2QRNA

Human deoxycytidine kinase dcmp, udp, mg ion product complex
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
241
structure length
228
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of human deoxycytidine kinase product complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Deoxycytidine kinase
total genus 81
structure length 228
sequence length 241
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2007-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qrnA00
1NLFA 1AZSC 5AJWA 2PMKA 3AF2A 5FBQB 2RGEA 3CX6A 5CB6A 1KAOA 3N70A 4DXAA 1PUJA 3A36A 1MO5A 3B2EA 4RKEA 4TQUS 1KSHA 2QMHA 3BH7A 5L3QA 2F1HA 3U7FB 3AF1A 4RFVA 2F7SA 4LI0A 4M9XA 4YDSA 2XTNA 1XPOA 2RMKA 1Z07A 1NLZA 3Q5EA 4KXFB 3B1VA 4QGGA 3O8DA 4DEYA 1QVRA 2K5UA 1W0KD 4BFVA 1RVDA 3WYFA 4A0GA 4BRUA 4R9UC 5K8IA 2HJVA 1GL6A 1CS4C 1UEIA 2ANBA 4KAXA 1KI2A 5IRCD 3RC8A 1UKVY 4URYR 5CK4A 3P27A 4M4SA 4PO9A 1F3OA 4BECA 4D0GA 1WXQA 2W83A 3ADKA 1PVOA 4L8GA 4KITB 2O0HA 1IQPA 3KQUA 4OI2A 1GAJA 2GXUA 5ELXA 2YNMA 3TK1A 4NP6A 5FL7A 1QHHB 2WJJA 1W7AA 1UKYA 1HY3A 4TYQA 4JLNA 3ZDQA 4MGZR 1E2FA 3U4QB 2IYVA 1FW6A 2GK6A 1CEEA 1XXHA 3GLFB 5KO2A 4A6XA 521PA 2QQ0A 3GLIA 3ZZTA 1JQLB 1R8SA 4OQLA 1TF7A 4DEXA 2A5YB 2H1LA 3FOZA 3TUJC 1FTSA 1ZJ6A 3RSLA 5L3SB 3O8BA 3EASA 4CDGA 4IDOA 3CPHA 1IY0A 3ADDA 2IYXA 2JJ8A 2VSFA 3H2YA 4LV8B 4JSTA 1FUKA 5FOWA 4A8JC 1G7TA 1R4AA 1N6NA 3NWJA 4DLTA 2OLKA 3FHOA 1ZNZA 5G53C 1KJYA 1W4RA 3BJIC 3K70B 2I1VB 2DPXA 3DKPA 4Q03A 3KL4A 2JLSA 2IYWA 1WBDA 3DZ8A 5A0FA 1S2MA 2B92A 3FMPB 3PV0A 2AHOA 1TADA 5DGXA 2FSGA 5B30A 1HTWA 1ZM2A 1IJEA 3BB3A 1VHTA 4GL2A 3AVVA 4EFLA 2O8BB 4KHZA 4HI0E 4R2HA 1E9FA 5JEDA 2DFLA 3MLEA 3VHLB 1EFCA 3U3JA 1DPFA 4FI3C 4PPQA 4Q9KA 3QXJA 2R62A 1GTVA 5AUPB 1GRNA 1A2KC 1JJ7A 4L16A 4WW0A 2CLCX 3CPJB 3KUDA 3EPHA 4EDHA 3UG6A 1M2OB 1UEJA 2F9MA 2ZPTX 3B6EA 2ZU0C 2GHIA 5J4HA 4MRSA 4GP7A 1R0YA 4D82A 4JLVA 4DLVA 4EPVA 3T1VA 3BORA 2PZEA 4HB4A 1UADA 1VYTA 2GBLA 3SNHA 2R6CA 4UXHA 3OIYA 4NPHA 2P6UA 2XZLA 1GKIA 3M1IA 2QSYA 3CZQA 1GP2A 4V0ME 4QGHA 5AWFC 4XH9B 4UQOA 4DLZA 4GT1A 2PEYA 5CJ2A 4RZUA 3GLGE 3V00A 5HPYB 1D2NA 2J41A 5C46F 1DS6A 3KXKA 4DIEA 4TLEA 1Q1BA 1HUQA 1DAGA 4FINA 1T5LA 2OHFA 2F43A 1Z0DA 3VX4A 3RC3A 4K81B 2JJ1D 1VG9B 3BH0A 5AUOB 1JBKA 1E1RA 1DEKA 2PCLA 1OB2A 1U81A 4LHVA 2WWHA 4BFTA 1ZM9A 1VYUA 4PC6A 2VF8A 1E99A 5FTNA 2NO1A 4EAQA 1LB1B 5TDHA 3THXB 2WJHA 1R0WA 4Q1FA 3BH6A 3TIFA 3QG5A 5P21A 4QJ4A 5DISB 1QHGA 2UKDA 1ZU4A 1YHNA 3CX8A 4PTLA 4DHEA 1FQKA 2ZRHA 3NG1A 2W00A 4A36A 3RVBA 3QOFA 2NQ2C 5IF9A 2JGNA 1WBBA 4CEHB 3OIUA 5BXQC 3NXSA 5CLLA 4QJ3A 2WJGA 1A7JA 4LZZA 2JLWA 3VKHA 2FGJA 5JHHB 3WY9A 2UVQA 3AKDA 4PHGA 1AS3A 2ZRKA 3NC1C 4KSCA 1UF9A 3W5JA 4V0LA 4IEIA 4X8LA 4JIMA 1H65A 4KYIB 4TLAA 4BFZA 2E1RA 2FFHA 3THWA 2DFTA 1VG1A 4BFSA 2XGJA 3DM9B 2FOLA 4DWJA 1T9HA 4ERNA 5BYJA 4ZV4A 2GCNA 4DCNA 4QRHA 1KI4A 1P75A 1E2KA 4LC1A 4DLYA 1T5IA 1OIXA 2OBMA 4IEEA 3WRYC 2REOA 4OQFA 1XWIA 3I5YA 4FCWA 3B1ZA 5KPDA 1SKYB 3PCRB 3HJNA 4KFTA 4PPGA 1TAGA 1JR3E 4ASUD 2XXAB 3LXXA 1DE0A 1F48A 1ZM4A 4B43A 1CKEA 3IHWA 2OG2A 4M1SA 1G5RA 3NC0C 3A4LA 3NHBA 3J81k 4HAZA 5CM9C 2ZRJA 2F43B 3A1UA 5TXGA 1E2HA 3WYAA 2PX3A 4O3MA 1HA3A 1P2TA 3FFAA 2AK2A 3HR7A 4PO8A 4TQAA 2W2VA 3EIEA 2HLDD 3WNCA 3VR1A 1ZP6A 4I99A 2CVFA 4GZMA 3RWMB 3A8TA 3EZ2A 3LBIA 2JLRA 5CB8A 2NO6A 3O8RA 1D6JA 4Q48A 3CRMA 4OBEA 5C2JB 2YKGA 2YWFA 4FWIB 1UDXA 2BMDA 4V02A 5H1YA 1ZBDA 2RGGA 4PC2A 3C5CA 4TLCA 4AKEA 2RH5A 4UXJA 2Q21A 1YJ5A 2AFHE 2ZS9A 3H4MA 1P2SA 4HAUA 1SGWA 3EC1A 4AD8A 1E1RD 2NG1A 4Q1DA 2YVUA 4N0EA 3FKSD 1RRGA 2NTYC 3PG5A 4TL8A 2CXXA 3SZRA 1AS2A 2DR3A 2O8FA 1BYUA 1U9IC 3IIMA 4JT2A 2XNSA 4ZDWA 2CE2X 3L43A 2F55A 3GEIA 4XJXA 2GCOB 1E4YA 4KO8A 5KPJA 3OAAD 1G4AE 2VHQA 4DB2A 2QE7A 3BERA 1BS1A 1OKKD 2GZHA 2PLRA 3N2IA 2V54A 4HLQB 4RD4A 1Z0KA 4DJTA 4BASA 5CIQA 1VIAA 4O2LA 4IOLA 1VCNA 3U7HB 2CL7X 2JJ2D 4LUCA 4DLUA 4MH0R 3ADCA 4DCVA 1SVWA 2X8AA 3GFTA 1SXJB 4HATA 3GFPA 1DAFA 5EE9A 1IONA 1R5BA 1OHHD 2J0UA 1T91A 1X1RA 1E3MA 2REBA 4E22A 4YMTA 4E03A 3KXLA 1DVRA 1CJKC 3VR5A 5J4KA 4JLBA 4PC7A 2QSZA 4JLJA 4V0NA 1ZVQA 2OILA 4IVPA 4BZQA 1YU9A 4I1VA 3K9GA 2I3BA 1S1CA 2PZFA 3EZ7A 4OL0A 3BIFA 3C7KA 4R98A 2B7BA 1W0JD 1R2QA 2RGNC 2YV5A 2BOVA 1OH6A 1QZXA 2IYSA 4MKIA 5SZKB 2RHDA 1J2JA 1CF4A 3QKRB 1Q20A 2R6AA 2V55B 5IK2D 2B21A 4Y0VA 5TB5A 2WPDA 5E95A 2C9CA 1JB1A 4NU0A 3I8XA 3K0AB 3BK7A 1RRCA 4IVQA 2O8EB 4Q4AA 1UAAA 1L7VC 1LTQA 3EXAA 1HT1E 5AUNB 4TMZA 4DDWA 4XWKA 2J0SA 1NN1A 3P32A 4R2IA 1IN5A 1P2UA 2QN6A 2DHRA 2PEZA 3W8NA 3WP0A 4B2PA 1WE2A 5LPNA 1XEWX 2ODBA 2GCOA 1WA5A 1U98A 2P0EA 4EFNA 3LX5A 1TQ6A 5JZVA 1OIWA 1FMJA 2FPKA 4MYHA 1NLYA 2BIFA 5HTKA 1VCIA 4IDHA 4Q18A 4OHZA 2ZRGA 3BAFA 1E9RA 2GDJA 2R9VA 4PHFA 2QEQA 4ZPXA 3TMKA 4PHTA 4QHYA 1S0UA 2GZAA 4XWOA 4N3NA 2GILA 2XB4A 3GJXC 1A5TA 1US8A 5EXSA 5EZ6B 5CM8B 3FWYA 3DM5A 1XD2A 4DBLC 1TUEA 4F91B 4HAXA 3TSOA 2CCJA 4JKIA 3X1XA 4D4KA 2ZJZA 1S96A 3A1SA 1AGPA 3MCAA 3V9PA 3D3QA 2IEZA 4DSNA 3SU8A 2F1JA 3W9YA 3EPLA 1W36C 2YC4C 2IF2A 1EWQA 1NVVQ 1S8FA 2KBEA 1CR0A 4M1MA 1G6HA 2YZ2A 4MQBA 1WQ1R 4I4LA 4G01B 4D0LB 4DSUA 2ZIAA 3I1FA 4FD2A 1E9DA 4L9SA 3L0OA 2O8DA 4M9SA 5F9FA 2RGXA 2RHMA 4BQSA 2ZJ2A 3ICQB 4GBMA 4C7OB 4BPBA 1XD8A 1KI9A 1KZGB 3LD9A 1QRAA 4JLAA 8OHMA 4MDEA 2P6RA 2GKSA 5FR2A 2FH5B 1D9XA 2Z4SA 2ZM5A 2C96A 1CJVC 4RD1A 1QHYA 2QTVB 2WOJA 2ZSAA 4LYFA 4C0BA 2RGBA 4LHWA 4GDFA 1Z8FA 2PT7A 1W0JA 2TMKA 3NBFA 1ZUHA 1XZQA 1OFUX 5IDVA 1ZUIA 1G9XA 2PJZA 2CEAA 1EWRA 2WWYA 1G3IA 2VH5R 3OFND 4IOJA 3REGA 2J45A 3RLFA 1UKZA 1OXSC 1B23P 1NBME 3GLHB 3A6PC 1HEIA 2A5DA 2Y8EA 2FA9A 5GJBA 5KNCA 4JVNA 3PQCA 2CCGA 3AVWA 1K6MA 1JPNA 1WRBA 2WM9B 3MWKA 2G77B 2WKPA 1BH2A 2IBMA 2QP3A 5EE3A 4PAOA 4AIIA 2FGKA 2OLJA 1XJQA 3CLVA 2QBYA 2KB0A 2ZJYA 1UKEA 5TY0A 5J4YA 2JDID 4C0JA 5FPTA 4AYXA 2FG5A 1RKBA 4PAQA 1US8B 1GL7A 4LBWA 4MGYR 4M9ZA 5L3QB 4Q01A 3HU2A 1HQCA 1UPTA 1KHTA 4JSYA 5F2EA 1GNQA 4QGAA 1FP6A 4Q9IA 4BZXA 1MO4A 1UBGA 3M0EA 3QEOA 3SOPA 4CT5A 4FXPA 2ECKA 4PSKA 1KNQA 2NO0A 4S2EA 1NY5A 3OESA 4DSOA 3U7GA 1F6BA 4XSHA 4YLGA 3AB3A 1P7CA 2W6JD 2ZUDA 1W5TA 3NDBB 1CU1A 3LQQA 4XVQA 4BLSA 1KY3A 3W3AA 2IS2A 3GP8A 4IXNA 2CNWD 4LY6A 2YJTD 3PENA 1E4VA 3PEWA 4KI0A 5L8VA 2O0JA 2O5VA 3CH4B 4GOKA 1ODFA 1UDWA 3L0IB 4PO1A 4GPTA 4CZ2A 2CJWA 5DYIA 3UG7A 1BKDR 5CYPA 5SZHB 5HZHA 1XTRA 4YMSA 5A4JA 4ZKDA 3KB1A 4UKDA 3T12A 4RCYA 1O3YA 2CK3A 5DYGA 1ZM7A 2ORVA 4C0HA 4JJZA 4GOXA 3ZQJA 4Q1AA 1KMHA 4BLTA 4A0HA 2ATVA 3FKSA 1G5PA 4C3ZA 1P72A 3Q7PA 2Q0HA 4RD2A 4BUJA 3MD0A 1N6KA 1XB2A 3SHFA 121PA 3IPXA 3ZLJA 1E2GA 1JR6A 4L4UA 3U7EB 3I32A 4D4MA 2W6IA 4OHXA 3AVYA 2REXB 1KTVA 2ZITA 4MKHA 1EFTA 2VSXA 2R65A 2QAGB 2ZRNA 2XJ4A 3ETLA 5EP1A 4BLQA 2ZI9A 1P60A 4ZKEA 2P3SA 4WXRA 1NJGA 2G3YA 3IQWA 2WMNB 4F4CA 2FX3A 1XF9A 1QDEA 1NG9A 4IDQA 5GADl 3CM0A 4Q47A 1R0XA 1LV7A 2XTMA 2YOFA 3U5ZB 1IM2A 3ZVNA 1LS6A 3PJRA 2QGZA 1YR7A 2VF7A 3FMIA 4IKEA 2AKYA 3FDIA 1N5LA 1GIAA 4LJ9A 5C1BA 2QQEA 3I62A 4NTZA 4B6EA 5H68A 1TU4A 3WMGA 3WHLA 2JLZA 2QM8A 4M2LA 5DI3B 3EPKA 2ZEJA 2WAXA 1GOTA 4N1AA 4Q4AB 4DT1A 3CPEA 5HR5A 4CVNA 2ATXA 4MKGA 1KO1A 2GVZC 3ZGXA 4TLBA 4W9MC 1TQ4A 4OYHA 4BEJA 5JECA 1PLJA 3IIJA 4TWZA 3TAHA 4L9WA 3MWLA 4PPFA 3CRVA 1ZMXA 4AURA 3GLIE 3Q7QA 1K8RA 2ZRMA 1YZKA 4G3XA 2AK3A 1T3LA 3IIKA 2YWHA 1N6IA 5FH9A 2QTFA 2FNAA 1G8GA 2IW3A 3EG5A 2WWIA 2RGDA 2WPDD 1VTKA 1KMHB 4PHHA 5FBVB 5FFMA 1XPRA 3B85A 3I61A 5AJXA 1A1VA 1P5ZB 2DCUA 1ZAKA 3NEJA 1FX0B 4JL5A 1Z22A 1XTSA 1P73A 2YC2C 1OYWA 1E94E 4PR0A 5FTKA 1KSGA 2BM0A 2HEIA 1DAEA 4PZYA 1UJ2A 3M6AA 3L0PA 3LBHA 2CK3D 3SS8A 3SQXA 3OAAA 2X19A 1OKKA 3KDSE 4II7A 3DEFA 4U00A 4B3GA 4JLKA 2CE7A 4EJSA 5DNYB 2H17A 3NBZC 4C9BA 3DHWC 5DIFA 2ZE8A 1MKYA 3KKOA 4G5QA 1KK0A 4M21A 4XD7D 5D3QA 3ONWA 1F2UA 3VR6A 2A30A 3QPUA 4MGKR 3LH5A 1OB5A 4US2R 2VLIA 2ZUBA 3T1TA 1N6RA 3TE6A 4OQXA 3OEEA 5H8WA 4M1WA 4AI6A 2QAGC 2W6ID 4BFWA 4AG6A 5LB2A 4OI4A 1DG1G 2WWXA 4H1VA 4HDQB 1EG7A 2QM7A 4A92A 1RYFA 3THWB 4Q4HA 1T8TA 4LCBA 4MGIR 4ESVA 1K5DA 3GD7A 4YONB 1OFIA 3SHWA 1GG2A 1NI3A 4TYNA 4DKXA 5DLQC 1G7RA 3KTAB 5DO9A 4UNRA 3GJ7A 2KSQA 4EKDA 4W5JA 5B57C 1W44A 3E2IA 2LCFA 3SJZA 2YWEA 4ARZA 1FNNA 4DVGA 2GJAA 2VRWA 3AVTA 4YQFA 4TMWA 4EIWA 2IL1A 1OSNA 4CEJB 5IK2A 2ZE7A 4LX0A 1OPXA 4NCHA 3U61B 3FHTA 1E9BA 2DWPA 3TUIC 4AK9A 2DFKB 2FV8A 2IS1A 1XMVA 4KFSA 2NZ8A 5EZ5A 2FEOA 3W5IA 1XFAA 2ZETA 4C2UA 1EFRD 3FHCB 3H86A 3KZ1E 4LSGA 4QHTA 4I81A 2EFDB 2WAYA 3AH8A 3RS7A 1F2TB 3QKSB 3TSZA 2ZJBA 3EARA 4ZCIA 1JI0A 4LJ7A 5HCIA 5HZKA 4JBYA 5GVRA 3VX3A 2GETA 2ERYA 1G41A 1KJZA 1R7RA 4M1YA 1I4DD 2QL6A 1UM8A 1U8YA 2VIIA 2ZRFA 2FPLA 4OKSA 2CHGA 2JLQA 4TMTA 3U6KA 2B8WA 1D2EA 3I4LA 5TVKA 2J3EA 2A78A 1N5IA 3HP1A 3OEHD 2WSMA 3PR1A 1Z63A 1G8FA 3RRNA 1F60A 4HAVA 5EP2A 5F9HA 5K8LA 3A1TA 2FFAA 2NO9A 3RRYA 3ZD7A 1KSFX 1FZQA 1XJCA 1G64A 5JBQA 1AN0A 4GP6A 4LK2A 4L5BA 1FTNA 2BCGY 2BEJA 1CBUA 1M1YE 4GMDA 4JS0A 3MGCA 2LWIA 3GLFA 1J8MF 1AK2A 1OW3B 2BJVA 2ZU6A 3CWQA 4NDZA 5JS8A 1BMFA 3C41J 1NKTA 3LLUA 4H1UA 4M8NE 3LXRA 1OJLA 3P20A 4B3CA 1YE8A 2HXSA 4QXAA 2W6JA 4LYAA 3C15C 4JLMA 4FMCF 3D31A 3VFDA 3MG9A 3IO3A 5KOYA 3KTAA 3CR7A 3LDAA 1A2BA 1KAGA 1E0KA 4Q1BA 1Z28A 3R7WA 3FB4A 1E0AA 1V5WA 1FL9A 3B8HA 2IWHA 4U7DA 2CLSA 1E9AA 1CTQA 2D4HA 5KSYA 4G5OA 2CNWA 5FR1A 2QBYB 3DZDA 1R0ZA 1RZ3A 4QBGB 3VNVA 3WHKA 4QKQA 5FBLB 4A6PA 1ZCBA 4KV9A 4F93B 1W4AA 4GMXA 4V03A 5LBIA 4B3DA 4EPYA 3C4JA 1XCGB 1G19A 2WOOA 5ANRB 3QXXA 5CLQA 5HE9A 1SHKA 2R8RA 4WAUA 1II0A 4C0QC 4HB2A 2QU8A 1Z29A 1LNZA 1KDPA 5LB4A 2IX3A 1OLOA 3KJGA 3KKPA 5E7MA 2OESA 3VTKA 1ESNA 3QNUA 5EUMA 5J4LA 4HLCA 1AQUA 1BO6A 3U3KA 1YR6A 1NNEA 1G7SA 1KOFA 4LHYA 2JLYA 1U2RA 3K0FB 1ZRHA 4GOJA 3CWZA 3AKYA 3U60B 3UANA 5LD2C 3U44A 4TMVA 1W36B 1EFRA 1QG4A 3K1JA 2OCPA 2O0KA 2J5XA 2XX3A 1NVWQ 2AXNA 2OSBA 3CNOA 3R9IA 2N46A 5BWMA 2KJQA 3MSXA 2WWGA 3VQTA 3UIEA 2CHVA 5EE5B 1G3MA 1LFDB 2C77A 2PL3A 1W48A 1MABA 4D2IA 2P5TB 1N3BA 2G9NA 5F3WB 3SJAA 1LF5A 1YQTA 2D3WA 1YZLA 1EX6A 4MRNA 3DO6A 2V6IA 1GL9B 4ACBA 5HKKA 1R5NA 1AGRA 1ZD8A 2CL0X 3TBKA 2IUUA 2C2HA 1YR8A 2ZRDA 4BLOA 2KI5A 3CB4A 4BZPA 3SBDA 2D7CA 2H7VA 1Q1QA 1E2EA 3EA0A 2ZE5A 2OT3B 3BFVA 4G0NA 4Q7JB 2GAAA 4O2RA 2HYDA 4DSTA 3BB4A 4M22A 1ELOA 1NBMA 4MRRA 3RNLA 2G83A 3VAAA 5DN6D 1IOZA 1N6HA 1CRPA 2DBYA 2IXFA 4RCZA 2O52A 1J90A 1Z6XA 1FMLA 4NE2A 4EPTA 1G8PA 4JVSB 4M0LA 1U9IA 4EFMA 2C9OA 1CJMA 3N5CA 4F7WA 2A3RA 1L4YA 1CP2A 2N1BA 3TGPA 4J0QA 3T34A 3VU9B 1Z83A 1QF9A 2GWHA 1KY2A 1VG0B 1WDTA 2ZI7A 1W5SA 2JJ1A 4N0DA 4Y0AA 1IN6A 4C0LA 1ZW6A 1SVLA 1KO4A 4TL9A 2HYIC 4P3YA 4LHXA 1TF5A 1F2UB 4NCNA 2KWIA 1JEEA 1GITA 2C5LA 3K0FA 1LVGA 4D4LA 4CF7A 2WTUA 2WJVA 3MAAC 2QG6A 1M8PA 2WKQA 3CW2A 3Q85A 5FUXA 3OZXA 2BMFA 3QPVA 5AUQA 5F98A 4X8HA 2PX0A 2OXCA 1XJ0A 3NH9A 2OM2A 3TLXA 1XRJA 3BGWA 1OH5A 4AC9A 4HB0A 2IXGA 3EZFA 2MSDB 2P67A 1E2MA 4B76A 4PAMA 1YRBA 2CHQA 1NRJB 1XCPA 3B1WA 3DOEA 4YC7A 5AJZA 1YZUA 2ANCA 2QA5A 4IJMA 4XD7A 4R7ZA 4UXIA 5LDDC 1II8A 3EIHA 3L2OB 1DG3A 3QXCA 1ESMA 5FL3A 4QBHA 2OFXA 4Q9JA 3TKLA 4EPXA 3QVUA 1OXXK 2OEPA 2R6DA 1P2VA 4Q4LA 2GZDA 1OH7A 1Z3IX 1KDRA 4NYIR 3ZZUA 4C0KA 4UNNA 1NN5A 2BWJA 2H92A 2R2AA 4DUGA 1I4LD 1Z08A 2Q3FA 3CZPA 3RS5A 2JIZD 3LQRA 4US1R 1XP8A 1NVXQ 2YYZA 3AVOA 3QKSA 4GNKA 4ITRC 2AD1A 2QT0A 3DOFA 4FCTA 2JCSA 2PMDA 2RAPA 4LC0A 3PUXA 3MRSA 4QFMA 5EQTA 4ASUA 2P2LA 1CXZA 4IDPA 1PLLA 4M53A 2V1UA 2O8DB 1KKMA 4AYTA 3R9WA 3AF3A 4FMDB 3GJ5A 2ZYVX 3B9PA 5HCNA 3Q72A 4FCVA 1PUIA 4NZYA 4Q02A 1KNXA 2ZSBA 3CF6R 1Z2CA 3IKJA 1QHIA 1SVIA 1ZC3A 3AUXA 1E9EA 5DN6A 4CEIB 4TSFA 3DVLA 4C4PA 5K8UA 4PC3A 2OV2A 4Q4JB 4P32A 4TTQA 5DH9A 1AS0A 1WMSA 1EXMA 2Q9CA 3LW8A 4Q7LA 4KFUA 2VHCA 2IT1A 3DMDA 1GZSA 3EA5A 4OK3A 5KNBA 2CL6X 2CJWB 3AGQA 3UMRA 3GLIB 4A2WA 3RAPR 4ZIRA 3TRFA 5FI0B 1TMKA 2FZLA 5JSZB 3QKTA 2QPTA 1X86B 5E4FA 3OF5A 1OV4A 3RDPA 3D6TB 2HXYA 4WZAE 2Q3MA 4BRWA 4PQFA 3UMFA 2FSHA 4NYJR 4BLPA 3THYA 1S1MA 2MMCA 3RS4A 2WZQA 1GVNB 3ASYA 3OEHA 3Q9LA 5FOSA 3REFA 2UZ3A 3PITA 1Z06A 3L0SA 2MMGA 2HCJB 2EFGA 4GSYA 3CNNA 1RJ9B 2F6RA 4NYMQ 4RD6A 2QENA 1GILA 1KMQA 4WOPA 5IT5A 3GLGA 2IUTA 5JJLA 1AKEA 1PZNA 1X1SA 4LGMA 2VYFA 4X8MA 5BN4A 2R6FA 4NH0A 1ZNYA 4ZDKA 1HURA 1E2DA 3VR2A 5C4GB 1BMFD 1E1QD 3NEYA 2C03A 3A1VA 3C14C 4MRVA 1NIPA 4Z1MD 1GUAA 2FMXA 3DKVA 4Q7KA 1CR1A 2GJ9A 1W2GA 3T5GA 1G291 4HUTA 4PSAA 2WV9A 4TQ9A 2OAP1 2ZJOA 4K46A 1GFIA 1OHHA 1RFLA 2BKEA 3LBNA 3SR0A 3AEZA 3K0AA 2PJRA 3KFXA 3CKLA 2MSCB 5SZJA 4IFEA 1DO2A 4UNQA 4A0FA 3CBQA 4BGDA 3SDZA 2EU8A 5JI2E 1XTJA 4UJ5A 421PA 4QL3A 2QI9C 4TTPA 2AFIE 3RRZA 1TTTA 2GXAA 2ERXA 2RB4A 4ZCLA 4E07A 3ADBA 1XTQA 4V0KA 4WZ6A 5H70A 4DRZA 2QY9A 3D8BA 2XNDA 1P6XA 2XAUA 2NPFA 4ZDJA 2ZI4A 1R8QA 1TEXA 3BS4A 1VKJA 3QPWA 2AWOA 4HAWA 3IO5A 3HU1A 3ZS8A 1ZD9A 4FWTA 4OQNA 4FW9A 2BHRA 1GDDA 2EFHB 3L8ZA 3OE7A 5JSZA 3UATA 4MDFA 3RABA 2Q9BA 1HE1C 4XTRA 4CYMA 1CR4A 2G0NA 3FVQA 5KSOA 2V6JA 3THYB 3IGFA 3CNLA 3SEAA 4ILEA 1XD2B 4LJAA 3WRXC 5GJCA 4QG7A 2PZGA 1KDTA 5L3VA 1N0UA 4E5UA 2NO7A 2ZRCA 1KO7A 1RJ9A 1CJUC 3CR8A 1E2QA 4B75A 4JBXA 2VP2A 2EWWA 5KDDA 4IXMA 4KVGA 1XTKA 5J4VA 1G8YA 5KNDA 1CJTC 1RYHA 5FUWA 1KO5A 2ZROA 1KJWA 3ZVMA 4AKHA 3ZH9B 4XOIA 4A2QA 3DPUA 4JKYA 3AVQA 1XZPA 2IC5A 2ZJAA 5HKKD 3PXGA 2OE2A 3CH5A 4Z54A 1Z6TA 2J7KA 2IHBA 2OFOA 2ZYUX 2XEXA 4NKRA 3VU9A 2CVHA 1A82A 2ODEA 2F9LA 4C30A 2O8EA 3GJ4A 1OFTA 3AF4A 3AKEA 1DAKA 2WVJA 2GXSA 3AP3A 4P4UA 2ZI5A 3SN6A 1IN7A 4YXWD 2WJIA 4ESHA 2ZTSA 2B7CA 4TZ6A 2VP5A 4MITA 1N6PA 4FIDA 1NBMD 4X8OA 4JJKA 4RD3A 2IS4A 3B1XA 4LBZA 1R6BX 1KDOA 2A2ZA 4JVLA 2JLVA 2O8CA 2JLXA 2C8VA 2Q3HA 1KIMA 4BEBA 1MV5A 3QXSA 5JRJA 4QBIA 3WMFA 3QIAA 3S1AB 4G5SA 1W4CA 4LJ8A 3TQCA 2DWOA 4KODA 4JT4A 3K8YA 1X8JA 4XVUA 1HE8B 1OXVA 3KKQA 3EAQA 1NVVR 1U90A 3I3SR 2ZS8A 2E87A 4B71A 1P9RA 3IQXA 1PLKA 4B2IA 5E7JA 1DELA 3MFYA 5GJWC 3QSYA 3WP1B 5BQ5A 3LY5A 1W47A 3GLHE 2AKAB 1FP7A 3RRMA 1E32A 1KK1A 1NIJA 3K0EA 3V4FA 3ZVLA 2IYUA 4WVFA 3OE7D 4RVCA 2BKUA 3KQHA 1VHLA 2QP9X 5M04A 4IOKA 3K9NA 3GJ0A 4HDOB 3R8FA 4GI7A 5BW8A 2XTZA 5JWOA 4NYJQ 3GEHA 2JDIA 1ZD1A 2J1LA 3RYTC 4PFSA 4O0MA 4OK5A 4QM6A 3T15A 1ETUA 1NJFA 3BFKA 3C16C 1KI6B 2I4IA 3EZ9A 5D3MA 2IK8A 2J46A 1Q12A 2EVWX 3SJBA 1OE0A 2NIPA 1MR3F 4CEIA 1G1MA 2CCKA 1WB9A 4QHSA 4B33A 4KYUA 2BDTA 3TAUA 3FMFA 2GXQA 2HF8A 2Z43A 1E2IA 4HUQA 2RCNA 4W7SA 3VR3A 2XB2A 1ANKA 2WIAA 4BLRA 1Q22A 4Z51A 4KBGA 1W46A 1TNDA 3EW9A 4ARZB 1E6CA 5AJVB 4PQYA 2GTPA 1SVSA 3R7WB 2ZSDA 4K8OA 5KHOC 4EJSC 3O8CA 3A1WA 2ZRPA 2HCBA 2ODNA 2ZJ5A 3IILA 3K0CC 2CDNA 3QJYA 5C18A 1BIFA 3WBKA 2IEYA 3KJEA 3Q8XB 4KJZA 1ONBA 4NYIQ 3IPYA 2V3CC 1A4RA 1P61B 2XSZD 1HYQA 2QORA 1WP9A 3DL0A 2WBLC 1CR2A 2G1JA 4P4TA 4TL6A 4AKGA 4KSBA 3GQBA 4LYJA 3WBJA 2OBNA 4JL8A 2FE4A 2JLUA 4B44A 1I2DA 5FI1B 3THXA 3A4MA 4U02A 3ECCA 4C2TA 1VDZA 3O47A 4RFSB 1ZNWA 2FSFA 2H16A 2ZE6A 3A58B 4A2PA 3LX8A 2OCYC 3IDQA 1NMXA 1M74A 1D5CA 2NOAA 4IVRA 2ZAOA 5FUYA 4DZZA 2GESA 1G17A 1VCMA 821PA 2DY1A 3IBGA 3ZS9A 3PEVA 4C0SA 4OHYA 1U8ZA 4A8JB 1YRAA 5B64A 4ABYA 2FFBA 3HU3A 2ORWA 3LAWA 1D8TA 3P4YA 4AKIA 3U3OA 2BMEA 4DUGD 1EFUA 1XMIA 2B6HA 3EZ6A 2WWFA 3C5HA 3PEUA 2QMOA 1DAHA 2JIZA 1Q1EA 1VECA 1MABB 3B13B 3D7MA 3OHMA 3VKWA 4ZIRB 1MT0A 1VIYA 1NF3A 4A0RA 2IF0A 1N2CE 3PUZA 1W0KA 1X6VA 1E0SA 2QROA 1HQYE 3FGNA 2FFQA 3KX2A 2HF9A 3W6NA 4M9QA 4DDUA 3QBTA 4RJLA 1OF1A 4CIDA 2D06A 4Q1CA 1ZUNB 1SQ5A 5JWRA 5FPYA 2BBSA 2Q9AA 1G18A 3PUWA 3RS0A 3G0HA 3I72A 1ZNXA 1BOFA 2ASEA 4NCKA 5EXPA 3VMFA 2XNDD 4URXR 5KYKA 1XEFA 1OT3A 3AP2A 3T61A 4XIGS 2J0VA 1GNRA 4P33A 5FL7D 4P4SB 1SHZA 2VQSA 3B60A 4QNMA 3SI7A 2OAQ1 3MMPA 3WMEA 4D6PA 1YR9A 1GRRA 1KI3A 1QG2A 3B5JA 3M4YA 4MYTA 4F4JA 1PV4A 3UPUA 5BYKA 4ZCMA 2H57A 1G3RA 2WKRA 3PIRA 3PVSA 1E2LA 1E2JA 1SXJD 2IYZA 3QXHA 4PX9A 5CYOA 1WF3A 4CT4B 3CIOA 1KSJA 2V1XA 4OJKA 3FFBA 4DCTA 1WCV1 3UK6A 3SC3A 1IJFA 1ZINA 5JMTA 1RRFA 5EXXA 4Q4HB 2NMVA 2PCJA 1IBRA 5EE0A 1CIPA 5J47A 4M1TA 2FN4A 3T06B 4BFYA 3U4QA 1E1QA 2V7QA 4YMVA 6Q21A 5E3HA 5GJVC 4KVAA 3GJ3A 1TQ2A 4GZLA 2J87A 1Z0IA 3SBEA 4POAA 1JALA 4URZR 2RGAA 1G5TA 1XTIA 2YWGA 5J5CA 3TQFA 1G8HA 3JVVA 3TR0A 1NKSA 1OYYA 4G1UC 4D25A 3OEED 2ONKA 3ZQ6A 4CEJA 4DLXA 2QT1A 1K5GA 4MKFA 5EXTA 3RS2A 1G20E 4E09A 3ZYCA 1Y63A 2QRNA 1GWNA 5KSPA 5JJKA 4Q9HA 1XNJA 2FDCA 2B8TA 4AG5A 3E1SA 1S3SA 1B0UA 4A82A 4TYWA 1GM5A 1EX7A 4FMCB 3TR5A 2QMEA 1R5OA 4LOAA 3ZD6A 1KI7A 2GEVA 2KE5A 1SVMA 4KFRA 1QHNA 2ZRLA 3KXIA 4LV5B 3AP1A 4IOMA 1Z0JA 2ZRAA 4FMBB 2GBLC 3X2SA 3I8SA 4PZLA 3CO5A 4MA4A 1ZIPA 4OHVA 1XEXB 3G82C 1SVKA 5CK5A 2H18A 1TU3A 3LRPA 2AWNA 5DI9A 1MOZA 4EPRA 5HE8A 3SFVA 3AGPA 3MWYW 3BD9A 2CBZA 5JFGA 3K70D 1D9ZA 2X77A 5FBRB 4DDVA 1E9CA 4TYPA 1N5KA 4D80A 3WYGA 1CRQA 3CONA 3GPLA 1ZU5A 3HDTA 3QG1A 4JL6A 4LDJA 3NBYC 4TYYA 3KB2A 2VP4A 2OUKA 1Q21A 4D26A 1E2NA 1JAHA 3P26A 2ZR9A 2FWRA 1NG1A 2V9PA 1AM4D 2X1VA 2RGCA 3QENA 2HT6A 3UMSA 1R10A 4Q66C 2ZREA 1CLUA 4V0MA 2CLDX 2VP9A 3EX7C 3R20A 4RKFA 2F1IA 2JAQA 1IXSB 4DLWA 1HT2E 1EFHA 3N2EA 3RSOA 5G3YA 1XX6A 3W34A 5GVSA 2VP0A 3V4RA 3KJHA 4NONA 4TN1A 3AF0A 3X1YA 3AV0B 4U5XA 2W2TA 4Q1EA 4HZUB 5FPKA 4XVRA 2BVNA 4JYBA 4O25A 4FMDF 3U3MA 3CF0A 1COWA 2QAGA 4DCUA 2CMKA 2YHSA 4M1OA 2Z0MA 2QP4A 1TX4B 1KKLA 1YZQA 2VO1A 2DWQA 5DHFA 3LNCA 1YZNA 1KZ7B 3QEJA 4G5GA 4I1OA 4QM7A 3L82B 1AQYA 2VHUA 3NH6A 4L15A 3AKCA 2BJWA 5CDFA 1DADA 5EE1A 1E69A 2J0QA 4Q00A 2A9KA 2X2FA 3AVXA 5BN3A 1E2PA 4OQMA 5KTYA 3VR4A 1RC8A 4W5HA 1MH1A 1D2MA 3NDPA 4FN5A 5TMPA 3IEUA 4PSVA 3I92A 3TW8B 5FOUA 1XEXA 4WIAA 3EPJA 1RIFA 4CGZA 3C8UA 2G1KA 5JI3E 3AM1A 4Z8YA 5KU1A 2EW1A 2A5FA 5FOVA 3GEEA 1KI6A 4PANA 3RWOA 4DT1B 2XSZA 1N6LA 3BBPA 3KQLA 2HDNB 4OI1A 4URWR 1KK3A 4PZZA 4TT3A 3T1QA 1FPMA 3UKDA 721PA 2OFWA 2GVDC 4KLZA 4LPSA 3GCGA 1JR3D 3FKQA 1P3JA 4Q21A 1C9KA 2J9RA 3JZAA 4PPNA 1W49A 4OHWA 2FSIA 2QTHA 1SXJE 3W6PA 4KLNA 1H8HA 1HV8A 4MUAA 5EJEA 2BM1A 4AY2A 3LO5A 3NHAA 5FOTA 1U8AA 4DLRA 5AK0A 3HR8A 4TLDA 1C1YA 1N0WA 2QUZA 3QY0A 3ASZA 4LBVA 4V0OA 2J7PD 3P4XA 3MJRA 2IXEA 3NIBA 2PLFA 5DE3A 1OXUA 1G6OA 3BWDD 1JQJC 3E5HA 4HZUA 2J0UB 4G5RA 4QC2A 2IYLD 2W0MA 4ZDIA 2GJSA 2W0SA 1S3GA 4B3FX 1ZM3A 3H1TA 4Q7MB 2VHTA 5TV2A 2GK7A 3U2QA 2AR7A 1QVAA 4MYCA 3A4NA 2GEDA 4HZIA 2PBRA 4HSEA 3F5FA 4YMWA 4B73A 1Q57A 3NVAA 4B6FA 5JJIA 3QKUA 4UJ3A 2ZSFA 5G41A 2ZXUA 1I4TD 3TVDA 3VNUA 1SULA 2IUSA 1J7KA 5CDFE 4LJ6A 1U94A 1NL3A 3ICEA 1AKYA 4AYWA 1IN8A 4A8JA 2C04A 2FZ4A 2BMJA 3ZVRA 5EP4A 1P4SA 4A1FA 5DSZA 4HYYA 1S9HA 1KK2A 2H5EA 3B78A 4URVR 3KFVA 1RPZA 4QJ5A 1U99A 2C99A 3WNBA 3HPQA 4B34A 3G5UA 2QRZA 1SKYE 1SZPA 2ZRBA 1FQJA 3X1WA 5L3RA 3LLMA 2EFEB 4IDNA 1TL7C 2ZI6A 3Q3JB 5SZIA 3RHFA 2ZR7A 2QGNA 1BYIA 1II8B 2Q6TA 1RRPA 3Q5DA 2QMUA 1H8ED 1PJRA 2ZI3A 2DB3A 5JEEA 4LHZA 4WA7A 3KQKA 2RGNA 1Z0AA 1SXJA 4WZBE 1GRQA 5KDLA 2YOGA 4IW3B 4ZO4A 4TT3D 1M7GA 2HT1A 2ZAMA 5JS7A 4KCGA 2GRJA 4HDCA 5FUVA 1OXTA 5G3ZA 5G40A 1U0LA 1JJVA 1G7CA 4OJQA 1F2TA 2NGRA 1Z47A 1P9NA 1LF0A 2WICA 3H0KA 3ZIAA 3TW4A 4RSGA 3RANA 1E79A 2ZQ5A 1IHUA 2F3RA 2GEUA 4R71A 1JXMA 2JATA 1GSIA 2IYTA 2AX4A 2F3TA 4LPKA 5B2ZA 1N25A 2V7QD 4DIDA 5IHPA 3SQWA 2O8BA 2QZ4A 4LJ5A 4BWYA 3AQ4A 1TPZA 1ZIOA 4JVMA 1L8QA 1M7HA 2IYRA 3K9HA 5A5GA 1EESA 1XCMA 1XEWY 2H8KA 2UZIR 2XOKA 4P4SA 2RKOA 4JZKA 2V4ZA 3I73A 2J7PA 1J99A 4Q5IA 3PEYA 3SJCA 1EK0A 1J8YF 1ZCAA 1IN4A 1E0JA 1KI1A 3PUVA 3SFZA 1IY2A 3CX7A 4LV6A 2OXRA 3CF2A 5TARA 4MUBA 4B2LA 4OI0A 2Z83A 4CW7A 3B7GA 2D2FA 1DARA 2W58A 3F8TA 5JLJA 2Z5FA 1M34E 3B82A 4W5WA 1G16A 5E7IA 2JASA 4JBWA 5AJYA 4B3XA 3QF4A 1W1WA 5FTJA 4NCJA 1QBKC 3EWAA 3FPAA 4TMKA 1T4GA 4P0TA 4UNPA 4XWAA 1MRSA 3AVPA 4HUQB 2QNRA 4YMUA 5KDOA 1NY6A 3GJ6A 2GA8A 3IBYA 2V8OA 1SVOA 2C9YA 3RS3A 1C4OA 2KBFA 2YINC 2BCJQ 2ZVQX 4CRWB 4RZXA 1G4UR 1T3HA 2GF9A 5KUTA 4Q19A 4RZ3A 2IYYA 2Z6VA 1KYIA 2A5GA 4TSFD 2QPOA 1L4UA 3TNFA 1TUIA 2BBOA 2XXAA 1JNYA 3R9XA 1XXHE 4PXAA 4UNSA 2VP6A 1Z6GA 2IWRA 1QHSA 2VBCA 4PC1A 3E70C 2XITA 2QPAA 2ZRIA 4IRUB 1TF2A 3ND9A 3W90A 3DDCA 1JEDA 1G3UA 3SE0A 4HLDA 2ZYWX 3FTQA 1Q1ZA 4HLUA 4NBSA 3BC1A 4TL7A 4KU4A 2HUPA 3B9QA 1Q3HA 1X8LA 1XMJA 1Z5ZA 2EQBA 3LW7A 3AUYA 4JLPA 3DMNA 3BRWD 1QHXA 4CEHA 1Z6YA 4EUNA 4EJSB 3U44B 5DHAA 3OFNA 3K53A 1JXOA 1F5NA 1T8UA 2VPPA 3KQNA 2WWWA 2IHYA 4C7OA 2ZS7A 3K70C 4NMMA 1II9A 2P65A 2Z4RA 1U0HC 5D3MB 3EWSA 1EGAA 3LVQE 2AN9A 2GCPA 2EYUA 1GKUB 2PH1A 1XD9A 4EQ6A 1NVUQ 2NPIA 4LYHA 1V43A 2O8FB 4M1KA 1QHHA 2VA8A 2ZANA 3A37A 4GRAA 3AVUA 3TUZC 2OZEA 4Z1MA 1DO0A 1RW4A 2XZOA 1ZC4A 1Z6AA 4DCSA 3QF4B 3NTUA 3K09A 2G0TA 3LWNA 3KJIA 5JWHA 4HAYA 5LD2B 4US0R 1VPLA 3NKVA 4DC9A 2ZSEA 2BBTA 4ON9A 4RZ2A 621PA 1LY1A 2A5JA 1S9DA 1NMZA 2L0XA 3FYHA 2FPMA 2OCBA 3F3YA 3FMOB 5K8TA 2HV8A 1HH4A 1XDBA 4JYCA 3LA6A 3SYKA 4JMPA 3TJZA 5FTLA 2OCAA 4BE7B 1AJEA 2FEMA 4BFXA 1Q0UA 4KBFA 2ONJA 2G88A 4LJYA 1LS1A 1M7BA 1T6NA 3L8YA 1UBFA 1X3SA 5UKDA 2J59A 4OK6A 5C4MA 1MO6A 5JHGB 2WIBA 5BN5A 2PT5A 1IXRC 1S4QA 1VYVA 2EYQA 4D0NA 1KGDA 2WHXA 1N5JA 4D4JA 2OO7A 3HPRA 4QNRA 1IY1A 1T0HB 2N42A 2ZUCA 1G3QA 1E96A 1L2TA 3P1JA 3W3ZB 2R6GA 1VCOA 1XMSA 1UFQA 4ACAA 2W2XA 2VTKA 4QOSA 1X8KA 1Z0FA 2GNOA 3BXZA 3FE2A 3W6OA 3WXMA 4A4DA 1COWD 3SYNA 3CRW1 1YZTA 1DOAA 4I1SA 3T1OA 1XXHB 2JEOA 4HEJA 1YZGA 5FPSA 1OIVA 1N0VC 5FTMA 1E9SA 2LKDA 3LFUA 4EQ6B 4EPWA 1O87A 4F38A 3K0SA 3JZMA 5FPHA 4A15A 2YOHA 1VMAA 2IS6A 3EC2A 3JVUA 3ZJYA 1AZTA 2NZJA 1FOEB 3TVTA 3X1DA 1DBSA 2MSEB 2HJGA 3KUCA 2D74A 4P31A 2VHJA 2BEKA 1DAMA 4ZI2A 1Q3TA 2G6BA 3BE4A 4IHQA 4LBYA 4TTRA 4YXWA 4JLOA 3PUYA 2DFNA 2QAJA 3OIVA 5FBWB 2BC9A 2ORIA 2AD5A 2FF7A 4Z8XA 3UWOA 4BFUA 3HYRA 4JLDA 2OBLA 3QF7A 2E9SA 2EFCB 2ZR0A 3BOSA 3KKNA 1W4BA 2A7QA 1Z2AA 1TEVA 1KI8A 4NHOA 1J70A 1FUUA 3I5XA 4NYMR 1W36D 3CRQA 4AWXA 1UBEA 1ZYUA 1YKSA 3QVVA 3THOA 3CRRA 2ODWA 5JCZA 4NCIA 3LV8A 1JR3A 2P5SA 1JECA 1GKYA 1XPUA 2ZVPX 3QQ5A 1Y3AA 4TZ0A 1AA9A 1H8HD 2C98A 4MRPA 1NN3A 2XJ9A 3UXMA 3QKRA 2WSSD 5J40A 3B1YA 5EUQB 3K9LA 1FFHA 221PA 3H84A 3U6BA 1DAIA 1P9WA 4A9AA 4C0AC 4HB3A 1P62B 4Q4JA 4IFBA 4GFDA 3PFIA 1Q44A 5JCPA 1XBTA 3ZIAD 1NSFA 4DDTA 2VL7A 3MUFA 4HLUC 2IYQA 3KKMA 1E79D 1SXJC 2JA1A 5DI3A 1T3SA 2GF0A 4URUR 2BV3A 2AXPA 3ND8A 4F92B 2O8CB 4QBFA 2ZJ8A 1JAIA 3LVRE 3S1AA 2F1RA 4LWZA 2D7DA 5KSZA 1VG8A 4TMXA 1G21E 1OH8A 3VKGA 2C78A 1IXZA 4F4IA 3MJHA 1CULC 3QBVA 3T35A 2DYKA 4B35A 4WXPA 5JRZA 2WMOB 3GLGB 1GNPA 3T5DA 1KO8A 1RE0A 2D62A 3QE0A 4DB4A 3UWKA 1NSTA 5CJPA 3GLFE 2XZPA 1T0JB 3HYTA 4PQRA 3NBXX 3W8RA 1FX0A 1UBCA 2GJKA 3TH5A 2I1QA 4XTCS 3SYLA 3K09C 4B74A 1I2MA 3IHLA 4I1UA 4QGFA 3X1ZA 3WNDA 2QE7D 2IA5A 1E98A 1LW7A 3OIWA 4RFSA 3U3RA 4B3BA 3R8CA 4S35A 4H9GA 3VHXA 1OFHA 3K0CA 3QUSA 1FNMA 1N6OA 3F0TA 2JJ2A 1H8EA 1YVDA 2X2EA 2P6NA 2C95A 2GJ8A 3GFOA 2ZYTX 5CITA 4WBSA 4MYUA 4LRWA 3IUYA 1XU4A 2WJYA 1TQDA 2FJUA 1SKQA 3GMTA 5AR1A 2SHKA 4DLSA 2FU5C 3ZZ0A 2D2EA 2VSOA 4XSGA 3CUEF 1W2HA 4NL4H 2LKCA 3GJ8A 3BFXA 2GAOA 2EWVA 1NN0A 2BBWA 4B48A 1MRNA 4B47A 4LJ4A 2AL7A 5CIWA 2HLDA 1DTSA 4B32A 1AIPA 2R44A 5FOXA 3TSWA 4RY2A 1U0JA 5L3SA 3GLHA 5EP3A 1IAQA 1JPJA 3MWJA 3QI2A 3HWSA 4YDHB 1MO3A 2WSSA 1M6NA 4Q9LA 2XOKD 3EIQA 5B58C 2VEDA 3BB1A 1NMYA 1NP6A 4D81A 4ZI3A 4RD0A 3IEVA
chains in the Genus database with same CATH superfamily
2BD0A 4YIHA 4CMJA 1C7RA 1FYEA 2PMKA 2ZPUA 2WDZA 5FBQB 5LA6F 4H7IA 3T9EA 4RK0A 1H69A 1V8BA 3EOBI 1G21A 4QSMA 4YRKA 2C0CA 2I65A 1NU6A 5TPWB 1MO5A 3B2EA 3I4CA 4RKEA 3SQNA 3TLZA 4TLLB 3RVKA 3F2VA 1YL7A 2PZ8A 4FX5A 2IYPA 5H3LA 3AF1A 4RFVA 2DTXA 1R5JA 3D7RA 4M9XA 4N7RA 3QFHA 4YDSA 1KQPA 3AT1A 3GAZA 3JD0A 1D3AA 3M9XA 4AY3A 5BSKA 4UCFA 4YMIA 5LN1A 3MBOA 1KQ3A 2P9FA 1G9TA 3FGPA 4FHEA 2X7HA 1H93A 3B1VA 3LSYA 3NNSA 4MLZA 4XD2A 4WRRA 1NI5A 2QTZA 3MINB 3KTFA 1XLUA 1NF9A 3NHRA 4AQDA 3NCHA 4CLRB 5JAMA 4CF4A 1IC6A 1RAIA 1CS4C 3R77A 4FDAA 1FFSA 2Z4TA 1TFRA 4LXQA 4KR3A 4A5OA 2GNAA 5IRCD 2C4HA 2ALJA 4PLGA 1IZ9A 3RC8A 5EIAA 1M2OA 3PEFA 2P2ZA 1GG9A 5CK4A 3ZUPA 1PQPA 4RW0A 3R7LA 4IY1A 1WXQA 5FLKA 2F4VB 1KH2A 3MVEA 3VPSA 1N2IA 1ZMBA 1IQPA 3Q9NA 3EUAA 3CT4A 1T0IA 2FWBA 4NDAA 4A10A 3ZE7A 4BMZA 5A5VA 1I7DA 1BN7A 1YK1A 3DO5A 4A23A 1QHHB 2JGFA 1UKYA 1E1CB 2P9ZA 3KQSA 4PYOA 4MGZR 1CVIA 4DABA 2IYVA 3JX9A 2ORED 3LKDA 5T4HA 1W52X 3L92A 1K7EB 2O07A 1GARA 2W2LD 4JJAA 4RY9A 5B3KA 4IDEA 5KO2A 2QQ0A 1YQGA 2X4GA 4OQLA 3WBBA 4RAOA 1QYRA 3A7DA 2A5YB 3VRHA 4DEXA 2YY5A 2HR1A 1VKNA 2F8SA 5LQNA 5JE8A 3Q8LA 4CDGA 2IKQA 1UCFA 3LKZA 3U81A 4GR9A 4EMBA 5KTMA 1PL7A 3D3JA 9GPBA 3ADDA 2IYXA 1DQSA 2A0XA 2VSFA 3TW0A 5A7HA 1PK7A 3GBSA 3M6LA 1G7TA 4EUHA 2X3FA 4QDOA 3OC6A 4YI5A 3FHOA 1KEEB 1ZNZA 1I5RA 2EP5A 3L4SO 4KX3A 4NZPA 4YJHB 2XWQA 3VVCA 4F3YA 3F8SA 4FS3A 2DPXA 2FSVC 3DYVA 2P79A 4NC9A 5JSFA 2JLSA 3WL4A 1CNEA 1WBDA 3LZCA 4Q15A 2B92A 2XUQA 5FWAA 1C2YA 1S01A 1GRVA 4J16A 1T34A 1ZM2A 2WJAA 1QNFA 1XYYA 3A6KA 1NRWA 3GRPA 1EUQA 3T38A 4C87A 4EFLA 1BJRE 3W5VA 5JEDA 1E9FA 2XCQA 3MLEA 5I5EA 3C8ZA 3FSJX 5HIAA 1DPFA 2XHEA 4FI3C 4Q9KA 3CGWA 4G23A 4WFJA 3WKDA 5A0TA 3QXJA 2R62A 3E35A 4K26A 4GM1A 2COKA 1YIDA 3M1LA 1GRNA 1T36B 4AO6A 4J91A 3CPJB 1V9LA 3WZLA 2VUIB 1KTIA 5H5JA 2XYGA 2XB8A 3W9SA 4IF4A 4HDSB 3C7TA 4C6TB 1VMDA 5J4HA 2M6RA 5EGSA 4RQTA 4O4IB 4UHBA 4DLVA 3FSRA 4QZVA 2PZEA 4R8LA 4DHWA 1VYTA 2R6CA 4UXHA 4OGWA 5TQ0A 2R8OA 4P35A 3UKJA 1FRNA 3M1IA 3FZQA 4CGYA 1JH8A 1GP2A 1JKXA 4CMGA 4XH9B 3U48A 3KETA 2F3UA 3L7CA 1I4EB 3BFPA 3IUSA 5F2KA 3IKTA 4DLZA 4GT1A 1LD3A 2ST1A 1LLQA 2ZIXB 3BWMA 3UJHA 4RZUA 3LF2A 4L74A 2XW6A 3V00A 5C1DA 4RA9B 3ZZNA 5HPYB 4YR7A 4PYLA 2GBCA 2J41A 3O74A 4BJ1A 2W48A 5C46F 5A9SA 4OF4A 1G6Q1 1O5OA 1P8JA 1DXHA 1WP4A 3KXKA 1OZ0A 3HYNA 4L8WB 3RIEA 1HUQA 1RJEA 1YBAA 3I01M 1T5LA 1CDEA 2FQ1A 2QTNA 3KQPA 3OT4A 4DMGA 3VVLA 3H11A 4QPPA 2R3SA 1QLHA 1QC5B 1PL0A 3DTYA 2P0YA 1ISPA 3H5WA 1E1RA 3AEXA 1U81A 4J7UA 2WWHA 1ADJA 4MJLA 4YTEA 1CUZA 5LZ7A 2IVZA 3G0DA 4MAMA 2C07A 3L6OO 1JG2A 5I01A 1SC1A 2VHYA 3OPVA 1NW8A 3NJ8A 1N75A 2YWXA 2MSWA 3V7UA 5P21A 4JDUA 4QJ4A 2AH5A 1IJBA 1N9ZA 5DISB 4G2TA 4CG2A 4LCEA 1QHGA 2WWRA 4POOA 1HF3A 1YHNA 3M6XA 3OY2A 3P19A 4P9NA 3ZY3A 1KMIY 2GZ1A 1IQUA 3MOSA 1Z73A 2ZDHA 2HWXA 3H5AA 4MUIA 4XWTA 1T8RA 4M1EA 1VLQA 1BE6A 2JGNA 2DFVA 3OIUA 1Q17A 1T3GA 4JYZA 4CEHB 2Z2YA 2QVGA 4QFCA 4TVBA 2EWMA 4LZZA 2FGJA 3DE1X 1GQSA 5JHHB 2DHCA 4UUMA 2BFWA 1EJBA 3DC2A 3INGA 4IEIA 3FA2A 5A6SA 1OBVA 4JIMA 4HEA6 5FLYA 3TLGB 3JQRA 1GTRA 4RH3A 4E94A 4LF5B 1YVPA 2P62A 4UEWA 1PTJC 1QZZA 2E1RA 4EEXA 1RNLA 1RMQA 2DC1A 1VG1A 4UZSA 7MDHA 4QEZA 4DWJA 3IQIX 4YY3B 5BYJA 2PXAA 5F4BA 1T5TA 6CHYA 1DDGA 4FFPA 2B69A 4N5NA 1P75A 3FFWA 4I55A 1E2KA 2JVKA 4LC1A 4DLYA 1T5IA 3EODA 4YRMA 1C30B 3T8YA 1DKRA 1FFBA 3T99A 5D3ZA 1O6GA 1AKWA 2REOA 1E4EA 1OAKA 1V5EA 4BMXA 5ECWA 2JF0A 3HCEA 1YQWA 3DQPA 4L85A 1R74A 2XLBA 4KQFA 3LG2A 4NEHB 4ASUD 2XXAB 1HQKA 3LXXA 1DE0A 3DZKA 4TTJA 1CKEA 3IHWA 1KY5A 2OG2A 4R51A 1AB5A 2R7AA 2V45A 4M1SA 4P53A 4UUPA 3RSFA 4AF8A 3NC0C 4EGAA 5BSRA 4CMBA 5IXJA 1JJFA 2ONZA 4MVXA 5CM9C 2I1LA 4ME6A 2F43B 5TXGA 1HA3A 3KDPA 1ISSA 1P2TA 3P0HA 4EI8A 5IAOA 1B42A 3MGAA 2W2VA 3EIEA 4ITVA 5J5VA 2HH9A 3COZA 1ZP6A 4I99A 3VR1A 3WNCA 1PFYA 3AHGA 4IZ6A 3RWMB 4H08A 2XUKA 2H31A 3GA7A 3I0NA 2PSFA 1NP3A 2QRHA 5TS2A 4UQLA 4RLFA 4JUCA 1AOXA 1KQGA 1PS9A 3LGAA 3R9KA 4FWIB 1UDXA 5BNWA 1G20B 4QFBA 2YHBA 4V02A 2WSLA 4DLAA 3I4FA 4FSDA 1HRDA 2WJPA 2FB9A 3GFGA 3IUMA 3MWEA 4PGFA 4UXJA 3O73A 1MOPA 1U0FA 3LUDA 4HAUA 4WFQA 3BE6A 5TX7A 2O4UX 4Q1DA 4UBJA 4CUJA 5LYJB 4N0EA 3RIHA 3SC4A 1IIBA 3FKSD 3OZRA 5K1ZA 1TEHA 2JW5A 4XGQA 1M6EX 4OYRA 3LDFA 2CXXA 3K6RA 4MW5A 5ECYA 5ELLA 4YQZA 3SZRA 1AS2A 4DLPA 2UU9B 2WILA 1SJ9A 1PE0A 4G26A 1BYUA 3B6ZA 1RYNA 2E4XA 3OP4A 3IIMA 4LIPD 1XNGA 3S2EA 4CV3A 4F4UA 4ZHQF 4MVJE 2XNSA 2F55A 2BF7A 3IERA 1QPGA 4KQJA 4XJXA 4OHKA 2FUCA 3LUGA 1TK2A 4F9FA 3Q0EA 3E58A 5DMHA 3W8DA 3ME5A 3NVMB 3OAAD 2QZSA 5BSVA 3V42A 1MW9X 4NENB 1OKKD 3CH6A 3OUZA 4G67A 4RIHA 5F5XA 1NI4A 2QKYA 4DIMA 1YE3A 5KKCA 3U7HB 4O2LA 3AM1A 2YL2A 1V3UA 2WSIA 1UQRA 2XTJA 2DULA 4DLUA 4LUCA 5FWNA 1JHDA 2Q2OA 5JTUA 2FR8C 1BEUB 4BBAA 5BY2A 1MXHA 3GFTA 2C5BA 5H3HA 1ZICA 4MQLA 1M8FA 5K0ZA 4WY8A 5HXAA 3LHSA 4M37A 1C3JA 2BGMA 1IONA 2QS9A 2VTVA 3PGLA 3TDMA 1PWXA 1O6BA 3E8XA 3SQDA 2WIFA 4NULA 4YMTA 3U37A 4QEDA 4YEDA 3UGKA 3VNBA 2FDXA 3P0RA 3QKWA 1OV6A 2HMWA 3JTEA 4V0NA 1ZPDA 4EECA 3GZJA 2OILA 4RXMA 2VDLB 5IP5A 3ZZMA 5AW7A 5GIOE 3EFBA 3E3NA 1TFUA 2I2DA 4KGZA 4QUAA 4EF6A 3W5DA 3BIFA 1AUPA 3TD9A 2B7BA 2EBHX 2QJWA 1SNYA 1GRCA 3NETA 5IN4A 3K1AB 4KPUB 1XQYA 2F48A 2JBWA 1PT5A 2ET6A 4Q3NA 3MWDB 1W6RA 2X9NA 3Q9UA 1ACLA 5L7YA 5H02A 3WDKA 4PINA 5KOHB 1Q20A 1RXSA 1ZJ5A 5H9WA 1XDDA 3K5HA 3ABSB 1P74A 4IV8A 3E2MA 5TB5A 2Z98A 2WPDA 3NHKA 5E95A 2C9CA 4YHHB 1RRCA 2PWBA 3K0AB 1IWOA 3BK7A 5IN5A 1XQ9A 5B1DA 3S28A 2VAXA 3TLKA 1UAAA 2R8YA 2ZJ0A 3QI7A 1X8XA 3O4HA 3UWDA 2AFHA 1UIMA 3G8BA 3HKCB 3O1IC 4FFOA 1GM5A 1BD4A 4O4IA 3ZNNA 4B40A 1MVNA 2QN6A 4IMJB 2DHRA 1W75A 2JI8A 3KKEA 3Q6MA 3W8NA 2Q3DA 5A4IS 5KTNA 1EDZA 3DA8A 3NAMA 2EZ8A 2GD2A 1U2EA 4P34A 2IELA 3LT1A 1W19A 3SSNA 1EDBA 1WE2A 4NICA 5LPNA 4Z4HA 4FYYA 2GCOA 4Y6PA 3WLRA 1YHYA 1MHTA 4O59O 5JZVA 1TQ6A 1OIWA 4BAZA 5AXCA 3B1JA 4MYHA 3A2KA 1P2GA 2QW1A 4KOEC 4GZ5A 3UYKA 1GUDA 3E7FA 4R16A 4Q18A 3COVA 1UWCA 4JOQA 4K1XA 2GDJA 2YJ5A 1NVEA 4RMGA 4ZPXA 2WVGA 5K4GA 5IUJC 3C87A 4ODIA 4PHTA 4UBLA 1OU4A 1L7PA 1E3LA 1PJLA 1R15A 1W35A 3SX2A 3SXUB 3NR2A 2BHLA 1AMUA 1XDGA 1A5TA 5HNKA 2YDYA 4HQRA 3KQVA 3DNFA 1XD2A 4K6CA 2HJRA 3OPXA 4F91B 1CERA 1JAZA 2VSYA 4IV0A 4EY5A 2CCJA 4PXYA 5DP2A 2PLNA 4XJVA 3A1SA 2C4NA 3P5SA 3MCAA 5B37A 3TNLA 2P2GA 5F64A 5I9IA 2OHIA 2D54A 1YFLA 4RYLA 1EINA 1DBRA 3QKIA 3BWVA 1D5WA 1HM5A 3ETHA 3JQFA 4NNPA 3F3SA 3WWCA 4GICA 3E2PA 3UUFA 4ZYXA 2WHQA 1WQ1R 4G07A 4G01B 3MAGA 4N9QA 2YX1A 1XMOB 3AC0A 5AM5A 7ADHA 3I1FA 4FD2A 5I4KA 2G06A 5FFNA 1LI7A 4S0ZA 3L0OA 4M9SA 5F9FA 2RGXA 4I50F 3ZCXA 1EFLA 4BQSA 3S99A 2AJBA 2F17A 1RU3A 3C3EA 3R3ZA 5TJ9A 5TQ2A 4P4NA 1PDOA 1KJNA 1ZXLA 5A4DA 1XD8A 4PG8A 4TXNA 1PGOA 1ZGGA 5K0LA 2QJTA 4D0RA 4R1MA 4JLAA 4MUEA 3F6SA 5F7ZA 3BK1A 5JXGA 3CVYA 1F0YA 1X9GA 2C96A 4RD1A 1YCGA 1ZSYA 4LYFA 4F0JA 4C0BA 2GF2A 1QCZA 2RGBA 2Z04A 4Q3AA 4UM5A 3WGMA 2IZ0A 4GDFA 2PZKA 3J7TA 1HDZA 2PT7A 3BA6A 3NBFA 2TMKA 3FPSA 1ZUHA 4TS3A 2I2AA 3D8HA 3KYDB 3MF4A 3Q41A 4EOGA 4YV1A 4W5QA 2XMBA 5ICSA 1TI7A 1ZK2A 1ZUIA 1G9XA 4REMA 4YJDA 5C52B 1JFSA 3HEAA 4C88A 4TT8A 4XPZA 1G3IA 4HKTA 3GFQA 3REGA 4C4ZA 2J45A 5HJEA 1OXSC 3GLHB 5G4LA 3A6PC 1K0UA 3QWAA 3JSAA 1I6KA 4JVNA 2CVZA 1USGA 2XE6A 3ZWDA 1WRBA 1K6MA 2WM9B 3E5RA 2Y1XA 2G77B 4INPA 3OQOA 4LCJA 4RHUA 5EIEA 2VSNA 2C3UA 2HU2A 4AIIA 3E05A 1YRHA 1CB7A 2FW6A 4PLYA 4D5EA 2ZJYA 3B8EA 5JDIC 1V16B 1Q1GA 3KQYA 4CUKA 3LYUA 2X8JB 4XB2A 5FPTA 4AUMA 1R3UA 3KZCA 1RKBA 4OQPA 3RVLA 4AYXA 1UZLA 2AA3A 1FA9A 4NABA 1NVFA 1OX6A 1UPTA 4MAAA 2E0IA 1OTXA 1GNQA 4Q9IA 2O06A 4NDNE 2ZXEA 3M9WA 4RPIA 3ZBUA 2PD6A 4I36A 4DJDC 4PSKA 5BQFA 1KNQA 5E6UB 1L5FA 2B7LA 2QU7A 2RKBA 1JWLA 4DMHA 2I6XA 3HDHA 3AWIA 4N5HX 4CN9A 3MUEA 4K03A 2CNDA 4C7XA 5IABA 1GUBA 3INRA 3NDBB 4TKUB 1U7PA 2YASA 4U2DA 2PFGA 3JWEA 4PAGA 4MWDA 1G2OA 3GGDA 1XDSA 1YC2A 1UMCB 3LQQA 1I7SB 3I9FA 4BLSA 3FETA 2QD1A 4DA8A 5EZYF 2VWPA 4JFRA 4JR0A 1SXPA 3GF4A 3L77A 1JLMA 3GP8A 3B1KA 2Q27A 5H0IA 3S8EA 1BU5A 1ZO8A 2POCA 2ZWVA 3QBJA 5BSMA 3RPEA 1J9ZA 4K3VA 3TLGA 3VPAA 3WIOA 4RVNA 1UJCA 3CH4B 1S7CA 1ODFA 1DJOA 4GOKA 1UDWA 3DEKA 3L0IB 4D92A 4DZRA 1FF9A 1BKDR 4GPBA 5CYPA 2JGRA 3L9WA 3PJEA 1WMEA 4E5MA 3DCIA 4YMSA 2NV2B 5A4JA 2FSUA 2ZSUA 1M75A 2WP0A 5BMOA 1XLWA 2LUOA 1O3YA 5DYGA 1QJ4A 3AR4A 1N7IA 3BTUA 4FQ5A 3UXEA 4UTPA 3SE7A 4D4GA 2A8YA 4JJZA 3RKRA 3V32A 1CUSA 2VHZA 2GUWA 1QB8A 5F1YA 1CFZA 1DMSA 3FDZB 5I7HA 1KMHA 3K4HA 1ZL2A 5HX7A 4NPAA 2XUZA 4BGVA 1U1CA 1W29A 2AEEA 4OQZA 4DA6A 2WG1A 4BNFA 4BQRA 5C7OO 1RADA 1R4MB 3KK0A 3HLKA 5LZ5A 5C81A 2Q0HA 4LOHA 3OZAA 1U7XA 1LPAB 3Q7EA 3CY6A 1AKUA 5JSHA 1N9KA 1VXOA 1RJGA 3U7EB 1QGOA 2XWPA 3EJWA 3EN0A 4NBVA 1UBNA 2C2MA 3KU1A 1HKUA 2K7ZA 4MKHA 2WIJA 4MW0A 4QDZA 5K3EA 1V71A 2D5IA 2R65A 4JJ6A 5FI5A 4G1VA 5EP1A 1FRQA 2JGAA 4CIWA 5L4NA 4BLQA 4BHTA 4R84A 4R69A 4ZKEA 1LWNA 2ADMA 1Q14A 2CMFA 2P4SA 3RT1A 5T64A 2P3SA 4ZT5A 3V8BA 2IDZA 5ICCA 1PJBA 1QRRA 1WR8A 3U80A 4UE3S 1K0FA 4WASA 2G3YA 1G20A 1GGJA 4B8WA 4YQYA 1QDEA 4IDQA 3LY8A 4Q47A 1Y42X 4LEIA 2XTMA 5CDYA 4X71A 1KVSA 1Y1KE 2OGTA 4RV5A 4MVJP 1CUIA 1D1TA 1LS6A 4QWMA 2QGZA 3H1EA 2UZ0A 2Z2KA 2I33A 2WUWE 5ALYA 3S27A 4DBVO 2QQEA 4NTZA 2RHLA 2Q5LA 2WM2A 4S1OA 4B6EA 1NVBA 1RBMA 4M2LA 3JASA 2Z6QA 1NMEA 4B3IA 4UOQA 3IUEA 1WSWA 1C7FA 1E60A 3GUVA 3QU4A 1RKXA 2WYIA 5EJ2A 4AIRA 1Y81A 2F3SA 2Y68A 4MKGA 3GT3A 2C58A 1A9ZA 4HOYA 4KGDA 3ZGXA 4ZTBA 3KELA 2COUA 3IB3A 1FJXA 3IVAA 1ADYA 1PLJA 3D2CA 3IIJA 4WJKB 5DNAA 3TAHA 4L9WA 3MWLA 4D99A 5C7YA 1MQSA 4EYOA 5CT8A 1B8OA 3IOMA 5TJHA 3Q7QA 3QU2A 2ZRMA 5HS6A 1YZKA 5JSQA 3IH5A 3ZGOA 2YWHA 2IBSA 3REQB 1SUFA 5HCUA 3GX1A 3VA7A 2FNAA 2HMUA 5JMOA 2MDTA 2BR4A 3DL2A 3PC7A 4G9BA 4DG5A 1KEKA 3L0BA 3U1VA 5JISA 1GKLA 1WCWA 3IHTA 2JRLA 4M60A 2DCUA 1ARZA 2G70A 3OZVA 1XCBA 1WVIA 3UVEA 2AMLA 1AKTA 1GQRA 3GEPA 2HNBA 1P3DA 1XTSA 5DTJA 5CG2A 1E94E 5KYTA 2ECPA 3G2LA 1NQOA 2H9YA 3E22A 3W7AA 1DAEA 2GN6A 1UJ2A 4PZYA 5CBPA 4IH4A 1CYDA 3SG0A 1VIMA 3WGJA 4OGKA 4O1HA 2YV4A 5ENZA 3Q8MA 4II7A 4B3SB 4U00A 1RWBA 3HH8A 2GZRA 3EEBA 3L1JA 4MQUA 3LZ6A 4RABA 3UT5B 1D09A 2H17A 5DNYB 3S5UA 4C4XA 2JANA 3CO0S 3DHWC 1EXWA 3KKOA 4M21A 4PQGA 4BNJA 3EVAA 4I9HA 1GZDA 2CJXA 3VR6A 1Z33A 3A4IA 1HKHA 2A9FA 1BC5A 3MCUA 1FC0A 4N9WA 1GPYA 4QYSA 4DJ5X 3HS3A 4LZLA 5AW0A 4HVCA 3R5XA 1XZDA 1UAGA 3OEEA 2Q6IA 4M1WA 5JXWA 5H8WA 1DC6A 1XZCA 2W6ID 4AI6A 3CZCA 4IS2A 5AQEA 4AG6A 3PKJA 2FN9A 4OI4A 3KHKA 5LB2A 3RYCA 1EG7A 2NW6A 5AXBA 5CA0A 4ZZ3A 1E61A 3ST7A 1RP1A 4IO1A 4CG0A 3DYIA 5D2CA 5JC8A 3E61A 5K0EA 2LPMA 4F60A 1I33A 2NT3A 4RLSA 4YONB 4YYEA 2JAOA 3GMIA 5A3JA 5EJ6A 4RWZA 3REOA 4DKXA 5DLQC 2LTAA 2O7SA 3NM6B 3KTAB 3JYHA 4MIYA 3I34X 4NU6A 4ZAXA 3TEMA 1XAHA 3E4CA 1Z5GA 3M4XA 3NT5A 2KSQA 3GRVA 5E6SB 3UAOA 4EKDA 1W44A 4OFXA 1IG3A 3OU6A 5EFZA 3WFZA 5JYBA 4ARZA 1FNNA 2GAIA 3ZXSA 2GJAA 3NHYA 1KC1A 5TMBA 4DLKA 5EESA 1CUUA 3AVTA 4RVOA 1VZ3A 2DE0X 2IL1A 1RZVA 4KYVA 4DNOA 4HNGA 2OD9A 5IK2A 4CEJB 2RGYA 2X1MA 3PU6A 3RFUA 1TU0A 3U61B 1VLLA 4PLPA 1M33A 5CLGA 3AY0A 2IS1A 1CUXA 5DWVA 2EKBA 1XMVA 4K1LA 1QRSA 5EZ5A 2Y2UA 3EBOA 1XFAA 3W5IA 1H94A 1SUAA 2ZETA 3QUBA 4I19A 4ND8B 3RI3A 4C2UA 3HV2A 2FFJA 4QHTA 2JCXA 1CZNA 2D1RA 1AGNA 2EFDB 3AH8A 3MTAA 3NWEA 4I81A 4K05A 1L7RA 2WEKA 5GVRA 1RC0A 3TLJA 1SHTX 4O6VA 2RHGB 4QUEA 1PEKE 1KJZA 5KOIA 2P3QA 1NXPA 1I4DD 1YWGO 2DAPA 2JFQA 1IBSA 1XAIA 4N82A 1LTKA 2K2QB 2QTBA 3ER9A 2GO7A 3TI7A 2JLQA 4P3NA 1ISGA 4UUBA 3HCNA 1D6MA 3LK6A 1QX4A 2VDWB 3PR1A 3RRNA 5B7NA 4GPD1 5M2QA 3WGVA 3RRYA 5K3CA 4OATA 3FNQA 1LX7A 1VGVA 1BMTA 1XJCA 3FMGA 5JBQA 1AN0A 3PICA 1GT91 1XU9A 1BHO1 4LK2A 4KAFA 2YXLA 2BCGY 5CT9A 2DFPA 2BEJA 2XRMA 3HY6A 1M1YE 4L76A 3LPCA 2W4IA 4JS0A 2Q45A 5KEIA 3GLFA 2ZU6A 4NDZA 5DU2A 4I9FA 5K20A 1YE8A 2HXSA 1CT9A 3KHTA 4FMCF 3DDNA 3T95A 3MG9A 3LDAA 4QQFA 2WQ6A 3R7DA 3SY8A 3MJFA 3B8HA 2IWHA 4R1QA 1U0NA 2YY6A 3OTOB 3OHSX 5ALHA 4GD3Q 1RMTA 1CTQA 3VZQA 1TM4E 5KSYA 2D7JA 4WZAB 3UJ6A 5LP1A 3DZDA 1XOIA 1POWA 3OP1A 1N2SA 4U63A 4A6PA 5DASA 4UTZA 3V4PB 4NZOA 2KQUA 1W4AA 4N6GA 1TA0A 1J0BA 2X41A 1NBEA 1NJ8A 1Z25A 1G19A 5HE9A 1YGPA 3MIIA 2C92A 2XMQA 3B5EA 1C7JA 1ZXXA 4C0QC 4HB2A 4B3TB 1JYSA 4RTJA 4WTOA 5T6BA 3H99A 3SZ3A 4YAFA 5K6TA 1N2EA 1OLUA 3B6KA 3PFFA 4GVLA 4JJ4A 1P5FA 1ORDA 1UZAA 2CD9A 1ESNA 3AHJA 1VJ0A 1AQUA 3ZLBA 4MI9A 4HP8A 1L5VA 4R6XA 3LVFO 4PG5A 4YJFA 2AGVA 4Z86A 2HHHB 4LHYA 4B7XA 1XZIA 1WEKA 1JHRA 4OJMX 3UM9A 3K0FB 4O5AA 4NK4A 5FFFA 3ONEA 5CTAA 5F33A 1JQ5A 3WRVA 2W6ZA 3EXFA 2FJPA 2X4LA 1C3VA 4FLEA 4GX1A 3K1JA 5IBQA 4FI3F 1IPHA 3IVRA 2XX3A 1QJCA 4WCFA 2AXNA 2PH3A 1CUWA 2H5JA 2OCXA 4KAJA 1KZ9A 3MSXA 2Q0SA 5BT8A 5CT5A 3VQTA 3NNNA 5BWMA 4U6NA 1NG9A 4JV5B 4CV0A 5LR6A 2R60A 2W98A 1G3MA 1JT2A 1JEQB 4BCCA 1JTVA 2C77A 1VBNA 1I14A 5K3AA 1LA2A 1ZRSA 1FE8A 3WK4A 4D2IA 2HHCA 1ZCFA 1QK5A 5AOCA 2GAFA 2ADFA 3VYUB 1R8YA 2EHJA 1Z5VA 4IJ6A 3RJ5A 4LWQA 3S2GA 1K86A 2YRXA 3DO6A 3OH8A 3AOEA 3O1HB 3A1FA 5FI3A 3ROGA 4AJIA 3V6MA 1XVLA 4IP0A 3U09A 1BDIA 1JE0A 3GVXA 3NHLA 2XVMA 4UVIA 1CNMA 2ZTUA 4MWZA 1YR8A 4G09A 4JODA 2F3PA 4BLOA 1D7AA 2AE2A 3IP6A 4C3UA 1XDUA 2FSPA 1WHTB 5B58T 1CF2O 2H7VA 3WK5A 2J32A 2LCIA 1U9YA 1Q1QA 2QT9A 5EWMA 3FYUC 3PIDA 3BFVA 2GAAA 3FBWA 2HYDA 4H6PA 1ELOA 1NBMA 4MRRA 5I6DA 5FEMA 3KOWA 2OD7A 1U3WA 3NONA 4B4OA 3IALA 1V39A 2ZVJA 4BX9A 3HBLA 5LYYA 5FQNA 5CEJA 2EW2A 2X0RA 1U9IA 5JZOA 4JAVC 3A9UA 4REQB 1TTPB 5BV8A 1VL6A 1A50B 3NB0A 2I2WA 1DWQA 2EF0A 2HMVA 5ILQA 3HN7A 5NLLA 1TMYA 3HYCA 3DLIA 4XIJA 5H80A 5ALEA 4L4YA 2GCIA 3L0YA 1W5SA 1PNTA 1LLDA 2JJ1A 4GS5A 3G9QA 4YASA 2XD4A 1HFJA 1KO4A 1LQTA 1SVLA 4UATA 4B4VA 3FTFA 2LZ0A 4X63A 3S0JA 1SUSA 1NAHA 2C1XA 2KWIA 4NCNA 4ZQBA 4CPDA 2WTUA 1A7AA 3SLRA 3QPCA 3Q8KA 1WABA 5AUQA 1SRRA 3PDIB 3WWYA 1G38A 1RQGA 2OUIA 2W6MA 3O95A 3A27A 3BGWA 4AC9A 1OH5A 2VJMA 4FQ8A 4HB0A 3CCBA 3AERA 1AH2A 4IKPA 2QM3A 2HSZA 1MH9A 3ZWVA 1OZFA 4BNKA 3R3XA 3T5CA 1ZJYA 1XCPA 4YC7A 3DOEA 3EMBA 2H59A 4YIKA 5AJZA 4HL6A 5KYVA 3L1HA 2NO4A 2ANCA 5CVUA 1TO6A 3PWSA 4D9NA 4EO9A 1FDVA 4GOLD 4JWKA 4MK4A 4UXIA 5A04A 2PM8A 3EIHA 1L6IA 1RFGE 4LE2A 2I55A 1RAGA 3SF8B 5JARA 3RKSA 2C7PA 1JSZA 4XDGA 3W78A 1FXWA 3OLQA 1WZEA 4OSPA 2OBXA 3LZDA 4Q4LA 4EFDA 4D9CA 5ES3A 2GZDA 3DW3X 4S0XA 2BM8A 3RR2A 4TTIA 4TUYA 2RGRA 2FZKA 3DLPX 4HWOA 4IIEA 1NN5A 3PR3A 5B4TA 5T41A 4YRSA 2H2GA 1U4SA 3D5TA 4GEKA 4IF6A 4A27A 3ZHRA 5EHZA 1HR0B 2DH6A 4MJXA 1PBTA 5KZMB 3GPCA 1I4LD 3CZPA 1TC1A 4FMPA 4JVOA 3RSQA 4DJFC 1YS2X 4WV3A 3HN2A 1JDBC 3LQRA 3NTQA 1SBQA 1FDIA 2MYTA 2YYZA 3K30A 4US1R 5ED0A 3VTFA 2J3LA 2X15A 4AXXA 2RAPA 2QG9A 2VXYA 2OO3A 5KKAA 5AM4A 2P2LA 2LRHA 3AEUA 2V1UA 4DV0B 4FMDB 1LX6A 4P4GA 4ONEA 3B3JA 4Z99A 5HCNA 1U3VA 4FCVA 1YTLA 1PUIA 1NW4A 3NVKI 4Q02A 1RE1A 2Y9MB 1A98A 1QYIA 1ZH0A 4JJFA 4RGBA 1SVIA 1Q16A 4U2GA 1YDWA 4TSFA 2EZ4A 3HP4A 2RBGA 5K8UA 4Y1RA 1LSUA 1FLAA 5JVDA 4TTQA 2KX7A 2W6CX 3AB7A 3SS7X 4PE5B 2QRPA 3SIRA 2VHCA 3DMDA 1UXIA 3OZCA 3EA5A 4OK3A 1E58A 5LNK1 2CJWB 3G1UA 2PGDA 1QX3A 4NARA 5LMCA 4CF6A 5FI0B 5JAPA 2AMVA 1TMKA 4DS3A 2PUEA 2FZLA 2Q50A 2EHDA 2BTQB 1X86B 2QPTA 4MS4A 5E4FA 5IVIA 2IXBA 2PJUA 4RYDA 1VA4A 1OV4A 2C7GA 2NV6A 1JLSA 2HXYA 3D6TB 2PUGA 3KFLA 2E1PA 1EWTA 1S1MA 2XVAA 3JXEA 3KYCA 3LA8A 3OE5A 3RS4A 2WZQA 3MQ4A 5ICGA 4XSVA 4ZAGA 4EYKA 2ZKLA 4EA9A 1AVTA 2UZ3A 3QMVA 2EG5A 4U7PB 1KXJA 5JALA 1U2GC 2QDKA 1JIJA 2HCJB 3AIKA 1KFJB 3EXHC 1KP9A 2Z8YA 3IVGA 1EBBA 1U8FO 3CNNA 4GSYA 5ALSA 3T1NA 5L6MB 3PRHA 4ZTZB 2PHZA 5K99A 1X87A 1F6WA 1YJXA 4AXBA 4HDMA 4G8BA 4GGPA 3ZWQA 4NH0A 3WQSB 4RJ2A 3VO2A 3RREA 1UZNA 1FJ2A 2CY0A 4QT0A 1CZLA 4ZAYA 2NN3C 5E9WA 2CGEA 3ZPXA 1QQ5A 4DBLE 3X3HA 3F7NA 3F97A 5CD1A 3C14C 1HNXB 3OBBA 2O3QA 1QQBA 4HMOA 4FGUA 3T5GA 5BOVA 5BN5B 5JNUA 5JH7B 3PFWO 1YQDA 4RIIA 4PSAA 3CEAA 3UB3A 5HKAA 3PNYA 5LOVB 2PKRA 1GFIA 2C57A 4BVBA 4EJ2A 1QGUA 2BKEA 3G2MA 3AEZA 4K9NA 2RB5A 5KNCH 3F73A 2FEKA 1U3DA 2PJRA 1BMQA 1V3VA 3HA7A 3LTEA 1P4JA 3X44A 2FKAA 2MSCB 4FUTA 4OCZA 3H9CA 5SZJA 4UNQA 3CBQA 3EPRA 2HWWA 4F4FA 4QYTA 4DG9A 5LNK6 1IVNA 1XTJA 1CJSA 1Z7BA 4WHMA 3ZTWA 2A1UB 1JJBA 1O95D 2X4DA 3RRZA 3ZUGA 5AQ1A 1YDFA 4WCFB 3W5SA 2GXAA 4K9SA 4E07A 2ASVA 3JQ6A 3DAFA 4KQGA 4V0KA 3MS7A 1RM0A 3KR2A 3CW9A 1J6UA 1X77A 3E0QA 1RABA 2XNDA 3PC3A 2XAUA 1D2RA 1GTJ1 3NV9A 3OZWA 3UENA 4PGAA 1RHRA 3CT6A 4TXJA 2VJAA 3HBJA 4FFRA 4ZCTA 2YCBA 5TIIA 2K87A 3JYQA 4N47A 3IBSA 1D0VA 4G65A 1F0KA 3I1YA 1ZCZA 4GOOD 5JSZA 2VDKB 2B8NA 2Q6OA 1Z6QA 2VT2A 2Q9BA 2C1EA 2ICAA 5FUBA 3ZX5A 5K0TA 4XTRA 1EEXB 2CXHA 3E23A 4JI7B 4U8GA 1K7XB 1YRLA 2Q5HA 1V3TA 2VZ0A 3CNLA 3MRXA 3KE9A 3O38A 1M8KA 4HQFA 5DN9A 4KXYA 5JO9A 5GJCA 5F23A 3PFKA 4UEKA 4CTMA 3N8NA 2ZYAA 3EISA 3PYMA 3W3AH 1RKVA 2WUGA 1ACMA 1CJUC 1RJ9A 3O6VA 3UJBA 2XVXA 3GGPA 2XF2A 2ZBFA 2G0AA 3GW8A 4KVGA 4R9SA 4FB4A 5KNDA 3F1LA 2IHVA 2XCIA 2ZUTA 3ZVMA 1NURA 2IXDA 1WDMA 4ZAFA 9ATCA 3AUUA 3JV7A 1EVJA 4A2QA 1TKRA 1W59A 3H2ZA 4LMAA 1O94A 3OQVA 3AVQA 4AF7A 2PVSA 4BV3A 4Z4FA 2YIMA 5HK8A 5HKKD 4MPTA 3AR9A 1ZD3A 5ALDA 2OFOA 2B1IA 1Y8AA 1C9MA 5MDHA 3OQIB 4ZVNA 2PUHA 2RHCA 3HMKA 2CVHA 4C7KA 2IOFA 3QU9A 1KBOA 1VMIA 3PC8C 1F8YA 2HTFA 1FMTA 3ENVA 2BMWA 1VI5A 2ZI5A 2Q49A 3UHJA 2YWRA 4ESHA 2NX2A 2ZTSA 2C4TA 4MITA 5LOVF 2OB1A 3QVMA 1UFKA 4JJKA 3ZGLA 5L9AA 2Z2ZA 1XVTA 3I9V6 3ECAA 3UGJA 1R6BX 2O8CA 4NAVA 2BZGA 5AJTA 3ABQB 2Q3HA 2JLXA 1L6RA 1GYPA 4UFOA 2O3TA 5AHOA 3S1AB 4LJ8A 3UJCA 1Z4LA 2I54A 1WKVA 2VTEA 2JJMA 2V97A 2ZATA 2SNIE 3V2HA 4CKWB 2NUBA 1NJ2A 4OLHA 3PXAA 4OLJA 1U90A 1PQYA 3L7NA 1XGKA 4B71A 1YGYA 1T35A 3ADOA 1PLKA 4E4TA 2O54A 1YI8A 4JITA 2CYCA 3SZUA 1U63A 2J3IA 1C8LA 2JEZA 3OQ6A 3N2YA 2C5AA 3GRFA 4MAFA 3G2HA 3QSYA 3KR0A 3LECA 1U2TA 2IHJA 4UCWA 5CNMA 2CLMB 4IUDS 4L5CA 3PSAA 3WC4A 1PI3A 3SQMA 3WP1B 1UANA 2C2WA 1O4WA 2BFPA 3JVDA 2FPIA 3LY5A 2NTJA 2DJ5A 4R2LA 4YREA 3GLKA 2XT9A 4OB8A 3FCCA 4QQRA 4PF1A 5EIBC 1E32A 3T7RA 1N5RA 1NIJA 3K0EA 3QPBA 4HDRA 1IPEA 4AJPA 4CJXA 4YDQA 1JQ3A 3WJAA 4M46A 2AIRA 4E5NA 1J20A 2W90A 2X4IA 3IP7A 4M1QA 2QP9X 4S2UA 4EB0A