1A9SA

Bovine purine nucleoside phosphorylase complexed with inosine and sulfate
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
282
structure length
282
Chain Sequence
MQNGYTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDTESQGKANHEEVLEAGKQAAQKLEQFVSLLMASI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Pentosyltransferase
molecule keywords PURINE NUCLEOSIDE PHOSPHORYLASE
publication title Calf spleen purine nucleoside phosphorylase complexed with substrates and substrate analogues.
pubmed doi rcsb
total genus 84
structure length 282
sequence length 282
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 1998-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1a9sA00
1B8OA 1K3FA 4E1VA 3LGSA 1V4NA 1Y1SA 3OPVA 5CYGA 2AI2A 3FNQA 1PR1A 4YNBA 3BL6A 5B7NA 2QTGA 3TL6A 1SD2A 2I4TA 3BSFA 2A8YA 1Z5NA 3DPSA 1ODJA 4OJTA 2OC4A 4L5CA 1NC1A 1Y1QA 3EUFA 4I2VA 3UAZA 3FUCA 4OF4A 4DA7A 5JPCA 1OUMA 3OZCA 4DAEA 1OTXA 2ON6A 1Z37A 1V41E 1ZOSA 4QARA 5CYFA 1T8YA 4MARA 4L6IA 4JP5A 1SQ6A 4QAQA 5F73A 1Z36A 2QSUA 1RSZA 3MB8A 3EEIA 1V48A 1A9SA 4U2KA 3T94A 1RXYA 4D9HA 1Z35A 3OF3A 1PK9A 2OECA 1N3IA 1TGVA 4YO8A 3IEXA 4R2XA 1T8RA 5K1ZA 3KHSA 1JDSA 2HSWA 4EB8A 1VHWA 1Z5PA 4D8YA 1RCTE 3KVRA 1PR5A 2OXFA 1TGYA 1Z34A 3IOMA 1OTYA 1VMKA 1I80A 4PR3A 5B7QA 1LV8A 1Y1RA 1RR6A 1RT9A 1OVGA 1RFGE 4LDNA 1Q1GA 3GB9A 4OGKA 2QDKA 3KVYA 4GMHA 3INYA 3FWPA 3U40A 4TS3A 1SJ9A 3DF9A 4PNPA 2BSXA 4NSNA 1U1DA 4QASA 2ISCA 4DAOA 1Z38A 3EMVA 3UAXA 3C74A 1PWYE 4BMZA 3UT6A 5B7PA 1TD1A 5F7ZA 1V2HE 1PKEA 3FB1A 4EARA 4DA8A 1A9RA 1FXUA 2OC9A 4TTJA 4F3KA 5C80A 4M3NA 4WKOA 3FOWA 4QATA 2P4SA 4D98A 4KN5A 3K8OE 4JOSA 4DARA 3GGSA 1A9OA 1RXUA 1U1EA 4R2WA 2A0WA 4BMXA 1ULAA 1YRYE 5CCEA 4GLFA 1A9PA 3E9RA 1TCUA 4TXHA 4QEZA 4FFSA 1ODIA 5ETJA 3LA8A 4TTIA 1V45E 4R31A 4BN0A 2GUWA 1A9QA 4TTAA 1YQUA 4LNHA 3UAWA 2XRFA 4G41A 1JDZA 3OZEA 3ONVA 3O4VA 1Y6QA 4D8VA 1YR3A 4WKBA 2QPLA 4MCIA 4D8XA 5F7JA 5I3CA 2A0YA 3E0QA 4F1WA 4G89A 2AC7A 3UAYA 4M7WA 1PF7E 1JDVA 2A0XA 4X24A 4BMYA 3KU4A 4OY3A 3NM6B 5F77A 2HN9A 4ECEA 1JE1A 2QTTA 4LKRA 3SCZA 3LBAA 4TXLA 5B7GA 4RJ2A 1Y6RA 5F78A 3OZBA 1JPVA 4LNAA 3KUKA 1NC3A 5DK6A 4G8JA 1RXSA 4YMLA 1OU4A 4F2WA 1T0UA 1RYZA 4WKNA 3NM4A 1ODKA 4H1TA 1ECPA 1ZL2A 3NBQA 3ODGA 4DA0A 4L5AA 1PR6A 5F7OA 1JP7A 1JYSA 1VHJA 5IFKA 3QPBA 1Z39A 3F8WA 4L5YA 3DJFA 1C3XA 4DANA 1TCVA 1U1CA 2B94A 1V3QE 1YQQA 3ENZA 1U1FA 4UC0A 1K9SA 2IQ5A 1K27A 4DABA 2RJ3A 4TS9A 1PR0A 5F7XA 3MMSA 3OOHA 4OGLA 1ULBA 1Z33A 3P0FA 4QFBA 1PR4A 4DA6A 4M1EA 5IU6A 1U1GA 2PGAA 4IP0A 4TXNA 1PW7A 1A9TA 3BGSA 1ODLA 3PNSA 3PHCA 4TXJA 4TXMA 2I8AA 3PHBE 4WKPA 3O6VA 3E9ZA 1JDUA 1PBNA 4OEHA 2H8GA 3BJEA 1LVUA 2AI3A 4MCHA 4K6OA 4LZWA 3UAVA 4NY1A 3OOEA 1A69A 3D1VA 1VFNA 5EFOA 5EPUA 3OCCA 4P54A 4F2PA 5FAKA 1T8WA 4GLJA 1JDTA 1SD1A 5F76A 1JE0A 1M73E 3K8QA 5EUBA 5CCDA 4TYMA 1OV6A 1B8NA 1QE5A 5CXSA 2HWUA 4WKCA 1LX7A 1XE3A 5CXQA 3DP9A 1YBFA 1G2OA 1PK7A 1CB0A 1Z5OA 4GKAA 4L0MA 1WTAA 1PR2A 3EUEA 4YJKA 2AI1A 5KB3A 3PNPA 3OZDA 3DDOA 4JWTA 2HRDA 3NM5A 1RXCA 3P0EA 1T8SA 3FAZA 1CG6A 1Y1TA 4NS1A 3KVVA 2Q7OE 1NW4A 4F3CA
chains in the Genus database with same CATH superfamily
3UTDA 4LSZA 2CLKB 1DT3A 2RE8A 3FYTA 3WNZA 1SK9A 5WRFA 1GL7A 3ADKA 5JAQA 2QPOA 3F5MA 3OPVA 1L8QA 2HPHA 2WU1A 3A7EA 4MULA 3IP5A 4RH1A 3K2QA 4XWKA 3HY4A 4I9HA 4Z9FA 2O8DB 5CD1A 1BA2A 2VF5X 3EISA 4NYIR 2Y1XA 2YL2A 1DOZA 1CV2A 4OGGA 5CLQA 1HNZB 2K87A 4MNTA 4B6PA 4CMCA 2NMVA 1DWUA 5GJCA 4AY2A 3W2EA 1HTBA 2XIQA 3QIAA 3KR9A 4WZBB 1C1DA 4JCOA 2IYAA 1KQGA 5BYJA 3AF6A 3I92A 2Y2VA 1JXMA 3LXRA 2PFKA 5HOEA 1IIRA 4HAVA 3DMDA 4LN1A 4ALNA 3M9LA 1HPLA 1N6IA 4LG1A 5JWHA 1ZUNA 4EHAA 4YCMA 3MWJA 1UR5A 3OEED 3MPOA 5K4GA 1KKMA 1GEEA 1RI1A 4LJAA 5HTKA 3SHTA 2HR1A 2HLDA 3T5DA 3LUDA 4Q7MB 4L3VA 4XYGA 3A6ZA 4HZUB 1QOPB 3AJ9A 2OD2A 3NNSA 4IBOA 2VRWA 2FZLA 3G02A 1E1RA 4YRTA 3VR6H 2NVUB 4TT3A 2AK3A 4TZTA 5KYXB 1C2TA 1NI3A 2OORC 2PVSA 2XQJA 2YNMD 3HCCA 3M6LA 3Q7RA 3URMA 5J1TB 4D0NA 2WZDA 5BVGB 2IX3A 3CUKA 1KPHA 2ZXEA 3OZCA 3TQOA 1KAOA 3BJRA 3JYPA 1YS1X 2RGDA 3WYFA 4EHJA 4G84A 1NYRA 3DXZA 3HP1A 4C0AC 3KCNA 1FTNA 4FU0A 3D5QA 3RC1A 1SA0B 3F6YA 2JIQA 1IY9A 5DLPA 3M3DA 4F71A 1JAHA 3VX3A 2FUEA 2O3SA 4Y1FA 4ZO4A 3S4YA 1AG9A 4YJ3A 4RU1A 5KHLB 1RHUA 1S5PA 1SQ6A 3R9KA 2I7TA 4JXZA 2O8CB 4DCOA 4F2DA 4AWBA 2X7XA 3JYNA 4DBVO 1KHHA 1XTIA 5JY1A 1BKSB 1GSHA 1LY1A 1Q44A 1UXHA 3DMHA 1K6IA 2WM3A 1YNOA 2WBLC 3LQKA 3MB8A 2R11A 2B8WA 2XADA 3OX3A 1O6GA 1YDWA 4IKEA 3TS1A 1NHGA 2VXBA 4TKUA 5L6MB 2AX4A 1GTJ1 1YL6A 5KSOA 3ZEIA 3OUTA 4MV1A 1Q2UA 2B4TO 3GJ3A 3M0EA 5BSUA 1LI4A 1TKAA 2DCMA 2EFEB 1SCUB 2W6PA 2ATIA 4QFDA 3TTXA 1E6CA 3AF4A 4D3FA 2C5EA 1H6AA 2PDAA 5HQJA 2GERA 4JZYA 4PGFA 3UPTA 3AFOA 1DKPA 4KRXA 3IQDB 4O4HA 1FDRA 3GY0A 2BCGY 4X00A 4LDPA 4ZQFA 1S2OA 3D3WB 3PHHA 3UGKA 3FZYA 3BAZA 2AN9A 3Q7PA 4LRWA 5FNVA 4ZKDA 3WTCA 3DMPA 1HO3A 1Z62A 2XZDA 4CKBA 1GA1A 2BELA 3FLAA 4JUIA 3R7NA 1XD9A 1KMCA 1DB3A 5FLYA 5JMPA 2A59A 1JDSA 4ZJUA 4YMUA 5DF1A 4KOAA 1RWBA 2IS6A 1FBTA 2FWMX 1XN4A 2POCA 4JLBA 1M2JA 5EHIA 5J3JA 4Z4GA 3L06A 3THYB 3OJXA 4C5AA 4UEJA 1G8FA 1G55A 2ZU0C 3OY2A 3K71B 3V42A 3NR2A 3VJKA 2ZUVA 1CF9A 4FFMA 3WLKX 1YR2A 4JHXA 1Q19A 5KTNA 3LGXA 1Z26A 2ZT8A 4HY3A 3CLUD 3C98A 2ZRKA 2OCDA 4K81B 1SXJC 1Q6ZA 3IAS6 4B09A 2X8WA 3GEEA 3NRCA 4K8RB 3DHYA 1DJNA 4M1OA 4NBKA 2O7NA 2YV3A 1D8AA 5TMPA 3OD5A 3NBAA 2ZYSA 2FPMA 3BMOA 4ER0A 4WWHA 1UC8A 3FUVA 2QR3A 4O4LA 1J70A 3C3MA 4K9PA 1V16B 5LZ9A 1G5IA 4YLEA 4YT2A 1NN1A 3D8TA 3KD2A 2OXTA 1D4OA 4GECA 4RACA 1GITA 3T0IA 1I24A 3LM8A 4D9KA 1CZNA 5LNK1 4HTFB 3JQ6A 1AXEA 1KIMA 1C4XA 1IG3A 3AGPA 1QHIA 1IUPA 2I8CA 4QGFA 3T35A 4E5DA 1XJCA 5JYEA 1EK2A 5KS2A 1ISGA 3O73A 4AF8A 3Q7SA 2P5YA 1ORIA 3OM9A 1BA3A 1WJGA 3ZWAA 2YIJA 3HN2A 4MWTA 2H1CA 3DXFA 1XEAA 4QLOA 1MJGM 1T1JA 1R5OA 1GU7A 1ATIA 4MRSA 2CJFA 5CJ2A 1JL3A 3D6FA 3WZ2A 4D0GA 2W2MA 3V8NA 1J0BA 5E9AA 3Q72A 2ZS9A 3D02A 4NATA 4KYIB 1NQTA 1TF7A 4MQLA 3O1JC 4ZP1A 2RHHA 3VR3A 3LECA 1X8XA 4K3UA 3S1AB 1XCGB 1WVIA 2X86A 2XBLA 4ON9A 4CM5A 1QAOA 4Q3NA 3V3TA 4D25A 3QLVC 1D2AA 4HDNA 2DGDA 3GX1A 1W4ZA 4AYTA 2WM9B 2Q0SA 4J49A 3IPRA 5CK4A 7ABPA 4I8IA 1HQCA 2XUAA 1ZXXA 4K6CA 1Z8FA 2DAPA 2ZBRA 2J4FA 4QXMA 2PXXA 3OA2A 2V3CC 2RGGA 1IOWA 4FNAA 5KKCA 3F6BX 1CU1A 4PZLA 1PL8A 4A6XA 5IS2A 4NG5A 1H3FA 1KH1A 2CXTA 1W87A 5U1PA 1IZYA 4A8JC 3IHLA 4GDFA 2C20A 1KO5A 3LOUA 4BKQA 1Y7PA 4XGIA 4QOHA 2PBZA 4OQZA 3OKFA 4XQ9A 4YRFA 1UJMA 3Q8LA 4O4IA 3QJ5A 5A5FA 2A3NA 4OD0A 1W46A 4PAMA 4PSDA 3SJBA 3UQZA 1U1EA 1A2QA 2UV8A 4D56A 4HL6A 1P45A 1EAYA 3WKDA 2HW8A 4BIIA 1JQBA 1X13A 1EGMB 4YBRA 4JLVA 1G5TA 4B6QA 1N5RA 1ZK0A 3OJFA 4KRYA 1GYPA 3SHFA 4DJ5X 1V8OA 1I7QB 3CZQA 4NV1A 5CB4B 3NHJA 4O2LA 1GG5A 1SVIA 5AR1A 4F8EA 3GV0A 1V45E 3H5NA 1XALA 1NVVQ 2I66A 4E2ZA 4ZDJA 1LBHA 5A7HA 4Q39A 3PUJA 4FE4A 1ACLA 4WTOA 2IHZA 4RVDA 2R62A 1VPWA 3TRHA 2W8BB 1B6RA 4RYDA 3OTHA 3OUUA 1PI3A 5TPZD 2C54A 4M6WA 1K06A 3UXHA 1GTL1 4G41A 3V46A 1S8FA 2J6IA 4LVUA 4EVIA 1VXRA 5DULA 3JXEA 3TEJA 4RTPA 5LQNA 3ONVA 4BX8A 4RXUA 3DQPA 3EE6A 3RVMA 1FCJA 1TO6A 2XHEA 5EJAA 5LCXA 1CEQA 1NP3A 3KQKA 3CVOA 3EH1A 4D0LB 3CF0A 2ZPUA 1WULS 3OLQA 1DAPA 4MS3B 4PM4A 2HGZA 4ZWNA 5DM70 1ESNA 3W6PA 1BFKA 2PJZA 3WMRA 4WK0B 1P8JA 3SEFA 4CMBA 4J0CA 3ADDA 5JHGB 1PWHA 3CR7A 4I50A 5IF9A 4TYWA 1XNJA 4BRSA 2PZMA 4FBMA 4R0VA 3HWRA 4LZPA 4NZNA 4LFBB 3C2QA 4ALIA 2A0YA 3IULA 2IVFA 2QYOA 2OBLA 1UIMA 3IMGA 3THRA 5CXUA 5INTA 1KI2A 4KIGA 2XB4A 4WNAB 5HILA 3VHRA 3G8YA 3RBXA 4DR6B 1TVMA 3NKVA 4HEJA 4RDIA 2MSEB 3QX7A 3HM2A 3I39X 1H23A 3KDAA 2PTHA 4RNDB 3ZS9A 2NUPA 4UTVA 2VQEB 1LBQA 1R66A 2G80A 1RWWA 3NASA 4URXR 1GD1O 2OBNA 4MSUA 3CX8A 3ENNA 5L40A 1MA0A 4AM8A 2Q6LA 1UBCA 2YJTD 4POAA 4LSMA 1M2EA 3T15A 5L3QA 5DGDA 3MERA 4E21A 4ZANA 4JBIA 1A9XA 1U0NA 3B7GA 4BLRA 3LYHA 3FMOB 1FU4A 3IQGX 4MUAA 1X1SA 4ZZIA 1HK7A 4B3GA 1QH8B 1CZRA 4TXLA 1PGPA 3TLXA 1XF1A 2I4IA 3CBQA 4EG6A 5JNWA 5KPDA 4UDOA 1DKUA 1CQXA 1KS9A 2X42A 3L04A 4R1OA 4OLJA 2EV9A 4O1HA 4WN9B 5AI0A 5HMMA 4N65A 3CLSC 4BWGA 2Q3EA 3EOBI 1HI9A 3I6ZA 4R05A 4YV7A 2DFLA 4M99A 3E4DA 4D9BA 1MOSA 2QLJA 2WHXA 3EODA 5THXA 1XPJA 4DQLA 4G8JA 1PD0A 3LXXA 3X2SA 3HCOA 3KSZO 4GVXA 3E9EA 1ZH6A 1XDDA 2O2ZA 3LV8A 4IKPA 4K9OA 3SGLA 3FUXA 2XD9A 3HCBA 3NHYA 2ZSAA 4N41A 1Y5NA 4EF5A 1B8PA 3JQGB 3JZIA 1M8JA 5FQOA 3DE3X 5DNDA 3AEQA 4DM7A 1ZC4A 3KPWA 1ECPA 1V4VA 4IY1A 1XCMA 5JAIA 4CM1A 1SUSA 2FW6A 3P0RA 3ZTWA 5J4KA 5H0IA 1JTFA 2JZOA 2VP6A 1K75A 2UZ1A 3UJNA 5HRCA 3FDFA 2R6AA 2HOQA 3AU8A 1VYTA 4MAAA 1JN0A 3LJKA 4QVGA 4OA5A 5HE9A 2PX2A 2WWYA 4Q1BA 1PV1A 5IFKA 1KI6A 1CY7A 2C77A 3N0VA 1QANA 4FP9A 3N58A 4G5GA 4B3BA 1OGJA 2JLUA 5KYYB 1ZK4A 2D7DA 4H18A 4H4CA 3GD5A 1JMVA 1JDPA 3HA5A 1JEYB 1TJ3A 3AETB 1NNEA 3TM5A 2WMYA 2XZTA 1TZCA 4J1TA 3CW9A 3A0RB 3WZMA 2A4KA 3L7JA 4PSAA 2IQ5A 3LYAA 3CZMA 4KK3A 2W2QA 4XE5A 1A50B 4IX1A 1ZOIA 1QFZA 1S8NA 1YOVB 2PCLA 4KJXA 2HXSA 3T9AA 3LCRA 4JJ7A 5SY4A 5ERGB 3ZE9A 1U0LA 2RGNC 5GGXA 5JCXA 1JJBA 2QX7A 3RJZA 4GG1A 1X9IA 1QGUB 3L82B 4P80A 3WGGA 4M4SA 3QZUA 4BEWA 3S1SA 4GSKA 5CT8A 3RF7A 5HZKA 3ACCA 3G2LA 1Z3CA 2M6SA 1K4KA 1U5AA 2XCIA 3GMSA 1KU0A 4OKSA 4JI4B 2ONYA 3L49A 1F5NA 1R5BA 2Y1KA 4AYWA 1WCWA 1Y1LA 3A4TA 3DOHA 3DL4A 3GYGA 4C3ZA 1NJ2A 3Q8WA 5HKKA 1SO8A 4ND5A 2C4WA 4PQRA 4B4WA 3NTOA 4ZJPA 3CF6R 3B6ZA 3WB9A 3AFIA 1HX7A 3DMRA 4CG3A 1JU9A 1V96A 1UT8A 1MTZA 5ITSA 1L4UA 3VKFA 5KWVA 3BTSA 1GR1A 3NHRA 5A3VA 2VATA 2XYPA 1V3UA 2O7RA 2PZAA 4AP9A 5JDIC 5KNCA 5K01A 4GZ5A 4D96A 4GOJA 2I9KA 4JVLA 4LZWA 2FZWA 3JS5A 4H7PA 2QBYA 3MPUA 2PFGA 1PZHA 3PVZA 4Q4AB 2NM0A 1Y7TA 1WW3A 2I2AA 3L01A 5EPUA 3MM4A 4E1AA 5JANA 3FRJA 2Y9MB 3REQB 1E7RA 3ZWMA 4F12A 4RTMA 4TKLA 1JWAB 3WGYA 4J8PA 4DBLC 1VG9B 3U4IA 1KEZA 1U81A 2PPLA 4BLQA 5EXSA 2H4JA 3VH3A 2FYTA 3DOEA 1VL0A 4RTOA 2UZAA 4TUYB 3P26A 1GFIA 4TSKA 3KYBA 4PN7A 1OV6A 4OXQA 3QI7A 2WPNA 2MMCA 2HK6A 5C8DA 4NEHB 3SXPA 4ALKA 3H7IA 4RQUA 4PX3A 4BGUA 1CQIB 1TVEA 2Q6VA 1H94A 4G1CA 4TMYA 1G21E 5DNEA 1JR3D 4EI7A 2UUAB 3HM9A 1T4DA 1V7CA 3EZ7A 3QOFA 3QOYA 4FOOA 5AO9A 3BH6A 4P5DA 4HXFB 4PZUA 1G2OA 4FW8A 2O3QA 1AS3A 4IUBS 4KUEA 2H1FA 4F96A 1HETA 1ZEJA 3TAUA 4OB6A 4QOJA 5HBGA 3Q10A 5JSHA 2E4WA 3QNWA 3NYWA 3EYWA 4G0ZA 1I0ZA 4U5XA 1DIOB 1YB1A 5E7IA 3RI3A 4HWKA 3OZDA 1IATA 2R9VA 3TE7A 5G1PA 2PX0A 5J47A 3GG2A 2XD4A 2IEAA 3CH6A 3N9IA 1OXSC 2CXPA 2R8OA 2PQMA 1BE6A 3T3MB 5IDWA 4YVFA 3LIIA 3QKSA 4G8DA 1XQXA 4IHJF 4PTLA 3WV5A 1QOZA 3SWWA 4D3SA 2Y1OA 1DRWA 2FSUA 3EPRA 1PVOA 4EJFA 3E53A 3ADOA 4LUCA 4IFEA 1A7UA 1TB4A 4LOIA 3Q3HA 4PAWA 1ZESA 5LB2A 1CS0A 2WD9A 4RMGA 1TAHA 5JRZA 3JQDA 1YF3A 2VO1A 4ZYTA 4PYRA 5T4EA 1IM5A 3BEOA 3KKKA 2RH9B 3OC0A 1OCEA 3ISJA 2HJRA 3DLBA 5JS6A 2OQIA 3AOEA 4M8LA 4LECA 5F5NA 1VJ1A 2AFIE 1RZRA 3H2ZA 5DPMA 2AKYA 3COWA 3IQFA 1MC4A 1ZH8A 4TSFD 5LBUA 3G0OA 3NHPA 2JIZA 1SHUX 3EAQA 1Y5RA 3MTAA 4UJ5A 4AKSA 4BNXA 4G5XA 3ZE6A 4CUZA 4D45A 3JSAA 1JHVA 1IY8A 4NR0A 4EYOA 3JX9A 1T9CA 3LNTA 1FYEA 4IIVA 5HM6A 4IUYA 3KJEA 1S2GA 3MD0A 3TLZA 1XXHE 1O7JA 4Z86A 1X86B 2Q2QA 2VJBA 3C3AA 2C8KA 3V4RA 2B35A 2E1PA 3ASYA 3ECAA 1YC2A 2YHBA 3CM0A 1WXXA 2JD2A 2J9ZB 2KM1A 2OP1A 3IVCA 4KQHA 4GKJB 1QGZA 2IU6A 4G85A 4N3AA 3SX4A 4UZSA 5DM0A 2WUVA 2FP4B 3Q3VA 2GNAA 4IDHA 3V8BA 2GXAA 3QH4A 3MZ0A 4KR6A 2XDQA 1ZMXA 3AINA 4QUGA 2I4LA 5JD3A 3VR2D 5IX8A 1CD5A 2H4FA 3FM9A 3V8QA 5BSGA 3CPJB 3MFQA 3R5SA 3C6KA 2LDBA 3DEIA 2BISA 4RGBA 5LZ2A 1U8EA 1T43A 1SEPA 3SF8B 3QBTA 4GM1A 3OAAA 3UEOA 3I6QA 3T9FA 3U3KA 3JWIA 4F46A 3C5HA 1C7JA 1LQUA 3I3SR 3PWSA 2ORYA 2XMBA 1WUKS 3L6BA 4RAQA 2N1MA 4PBTA 4TMWA 3K5WA 2A0FA 2P77A 3FTEA 4GX0A 2ON6A 4KXVA 1QHHA 2GZMA 3AESA 2ZWPA 3KJHA 1Z82A 3MIIA 1E0DA 5CH8A 4KPFC 1GUBA 2RD2A 4HRYA 1FXWF 1KZ9A 3D3JA 2WB2A 2CNWD 4FHGA 1O9GA 1Q57A 4EEXA 3LBHA 2ZJOA 3G8BA 3Q87B 4S12A 4AJOA 1DNPA 1DU4A 5HK9A 1KBOA 4XVQA 3U3XA 2O9JA 1Z4LA 5EINA 1DQZA 1MPTA 2FPOA 1JH9A 1KU6A 1XRSB 3F4BA 5JCOA 2I80A 2X8LA 2LCIA 4DWOA 5B58C 2FRDC 3BMQA 4Y7CA 1U9IC 1N0UA 1YB5A 3H5LA 3ZJ5A 1VJTA 4HUTA 1EVKA 1ZC3A 1EVEA 1P61B 1UKAA 2LPMA 3O2JA 5KPJA 3RNOA 2B0JA 4N7JA 1JZQA 3CUEF 3HYCA 3WISA 5JIBA 4FE7A 4HLDA 2XCSB 2UXBB 1KO7A 4L75A 4O0LA 1KSHA 2LKDA 2WVHA 4R9UC 5E8JA 3ZNNA 3P96A 4DNXA 2HTFA 5A4KA 3HHPA 1IHXA 4BO1A 1HNXB 4RK0A 2BPOA 2ZIGA 3T94A 3NAZA 4JP2A 1U9JA 1CUGA 2EFHB 3SY8A 1H4VB 2H5JA 3LCVB 2IODA 1CR1A 5K3BA 5B3KA 1YJXA 5ALIA 2CXQA 5KEIA 1BCRA 3ANXA 1SUCA 4UXJA 1O96B 1S96A 5J43A 4NMHA 3TTTA 2YKGA 1EUYA 4AN4A 1CUFA 5DI3A 1HKUA 3B3AA 4D8WA 1HWYA 2CLLB 5ER6A 5TMDA 1J0DA 5ALTA 3T7IA 2QJWA 3H0EA 5IKEA 3GDHA 5T3UA 4OFBA 4YAKA 1I2DA 2I6QA 1U3WA 3A3YA 3DOJA 1G98A 2IZ1A 4B2IA 1FU8A 1DCFA 1DIBA 2GRAA 2PR2A 1Z56C 4KFUA 5KWSA 4Z4FA 4QXAA 3OEYA 4YAWA 2WFLA 2ZBPA 3IEUA 4WD3A 3W4JA 5FV4A 1S1CA 4QVKA 1RD4A 4D4JA 4N5HX 3M4XA 4U7GA 5BN5A 5J40A 4IINA 1XTRA 3QMWA 5H1YA 1SXJE 4BKUA 4DPMA 3GP8A 1GLVA 4U1RA 1DRKA 4JBLA 3CLTC 1D5CA 1RAEA 4OJMX 8ABPA 2QRHA 1T9AA 3BXHA 4XUCA 1RFLA 4EVRA 1OVGA 1FLVA 4IQFA 1FJXA 2J46A 3KWFA 4MR8B 1RQXA 1Q1GA 1Y4UA 4YJHA 4EKGA 3RGGA 3LZCA 4INOA 1WEKA 3KJQA 5SY6A 4P7FA 3RVNA 3VPSA 3KSDO 4DJFC 4GMHA 4EF4A 1CW2B 3H6GA 1A4RA 2V7UA 3GOQA 4NBLA 3R3VA 4WNYA 1LDNA 2FX5A 3KELA 4EG7A 1E1CA 3BYZA 1MH1A 3U1TA 4CNBA 5GINE 1PGJA 2BL4A 3IUNA 5E6RB 1NTRA 4U7FA 4YFYA 2FUCA 3TLYA 1R27A 3B6KA 1E2LA 4UUAA 3BB1A 1GTVA 2IY8A 2R4QA 4GP7A 2K2WA 1KVRA 4YRNA 3B1YA 4QDOA 5L7TA 5TIIA 4RPJA 2ZUTA 2C78A 2RHGB 1L7PA 1J39A 1YJAA 1L7XA 4OTZA 4NCJA 3WJ2A 5HTOA 1AGNA 2PMFA 1BMQA 2F3TA 4UD6A 5COAA 5TT1A 2VK4A 3HMQA 5FCDA 5A71A 1OC4A 3K7EA 1Z38A 2X1VA 3JQ8A 3WK8A 3HLYA 5I3ZA 1OU0A 3SMQA 2YXPX 4KQ2A 3AY0A 2GB4A 2HI0A 2QGZA 4KQWA 3ZCRA 2EWWA 1J7KA 2LR0A 2W2PA 2AF4C 5TPWB 3ZS8A 1WHSB 3AYZB 1VL5A 3HJUA 1JG2A 5BWBA 3P9ZA 1REQA 1KBQA 4PS1A 1WB4A 4Q9DA 1U65A 3U6KA 3O8OB 4WXEA 1GGFA 3ZDCA 1Q7GA 2OHFA 3CKLA 1GNSA 5DIFA 1GAEO 1LKZA 1CY4A 1K8XB 1ZD2P 2HEGA 3LPMA 3OLCX 4FYKA 2YJ5A 3SBEA 5C5IA 1U2GC 3N2GB 2H5EA 3VOSA 4Z1MA 5TT0A 4BO7A 3P2YA 1ESMA 3LC0A 1MU0A 4DPKA 3NVMB 3P97A 3DOIA 3O0DA 4A7PA 3H2YA 1LI7A 1MABB 3JPWA 5ALDA 1L1RA 3D0OA 4E6EA 2J7PD 2VUHB 2H4WA 3NTLA 2YJ4A 4W5QA 5IBRA 4BNHA 3UUFA 5TE9A 3QFFA 1RKVA 3FCEA 5E95A 1HTWA 4IZOA 4RZXA 1CUVA 1U80A 1B76A 5K4HA 1A97A 1P44A 2QORA 3GCZA 4YR7A 1CQZA 1RXUA 5CDFA 1MR3F 4IH4A 5AKJA 4JR0A 5EZ6B 4WEQA 4OHRA 4BMOB 5HF8A 3N1UA 1OAOA 2E4UA 4JQZA 3UPUA 2JCXA 3BQ9A 3PJDA 3UJ9A 4BWYA 2BFDB 2CVZA 3O3NB 4K87A 3AHEA 2PUHA 3BD9A 1LW7A 1JBEA 3IAFA 3O2NA 2XJ4A 2GJ8A 2E4VA 2J5BA 3ETLA 3IT2A 3OTIA 4JLOA 1YK1A 2PXHA 1WCXA 3HJBA 3VAZA 1CB7A 2Q9AA 2PUEA 2FSVC 5CM8B 5JISA 3HJRA 5D3MA 3ENWA 5CMLA 4NRDA 2WIBA 5T41A 1LBTA 3I0NA 4YHBA 1GPWB 4FGUA 3OTGA 3KZOA 4U39A 3NT2A 3V7NA 5MGNA 1MBZA 3PLAE 2MSWA 3QJGA 1KY4A 3B3FA 3NBUA 3VI4B 3RT7A 1KNXA 1T3LA 1HV8A 1YIAA 2ADMA 1APBA 2NXWA 4RK1A 4YMTA 1MG0A 4F9TA 1WDWB 1SIOA 5T7BA 1FY2A 1MAWA 1EJ2A 2XTAA 1XKLA 3A05A 5CVVA 5KYWB 4O4HB 3CRZA 4MS1B 3WA7A 2IXGA 3A4IA 3GJZA 4JX8A 2TMKA 5FNVB 3BIOA 4NX2A 1AMNA 1KK3A 2C4VA 2RARA 2ZE5A 5FFFA 2FRVA 1UC5B 5GVRA 5AW6A 4NBVA 2O48X 2P7IA 3U4DA 4YDRA 1IN1A 1V2GA 4EUHA 2GF9A 4G0VA 4Y1RA 4KAXA 4N9QA 1NBIA 4GYKA 1C9NA 1XEWY 3CA8A 4LISA 4RCVA 2JAQA 5ELMA 3IIIA 4JVMA 3R3ZA 4QJBA 3GLVA 4UASA 5M3BA 3TOXA 4NWIA 1L3IA 3AI1A 4HN9A 1ZMRA 2W6NA 4I3FA 4RMJA 4HV4A 3B2EA 3AHIA 4MRRA 4BGIA 4HJRA 3HB1A 5E0KB 4TVBA 2EJBA 4CHTA 1E94E 4INAA 4DWWA 3LFHA 1XNQB 4ALLA 1SCJA 1WUYA 2VCEA 4TL8A 1ZDMA 3VZRA 1DT5A 5A9RA 4O4LB 4BNWA 1E1KA 5K05A 3G9XA 2VCHA 1KNQA 1ZXBA 3C7CB 4XFDA 1YFLA 5ILGA 3CX3A 3F74A 4WFJA 1E2BA 2YJ3A 2XMGA 1N8NA 4Q4JB 4LXYA 3ET5A 3BMCB 4DMUB 1WPRA 3KEMA 3RHFA 3HH8A 1N92A 1IXSB 2A5LA 2DFPA 3MW8A 4HPXB 4TM8A 4BVJA 2OKGA 1IXRC 5CEEA 1F2TA 4FS3A 4YC7A 3TGWA 4CW7A 3K72B 5CPBA 3LP8A 4Z54A 2Q6KA 5ALLA 2YFQA 4CQMB 4XRGA 5AVXA 3EVBA 3JQRA 2X8AA 1UKBA 2JFUA 4PGAA 3O0TA 2C5LA 5E6UA 5GOTA 2PGLA 3DZGA 3LQRA 3ILHA 5JAPA 2OWEA 3X43A 1U0EA 5FF9A 2IY9A 3NJRA 3NM4A 4V0RA 1R1DA 2A2ZA 5LB4A 2GI4A 4YMVA 2C7GA 4JOQA 4WA7A 4DSUA 6REQA 5LNK6 5EJIA 5GZ6A 4JKYA 4P7BA 3I32A 5FR1A 1XVAA 5EA2A 2R84A 3E5RA 3MINA 1GQFA 4IDQA 3NNDA 1DZ3A 3C5CA 3WLIA 4YPVA 3OCUA 4F72A 2BKAA 4RGQA 3AV3A 2I9PA 3F3KA 1VA5A 4FILA 3P9IA 4UU0A 2C9BA 4AMVA 4ZVUA 1E18A 2EWVA 5HCUA 3W79A 2FB9A 1DKOA 3HI6A 4FWBA 4EY8A 4WUVA 5K0SA 1E2IA 2HLDD 1K0FA 3MJFA 1UDAA 4LXUA 4O4HF 3ZX4A 2FQ1A 1JWBB 5A4IS 5CT4A 4BFTA 1MIOB 1PYGA 2AL7A 1E1RD 2XKKA 2CKMA 1M6YA 5FNVF 2WWRA 4TT3D 3P2JA 4HUJA 4OB7A 3TW8B 2HA6A 4AICA 4FYWA 3H4TA 1L1EA 2OXIA 4YRLA 1D7OA 2X0NA 4KIFA 5DX8A 4YT8A 1OX6A 4FJ1A 5H4HA 1N5KA 2VI5A 1PUIA 3NTUA 3PUYA 1JIQA 1K27A 3EF1A 3PWZA 4KDCA 3PV0A 4O4IB 1ZIXA 3MMSA 1R18A 3GGCA 5ARBA 2PSJA 1CT9A 2XF2A 2ZTHA 3Q5EA 4KO8A 2H54A 3NRJA 4O1MA 4B83A 5IDXA 1NVDA 2F67A 2HU8A 2XGOA 1HA3A 2R5FA 3LS2A 2YCLA 1U3CA 4JT8A 1X1TA 2AOVA 5E3HA 1YE3A 5IU6A 1HT2E 5FEMA 2PSSA 4ES6A 2G3YA 3IAEA 3ILSA 4Z53A 5K2MA 3PNSA 4TXJA 5GADl 1JQ3A 2ZIEA 4WFIA 4XGNA 3AHHA 3KYCA 1FX1A 3BFJA 1EAMA 2PGXA 4O4LF 3UBTA 2PUFA 5FA5A 2NSLA 5B4TA 2OBXA 2QAGC 5LC1A 4K03A 4C06A 3SSAA 2C9DA 3KQLA 3GROA 4KLRA 4KXUA 1V5IA 4Z0NA 3BIJA 3DTVA 3IT1A 4H17A 1JLRA 4NTZA 4OXNA 4X7RA 3T5PA 4BMCA 1ZOOA 1F4PA 2QA5A 5C0OE 2AI3A 3GLSA 3WSWA 5K0FA 4J16A 2ZM6B 4MCHA 4MP3A 1C0EA 3ZU4A 5A3JA 1R0XA 5CU7A 4X5OA 1GZDA 2BN4A 3FTNA 3RFUA 2CNDA 2RBKA 3F5DA 1F5SA 4C4OA 5FI5A 4ZC1A 4EFLA 2P68A 2XMPA 1OJ7A 1EFCA 1R0WA 2N75A 2V4MA 1Y8AA 2ZWMA 3ML1A 4C20A 4P54A 4DBLE 3TZQA 3DWEX 3GLQA 5FAKA 1C4WA 3CJTA 4PFKA 5GVSA 2NUTA 1LF5A 1O57A 1NXTA 3R6LA 5BUCA 1FYVA 3OU6A 2PJDA 2YMPA 5CVTA 1C7QA 1SAYA 3R20A 1DRVA 2JGFA 3DVQX 3M81A 2PIAA 1ZD4A 1U7PA 3QUBA 2W83A 3V9PA 3ZDQA 2V7GA 2VDPB 2ZM5A 1KJ9A 4EVSA 1GFWA 5EJEA 1ADCA 3SD7A 2QD2A 2XE4A 5IZCA 1D9XA 1IDOA 1E5VA 3IDFA 1E3JA 4G4IA 4ND2A 4INJA 2JBAA 4OCZA 2QZZA 4Y1GA 5GIOE 3M82A 3UB2A 3PXBA 4AP5A 3O9ZA 1FSFA 3A3NA 2F90A 4GAEA 5LLTA 4I4IA 5JXGA 3GLGE 3OHMA 5KMGA 5LLSA 5KOHB 2OTCA 5A7GA 4JUBA 1ONSA 4GKAA 4N5IX 2YV2A 3QELA 1KAHA 4JJZA 1CIVA 1HORA 1ST2A 3BCUA 1CYDA 3K32A 5L3QB 1GQOA 4G4JA 1X1DA 2BGLA 1J1IA 1R6VA 4RXMA 1W4CA 4YJKA 621PA 4ZVSA 3PNPA 5EHXA 1HUQA 1WRBA 3RIXA 3U37A 2YQ4A 5J5VA 3FYUC 3HU5A 3D0RA 1CX9B 1MO5A 4Q1CA 1TQDA 3SR4A 2GHRA 3DSRA 2VFAA 4O4IF 2P78A 2E5LB 3BD8A 3RUAA 5KYGA 1RXCA 2GJKA 1P31A 3D1LA 1ZKMA 1ORTA 4D8UA 4EI8A 3W5CA 3B7PA 3BIFA 3UHPA 1CG6A 3UGQA 1OBHA 2DSNA 4AUMA 5BT8A 4TS1A 2H3HA 1OBCA 1Y9DA 3E9NA 3V7UA 4ZHQA 2R6JA 1HLDA 1NQAO 2IOFK 3EYAA 2W2KA 4FXOA 5H81A 4OPMA 2NU7B 1YU9A 3NWEA 4RH0A 3VR3D 4X3PA 1DQYA 1U2SA 4TQ9A 4BJ1A 1Q1BA 2B25A 2CMDA 3FTPA 5LQKA 1P33A 1FJHA 1ZMOA 3PFIA 1RLOA 4F3CA 5CDYA 1BU5A 1TMYA 4MR9B 4P7GA 4ZZ1A 1IPHA 1IBSA 2IPOA 4U9UA 1Z0DA 1PS0A 3IUYA 3A6FA 3EBPA 1BJTA 3IRVA 3MJEA 4G36A 5A4DA 2CF6A 3LY8A 3FVQA 5F21A 3ZHTA 4BQIA 1KDVA 3KETA 5AW0A 3GZNB 4ZCRA 4ZI7A 1V5EA 4UBIA 3FSGA 1HDGO 5K3SA 5AQ1A 1OI4A 2Q3DA 3HP7A 3F8TA 4BU0A 3CONA 5EIBC 5G4LA 1ST3A 4Z49A 1PJ3A 5B4VA 2CFTA 5E9QA 3WRXA 5F3DA 3GT4A 1EEHA 4B17A 3Q3GE 5HUQA 3KALA 3OCXA 1XZAA 4TT8A 1EKXA 2QVCA 3U7FB 1VSTA 2H0QA 2P4UA 4N0PA 4PHTA 1UDRA 4MQEA 1L8OA 4QTUB 5B5SA 3V2HA 5IF3A 1OI3A 4MVJE 1RMQA 2EX1A 4QO8A 4NCNA 2ET6A 1E9BA 3K0BA 3K70B 3DPSA 4MITA 3Q9SA 5FUXA 3W1EA 1AKRA 4B33A 4ZO8A 2ZW9A 2QLBA 5CAEB 1BGXT 1ZJWA 1J5EB 1DP4A 3F49S 4X41A 3FYSA 5ICFA 2ODBA 5TQVA 1RQGA 3RODA 3WX0A 3ZBPA 3D4NA 3BE6A 3LDFA 3L46A 2G1PA 2DR3A 2H31A 1M34E 3TLJA 1QYDA 4PXYA 5BY2A 3N2KA 3FPSA 3QSGA 1JIJA 5KYVA 4QTZA 2ID7A 4WE3A 3HK2A 4GC9A 3L7IA 2OFXA 5FL7A 3T34A 3GPLA 2NXJA 5B53A 1XA4A 1AHHA 3CZ9A 4BPBA 3RE1A 4RD3A 1X8KA 1YS6A 2ZIUB 4EENA 3G2PA 4R16A 4EY6A 4OO3A 2HMYB 2GEKA 1QU3A 1C5KA 1G7CA 5EE3A 4ZOQI 5CNJA 4BAUA 3I62A 2R8YA 2XI4A 1Q0RA 4BUJA 3ZVMA 4FYXA 1DJOA 2P2DA 3WDKA 1T1RA 3GJ4A 5LR6A 3H65A 2V8BA 2IA5A 3N5CA 3ZU2A 1E58A 4NENB 4S2UA 4M36A 2C5HA 4MUYA 1XEXB 5DLYA 1VLZA 5LKAA 3DCYA 1L7VC 1KOLA 4FZRA 4EA9A 2XMRA 3C39A 1X7YB 3AL3A 3DL0A 3RTDA 2EFYA 2JC3A 1KKUA 2E18A 5DMHA 4X45A 5F2EA 5FO1A 4YAGA 1Y6FA 2QBYB 1TJ5A 4JGIA 5K5EA 4QX6A 2R1TB 1C81A 3MILA 3SC2B 1DELA 1NWHA 1TQ4A 5A2QA 2N47A 4YRAA 1CJKC 4KAAA 1NASA 3HXQA 2A7QA 3TQSA 3MWLA 4D9HA 4RD2A 2XMSA 4OFZA 4K8OA 1MA3A 4UUQA 1TYEB 3V1TC 3V4SA 5DHQA 1QVRA 5FHQA 2OVBA 2ZXFA 4NHEA 3GUCA 5A3QA 1FNSA 3KTAA 5K8VA 2IV7A 1HFJA 1NR1A 1V9SA 2ASVA 3D7NA 1W85A 3X3HA 4ZYUA 3V8MA 4C29A 3L0YA 2FPSA 1LNQA 2H4HA 3HDJA 4OAOA 5ADHA 2PKYX 4ZEOA 4QEDA 4P53A 3A1TA 3SK0A 5BUQA 2YVAA 3WO1A 2FVXA 1Z5GA 1QX4A 4R83A 4EB8A 1HFWA 2UVQA 1ULUA 1DIHA 3MYYA 4YH1A 1Z88A 4WCFB 4JKOA 3WGOA 3F97A 5AHWA 1JXQA 3RVLA 2WSLA 1VG0B 2ZUSA 1NDQA 3IKVA 4LZLA 1I80A 5CFQA 1GL9B 4XW2A 1ADYA 3F3YA 1LV8A 1RQRA 5F98A 4YCBA 4EFKA 3OPYI 1YZFA 4P3YA 3KKZA 1MX1A 1P81A 4OLFA 4P3OA 3NHBA 4POOA 4BNZA 4P92A 4DVGA 3TPZA 1ZGJA 1KF0A 3AVPA 3DZDA 3MTJA 3E5HA 1S2MA 1RT9A 2QW8A 3GHYA 5K8UA 4KR7A 2WU0A 1AURA 4GBMA 4YRCA 5H02A 5CVCA 3EG9A 4CEHB 5EAIA 1L5ZA 3DLPX 5I48A 3NG1A 1KEVA 2GJ4A 4BWFB 2X3UA 4RKQA 3W6NA 1ZCZA 4RQTA 3NIBA 5HKKD 3QSYA 3A1SA 4XDHA 2JFVA 3I2YX 2G5PA 4PX5A 1M7BA 2NNWB 4A3SA 1TVCA 4DA9A 1CS0B 2QZ9A 1PT8A 3M3PA 1T9GR 3NPAA 3OPNA 5FFNA 2QD3A 3OZWA 3OWXA 4PLVA 3WJ1A 4YUWA 2Z56A 2ZTMA 4I1IA 1Z08A 2QTLA 1PHRA 2JLRA 2IC5A 4Y6RA 2HNBA 3GN1A 1UAGA 2E55A 3GAFA 4W8HA 1VPVA 1XLWA 3LPAA 3G2QA 4RL6A 1G21A 4UOQA 4EPWA 1OIVA 3ZHCA 1CJCA 3I1YA 5KNCH 1WLYA 3M49A 4G0YA 2GYWA 1B0PA 3B6JA 4Y3UA 3S6JA 5K0GA 3GLKA 1CIPA 4QBHA 4ZV4A 1FLNA 1Q17A 2DZDA 2G25A 1Y6GA 3LC1O 5EKXA 1CY6A 4MUBA 1KP9A 1P9OA 1WAMA 3C45A 5EHGA 4BUCA 3EHEA 1JKJA 2GZAA 1O97C 2I4MA 4H15A 4I9UA 2YYSA 4JKIA 3ENVA 1QO0A 1S4QA 2J9FB 4FD2A 5DHFA 4PPQA 5J5AA 1F8XA 3OZVA 1BXKA 3BXEA 3LX4A 4HEHA 2FMHA 4XDYA 5BW6B 3RVJA 3CVXA 2QT1A 1JIVA 2ID8A 3CRQA 4HATA 1ZGHA 1DC6A 2VJOA 5ALRA 3RVKA 1OV4A 3II6X 3LUCA 1EFPA 3OPYA 3NIFB 3UV6A 3ZTYA 3C8MA 3K09C 3KD3A 4F3KA 3GXBA 2DCUA 1XVVA 3KUDA 5I9MA 2AX3A 3ZE2B 4REMA 3GFPA 3ZZ1A 4TLLB 4BLWA 5IG2A 2MSLA 5D1HA 13PKA 2FEPA 2TMYA 3DUFB 4LCBA 3PFHA 2B98A 5DHAA 1I10A 4Q9NA 3KZKA 2AQIA 3VYWA 2B1JA 1AGRA 1M66A 2WR8A 1Q77A 2VP5A 2ZYVX 3Q9UA 3J80A 2IT1A 1T8TA 1A27A 2BEUB 2PH5A 4QDTA 4RQBA 4ZDIA 1A9OA 5KVSA 4LVCA 4GPZA 2ZK7A 1H22A 1GKKA 2BUAA 1STOA 3ZK9A 2AFIA 2RAVA 4BMXA 2PS3A 1GPKA 1VJGA 4IOLA 3HWSA 2D3WA 5A2GA 1L5LA 2AZTA 5DGIA 4PFJA 4ZI3A 1HFKA 4B32A 4LKOA 3L7NA 1M7HA 1CWUA 3U5ZB 1P75A 2BY4A 2ZWOA 1BX1A 5KNCD 1C9DB 1J42A 1IXYA 4XLLA 3FROA 4DTCA 1NMSA 2J30A 2NXEA 2UYHA 4M1YA 4NDNE 1XXHA 3QVSA 5ISMA 2QN7A 3HDGA 2C5FA 5E0OA 1QGDA 2J0VA 3HRIA 1DARA 1P17A 2X8JA 4PLPA 1W36D 2WPDA 4R54A 4IGAA 5D8DA 2XUJA 1TO2E 2ZANA 1D4ZA 3IDZA 4HYTA 4KU4A 1WZCA 5GV7A 1WCIA 5CLHA 5THKA 3O9MA 2GBCA 3B9BA 1NXQA 2SCUA 3P9YA 3T3OA 2GO7A 4CM8A 1AK9A 1AC5A 1KKLA 4OL0A 1XGKA 4P4SA 4DA4A 1GL6A 4Q18A 1CNMA 4IL5A 2QSZA 2OV2A 3O47A 1CYEA 2OORA 4MUJA 5E2AA 3Q1LA 1Y8ZA 1NLYA 3OA0A 2Q2WA 2QLLA 1S8OA 1VPDA 5IULC 2C82A 3UN1A 4MOWA 3VQTA 3BJMA 4JGGA 1EWVA 1SNYA 1DEKA 2QTHA 2X6TA 4ITRC 2H7CA 1J33A 4M55A 4KQXA 4NLLA 5FI3A 4WOPA 3ZWBA 1M6VA 3AVWA 3RBAA 3GBPA 3W3AA 3JR3A 5DWQA 4EIWA 4N5MA 4ZMSA 2FI1A 2H7YA 1LRKA 1JIKA 1LNSA 2VP9A 2VQSA 3OPXA 1IJFA 2C7VA 2ZVQX 4MP8A 4R0NA 2GKSA 3KXPA 4OATA 4KOEC 4JL5A 1FMJA 3I04A 1F51E 2AMLA 2VZ9A 4FSDA 4AUNA 3A9VA 5EKDA 4BP9A 2VUIB 3K6SA 3SJUA 2CNKA 1DKNA 1RW4A 3ENQA 4B2LA 3AFNA 4BMYA 4R9NA 3WL6A 1W5TA 3I9OA 3VNUA 5EWJA 1NULA 3VSEA 3C14C 2NZXA 3CO0S 1G5HA 3V4OA 3MJRA 1ISMA 1NFQA 3PQ7A 4F4UA 5JCZA 5FJIA 3JYQA 4GQAA 4WXYB 4J7UA 1E4EB 5BN4B 1RP1A 3ZTTA 4A82A 5K0TA 1CHNA 1I4WA 1P0QA 2W6CX 3CYFA 4WESA 2CLFB 4LDAA 1G8GA 2GESA 4LGMA 3WNVA 1FQWA 1A04A 3GJRA 3DB1A 4IEFB 4NH4A 3QKIA 3F8SA 2P75A 4TWJA 1NVKA 5GP1A 2H9IA 1L7AA 4BJ5A 5AM2A 4TRJA 3A1EA 3QITA 1FFXA 2C00A 3GCWA 3GYBA 3RHSA 1QGAA 1XTTA 4B5LA 3P0IA 3STYA 3MRVA 4BECA 1JG6A 3H42B 3I61A 1TU0A 2JIZD 3DCNA 3D31A 5FWAA 4ENWA 5I7HA 1E1DA 3SLKA 1GDTA 1S02A 4O2BB 2REXB 2NPIA 2ZUCA 5DYIA 4L8FA 4TMZA 4BNDB 4HNGA 3FNHA 3AJ8A 3RQSA 1SC3A 4A8TA 5A02A 1EWTA 4ID9A 1P7VA 1AN0A 4QRDA 4R68A 4UBMA 4F2GA 3LY7A 2EU8A 2ATCA 1II0A 5ALZA 3PX7A 4L5AA 1SXJA 1GZHB 3A6HA 1WD5A 5B58T 4NJMA 4D9IA 3GC6A 4IFBA 3L79A 5AK4A 1ENZA 4EYKA 1TO1E 1WR8A 1LB1B 3U26A 1EK1A 3DTYA 1JB9A 1NVAA 1NL3A 5EOVA 5A5VA 1J8QA 2ATEA 2RHDA 2VP4A 3CQ9A 1W2GA 2XKAA 3ZX5A 3PQ5A 1UMCB 1VZ2A 2OHJA 1W96A 4UNNA 3BG5A 2FPGA 1Z25A 3OAAD 3UWKA 4E6PA 3TNJA 1JLKA 2Q4BA 3FZNA 1TCVA 1PEYA 3FKSA 3NHAA 4CIDA 4F8JA 5CD9A 2D8AA 2JA1A 1S3IA 4TRMA 4D99A 3LUPA 3U3JA 1D1PA 2QSYA 4XOIA 5H83A 1EP9A 2B20A 1EGQA 3B9QA 3I37X 5TEVA 2NU8A 2VPZA 2DYKA 1FX0B 3B5EA 3C8HA 3KZNA 3FDZB 4JROA 3E3LA 2ANCA 4CKCB 2NQ2C 2JLAA 3RYHB 1J21A 3WAJA 4C01A 4EUEA 2C7RA 4I55B 1JG7A 4ER7A 3H5OA 1QONA 2DH5A 3THSA 1QE3A 3PF8A 4DQVA 1QYCA 4Q47A 4QFBA 2OMKA 2C29D 1O8CA 4LC0A 4M1EA 3OT5A 4MW5A 1E2FA 2PGAA 2KI5A 4ZOLA 1C9JA 4KBFA 1QE0A 1A9TA 5TS3A 1AHPA 3TI7A 2H4XA 3SKXA 3PHCA 1RQ2A 3DMFA 4D02A 5JWOA 1SGWA 5J2UA 4JVNA 3ADCA 1X9GA 2RHOA 5HGJA 3O6VA 3QLVA 2R47A 3HYSA 4HAWA 1Q1NA 1JDUA 2FN9A 1W29A 2G9QA 1F8GA 4AMGA 3IV9A 3TTVA 4KWTA 1UZNA 1YCDA 5IK2A 2QL5A 4E03A 2IOFA 3B3JA 1S89A 3HYRA 1KZ6A 3F7OA 2AE2A 2BYTA 3DWFA 1J2JA 4K40A 4ZU1X 5HDBB 3UJCA 2FR8A 2PV0A 1JEQA 2UZIR 2AKAB 2KS6A 4H27A 4JXKA 3HXLA 1T25A 1O0BA 3ONFA 2GLTA 1A69A 3CW2A 2RBGA 3M6WA 4MB0A 4A8JA 2DLNA 1HYGA 1OA1A 1GJRA 2VBFA 4RLHA 4JOCA 1LV7A 7REQA 4F2PA 1P1IA 1SURA 2HRCA 2Q3JA 2PO5A 4PW0A 2I87A 2WV7A 3OZAA 3QXGA 4MQFA 3TKAA 3V1LA 1F9AA 3BK7A 1MD9A 3GCDA 4MROA 3RV4A 4BKPA 1KOFA 1FVHA 3CLUC 4LWPA 4M83A 4P33A 5CJJA 1X1QA 1HLFA 4YROA 1KK2A 1IZZA 1O5OA 1QTNA 2NAPA 4FFRA 2CLCX 3HEMA 4B81A 1CDDA 1KR5A 1VBKA 1JTEA 2P91A 3K1AA 4TQGA 2E21A 3T3DA 1SBYA 2HWUA 5TMEA 5JLJA 4U6SA 4HZGA 4F4IA 3OBIA 1SBIA 5JSFA 1AV7A 4TTVA 4UCWA 3RSFA 1AK1A 1RQPA 2QWXA 1S9HA 2G06A 5DTJA 2ZIAA 2Z95A 2WHPA 2G36A 2WW8A 3T4XA 3VAYA 3WWPA 4AG5A 3HU2A 3EB9A 4B73A 5BWOA 4KUGA 3CZAA 2QTAA 1L5VA 1UK6A 2V9ZA 1WUTA 3NX4A 3RVSA 4IQ0A 4CLOA 1GVNB 4P86A 4E70A 4B74A 2EGGA 3BRWA 3RYIA 5EEHA 4JR2A 1AZLA 3N3BC 4N3BA 3UK6A 6YASA 3PC3A 1D4AA 1MAVA 2WJ3A 2YHUA 4JWTA 1H0HA 3LP6A 3TXYA 1QYXA 1GKYA 3RYCA 3K2EA 3OJ0A 2C2ZA 3QVWA 2GRUA 3CUVA 4BZXA 5A0TA 1DTSA 5A6SB 1EIZA 2VAXA 2QM3A 2CB0A 4Q3EA 3S0JA 4H60A 4K26A 4I55F 2OFFA 2DBZA 4AF6A 4ZYVA 5HJ2A 2PA3A 4KTVE 5C8YA 1WUIS 4M0EA 2G8NA 3WLQA 4BQOA 2O2IA 5K0CA 1OH7A 3EFHA 2PL3A 3JQ7A 1UZLA 2FOXA 1NUQA 1ZD5A 2WVJA 4BO6A 3VGPA 1E9DA 3EUAA 1FP2A 4WBNA 4AMBA 2G9VA 5JS1A 2GN4A 3CIOA 2O0MA 2RHCA 2Q5IA 3GCXA 1SXQA 2P5SA 3QWBA 4JDUA 3PXEA 2WT9A 2GPSA 3VHXB 1QCDA 3R6GA 4HWPA 5IMBA 3RYFA 1Y8RB 1DDIA 1GPMA 3HLTA 3BFVA 3I2HA 5HVNA 5CVDA 1DIRA 3A6KA 2L2QA 3L8GA 3N2ZB 1PHPA 1X39A 5EKSA 5LPNA 1ADBA 1ZNZA 2GCOA 2QN9A 3ASUA 4H4EA 2J0SA 3LGSA 4CR6A 3MINB 3LUJA 3UMMA 3FZGA 4F4JA 2I7DA 3ROFA 4CNQA 2EEPA 3RVRA 1CPYA 1T35A 2GBGA 4LA4A 2CYBA 1FDOA 4PNHA 5HOQA 2Q4OA 3D9QX 3IP8A 2VSQA 1JSRA 3TH5A 2WYIA 4Z1MD 2W2TA 3R3JA 4Q3OA 5K6RA 1TKCA 3QTLA 1FTYA 2HWYA 2HSDA 1XP8A 1TYCA 3BE4A 4G86A 3R7BA 1QUFA 1VHLA 1YBAA 3FYCA 2BHLA 3OFNA 2DWOA 3VV3A 3HKDA 4Q5IA 1RMTA 1YI1A 2HMTA 3HKCB 1A7KA 3OKAA 2PG3A 1F3OA 5AI6A 4XFJA 3A2NA 5FULA 3EXHC 3CHYA 5AKEA 5FPSA 3AUFA 4U4AA 3BHJA 1FDVA 2AUNA 2NP6A 2WICA 1Z22A 2FV8A 1YMUA 4WJLA 1GPUA 1E1YA 3KOOA 5KJCA 3AHJA 3RUHA 1CLUA 4Q05A 1Q1AA 3BE5A 2DHRA 3A9SA 1YH3A 1XKXA 4OF4A 3WJ7A 5LQAA 3T9DA 2M1XA 2VOEA 2BF7A 3L7AA 3AH8A 3ZKAA 1N57A 3MXOA 1OGIA 2ZIZA 4IVNA 4DT1A 4REOA 2FH5B 3FVVA 2Z98A 1NQVA 1SZDA 2H85A 3JU3A 1FNMA 3OWOA 2B4QA 5IKXA 1WCYA 1BS1A 3OECA 3GEIA 4Z4HA 1Y0BA 2I5PO 2D62A 3OZFA 1ZN9A 1BEUB 2IYUA 3F67A 3L40A 4JVOA 4U2GA 3EXFB 1TYDE 2ZUUA 4BUZA 2H11A 4C04A 2QV7A 1SKQA 1L8AA 2R7NA 4DNFA 4YDQA 1PJ4A 4JK3A 2FN3A 3L02A 4AX4A 1NA5A 3PG5A 4BFSA 5A5DA 1QV7A 3L7MA 4OLBA 2Z4TA 3TSWA 3F5SA 3JSXA 1NBOA 5AM0A 2P79A 2J3MA 2QSUA 4XGRA 4E4RA 2QV0A 1Q12A 2H5LA 4IPTA 3TUIC 2V7VA 1Y9EA 2WKRA 3LSYA 1DC3A 4OHFA 4RKEA 2C57A 4XSVA 5LA6A 3TUJC 3USZA 2DPMA 2P3QA 4OM8A 3U5TA 1XLTC 3OQJA 2PQ0A 2V74B 1G20E 3Q6IA 2Q9CA 1RS0A 1N2BA 4PC2A 1I4LD 4R3UC 1NKSA 3A4MA 3L0ZA 4ZT6A 3RIMA 1THTA 3TNLA 2F64A 2Z2JA 3Q8KA 4A91A 2RGNA 3HV2A 1FTQA 3LFTA 4JODA 5KNBA 1JJIA 1O6FA 5EZYA 4ER3A 4V2IA 2NYUA 2BEVB 4IMRA 1A71A 2O20A 2E3JA 4DRYA 3ECCA 4GSLA 5FPYA 4R2XA 4EHHA 2CD9A 4ZK6A 4NE2A 5J2TA 1XK6A 3R5FA 4N6OA 2PYDA 4A2CA 1JPNA 3C7DB 4R3WA 4DIEA 2EZTA 3UH0A 3WFIA 4CFYA 8GPBA 1MGPA 1N3BA 4K86A 2JGLA 3ITNA 1NUHA 4PRLA 5KVAA 3DOFA 4WY5A 4P31A 1R0SA 1UQUA 3BQNB 1ITZA 1H4TA 1Z34A 3IOMA 4DV6B 4ZOAA 4KH1A 3UHFA 3GNSA 5AVOA 3QELB 1NN3A 2J6CA 4P4GA 1KP2A 1GPLA 1UBOS 1P72A 4U7JA 5JDIA 2XEXA 5ICCA 4MKRA 1KH3A 1JSZA 1TL7C 1RYBA 1PJ2A 2RB5A 3QYPA 3BORA 1X2BA 1NZJA 1H5NA 5TVGA 1HDOA 1KEEB 1YZGA 1IEVA 3A4LA 3L7BA 3VC2A 5CBPB 3LA6A 2D2FA 2VLIA 4KP7A 4CLXA 3DVLA 1NFFA 2QN1A 5C35A 3TJRA 1RJDA 1IH8A 1YVRA 1T8UA 4A27A 3QMVA 4E31A 2XA9A 1IDN1 3A4YA 3GT3A 2ZLBA 4OGKA 3H9UA 1RC0A 4L16A 2FQWA 4DQUA 4J7AA 3PZBA 4X71A 3G9UA 3INYA 4CPDA 2WC1A 3UY4A 2PL1A 2WF9A 3PQ4A 3QEOA 4CHGA 3NEAA 4L15A 1IJEA 4ZRMA 3TB6A 1KERA 1KI7A 2BFEB 1PJTA 2GUGA 2GPJA 3B8EA 2ZRIA 4X6LA 1BHJA 2Z8YM 2Y0DA 3QWIA 2P2NA 3GZJA 4NSNA 2OO7A 2ZYUX 2NN3C 4Q12A 4PYMA 1SXHA 5F3RA 3L7DA 3GLIA 4OI0A 1GUDA 5LWQA 5ICMA 4TM7A 4X6YA 1R8YA 5EXPA 3H19A 3TZHA 3TRFA 1NW7A 4DHWA 2R8RA 4ZTZB 3QG1A 2AZ4A 3BL5A 2ISCA 1NQXA 2VDWB 3GLGA 3L4KA 3M70A 4Z7JA 2OESA 1TEZA 1PWYE 3MWDB 3RK0A 2O5CA 2FKAA 1FFGA 2ZYAA 2QD4A 3IAM1 3KP1A 4D4IA 1FMTA 1UFKA 1U63A 2FW1A 1Y81A 3KT0A 3QPCA 3OZXA 4MVJI 4U9HS 2D1RA 4REQA 4BFYA 3JYOA 1NATA 5DRYA 5FORA 5TQ0B 1OWNA 3IAXA 5AKXA 2GILA 3U7EB 3IT0A 4C6TA 1H4SA 4MUMA 4OREX 3H18A 1UPXA 1VP3A 4TMFA 4LJ8A 4YMWA 4EAQA 1CZHA 3CRRA 3PXUA 4MQEB 5C4MA 2JANA 3PC2A 5HYVA 1RLIA 1VL6A 2CNBA 4CRWB 1AMOA 1V1MA 5ESDA 1W6RA 3AL2A 1E1NA 5F23A 1WSAA 3OQVA 2FPRA 5AFSA 4OLAA 4KVFA 4WKOA 1EX7A 9ABPA 2Q41A 2DWCA 4QATA 1HDRA 1WU7A 4N47A 1KZGB 1KDYA 4KN5A 3K8OE 5JI3E 3CNHA 3KQNA 3UC5A 4I6JA 2VWHA 4LE1A 5ALKA 2EBWA 1G60A 3GR6A 3H2HA 3EULA 4QU9A 3BZBA 1DAEA 3STTA 1S2NA 3WL4A 4HGPA 4DADA 4YCNA 2JJMA 2FZ4A 1RIFA 4CV1A 2RG1A 2VHXA 5KOIA 1TMOA 3ESCA 1VP9A 3TDMA 2CLEB 4NV0A 3HB0A 3DTVD 1MNQA 5EHNA 1XEFA 3AR8A 4B4UA 4F7WA 4Z3OA 2ZOSA 4NJOA 3R3UA 4L3WA 1IN5A 3NTRA 1O77A 3NU1A 3WWCA 1A88A 2OCPA 4HDRA 1G5RA 2D06A 5PGMA 4CWAA 5A9SA 1EX9A 4Y0VA 4QGAA 1JSXA 3VKVA 1KY3A 3FYDA 2PVCA 3EQZA 4X1IB 1JI0A 2ZJ7A 1E32A 2I7VA 3JWPA 1Q7CA 3RKSA 3ZZTA 1G8MA 5JD4A 1IRIA 4P5EA 1HRKA 2GUWA 3DDNA 4RA9A 1QRSA 2BGGA 3O94A 2UYOA 2WP8J 1TZ2A 5FI0B 4HRXA 4PU0A 3TNYA 1AN9A 3ICEA 3SVZA 2CVQA 3DZIA 2C4HA 3NZEA 3C85A 1FFSA 2OE2A 4MVJA 2XMCA 4OBEA 4ARSA 2C7OA 5DYYA 3K0KA 4L73A 4NBNA 5B3LA 4AY4A 4MW7A 2RGEA 3T7JA 1NKVA 1EI9A 1AHIA 1HT3A 2ZIFA 3L4BC 2XYVA 5LP6B 2DG2A 4ICIA 2X8BA 5IMSA 1M34A 5M5BA 3INRA 4BO5A 1G5PA 4AZ3B 3FJOA 3W4KA 1ZH0A 1QWSA 3CRNA 5FO0A 3KNZA 2J3LA 2UKDA 4FX5A 4M86A 2XZPA 4Q9LA 4O5AA 4DKJA 2A30A 4W8GA 1H9BA 1SKBA 2QXTA 1V8PA 3K0AB 4N6NA 3JARB 4X20B 1VSUA 4C2AA 2EG9A 3VVCA 4UARA 1Z06A 2BE7A 1NM5C 1DBVO 1IE3A 3QKRA 4XRRA 2FGKA 1CZUA 1QHGA 2Y6UA 3GEHA 3MCVA 3ND9A 4KHZA 1N9KA 1U0TA 2XWPA 3EA4A 1QZTA 4JZKA 4DEXA 3GP5A 2FRDA 5JSYA 1N2CB 1TZMA 1YRBA 2DY1A 4WN3A 1RZVA 5CPFA 1N0IA 2DQ4A 4EO9A 3T5AA 1EUQA 1Y63A 2BTQB 3R0QA 4HDMA 2QIOA 3WDMA 2C88A 3D3NA 1UMDB 5IARA 1CRPA 4D74A 4HGZA 1UXJA 4H3HB 5TEWA 3DZFA 2XYHA 4RK7A 4G01B 5FUWA 3NH6A 1QIFA 3TDNA 1BXRA 3IIMA 5T6BA 3GJXC 4O02B 4Y6PA 5F3WB 2GEVA 1TLTA 2OLEA 2R8ZA 1P4GA 4JBWA 1B26A 1WW8A 2AS0A 4MR7A 5LQJA 1R4ZA 2Y66A 5CR9A 2QDXA 5ALWA 3WYEA 5COQA 1WHTB 3L4SO 3M33A 1I5RA 2C96A 2RJNA 4ILEA 1AD2A 4N7RA 1YZLA 4NOLA 1J56A 5FQNA 1JPVA 4RPKA 4B6RA 1BVYF 3I1IA 4U2BA 1J22A 3PX3A 3O3CA 1E64A 3DBRA 1WCV1 1QBGA 1UJ2A 1XTBA 2LUOA 1XU9A 2E37A 1ZPDA 4RDXA 4GI2A 4BKMA 1UBHS 1YMVA 1Z45A 4X1KB 3AVYA 1H0RA 3PIRA 3O1LA 4URZR 4RKRA 4WKNA 5KCMA 2YWJA 4MA0A 2ZS7A 3LUAA 1DJPA 2DHEA 4CL2A 2O05A 2UZ4A 1Q95A 1UPCA 4AIIA 3FDXA 3SVLA 2BJWA 3KHKA 4BDTA 3AP3A 2VJLA 1Z4JA 1G3RA 3SEQA 1M1ZA 5JS7A 4E5MA 5MGBA 5AM1A 4WOKA 3KJNA 3WO0A 4BE7B 2PJRA 2CLHB 1QIJA 1RQ7A 3PIIA 3QU4A 2IZ0A 3CEAA 4K9MA 1CLEA 5DBGA 2O8FA 2W58A 3B1ZA 1YZYA 2G9UA 1HF3A 2GPNA 3E8SA 5LP6F 2AOUB 2RKOA 2P9ZA 4HMPA 5DN9A 2REBA 2XT0A 5HP4A 2UAGA 1Q0SA 4TMXA 3DZCA 3HL0A 3P9QA 3BRQA 4JLSA 3SS7X 3VR4H 5FL7D 1T36A 1HH4A 3CJRA 4TKZA 2GAIA 1L7OA 1SXGA 4R01A 2Q5LA 3E1SA 3OFKA 1M74A 1GM5A 5AW8A 4HWSA 2IIQA 5E4YA 5DT2A 3WBKA 3D6TB 3FY4A 2HU7A 4HCJA 4CG2A 2YFKA 1FA9A 3H9EO 3OLWA 3JWGA 4KI0A 3F98A 4NEQA 4P32A 4G5FA 3IPLA 3PUZA 3TQHA 5ENVA 4UU8A 5L7YA 1AE1A 2PMKA 4OSEA 5TB5A 3VNAA 4NP6A 1I3MA 2JLVA 4E5NA 1RU3A 1JFFA 1UL1X 1HL3A 2GM5A 3P0JA 2I8AA 3AQIA 1MW9X 4ARBA 1XTKA 4Y6OA 3V1MA 2BTEA 3K9GA 3ZXXA 4JHLA 4MVJG 2YYAA 3R3XA 3WLRA 3A6LA 1V25A 2E5FA 3CUUA 2X8JB 4YP1A 5C1PA 4BO9A 3BJEA 3K8YA 1WUHS 3TD2A 4QICA 1PZMA 2O5RA 1WMEA 3VPGA 3WZLA 2CXSA 2XAAA 3DV0B 1Z0ZA 2AQKA 1X7WB 1U2GA 1SUFA 2EYQA 1T4GA 2B36A 2A1UB 1PZGA 3M1LA 1XOIA 3ORFA 4QNMA 5E9JA 5HE8A 2IS2A 2PT5A 3OZRA 3PTZA 1G291 5BQXA 4U2EA 4ZYWA 5KSYA 2CBGA 1SVSA 1XVTA 2VDMB 5CLLA 3BHMA 5J59A 5C18A 4LV6A 2GX6A 1Q20A 3W8DA 4P58A 2PLRA 3T7CA 3QXJA 3WOVA 4J90A 3B3QA 3LQ2A 1X8JA 4O4JB 4IVQA 4OHUA 2CHFA 1ARZA 2D74A 4M53A 3EQ7A 5LJIA 1EB9A 1L5QA 3INNA 2ZRNA 3M5DA 2NZJA 1W30A 1Y4SA 1LLDA 5K3DA 5DLDA 3TSCA 4OYRA 1XRPA 4HNAA 5LQSA 2EX0A 3UCEA 4EBBA 3B6IA 3PEUA 1AQUA 2QTNA 3JALB 3R6DA 3TLGA 4CXMA 5KREA 4JOBA 3JAWA 1NY6A 2IYQA 3FUUA 3PLNA 5JSZA 1D1SA 2H4ZA 1KIAA 3IGFA 4FYVA 5C3UA 2XGMA 3C16C 4CDNA 4F9FA 5EQFA 2JGRA 5EIOA 2PIDA 4PIMA 3LRPA 1BMTA 4RKWA 5ALSA 2GD1O 4E1BA 2Y05A 3EH2A 3P94A 3GRPA 4WA8A 1L8LA 4IKOA 3RRJA 3U3MA 2FSVA 1SKYE 3Q40A 4MQBA 3WB2A 5B1DA 4F6RB 3HUDA 4XQ0A 3U62A 1OQAA 4MYCA 3NDRA 3T7RA 3UZUA 3ZDBA 1J0XO 4JP3A 2BFCA 2G7ZA 5F1OA 1P9WA 4ZCTA 5FA8A 3DA8A 5C1IA 5I7SA 3PR1A 2G7MC 2IOHA 2BOVA 1DBPA 1YTLA 4BBAA 1X8LA 1L9XA 2ZAOA 4BCBA 5HKOA 4X8HA 4QM6A 3HLKA 2BFFB 1I9CA 1XMJA 4K9NA 1V7ZA 2QUZA 4HB2A 3HO6A 1F2UB 2FUNB 4N18A 3AVTA 3SVTA 3H04A 1UBMS 4GRDA 1VJ0A 5EIFA 3CZ5A 5DDIP 1IJKA 1G6HA 1PTKA 1XQYA 4RF2A 4M0MA 1B2LA 1PLLA 3WGLA 2UUCB 3SC6A 1O94A 3OICA 3S70A 2WF6A 3O93A 1GAWA 3FPCA 3CY6A 1IHYA 5K0JA 3D2CA 1FNCA 4JYZA 4ID3A 4IOKA 2PUBA 3BK2A 1NURA 5LOVA 4LE2A 3QVKA 5FBKA 3EA0A 3LHFA 1KHTA 1YIOA 4PAOA 5HK8A 1YZKA 2CV0A 1JQAA 2HY7A 4TL7A 5DX0A 4DLAA 3SJZA 3HGQA 3MLEA 1RBQA 1QVAA 4AUEA 4KXYA 3FIUA 4EM6A 3S7TA 2JFOA 2DVMA 3ZYCA 3ZGZA 4PAGA 3TDKA 2NSYA 3G0GA 4GOLD 4KDRA 3TRKA 1DQSA 4K1XA 1HDIA 2AI2A 1U0RA 2G28A 2YVUA 2RBEA 3BTUA 3C7TA 3DR3A 3FNQA 5DWVA 5KQMA 5JZSA 2O1XA 4LF6B 1K3TA 1FDUA 1PFGA 2ZROA 4HAUA 4LRSB 4DHEA 2GETA 4FDMA 1GRRA 4ZFNA 3DAPA 4M7RA 1R6AA 3I1JA 3SU8A 4AZSA 4U7TB 5HF6A 1TT5A 3WICA 1JR4A 2L82A 4NBRA 1OLOA 1QZZA 2HQBA 1XV5A 4NV3A 1XX6A 2BP7A 1BDMA 2DPHA 4MW0A 3D5EA 1BCSB 2V7TA 3AEKB 3O75A 4EW1A 1OI7A 4MIYA 3GRZA 4DCJA 2OZLB 2G5CA 4I0WB 1WZIA 1S9DA 4GLLA 4C1BA 4OHKA 5A0VA 2EF0A 2IWHA 4WX2B 2ICAA 5HFJA 5B1YA 4S3MA 1JHDA 5KDDA 3D3KA 3OQNA 3PIDA 3WY9A 4EUFA 1ZVKA 2NGRA 4IRXA 1N0WA 3DBHA 4LFCB 2QUKA 3F0TA 1ZYUA 1EJ6A 4ZAZA 1OFIA 3WYNA 2D8MA 3ZLTA 1FS5A 3TVDA 5LQCA 4BFZA 4ANFA 4W99A 3RS5A 3OT1A 1NONA 4HUQA 4BNGA 1Z37A 3BKWA 3MB5A 3C3BA 3I2KA 3X1JA 1A7JA 1Z4PX 1NMEA 4I9GA 5BSHA 4TV9B 3CNQS 2HTEA 2WPDD 3NGLA 2HMVA 2Q9UA 4DNPA 2QUHA 1IIBA 3CBGA 1ACJA 5K8IA 1XRMA 4Z5XA 1M0EA 1L5RA 1KYZA 2WTEA 3ZI4A 4BE4A 1BGVA 1OB2A 4NZMA 4XAQA 2REQA 1CJSA 1YB7A 2HM7A 2WWGA 1D0SA 3O91A 4LY0A 1M72A 3PGVA 2YICA 3SF0A 4YP9A 1MOPA 2R6FA 2VTDA 4AKHA 1A4IA 1GRCA 3CS3A 1OX5A 4JQSA 1ECBA 1ZJZA 4JYCA 4MW6A 4FFPA 5EUCA 4E12A 3GLFB 3PE3A 1QG4A 4EHDA 3FR8A 3FG9A 3MGAA 2BR5A 4RZQA 4PX9A 1NRWA 1R0KA 3N39C 4FS8A 2V6IA 5EHQA 4OU4A 4DJJA 1U94A 1DFIA 2C07A 5ALEA 4C05A 1FDSA 4JU9A 5GM2A 4J0DA 1U3DA 1WTCA 1DBIA 2ZIXA 2L19A 1X7XA 3H1GA 1SQSA 3KQUA 1JEOA 4MKZA 4K9LA 5L95A 3BK1A 2X1LA 3HR8A 2Y1WA 3ETNA 1CR2A 3QUAA 3TZEA 1L5MA 1XPOA 3AIOA 4UE3S 2VBIA 5BNTA 1NU6A 3R41A 1ORRA 2H4YA 1DADA 2DBRA 4DM4A 2P6RA 3ND6A 3IDOA 1SN7A 1U8XX 3JQEA 4NE9A 4TZ6A 3CNNA 3RDPA 3RAFC 5EVJA 4QXRA 2XUZA 4CG1A 5FUQA 1N2EA 2QAGA 3PCTA 2C5AA 2VAVA 1RWPA 5AJVB 4CF5A 5JQGA 2RGAA 2PRSA 1PRYA 1U0OC 3CPSA 4BCCA 1H65A 2PZEA 2NZ2A 2Q3HA 4MUGA 5H3LA 5I47A 1JALA 2C5BA 1FNDA 3FW1A 5I9IA 3BT7A 4WBNF 1V1JA 3LAWA 3KX2A 5CIWA 4ZVRA 4GIBA 4GRIA 4UQPA 1HOTA 3SMVA 5ELXA 1MQ8B 2ZRFA 5JPDA 1DDGA 2ROQA 3MS2A 4NMXB 1SR8A 1EWRA 3QBJA 2FMUA 1SOWA 2HU5A 4RESA 1ZD9A 4P8RA 1OWMA 3PEWA 2EKQA 2VT2A 3BA1A 5EJ4A 2O54A 4TYQA 4MLPA 4IDOA 4B2PA 5AWFC 1DBSA 1KH2A 3L6EA 3M4YA 1JG1A 1KE2A 5F2OA 1EBBA 3MQ4A 2DTEA 4D2IA 3E8MA 1YC5A 4NECA 4ZK2A 4EDFA 4FDUA 1ZGBA 3UM9A 2ODPA 3ZWWA 3AEXA 5IABA 2VK2A 4TV9F 1H1LB 3HVIA 3GRYA 1SXJD 1TW3A 4ZVTA 3UHOA 1KEUA 1KEPA 1M1YE 3RC7A 3SFZA 4JXXA 1TF2A 2GCOB 5L3ZA 3DDSA 4HLCA 1YL7A 3RR2A 1N77A 3PVCA 1PL7A 6GPBA 2WFZA 2PPVA 2DSTA 1U3UA 3OPQA 1PWEA 3UATA 1JEDA 1PQPA 5L7WA 4B3MB 3LX6A 1L5NA 4IZIA 3EXAA 3V9AA 1BFDA 4UFNA 3KFLA 1C8VB 1XZDA 4PVCA 5E6SA 2ODNA 3FKSD 1EX6A 3HACA 1PO7A 2H6EA 3SBDA 3OLZA 4LYEA 3UVEA 4J0GA 3Q8MA 1XDGA 3NW9A 3UT5A 3NVAA 5I01A 4D97A 2W22A 1F38A 3KXIA 1OFHA 3ZI7A 3PXCX 3ZZUA 4I4CA 3WS7A 2ESRA 1I1QB 2H59A 5KQLA 1CY0A 2B1RA 5EZ5A 1ZEMA 2B69A 4ZQCB 3PNYA 2WZCA 4P4TA 4WY8A 4U0KA 1RYNA 2W2NA 4E15A 4QYIB 4YRIA 1C4OA 1IZ8A 1NTOA 1GLGA 3NUGA 3Q9LA 4YUVA 4XASA 3VO8A 3PKZA 1MLDA 2GN9A 3OPMA 2WMNB 1IBRA 2QSJA 3OZGA 4PY2A 2IPNA 3TCXB 1C7IA 1A9YA 1GPBA 1P9LA 2OOSA 4XPIA 3SHVA 4F5ZA 2V5VA 1HY3A 5A7FA 3GMTA 2HUNA 4OQDA 5I8ZA 1QTIA 3IALA 1VI6A 3K20A 5G1NA 5HMLA 5IHPA 3DKPA 2FPIA 1J5XA 3G3EA 3IE2A 3PICA 2GDJA 1L8XA 4GI1A 4HG2A 1EWQA 2B7LA 5KUTA 4L22A 5DNVA 1RBMA 2VHUA 4RGYA 3OQHA 3AF0A 4FYPA 2PGOA 4LJ6A 1NW8A 5CFRA 2ZZMA 3FDIA 5IK2D 1YRYE 4EY5A 1Q1QA 5TY0A 4KMMA 5CCEA 1NZDA 1Z5WA 3LWNA 5KZMB 3MJHA 1BKYA 5IJZA 2FN4A 1XNGA 221PA 2R1VB 4CT4B 1TCBA 1C4KA 4RFVA 3TEMA 5G4KB 5FBVB 1UT6A 3GPBA 5ETJA 2X0EA 4B34A 1N6NA 2WKSA 1XB2A 3R4VA 3N70A 1F48A 3AI3A 4DB4A 3QVGA 2V6FA 4HDSA 4ECAA 4ZIRB 1N78A 5J23A 5JASA 2OCXA 1C3OA 3K9NA 3L0OA 4Y6QA 2IZZA 1E61A 1MVLA 3A9UA 5JZVA 4DB2A 1YR9A 3QWFA 4D44A 5C8YF 1M1UA 1K8QA 4D4KA 4A36A 2QMQA 5A3RA 1PGQA 4JJ6A 1D6NA 2OQRA 3B36A 4NOKA 4DSTA 1XMXA 1N2IA 2ZRJA 3IBCA 1L2TA 3ZY6A 5CIYA 5ADUS 4IW3B 4KIJA 1T15A 4HAIA 2PZFA 2UXCB 4PYLA 1SK8A 2FCRA 1OROA 3Q6NA 1AY0A 4S2EA 3JATA 1B16A 1XJ0A 2B1GA 5CK5A 4F85A 4G4SO 4K7JA 16PKA 2A86A 4AXXA 4Z4EA 2W2VA 4C3UA 5C8ZA 3O3OB 2WB4A 4N7BA 5IANA 3I8OA 1E59A 1MMFB 1Q7BA 2X15A 4X54A 2GM4A 1SFRA 1WKVA 2J0UA 2YVLA 1L7DA 1Z0KA 3GL9A 1RYEA 3IUPA 3JQCA 4NICA 1YHYA 4ZREA 1NW9B 4CV2A 4JFRA 5CEJA 2CN1A 2XNHA 2WOJA 1LJLA 1XU7A 3NNNA 1T4CA 3K4QA 3H9JA 1IL0A 3BRWD 3WFJA 1C14A 3OETA 3ECSA 3PHIA 4QYSA 1ZZGA 5AW2A 4D0RA 2RHTA 2VP0A 1P6UA 4FFNA 2QZ4A 4DIUA 5JATA 3O21A 4LY3A 4K46A 1K7CA 1JHQA 1EFVA 2MDTA 3LMKA 1PE0A 1WMSA 3KYDA 5KYUA 1M83A 1FF9A 3WLFA 1P3Y1 4ZCIA 4F60A 4QGBA 3R5HA 3TE6A 4KWHA 1OLUA 2CXNA 3GJ0A 4GP6A 1QV9A 4PRKA 1NR5A 5ALUA 2ZBGA 4BRZA 5JNLA 1G6Q1 2C0QA 3U81A 4BRUA 1WDMA 3CFYA 3KR2A 3OC6A 3WXBA 4B84A 4ND4A 1G20A 3OSZA 1C30A 1G6KA 2I6TA 3PUHA 4MICA 1GNRA 4DC0A 3NS7A 3HU1A 2ZSDA 3MGGA 4OUDA 1E9SA 2AN4A 2HNAA 3DMNA 4GL4A 3EBOA 5I7OA 3W5BA 3FFXA 2JZCA 2X9LA 4QHTA 3HG7A 1T2EA 4Q4CA 5DOVA 3LNCA 3N2YA 3ETEA 4BN4A 1AKWA 1RAFA 3GLIB 2FDCA 4ND1A 3JQAA 1NY5A 1NXPA 3Q3CA 5I9SA 3R0ZA 4KV9A 4IZHA 3IC5A 4UJ3A 1QTRA 1Z74A 2IYFA 4WH0A 4PIVA 1M8KA 4FEAA 3RREA 4QXQA 2D1TA 4KJZA 4W7IA 2JLXA 3ESDA 2VNIA 3OFND 1GIAA 3NBQA 4NU5A 4DA0A 1KMQA 2YW9A 1K2VN 2I65A 1IUKA 2XY4A 3W7BA 4FCVA 1P2BA 5F7OA 1CUYA 4GF5A 4MO2A 3ZD7A 5HKBA 1WKBA 5LA6F 1FFEA 1XELA 3ABIA 4HAZA 2HSGA 3D7SA 3CLSD 3TNDA 5KNBH 1KQ3A 3IKJA 1VI5A 4URYR 3ZHUA 4N76A 3LSTA 4HI0E 1Z39A 2IZ5A 4MI3A 4BP8A 4L85A 1WBDA 4F84A 1PUXA 2ODQA 3LW8A 3RAGA 3UWSA 1O08A 4GQBA 1EDZA 1V1MB 2EIXA 2GTHA 2OGSA 3C3YA 1OOEA 4RDCA 3TIIA 4BFUA 4DRXB 1L5HB 1LDGA 2A58A 4R7ZA 1U7TA 4DMKA 1DOAA 5EXTA 1TMKA 1TUGA 5I8WA 1E2GA 4JLPA 1QSGA 3IAM6 3KB8A 1IN4A 3LWZA 4HFMA 3H75A 4CF4A 3HY6A 3GLHE 3W5JA 3I9V1 3DW1X 2PD3A 3KK0A 5KCZA 4D82A 3DLCA 3KQYA 4UCFA 3EVNA 2QGNA 2RGBA 3L6DA 1P0IA 2H18A 2CMHA 4IIYA 4U6NA 3WMXA 4E33A 2EKBA 1K63A 4ZAWA 4P0PB 3QA9A 5GY7A 1THGA 1ULBA 4M0CA 2WMDA 2O3JA 4UUNA 3E7DA 2BH9A 4UM8B 3ZVLA 2YWXA 4BAGA 3TW4A 4EKDA 3T3HA 2WVGA 3OM8A 3ZVRA 3U3DA 3FOAA 2JGNA 2R8XA 4F3RA 4WZAE 3TM4A 3U7IA 4EB6A 3FCUB 4YT4A 3HWX1 3FAKA 2W6JA 5B6IA 1JX6A 1DXQA 3KKNA 3R75A 1E5TA 3C24A 3BIWA 4PZDA 1FRZA 1LJ8A 3M4NA 4LYJA 2P5TB 3HRKA 5LJLA 1JLMA 1N3LA 2I6GA 4JENA 1R3UA 2H2WA 3K09A 4CUKA 2DQSA 2IFTA 3DMYA 4IZ6A 4WDQA 4B8WA 2ZWAA 1BVHA 1AZSC 5KNBD 2KLHA 1G1AA 1GKIA 1SD5A 3RJ5A 1B6GA 1WPXA 3KXLA 4D26A 1FFAA 2XH8A 2ZTUA 1VMIA 3L0CA 2CT8A 4M22A 2FLVA 2HA5A 3ANTA 4DCGA 3NOQA 4O3MA 1PSWA 5ALQA 2B8TA 1BW9B 1QR2A 1WDKA 4Z0TA 3HABA 3ID6C 4E07A 3DLHA 4BL5A 4B7AA 3FCSB 3LHIA 4L78A 3VZCA 1IU9A 1R5NA 1WDTA 5BPHA 1M73E 4HLQB 1EVZA 2WJVA 1WUJS 1ORDA 4HB4A 2VF8A 3QMMA 4IMJB 3H2SA 4LV5B 1QWOA 2F55A 3R9XB 5EP3A 2XAUA 5CCDA 3NBKA 1ZI9A 2MTBA 4DXDA 4XJTA 5L4SA 2OXCA 1GTG1 3G8AA 5AMXA 4ZVVA 1XCBA 1KQNA 1C3JA 1AM4D 1Z18A 1CR0A 4QUAA 5BQ5A 4IFIA 3W5SA 1CUIA 4Z7QB 1MB4A 2I55A 1J1ZA 2HSZA 3PPWA 3T4PA 3AM5A 5JMOA 4DR5B 4R8RA 2ZSFA 2VPPA 4MEBA 1N5MA 1P5JA 3OMXA 1WZNA 5AVQA 1D3AA 4IIBA 4AZ0B 2IBMA 2I4OA 2FZVA 5JR3A 4D43A 5D85A 3SJ7A 4UVIA 3I4FA 4B0PA 4WPGA 4WIAA 1SKUA 2Q3MA