2QRNA

Human deoxycytidine kinase dcmp, udp, mg ion product complex
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
241
structure length
228
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of human deoxycytidine kinase product complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Deoxycytidine kinase
total genus 81
structure length 228
sequence length 241
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2007-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qrnA00
2WJGA 2C95A 5JSZA 4OQNA 1WCV1 2BMDA 2QTVB 4JVNA 2ODWA 4LK2A 4MUAA 4WXRA 5TDHA 3O8BA 3CRW1 3B1VA 4DCNA 2XOKA 1Z6AA 1P3JA 2XITA 4R2HA 4F7WA 2LKCA 4RD2A 2PLFA 2YWGA 4X8MA 4YLGA 3SDZA 3K1JA 4P3YA 1FZQA 2B7CA 3OIVA 2IA5A 3UK6A 1XMVA 1XP8A 1GIAA 4Q1DA 4F4CA 2IHBA 2FEOA 5FFMA 3TSZA 5KNBA 1BOFA 3ZLJA 2CHVA 1VKJA 2GJAA 4D0NA 4DXAA 3HPRA 1KZ7B 1FNMA 4PC6A 3ZVRA 1UEJA 2GTPA 1LF5A 4Q9KA 4JT4A 4XSGA 3UPUA 4Q47A 3AVQA 2GF0A 1XD2B 2W0SA 5HKKD 1LTQA 1XD9A 2HCBA 1F2UA 2BKEA 3AVUA 4BEBA 2ZTSA 3FMIA 3Q5EA 1P62B 4XWAA 5L3SA 2IYUA 1OH5A 1QHIA 2RGAA 4ACBA 1U81A 2EYUA 1XJCA 2ORIA 1YE8A 3BERA 3H2YA 1TQ4A 3OAAA 4B3XA 5BYKA 2IS2A 4CGZA 1D8TA 4B48A 4MRSA 4B3GA 1Q0UA 2J7KA 4TMTA 3T06B 3PEYA 3OEHD 3TSOA 1G41A 2GILA 1Z22A 3D7MA 4Q4JB 3ZIAD 4XTCS 2CHQA 1COWD 2KWIA 4UNNA 1Z2AA 1E1RA 4NYIQ 5GJBA 4WIAA 2GEUA 2W6IA 2HYDA 2YJTD 3B6EA 1E2EA 2EFCB 5DH9A 1E94E 3B5JA 5L3SB 2W00A 3T35A 5KDOA 5DHFA 1A2BA 5JMTA 3NWJA 4IW3B 3WP0A 1YR6A 1YRAA 2BJWA 2GNOA 2VP0A 4Q18A 1ZM9A 3ICQB 1W2HA 4FWIB 4LZZA 3EC2A 5FUXA 1W5SA 2ZI3A 4M1KA 3SZRA 4B2IA 4WZAE 3K9LA 2C04A 3U7EB 3EPKA 3K9HA 4S2EA 4O3MA 1KDOA 1XBTA 3CX7A 2FSHA 2F43A 2ODBA 2FWRA 4DWJA 1FTSA 2ZRDA 1FX0B 1R0XA 4MH0R 2DY1A 4RCYA 4WZBE 4II7A 1TEXA 1W0JD 5E4FA 4AD8A 2QEQA 2RH5A 2IYQA 3LBIA 1JEDA 3O47A 2GETA 2O8EA 1VG9B 1Q1EA 2Q9AA 3FKSA 5AUOB 5IRCD 4HLUC 3SQXA 1Q3TA 3EPJA 1XXHB 4Q7JB 4RVCA 3A1SA 3N70A 5FTNA 5J5CA 1RIFA 4R98A 1WA5A 2NO9A 5CJPA 3THXA 4B35A 1KSHA 1AZTA 2B92A 2GF9A 5BWMA 4G01B 4ZDKA 4CF7A 4ZDJA 2EWWA 1SVLA 1E99A 2R6FA 1DO0A 4PO9A 3RAPR 1QVAA 1C4OA 1H65A 3RSOA 4ITRC 1NMYA 3SFZA 3R9WA 1GRQA 2I3BA 5KDDA 5H8WA 3VKHA 3ZH9B 1M7GA 3KJGA 5F3WB 4C0SA 1NKSA 1QBKC 4Q9JA 1LNZA 3F8TA 1EX6A 1ONBA 4TMVA 3TW4A 4HSEA 1DG3A 1GNPA 1DS6A 4RCZA 4V02A 1II0A 5EP3A 2NO6A 2XNDA 2IF0A 2GZDA 4KYIB 3C41J 1G4UR 2PMKA 5D3QA 4B75A 4IKEA 1GL9B 1YHNA 4DUGA 4TZ6A 2WM9B 2FPKA 2GBLC 2RGBA 3CM0A 3MWYW 3LA6A 1Z83A 3SQWA 1YZKA 3NBYC 1DTSA 1OIVA 3LW7A 4GMDA 4OHYA 1RJ9B 1JXOA 3OIWA 3OE7D 4OI0A 1N3BA 1VECA 1GZSA 5E95A 2AN9A 4A36A 3H86A 2OBLA 2BBOA 3BS4A 1HTWA 2ZE8A 4LBVA 3ZVMA 3NC0C 4MRNA 4HDOB 1X8JA 2CE2X 2ZSDA 4DLVA 3AF0A 2GWHA 2O0HA 1S1MA 5DYGA 3SR0A 1KGDA 3SI7A 1W36B 3U3KA 2IUSA 5FPKA 1E2JA 4RFSA 1MO4A 4Q4LA 1IJEA 4HUQA 2KSQA 2XNSA 5FUVA 1DVRA 2OLKA 3FHOA 1TU3A 2CL7X 3BH0A 4NCNA 2REXB 4PO1A 1HY3A 1X86B 4GNKA 2DWOA 1E6CA 4C0JA 3ZDQA 3VHLB 1U98A 2RMKA 3VNVA 3IEVA 4BZXA 3BGWA 2EW1A 2Z6VA 2PCLA 4GZMA 4BFSA 4Q1FA 2QAGA 3CIOA 1KDTA 2KI5A 3X2SA 4MKGA 2X1VA 1VG8A 2AL7A 5A5GA 1H8HA 4Q1AA 3X1DA 4HDCA 4RD0A 2O8BA 5EUQB 2R9VA 1VYTA 4IEIA 4BEJA 3BB4A 4QFMA 2FF7A 2QUZA 4URWR 4DSOA 1Z0IA 4JYBA 3UG7A 1JR3A 2XOKD 1KI2A 3M4YA 2YV5A 2GZHA 1Q12A 1MOZA 1Z08A 3BIFA 5H1YA 3RABA 3ND8A 4YXWD 3EXAA 2QMHA 4C0HA 4DT1B 1ZU5A 3IQXA 4TLAA 1M6NA 3RS0A 3E1SA 4DEXA 2GCOA 2IWRA 1E79A 2OT3B 3ZQ6A 3RS5A 4HZUA 4F93B 1RYFA 4HI0E 1FUKA 2J9RA 2J7PD 5G53C 1NVXQ 2ZRBA 2UVQA 5FBRB 1GSIA 5DHAA 4KU4A 2IWHA 1II8B 3MJHA 2ZYUX 3UIEA 2D74A 2V55B 1UF9A 5TVKA 3AKDA 1F2TA 3GJ7A 4AYTA 3OESA 2ZJZA 1G6HA 2XSZA 4ZKEA 1T9HA 1EFCA 4HZUB 5C18A 3QQ5A 3DOEA 1ZBDA 3QVVA 3PJRA 4WZ6A 3IGFA 2FSFA 3OAAD 1G64A 5J4YA 3K0FA 1IM2A 1XTRA 3T1QA 1MO6A 4LC0A 5JCPA 1J8YF 3RVBA 2IS6A 3PEVA 1Q21A 3EAQA 1GILA 1U94A 1ZVQA 3AP2A 2JEOA 3TE6A 4AURA 2UZIR 1S0UA 5BN4A 3QJYA 2IYZA 5HCIA 5DO9A 1T8TA 2OO7A 4GDFA 2FJUA 4DCVA 1X1RA 2ZSBA 4PSVA 1LVGA 3BXZA 5GADl 2A78A 3VKGA 1N0VC 2GAOA 4NYMR 4TN1A 1K8RA 1KJZA 4HB4A 4LJYA 2ZUDA 3HJNA 5FOVA 2WWWA 1SVMA 4ESVA 4NL4H 2V9PA 3GJ4A 5KPJA 4LPSA 2NPFA 4C0AC 1GUAA 2BEJA 4Q7MB 4QJ4A 3RRZA 4FD2A 4C2UA 4KI0A 3K0AB 2VSFA 3I5YA 1MKYA 3FDIA 5SZJA 2BJVA 1D6JA 4HZIA 4KFTA 4LI0A 2D4HA 1JNYA 3KFVA 1E9RA 4OI1A 1Z29A 1E2GA 2CLSA 5IK2A 1KY3A 1YRBA 2ZANA 4RD4A 3KQHA 1ZW6A 2XSZD 4QC2A 5FUWA 2IYWA 3GJ0A 2DPXA 3FMPB 3R7WA 4DCUA 2QA5A 2VRWA 3LLMA 2DR3A 2GK6A 3B9PA 1E2MA 3QI2A 2OLJA 1D9XA 2ZXUA 4CEIB 2XEXA 2FSIA 4O0MA 4MDFA 2K5UA 5DE3A 1T3SA 1YZLA 1NKTA 1VCOA 2OE2A 2VHJA 4W5WA 4PFSA 5EXSA 4RKFA 2ZROA 1G19A 2QMEA 5E7IA 2ZU0C 5FOXA 4JJZA 1BYIA 3R8CA 1TU4A 5FR1A 3ZVNA 2PT5A 5B57C 1UAAA 3V4RA 2ZREA 1OYYA 4R7ZA 1OB2A 1TADA 2QPOA 3CRRA 5L8VA 2ZIAA 2QPAA 2AKYA 5J4LA 5CYPA 3U4QB 3THYB 3LV8A 1ESNA 2C99A 1LV7A 1W47A 1ZD9A 3GLHA 3MMPA 5DSZA 3VFDA 3MAAC 3AQ4A 5G40A 2MSDB 2ZRHA 1OH8A 1CF4A 4TYNA 1VMAA 1XEWY 5J4HA 4UNQA 3PUYA 4OK5A 3RHFA 5CDFE 2JLVA 5FL7A 3EA5A 1IN5A 3NG1A 4AKIA 2HUPA 1ZCAA 2ECKA 1DE0A 4FCVA 3QPVA 4LBYA 3W90A 1QG4A 2A3RA 3L0SA 4O2LA 3TUIC 3L82B 1PUIA 4TQUS 2F1JA 5FPSA 4HB2A 4ZIRA 1NVVQ 3I72A 1L4YA 4Q21A 3WP1B 3T12A 4QBHA 4QM6A 4ASUD 2WZQA 4PO8A 3RANA 1P72A 1UKVY 1G17A 3V4FA 3P1JA 1OT3A 2X2EA 3VR4A 3CPJB 3C5HA 4HAYA 1CP2A 3U60B 4QGGA 2QMOA 4L9SA 4OL0A 3GLIA 2ZSFA 3R20A 5DIFA 3FKSD 3R8FA 3K9GA 4LBZA 3QEOA 1ZU4A 4U00A 3FGNA 3QKTA 1H8EA 4WVFA 5JECA 4NPHA 3V9PA 4B6FA 2ZJBA 2BCGY 3NXSA 3RC8A 4B3FX 1NP6A 3NH9A 3TQFA 2YWFA 5FUYA 1GFIA 1OPXA 4B74A 2C8VA 3VR2A 1BYUA 1D2NA 2HJGA 3I8SA 4M9ZA 1CIPA 1QDEA 4PHHA 2BBWA 4JIMA 3TR5A 4A0GA 3AVXA 1E9CA 3BBPA 5G3YA 1CLUA 1RPZA 1G5TA 4HYYA 3TLXA 4A0HA 3BORA 1QF9A 2MSEB 2R8RA 4J0QA 4JKYA 3TVTA 1FMJA 2ZR9A 4MKIA 1AN0A 4NYJR 1Q22A 3NIBA 4C0LA 4TSFA 1ZINA 3IIJA 4N1AA 4ARZB 5JEDA 4XD7A 1VIAA 2ZUBA 1E98A 2QTHA 4MRVA 1QHYA 2GJSA 4Q5IA 1Q57A 5SZIA 2XTMA 1XEXB 2GZAA 2ZI5A 4BLPA 4D6PA 1Z0AA 2PZGA 4S35A 3KB1A 4LJ5A 2FZ4A 3W34A 4JVSB 1IN7A 3P4YA 2XXAB 4P4SB 3KB2A 4ASUA 4URXR 3LH5A 4EJSB 1GP2A 3AF2A 3KQKA 1CR2A 1F2UB 5JRZA 3ADKA 2CL6X 1S3GA 2FOLA 1OJLA 1R4AA 3LO5A 4LYAA 4Q1BA 4RZUA 3VR5A 5B64A 5IT5A 3TJZA 2F43B 3OZXA 1TTTA 4RFVA 5UKDA 1FX0A 4XVQA 3N2IA 4L16A 5IK2D 2O0KA 5B2ZA 4A6PA 4HAVA 2J0UB 4A2WA 5M04A 2OCAA 3GEHA 3EIHA 3H1TA 4ILEA 1T5LA 4M2LA 4A92A 2KBFA 5C46F 5KO2A 2V6JA 4OQMA 3QPWA 1SXJE 1WF3A 2NTYC 5FTLA 1NSFA 1W0KA 1Z0DA 1C1YA 4AYXA 3WY9A 4HEJA 2QM7A 1XB2A 3B2EA 3DZ8A 2R6CA 4BZPA 4YDHB 1S96A 2ZI7A 5EP2A 4MYUA 1R5BA 2PJZA 3KXIA 2XB2A 4PPNA 2J0UA 4PX9A 8OHMA 1SVSA 2FFAA 2J87A 3JVVA 4CEIA 4LHZA 4K46A 4JLMA 5CLQA 5AK0A 3O8DA 4V0LA 3VTKA 2NGRA 3TBKA 2ZRPA 3LWNA 1SVWA 1T4GA 2JGNA 2Q3MA 1NJFA 1ESMA 2BKUA 1PJRA 2ZEJA 1SXJA 3QEJA 2F3TA 3LRPA 4R2IA 4RY2A 4Z8YA 4YMTA 2ZQ5A 4GOJA 4YMUA 3P26A 5BW8A 4LJ4A 1I4DD 2VF8A 1JR3D 4UJ3A 4XSHA 1V5WA 3C15C 2A9KA 2OZEA 4YXWA 2HEIA 4ZDWA 2B7BA 1GTVA 2ZS8A 1CRPA 3CLVA 1NIPA 4JYCA 1ZUNB 3C4JA 5LB4A 3AP3A 3MUFA 3AF1A 3DM5A 4L5BA 1XXHA 2CCKA 4FMDB 4B2PA 1FQKA 1KDRA 2FSGA 5JZVA 1N6RA 2GA8A 4C0KA 1OHHA 2B21A 1EFUA 1YZTA 4AG5A 1OF1A 1XNJA 2JLRA 5JLJA 1GDDA 1XEWX 2NG1A 3CWZA 1G3RA 3H0KA 1G7SA 2QTFA 4HAZA 3B85A 4ZI2A 2QSZA 3OFND 4LJ8A 2WSSA 3CH4B 5JHHB 2ZJYA 4AWXA 4WAUA 1NLYA 2VIIA 3I92A 4QHSA 1P75A 3RLFA 1ZM7A 1Z8FA 2P5TB 4EPWA 3GD7A 1NY5A 5A4JA 1VTKA 2JJ2D 4M21A 2A5JA 3A8TA 3GLIB 1KO1A 1P6XA 2F3RA 4IDQA 3LBHA 2PZFA 1K6MA 3KZ1E 5JJLA 1SVIA 4F92B 2B8WA 2HJVA 1ZIOA 3Q9LA 4QNRA 4DBLC 2C9YA 3SS8A 4D26A 4TYWA 2V6IA 4D4JA 4F91B 4RKEA 4A1FA 1MRNA 1HH4A 3AKCA 3TQCA 2X77A 2D62A 5D3MA 5AJWA 4HLCA 5DYIA 4LV5B 3BFKA 2HXYA 3AH8A 1E2QA 2O8BB 1YVDA 2HF9A 4XTRA 4MRPA 3H4MA 3BB3A 1Z6GA 4UKDA 1W5TA 4A6XA 4DDTA 2KBEA 5HCNA 4JBXA 1KKMA 1R5NA 1RYHA 1CS4C 2XB4A 1KDPA 1LS1A 3U7GA 4JLOA 1XF9A 1UFQA 1A7JA 1K5DA 1N6NA 1NG1A 2QE7D 3BD9A 3EW9A 1F60A 4G5GA 4C3ZA 3PG5A 3V00A 3VX3A 1Q20A 1EFHA 3AF3A 1ZUHA 2OFOA 1S1CA 5ANRB 2OCBA 4HAXA 4PAQA 4B34A 3AVWA 1E4YA 1VCIA 2GCOB 2NOAA 4XWKA 1D2MA 1W4RA 2OEPA 3RC3A 1FP7A 2G6BA 1X6VA 4NYJQ 1S2MA 1T6NA 1J8MF 2GJ8A 4HAUA 3E2IA 3CONA 3TAHA 1RZ3A 3X1XA 5DN6A 4P4SA 3U3RA 3B9QA 1MABB 3NC1C 3TMKA 2QRZA 3BWDD 3CUEF 1F48A 4LDJA 2F9LA 2NIPA 3X1WA 3HR8A 4JZKA 1I2MA 5TXGA 4ESHA 1RKBA 2JASA 2OV2A 2IYSA 1IOZA 3CF2A 3GJ8A 2VHUA 1E69A 4C2TA 2E87A 3IILA 1ZC3A 2Z43A 5L3RA 4U5XA 4IOMA 3KTAA 4LV6A 1OFHA 3FFAA 1OW3B 3E5HA 3C16C 4LJ9A 4BFXA 3K0SA 2FH5B 2GXAA 3VR3A 1QZXA 2IYXA 2ZRFA 2VSOA 3PEUA 4XH9B 1UPTA 4URVR 4TT3D 4TMWA 1GWNA 2ZE6A 3GJ5A 3SHWA 3RS4A 1UBGA 2IYRA 3S1AB 1JR3E 4GOKA 5KNDA 2QBYA 4G5RA 1FMLA 3NEYA 5FTMA 1TQDA 4M1OA 1QHXA 1KMQA 1DAIA 2QY9A 1Z0KA 3BJIC 1F3OA 821PA 2D7CA 2QU8A 1E9DA 1XMSA 4XWOA 4ZKDA 3KJHA 4DC9A 5KPDA 3M6AA 2ODEA 5IF9A 1RE0A 3GLGA 1YZNA 3W3AA 4M1TA 2Z4RA 1KO7A 1UKZA 4US0R 4KHZA 4GOXA 4LGMA 2H16A 4PPGA 3ZZ0A 4RD3A 4BFYA 2I1QA 4MITA 3ICEA 3ND9A 4IOKA 4LV8B 3U3OA 2SHKA 3B8HA 3L0IB 3H84A 1K5GA 2ATVA 1TAGA 3EASA 4V0OA 2CCJA 3WYFA 5F98A 1EWQA 5KSOA 1E96A 4GT1A 1KTVA 4L15A 1CTQA 1G21E 4KV9A 4Q02A 4UXJA 1AQYA 1XTJA 4A8JC 1KK3A 1HUQA 2HDNB 4B3CA 1MH1A 1BO6A 2W83A 1RRCA 3RYTC 1V43A 4PC7A 3ADDA 3NH6A 2XJ9A 2QN6A 1NY6A 4K8OA 4KVAA 4RZ3A 4DVGA 2PLRA 2ONJA 2AWNA 2JDID 3RRNA 2W6ID 3PUZA 1KJWA 1N6HA 2GJKA 5EUMA 3CPEA 3TRFA 4Q7LA 3AKEA 4PANA 1SXJD 2YNMA 4JLBA 3TW8B 2RGCA 2FEMA 2XTNA 4DSTA 3EX7C 3KQLA 4I1UA 1KNQA 3HU3A 1PLKA 2ZR7A 3WHLA 1LFDB 3MJRA 3I32A 2YC4C 2FV8A 3B78A 1XTKA 1MO5A 1TMKA 2C98A 4JLNA 2AFHE 3DKVA 2DFKB 2QT1A 1XFAA 1ZAKA 2LWIA 4LY6A 4M4SA 4NU0A 4ON9A 4P4TA 2ZM5A 1U0HC 3A1UA 2J59A 2H1LA 3EIQA 1OIWA 4DSUA 4NONA 2PL3A 3C5CA 3CRQA 4PQFA 3RWMB 3ASYA 3VR6A 4X8HA 1SHKA 4EFMA 4P4UA 1R2QA 2FE4A 2QROA 2G0NA 3IDQA 3GLFA 2H7VA 4YMWA 2F1RA 1CRQA 1NJGA 3WMEA 2ZYWX 2JIZD 4E22A 4EUNA 1XU4A 3B7GA 2KE5A 4TTRA 3T1OA 3NBFA 1ETUA 2O52A 4A2PA 2VP2A 2ZRLA 3L0OA 1LY1A 2CHGA 2VYFA 2Q9BA 1E2HA 3K0EA 3LX8A 2Q3FA 3RNLA 1GAJA 5SZHB 1KK1A 4BFWA 3CW2A 1W7AA 2D2EA 3CNNA 1CXZA 4B6EA 2JATA 2QMUA 3P4XA 1E32A 4KXFB 1G18A 1U8ZA 2PX0A 5EXPA 2JLUA 1JR6A 2FU5C 4MRRA 1VG0B 3K09A 4V0ME 4G0NA 4PR0A 4EPRA 5L3QB 5JSZB 4LOAA 3K8YA 4TYPA 4CT4B 2V1XA 4DIDA 3MD0A 1P5ZB 1ZCBA 2VQSA 3JVUA 2Z83A 3Q3JB 4A0FA 4OKSA 5JJIA 3IBYA 2W2VA 5GJVC 4C4PA 3QOFA 4TL6A 1RRPA 4B2LA 2EYQA 1MABA 4JKIA 1FTNA 1P9RA 5K8TA 1E1RD 1CR1A 2HLDD 4N0EA 2AXPA 2YYZA 1J2JA 3GFPA 5EE1A 3BH6A 3U5ZB 2OG2A 3DOFA 3MLEA 4BLSA 1KIMA 4XVUA 1DARA 4E03A 2RGEA 2A2ZA 2WJVA 1M7BA 3UANA 1R8QA 4AKGA 1CU1A 3REFA 1SKQA 5CDFA 3U6BA 4LHWA 4L8GA 3Q7QA 3EZ2A 1II8A 3WRXC 3OIUA 1W4BA 1G7RA 2LCFA 5SZKB 4MGYR 2C9OA 4M1WA 3O8CA 2JIZA 3A1WA 1D5CA 4GBMA 2FPLA 5F9HA 3AVPA 2BBTA 3NBZC 3LBNA 1KO4A 621PA 2ERYA 2QPTA 3NDPA 1Z3IX 1KY2A 4NE2A 1YR7A 2XXAA 3HPQA 1Q1QA 1W2GA 3DM9B 3HP1A 4GI7A 5C4MA 5K8UA 1R10A 2MMGA 4G5SA 4NCHA 3KKNA 2ZRJA 5FR2A 2ZETA 5GVSA 4MGKR 3WNCA 3BRWD 3WNBA 2R2AA 4NHOA 5JS8A 3CBQA 1DBSA 2DFNA 2QGZA 4NBSA 2XJ4A 5EXXA 1GM5A 4P0TA 5JI2E 2BC9A 2WVJA 3PENA 2WBLC 1UEIA 3THWA 1PZNA 1FW6A 3AM1A 4TLBA 4I1OA 3PCRB 1YKSA 2OILA 2OFWA 2AKAB 2X2FA 4V03A 2GXUA 1O87A 4OQLA 3GCGA 3QF4B 1YZGA 2VL7A 1N6KA 1ODFA 1U9IC 3A58B 1EFRA 1IQPA 5AJVB 4P32A 5JRJA 2GCPA 1GRRA 2P6RA 2VP9A 2ZI4A 3O8RA 1SKYB 4JBWA 2ASEA 3U44B 2CXXA 3THWB 1UBEA 4C0QC 1UKEA 1TX4B 4RJLA 3UATA 1HURA 2ZJAA 1YJ5A 4LHYA 1P7CA 3AVTA 3EZ6A 1N5KA 4I99A 1P61B 4D80A 3CZQA 1ZNZA 3Q85A 4M1YA 4X8LA 2FN4A 3VMFA 1R0WA 2AR7A 2ZPTX 2WJIA 2VPPA 3PIRA 1DAGA 1LB1B 1Q1ZA 3PXGA 2V8OA 4POAA 2AWOA 1HE1C 1E3MA 1Z47A 4JVLA 4A8JA 1BH2A 1OXTA 5H68A 1JQLB 1A1VA 4PC2A 5C4GB 4PXAA 3R9XA 1AS2A 2YWHA 1FOEB 2ATXA 1Z5ZA 4TQAA 4HATA 4CEHA 2NQ2C 2IC5A 4I4LA 5JHGB 1KK0A 4WA7A 4AIIA 5F9FA 1NL3A 3SHFA 3T5GA 4OI2A 3SE0A 4FW9A 4NCKA 5K8LA 3SYNA 2EU8A 1QG2A 4GZLA 5EJEA 2J1LA 2GK7A 1QHGA 4QGHA 4Q9HA 4WOPA 4BLRA 3AF4A 4EQ6B 3EIEA 1U9IA 1R7RA 4RSGA 2GVZC 1QHSA 4PZYA 1VCMA 4R71A 1W4AA 3GP8A 3WXMA 2OXCA 5FOUA 1G3QA 1Z63A 1Z28A 3QE0A 4QJ3A 3CRVA 121PA 2RGDA 4NTZA 1Z6XA 4KITB 1ZNXA 5CLLA 3EG5A 5TV2A 4US2R 3RDPA 2O8CB 3ETLA 1WDTA 2YVUA 4IDOA 1YR9A 4PHTA 2J46A 4XJXA 5BQ5A 4BWYA 2JLQA 1SHZA 3GJ6A 2OESA 4YDSA 2BBSA 5FPHA 3SFVA 2W2XA 4PZLA 3C8UA 3KXLA 1XD2A 3I8XA 5HTKA 4B76A 4XOIA 1HT1E 4FMCF 2YZ2A 2RHMA 1IAQA 1SXJC 3VQTA 3GQBA 2CMKA 5FPTA 2QORA 4A82A 2V4ZA 2QL6A 2G9NA 3CNLA 5LBIA 2J0QA 3DL0A 2WKPA 1G8HA 3CF0A 3KKMA 3EZ7A 1ZNWA 4YQFA 3K09C 1EFTA 2EFHB 2A5FA 2VP4A 3IBGA 4PPQA 3J81k 5AJYA 1ZNYA 2VA8A 3FFBA 3OEEA 3T5DA 3PQCA 1VYUA 5CM8B 2YOHA 2XX3A 4N0DA 1E0KA 4URYR 3MWKA 4NKRA 4GL2A 4V0NA 1TUIA 1NVUQ 1KI9A 3KDSE 3QENA 4HLUA 2R6AA 4KVGA 4V0KA 1G20E 5P21A 4BE7B 4CYMA 4QKQA 3BAFA 1XTIA 2ZRIA 4IOJA 1HYQA 3ZJYA 4HDQB 2ZR0A 1D9ZA 4D0GA 1US8B 4QL3A 4D2IA 2OBNA 4IDPA 4DLTA 4MDEA 2OBMA 5FBWB 1FL9A 1MR3F 4M9QA 5B58C 3IO3A 4MYCA 5DI9A 1UDWA 2R65A 1KSGA 4B43A 2ZUCA 1A5TA 1KHTA 2ZS9A 4HB3A 2HLDA 3QKUA 2C03A 1OIXA 4QG7A 1J99A 1XTQA 3FYHA 1P60A 1S4QA 1IY0A 3DHWC 3PUVA 2J0VA 3SYLA 1Q1BA 2KB0A 2BDTA 3QY0A 2FMXA 3AVYA 4Z1MD 3ECCA 4G1UC 4LBWA 4EFLA 4YONB 3ZVLA 3TUJC 1OLOA 1BS1A 3AVVA 2PBRA 1ZM2A 1FQJA 4BLQA 3KKPA 3WMGA 4CIDA 2O8EB 1XJQA 2CVFA 3I1FA 1DOAA 4JLPA 2JLSA 1T0JB 2IYTA 4IEEA 4KODA 3SN6A 3ADCA 4OBEA 4OJKA 3QXHA 2BV3A 4ZCMA 1L7VC 1MO3A 3MWJA 4TL8A 5FOTA 5GJWC 1IBRA 4B71A 1E1QD 2PX3A 4V0MA 3ZZTA 5KUTA 3MWLA 3P27A 1XJ0A 5CB8A 2AX4A 3NHAA 3KXKA 2YOFA 5DI3B 3OEED 3I61A 1GNRA 3A6PC 2WMOB 2WWFA 4GPTA 5JCZA 1DAFA 5GVRA 2G83A 5EQTA 3D3QA 2QNRA 2JLZA 1VDZA 2OCPA 4TLCA 2CL0X 3QKSA 2XTZA 3SBEA 2GEVA 1Q44A 4TZ0A 2IUUA 1Z2CA 3EZFA 3QG5A 2RGXA 4PQRA 1XX6A 2P3SA 2ZITA 1AA9A 3L8ZA 4FCWA 4M8NE 4Z51A 1FP6A 1SXJB 3RSLA 1SGWA 1CJTC 4C7OB 1KYIA 2J45A 4OJQA 3UKDA 2ERXA 1JXMA 1EFRD 1Z6TA 2C96A 4DCSA 1S8FA 3SJZA 1XCGB 1JAIA 1E0AA 1RJ9A 4YC7A 1I2DA 3EPHA 3P20A 1VPLA 5J4VA 4QM7A 4NH0A 1TUEA 3A37A 1M74A 4NCIA 4TYQA 2DYKA 4PQYA 3CX8A 4KJZA 1P2VA 1U0LA 1NIJA 2GHIA 2QSYA 1E2DA 1NBME 2QRNA 1XMIA 2NPIA 3BB1A 3IEUA 4BFUA 4HAWA 3A4NA 5FL7D 221PA 1NI3A 2REBA 3DVLA 1SQ5A 5EP1A 1W0JA 1R0YA 4AYWA 3CF6R 3NHBA 2DWPA 3B13B 2XZPA 5FOWA 1N6IA 4ZCLA 4TL9A 4US1R 2ZAMA 2Y8EA 4JMPA 4M9XA 4DKXA 2ZSEA 3G82C 4EKDA 1TQ6A 3D31A 2IHYA 4Q1CA 1GVNB 1KOFA 1P9NA 2FFHA 4DB2A 1G6OA 4IDHA 1FNNA 3IKJA 4JLDA 1OXVA 4JLKA 1IONA 1JJVA 1M8PA 3UXMA 4EPTA 1OSNA 4OK3A 2ZRCA 4PTLA 5KHOC 3UWKA 1WBBA 3L2OB 2P5SA 4AK9A 1IXRC 4UJ5A 2IUTA 2AK2A 4TL7A 3U3MA 1KKLA 2VEDA 1A2KC 2ORWA 3LVQE 1CEEA 1YU9A 1H8ED 3IIMA 3U7HB 2V7QD 1Z6YA 2ZI9A 1CR4A 2N46A 2GJ9A 1KO8A 2ZSAA 3FKQA 2J0SA 1X8KA 1VHLA 2YC2C 4BUJA 1N6OA 2L0XA 1HQYE 3PUWA 1HE8B 1E9SA 2XNDD 2G77B 2P65A 3FE2A 4EAQA 421PA 1RRGA 2WKQA 2WOOA 1UDXA 1EESA 1L2TA 1T91A 1LF0A 4OHZA 3T61A 3CWQA 1PV4A 4FMDF 1U99A 3SJBA 1G7TA 1JECA 2RKOA 2NO7A 2CE7A 4JL8A 1JPNA 1G291 2WHXA 3EPLA 1G8YA 5AJXA 2DHRA 4BECA 2PEZA 2IXGA 2VO1A 1W49A 2NMVA 1SKYE 1UADA 2W0MA 2O8FA 2FZLA 4Q19A 1T3LA 3LFUA 2PT7A 4WXPA 5BN5A 1JPJA 4CDGA 1C9KA 2CDNA 5TY0A 1KSJA 1O3YA 4Q00A 5J47A 1N5LA 1TQ2A 3FVQA 2HT1A 2IK8A 4DT1A 4DDVA 1PLLA 5FI0B 2BM1A 5FPYA 1FPMA 4EPVA 1W1WA 4OK6A 4IXNA 5JWOA 4TTPA 1QRAA 2QGNA 4B3DA 3GLIE 3CRMA 3KKQA 4RZ2A 2CCGA 3EC1A 1OV4A 1GITA 1GKYA 3CR8A 2JJ2A 3TVDA 4DLWA 4MKHA 3WRYC 3QKRA 1N0UA 5LPNA 4KSBA 2CNWD 2BEKA 1OXUA 2IBMA 3WYAA 1TF2A 3TIFA 1SULA 2QP4A 4OHWA 4W7SA 1KI6A 1T5IA 5LD2B 3UWOA 3G5UA 1G7CA 4UNRA 2H17A 3DZDA 2F7SA 3QKSB 1IY1A 4GP6A 2MMCA 3GPLA 1S9DA 4TSFD 4NDZA 4LPKA 1EK0A 2FNAA 3GFOA 1AGPA 1DADA 1DELA 1KNXA 4JLAA 3BFXA 3RS3A 3QKRB 4ZO4A 4EJSA 1Y63A 3WNDA 1M1YE 1WMSA 2R62A 4Q9LA 3AGQA 1N25A 4DIEA 1KI6B 1P4SA 2PH1A 1DEKA 1WP9A 2H8KA 4G5OA 1TF5A 2CJWB 4IRUB 4IHQA 1G4AE 4KBFA 4C7OA 3GEIA 4DLUA 4EFNA 1RVDA 2CEAA 3TGPA 5HR5A 1IY2A 1AGRA 2YWEA 3QUSA 4LC1A 3VAAA 1XDBA 5E7MA 3IUYA 3LXRA 2WICA 2JJ1D 1RFLA 2NZJA 2WIAA 5JWRA 1P73A 2RGGA 2H18A 3KQNA 1N6LA 2OXRA 4Y0AA 1OE0A 1W48A 1KAGA 3BH7A 2ORVA 3L43A 3K0AA 3LNCA 4Q4AA 2BVNA 1VYVA 1CKEA 1XEFA 1VIYA 3ZD7A 2FFQA 4L4UA 1AQUA 2FDCA 2VP5A 1OXXK 2AD5A 3MFYA 1XZQA 3ZD6A 1RW4A 1E2LA 2ZI6A 4AG6A 2IYVA 5DNYB 2F55A 2FX3A 3DKPA 4LX0A 4IDNA 3A1TA 1KMHA 1KI3A 4RFSB 4TYYA 4OQFA 3GLGE 2HXSA 3OHMA 2WSSD 5DISB 1NLZA 1N2CE 2IL1A 3VHXA 1AIPA 1S9HA 5EE0A 2B6HA 3NEJA 3U44A 4DSNA 3LLUA 4GRAA 5L3QA 1IXSB 1M2OB 3ZS8A 1N0WA 2AFIE 3FTQA 3RS7A 1MRSA 3SOPA 1GNQA 1IXZA 1AKEA 1II9A 2RHDA 4FWTA 1YZUA 3RS2A 3LD9A 1KMHB 2P0EA 4DUGD 1WQ1R 3M1IA 2QAGB 4M53A 4Q03A 5HE8A 3EA0A 5CB6A 3K0CC 4LYFA 4Z1MA 4MGZR 1VCNA 4BFZA 2VLIA 1XCPA 4XD7D 2JA1A 3MRSA 2RAPA 4WW0A 5JWHA 3W8NA 3RRMA 4B73A 1JB1A 4E09A 4KLNA 4LCBA 2O8CA 1LW7A 5A0FA 3L8YA 1YR8A 4FIDA 3GLHB 1W44A 3TAUA 4DLXA 2FA9A 1UBFA 4PSAA 2JLXA 3NKVA 2WAYA 3QXSA 3KUDA 1WBDA 3QVUA 1P9WA 3LVRE 3VU9A 4PZZA 1AK2A 4BQSA 4O25A 1KJYA 1R6BX 1W36C 2ZVQX 5CJ2A 2ANBA 4FXPA 3VKWA 2O8FB 4IFBA 5C1BA 1E9FA 2VBCA 2V7QA 2HCJB 1L8QA 3FWYA 5IHPA 1XTSA 3HDTA 5D3MB 4KBGA 4NMMA 1H8HD 3CNOA 1E4VA 2LKDA 4MUBA 4M22A 2QG6A 2Z0MA 1I4LD 2Q3HA 5EE5B 4PPFA 1D2EA 4D25A 3HR7A 4Q7KA 2ZJ5A 4FI3C 1KI1A 2WAXA 4D82A 4MYHA 1NN1A 2WWXA 3CPHA 5HZHA 1JBKA 4KFSA 1IN8A 2VSXA 4UXIA 3MCAA 2FGKA 5FTJA 2N42A 4ACAA 4D81A 1ZD8A 4DLZA 3QIAA 1E0SA 4A4DA 5JBQA 4B33A 2AXNA 2EVWX 1NBMD 4Q48A 4DCTA 4QXAA 3WBJA 4LWZA 1AM4D 1W36D 5CIQA 2XAUA 2ZRMA 1E79D 2PZEA 2W2TA 1CULC 4R9UC 2RB4A 3NDBB 1AJEA 5EZ6B 3C7KA 3KX2A 2J7PA 4PAMA 2P6UA 1ELOA 1X3SA 2YOGA 3JZAA 3QSYA 4TTQA 4IJMA 2BHRA 3THOA 3WMFA 3CKLA 1RRFA 3HU2A 2QAJA 3SEAA 1GRNA 1KI8A 4AY2A 3OE7A 2VH5R 3FB4A 4ARZA 5KU1A 3KL4A 4CEJB 2IXFA 4NYIR 1X8LA 3TUZC 2CJWA 4PHGA 1FUUA 3TK1A 4RD1A 1OHHD 1AS3A 1IHUA 1KAOA 2UZ3A 2BWJA 1US8A 3W8RA 1OKKA 4CW7A 2GVDC 2EFDB 4FN5A 1XMJA 3SJAA 5BYJA 2WJYA 1GL7A 4MYTA 4DJTA 1PUJA 2AHOA 3Q72A 4HUTA 2CNWA 3I4LA 521PA 1F5NA 4AKEA 1B0UA 2CK3A 5C2JB 3KJEA 4CEJA 2GKSA 2OCYC 3IQWA 3FOZA 3S1AA 2G0TA 3T34A 1NN0A 2ANCA 2OAQ1 2OFXA 5LB2A 3WHKA 2GXSA 2YINC 4QRHA 4IFEA 3K70C 3KUCA 2GAAA 2QI9C 3GJXC 5E7JA 1NMXA 1R8SA 2C77A 2JLWA 5KSZA 1AS0A 2GCNA 1Q3HA 2ZYTX 1ZC4A 5CIWA 4M1SA 4YMSA 3LAWA 3TKLA 3GLGB 3LDAA 5EXTA 1ZMXA 2N1BA 3KKOA 2YHSA 5KTYA 5FOSA 2IYLD 1CJUC 4MA4A 1E2NA 3BFVA 4RZXA 3GLHE 4XIGS 1OFUX 5HZKA 1U8AA 3KQUA 4FCTA 2HYIC 4BLTA 2QT0A 4OHVA 4F38A 4M1MA 3SBDA 5BN3A 2V54A 3E70C 1VHTA 3SJCA 4D0LB 3U4QA 3THYA 3ZZUA 1YZQA 2HF8A 4ERNA 2H5EA 3U2QA 1QVRA 4DLRA 1S3SA 5IDVA 3UMSA 3GJ3A 1Z06A 3U61B 1ZRHA 3BC1A 4TLEA 3NTUA 2ODNA 4HLQB 1W4CA 2YKGA 3A1VA 2BCJQ 2CBZA 4KSCA 3GFTA 1OKKD 3RRYA 3D6TB 3ZQJA 3PUXA 4PSKA 1P2SA 3EWAA 3REGA 2KJQA 5CK4A 3QPUA 4EQ6A 6Q21A 1A4RA 3F0TA 3F5FA 1E2FA 5TARA 4LHVA 4BFVA 2VTKA 3Q8XB 2WMNB 5TB5A 2IEYA 4E07A 1TPZA 1QHNA 721PA 1CBUA 1ZYUA 3AGPA 3AP1A 3HYTA 4QGFA 5FTKA 2D2FA 4HB0A 5AUQA 4UXHA 2W58A 3K53A 1ZM3A 1MT0A 3SC3A 3K0CA 4EPYA 4JLJA 1J7KA 3K70B 2XZOA 2BOVA 3B1ZA 5EZ5A 2NO0A 2OAP1 1NNEA 2WV9A 3N5CA 1TNDA 1Z0JA 4DDWA 1KI7A 3M0EA 1AKYA 3QG1A 1R5OA 1YQTA 3IO5A 3IPXA 3I62A 4DRZA 2BM0A 2NZ8A 4LHXA 1KSFX 4LSGA 4EDHA 4W9MC 4M0LA 4OI4A 1E9EA 1WRBA 2R6DA 1PVOA 3QNUA 1E2PA 1DAHA 2VHQA 1EWRA 2OM2A 4FMBB 4QBFA 4LYHA 3W6OA 3EARA 4IXMA 3Q7PA 1XD8A 1NBMA 2QP9X 4JL5A 1T3HA 1DAEA 1WE2A 5JEEA 2EQBA 4C9BA 2J5XA 2F9MA 5DLQC 1OFTA 2IW3A 2CVHA 3DEFA 4M9SA 3FMOB 4ZV4A 2CLDX 1IJFA 3UG6A 1XZPA 3KFXA 2BMEA 2G3YA 2ZE7A 5KYKA 3UMRA 5KSPA 1G3MA 1BMFA 1DPFA 4Q9IA 2ZRAA 3D8BA 4YMVA 1JI0A 3DMNA 1OH7A 1XEXA 1TEVA 2JJ1A 4DLSA 1OFIA 1G16A 2ZRNA 3TNFA 2G1JA 3CR7A 5K8IA 2IX3A 2JLYA 1CJMA 4OHXA 1DO2A 3AKYA 1NSTA 2HT6A 4I1SA 5F2EA 1T0HB 3W3ZB 4EIWA 1F6BA 1F2TB 1XRJA 1U0JA 4DHEA 3UMFA 1NN5A 3P32A 1GKUB 2WKRA 2QBYB 1BIFA 3PV0A 2JCSA 4JVMA 3W5JA 4UQOA 3TSWA 1WB9A 1E9AA 2A5YB 3THXB 4AI6A 3B1YA 4DEYA 2PMDA 1R0ZA 1G3IA 4UNSA 2B8TA 1G8GA 4ZPXA 5EE3A 4NCJA 5AWFC 1NF3A 1UJ2A 2Q0HA 1HT2E 3PVSA 5KDLA 1M34E 4TQ9A 3DPUA 4BASA 4C0BA 4DB4A 2Z4SA 4LJAA 1G9XA 3HU1A 1XPUA 1B23P 3CH5A 5JJKA 3IHWA 4OYHA 4URUR 2QZ4A 3KTAB 2GXQA 1OB5A 3K9NA 4GP7A 3HWSA 1ZM4A 2PCJA 1N6PA 4Q66C 4BZQA 2Q9CA 4MQBA 3AEZA 4BGDA 2V3CC 2PEYA 4OQXA 1LS6A 3I3SR 2MSCB 2IF2A 4H9GA 3B1WA 2WIBA 4KLZA 5HKKA 2VP6A 3U6KA 4QBGB 2IS4A 4CVNA 4G5QA 4GMXA 2IYYA 2GRJA 1QHHA 3OIYA 1N5JA 3CB4A 3SU8A 4N3NA 4AKHA 4URZR 3DO6A 2W6JA 2XGJA 2JAQA 3W6NA 2ZYVX 2V1UA 1W0KD 1ANKA 4WBSA 1CJVC 2DFLA 4PC3A 2J3EA 4D4LA 4BFTA 2IXEA 2DB3A 1OXSC 1EGAA 1U90A 2A5GA 1IN6A 3AUXA 3GEEA 1E2KA 4E5UA 4HUQB 1FFHA 4KAXA 3LX5A 4QHTA 4ZDIA 5EP4A 2PJRA 5FBQB 3NBXX 3GLFE 1OYWA 2P2LA 4O2RA 4JT2A 1XWIA 2WWIA 3OFNA 1NN3A 2R6GA 4CRWB 1UBCA 2J41A 3HYRA 1RC8A 1DAMA 4TT3A 4IVRA 1Y3AA 3QF7A 5HE9A 5FL3A 1SZPA 4A15A 3PR1A 4I1VA 4CZ2A 1E9BA 4IVQA 5CK5A 2AK3A 2G88A 3GLFB 4DZZA 5AJZA 5TMPA 3I73A 3AV0B 3F3YA 4BRWA 2CLCX 2ZE5A 4A8JB 2IS1A 3A4LA 1XPRA 2F6RA 4BLOA 2C5LA 2QENA 1E2IA 4Q01A 2R44A 5EE9A 1E1QA 2WSMA 5FBVB 3QXJA 2E9SA 3X1YA 4GSYA 5KSYA 1CR0A 2A7QA 4TMZA 3AVOA 1HV8A 1G1MA 1SVOA 3CZPA 1NVVR 4Q4AB 1G8FA 1X1SA 5H70A 3QBTA 3A4MA 3A36A 4C30A 3U7FB 4Z8XA 2WPDA 5DGXA 2OSBA 4ZIRB 4B44A 4FMCB 2D7DA 2ZRGA 2ZJOA 4PAOA 4Q4HA 5J40A 2O8DB 2AD1A 4ABYA 1U2RA 2Q21A 1BMFD 1P2TA 5HPYB 4W5JA 2D06A 3EWSA 3AB3A 4ZI3A 2TMKA 1KZGB 3FPAA 1P2UA 2C9CA 2GDJA 3PITA 2WWGA 2FGJA 2JDIA 3LY5A 4JJKA 1NRJB 4RD6A 5KNCA 4L9WA 4EJSC 2BMJA 3PFIA 5CYOA 2CK3D 1J70A 3B1XA 3BOSA 4TMXA 4NP6A 3K0FB 4Z54A 4LRWA 2F1IA 2WOJA 4DLYA 1AZSC 2RGNA 2ZS7A 4QBIA 1KI4A 1IN4A 3W9YA 4I81A 2DCUA 3Q5DA 4UNPA 4TMKA 4KCGA 2DWQA 4A0RA 3B82A 1Z0FA 4IVPA 3ZIAA 2WWYA 2Q6TA 4QHYA 4JSTA 3MGCA 2ZU6A 2F1HA 1UM8A 3QBVA 3SYKA 2DBYA 4CT5A 4LYJA 3L0PA 1EXMA 2WJHA 1Z07A 2RGNC 1GOTA 2P67A 4JBYA 4Y0VA 2QE7A 4NZYA 3T1TA 2NO1A 5GJCA 5FI1B 3PEWA 1N5IA 1CJKC 3JZMA 1HQCA 4Q1EA 2BIFA 5LD2C 3VU9B 1JALA 1E0JA 2C78A 1ZD1A 3ASZA 1L4UA 4H1UA 4HLDA 4W5HA 1KK2A 4F4IA 1U8YA 2A30A 1A82A 2G1KA 3LXXA 4H1VA 2WPDD 4D4MA 2QP3A 2Z5FA 4QOSA 1EX7A 1M7HA 1ZUIA 2BMFA 3AUYA 4KFRA 2GBLA 5BXQC 5CITA 5L3VA 3KJIA 3T1VA 1OH6A 2EFEB 4NYMQ 4ZCIA 2ZRKA 1ZJ6A 2E1RA 4XVRA 3BK7A 1G5PA 4Q4JA 3WBKA 4P31A 2O0JA 1NG9A 3MG9A 2FPMA 3W5IA 1GKIA 1MV5A 1JAHA 3TR0A 3OF5A 2DFTA 4JS0A 4B3BA 5B30A 1PLJA 4P33A 3R7WB 2OUKA 2A5DA 3LQRA 1TF7A 1JJ7A 4TLDA 3VX4A 1COWA 1QHHB 1SVKA 1VG1A 3ADBA 1NMZA 3IPYA 4U7DA 5JFGA 3CO5A 1G5RA 3FHCB 5G3ZA 3B60A 2QQ0A 1DG1G 4A9AA 1ZIPA 2I4IA 4QGAA 3ZYCA 3DDCA 3LQQA 1NVWQ 2IT1A 3LW8A 2GEDA 2I1VB 4AC9A 2XZLA 2H92A 4KFUA 3ZGXA 3ZS9A 4X8OA 1GG2A 3VNUA 2WJJA 1EG7A 1G3UA 3FMFA 1DAKA 3C14C 3GMTA 2P6NA 4QJ5A 3WYGA 4FINA 2VHCA 2WWHA 3EZ9A 3SNHA 3U3JA 2D3WA 5DI3A 4D4KA 5FH9A 1J90A 1ZP6A 2IEZA 3N2EA 3W6PA 5G41A 2WTUA 2FFBA 4A2QA 2EWVA 1W46A 1HEIA 2FG5A 3R9IA 5KOYA 4CEHB 1KO5A 2HV8A 3QF4A 4LJ7A 1NLFA 3K70D 4PC1A 2ZAOA 2OHFA 1G8PA 4JL6A 2X19A 3FHTA 5ELXA 2VHTA 2QQEA 3BE4A 4LJ6A 4F4JA 2EFGA 2W6JD 3QXXA 5J4KA 4EPXA 4MGIR 4JSYA 1HA3A 1I4TD 4PHFA 4TWZA 5AUNB 5JI3E 2UKDA 3X1ZA 4DDUA 4U02A 5FBLB 2O5VA 3DMDA 3TH5A 4B47A 1JQJC 3IIKA 4LUCA 4BPBA 3ONWA 3QXCA 2QAGC 3I5XA 1XPOA 5AR1A 2RCNA 2REOA 2ZJ8A 2ONKA 2ZVPX 5E3HA 1BKDR 1JEEA 3T15A 3G0HA 1GL6A 1T8UA 5DN6D 3MSXA 4KYUA 1TL7C 2C2HA 2ZJ2A 3NVAA 3RWOA 5AUPB 1XXHE 5CM9C 4QNMA 3CX6A 2X8AA 3VR1A 4Q4HB 5LDDC 4K81B 2O8DA 1UKYA 3IHLA 4IOLA 4BRUA 2GESA 4B32A 4GFDA 2QM8A 5JS7A 3OEHA 4G3XA 4KO8A 2JJ8A 4MKFA 4JLVA 1WXQA 1XCMA 2VF7A 2H57A
chains in the Genus database with same CATH superfamily
4KQJA 4OQNA 1U0SY 1IM8A 1RYYA 4M0DA 2B3DA 4QXRA 4LK2A 5E2IA 2WILA 3ECSA 1I9CA 4MUAA 4WFKA 3TO5A 2CVOA 4ZT7A 3B1VA 4J1TC 4EBFA 3M34A 1P3JA 3LYUA 4F7WA 2LKCA 3EXHA 4RD2A 3SDZA 1WOMA 1XU7A 5DCUA 4P3YA 1FZQA 1E61A 2V58A 3PYXA 1ADYA 4IKOA 3UK6A 4LDNA 1GIAA 3NEPX 3G17A 1EWYA 1V35A 5I7FA 4OLAA 4DCMA 4G5FA 2P41A 2QMYA 3C4VA 2AW5A 2JIRA 4DC1A 5H59A 3HKBB 1R4NB 2HWYA 4AO8A 2FDXA 2G82A 3U7QA 3FN4A 4D0NA 4DXAA 4MA5A 3H2JA 4PC6A 1M6WA 1T8YA 3NBUA 3ZVRA 5K9ZA 4A5OA 4BPRA 4JT4A 4ZO8A 3HS3A 2DTEA 1I0LA 1LSSA 2QOEA 2D1FA 1LQUA 3ZUGA 2CUNA 5I45A 3T52A 1LTQA 1YCDA 1LPBB 1FDOA 2Q2NA 3VTZA 1A8IA 3AMVA 2ZULA 3FROA 3WSVA 4KR3A 4ARSA 1OI2A 2VZ8A 2QG4A 3C0KA 1LX6A 3Q5EA 2HF2A 4CKCB 4ARBA 4YJ2A 3FPCA 2IYUA 4A1OA 4EVSA 3LIPA 1DX9A 3F4LA 3IKTA 3VSEA 5BT8A 2ORIA 2AOUB 4WI1A 3ZI0A 2FR8A 2Q1TA 1ZN7A 3OAAA 1TW2A 3W1EA 1U7PA 4UBOA 1D8TA 1RACA 2XOEA 1ADGA 1KARA 4WGFA 4B3GA 2P8JA 3EFEA 3NTQA 2O7NA 4NOMA 3OEHD 1MNAA 1TM3E 2VYQA 3ZIAD 4IQ0A 4NYIQ 5GJBA 1FFGA 1XMPA 1JB9A 2GEUA 3I45A 2YJTD 3DT9A 4X0EA 3WKDA 2BUBA 4C89A 2O59A 1E2EA 2B4AA 4ND8A 5DH9A 2PMFA 3B5JA 2W00A 4GGPA 1ISRA 4J29A 2C3OA 2XUKA 1UT8A 2VCYA 5BN5B 4EMSA 3KDAA 1KFCB 2GEFA 1UFOA 4OAPA 5JMTA 4ZGGA 1L8LA 4F97A 5CEFA 2VP0A 2BJWA 2W93A 1T8RA 4GPAA 1L5KA 4UMFA 1MC8A 1W2HA 4O2BA 3X2FA 3VNQA 5DM0A 5KJFA 3BQ9A 3M2TA 3NHLA 2NWQA 1VBNA 2VFAA 4TV8B 4A91A 4WZAE 3K9LA 2C04A 1ZGJA 4S2EA 1I14A 4MS3B 1KDOA 5EUCA 1OI3A 4XX1A 1RYZA 2RHWA 3BK1A 4Y18A 1R0XA 2IZ1A 2DY1A 3MTGA 4NWIA 5JAIA 1T1GA 4YJFB 2QPLA 3R0IA 2IGBA 1EU1A 4W6QA 5COBA 2QEQA 3UH1A 4GYYA 2PL9A 3BG5A 3NCTA 2O8EA 2PUBA 3CSSA 1SB9A 4M60A 1Q1EA 2QG9A 4MW1A 5AUOB 2AB0A 4Y2RA 4AU1A 5LUAA 3CH7A 3HDYA 3EPJA 5ALEA 4U7PB 1XXHB 3D3NA 4YYEA 3NHRA 4TS3A 3PGA1 3A1SA 4YRQA 3N70A 1QC5A 3KFLA 3M4ZA 2TMYA 5J5CA 3EVFA 1Z7BA 1WA5A 3NAMA 1Z62A 2NO9A 3PBKA 4PZAA 2WJWA 5DHUA 1E59A 4NAVA 4B35A 4JUAA 4CIYA 3VVBA 1AE1A 4QYIB 4A10A 1BA3A 1GPDG 1DC3A 4LOJA 2FKAA 4QPCA 1E99A 2R6FA 4ZDJA 1DO0A 2XEDA 4PO9A 4UM5A 1OBVA 1VJRA 3JD1A 4EUSA 1S01A 1Z9BA 2QJWA 2YL2A 4CLRB 5JXJA 1WU7A 5J9FA 3E3AA 3RSOA 3QMVA 2PN1A 3RU3A 5DGDA 1T13A 5KDDA 1AXRA 1JDSA 1LDYA 3G9TA 5ICSA 2C8KA 3ZH9B 2NM0A 4KGDA 1A9QA 3UOAB 4XQ9A 4M46A 5E38A 1UMBA 1YQGA 2WHQA 4C0SA 3CISA 1HG0A 1LNZA 1G5HA 1QIKA 3PE3A 3PGVA 3QM1A 1JJFA 3RFUA 5LMZA 4IZHA 1T9CA 1ZD3A 1GNPA 3RTAA 5K6TA 5ALWA 4EATA 1W85B 3RFFA 5LOVF 1II0A 5EP3A 4BWVA 2XNDA 5KU7A 5TEVA 3ED5A 3G02A 4KYIB 1ZWKA 5D3QA 4B75A 2ENWA 2PD4A 2RJNA 4ZV7A 5IX8A 2PKRA 3L4EA 3BGOS 1ZRMA 1YHNA 1Y5RA 1YMUA 4DUGA 1WHSB 3LDGA 4H27A 4OHOA 3OF2A 4TZ6A 4MS1B 4EENA 3V7UA 1YZKA 2H1WA 1DTSA 1WB4A 3ACDA 2V7PA 3LW7A 3NBYC 4NU5A 6REQB 1RJ9B 2E6UX 3OIWA 1QB8A 3NPMA 1VECA 3OE7D 1N1EA 4QUEA 5E95A 1CUJA 2QLMA 5T41A 1CK4A 3C3WA 3KCQA 4KOAA 3AHCA 2ZSDA 4D57A 2ZYRA 3I0ZA 3AF0A 5JC8A 4H77A 1FFDA 3Q3EA 4A36A 1L7PA 2OC9A 4AWBA 3PYLA 5CUQA 2YCLA 1ACLA 5LLSA 1UOOA 5FUVA 1DVRA 3LQKA 1BN6A 3STYA 2FY8A 4NCNA 2CHFA 2A0KA 2ZQYA 3MNFA 5NLLA 3RIGA 3P9IA 4AF8A 3GFBA 4N0PA 5CB4F 4RPIA 1WXIA 2XQJA 1K4YA 4XLLA 1M9NA 4RMNA 2VDUE 4EB6B 1DV1A 3DE3X 1E6CA 4MAMA 3RYHB 1T34A 2PANA 2ZQZA 1GGVA 3B5EA 2JGIA 3VH1A 5CFMA 1GLNA 1C29B 3AR9A 3VNVA 5KX5F 1A3CA 2JKZA 4UU1A 4BZXA 3QX3A 3IEVA 2AUMA 2BHSA 2D6FA 5J58A 2EW1A 2XUZA 1ONOA 1YTLA 3MT8A 3UFBA 2O06A 3FWZA 2PS0A 2J9FB 2ETVA 4OB6A 4BLVA 2X1VA 5IBRA 4L73A 4U7GA 4QPJC 5ED0A 5KCZA 3BMQB 2PSDA 4JB2A 1BDIA 1ZXXA 3WK9A 3DBLB 2A3NA 2QJTA 1USUA 2R9VA 1VYTA 4UEOA 3T7IA 4ZAYA 2JIBA 2G25A 4IIEA 1Y1QA 4AL4A 5AKKA 1QCDA 1Z0IA 1EBBA 1U2EA 3ZXSA 5AQEA 2RC6A 4OIMA 1ZHOA 2G5TA 3ZHRA 1QE5A 4YXWD 5KB3A 1UQTA 1CUFA 2QYSA 3NHKA 3LHFA 2VTVA 4OV6B 3IQXA 4TROA 1ISJA 3Q0EA 3RH0A 2BGUA 4NU8X 3GHYA 3G85A 1XNQB 4DEXA 4GYJA 1Y81A 3ZQ6A 2WTEA 4YAIA 2GKOA 4R1UA 4D3YA 1AQIA 2QD3A 2O23A 4XZ3A 2J9RA 1VHJA 1Z0UA 2ZUEA 2A1TR 4Q7QA 3GLVA 5HF5A 3KLOA 3OJEA 1QF7A 2XMPA 4MV7A 3IQDB 1GSIA 2PD6A 4KU4A 5DHAA 2ORYA 1YRLA 1DHRA 1FSFA 3NNNA 3QUAA 4JYPA 1EKXA 2C2ZA 4BX8A 1R0CA 3UIEA 3ZZMA 4KUHA 1UF9A 3REQA 5L3QB 1F2TA 4ERXA 5CXXA 2C31A 3OESA 1LDBA 1G6HA 2K2QB 3I6ZA 3OTGA 3GDGA 5C18A 3PICA 2VN8A 4R8LA 1SOMA 3ANXA 3PTZA 4QFCA 4S3MA 3VVLA 1PTKA 2IDZA 3OY7A 1TA4A 2VNHA 3IGFA 1XDDA 2HSDA 4BJ1A 1D4OA 1H2ZA 4LC0A 3K1AB 3R4CA 1MFZA 2I4RA 4ES6A 5HTOA 1RAAA 2BFOA 4RVSA 2GPSA 2GTHA 4WH0A 3TEJA 1F38A 2I6GA 3EAQA 4MIKA 4Q0MA 3AP2A 2C9DA 1JN0A 3OJCA 3ZE7A 3OKPA 4AURA 3CLKA 3C1OA 2CDAA 4YWHA 4TTVA 1TYAE 2IUEA 1PWXA 2IYZA 4RK0A 5HCIA 3E7XA 4M7PA 1JG2A 2OO7A 4OU5A 2P30A 5A4MS 4GDFA 4IV0A 4ND1A 3VDMA 1X1RA 4DCVA 3AM4A 2VUTA 3P9PA 2A78A 3VKGA 4PFQA 4XIIA 2P6PA 2J3DA 4IYJA 4NYMR 1H93A 4R1OA 2L17A 3NP9A 2O2JA 3WAJA 2AV6A 3DBOB 3NM6B 1A69A 1E66A 3HJNA 1D2CA 4PVCA 2DUJA 2H4HA 2V9PA 3V7NA 5KPJA 3AIKA 1BQEA 4R0NA 4KKXB 3JQEA 5H4HA 3TL2A 3K0AB 2VSFA 3PQ3A 3LPLA 3FDIA 2CN1A 2WD7A 3R0ZA 2W42A 1B00A 1XA4A 4KFTA 3KO8A 4LI0A 1ZZEA 1VMEA 2FQXA 1E9RA 2YVAA 4QDOA 5LA6B 4OI1A 3VPHA 1PFUA 3I39X 5BUCA 5K0CA 4YS6A 4YBZA 2TSYB 3ZHOA 4O5AA 4IKPA 2HLPA 1KY3A 3W3AH 5FQNA 1ZW6A 2XSZD 2CXOA 1C7IA 2Y99A 2IYWA 2DPXA 3MLBA 3R7WA 4DCUA 4O08A 2VH2A 4E3ZA 2XHEA 4JJAA 3AUKA 3IUMA 3I09A 1IE3A 2AA3A 4QELA 4X60A 5HW0A 5KTPA 3L8HA 1Y48E 2AUTA 3ICOA 3WK5A 1UWKA 3L49A 2HSGA 2Y92A 1V41E 1V5EA 4L3VA 3KBOA 1U6IA 5BNFA 5LNK1 4NXNB 2E37A 3I37X 1YZLA 3ZWVA 1NQWA 2GUWA 1L1QA 4J4HA 3RU9A 1W35A 1QX4A 1T1RA 5EIXA 1ZGHA 2P5UA 2BEVA 5JCXA 1CEYA 4WEOA 1U3UA 2QWXA 3C43A 2G1AA 5IMBA 4WWHA 5C8YB 5E7IA 3R8CA 3PFGA 1QZ3A 3EOAI 4FX2A 4JJZA 4U7FA 1PR4A 2C1ZA 2J07A 3TB6A 3UGJA 3A2NA 2VWHA 4PFJA 3ZVNA 3QX7A 1U2DA 2IP4A 4Z4IA 2WTBA 4U7WA 1OB2A 3CRRA 1ZN8A 2FHSA 5FFNA 1TO2E 5GOZA 3OECA 5J4LA 4QOIA 1KYQA 1O94C 4ZQIA 1W47A 1ZD9A 2XE8A 3FBGA 3VFDA 1Y8ZA 1QWOA 5G40A 1SUPA 3CG0A 3D7RA 2WUVA 3UW3A 3ZXIA 4BC0A 1H4VB 3C5EA 4MPDA 2HIMA 2JGMA 4UNQA 1QP7A 1Q0TA 3MTDA 2Z9DA 3E53A 1S02A 3SICE 3SG0A 1P19A 5JH7B 1ZCAA 2WF6A 2ECKA 3FPHA 3ZH2A 2UZ4A 1IHXA 4FCVA 4ETMA 2MWMA 1XKTA 3HH8A 4LBYA 1BW9A 4ADSG 4FOSA 3L0SA 2V5VA 4F04A 3ZQUA 2H2WA 3RJ5A 1M2OA 5BMOA 4UREA 1XZAA 2I4MA 4HB2A 4Y2TA 4NCBA 1NDUA 3L7NA 3OWXA 2WR8A 3LL4A 4ZAZA 2F8TA 1TK3A 2QTWB 5JMPA 4PO8A 4ROTA 5IJZA 1UKVY 5LZ8A 3VPFA 3P1JA 4WE3A 1OT3A 2OBBA 1LSOA 2P11A 4IGAA 2WWTA 3PFCA 5FA8A 3WGVA 4KN8A 3CKKA 3CPJB 4DIBA 4BVJA 5DRYA 3U60B 3VH2A 5E9AA 4OL0A 3GLIA 1QCYA 4XJVA 3OIFA 1T24A 4JBHA 1VE9A 2A92A 1B0PA 4LBZA 1KFBB 4U00A 5EHZA 5EHXA 3FGNA 5ECYA 2G5CA 2XQFA 3QKIA 4M88A 5EAIA 1KP2A 2PR2A 2V96A 1U0NA 1B26A 3EZNA 3O2SB 4NPHA 1DBWA 3I9NA 2ZJBA 3DUWA 4WMLA 3V9PA 3NXSA 4PY2A 3RFXA 5C80A 3MPUA 4MJ3A 3U48A 4D6YA 1P5HA 3EBLA 3RC8A 3RSGA 4R0VA 1MJNA 1NWCA 1CSEE 1OPXA 2C8VA 4NNJA 3WA6A 1D2NA 1MAHA 1S2IA 3DS8A 3PIDA 4IMPA 3WNVA 4CFSA 3DE0X 1QDEA 4Z4EA 3T9DA 2XBMA 3H5OA 2BBWA 2I3ZA 3GQVA 4A0GA 1V1MA 1Q0HA 3VDNB 1E7SA 2FE1A 4XYGA 1J25A 1G5TA 3UHFA 1MJ5A 3F5DA 3QVOA 3B48A 3E27A 2I3GA 4OGFA 3CW9A 3TLXA 4A0HA 5CIYA 3LT0A 2XUIA 2WRZA 4QDUA 2WFLB 1A9SA 4IQFA 4QA9A 5KOIA 1FMJA 1QK3A 2VHVA 4JXKA 4JUDX 3WDSA 2NLOA 2R84A 3KJNA 1OXKB 4GIBA 3KHKA 4ARZB 4EM6A 2G9ZA 4XD7A 1SPXA 4LRXA 5B7NA 3FM9A 1E98A 4G4SP 2K7ZA 1GTSA 2GJSA 4K40A 2VJMB 4MCAA 2XTMA 2RAVA 1XEXB 2XCLA 4IDDA 4BLPA 4BWFB 4DMFA 2PZGA 5LZ5A 10MHA 3D4LA 3PX7A 2D2XA 1AUPA 1Z5GA 1ZK1A 2AC2A 1GGHA 1Q7GA 3C7AA 2H1VA 2H07A 2PSSA 4LTNA 4P4SB 3SM3A 3TQSA 2FMTA 3DOJA 1NW9B 5F12A 4FFLA 5BSMA 1QZUA 6ADHA 4HH3C 3H2GA 1X9IA 4GR9A 1X77A 3AF2A 3Q1LA 2ZSKA 5JRZA 2FOLA 1S3GA 2X5JO 1R4AA 3FVWA 3LO5A 3L9XA 4Q1BA 5EC8A 4BCDA 4CM4B 5LZ4A 3TJZA 1BS9A 4RFVA 4XVQA 1J0EA 2OFPA 1R8YA 3LF2A 3M6IA 2Q4DA 2QDXA 4XIJA 2YV3A 5B2ZA 4LF7B 1X80A 4M2LA 3H1TA 4A92A 4ZYVA 1T5LA 4E5VA 4CTJA 4G36A 3L4JA 1X19A 2CKMA 1U3GA 2V6JA 4XEUA 1L5SA 3DD5A 3UQZA 5LU8A 4PNZA 4JXXA 3BZUA 3CTPA 1C1YA 1M2VB 5JTTA 5BR4A 2Y1XA 1Y6QA 5M29A 3LJKA 1ZEMA 2QM7A 3COYA 4PLVA 5DHQA 3SX4A 1H2BA 3R7NA 4PQGA 2BI4A 2AN1A 2HWKA 1S96A 3ZDXB 3KXIA 1X80B 1W6UA 3OH8A 2K87A 4G24A 5AK6A 4BQOA 2J87A 4BMCA 2R87A 4I55B 4WRRA 1T0BA 2VBFA 3TBKA 5E9QA 3T5TA 2IP1A 4N18A 3OURA 1PWYE 1NJFA 2ZEJA 1WVIA 1TB4A 5TT1A 3HUTA 4RU1A 4DMCA 2EJUA 2X9QA 2GMWA 3JQ8B 3CE6A 3X1KA 5JQGA 1T10A 1UMKA 3P26A 2PX6A 4RZIA 1I4DD 1Y8AA 3MJ4A 3A6FA 3MJDA 3LFTA 4CF5A 4BN5A 1F12A 2VK4A 1V5WA 4BJ6A 4IMJB 1BHJA 1EVJA 4OQYA 1PJQA 2RCYA 5JNLA 5IXSA 1CRPA 1GUYA 4DMHA 4JYCA 2AOTA 2NACA 5LB4A 2HMTA 5A3VA 2IZ6A 3EGVA 4QOFA 4RH0A 4L5BA 2DR0A 5INTA 1XXHA 4K8RB 1BDHA 3UV7A 1QH1B 1VBMA 5D3ZA 1KDRA 2XXJA 5JZVA 4U8HA 1GVHA 2GA8A 3DCIA 5BSWA 2P3OA 2MSNA 2PU5A 1OTYA 3JVIA 1CNFA 1L7AA 3FI0A 1R6TA 1XNJA 4O2AA 1E3TA 5ALLA 5J2TA 1UFRA 2AC4A 3A1NA 4BO2A 1GDDA 3KVVA 1I24A 1G21A 1RJDA 1STOA 4GPIB 4EJ6A 4Z4CA 13PKA 2QTFA 5H3HA 3OZEA 1VPVA 4HTFB 1MW9X 1ZISA 2WG1A 3ODGA 1QGZA 3UJBA 2I7CA 3PB3A 1DIOB 1ZJYA 1LW6E 2QSZA 1TAHA 2JLCA 3CNBA 4LJ8A 2VQEB 3UBMA 4P34A 2BFFA 4AWXA 2XV1A 1MQSA 2VIIA 2INGX 2HSJA 1JLRA 1P75A 2FQQA 1ZM7A 2MIIA 2P5TB 2DZDA 4MKXA 2P9CA 4DGQA 1UMCA 7MDHA 1FSPA 1X9HA 1VTKA 1DJNA 3EDRA 4M21A 1K7FB 4E11A 2F3RA 2XUQA 3KC2A 1KQPA 1FF9A 3LBHA 2PZFA 1SVIA 2RHCA 3IKVA 1I6LA 1W2WB 4FNGA 3ZDCA 3O4GA 5L3ZA 3DLIA 5BXYA 1YWGO 1HDIA 5LP6F 4ZOBA 2D13A 3MIZA 4G8CA 1HH4A 4A1FA 2WQ6A 2GQ0A 3MPOA 4NSNA 5AJWA 5DYIA 1XYYA 3I5UA 3OMWA 1E2QA 3NM4A 2DUNA 1V9CA 3BB3A 1TC2A 5GGXA 4TLLB 2KBEA 4JNKA 1E1KA 3DMGA 4JBXA 3N2ZB 4ND8B 4QU0A 2B36A 4NK5A 1AUOA 2B1RA 2V5UA 4MSUA 1T9AA 2YQ4A 3X1MA 4D3DA 1E1CB 3DPSA 1A7JA 1EB8A 3BD9A 3P94A 4IZIA 4XX0B 4C3ZA 3F1KA 1RLIA 1O03A 2PRIA 1RRVA 1YUNA 4EB8A 3ZC3A 4FFNA 1W9MA 3QUBA 1ONSA 4OB7A 2R00C 1CDDA 2YJGA 3OOHA 5ANRB 2I91A 4CG3A 1I0ZA 2W71A 1RI1A 1GEGA 1O95D 1XQYA 2GCOB 2NOAA 2RGWA 4MRMA 4CMGA 4RTQA 4XWKA 1D2MA 4F5YA 1PWHA 3JTEA 4LW8A 4DWWA 5EPOA 2HSEA 1FP7A 1X6VA 3B3AA 1S2MA 3FUVA 1J8MF 3I0NA 3G8YA 3RARA 5BRJA 2ARKA 1CQJB 2C54A 2X9NA 3KEMA 4XOUA 4Q6BA 4O4IF 5I9LA 1QH8B 2FW8A 5AYVA 2Q3DA 3SY8A 4G0XA 1NNI1 3GVHA 5HOQA 4OCZA 3V42A 4M1ZA 1IZ9A 1E6MA 2FQWA 3L92A 1F48A 3V2UA 2DUWA 1MEJA 3DAYA 3X1WA 4ZT2A 1XQWA 1YS9A 1EGMB 2C97A 2R97A 3HDHA 2YVLA 3G88A 3DD1A 1RKBA 2JASA 3GJ8A 5T4EA 1IOZA 5TXGA 1WLSA 1GAQA 2CLMB 4MVJM 4UULA 3IILA 4EX6A 1AQNA 4M9UA 3OTHA 1C0IA 1ZC3A 4P92A 4J0EA 3GLSA 2A0YA 1PYOA 5L3RA 3OO0A 2PGLA 1QH8A 1QYIA 3VC1A 2WYWA 4R1MA 5AVSA 3GH3A 5DXAA 2CNLA 1LTKA 1ZDMA 3DXYA 4REQB 2EEPA 2ZE6A 1EM6A 3HRKA 5TQ0B 5BQOA 3SHWA 4LNAA 4TM8A 3EZYA 5AVOA 2ZDGA 5JSQA 3LU1A 5AW0A 4GOKA 2X0RA 5EEGA 1BE6A 1NKVA 2Y1GA 3HCDA 1XJ5A 1YVEI 4G5RA 1FMLA 3NEYA 2AJDA 3H1PA 3SZMA 3BULA 4ESOA 4F4HA 4DMUB 5IG2A 1JH9A 1EVZA 2QY9A 3BJIC 1NQXA 5C3MA 1RFGE 1CVRA 2AOVA 4JEMA 3CUKA 5HFJA 4C6TA 1TD1A 1F3OA 4ZI3A 3TF5A 821PA 2QU8A 1W85A 1JU4A 1XMSA 3WICA 4E4RA 3QU5A 1E3MA 5J5AA 2WPNA 1KWKA 2XUJA 3KJHA 3FD8A 5DMHA 3M6AA 3ONEA 5JG7A 1CEXA 3OWHA 4P3KA 5TMBA 2HA3A 1KO7A 3VR5D 2VAXA 3ZY3A 1P4GA 1RQ2A 4IIJA 3ZZ0A 4EZIA 3ZCPA 1RR6A 3LY9A 1OASA 1J0CA 3E8SA 3WRYA 2QYOA 2B1IA 4M54A 4QYXA 2A67A 3U3OA 4M0UA 2IPAB 3B8HA 4MR8B 2ATVA 1GQ2A 2IPMA 4J8PA 4D5GA 2UVPA 1IIBA 2X8JA 4GGOA 3A04A 3ZE2B 5F98A 5KSOA 4M9CA 5BSVA 3TLGB 5I9BA 2H54A 1X7YA 2WIJA 3IBSA 1G21E 1FXUA 3IKMB 4KV9A 2PTHA 4Q02A 4DIKA 4BGUA 3PXCX 4A8JC 2NN3C 3DV9A 4DA6A 1HQDA 1HUQA 1HYGA 2HDNB 2I2AA 3I28A 3L18A 1YFLA 1BO6A 4EL5A 1CQIB 3KOYA 3TIVA 4PYOA 3K5WA 1D4AA 3G5AA 4FS8A 4YJGA 3QNWA 4JP2A 1L5RA 4U2EA 5EZYF 4AMBA 4RHXA 3RTEA 1NY6A 1H22A 3MXOA 4MWSA 2PLRA 4AP5A 1UT5A 3RRNA 2JDID 2QTAA 1QIMA 3LS2A 4KUEA 2UVPB 1KJWA 2GFHA 1L7EA 3OX3A 3OUUA 3OZGA 1DI0A 3IUBA 5DSTA 1YJ8A 2P4QA 1MXFA 1SXJD 3IAHA 3ZU2A 5HRAA 2XTNA 3H3FA 2DQSA 3PKZA 5E4TA 4RLFA 2PXHA 2XD4A 3K15A 4IIBA 4I1UA 1KNQA 1RHKA 1E4OA 3VI4B 4S0XA 1J06A 5AXCA 5L6MB 2QX8A 1A9OA 3WHLA 2QUJA 2Q6OA 3HJRA 1DXYA 3GEBA 1NX6A 2EHDA 1K89A 3JSAA 1XTKA 3T7AA 2VS1A 3TD6A 2C98A 3BCRA 4FW8A 4II2A 3ZGOA 3FMVA 4RVUA 4ODIA 2LWIA 1DFGA 1Q1AA 4FQ5A 5FYQA 5ARBA 3PWTA 1A9TA 1JS1X 3PI7A 5TC4A 3QBEA 1U28C 2G8NA 5I5GA 1EVEA 1PX2A 1C3XA 4GVLA 1D2HA 2JL1A 4XGNA 2PL3A 3C5CA 5HQJA 1E1LA 1GPLA 1K97A 1U1DA 1R2QA 3I01M 5CHEA 3TL6A 5BWCA 3WGTA 3LECA 2G0NA 2B0JA 1VIVA 3IDQA 3TSCA 5CB0A 1FSSA 1L4BA 3PVZA 4M8SA 4D0RA 2PZMA 2F1RA 5JROA 5LVAA 3GLFA 4TVKA 4AY6A 1NJGA 4N3BA 2ZYWX 3BCUA 1HDRA 1XU4A 3B7GA 3ICPA 1WSAA 2KE5A 3PXBA 1A7KA 2XNJA 3GN2A 5KYUA 2OK8A 1TVEA 2HA4A 3NBFA 4Z3DA 4J0JA 2ZRLA 3FZNA 4CMJA 3BD6A 3HCWA 2Q9BA 3K0EA 1T26A 3HLTA 2Q1UA 2YMQA 5JBIA 1A7AA 3IELA 4I50A 1U3FA 3JYLA 3CW2A 5ALDA 2XODA 4DJFC 4D9EA 1CXZA 4B6EA 3O1JC 2JATA 1JDJA 6YASA 3NIWA 1G18A 5EXPA 1JR6A 1BFKA 1FFCA 2FU5C 2PL1A 3JAWA 4OIFA 3JPYA 5IFKA 3X44A 4JELA 3DMTC 3K8YA 4CT4B 4QLAA 3MD0A 4JU8A 5FO1A 1S2GA 1P5ZB 3JVUA 4X97A 3V7FA 2BTEA 5JJIA 2W2VA 3QOFA 1B16A 2C9MA 4HP8A 4TL6A 4ZU6X 2PBZA 4PLFA 4JBIA 5L7YA 4HNUA 5JS7A 2EYQA 4IIFA 2CMFA 3A3KA 2B8NA 5B12A 3CMMA 1DFHA 1N4AA 1A50B 2EXXA 4IL5A 4XB6B 2B30A 4PRYA 1PGQA 3C8DA 1LPMA 2AXPA 4IPTA 4Z3OA 3U5ZB 1C3VA 3ABRB 3BH6A 2PKCA 4MLPA 1Z73A 2X0NA 4BLSA 1NX9A 3ZJ5A 4E03A 1ZD5A 3GY0A 3HVKA 4UW9A 3KSMA 1H9CA 1CU1A 4L4SA 1SKQA 2CJYA 2IP2A 3VR6D 2FUCA 4JROA 3PFNA 3ZW8A 3U6BA 3WGNA 4YREA 4DPKA 4RNCA 2Q62A 4RKRA 3T4XA 3OIUA 3L4KA 4HKTA 4P2GA 5SZKB 3O8CA 3FNIA 4JP1A 4M1WA 4MGYR 5JO0A 4MUFA 1P80A 3L7LA 2R66A 3PQDA 1CB0A 1FDIA 4CMCA 5FI5A 4IHJA 5F9HA 1RTTA 2BBTA 1SELA 1HDZA 3HXLA 5ELMA 1H2AS 2ERYA 2O54A 2XMZA 4K6MA 1BU5A 4OEHA 4CT0A 1XLUA 3DUFA 2QN8A 3AEUB 3GEDA 5A0VA 3IP1A 1NAIA 2QS9A 2MT9A 1M6EX 2O5EA 3PXUA 4BKQA 1Q6ZA 2GD6A 3L93A 3KKNA 4NCHA 3FJYA 3EUWA 1T1IA 1BDBA 1UDRA 2OY0A 2H63A 2QRJA 4UUMA 4UZEA 4BNWA 5ICEA 1SN7A 2RAFA 4YO8A 5GVSA 5JIBA 1GPUA 1KAEA 3DXFA 4IQ4A 1MB3A 2V98A 2I6XA 4PTYA 3BRWD 3WNBA 5DM4A 1AHNA 2R2AA 4IIJB 4NHOA 5C51B 3CBQA 3GX1A 1QCZA 4K9DA 2HNAA 2XJ4A 3HM2A 4CMIB 4UBIA 3H3XA 1JW9B 3GNQA 4C4OA 5JI2E 3PENA 5F4BA 2PIDA 1EJ6A 2IXAA 2YXEA 3IEIA 3KPVA 4UPVA 4E5KA 3ZIDA 4F11A 4NBRA 3VTAA 2H2GA 2PUEA 1MAUA 3ANMA 3TW0A 5IVPA 1Y0BA 3RK4A 3T4PA 4E51A 4UUQA 2XH8A 3VR3D 2OFWA 2CDCA 3C8MA 2GXUA 3IAUA 4HHEA 4NPCA 3PX2A 1X7YB 2BZSA 4YRMA 5CFLA 2GLXA 2GPNA 4AFNA 3HDQA 2UU9B 1ODFA 1P9OA 3SE7A 3HL4A 1U9IC 1QOQB 1YR2A 1DMRA 3RW9A 4TSKA 1RPAA 4TS1A 4CTMA 5JRJA 3QTTA 4A5SA 2QX7A 3B6MA 2PUDA 2P6RA 4Q4CA 2F62A 3AFOA 1ST3A 2ZI4A 2JBWA 3VHXB 2G5GX 4OQ4A 3PC6A 1K1EA 1KAQA 1I13A 3W6UA 3O8RA 5IAGA 3JQDA 5L95A 3NVDA 1B15A 1YJ5A 5F1PA 2X7JA 1P7CA 4WOKA 3AVTA 3BICA 1XRQA 3M9LA 2DJ5A 2OECA 4D80A 4PS1A 2W48A 3G2LA 1PR9A 3Q85A 8AT1A 1QXSA 1KP9A 1R0WA 2AR7A 5BUZA 5CPBA 1KJQA 3OG9A 3KUKA 4R7TA 1LB1B 3TFOA 5THKA 4LX8A 1S2NA 1Z2NX 1Y5LA 2QV0A 1Z47A 4JVLA 1QV9A 4JVOA 3L4SO 4BLWA 3ZGLA 5H68A 4PXAA 3NIFB 5ITZB 4LVOA 3NDIA 4M98A 4OKNA 2J33A 4JC4A 3ZLBA 4HATA 4D4GA 4CEHA 3ZXYA 4AIIA 4WA7A 5F9FA 3MAJA 1JQ3A 4FEGA 1EUDB 4G1CA 4RPLA 2W6MA 3KD3A 5H5JA 1SK8A 4LC9A 3AWDA 1ZK2A 3SE0A 4L95C 2HA5A 2SCUB 4LXYA 3QYJA 5E6SB 4FTWA 3V46A 2OV6A 4LQDA 3F98A 3VBCA 4GZLA 2HO4A 1NJ5A 2JPDA 4JJ7A 4J03A 4LQ4A 4QGHA 2I3AA 4XUEA 1JKIA 1SWVA 4L75A 3U40A 4WOPA 4LMBA 2HTFA 4GOLD 4PRZA 4AUKA 4BX2A 3VPGA 1FK8A 2PMBA 2Q1XA 4RSGA 2GEJA 1NF2A 2FPXA 3NI2A 1QHSA 3NYIA 1N5RA 2BFNA 3CX4A 2BFBA 2PLNA 3HCOA 2PKQO 3O2NA 2C2YA 5KQPA 5LXTF 4W1QA 2X7HA 2OOSA 2OXCA 4RK5A 2BCEA 4EYOA 3UVEA 1JH8A 3I05A 4S0ZA 2PL5A 5T64A 1Z28A 4JI7B 4K0RA 3CRVA 121PA 5LYYA 4F3YA 2JG3A 3GIDA 2QRGA 1V1MB 1H5QA 5TV2A 5IJ0A 2P9ZA 1N1GA 5BRNA 3RYIB 2QL5A 3JWPA 4OQQA 4TKVA 5FFFA 3D4PA 1UM9B 1U31A 2J46A 2OUIA 3B12A 4Y2PA 4EWLA 4G0VA 4N0MA 3UXEA 5A9SA 1RXVA 4NBUA 5FPHA 3P45A 3FDZA 3SFVA 4PZLA 2OGSA 1XD2A 1P31A 1AKRA 1P8AA 4RVNA 1HT1E 4RL4A 4C2BA 7MHTA 3ZZ1A 5EJ9A 4U3JB 3M89A 2O2DA 2XT6A 2ZR8A 4II3A 5K3BA 2XNCA 1OFVA 1SXJC 3IUJA 4M0PA 3VQTA 3ZEAA 1AX9A 3O38A 2OCLA 3STXA 1XHEA 5FPTA 1U9CA 2EKPA 2TYSB 2BDEA 4OSEA 3D0RA 3NQ41 2SICE 3DP9A 4KSYA 9ATCA 1O5IA 3SEFA 1A5SB 4ZQHA 3N0VA 1ZNWA 3L1VA 1RLUA 2VR1A 4HTAA 4MV3A 1NFFA 2XVYA 3SMQA 4PPQA 2IIPA 4IJQA 1DWQA 3FFBA 4TRRA 5K0GA 5EFOA 4IG4A 5HUJA 1YI8A 2XX3A 2AG1A 3W7AA 2SNIE 4NFSA 1ADJA 1V4VA 3INRA 4HVTA 1MC1A 1OUMA 1R9GA 2A0UA 3I9FA 3KDSE 3QENA 5P21A 4V0KA 2R6AA 4BE7B 4BTEA 4CYMA 5HYVA 3KYCB 4P82A 2QX6A 5DM70 1IY8A 4CG1A 1QPZA 1BHSA 1D9ZA 3O4VA 5FUQA 1NVAA 2XMCA 1SC3A 4K6CA 5ICMA 4D2IA 2OBNA 2J9YB 2J6HA 1A9RA 2H8GA 2OBMA 1TKAA 3I53A 4IDPA 3SZGA 2EWMA 1FL9A 3T3NA 4I5IA 1NVKA 1F3LA 1KEZA 3IO3A 4MYCA 1T2FA 4ND7A 2JJQA 4C1NA 4LFBB 1MPTA 1T8PA 4M1EA 4HVCA 2QJOA 1IAVA 2PQ0A 3P2EA 5JTUA 2V6BA 3AZOA 1PWEA 2OFFA 2YJNA 2R86A 1ILWA 1P60A 2OPBA 1GKKA 1PQPA 1YBVA 1Q1BA 2NZUG 3AY6A 4UHFA 2VSQA 4XB1A 1YFZA 3DMRA 3RUDA 5DNCA 5JYCA 3AVYA 2HQSA 1OBFO 4LBWA 2QXYA 4YONB 2Q4RA 3UA4A 3ZV4A 3DE1X 1OR8A 1QQ5A 2PBRA 1BS2A 3B9RA 3K2IA 3MB8A 3NKLA 3KKPA 4GSLA 2CF5A 1V4BA 5DHTA 3C5WP 1CVIA 4RL6A 3ZNOA 5CVUA 1GYPA 1SCJA 3ZX4A 3A14A 4KFCA 5K05A 4JLPA 2BI8A 1EA7A 2JLSA 3HFRA 3PTLA 4RY8A 4DNPA 5KZMB 3CZMA 4BNNA 4KODA 3ADCA 2JAWA 3ELDA 2LV8A 4EEKA 4LY3A 4E7OA 4W5RA 1Y42X 1PJ2A 3FOCA 4REMA 3W2HA 2EV9A 3S28A 5C9ZA 2P9YA 3LQ4A 2DGDA 3G8AA 4GLJA 5GJWC 1D7OA 1CFJA 5FXMA 2A14A 5DV9A 2LTAA 4BKOA 4CMKA 4WLUA 1XJ0A 1I2ZA 5DW0A 1H6AA 1DEXA 2AX4A 2YOFA 3OEED 2FSPA 3OPQA 1GNRA 3R0XA 3MZ0A 2WMOB 2WWFA 3CNEA 4GPTA 4ZOLF 4F2WA 5JCZA 4MMXB 1HQKA 1XZLA 2G83A 3D3QA 2B37A 4LXHA 3JYOA 4DLLA 3MWGA 3HZZA 5LYJF 2HB6A 1OVGA 2OCPA 3L6OO 4RADA 1N0IA 3SHOA 2I8AA 3HKCB 1CWUA 3QKSA 4EHJA 4BNIA 3A6KA 5REQB 5DU2A 3SXPA 3SBEA 3COJA 1QO0A 3WKEA 4TV9B 4RSMA 4WNAB 3NJRA 5DTMA 5EJMA 2IUUA 4DR3B 3EZFA 4EHNA 2RGXA 3FPEA 4J6EA 2P3SA 3DDHA 2YBEA 2H1HA 1GV0A 2VXOA 4FCWA 4M8NE 4RSHA 3QYFA 4P80A 3RSLA 4E32A 1XSEA 4FGLA 4C7OB 2Z4TA 4XA8A 2NUTA 2ERXA 3B6JA 1JXMA 2JAXA 2RONA 3BZBA 1WTCA 3CKMA 3VTFA 2B82A 1G1AA 3SJZA 1EK5A 1L4KA 3OI7A 5KTSA 1E0AA 2PT6A 3DDUA 1RJ9A 2OHVA 4TV9A 2QRPA 2V03A 4YRDA 3ZCRA 2ESRA 3RHSA 2ZAGA 3MMSA 1NE7A 1J8VA 1QK4A 3KT8A 5LQRA 2IHTA 1VYHA 4PZDA 2XGMA 4NCIA 5I4KA 1XTUA 2EFYA 2P69A 2R60A 3W7BA 2EG9A 3REOA 1ISFA 3SEQA 4IIDA 4D9FA 1ILEA 1U0LA 3KQVA 2J08A 3NYWA 3JZDA 3WIBA 1VPWA 1NIJA 2VLBA 1KS2A