1A9SA

Bovine purine nucleoside phosphorylase complexed with inosine and sulfate
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
282
structure length
282
Chain Sequence
MQNGYTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDTESQGKANHEEVLEAGKQAAQKLEQFVSLLMASI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PURINE NUCLEOSIDE PHOSPHORYLASE
publication title Calf spleen purine nucleoside phosphorylase complexed with substrates and substrate analogues.
pubmed doi rcsb
molecule tags Pentosyltransferase
total genus 84
structure length 282
sequence length 282
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 1998-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1a9sA00
2GUWA 1V41E 3P0EA 4M3NA 1B8NA 3O4VA 1U1FA 4GLJA 4TS3A 4M1EA 2HSWA 2AI3A 2I4TA 1RXYA 4OGLA 1TGYA 4TYMA 3PHCA 1PK7A 4EARA 3KVRA 4TXLA 4YMLA 1ODIA 1JDVA 3OZDA 3KVVA 1Z5PA 2ON6A 5I3CA 1A9TA 1ODKA 1FXUA 2A8YA 3DF9A 4R31A 1Z5OA 3E0QA 4LZWA 4LDNA 5K1ZA 1PR0A 4WKPA 3FUCA 4QASA 3LA8A 3ODGA 5CYFA 3PNPA 3KVYA 2XRFA 4L5AA 3OOHA 4YNBA 3DDOA 1YBFA 1RXSA 1I80A 1OTXA 3D1VA 1VFNA 2H8GA 4TTIA 1ZOSA 4E1VA 4JP5A 3GGSA 4LNHA 2I8AA 3FNQA 3EEIA 4NY1A 2HN9A 4BMYA 1PBNA 1JPVA 1Z34A 4DA8A 3IEXA 2OC9A 3DP9A 4TXMA 5F7JA 1V4NA 3UT6A 1VHJA 4UC0A 4EB8A 5FAKA 5F77A 5JPCA 1V2HE 2AI1A 4K6OA 3LBAA 1YQQA 3PNSA 4P54A 5C80A 5F78A 4G41A 1JDUA 1T8WA 4H1TA 1U1DA 1M73E 4F2PA 4KN5A 1Z33A 1A9RA 3F8WA 4NS1A 5ETJA 5EPUA 2A0WA 1VMKA 4WKBA 5EUBA 3DJFA 1A9OA 1PR6A 1Q1GA 3P0FA 3T94A 4PNPA 2BSXA 2ISCA 3UAYA 4QARA 4M7WA 3NM6B 1PKEA 4NSNA 5EFOA 1U1GA 1A69A 1OU4A 1TGVA 1PK9A 3EUFA 1SD2A 2QDKA 4I2VA 1RXUA 1SQ6A 3K8OE 3U40A 1PR4A 1T8SA 1JDTA 4F1WA 5F7XA 1TCVA 4WKCA 3UAVA 4OEHA 5F7ZA 1U1CA 4L5CA 1YRYE 2HRDA 1LV8A 3GB9A 3OF3A 4BMXA 1T0UA 3MB8A 2B94A 3FWPA 3OCCA 1RT9A 2OECA 5B7PA 4F3KA 1LX7A 3KHSA 1Y6QA 3OZBA 1K27A 1Y1TA 1XE3A 4TS9A 1LVUA 2AI2A 4D8XA 4F3CA 1NC1A 2QPLA 4D98A 2Q7OE 3C74A 1RSZA 2OXFA 1NW4A 3OZEA 4MCHA 3EMVA 3NM5A 4JWTA 2A0XA 3UAWA 1Y1RA 4TXJA 1A9PA 5F76A 1TCUA 3ENZA 1OV6A 4MCIA 4D8VA 1RCTE 3BSFA 3BGSA 1JE0A 3K8QA 1CG6A 3LGSA 4L0MA 3INYA 4TXHA 4LNAA 2A0YA 1Z39A 2QTGA 3BL6A 4DARA 1Y6RA 1OTYA 1N3IA 1V3QE 1YR3A 4IP0A 3OPVA 1JE1A 3MMSA 3UAZA 1RR6A 1B8OA 4DABA 5B7QA 4DA6A 4L5YA 2PGAA 3IOMA 1PR5A 2RJ3A 4G8JA 4X24A 1Z35A 4TTJA 4DAOA 4QFBA 5F7OA 4OGKA 3E9RA 4BN0A 1RYZA 4ECEA 3FAZA 4OJTA 4U2KA 4DA0A 3O6VA 1SD1A 1YQUA 1Z38A 5CXQA 4OY3A 4YJKA 4OF4A 3OOEA 1Y1SA 1PF7E 2QTTA 4QAQA 4D8YA 1JDSA 2IQ5A 5CXSA 1Y1QA 4PR3A 3KUKA 4QATA 4R2WA 1ECPA 2HWUA 1Z37A 4D9HA 3FB1A 4QEZA 3TL6A 3OZCA 5CYGA 1K3FA 4TXNA 4WKNA 4GLFA 1JYSA 3ONVA 3FOWA 4RJ2A 1NC3A 3QPBA 5IU6A 4JOSA 3NM4A 5B7GA 1CB0A 4DAEA 5CCDA 1PWYE 5F73A 3PHBE 1A9SA 2AC7A 4R2XA 1ULBA 1QE5A 2OC4A 1T8YA 1ULAA 4WKOA 4DANA 1PW7A 1JP7A 5IFKA 1ODLA 3UAXA 1PR1A 1OUMA 3DPSA 1Z36A 1JDZA 1G2OA 1PR2A 5KB3A 1C3XA 4MARA 5DK6A 3BJEA 1ZL2A 1T8RA 3SCZA 4GMHA 3KU4A 4FFSA 4G89A 1V48A 4GKAA 2QSUA 1U1EA 4L6IA 5CCEA 4F2WA 1ODJA 1SJ9A 1TD1A 4LKRA 1OVGA 1A9QA 1RXCA 1RFGE 3EUEA 1WTAA 2P4SA 4BMZA 3E9ZA 4TTAA 4DA7A 5B7NA 1VHWA 4YO8A 3NBQA 1V45E 1Z5NA 1K9SA
chains in the Genus database with same CATH superfamily
2GEUA 3OZTA 1QYRA 1X1DA 2ZLBA 2R2AA 1JXQA 1MLDA 1OIXA 2JCVA 3AETA 3FMPB 5CVJA 5B58T 3RBZA 5LQMA 2B4AA 2ATVA 3KXIA 3C3BA 4AECA 2BM1A 1JFTA 3EPRA 3HDTA 2KS6A 1CUXA 2HSWA 3PFNA 1FXWA 1N5MA 2GJ9A 1LS6A 2R4UA 1ISRA 3EOBI 4OGLA 3UK7A 1QFSA 3D8UA 1X94A 2BDUA 3BK2A 2XCSB 3KV1A 2CZQA 3AFGA 1QANA 2PD6A 3A3NA 1RZRA 3Q8MA 1JHPA 2BL4A 3K1YA 3PB3A 3QUSA 3Q6IA 4HFNA 1B26A 1G7RA 2I99A 3T9FA 3VC7A 5ALPA 4JIGA 2PZAA 1XZQA 3QNUA 5DYYA 5AIAA 2GBIA 1C8LA 4HS9A 2EXXA 5HXAA 5E9WA 2VPTA 2O5EA 5LNK6 1TT5A 3M81A 1LI5A 2VI5A 1BGWA 1FXUA 1K8XB 3FOBA 4BU0A 5M29A 4E5UA 3JV7A 5KQPA 2DKFA 3HP4A 1XNGA 4ZI2A 5CAEB 1CY6A 1XZLA 2LBPA 3ITKA 3MD0A 3PL5A 3SYKA 4MR9B 4TTRA 2JI8A 3F5QA 3M4YA 4AC9A 3WQQA 3DQPA 1SIUA 2MSDB 3TZKA 4KN8A 2XYRA 1TL7C 5ALVA 3FHOA 4GGMX 1PTJA 1YJBA 1FMLA 2HM7A 4G81A 1N2BA 1C1DB 4ZYXA 4AJNA 4W9NC 2YV2A 3GLHB 5BQOA 1BJTA 2RH8A 3T3DA 4XH9B 1JAYA 3L6BA 4CKEA 4WCDA 3HUDA 1UBGA 3NHYA 5A5EA 4MVJD 4FYVA 1MV8A 3OCJA 4MKZA 3FYCA 3L7AA 2WPDA 4KJXA 1M10A 4DMMA 5A4IS 3PQ7A 3R0JA 1LRJA 2XQVA 4I9UA 4F1KA 1ZR2A 1H8HA 2NZYA 2HTFA 2NSHA 2HWKA 5EP4A 3ZHOA 2GN4A 3AHHA 4YV0A 2FEOA 5CEFA 2IHZA 3IEIA 2NO5A 2OBLA 4EDFA 1N2CB 3DVRX 3KZKA 3G2IA 3S70A 1L7MA 5HQJA 1E7YA 5JE8A 2VQSA 4EB8A 2X4IA 2P2DA 5DSTA 4E07A 4WFQA 1GV0A 2OMEA 2RGCA 2V0CA 2WLTA 3A9SA 4C29A 4POAA 2CVPA 2QTHA 2ZTSA 3ACDA 2WV7A 3G1UA 1LLUA 5IRCD 1RMQA 4EBFA 4GKBA 5IARA 1USKA 2VO1A 4ZYTA 1CWUA 4NTZA 1HBJA 4ZO4A 3KG2A 4YJ3B 4NY1A 5LM3A 3KQNA 1N2EA 3A31A 2ZI6A 3EXHC 1OHHA 1XTQA 1THMA 1G63A 4HGQA 3F6CA 5B30A 2XZOA 3FLMA 4MA5A 2SKEA 3WSTA 2I62A 1FA9A 1MVOA 4PWZA 2Y05A 3ABQB 1NVUQ 3LCJA 4FEEA 3WYAA 4EB6A 3ZHVA 1LXCA 4DR7B 4ON9A 5TS2A 3NDJA 1V4NA 1UDCA 4NG4A 5L3SB 5I7WA 3MWLA 4Q34A 3DZCA 3LIPA 4IJUA 1XBTA 5ALDA 4BNIA 1GLVA 1VSUA 3AP3A 3KBOA 3NIBA 5F77A 4YMHA 3N0VA 1KJZA 3RGGA 3VJLA 4R0VA 5KPJA 3F3SA 4X7MA 3RYCB 2QIOA 3H2IA 1I9GA 3K72B 3HN7A 1I13A 2W6QA 4ARZA 2JZNA 1G19A 4ZV7A 5C32A 1SXJD 1BGVA 2V6BA 4L8GA 3WLPA 2OZLA 2IE8A 1E4OA 1RAHA 2DOKA 1GYRA 1BQEA 1KK0A 2FUNB 1Y89A 2QAJA 2XMSA 3ICPA 3NHFA 2O2DA 3PYMA 1NYLA 3GA0A 1U1DA 2P35A 1QDUA 2GKGA 3F90A 2UUBB 4KN5A 2ZBEA 1JFSA 4DV0B 4QDUA 3LUFA 2NX2A 3AWDA 2C78A 3LXMA 4CPDA 3BFJA 5L9AA 3I53A 4OFZA 4EI7A 3ONFA 3CLTC 4TM7A 4H3KB 1DDIA 1HYGA 1UWKA 2O2SA 1ZCFA 3LYAA 4IHKA 3OAAA 5DN6D 1UP7A 2B9VA 3HUUA 4I4IA 1SKQA 2C2WA 1FBNA 2YWBA 3G2NA 3PDIA 3D3WA 2YICA 4L2IB 4OUDA 3IPYA 5JTUA 3PGJA 4UU8A 3TQCA 4NENA 1PZNA 1RHUA 4Q7EA 5FP0A 4BXOA 1TMOA 1U3UA 5CA0F 4KV9A 2Z4RA 5KQRA 2QI9F 1IHXA 2D54A 2PN1A 1PT5A 2ZIAA 3CG0A 6ABPA 4PVDA 1PKEA 2YJTD 2I6FA 4AW9A 1LH0A 4RTNA 1I8TA 3RK0A 1T8TA 1Q77A 2IVFA 2W8ZA 2D1FA 4WZZA 3HK2A 4TMTA 1ZN7A 3SC4A 3KSZO 1R6AA 4XM2A 3T6KA 1CRZA 3TTWA 2HBZA 4BX0A 1SVMA 3WJ2A 1EDEA 4R54A 2QRVA 2R1TB 2ZSDA 3EZ6A 2ZUDA 2I03A 1JQKA 5DEIA 1FTGA 4BJ5A 3PPIA 3GLRA 4U9IS 4JBXA 1U80A 2DVMA 1GTJ1 3DOIA 5IAAA 1MZVA 3I58A 1AGXA 1E3QA 1SQ6A 1V1RB 2OEPA 1BD3A 3DW1X 3A6GA 3BMOB 1IOZA 3FWKA 3IT0A 4B3DA 3SYNA 5JQGF 4AKIA 2WAOA 1ML4A 1Z17A 1LDGA 2HIMA 2IV7A 5I9MA 2ZWOA 3H5OA 4CZ2A 5EJ2A 4NMHA 3LNCA 4C22A 3VPXA 4EA8A 3AONB 5HR5A 2CMKA 2Q1UA 3HZOA 3NAQA 3HB1A 1WRBA 4Q9DA 2ONCA 1KXZA 2EFEB 2G7MC 5JAUA 1AKVA 1UBUS 3WHIA 1JIKA 1WWKA 2QHXA 4I81A 2XHZA 5BUSA 5KUTA 3K1JA 2C2BA 5BW5A 4DIMA 3I9V6 4DUZB 2GBPA 1Z4JA 3V2IA 3VX4A 2ZRGA 3QVWA 4ZQEA 2WG0A 3U7GA 1VCMA 4B9AA 2HK9A 4LK3A 4YRBA 1RHQA 2YVQA 3LT0A 3O8OA 2ZYVX 2P8SA 4BV8A 1I2AA 2QTVA 2AR0A 5H1YA 3B7PA 1S7CA 2P9CA 2DEUA 2PLNA 1VMIA 4O8CA 4OB6A 3ZHZA 1XRMA 2O8DB 1BOOA 5AW9A 2QVGA 1NBIA 2NQ2C 2Q6LA 3TM5A 4FOPA 2M98A 1UMDA 1ZJZA 3QYPA 5KJEA 5PGMA 2Q3LA 4AJHA 5EHIA 4D8XA 2E37A 3QE0A 3GQBA 5EHZA 4MVJI 3DHYA 1SCAA 4GHWA 5HQ3B 5B4UA 4OTZA 2RGBA 3OTGA 4JCOA 1V11A 2UYCA 1D9ZA 4B83A 2YWGA 3WYCA 2DTDA 4LOAA 1L4KA 5SY9A 2GHIA 2XI4A 5E8JA 3LH5A 2RGEA 4HQKA 2H9IA 3EOAI 3PYLA 4M0FA 1SIBE 4RSRA 3QGMA 2G5TA 2V1XA 4QYSA 2BEUB 2GD1O 3UAWA 1SQSA 2DWPA 1NZFA 1NWCA 2BFFA 5SV2A 1PUXA 3UO8B 3RRYA 3GEGA 1RWXA 2BRUA 1L0BA 4ZCRA 2YR0A 3ENZA 2XGMA 1OWLA 1HSOA 3F78A 3BKXA 1OX6A 4ILEA 5IEBA 1T36A 1JHMA 2QZSA 3THWA 4P0QB 1FMJA 4XD7D 4DQKA 1AN9A 3CH6A 1U8XX 4X6XA 3K6JA 2R6GA 3VO2A 4XWKA 1OTHA 4NBWA 3RF7A 4GMKA 4QTXA 4YS6A 1B73A 3PC6A 3KR2A 4FCVA 1LX6A 3BWEA 5HBRA 1C4OA 2EDCA 2BMAA 2Q0SA 3AB3A 3GC6A 3I72A 4FFVA 4RPHA 4TYWA 4IDHA 4MA0A 3IHTA 5C0OE 3PHLA 2V8BA 4OHYA 2K5UA 3O5AA 5JEDA 2XUZA 2VP2A 3I5MA 2CLCX 3VTKA 5HKKA 2INGX 5KKNB 4DT1B 1Y6RA 1EX7A 3KXPA 1Z62A 3HBFA 1H9BA 2A5GA 2WTMA 4JEIA 4LQDA 4UVGA 1V5IA 4FT4A 5KBYA 1AMUA 3UEOA 3PGVA 2ETVA 5J4HA 1YHNA 1ZNWA 4ZCPA 1B2LA 3WDLA 3SX0A 1PYOA 2NUAA 4C1NA 2LPMA 4E5YA 1I94B 2HXYA 1NDHA 2WKQA 1Y7PA 2SICE 2RARA 2GBLA 3ZWMA 1T6XA 3MMSA 1BA2A 3HP7A 1HT2E 4LJKA 1TK2A 1CNFA 2DHDA 2WM9B 3BIOA 3L7CA 1X86B 2DUJA 1BEZA 1CNMA 2F1OA 2QROA 3IV7A 3QBJA 2CL0X 4DA6A 5AM2A 1WR8A 221PA 2Q3DA 1BN7A 5IC4A 1ACMA 3UVEA 4P3OA 1VCNA 3PUVA 2FPGA 1B15A 1KJYA 4HDNB 4Y18A 1I6WA 5KKAA 4DS3A 1RC8A 2XBMA 2GARA 1LPMA 3C43A 3W5JA 1P1RA 3HJTA 1PDOA 2FDCA 3AUKA 4YASA 4RZSA 3E9RA 1WDLA 1HWYA 1SQ5A 4IDEA 4Q00A 1I7SB 2F64A 4YJDA 3I6BA 4ECEA 1CQIA 1AZWA 2FMIA 3KSRA 3NWEA 4U2KA 4A2QA 4EELA 4JX8A 3E5MA 3GLQA 4MRMB 2RHTA 3QIAA 4Q93A 5H9WA 4XVUA 5JZVA 3U4GA 1U5CA 2A1UB 2RGYA 4P80A 4GKVA 4DNQA 4FGJA 5BYBA 3D6VA 1Z38A 3GZ4A 2JCBA 2WBLC 1DXOA 2I2DA 3V2HA 3ZI4A 4V0LA 3TNYA 5ICSA 1AXGA 1NXWA 2IL1A 4HDSB 3NC0C 4X8HA 3DMHA 4L4SA 3YASA 4URYR 1RI3A 3GJYA 3F9RA 1ZONA 1ESDA 1XCMA 1ZRNA 2ATXA 2QM0A 2WOOA 3EGXA 4OP3A 5T4HA 3UGKA 1GPUA 2QTTA 3A4VA 4QAQA 2E0IA 2F2TA 3ZK9A 2I55A 1S01A 1UPFA 3GYGA 4Y0VA 3R9XA 1N5RA 3G02A 1LBHA 1QYCA 2DX7A 2JHPA 3CT6A 3PRKE 4LHWA 3TQQA 4MSUA 4PXYA 3TW8A 2A9QA 4MAMA 4B3SB 3PWZA 4HVAA 3H2BA 4FGWA 1JGTA 5JRJA 3BMCA 1OKKA 1UXOA 2B69A 3M5DA 3TIXB 2W98A 5IWAB 4PHHA 2P79A 3B9PA 3U48A 1DAHA 2FYTA 1GG9A 3HHPA 2KMLA 3V8EA 3DLAA 2GDZA 3MMNA 4J3NA 2N1MA 4M98A 3D59A 1COWA 3ZKWB 3A4YA 4QYXA 1P4HA 3MCTA 1U5BB 1BYUA 1NXVA 4IIYA 5HRUA 2OO3A 5JTTA 2XX3A 3H13A 3AUJB 3CCCA 1TU4A 2YCLA 5M5BA 1C8VB 3KXLA 3X1MA 5IZCC 4JGIA 5I5EA 2HJHA 3H05A 1CZKA 3L1IA 3TO5A 1II8B 3ST7A 4UBIA 1M1YA 2V7GA 4XRGA 4FFMA 5KWSA 4B5LA 1W0JD 4O2AA 3C98A 1JVBA 1T13A 5HZKA 1I6KA 3ONVA 3FPCA 3N8HA 1E2KA 1AS3A 3KJZA 3V7YA 4FCWA 2KYRA 2XVAA 1N7HA 1X1EA 4LDZA 1C0KA 1N9GB 3KYDA 3SM9A 3FBWA 4PTYA 5BORA 3STVA 5L51A 4NXMB 1MTZA 2WZBA 1Z25A 5LQRA 1SNYA 3KKEA 3PX2A 3DWEX 4L8LA 1HH4A 3GP3A 1L7NA 2HD4A 3H86A 1VKJA 2AJCA 4ZO8A 1B74A 3RVNA 1PSZA 4D82A 5LWQA 1Y6GA 4W4TA 1YQWA 1YOVA 3FRHA 5JNTA 3GJXC 4ZPXA 4EHLA 2YDXA 1QUEA 2I2XB 3H2KA 2HMWA 2KBEA 1J2YA 1NQWA 3P0RA 5BOVA 3GROA 3SHOA 4OQ4A 4B7CA 2A35A 5FL3A 4EIWA 1DFGA 1NMXA 1RHMA 2V7XA 4A73A 3RLIA 5AM3A 2ZWVA 1XOIA 2JIZA 3H4VA 4ITRC 2NU6B 1WMSA 2GETA 3F4LA 2GT1A 4QLAA 5TT0A 1LQTA 2DWUA 3CE6A 4M8KA 3RHFA 4E70A 4S24A 5SZHB 3REOA 5JYCA 2AE2A 4MKHA 4R8LA 4B87A 3LLVA 1SU4A 2Q2QA 4NLLA 4LUCA 4ZOCA 4FGKA 2WQZA 3VH1A 4F6RB 2AQKA 3E22B 1ZIYA 2I67A 3A27A 3DBRA 4ND6A 3C3CA 3DAFA 2PKXA 3L82B 3P71T 4TVBA 5GADl 3PFCA 3GFTA 3MPUA 3NHMA 5DYNA 1U65A 3W0LB 2PMEA 2FN8A 3SDSA 2HQBA 1YKFA 2ORYA 3ABOB 5DM4A 1GFIA 2CJWA 1A3CA 2HRQA 3OETA 2WIFA 1NUUA 4KAFA 4UAUA 1VJ0A 2IP4A 2VUUA 3GUUA 3H4MA 3VYRB 4CN8A 1JIXA 2R5NA 4RZXA 3I0NA 3V55A 4EECA 3PC8C 1FFXA 5AUPB 4N5DA 4DCJA 1UBFA 4EX7A 3PPWA 1ETHA 2NSYA 1V48A 1C9NA 2BMVA 1FQOA 1BW9B 1UAGA 2QSUA 1LK0A 1IOLA 2VOJA 3FMGA 4UDNA 4WNCA 1BFUA 2HJVA 3BZBA 2JH9A 1NUHA 1TM3E 2Z4TA 2HLDA 1C4KA 2VSYA 5B53A 4I7EA 4ZODA 5C7LO 4ZQGA 3EVNA 4B0OA 5EMNA 1Q95A 5THKA 3UNXA 5KINB 1WHSA 2QD4A 4HZUB 4C6HA 2OTCA 4R0MA 5U4XA 4G0VA 1LDNA 2CVHA 3U37A 1OBFO 3OLVA 4DYHA 4MV9A 4U1RA 4NHEA 1WUHS 3SY8A 1Z6AA 1R7RA 1KAMA 4Q3OA 2IBSA 3GCWA 4TTAA 3TX6A 1YTUA 4XR9A 1XYGA 2E7ZA 2ZANA 3BDVA 3LVRE 2AQ8A 5HE9A 1IJEA 3TH5A 1J99A 2AC4A 2F3TA 1QGYA 2DY0A 4W9NA 4CQMD 5IHPA 1JFRA 3MT9A 1M7HA 3D6TB 3IMKA 4X1YA 5E1OA 3ICQB 2AYYA 2OXTA 1RBMA 2CXHA 4QYWA 3T1VA 2PEZA 5L3QB 1JQ3A 1ZXLA 3RRFA 4AIIA 1RJGA 1SKYE 2NYRA 5HGJA 4ZK6A 1BEUB 1KF0A 1QZZA 2CK3D 1RWVA 2AX4A 4Q3NA 2ZKIA 3RPEA 3T9AA 3TRHA 4YTEA 2FUG1 4GOJA 2HGZA 5TT1A 1HE1C 1KYTA 3I05A 3SZMA 4YAWA 4TOIA 3CZPA 2PUEA 2DCMA 5KJ6A 4RMJA 4AY2A 2QI9C 2AI3A 1K1EA 1E3LA 4HGOA 1QIGA 4K2HA 3UANA 4WFJA 3ZPXA 1Q3HA 1G8SA 2X58A 3FRJA 3OMXA 3U39A 3ZY2A 4AX8A 5JZ9A 1TIPA 5GM2A 1XEWX 2R62A 2ZRDA 3FVRA 4J4TA 4EKDA 1EX6A 2WZQA 3EEOA 2YOHA 4LXXA 4PSDA 3O2JA 1JHYA 3BXXA 4LMPA 2ZYAA 3AHIA 5AJYA 4O4IA 1L7PA 1RTKA 4YRPA 1P7ZA 1Z5WA 2GM9A 5I8WA 5JCOC 2DFVA 3DZDA 1MA3A 5DK4A 4ZJYA 2BW0A 1M8PA 4R6WA 1W19A 1K7XB 4KOEC 3TTXA 2CKDA 1X3LA 4G23A 3EXHA 3KYBA 3OFNA 4R31A 3UV6A 1N1DA 3P97A 2E1PA 2WMNB 1ZJWA 3WL3A 1YVUA 4PHGA 5CH5A 3KYJB 4YMIA 1ONOA 4Z4IA 4NMXB 5CJ2A 1ZH4A 3DEIA 4R98A 1F12A 2RGDA 5CA1F 1R6DA 3FMIA 1VBNA 1SIOA 4G65A 4ZANA 3V3TA 5M7EA 2R8RA 2YS6A 1FE8A 1JLMA 5BSUA 3KELA 2QJRA 3AUYA 3RAGA 4FI3C 3QWHA 3L07A 4ZCIA 1K2WA 4RVNA 1H5NA 1EFRD 2ZK7A 1E4EA 2JVKA 1DIHA 5CMLA 5TDHA 3RQSA 3VVLA 5EERA 5LP1A 5BR1A 4FHZA 3OC6A 3TQTA 2WNIA 1F2UB 1P1CA 1KEEB 4B46A 5AM1A 1JG6A 2POCA 5IVDA 1U4NA 4ZAWA 3GJ4A 4RK0A 1VL5A 3SEFA 1H1LB 4KTVE 1YBVA 4URHA 4R9NA 3CF4G 4Z4EA 4PLZA 2HMYB 4C4OA 1HXHA 1I2MA 3A32A 3PFIA 4FNOA 4BP9A 3PXEA 4DJDC 3W04A 3ZN2A 4AZWA 3F47A 1X8JA 2X13A 1KIAA 1E69A 1U3VA 3KHKA 3O7WA 3BD7A 2DPXA 1LPAB 2FJPA 3L40A 4R3UC 3LSYA 4ARVA 5HJ7A 3V80A 4GS5A 2R9VA 4XDYA 1JA9A 3EY4A 1KSHA 1SHZA 3QOXA 3EGIA 3IAAA 3K5HA 1E94E 2DAPA 1ZGZA 2V4ZA 3ZGYA 2DUMA 1Y1KE 4MVXA 1BGXT 2COUA 4UCXA 3ECSA 1E62A 3G5LA 4TZ0A 4Q39A 3FLEA 1EIZA 2C8KA 5I7VA 3NIGB 3W1WA 3AQ4A 3GDHA 3IA7A 3FDZA 3NYIA 4EFNA 4HJXA 1K66A 1QGUA 4KO2S 4URWR 3GRAA 1JHOA 4NATA 3E48A 3Q15C 1Z34A 1ZWKA 5FBZA 2IZ5A 1RRPA 1IWBB 2YL2A 5H9VA 3SC2B 3GLIB 4KV7A 3LP8A 3KR0A 3P9YA 4BRSA 1YIAA 4G5GA 4CLDA 1WB5A 4Q9LA 2I3BA 1NOKA 2CXSA 3NALA 4EHKA 1IUKA 1XDBA 2A0FA 2GZMA 5AI9A 4ER6A 5JPCA 1DJNA 5T41A 1YIOA 2Q4DA 2XNCA 3KR1A 5ALZA 2AKAB 4ENRA 3LQFA 4RA6A 1MHPA 3K20A 1YQQA 3L18A 2FPMA 1SCIA 2XMPA 2YV4A 3WTCA 4ZPJA 1NVGA 1T5IA 2CNWD 4YJ2F 1AUPA 2JAQA 1DXYA 1RWQA 4RX1A 1JDUA 2K7ZA 1I1NA 2NTYC 1DO2A 4ESEA 3PUXA 3DL4A 3PU6A 2BUBA 4ND8B 2BMFA 3KQMA 4OHMA 2H1HA 1N4DA 4G1EB 1GRVA 4RGYA 1PT8A 3GZTB 3D2LA 5ADHA 4IXMA 1MNQA 3P9KA 4BZQA 4IIGA 3H19A 2PMFA 1UDRA 4BFSA 2V6FA 3QEMB 1DO8A 1E59A 1E96A 1CUGA 2EP8A 5KYYA 3ZIDA 2LE0A 3O0TA 5LYJF 1Q1GA 1DKRA 2OQRA 4G8BA 4II3A 3GYBA 3KETA 1H5QA 4J7UA 2Q2VA 3QMVA 4N03A 2P9BA 3L77A 1H6CA 3JAWB 1QHFA 3AFOA 2FJUA 4MDYA 4RWZA 2VSQA 2AG8A 1K6IA 4PCUA 2P5TB 1PP4A 3TE6A 3RO7A 1ZM9A 4QARA 5CAEA 2AFRA 3W8FA 3ADOA 2IODA 3JY6A 5AVSA 3WFIA 1GCUA 2V7QA 4KQHA 4TT8A 3B3JA 4RJTA 1GZUA 1Z28A 3SX4A 1ID1A 2LZ0A 3AJ8A 4PC2A 3UB2A 3N0XA 3H1PA 1PVDA 3B60A 5DSXA 2XZTA 2YBDA 5IBPA 3OQPA 4KACA 3OP4A 4DY6A 3I9OA 1E0AA 1EAYA 1JMKC 4PAOA 4Q4JB 4YO7A 1OU4A 1UBCA 3JSXA 4Y1RA 5ARDA 5ALUA 3O8QA 5D6OA 2C54A 2H65A 4OM8A 2PPLA 3ZJUA 4HQNA 5AHXA 1NYRA 1VCHA 4C30A 1JDNA 2O3UA 2GJKA 1M0SA 4AY4A 3OFVA 4D5GA 4DZRA 1Z0FA 2X0JA 2PXXA 1E9VA 1B00A 1V3UA 2CLMB 2VNSA 3EPPA 3IDZA 3UW3A 4BFUA 2I76A 1C3VA 1MOSA 1XZAA 3GO4A 5FTNA 2BE7A 2QMUA 1BKYA 3AUXA 1ZRMA 3HPQA 4GGOA 1HEUA 1CLEA 1UCFA 2BJWA 4MRAA 5G1OA 3R76A 3TLEA 2BFOA 3W3AD 1NVFA 5EYPA 3U3MA 1OF1A 1YQXA 3FJYA 1DIOB 5LFAA 2Q6VA 1KBZA 3L02A 2WUVA 1WW8A 1YGPA 4L5CA 1DO0A 4LQLA 9ABPA 3DC2A 3DR3A 3FNEA 3WA7A 4RHYA 4XX0B 4UU0A 3FHTA 4GZ6A 3JALA 3K0CC 4MR8A 3OLZA 1EQAA 2V6JA 2OHJA 1MBZA 2GD6A 4BQFA 2MINB 1WXDA 4PZYA 1X42A 2B94A 3FWPA 3W6PA 3GEIA 4WESB 3AVXA 5CFOA 3TFOA 2PRSA 3K70B 2V4UA 1YVRA 3FFWA 3FHJA 4U7PB 4WLEA 3V00A 1XL0A 1YDMA 3L6OO 4IX1A 1J8MF 3H2SA 1U4SA 4G5QA 3IC5A 5KVQA 5EWLA 4DIDA 3UHAA 3TXAA 4RFSA 3HFSA 3H2YA 1TDJA 4RTKA 1LU9A 2W6JA 4UTZA 2O8CB 1T6ZA 2IGTA 2MSLA 3CLRC 3MWGA 2QQEA 1YA8A 3MWJA 4IJ6A 4MKGA 1EIWA 3K1AB 2A86A 2HBYA 3GGOA 5DX8A 2YN2A 1I9CA 2OVBA 3AERA 5FPHA 4C0AC 5JC1A 2ZIEA 4B6OA 3GHYA 1JHDA 2LP4Y 3C7AA 1HYQA 7MHTA 2H7VA 3ER6A 4YYEA 1VG9B 3PQCA 1FRFS 3SR3A 5FUMA 1S2GA 1G17A 5IUJC 4QM6A 4R5MA 1ZJ4A 2H7CA 3MT7A 1ZD1A 2QUIA 1EVKA 4J4HA 4BUCA 3NWJA 5DCWA 3K8ZA 4Z7JA 3CMCO 1OFHA 2D7JA 1PRYA 2QG9A 3NTQA 4QUJA 1XR3A 3UCEA 1X39A 3S6JA 1CQPA 1M2OB 4H4CA 4TV8B 4RJJA 4JMPA 1H2ZA 1Z7GA 3DQZA 1L7RA 3HYRA 4PTLA 3BORA 4MA4A 1G7CA 4MV0A 3UUEA 2CLKB 1RQ7A 3QYAA 4HO1X 4IOJA 5JSFA 2YINC 2DSNA 3QW2A 4F06A 2HMTA 4BTVA 1Q0PA 2OM6A 2QLLA 4WLVA 1V95A 2Q2NA 4ZVUA 3LHDA 5KYWA 3PWKA 4HXEB 4XB2A 1E2DA 1T1GA 2HRBA 2IXGA 5IASA 1H22A 3QBDA 5DGHA 1NLUA 1KZGB 2YRWA 3VYUB 1HZJA 1KH1A 4AZ0B 2G83A 1JIJA 2XGSA 3R7BA 2WY2D 1YE3A 3CZCA 1WOYA 4RPIA 3W4JA 3H11A 3IRVA 3NW9A 3STTA 4QPZA 1G6KA 4JNCA 3DKPA 2YQZA 4UFNA 1DG3A 1XQVA 1GT6A 2GPTA 3E8XA 2PWBA 3BWYA 2V3VA 1JE1A 1L1RA 1RYHA 2E55A 5ICEA 1U0BB 4LIPD 3TBHA 7ADHA 2W6CX 1PS9A 4F85A 2BMJA 4NYJQ 3O74A 1VIYA 4B3TB 4MS1B 2BEVB 1GYQA 3P9XA 4N12A 3PLAE 2QK4A 4V1CA 4P4SB 3INNA 1ZSVA 1ACLA 3V4PB 4FGUA 5ILOA 3KOUA 2L69A 3PT9A 4O2LA 4Z86A 1WPQA 4A36A 2YVLA 2H1FA 3CLHA 2PKQP 4KLAA 4CMJA 5IZCA 4DV3B 1PW5A 4HQFA 3G5TA 2AS0A 3WB9A 5DM60 2EL9A 5EZSA 3P32A 5A5FA 2Q50A 3A70A 4U9HS 2JLRA 2J7KA 2GCIA 4FD2A 3PEVA 1ZCBA 4DA0A 4IXWA 1QS0B 2J9GA 2VHCA 3B5JA 4R1TA 4BRWA 3AKEA 4JI8B 1IM5A 1EGVB 4W7HA 2VHVA 1KU0A 2VSFA 2Y0PA 521PA 1RYDA 1IBSA 1NBHA 4WOCA 1FU8A 3QELB 4CG0A 1GAWA 1LTQA 3BILA 2HQOA 4K6CA 1DIGA 3BCRA 4R68A 5GP1A 2JFXA 4WBNB 1NMYA 3HGQA 4BX8A 2FI1A 4RPCA 4EMBA 1KDYA 4J4BA 1GKLA 1XJCA 1AA6A 2DLCX 3ZW7A 4IOKA 1AB5A 4FFNA 3U4CA 2SKCA 1VBMA 2XD4A 1JHZA 4EKYA 3UOGA 3OBIA 4R8SA 1F51E 4G0NA 4ZU3A 4EYGA 2C5AA 2PFGA 4DMRA 4F5DA 1JECA 5FKJA 5LXTF 1NYQA 1JLLA 1MB0A 3JZDA 2N9UA 3PL1A 3C5EA 2BEKA 3OX2A 4DDKA 3WGUA 2HWUA 9MHTA 3NFRA 1C81A 2OGWA 1H2FA 2O1EA 3GLUA 3JQCA 3FSGA 4CM9A 2C4KA 5JCZA 3LV8A 3WYDA 1QP7A 3VSDA 1U3GA 3FNHA 2AFIE 4B81A 1U3WA 1X87A 1JBQA 3TIGA 3L7DA 2QTLA 1NWHA 1KIMA 2J4FA 2XUAA 4CG3A 3OA0A 1X7DA 3WGLA 4JJZA 4YLGA 4MW9A 1JDBC 3EVZA 4YMLA 1RFLA 5DEOA 1GDTA 4NQRA 1FU4A 1GAJA 1JG4A 1SBIA 3PC8A 1QHXA 4HB4A 3U4HA 2YIMA 5TVGA 2ID4A 3PPVA 1BE8A 2J87A 5E7MA 5BN5B 3SF8B 1QP8A 1TD9A 4L8YA 2J3MA 3LBFA 1ULUA 2QLMA 4PZZA 1CUEA 1EVQA 2CVOA 4IOMA 4RV9A 5DGXA 2HK7A 3EWSA 5LPNA 3DL0A 5EJ4A 1VYHA 1Y5IA 3KCNA 3TWOA 1H23A 3IKVA 3OFKA 3Q3EA 1Z29A 1MJFA 1P2BA 1V6AA 4YK7A 5C1BA 5KPDA 1T4MA 4YP5A 1T91A 5LOVF 4CQNA 2GPBA 3DA8A 3MMXA 1ZD4A 2PRJA 3DEAA 3NWPA 4GMDA 4NZOA 4AUEA 3KKNA 1H05A 2IYUA 5C34B 4AMBA 4C08A 3OE1A 3CW2A 2X41A 3CRQA 5JXWA 4KQ9A 1MIHA 1ZH8A 4D02A 4D9EA 2DJIA 2F3UA 3SS9X 1E79A 1O95D 4RZ3A 4LGYA 2HPVA 4IJQA 4MMXB 3TIVA 2XNKA 3FCYA 5TVKA 4F3YA 3QWFA 1IONA 4Q16A 4X00A 1Y6FA 1UJ4A 1IQPA 4YLYA 2ZU6A 4F12A 2BJHA 1Z36A 3EISA 2QUZA 1WVMA 4MVJH 4MK4A 2NN3C 4BVLA 1C3XA 3BXZA 5JXGA 5CA0A 5LSAA 4RW0A 2D06A 2GESA 3OWXA 3GJ0A 5HIJA 3S44A 4WFIA 1XVTA 3K4HA 1T8RA 3I9LA 4P98A 1E1LA 1VL8A 3ACBA 4O8ZA 4UKDA 4E5MA 1UT6A 2F6RA 3B7WA 3KXDA 4EW3A 1T1RA 3U7HB 4GMHA 3GCGA 1QGZA 3KHUA 3LK7A 1JKXA 2CHVA 1M5UA 5D5HA 3TMAA 1YE8A 3AOGA 3TZEA 2A1UA 3ABIA 3OX1A 2YWFA 1Y63A 4ZRDA 3QA9A 1DQRA 4H6WA 5CDHA 5K4HA 4I3HA 5JCOA 4L6IA 4ZVLA 2D5BA 1P8JA 2ZJYA 3B1YA 4ZQBA 5FPSA 1L3IA 4LY0A 1MKYA 5CW1A 1JHQA 1TC1A 4FGSA 1EFTA 4FIZA 5TQ0B 2GO7A 5CEJA 3OJLA 4ZVRA 4I50F 1UFRA 1UQRA 5IK2D 1ZW1A 4XQ0A 2M32A 1RFGE 1UDWA 3FBTA 3GCDA 3HSKA 1XA3A 3PEUA 4WZ6A 4JI0B 2H3HA 2G5PA 2C97A 1I7QB 1VJ5A 1QTIA 3DDHA 2Z83A 3TB6A 3CLUD 3PQ6A 1ADCA 3BE8A 3CGWA 3WR5A 1C41A 1T6BY 2P2GA 2FZKA 5J23A 3HVRA 1OJLA 2MHCA 5C18A 1TE2A 4AB1A 3IVGA 2OILA 1LDEA 2Q1WA 1HKHA 3D8TA 2OBBA 3LYLA 1OPRA 4GI2A 1U94A 3UV7A 1K9SA 1OXKB 5C8YB 4IEIA 4KAAA 4D9JA 4WXPA 4JP2A 5FWAA 1PZFA 1PEKE 2FZ5A 4OOFA 3GQVA 2B25A 5BR8B 3IAS1 1XZCA 1RXWA 1JEAA 2Y3IA 4FFBA 1Q19A 1RPAA 4KLRA 5AW8A 1TAUA 1GGKA 2POQX 3F8TA 3ZKWA 4GLJA 4BGVA 4G0WA 4A8HA 5EWJB 2CMGA 5ECWA 1JIQA 2Q5OA 4EWLA 1VRVA 4JHXA 4WXMA 3K30A 2G0TA 1TA9A 5JLAA 1V25A 2HV8A 3MW8A 4JR1A 4BO8A 1PK7A 2O2YA 2Z57A 1EZZA 1RLOA 4P86A 4TXLA 3IT1A 4RANA 4X91A 5D85A 3ZX5A 4BNJA 4D46A 1RPJA 1DUIA 1JDVA 3I30X 4Z1MA 5GVRA 4BNWA 4HGZA 5E9QA 1AV6A 1QQTA 1KKUA 1SG6A 4QGFA 3X1WA 1PFGA 2CDRA 1Z6XA 2CF5A 3CFYA 4I55B 2CMDA 4LXTA 3WKAA 4PPGA 2H2DA 4U7HA 4E7PA 2B4KA 1A9TA 3E0XA 3BTUA 5AVUA 5KKCA 4M1WA 1GZ5A 4CMAA 4R9RA 5CG2A 1S3IA 3I52A 4RHEA 2EIXA 2WP0A 2ZJAA 2JAHA 2JS7A 4K8RB 4R9VA 1Z4NA 3Q3HA 4LZWA 4MQBA 4QBHA 2JIRA 4YQYA 3T5TA 3SWWA 4LDNA 4GI1A 4E51A 3T99A 1G60A 4OBBA 1E3WB 3MQ4A 1P0CA 3E9MA 1E8MA 2ZJ5A 4RD1A 3ZNNA 1OLXA 2JL1A 3ZTWA 3KC2A 4M0DA 1SZJG 3HWX1 3AFHA 5E38A 3IP5A 1JU3A 1TZCA 4LRYA 2ASVA 1P61B 2DM6A 3C2QA 4GI5A 1T4CB 4GZ3A 4M89A 3UJPA 3CPHA 3P9RA 5FWYB 2EOAA 2E4VA 3LXUX 4FGZA 4KI0A 2NSJA 3LPDA 4QGHA 1DFHA 4S1OA 4EYSA 1PFVA 1NXSA 2G8NA 4CL3A 2ZUBA 2VK2A 2VRBA 2ZYWX 3E22A 3TECE 5IXYA 2FSSA 3AVWA 2IZ6A 3MQ2A 1FS4A 1U9JA 1YBFA 2VR1A 4MVJF 4FE3A 4YNBA 4EMUA 4NXNB 1L5HB 1YJAA 1CVLA 1I14A 4OIFA 5K8IA 1DPGA 1I80A 4ZD6A 2E1RA 3QP9A 2H92A 5ALOA 1GWNA 4NX2A 3JAKA 3TR6A 5U1PA 4F21A 1GPWB 1PLLA 2PRZA 4CCSA 2BFDA 4NK4A 1IXZA 4BC1A 4H3HB 1ISIA 1KMIY 3D31A 3X3HA 1LDMA 3B70A 3OM8A 5IEJA 2C2XA 4A8JB 5JG7A 4BUZA 3F1LA 2W2LD 2PCLA 3O4HA 3OM1A 4IUBS 3RFUA 4MKXA 1BW9A 3E9NA 2VBIA 1SWVA 2KX7A 2LCFA 5CIYA 4RS4A 1R6BX 1AT1A 3SEZA 1GPYA 2J32A 4JBNA 4MEJA 3SHFA 4A7PA 3B1FA 3AIOA 1G21E 2GCOA 4JLPA 4QQRA 1TIKA 3EODA 4OGFA 3EQ8A 3X44A 2FLKA 2XMZA 3IEXA 3T54A 5K8JB 3MK31 3L0BA 1WHTB 2HJSA 3U4MA 1A96A 1PEYA 2GYVA 3Q9LA 4PC1A 2ZE8A 5JO9A 1SCBA 3QKWA 4QIHA 3GRPA 4HTFB 4TXMA 4C87A 1ONSA 1H0SA 3CTPA 3D0QA 2QRZA 1R37A 3HKEA 3QEJA 4LGMA 5IM4A 2J3DA 1UMKA 3FGOA 1T4BA 2B4RO 5I01A 5F21A 2XLBA 1SAYA 2Z8YA 3F7NA 3OQ6A 3V3KA 2IU3A 1B6RA 4UMFA 5B1DA 5CDTA 4CIBA 4NYJR 1QR6A 2ZIVB 1XYVA 1XHEA 2GCNA 2BCGY 3GIDA 3B2EA 4JB8A 1YSCA 3F4KA 1HEYA 3EAQA 4B43A 1BE6A 4IIHA 3W7AA 2Y1XA 4H1TA 3ZOKA 2AXPA 3L9XA 4S2EA 2P9TA 1YFZA 1H3FA 3TLGB 1XEWY 2QE6A 4FEAA 3HEMA 2YY5A 4XX1A 1LW6E 2XQGA 2Q99A 2ERXA 2FVYA 3KHTA 4LHYA 4BYMA 3PE6A 4PONA 1DGQA 5J2UB 2C84A 1MXHA 2A0WA 1LFAA 1FDIA 5ESDA 1NAHA 4DUGA 1ZSNA 2H2HA 3FETA 2IQIA 1GITA 3ZS8A 5D3MA 4IHAA 1O7JA 1DINA 4RK1A 4C0XA 1M2WA 4XFJA 1DZIA 3K0CA 3ZW9A 4OFBA 2BM8A 3EQ7A 2XDQB 3T94A 1N1GA 4OXKA 1IRXA 4YRQA 3JXEA 1NA5A 1GPH1 4DIBA 1GY8A 4FWIB 4IGKA 3VKWA 3SJBA 3R9KA 1U2DC 2IS6A 1R0KA 3ROFA 3TLXA 5FA8A 3AMVA 4CHGA 1PT7A 4NICA 3E7DA 3AR3A 4N5HX 1KZ1A 2YMMA 2HMSA 3T4XA 1WS6A 3UMMA 4WQMA 1HC7A 1KEZA 2GPYA 2WEKA 2A3RA 5MHTA 4LYFA 4AF8A 3KKPA 2JFBA 2JJYA 1QB8A 1O03A 2BKLA 1E6WA 1V1JA 2JPDA 3PD1A 5CLGA 4B71A 3EIXA 3DOUA 1K63A 3DV0B 3FE2A 3IAXA 2PEYA 2WU3A 2GA9A 2H48A 3H75A 4IIJA 5EXXA 3RC1A 4M0LA 2C2GA 3T5GA 2CXQA 4EEXA 3RS8A 4ADSG 1IBLB 1FL9A 2FK8A 3W5DA 1F2UA 4HY3A 1KEEA 4GDFA 2QTAA 4LKOA 4WN9A 4D9IA 4AUNA 1RXUA 2QUJA 3F5SA 1KE2A 4E7OA 1UIMA 3LFUA 1TUGA 3G2OA 3UENA 1GV1A 3VNSA 1TB4A 5JR3A 4MP6A 4TMFA 5M3BA 2OZEA 4F1WA 2V7EA 4JL8A 4KQJA 3BYZA 3H9CA 3CZMA 1X8KA 4OPMA 3SEAA 3U49A 3ZGNA 1TCVA 3L4JA 3U13A 1FQKA 1HETA 3QA3E 2XUKA 4IYJA 1XMPA 4FCTA 5AJWA 1E2GA 4GC9A 1KDTA 3OFSA 1JQDA 2Y1EA 4RKEA 3QLVC 4G24A 1ACJA 4R2LA 4G97A 3F0TA 1QVZA 4CFYA 4YH1A 1DBPA 3D4PA 3GB9A 5DMHA 4IR7A 1I5OA 4P84A 4CM8B 1DAMA 1L8XA 2J59A 5DVZA 1BMFA 1XLUA 5JAQA 4PX5A 2C98A 2FY8A 3UCFA 2PKRA 4NS4A 3CBGA 3FXAA 1VL6A 2OECA 4YECA 4PYLA 1VHLA 1OWPA 5SYAA 2P5UA 3UGQA 3UYKA 4FHDA 3V4LA 3HO1A 1JS1X 4RH3A 1KHHA 2X76A 4GR9A 3AG6A 3I1JA 3ROTA 3L1UA 1I01A 2CNNA 1Y1TA 4BE4A 2JANA 2RGRA 4WXYB 3FOCA 4QU8A 1JJFA 1ATZA 4J7XA 3DNMA 5TMPA 3SSMA 1VE5A 1P33A 2HI0A 4LBYA 3SC3A 4B2PA 4EHFA 4RL4A 1OJ7A 2ZRNA 4X71A 4C4YA 1FP4B 1IXRC 1S9DA 3RU7A 4EW1A 3DHNA 4J0KA 2V65A 2RAVA 3DMGA 3S8EA 1DEAA 2C57A 5F52A 2R86A 3WLMA 1T4DA 3IJRA 3OEED 2R00C 3WWOA 3THXA 1N2XA 3QXHA 2PTGA 3LLMA 1DBIA 2W6MA 2J3JA 4D0GA 5L8VA 1SA0B 4ND8A 3AL2A 3CRZA 4TXJA 2ALJA 1DLIA 1OD6A 1ZCZA 4HX2A 1F2TA 4QX6A 4TKUA 4U3JA 2NV0A 3QY9A 4Q05A 4QVKA 3OKCA 5KOJB 2R1VA 4TLDA 3HH8A 3UH1A 2FWAA 4KREA 4AMVA 3E3OA 4NECA 4ZU6X 1XF1A 2AOTA 5DXJA 3LC2O 1Y9AA 3QEMA 5THXA 3BXHA 4OXNA 5DXFA 4JQZA 5TQ2A 4CI9A 4GPAA 1IZ9A 1O94D 2HSDA 2NUBA 1AIPA 2PSSA 1RVDA 1NVWQ 4LJ8A 4B74A 2FPRA 2LDBA 4C76A 2V1UA 4FW9A 3AUFA 5K7SA 3ESBA 4EYEA 3P26A 1EWTA 4LNAA 4LF6B 4YMVA 2G88A 3K0FB 2FW0A 1C7JA 4RKYA 5SZJA 3SS8A 3I3OA 3EAFA 4LTNA 3VVMA 3L04A 1SBQA 3OC0A 4QXMA 5BVHB 4CKBB 1NF2A 4TMKA 1KPGA 4Q4DA 1DP4A 3A6KA 4X1KB 5AK3A 1N3YA 3AKDA 4ZOAA 1YR3A 3PQ4A 4W6QA 1FLAA 1AHPA 3FIUA 3GPCA 3SYLA 1DC4A 4P53A 4B8WA 4KFUA 4BVGA 4N18A 3F98A 1YU9A 2ONZA 4YRRA 4L07A 1KAEA 3AVUA 3KWJA 2FCRA 2JGRA 2VTVA 5B7QA 2ODAA 3PZBA 4Q48A 3FNGA 5CB4F 1KAHA 1FQWA 1IG0A 4N3CA 1JEYB 1VL1A 4DPKA 3WL6A 4K9OA 2JFVA 1YJXA 1C1XB 3H5AA 4LRSB 1AKQA 2NACA 1A0OA 5EMLA 5KTSA 3MGKA 4ZIRB 1A1VA 2HF9A 2PWPA 4HNHA 3OPYI 1BNCA 3Q7PA 1I7LA 1RJDA 2IIVA 4G1BA 1UZMA 2QLFA 2VK8A 1IXKA 4HDMB 3NEJA 5BV0A 2IPAB 3FAZA 2GJ8A 1P5FA 2IV2X 5CA1A 3GG2A 1BE1A 2D2VA 4I9NA 3RAPR 5BSHA 4KYTA 3WP1B 2FQYA 3LE8A 1ECFA 3ANTA 3A9UA 1NF9A 5FOXA 3FF1A 1L1EA 3ZW8A 3QSGA 1Q5PA 1FRZA 4HBZA 4LC1A 1FNBA 5DBOA 1N6KA 3C4VA 3NOOA 1R6TA 4WESA 1U2PA 4PHFA 4PPYA 4ENSA 5CU7A 1K6MA 1J2UA 4DEXA 3I92A 2AW5A 5EUQB 1W0CA 4QXOA 2VQEB 2IYSA 4HQLA 1WLSA 3NPAA 1T3ZA 2Y6VA 4I5IA 4TKMA 3SZOA 4C43A 2FX5A 3PYXA 2ZSIA 3HKDA 8ADHA 1CIJA 3CIFA 4XASA 5G0WA 5FWXB 3LFHA 5LMNB 1XFAA 3TD6A 2KWIA 4DA9A 3TUZC 2WJVA 1JAHA 2GN2A 4TN5A 3P1JA 3IQIX 4J49A 3TJZA 5GVSA 2UUAB 1TLFA 3REGA 3G3EA 3JAMA 3UJ3X 1SIWA 1VG8A 3O2SB 4NONA 4ZAXA 1P2GA 4OM7A 3K9CA 4PQEA 3UT5A 3T3MB 4IF6A 4UDXX 3KT0A 1QLHA 2GKOA 4E30A 5KDOA 3ZC3A 3AVYA 1ECPA 1ZMRA 1F6DA 2OV8A 2Q62A 3KT6A 2FAXA 3DZFA 5HEKA 3VPSA 2I9KA 4GL2A 3NGMA 2FP4A 1BXRB 4JUAA 4MUKA 2ZI3A 2J45A 3DE2X 4HDKA 1LC3A 3FB1A 5JSYA 4I19A 2OAEA 1WP9A 3BXPA 4QGSA 3O83A 1F8UA 2GJAA 2JZCA 2K2QB 5IFKA 4IW3B 1PE0A 3IPXA 4D26A 4C7OB 4WWHA 1PJRA 3QBEA 5FV7A 1GLNA 3B3GA 3F1KA 4MQLA 1JEQA 4EHJA 3ND5A 4F5ZA 4W1PA 3VI3B 5KVVA 2Q3MA 2XOXA 3IAM1 2D5CA 4RSMA 1XCBA 3ZCQA 2AR7A 2PZKA 2AG1A 4JYZA 5GM1A 3BPSA 2OD7A 2NUTA 4A6XA 1BDBA 2GWHA 1HE3A 4Z4GA 2CEAA 3UFXB 1GZDA 1Q21A 2ET6A 5CCEA 3E3NA 2WIDA 4YJ2A 2ACVA 2WIBA 4XXHA 2MCFA 2O54A 1TF7A 2XNHA 3AY3A 5EI5A 1Z0SA 5IAOA 3IIEA 3ZVNA 5JAOA 2NWQA 5F1PA 5TPWB 1BXZA 4UEJA 1HL7A 1S6YA 2BKUA 4ZT6A 1TI7A 3G9XA 1CR4A 4QG7A 5FYDA 3R9IA 4AP5A 3PGXA 4ZQFA 5EMHA 1H8ED 2Z98A 1T8YA 4FYKA 1YZ3A 4L27A 5HM6A 3G89A 3UUFA 5KTKA 1BVUA 1UKCA 2DBZA 1BD4A 4MLDA 5H0IA 3B9QA 4XJXA 3A26A 4ZJUA 3FGPA 1Q7GA 3ZGVA 2X42A 3HQ4O 2XLCA 5LYJA 4N47A 2X5XA 1FSFA 1VJRA 1OPXA 3PDJA 2QAGC 2AFHB 2RI6A 3JYPA 3QKRB 4KDRA 4FZRA 5EIXA 4OX9B 3AFIA 3TF5A 3ODPA 1G2OA 1Y9JA 1PT9A 4BQIA 1J09A 3VU0A 4P9NA 4ABTA 1ID8A 2ADMA 5F51A 4RHTA 3UB3A 2ZBPA 4N01A 1MIOA 3EJ6A 4RK4A 3R74A 4E15A 3K2BA 5JLJA 1MG5A 2Q3JA 3V7NA 1T3HA 3AM1A 5E9AA 1IN7A 2PXAA 1OFVA 3OE7D 3SCZA 2G71A 4DLRA 5MN4A 1YR9A 5HUHA 2WJIA 4NOJA 4M2LA 3TAXA 4JSTA 3VM6A 1II0A 4YMUA 3DM5A 3CZQA 1XZKA 3WB2A 4BJ1A 1A2OA 4OL0A 3MRVA 2HK6A 4MS4B 5E6UA 5HS4A 1U9YA 3JZMA 2JCGA 3L06A 4IXDA 2EYUA 4PG8A 1OLSA 4Q0MA 3URMA 1QIMA 1P1FA 1C9JA 2BSAA 1JR3D 2E4YA 2R2GA 2VYFA 3E4CA 3H9JA 4HWOA 4JXZA 3EVGA 4YAOA 2W42A 1NATA 3R3JA 4C4AA 3Q72A 4O4JF 1Q11A 2AZMA 3OCYA 5FULA 3ZUGA 3KDPA 4JJFA 3T1TA 4PRYA 1EFPA 5FB3A 1SXJC 1ABBA 1VA5A 4LF9B 4QM7A 4RH1A 2HZ7A 1L4EA 2IYFA 2LD4A 1WXFA 1XVAA 3KYIB 3WFZA 1H3EA 5EN4A 3R24A 4M36A 3RFFA 3FPJA 1ZAYA 2A7XA 1DB3A 3KAPA 1L4BA 2EFYA 4TLAA 2QY6A 1I2BA 3N5KA 2PQ6A 4X62B 2Q6TA 3PQ5A 1LA2A 2JCSA 4X63A 2WJ3A 2B1RA 3C3DA 3NIWA 2IIBA 4BQQA 1DMSA 1X2EA 4LEIA 2GD0A 4MR7A 3H1EA 3IT3A 4BFVA 1NU8A 4UDYX 1ICIA 1QXSA 3O92A 2D8AA 3DAOA 2FE4A 3N2KA 3D0OA 4FLFA 1KI7A 3JZFA 3A06A 4MQUA 1OIWA 3OA2A 1A9XB 3BWVA 1RBZA 3PD0A 5ITZB 1PSDA 1UKEA 4FCCA 1XMIA 3TKAA 3UOAB 4CIXA 3KVVA 3L4SO 2PSEA 5BN5A 1BTOA 1V37A 5DW0A 4BQOA 1OV4A 5EVJA 3SDZA 5BW4A 1MGOA 4OHKA 3W4KA 3BHJA 4Q12A 4KZKA 3GPLA 4K9PA 1IM8A 3G0DA 1Q57A 3LM8A 4Z6KA 1APBA 4J1SA 2PFSA 3NFYA 4HAWA 2A8YA 2J9ZB 4JNKA 1VE1A 2O2HA 3DF9A 4P08A 5TF0A 3RIYA 1EM8B 1ODTC 3Q10A 1ECGA 3E0QA 3I12A 4IQ0A 4HUQB 2F9MA 4EATA 1KZ4A 4PG4A 3WBFA 1VFPA 3BD8A 1AUQA 4N54A 5MFPA 1PR0A 3AOEC 3VJKA 5CB8A 1GO2A 1MQAA 2NQTA 4WKPA 3KT3A 5ELXA 3CNBA 1M3SA 1RRMA 2BLLA 3BMNB 3DUFB 3F46A 3L0ZA 4GT1A 2HFKA 4L85A 4M49A 3HA3A 1V5EA 4QODA 1TU3A 4GPTA 5TEWA 1GEGA 1E77A 4BB0A 2H2WA 1V1MA 2H59A 4LJAA 1OZHA 3ET4A 1Y8CA 2CZCA 4CDGA 1ZINA 3UA3A 4F4DA 2CLLB 2J5BA 4HX5A 1ETUA 4D9GA 4AMZA 1XZNA 2W2KA 3E9CA 3R5JA 4JT2A 2F90A 3R3XA 2OAGA 1XTRA 4P3KA 4C2UA 4JOQA 3O8LA 3ANMA 3ETGA 3DE6X 3ABRB 3V8RA 3VTFA 4WK0B 2AOWA 3PEWA 2A9RA 2E4ZA 5B58C 4I4LA 1U0RA 3SQDA 1VFNA 4OH7A 1R6UA 2A5JA 4HDAA 3RFCA 1G8GA 2ZBRA 1WJGA 3RR2A 1COZA 4PZCA 1ORHA 3H9GA 3PLRA 1JG3A 4QUGA 4CMEC 1ONNA 2NG1A 3NAMA 4TUYF 2O19A 2R79A 2QRQA 3EZXA 4YIKA 1Z8FA 5FTKA 4LFCB 3PNBA 2GVZC 2YV3A 3G59A 2JGNA 4HPJB 3TAUA 5LU8A 3PCTA 1L5FA 2XZDA 4FLMA 4IDBA 4OV6B 2EQAA 1ADBA 3CW8X 3EA5A 1RPTA 4RJKA 2ZE7A 5G1NA 1J90A 3AKZA 2ONKA 4HDQB 5TQ0A 3N28A 2YHUA 3QKSA 1F4PA 4RO0A 5K0JA 2UYYA 4PEVA 1IN4A 2C4TA 2G9UA 3A6EA 3IAUA 3LPLA 2QW0X 5CVCA 5EKSA 3ZHQA 1E58A 4D9NA 4DA8A 1FX1A 3CVXA 2WB2A 1NN1A 3TL3A 1ADJA 2Y1KA 4PY2A 2GNAA 5TMBA 1R18A 3TDMA 1I0LA 4P4NA 3G2PA 3KV3O 5A4MS 1VHJA 2I6TA 3P8ZA 5D00A 3DFIA 4MMYB 4EUNA 2JLZA 1RZ3A 4ZQIA 2G4LA 3ZI7A 2QR5A 1F17A 2RAPA 3C5HA 3HZZA 1M1XB 2VZ0A 5AKYA 4X1IA 5FDFA 4AJJA 5ALIA 3LWZA 2D1QA 4WIAA 5FUQA 2G07A 5J3JA 3BDIA 3H5NA 3KKMA 2XCRB 1FMFA 2ZU0C 4OGWA 3MBOA 1RWKA 1Z88A 4BLUA 1P62B 1QU2A 1S3GA 3I4LA 5JALA 4KQMA 2A59A 2WSBA 5G0SA 3L84A 2P6PA 4E6EA 4H7HA 4C6TB 4XCXA 3ONWA 2B99A 1ORVA 3H3JA 1ECCA 2X2FA 1P3DA 3VR4H 3JQFC 4OLHA 3MYYA 4GMGA 2XT6A 5IJ9B 5KC8A 4UBLA 3RVSA 5CBPA 7AT1A 1ZHOA 2OK7A 2YIJA 3QLVA 3VSBA 5AVXA 4NZYA 3D8RA 1TUBA 2UYOA 3QXXA 3JQAB 4LV5B 1Y37A 4E4YA 4EHDA 5HRAA 3AH8A 3AJAA 5ALWA 1DQNA 3JRXA 4UUAA 5GAJA 3W5CA 2ZDGA 2IJGX 1TTPB 3R5TA 5DRYA 3HRKA 1FSZA 3SXPA 3VZPA 3ZLUA 4RD4A 3CPJB 5EZQA 3T0IA 3RREA 2QRGA 5EJEA 4R8VA 1ISFA 3FTEA 3M5WA 1U2TA 3VNVA 3WDKA 4HOYA 1P1IA 1H6DA 4QU0A 4CQMB 3C8DA 3TVDA 2XMDA 1L4LA 3LUJA 4HI0E 4NSNA 4Y1GA 2ZJOA 1UC5B 4JJGA 3N0RA 1QHHA 3VDMA 5FEMA 4G4SP 2GK3A 1QH1A 3OO1A 4GQBA 2XUIA 3WMGA 4DMLA 1BX1A 2BZ0A 2XYHA 1REQA 4JLSA 1T15A 1T4CA 4BNDB 2XDYA 4FZVA 4CEIA 3N70A 3SE0A 3BXEA 3U31A 3UY4A 4BKRA 1GUAA 4OXIA 1NXTA 2G5CA 5JDCC 5L7YA 4BVBA 4RNDB 3EB9A 3R0QA 4P93A 2X4LA 3A1UA 2PG3A 3ZLBA 2AEJA 4PLCA 2SCUB 3VR2D 3I61A 5A1JA 1KOGA 1NTOA 3A6HA 2R00A 3F49S 4KRGA 1TMYA 2B21A 5L6MB 3ANNA 4TRNA 3HCNA 5B1SA 2AZDA 4IGIA 3NJ4A 1EB9A 1EFLA 2JIBA 3H0CA 4BWFB 3F6RA 2CNDA 1A7KA 1SUDA 4IEEA 1AMNA 1ODCA 2XF8A 3E1SA 1U1CA 4EFDA 3AHFA 3DPUA 4H4EA 2RHBA 2XQFA 4MUFA 4B2LA 2CBXA 2YC2C 4U02A 1NASA 1YS2X 4PCAA 3EGWA 4PNZA 1ZD9A 1Q0SA 2FGJA 5DLQC 1EUDA 1LRLA 2Q8NA 3DWIA 4C3UA 2FPIA 3C3KA 2C7BA 1CR1A 2QM8A 2Q3EA 3I2KA 3M4XA 3VAZA 2WP8J 3BRQA 3M9LA 2AOXA 4KBGA 2ID7A 5KU1A 2WM3A 4GE0A 4RAOA 5E2IA 3VFDA 3A2LA 1GNVA 1YGYA 5HM8A 3TD2A 1PUIA 4WJKB 5ADWA 1X9GA 2BBTA 1JV2B 1G8KA 4W1SA 1GQOA 4MKRA 1GQQA 3DVAA 4DMCA 3MM4A 4TZ6A 4ENTA 3AILA 2QB5A 3IHKA 3NHAA 1CERA 2WWWA 4Q3EA 1M6VA 4R41A 4Y2UA 1T35A 2FEAA 1XQ6A 1P0IA 2O0MA 3D3KA 3P2KA 4L0DA 1CW2B 4OQDA 3WIDA 2NU8B 5K3SA 4XB1A 3GPDG 3L7KA 5CPFA 1LNZA 4HQOA 2WM8A 2I91A 3QFHA 3HB0A 3TD9A 2X5NA 2H08A 1MORA 1EK1A 3LUGA 2YWHA 3Q7RA 2Y4NA 3MOSA 2O2EA 2ZWMA 5F76A 1P8AA 1T24A 1ZJJA 5T3YA 3TLGA 2ECPA 1UPBA 1FP7A 1JSRA 2B1IA 3OCXA 9LDTA 1N78A 4RPLA 3CCBA 3QOWA 4PYOA 2ZJ7A 4MCIA 1KERA 1X7XA 2O50A 2ZCUA 3KOZA 3L79A 5AW1A 1V5FA 2VPWA 5J2UA 5DGTA 3HCCA 4FPXA 3G8AA 2FWBA 3MJSA 3NAGA 5K20A 3JD4A 4F11A 4Q15A 1W6RA 4F4CA 2EATA 1FDUA 4JUDX 4Z8XA 4EFLA 1QF7A 2XDQA 2M6LA 1GUYA 2X86A 5IDWA 1BC5A 1JEEA 4HNRA 4CKWB 5GPBA 1WU7A 4JBLA 3TR0A 1UBEA 2A58A 3MRSA 4C7XA 4F8JA 2E5LB 1QTRA 5TQJA 2RHJA 3R41A 5LMZA 4O6VA 1U3CA 5IDVA 2XKAA 5LDDC 2ADFA 4XCQA 4Y9UA 2YJ3A 1S9HA 3DFUA 4NH0A 4XWYA 4F91B 3RADC 4JEHA 2Q5FA 4KIWA 4F4FA 1FFHA 1Y8RB 4N0PA 4LDRA 4IP0A 4V02A 1Z75A 3HTXA 2BGRA 1TFRA 4EZIA 2C3OA 3OJEA 4GL4A 3QKIA 4J0FA 4BL5A 3QNMA 4MI3A 2Z6VA 3DDZX 5E3IA 3VYVA 4EG6A 1JJ7A 1FDVA 3L2OB 1G8YA 4IZ6A 4XWAA 5DB4A 3Q2IA 4N9WA 2J0UA 1XQ1A 3IPLA 1B8OA 1BH2A 3M6FA 3L1KA 4C3OB 2C1EA 1YO6A 4H7EA 3BVPA 1E6EA 1YB5A 3V7WA 1KFJB 4P4GA 2NU9B 3RUIA 4NFSA 3L4KA 1WA5A 2AMJA 2RJ3A 2V45A 3W05A 1Z35A 1CRLA 1F4LA 2QYSA 3MGCA 4ZEVA 2N46A 1J0CA 2X5KO 1BH6A 2PFKA 1L7VC 2OO5C 4B44A 2W5UA 1NV9A 2WSSD 3DDUA 3EF3A 3KEOA 4V2IA 1GD1O 2GPAA 5AICA 2FWRA 4F72A 4PANA 2IXDA 4EW2A 2O4CA 1ABEA 1CUHA 5ARBA 3RH0A 2MYTA 5ED4A 4FWBA 1RBYA 1U9ZA 1XZIA 2P3QA 4L9SA 4AZ3B 1D04A 3ZU5A 2NTVA 2NADA 3L0CA 5JCJD 1JXOA 1E2MA 1HV8A 4BO3A 5DCUA 2J5XA 4F97A 1ZLYA 1NUSA 2EF1A 2I1WA 5JAMA 5HF5A 4GX0A 2IITA 3THYA 2Z8YM 2EKLA 3DMDA 3N7TA 4KPGA 1L8OA 5IM5A 1Y1SA 3VKUA 3HNPA 4MV8A 1DL5A 3CUVA 1XNJA 4GR5A 4RIFA 4MVJA 1GNRA 3PJDA 2Y0EA 4OXQA 5KOYA 1F48A 3GG9A 3WKBA 1E3JA 1DWOA 1UC4B 2GZAA 1KC1A 4WDRA 5HF9A 3TQSA 3K15A 2CD9A 1EGAA 1T5LA 1WQ3A 3SQOA 5CT6A 5BWLA 1ODSA 1Y1QA 5MGNA 4NFHA 2JK1A 3WGVA 2H1IA 1FP4A 2P9FA 3K2QA 2ATIA 1QQBA 1USIA 3E81A 2WWVD 3PT5A 4PU0A 1QC5A 2JGDA 2J6CA 2P6UA 1SR8A 2ORIA 2JARA 2QAGA 3ND7A 1O4VA 4UTRA 3C6YA 1IY2A 1JEOA 2XGGA 4X0EA 4BX2A 1SC6A 1T5BA 1IVYA 2CLEB 5EE1A 4YJHA 4UHHA 4JCCA 4KCGA 3HXPA 1NI4B 3C6KA 4RNCA 2C88A 3ZE1B 2CN1A 3JX9A 3IPRA 1Q0UA 4RLFA 3CXRA 1IY1A 2ONJA 1G7SA 3VR5H 1ZZEA 3BULA 1CDZA 5SZIA 4PE5B 4PIPA 1MRSA 3MBKA 2R44A 5LNK1 4EJ6A 1HA3A 4JKOA 4UXJA 2B1GA 3RWOA 4QOHA 1HDCA 2HJWA 3N05A 2XW6A 3ADPA 3K4PA 3OEYA 2ICAA 4LHSA 2FEWB 4GOLD 4TYPA 4G25A 1OXXK 3BIJA 1WXGA 4RVDA 5JBIA 2ZBGA 2RONA 2WSMA 4AXBA 2ZI9A 3FH0A 5JU6A 3KUDA 3AEKA 5G0UA 3R8CA 1A9SA 1TAGA 1USWA 2C2YA 2ZR9A 3BBPA 3T3GA 1SXJA 1A7AA 4YRMA 1YE5A 3B12A 4YJFB 3QE9Y 1OB5A 3FVWA 1QG0A 2GVDC 2JGIA 2HL6A 3KFLA 2NVUA 3KQTA 3ZCUA 2GM5A 4DCGA 4V0RA 4CXMA 2VBGA 3A37A 2YYYA 4BNLA 1S02A 2R8EA 1XNHA 2WHPB 2BLNA 2NO0A 1Y1LA 1NVXQ 3WIVA 1XPUA 4OFWA 4R8MA 1DAEA 4V0KA 1ZH0A 5K8UA 4V38A 2Z5GA 2MR6A 3B38A 3GJSA 2O3JA 2I1LA 1FNSA 2Z2XA 4Q1BA 1IEWA 2BEWA 3OMWA 4C88A 5IJZA 5AKZA 2XTAA 3HVHA 3LBHA 2NGRA 5DN6A 1YRQA 3E5RA 4MJXA 4RMNA 1BHJA 4IXNA 4DEVA 5B57C 5B6IA 5CDSA 2WHQA 1LSJA 3WMXA 3GN2A 1K89A 3AB7A 1E99A 2OXIA 2FRDC 3G2MA 1O0BA 2D5IA 1J1IA 1G3UA 1S8FA 2C5HA 1CP3A 3FSEA 4C6SA 2EEPA 4ESOA 1YRAA 1DX9A 4J3FA 1U7OA 2WVJA 1ECLA 3GVHA 3N2LA 4IDGA 3SFVA 4F2WA 4OXYA 1T5OA 3FNRA 4FKMA 1UBMS 3WLFA 1XWFA 4KSYA 4J0JA 1W9HA 1Y9ZA 1C9KA 1HDXA 2YXEA 5IDYA 3L7LA 4D56A 1G2QA 1Y9DA 2BYTA 1JSLA 2XXBA 4ZT4A 2XCIA 3T34A 1F9AA 1NJGA 3V8VA 2IU4A 3AOEA 4OQXA 3VU9B 5EJ5A 2HX1A 5KTOA 3JTEA 2QZ9A 1UKVY 1VHWA 1R2QA 2PZJA 4EG3A 1L5QA 1R4AA 3G5UA 1DKMA 3QOFA 1FYVA 1INLA 1XPOA 2YY7A 4YAJA 1WD7A 4DC9A 3PQ3A 2R68A 4LYAA 5AR1A 4YV7A 2FPWA 2R8ZA 3PJFA 3QTLA 5JASA 2UXCB 5BPFA 3R7AA 3B9BA 4BNMA 1WUYA 1Z5VA 3R8XA 4M9ZA 1U90A 4K46A 3P0EA 1JLHA 3FYTA 1K8YB 4QU9A 4E5SA 5HTKA 3DTVD 2VT3A 4YMGA 2G17A 1VDZA 4DC1A 5JI2E 3LBNA 1YF3A 2DQZA 5KNLA 4A5SA 2I4TA 4K1XA 2YV5A 2BI7A 4OAQA 4OLBA 3JVEA 5JJIA 1GN8A 1Z5UA 3B20A 1NVAA 2ZWIA 4QFDA 4DHEA 4GXQA 1QWOA 3HRIA 3U7QB 3ZGZA 1G20A 3CF6R 1PR3A 3R5KA 4MGKR 1EE9A 4K9QA 3B6EA 5IG2A 1IEXA 1O96B 3HR4A 1YNOA 2DUNA 4INPA 5IUNC 2AMVA 4CMEA 1P4GA 4KRFA 2Z0MA 3NAZA 4B1FA 3C3MA 4KPEC 1NJ6A 3M6WA 1FUYB 4CT5A 1MENA 3I5UA 1R5OA 2F17A 1ODKA 3U44A 5BPHA 3FSRA 2X5JO 2P30A 3NORA 4IJMA 3GMIA 2JAUA 1RBQA 1XUOA 3U1VA 4IV5A 1Y7IA 4ZVVA 2OA0A 4DJFC 2D0OB 1UZAA 4D8WA 5FXMA 3KQVA 4LECA 4RTLA 2AD5A 2HA7A 1XTUA 3NDIA 1CS0A 2F3PA 1T3SA 1JMYA 2HMUA 1QTNA 4UUOA 3G13A 4IQGA 4P7GA 4E2FA 1H2AS 2OV4A 4EUHA 4LYHA 1XALA 2O0JA 1C7QA 1NRXA 1P0MA 4KIUA 2FUKA 1U0OC 3WV5A 3ZIAD 2ZCJA 2IC5A 1SD5A 3HA7A 5IXSA 1KFKB 2VS1A 3D1JA 4GYKA 5EE0A 1JAXA 4L1KA 2QJOA 3K7EA 1QM5A 3LA8A 1YDHA 1TKCA 3ODGA 1VKZA 1OX5A 2RHOA 4GNKA 3NYQA 3EFOA 4MOWA 4YJGA 3BICA 3QU5A 2QM3A 1ND5A 3TXXA 1QIEA 1YQTA 2BM0A 3F7MA 3PNPA 5I7FA 1YB1A 2PGDA 1RRVA 5DH9A 5FUVA 1C0IA 2B2NA 2HA4A 2ZB4A 3BMQB 3D3JA 4XD7A 5FCDA 2Z9CA 4W1QA 2H1VA 4PFKA 1R74A 3E5NA 5IS2A 5EIAA 1O2DA 3QVJA 1VB3A 1Z8NA 1T2DA 2R4QA 1K88A 3LAWA 3C24A 5FOUA 4UREA 4K3UA 1UWVA 3H65A 3JQFA 5L3ZA 3TQFA 2XKBA 3ZCTA 5JCPA 3QVUA 3PHHA 3IIIA 5JUWA 1Z73A 1FJ2A 3ORRA 1IXSB 3I9V1 2DBRA 4JP5A 4MI9A 1I3NA 4LPKA 1M76A 3LXXA 5EHQA 1Z6GA 4QO7A 5THQA 3AL0C 2XQKA 4TWAA 3SG0A 1DAKA 4XYGA 3QTBA 2WU8A 2OFFA 2DWOA 1TPZA 1U31A 1CC1S 4N7MA 5U4QA 2O8EA 3PGA1 1NF3A 4AJLA 5CB4A 3LQ1A 2BGGA 3U4QA 1GAQA 1XU7A 3BKWA 4Y2GA 2AT1A 1GZSA 5MFZA 2ZJZA 2OLJA 3NUGA 1IB6A 1OAOC 1QFJA 4PZLA 4CBVA 5E2AA 5L40A 5LA6B 1W47A 2IEYA 4QTYA 2WWTA 2O8CA 3PEFA 2F55A 4X8OA 5JS8A 2FKAA 5JSZB 2XQJA 3U3XA 1CT9A 1K8ZB 3G9QA 3PC3A 1V2HE 5BYJA 5BV1A 4FOOA 5FQOA 5LP6F 1EWRA 4LJ9A 1Z0ZA 3I37X 1HQKA 2OGSA 1N0IA 2R7MA 1QP4A 2X77A 5BT8A 1IFXA 1OLUB 1B0AA 5JDCA 1UXGA 4Q9HA 3KJHA 5EE5B 3RG2A 1P5ZB 3CEPB 4I4TF 4KOAA 4XYBA 1L8LA 3DAPA 1XQWA 1M73E 4PPNA 3GLFB 4H7JA 2WB4A 1A1SA 3LHSA 2V58A 1C9DB 4CW7A 3GARA 1Q1AA 2G4VA 1R9NA 4M0MA 4FDVA 5FRDA 3TCXB 3PDWA 4FM9A 4A6DA 1EGQA 1LPSA 2FZGA 2QL5A 3AF2A 3DAHA 4X61A 4BNKA 2HHAA 2ZKLA 1N0WA 3ORYA 2FG6C 4TM8A 5AO9A 2NXCA 2Z2YA 4K88A 5JADA 1SO8A 2PVSA 7REQA 1HLDA 1LJ8A 1CUJA 1IHPA 2GTHA 3V4FA 4L5BA 2QTCA 2FQWA 4W5HA 4DC0A 3DOHA 3P0FA 4NNPA 4QPJC 2FXIA 2WTXA 3A6LA 3OLYA 4RF4A 3ZXSA 5IDXA 2QZPA 2EFGA 1OA1A 2VDRB 4M55A 1KZ9A 2YYAA 3PE3A 2YHAA 4FHEA 1P9LA 1U99A 2XECA 4B76A 4G1MB 1CY2A 2WMDA 4S0XA 2WWHA 2OQIA 2PLRA 1SUIA 1HQYE 2MSEB 2Z09A 2FW6A 3D54D 3HYSA 4IS2A 4NE9A 5CFLA 4D43A 3LU1A 2EZUA 1XMSA 3QM1A 3VNQA 4QU5A 2ZPTX 1QHEA 4KXQA 3JASA 2J5QA 2ZYTX 1KEPA 2B78A 3AI1A 4QA9A 3QV2A 4DIKA 2I6XA 2FETA 3RWMB 1B8VA 2NVWA 4TVKA 2GK7A 3WLQA 1WKVA 4JV5B 1WXXA 4Y7DA 1G1MA 2E6UX 1LF5A 1RJ9B 3LOUA 4EPRA 3MTJA 4ERNA 1KY5A 4WZAA 2OCLA 4OMFG 3NHLA 2QDKA 1MAAA 1TTHA 1OYOA 1V16A 2IHJA 1SVNA 1KSFX 2IOHA 1F60A 4HAVA 4M99A 1W0JA 1ZNQO 4XKJA 3VV2A 3MINB 5D86A 2GM3A 1XZDA 1ISSA 3ZD8A 5DNUA 2VDVE 3UAVA 2FH5B 3SHWA 5JD4A 2V5VA 2C9OA 3D7LA 3HFGA 3ZXYA 1KI3A 2YN0A 1V2GA 3ZV5A 3BE6A 3ZJ4A 4P7KA 3BX1A 4B17A 2G8LA 3B1KA 2V96A 5TGTA 4B48A 4JEMA 1GPKA 4DLKA 3V4RA 3MYRA 5IN5A 3OF3A 4AZSA 5A2QA 4WNAA 4CLRA 3IQFA 3I8XA 3RS0A 4C06A 5C8ZA 3FTQA 4EG1A 1R5BA 5TY0A 2H2AA 4JC5A 1RKBA 2EARA 2OXCA 3DXXA 5C4MA 2C4NA 1DQSA 3B85A 4QTZA 1D2AA 4P7BA 1R9JA 5AVYA 5IW8A 1GADO 1VKNA 4IH4A 4IV0A 3C6BA 2GF0A 3BJIC 4JELA 4OMDA 1G8AA 2BISA 1KJNA 1UH5A 2HUNA 4JB0A 4I6EA 5H4HA 4B82A 4C9BA 5JCXA 1SCUB 2VCHA 1NY6A 5IVPA 2J07A 3HCRA 2D0DA 2ZJFA 2FWIA 1O5TA 3PFWO 1M2EA 5CFPA 1EXWA 2B82A 1NQTA 1U3DA 2D62A 4HRVA 2PS0A 2PT9A 4EJSA 2BCJQ 1Z0JA 1ONPA 2H4WA 3ZZ0A 4NCBA 3LIIA 2D7DA 3N2NA 1K3TA 2HHLA 3OZXA 4JLOA 4DLLA 2E3JA 3QVMA 1NGSA 3EZGA 1TLTA 3I23A 3HNRA 1YASA 4YAIA 1A9PA 5DISB 1R10A 3G9TA 1DBQA 1XMOB 2CNOA 3DE7X 5JD3A 2OO5A 1N6OA 1OBHA 3JQBC 2NNLD 4A23A 4G0UA 3IUYA 4O4JA 3FCXA 5AK4A 4GF5A 5LLSA 1NVDA 2H1OA 4LX8A 2JGMA 5IJ9A 1LJUA 1NBMD 2R7KA 2JJ1D 2DFDA 2YXLA 3HBLA 4NP6A 1KE1A 2GXQA 1CUUA 2XMGA 2EWMA 1DWUA 3QLEA 2DR2A 3TFWA 1DKOA 1RYBA 5LB4A 2C1ZA 3GFBA 5A71A 2HU8A 1K8RA 5DF1A 5AW5A 4IPTA 5AQ1A 3BE4A 3A14A 3QVGA 5IYZB 3ENVA 2Q9UA 2MTBA 3HYLA 3MLBA 4BU1A 1I7PA 1SC3A 3PRYA 4TXHA 4B7ZA 5E7IA 3G0BA 4MIOA 1G4AE 2GA8A 3CE9A 1O95C 4QRDA 4TSRA 3SIPA 4CQMA 3GLIE 4KX5A 4M8SA 1BSVA 1OXVA 4H77A 1RJEA 2Q5HA 1V3QE 1JQEA 3C3JA 1I30A 4MO2A 4MRNA 3PLNA 2YUTA 4GXNA 4QD3A 5AM5A 3K1TA 4NWIA 1QYDA 2GS9A 2I6GA 3P9PA 4JC0A 5IKMA 4MQFA 1GARA 1U8UA 2CK3A 4WMLA 1QK4A 1E1QD 1E2QA 2NO4A 3IVCA 3O90A 4DL9A 2JGKA 4L02A 1JG7A 4BNDA 3L01A 3B78A 3U3DA 1WY7A 3VOTA 4QC2A 2VPQA 2C9YA 3ZD9A 2F8LA 2FN7A 4RJIA 2QX4A 2ZSAA 4DABA 4MROA 5CGQB 5HZHA 1FCJA 4HDRA 4NRDA 3ZBUA 5CFNA 4DTIA 3P9NA 4C7VA 2B36A 4FFDA 3LGXA 4FOLA 1QRRA 3D5TA 2GAOA 1BS2A 2VH2A 1J8YF 1ZESA 2IDZA 1YZNA 1XD9A 1Z7EA 3NH6A 3RJ9A 3DTNA 3ZLJA 3SXUA 3KQWA 3WWZA 2HREA 2QVXX 3RASA 2QL6A 3HKCB 4OO3A 3THOA 1G4HA 4KMMA 5C7OO 1P1BA 1L5GB 1NBOA 1VI6A 2XUPA 5DNWA 1WPXA 1RAEA 4X85A 3CZAA 2Q5CA 1ZVKA 4QOJA 3EYWA 4CGYA 3UPDA 1ZD5A 2VHUA 3AYZB 1RYFA 1VSQA 3LHIA 4II7A 5CVTA 1FIUA 3JYQA 4KYIB 4IXTA 1KJ8A 4BRZA 3CLUC 1QIJA 1LW7A 1TO1E 5LXTB 3VAYA 1EAMA 3TUJC 2F62A 3UWSA 5EVCA 5IAJA 4FT2A 1LV7A 4KBYA 4LYDA 5DLYA 4AROA 2H1CA 3OOEA 2C9BA 1N2SA 1CETA 3IVMA 1Z7WA 3FOFC 3UC9A 1EFRA 2FV8A 3ASYA 3JD2A 3ZI0A 1K0UA 1BAPA 1ANKA 4QREA 4BRUA 1PU2A 3GRKA 4PCVA 5CFZA 5K05A 4FMPA 4JJ6A 3CUTA 3TOVA 2BFBB 2KQUA 3UG7A 1TUEA 4PR3A 1B42A 1EFUA 3FOAA 1YCGA 2BUCA 2IW1A 3AU8A 1Y3BE 2QRLA 2YVKA 1J25A 3RU9A 4QATA 1O9BA 1QV9A 1WUIS 3QG5A 1QCDA 4TUYA 3OQMA 1QPZA 3ZJVA 2NMVA 2LKCA 5H83A 3KZVA 4X95A 3VBCA 4TTTS 1Z37A 2KW5A 5FI0B 8MHTA 3G8DA 5EJFA 4WA8A 2FQQA 4X41A 3EULA 1UDXA 3ZJ5A 2XKJE 1T9BA 4L3OA 3C97A 3T06B 3GA5A 4TXNA 4DIEA 1GG2A 3ZD6A 1WMAA 4JYAB 2ST1A 1UBOS 2PR7A 1JHUA 4H0FA 1PVVA 2N47A 2J9RA 2UUPA 3QPWA 4MI1A 4ZJPA 3MS4A 4QT4A 3H5VA 3LD9A 1UP6A 1MG0A 1SM4A 4AYXA 2ENWA 2K2WA 2LUOA 2CXUA 5L95A 2UZ4A 3Q6MA 2FRDA 2ZVDA 2GMWA 5T3UA 2QD2A 1T5TA 2AJDA 1UM9B 5B2EA 1R88A 3EGDB 4NPCA 4AO6A 3U9SA 4Q9NA 4JROA 3VUEA 1DDGA 1SXIA 2P0EA 3GJ7A 2KHZA 2OB2A 4HHEA 4ZYWA 4BLQA 3FTPA 4XD2A 1OI7A 4UXHA 3H6GA 5AKIA 5EXEA 4JOSA 5DPMA 2H5JA 1UJ5A 3MG9A 1NHGA 1U8YA 4DKXA 3SZGA 3I1IA 5ALJA 3DWFA 2CNWA 2CYCA 4X5OA 1JIUA 3THRA 3ZVLA 3DD5A 3NMUF 3MT0A 3NEYA 1SOAA 3FY4A 5IKOA 2WFLB 3EEYA 1W8DA 4LJ4A 5E0OA 3TYXA 4BECA 2RAFA 3HYTA 3GN1A 2C4WA 1D2MA 1VLMA 2ZPUA 1GPDG 2VXYA 4DCMA 1JP7A 1MO2A 1GL9B 1W36B 3UAXA 2QENA 1JX6A 3F4BA 2WHXA 1IY0A 2PBRA 1DPFA 5BSFA 1TTQB 5LJLA 3OT1A 4MTCA 3NASA 1PKXA 3JQ9C 5KB3A 5A9RA 4K03A 3TPZA 2Z1DA 1L1QA 4IIVA 5LQNA 3HZHA 1YCFA 3T3EA 2X8JA 1H42A 3PNVA 4N49A 3S55A 1LQUA 4QQNA 4I50B 5K2OA 2IY9A 4GD3Q 2J6HA 4DIOA 5I5GA 3Q3CA 1Y8QB 4UEQA 4LF7B 5JEEA 1JKJB 1DUSA 2WF5A 4AZ3A 3IKLA 4CV3A 1TJ5A 5TR9A 2AVNA 2BM9A 5KO2A 3WAKA 2ZWAA 3PXGA 3WNDA 2ODEA 2F9FA 1D2GA 1NFQA 2WDPA 4HMQA 3RRNA 2JIMA 4CKYA 5KX5F 2QTWB 2NTNA 3GFRA 1PNTA 3AL3A 1GUZA 2A9VA 1LRKA 1TRKA 2OPHA 4X7PA 4W9MC 7ABPA 1X7YB 3ZG6A 4DRYA 1QRSA 4TRJA 2ZZNA 3TI7A 5FI1B 2G80A 2VKTA 1R9GA 1PCXA 2TRSB 2V9PA 1D0IA 3S28A 1CTQA 3JATB 4ICIA 1AQJA 1A4XA 5FTWA 4C78A 3FOEC 4FDMA 5GWXA 4F92B 4MEAA 3HRHA 1M8JA 2CGEA 3DO5A 3ZNOA 2H5LA