPKA 3QEJA 1E1RA 2B7CA 5FL7A 1BS1A 2FPMA 3LQQA 4PC2A 1XXHE 4FXPA 4GOXA 4IOKA 4YMUA 3T61A 1TQ4A 1DG3A 4BLSA 4HDQB 3CKLA 4LBVA 1OT3A 2O8CA 1Z6TA 1P5ZB 2YV5A 3HR8A 3QE0A 3EPLA 1X3SA 2FFQA 3FHTA 3AB3A 2CHQA 5TY0A 3NHBA 3GLGB 2H92A 4Q66C 1KIMA 5EXXA 3B2EA 3GLHE 3F5FA 2A9KA 2BBWA 2FA9A 1KJWA 4HLUA 2GJSA 4NTZA 4Q01A 3PJRA 1ZINA 3TIFA 1AKYA 2V7QD 1KDPA 2OCYC 2ZJ8A 4EJSB 2IS6A 2A5JA 5DHAA 4B3CA 1TPZA 2OHFA 5CYPA 1Z2AA 2QAJA 4P33A 4NYMR 4O2LA 2NO6A 2F1RA 1IHUA 4CIDA 5F98A 2CK3A 3KKNA 1T9HA 2ZE5A 5GVSA 4C2UA 1VPLA 2CL7X 1KI6B 2IYQA 1G7SA 2QMUA 2O8DB 3AF1A 3RRYA 4OHWA 1Q22A 2CEAA 3NBFA 4PHHA 5FI0B 3W8NA 4CVNA 5JCPA 2G0NA 4A6XA 1Z22A 1EFRA 2BM1A 2ZRBA 5JEDA 2WJJA 1XP8A 1YQTA 4BLRA 1JECA 2YINC 2OBLA 1M7HA 4NYJR 1P73A 1ZRHA 1AN0A 4PSAA 1VCIA 3E2IA 1DE0A 1F2UA 4CDGA 1S1MA 4URXR 1H8HA 1LS6A 4JVLA 2EWWA 4OK6A 1Y63A 5K8LA 1CIPA 1F5NA 1A7JA 3F8TA 2IX3A 2P0EA 3I5XA 2FN4A 4Q03A 2KBFA 1CR2A 1OXXK 3VHXA 3UPUA 2ZI5A 3LWNA 2PMKA 4DHEA 1Z63A 4Q9IA 5KNDA 4PFSA 3EPKA 2IF2A 4ARZA 1RYFA 2H1LA 2SHKA 1ZD1A 3A4NA 1L8QA 3DM5A 3SHFA 4TYNA 3KTAA 1HV8A 2DFNA 3NVAA 1P62B 3LBNA 3MMPA 2BMEA 3HPRA 4A8JB 5EXTA 2ONKA 4D4KA 4JLMA 2C8VA 5KDDA 4O2RA 1OV4A 1ZUNB 2H8KA 5GJCA 3KKMA 2I1QA 2W2TA 1COWA 1Q1EA 1KAGA 4DDVA 2AWOA 2OCPA 2Q9AA 3QSYA 3EC2A 3UXMA 1U8YA 4TQAA 2VHTA 2AD1A 3LVQE 4RD4A 1XTRA 2XX3A 2WMOB 3EA0A 4URZR 4YXWD 1XBTA 4MDEA 3FPAA 4W9MC 3O8RA 4Q4HA 2EFDB 2ZR0A 3WYGA 1RYHA 2XJ4A 2A3RA 4TTQA 1AJEA 3LAWA 2OLKA 2B21A 2OE2A 1CJMA 4GI7A 1JNYA 3OEHA 4IVRA 3GLFB 4LHVA 1N6LA 1S1CA 1UDWA 2WWWA 2DPXA 3QVVA 4QHTA 1W1WA 3DVLA 3QKSB 2VSXA 2JLXA 2KSQA 4MGKR 3TQFA 2HYIC 1LF0A 3P4XA 1E6CA 1M8PA 4LYHA 2PX0A 5KSOA 1XPOA 3O8DA 3Q7PA 5EUMA 1TNDA 4AURA 4ESHA 1XEFA 1N3BA 3WP1B 2ZVPX 2BCGY 2R6CA 4GZLA 4PHGA 4P3YA 1P4SA 5EQTA 1E2HA 3NH6A 4MGYR 5BXQC 4EQ6A 5TMPA 1VYVA 1ELOA 2IA5A 3RC3A 1XD9A 3B1ZA 4L9WA 1NMZA 2GJ8A 3KUCA 2EFHB 2DWOA 1GRQA 4NU0A 1E9EA 1SKQA 5IT5A 1HTWA 2J3EA 1Z6GA 1E32A 4F93B 2XXAB 4WVFA 3UMFA 2WPDA 1D6JA 5L3VA 5KPDA 1W2HA 1WCV1 3U4QB 1KMHA 1JXMA 4M1KA 4HLQB 3RS7A 5JRJA 2IF0A 4TSFA 3IBGA 4RKFA 2C5LA 2GCPA 4JLNA 4C7OB 1LV7A 2BBSA 2PCLA 2QPAA 4HATA 2EFCB 3Q72A 1YR9A 2C98A 2CHVA 1X6VA 2L0XA 2CE7A 4GL2A 1RKBA 1DAIA 1II9A 1DO0A 2QM8A 2VYFA 1RW4A 3C5CA 4TLBA 1E9CA 3AVTA 4I1OA 4QJ3A 1UF9A 2RB4A 3BOSA 3RRMA 3TUIC 1N25A 1VIAA 1TQ6A 5AK0A 2BHRA 2BC9A 1VYTA 4TTPA 4L5BA 3CIOA 2BEKA 4G5RA 2HCJB 2QE7D 2ATVA 4C4PA 4OK3A 1KGDA 1SXJD 1XXHA 3QF4B 1MABB 3LDAA 4LJ6A 3BBPA 4M0LA 2PZFA 1NJFA 2ZRNA 3AKYA 3B82A 4RD0A 5EE5B 4Z1MD 3LO5A 1P9NA 2QG6A 2R6AA 3Q5EA 4M4SA 4HDOB 2JJ1D 5EZ6B 1OIXA 3LBHA 3I8SA 4PTLA 3KQLA 2A2ZA 3GLIE 2IYTA 1G5RA 2VP0A 1KNQA 4OI0A 2GCNA 5H70A 1H8EA 1S8FA 4A1FA 3GLHA 1XCGB 1Z07A 5DN6D 1Q0UA 3GPLA 2V7QA 1T0HB 2ZJ2A 3S1AA 2GETA 3HJNA 4KI0A 3IIMA 4EFNA 5J4YA 1DOAA 3ETLA 3ZH9B 4DDWA 1CLUA 3MFYA 3QKRB 2Y8EA 1E2FA 1G17A 1AZTA 2ZROA 2DCUA 3PFIA 4KFUA 1XZQA 3NTUA 1AS0A 3R8CA 5JJKA 1TUIA 2ZSEA 1FOEB 4BLOA 4C3ZA 4E5UA 5EP3A 3CB4A 2OFXA 1RFLA 3VR2A 2A5GA 3TQCA 1FTSA 2YC4C 2I1VB 2HXSA 3GFPA 4FCTA 2QAGA 5FTNA 2F9MA 2PEYA 1A2KC 4R2HA 1G3UA 3GEEA 3P26A 4H1VA 5FUXA 4XVUA 4AKIA 1IQPA 1J99A 1SKYE 3LNCA 2BOVA 3FMPB 4W5JA 4DVGA 4UNPA 4QXAA 3H86A 4B43A 1YR7A 4IDQA 4JKIA 1JB1A 1F48A 1T5IA 4HDCA 4JBXA 3ZVLA 3B8HA 3PEWA 2GXAA 2REOA 1JJ7A 2FDCA 4XIGS 4TWZA 4FIDA 4B6FA 4E03A 3KFVA 4G5OA 5C46F 2YKGA 3KB1A 3SJCA 1R0XA 3I73A 2NPFA 3KKQA 3KQKA 5L3RA 3ND9A 5G3YA 2GWHA 2A5DA 2C9YA 1U99A 4A15A 221PA 4B3GA 3IO3A 2B92A 4DLUA 1BMFA 1KK3A 1NY6A 1TQ2A 2WWFA 4MYCA 5C1BA 1KI2A 1TEVA 4DB2A 1ESMA 3FFBA 2YC2C 4JVNA 3GJ0A 1VMAA 2FU5C 3ZD7A 1Z0JA 1AKEA 1W36D 3TKLA 1ZU4A 3VKGA 5DI3B 1Q3HA 5CITA 5IHPA 1EWRA 4NYIR 1NI3A 5JS8A 1FX0A 3U4QA 4OHZA 2WZQA 3ZQ6A 2H5EA 4ZDWA 1UBFA 2B8WA 2X2FA 4F91B 3GMTA 1SVIA 3OAAD 1KK0A 1ZNXA 4JJKA 2ERXA 4JZKA 1CJUC 5FOVA 3BFXA 3LVRE 4DCNA 4HI0E 4RCYA 1R5BA 1OXTA 4CYMA 1G41A 1IN8A 3PUZA 5CM8B 5HZHA 3WP0A 5KDOA 3L43A 5EXPA 5AUPB 3ZYCA 2HUPA 1E2QA 1Z3IX 4OQMA 3FGNA 4R7ZA 3PEVA 3OIVA 1K5GA 2NMVA 1SVMA 3PUVA 4B3BA 1KO1A 4NONA 4QM7A 3O8CA 2BWJA 3DHWC 2VTKA 4CT4B 4NMMA 3TR0A 3GEHA 4GNKA 3RAPR 1DAFA 3CR7A 3UATA 4IFEA 4RZ2A 3K9GA 5AUOB 2HT6A 2XZOA 3VR6A 2R44A 1OB5A 4JJZA 1RRPA 5K8TA 3R7WB 2JJ2D 3F0TA 821PA 2RGEA 3C15C 4B74A 2MSCB 4WBSA 5CK5A 1IN4A 1IN7A 4UXJA 4BQSA 4MRRA 4URYR 4DIEA 1G8GA 1XMSA 2R6DA 1JEDA 1CS4C 4RFSA 4I81A 4LPKA 1FP7A 4PHTA 5DYIA 4M1TA 3QXSA 4MKGA 4C0SA 1QHSA 3U60B 3BXZA 4OL0A 4R2IA 2BV3A 1YZNA 2HLDD 4LYFA 1G6HA 1UEIA 1P75A 1MH1A 1RRGA 4LX0A 1W7AA 2LKCA 1CP2A 4GFDA 3E70C 3NEJA 1U90A 4Y0VA 2PT7A 2FWRA 2CNWD 1US8B 4TMKA 4J0QA 2D06A 1NN0A 4L9SA 4TYQA 1DAMA 3QXJA 4Q1BA 1Q3TA 3K1JA 3SEAA 1KDRA 4TLAA 1NP6A 4DB4A 1NLZA 2ZU0C 3B1XA 3WBKA 1IXZA 4KBGA 1G21E 1KK1A 4PC1A 4X8MA 3N2EA 4NKRA 1CJKC 2NO7A 4TYPA 4WZAE 1FW6A 4AY2A 3QUSA 2RGDA 3PXGA 4R98A 5CJPA 3AVPA 2NG1A 3B85A 5D3MA 3B1VA 1II0A 3HDTA 3C14C 1UEJA 5JFGA 2JCSA 2G83A 1P3JA 4TTRA 1G4AE 1UPTA 1TF5A 2RGCA 5UKDA 4IFBA 1E3MA 1DADA 2ODWA 3CH5A 4S2EA 2ZYUX 1XB2A 3Q3JB 3SNHA 5G41A 2NZ8A 1HH4A 4YC7A 4HUTA 5E7IA 4DIDA 3CNOA 2D62A 4EDHA 2O8FB 1LW7A 3U3RA 4DRZA 1KO8A 3DPUA 4LDJA 1HT1E 5LB4A 1R8SA 2WVJA 3OZXA 2GZHA 1XWIA 2PLRA 2CE2X 4O0MA 2PJZA 2J0UB 3AH8A 1HA3A 4Q1AA 521PA 1NN5A 4A0HA 2WAYA 2W6IA 3AKEA 2IYWA 2ZRHA 3Q85A 4PPFA 3W6OA 1RZ3A 1MO6A 1GZSA 2ZAOA 4HB3A 2DBYA 1S0UA 1NL3A 1OKKA 3LBIA 3PCRB 4BE7B 1VECA 4C0HA 5FPSA 2J9RA 4JLDA 4ZI2A 1ZNZA 3UANA 4EPXA 3P4YA 2AWNA 1CU1A 1XTSA 4A2PA 1SVSA 4DSOA 3K53A 1QVAA 4Q7MB 4IDPA 3SJBA 4Q21A 2BBTA 3SFZA 5EUQB 3BH0A 4US1R 421PA 2WICA 1OF1A 3K8YA 5HTKA 1QHHA 2FSGA 1J8MF 1G8PA 2DB3A 1EFCA 1QG4A 3GJ3A 5BW8A 4TMTA 1ZYUA 2GJKA 4A92A 2P3SA 3K09C 4KFRA 1FMJA 2O8EA 2DWQA 3W3AA 3THOA 1N6IA 3QBTA 3QXHA 1EXMA 1S3GA 1E2IA 5TVKA 1I2DA 4XSGA 1J70A 1ZUIA 2G77B 4M8NE 3P20A 4H9GA 3SDZA 2EVWX 4XD7A 4AWXA 5JJIA 3WMFA 4I1SA 3FMFA 1AS3A 1M2OB 3TRFA 5DISB 3ZGXA 2JLUA 4NCIA 1E9RA 2XB4A 2ZRJA 5A0FA 4MA4A 3LXXA 4G3XA 3TJZA 3W6PA 4EPWA 3TW8B 1SVKA 1X8KA 1KSHA 3W3ZB 1JAIA 1HY3A 1T6NA 4D2IA 4CZ2A 2CVHA 3SYNA 3BB1A 4HB4A 3BH7A 2IS2A 2HJGA 3I61A 4GOKA 3THWA 4R71A 1COWD 1D8TA 1JI0A 1OIWA 3QQ5A 1GDDA 3OFNA 3VX4A 4B2PA 4LWZA 4DCVA 5CB6A 3FDIA 4QBHA 3RS3A 1KJZA 1C9KA 4JBYA 4MUBA 1K5DA 3BIFA 1Z0KA 3EIQA 1G291 2JJ2A 5FOTA 1N0UA 3QF7A 5FPKA 4ZDJA 5AUQA 3KKOA 2VHCA 2C2HA 5AJXA 1JPJA 5AJZA 5JHHB 4Q9JA 2C03A 3RS2A 1QHXA 2GF0A 2IXEA 4MRVA 4MYTA 1VHLA 4C0QC 5L3QB 5DSZA 4DSTA 1EK0A 3OEHD 5JS7A 4NCJA 3OE7D 2ZE8A 4FMCB 1PJRA 1VCNA 4HZUA 2Z5FA 1HUQA 2FPLA 3A36A 2BEJA 2JIZA 3TE6A 4QGFA 1ZJ6A 2QSYA 1SULA 1YZTA 1OLOA 4LBZA 3UK6A 3WNCA 1BIFA 2C9OA 1XJCA 5JI2E 2WSMA 1E2LA 2Z4SA 2BBOA 2TMKA 3OIUA 1T91A 2WKQA 1ZAKA 3VR4A 3TSOA 2BJWA 5FOUA 4G01B 1E79D 1W5SA 2CNWA 4MKHA 2DYKA 3SU8A 3THYA 1KI7A 1Q57A 2LWIA 4Q9KA 1HT2E 3VR5A 2FMXA 2GJ9A 3EIHA 2W00A 4JBWA 3PEUA 4QBGB 4DLWA 1NIPA 3FHOA 1E98A 2F43B 3WBJA 3P1JA 2KWIA 3T15A 4ZIRA 1G3MA 5EZ5A 1NG9A 4QFMA 1KO4A 3IKJA 3CF0A 3LLMA 2WPDD 5CLQA 3MCAA 4JLVA 5C2JB 3FE2A 4V0ME 3CF6R 1G5TA 1RJ9A 3SYKA 1ZM2A 1SVLA 2BJVA 1IJFA 2QBYA 4TSFD 4QGHA 1CJTC 4W7SA 1F2TB 4M21A 1E4YA 3CZPA 3IPYA 3GJ7A 4EUNA 3RS0A 2QP9X 4KYUA 3U3JA 5FI1B 3WNDA 5JZVA 4LJ7A 3TSWA 4UNNA 1K6MA 3SFVA 4F38A 3NG1A 3VAAA 1O87A 2CJWA 3X1WA 1WP9A 1IONA 4Q4JB 4JL5A 4GP7A 3KQNA 4D26A 3AEZA 4QNMA 4EJSC 3G82C 2F9LA 5GVRA 4MYHA 3QOFA 3TLXA 5GJVC 4JSYA 4FMCF 3ZDQA 1N6KA 1XD2B 1W49A 2IS1A 3MWJA 3K0FA 1G18A 2ANBA 2R6GA 3DOFA 3RS5A 3CWZA 4ZKEA 4M1SA 3ZZ0A 4P4UA 1GL9B 2A5YB 1A1VA 1H65A 3U2QA 4DSNA 4A0FA 2J1LA 2CDNA 2P65A 2O8BA 1NKTA 2ZYWX 5KSZA 2X2EA 1H8ED 2WWHA 2FEOA 2XNSA 1K8RA 2OBMA 5TARA 2NIPA 3EC1A 5C18A 2QRNA 2NOAA 1PZNA 1NBME 5AUNB 2GVDC 3C41J 4NYMQ 2ZRLA 2F1IA 5C4MA 4Q1CA 3CPEA 2GJAA 3L0PA 2VP4A 2AXNA 2F1JA 2IUSA 2K5UA 3U7GA 1E94E 4QRHA 1DELA 5FPTA 3EAQA 1P61B 4Q4AA 1CR0A 1KDOA 1P2SA 1YZQA 1G1MA 5EXSA 5L3SA 2GF9A 2WJIA 2V6IA 4BLPA 3U44A 4RKEA 1KI9A 1B0UA 5FH9A 2RGBA 1XD8A 4NYJQ 5J40A 4IXMA 3T1QA 1XCPA 1FMLA 4RFSB 3U3KA 3SN6A 1G3IA 1ZIOA 4CF7A 5JECA 3R8FA 5E95A 3T1VA 4Q4LA 4A8JC 2DR3A 4Z54A 2XB2A 2ZREA 2WWIA 5HPYB 4YDSA 3K9NA 3A6PC 3AF2A 4AG6A 3AGQA 3U6KA 1M34E 4ZPXA 3KQUA 3VNVA 4FWTA 1G7RA 4UXIA 3ZJYA 4DWJA 5CLLA 3NKVA 4RSGA 2PX3A 1XEWY 4LHZA 1WQ1R 1MO3A 4KSCA 3EASA 5LBIA 4GDFA 2D7CA 2ZI6A 1N6RA 3CH4B 3KUDA 4TLCA 2PBRA 1HYQA 3DMDA 1KNXA 3REFA 4ZCIA 1AIPA 1SXJB 5EE1A 2ZJAA 3ZIAA 1AM4D 5KSPA 3VFDA 4P32A 5TV2A 1BMFD 4PO8A 2REBA 1CKEA 4Y0AA 3MLEA 1OJLA 3VU9A 2UKDA 2OM2A 5BN4A 3EZ2A 5DLQC 1OXVA 2B6HA 4PR0A 2NZJA 4L8GA 1CRQA 2CLCX 1FUKA 2G0TA 2VP5A 1R0YA 1II8B 4YQFA 1BO6A 3GEIA 3T5GA 4DKXA 5GJBA 3OESA 2F1HA 4PQFA 5FR2A 3A58B 2JJ8A 4CEIA 1G8YA 2GKSA 3RNLA 1TUEA 5LPNA 1AA9A 4HYYA 1OPXA 2ZU6A 2YHSA 1FFHA 3VMFA 2J7KA 3AF3A 4GOJA 3U7EB 2FJUA 5DH9A 2XOKA 1YZGA 4BZQA 4WIAA 1OFIA 1P72A 4IDOA 3TSZA 1AQYA 2QMOA 4QHSA 3OE7A 2ZXUA 2F3TA 1X1RA 1GSIA 3TMKA 2QA5A 2GNOA 3MWYW 4RD2A 4URUR 5FR1A 2MSDB 1F3OA 4QG7A 4LSGA 1GOTA 1GNPA 1SHKA 1D9XA 2ZM5A 4NP6A 1KKMA 4JT4A 3REGA 3VHLB 2V8OA 2A5FA 3GLGE 2D74A 3K70D 1E79A 2QN6A 4DDUA 4DUGA 4LV8B 2YYZA 3K0AA 3B13B 4WZ6A 3SZRA 4CEHB 2PH1A 2PMDA 4JMPA 4CRWB 3M0EA 1LF5A 1LVGA 4D6PA 1CJVC 1E2MA 1MO5A 2B8TA 4F7WA 3FKSA 4KV9A 1ZD8A 4OHYA 3W6NA 2J87A 3BB3A 4JL8A 1Z5ZA 3D3QA 1IN6A 1L4YA 1YRAA 4V0OA 5JSZA 2CLSA 2QPOA 1ZIPA 4UQOA 1VHTA 4IW3B 3X1DA 1FL9A 3LLUA 4LV6A 2EWVA 4XVQA 1NVUQ 4V0MA 3I4LA 2FFHA 1KI8A 5BN3A 4HUQA 4NDZA 1LTQA 2ORVA 1KMQA 2F55A 2YVUA 1BYUA 5AR1A 4LYAA 5G3ZA 1W36B 4I1VA 4OBEA 4PPGA 3WHLA 3ICQB 2OUKA 2BKEA 2DY1A 4KBFA 4PANA 4PC7A 2ZRKA 1JR6A 3TW4A 4Z8YA 5K8IA 4TQ9A 1DEKA 4DZZA 2ZJYA 2VL7A 4K81B 3TR5A 1KY3A 2J41A 4D4MA 4P31A 4DJTA 1T3SA 3GQBA 2OEPA 3QPWA 2V1UA 1VG1A 1PLKA 4BRUA 3EW9A 3NWJA 4YLGA 1T4GA 4FD2A 1W46A 1GWNA 1E9DA 2EYQA 2ZE6A 2QI9C 2WTUA 1U94A 1UADA 1AGPA 4B44A 3VKWA 1OFHA 2WHXA 4QJ4A 1FQKA 2IEYA 2PZEA 2H7VA 4XWAA 2AK3A 1AGRA 2FSFA 2FSIA 2QRZA 2YWHA 4G5SA 4PC6A 2YWEA 4Q1EA 4B2LA 4KSBA 3RWMB 1Q21A 4KHZA 1U98A 4D81A 4DBLC 5F3WB 1CEEA 4RD6A 2D4HA 2ZYVX 4F4CA 1YZUA 1JALA 3J81k 3FKQA 3TUJC 4MGIR 1PV4A 3QEOA 2NO1A 4PX9A 3IGFA 1AK2A 1TU3A 1KO5A 4KVAA 3I1FA 4LCBA 3D8BA 4BZPA 5EE0A 1IM2A 1NBMA 2VO1A 2W2XA 3K0EA 5LD2B 2F7SA 4LYJA 3RSOA 3CX8A 1M74A 1NLYA 3QG1A 5JLJA 4TT3A 1XZPA 5AJWA 3TAUA 2CVFA 3ONWA 4YMSA 1Z6YA 2QQEA 3WY9A 2PT5A 3A1TA 3BFKA 4AYTA 4AYWA 5IRCD 1XJQA 3LA6A 1QHYA 2V9PA 1G19A 1G20E 3NEYA 3W5IA 2W6ID 3VNUA 4X8HA 1BH2A 5CK4A 3GLFE 2FGJA 4XTCS 2N42A 4E22A 4JLJA 4BRWA 1TU4A 1OH6A 2CMKA 1G5PA 1ZM7A 1OKKD 1A2BA 1XMJA 1GG2A 2ZRFA 4M9QA 1TQDA 3Q8XB 4JT2A 3B5JA 3THYB 1XEXA 1UKVY 2WV9A 2IS4A 2H17A 3DO6A 1KO7A 1V5WA 1M7BA 4NZYA 2JLZA 4Q48A 5KYKA 4LJ8A 1CTQA 3CO5A 4CEJB 1GUAA 2C04A 3C7KA 3THXA 4NH0A 4I4LA 1VG0B 1J8YF 1VCOA 2GBLA 3AVOA 4Z8XA 1S9HA 4YMTA 1X1SA 3NBZC 1RJ9B 3MSXA 2VP9A 3PUWA 2QBYB 2WWGA 4PSKA 1ZUHA 2AKAB 2E9SA 1RE0A 5KOYA 4NYIQ 3WRYC 1JEEA 1GL7A 4YMVA 1UDXA 2EFEB 4IHQA 4L16A 2ZUDA 4C0LA 2ZSAA 2C9CA 4P4SA 3IIJA 4OI1A 4EFMA 2I4IA 1EFHA 1QBKC 2G1KA 4I1UA 4JYBA 4QGGA 2BMJA 4A9AA 1NG1A 2G3YA 2GTPA 1NLFA 4Z51A 1ZMXA 1Z08A 3B7GA 3SQXA 3LRPA 4LV5B 4QNRA 1FUUA 2JLSA 4XD7D 5FBRB 3NHAA 1WBDA 3RSLA 4IOMA 3D6TB 5CIQA 3RWOA 5H8WA 2QT1A 2OT3B 1NRJB 2HF9A 2J0QA 3U3OA 2CHGA 2O8CB 1JAHA 1TADA 2NO0A 2Z4RA 4AKGA 4LBWA 2ZUCA 4US0R 4Q1DA 5F2EA 1VTKA 4PAMA 5SZHB 3BB4A 2ZRPA 4MYUA 3ZD6A 4W5WA 2FEMA 4B76A 2Q6TA 3ADDA 1YU9A 4MITA 3FB4A 4AD8A 2QM7A 4C0JA 2O8BB 1JQJC 3D7MA 3KJEA 2HYDA 3X1XA 1YE8A 2AK2A 3OFND 2W83A 1LB1B 3HU3A 4HLDA 5KU1A 3GLGA 2VHJA 3AVXA 1XFAA 2QORA 1W4CA 2YJTD 3L0SA 1G8FA 3WNBA 2WKRA 3LD9A 2D7DA 3OEED 1JBKA 3BGWA 3QENA 5EJEA 4QHYA 4B71A 2FFAA 3EZ7A 4A0RA 1R0WA 2WMNB 5EE3A 1W48A 3LV8A 1EFUA 4EJSA 1WBBA 2BKUA 4G0NA 4ITRC 4TMZA 4BLQA 4B6EA 1S96A 1QF9A 3AVUA 4DLZA 8OHMA 2J7PD 2OXRA 2JIZD 4HAXA 4GRAA 2O52A 4XTRA 4C0AC 4DCUA 1KY2A 4QL3A 4MGZR 1KI6A 2IWHA 2QSZA 2O8DA 1OXUA 2ECKA 5AJYA 3IHLA 2HXYA 2O0HA 3P27A 3DL0A 4B32A 1NN1A 4ACBA 3NDBB 3EX7C 1F2UB 2AD5A 2ZRDA 1Z6AA 3MJHA 3WMEA 2Q9CA 2OCAA 2ANCA 4OJQA 2R2AA 4LOAA 2VH5R 1GP2A 3IILA 4XSHA 3RYTC 3QPVA 3CR8A 4K46A 4LK2A 5B64A 4KCGA 3B1WA 3RLFA 4KYIB 2BVNA 4ARZB 2P6RA 4WZBE 1SGWA 5FBLB 3SS8A 4UJ3A 3V4RA 2XGJA 4ASUA 5HKKD 2NQ2C 1A5TA 1G7CA 3KTAB 4D80A 4UJ5A 3DKPA 1HE8B 1QHGA 1M1YE 2FE4A 3UWOA 3GLIA 1W4AA 2P5SA 2QROA 5ELXA 1R10A 4MKFA 5KO2A 4ABYA 3UG6A 4PZZA 4Q7LA 4HB2A 5J5CA 4JKYA 3L82B 4A8JA 4D0GA 4BZXA 4TYWA 3RANA 2C96A 1D2MA 4POAA 5SZIA 2P2LA 1DVRA 1X86B 3P32A 3WMGA 1Z29A 2GCOA 2MMCA 4IDHA 1NVVR 4O25A 4Q4HB 5HE9A 3SI7A 4RVCA 1ODFA 1TTTA 3W5JA 1QDEA 3HYTA 3RC8A 4PO9A 2GAAA 1IY2A 2JASA 2R6FA 4A36A 4HAZA 1E0KA 3O47A 4U5XA 2AX4A 3O8BA 1U2RA 4HAVA 4EPTA 1M6NA 1G8HA 2WOJA 2D2EA 2ONJA 4TLEA 2JATA 1E9SA 1DG1G 2J0VA 4KVGA 5G40A 3UG7A 1D9ZA 3EPJA 2QGNA 4B35A 3GLFA 3WYAA 1C1YA 1DAGA 1FNNA 1KKLA 5IF9A 3KX2A 5B30A 2QTFA 2FH5B 4A2WA 1Q1BA 4EQ6B 1XEWX 2IHYA 2HF8A 1XDBA 1IAQA 2HV8A 3GJ5A 3U6BA 4F92B 3BFVA 3B6EA 2KBEA 4DLVA 2Q3FA 3EARA 1OYWA 2PCJA 4Q7JB 1W4BA 3PUYA 5CJ2A 3KXKA 2GILA 2ZJBA 5FUYA 3EPHA 3SOPA 3AF4A 4I99A 4F4IA 5JSZB 5C4GB 1W44A 2IYUA 4AKHA 1KMHB 1WE2A 3ADKA 4B48A 4N3NA 1P9WA 5EP4A 3B78A 4ZKDA 2XXAA 2OAP1 4F4JA 3WRXC 2IYRA 1XMVA 4GBMA 4AC9A 4B73A 2I3BA 2WOOA 4TL6A 4DLTA 3BH6A 4OYHA 2ZPTX 1OIVA 4ILEA 4RCZA 2D2FA 3I62A 1J2JA 1GTVA 4D4LA 1JJVA 2QL6A 1EX6A 2DFKB 3IDQA 3OIYA 4Q02A 3KJIA 4DEXA 3CM0A 3C8UA 3DOEA 3LW7A 1PVOA 4M1YA 3A4LA 3DZ8A 2ZRMA 3A1VA 3CRRA 3T12A 4PHFA 1MR3F 2AFHE 4BFWA 3ZVRA 1XXHB 4U7DA 3KJGA 1I4DD 1G3RA 3ECCA 3ICEA 1XTKA 3ZIAD 3L0OA 4DLSA 2ZRIA 3A8TA 3BERA 5J4VA 2ODBA 3KXLA 3PITA 1E2NA 2VEDA 2GK7A 2Z0MA 1LY1A 2KE5A 3QF4A 2RGNC 4EPYA 3OHMA 3GLHB 3AVYA 3FFAA 2C78A 1NMYA 3LXRA 3QY0A 5JBQA 4PZLA 1DO2A 3I72A 4C30A 4NE2A 3S1AB 4BFSA 3CONA 5EE9A 3JZAA 1EG7A 3OEEA 1S2MA 3QIAA 1P60A 1VG9B 3HP1A 1WXQA 4D0NA 3AKCA 3ZVNA 4DLRA 5DHFA 2QNRA 3IBYA 1Z0IA 2XOKD 2AHOA 4KO8A 1J90A 4Q1FA 1E9BA 5SZKB 4D0LB 1UKYA 2VF7A 3EXAA 4Q7KA 4IOLA 1WRBA 2X19A 3QKRA 2XITA 2J7PA 2QAGB 2EFGA 3R9IA 3B9QA 2HJVA 1CR4A 1IN5A 2BM0A 2IT1A 3H0KA 3D31A 2R65A 3SQWA 1N6NA 1A4RA 2YWFA 5D3QA 1O3YA 2V6JA 1AZSC 1WMSA 1UBGA 2IC5A 4BEJA 4OQNA 1E0JA 1ESNA 4DUGD 2FOLA 1W0JA 2H16A 4XVRA 2OLJA 4MRNA 5J4KA 3FOZA 3Q5DA 4JLAA 1WA5A 4E07A 3FKSD 1W0KD 2VA8A 3NC1C 5CIWA 2QEQA 5IDVA 4BFZA 4FW9A 3HR7A 4WXPA 2O5VA 1E2PA 5BYJA 2JDIA 2GZAA 3LH5A 4FCWA 2GEVA 4GPTA 2OFWA 4KODA 1DAKA 5HKKA 3B1YA 1KZGB 2ZJOA 3LW8A 4BEBA 5B58C 1OH7A 3GCGA 2W0SA 5KTYA 3ZZUA 1RC8A 2E87A 3MUFA 4IVQA 4B47A 3M1IA 3AQ4A 2J59A 1DAHA 3JVVA 4XWKA 3X1ZA 3SBDA 4LRWA 3U3MA 5FPHA 3RS4A 4OI4A 3Q9LA 1F60A 2ZI3A 2AR7A 5HCNA 4Q9HA 2QMHA 4V0LA 2N46A 3K9HA 1FX0B 1OE0A 2IEZA 2IW3A 2OXCA 1LNZA 1YZKA 4ZO4A 5JWHA 3RABA 1Z2CA 3BC1A 1T8UA 3SJZA 2PLFA 4PAQA 1E2JA 1JR3E 4B3DA 1M7GA 3TK1A 4BWYA 2VSOA 5F9FA 1WDTA 3KQHA 1OFTA 1BOFA 1OXSC 4HB0A 3I5YA 1U0JA 4GSYA 1ZU5A 4H1UA 1FZQA 1UKZA 2OILA 1Z0FA 2GHIA 4NHOA 3TVDA 4A0GA 1Z0AA 3BAFA 2IYLD 1RRCA 1EX7A 4IXNA 1E2DA 3KZ1E 3A1SA 4YDHB 3AVQA 1NVXQ 2IHBA 4EIWA 2IXFA 2XAUA 4NCHA 3QVUA 1L2TA 4R9UC 2W6JA 2XNDA 2XEXA 5E3HA 3CLVA 3ADBA 1VKJA 4HEJA 1OYYA 1P2TA 1CXZA 3L8YA 4JSTA 2ZAMA 1Z6XA 4RZUA 1UAAA 3K70B 3QPUA 4RD1A 4U00A 5DGXA 2G1JA 3PV0A 2D3WA 4YONB 1P2VA 1E1QA 3CX7A 4GP6A 2IUUA 1IXRC 2FGKA 2RHDA 3CRMA 1J7KA 1NBMD 2ZRCA 3TVTA 1AS2A 1ZW6A 3BK7A 4X8LA 1D5CA 3B60A 4KFTA 2Q9BA 5BQ5A 5CDFE 3VQTA 2ZS9A 4OQFA 4TT3D 4RJLA 2GVZC 4LGMA 3HWSA 3KFXA 1NF3A 4DLYA 1MO4A 1SXJC 2ZUBA 3NC0C 3ZVMA 2GA8A 2KB0A 4M1MA 1T5LA 3R7WA 2AN9A 4GMXA 3ZQJA 5KNBA 2REXB 2RMKA 4M2LA 2HCBA 4D4JA 2ATXA 3UWKA 4B75A 3EA5A 6Q21A 3W34A 1CBUA 4GMDA 3ZS8A 1XF9A 2RCNA 3IPXA 1I2MA 4PPNA 2VHQA 2QTVB 3C4JA 2IXGA 4XOIA 2XSZA 1P9RA 1R5NA 2P5TB 4TYYA 4JLKA 4IEIA 2ERYA 3F3YA 4NL4H 1UJ2A 5FTKA 4EKDA 2FF7A 4V02A 2H18A 5FTLA 3AV0B 4RY2A 3TAHA 1XJ0A 1US8A 4TMWA 1QHNA 1OSNA 4QJ5A 2DHRA 2QY9A 4P4TA 5EP2A 2N1BA 1PUIA 3BD9A 4QKQA 4TZ0A 1JXOA 3T5DA 2VP2A 1TF2A 1KK2A 3EG5A 1NVWQ 2V4ZA 4G5QA 4Q19A 4JIMA 4PAOA 3TGPA 2PJRA 2QZ4A 2Q3MA 2QUZA 5D3MB 4DCSA 3GLIB 3BRWD 3U7HB 1DPFA 3TBKA 1E2KA 1TEXA 4BFYA 1GNRA 3LQRA 2JGNA 2XTNA 4FINA 1U0LA 4AI6A 3IO5A 1MKYA 1N5KA 1Q20A 1D2EA 2OCBA 1KI4A 2W58A 4RFVA 4N0EA 4UNRA 1KSFX 3IEVA 1NSFA 2GCOB 4OQXA 1VDZA 1FPMA 2WKPA 4O3MA 3H84A 1R6BX 3KDSE 4LZZA 1ONBA 2ZJZA 3I92A 1E69A 1I4LD 3ZZTA 4MRPA 1U0HC 2WWYA 2O8FA 2ORIA 3K0CC 4A6PA 2J5XA 4CW7A 3AF0A 1OH5A 3AUXA 3WXMA 4UNSA 1N6HA 1IY0A 2WIBA 2ZR7A 4KLZA 1SKYB 3ADCA 3BS4A 4RZXA 2J0UA 1W36C 2VSFA 1MRSA 4JYCA 4HLCA 2VBCA 4KLNA 4G1UC 1VCMA 1W0KA 4A2QA 1TF7A 4BFTA 4LJ9A 2QTHA 4K8OA 1C4OA 1EFTA 1EGAA 2X1VA 2CLDX 5P21A 3LX5A 5E7JA 2W2VA 2PEZA 4LJAA 1QHHB 2QENA 3GJ8A 3V4FA 2OFOA 1YR6A 2AKYA 4OK5A 3WYFA 5E7MA 1YR8A 4UKDA 4HAUA 1E99A 3GJ4A 4ZI3A 4IRUB 2CL0X 5DE3A 4PZYA 4TZ6A 4Q5IA 3IQWA 3A37A 2O8EB 4AK9A 1R0ZA 1ZCAA 4BECA 5JI3E 1R8QA 2IYZA 2DWPA 1RIFA 3AP3A 4KAXA 4XWOA 5KPJA 1I4TD 3FYHA 5G53C 1CRPA 3NH9A 3TUZC 1GRNA 4BPBA 1TMKA 3C16C 3FHCB 1S3SA 3CNLA 4W5HA 4PC3A 1KAOA 2Z83A 2ZEJA 3FMIA 3GJXC 3L2OB 3A1WA 4KXFB 4B3FX 5LD2C 5JJLA 5AJVB 1P7CA 2HT1A 1JR3A 3KJHA 3SHWA 2YOGA 3T06B 2E1RA 2YOFA 1UBEA 4II7A 4KFSA 4ZDIA 1D2NA 5J47A 1NKSA 1GNQA 4ASUD 4BFXA 3H2YA 2LCFA 1RPZA 4HZIA 3CUEF 2XTMA 5HZKA 3EIEA 4TMVA 5KDLA 1SXJE 1YZLA 5FOXA 5BN5A 3N2IA 2PL3A 1KDTA 4DT1A 5TB5A 2P6UA 3THWB 3HPQA 1LFDB 2NPIA 2WBLC 3K09A 1V43A 1Q1ZA 3AP2A 3IUYA 3N70A 3VR3A 4JLOA 4QM6A 1PUJA 2IYYA 2RH5A 1U9IC 3V00A 3H1TA 4PPQA 1QHIA 2CCGA 3R9WA 4V0KA
chains in the Genus database with same CATH superfamily
1LBIA 2VDNB 3DW1X 3SIWA 3CUVA 3VAYA 1H1LA 2BSQA 1R4AA 6YASA 5IAKA 4BMNA 3NT2A 3ZU4A 3LFUA 4BXOA 1GGEA 3SEFA 1UBCA 2IWRA 1CF2O 4OMCA 5FUVA 1UFKA 1AKWA 1I6LA 2HA2A 4LPSA 3H7AA 1QF6A 5DBIA 1YOVB 4S35A 4IMIB 3RIMA 1H05A 1VIYA 1UINA 2HO5A 1M2GA 5J5AA 3JARB 4NU5A 3NM6B 4HSEA 5J1TB 3S2ZA 3QVGA 1KFJB 4MZXA 3V4VB 3V9PA 4MW5A 1N2OA 1L7PA 1CUXA 2MR5A 2O8NA 3VC7A 4ETWA 2CFTA 1SUEA 1G8KA 3QUCA 1XNRB 4OHXA 1YJXA 1A0OA 1YWGO 4YDRA 5HEKA 4U2FA 3K32A 3KB6A 1T5DX 3D7SA 4AP6A 1EX9A 4MRSA 1YC5A 1OH8A 2QMZA 3GPDG 3IJEB 3QXCA 5HQTA 1JT2A 4G1EB 4HS9A 5IWAB 2OP0A 1J0DA 3E5HA 3EJWA 1A8HA 1U7OA 1FNMA 3OA2A 1DC8A 3W5SA 4REQA 2OCDA 4RKRA 3HYRA 4LJ4A 4CCAA 1VIVA 3KZVA 2ZTMA 3KG2A 4P5PA 5DB4A 3HVHA 4HGZA 4GR5A 2IZ1A 1HFJA 1DKUA 3B6MA 1I32A 2Q3HA 1YZ3A 3A6HA 4OIMA 1HQKA 4UUNA 5LYJF 4GQIA 1VBFA 1MV8A 1QPZA 4AY5A 1YVUA 1ZVMA 3GZJA 5AVYA 2ZQ5A 2WAAA 1VZ3A 3JR7A 1W2GA 1L7MA 2Y9PB 1T8PA 2IP2A 2F43A 2R62A 1I2AA 3H5LA 5DYYA 3WTCA 5EVCA 3PNSA 2OV2A 3ZWVA 1BE8A 4A3SA 5A04A 2X15A 3NNNA 1J6UA 5CW1A 2JVJA 1TAHA 3BX1A 3FWHA 3BRWA 1B0ZA 4ZQGA 3HFGA 5K0NA 2HJWA 2XTAA 4INZA 1TK9A 3KLBA 1WCIA 1RZRA 3WNQA 2QL7A 5IW8A 3R20A 121PA 3IIKA 4UASA 3NV9A 1SOWA 4YCBA 3T7TA 1DIBA 4UU7A 1WP4A 3NIBA 4GUDA 4LMBA 4MH0R 4MKIA 4HLUC 3H2JA 2G9NA 1DXHA 3BWDD 1EAYA 4RTQA 2XCRB 4EVIA 1L7VC 2GESA 2Z6QA 1ORTA 1VLQA 3NW9A 1IBRA 1AY0A 2ABWA 4TLMB 4GX0A 5D6NA 3S5UA 1QG0A 1L4BA 4CT5A 5G0UA 4BQPA 2RKOA 1Z2EA 4D9NA 5CG2A 3LZDA 3NR2A 4AROA 4PXAA 1Z83A 1DKPA 3DTVA 4NCNA 1GNVA 3STUA 3TW0A 2ZJ1A 5E6SB 4EPVA 4OL9A 1BVRA 2WUDA 4IGEA 2OSBA 2P5UA 3I0ZA 2HC9A 4XUDA 5LQKA 1T29A 5DHQA 4URVR 1GQ2A 4R1OA 1KIFA 5LZ8A 1PKEA 1NDUA 2MYUA 4F1KA 1VG8A 2HEIA 3VTKA 4AM8A 5BNWA 4DCMA 4AMBA 4MO9A 1A69A 2B1RA 3OWHA 3VGPA 3LCUA 4RZIA 2WSSD 1P6XA 3K6JA 3SICE 3TEMA 1ID8A 1KOGA 4ZDKA 5KNCH 2H06A 2RHWA 3OZ7A 4WXRA 4FX2A 3GYBA 2ST1A 3NVKI 1X1EA 2FKAA 3OWOA 3U7FB 3LCMA 1N5MA 5EWLA 2H4XA 1XMPA 2IU0A 4OKSA 1XTUA 3VOAA 4OQPA 5BSHA 4HAYA 2C4MA 5CURA 5J5VA 1PFKA 2G06A 2G40A 3L01A 1SU4A 2RHTA 1EUDB 2QMEA 3A2NA 5IEBA 3V8RA 1CVRA 2YHBA 1Q7TA 2OBBA 1OU0A 3EZYA 2SCUB 4DTIA 1ML4A 2GAJA 2H57A 4J1TA 4EYEA 2IE0A 2QYOA 3S2UA 2I3ZA 3TE7A 4MSUA 2A0UA 3UKDA 3WYBA 1FDTA 3H8JA 5L8VA 1TRKA 3U44B 4YQEA 4ZGWA 3OTIA 3NOVA 3VTFA 3AVWA 1DV2A 5T8KC 1EWQA 1WIWA 2ZZKA 1ULSA 1EDOA 2O3SA 3BDVA 5HR5A 4Y0NA 2XQKA 5TPWA 5DP1A 1ULZA 2FG5A 3JY6A 3OT4A 4MP3A 3KEQA 2EJWA 1NMXA 1CQJA 4TSKA 1W85B 3DBRA 3I8XA 3JYPA 4AB1A 3RADC 1N5LA 3Q9SA 2GXUA 2HDOA 2P30A 2VPPA 3FVRA 2BMFA 1AVTA 4IDNA 4KIJA 3EWAA 1SVUA 2CF6A 2YZNA 5IBPA 3TH5A 3WLFA 2RSLA 4PYJA 1TL7C 1UFQA 1X7XA 2ZB4A 1XMQB 4OMUA 3ZHVA 3FCSB 3IP9A 3O3CA 1X80A 5B1IA 3DXYA 3UHJA 3EQ8A 4YRFA 5HQ3A 1L1RA 1O94D 4G09A 5M2QA 1KQGA 1DIGA 2J08A 2WABA 1DTWA 3B12A 4TXHA 3SR0A 4YUAA 2GKGA 5A4JA 2R9VA 2RGAA 1RIIA 3DZFA 2J9FB 4PTZA 4YECA 2GHQA 4MCAA 1DDOA 5FTMA 2V97A 4D9HA 2YCLA 4PSUA 4FC7A 2ZRGA 4C08A 1XQWA 4CF4A 4D3ZA 3X2SA 1W59A 1ZS9A 1TLTA 2DUMA 3FDFA 3FVQA 3WDMA 2AOWA 5JSHA 1HBJA 3QH4A 4WAUA 1LLCA 4FWIB 2QD1A 5J4LA 1SXPA 2Q2WA 2JCYA 4Y2YA 3N2YA 2LUOA 3AFHA 1EZ1A 2DXIA 4B83A 2JH9A 2H4YA 3IHWA 3GNSA 2QE7A 5B2ZA 4DQDA 3VOSA 3IR5A 4RHCA 4GLOA 1YR3A 1Y4ZA 4XCQA 1SXJA 4XYLA 1IWBB 1S4QA 3G8YA 4BPRA 3NATA 4M22A 1QQTA 3BK1A 4JJ8A 5HE8A 1PNVA 2EP5A 2DM6A 4LZLA 4HFJA 3RAGA 4DA8A 1OR8A 4XQCA 1TA4A 3A3KA 3GT3A 1PK8A 1OHHD 2OG2A 4ZCRA 3AY0A 4HDNA 5LDDC 1K6JA 1MT3A 1KQNA 4F72A 3CBGA 4A73A 3WVNA 3W90A 5ALVA 1FU4A 1HSZA 1YJ5A 2ZI7A 2QB5A 1Z17A 4N6GA 2PR2A 3GRZA 3HWX1 3KLOA 2BRUA 3BDAA 1EDZA 1FCJA 1QG2A 2JVKA 1ZI9A 4OHPA 1R15A 3PZRA 4DNXA 3LL7A 5HCIA 2FP4A 3RS9A 3ZW9A 5BYKA 5JRZA 1GFSA 4HWOA 5BV0A 2UXBB 1QKJA 1WZEA 3GDOA 1I1HA 1LSJA 3UUGA 4NY1A 1LFAA 2QZ9A 1ES9A 3NBUA 3UAVA 2OPBA 3NUQA 2WSLA 3ORRA 5ALMA 1G6Q1 1W5FA 1G7TA 4HFRA 3OF5A 3F74A 2GK3A 2IEIA 2O48X 5FL7D 4M86A 3NETA 4L4ZA 4BLUA 2E82A 4MV4A 3LQFA 1T2DA 1TM4E 1FY2A 5AKYA 1NW7A 2W6JD 3M4ZA 4QE3A 3CUKA 1RVV1 1N2CE 4L6IA 1UP6A 1X7DA 4OBXA 1N2XA 2C99A 4GZMA 3K0SA 2AFIE 2ZTSA 3MJFA 2XDAA 5ALNA 2NYUA 4FI3C 1NOJA 3AM1A 1E1QD 4WKNA 4OU4A 4I5GA 3IT1A 1NSYA 4NBNA 1T4CA 4FCVA 1NAIA 1VMEA 4ENVA 5CB8A 1J1IA 2EZ8A 4M9XA 4YVFA 2V4MA 1XV5A 3OC0A 4L27A 4LHWA 4QFCA 2H63A 4JLBA 1I4WA 2KLHA 3PENA 2KJQA 1LC0A 4EOGA 4RC9A 4DDTA 5CXXA 2QX6A 6GPBA 3LYUA 1DX6A 4MVJF 3LY5A 3AZOA 2HDWA 3GLRA 5LXTA 1VBKA 3GZNB 2JBAB 3VSBA 3F6YA 2X22A 1L4LA 1Z0UA 4PO3X 1AOXA 4DC0A 1TPYA 2HNKA 2NGRA 2Q07A 4AWAA 4L9AA 4DMHA 5JU6A 1O4VA 4BKPA 3GJTA 3EZGA 1MX3A 2ZB2A 4TL9A 3ROMA 4QBFA 5KEIA 4LBYA 3LRXA 2CK3D 1B4DA 4V38A 4UZSA 1JKIA 1TTHA 3AINA 4ND6A 3KL4A 4REOA 1HZJA 1WXGA 1Y5IA 5TGDA 4EH1A 1NI5A 2B1QA 4KUGA 4AULA 3KSBC 2OO5A 3B8EA 3L1VA 2XOXA 1OWMA 3ENKA 3TFQA 1BQ3A 2G36A 3FWNA 3W9UA 5KIAA 3QU9A 5BP7A 4A7PA 3HNOA 2VHUA 3K0BA 4ESVA 1MT0A 2P1RA 3EZ6A 4RHEA 5KQPA 3KPJA 4KP7A 4FE4A 1YVDA 2X1LA 4L2IB 3OLVA 1V5GA 1PQUA 1Y82A 1ZNYA 2A4KA 3G0DA 3U4GA 2QRPA 5BWOA 2I4MA 1G1AA 1M2WA 1NF8A 1NV9A 3G59A 1CIVA 5JFTA 3MWKA 4WMLA 3K9LA 4X64B 2F6RA 1R0LA 2GX6A 3GT4A 4V0NA 4XA8A 3STYA 3WIOA 3KQTA 3KE9A 3Q3EA 4ZU6X 3L40A 1HNNA 3D2LA 5AW9A 3TPCA 3WGLA 1IOWA 5DTIA 1SUSA 5ITSA 2DHEA 1J7JA 3PTAA 2ZJ5A 1E3TA 4ETIA 2WSSA 2WIDA 3SSNA 1RKUA 3NBYC 3SE7A 4IX1A 1M8KA 2JEOA 2ZIAA 4D7AA 1ANKA 2V3WA 4DT1B 4BFVA 4M89A 4BASA 1HNWB 3RVJA 2VF4X 5JPCA 1ATZA 1NXTA 2KLBA 4UHDA 1VLLA 4O3FA 3I9JA 2I2FA 1ZFNA 1NIJA 2QUHA 3A1EA 3CKKA 3PUXA 4E5NA 5BNIA 1T0IA 3UOWA 1TA9A 1F4LA 1NVEA 4R5HA 4E14A 4ZCMA 2REQB 2RIPA 4LN1A 4C6SA 3U5TA 3TOVA 1P6QA 2DWUA 3LC7O 4EAQA 3D6FA 1OWLA 3TGWA 1IBLB 3ABIA 1JB9A 2PXAA 4IJMA 1UWLA 10MHA 5HZGA 4H59A 2IEAA 1Y6RA 1K3TA 3DL2A 3L4BA 1LZKA 4YA6A 2XT9A 3CH6A 4JS0A 3SVLA 2GBLC 1RXVA 4DMMA 4FT4A 3QMWA 5AK4A 2IV2X 4X5OA 3LUAA 1BYIA 2HV9A 4P81A 5AI6A 3R3VA 2EQ5A 1Z2NX 2FNAA 2QZJA 3ZWCA 1Y8ZA 1XAHA 1W73A 3AGPA 1K06A 1QIKA 1SK8A 3DF7A 2IZ5A 2GR9A 3G5LA 2FPRA 2ZWMA 3EQ9A 3JVDA 2EERA 4K88A 1LBQA 4ND2A 3AIOA 4AJIA 1LZLA 3OP1A 1JQLB 5GOTA 3GD7A 5F1YA 1XEXB 2X5KO 1CC1S 4GZ5A 5EINA 2IP4A 5IC4A 1XCMA 2RHMA 2AXPA 2D0PB 4Q9LA 4DLNA 4DSUA 1I5OA 3OQIB 3HRHA 3PE3A 3BCSA 3D6VA 3KOUA 3T95A 4A16A 2ZM6B 2RE8A 3G13A 3F49S 3D1VA 3THXB 3KM0A 4LUCA 5JTTA 1GM5A 3CMMA 4U7JA 1GLVA 3PQDA 4JT9A 2G4CA 1T5SA 1Z8FA 3WOHA 1O0CA 1XLVA 3EOBI 3EC7A 2IRWA 4C9BA 4D43A 1IXSB 5F33A 2Z5LA 4IUYA 4XLTA 1ZHFA 2J3LA 4LY0A 3RKUA 3OPXA 4TXJA 1DB3A 1B8PA 7REQA 3OJFA 4N1AA 3MIZA 2RGGA 4CMIA 4YP1A 2J9YB 1Y6GA 1DHTA 5BNZA 4AL4A 4F6RB 1KYIA 5H68A 1XTBA 1OHHA 2PKWA 2P6NA 4R7GA 1GEEA 1UXKA 4TZTA 4KITB 1GTSA 3A7EA 4NC9A 5ULLA 5AO9A 2CKDA 4ARBA 4E2XA 3M1LA 1X8LA 3QLUA 1HE5A 2V3CC 3F6CA 1QO0A 2EU8A 3I23A 4DC9A 2H7CA 2H4HA 1DBPA 2IUTA 2CBGA 1VLMA 5DLEA 1CS0B 3DM9B 5IXYA 1H1TA 3UIEA 3I6YA 3PL1A 3P94A 2EEZA 2DFTA 3QKUA 4IGFA 1NVTA 1FP6A 2QDXA 1RXIA 2YZ2A 3KPUA 4KWEA 2PWAA 3SQDA 4PX5A 3TNFA 1UJ5A 3HGMA 4BO3A 2YZMA 4DEYA 2FPKA 5FL7A 2NSHA 2XT0A 4EZBA 1BS1A 1WDKA 2EFJA 4NFYA 3HH8A 2BFWA 3HSKA 4YMUA 4IOKA 5EMLA 1GSOA 3PHCA 3T61A 1ISSA 1FW8A 1TQ4A 4BLSA 1RJGA 4HDQB 2PQ6A 1KQFA 5I8WA 3PD7A 1UEXC 3CKLA 3R44A 4HYTA 3ILYA 3FJYA 2RH8A 3HR8A 3F73A 3QX3A 5FUMA 3CB2A 3CJQA 3QYFA 4KQJA 1N2CA 4X00A 1QGDA 1RLIA 1YGPA 2FFQA 1AUPA 3AB3A 2CHQA 3FF1A 5TY0A 1LBTA 2AFIA 4PPYA 3GLGB 1P2BA 4Q66C 1I7QB 3C5WP 5EXXA 5KKNB 1U3DA 1MJGA 1N8TA 3GLHE 1I3NA 1KYWA 2G0AA 2JH3A 3HUUA 3T9DA 3UGTA 5CA0F 3OZUA 3U13A 2GD6A 1G5HA 4HLUA 2ZB7A 3IUPA 1XL0A 4NTZA 1J06A 3PWSA 5K3FA 1OZFA 3R3JA 4C29A 1JDJA 1TO1E 2OCYC 4BNUA 1OXKB 1H2ZA 2A5JA 3P0RA 1BN6A 1KYYA 4NULA 4CTJA 4YRMA 5U1PA 4LF6B 2G72A 1FF9A 4NYMR 2G07A 2HB6A 1YKFA 3W1EA 5JIBA 5LQAA 2F1RA 1IHUA 3HO6A 3OOYA 3WJ7A 4CIDA 1Z8NA 2CK3A 5F98A 3KKNA 1T9HA 1XTTA 5GVSA 2HWYA 2E4XA 4E51A 2CL7X 1G7SA 3KLNA 4YEDA 3AF1A 3FUWA 4L5AA 3V7NA 4OHWA 1Q22A 3FDJA 1ULTA 3GLQA 3I83A 4X0EA 1U3TA 4PHHA 5FJIA 1GVHA 4A6XA 1SEVA 4TVOA 1Z22A 1QTQA 3IDOA 2BM1A 3DCNA 3A6DA 3WL7A 4J29A 4BLRA 2JFBA 1F2DA 2JIMA 4ISBA 1VE1A 4NXNB 2DFDA 2YINC 4H08A 3E8MA 1M7HA 3KCQA 3L7CA 1E20A 4BX3A 2IGTA 1XTVA 1ZL2A 1T6BY 4KACA 1MZVA 3E2IA 4EJFA 5CMLA 5FWYA 4JVLA 5A2QA 5A5VA 2HRRA 1YBFA 1TI7A 3EDCA 1BAPA 4F5ZA 1EFDN 2IX3A 3SHOA 1C3LA 4PEVA 3LDHA 1UBSB 4JUFA 4ZRDA 1YB2A 2PFKA 2COKA 1TU0A 1NP7A 3A9UA 4OXIA 3MCTA 1RQGA 2OD2A 5T64A 4ALIA 4Q3NA 2ZI5A 3QYPA 1VI2A 4MLPA 2YYSA 8GPBA 2AJTA 5J2UB 4KQGA 3ZC3A 4DHEA 3S5JA 1RE1A 5HYVA 5KNDA 2VSNA 3GPBA 4PFSA 4MAMA 2YXLA 4CF5A 4RTSA 1IN1A 2IF2A 2VF5X 3PP8A 5DTQA 2RHGB 2VJPA 3HNPA 3PGVA 4FYYA 1CY6A 2O2CA 1OX4B 2SHKA 4GBJA 4IJ6A 3ZY5A 3MHPA 2Q46A 3ZLUA 4JVOA 5LN1A 2AW5A 2VJQA 2JAHA 2X0IA 4Y2XA 5DM0A 2Z1NA 1TJ3A 3NVAA 3LBNA 3O73A 3ZR4B 2O6HA 3FPLA 3HCCA 4ILKA 2D5AA 1AUVA 3L8CA 3HPRA 4A8JB 5KJCA 4ZTZB 4D4KA 3WIVA 4JLMA 2C8VA 5KDDA 1MXHA 3BWBA 1AK1A 1QGAA 2J9ZB 1RLJA 3KKMA 3M49A 5GJCA 2IYOA 2PLAA 3LGAA 1Z5NA 1D1QA 2O07A 3D6HA 3D7RA 4RJ2A 1KAGA 3SKYA 4Q82A 13PKA 5K7SA 4J91A 2Q9AA 4XD2A 1NMEA 5FFFA 3OLQA 3EEFA 4RD4A 1N7IA 4TV9B 1STOA 4FJ2A 4CI0B 2GUWA 4D74A 5JNSA 3FPAA 1X9HA 4RU1A 3SSOA 3O8RA 2PWZA 3TINA 1NBIA 1RYHA 3V4OA 1PT9A 5J1SB 3DE3X 1WZ2A 2P4EA 5TPZD 1G20B 4MLDA 1CUWA 5INTA 4V2UA 1SU6A 3NB0A 1A2OA 5JV5A 4LHVA 1L5QA 1VHDA 3CZ4A 4YBRA 1P3DA 1UUFA 2DPXA 5M3BA 1ZN2A 4L9RA 1SH7A 2VQ6A 4AKSA 1P18A 2DT5A 3CW8X 3IUSA 4E13A 2KSQA 3OFKA 1YSCA 2JJYA 3PKIA 4QVGA 1FFBA 3GP3A 3VVMA 4FGLA 3IP5A 1E6CA 4LY9A 2VH1A 1YVPA 4L4YA 4LYHA 3HB1A 5KSOA 1XPOA 3O8DA 3Q7PA 5BR7A 4NABA 3ZE0B 1SBTA 3BMQB 5FHRA 3HZOA 1XEFA 1JQDA 1JIUA 4UBKA 2VQEB 3WWCA 3G2PA 4PHGA 1QYRA 1P4SA 2YICA 3EGVA 3QBEA 4K87A 1NXWA 3DE4X 4KNWA 1NW9B 4KR0A 5FWDA 1E2HA 3RSCA 4AUNA 1QQAA 3BCHA 3H42B 2X0KA 5JADA 2P3OA 1VYVA 7ABPA 1ZJYA 1ELOA 2IA5A 3G88A 1XD9A 4ENQA 3RYCB 3DP7A 1NMZA 3KUCA 3P9XA 4WESB 4HR7A 2CHEA 4EO4A 3BCRA 2Z58A 2XGMA 3ELUA 4P38A 1Z6GA 1E32A 1O95D 2NT4A 2XXAB 3K31A 2B99A 3Q11A 1BW9B 4QPDA 3BYZA 2P9FA 4BAGA 1WCV1 2PGDA 2WI8A 3FIUA 4NBTA 4H16A 4FU0A 5D85A 1WDMA 3A3OA 3D4BA 4TSFA 4Z86A 4TKVB 4XAQA 3RCBA 1TT7A 5F1PA 4JLNA 2YQZA 3ZGOA 4C7OB 1LV7A 2BBSA 2PCLA 3A4IA 3ZWXA 1WVGA 4QASA 5JCXA 3BA1A 4HATA 4DUYB 2CJXA 4H7EA 3Q72A 1N57A 4O4JF 2C98A 4EDFA 1KZYC 3E8XA 1IBMB 1X6VA 4IX9A 4QDUA 5L6MB 4EG4A 3HL0A 3V1NA 2O2YA 3LIIA 4BQQA 2RARA 3VDNB 4D9KA 1E9CA 3F4KA 4I1OA 2XUPA 4PYLA 4L4SA 2W6CX 1E58A 1UK6A 4MCHA 4M0DA 3W77A 1MA3A 4TS3A 5CVJA 5FHQA 3I39X 3ZLTA 4PV7A 5BUZA 5J23A 2UZ4A 5EJ7A 4ZYXA 4DG8A 1Z18A 2HCJB 3CCCA 1VKHA 3M6VA 5ITZB 2C2YA 3BZBA 1HDZA 2HAEA 1KGDA 3EFHA 3PFFA 1HFKA 2BLLA 2J6IA 3JALA 3LDAA 3QF4B 3TW8A 1GTL1 1LKZA 4HXYA 5EHIA 3Q5EA 2FW9A 2QG6A 2R6AA 4M4SA 2OZPA 4HDOB 4P84A 4BV3A 1OIXA 3LBHA 1IOLA 3MFQA 4I4TB 2W6PA 3I8SA 3IAXA 4PTLA 5HRAA 5BNFA 1ENOA 4MI3A 2IYTA 3UM9A 2BSAA 5ENZA 5DCYA 3TTVA 5CDUA 3OIFA 2GCNA 4ER7A 4ZK2A 2EJBA 2YQ4A 3ANNA 3L8HA 5H70A 3GLHA 2AFVA 1CB0A 1XCGB 1JLHA 1VE3A 1TFUA 2GM5A 1V5IA 4CM8B 5JS6A 1Q0UA 2GETA 5FEMA 1SNYA 3ETLA 4CKEA 1R6XA 4I1YA 3P8ZA 1R6VA 1EAMA 1RQNA 3SDBA 5A5DA 1T9CA 3V6MA 3ZVKA 1V4VA 1O8BA 1ZMTA 3H4IA 1J49A 3QKRB 4FMPA 1G17A 5EI5A 1NYLA 1AT1A 4J0IA 4LMAA 4EATA 3I5AA 4PLCA 1XZQA 3NTUA 1MGOA 2P9TA 3R9KA 5JJKA 4HGYA 5EJ9A 2ZSEA 1R0SA 4UTPA 1P19A 2OFXA 1QYCA 1W88B 4IO0A 3ZJTA 4QX6A 1LX6A 3CE6A 3P9NA 4KK3A 4QDJA 1HQDA 5KWEA 3UGJA 1FDSA 1SCUA 2GM9A 2OCKA 3JVIA 2FMFA 2PEYA 5JCJD 3N58A 5LMUB 1OOEA 4C6TB 3QMVA 1I24A 1ZMBA 3P26A 5H9VA 4DREA 1SKYE 3LNCA 2LR0A 1PQYA 2QNIA 1FXWF 2FSSA 4TXNA 2CFRA 4OGWA 2XD4A 1KEWA 2WT4A 1YR7A 2X6RA 1C30B 4ZK6A 1JB1A 1F48A 1WDLA 3B8HA 3C3JA 2CNLA 3EQ6A 5IAJA 2FDCA 4CHTA 1DI0A 4TWZA 3FLEA 5CJJA 4B6FA 2QXUA 1X3LA 4G5OA 2CMHA 4RESA 4E03A 2R84A 2OXFA 2XVXA 1EA5A 3J7TA 5C46F 4J94A 3NUZA 1YS1X 2JFPA 3KB1A 4R4JA 4RA6A 3HE3A 2HSJA 1KAMA 1NAHA 1Q74A 1R0XA 4KE9A 5DW3A 2X3FA 4NZPA 2BE9A 1PQWA 4KUEA 1VGRA 3KQKA 1GZHB 3ND9A 1FVHA 1XVVA 3FTNA 5G3YA 4X90A 2GWHA 4Y6LA 3I2GA 1Q7RA 2X76A 4NJEA 1TZ2A 2E6KA 4OCZA 3IAM6 2OZVA 3IO3A 1H9BA 3LYAA 4NMWA 3Q0IA 1KK3A 2WF9A 2A0WA 5GGXA 3AWDA 1KI2A 3PHHA 1NVMB 3RTAA 1ESMA 1QLJA 2YC2C 5C31A 5L7TA 4LQ4A 1VMAA 1GPNA 1E6KA 3Q8LA 2FU5C 3DTTA 3OM8A 4KWIA 4GXRA 4ND1A 1V7PC 4WNAB 4DIUA 3UMYA 3FPBA 5DI3B 3E7PA 1GPYA 3CMCO 5JYCA 4BLVA 2ZBEA 3AMVA 3VR5H 2ZULA 3L0DA 1NI3A 3N86A 4H7PA 2Y66A 1YS4A 3TNLA 3U4QA 1VL1A 1OA1A 4ZDWA 3VXKA 2B8WA 2JB9A 4FZ5A 3GMTA 1P45A 3HDYA 4WXEA 4BO8A 3NBMA 1DWUA 4TMFA 1GCIA 1F5SA 2YIVX 3CLUC 4DL9A 2WU4A 1WAMA 2YJGA 2GO1A 3IP8A 3HM2A 4HI0E 4IHJF 3RKSA 3VMFA 1NBAA 3RYFA 2SBTA 3WS7A 5BMVF 1MW8X 5LJLA 2V65A 1ONSA 4GQBA 4D42A 2CXPA 4QUJA 5HZHA 4B3JA 4V1CI 1R8YA 2LIVA 2FPGA 3L43A 4NDAA 4JELA 4TLLB 5AUPB 1S2NA 2C4HA 4OQMA 1X42A 3FGNA 1SCDA 1TYEB 3PEVA 3BGIA 2NMVA 4PZDA 4EG0A 5DNYB 1Q1GA 1TO6A 4EA7A 1R6DA 2BR3A 3NCTA 2HM7A 1V3TA 4W5QA 3O8CA 1NBOA 1NJ8A 1K98A 1NPTO 1R8XA 1ZIXA 2BWJA 2PGLA 1ACJA 3DHWC 4O8CA 4P5EA 2GF2A 2V03A 4CT4B 3GEHA 1YRHA 4MUXA 4PQGA 3O38A 3UATA 4I46A 4GPEA 3H05A 2YNMD 4EZIA 3MRVA 5ITWA 2XZOA 4K9MA 2EBWA 1ZPDA 3P96A 3RROA 1PNTA 1RRPA 1SOMA 1QGZA 4L22A 2JJ2D 1RCTE 5K8TA 1YKGA 4DDKA 2RGEA 2WB4A 3OJ0A 4EKYA 4F9FA 1H4TA 2MSCB 2W2LA 3TIXB 3O9ZA 4V1CA 1V1RA 3O4JA 4GG1A 1OH5A 2WJ6A 2FZEA 3E6AA 3EYWA 4URYR 4WN3A 1XMSA 5F7ZA 1JEDA 5C8VA 1CS4C 4U39A 1A3CA 1TAQA 5AIAA 5H4HA 4EELA 4UQLA 3TKYA 5JNTA 1S3FA 4PHTA 3IUBA 4MKGA 4BKOA 4C0SA 1QHSA 3U60B 5HBRA 2QTTA 2H7XA 2A4MA 4LYFA 5DN9A 1UEIA 4J2TA 1P75A 1OWPA 1RRGA 3H9JA 4LX0A 5IFKA 2EJCA 5J2TF 1WQ3A 2G5PA 3UUEA 3VO2A 3VO9A 3E70C 1X77A 4GPBA 1XROA 4K03A 4M3NA 5BSVA 5IKEA 3KCNA 3HDQA 2DH6A 2X5NA 1NN0A 2X9VA 4FFMA 1CUDA 1V95A 2BAGA 2ZYDA 3RD5A 1DFGA 4FGZA 2DBRA 1P8AA 2JEZA 5FFNA 4BZZA 4NFHA 4P7GA 1F8FA 2UUPA 2EP7A 3UFBA 4CF3A 2PUGA 1Z5OA 1HDEA 4KXLA 2B98A 1FDWA 3KEOA 2YHIB 4K26A 1NP6A 4MUGA 4P2GA 4TLAA 4W9NC 5I4IA 3B70A 4DB4A 4QPNA 2W70A 3GMDA 3WBKA 1IXZA 1PZXA 2CJPA 3I2FA 3FGOA 1KK1A 3E9EA 4HNHA 4PC1A 2HTFA 3GBSA 3PL5A 4PX2A 4X8MA 2WA2A 4I55A 1XZLA 3HCDA 4WPGA 4WZAE 3AHJA 1FW6A 2CNDA 4AY2A 1YGYA 4DJAA 3MT8A 3UAGA 3PXGA 5DYWA 4R98A 3GHHA 2I3AA 2AJ8A 4I5EA 3C8ZA 3BE6A 3UT5A 1HKUA 4D9JA 1CEYA 3MRTA 3KO8A 1EXVA 3G0OA 1WKCA 2O9JA 2RC5A 1U2QA 1Y7IA 4KC0A 4B81A 2G83A 3G1TA 1D8AA 1P3JA 3D54D 1TF5A 1DADA 4QO7A 4YACA 3H2KA 3WGGA 1RYDA 2YN2A 1HDRA 5COQA 3NU1A 3Q3JB 3SNHA 3DDUA 1Z2PX 5E7IA 4INPA 3ZI7A 4DIDA 5BYAA 2O8FB 1GYQA 2GM3A 1D09A 3D6JA 3L04A 3WJAA 4C7VA 5IZCC 4C87A 1GN8A 1DIRA 4LDJA 1HT1E 3S1LA 3HXMA 5ICGA 3GY0A 1QE3A 2PLRA 4WGGA 3DC7A 1BTOA 1EQAA 4C0XA 1K4KA 3N8IA 2J0UB 4A0HA 1Q0TA 1NQTA 2R8ZA 3DVSX 4P92A 4JGGA 4E5VA 5FA5A 1W25A 3N74A 4V2IA 2ZRHA 1V8FA 2HBRA 4I2VA 2C3UA 1IAVA 2QYSA 4GWLA 4KLCA 3T7KA 5BV2P 1MO6A 4W7HA 3TTXA 3ICCA 5JBIA 3A1DA 1SKBA 3AL2A 2IOQA 1OKKA 3D0QA 1YB7A 1H66A 1OLXB 1VECA 4BIIA 2QTNA 1WSBA 1VP9A 3VO1A 4C0HA 3T9EA 5IUNC 2AJDA 2QRLA 2XI4A 1FVFA 3CLKA 3GK3A 2AOUB 1XTSA 3DE7X 5TVGA 4B7UA 3OY2A 1ECCA 1SAYA 5CXUA 3A6ZA 4NMHA 1NW4A 3W5UA 5GP1A 3IKTA 2VPTA 5EUQB 2VXYA 5C1PA 1Y4DE 4US1R 5IANA 1UQUA 1ADFA 3A31A 3RIGA 1C4WA 2H1HA 1OF1A 4YP5A 1P5HA 5HTKA 4TQGA 2FSGA 4M0FA 4YAGA 1HFEL 2AC4A 3NP9A 1JQBA 2C5HA 4M7OA 4ZAWA 2HUNA 2XMRA 4V3CA 1C9MA 1EFCA 5CH5A 5BW8A 1E6UA 1LPMA 1JFRA 5A02A 1UZNA 2OYSA 1ORHA 2P3SA 5FYDA 2OGUA 4BN4A 4RTOA 2R8OA 4YCNA 4AJ9A 1C1XB 1HM5A 2WKWA 1IULA 1YZFA 4WJKB 5DP2A 2YYAA 4TWBA 3THOA 5KQSA 3QBTA 5JC1A 1JUDA 1EXMA 4Z5XA 4OD0A 4EYOA 3VR0A 4D4GA 4QXPA 2HA0A 1G2OA 1ZUIA 5AW2A 4KKVA 5AVSA 4EUEA 3S4YA 1PTKA 3L6BA 4N8DA 1ORIA 3DV9A 3BD7A 3GQVA 3EDRA 4H9GA 4Y98A 4FONA 3RVQA 3W04A 2EDAA 1HL7A 3OT1A 4JV5B 2DPHA 5K4HA 1M1ZA 1M2OB 1QTRA 4MVYA 3QX9A 5AKXA 1E9RA 4WFKA 5H3HA 2WIFA 5AQEA 4YXFA 4HX5A 3W3ZB 4EF5A 4R0MA 1JAIA 1WLYA 1GTRA 3C6BA 2P9EA 4DJJA 4UVHA 1VM6A 2WYWA 4CZ2A 4HDMA 4IMJB 4H27A 4GOLD 1A96A 5LLDA 2GNPA 2QQ5A 4JB8A 3IDAA 3G9ZA 4GI2A 2DFPA 2I66A 2ZWAA 3JW8A 3M2TA 1NATA 3QQ5A 1DKNA 4R71A 1HR0B 4L6AA 1DBIA 3O4GA 3V6LA 1RM3A 2I6XA 2Q27A 3LA8A 2B5WA 2H4JA 1ONOA 2YIJA 3IQGX 5DRYA 3R7LA 4B2PA 1J24A 3FDIA 2BEWB 4QBHA 3ILHA 2Y1DA 4S3MA 1C9KA 3U4DA 1F6DA 3IMGA 5L9AA 4DSAA 1K5DA 3RJTA 1PEKE 3EIQA 2JJ2A 4ZN6A 1N0UA 4EEKA 3N0RA 1VJ5A 2VHCA 4B5KA 2GVNA 2HU8A 2GFIA 4HS4A 1UBRS 1Y37A 2CMGA 5CXQA 2MT9A 4ZHQA 1WD7A 2HCTA 4MDHA 5L3QB 2BTQA 1THZA 1FSZA 1WM1A 2NM0A 1RYYA 4NESA 1P44A 4NCJA 4NNJA 4TVBA 3O9MA 3EXHC 2ZE8A 3OE7D 3VH3A 1PJRA 1TJYA 3SG0A 3HYCA 2Z5FA 1HUQA 3A36A 5TEVA 2JIZA 4CCYA 1OTHA 1YQEA 1ZJ6A 2PH7A 3JASB 1SULA 4LBZA 1OLOA 1BIFA 1QGOA 1XJCA 2BHSA 2C9OA 3CCFA 2WSMA 1E2LA 1TKAA 2C2XA 4PGGA 4R51A 2BBOA 4IIYA 4NVRA 4XM1A 5D7BA 1T91A 2WKQA 5JASA 4KH1A 3VR4A 2Z2XA 3LCJA 5AHWA 2B8NA 1YCGA 1E79D 4MVJG 3SU8A 1LWNA 1KI7A 1OVMA 2BM9A 2MIIA 3Q2IA 4JH0A 5ITVA 2FF5A 1RC1A 2HO4A 2W00A 4BV8A 4OYLA 4J4BA 4QBGB 5CH8A 3EMKA 3HB0A 1V6AA 3I58A 4PG6A 1ZBQA 2I6SA 2L2QA 4OGKA 1VJGA 3PFHA 4ZIRA 1AHPA 3MRXA 1JH8A 1P4GA 3FW1A 4S1TA 4WFQA 4ZP1A 3FR7A 3RUHA 1BMTA 1IVYA 1IHYA 4YP7A 2ZGVA 2M6LA 4F7DA 4ABTA 1MAWA 2IP1A 5C51B 5C2JB 3MCAA 4JITA 1NONA 1IMOA 3FE2A 3IAS6 2PWBA 4V0ME 3CF6R 2WEKA 4JBHA 4JQOA 4GZ6A 3IEMA 1JJAA 1NW6A 1F2TB 4M21A 1BX1A 1GZ4A 2QTAA 2M6SA 4YMLA 4WZAA 3RBZA 4EUNA 2OO3A 3EISA 3TXYA 2QP9X 4GSLA 4RF4A 3MJEA 1K6MA 3CH7A 4O33A 2EJTA 1BXRA 4YI3A 1PWYE 1O87A 2OV1A 1VSTA 3VAAA 4IIXA 4Q4JB 1NBWB 5LIRA 1NU6A 1IHXA 4JL5A 1OU4A 2JHGA 1PS0A 3NTRA 2AN4A 2BONA 2FMUA 2JCGA 3G82C 2F9LA 2VSYA 4HEA6 3C3BA 2DGDA 1X7ZA 3C85A 3DWIA 3PTLA 1LRKA 2O3JA 3QOFA 4HNAA 4MYHA 3FPHA 4FMCF 4RMHA 2SKEA 1U9JA 4DAOA 3IP7A 1J20A 1C7JA 3GPIA 4MOWA 5DX8A 2WYVA 4CV1A 1E5VA 1E5DA 4O59O 4E3ZA 3UAOA 3H9GA 1ZUWA 4CLOA 2N0SA 1W5BA 4I2NA 4Q3DA 5C8DA 1H65A 5HOEA 2R6HA 2K2WA 2Q49A 4A0FA 4HGQA 1EYZA 2C2ZA 3JAKB 3ORHA 5AHXA 3EY4A 4BNNA 1NKTA 2XLBA 3TD2A 1PFVA 2POCA 5KSZA 5I7OA 1NUTA 4Q12A 4W9RA 3OJWA 5DGHA 1T36A 3BTUA 3ZPXA 2VHEA 1KJIA 1JTEA 2B7LA 4I5DA 4MPPA 5EXEA 1OCEA 1NBME 1ZXLA 2GVDC 1V5EA 1A98A 1XOIA 2ZRLA 3F2VA 2FAXA 5AW4A 2EZTA 2II6A 4Q1CA 4DC1A 1U2SA 3VKFA 4C7KA 3L0PA 1OZ0A 1DZ3A 1N2SA 1SQ6A 5HKLA 3WIUA 2EJVA 4YI5A 2K5UA 1E94E 4QRHA 2BHNA 3Q3CA