1A9SA

Bovine purine nucleoside phosphorylase complexed with inosine and sulfate
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
282
structure length
282
Chain Sequence
MQNGYTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDTESQGKANHEEVLEAGKQAAQKLEQFVSLLMASI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PURINE NUCLEOSIDE PHOSPHORYLASE
publication title Calf spleen purine nucleoside phosphorylase complexed with substrates and substrate analogues.
pubmed doi rcsb
molecule tags Pentosyltransferase
total genus 84
structure length 282
sequence length 282
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 1998-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1a9sA00
2Q7OE 1OTYA 3DDOA 1Z38A 2HN9A 1Z5OA 4KN5A 3OZBA 3FNQA 4PR3A 3DP9A 3LA8A 3E0QA 5CXQA 1CB0A 4YO8A 1TD1A 3DJFA 3ENZA 5IU6A 4OEHA 1TGYA 3K8QA 3P0EA 4WKNA 1LV8A 4G8JA 5EPUA 1B8OA 3UAZA 4GMHA 3OZCA 1ECPA 4LKRA 4MCHA 1OU4A 4OF4A 2OC9A 4TTJA 1M73E 1B8NA 4QAQA 1ULAA 4M7WA 2HSWA 5F7XA 4H1TA 3EEIA 4WKPA 1PK7A 4YMLA 5IFKA 1U1DA 1U1FA 2B94A 3FAZA 3FB1A 4D98A 1K9SA 4I2VA 1A9OA 3KUKA 4DA0A 1YR3A 1N3IA 5CYGA 4QATA 5JPCA 2QTTA 4F2PA 2P4SA 1RYZA 2H8GA 4UC0A 3OZEA 5EFOA 1C3XA 3TL6A 2I4TA 1YQUA 3IEXA 5F7OA 1Y6QA 4NS1A 1YBFA 3E9ZA 5F7JA 1ODLA 3OF3A 1SD1A 1FXUA 4DA7A 5C80A 1K3FA 1PR0A 2QTGA 4D8YA 1SD2A 3UAYA 3O6VA 1ODKA 3NM5A 3PNPA 2A8YA 1JDZA 3FOWA 1Q1GA 3KVVA 1Z36A 1TCUA 1ODJA 3EMVA 4DAOA 4L5YA 2IQ5A 4M1EA 2OXFA 4X24A 1T8YA 1V3QE 3OPVA 4K6OA 4DA6A 1A9PA 1QE5A 1T8WA 3NBQA 3PHCA 1T8SA 1Z5PA 5DK6A 1Z5NA 4TXJA 4EARA 2XRFA 4MCIA 4LNAA 5B7QA 4DAEA 1VHWA 3KVRA 3F8WA 1V48A 3OZDA 3PNSA 3NM6B 3C74A 1YQQA 1WTAA 3T94A 4TXHA 1NC3A 4TXNA 1RXSA 1PR4A 3OCCA 2OC4A 4QEZA 5F7ZA 5CYFA 3DPSA 1A9TA 4NSNA 4OGKA 4P54A 5FAKA 1PWYE 3BL6A 1ODIA 4LZWA 3KU4A 4BMZA 3K8OE 1JP7A 4BN0A 4BMXA 1U1GA 1JE1A 2AI3A 1JDTA 2BSXA 3FWPA 3GGSA 1A69A 1VMKA 1PR6A 4F3CA 4WKBA 1OTXA 1Z39A 1A9RA 1CG6A 3GB9A 1PR5A 4E1VA 4TTAA 4DA8A 1LVUA 4JP5A 4D9HA 3P0FA 5I3CA 1Y1SA 1PW7A 1OUMA 3LGSA 2RJ3A 3EUFA 4RJ2A 4IP0A 4TYMA 1RXUA 4G89A 2A0YA 4L5CA 4QASA 1T8RA 3BSFA 1JPVA 3QPBA 4BMYA 4D8VA 1PK9A 4R2XA 1NC1A 2AI2A 1PBNA 1ULBA 4F3KA 2PGAA 3ODGA 1U1EA 1Z33A 4JWTA 5F77A 4L0MA 2AI1A 1PKEA 4FFSA 1Z34A 5K1ZA 1OVGA 3LBAA 4EB8A 2ISCA 5B7PA 3OOEA 3BJEA 4JOSA 1RFGE 4F1WA 1A9QA 1RR6A 4M3NA 1VFNA 5CCDA 4G41A 1JDUA 1LX7A 1V41E 5F73A 3BGSA 1PF7E 3D1VA 5F76A 1SJ9A 1ZOSA 1TGVA 3O4VA 4D8XA 1RSZA 4GLFA 3IOMA 4WKCA 2GUWA 1NW4A 3KVYA 1XE3A 3FUCA 1JE0A 5CXSA 4ECEA 1YRYE 1T0UA 5KB3A 2AC7A 3SCZA 4PNPA 2OECA 4QARA 1Z35A 3DF9A 2QDKA 4R2WA 3UAVA 1RCTE 1JDSA 5B7GA 1U1CA 4MARA 1A9SA 4U2KA 1ZL2A 3ONVA 4GLJA 4DABA 1RT9A 2I8AA 1PR1A 2A0WA 3PHBE 1JDVA 3E9RA 4F2WA 1V4NA 4DANA 3KHSA 4NY1A 5CCEA 1OV6A 1Y6RA 3UAXA 4YNBA 2QPLA 5ETJA 3U40A 1RXCA 5EUBA 3OOHA 4GKAA 4R31A 4DARA 4LDNA 4TS9A 3UAWA 3NM4A 2ON6A 1V45E 1Y1QA 2HRDA 3EUEA 1G2OA 4WKOA 4QFBA 1V2HE 1I80A 4TXLA 2QSUA 4LNHA 4L6IA 4TXMA 4TS3A 1K27A 1RXYA 4OY3A 1Y1TA 4OGLA 1PR2A 1Y1RA 4YJKA 1SQ6A 3MB8A 3MMSA 4TTIA 5B7NA 3INYA 1TCVA 3UT6A 1JYSA 1Z37A 4OJTA 1VHJA 2HWUA 4L5AA 2A0XA 5F78A
chains in the Genus database with same CATH superfamily
1O54A 3ORYA 4MMYB 4JQYA 1EEHA 2AXEA 4LN1A 3AETA 1QCCA 1U3VA 4QBHA 5ABPA 2GF0A 1ZHOA 4FQ5A 3P0RA 1KZ1A 2C8KA 3I6MA 4GBMA 5FULA 1OFVA 2NPOA 1N2EA 1P2BA 2QK4A 4KBFA 4LC0A 1MQ8B 3TWOA 2PWBA 3GJTA 1E20A 1L5KA 1JQ5A 2UKDA 4AN0A 4MW9A 2QX6A 3QEMB 4DQ0A 1KEZA 4ZODA 5BOSB 2EJTA 2PVSA 3FKJA 1XQXA 3FPGA 4HAOA 5HK9A 4ZTZB 1NVUQ 1CQPA 3SM9A 2CNDA 3EIXA 4H27A 4HDOB 4K6KA 5AW1A 3JWHA 1UBKS 4Z1MA 3DYVA 2IYPA 4DGQA 5AJVB 1I5RA 1AUOA 4DZZA 1QQTA 1M3SA 2DWCA 3RU9A 5CD9A 1XEWY 4MW0A 3VPHA 3TI9A 2X2FA 4I4TB 3RROA 1E4OA 3HB9A 1TMKA 1Y3AA 5KNCH 4KYVA 3EGCA 2YW9A 2VHYA 3D4LA 3L05A 1Z4JA 5BMVA 1DMRA 3RLIA 3FTFA 1W59A 2OC9A 4NFHA 4RLSA 1V16A 1G59A 4C0QC 2VPYA 4G5YA 4TTJA 3ND6A 4LF4B 1BVHA 3H9GA 3WKEA 2OUKA 1K8XB 5I9LA 3GZNB 1ABFA 4JC0A 2AQHA 2VJAA 1Q44A 5EMNA 1EFLA 1TUGA 1X7YA 2Y0DA 1Z7EA 2NTYC 4O29A 4RMJA 1M34B 4U6NA 4CEHA 2ZRIA 4K9PA 4ZAXA 5BWBA 2JHCA 2HPZA 4GFDA 3HB1A 3NHBA 3RJ5A 5FDFA 3TE6A 1NZJA 4Z9FA 1MKYA 3NONA 4D98A 1D04A 4GNRA 4A8JB 3N8GA 4D6PA 4EJMA 2DHDA 1XPOA 1SOAA 1SVOA 3KUKA 3KZKA 2REOA 3GLTA 4ZT6A 2GGSA 2H00A 4B33A 4EG0A 4YRDA 2O1WA 3PFIA 1E0SA 2BKEA 3MAJA 5GQSA 5CYGA 4OQFA 3ZBPA 1QTQA 3K8YA 3SYRA 3HYSA 3DEJA 4RTSA 4F2PA 4UZEA 1J22A 1H1TA 3T9CA 5KSZA 1QKIA 3FPLA 4G0MA 1Q0PA 4AG5A 1I1OA 4R9SA 3QQ5A 3WNQA 1JAIA 1PS9A 2GESA 2N9UA 4H7JA 5C7IO 5LM3A 3AUFA 2O8FA 2VPIA 3FLAA 3T1HB 3AL3A 1LA2A 4PRZA 3TW8B 3FYUB 1JR3D 3CC8A 5NULA 3ZD6A 3K96A 5DRTA 2GXUA 2ZUVA 3TIXB 1SQGA 1RYDA 3VNBA 1JI0A 2IOFK 1E9DA 2R44A 1R88A 2RKWA 2VA8A 3FJOA 1P8AA 2H7YA 4HDMB 4OIFA 1ZU4A 4RHUA 4DADA 4F5YA 1CJMA 1N6IA 4OL0A 3RAPR 2BMDA 3F47A 1CQWA 3HRHA 3AXSA 4MPTA 3SN6A 3ETLA 2P8JA 2ZYHA 3LC1O 4N5MA 4RFSA 2JEYA 3I23A 3R7NA 4G8BA 2O8VA 4F4IA 2R1TB 1E4YA 2IEGA 1C30A 2ZTSA 4LHWA 4BO3A 4K9LA 3RUFA 3GOQA 4MRMA 5EZYB 2VT2A 1ZKMA 1KJWA 1QC5A 3LHIA 3NHRA 3EPPA 4C88A 1JEDA 3JPYA 4FJ0A 1ZLYA 1BEEA 1JKJA 2W6JA 1K4MA 4FCVA 2CSUA 4KV7A 3P2MA 4P1ZA 5EIBC 3DW3X 2EFGA 1Z74A 4BNMA 2XZPA 5D87A 5K8CA 1ZJJA 2GF9A 1N6HA 4NAVA 4LVUA 4GM4A 4JX9A 3DDNA 4UDOA 3GZJA 4NRDA 5AM2A 2A9JA 5J2UA 3KBOA 2C7QA 1L4UA 1KVQA 1W1IA 1ZGCA 3RF6A 3F5QA 2W70A 5CJJA 1I0ZA 1XF9A 1H6DA 2FQYA 1Z06A 2X1HA 3M6MD 2EZ9A 1G4AE 3UK1A 2W6QA 3LW8A 3HFRA 4M36A 4ZEXA 3PNKA 1TU0A 2XOKA 5KREA 2XCRB 4TYYA 2OXFA 4GICA 4HGPA 4PLHA 1TKAA 4JT8A 1QK4A 1V3QE 4I1UA 2C4WA 3BK7A 1DC3A 1WXHA 3QVLA 5CB4F 2YYZA 1I6MA 4MW5A 4A2WA 4G0VA 4IOJA 3D2CA 4RAQA 3GJXC 3GAMA 4AJEA 3E1KA 1P7WA 3P4YA 3BTOA 4LFAB 2F17A 3LCVB 2Q3LA 4I9FA 4HG2A 4JP3A 1WRBA 3TAHA 2CV2A 3JS5A 3I04A 3PHCA 2JFOA 1P1CA 3V2IA 4AIRA 3RNLA 5KQMA 4CLEA 2HJ9A 5BOSA 2VK1A 4LXYA 1UXKA 4HS9A 4E2ZA 3R7SA 1GZDA 4Y6OA 1O0BA 2CY0A 3EGIA 3D6MA 2WAXA 3OZIA 3D3EA 1RPZA 1FUYB 3QNUA 2Z83A 2IXEA 4ZO9A 2GKSA 1XA0A 2VPXA 4KQKA 1OT5A 4KXLA 2IHTA 4CCSA 1V9CA 2R2GA 2ZLBA 4OGWA 2IXGA 4R1TA 5U4XA 4EX6A 3TLZA 4U7GA 3T4XA 1AS0A 2X8LA 2YY5A 1ONNA 1MOPA 4I8DA 4KN6A 5DCYA 4ARZB 3RS9A 3R23A 1V8DA 3JRXA 4XW2A 1G21E 3CNHA 1XVAA 2G5GX 3SG0A 2BJHA 2P6UA 4HZGA 3F9RA 1RXVA 3A6LA 3WNBA 3VH4A 3UT5B 4ID9A 2FSFA 2G08A 4PCUA 4UXIA 5CVVA 4UVHA 1GUAA 2QTMA 4AJ4A 1L8OA 3OY2A 1NVVR 1F1JA 4M6WA 1NVBA 2DFPA 3NBZC 3NYQA 3PK0A 1E61A 4QO8A 1JPUA 3U3ZA 1BN6A 1GQSA 2WJYA 4BJHB 4NFYA 1IG0A 4J0DA 3I8OA 1MW8X 1N2GA 5FV4A 3UWSA 3JQ8A 2BBTA 1CUIA 5I4CA 3Q2IA 3A9WA 2GPAA 4LY3A 3RF7A 4B4WA 4E2XA 2ECPA 2PLRA 3I0NA 5HRCA 2WZDA 3QITA 3C3MA 1U0HC 3RSFA 4MR7B 4HBGA 4GPBA 3BWDD 3L0BA 4XLLA 3EXHC 3PUVA 1JLRA 2DJIA 2QRNA 2ZI7A 4P84A 3WC4A 1KIMA 1LSSA 3MCAA 1V8ZA 4DIKA 2MT9A 3AZPA 3AERA 3OZTA 3L6CA 2I3BA 1N9GB 3NHZA 5IDVA 3DMTC 5I7RA 5BQXA 4OHXA 1Y48E 4Z3OA 2W2LA 1YB4A 2XQFA 4RZHA 3AILA 1UR5A 2VUSA 1DX9A 4TMWA 1E5XA 5CTJA 2LZ0A 4DGSA 4CF6A 1J39A 4XLZA 4LRUA 4O02B 4XM2A 2ZDHA 3FCCA 3URMA 4R40A 4ESOA 5EIEA 3OLCX 2XCOA 1S2IA 5GONF 3PA6A 2XITA 1A5AB 1Z0KA 1ZK4A 5FJJA 2WKQA 1H2AS 2YXEA 1H9BA 5E3JA 1HT0A 3PHGA 5LQUA 1T4CB 5LD2C 5CVTA 3I73A 4JJ6A 3VO2A 4I55A 2PUWA 1CUHA 4J2TA 4XWTA 2NN3C 3H2JA 3HBMA 2Q5EA 5TGZA 3EFBA 3ROXA 3RRFA 5L51A 1SBCA 5BVGB 5LDHA 4QQRA 1L7NA 2YFQA 3N86A 1XMIA 3QLVA 4FDAA 3SEAA 1BMQA 4ZHQB 3ABOB 1C0EA 4R1UA 1V7CA 1VQ1A 3BBPA 4HVAA 2V7TA 4KXNA 3R7LA 3CIFA 2J1LA 4G0YA 1BHQ1 2DWQA 3D8RA 5AXDA 2AN4A 3TTXA 1IZ9A 4H18A 4QUHA 3ESXA 4ZXPA 3GH1A 2C3PA 1XNRB 3LP8A 4N3CA 1BCSA 5KVSA 1IWOA 1U0BB 1KY2A 2B2CA 2ZU6A 4TGLA 4BP3A 3NH9A 3GLIA 2GNPA 3DJYA 1VJ5A 5CIWA 4QOFA 3DB1A 4X6YA 5J4YA 1YOBA 4YV1A 4N5LA 2G1PA 3UK7A 2ONZA 4YAKA 5FPSA 2G1AA 2XUHA 3HBNA 3QPBA 5EP1A 4E1BA 1XZAA 2CD7A 2SKDA 4P2GA 4XDHA 3T9FA 3DE5X 1RHUA 5GZ6A 4E5KA 3OPXA 3DNFA 3DE6X 3KAKA 3N2GB 3R3SA 4LX8A 3LJKA 1T13A 1Q95A 2QRJA 2RSLA 3AHFA 4G97A 4O5OA 1ZH8A 4EW6A 2RAVA 5F33A 2PMDA 3ZXXA 4X5OA 4QE3A 3H42B 4R1SA 1HDYA 2NPFA 1E2MA 3WJ1A 4LF9B 4C5AA 1YJBA 2ONKA 4G07A 2O5EA 2RFLA 3PUXA 1RYEA 4PS0A 1PKEA 5GJWC 4OQQA 1PJTA 5BUSA 3MNFA 4I66A 3C6MA 2QAGC 5K1ZA 2CXNA 5JZVA 1SIOA 3D7SA 3BJEA 1F8GA 3E4CA 3NHAA 5GOTA 1Q12A 4PG7A 2GR9A 1B14A 4RTQA 3RIHA 1GG9A 3UPDA 3DBHA 4L28A 1ONBA 1YS1X 3MWJA 2W6CX 3GMTA 3TVYA 1P2FA 2HK9A 1ZIYA 5T41A 4OXXA 2O7QA 4RS3A 5KAMA 1PUXA 4DKXA 2GK6A 1QE3A 3NRBA 5LR6A 4KNVA 4XI9A 5DISB 4BMVA 4D5EA 1LW6E 1Z0UA 2I4NA 3GGOA 1WDWB 4RDIA 1PUJA 2J67A 1P5RA 4F38A 2EERA 1GCUA 1YIAA 4W7SA 6REQA 2AYZA 3FUTA 3K2EA 2HL6A 5AQEA 3ECSA 3UQZA 3S1SA 2EJUA 4YPFA 3LUBA 3LUJA 4B4DA 1C3OB 1IY2A 4TYPA 2L19A 4FW8A 1CVIA 4UAJA 2ZUDA 3QX7A 5F5LA 3WZ2A 1JKMA 1DIGA 2AC4A 1AC5A 2E87A 1ZOSA 2HX1A 2OQRA 3ABIA 5K0CA 3AHDA 3VVMA 4AT1A 1E0AA 1IN8A 2VRCA 3D6FA 4IVRA 4K6HA 1XGKA 4JP8A 3U3DA 3WK8A 1E60A 3W8EA 1P4JA 2JFZA 1RJFA 2OGSA 3DEZA 4PZZA 1IPHA 2ALJA 1FYVA 1KQ3A 2QP3A 2X3FA 1MF7A 2XUKA 5DI3A 2OFOA 5K3BA 4MS4A 1OXBB 1Z29A 2X13A 3GFFA 4M9RA 4DCGA 1XNGA 1JW9B 4M8IA 4CV1A 1QRUA 2VR1A 4ZJYA 5E1DA 1GTMA 1T0UA 3D3WB 4S0ZA 3STXA 1FXWF 1C3VA 4L4UA 4G09A 4K2AA 1MO4A 4TSFD 1EA5A 4AWAA 1ZONA 3TGWA 1D2GA 1MTOA 2EV9A 2I2XB 3JAKA 3LT2A 3QF4A 4FFRA 1TT5B 1RAAA 3SXUB 3UMBA 4OHOA 5AW6A 1RPNA 2ATIA 2XGJA 1VSVA 2PXAA 2K5UA 2DH6A 2B4TO 3AUSA 3N0WA 2J3HA 2YNMC 4GQAA 3HU1A 4WD3A 3FAKA 2VNJA 1GGJA 3PTLA 4Q93A 2NOAA 2VEDA 5KX5B 4DMLA 2SICE 1NJGA 1UPUA 2C29D 3UTDA 2HSGA 4CTOA 5ARDA 1NUAA 1KYZA 4B74A 2JD1A 2R9VA 5BR8B 2B9VA 1P4GA 3V9AA 3RUHA 3N28A 4UU1A 4HRXA 1QMGA 1P5HA 3MB5A 2I8AA 3W78A 3CV3A 2EFJA 1QFZA 1QANA 2QT1A 1WBDA 3WLSA 3TAXA 3HPRA 1JB1A 1Z4KA 1VPEA 2QMYA 2X4GA 3L8FA 4PHTA 1ZUWA 2GA8A 2XQKA 2WHYA 3SKYA 4OB7A 4L0CA 3I5YA 5FPKA 2W6IA 2WOJA 3P9RA 3Q98A 5ALJA 3RJMA 3VTFA 3LDUA 3QLJA 2BSQA 4KQEA 5KC8A 3RVPA 3OFNA 3A9RA 4KQIA 1ISIA 1P19A 3UCXA 4W7IA 1Z2OX 4N40A 3BL5A 3TLKA 1I1QB 3HKCA 4MMXB 5EJGA 4LAFA 4M76B 2IQIA 1OZHA 1T5IA 3CCBA 1K75A 2UUOA 2X6QA 3T7IA 3I2JA 2B8JA 4X71A 1SK8A 4RA9A 1ZPDA 4Q1EA 5DNDA 3ZUPA 3T9EA 2OMKA 2VHJA 4LTMA 1G2OA 4XQCA 3UYKA 4WKOA 3TZHA 5L7WA 2ZATA 4Y98A 5FTJA 4GNKA 3ZKWA 5D2CA 1L5MA 2JFFA 3GPDG 5IP5A 5B1YA 1D2NA 1TO2E 3QYPA 3K6SA 1XA3A 1Z4OA 3PPYA 3EVZA 3MBOA 4LJKA 1WABA 2EQBA 3THXB 3CNLA 4KR7A 3U7IA 1QP7A 4BZQA 3R7WB 3IP9A 4OK3A 1R10A 1ISHA 1C29B 3EY4A 4GYJA 3WTCA 2QRVA 5BSEA 1FIUA 1G291 1YUNA 1Z7GA 2C2ZA 2ZIAA 2C4TA 4UREA 3ORHA 4P3XA 1VG1A 5A6VA 4A4DA 3OECA 5KYVA 4F1JA 5JD6A 3FVVA 5TEWA 2BUCA 1L7DA 4FGKA 3H1FA 3E9YA 8ADHA 2QAIA 3AQ4A 4CMHA 2YUIA 3CZQA 2P67A 2BEWB 4MGIR 5EPOA 4FWBA 3FJ1A 3MB8A 1QIIA 2OO5C 2Q4TA 2XBLA 4MPPA 4MW7A 5DZSA 4PYMA 2PX6A 3OKCA 3QFTA 5B1HA 3IQIX 1Y8AA 1Y82A 3EXIB 3JATA 4US1R 3FN4A 3DL4A 5K20A 1AKYA 4JEMA 1HZZA 4U5QA 1CUFA 2R97A 4J0KA 4QU8A 5E8RA 5JH7B 1N6OA 4MR8A 3EC2A 3OTWA 4J7CA 1J33A 1WPGA 3EEBA 3NDIA 1PJLA 4WXHA 2X22A 4NPCA 1CY6A 2YX1A 3KOXA 3OQJA 4E5PA 3I1YA 4M8NE 4YMTA 2QLLA 4DR1B 4UKDA 1PW5A 2QMUA 3JTEA 5AJWA 3F9CA 1Z38A 4TLMB 1Z5WA 3EXAA 1QZ3A 2Q5IA 2H29A 2ZBRA 1OYOA 1U98A 1E3TA 1Y8QB 1W44A 2FTKE 4L9AA 1Z5OA 4XXHA 5JNRA 1C8BA 4N54A 4CE6A 2C82A 1B76A 3THRA 1JTVA 4UXJA 2FP4A 3REFA 3W4KA 4AJ9A 4B2LA 2BH9A 2CK3D 1O2DA 3ZHSA 3DMYA 1RS0A 4E3ZA 3FDJA 3JARB 3CYFA 3UK6A 4CMGA 1X1BA 1VOTA 4KFUA 4QELA 5F35A 2DQYA 3VR6D 2VHXA 2PD6A 1OKKD 4FZVA 1UJMA 2VQEB 2AFIE 2HXGA 5EJ5A 3OQMA 2CB0A 1B0ZA 2YS6A 4MYCA 3S70A 5LFAA 1GM5A 2ZB2A 1Q74A 2HMWA 4LS3A 4ZI5A 1YS6A 4G0PA 3IUMA 2HRZA 1WU7A 1QV7A 2VSNA 2E4VA 3UWOA 4MK4A 3C87A 3ADPA 4QDXA 1YQTA 2FLKA 4DLKA 4E2YA 5LJLA 5HF5A 1A7AA 2WMYA 1IHDA 2Y8EA 3LCJA 4M7WA 5TF0A 1LRLA 5TB5A 1PDVA 1Q1NA 3MFQA 3WK4A 1TLLA 1N7GA 7REQB 5JZBA 4KTTE 5CURA 4DDKA 2O8DA 1ZYUA 4BWVA 1FS6A 2XPCA 1MNQA 1B7GO 1P0MA 4MQLA 3E23A 3LF1A 2J59A 3BH7A 3FAZA 3EYAA 4NHOA 1P74A 1WWKA 1H2XA 4OFBA 1NL3A 4AYWA 2XUJA 5DTIA 3JWJA 5BOVA 3D4IA 3PWKA 4A91A 1LPAB 4D0GA 4F06A 3MJEA 4OGFA 5IX8A 5I9MA 2PUBA 4NBNA 4LNUA 4P34A 3SLGA 2L42A 1CJKC 3DQPA 1J8MF 1ZOLA 1RZVA 1X1CA 1VLJA 4IXWA 1A5ZA 1KXZA 2PTGA 5F2OA 3A3NA 4H31A 1JLLA 4BAZA 3BFKA 1AV6A 5CM9C 3F6SA 4RSRA 3NHJA 1GZVA 1KFBB 4I7EA 1KQNA 5JJ5A 1QVZA 3DE4X 2I4TA 3HUTA 1QV9A 1NX6A 4Q3CA 4EJSB 4KDFA 1V11B 4Y2PA 2I2BA 1X94A 1JQAA 1XTSA 4EQZA 4ODIA 4UM5A 3QKSA 3NHLA 1NN0A 1ORIA 4A8TA 1LQTA 3EZGA 3H19A 3NW9A 2B6HA 3GJRA 4QUJA 3WLHA 4CKBA 5DTJA 3ZTWA 3KSZO 2A0UA 5K8UA 2ZUFA 3L5OA 1CUSA 3LUFA 1ZIPA 1YIOA 3JU3A 3LIPA 4ZQIA 3RSHA 5JJBA 2PHZA 3KAPA 2FQXA 1I01A 1LDBA 4URZR 3S1AA 3V7FA 2J9YB 2XQVA 3U4CA 3V32A 1M75A 2KB0A 2P6MA 3WRWA 5CB4A 2DR2A 2B5OA 2YRFA 3ABRB 2NV0A 5JS6A 1UM9B 2FZVA 3OCJA 1K3FA 4UU7A 2JGIA 1N25A 2HB6A 2O2HA 5DHQA 3U17A 5J1TB 1GXSA 4ER0A 4F9FA 2D8AA 1DAFA 3DWEX 3EAGA 4KEAA 1U0JA 4MLPA 4PGGA 2ORYA 2XYHA 1KZ9A 3UAYA 2X0JA 3U7QB 3M6UA 4HWGA 4JLVA 5AHWA 1R9MA 2XGMA 2BEKA 4M21A 3AX6A 1WZNA 1SIWA 2II6A 3GBVA 1EDEA 4GAEA 3NIBA 3BB4A 4M1YA 2ADOA 1XQWA 3HY4A 4MVYA 2INGX 4FKBA 4P31A 3OTGA 3Q1LA 3EHDA 2HK7A 4A2CA 4HH1A 2W8BA 5HILA 4CJXA 2JK1A 3DTTA 3DFZA 2PJUA 1RQLA 1TJ4A 3RR2A 4EGSA 4TKVB 1G20E 1V71A 1PI3A 1MO6A 1QCYA 3C39A 3PD1A 4N0MA 5NLLA 4UXHA 3I1JA 3OBIA 3MUFA 4M1EA 1EEXB 2EYQA 1UBSB 2RGNA 2ZRDA 4F86A 4PSKA 4R41A 4EKNB 5HBGA 3W2GA 3MCWA 1E4EA 1K1EA 3CUUA 3DM9B 4RADA 5IXYA 3FDFA 2F64A 5T4HA 1B23P 2E48A 3AP1A 2QRLA 3WL5A 4AF6A 4CM9A 1DIOB 3QA9A 3B1ZA 3UENA 1Q6YA 2QE7A 3PDUA 3QXGA 2XNKA 4G5GA 4HAYA 2G04A 4UARA 5E7JA 3TJZA 2F3UA 4KE9A 4EGFA 4U39A 2CCJA 1XWIA 1J70A 2WZQA 3QBTA 2WIDA 5JYEA 3IAFA 5J2TF 1VP3A 3PV0A 4KH1A 5IT9A 1UBJS 5IXSA 1IY8A 1Q7BA 2H8KA 3CM0A 1BRTA 4YRAA 1WPQA 3V00A 1GL7A 1AZTA 1LBTA 3H0EA 4LJ6A 4ENSA 4ZZ1A 1T4DA 1CUXA 3DOCA 1XDWA 3GZ4A 3MA0A 3VH1A 1JPNA 5JMOA 1MO3A 1B0PA 2QRHA 3B9PA 1KDTA 3TECE 1I2BA 1ZN8A 4P4LA 3MRXA 2WP8J 3VRHA 2GDZA 1XDGA 1CXZA 3FGOA 5I7UA 2YZKA 5AKIA 1GTSA 3BOSA 3PBKA 1WOYA 1S1CA 2PN1A 4XQGA 4MQMA 4YRJA 2BGKA 4IIUA 4XGQA 3TGPA 1AGXA 1M6WA 2JCXA 2O20A 3CQ9A 4JJAA 4YRRA 2CFCA 1DZIA 5BV2P 3AJ9A 3Q2KA 5EKSA 5FEMA 1LNQA 2YVLA 3TZBA 2AFRA 1QAMA 1USUA 4ROTA 2PZFA 1VJGA 1Z8FA 2H4WA 2AOUB 4JB2A 3JQ7B 2R48A 4TXNA 5FNVB 3ED5A 4DHEA 1LWOA 1E66A 3M3PA 3HVRA 2F1RA 3D5QA 5GONA 1OHHD 1PVVA 3DM5A 5LDDC 5HWSA 2EATA 3KPJA 4FW9A 2VXBA 4WZBB 4PYJA 1AHNA 3KR0A 5ESDA 1J8QA 3IR6A 4K7JA 5LZ7A 3DUWA 4H9GA 4IWXA 2HNKA 1K2WA 3LMKA 2EW2A 4D3SA 2QLNA 3TLMA 2XMPA 4NULA 2FQQA 3U0BA 2P35A 4OCZA 4C1BA 1E5VA 4LKOA 3MS2A 5EESA 3RG2A 2EFCB 3OP1A 2XE4A 1M76A 3C3XA 1YB5A 2XNCA 3IPRA 3O4IA 1DZ3A 3KU4A 3BD6A 4NFLA 3FD8A 5IXJA 4GX5A 1KJJA 1TEXA 2V0CA 3C45A 5BV7A 1QHHA 3F7NA 1ZHFA 1ORWA 3L93A 5C35A 2GNOA 3F8TA 4M98A 3AUYA 3HBJA 1DEHA 2G07A 3BCSA 4FSXA 1T34A 3B1WA 3UXHA 4C1NA 1BC5A 1J09A 2R7LA 3IDZA 3Q0IA 5HKOA 3C15C 3WE7A 4GMGA 1HL7A 4FI3F 5JD3A 4BMCA 4DE5A 5D7BA 3JAMA 1I2ZA 1UJ4A 1IEXA 2B20A 2FFQA 2W4IA 4MOWA 4Q15A 1QU3A 4HX2A 4ZMSA 4L5JA 2FZWA 4WEQA 5CNKA 3ZYCA 1RYMA 1OFUA 3ILHA 3R0IA 5IAEA 2EEPA 3PS9A 2P69A 1VSUA 1PR5A 2I2CA 1F3LA 3LLUA 4DA8A 1LVUA 1XJQA 4GLLA 1Z2CA 2AC2A 1QK3A 3WYAA 3JVVA 3KXDA 3CVVA 1L5VA 1FXSA 1XZ8A 2Y1XA 4L57A 3TW6A 5DV9A 2A14A 4GIBA 4TL9A 3V34A 3HB7A 3PICA 4JJFA 4DMUB 4LMAA 3LGSA 4U00A 2RHWA 3S4YA 2WT9A 1ZD8A 3FDZA 4IDCA 1IYZA 4P58A 2PV7A 1SHLA 2WFAA 3AB8A 3GPCA 2NP7A 4YJ3F 4POAA 1E3DA 4E12A 2PGOA 3M4ZA 1QPBA 1SO8A 1E96A 5TF4A 3GNSA 1X86B 4O08A 2AE1A 4PLTA 1I13A 4P8RA 3OURA 2J9GA 1BO6A 2W7TA 4C5CA 2GTPA 2O2IA 4JN6B 3TQFA 3AOEA 3OX1A 1VJTA 1JU9A 2BL4A 2DBVO 3B5EA 2MYPA 3O9ZA 4W5HA 3A9VA 4BB5A 3RAJA 4BO7A 1X8LA 3TFWA 4ZEVA 3WWZA 1N57A 2OHVA 4A0QA 2V4ZA 1P2GA 3LYHA 4IFBA 4KX3A 4OI2A 4X20A 1K5GA 1STOA 2OCKA 5EXTA 3ETNA 1CZUA 5AP9A 2GBLC 1FB5A 4ND6A 1KSGA 1SULA 2B61A 2NZWA 2BCEA 3CX6A 3I39X 4FGUA 3AVOA 5K5EA 2DERA 3U5ZB 2JGDA 3AHHA 3MJFA 3OE5A 4QU5A 5C5DA 4RH1A 4LGMA 4C6TA 2QSYA 1HEYA 3KPVA 1N2OA 2P7HA 3E7DA 3ZK7A 3T99A 3JZMA 1FP2A 3LLSA 2AJDA 2CNWA 2QVLA 3HO1A 3JASB 1EGHA 2F3TA 3H11A 1H5UA 4EAAA 1M6VA 5U1PA 2OVFA 3X2SA 1USGA 4G0OA 2W90A 2P9GA 4M1TA 4ZP1A 2V3CC 3ZD9A 1DAKA 1Z34A 2RB5A 1DO2A 1WB5A 1Z83A 3H0CA 3UFXB 4DEYA 1HQCA 3EFOB 3CZPA 1KPIA 1TAGA 2C9OA 2R96A 2B82A 4CQLB 1YKFA 4DRXA 2UVPB 9ATCA 1SG6A 3AINA 2GLUA 4M53A 2HLNA 3G5UA 5JPIA 1RR6A 4OA8A 2ZSKA 4TT3D 2TSYB 3UATA 4LWPA 1VMAA 4ZVUA 4UOZA 3N2NA 1Z56C 4WESA 4RH3A 3DCYA 3KHTA 5FADA 1FXWA 2QDXA 4GS5A 3PUKA 1MX1A 2O2GA 3QUTA 4IUCS 2Q6LA 3ZVRA 1ESZA 1GPYA 2Q1XA 1YMVA 1XZKA 2D3TA 3PA8A 2ATXA 4PRYA 3HZRA 5K2MA 5FWXB 3N74A 1EAYA 4IUDS 3SZMA 3RVNA 3SHFA 3PB3A 2AF4C 3OCZA 5DTQA 1L6RA 4LMRA 1XDUA 5C37A 1HT1E 4YRCA 4K9SA 1C3EA 3FHLA 1Z13A 2B34A 2X8BA 3X3HA 1TTTA 3IOMA 4KRFA 4KYTA 4I4NA 4PLWA 1CETA 2QN3A 4WLOA 5IBRA 3T12A 3IPLA 1T2NA 4FDVA 5MFPA 3TGLA 4X61A 2RBEA 5AHOA 5C4GB 3KVYA 4RF2A 4BVGA 3IJ5A 2PR2A 4L4RA 2J0UA 4Z7NB 5JDCC 1Y5MA 2QI9F 3EA4A 1GPAA 3IE0A 4BVKA 5CDFE 3MT7A 2J4DA 4W5QA 1N0UA 2HJHA 2PR7A 2ZRFA 3OHPA 2OM6A 2WBLC 4GVXA 4QLAA 5E6UB 1ULZA 1P31A 1UPXA 2BR3A 3ETDA 3HXTA 2RHLA 3HUFA 3P9CA 3R5HA 4MQBA 4XPIB 3V3TA 6ADHA 1OX5A 1G9TA 1ESCA 1SHKA 1BE8A 4ZOEA 3HY3A 3NMUF 1N7JA 5A9SA 1DKQA 5AVUA 3SMQA 1Z18A 1MGPA 4JASB 3N2KA 4I4TF 2HPAA 2Z56A 3NBFA 2ZTLA 2I87A 2QN9A 4MAFA 3ZDYB 5B1EA 1GKYA 2PUFA 4E15A 4MWOA 2WWYA 1F4VA 4YQFA 2IU6A 4ZANA 1E7RA 4US0R 2KYRA 4R98A 2O0HA 3VZQA 4L8GA 1K88A 3M33A 2F3QA 3Q8MA 2FMXA 3N3AC 5A0VA 4RF5A 3R3WA 1N6NA 5G3ZA 3KT3A 3C7TA 121PA 3E9RA 1AK1A 1KO1A 1SUCA 1VKZA 3C6YA 3RG8A 2P6NA 4UBMA 2HUPA 2WW8A 4XE5A 2HMUA 3IAAA 4RLFA 3ZWKA 4IDEA 1Z2NX 3WMEA 2H7XA 4KPUA 9LDBA 4RIIA 2VT7A 4AK9A 1DKPA 5IHXA 3LF2A 1DEKA 3RGGA 4BUJA 4ZCTA 1PX0A 4WDRA 1CHDA 1KO8A 3U4AA 4P0QB 1XZFA 1G8AA 4RETA 4BQPA 3M9LA 3SY8A 4Q7QA 1QDLB 1M6EX 3LQ2A 2QTNA 4PX3A 5ALKA 3WIEA 1V4VA 1QXSA 1WBBA 3G59A 4DARA 4LDNA 4TS9A 2PSDA 3CMCO 1HEIA 5HF8A 3SIXA 2XGSA 5IH7A 2ZR9A 1NXXA 1TK2A 4P33A 5FBWB 3KWMA 3WWPA 1RZRD 1BXGB 1KF0A 3RKUA 3KR2A 1O6CA 3S8MA 4YV7A 2V0GA 2P1DA 1Y1QA 2UYOA 3OLVA 2CCGA 2AOXA 4FGWA 5T64A 1D4ZA 1YTLA 1QIFA 4F4HA 2CMGA 4RESA 2HXSA 5DM0A 3F0TA 5D3KA 5ALEA 5DHUA 4F6RA 5LWHA 1SGWA 4F2DA 5KPDA 1GZ7A 3U81A 4ZOBA 2QL9A 4E11A 4A9AA 5JRDS 1L7EA 3HCWA 4FX5A 3TTYA 1DWOA 2Y0PA 1IUOA 1EB9A 1H6AA 1Z5UA 2RGBA 3O3CA 1JHRA 1XTVA 3JZDA 3I72A 4M0FA 1P1BA 4RHYA 3IEVA 2POQX 2XCIA 4KQHA 1W94A 5CU7A 2ETXA 5E2AA 4C4YA 3I5AA 5HMMA 1YHNA 4KIUA 1Y1TA 2OHOA 3EVGA 2JFXA 1TVKB 2QAJA 5LDGA 2WV7A 3ER8A 4BWGA 3SF8B 5LZ8A 5ADVA 1F2VA 3FHCB 3IEUA 3PXEA 1HDOA 5EZYF 5EC8A 3BCUA 1O6BA 3VM6A 1PZEA 2VT6A 3I4FA 3LUDA 2GETA 4J49A 4MVJD 3WLMA 2AZ4A 1XZMA 1TUBA 2XB6A 3L43A 1UPFA 2EJBA 4KQJA 4R3UC 3HDHA 5B7NA 2DTEA 4TMYA 1TCVA 1N92A 3ONDA 1J1IA 1DIAA 1JYSA 1QWSA 3D8TA 5JXWA 5J23A 4ABTA 4OJTA 1I3OA 5IAOA 4A5OA 1IBRA 4K26A 2DX7A 2EDAA 1EFVA 2I4RA 4PE5B 5DCWA 5T6BA 3TYXA 4DSAA 3QEBZ 4D26A 4DNQA 5CDTA 3OJXA 3E8SA 2OFFA 5D3MA 3IQEA 3MT9A 1BDJA 1ISFA 1YR7A 2CVQA 3IXLA 1NG1A 3JVDA 3LG2A 4D0RA 3B38A 2Z8ZA 2RGRA 1OTYA 3QI2A 1TDJA 3CRQA 2HYIC 2AXPA 2ESRA 2R1VA 2LTAA 1V5IA 4WNAA 4PTLA 2HN9A 2ZG6A 3UHOA 1A5SB 1OLSB 1SU4A 4CV3A 2XBUA 5H4HA 5DOZA 1X7WB 3D59A 3BVPA 1E6UA 1FPQA 1UPAA 3Q1KA 3VNQA 2G9VA 1JA9A 3CTPA 4PSDA 3E5NA 3E05A 2EZUA 3FZGA 3KQNA 3K8QA 3L6EA 2PJZA 3AWDA 4HDKB 1ZL0A 4XIIA 2YJZA 1L7XA 3VC3A 1IM5A 4JVLA 4RV9A 4S05A 3EGDA 4G8JA 2HF2A 2JEZA 1JHXA 2NZUG 3M49A 4JUDX 4LYEA 3SPXA 2PAAA 1AQIA 1HGXA 4BDSA 5H5JA 4EPTA 1OZAA 3OMWA 1QHEA 1O58A 4CM8A 3MPOA 2V3WA 4XB2A 4EI2A 3OQNA 4WNYA 3COSA 2WYUA 1L7AA 2IHNA 4JBXA 1TQ8A 2Q5HA 3O38A 4L51A 4ZMRA 2QP4A 5JNTA 4E21A 2VP9A 2YBEA 4RENA 1GDHA 3I0MA 3LZCA 3VPAA 1OI3A 3NX4A 5ITZA 1P2VA 4Q47A 4YUXA 1IN7A 2OGWA 1NXPA 1DV2A 2YZNA 4K8RB 1RKUA 2N3ZA 4RIFA 5AFSA 2O8FB 4P4SA 1HDIA 1P7YA 4RAOA 4RZIA 4ZQHA 3U80A 3HADA 4QPPA 1Z7WA 1YCGA 1W25A 2HHCA 2OCPA 2G5TA 3HB5X 4KYIB 3GT7A 1IBKB 2AZXA 2QUJA 2VF5X 2JFHA 3BD8A 1R0BA 2ODNA 1WUIS 1NURA 4G5XA 3A9TA 5LA6B 4DLRA 2XXAB 4I9HA 3C5HA 3CLUC 5EZ6B 1ONOA 3L02A 5T57A 3B1YA 4C14A 5KNBA 5D6OA 1D1SA 4ZPXA 5EKTA 1PYOA 1BHJA 1VGVA 3JZIA 4HX5A 4JQSA 1H69A 1K3UB 2BPOA 3WGUA 2I03A 4FZ3A 5TQVA 1T3HA 1UMCB 3MJCA 1XP5A 4OHWA 5A6SA 1S2GA 4JHLA 3MPUA 1UWKA 4E6PA 1CF2O 2EC5A 5JAHA 2DPLA 2ZT5A 5TPZA 5K99A 1FP4A 4I50B 4EG5A 2IIVA 4C2TA 3WQBA 1Y6GA 3L0SA 4NZZA 2VQ6A 1SOVA 2RG7A 2C03A 2XUQA 2BEUB 2RJNA 3R4CA 3QGMA 3RIEA 1GGHA 2A1TR 4NS1A 4KPYA 3FA2A 4R16A 4WOCA 2R65A 5FHRA 4J1TC 3VX3A 4X1KB 3CS3A 3CEHA 4I1YA 4WNCA 2B3DA 2HO5A 3OUTA 4YQEA 2A9FA 1ADJA 4UEJA 3R3JA 5F9MA 4BO2A 1BA2A 4QLBA 4CNBA 1RZ3A 2Z2JA 3KZXA 1YR8A 4PZCA 1DBPA 2QEQA 5CLLA 1PWHA 1Q84A 2QMEA 2FEOA 1WV0A 3B60A 1NULA 4W5RA 3P20A 3V1YA 2D62A 2EG9A 4R9NA 1QDUA 3EDOA 4TM8A 3GEMA 2OV4A 3A6JA 1G21A 4E14A 4IILA 2J9FA 1OASA 3C24A 4UBKA 1YJXA 3BXHA 2L0XA 1DHTA 1U0SY 3CKLA 3HR8A 3KQTA 4GUAA 3G2LA 1ODKA 4JELA 3SDSA 4X64B 2PGIA 3L7IA 4B3TB 1ABBA 5IZCC 1CUYA 1U8XX 1JMKC 4HDCA 5FOVA 2PY6A 3RABA 4BLRA 1OH8A 3MCTA 3ZVMA 1NY6A 1Z36A 2JLQA 3HP7A 1U3WA 2P79A 3OLZA 4JC4A 3GU3A 4RYLA 5ALSA 5IEJA 3G8DA 3EEFA 1MC4A 3HNPA 5EXPA 2Y1CA 2BGMA 4XA8A 1GGNA 1Z45A 4Z8XA 3KYIB 1DAIA 2BGRA 4QYIB 1L4YA 1L5GB 5IWCA 1N3LA 4IJVA 3RHFA 1JJBA 5JV5A 3KSMA 1KOLA 4MPDA 2V7QD 2P9TA 5BSKA 2O2DA 3LHFA 2PMKA 4HZIA 1C80A 2JGFA 4B6GA 1F4PA 3RQIA 4ZI7B 3L7CA 2VDKB 5EWMA 3EIUA 3K9BA 2DR0A 1KGSA 4BV8A 5KYUB 3A05A 1CUCA 3WLJA 2Y1FA 1ZAYA 4RHXA 1DJQA 1QUEA 2YHBA 4PN3A 1AF4A 1BD3A 3UHFA 3I61A 1TZ2A 5D1HA 4J3FA 5DK6A 3LM8A 4LOAA 1ZX1A 5EJ9A 2Q7DA 3TPFA 1B3BA 4Q19A 4BNJA 1UBMS 1D2HA 2CLIB 3SYMA 1X7ZB 1ZH6A 4MIOA 4ER6A 1V47A 3GRYA 4LNAA 5ECGC 4X1YB 1GT91 4YWHA 5ADWA 1R0CA 4NBRA 4TMZA 1X8KA 4YMWA 4TN5A 1VHWA 3RYIB 3PC8C 4EJFA 2WHQA 4C7BA 1CX9B 1JSLA 3RVOA 3BFPA 3ETGA 3R3HA 4WLUA 1JBKA 2HBYA 2VPQA 5CM8B 1ORRA 1YAHA 4GBGA 1JILA 4GR9A 5KPJA 4BO5A 2I76A 4CVNA 3HJFA 1YQQA 2QJFA 5KCZA 1RAHA 4R8KA 2O54A 3PRYA 2H9AA 3LGAA 4OJQA 4FLMA 3OY7A 4AJIA 5CA1B 2PSEA 3NKLA 4Q18A 4RPKA 2J3QA 2YMMA 1GRNA 1U65A 3INRA 4O2BA 1W35A 1CEQA 1I2CA 1QH1B 3OCWA 1CRLA 4Q01A 2IP1A 5AVVA 2WUEA 3MTBA 4NBWA 5HUQA 5LMCA 2O3RA 3BFVA 2GEFA 5DLQC 3LQQA 5IVDA 3VZSA 1CE8B 4B47A 1USIA 3NGXA 1SU6A 4OU5A 3JQ6A 3Q9NA 2PZMA 5IBQA 2PKYX 1TVCA 4FPXA 1AK9A 5F98A 1BQ3A 1EP1B 1RHMA 1V7ZA 3ITDA 3L06A 5HDQA 2PJDA 1QO0A 2F1IA 2IKSA 3V1LA 2NAFA 1LDNA 3O3MB 4KSYA 3FHJA 3GLRA 4E5DA 4QUIA 1E58A 2QHXA 2X0IA 4HLUA 3TR5A 3KXLA 2HRQA 2OCXA 2C7RA 4B44A 5CB8A 3U1VA 1HE5A 5I8ZA 4RXMA 4ATNA 1T2DA 4BFYA 3G0HA 1L8LA 3BRWA 4YJ3A 4TV8F 3TAUA 4GKKB 2HMYB 1XYVA 2VCHA 3AR8A 4B84A 2QB5A 5HQJA 5IJ9B 3KV3O 1MJHA 1PWXA 4YASA 4DV1B 4YCSA 2B8NA 1R74A 1VMKA 1C4WA 1PR9A 1UMDA 2FZ5A 3FYTA 3K53A 1F51E 2OSBA 4JAVC 2P6PA 3SHVA 2ZROA 1OMOA 2OFPA 4BO9A 3K1YA 4CRWB 2DFKB 1QH8A 4KXMA 3K09A 3O03A 3OT4A 4XX0A 1F9EA 3ROPA 4MZXA 2K2QB 3P9YA 3VH3A 2DY1A 2Y05A 5UKDA 2PVPA 4UHJA 5H68A 5IK2A 3HLKA 2YZGA 1BOFA 1LJ8A 2NUPA 3I05A 1L1RA 3HCDA 4AG3A 3JSXA 5KX5F 4DUGD 5DW3A 5T4FA 1GEGA 1I2AA 1UKBA 3HJCA 4Y2VA 2IXFA 3RAGA 3WNVA 3K4PA 3EXEA 3EZNA 3OZWA 4NV1A 3LRXA 3MHPA 4RPCA 4AWBA 3CH6A 2IHUA 1RIFA 3KPWA 5JW6A 4IP0A 3RK1A 5F1YA 4D9JA 5AUNB 1YDFA 3R3YA 1E2QA 2JANA 4Q02A 1RHKA 1RKBA 3ZZMA 3SLRA 1G7CA 4GQBA 5FLYA 4EA6A 1E59A 2ZIGA 2Y0BA 4ND2A 3G7NA 4RYDA 3ACDA 3LCRA 2G1JA 2GM3A 4R01A 3WMXA 2CSXA 3Q0EA 3T5DA 3AF4A 3AVQA 3TLEA 4RBNA 1TQHA 4GYWA 3PUHA 3QE4A 1L9KA 3R6TA 3PC6A 1OA1A 1WCWA 1KPHA 2A7QA 4Q03A 4B09A 1SVSA 2WUFA 4P7BA 4B9EA 4PRKA 4IG4A 3WADA 3NBMA 4RLQA 4D43A 4QYTA 4C78A 1KI6A 4YXWD 3T1OA 2VHCA 4XH9B 5ALHA 2H2IA 2OBBA 4IS2A 2G7ZA 5ILOA 3H17A 4PXAA 3PR3A 4FE4A 3NUZA 2V58A 5FFNA 4P0PB 1GLGA 1A9ZA 4G24A 4N65A 1X1QA 4UUMA 1I4WA 2Z1NA 1KH3A 3QG1A 3N0RA 4MHSA 2ZGVA 4P5DA 3QRWA 3CR3C 1ZH2A 4ZQCB 5LQSA 5K6RA 1KHHA 3PHJA 3ZX4A 1RJGA 5DIFA 2JFNA 3G2QA 4RQTA 4RO0A 5G1NA 2I7VA 5JFGA 4CL2A 5BN4B 3S2UA 3MEQA 1ZAKA 3BKWA 5B7PA 4PBSA 1IZZA 4KVAA 2FR1A 3HP1A 1BKYA 1ZM9A 1EX1A 3GDFA 1ZQ9A 2DP4E 2PUGA 1DUSA 4F1WA 2P9HA 3EIEA 3DZKA 3CH4B 1XP8A 5B3JC 4QT0A 3HU3A 3F6BX 3HO6A 1T29A 2R62A 3C1OA 4ETNA 3VU1A 2WWTA 3Q8XB 4F11A 3TW4A 2ZI6A 5I47A 1UDBA 2PFGA 3H1GA 5AVXA 1Z07A 4RGVA 4Y1EA 1KETA 4UD6A 3DOEA 1F5NA 5DFAA 4Q1DA 1DSSG 1L5SA 4QTUB 4JUBA 2JLCA 2M98A 3LC7O 5EJ8A 1CERA 1PUIA 1KK2A 2PSHA 2PUCA 2V5UA 3O26A 4OOEA 4EY5A 4I4TA 5JH7F 3G7SA 3S3TA 5DBFA 5M2QA 2DT8A 4KZPA 1GUBA 4EZBA 3K05A 2JCBA 3NP9A 3WB9A 4JR2A 4HO1X 3QBEA 4EO4A 4NDZA 2GPSA 4OYYA 3SQWA 3A3KA 3ELUA 3HNOA 1T1SA 5KNBH 3VQTA 4G2TA 1X87A 4ZYZA 3OQVA 3GZNA 4H77A 1G5HA 2IOQA 2WWWA 1XE3A 3FH0A 3IB3A 1WW3A 3R20A 2XOXA 3FUCA 1CFJA 1UFQA 3AUKA 1PR3A 1WUYA 3AV3A 3OO0A 4YJ2B 4DA9A 4EMBA 4RULA 4FFMA 2H1FA 3EDMA 3TNFA 1CJVC 3BCRA 1SBZA 4HDSA 3ZJ5A 2G5CA 1H8ED 1T8TA 1VFPA 2C5SA 3FCYA 3H6HA 3N5KA 4RFLA 3IEMA 1NM5A 3GJZA 5J59A 1KBZA 2R25B 2H4HA 4R2LA 3O8RA 4F5DA 2H5LA 3LW7A 4H6XA 3TD2A 3UXYA 1VKHA 1W30A 2Y66A 3CKYA 3UO8B 3R9XB 4HB3A 1O03A 4XUGB 1VYVA 4PHFA 3VFDA 2RD2A 4MV8A 1VBMA 3NVDA 5BRJA 1QR6A 3EPJA 2BTEA 4MRRA 4CKCB 1DXYA 3IKTA 4CQMA 2Y93A 4M46A 3GRUA 2PYDA 4XYEA 4F1KA 2ZRMA 3MCUA 4YI5A 4YLEA 3WLEA 3GNQA 5HX7A 1ZESA 2X9LA 4FFLA 2YN0A 5CB6A 2GYYA 3D7LA 2WHEA 4AY2A 5SYMA 1CT9A 1RVV1 4PSAA 4UNIA 1N4DA 3G6KA 2FEMA 4DG9A 3C6QA 1W0CA 2QG4A 3B3GA 3ZLJA 1NUUA 4HB2A 1TUIA 1FLVA 3OU7A 3TCXB 4HDMA 1IH8A 4ZHQF 4LDAA 1VG8A 2E4WA 4PF1A 4HLNA 5BMVB 4LI0A 2BFWA 2ZTUA 2Q29A 1UJ6A 3TNJA 1SKYB 4KUHA 4TKMA 3UAXA 1ZZEA 4BBAA 4U02A 2WNIA 4J4BA 2OCDA 1EFCA 3OP4A 2XTNA 2AJTA 5DK4A 3TUIC 3M1AA 4YYZA 4RABA 3FLBA 3LX4A 2EBHX 2R1TA 5GMOA 4HEQA 1IHUA 3NXKA 4EZEA 1UBTS 5DOVA 3DZGA 4IDAA 5ALGA 3LS2A 3QX9A 4UU0A 2EBFX 1RCUA 4OHVA 4Q3AA 1WY7A 3SBEA 3VC2A 1KJIA 2V8OA 3MTEA 4GWKA 2IS6A 1HYGA 1BWQA 4PNEA 1DJLA 4Q0MA 4B35A 1CUDA 2WFMA 3SICE 3OZRA 1KWKA 1QP4A 1E79A 3AM3A 2FY8A 1PYGA 1I51A 2VF4X 3OAAD 3R3UA 3TM5A 1Z4PX 3G85A 1HXHA 4OJNA 1K8YB 4AG6A 3WLNA 4EY7A 3LBIA 1CPYA 3OE7A 1E6MA 3GY0A 1EFHA 1S8FA 1RXYA 2BDTA 2V45A 2PUHA 2AFIA 3LKBA 4GX2A 4LSWA 4N01A 3VZDA 3VYVA 5JBNA 1U2GA 3JXEA 1O9BA 1D2CA 4ZTBA 2X7JA 1A77A 1O95D 3VNSA 3C1TA 1NJ2A 4KXXA 4N0DA 4CM3A 4ALLA 5I51A 3OIVA 2NZ2A 2ZSEA 4JJGA 1XL0A 1IXYA 1JHZA 5AVQA 5JSFA 1FF9A 1ZJZA 3ZGNA 3N7UA 4V03A 4A2PA 2DUJA 1ZK3A 4PZUA 4TQ9A 4XOIA 1ILWA 1P7ZA 1PRYA 3ESRA 4ZQEA 3ZE2B 5JO0A 4KWTA 3UT6A 3E53A 3DBLB 4YH1A 3IUQA 3NDRA 3TRIA 4X63A 3ELYA 5JTUA 2QX4A 3MRVA 1X1TA 4LGVA 1SVUA 5H1YA 4AX4A 3DMDA 4BQQA 4C4AA 2O2YA 1SVMA 4OQMA 3DHWC 4I5GA 2P4QA 3D6AA 1NG9A 3TR0A 3OCYA 4ZT4A 1R9GA 5ALVA 2WB2A 2ZSJA 3PE3A 4ARZA 3RHSA 4JI4B 2BP7B 4DCJA 1GZUA 2ETVA 1KEWA 4Y2RA 1M7BA 1V0JA 4Q9JA 1I7DA 1C4XA 4GKVA 4I9GA 2W93A 4DW8A 1WG8A 1E6WA 1DPGA 4H4DA 3FNHA 4BB9A 1JJAA 3MWYW 3KB1A 3GG9A 1T1IA 1S4MA 4LZPA 4YJFB 3VPGA 1PWEA 1TD1A 1G4UR 1WP9A 2D2IA 4JMPA 1ECLA 5JZSA 5CPBA 4YAOA 4HUJA 3AEUB 4BS9A 3VGPA 4UTPA 5GP1A 1QYRA 3AP2A 5J9FA 6CHYA 2IW1A 4LXGA 2BFCB 2H0RA 4FILA 1DBQA 2CEKA 2HRCA 2X86A 1LV8A 2BV3A 4YP9A 4C30A 2J5RA 2UZ1A 4ZIRA 5E3HA 5AVTA 4CIDA 3RBVA 3LWZA 1FUIA 5E4YA 3MWDA 1J97A 1OA0A 3DV0B 2Z6QA 4L3OA 3HDVA 3PGXA 2AOTB 2GVDC 3GLVA 3PNVA 4FOOA 4QOHA 3U6BA 2F8TA 2A9QA 1EX7A 4D0SA 5FUMA 4BZZA 1ECPA 3OD5A 1URPA 2NTEA 4N47A 4CKZA 1PL0A 3GHHA 2P4UA 3ASZA 2XWJI 5CDGA 4L0QA 2Y4NA 3NWEA 5KMGB 3BGVA 1IHOA 2IZ0A 1L4HA 3G89A 2HEGA 4EHBA 1P3Y1 2FMUA 3GCDA 3IQGX 1RAGA 3QPAA 1GFSA 4FIZA 4I1IA 4P93A 4WKPA 2O48X 3TCKA 2V4MA 1E2DA 1DFHA 1FX0A 1GUFA 3EIOA 1U1FA 4TL7A 4YMLA 5IFKA 5HVNA 2DC1A 1L5FA 1YBAA 1CR0A 2Z8YM 3N2IA 1SBYA 4ZOCA 1N2CE 3M6LA 5EQJB 1S3FA 3FOBA 4ZVMA 4PQRA 4DC9A 5FNVF 2NWQA 2G4LA 5C8YF 2Z9BA 4PG6A 4Z86A 3PEFA 4FS3A 3B70A 4Q4JB 1JEAA 2FW8A 1XEAA 1YR3A 2XE7A 5KHLB 1X74A 3UJ9A 2UUBB 2COUA 2M6KA 2WYVA 2YMQA 1A8UA 2GVNA 4DNOA 1T4CA 1N2XA 4JI5B 4V39A 5FL7A 5SZJA 1DQSA 1THZA 1X15A 2ORWA 2PUAA 1OC2A 1XXLA 2PZAA 3Q9UA 4UVEA 2JH9A 5EMKA 3ZWVA 4W5TA 3WYGA 5CG1A 1G20A 4J16A 4KIJA 1EBUA 2OV6A 1Q77A 4L07A 3IESA 4C9BA 1DBIA 1KAEA 5BYBA 2CLDX 2R2AA 2Z2XA 1DBRA 4PLPA 3V1KA 4R0MA 4DV4B 3WRYA 4B7XA 4X66B 1L3CA 1KI8A 1A5BB 1X7XB 2FWJA 3B52X 1WUTA 4REMA 4WX2B 4BVFA 4OBEA 1GSAA 2B21A 2EJWA 3ML1A 3TBHA 1ZCJA 4MRPA 3JRNA 3O2QB 3NAGA 4IAOA 4TRMA 3ZD8A 2JAQA 2LNDA 1Y6QA 5DBEX 3PKIA 4KREA 3I37X 1WR8A 2X4IA 3BT7A 4ZCIA 3THOA 1T8PA 1RBZA 2B2XA 1ISRA 3PEVA 2AS0A 3KYBA 4UQPA 2PZLA 3CZAA 3P97A 3SFZA 3ZBUA 4AYXA 4IL5A 2B69A 5KU1A 1W5TA 2HI0A 2ZI5A 5G4KB 4EA9A 3BSWA 4Z8YA 3PTAA 3VKWA 1K4YA 3ZDAA 5EMHA 4RTNA 1UANA 3W0LB 5J1SB 2ZR7A 5FTLA 3GLKA 3EZLA 5D5PA 2WNSA 4ITRC 5AM4A 4DA4A 3ETJA 1IBMB 2ERXA 4OQXA 4C03A 4F60A 3WDSA 1NLFA 3EQ6A 3GLSA 5FOSA 4F9GA 1W34A 3R44A 3FLEA 1YB2A 1SD2A 3F90A 4B6EA 5KTTA 1EGMB 3AT1A 1G9SA 1ID1A 2REBA 5ULLA 1EIZA 1WHSB 2VBGA 4LHEA 4RM3A 4X7PA 4N5NA 2NXCA 5HM8A 5JEEA 2P9BA 2GN4A 2YBDA 1T25A 3A1EA 4JBIA 2V7GA 5CK5A 2WYIA 4UPEA 4N6OA 3E9QA 4S0XA 1MB9A 1Y3IA 3EMVA 1BVYF 1GPNA 2E5FA 3A4TA 3CX8A 4MUKA 3VISA 3F4LA 5HIKA 4CMAA 2SKEA 2FQWA 3EPRA 3L8ZA 4LOLA 3ZU4A 2D0IA 1IQUA 4U0JA 5A7FA 5E1BA 5E1MA 5KQRA 2YWDA 3EASA 4J0GA 1HY3A 5L4NA 4ETIA 1N34B 3BK1A 3BE6A 4UTNA 4R5HA 2IGTA 3RADC 4RTJA 1L5NA 4WXRA 3IPXA 3NRCA 2IOFA 5LZ9A 3NKFA 3I9KA 2I9PA 4CLOB 2LBPA 4JLAA 1X2BA 1ZRSA 4MHTA 4LBWA 4P5EA 1YK0A 2HHLA 1KMIY 3KQQA 2JAXA 1RDFA 3NATA 3F6CA 1YZNA 4Y6QA 4F72A 3TXXA 4YJHA 3FUWA 2I8CA 2LDBA 4CKXA 4QRIA 4X44A 4ZCRA 1SXJB 5IW8A 4ER5A 4YN3A 3QEJA 2YUTA 3PJDA 3Q88A 3ULKA 4EHFA 5KTKA 3NVAA 3C8UA 3KQSA 3OMXA 4UHKA 4BAGA 2GPWA 3OTHA 2R8BA 1XI2A 4NYMQ 3ZQ6A 2PCLA 3K20A 3OZXA 3BULA 1P1IA 2GERA 1UKYA 1H6CA 1KDYA 2MINB 3QPDA 2X19A 3NHUA 1FUEA 4JHXA 1KE2A 3DZCA 4TV8A 4Q3NA 4R4JA 3AP3A 4II3A 1NONA 3WGNA 5A4AA 5ICSA 1MAWA 4JI6B 1R4AA 3HCRA 3KZMA 1VRVA 3QTBA 3CJRA 1OPXA 4F5ZA 1JJIA 5M04A 2DCUA 2YXNA 5H3HA 3N7TA 5DHRA 1BRMA 1H66A 4S1NA 1PAUA 3GOHA 3H9BA 4TTQA 4P3OA 1BE6A 1T0BA 3GEEA 3V7WA 2VHZA 3FB4A 1W6UA 2I1LA 1HG1A 4M4SA 2QX8A 2QW8A 1SNYA 3HHEA 3GFVA 1UCFA 2FDCA 5KX5A 3SBXA 2MTBA 2W8ZA 5IBCA 5FUBA 4IHJA 4TYQA 4C0SA 1PJAA 2J0QA 2QD1A 5AHRA 2EEZA 2GKGA 3ANSA 5DT2A 4ED9A 2I6GA 1GL9B 1E9SA 1RLUA 1JA0A 1W0JA 1NW8A 2OGUA 4HJXA 2C2MA 1POWA 1KZ6A 1E2FA 5KOHA 2ZT7A 1SUPA 1FSSA 2VUTA 3V6LA 3WGVA 1DIHA 1RRMA 1CUBA 4NR0A 4Q66C 1ZD5A 3GJYA 4LWZA 4B73A 2VHUA 1KHTA 2P0EA 4CEIA 4GMXA 1NQ5A 3MXOA 3QVGB 3DO5A 4LJ7A 1P9LA 5AK0A 3A1WA 3ORSA 5IT0A 3II6X 3IIMA 2W2KA 4M1MA 1NAHA 5I7OA 4MDFA 3PFGA 1K06A 3UK2A 3C7AA 5HFJA 2BWJA 2B4AA 4QPDA 1L6IA 3JCZA 1T24A 4PYOA 1YZFA 4LYFA 2J6IA 4O4HF 2ZRNA 3EARA 3I9V6 2GXAA 3I58A 1WW8A 4ZZ2A 3DEHA 3FGPA 4BLQA 3RTDA 2J3EA 3AESA 4Y6SA 1H1DA 3KTFA 4G2NA 3U26A 5DN6A 2FCAA 5LJIA 1Q92A 3R7FA 2CWDA 2QVGA 3U3MA 1O08A 2FW6A 1WVMA 1UJ2A 1LB1B 2H2HA 3DEFA 4RX1A 4OQ4A 1Q83A 3UA3A 4IWYA 1KSHA 4XD7A 3OPYI 5KU7A 4GPEA 1G55A 2ODQA 3VOTA 4KW7A 4YRGA 2C77A 3CUWA 1OFTA 2DJ5A 4HJRA 3BB1A 4A1OA 5KNCD 2IDZA 3VX4A 5CFRA 1O5OA 4HTFA 5H83A 4OM7A 1OIVA 3VR4D 5JMTA 3FVQA 3MAAC 2AZDA 3BICA 1HI9A 1XN1A 3N58A 3SC2B 4ZCMA 3SS8A 2C58A 2NO6A 4G5HA 1SELA 4JKYA 3SJAA 5IKMA 1FW6A 5J2TB 1JR3E 1LGYA 2EGGA 2X4LA 4PYIA 2F8LA 1EAMA 1UFOA 2NU6A 4DTCA 1JBQA 3AVTA 4MQFB 1NNUA 1UAGA 1BH6A 1V96A 4KTVE 4DJEC 3T5MA 5GZ1A 2P5YA 2VXOA 2JDID 1AN0A 2IHVA 3DWFA 4YMGA 4Y9SA 1QF7A 1YU9A 5TV2A 2GM9A 1V9LA 1J90A 3MTAA 3NWJA 4OI4A 5ADUS 4O4JF 3JAWB 5HBRA 1G3MA 2HOQA 2YN4A 3LDGA 3Q5GA 4FYPA 4LBZA 3UUFA 2VF7A 5C5IA 3GA0A 4DB2A 3NGMA 5CNMA 1KDVA 1N5RA 5CDFA 5F77A 3EXIA 1EGQA 3HDQA 1U2DC 2DWPA 4PLYA 4BNGA 2ODWA 2OGZA 3DLBA 4KLCA 1Z15A 1KSFX 2AI1A 2ZBQA 4Y6LA 4S24A 1XZBA 5I5EA 1Q5PA 2XDQA 2X0EA 3LPNA 4FJ2A 1KBQA 2ZXEA 3ANYB 1FUKA 3BS4A 1RI3A 3OVMA 5CT9A 2WDZA 1EVEA 2XCUA 3ACCA 3DTVB 4NOMA 4Y0NA 1TQ6A 1A9QA 1Y8QA 4KQ6A 4OATA 3ZPXA 2GT1A 8LDHA 4PINA 3A1FA 1E5LA 4D9CA 2C7PA 2AQIA 3CVOA 3FPSA 4WLVA 4DMMA 5B36A 3CWZA 3PQFA 5LQDA 1Q1AA 3KCQA 4F5EA 3CZ9A 2W58A 4TUYB 3GAAA 4QDZA 1YA4A 1LZLA 3JARA 3K2QA 3KQWA 3CNEA 3OI7A 4JNCA 2C1XA 4IZOA 3BXPA 3RQSA 5HP4A 5F73A 5D00A 5JE8A 1VHDA 4PVCA 4F2HA 1EVQA 3OX2A 1R6UA 1CU1A 1NT2A 5DP1A 2ZANA 3K0EA 3RT1A 2HK6A 1FFBA 5K3FA 1Q16A 4NYIQ 4HNSA 4Z3DA 5DNCA 4OHBA 3OEHD 1J42A 3AUTA 3UWPA 4EUNA 2A35A 1JEQB 1M1NB 3DAOA 2ZVDA 4B48A 1Y4DE 4BGVA 4Q00A 4JT4A 1FOEB 1U94A 4NYJR 4JLMA 5AM0A 4GEGA 1DKNA 1PZFA 3VUFA 1KORA 1RKQA 3ZDQA 1NFFA 1QGZA 5J4HA 1IPFA 3ES9A 1OLUA 3Q4GA 4HGYA 4IQ4A 2R5WA 3VZRA 5LVAA 4HXFB 3F2IA 1YZGA 4RIEA 4ZRNA 3WBFA 4CTNA 2DPYA 2P2YA 4KAAA 3MQFA 4UHFA 5AWFC 1Y6ZA 1R5NA 2VQ3A 2W22A 2ZIUB 3OEEA 4L1KA 4ML3A 4OKIA 5EHQA 4Q4CA 2ZYDA 4XWWA 1J23A 1HTWA 2DOKA 3RSSA 2WF9A 1PBTA 4ZDIA 2PKQO 3OKPA 4KFSA 1AN9A 3TE7A 1N2HA 5BNZA 3ZGVA 1T36A 5K09A 5L3RA 3ROTA 1XMOB 2I2AA 3AHGA 3F98A 1QRTA 1L4EA 4RVUA 1T9ZA 1JVSA 1ZM4A 2H4XA 2V5AA 5JNVA 2VAWA 3ZI4A 1TU3A 2DBZA 2Z98A 2J08A 5EQTA 3OTOB 4LRYA 4Q3KA 4Z9YA 1N4AA 1B00A 1OAOA 3CJTA 1XCJA 3A4YA 4LQ4A 4M0UA 1AUPA 3D7RA 5AI8A 5FUQA 1D2MA 2YFYA 4FHDA 4GLJA 5JYBA 1O94A 3IA7A 2PTHA 4CV0A 1IRXA 2W2TA 4DABA 4EJSA 2WD8A 1V11A 3LHKA 1Y3FE 1W4LA 1GPMA 3QVMA 4G01B 4I9NA 1L4LA 4UUOA 1J2YA 5HIAA 3ZY5A 2ZM5A 1EP3B 3T4EA 3EBPA 4JYAB 1U0LA 3EZ6A 1IXRC 4WXYB 3ZS8A 4C3ZA 2FPGA 1XPUA 4FC7A 1Z0SA 4GSLA 1WQ4A 2QP9X 1XCPA 3DE0X 1A9XB 1UPTA 2JVJA 1FP1D 3BEDA 1SZPA 2VPTA 3N9IA 4GUDA 1XAJA 2WMNB 1SFRA 5THKA 1CZOA 5LA6F 4PG8A 1FFXB 5DTMA 3RTCA 4PC1A 1C1HA 3OOHA 3ZV6A 2C7GA 5D5QA 4D9BA 5IJ0B 1ZGGA 4CETA 5TGDA 1CULC 2KLHA 5C3MA 2HQRA 2PBLA 4EW2A 4RANA 2JIRA 3C98A 1GU7A 5HQ3B 2XIQA 4G0XA 4K9NA 4RZQA 4K1LA 2CN1A 4P4NA 3TRKA 2ZZKA 3TQCA 3DEYX 1ZOIA 3IVAA 1C81A 4Q16A 4KVGA 2C3OA 5BN1A 3WA7A 4CMCA 2R8XA 4JVSB 4PR0A 5E9WA 1HMYA 4BCCA 6ABPA 1PS8A 2ZRPA 4CEHB 1NA5A 1G3IA 3AKCA 3G2PA 1L7QA 2FSVA 2Z3ZA 5ELMA 5B6PA 2P8SA 1JXMA 2O8NA 2OLKA 3CUKA 4JVMA 5CR9A 1ZH0A 1PEAA 3V7NA 1AT1A 1W85B 3FHOA 1F8YA 3OKFA 5JJKA 1W2GA 2R8ZA 4ZYUA 3HDYA 3EJWA 3BDIA 4B83A 4ZMBA 4GYKA 5C5CA 5DO9A 1GYQA 16PKA 2YOGA 5K0TA 3SS7X 4PX9A 3UUEA 3QVOA 3KTAB 2EFHB 1E9FA 1KJQA 2XA2A 1FMTA 1XRPA 1W2WB 2EP8A 5KO2A 1YUMA 5SICE 2Y4OA 2X0FA 1HK7A 1GU1A 1UBRS 2RGXA 4LV8B 5ENDA 4DFDA 5JDIC 3P2EA 4WRRA 3FFXA 4HNAA 4WY2A 1DAOA 2OOKA 2IELA 3WK6A 4RK6A 2W2OA 2UZ0A 3QLEA 4PIPA 3ZHOA 1CJSA 2OG1A 3BWBA 4Y30A 4D42A 3GL9A 3RU2A 3B7GA 4AJJA 4US2R 3E58A 4EPYA 3MSXA 5AKGA 2DLNA 4NATA 4RPHA 4I81A 4HAWA 3HB4X 1KMCA 1ML4A 3ZCSA 2IYYA 4WSOA 3VSBA 5DWVA 3QA3E 3VYSB 1XD8A 3DR5A 2IH5A 1FFEA 2RHTA 4Y9RA 4Z51A 1F7VA 3AIMA 4MVCA 3RHTA 1ZIXA 1HQDA 1O7JA 1QO9A 4UE2A 2R4UA 4CTKA 4ZYWA 3NRJA 2R7MA 1GRCA 1DELA 4FFBB 3VR2A 3E9NA 3ZU2A 5CXQA 4ZI7F 1HZJA 4YJDA 4YBZA 1TPZA 3KQHA 4ENTA 1F6DA 4WCVA 3KEGA 1W2HA 3R5SA 2Y6UA 2HSJA 1E1YA 4AY6A 2CF5A 3PPXA 1C1XB 1L5HB 4O2RA 3THYA 2FW0A 5C8YA 5SV2A 1XYYA 5AKXA 4CYMA 2JPDA 2CXHA 3ZH2A 3C2QA 3SX0A 4ZGBA 2RH8A 4NXMB 2BDUA 2LR0A 1R12A 5FCDA 4KO8A 5SY4A 2DTXA 1KR5A 3O0DA 2IUYA 2CXPA 3R6LA 4MV5A 1A4IA 3OZCA 3TOSA 2WWHA 3VZBA 3NT2A 5JDIA 1EG2A 3P96A 5TIIA 2JL1A 1Y9JA 2QNIA 1JIKA 1GY8A 1SM4A 2H4YA 2LIVA 2Q7XA 2RDMA 1LSOA 1QV6A 4N9QA 1GRRA 1QDEA 2I2FA 3ZDZB 3QOFA 4GBED 2OQVA 4C06A 1NJ8A 3HCEA 5LB2A 4BTLA 3ODPA 2ZIEA 1Y7PA 1JDBB 3JD2A 4QKQA 1D09A 4K9KA 4LPSA 1SVLA 2OKGA 3TXAA 4D56A 4UVDA 1WCV1 3E2MA 3L0PA 3LQYA 4X97A 5L95A 4FYVA 1JLMA 1NRXA 4Z1MD 4FCCA 1U04A 1SXJE 3JQBC 5HF6A 2EWWA 5CA1F 2YL2A 3BREA 3BWVA 4HGNA 4E46A 1C5KA 3OWHA 1K9SA 2ZSIA 1SAYA 1I10A 1TQDA 4D9GA 2I4IA 5ALMA 4GP7A 1SXHA 1W8DA 3L4JA 4MWTA 4RDHA 5CA0A 3WSWA 4J3NA 2AKEA 4REQA 1EDBA 2I54A 3SR4A 1EE9A 1XJCA 1RP7A 2QN2A 1QHIA 3HM2A 3OH8A 4PCAA 5I7FA 1YVRA 1VP9A 1PNQA 1PCXA 2YV2A 3Q10A 4OU4A 5CM2Z 3WGYA 1LF5A 3W3AA 1AQJA 1CQZA 3RRBA 4YREA 1KQGA 4JV5B 5EFOA 5KSPA 3KJFA 4EO7A 3ND8A 2L69A 4F04A 4MYTA 1N2JA 2G6TA 2ZQYA 2B1JA 4MVJM 1YI0A 2CLHB 1CLUA 2FPRA 4MI3A 4QFDA 1PSDA 5TXGA 4DV6B 1IVSA 4JXZA 2C9CA 3E1SA 4ENQA 5JAIA 3FYDA 3IEXA 5LKAA 1FNDA 1XVLA 2YXDA 4LDZA 4MB6A 4NJEB 3VDRA 2BHNA 5G40A 1QIHA 3OIUA 3EXG1 4PLFA 3BWYA 2FPOA 2ZBUA 2HLDD 4R3WA 3GJ0A 3T1VA 4JROA 4D4LA 4YT8A 5A3QA 4S1PA 2J85A 2IOYA 2QE6A 4J7UA 4IV5A 3A1NA 2IPOA 1CHNA 1BE0A 1OJLA 3P0JA 1IPEA 4INJA 1T2AA 3S55A 5JNUA 1EB8A 4NNOA 3WLLA 3RT9A 2YY6A 4FMDB 3ZXUB 2GFHA 2PYIA 2PL5A 3T7TA 4K9QA 1P9OA 3JYOA 2XOEA 4V2UA 5M5BA 5FNVA 2CE2X 2XUOA 2VTEA 4DILA 4EZIA 1XWWA 2X23A 4DVJA 1FSFA 3E15A 1E8NA 1L0BA 3U13A 1G4HA 1Y7HA 4GZ5A 1B8PA 5SYAA 2Y67A 4MEBA 4FHZA 3UKJA 5HK8A 3M1LA 4ASUD 1KNXA 3KJQA 4M1KA 1BN7A 1KAQA 4RFSB 1KZGB 4DSUA 3A1TA 1UXGA 3TZQA 8AT1A 1Q1GA 1UINA 3J7TA 3QVVA 2WE7A 3GK3A 4G3XA 1JAHA 4GKJB 5HCUA 3HKDA 4HTAA 4MRMB 2ECFA 3E9CA 5DYWA 1KP9A 4DAOA 1OH7A 1A97A 2IPAB 4X60A 4BX8A 2IPMA 4E51A 1Z0DA 3FETA 2HREA 2GCPA 2I99A 1U2QA 1JKJB 5FB3A 3DKKA 3UWKA 3O8OA 2WJ3A 2AK3A 3ZGZA 1NXOA 4PAOA 3DD1A 3V55A 2PRKA 4K6OA 3EIWA 4X3PA 2W6JD 1SH7A 1YS2X 2FHPA 1BHSA 2MYTA 3WNCA 4V0MA 3Q0TA 4BO4A 2WVHA 5HHTA 5J2UB 5BRNA 2JIQA 1Z9BA 3ZKWB 1Z28A 2AX3A 3MUOA 4QUKA 4LZNA 3PDCA 2AT1A 4LHVA 4PM4A 4KWCA 4EEKA 2TMGA 2QTZA 3EODA 3CLKA 1AUXA 2OXCA 4P32A 3ZI0A 1H23A 2Q3CA 3JPWA 1GP2A 5KHAA 4M9ZA 2I4LA 4N6NA 3TLCA 4GPZA 3E5RA 1IC6A 4B3CA 3WGIA 3SYKA 1Y81A 4KUEA 4PZYA 1PFKA 2CNLA 3KOUA 4HAZA 1AX9A 2XOKD 1FS5A 1RWPA 1O0CA 3W8NA 5E0KB 1DTSA 1LSUA 1U99A 2GOYA 2SBTA 4X91A 1NLYA 4J1SA 3EVBA 3DAFA 2G0AA 5AK6A 4LYDA 5DEOA 1EUYA 2J5QA 1LJUA 1R0KA 2O2EA 1N5LA 2GAJA 3I9JA 3KOWA 3CF0A 4JEHA 1L4KA 1YRQA 4U2CA 5LU9A 2PSSA 2ACWA 2X9VA 1ARZA 1P3DA 2FOLA 2CHFA 2XD4A 2C7VA 1IDN1 1PK8A 2ZWVA 3A0UA 3SD7A 1W9MA 1DB3A 5J3JA 3T94A 4QUGA 3I0ZA 4G4GA 1PSZA 3FIUA 4GP6A 4KE7A 5DBGA 4MUIA 3FNBA 5E6UA 3RI3A 3WKAA 5BN3A 1SPXA 3RFUA 4UDYX 5A4MS 2FKNA 2R4QA 4KR0A 2OHGA 2VYQA 2W5UA 4N5IX 1YKSA 3KKPA 1LI4A 3DLIA 4N7BA 4JENA 4WNIA 2JRCA 5ER6A 1NLZA 4MYUA 4KPFC 4C0WA 1HX7A 1A9TA 1BNCA 1G2QA 4O4HA 3HMKA 2YH2A 4FSDA 4IJKA 2O0MA 3W9YA 5BN5A 3PTZA 3K1TA 4S3MA 2W9XA 4TVKA 5FAKA 1XLUA 4M6WB 4YV2A 3MZ0A 1VA4A 1I30A 1CVLA 4AZWA 5IUJC 2MU1A 2R7KA 2V9ZA 3FSEA 3ZQJA 3IHTA 5K03A 3ETEA 1Z8DA 2XTMA 1WMBA 2CLSA 2ICAA 3M83A 3QV1A 4PX5A 5EJMA 1VLZA 4CN8A 3OM8A 2ZSFA 3ZY6A 4C2AA 4XLTA 1JP7A 2WKSA 4AIIA 1Y7LA 4X45A 4YJ2F 2A3NA 1O57A 2ZRLA 3H8WA 1EDDA 2IXBA 3HZZA 4OD0A 4YRZA 5K8JB 3WO0A 1Z22A 3VR0A 2GXQA 1A3CA 3PL5A 5DULA 4DYHA 1JR4A 2I1WA 4W5JA 1Z6GA 3A11A 1JAZA 2AJ8A 5AM1A 2Y9MB 1GARA 5KVVA 5JCXA 4QJ4A 1BMTA 3AJDA 3NASA 4XFKA 3AERB 2EBWA 2FXVA 4B7CA 4BKQA 1Y0BA 4JGIA 5FO1A 1WEKA 2BRUC 3GVXA 1XLTA 1W5SA 1BXGA 3ZU5A 4QPZA 4MLZA 1TYZA 4O4JA 2HMAA 2ID7A 1ZQ1A 2MSDB 2PM8A 5EP2A 5FNZA 5FOXA 2JLBA 3WNZA 2W2LD 3ZR4B 4F96A 5INTA 4LE2A 2IV7A 1KWGA 3A14A 3O93A 5CFQA 4QWWA 5A5GA 1Y34E 2G88A 2C94A 2H5JA 1CK4A 5FFMA 2QLFA 3WIOA 3WMRA 5DH9A 4DXAA 1TFRA 4EI9A 2P9ZA 3EPKA 4P3YA 1E2PA 1U7PA 2QYHA 3EVFA 1XD2A 2VSFA 4I55B 4D3FA 5A4DA 4L4XA 5JANA 3DAGA 3ROFA 4E13A 5BMVF 1SXPA 4KXYA 2PS3A 4MKFA 4MKGA 3HYNA 5BP7A 3T3HA 4BVHA 5AD1A 2YYSA 5HJ7A 1BCRA 3D4OA 4PSVA 4CNQA 2Y1GA 3EX7C 5K2OA 2AZTA 1TVKA 2E21A 1V5WA 3DE1X 3B6IA 2D4HA 4MUXA 4WBNA 5KSWB 3TLAA 4N39A 4HEJA 1OE0A 2XW6A 4ISBA 1EFRD 2BFEA 4LDJA 2VDNB 1P1HA 2O3UA 2W6PA 4PQFA 2QTAA 1KH1A 4X94A 1TZBA 4ZVTA 1YOVA 3USCS 2JLWA 4WOJA 1BCSB 2TMKA 3NHWA 2YHUA 4J2OA 2HDOA 3G0BA 5KJCA 2ZUCA 4Q12A 3RSZA 5HKLA 5IPFA 1KYXA 4MDHA 4BMNA 4BX3A 3GLIB 2DB3A 2LCIA 4LWQA 3QU4A 3A2LA 2Q0HA 1E1LA 1SUFA 3PQCA 4MUGA 3SXPA 2BM1A 4HBZA 3DZIA 4YECA 1VCMA 2MCFA 1CRPA 1M2HA 1NFRA 3H5TA 1WMSA 2GRJA 3ORFA 2R6FA 4GZ6A 1E4VA 1O8CA 2EZTA 2NYUA 3ND7A 4JOSA 1UXIA 4BGEA 3ZGOA 1Y3DE 1VE1A 3A32A 1QVRA 3R74A 3FMGA 3TB4A 4G67A 4IH9A 4TRRA 1LVHA 3GYBA 3EY9A 1Y3CE 1AK2A 5EHNA 3UJPA 2H59A 3D54D 1O87A 2HQ1A 1X7WA 4C7MA 2ZAYA 4MI9A 4P9NA 4FVTA 3KB8A 3LCUA 4IYRA 4JU9A 3SYLA 5CBPA 3OMLA 2JI6A 3EDRA 2CMFA 4RHTA 3FNFA 4N03A 3MCVA 2D5IA 1V3UA 2B4RO 3LECA 1CB7A 5EHZA 2RONA 1QQ5A 5BMOA 1BDBA 5K8IA 3BXZA 4WN9A 3I9V1 3VAAA 1F0NA 2CL6X 2Q4OA 3AFIA 3FSGA 2NG1A 4RS4A 4ALIA 4EEZA 3KSBC 1VCNA 1X92A 5AVZA 3CCCA 1XTJA 4GOND 4QT4A 4NCHA 1H8HA 2DVMA 2Q1TA 4PBTA 1SC3A 3OE1A 5J58A 1DKUA 4WKCA 4M9UA 1JA1A 2H9YA 3GARA 4TS4A 4AZ0B 6REQB 1VPDA 3LL7A 5A9TA 2WJIA 4ZI3A 4UEQA 1OXUA 1PT5A 4OLFA 3PXGA 1AKWA 3LQ1A 1KKMA 1NMEA 2BUBA 2BZSA 3GXOA 4OK5A 5JCJA 3W3AH 4D3XA 4DBZA 5HF9A 3X1DA 3G8CA 3M1YA 2G0TA 4NLLA 4NZOA 1BFKA 5ERGB 4LFCB 4IRXA 4WE3A 1US8A 3A27A 2AC7A 3L7BA 3LU1A 4HNHA 3ZV5A 1N5MA 1P4SA 3JQFA 5H0IA 4BNLA 1PFGA 2D5LA 2VRCD 2YQ5A 2SKCA 3UAVA 2MOKA 1XZJA 4Z4IA 2VAXA 5DI3B 3K0FA 1W6RA 4MS4B 5JIBA 2QAGB 2IW3A 5E9QA 1S02A 5MDHA 4IEFB 3WDLA 1MGOA 1BXZA 4XASA 2IYEA 4WQMA 2FMKA 2ZDGA 3LY7A 5TS2A 3FOEC 1K63A 4MGKR 4J4HA 3QWBA 5K0SA 4PY2A 3PNYA 1NP6A 2HXYA 5JS2A 3IHKA 4DJDC 1UC9A 3UJCA 1W36C 3HRIA 8GPBA 3QF4B 3JAKB 3NTRA 3FSRA 3WB2A 2B92A 2Y9PB 3WYDA 5A1JA 5IC4A 2FEKA 2XQGA 1FVFA 3LXUX 4WN3A 1KZ7B 5T8KC 4YTEA 2A0WA 2OB2A 4M8SA 3TOXA 3V4OA 1TAUA 2EJCA 2PUJA 4O8CA 1CY1A 3F5FA 4NYIR 1EK1A 5EKXA 2HBRA 5CVDA 3HABA 1EX9A 2BEUA 1P6UA 1H3EA 4XSVA 5KHOC 3DPIA 3KKOA 2C31A 1AB5A 1GQRA 2YC2C 1UP7A 2TMYA 3HZOA 4YNBA 1GPKA 1RPTA 5JADA 1C2YA 1H93A 1RXCA 3ETHA 3DHNA 1RTKA 3FDXA 5BPHA 3S0JA 2GK4A 1DJPA 2Z5LA 2NVWA 3ZTYA 3QPVA 4QVGA 5KYTA 621PA 2HM7A 1WY5A 4WCFC 4MWDA 1GPBA 1I7PA 3G9QA 1WMEA 3C3CA 3I4LA 2FUNB 2HQOA 1BS1A 1P18A 4I5FA 2OCGA 2Q1UA 3GQBA 4L4SA 3K94A 3M5CA 4S2EA 5JROA 3HKCB 3BXOA 3OFND 1T4BA 1VI6A 1UUFA 2HU5A 3KXIA 5G53C 5AH0A 4L3WA 1V4BA 3ZCVA 2CBXA 4RA9B 3SZRA 3ZIDA 1TA9A 4D9FA 3KOMA 5AQ1A 4GMFA 2XMQA 3GFBA 3KJNA 4N3AA 3U4GA 2P3LA 4Q3EA 1T9GR 5HJ2A 3FVTA 3I28A 4HB4A 3BX1A 2GCOA 4PCLA 1PFQA 2YJ3A 4OGLA 3P9ZA 4MUJA 3K6SB 3PKZA 4JU8A 1ZNWA 2XVYA 4GZLA 2C2GA 2XRZA 4WPGA 2PZJA 1PJ3A 2ZRJA 2VATA 4M1SA 5KYUA 3EMDA 4Q7JB 1XALA 3I34X 1CVRA 1GDDA 3AVPA 1FTYA 1N2IA 1D6JA 2IP4A