1A9SA

Bovine purine nucleoside phosphorylase complexed with inosine and sulfate
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
282
structure length
282
Chain Sequence
MQNGYTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDTESQGKANHEEVLEAGKQAAQKLEQFVSLLMASI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Calf spleen purine nucleoside phosphorylase complexed with substrates and substrate analogues.
pubmed doi rcsb
molecule tags Pentosyltransferase
molecule keywords PURINE NUCLEOSIDE PHOSPHORYLASE
total genus 84
structure length 282
sequence length 282
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 1998-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1a9sA00
1PBNA 1WTAA 1YQUA 4TXJA 3P0FA 1V2HE 3UAWA 1JDSA 5FAKA 3LBAA 2QPLA 1QE5A 4GLJA 5CYGA 2AI1A 3EUFA 1TCUA 4NSNA 1U1FA 2A8YA 3KVYA 4E1VA 4MCIA 4JWTA 4OF4A 1LVUA 3EMVA 3OZCA 3O4VA 3OZDA 3SCZA 4G89A 4P54A 4OY3A 1NW4A 1JYSA 3PNSA 3NM5A 1Z35A 4BMXA 2ON6A 1T0UA 3GGSA 4PNPA 1TGYA 4TXHA 4DA6A 4NS1A 1OUMA 1V3QE 4GKAA 4YO8A 3PNPA 4M3NA 1A9SA 3FAZA 5EFOA 1ULBA 1Z5NA 1Y6RA 1ODKA 3FB1A 3FNQA 5CXSA 3T94A 5IFKA 3UAYA 4BMYA 4PR3A 3ODGA 4QFBA 4L5AA 4L0MA 1PF7E 1SD2A 2QSUA 3DDOA 2PGAA 4LNHA 4RJ2A 2OC9A 4TXMA 4GMHA 4TTIA 1YR3A 3MMSA 4NY1A 1V4NA 2GUWA 3K8OE 1XE3A 1N3IA 1JDTA 1RXYA 1Z5OA 3MB8A 3NM4A 1YRYE 1TCVA 1A9OA 3E0QA 4F3KA 4M7WA 1PR2A 1PR0A 4K6OA 1OU4A 4BN0A 4YNBA 1V41E 2IQ5A 2OECA 3NM6B 1ZL2A 2A0XA 4X24A 1Q1GA 1RCTE 1A69A 3DJFA 4QATA 4WKOA 1SD1A 3QPBA 5B7QA 1OV6A 4LDNA 4DA7A 1YQQA 1Z33A 1T8WA 4TYMA 1LX7A 1B8OA 1RXCA 3NBQA 4YMLA 1T8SA 4QARA 4UC0A 1JDVA 5F78A 4F2PA 1SJ9A 1VFNA 5DK6A 3BJEA 4L5CA 4D8VA 1Y1TA 3O6VA 1I80A 1M73E 3BSFA 1ODLA 3KUKA 4R2WA 1ZOSA 4BMZA 1U1DA 1ULAA 4MCHA 1RR6A 5IU6A 1NC1A 1U1EA 1ODJA 1Z34A 3FOWA 1V45E 1PR6A 1RSZA 4YJKA 5B7GA 3OCCA 4WKBA 3KU4A 4QASA 4L5YA 1PK9A 1Z36A 1TGVA 3INYA 1A9PA 3OZBA 1FXUA 4ECEA 1JDZA 1RXUA 1VMKA 4MARA 4TS9A 3P0EA 1Z38A 1A9QA 3PHCA 1G2OA 3ONVA 3EUEA 4QAQA 2OC4A 5F76A 1OVGA 3IOMA 5F77A 3OOHA 3K8QA 3TL6A 4D8XA 4DAOA 1PK7A 1VHWA 3U40A 1Y1QA 4FFSA 4TXLA 2I8AA 2A0YA 5C80A 4DAEA 1Z37A 1PR1A 1ECPA 5B7NA 3EEIA 1PR5A 3KVRA 3UT6A 1OTYA 4D98A 4KN5A 5B7PA 4GLFA 1JE0A 4LKRA 3LGSA 1T8YA 1YBFA 4TTAA 4F1WA 4D8YA 4JP5A 4OJTA 1A9TA 1PW7A 1RT9A 1SQ6A 4TXNA 2QDKA 1A9RA 1V48A 5CYFA 5F7XA 3E9ZA 4DABA 2QTTA 1JE1A 3D1VA 4OEHA 4WKNA 2P4SA 4WKPA 1CB0A 1RYZA 4R31A 4LNAA 1Z5PA 1LV8A 3BL6A 2A0WA 5CCEA 4DA8A 2I4TA 1Z39A 2AI2A 4G8JA 3UAXA 2ISCA 3ENZA 2RJ3A 2OXFA 5K1ZA 1TD1A 4EB8A 3F8WA 1PR4A 1PWYE 3LA8A 5F7ZA 1T8RA 1VHJA 4OGKA 3OF3A 2Q7OE 4DARA 4EARA 3PHBE 4DA0A 5CXQA 3FWPA 3E9RA 3UAZA 4H1TA 1U1CA 2HWUA 2HSWA 4IP0A 5ETJA 3FUCA 1RFGE 2XRFA 5I3CA 1JDUA 3BGSA 4WKCA 4LZWA 2BSXA 3IEXA 5F7JA 5F73A 3DF9A 4TS3A 3DP9A 4G41A 1CG6A 2QTGA 4M1EA 5KB3A 3KHSA 4I2VA 4R2XA 1K9SA 4F3CA 1Y1RA 1RXSA 2AC7A 5F7OA 4TTJA 3DPSA 4QEZA 3KVVA 4L6IA 3OPVA 1K27A 5EUBA 1JP7A 1Y1SA 1Y6QA 1ODIA 3GB9A 5CCDA 5JPCA 4DANA 1PKEA 1OTXA 3OOEA 4JOSA 1NC3A 3OZEA 1B8NA 4OGLA 2HN9A 3UAVA 1K3FA 2H8GA 3C74A 1C3XA 1JPVA 4U2KA 4F2WA 2B94A 5EPUA 2AI3A 1U1GA 2HRDA 4D9HA
chains in the Genus database with same CATH superfamily
5BXYA 4GUDA 4E2FA 2AMLA 3A9CA 2DT8A 4O4IB 2E1PA 3OQ1A 2V4UA 1FQOA 1G21A 1YONA 4H15A 4YJ3B 1Z6YA 3A6PC 4XPIA 3RYHB 3HQ4O 2P1RA 2QVGA 4TMYA 4I14A 4CMAA 4IMRA 1NJ5A 3DCJA 4PYKA 4I8XA 2W48A 3KOMA 1IZZA 3KYJB 1DQRA 4KAAA 1PJQA 1AQLA 1FYEA 3UAWA 4B75A 4F38A 2R6R1 1Z73A 1V7QA 3HDQA 5GONF 1SKYB 2QXYA 1T25A 5CYGA 1GHTA 4YUZA 1PG2A 1BKYA 3LRXA 3LA6A 1Z2NX 4NSNA 5EIFA 1AA6A 1HEUA 1GXSA 2VHTA 4CV2A 1FRNA 5FR2A 4A3SA 4DHWA 4MQFB 3BFVA 3PLRA 3KSAC 1FQKA 3SVZA 1BA3A 2GERA 4RMIA 2EX0A 1NFRA 4NMLA 3VOSA 2YTZA 2P62A 3B1XA 1QONA 4DIFA 4AVYA 3F7NA 3KQYA 4BECA 1NPYA 3UHFA 2HV9A 2IHYA 1L8AA 3VSAA 3D4BA 4LJLA 1KJ8A 4JIMA 3ETGA 4BZZA 3PXGA 2FW9A 4TKUB 4KIFA 3IEVA 4U02A 3A1UA 1PU2A 2X1MA 3DGEC 1OKKD 1WRBA 3LCVB 1O08A 2FWBA 1FOEB 4KYIB 3S4YA 2AVNA 1AZSC 5CH8A 3ZGYA 3NVAA 2CLEB 3CXRA 2PX6A 4UPEA 4GX0A 1H2AS 2O9JA 3NB0A 4O1HA 4UTOA 3VO8A 4DWWA 4KE6A 1WXXA 4WZBA 2IU6A 3MTIA 4HEHA 4IO0A 1PZGA 1KO5A 1V3QE 1H0SA 4EG8A 5CA1B 4EVQA 3H0CA 4YO8A 4TLMB 1W47A 1TEVA 3IODA 2OAP1 4XI9A 3RJ9A 3EPJA 4QBHA 3CBQA 4DDVA 3LQ4A 3PC6A 3GPDG 3QYPA 4JD5A 5ER9A 3SDBA 3TH5A 2YFHA 1RS0A 5DHTA 4LV5B 2DBQA 4FFMA 4I4TA 3AVWA 1UPBA 3DPUA 1A88A 2OORC 3AG5A 3GLIE 5AVQA 2UUOA 4CMEA 2IHZA 1G20A 4RPHA 1TF2A 3FUUA 4QREA 5DNAA 3RG2A 1XMOB 1ITZA 2YJ3A 3LUPA 3IMFA 3NT2A 3EVBA 4J91A 4G0UA 1NW3A 5H81A 5FBHA 1S9DA 2RI1A 1K5DA 1QO9A 1E9FA 2AHRA 4WSOA 1SD2A 2IGTA 3PXBA 3CQ9A 3RSOA 1UFKA 2QR5A 2QZZA 4GXQA 1XZFA 4EGQA 3VVBA 5FBVB 2AJDA 4ICIA 2JAQA 2ZIWB 2PGIA 3VDNB 1UODA 4W1PA 5KC9A 3QOWA 1M6VB 1OFHA 3ZX4A 1QHIA 1QF7A 3KB8A 4IZ6A 3BCHA 5KNDH 3OJ0A 2AVDA 1FDTA 3FVQA 5JYEA 2N9UA 4UBNA 4CQLB 1GG8A 1YR3A 1Z4OA 5KWEA 3QMPA 3QBJA 1ADGA 2ERYA 3TS1A 2DFKB 2PZAA 4BJ1A 4A0FA 2JAOA 3X43A 3QU7A 3WRXC 3K05A 1KVUA 3QKSA 3KSBC 4K46A 4M9SA 5CBPB 1DOAA 2HDWA 3NEAA 4QT4A 3RYCA 3SNHA 2F8MA 1NG9A 2NXWA 1SOWA 2PZGA 3O31A 5ANRB 3AG6A 3STUA 1J8DA 2W83A 3GDHA 1TU3A 2BJWA 3VISA 1N0UA 2NZYA 3ZHQA 2D2XA 5IK2A 3GY0A 4AMGA 1PJTA 1LSOA 1R50A 5BN5A 4WLNA 4D74A 3OEEA 1BU8A 1VZ2A 4LNUB 3TTYA 3P52A 4YAJA 4B3RB 2O6LA 1YS6A 4MRAA 3QX8A 4EMTA 1XCOA 1SIUA 5CXXA 3WHPA 4ZWNA 1LJLA 2XUPA 4BMNA 2Z3VA 4DXDA 1W0JA 1YE8A 3BDAA 4PY2A 3USCS 1DAPA 2IS4A 4I9UA 1BDMA 5G4LA 1W73A 4R4JA 3JQQA 4RCVA 5ILQA 4D3YA 3JZDA 3CW8X 3U7JA 5M5BA 1Y80A 1RLUA 1W85A 1RCTE 1JHUA 3C7KA 5E1BA 1AHPA 3GDGA 4RLFA 4HDSA 1G8AA 2LD4A 1MVLA 3WLEA 1X9GA 4KIJA 3W7BA 4TZ6A 1OFVA 3AINA 5ALYA 1XMXA 4NULA 4UHHA 4BBZA 1R9GA 2O2EA 2OXEA 4REOA 1RHQA 2AEFA 5LZ4A 4RPIA 2Y99A 3QY0A 5A5FA 2A9OA 5JNLA 5KTOA 5EXXA 4MQEB 4DCMA 3JYHA 1UC5B 3DBLA 2MMCA 3QNMA 4UMDA 3NJ4A 1TLLA 3TQQA 1JR2A 4JUIA 1U2DC 2R87A 1XTRA 4R1MA 2HU7A 3P9NA 1JRLA 3VI4B 3VR5A 3IIMA 4QG7A 1DMSA 1U04A 4QARA 5F9HA 2Z5GA 1JWLA 2NMVA 2PBLA 1DE0A 5DYGA 3NUZA 2X4IA 3M1YA 5I9BA 4FYVA 3VR4H 5JUWA 2HHLA 2V9CA 1BVYF 1P61B 5EIEA 2EYQA 4IRMA 1W2WB 4NCAA 3R7DA 3RBVA 3T7EA 2FGJA 4C4SA 4DA9A 2HA3A 1KBQA 4EMSA 2KM1A 2OTCA 1R0WA 3Q4GA 3FVTA 4QYMA 1P75A 2RSLA 4QFMA 2J6BA 3EF1A 2X40A 4EPXA 1HF3A 3FPKA 1Q12A 5C7LO 3TZEA 1BJRE 1ADCA 2RB5A 3T7IA 3P2YA 2Q0QA 2ZRJA 4QRIA 3SG0A 3FSGA 4QECA 1AA9A 4NTZA 4R2WA 2CMDA 5AM0A 1ULAA 3SYTA 3UMBA 5KDOA 2DUUA 4YJ3F 5IULC 1UKYA 4RD2A 4C0LA 1P81A 2GLXA 1TO1E 4KRYA 2H51A 4ND2A 1B8UA 5A5GA 1PQUA 5JS6A 1JDBC 3RR2A 2FWMX 1V45E 4G9BA 5LJLA 4YDQA 3L6OO 3LY8A 1LS1A 1EFTA 1CW2B 2XCLA 4OHMA 4E88A 5TIIA 5F52A 4Q9IA 1CP2A 1G9TA 2GK7A 3C3PA 3GOHA 3QU2A 4N49A 4NMMA 4EO9A 4YUAA 3PJDA 3PNLA 4PRLA 1FU7A 2Q3EA 1H8HA 4BNMA 2ID7A 2XCTB 2SKCA 5HRAA 4G1BA 2A92A 1O94A 1P0IA 3B82A 2O8FB 1G3UA 3UUGA 4M83A 2AXQA 5K2MA 4XZ3A 3NCHA 4MR9B 3O75A 3QTLA 4NENA 1F7UA 2WM8A 1A8QA 3QVJA 1LC3A 1MEOA 1S3GA 1L7PA 3D0RA 4X3PA 1CYEA 2PL9A 3D7MA 3KU1A 4S2EA 3E70C 2VUSA 3FPSA 1V9CA 1IBLB 1BCRB 4CN9A 4L9WA 2H5IA 3K96A 1QH8B 1UAAA 2AOVA 3AYXB 1CR4A 1MUUA 3JQEA 4G5RA 2JFQA 1J5XA 1L7EA 1QYXA 1E3WB 4RAQA 3QFFA 1CEXA 3ONDA 3GJ5A 4F4CA 1ZA2A 4X6LA 1TQ6A 1RBQA 1Q0TA 1XWWA 5JLJA 2XMPA 2APJA 3N2ZB 4FFOA 3LBFA 1F3LA 1MZVA 2IDKA 5C81A 1CRLA 2XCSB 2FSIA 3USES 4QWWA 1M34B 3OX1A 3R44A 1W6UA 4KZKA 3S2ZA 3OX4A 2QAJA 3PBKA 1PUIA 3T54A 4F9FA 4C6RA 1OVGA 1P1IA 4IOMA 2HPAA 2C31A 5FPHA 3R5XA 4FGJA 3ZDZB 2ZS9A 2C0CA 2JFHA 3AW9A 4G8CA 4H6PA 4KFSA 4Q6WA 3HKCB 3SHWA 4EHIA 1N5KA 2X5KO 3A0UA 1G8PA 3HNRA 3WB0A 1DJPA 4I3HA 1A76A 4AICA 3L7CA 1CRWG 4PLPA 3GGJA 4B3DA 4BNWA 1ZR4A 1W36D 4WFJA 1E5LA 1YZKA 1VJ5A 3DFIA 3QI2A 4FE4A 2IXAA 4CT4B 1ZNWA 2W70A 2JJ1D 4HQRA 4PZUA 2QL9A 2W8BA 4FFSA 3KT3A 4FHZA 9GPBA 4YRQA 2O8EB 4D9IA 2R62A 1DVRA 1E4EB 4MV5A 3MCUA 4JU9A 4OFBA 4MI9A 1Y6GA 2N1BA 2DB3A 1RP1A 1FBNA 1N0VC 4TQ9A 5CDFA 1XTJA 1ICEA 5IW8A 4A73A 1T4CA 1FS4A 5I9SA 4GP9A 2OO7A 4E12A 3CE9A 4PC6A 3OKPA 1CUUA 3GUYA 1E2KA 4FOSA 4M1WA 2WT8A 3K4QA 3SIXA 4AG5A 2VP5A 2VSYA 3FHJA 4TROA 4ZO7A 1N2BA 3DB1A 2P7IA 3EOZA 4EELA 2YCLA 5JS8A 4F1WA 3H11A 2FN9A 1IBMB 3EIOA 4M1ZA 3W8RA 3EZXA 3ZWCA 3VPSA 3T6KA 3ZHBA 1IQUA 4A2PA 5KEIA 1KZ4A 3SK0A 3EBOA 4UEWA 1YL6A 4NAVA 5ED0A 5SY4A 1YRQA 1CLUA 2WMDA 1U9YA 2PT6A 2E37A 1J2RA 2PVPA 1C4WA 2WPDD 2XNDA 3IIKA 3NDIA 4YI3A 5DFAA 3RIGA 2B4RO 1U8UA 2B2NA 2J46A 2PZEA 3DMNA 3BTUA 4FT2A 3E35A 3H9BA 4UUAA 3GDFA 5JAMA 2M6KA 4DMLA 4DABA 3I61A 3T8YA 5E2IA 4MVJH 5DP1A 1N92A 4C04A 4CF6A 5K6TA 4CV1A 3WMWA 1SBTA 3D1VA 3FKQA 3ILVA 4S0ZA 5KQGA 2Q3CA 1K3TA 5I4IA 1YBMA 4Q9NA 5JJLA 4DILA 3L6UA 1O3YA 1F12A 4OREX 5ALSA 4MTCA 1RYZA 1E7YA 2PWBA 4IV8A 4R31A 1LTKA 3ZHCA 1C0IA 4LNAA 1U9ZA 2WYWA 3VGJA 4C2BA 4CM9D 3Q11A 2ISSD 3KBBA 3R41A 1EP2B 1JHPA 1JVBA 4B3HA 2JLRA 2GEKA 2AS0A 2VO1A 1VMEA 4NMXB 4TKVB 4R69A 1IZ7A 3IAFA 3ENQA 3PXEA 2BFEA 1BMQA 4LRTB 1XZEA 2IUYA 2AJBA 1LS6A 4PX2A 3T9FA 4EIWA 5CCBA 4GPIB 1B43A 3KHKA 4HGOA 2Q3LA 4GWLA 2QAGB 4OXNA 4ZRMA 1SQSA 3UJDA 3V4PB 4XSGA 2A9KA 2BGMA 2P79A 3HVKA 4DLPA 2Y1CA 2EKPA 3IALA 4Z54A 4YQFA 1T10A 3E7WA 4JR0A 3KFVA 4TL8A 3BHIA 4HX9A 1N2CB 4X6YA 4W9RA 4X62B 2PG3A 1LZLA 4OIFA 1T8RA 5CHEA 1UZLA 1YVRA 2W6ID 3P97A 1Z2EA 2KW5A 4JCOA 5FLKA 5JAUA 5JR3A 5LQNA 4QX6A 2B21A 5BQFA 3Q3IA 1VL6A 3ZIUA 2C88A 2BGUA 1IZ0A 1KGSA 3ORQA 2H1RA 4PZLA 3AR4A 3RROA 1T2FA 4GNRA 4TPKA 1VB3A 2BUBA 3OLVA 5ES4B 1PUXA 5L3VA 2XXJA 4H1TA 4DW8A 1L4YA 1IJKA 4QDTA 2XUKA 5H83A 1ZAYA 2G1PA 1TAQA 2QTFA 2X2FA 2VS1A 1MCZA 1L1FA 1JBEA 5B4VA 1ZSVA 5J4YA 5TSDA 1XF1A 1YR7A 2HL6A 3QP9A 1LTHR 2RBGA 1X2BA 1M1NA 2XNDD 1QKIA 4G0YA 4N5LA 5IJXA 3SLKA 4EFNA 3NR2A 4PC1A 4QHSA 4CCSA 1T34A 3KPVA 4G67A 2AZTA 1M6VA 2DUJA 3CPEA 3I2FA 5SZKB 3U9TA 1I4TD 1WXEA 5KKNB 3OOYA 3TGPA 4I19A 3L92A 4BAUA 3WX0A 1KXZA 4JYBA 5HOEA 1KERA 1EUYA 3F97A 1PFUA 2G7MC 1EQAA 1GWNA 3G2LA 3THWA 3QLVC 3KT8A 4NJMB 4O4JA 4XQGA 3GZJA 4QNRA 1X7ZA 3G0CA 4MUEA 3OZUA 2HEGA 4XIFA 3RPEA 2FFHA 3UMSA 1KYWA 5FUMA 1OH8A 2WF6A 3ZGZA 2YFQA 3LUAA 2DH6A 1M8PA 5ALPA 2G25A 1QXSA 4HLUC 4A6XA 4DLBA 4ZI5A 3EYAA 3TSYA 2RH5A 4AY5A 3PJGA 2Q9AA 2IYLD 3CX7A 1DIHA 2Q0XA 4NQZA 1XHFA 2YWBA 4C3UA 2WFMA 4DIBA 1JHXA 4PGAA 1ZGZA 4BWYA 3WWCA 1Q1ZA 2C0QA 1YHYA 2I55A 4CIWA 5G1OA 5I7HA 3HM9A 1USUA 4W63A 5BRAA 3W5BA 1D8TA 4BKPA 4YLGA 2B92A 1GGVA 4GI2A 4DYVA 1Q0ZA 1YAJA 2XA1A 2Z1MA 3W5IA 2JK1A 3ZJVA 1QRRA 3TOXA 4AL4A 4CDNA 4EF4A 3GDOA 1UBGA 2ZRPA 3C4QA 4LOAA 5G0UA 2OAQ1 3ZXXA 5JAPA 1HM5A 5JRDS 1MNAA 4MVXA 2UV8A 1CE8B 4HK4A 4TVKA 4DOMA 1H85A 1EA5A 4MS3B 1OTXA 1JXAA 1P18A 4IDDA 4UUQA 4V24A 1G41A 1G8MA 3OICA 3SX4A 1E0DA 2YHAA 3CEAA 3JPWA 2QGNA 4N41A 1QP8A 1LXCA 1M1NB 2VSOA 4D0RA 4GZ3A 2WTEA 3RS2A 2DPGA 5DBOA 3R8XA 1JA0A 1U2ZA 2Q27A 4DSNA 4G1FA 1ENOA 1KJNA 1CIJA 3OLQA 2ACEA 1X7GA 2GCNA 2J4FA 1C3XA 5ED4A 4BUCA 2BDTA 1LLFA 2H3HA 3ZGXA 1Z0KA 2Y0PA 4F2WA 5IF9A 2M32A 4C3VA 1WCV1 1RM0A 1DX6A 3WR5A 4DLNA 4YBRA 4N5NA 1U1GA 1Z4PX 1CUWA 2B69A 2PBZA 1L8XA 3L6EA 3OFKA 4MJ7A 4COKA 4C5AA 1NBAA 3SR0A 2ETXA 3TZQA 4XH9B 1KRWA 3E58A 3WHIA 2ONZA 1RPZA 2GASA 3FLMA 4YP6A 4FM9A 1ZJ5A 3OPNA 1NBWB 2Y3IA 3Q8KA 4U5XA 4MB0A 2PA3A 5EZQA 1ZPDA 1EFPA 4GNKA 3FI0A 4L0QA 5F9MA 1UXGA 3WS7A 2RAUA 3AUTA 2YY5A 2IW1A 1YCFA 3DOHA 1SXJB 4B4KA 2XDWA 3LCMA 2AFVA 4QUGA 3ZKWA 4S1TA 4XR9A 3A1CA 3EDYA 3QWFA 4AN4A 2YVKA 4M53A 4XQCA 3DFMA 3FDZB 5FORA 2D3TA 3ELYA 3RDPA 3PR3A 2UYHA 3WIDA 1DBQA 2E87A 3JR7A 4KXVA 3Q10A 4PCAA 1FC0A 2EJVA 2Q6LA 1IVYA 3AK4A 4QQ8A 3WFZA 2VBIA 2PLRA 2DJ5A 2J59A 5ENDA 3PGVA 1J21A 2ZJOA 2ZSBA 2QD5A 4II3A 1HNXB 1DJNA 3M4XA 4DF3A 3TLXA 3OZCA 2O07A 1DXQA 1N6OA 2O20A 5JWRA 3AWIA 1SD5A 2NTVA 1DT3A 4E2XA 1H2YA 5FFMA 5J4VA 3KX2A 5F2EA 1W2GA 5LNK1 1E62A 2CVFA 4NNJA 3BEOA 4E94A 3NGLA 1TM1E 2NM0A 3NM5A 4B80A 3LAWA 2BHLA 2FWIA 2W37A 4JGIA 3WV5A 1QLWA 3UK0A 2P41A 5C5DA 5JRZA 5A4KA 4MUAA 1GNPA 1EVYA 1VE9A 1P91A 3BXFA 3GFRA 3V4OA 3V7UA 2PNJA 4WV3A 2A6PA 3E3AA 3GEGA 4L02A 4L15A 1TW2A 5DIZA 1JR6A 3FB4A 1AX9A 3LY9A 2B8EA 2QA5A 4FHDA 1RWVA 1YKGA 2W93A 3STVA 4Q24A 4OIMA 4PONA 4CEIA 1QYWA 3F5QA 3QF4A 3MCAA 4BLTA 3G13A 1UCFA 3H99A 1HQYE 4TT3D 4RETA 3MIIA 5A7HA 2VK8A 1X8JA 2GGSA 2IODA 2VDRB 1GCAA 2V7EA 4ZAWA 5EFOA 3NWPA 4YI5A 1T3SA 5IM4A 3OBIA 3EGXA 4YR9A 3BGVA 3K6KA 1A8PA 2FNAA 3GWGA 3V3TA 5ICSA 2LKDA 4LGYA 3L7AA 2Y71A 2D1RA 3IP5A 3TLAA 1J1ZA 3DMPA 3H8VA 3T94A 3V4RA 4NNOA 1JAIA 3T5DA 3ZLBA 1ML3A 5EHIA 4LZZA 2EZUA 2OR3A 4PR3A 2EGUA 3ONWA 2WILA 1IIRA 1BH6A 4QU5A 1RMYA 3O21A 4FR0A 4JC4A 3I5AA 4GWGA 1E3MA 4ENUA 5G53C 4NCBA 4WADA 1F9AA 1FUYB 2ZYIA 5TPWA 3E23A 4KXNA 2PGAA 4WL0A 5BVGA 2SHKA 1CQXA 2VPIA 1YMQA 2GKGA 4MQUA 2ZBRA 2V97A 3ER9A 3IELA 1K86A 1NUUA 4ZO9A 4KLCA 3DWEX 3W9SA 5AVXA 2DTDA 2O3QA 3MB5A 4QUIA 1G8SA 1JSXA 3RTEA 4J9VA 4MYSA 4OKNA 4PO1A 1GZ5A 2AFHA 2WVGA 3MMSA 1ZJYA 1Z5GA 2HIAA 2OWEA 2V7QD 3ILYA 2CVQA 3LUGA 4QFCA 2IV2X 2ZTSA 1V4NA 4KX5A 1BN6A 3KT0A 5HKOA 2P9BA 3N8GA 1G16A 4RVUA 5DHQA 4IJ5A 3KPWA 1RRGA 3RSCA 1I4WA 3VPBA 1GZ6A 3EHDA 4FXPA 3OFSA 4PG8A 6REQA 3IUEA 1R9MA 4B79A 1J8MF 1Z5OA 1RCUA 1XQ9A 2FW0A 1FTWA 2B5WA 2LZ0A 5KBYA 2VBCA 2C3MA 4PRKA 4YRIA 1O97C 5MDHA 1IMOA 1IRIA 2I78A 3NV9A 3H1EA 4RV4A 1H42A 1IXZA 1P1BA 4XWGA 3IQWA 5F4ZA 3ZU5A 2ZREA 3E0QA 4OSEA 1W44A 5EEGA 2ZRFA 2EJUA 4UREA 1NI4B 4AG6A 4F6LA 3HU5A 3L79A 4RY2A 3OSZA 2SCUB 2QL5A 1NE2A 3FYSA 1NW5A 3EQ8A 5D3ZA 2OEPA 5FL7A 5U4XA 2YQ5A 2ZYAA 3RE1A 4YNBA 1G8FA 3W2FA 2Y4NA 1PCXA 2ZUTA 3G2IA 2ES4A 2X2OA 3NEJA 4PHTA 1XV5A 3B6IA 4KH1A 1TCCA 2WD7B 1QZXA 2Z8ZA 5EWMB 3KT6A 4E5MA 1QCDA 5IG2A 2GN9A 1U31A 4ZU1X 2E4YA 3NALA 2VUUA 1IY9A 1OMOA 4IVPA 4OL9A 2ZTUA 3AGQA 3H16A 5JSKA 1MO2A 1ZL0A 4N0QA 5HKBA 2QU8A 3DMHA 2R4TA 2FMFA 4KACA 5FF9A 3KTAB 3ELUA 1ZIOA 2WF5A 2AV6A 4GT1A 4MGHA 3T9BA 1E2JA 1LRJA 2IHJA 2Q4OA 3HR7A 1KAHA 4BXOB 2KQUA 1C4XA 2IPLA 5HE9A 3QPAA 4P81A 3I05A 1C1YA 1Y6JA 3L7JA 3LRTA 1DKMA 4TLLB 4CM7A 3GJ4A 4CMJA 3RW9A 1FQJA 5JI2E 4QZVA 2WQ6A 3N5KA 2GM9A 4IDQA 1XTBA 3QA3E 3CNOA 2ZB7A 1GITA 4JROA 3PC3A 4AUMA 2F17A 2RCYA 3LNTA 2ZYSA 4I1VA 4K8OA 4FC6A 2DPYA 1XTKA 3AEZA 2ZT8A 2HW8A 1A8UA 1Q1QA 1MABB 2J3QA 1TAGA 2IF0A 1O6GA 3SC4A 5AHKA 3KVNA 3BJRA 5BYJA 4PQEA 2PAFA 3GP8A 1MTZA 4AJEA 1NZJA 2WTUA 2QSJA 5L6LB 2IIBA 3WL4A 3C5VA 5CRIA 1MVOA 5KYXA 4JBWA 1Z2AA 1I3MA 2J3IA 3NANA 2FCAA 2GA9A 3LF1A 1KEEA 3BB3A 2RK6A 3BRWD 4WY5A 3GLFE 3AETB 4YMTA 3Q7TA 3B1YA 1N2SA 1MV5A 1YCHA 2Z1DA 1R0BA 4D3DA 3I04A 4NCNA 3G9UA 4WZBE 3KQHA 1FW8A 1NI4A 1XB2A 1F8XA 1QYRA 4A5SA 1KH3A 1LLUA 4DY6A 2CNBA 1ODJA 2XUGA 2VHJA 3ADDA 5ICEA 1F2UB 2IIVA 3CZ5A 2IOQA 1UOPA 1NV8A 4B73A 2Q5LA 4C01A 5I7VA 2CUZA 4RM3A 1L4EA 1F0PA 2Q3BA 4RF4A 3U4AA 3EIQA 3SYKA 1MAHA 3BD8A 3IDSA 2MYUA 2C00A 2XVZA 2GBGA 2EP7A 5AJYA 4WY2A 4M87A 1EHCA 4RORA 2NW6A 4HFMA 4PVDA 2BI4A 1P1JA 1JU9A 1KR5A 2F3QA 2KPOA 3C5CA 3D8BA 1GUYA 3E7PA 3PUVA 3PGLA 1BC5A 3PXXA 1E99A 1PKXA 4IJWA 5DTIA 3P9XA 1Z36A 1T3LA 2D5LA 3QVSA 3ST7A 3PEFA 2B0CA 3OO1A 5AT1A 3ZY4A 2NUAB 3SJBA 4YC7A 1AGYA 5CLGA 3OZBA 1OASA 3LYHA 3UBMA 2ORWA 1DLIA 2AXEA 3VZPA 1HFKA 3D8SA 1OSNA 2IKSA 1D4AA 1KNQA 2FMUA 4F86A 5E8RA 5E9AA 5KNCH 2GJ8A 2MJLA 3DNFA 2IV3A 3OZIA 2QW8A 5D1HA 3C45A 1NTRA 3ZZUA 4KQKA 1L1EA 2P67A 3OE7D 3QE3A 4X45A 3S6JA 4IGFA 5LQMA 1MAVA 1Q17A 3D3WB 4BFZA 1P0CA 4W5TA 3V7WA 1OJLA 5KOHB 2FWRA 2X6QA 3IP7A 4L73A 1QWOA 3PQ4A 4QXAA 1O89A 5BSWA 2R96A 3ABOB 4JYCA 5F77A 3UB3A 3ZCPA 1MT0A 5FO1A 4ZZ1A 1JT9A 2ZRNA 5EIWA 1ZD8A 1N9ZA 2WNIA 2X86A 1UC8A 2YXEA 5C8DA 4WZZA 1EA7A 5JD6A 1BW9B 3U3ZA 3ZDCA 1QFSA 4JAVC 5A04A 1AQJA 4BWGA 4FOTA 1OYWA 5DRTA 5ES3A 3ABSB 2C4HA 4FFVA 4BNYA 1SC4A 4I55F 4BRZA 4JLDA 2QN8A 1FYDA 3P2IA 4I08A 4OQQA 1XP8A 1EFLA 4LHSA 4TN1A 1UFOA 1NQAO 2W7TA 3NG1A 5J9FA 2YYSA 2X2EA 1YULA 1Z4JA 4H27A 5KU7A 5JAZA 1UXJA 3CCCA 2OVFA 3R3UA 4OJQA 2VZ9A 1S2GA 1OXVA 2UZ1B 2ZZNA 1XVLA 4FBMA 2V96A 2GAFA 2NYUA 4U7JA 2NTEA 1M2VB 4YVFA 2WUEA 5C46F 2HLPA 1H1LB 1ZLYA 2PT9A 1O6FA 3AU9A 1XT6A 2GJKA 1V8PA 2DSTA 3QELB 4UE3S 2EJTA 2PRJA 3HP4A 4RPLA 4DY4A 4TTAA 2PSFA 4JQOA 2HDOA 4Q00A 3E9EA 4S24A 3GAFA 4BO6A 2ARKA 1MQSA 1N3BA 2QJTA 3DVSX 3HBJA 3AI3A 4IJVA 5CGQB 4AJNA 5K0JA 1ZFNA 5KSOA 2Q6KA 2I4LA 4LJSA 2XTJA 2R60A 3D3EA 4D4HA 5U4QA 4C2UA 3DZCA 4W7HA 3OPXA 1ECGA 1TW3A 3OG9A 3O8DA 5F5XA 4ZZIA 1V48A 2R5NA 1USWA 1E77A 5A6SB 4EHDA 3KV1A 2I7TA 2FPOA 5C1OA 6PFKA 2XJ9A 4L9SA 4LF4B 4M7OA 2O57A 3DM9B 2HREA 1BXGA 3PQ3A 1FBTA 1XXHE 4DMGA 1ZD4A 1SZCA 3B9RA 1Y7PA 1QBKC 2JLSA 1V95A 3HCWA 3G1TA 4YP7A 4M9XA 1VPEA 2P4SA 1M1ZA 1RWQA 2R7MA 1M8KA 2WWRA 5ILGA 2L2QA 1YI8A 2JIDA 2P4QA 3DE0X 2B1JA 4HDRB 1WS6A 2R9VA 2E7ZA 1QYIA 3KALA 3C3KA 5EE1A 2BFFB 2RGRA 4DB2A 2A0WA 1EGAA 4OGGA 3EPRA 3RU2A 2Y2UA 3CTPA 3C6YA 1V39A 4DCPA 1QIIA 2A78A 4MZDA 3K4HA 4RA6B 1R5NA 3WL6A 4MQ4A 1MQ8B 1MJGM 4YAFA 821PA 4MQEA 3WLOA 2UYOA 1JSZA 4N7BA 2A9FA 4C1BA 1NU6A 1AKYA 1KFBB 3IBSA 3K15A 2KS6A 1FNBA 5K5EA 4AM8A 1SK9A 1EYZA 3I9V6 1P4SA 2JAPA 5A71A 1EK6A 3OJCA 4XIIA 2XZDA 3ROKA 4B3SB 1DRWA 3HA3A 1H69A 2D2VA 3UYKA 1N8SA 3PUJA 5AHWA 2V1UA 3JAKB 2NNWB 5LYYA 4HBGA 4LV6A 5IWAB 1FNDA 1GRCA 2R86A 1UDXA 2DPHA 2EGHA 2XUIA 1OIVA 5AO9A 3WQHA 3RWBA 5K09A 1JHVA 3VSCA 4QHTA 5AFSA 2QMOA 3E9RA 1E0SA 4AWAA 2I2BA 3PWSA 3M49A 1NIPA 4X1OA 2WABA 1I13A 1SUAA 2C9YA 3OU2A 4BBJA 5IT5A 3VBCA 5LU9A 1G4UR 4KIUA 1VB5A 2GK4A 2M1ZA 2HDNB 3IIIA 3TQHA 4CQMD 3DEFA 3BIXA 4ND1A 2HA4A 3FUCA 4MLDA 4N3GA 4MQFA 4MIYA 1PEAA 5HS6A 3VSBA 3FKSA 4BL5A 4EHHA 5EJ7A 1ZH4A 2VKQA 4WKCA 3IERA 4BVHA 2NYAA 4KQIA 4U6NA 2FFBA 3G8BA 3CZ4A 4E33A 2XMQA 3C3DA 2OCAA 5MN6A 4PQGA 4CTOA 2JLUA 4P0QB 2ERCA 1OI4A 1DX9A 1J49A 1U7OA 4QUEA 5F7JA 5HR5A 2WWXA 2B0JA 4RIFA 3DEIA 4D9FA 1PGNA 1QE3A 1DKOA 3HS3A 2J32A 2G4LA 1R8YA 2AC4A 2NNLD 5A0FA 1GU7A 3AL0C 2BD0A 1G9XA 4FE7A 3FMGA 3LQYA 4D5GA 2O05A 4ZVRA 1J7KA 3OIVA 5LZ8A 3ABRB 5BNIA 1UDCA 2YL2A 3RIEA 1SB8A 1GCIA 2FRVA 2Y68A 5DCUA 1FK8A 3KYIB 1I0IA 2ODEA 4YCLA 4HKTA 1DZIA 4TM8A 4DIEA 4CUJA 5JXHA 4CCWA 4ZJUA 5DHRA 3MS4A 4LBZA 2P9TA 1Z8HA 4L28A 4W82A 2VQEB 2O5VA 3ACBA 3HI6A 2WTNA 3NBFA 1QDLB 3ANNA 1OAOC 3NUQA 3ZLUA 3SIPA 4GMXA 1AK2A 2X5XA 2WYVA 1NW9B 4BP1A 3TCKA 2R6AA 2OLEA 3QLUC 1DBIA 3EVFA 4S0XA 5KYYA 2MCFA 2O1WA 2QJWA 5IF3A 4OLFA 4XM1A 2HQSA 1TA4A 4TZTA 3G82C 3TSWA 1Q77A 5EUBA 4TTRA 4AROA 5B6JA 3WG9A 1JHAA 1YNOA 3T52A 5LIRA 1GA4A 2PGJA 3V48A 5MN5A 4XD2A 4MPDA 2GCEA 1NT2A 2J3KA 3I0NA 4FFNA 1B23P 1TE2A 5DLDA 4MUGA 4IFIA 1VYHA 2BKVA 4QHYA 4RLHA 5T64A 3TNDA 1F0YA 3VR6A 1QPBA 2Q8NA 1EEHA 4Z5XA 5HIAA 2WWTA 4HDKB 2PKYX 2XKKA 1SM4A 1TF7A 1DC5A 4M55A 3DE3X 2WOOA 3O8CA 3FCAA 2Y4OA 1MGPA 5EWLA 3V4FA 2EW2A 4YAOA 1WXHA 2QD3A 2Q6TA 3B1JA 3DNPA 4RHYA 3VC1A 3KWMA 1S6YA 2JIQA 1VE7A 3NYWA 4U3JA 4D9HA 4YV7A 1YJCA 3B89A 2QBYA 2FZLA 1GM5A 1RE1A 4RF5A 4Q7KA 5CT6A 1XD8A 2ZAGA 3HPQA 2B99A 4ZT6A 2P5UA 2BM1A 2O8DA 5HIMA 3HNOA 4P80A 4R1UA 3STWA 3HN6A 2I9KA 1Z47A 1KY2A 4EYEA 4NZYA 4DADA 3DD1A 4GL4A 1T2DA 2BZGA 2VTDA 1SXJA 1ILWA 1WABA 1EFPB 1P60A 4P82A 4GI5A 3ZLTA 1HSZA 2ZJ5A 4UZEA 1FP2A 1A04A 2ZE7A 1L4LA 3H11B 4QJ5A 2FP4A 2MMGA 1DG9A 4LVUA 4RZSA 1E1KA 1UJ5A 2HQRA 2PGXA 2JH3A 5IBPA 4IZHA 3E81A 3QSGA 2YC4C 1W34A 2R48A 4X7PA 4EGJA 3DFUA 3B52X 4I2NA 2FMHA 3NDPA 4MQLA 4V0LA 1ZH2A 3FR8A 4LMRA 1K4MA 5B4UA 3UPTA 2MHCA 5CB0A 1LVUA 3ZEIA 4LYYA 5JDIC 3LQ1A 1TD9A 4K9KA 3GBVA 3C39A 1KJWA 1RXIA 5A02A 2PLNA 3RYIA 1LTQA 2AGVA 2H52A 4KB5A 2JPDA 3W6UA 2D7DA 4G1CA 5DW3A 5K0FA 1A5AB 2GAOA 5EKTA 2H92A 1WDKA 2IP4A 3C6KA 1VL5A 1Q7BA 4X8OA 5CVVA 3K20A 4CKEB 3B1KA 5K3EA 2PANA 3TUZC 5ITSA 1K06A 4ZVMA 3HXKA 2YZKA 4RTPA 1QQ6A 4GWKA 1CUHA 3BHMA 3ZGOA 1E8DA 1OD6A 2ON6A 4TLBA 4DGQA 2JLWA 5T4EA 1W94A 1H2EA 2QNBA 4CLRB 3UA3A 1GNRA 1C1DA 3K6SB 1P7CA 1KI7A 3GJRA 1XDDA 4MYUA 3ZY3A 2ZJ0A 4BJ3A 3MTEA 3LCRA 3ZDXB 3IURA 2C84A 1N57A 1X1RA 2PZBA 2X1HA 4O4IA 1AKEA 1SN7A 4U0KA 2VF7A 5KX5F 4KXYA 3DMTA 4K88A 3EQ2A 1C0KA 2Z2ZA 4XOIA 3ROXA 5AW4A 5I7OA 2BTOA 3OJFA 5J3JA 3PWTA 4CLDA 3EIEA 1I01A 3S1AB 1VGQA 4A4DA 1RPTA 4BKQA 4QYWA 2SBTA 2OV2A 3TTWA 4X95A 4KXFB 5EXTA 3RK1A 3TIGA 4CF5A 3WRWA 5KQRA 5ALEA 2V7XA 3C6BA 2F1HA 4R2MA 1CE8A 4OG2A 2WIFA 3WQQA 3FVVA 2PUHA 2NO4A 3EBLA 2ENWA 4A15A 1KZYC 3RIHA 5BWNA 2VKTA 1MX1A 4D1YA 2AMYA 1NQ5A 2EFGA 1SCAA 2D8AA 2FR8C 2LKCA 4WBXC 4WN9B 2A35A 3CEJA 5AKLA 1T5IA 1E2GA 3F6BX 2GNPA 4DT1A 1UT8A 4PC7A 3ZKAA 4D9GA 3M9XA 3S1LA 4G0QA 2HRBA 3BWMA 1JLLA 3EVGA 1P3DA 4EPYA 2JBWA 1Y9ZA 4CKWA 1X7YB 3H9EO 3HJCA 3PPIA 2C2KA 2Q1UA 1QU3A 3IB6A 1PG5A 2P4UA 5IC5A 2XT6A 4TTIA 1QF9A 4JJAA 4IRUB 2P78A 1RI3A 1JG6A 2E5LB 3CWCA 2C4TA 2FE4A 4Q21A 3H1PA 2GUGA 5JAOA 4RZ2A 1SBHA 2XB2A 3IT1A 2EX4A 3GCXA 4HLCA 3T7AA 3TD2A 4JXJA 3T9CA 1UAYA 1KY3A 4AF8A 1NI5A 1R18A 2FUEA 4O4HF 4GOXA 3CYFA 3QHPA 2FPPA 5JFOA 1NOKA 3D7SA 2C2GA 2XYGA 3IDOA 4FW8A 4HVCA 1G5IA 1JKJB 5HRCA 3CVUA 3UOAB 2R1ZA 1F5NA 4HNVA 3WLSA 1T2EA 1SB9A 2VP2A 3KXDA 1D04A 2FG6C 2YW9A 1YZUA 1BCSA 1FLDA 4RXTA 2O3JA 2RHDA 4YJGA 1TUBA 3CNHA 5LXTF 3ZJ5A 1ISHA 2ASVA 3EZLA 3MILA 3CJTA 1OU4A 2WJGA 3BSSA 4EPWA 5CDTA 2GPBA 4OU4A 5BNWA 5JEEA 4YDHB 4N76A 1GGMA 4O5OA 1K7EB 2IQ5A 4AJ4A 2OECA 3IDZA 2CGEA 2ORVA 4FDUA 3ZE8A 2C95A 4M76B 3T7JA 2QRGA 3GJQA 4U39A 2A0XA 2NZVG 1VA4A 1WSBA 2IUFA 2WD7A 1J7JA 5EWMA 2WFZA 2ECKA 3FGPA 2FLVA 3ENVA 4IW3B 5HF8A 2BHSA 1SUBA 3COVA 5JVDA 1MW9X 1SKMA 2H5JA 3AJEA 4OXXA 2VIIA 3JVIA 1P39A 4I81A 3I4CA 5B58T 2G9ZA 2H16A 3IUBA 3QPBA 4WN9A 4ZQBA 5E2AA 4WFQA 1PDWA 4IEFB 1X3SA 4EG4A 3FI9A 4FKZA 2XKAA 4QG3A 2W2QA 4ZQEA 3ZDDA 3SOZA 1NUSA 1N9KA 4NATA 3QIVA 2HADA 2CXXA 3JX9A 3U37A 2R6ZA 2Q1YA 2W6MA 2X0IA 3HEMA 4JGBA 5GM2A 3UWOA 2R5FA 3MD9A 1LDNA 3WA7A 1PS9A 1M5UA 2WWGA 2WIDA 2Y9MB 3IHLA 3BTOA 2A67A 3SDSA 1GDHA 1ZI8A 1HR0B 1W9HA 3NOQA 2C8KA 3PPXA 3GRPA 3I3OA 4R2LA 4K6KA 3VH4A 5CX1A 5AXBA 2IZ7A 2ODBA 2VAVA 2WHRA 4Q4HB 2EKQA 5GINE 1YFLA 1I7PA 2GWRA 4A5OA 3KPYA 3SC3A 1VG8A 3V6MA 3BYZA 1C3VA 1GPAA 1HYGA 2AR0A 2XAUA 5EPOA 4BKUA 1RYBA 1ODLA 3OQIB 3MJ4A 4WERA 3ELWA 4ARUA 4C0WA 2QVCA 1RIIA 1CUGA 3I09A 1ML4A 1X92A 5JI3E 5EMJA 1Z0IA 2RC6A 3F96A 4BVEA 4R5HA 1RR6A 3KQSA 5K0LA 3SFTA 2ZJ6A 3UH0A 4K3VA 5FWYB 4ZI7A 4O6VA 3X1KA 3UFXA 1JQ5A 1Q1NA 4TQAA 4TYPA 3ND7A 3JD2A 1OX4A 3E05A 4HADA 1U5CA 4QBFA 4CZ2A 1QVRA 2DM6A 3QLTA 4GPEA 4JI6B 4JEMA 2EWWA 3IH5A 3ADOA 3TRJA 4R98A 3Q2IA 3RUEA 4N18A 4ZVSA 5JYCA 2C57A 1T0HB 3DAOA 3IEUA 1RHRA 3GAAA 4R51A 1O9GA 4CCYA 1HEYA 2P2LA 2H0QA 2H48A 5B64A 5FI5A 3AC0A 3TECE 3CLVA 4CIDA 2RD2A 3SS7X 1ZITA 1THZA 3W6PA 1LJ8A 3HUDA 4PN3A 1E3DA 3TLGA 2EFDB 2YW2A 1WOYA 3A6DA 2VYFA 1C81A 1TM3E 2RI0A 4DWJA 4ECEA 4I9NA 3FPEA 5A7GA 3FCOA 1E4VA 4JFRA 5FA6A 3FH0A 3U3DA 4HQKA 2DKNA 3KJHA 4B7UA 2CEAA 2Y0BA 2Q2VA 3IEPA 4M0MA 1ISJA 1EJ2A 2RB4A 3FPJA 1R00A 4F9GA 3D3WA 3WADA 1L5QA 1NBIA 1Z38A 1NX6A 5KOHA 1DXOA 3L8HA 3MMXA 4LBYA 1ZRNA 1L5VA 1JJFA 5D3MB 3V6LA 5BRJA 4QM7A 4DDWA 1CF4A 2BV3A 5F76A 1EWTA 1ZQ9A 1UBLS 1VGRA 1WHSA 1HDEA 3HKCA 3NGMA 3NPMA 5CT4A 1SC6A 3SU8A 5KDDA 3QUQA 4DV2B 1SR8A 2OXTA 3FFWA 4MA5A 2HYIC 2B3TA 2ZVQX 3AVPA 3U7QA 1HGXA 3H5IA 4XX0A 4L6CA 2HLNA 4JR1A 2J8ZA 3H6KA 2O8CA 1CC1S 2GAIA 2O8VA 2GXSA 4OQ4A 2ADOA 4L8LA 3JQGA 4IHKA 1CY7A 2NUBA 1P2FA 2X77A 3VZRA 4JMPA 2F1OA 4OBXA 4BO1A 5KIAA 1M67A 2OFPA 3K73O 2QBYB 2C4NA 1PFWA 2WIKA 4KDEA 4DLKA 1JDPA 4FBGA 1EXNA 2F3RA 3ADBA 3ETCA 5IKXA 3IS3A 3TOZA 2RHBA 3JYPA 4D98A 2H18A 1V8OA 3K70B 1FU4A 4XQ9A 2PA0A 1BXKA 4EJ2A 5IJWA 4Z4GA 1CQIB 4O1IA 4PCLA 4NJMA 5EJGA 2BZSA 4RQAA 3ZE6A 2VUTA 1DQPA 1Z2PX 5HOQA 3KKEA 3H2SA 3L7IA 4QOJA 4RMHA 3ZHXA 5JJKA 2B3DA 3UMCA 3E8XA 4YP9A 4DZTA 1P29A 1N8TA 2C1EA 1XTIA 2ODWA 2GHQA 2PK3A 4S12A 4BV8A 1Z5VA 2HSGA 4IKOA 4F1JA 4DR2B 2G07A 2XWJI 3NYIA 2FOIA 5EKSA 3HABA 5LZ2A 1YTUA 4WH0A 1E59A 3W6ZA 1KVRA 5BSUA 1ND5A 1T1RA 1ZK0A 5FOTA 1K08A 2XI4A 1KOJA 3PFHA 4X3CA 5FWXB 2I80A 3T7SA 2PXCA 2M9MA 2ERXA 1EZ4A 3IMKA 3RUIA 4EQZA 4B6PA 1VC2A 2ZE5A 3IKVA 4NBRA 2HWXA 4LCJA 3L8GA 1ZC3A 3C1AA 3ZIAD 4ZI7B 5FWYA 5KQLA 1OWLA 1WVMA 2IOYA 4URFA 1JJIA 3FWNA 4GDMA 3ROEA 4CJXA 3OPYA 1EJBA 3IIJA 1GVNB 3LXRA 5E38A 1XNJA 4N48A 3KPUA 1EP9A 1YSCA 4D56A 2V5VA 4NV1A 3DFKA 3TOSA 2CHEA 5JYDA 1N4DA 5AXCA 3ZWDA 3TXAA 1DBSA 5A4MS 2QD1A 4EB6A 3QJ5A 2FN3A 3U9LA 1H3EA 2WU3A 3WSTA 2BBOA 3W2IA 4AP9A 4MK4A 3DVQX 2VP4A 4RO0A 4PNZA 3X3HA 3ZW9A 4B33A 3OZ7A 1Q22A 2IF2A 4N9QA 2KSQA 4CFSA 3L1VA 3QYFA 4LJ6A 3W79A 3JALA 3BILA 3H6HA 4KQXA 1U98A 2PMKA 1CUEA 2B25A 1T4CB 1A2OA 1OLUB 2A2ZA 4KVFA 1YVEI 2Z8XA 1F8UA 2WAOA 1ORHA 4O8ZA 3UATA 2NTYC 1ISMA 2JIOA 1GDDA 4JMLA 3JD0A 4EARA 2QRVB 1JEEA 2X76A 3BIWA 4LYDA 5BSEA 1N33B 3FWPA 5JS7A 1Z8DA 1YQ9A 4JZYA 4BKOA 2PXAA 3ZTYA 2VTBB 1AE1A 3VVLA 4YWHA 4GR9A 1H4SA 4IDPA 1SVMA 4EG1A 1WHSB 4RHUA 4MGEA 2R8BA 3F4BA 3Q8MA 3STTA 2H59A 3ZWVA 1ORRA 4BMYA 2HWUA 4NLLA 1PK8A 1IXSB 3C3YA 2OBXA 5ALUA 1E5VA 1TRKA 1EIWA 1KEEB 1FXSA 1X74A 4BLUA 4G4IA 3AUYA 4BKMA 1WZNA 4GXRA 2PGOA 2I54A 1JDUA 4FPXA 4G0VA 5K3AA 1JFSA 2RK3A 1E1CA 1H4TA 2J6HA 1A7JA 2OBLA 2Q4RA 4FNOA 2C7GA 4WCFB 1ESEA 1I3CA 2X5NA 5ESWA 4LXXA 4PG6A 3B3JA 1DAGA 1WEKA 3JWIA 4EB0A 2UXCB 4UUNA 1U7UA 4DRXA 4P4SA 1YS1X 2ZR9A 5K3DA 3R7WA 3VYWA 3RS0A 3O3CA 3KWJA 1X0XA 1XEAA 5TNXA 4EL5A 1XVAA 1KHHA 2G9NA 3ZV7A 3DAPA 4HEA6 5EP4A 3QW4B 3AEYA 2FUG6 5TMDA 4JLUA 5B55A 2IEAA 1EXDA 2AD1A 4NYMQ 2IYWA 4GAEA 2J31A 3C70A 5IC6A 5A5DA 4YCDA 2C9DA 2Z09A 4E13A 1NUTA 5EE5B 1P80A 4JBYA 5EI5A 1R37A 2UYGA 4ZCRA 1UKCA 3ER8A 4E46A 4YV1A 2BF7A 3FLBA 1MO6A 1VSQA 2EOAA 1NXVA 3FSEA 3UO8B 4TWAA 1JEJA 1DWUA 1QH8A 3HSYA 3P94A 4NG4A 5HMMA 3WK7A 4EEZA 2Q5OA 2ZBGA 4UAGA 2NVUA 3OPVA 1PQYA 2KHZA 1GJRA 5HZGA 5J4KA 4F7WA 1J42A 1H8HD 1SA0B 3ZDYB 4KNWA 3BRWA 1QVZA 3GI1A 121PA 5BRNA 1JP7A 2XXAA 6GPBA 5FBQB 4HYQA 5IZCC 4H4CA 3ZE2B 2A7XA 4G63A 2QROA 3DONA 2GJSA 3ZWNA 2YX1A 1A4UA 2ZIFA 4LA4A 1N9GB 4RM2A 4OHVA 2OGTA 4UVIA 3AW8A 4UAJA 4DNOA 3HM2A 5E1DA 4QRDA 2X9NA 3NTLA 3HYTA 1KOLA 4EB6B 3LGXA 3PUKA 4MKHA 2FHPA 1PV2A 4MW0A 2VNAA 3CX6A 1MC4A 2I62A 5DIFA 1MDBA 2AE2A 2OLKA 2QAIA 4JNCA 4NU6A 2IIPA 1OXMA 3IFSA 3JQFA 1OYVA 5TGZA 4Y6PA 3EXFA 3TSZA 5KU1A 2DULA 3TLZA 1ZUWA 2C2MA 5CA1A 1ST3A 3Q8LA 4TSKA 3SHQA 4OMUA 3KE9A 3AEQB 1XYYA 1DC7A 1XC7A 3DKKA 4RH3A 2WM9B 2XBLA 5TX7A 1ZWKA 2H6EA 4L27A 5BWOA 1N5LA 3QGMA 5G0WA 4BLOA 4JXZA 3RC3A 3C43A 3ZXSA 3G2HA 4R8LA 2ZVPX 2YH2A 3OURA 1T91A 1TXGA 1T9GS 2NO6A 3HFJA 4GMKA 2FA9A 3P9RA 2BBWA 5BMOA 2OG1A 5KO2A 3U31A 3R9XA 1C30A 3CNNA 4DHEA 3QIAA 3GXOA 3KQOA 5KYUA 2XGMA 3VBEA 3SP1A 4GLJA 3TEJA 2AI1A 5KTSA 4ZANA 4MP3A 4RMJA 1H2BA 1KC1A 4QTTB 4Q47A 3MTBA 3PK0A 2P6NA 2QRLA 3QU9A 4W8HA 4TYWA 1AM4D 3KKPA 3QVOA 4HMOA 5AVZA 1ZGGA 5HW0A 2J5RA 1RRKA 3P9QA 3R5FA 5DKFA 4ZU6X 4PEVA 4Q9AA 1DG3A 2R6HA 3QXHA 4GSKA 2RKWA 3GPLA 3TQIA 1BFKA 2IPXA 4ENQA 1QCYA 2GFHA 4RYLA 4D6XA 1RKQA 1D0SA 1PJRA 2WSYB 3S5UA 1YZQA 4EHLA 2ZSDA 4A10A 3JQBA 3MGKA 1DV2A 2BGLA 4ODIA 4BEWA 5DCLA 1UADA 5FYDA 3BERA 2D06A 3FIUA 2X9VA 1GPYA 4NH4A 3UW3A 2CXUA 1CUZA 2RGEA 3ID6C 4I4LA 4Q1VA 2OGWA 2QX4A 4NZZA 5L8VA 3GFBA 3QA9A 1LDYA 2R8RA 4UAUA 3FOZA 2ZWVA 5SZIA 1MVNA 1KI6B 4HZGA 2I67A 4TUYF 1KVTA 1SVSA 1Q0LA 3PZRA 2EKBA 1UKZA 4RK1A 4IZOA 1Y3AA 2QPAA 2PLAA 3Q7RA 1N2XA 1ZIYA 1JXOA 1ISPA 4OFWA 4BJ5A 5IXJA 3AOEA 1NZDA 1DO2A 4OGFA 1XMIA 2B1GA 4IQ8A 3C5WP 4LKOA 4B71A 2HU5A 5E9QA 4BO3A 3W5VA 3HRIA 4ZO6A 3SI7A 1JSLA 2D13A 2HNBA 2JS7A 2PGLA 2YQ4A 1RJDA 3FPGA 2H4WA 1MOPA 3LT4A 4IH1A 5ULLA 4M6WA 4BIMA 4HNAA 3EXHA 1LB1B 3JASA 4MUBA 3AY7A 1H4VB 1ABEA 1QIHA 3INNA 1FDIA 4X54A 3R0ZA 1QR6A 4Z7NB 3ICQB 1V3UA 1WY5A 4PRZA 3UXHA 2PUEA 2DKFA 3GHHA 1EAYA 1SKQA 1Z28A 5I8PA 3U09A 3ZWOA 1WV0A 3FJ1A 3Q40A 4OB7A 1E6LA 3SEFA 4JJFA 3TZKA 3ML1A 4I6JA 4EPRA 3JQRA 3RSLA 1CFZA 2YXPX 3OEYA 2H1OA 1I3KA 1KORA 2FPKA 1LQ2A 1NT4A 4HRXA 4C6SA 2GAJA 5D85A 2MU1A 2QQGA 4JP8A 5JV5A 4L07A 3A2KA 3BWDD 3HBFA 2FZ5A 4HDNA 1V3TA 1VKRA 2CDAA 2XTAA 3SSAA 3TLCA 3VR2A 4FZJA 5J2UB 1VHLA 3NCTA 1F8FA 3PCXA 3UK6A 2IPOA 4RF3A 1JZSA 4L4UA 1HETA 1LPBB 2C04A 3A27A 1PWEA 2C20A 2DTEA 4MUHA 1JI0A 1U9JA 4X1YA 3ZV3A 5IYZB 5F3RA 1IN4A 2NSYA 3M6LA 3CUTA 4KKVA 5HK8A 3TUIC 4MRNA 4YCMA 4KQCA 4ALNA 4R1QA 1YDGA 4JN6B 4LGVA 4PYIA 3JRNA 3ZCQA 3F2IA 1IOLA 1C4OA 1ZM7A 1DX4A 1YDHA 3SZOA 3AX6A 3HXOA 5C32A 2CMGA 4ZAXA 1JI3A 5FJIA 3V2UA 4ETIA 3H5VA 4NDZA 3VDQA 4AUNA 5JY1A 4E14A 4IVQA 3MPOA 3IAHA 1ORWA 3RAPR 1R5BA 3GGOA 2QAGC 2I34A 5EQDA 4XDZA 2A14A 3PFBA 4QKQA 4LRXA 3GL9A 2RK4A 3RVJA 5EHNA 1VDMA 2OCIA 1LU9A 1NVTA 1VMIA 1VSTA 2DU8A 2VP6A 3C85A 3LO8A 3ICVA 2JRLA 4JJGA 5FTMA 3WLQA 3RABA 3N2KB 1OVMA 1MPXA 1NY5A 5IDXA 5H59A 3COWA 1ZL2A 1I2ZA 4OLHA 5E3JA 1AVTA 4IBOA 2OHVA 4CKXA 5FT9A 4QVGA 2C0PA 1UWLA 1XZJA 1TQDA 1ZVQA 1YH3A 4AJ9A 5BW5A 2O8FA 3RVNA 4LJ9A 4IEEA 4RF2A 2MWMA 3MRSA 3BF7A 1OIWA 3H2HA 4NXMB 3MM4A 2BSQA 3UXYA 1QVAA 4Y2GA 5TDHA 1U7ZA 3W2GA 4FMBB 1XHLA 2R3SA 1RABA 2AIRA 5AXDA 5LDDC 1T8WA 4K9DA 4TYMA 4C4AA 2JAHA 5T67A 3R7SA 3A9TA 2CB0A 2C9ZA 1PTKA 1RXCA 5HF5A 3N0VA 2E5FA 4TWBA 4RJJA 4WOJA 1PFYA 2PT5A 2WNSA 2HHHB 5BR7A 5J63A 3LUFA 5CBPA 3RYCB 2FZEA 3Q88A 3C48A 3QELA 5ARDA 1U3WA 1VRCA 3NHLA 2IE8A 5BSKA 2EP5A 1A77A 4K0RA 3VJMA 4ZFNA 3LUBA 4EABA 2MR6A 3DL2A 4B47A 2CFOA 3OQIA 4HGPA 4W4TA 4ZOLF 4ZYXA 5K8UA 4LWPA 3WL3A 1GU0A 2F1IA 3MXOA 3EGCA 2XMDA 3LIPA 2JVJA 2VQSA 3AR2A 2O4UX 4PYQA 1M0EA 3PHIA 4KR6A 2GD0A 1U1DA 3PF9A 2P2GA 1HA3A 1Y5LA 3MT7A 4PGHA 3VZCA 4B3CA 2CYBA 4WZAA 5I8WA 1HE4A 2DBRA 1H23A 2V6FA 3FM9A 1NLFA 3IMCA 4NBNA 3B3QA 4L95C 5EZYB 1X7WB 5G3ZA 2EKDA 3T15A 4CM8B 4Z4IA 4BV2A 3PKIA 4B6OA 2JIBA 2Z3ZA 2RGAA 3NNDA 3OCJA 3ZWKA 4KHZA 1Z8NA 4UTPA 5EP2A 1GZVA 3C4VA 4EITA 3TNYA 1H0HA 3GT0A 4O2BF 9ATCA 4BNDA 1FU8A 4AMVA 1JU3A 4HN2A 1H93A 1XZKA 1E9EA 4HRAA 3G1UA 3VUFA 2Z9BA 1CVIA 5DRYA 1KO4A 5BVHB 4FSDA 4TSRA 4GX1A 5JCXA 1I14A 3IUJA 3LTEA 4LX0A 2H29A 5EQFA 3DL7A 2H5LA 2IHUA 1ADFA 1A7AA 1LBSA 4QOHA 5H4HA 4BO9A 5JSQA 4RTMA 3AF6A 2XADA 4MRSA 4PSCA 1W4BA 1OLSB 2YASA 1UQRA 3BTVA 1Z0DA 3IO5A 2OKCA 2VRCD 3AKCA 5EE0A 1COWD 2RFLA 3F4LA 1I32A 2P2YA 2XVAA 1IN8A 2Y1LA 5DF1A 3OU6A 1NVBA 1NV9A 4J7XA 3TIFA 5HK9A 4DYHA 4EO4A 1BGWA 2E4ZA 1L5NA 4HFRA 1DO0A 3K0HA 4QUAA 2KI5A 3V8VA 1NMEA 1N2JA 1LV7A 2MOKA 2PKXA 5BSTA 4F4JA 3QXXA 2JKYA 4IHJA 4MVWA 5FBWB 4WINA 4EHBA 3OFNA 4XASA 3U3OA 3FY4A 1J25A 2W6NA 2FPUA 4RQBA 3WDMA 3EVAA 1M3SA 1UEIA 3DZFA 5JE8A 1CD5A 3LF2A 4D97A 2D74A 3HZHA 4ITUA 1FDVA 1W9MA 2C5LA 1JN0A 4QGGA 5H16A 4BFXA 3PKZA 1AN9A 4UQOA 5JS1A 4EBFA 1T0JB 1G7SA 4D8XA 1NXXA 1AZTA 4YCAA 4G2NA 2I6TA 3OEED 3WIUA 2VJLA 2QI9C 3N1UA 2P65A 4G36A 1Z0UA 1E3IA 1JA9A 1PT9A 1TFUA 1RWWA 1X80A 3EQZA 2YY7A 1S7CA 3E7DA 4QUJA 3THYA 5KYNA 3DE4X 4L51A 4KAFA 4B34A 3AIKA 1B2RA 3EFOA 3KQQA 4Q12A 3ZZ0A 4DAEA 4F4HA 3EVEA 3VU1A 2O2JA 4ER6A 1KZHA 3GJ3A 4N0EA 2DQ4A 4KWEA 4KGZA 3V1MA 3ZHRA 4GD3Q 2QQFA 2NU7B 3BEDA 1P7PA 1VE1A 1MC1A 3D3QA 3L0IB 3HLKA 3UAGA 1DKUA 3ICWA 3L40A 3AF1A 4PTLA 4RS3A 1P5HA 1RVV1 5EYPA 2BBTA 4KBGA 2QXTA 3OJEA 2JDID 2JRCA 4LKRA 2QYTA 2B5VA 4Z2YA 1MO3A 3DUFA 3TDMA 3F47A 3SS9X 2VH1A 1A27A 2VH2A 3ACCA 2BISA 2P8SA 3R3YA 1FFXB 2X6TA 3BPSA 3GMTA 1GARA 1D8AA 4TKMA 2CVPA 4JJ7A 3HJUA 2BR3A 1L5HB 1NAHA 2VHWA 3K1TA 4GECA 4HAIA 4ACAA 2JGNA 1WZUA 3N53A 1NXQA 2YHIA 2GZ3A 3IT2A 2DUWA 4QUHA 3RSFA 1X15A 4NDAA 1V5EA 2AEMA 3AP1A 3E9ZA 5EJEA 5AVUA 5JD4A 1H0RA 5LJIA 1MGOA 2E6KA 3H3FA 1YMVA 1UJBA 4WZAB 1H8EA 1M1XB 2CNLA 3BVPA 3HDTA 3IKTA 1JE1A 2MTBA 5PGMA 4EF6A 1SY7A 2QXUA 3FHCB 3UPDA 3I3SR 4M7RA 4MUJA 2Z2JA 3P9ZA 5DSTA 2WMOB 5CA1F 4OEHA 2I99A 3EF3A 3X2SA 3EGEA 1XK7A 2ZRIA 5DX8A 4HATA 3K0AB 1D2HA 4ZDWA 1HQDA 3FNBA 3EPPA 3D6TB 3PQ5A 1MA3A 1XNHA 3WY9A 5BSGA 5IVPA 3FPBA 4HGQA 2KLBA 2R8PA 4XSHA 3I72A 3I5XA 5JMOA 3GC6A 3LQKA 3TAUA 4DSAA 4WK6A 3UW1A 1RRPA 2NSHA 2AI2A 2RC5A 1RHKA 4G8JA 3A6FA 3FFXA 3NHFA 3PRYA 4WY8A 2PUDA 3HO8A 1E1LA 5AKXA 2V7VA 2F1RA 4G84A 4FJ0A 4BNNA 3HU2A 1WBBA 4F4FA 3CVVA 1V8FA 4BC1A 2BHTA 2KYRA 1J2TA 3IDQA 1SUIA 3QHQA 4K2AA 3W4KA 4NP6A 2OCXA 2OENG 2C9MA 2JATA 5JBNA 2H2GA 5FWNA 1OLUA 1A4RA 1KOGA 4XVRA 4GRIA 1X1EA 1SPBS 2JHAA 2R8XA 3MGAA 3M7IA 3VC2A 2BKUA 1Q91A 2R4QA 4L4RA 1M0SA 1QUFA 4R2JA 4KOAA 1SEVA 1FYFA 1OWMA 2E4XA 1LW6E 1L0BA 1DEKA 1FTSA 3D6AA 4MW2A 5IBCA 4EFMA 1G63A 2BEVB 1VJGA 5JARA 4R9SA 3CG4A 4WUVA 1YQEA 2QLBA 2WIAA 4HQ6A 3RC1A 1VKJA 2H4FA 3K0EA 5EN4A 5IBQA 3VPAA 4B1FA 5BW4A 3HK2A 1I9CA 1X8LA 3F6SA 5FOWA 3WE7A 4TRMA 4PYOA 3DTVB 5JD3A 1GL7A 1L4NA 1SUPA 3WGLA 4GXNA 1HG0A 1W4LA 1CS4C 4MHOA 3G6KA 4J4BA 1XDUA 3L5KA 1QQTA 2VXCA 2A84A 3A7DA 2J9YB 3MERA 4TL9A 2PMDA 1CF9A 2FPWA 2Q5EA 4QLAA 3U4GA 3CKLA 4JHXA 1XMVA 2PMBA 2H11A 2Q4TA 3E22B 2VH5R 4PZAA 2XA2A 2XZTA 1OC2A 1JGTA 2HA2A 4ACBA 2ZJZA 4NE9A 2ZXEA 2O0LA 1R6TA 2XV1A 4RVHA 2VEDA 2PWAA 3D8TA 3Q72A 2P9EA 3UIEA 1RXEA 2Q62A 3U39A 4E07A 2PX5A 2PX2A 3JYNA 5K4HA 4TL6A 3Q41A 2HLDA 2P4EA 4J6FA 4OGWA 1KY4A 2Y1OA 3CEPB 3KR1A 4IMJB 1PYOA 4RADA 5KNDA 2ZJ1A 2C03A 1CXZA 5F5NA 4N82A 4JLMA 4G4SO 3E9QA 5GONB 3ANTA 1AOXA 1VG0B 2ZEJA 3MF4A 1RJEA 5DNWA 3ZQUA 4ALMA 2EP8A 2NADA 2WTAA 5IEJA 2XJ4A 1XJ0A 3JQ7A 5K4AA 5JASA 1PZNA 3OQNA 1IM5A 3TB4A 4EOGA 3LXMA 5AKIA 2BUCA 2NPFA 5F23A 3ZQ4A 1ZOLA 4AN1A 2ADMA 3H9GA 3BH6A 1KMNA 1Z0ZA 2BEUB 3IUMA 3MBIA 3CZPA 4MB2A 4TVBA 3N05A 4TS1A 4HDMA 4C76A 4EUFA 5JJIA 2XHZA 4O02B 3KS9A 3ERCA 4IDBA 1I51A 4IH4A 3RFTA 4C4OA 1MG5A 5BPHA 2QUAA 1C9NA 1RAAA 3TLJA 3CJQA 1XQVA 2QMQA 7ADHA 3H8WA 3KAPA 5SYNA 3TW6A 2QUJA 3BKXA 2D00A 2GX6A 2N42A 5KQPA 2I2XB 2XYHA 4MMYB 1G2IA 2JVKA 3TBFA 1I4DD 3FOFC 1XU7A 3K5PA 2INGX 5BN1A 5LKAA 1E9AA 1Y5NA 2AKAB 1GT6A 1CQWA 4R7TA 3IX7A 3UQYS 4D9CA 3C74A 1GZ3A 5E4FA 2FKAA 1Z0SA 1KMQA 4CMKA 1JPVA 4S35A 1ICIA 1YHZA 3S3TA 1E2EA 2VHYA 1ONPA 5JZ9A 2H2WA 1ISRA 2DWUA 1ANKA 3ESQA 1R4NA 2Q0SA 1LX6A 3A6ZA 4K40A 3F98A 3OOJA 4KYVA 2XQFA 2YYZA 3DHNA 1Z4KA 3TG2A 2A58A 3TOCA 1ZBQA 1V5GA 3NXKA 2K6GA 3BG5A 1HMPA 4OA8A 1TZMA 4ZCSA 5FBRB 1QDUA 4EFKA 4K6CA 1DNPA 5KREA 1M7HA 3QXCA 4OQFA 3R75A 3E7FA 4AJ2A 5GJBA 2W58A 1URPA 5FXMA 1KDPA 2O48X 3DBRB 1CIPA 4B8YA 4UULA 3KTFA 2O2ZA 3JVEA 1A9ZA 4MGZR 4LUCA 3I2GA 1CPYA 2CJWA 3HBMA 4XCXA 5FAKA 3WQBA 1E1YA 4AS1A 2CMKA 4AX4A 2FEXA 4PLZA 4WXYB 4EHNA 2PS3A 4MDEA 3MEQA 1RKUA 2ECOA 2PZ8A 1GNVA 4MNTA 5DGHA 5LDGA 1SKUA 3FCXA 4Z4QA 3WWOA 2IHNA 3QUTA 1R16A 3C6ZA 1QHSA 5K6AA 3AP3A 5G4KA 1W5EA 4HB2A 3VO1A 4DWVA 3ES9A 3OWHA 2VI5A 1QQ5A 1T9AA 3ZQ6A 2X6RA 1E7RA 1KK3A 1MX9A 1P1RA 4M36A 3PJRA 2QZSA 3HA5A 3I9JA 3OP1A 2R7LA 4XFJA 4O3MA 2GVZC 2HJVA 4RHEA 1KFCB 3FTPA 2QL6A 3BQ9A 5L3RA 4K2HA 1ISFA 1MOQA 1BJTA 5JQGA 1RYFA 4O2AA 4X44A 5F2OA 1EX1A 5BWMA 1E3EA 4I1PA 1JR3E 4PVCA 5BNFA 1ODSA 4BNZA 1B3RA 2CXQA 3CRMA 4Q48A 2HCBA 1PT8A 3UB2A 3DAYA 1O97D 3Q5EA 3DFZA 4UHFA 3W90A 5LQRA 3GT3A 5IS2A 4R0MA 3BWYA 5KSYA 5TF0A 3ZHZA 2BAGA 1C3OB 1DJLA 1WW8A 2EATA 4RJIA 1NQWA 2PN1A 3E3OA 2JIZD 4NMHA 5EWJA 4ZMBA 1T1GA 5EJ2A 4D9KA 3LL4A 3MBKA 1WE2A 2VP0A 2X2PA 3L9WA 1EU1A 4Y9RA 4YO7A 4D46A 4UPDA 1WXDA 1C1XB 1T3GA 1TUIA 4Q16A 3UOGA 3OQMA 4B6EA 2ZR7A 4LOJA 5EPEA 3WLHA 3I32A 3I4LA 3Q87B 1B6SA 3S1AA 2Z5LA 4HDMB 1GZUA 4FNAA 2HF9A 1FTYA 3H97A 4FJ1A 4BB9A 4DDKA 3L7BA 1A5SB 4MDYA 5KKAA 2P8JA 1D09A 4MS4A 4NQRA 5JHGB 2QX9A 3GFPA 5IFKA 5ICMA 1YB2A 1U5AA 1UZAA 1OXXK 4MW9A 2G4CA 1GQFA 1IHYA 3DDHA 1C3JA 1H6BA 3KP1A 1BIFA 3UT5B 5T7BA 3NWBA 1THTA 3U1BA 2ZK7A 4QA9A 1M0WA 2FYTA 1AGRA 2BIFA 1L7NA 2CXTA 3AF5A 4F85A 3RC8A 1KSFX 3GR6A 3QXJA 1YC2A 4PSKA 1F4PA 4F9TA 2NQ8A 2PNFA 1J0DA 1C9KA 2LTAA 3RKUA 3VHXB 1THGA 2TS1A 3OZGA 1ZGBA 2XSZD 3B6ZA 4JLBA 1Z82A 2GHRA 2YNMC 4WKGA 2J3LA 3ZWMA 4MLPA 1HX7A 4WQMA 2I76A 2XYVA 1I5EA 3AY6A 1T9CA 1SFRA 4OJNA 5K6AC 2FG5A 1KI1A 1J39A 4JIGA 1O4WA 4JP2A 2UZAA 3CCBA 4LYAA 5GJVC 3V1KA 3M6WA 2R97A 4MUYA 4P4LA 3NHUA 3PE4A 2BRUA 4YJHA 2RHCA 4MV0A 3DBRA 3L4BC 1RJGA 1VOTA 4JXKA 1G9SA 4ZVQA 4J76A 3O95A 4GE3A 4TRRA 1IULA 3MB8A 1RPJA 1NVDA 4RD1A 1SG6A 4F91B 1RD4A 1SHZA 4PHHA 1XLTA 1NONA 1GVHA 1XZBA 4S04A 3BHNA 1OGYA 1SXJE 1RLOA 1UBUS 4RVSA 4ARAA 1BWQA 3KJZA 3PRJA 4IIJF 3SY8A 4F3KA 1CUIA 4M7WA 2X4DA 2W2LD 1RZ3A 1K88A 1Y9AA 1LQUA 5IAEA 4Y9DA 2QLNA 4XIYA 4BLQA 1QSGA 2NTNA 1X1DA 3PC4A 4NCHA 4IGKA 4PSUA 2G70A 3KJEA 2VF4X 2Y1EA 3GJSA 2PX0A 5E9JA 3TW4A 1M10A 3LDHA 4HYYA 1L7BA 1P8JA 1TTQB 3B51X 5E6RB 3CN7A 2YRFA 4DIOA 3GJTA 1MENA 5EP3A 3FKJA 5E7IA 2WJHA 3PG5A 1UIMA 2IOFA 3QVMA 4KLNA 4MICA 3UJ6A 3GEEA 2W4QA 5ALKA 2HNAA 1CZOA 3QBEA 4X41A 4ZIRB 2QORA 2ZZMA 1SU8A 4F4DA 1TT5A 5HPYB 4Q4DA 3VPDA 6Q21A 1J56A 3PHJA 5P8WA 1YQGA 1OV6A 2Y0EA 4DA7A 4RWEA 3BL5A 3UKJA 1YQQA 3GCZA 3UHOA 4ZK2A 2CFRA 3WSVA 3CLUC 3O4HA 4YPOA 3O8NA 3VNUA 2G17A 2IDJA 1HFWA 3DEZA 3AEXA 3NAMA 3QF4B 1NFFA 4K86A 3ZWWA 3N07A 1NRIA 5E95A 4CQJA 3UXMA 4I50A 3OCWA 1M6NA 5AJXA 4B3GA 2XAAA 2Z43A 1XJ5A 1C9JA 4OFZA 4LSMA 3T5BA 4R41A 3ZGNA 5LVAA 1DWQA 1V71A 5EEHA 2YV5A 3DE6X 3U4QA 4Q4LA 3WOVA 3NH9A 4CEJA 3A9WA 4DUGA 4GSLA 1DZ3A 1TPYA 3EWSA 1NJSA 3AY0A 3T61A 4KVGA 2O7QA 5AVSA 1I80A 2I4RA 1OI2A 4YIKA 5EA2A 4DIDA 4WLUA 3FW1A 5AP9A 1JXQA 2J45A 3EWIA 3AY3A 4GGMX 1NA5A 2ZJYA 1K5GA 3T4UA 2W11A 3B60A 3IXMA 4KH0A 3VOAA 1BRMA 3VJKA 2ZW9A 3N2GB 1KQGA 3HY3A 4GI7A 4D0GA 2WSSD 3KLNA 3MC1A 3RRBA 2GKOA 1Q0SA 4Z9AA 1FSPA 2GN6A 5CDYA 1PNQA 4QPNA 1H2XA 3L7YA 1HZZA 2ONKA 3CF4A 2BSAA 2GEBA 4K03A 5AUQA 2K7FA 2OMKA 1QIKA 2ZJFA 3COZA 5DB4A 3NMUF 3ETEA 2QJFA 5JNTA 3BCRA 1JFLA 2PRSA 3FOWA 1WQ3A 3P9CA 4JT2A 1TUEA 4KUGA 3OCVA 4ONEA 3ZVLA 2VPQA 1CZNA 2A9QA 3JYQA 3MWFA 3TJMA 2R47A 4N6NA 3CLTC 1XJQA 1PVVA 1B0AA 2BONA 2GJ4A 3EQ6A 4HNSA 1KIAA 2C9CA 2QX8A 2O3UA 3P96A 5I7FA 3L0OA 4MO9A 3DGFC 1CNFA 4M1OA 1UJ4A 4E5YA 1B0UA 4OHCA 2ATXA 4UDOA 3GAMA 2DQYA 4TWRA 5LZ9A 3U7HB 4G86A 4MIKA 3QKRA 2WLSA 1QKJA 1GPMA 4KJXA 3JQ7B 3HGMA 3X1WA 1IOVA 8OHMA 4MQ6A 2YOHA 1TYBE 3P2KA 1IJFA 2QU7A 2GK3A 1HKHA 3G0GA 3SC2B 4AO7A 4C0JA 1G5TA 1RRVA 4IS2A 2AFRA 2FX2A 1RXUA 2EEPA 2VHVA 5K0CA 4R3WA 2BMEA 1QGUB 2XSZA 3U56A 4FILA 4F2HA 4HT3B 2Z5VA 1AK1A 3G2MA 4YCJA 1IAVA 3KDSE 4R7ZA 1JQJC 1LCIA 2C7BA 2VQ6A 2WKQA 3AI1A 4IIJB 5A5VA 4M38A 2RHTA 2XWSA 1YJAA 1P4JA 4BFYA 4YCCA 3PIIA 4Q34A 1OAOA 1KY5A 5HE8A 3EUEA 1Y8AA 2ODAA 5LB4A 4RHFA 5SY9A 2IYXA 4CXMA 2AYXA 2QUIA 4GR4A 2FPXA 3WI7A 1SG9A 1Q7RA 2XUQA 3E3MA 5IJAA 1T2VA 1FSGA 3K8QA 2IEYA 5FOXA 5KMGA 4KLRA 4ECAA 1O58A 2VNIA 3WDKA 5DBEX 3ZS9A 1W88B 2DFDA 4Z0NA 5ALWA 4D92A 1QAMA 2ZU6A 2IK8A 4UFOA 2V65A 4N3CA 2BFCB 3C3XA 1K0UA 1KDOA 3GJZA 1NVMB 1N6IA 3QQ5A 4CYMA 1GPUA 1M1UA 1H5QA 4MA4A 1GEGA 3EIHA 3EFOB 4KO3S 5ERYA 1Y3IA 2I8AA 2CBXA 4YRFA 3TW8B 4YH1A 1GPDG 3B5EA 1IM8A 1HQKA 2H2FA 4I4CA 3WHLA 2CFCA 4C3OB 3IO3A 2XQJA 4FN4A 1FFYA 4J0IA 4HAUA 5C8YB 3PUHA 3I5MA 1KFJB 4YV2A 2OILA 3E5RA 3MTGA 1CUFA 1VZ3A 5DM1A 2D62A 4P84A 5AW8A 1YFKA 5AJHA 3ZN2A 1MB3A 2PR2A 1IY8A 1GL3A 3HJTA 4A36A 1B0PA 2LCQA 5AM3A 3U4DA 5A2QA 5LP6C 3FTNA 3CWQA 4NVRA 3I53A 3MBOA 3CF6R 4OHKA 2VTKA 1AQIA 1Q2XA 2HGZA 3EW9A 5CJPA 4OI1A 5EJ9A 1PFKA 2CE7A 2AX4A 2ONCA 3CN9A 2IQIA 2ZUSA 4M0CA 1OZHA 2FSGA 4PC2A 2NGRA 3ZKWB 4ESOA 4JP5A 5ALIA 5KAPA 5TVKA 4GBMA 5FLEX 1FCJA 4QBGB 5JZSA 3LDAA 2TRSB 2BGIA 4KE7A 4BRUA 5KNBA 1K4KA 2NO9A 3ITDA 1BDBA 5JJCA 2WZBA 2QDKA 1L5HA 5FWAA 2V6JA 1T0IA 3MT9A 3R77A 4MKRA 3GLFB 1E20A 2FWPA 1TECE 3LHKA 4H17A 2C5EA 3H1AA 3U7EB 1X86B 1L3CA 1SXJC 2FEWB 2ILVA 2GZRA 3AL3A 4C29A 3VR1A 5D00A 3LGAA 1B0ZA 1GGJA 2H2AA 5SZJA 1Y4UA 1KIMA 4WKPA 2OXIA 4L3WA 1DAIA 2LPMA 3WGMA 1JVSA 5IX8A 1U99A 1J90A 4HXFB 3ZY6A 2A5FA 4J07A 1TAHA 1RHJA 2HRCA 2WEKA 3K32A 4ITRC 3X1XA 5HF6A 3W3AD 2CZCA 1RLJA 1O5OA 2I4TA 5L53A 4XA8A 1K66A 4F2GA 2XTMA 2WFAA 4IINA 2DBZA 1DKPA 5D6OA 3DT9A 2W2NA 3PCTA 3QKRB 3IOYA 3NS7A 3TVYA 1P5JA 1TD1A 3NEPX 1PR4A 1RJ9A 1YFZA 4H7JA 2D6FA 2MINA 1O77A 3WKAA 3ZZ1A 3KQTA 3EEYA 4RTLA 5LOVF 3RV3A 4HJXA 3T1HB 2WYIA 4XGQA 3GNSA 2O8BB 4QYSA 2P90A 2QRVA 4N3BA 5KNCD 2DY0A 1LPMA 2Q8QA 2ZIXA 4R5MA 4TMVA 1TM5E 1ARZA 1GUDA 5EIBD 4WDRA 1VKNA 5HBGA 2FPGB 1XRLA 3AEKA 3SKVA 3LFHA 4WIAA 4DA0A 1ZUNB 3IR6A 3GJXC 4XUGB 1HBJA 3U6KA 3R9XB 3MWJA 4QXPA 3WZMA 1Q1BA 2XOEA 1M33A 4G97A 4EF5A 1T26A 2X0FA 3EUWA 4GMGA 3A9SA 1ADYA 4KQWA 4UAVA 1B15A 2RDMA 1CF2O 1KDRA 4EJSC 5CB4F 1G7CA 2QG4A 4DKJA 1YJ5A 1Z75A 3DG9A 3HDGA 2W2PA 2DFVA 1E1QD 6YASA 2H1FA 3ZI4A 4Z9FA 4X5OA 3OZRA 2PIAA 5FWXA 4GZMA 5KWVA 3ZD6A 3J7AC 5JOQA 3CS3A 3NO4A 3NXSA 4MUFA 5AK3A 3PVCA 1T9BA 3MWLA 2H7XA 1NUAA 2R25B 1M2EA 3GMDA 2FY8A 3NT5A 4LZWA 3QNWA 4OQNA 5H9VA 4C5BA 4OB8A 4D4MA 1K5HA 1W2HA 3FOAA 4XGKA 2FLWA 3LIIA 3BICA 4FQ7A 5CITA 1RLMA 4QBKA 5J1SB 3Q8WA 1CUVA 3N8NA 1FFAA 5EMNA 3Q9SA 1VKZA 4FC7A 2IU0A 4F84A 1MKYA 4BNDB 1E6CA 3FMFA 2EWVA 3KZMA 1RRCA 1J5EB 2R6DA 2ZTVA 2G3YA 3BT7A 2GD1O 3RSSA 4QPZA 1RZRD 4AJLA 1VG9B 2B36A 4I2VA 1QORA 2RE8A 2YC2C 2RJOA 2ZSIA 1P4AA 2D5AA 2FFAA 1ZK2A 1K9SA 2C2WA 4EO7A 1J2JA 4F3CA 3FF1A 1NRXA 3UJPA 4L3OA 4AFNA 3COSA 1P1HA 2AN9A 4YRJA 1SPXA 4NCJA 3EZNA 2AMFA 4A6PA 4PZCA 2GBIA 3PR1A 3QI7A 2Z2YA 3KOYA 7ABPA 2GCOA 3M6IA 3HLYA 1NP3A 5D87A 4AKSA 3EN0A 4L1KA 4M54A 4EKGA 2QS9A 2PSEA 4UVHA 3JQBC 1UMDA 1IPHA 1I3LA 1ZO8A 3GFFA 3HVJA 3IR7A 1D2GA 4IO1A 4HV4A 3S1SA 4W9NC 4IVRA 5FPTA 1I7NA 1Y6QA 2F64A 1XCGB 1CY1A 1IBSA 1TJ3A 3DDSA 3U81A 4XCVA 4ZYTA 3AZQA 4M98A 2HFJA 4D8UA 2HPZA 1WV1A 1BFDA 3DTVD 3R0QA 4PGFA 4DV6B 1ZXXA 3MTQA 4OAQA 3QX3A 2OHHA 3M70A 5CDFE 2GZHA 5MGBA 3LX5A 5JCZA 3RG8A 4HAYA 2QQ0A 5TEVA 1YVUA 4LOKA 3E9DA 3MCTA 2PO7A 4HH3C 4BWFB 3THOA 4JJEA 4XX0B 5HEKA 1Y42X 3IPCA 4LSZA 4WXHA 3DVAA 4W99A 3JD4A 4D9EA 4LF6B 3FYHA 3R6LA 1DKRA 2AI3A 1JHZA 1MH9A 3CH6A 3NHSA 3T0FA 4CBVA 3PS9A 3SF8A 4X00A 2JBHA 1DAKA 2HRDA 3WC4A 5EJIA 3VZBA 3O4JA 4M89A 1JKFA 4UHBA 3QE4A 4D8WA 1FFSA 3M0EA 2V3WA 4R71A 3R6TA 1IL0A 1A71A 4WLVA 1PJ2A