4RV5A

The crystal structure of a solute-binding protein from anabaena variabilis atcc 29413 in complex with pyruvic acid
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
364
structure length
364
Chain Sequence
NTIPIGIALAQTSNVALLGQEQVAGAKIAEKYFNDKGGVNGTPIKLIFQDTAGDEAGTINAFQTLINKDKVVGIVGPTLSQQAFSANPIAERAKVPVVGPSNTAKGIPEIGDYVARVSAPVSVVAPNSVKAALKQNPNIKKVAVFFAQNDAFSKSETEIFQQTVKDQGLELVTVQKFQTTDTDFQSQATNAINLKPDLVIISGLAADGGNLVRQLRELGYQGAIIGGNGLNTSNVFAVCKALCDGVLIAQAYSPEYTGEINKAFRQAYVDQYKKEPPQFSAQAFAAVQVYVESLKALDTKNKVSKIQLPELRTELNKQLLTGKYNTPLGEISFTPIGEVVQKDFYVAQIKMEKDGSQGKFTFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Amino acid/amide ABC transporter substrate-binding protein,
publication title The crystal structure of a solute-binding protein from Anabaena variabilis ATCC 29413 in complex with pyruvic acid
rcsb
source organism Anabaena variabilis atcc 29413
total genus 138
structure length 364
sequence length 364
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rv5A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rv5A01
3GBVA 1GLGA 1P6QA 1ZH2A 1PEAA 1Z2EA 2MYUA 1EFAA 5IUKC 3CKMA 3EAFA 1W9HA 2PUBA 5B3JA 1HEYA 3BREA 4G0PA 1DBQA 4TLMB 2IPMA 4JP1A 4LX8A 1DJMA 2I6FA 3RVQA 1USGA 3SQNA 4IMJB 3OQOA 2PUFA 2N9UA 1QP0A 3HUUA 4Q6BA 1ZAYA 3I09A 3NNNA 2JRLA 1MB3A 4MPTA 2WY2D 3CU5A 4Z4GA 4Z9BA 5BRJA 1TVMA 3MA0A 1TLFA 3JY6A 2E4ZA 1FSPA 2QW1A 1JYEA 3GRCA 1P2FA 4PZ0A 3T6KA 3URMA 4PE5B 1Y1LA 3QELA 4MS1A 1U0SY 1JHZA 2V0NA 1PHRA 5F64A 3KLOA 2RDMA 3CRNA 3F7NA 4TN5A 3T38A 3FGZA 5KQLA 3TD9A 2QXYA 1ABEA 2ZWMA 1A0OA 1ABFA 5DTEA 5KC9A 5JS1A 1NTRA 1QKKA 1Z26A 1ZITA 4OLAA 2HPHA 3C6QA 2LP4Y 3Q9SA 1E6KA 2MSWA 1FFGA 2F8SA 1BVHA 2QR3A 5D2CA 1ISRA 2MYPA 3CTPA 3MF4A 3EODA 3QLVA 4NQRA 5I4CA 4UHKA 1EAYA 3VNAA 1EWKA 2IYNA 3JS5A 3QX8A 4IMIB 4MR8A 3VNBA 2A9QA 2O20A 3KYIB 5BQ3A 4MLCA 1ZDMA 2HQRA 4KQCA 5TPZA 3HVRA 5HKOA 3MM4A 4WT7A 4RWEA 5IUJC 3HO1A 5T7BA 4YR7A 4PICA 1NY5A 1RZRD 7ABPA 3EQ2A 1TJYA 1AB5A 4RK1A 1YS7A 1DCFA 2FEWB 3KSMA 4RZSA 4WWHA 3SAJA 2FLWA 3RQIA 1XWWA 2XDYA 4YS6A 2LBPA 8ABPA 4KZKA 3HM9A 3LOPA 4Q7EA 1B00A 4H3HB 3JTEA 3CZ5A 5KQGA 4LZLA 1ZESA 1DBPA 1DZ3A 3A3KA 3Q7TA 4IILA 2H0AA 5FWYA 3LUGA 1SXGA 3F6CA 4G0QA 4Z99A 5TQ2A 4ZJPA 1I3CA 5IBQA 1A04A 3I42A 1NXPA 2FQYA 2WJAA 1JFTA 1QQBA 3C3WA 1YS6A 4KK4A 1M5TA 4WZZA 1M5UA 3L6UA 4OBBA 4B09A 2R48A 2FEKA 3JVDA 4KPYA 4JOQA 3R0JA 4TMYA 3QEMA 4RSMA 1RXIA 3IPCA 1F4VA 2E4UA 4L4UA 3D8UA 1APBA 4DQDA 5TQ0B 3H1GA 4EVSA 5TQJA 3CZCA 1EWVA 4RV5A 1YVUA 4DN6A 2NT3A 4F06A 3KLNA 3A0UA 1DBWA 2MSKA 2CHFA 4MS3B 1D1QA 2L17A 3GT7A 3P9YA 4D6XA 3UUGA 4YP9A 3HCWA 4ETIA 1YK1A 5DGCA 1DRKA 3KJXA 1JYFA 3W9SA 2A9OA 3MQ4A 3LKBA 4ETMA 3G1WA 3RVSA 1ZH4A 2MSLA 2JCGA 2RJOA 3IP5A 3QEKA 4RKQA 4FB4A 2CHEA 3NNSA 4LRQA 5JS2A 3N0WA 2JVKA 1MAVA 4RXMA 4YWHA 3O75A 2IPNA 5CNMA 2L18A 2L2QA 1A2OA 3KCNA 4QPJC 3BBLA 5TPWA 4G86A 2VUIB 1FFWA 4RK4A 3EGCA 4O1IA 2YHAA 6CHYA 2GWRA 5EWMA 3A10A 3DGFC 3HK2A 4RY9A 4H60A 2WMYA 3OQMA 4Y9TA 4NCAA 4S04A 1CYEA 3MIZA 4XAQA 1IIBA 3CG0A 2W42A 2L19A 2A9PA 2GX6A 4WUTA 1ZVVA 4XLTA 5TPWB 1QPZA 2PUDA 2FLKA 1KRXA 3M6MD 2ID7A 4JA2A 3QLUC 3TB6A 3GL9A 4OG2A 3OO1A 4F12A 4W5NA 3RVKA 2FMFA 4G0OA 1QQAA 3QLTA 3SG0A 1SXHA 3IP6A 3OLZA 1RZRA 4QICA 1NXTA 2GI4A 4P1ZA 5C5EA 2ID9A 3FDFA 1JDPA 3CNBA 3CS3A 5HQJA 3BRSA 4LDAA 3O1JC 3Q7RA 2FMKA 1JDNA 1URPA 1YMVA 4RK7A 2A9RA 3JPWA 5B3JC 2PJUA 1QP7A 2R4QA 3OLVA 2RJNA 1ZHHA 1LBHA 2FMHA 3FFXA 4G0ZA 1NXVA 2FN8A 4NICA 5FBHA 1ZY2A 3RH0A 5C5CA 1PUXA 4MR9A 4MLDA 5TE9A 3K9CA 3Q41A 3H5VA 4S05A 1NXXA 4G97A 1PNTA 2PUEA 4MS4A 3LMKA 2BGGA 3K4HA 3QELB 4MS1B 3SNKA 3DLBA 3HDVA 1EWTA 3Q7SA 4UHJA 1TM2A 4F8JA 1KGSA 2WWVD 4W5OA 4YRZA 3GWGA 3M9XA 3LFTA 3N8IA 1K68A 2FXIA 2PMCA 1LJUA 2KYRA 3IP9A 3N0XA 3OLXA 3HJFA 1D4ZA 2NZUG 3FFWA 3H5IA 3UK0A 1RNLA 3O2JA 1U8TA 4LE2A 4O1HA 3ROFA 5CHYA 1LK0A 4MGEA 4G0MA 2CD7A 2HJ9A 3ROTA 2LPMA 3O1IC 4MR8B 4W5QA 1W25A 1ZN2A 2PE5A 4RY8A 3HV2A 1TMYA 3G85A 2YHBA 4EUKA 3BRQA 1BA2A 1Z17A 2IDMA 4IGAA 3QLVC 4OTZA 2JB9A 1DC7A 3RVRA 5ABPA 1MVOA 3E3MA 4CBVA 4H3KB 4E7PA 1VPWA 4NV3A 4L85A 2QSJA 1MIHA 3ILYA 3NBMA 1L5ZA 4F11A 4MQFA 3RVOA 5JNWA 3C97A 3MMNA 5EWJA 4ZMRA 1NATA 3KKEA 1LJLA 5CNJA 2HQOA 3H6GA 5FWYB 6ABPA 2E4XA 3IP7A 4N0PA 1OXKB 4RXUA 1Z13A 4MQEA 5TQ2B 2MYNA 1K66A 5BR1A 1FFSA 1DCKA 4XARA 3RVPA 4EYQA 4LE1A 3OQNA 1BAPA 3O2SB 4YV7A 3H5LA 1KMIY 3QEMB 4RK5A 4EVQA 4Z4FA 3ILHA 3QK7A 4FE4A 4EYGA 4FE7A 3OMXA 4D74A 2NT4A 1D5WA 2MYTA 4MQEB 1PEYA 3LKVA 3O1HB 1JWLA 1GUDA 1RPJA 2P9HA 2PKXA 3RVNA 5HSGA 1GUBA 3KTOA 1BDJA 1L5YA 5E3JA 1WETA 3HS3A 2FW0A 1YK0A 2PUGA 3F73A 2AYZA 3O21A 3LUHA 2GKGA 4IRXA 4Z0NA 3D02A 2VUHB 4G0YA 1XHFA 4GPAA 3LUKA 4N47A 3UKJA 2FMIA 1JLKA 4MAAA 3CLKA 5KI6A 3HDGA 3C3KA 2FTKE 4XASA 4NCBA 1ZGGA 4KVFA 1SXIA 2JVJA 4N03A 3HUTA 1RXEA 1CHNA 3LUCA 2IPLA 5IEJA 5FWXA 3SM9A 3E61A 2JVIA 2IOYA 5DCLA 2RGYA 4XFKA 5JNRA 5HM6A 2B4AA 1U2PA 3CHYA 1DC8A 1PNRA 4N76A 1R8JA 5IX8A 1EHCA 5FBKA 1NXSA 4JASB 5BRAA 5EWMB 3KYJB 2R47A 2E4WA 4HNRA 5IULC 1JFSA 4YO7A 4KQ9A 3HZHA 4YCSA 4D6YA 3OM0A 3H1FA 1SD5A 4P98A 1ISSA 2R25B 4M88A 4MR7A 2QU7A 4YLEA 1VRVA 3DLHA 1QO0D 5DLEA 5GQSA 1QNLA 2JK1A 2P4UA 3M9WA 3EDCA 4HNQA 1Z15A 3KHTA 3N6VA 4RK6A 3S99A 4Z4EA 3FFTA 4MYRA 2PL1A 4OATA 3H6HA 4ZYLA 2IPAB 2PL9A 4MR7B 3MYYA 2QV0A 2B1JA 3IPAA 3N0RA 3GV0A 3I45A 2FN9A 3TX6A 1JL3A 4RXTA 4QYWA 4Z4HA 1S8NA 2CWDA 4ZMSA 2FVYA 2TMYA 3T8YA 4EYOA 3H5OA 5JNSA 1NXOA 2HSGA 3GBPA 1J56A 1JX6A 3H5WA 4RK0A 1KRWA 1AB6A 1DG9A 4JAVC 2VK2A 3TO5A 1C0EA 3JVIA 4MR9B 3GA5A 1E6MA 3LUJA 2WRZA 1ZGZA 2FKAA 3H75A 1U04A 3NHMA 4MS4B 5JNUA 1E2BA 3H1EA 3RVJA 3LUAA 4KRFA 1BDIA 1P6UA 4Z9AA 1YMUA 2PUCA 2NZVG 2ZAYA 3CFYA 4RKRA 3HEBA 3T95A 2JBAA 1YTUA 1F51E 5GOTA 5KC8A 5JNTA 5PNTA 3TMYA 1T34A 1JF8A 4HYEA 1CEYA 2LUOA 9ABPA 1Z18A 4PEVA 4EVRA 1D1PA 3IDOA 5ED4A 3NHZA 3C3MA 4KK3A 1VLZA 1Z16A 3EQZA 3OMWA 1M2EA 4QYMA 2JBAB 3H5TA 3CG4A 3JPYA 5CNKA 1D2AA 4KREA 3NNDA 1FQWA 3O2QB 1DP4A 4JB0A 2E4YA 5IC5A 1GCAA 3EULA 2E4VA 3QX9A 3GYBA 2IKSA 1C4WA 5CNIA 4EGSA 5KQPA 1P8AA 2FQWA 3I5AA 1Z2DA 3L49A 4ML3A 3KG2A 4O5AA 2PAFA 1JH9A 4XXHA 2M98A 4RS3A 1JFVA 4MQFB 1QP4A 1GCGA 2OQRA 3OLWA 5EWJB 3EJWA 4GNRA 4Z4CA 5TQ0A 1SRRA 3DGEC 3N75A 3N53A 3RVLA 3A0RB 4W5RA 3HXMA 3LUDA 4KNYA 1H9CA 5T3YA 3OM1A 1M2FA 3FMVA 4MS3A 1QO0A 5IEBA 4KV7A 5EWLA 4EY3A 3LTEA 5JNVA 2FQXA 2J48A 2VYCA 4MRMA 5KWSA 4Q6WA 4RDCA 2GBPA 3B2NA 2Q5CA 5TPZD 1USKA 1Z25A 3F6PA 2NUBA 2WJWA 2PUAA 5KQMA 4JB2A 3KS9A 5EWLB 4WXEA 2X7XA 2QVCA 1U2QA 4MRMB 1JBEA 1YIOA 1DCMA 4EYKA 3Q15C 1E6LA 4ZPJA 4IF4A 5IUNC 4F3TA 2QVGA 2WB4A 2M1ZA 3BILA 1MB0A 4KMRA 4W5TA 3OO0A 1XHEA 4G0XA 4WXMA 1OXBB 4TLLB 3LUFA 4LDZA 1LBIA 3HSYA 4N0QA 1VKRA 4OLBA 4HNSA 2DRIA 1USIA 3O74A 4Z4IA 2QZJA 1BDHA 1NXWA 3OLYA 4RU1A 5DKFA 2OENG 3QLUA 4PYRA 4N41A 1DRJA 3DZDA 2F8TA 2LIVA 1Z12A 2FSPA 5FWXB 2H3HA 2AYXA 1QMPA 3DBIA 4DADA 4ETNA 2FEPA 2PLNA 4LE0A 4E7OA 4KFCA 4YGXB 3RVMA 2HQBA 3SY8A 4RY0A 1UDRA
chains in the Genus database with same CATH superfamily
1KL7A 2IHTA 1RJFA 2PZGA 2ORVA 3F3YA 1S1CA 1U0JA 1VXOA 4E2FA 4ZZ3A 3WHPA 2C9ZA 4KI0A 4X7PA 1TQ4A 4PC2A 4I7EA 1NTOA 1VFPA 4M2LA 1WTCA 1YWGO 1B0AA 3QVGA 3RVQA 3UXYA 4IX9A 4QUBA 2CNWA 1JECA 3OZUA 3DCNA 4NR0A 5TLSA 1MO6A 2JRLA 2VT6A 2CW5A 5AM0A 2ZAIA 1VE5A 5HDBB 3NVKI 1B6RA 4NG4A 1X2EA 5CU7A 2PFSA 4YV2A 7YASA 2BHSA 1MW9X 3MUNA 1M6NA 1Q0SA 1SA0B 2YWXA 1GZUA 5BSKA 3K1TA 4IIFA 2XWQA 4TTSA 3OTOB 2G4VA 3DXZA 2GHTA 4J91A 4PY2A 5FJJA 3E05A 3IPXA 4AURA 2VJOA 1DTWA 1V6SA 3FWHA 4W4TA 5BNWA 1JILA 1FYEA 4CM5A 5EHXA 4DA7A 3I61A 2E49A 4UPVA 3EG9B 1NVTA 2R11A 3MFYA 4L1KA 4DIBA 2VTBA 1WZ2A 5L8VA 2HWUA 2VHXA 3EZFA 3KLMX 4FMPA 2HRDA 1G8GA 2PV7A 3BMXA 4AKSA 3O90A 4HSGA 1IQ0A 2N3ZA 4LPSA 3OZDA 2G7ZA 1JDZA 1M34A 2YTZA 4X1KB 2CVZA 1H4SA 2W6NA 5CIWA 2ZT6A 4EFDA 3TJMA 1KKLA 1SG6A 2GJ8A 1JGTA 3CUWA 3PF8A 5EEGA 4OQQA 2IQ5A 5B4UA 3ZVLA 2IIBA 2PRSA 3WXMA 4FCCA 2HQRA 4HAUA 2DGDA 2IYUA 4M7RA 2J30A 5GWXA 1IXKA 4DZRA 5FI1B 3CIFA 5TT0A 5HKOA 1CUAA 3MM4A 5D5PA 2AFHA 2RARA 1AS2A 3C2QA 3RUIA 1AKWA 3HO1A 4N39A 7ABPA 4R8KA 1CJUC 4L15A 1M76A 1DCFA 1JHAA 1P9RA 3TQCA 3SVLA 1KJZA 2JIBA 3NW9A 4WDRA 2C2ZA 4YC7A 4I1OA 3G2HA 1WXEA 5CDGA 1DBPA 1LK5A 1GXSB 4R8RA 5BN4A 3HBFA 1XDDA 1CUFA 2XZDA 3RYIB 3X1KA 4ALMA 5FWYA 1ZH6A 4JUFA 3HJUA 1UBLS 1MOZA 3W6OA 3ZCTA 3BQ9A 4UNIA 4F3CA 1GL9B 2YINC 4PYMA 5HRUA 4G4SP 4BX9A 2IUYA 2VP5A 5IDVA 4OBBA 3WK8A 3X2SA 1QGZA 9LDBA 4Y1GA 1PTKA 2C4UA 4JOQA 1YDEA 3LAWA 5DI3B 4P3YA 4DDMA 3G8BA 1A76A 1F4VA 4CUZA 4ILEA 1Q0RA 2C3OA 3G5LA 3IIJA 4P54A 4TRRA 4J16A 4AL4A 4LHVA 2QT9A 3W78A 3HKEB 1APBA 3FUTA 4UBOA 3BGIA 2AEEA 3OE5A 4GKBA 3BFJA 1HEIA 2BHLA 3HC7A 3KDSE 4AN0A 3CVUA 3IJ5A 4ND8B 2ZK7A 4N54A 2C7RA 3PQ4A 4BNHA 2CNKA 3G02A 2VKQA 2QTCA 1W7AA 3MINA 3A4IA 4UDNA 2NXWA 2A9JA 1VP9A 3L1UA 3VR5H 4B4VA 1N5MA 1WB9A 1GPYA 3G23A 3OQIB 2O8VA 1H2HA 4DXAA 4IEIA 3T4PA 1OPXA 3DCIA 4DR3B 4H1TA 1FRQA 5J4YA 1B0UA 4YMSA 1W85B 4D92A 2G8LA 3A4MA 3KOYA 4MMZB 3RFCA 1B4DA 4JT2A 5AVXA 1JU9A 3MJEA 3ETJA 1NU6A 1RT9A 2A1TS 2QN3A 2CJWA 2UVPA 2WJJA 5FUXA 2OV6A 3BA1A 2DP4E 1KYTA 3BICA 5KX5F 2UDPA 3G8YA 3HZZA 4B3CA 4ZQHA 2Z98A 3H6KA 1GT6A 1R8SA 3L0DA 4G2TA 3F71A 2QE7A 4HDKB 3WB9A 2FFQA 4ZVMA 1FDTA 2V9PA 1OB5A 4A2QA 1QHEA 2KMLA 4DANA 4A15A 1PGNA 1XCGB 3EF1A 1BIFA 4X54A 1UZAA 3ZE0B 4XKJA 1P0CA 1HRDA 2GVDC 1XU7A 2JATA 3PXUA 2CE7A 3U7HB 4RY9A 1ONOA 3S70A 1N75A 2AGVA 3D4BA 4NCAA 1CUJA 4P7FA 2Y1WA 4F5YA 2BEUB 3D81A 5G1NA 5JVDF 1UZUA 2VATA 4HB0A 5FBQB 4U5XA 5BYJA 4DC0A 3V8EA 2Q8PA 5D86A 3OMLA 3F8WA 4HPWA 4FBMA 1PR6A 4TTTS 1G38A 1WCYA 2DFNA 1OYYA 2VVTA 1NC1A 2ID7A 2X8LA 4C6SA 4C7JA 4LF7B 3AVVA 4FYPA 3EBPA 3A1UA 2XE7A 3DFUA 3JQRA 1XCPA 3NGMA 3P4UA 5BR4A 3GRUA 2X23A 4JLPA 1JFTA 4FD3A 4AKGA 5JAMA 4Q7KA 4H4EA 2OKCA 2GI4A 3B38A 4FVTA 4OLJA 2VQEB 1XP8A 1IEQA 5J43A 1QCZA 2IF0A 2Y92A 3I58A 5HOEA 4BX8A 1EFPB 2QN2A 3I9LA 2ADOA 1C1XA 3JWEA 4X91A 1VMDA 3O1JC 3AU8A 3DQQA 3Q7RA 2EFEB 2Q4RA 1URPA 1NVEA 3Q1LA 1M75A 1P4RA 3S2ZA 4TVSA 5HCNA 4GL2A 5AM3A 2A30A 3ONVA 1JXQA 4FFPA 2WICA 4UM9D 1OWOA 1P62B 3CCFA 3OLVA 1NQXA 3KKNA 2ATIA 4QG3A 1UBMS 2OK7A 5J47A 4QXRA 5K6AA 4Q47A 4DOMA 1TJPB 1TZBA 4H0CA 5AW7A 4B4KA 4G97A 1HV8A 2D4AA 3IUJA 4DDUA 3CW8X 1N2CA 3F6RA 1RIIA 3BRWD 1BWSA 3CM0A 3K4HA 3X0DA 3ZXUB 3I9JA 3CRW1 4KE9A 1DQNA 5B3LA 3AO0B 1H0KA 2ZKIA 2IEZA 1VIAA 5C81A 1OYOA 2EEPA 3FPAA 4O2RA 1X7XB 3DUFB 4XQ0A 5F23A 2ZYWX 3SR3A 2H8GA 1YKGA 3LRXA 2ZTSA 2KYRA 5MF6A 1SXJE 1QGAA 2RHWA 1KWGA 4WV3A 3I73A 4H6PA 4BGVA 2HB6A 2NO6A 1S2OA 1CR6A 1X1AA 2PUTA 4G0MA 4LOLA 1H05A 3AG6A 5IKEA 1LCIA 3ROTA 3IQGX 3BC1A 5TQVA 1DIBA 1M54A 4KYVA 4BNMA 2CVPA 2KS6A 3TI7A 4Z1MD 5CXQA 5IF9A 3M5DA 1Z6XA 3O8QB 4JLMA 4L4SA 1LUAA 1QDEA 5DV9A 2CHQA 1XN4A 5EGSA 1OI4A 3KSDO 3IODA 3T3DA 1H6BA 2FRXA 1S89A 1U3CA 4ZOLB 3WIBA 4W8OA 1DC7A 3JYNA 4WN9B 5A5DA 1X7ZB 3EBLA 1GN9A 2R8XA 4P82A 4IS3A 5DJ5A 2I22A 4FOSA 5CDUA 4K2HA 1IHOA 1TYAE 4FCTA 2A3NA 4K7JA 3D43A 2XGJA 2GBFA 2C9DA 5EJFA 1YMQA 1EQAA 2GJAA 4IDCA 2R5WA 1DOZA 3MCUA 3PNPA 1GWNA 3KAQA 3EVNA 3SP1A 3VOSA 1QHXA 3HZOA 5ICEA 1Z13A 5JC8A 2JLWA 1A2KC 1Z4QA 2AJTA 1VL5A 4JJAA 4JQCA 4EY6A 2XTZA 2QRLA 3I2YX 4RC9A 5HRAA 1NDHA 3Q7PA 4D8TA 4FGZA 5JNLA 3BN3A 2P2YA 3M70A 2QNBA 2QXTA 3ZLTA 3A6GA 1XDZA 3B2QA 4IBOA 4RVUA 2A9FA 3ZHTA 3PEWA 3B1JA 3KQVA 3O1HB 3AKEA 4M49A 1O0BA 1H3FA 3FYUC 3PQCA 1XXLA 1JEJA 1MABB 5PGMA 3GLRA 5EHZA 1C0PA 1E79D 1I13A 2H1CA 4WESB 3F73A 1VOTA 3O21A 2F55A 2GKGA 5IJ9A 4TQUS 4OGKA 5J63A 4PM4A 2PKYX 3ZK7A 4RTKA 3GRYA 1JHQA 4FW9A 2Y1EA 1Z0IA 1Y7HA 3F8TA 3G2LA 1T1GA 1NQUA 2G9NA 3TL3A 1O03A 3VV2A 1IUOA 2XVMA 1ZNQO 1LX7A 2PD3A 1JB9A 1JLKA 2WPDD 1EUDB 3OPVA 4MAAA 2XBMA 6LDHA 3HU3A 1QP7A 3HDGA 4LF4B 1XTTA 3S2UA 4PYOA 4DV3B 2WJ4A 1RJDA 4TZKA 1WDMA 4UBKA 4RPLA 3G0HA 1XPUA 1N92A 4GSLA 3AJAA 3GGJA 4DLXA 4XGIA 3HB7A 2JA2A 3N9IA 5EE1A 4YUAA 3TZBA 4MV7A 4B1FA 2IEIA 3K0CA 3MCWA 4ZYYA 4KL8S 3CGGA 3IUPA 5HKLA 2OZPA 3FRJA 4PWYA 4OQDA 3ASUA 1BVUA 3Q8MA 2VHJA 2C8VA 4UOEA 5FBKA 2DTXA 3R8FA 1XVAA 4UFOA 2QMEA 4ER6A 1DKRA 4MROA 3T7TA 1T9CA 3HZHA 3D7MA 5FCDA 1UWVA 3K6KA 3TSAA 4PCVA 2HLDA 4DJTA 1RBQA 5LB4A 1ISPA 3VR5D 4E08A 2IXTA 4LUCA 1O2DA 3EVDA 2QRZA 3LQ2A 4ESOA 3RBVA 5FORA 5DLEA 5GQSA 2OXEA 2X6QA 3HB5X 3S99A 3TIVA 2DFTA 4RK6A 4R8VA 3AVQA 3PUJA 1NC3A 4KDFA 1EFRA 3DOIA 3RK0A 4OXNA 3ZHUA 3CZPA 2R84A 1MOSA 2QG6A 2C7OA 4ZYLA 4CM9D 3DJFA 4JDPA 4UOQA 5F77A 1JHOA 3ZBTA 2VRCD 3IXQA 1O9HA 3IPAA 4B7CA 1NYRA 1SA0A 2X41A 1TIBA 3PVZA 3TR6A 3U4HA 5C18A 2APJA 3M9LA 1KY3A 2NUPA 3ZI7A 2Z2KA 3CV3A 1TPZA 2EAUA 4OVKA 4Z4HA 4FXPA 4RD3A 4WY8A 1HLFA 1VKOA 2JAPA 2MR5A 3AF5A 2ERXA 5DSZA 3T61A 2OG2A 4BYGA 2ZS8A 3F6YA 4HG2A 2PQ2A 1R66A 1CUBA 4Q05A 3CLSC 1AB6A 1ZK0A 1FS4A 3B36A 3FBTA 4AK9A 2PH5A 4CM7A 1HA3A 2BN4A 1CIJA 4OHRA 4KR2A 1JIUA 1DAOA 1Y6FA 2UUBB 1PJSA 3RAJA 3NHMA 1I2MA 4MS4B 3V42A 1E2BA 3QFFA 4HAIA 3RVJA 4KRFA 3PUYA 4Z9AA 4CLOA 4MQ4A 4WGFA 1LKZA 1VQ1A 3M6AA 1TC2A 2VRWA 2JBAA 4YUWA 5KC8A 4LJYA 3ZCQA 1PQYA 1N7GA 2OAEA 3GCDA 4KE8A 4D02A 4QGHA 4PHGA 3HVUA 2BOVA 3ZWNA 4TYYA 3OJ0A 4PPYA 4RV4A 1DO8A 5JXHA 1YHZA 1J8VA 2OHFA 2ZR0A 2PQ6A 2GO7A 2NU6B 3O7WA 4DREA 1RYEA 1Q14A 1XVVA 2ODEA 3V4OA 2ZPAA 5CDTA 1S3SA 3CO5A 2QYTA 1U4OA 3QLEA 2Q49A 1K1EA 4PQGA 1RRCA 1FP1D 2FN4A 2D2IA 1XKXA 1ZPDA 2D2XA 3PQ7A 1I7PA 5IARA 3S1SA 3Q5GA 2QTAA 3CJRA 5EXSA 4RDHA 2JLSA 1XZ8A 4M9XA 2E4VA 2CXOA 2WTXA 5FL7D 5I7EA 3BE4A 3SQXA 5EMHA 5C32A 2QENA 4MUYA 2REXB 4E5KA 5DDIP 4MWSA 4Y2TA 3CB2A 4R0VA 3L49A 1Z2DA 3NUZA 3TQIA 3H2GA 1U3WA 4Q01A 2AZTA 3GEIA 4M0KA 2JH8A 4XXHA 5A6SB 2XVYA 2GSWA 2WF5A 5DI3A 4MCAA 4PYLA 4ENWA 3G0GA 3JAKB 3NHUA 1NULA 4Y2PA 5KWIA 3A4NA 1N78A 5J4HA 3ENNA 2HMYB 1OH8A 1JSXA 1Z34A 1FIUA 3H11B 3SICE 4IOMA 3PC3A 3TDMA 3ZGOA 5A0VA 3Q11A 4YRIA 1JIKA 1VJ0A 2W2QA 5A4IS 1ECFA 3A25A 4ND8A 2Q0SA 3PLNA 1WUHS 4GLJA 3ESRA 3BE8A 4LWZA 4B6GA 1QIMA 3E58A 1AQUA 3R9WA 4NZMA 3OSUA 2D74A 3SHTA 2HJWA 5ENZA 3OQHA 2LKCA 4CU2A 4EHFA 3O9MA 4DMGA 4CM4B 3EGDB 5D8DA 1JNYA 1BMTA 1H6DA 3GAAA 4R81A 3RWMB 3NRJA 4JQZA 1AN9A 4XQGA 1W85A 4DXDA 4IV8A 5BQXA 1TF2A 5FQOA 4BCDA 4LZZA 2GO1A 4K6FA 4J6EA 1ETHA 4NBVA 1P18A 3HL0A 4ZI5A 3OA0A 1U2QA 3TFQA 4X1IB 3INGA 2VBGA 1A9PA 1DCMA 5JIBA 4B80A 3ZK9A 3U0VA 3U6KA 3O94A 1GFSA 1CIPA 3LGSA 2WB4A 4LY3A 1OCEA 3WQQA 4A5SA 5JD4A 4HV4A 4G0XA 4J3NA 4XX1A 5LUAA 1L1RA 2Y6VA 3EZ2A 5ELMA 1CHDA 1L7NA 3C5VA 1MORA 4Y2YA 2DRIA 2OCDA 1YZQA 4NFYA 5GJWC 3TS1A 4OU5A 1G9SA 1HE1C 1OLSB 4JU8A 4KITB 4RESA 2F8TA 1H8HA 2BEUA 1NVVQ 3HH8A 5TS2A 1M0EA 3OAAA 4DDTA 2H4WA 2WJZB 4L51A 2HSJA 3HXTA 3UOGA 2ZI5A 2WAOA 1DG3A 3KQQA 2BE9A 3DMTA 2VJPA 1LRKA 4O4HF 2ONYA 3G9QA 5BUZA 4JXZA 2AXNA 2KHZA 3NAZA 1UDRA 1PJ4A 3F46A 1SKBA 1WMSA 2ZYAA 1KQNA 5JT1A 3LY7A 3Q7QA 1BQ3A 2ASVA 5ARBA 4CEIB 3NHWA 5IUKC 1RXWA 3BREA 1HE8B 3LPNA 5BYKA 4KUEA 3HADA 1W1UA 1PT6A 3G2JA 3VH4A 3IPYA 1RE0A 2XGGA 4BJ6A 5K8JB 2RAUA 4DM7A 3IE1A 1T2DA 1CJMA 2GDJA 2WHPA 4WNIA 3UJHA 3KSBC 1YVPA 1J97A 1IFXA 4MPTA 1P77A 3FCOA 2BTQB 3HDHA 4PFKA 1ZKDA 3JY6A 1LDYA 3UJ7A 1XJWA 1P2FA 3V8RA 1RBMA 2WUFA 1NNUA 1U94A 2CE2X 4C6HA 4D9MA 1XZHA 1KAQA 3WRXC 1N5OX 2R8EA 3IR7A 4DRZA 2OM6A 4RFLA 5DLPA 3R4VA 4UDXX 5REQB 1TKRA 5A6VA 4DAEA 1KR2A 2GXUA 4OU4A 4ZU3A 3SFZA 2RI1A 4QQNA 4OXQA 3NHSA 2RGWA 3DUFA 1KKMA 1WA5A 1J00A 2XPCA 3H13A 4IXMA 1JHPA 1Y1QA 4PO9A 2GD2A 2QN1A 4EG1A 4YQEA 5K3FB 2PZ8A 3ICWA 3JWPA 3LNCA 4TMTA 1B2RA 2WK1A 1A95A 2G77B 4MV5A 2PGIA 3HCAA 2CXSA 4PZAA 4RA6B 2PQ0A 1CK4A 2JGMA 2QJTA 2XVAA 4DMUB 2WC1A 2VIIA 4JI8B 3DSRA 4JNCA 4YVFA 2PQMA 3UJDA 3BFKA 2COUA 1DKQA 2IYNA 2VHWA 3C14C 3FLBA 4L6AA 1IB6A 1XZBA 2OCKA 3DDUA 4MLCA 4YN3A 5WRFA 4D45A 3AB3A 4JV5B 2YV4A 1S7CA 1EUYA 2WHQA 1LV8A 2FZ4A 4ZOLA 3RNOA 1KAOA 1X1CA 2WOJA 3PRKE 4HWSA 2VPIA 2P7HA 4J1QA 4JSTA 4WN9A 4C07A 1OTXA 1OT3A 4S1TA 3LJKA 3MQ2A 3NT2A 4OLHA 4Z54A 3O3OB 3PUXA 1F2DA 3OPYB 5BQOA 2ODBA 1J1ZA 4KLNA 1SBQA 3HCNA 2R60A 5BPFA 1OX6A 3FCAA 1LFAA 1G20E 1E7SA 4F8YA 1MGPA 3N39C 4YO8A 2D54A 5D84A 3VYWA 1Y3IA 4B40A 1FP6A 1HWYA 1MMFB 1UQRA 2RHDA 3UT6A 1LDBA 1NXPA 3DD1A 1P2VA 3G2OA 1QHGA 1PJ8A 4NNOA 5AMXA 1OILA 1LPPA 2LD4A 1VHWA 2IHYA 5C7IO 1QZTA 4BO3A 2P3LA 4RSMA 4DDKA 1GQQA 1CQXA 2DWPA 3ROGA 4D96A 1EP3B 4MA5A 2IWHA 4A8TA 1DMSA 3Q88A 5F5NA 3PTAA 2YOHA 4Z53A 2DUUA 3LM8A 4KAAA 2OD2A 1B42A 2LXNA 3EQ7A 3P96A 1MABA 3QKTA 4HEJA 1ECPA 3M5WA 2ZRPA 4MQ6A 4UE6A 1YVUA 3AUKA 1F6DA 3VSDA 1D6MA 1KTIA 1F0NA 2BGJA 3KL4A 1GNQA 4WESA 4KN8A 5AVOA 4EB8A 2GXAA 2JD2A 1UPFA 1Z62A 2DPGA 4JB8A 1TCCA 3PA8A 3VTFA 1H4VB 2JFPA 2VG8A 3TQTA 1ORVA 2CSXA 2F4VB 4L3VA 1IL0A 1OXUA 2QN8A 4P2BA 1T2VA 4WE3A 3BSSA 3INRA 3MOGA 4BFLA 3ZIUA 4DCNA 1EUDA 2GYYA 1XTQA 1E1MA 2IV2X 1Y4AE 4M9UA 3SSAA 1C30A 3ZV7A 2C4TA 2DHEA 3Q87B 1PJTA 4IYJA 3EEOA 2CLSA 1UPTA 1ZW1A 1EEXB 1ZGBA 3KRTA 4HB4A 1LVHA 3SIWA 5AM2A 1T1SA 3IXLA 2V3WA 4CCYB 2XYQA 5FB3A 3PVCA 2JA1A 1PJAA 4G0WA 1JAIA 3QPAA 2H1RA 4F71A 4L07A 1K06A 3LOUA 2GWRA 4U7DA 4LJLA 3DGFC 1WZNA 4P4SB 5FR1A 3KD2A 5EJGA 4BX2A 3KZVA 1NVAA 4O4JB 2ZEJA 1G5QA 4QT4A 4IV5A 4ZK2A 4MDFA 1BHO1 3UWPA 2A9PA 1FU8A 4WJLA 2YN0A 1RVDA 1K2VN 3BK2A 2IYXA 2HRCA 4D97A 4ENTA 3QITA 3VO9A 3E5RA 4C0XA 3GH3A 3IURA 5KVVA 1CKEA 3BJIC 3EIQA 4FUTA 1X70A 2D7JA 4WLOA 2DM6A 1DPFA 3MSXA 5AJWA 3WRWA 1ECJA 3QLTA 4KN6A 4N9QA 2AR0A 3ADDA 3OLZA 2CBXA 3NV9A 5I9SA 3FTQA 4QICA 4PG8A 2V1UA 2ECKA 1ONPA 2Y67A 1NHGA 2XCIA 3L6EA 2X77A 3R0ZA 3I5XA 2J59A 5HQJA 2GBLA 5B12A 3JRNA 3OHMA 1JDNA 1N5JA 1T8UA 2QMUA 2QTBA 4P31A 2YFHA 4E94A 4REMA 1VTKA 1G7CA 2GVNA 2JLAA 5I7WA 1C8BA 3B6KA 4RGYA 4WX2B 1Y9JA 4HVTA 1YE3A 1R6VA 2O0HA 3GHHA 1PUXA 4KIUA 5JTTA 2WFLB 3JQAD 4R1NA 3QYJA 4KXXA 3PVSA 1RRPA 4XSVA 2FW9A 1N2JA 4MS4A 5KNDH 1E0DA 4BKRA 5ICGA 3I2IA 4LQDA 2NSDA 2V5VA 5AKJA 4IXWA 4DDVA 2IYEA 4D5GA 2IYYA 1JJIA 4I5DA 1Y8QB 2GNPA 2V7EA 4HVLA 4W5OA 1IBCA 1XCJA 2Q4DA 3MGGA 4PF1A 3U37A 3IQFA 3TZ6A 4IH1A 1NJGA 3AP3A 5DYGA 4M0PA 1FUEA 4M86A 1KTVA 3H5IA 5DGDA 4OHXA 1RNLA 4OHCA 3AEQB 4GQAA 4Q4HB 4BNDB 1HGXA 2FUEA 2NU6A 4LMBA 2DHDA 3BWDD 4L4YA 1LK0A 4MUFA 4MGEA 4RHTA 3ZWMA 4DCTA 1LW7A 2V7QA 2X4DA 3MBOA 1E0AA 1T5TA 1W44A 1JZTA 1THMA 2ZSFA 2QYOA 4ZYZA 1RKBA 4MR8B 5FO1A 4RY8A 1Y5MA 4D4HA 3IE2A 3G85A 3BRQA 1VJ1A 4DLBA 4FOOA 1YZGA 1XDBA 1XEXB 4ND2A 5AJTA 2B1RA 4PW0A 4UTOA 3PFFA 4LYJA 4RTNA 1L7VC 4N4AA 1V7PC 4N65A 1KDVA 2VA8A 3Q0TA 3KELA 3GLTA 5JI2E 3EB9A 1EXNA 2GLXA 3SVZA 1YVEI 4A4DA 1F7UA 1O6CA 1U5BB 2BFFB 2JKZA 4BC1A 1L5ZA 3W06A 3N2LA 4UXJA 4I4IA 5LM3A 3M2PA 2ZSDA 2R1UA 4DHWA 1LJLA 2F3TA 2HQOA 2YJ6A 3OOJA 4EAAA 3H11A 2J5BA 5K01A 3HY6A 1DC6A 3ZY4A 2B4YA 3K31A 1PT7A 3MXOA 5IBCA 2GXQA 4LF5B 2RG1A 3N86A 2D0PB 2FZEA 3TKYA 4WZAE 3QEMB 5CBKA 3GJ0A 2Z09A 1WKBA 3DDHA 1EFHA 4AWAA 4YJDA 4E1VA 4RTOA 5K3SA 4LV5B 1ATIA 2Z4SA 3EGDA 2W4IA 3HYCA 3NZEA 3GUCA 3S8MA 4CM4A 5GZ6A 4OQMA 4LHYA 3WP1B 2J5XA 2DH6A 2X2EA 3ZJ5A 1EEHA 4BNKA 1T4GA 3H9EO 1ACJA 2R00A 4HWPA 3W2GA 4F38A 3MD9A 4R1SA 1AHPA 3NBUA 3SQMA 2AZDA 2PUGA 1V43A 5KTKA 3MYRA 2V58A 4IG9A 3HB0A 3W90A 4X1IA 4EGAA 1U7OA 1JJ7A 5JZBA 2BISA 2CJYA 3TOZA 1DPGA 4MKXA 2KWIA 1PS0A 3FSJX 1C41A 3K5WA 3E48A 3WYAA 3P97A 2I9KA 1I0IA 3KUKA 4J76A 4YREA 1DKNA 2IS6A 3WB0A 4A23A 1MXFA 1X0VA 3E7PA 3L8FA 1TZMA 2XNKA 1Z07A 3GX1A 1GYPA 1KS9A 2H2WA 3TPFA 2ZWPA 4BZQA 1PZMA 2PS3A 3TRDA 2P9EA 9GPBA 4LFAB 1ODFA 4IIUA 2H52A 3A11A 1KC1A 3BK1A 4H6VA 1G8YA 1ZXBA 1JEAA 1Y98A 4XQEA 4M8IA 4UTXA 3UAVA 2WFAA 3AHDA 4KN5A 4I08A 5LA6F 1DRWA 3ISVA 2E4WA 3LO8A 1DBSA 3A6KA 2EXXA 1T36B 3JARA 3SZUA 3VAAA 4PVDA 5LYJB 4XVUA 4MDEA 1O94A 4CEIA 1P1JA 3Q0EA 3UA4A 4V1CA 3JQ7B 4WTOA 1PV2A 4B83A 4HLUC 3FYTA 1DKUA 2CF6A 2HGSA 3EXFB 5COQA 4QJBA 5DBHX 4KYTA 1KK0A 3HXOA 1O1YA 4H17A 4I5EA 3M1IA 2R7KA 3RLIA 1JFLA 1USWA 1QV6A 1CQJA 1PGOA 2X0KA 3I6QA 3QXSA 4FEAA 5AHKA 1N9GB 3Q8WA 5B2EA 5JCJD 3UK2A 3WADA 5KJFA 3EX7C 1IUKA 1CR2A 2BTQA 1JDBC 3F6BX 3GGSA 4FI3C 4M54A 4BLSA 5AD1A 1EK0A 2AX3A 3OQVA 3AY7A 1QHIA 4AY5A 1NP7A 2Y05A 4HXFB 1LQ2A 3AHEA 3AKDA 2A7XA 1KI3A 2EW1A 2YHIB 1FJHA 3EZYA 2JDIA 3VRHA 3V1NA 2DR0A 1VJRA 3JD1A 2I4IA 5LSAA 4EYOA 3QBTA 3KJIA 5LC1A 4ZTZB 1CJBA 3TOVA 1U3GA 5C31A 2GB4A 4EJSA 1ORTA 4MVJA 1IM2A 1QTRA 2V4UA 1MO2A 2Z30A 3NI2A 3B82A 4JAVC 4V0OA 5K3FA 2Y1XA 2AG0A 1G59A 1QLJA 1AH2A 1EBFA 2JARA 3AI3A 4FILA 3LO5A 2AVDA 3QA3E 4K26A 4WXPA 2P4HX 4YNBA 4G63A 4RA6A 1Q17A 5G1PA 3VC7A 3G5AA 1FSSA 3JALB 1NBME 1PZGA 1TTPB 2ZAYA 2AE1A 3JASB 4P83A 5CXXA 3SHQA 5JMTA 3RS5A 3PLAE 2QDXA 4BQFA 3NRBA 4DR1B 2BKUA 2JI4A 5AI6A 1YZLA 2X40A 2ZM5A 1XEAA 3B1WA 1SKYB 4UZSA 2HNAA 1YD7A 4XW2A 2Q7XA 3WBJA 5EIXA 1TFUA 3PNMA 4AS3A 4N6NA 3KE9A 1ZMBA 4ARCA 1J49A 5K20A 3EQZA 4A7PA 1A97A 4D41A 4PBTA 1YI1A 3BJEA 1L7QA 2PWAA 2BFOA 2Z9CA 3MUOA 3O3MB 2XKBA 5H3LA 2VXCA 4O33A 4R2MA 5BRNA 1BS2A 5IHXA 3EFOB 2D8MA 4I6GA 3E1KA 4S1NA 4RF5A 1D07A 2QPTA 4I9HA 1PW5A 3QX9A 1SVWA 5DWQA 3QXGA 5JUWA 4UMDA 2VKTA 3EASA 4EG0A 4QEKA 1KA9H 2V97A 5DHRA 3I1FA 4IICA 4BJ3A 2Y76A 1VPEA 2AFIE 3EXIA 1VA4A 1YQXA 5KNDD 1G0OA 1WV1A 3U5ZB 4FNAA 3MWDB 2PAFA 2V7PA 4P4NA 2VPXA 4RS3A 2OEPA 1NSTA 4L8GA 3VVMA 2QRUA 2QSZA 1GCGA 5KYKA 4Q21A 4GXQA 4PC7A 3OIYA 2AQKA 2UYQA 1Q0HA 4DQ0A 1I0LA 4Z4CA 4L74A 3RHFA 2AN1A 2X5OA 4PZDA 1L8OA 1MC8A 1RBZA 4YRAA 4FBGA 4XUEA 3RVLA 4TV9A 2PR7A 4DLZA 3TK1A 4DVJA 1AMNA 4MX8A 1U9IC 1E8NA 3BXFA 2WYUA 5AIAA 1HQCA 2D59A 3YASA 2K6GA 1P2BA 1N5LA 2QW8A 4HB3A 2QX9A 4BTVA 3A1EA 3AR6A 1TEZA 4R51A 1YL6A 4BE7B 1KVTA 2AQIA 1SZPA 5BW4A 1V41E 5HIAA 5HJEA 2NZWA 5LUBA 2NXJA 1YDFA 3C8MA 4PO8A 1K97A 3OT1B 3JQ6A 5EHGA 2IH5A 5AVTA 1W46A 5C1DA 3D1VA 2V7VA 3ZNQA 2ODNA 1JB1A 1E62A 1SCBA 4AC9A 4CMIB 3PHGA 1ZHOA 3ZUPA 1V16B 2W7TA 1RLIA 1L7OA 2ZI4A 3CPSA 1YACA 4KXLA 5KJ1A 1WP4A 1I94B 4HFNA 5B58C 3JQBA 4GRDA 4B3GA 1AF7A 1E2DA 2AUNA 1KNXA 4L9SA 4HDMB 3B3AA 1G7TA 3K4PA 5GGYA 1Y8RA 1I30A 3DLIA 3ZN2A 1QFZA 1MC4A 2ZRMA 2IXDA 4QOSA 1MO5A 3VQTA 2LR0A 2BFDA 4BIMA 1PKXA 1H2FA 1U7HA 3BE5A 1XRMA 1MDBA 3UHAA 4TT3A 2XWSA 4YP6A 3OLYA 4FFDA 1FVFA 2BEJA 2BONA 2OENG 1MEEA 4MP6A 4P4SA 3BFXA 4DY6A 4EPRA 5HKKD 5DNVA 1ANKA 3IOBA 4O4LF 4UCWA 3G59A 3C41J 1O95C 3GVIA 4TZTA 4UOZA 1MVLA 4JH0A 2X6TA 3AFIA 3D3QA 4DRXB 2CYAA 1KZ9A 3QY0A 1BNCA 2V65A 2BLNA 4ZRNA 2D1YA 3K0AB 2JIRA 3QIVA 2YIJA 4QFBA 5EESA 3RKRA 1L1QA 3WA6A 4PZPA 4AMBA 1R0LA 4LYAA 1A96A 4NMMA 1ADFA 3NT4A 3IQEA 4K9KA 5LVAA 2CK3A 5F2NA 1QKJA 1X7YA 3D8BA 1GO2A 1NOKA 1UJ6A 1I6LA 2ZS9A 3BX1A 2CNOA 5B3JA 1JEEA 5K8VA 1KEZA 3OFSA 1G18A 3WRYC 1RQNA 3P0JA 2LW7A 2W2TA 4YJ2B 4Y6PA 2FSGA 1PZHA 3IP1A 3ROXA 3ZGLA 3I09A 2EHDA 1MB3A 2BWJA 3WI7A 3M6UA 4DB4A 5BRJA 3ER9A 5H16A 1NPDA 1J7KA 2BBOA 2HSDA 1TLFA 4PS0A 2PUHA 3MK31 3TNJA 4B44A 1PVVA 2I7TA 4P34A 1CFZA 4B35A 2HEGA 4CG2A 1U0TA 1T9ZA 1VCMA 2QPAA 2NU7A 4XUDA 2E1PA 2IFTA 3W1WA 1T35A 3G7SA 3H2KA 5FOSA 3UMSA 3Q2KA 3UCFA 3VOTA 3TQFA 2VT7A 2AMFA 1K3UB 1Y8QA 1UZLA 2H06A 4NDAA 3HGMA 4ZP1A 1UOPA 2XYPA 3FGZA 4IGEA 4KMOA 3O8BA 3PHHA 4K05A 3TD9A 3W5VA 4WI1A 3WG9A 5FA5A 4H08A 1FTSA 2QT1A 3F5FA 4KGZA 1S1MA 4LQLA 3WAKA 4ZCTA 2RFLA 3GRKA 2ZTUA 3AL2A 4Q4HA 4BNDA 4U6NA 3DO8A 1CD5A 2GCEA 5D2CA 3FNIA 3RHSA 4PR0A 5HZKA 1NL3A 3IDZA 2W6OA 3EODA 3QLVA 2CLDX 3GEBA 4UHKA 5U9CA 4MR8A 2GS9A 4U2BA 3ZK8A 1Y8AA 2OYRA 4NBRA 4NNJA 1E2MA 3AF1A 3AHIA 1MB4A 1WDWB 4YJFB 1ORRA 2EARA 4KNWA 1K9SA 3AIKA 3P1JA 2H16A 4OXYA 1QQ7A 3NAQA 5AJHA 2B5WA 2R8RA 2JRCA 2RKWA 4U2DA 4WT7A 5FL3A 5F21A 4G1VA 4C6RA 1JR3D 4RWEA 4BFYA 4XUCA 4GUDA 3RU2A 1NY5A 3UVEA 2YASA 3MC1A 4HX9A 3SAJA 3E82A 1KQGA 4TTVA 1IIRA 1BS1A 1BJRE 2AKYA 4J9VA 2DB3A 5TF4A 4EPTA 1SR8A 1L4MA 2BFFA 1GUYA 1SK8A 1W5BA 1OZFA 2C94A 2GCGA 1C0KA 2IL1A 1PSDA 3M4ZA 5L95A 3HRHA 1DX9A 1Z56C 3Q7TA 1E6WA 2G40A 4LZLA 5I9MA 4B48A 3LGXA 1WMDA 1O7JA 3A7EA 1BH2A 2QY9A 2WEKA 5FNVB 3WNQA 3AVXA 2H18A 4ITVA 4BLWA 1EVJA 1ZUNA 1DJNA 3DKPA 1QF7A 1XHLA 3ZHSA 1VPDA 2VHEA 4TKVB 1IRXA 3AETB 3QBVA 3HSSA 2E2WA 5ERXA 4DA9A 4F5ZA 3ZJVA 5JAHA 1DIRA 2RKOA 2HV9A 4AO7A 3QEMA 2VDQB 1TLTA 2WT8A 2ZRQA 4HWTA 4JL6A 4ZTBA 3VPBA 5JAPA 4PQEA 1ZXXA 3U0BA 1NM5C 3VPGA 4LI0A 3ZBQA 1L5KA 1QJCA 2VYND 3D9QX 2GRJA 1YUNA 3H1TA 4MUHA 3V4ZA 4PSCA 3CLTD 5KHAA 2HBZA 3J81k 3ZCPA 3CZQA 4ECAA 3GLIE 1CZNA 2I4OA 3UTCA 4MUJA 3WOVA 5EI5A 2IUUA 3DPIA 4ONEA 3MLEA 2YZ2A 1ZH0A 4RADA 3H16A 1DDIA 1P9WA 3FB1A 5BSRA 2XX3A 1LI5A 4JYAB 4NBWA 3U3OA 2QHXA 4JJ6A 5JBIA 4QEZA 3X2EA 2XQKA 2CVQA 3RW9A 1AHNA 4D9JA 3CZ4A 3KJXA 3KZCA 4YJKA 3KB6A 1RZ3A 3QBDA 2BGNA 3SQDA 1P80A 2DHQA 2QV7A 3G1WA 4M87A 3UMRA 4B8WA 3ITNA 2OLKA 3LHIA 2VHVA 3Q98A 4TLBA 3DQPA 2CHEA 5LZ9A 4DF3A 2OCLA 1YS2X 2Y2VA 1HQKA 3TQQA 3PU6A 1EWRA 3P0RA 1N2GA 2D00A 2XDWA 3HY4A 1WMAA 4X3PA 3OEWA 1DSSG 3GJXC 4ZOQI 5BY2A 1NF9A 4MV4A 5I4IA 1YS9A 2CEAA 2TYSB 3ZV3A 3TCKA 1C8LA 3FTFA 5IAOA 1ODLA 1HUQA 2H1FA 1R88A 1G64A 5U1PA 4RJIA 2D2VA 2VS1A 3CSUA 1XX6A 4TSRA 2J7PA 4Q9NA 4RLQA 1OTYA 3DLCA 5LYJA 4M22A 3VDRA 4DQXA 1E63A 4WBNB 1T0UA 3GUYA 3MMXA 2I55A 2XY4A 4C0LA 3EUEA 1MIOB 2JD0A 2H8KA 2P62A 3JQ7A 2EZ4A 5HDQA 8MHTA 1AQLA 2BMEA 1QYXA 4XLTA 1JIJA 1U2GA 2Q4OA 3AR3A 4N40A 2PU5A 3QF7A 1NJ5A 2NTJA 5LZ5A 4BO8A 4BDSA 1QGOA 4X65B 3VNVA 1P1FA 1GRVA 2QZ9A 2YHUA 2HMWA 3PWZA 4IIDA 4LA4A 1N9GA 2FMFA 5ED0A 4ZT3A 4LJ5A 4ER5A 2LDXA 1EINA 2H9IA 1B73A 4IM7A 1LW6E 2FZGA 3ITEA 3KQNA 4ZN6A 3QHAA 2WKRA 4FNMA 4QT0A 4POAA 1RZRA 1I5EA 1A2QA 3F4BA 4BQIA 5BNFA 3LOPA 1AK1A 1L3IA 2CKDA 1JSZA 1ZEMA 5ICSA 2G5GX 4HQ0A 2V6GA 1XCLA 3MTGA 3PX3A 2QF7A 2XZLA 5F7ZA 3VYSB 5EZ5A 4FHZA 2EHJA 1ZHHA 1LBHA 4G0ZA 4OBXA 4WJZA 1NXVA 5FBHA 2GPNA 5LQSA 1QP0A 3C7DB 2ET6A 3ORFA 4JYZA 3EXAA 3TNLA 5KWJA 2ZIEA 3E53A 1USUA 1RI1A 2R8BA 3DLBA 1Y33E 2OC4A 1I1HA 1QCYA 2DG2A 2NSHA 4FSDA 1EGHA 3JALA 3JASA 1E18A 1U1EA 5FFMA 1NT2A 1H9BA 3FAZA 3PIRA 4MGIR 4PAGA 3QA9A 1E96A 3AOEA 1M72A 2D3TA 3E84A 3GJ7A 1Q7TA 5H59A 5IKMA 1T3LA 2P68A 5EIEA 4YYEA 3HMQA 2JIOA 1QVVA 4GBED 2K7ZA 2O2HA 4EW1A 4OUDB 4D6PA 4R9VA 3A1NA 3I0NA 1TFRA 1NUUA 3LDUA 4A8PA 2CD7A 4A2CA 4DQKA 5CEEA 3N8HA 2WSYB 1I2BA 2I1WA 3C3YA 1DOAA 1K0UA 4MDHA 4P8RA 2F2TA 1TAUA 1GPWB 1KEVA 1NMXA 1BGXT 1W25A 3U7EB 5BSEA 4JQOA 1J24A 1EG2A 3KR9A 3EFOA 1W1IA 2HF9A 3NGXA 4JY7A 4GSKA 2NNLD 3G13A 4D4JA 4F2DA 4U7HA 4EUKA 2C57A 4DIDA 2ZI6A 4AJHA 4NJMB 5HF5A 2HU5A 3GFTA 3TAUA 4BKUA 3P52A 1KMHB 4TYMA 3P94A 4CKCB 3E3MA 2CMHA 3WL5A 1VPWA 2FDXA 4MPDA 4DBVO 3WLTA 1WXIA 3MWDA 1E89A 2Q0HA 5IBPA 4F3NA 4I5GA 2VJBA 1WS6A 1P44A 1X87A 3TKAA 1D2MA 2GZRA 2VTDA 3NATA 4OREX 4PC6A 4FTWA 3L43A 5H3CA 1S2NA 1H2BA 1RZUA 4PGGA 4R6WA 3GFBA 3HHPA 2Q5LA 5LLSA 2ISQA 1QIIA 4O4IB 1Z2PX 3VPSA 3ILXA 3GP3A 2WJYA 2F1IA 2P6NA 1UEIA 4BZWA 1CY6A 3BE6A 1Z28A 3Q12A 3PJRA 4LMRA 1KO5A 3HCDA 3EGOA 1W52X 2JFWA 4ZU1X 1WABA 2PS1A 2ZS7A 3QK7A 4EYGA 4HT3B 1X1TA 3GQVA 1DBVO 1YQUA 3B1XA 3QIAA 3WB2A 4FONA 1JU3A 3V8NA 3NCTA 4M0DA 2J9YB 2XBLA 2AN3A 1GPAA 1ZCBA 3OT1A 4JP8A 4R71A 5LMNB 4UUNA 3RVNA 1IH8A 3QJ5A 1GUBA 3JVEA 1OXSC 1AA6A 4S2EA 4Q19A 3WLHA 1QH1A 2ZXUA 4AWXA 4OHWA 3EMKA 1R0SA 5BNTA 3V8QA 4ZAXA 4E5SA 3STYA 1LLDA 2SCUA 2NAFA 4C4XA 4AQ7A 3AM1A 4OHZA 2P9TA 4O4JF 4KQWA 1GP2A 1U5CA 1KEEB 1T3TA 5ES4B 4G23A 1DFIA 2P78A 2H2DA 4ZO8A 3CVXA 1N6LA 3QYFA 2PGXA 1LBQA 4IOJA 2O54A 3FKSA 2OE2A 1KZ4A 1JEOA 3WAJA 4Y7CA 5DOVA 2C8JA 3KJZA 2VH1A 2GWHA 3HUTA 1Y6QA 1I5OA 3HCPA 4Q1FA 4R1UA 3NWJA 5K0NA 4U8GA 2P9QA 1XZMA 1BEZA 2NWQA 4EUHA 1OIWA 3NWEA 2XMDA 4RGBA 1JBQA 1PRYA 1CULC 2ZRLA 1FXWF 4E70A 2J0SA 4DA4A 1ZJ4A 3F2VA 4WA8A 1L5OA 2G83A 3QWAA 2PSJA 4N7MA 3K0AA 5FTJA 3RFXA 5EJ7A 1E4VA 5B57C 4TUYF 1AMOA 1GGKA 3FTNA 1EWYA 2IU4A 2G3YA 2WSMA 3LCRA 3BZUA 3F74A 3I9OA 3RBXA 1C4KA 1ULAA 1P74A 2BBSA 2JL1A 2WMNB 3FTDA 4ZALA 2P91A 1PWXA 2WOOA 4YXWA 2ST1A 3KOUA 5FULA 1Y8ZA 5E9QA 1YA8A 4F4JA 4Z6KA 4CE6A 5KTPA 1Z15A 3HACA 2WUGA 4KHZA 2YMMA 5EPUA 4O3MA 3R7WB 5LDGA 2XRFA 1W36C 4RD4A 4CIDA 4ZHQA 1LQUA 2RAVA 3RVDA 2YXBA 4LRTB 3WLPA 1JG4A 1E7QA 4KODA 4NBNA 2I5PO 2FG6C 2H7VA 2WZDA 5G41A 3D4OA 5M2QA 2IU6A 4QLAA 6GPBA 3GP8A 1JEYA 3I9NA 1ZD3A 1SKQA 3AR4A 3HBJA 3NJ4A 4OQEA 5THQA 3E2IA 4CMAA 5I6DA 3LBYA 2ODTX 1C9NA 2QP9X 3IIEA 3IKVA 1GGVA 2Q6OA 5DNWA 3ABOB 3RRJA 3FOFC 5JASA 1VG8A 4O8ZA 4PAOA 2EERA 1J25A 3S1AB 4Z9FA 5K7SA 1WIWA 3SE0A 1QK5A 4JLWA 2G70A 5AUOB 5JNUA 1N34B 4S0XA 2E5FA 4IUDS 1C3LA 1SELA 4ZA2A 4AMGA 5EIOA 6AT1A 4MVJM 4AO6A 3V3TA 5L3VA 3F1KA 4NOMA 1PT5A 4QELA 5PNTA 4KR3A 1JF8A 1YB7A 4PLZA 1Z47A 4V3BA 1JVNA 3C0KA 1FMCA 1U2RA 3KX2A 1EVLA 5KPJA 2F8MA 2OCIA 4MW1A 4FFRA 4M1TA 1P3JA 3PFKA 5C8YB 3RKUA 2W6JA 4KK3A 2G1JA 2AK3A 4GP7A 4DJAA 4QGSA 1BKDR 2RHOA 2RB5A 3CR7A 3AI7A 4L7VA 2EFGA 2AJDA 3R6DA 3VHRA 4W1PA 5M34A 1A4UA 1CZKA 1FMJA 4DYDA 1ECBA 3QU2A 2E6KA 4HXEB 1SBYA 5K0GA 3Q8XB 2GH1A 3GYBA 2F64A 4KQ1A 3D5QA 3JWGA 4LOJA 4J1TA 3L7LA 3OOHA 4FZRA 5KQPA 5IVIA 2ZUSA 3ROQA 2O2CA 4ML3A 2JGAA 4KO2S 1VMAA 3AETA 4O5AA 1GL7A 4K87A 3INNA 1IHDA 1JMYA 4ZGGA 2RHRA 3TPZA 1WAMA 3WMRA 4D4KA 1JJBA 4Q4AB 3VH3A 2V03A 3NX4A 2R4TA 5B1DA 1BXZA 2W83A 4FQ7A 2H54A 3KEOA 1IZ9A 3N53A 1V95A 4W5HA 3OCXA 3G2IA 2ETVA 4HDOB 3FTPA 3E4DA 4JBXA 2X5JO 2NU8B 1XCOA 3UQYS 2IXBA 2FSUA 3A1DA 3P0IA 4UUOA 1VSBA 3LWDA 3FYDA 5CLQA 3IV6A 3PBKA 4XJXA 5IEBA 1HC7A 3GJZA 2FQXA 5E95A 5KWSA 2NQ2C 2HLPA 1WHSB 4JUIA 1UT5A 1QXSA 2IBTA 4NS4A 3VJLA 1Z3CA 2RHJA 3GVHA 3SU8A 4AJNA 4DNQA 2RGUA 3JAWB 4UM5A 4B31A 1RQXA 3MN1A 2IYQA 2R1ZA 3ECCA 3UHJA 3ER8A 3ND8A 1YJ5A 3IERA 4AW9A 3QVLA 4LHWA 4ZT7A 1Q0ZA 5DULA 1KQ3A 3IYLW 2H4HA 2PTGA 5EWLB 2VN8A 1R6UA 5G4KB 2ZYTX 1HKHA 1L8LA 1OASA 1U9YA 1QDLB 4ZO6A 1CNEA 4M53A 3FPEA 5IUNC 1B41A 2TMGA 2O1WA 2JANA 3L7NA 2G1KA 1FA9A 4PIMA 4RW0A 4YJ3B 1TA9A 5JXIA 1C9JA 2H4JA 5EUMA 4DQVA 4JEHA 5DH9A 4AN4A 2CC2A 2FOXA 1Y6JA 2AH5A 2Z5LA 3L2OB 3LECA 5KCMA 3R44A 3KDPA 4UDOA 1M2VA 1R5NA 3AYZB 1S01A 1E4YA 3QE3A 2EX4A 4PYRA 3KOZA 4JI5B 1MIOA 2J6BA 1RLOA 4CG0A 1Q11A 3PFWO 3F9CA 4RMNA 5K0ZA 4BNGA 2AG6A 1XLWA 1FP7A 2Y1GA 3FAKA 1QAOA 3DHWC 3IAFA 2HQBA 1XVIA 1TEVA 3OG9A 4MI6A 4AJ4A 4RY0A 1JDVA 4DJEC 5IFLA 2YJTD 1C9MA 1PGQA 4PNZA 2ISSD 4HZUA 2HA3A 1YO6A 3M6WA 3I1YA 3PWSA 4HXGA 4OHFA 5ALKA 4ZVVA 2VEDA 4C29A 3GNLA 4KFTA 2WP8J 1W49A 2XE6A 4EFNA 3R74A 1IHPA 5AJZA 3RR2A 1Z7BA 2Q2WA 1X86B 1ZXLA 4DJFC 1J8DA 4YRNA 3S8YA 3GLGB 4KRYA 1ZMTA 3TE6A 2OZEA 4GPBA 1E1RD 2WWHA 3DDOA 4AP6A 3ERCA 4DQLA 4L78A 3VKWA 4KFUA 4Z4GA 2IZOA 4RTPA 3TMAA 4JENA 4GRIA 1NYQA 3H1PA 3DVQX 3EVGA 4RZQA 5E4YA 4D9KA 2GZSA 3K1AB 1JKJB 3W3AD 4ND1A 5HIKA 1I33A 1MV5A 4AUKA 3U1VA 2OTCA 5A5FA 4GR4A 3TW8B 4FDTA 4NWIA 1WBDA 3TIGA 4IRUB 3KLOA 2H2AA 2NG1A 3I6YA 2OECA 4URYR 2J08A 3DQZA 1P7WA 3FWNA 1QTQA 4CI9A 2JG3A 5KC9A 3CUVA 4L9AA 4N3BA 4EA9A 3F6SA 5JS1A 2MOKA 2XQGA 2P79A 8OHMA 2I66A 3ZHZA 5B2ZA 5HMMA 1QIHA 1RPNA 2ZRGA 1WUYA 1ZUWA 2J3IA 2ZUVA 4OUDA 4URHA 1BVHA 1G3RA 1JT2A 4X71A 3L4KA 2WYHA 5D6OA 1NUAA 1B14A 1JLSA 4I9FA 3G89A 2AHRA 3JYPA 4K9SA 4ZOEA 3THRA 3UMCA 5I4CA 4TZ0A 2FY8A 4DJDC 3QX8A 2A5GA 3H8WA 2FZKA 3IB6A 1VA5A 3O3NB 4GKVA 4EKGA 4C3UA 1Y1RA 3IBCA 1MQSA 4J0JA 4NJMA 3ANLA 4X1OA 1L6IA 3LHDA 2VXBA 2HDNB 3A1VA 2HJSA 3C70A 2X7JA 3G17A 4PS1A 5ALJA 3V9AA 3STHA 2QVLA 3NUQA 1T9AA 2GJ4A 4D3SA 5ILQA 2JAXA 4WWHA 4A5OA 1L8QA 3V4VB 3TZEA 5BVGA 4BMSA 2BKXA 4YS6A 3E5NA 3KR2A 4M89A 3ZIAD 2D4HA 4RHXA 1A4IA 2YJ4A 2CWWA 2GKSA 1RWOA 3MS2A 4Z0HO 2EC5A 3A6DA 3TOSA 1KARA 1QYDA 1XELA 1AX9A 2A5JA 1P5HA 4J0CA 3QG5A 3AL0C 1LRLA 5C53B 2AC4A 1SC4A 1KDTA 2CXPA 2V96A 2B9VA 3R0JA 2P9FA 3IVMA 4QYSA 2FSHA 1KFJB 4IDOA 2YBEA 4IEEA 2VF5X 2HZ7A 5TQ0B 3TFWA 3MELA 4YRKA 3TE7A 3COPA 2YC2C 3B7GA 1YU6A 1AY0A 2CFIA 1VL6A 2VLIA 3LW8A 1DAMA 4U0JA 3TZQA 5C8VA 2R62A 3V1LA 4DSAA 3OOYA 2CHFA 4MS3B 1YGYA 3P9YA 4MJ3A 4ISBA 4RJKA 3D6MA 4WOPA 5EN4A 4H1WA 4CR8A 5B6JA 4GAEA 1CB7A 5EJ4A 4KQIA 1GNTA 2OAP1 4WCFB 1KF0A 3HCWA 3WGLA 4P32A 3N3BC 3TDKA 2F3PA 1EK1A 1SXJC 1KP3A 1XEFA 2NO1A 5DGCA 4CYMA 5K9ZA 4GMXA 3QVSA 3EMVA 3A2NA 3GJTA 4DSUA 3PX7A 3ODPA 5KAMA 2E9SA 3G2QA 1IEVA 4FB4A 2X9QA 3F9RA 5JZ9A 1UJBA 2OPHA 1V39A 3HPQA 4L3WA 4Y0VA 2OO7A 3LWNA 3WFJA 4ARAA 2JVKA 4U00A 2NUAB 5KUTA 4Q4CA 2O0MA 3DMFA 5T6MA 2O3JA 4YJ2F 4KR7A 3C15C 1SHZA 3EGXB 2VF2A 2HY7A 4XDHA 4CLEA 2UU9B 3C3AA 3EBOA 6CHYA 3RGGA 4U2CA 3FD8A 2XNDD 1DU4A 3U7JA 5FV4A 1E3SA 3RSZA 2F1HA 1A82A 1CYEA 1YDWA 1ADCA 1H66A 1X3SA 3MIZA 4GPD1 3EPLA 4DB2A 3DW3X 3KO8A 2OCGA 3OZEA 1KE1A 1KOGA 4R5HA 5HF8A 1E7MA 4U0KA 4JJGA 1TIPA 2G5PA 4RTMA 4BLRA 2VDRB 4BAGA 1ST3A 2ZE7A 3P9KA 3SC4A 1ZVKA 4HNUA 3R7WA 1T6ZA 4OJMX 3QF4B 1L7EA 3AINA 2DAPA 3ZJYA 4DV6B 1RAIA 1NA5A 1ZL0A 2DOKA 4RPCA 4D9FA 1OFIA 2CZGA 3KQHA 3SG0A 2SKDA 4DPKA 1M2NA 3F5MA 3BHJA 1JE0A 2BSXA 2EX1A 3E2PA 3W5AA 1GAJA 3JQ8B 4K1LA 4NEGA 2GETA 2KW5A 4FWIB 5B55A 4LDJA 3KL2A 5ADHA 1E5LA 3S55A 2ILTA 1RJWA 2QVBA 1EX7A 2MU1A 2WUVA 4IJ5A 2VZLA 3JD0A 5ILGA 4KXQA 2WF9A 5M3BA 3UCEA 1W88B 3JX9A 1L4UA 4JI2B 2BRUC 4D8YA 3IBYA 3DV9A 4DLKA 3S1AA 3HRKA 1E4OA 1HE3A 1QYRA 3DE0X 4KR0A 2C7GA 3OUZA 2CCKA 3VPXA 4DCUA 4DSOA 5EPOA 4WLEA 2GNOA 4I50B 1BFKA 4E09A 3OIFA 4XM2A 3JXEA 1YAJA 4LXYA 1QE5A 5BQPA 1FZTA 2FEOA 5KTOA 3VSEA 1RJ9B 3RRNA 4MLPA 4BO0A 2ZJ3A 5I7RA 2WWVD 1H94A 4U2GA 2WABA 4EVIA 5FRDA 3RUPA 3Q8KA 3M9XA 2PWZA 2E3JA 3ANTA 1GNLA 4G65A 3VKVA 2C58A 1KVUA 2XNSA 3R77A 2DUMA 1Z22A 4B6RA 5AK6A 4D99A 3IVRA 3GGGA 5FNVF 2XMZA 2FI1A 4BBJA 1FJGB 2BGKA 5C8YA 4M0EA 2JIMA 3VR3A 4DCCA 1JJFA 3WO1A 2P9GA 3X1YA 4R2XA 2JAOA 1BCSB 4N8EA 2LPMA 1EVEA 2VDMB 3IOEA 1JHRA 2XTJA 5DN6A 1FW8A 3O1IC 1AXGA 3V00A 2C3YA 3QUTA 4AKTA 1IJKA 2E85A 2GASA 4CCSA 1MD9A 1G8JA 1SBZA 3GEHA 1LB1B 2QZPA 4FX5A 2ZIXB 2QW0X 3TM4A 1I80A 1D0IA 4EDHA 1FTQA 1X1BA 1X7GA 3GJ4A 4XFJA 3ZCVA 3WLLA 5ADVA 3OIWA 1JAYA 2RJ3A 4GWLA 1WHTB 2DT8A 3GHYA 4EEXA 1KPHA 2OVFA 1I2CA 2H3EA 3NXKA 3H1AA 3TRKA 1KXJA 3ED1A 2B8EA 1OR8A 2EZ8A 3I28A 3OFKA 3PSAA 4QOHA 3MMNA 1QH8A 1R6TA 1RYZA 2RI6A 1GKIA 4KUGA 3A4TA 5FX2A 3D8SA 3K30A 4N0PA 4AP5A 1FDSA 1PU2A 3OHPA 4U4AA 3DM9B 4R5MA 3ESAA 4E32A 3K2QA 4RJLA 1X94A 4LE1A 5KYUB 2PHZA 4TLCA 1VKNA 1M6EX 1Z74A 3LZ6A 5JJKA 1T3GA 5G0UA 2BSAA 1W47A 4EPVA 1WHSA 1NBOA 3BAFA 3L04A 4YLGA 1Q50A 1RM3A 3M34A 4YP1A 1VE9A 3KJHA 3JAWA 2ZG6A 3PGKA 1TT5A 1L5YA 4BVAA 1NPTO 3ANXA 1EJBA 2W2LD 2CDAA 2ZSJA 3K53A 2FNAA 4HUJA 4W1QA 4WBNF 2H08A 2O2IA 4MICA 2VUHB 4HQKA 1AK9A 3U80A 3DDZX 1WF6A 4HYQA 3F0TA 4IW3B 1B43A 1TF7A 2P75A 3WHKA 3EEBA 3OY7A 3CLKA 3DTNA 3ENQA 4GX5A 4IEFB 4YJ3A 2JIZD 3EA4A 5DB4A 4CF5A 3I12A 3ENWA 4ZODA 1XZGA 1T4CB 3MJRA 4OYLA 5LJLA 5I47A 5LL6P 3G9ZA 4ER0A 1P33A 3TTVA 4C0HA 5JD3A 2QX8A 2XMSA 3IAAA 4CETA 4FYJA 5COAA 2GOYA 1D03A 4OI1A 2VJKA 2ZDHA 4Z7OB 2IOYA 2AC2A 3OFND 3K09A 4WKNA 4C4YA 4IHJB 2GN2A 3NOXA 1FRFS 1DC8A 1HPLA 1GTVA 1RWNA 2QR2A 4GYYA 5J9FA 1VPTA 1EHCA 3UBMA 3SIPA 1J06A 3A06A 3TR5A 4GZMA 4BLVA 1T0JB 1NWHA 2G36A 1JN0A 3A6EA 4I2NA 4RHUA 1RU3A 4R8LA 3A27A 1I3MA 2HIMA 4Q3KA 2PT5A 4YO7A 1EAMA 3A9UA 2HQ1A 3BGOS 5TARA 1U7XA 5SYMA 3WQRA 4W9NC 4Q15A 4B3XA 2QLFA 4FFOA 2VAMA 1N5RA 4QUHA 3GLGA 1A8SA 1YBVA 4IVQA 4X20A 4BMVA 1YOVB 3NOOA 4Q3BA 2WM9B 2IZ5A 3KPVA 4QWWA 2XCTB 2UXCB 1FX1A 1TCUA 2IELA 5A9SA 4M46A 1A8PA 1J90A 3B6JA 4Q1EA 4UUPA 5AI4A 1OBCA 1L7RA 3EXEB 3K1AA 3NTRA 1AKNA 2G71A 3EXHB 4GXNA 3KLBA 1XMQB 4IIXA 4HH1A 1OAKA 3CINA 1D0VA 3TW8A 2OV4A 1POXA 2OLJA 4QODA 1NXOA 3GDWA 2V7GA 2ZJ6A 1NYLA 1E9DA 3ZU5A 3L93A 3GA0A 2XIJA 3P19A 3QV1A 1EQUA 4I8IA 4S35A 4YB8A 4ZVQA 1GFZA 2AS0A 1PLKA 2FX2A 3TO5A 1WNFA 5J40A 4EB0A 2P6MA 1U04A 1XI2A 2X86A 4X3CA 3GAZA 3PCRB 1UT6A 2B6HA 5E7QA 4ZDWA 5IJAA 4L8WB 2FUG1 5BOVA 1NLUA 4FT4A 4XWWA 3DCYA 1FDWA 3QVMA 4LJRA 2H1IA 1XMPA 1WOMA 3LH5A 1R0KA 1OLUB 1CY7A 5JNTA 3CUEF 1T34A 3G2KA 3ZCSA 1Z88A 1DO0A 2OBYA 1SUEA 2P77A 2HRQA 3UH1A 4A1OA 5JO9A 5IC4A 3OESA 2IRWA 1WO8A 5IG2A 3IDOA 1XNJA 2LNDA 1IVSA 4MRAA 4PLHA 1YKSA 2QL5A 2AMJA 2FZLA 2JFFA 4TV8A 4BLOA 2Z83A 4O4IF 4BBPA 2QSUA 1M2EA 4BNFA 2PMDA 5EJEA 3DEIA 3K96A 3RD5A 4EMSA 4F2WA 2X0DA 4JXJA 1LDNA 3PQ5A 3VGPA 5K03A 4DR7B 2H51A 1A5SB 1FFXA 2J3MA 1H2EA 2PCJA 5IC5A 1M8JA 1YIAA 5JEEA 4F46A 1WD5A 1SQ6A 2J0UB 4U6SA 3M7IA 4B4DA 4DIUA 1FSGA 1GR1A 4PYQA 5IMBA 6YASA 1TW2A 2R7MA 4NCNA 3DAPA 3E18A 5L7WA 1KEPA 2ZYDA 2QRHA 1L7MA 2B35A 2Q99A 2Q8QA 1PD1A 1KY2A 2K2WA 3LXRA 3D2BA 1M2OB 3T3EA 1RC8A 2JGIA 3DAYA 3E03A 1K7XB 1Q21A 3V2UA 2JJQA 3W4KA 3PXGA 3U60B 3COSA 1SRRA 3A4LA 5TQ0A 1QLWA 3FSGD 3ZE9A 4FMCB 3H2BA 2W6ZA 4BQRA 3SKYA 5AOVA 2DPMA 2BZ0A 2WAMA 3P5SA 1LBEA 4RA9A 4AAYA 2AV6A 1U80A 1GADO 4KNYA 3OLQA 1DQSA 1YRLA 1QBGA 2ZJ8A 4MS3A 4OBWA 3HVHA 4LGYA 3EDOA 3S7ZA 2WWIA 1T0IA 4N3AA 1PSWA 5BV7A 2G1AA 2GDZA 1O87A 2XKAA 2PYIA 4Q6WA 3PGJA 3SLRA 1SKUA 1KZ1A 5AVZA 4GMFA 5A0TA 1UOOA 1CQZA 4LISA 4WJKB 4J0HA 1Y4SA 1VE7A 3I8SA 2NUBA 4BFVA 5CG1A 2NVBA 4GH5A 4I4LA 4YRMA 7MDHA 2PUAA 4XM0A 4QM7A 4FLMA 3K8OE 2X7XA 2PV0A 2QVCA 1NKSA 3GGPA 3MUEA 3R9KA 3D4NA 1U0BB 3VO2A 3LOQA 4L5CA 4V2UA 4EY7A 1ICIA 1N57A 1CZOA 2NUAA 4JR0A 4WACA 3UG7A 4EMUA 2MSDB 2OO5C 3BILA 3B60A 3T7IA 1JWBB 2O19A 3ISTA 2WU1A 4F8EA 4YCBA 5CYGA 5F9HA 3EGXA 4N0QA 3Q7IA 3UYLA 3PJEA 1PR9A 1VJTA 1JIXA 1KBOA 1XMXA 4EF6A 3PITA 2YWDA 1PZXA 1OIXA 1IN4A 1KU6A 1U7UA 2VP4A 5TEWA 4ARBA 4BFUA 2Q5OA 4OP2A 3KYCB 4BGDA 3ORSA 5IN5A 1Q77A 2FCRA 3WRVA 3ZJUA 2HW8A 4CKXA 3DOJA 1MZPA 2C9BA 5EZYA 1MOQA 2MDTA 4AF7A 4UE2A 5LU8A 1EIWA 1U6KA 3ORRA 4JSYA 5EQFA 1VCIA 1FC0A 2XXJA 2A1UA 3VYTB 3QSGA 1MLDA 2R66A 3H4TA 5E7JA 3QF4A 1PL8A 2I7XA 3ZWYA 1HXHA 3H0KA 4KYIB 4AECA 2HUPA 1CT9A 1JI0A 2ZRBA 4P33A 5I7HA 1JMKC 1EESA 3ETGA 1N6HA 4QPDA 4BASA 5FBZA 3DAHA 4MA0A 1QDUA 2DE0X 3JQ8A 1X7DA 3B5IA 3M83A 1D0SA 4RBNA 2AN9A 3K92A 4KC0A 1HT0A 4KP7A 1XALA 3AZOA 3IS3A 4LNUB 3GY0A 1K6XA 4QOIA 5MHTA 1TPYA 4FGWA 4BHTA 3S2IA 3G7UA 3OC0A 1RD4A 1UKBA 3F3SA 4Y9DA 3WICA 2EG9A 3MA0A 1C9KA 1A4XA 2RB4A 4F97A 10MHA 1HNWB 1KI7A 2E4ZA 2Z2ZA 1BKYA 3BHNA 2X1VA 2VDUE 1JQEA 2I3ZA 2PRYA 4I50A 1JG3A 1RXCA 2PCLA 2XGOA 3DUWA 3OJXA 5K3BA 2YIDA 2QE7D 1GZ6A 4HDNA 2FJPA 2Q27A 2PKWA 1RJ9A 2P8SA 1H8EA 3MLBA 1XVLA 3OZWA 4G36A 5L3QB 4K9NA 2C77A 4ES6A 1JG7A 2V8OA 1JAXA 3VPDA 1YZUA 2C04A 3K9NA 3TOCA 4I1YA 2EWWA 4G8DA 1IYZA 1ZM3A 1H2ZA 4NEHB 5HGJA 2C3MA 4M1QA 1Z37A 3EAQA 3RSFA 3TW4A 3U7IA 1ZITA 1MAAA 2XA2A 3B6EA 1E2JA 3PPWA 4Q3LA 2WM3A 1JKIA 2A5FA 1L4HA 1ZL2A 3QHQA 4BFZA 4CVNA 3N8KA 1J23A 2HKIA 4FEGA 3QBJA 5BQFA 4DLUA 1NZFA 3D3JA 5SZKB 1F0PA 1SRQA 2AIRA 3O4HA 1W93A 1XZNA 2O20A 3D3KA 4MVXA 5GIOE 4RVNA 3AYXB 3C39A 4BTLA 3N28A 1WKVA 1NJFA 2ZIXA 1SPBS 3VAZA 1T13A 1YCGA 2PZLA 3AHGA 2P9YA 2YICA 1HY3A 3JTMA 3L9XA 3PJDA 4QAQA 4LF6B 3SXJA 3ZHBA 4PICA 3LK6A 3AEYA 1IY9A 3ICOA 4ZQGA 4L0MA 3SKXA 5BR7A 3KSMA 4KNVA 1WHTA 2WTBA 5G40A 1PJQA 1EM8B 3O82A 2F1RA 2VYFA 1PNQA 2JK0A 2XD4A 2VPWA 2XOKA 1PUJA 4KZKA 1NBAA 5I7OA 4EPWA 2PMEA 2B3TA 3A3KA 1ZK1A 4IKPA 1J9GA 1YB1A 1YQQA 1T5LA 3IVAA 3RYHB 3AF3A 4UU1A 1ODKA 2FQYA 3CEJA 4I4TB 4UDYX 2F00A 3SM3A 5KYUA 3R76A 3TWOA 2AX4A 2AMYA 2PX3A 4C08A 5K8IA 3V4SA 2AOTB 3ZZ1A 1RQGA 2GAIA 4LC9A 2JCVA 2Q1SA 3HYLA 4HNVA 1QWSA 1VE1A 3F5SA 4K5QA 2AHOA 5KYTA 3RUHA 2LCFA 4ND7A 2BV3A 4V0NA 2IF2A 3NEJA 1XEWX 4HH0A 5L3ZA 3UJPA 3WS7A 4C43A 4XWKA 2WG1A 3QE0A 2I7DA 3N5CA 3OJWA 3ZIDA 1G98A 1BH6A 4LZNA 1QC5A 2RHLA 4Y0NA 1CVIA 5UKDA 3VYUB 4HEHA 3TNFA 1PL6A 4C03A 3BSYA 3UUGA 4CF3A 1U7ZA 5AIBA 3ZW7A 1THZA 1U7PA 1YB6A 2J3DA 2XTMA 2XZPA 1Z9BA 5DM2A 3UM9A 4AUNA 3KHUA 3RSGA 3BIOA 2G0TA 3O03A 4D79A 1RC0A 5KVCA 2ATXA 2EKPA 2HBRA 5GM1A 1ZBQA 3KNZA 3UJ6A 2I2CA 3HWWA 4G1UC 1VBKA 2A9OA 4ZZIA 2HCTA 4UC0A 2RKBA 3SF8B 1V5IA 3HBAA 1I7NA 4JUAA 3DV0B 5AM1A 5ESWA 1E1LA 4FYMA 3DEHA 3GUVA 3MTIA 1DBIA 1VLQA 2QXUA 1VCOA 2QORA 2OG1A 2QZZA 3PK0A 5J59A 2ODAA 3V4FA 5EMKA 5DBOA 4R8SA 4UHBA 3B9PA 4RZUA 3JQ9C 3IHKA 1BO6A 3IA7A 5AKLA 2BE7A 4YWHA 2GEKA 3RVBA 5A4MS 3RGWS 4R1OA 5JJBA 5KAPA 3FOZA 4IHJA 4QO7A 2YRXA 1LWOA 2FJUA 4TS9A 5AKYA 4YY3B 2FHPA 1W8IA 2C7BA 3F2IA 2ZVJA 4NF2A 4BL5A 3FPBA 3CEHA 3EVFA 3GNTA 3HYNA 4UAVA 1FP2A 2JC3A 4CKWB 2OSVA 4WUTA 4L6IA 4I9GA 1SZJG 4C0BA 1WE2A 3GPLA 3VPCA 1QPZA 2PUDA 4W8HA 1MJ5A 1IC6A 2QAGB 1KRXA 2D1TA 1M67A 4JA2A 4M99A 1VJDA 3K6RA 3GL9A 4NYIQ 1SVMA 2ATEA 1OT5A 2QPLA 5EVCA 2PX6A 3IMGA 5ADWA 1FLNA 3K5IA 4YV0A 5KTTA 3AF6A 2YVLA 4CG1A 1ZD2P 5HIIA 2Z3VA 2FRVA 3EXEA 3R6WA 4CDNA 2WF8A 1NQAO 3EXHA 1CRPA 4ZOCA 4BNJA 1JDPA 2IYZA 3I3OA 5LCXA 4F96A 5CA1B 2RH4A 2XRMA 1QF9A 2JH3A 5TGTA 3EQ9A 3S4YA 1CY8A 1T6XA 2PJUA 3LGAA 5T4FA 2ZRFA 4K9DA 4NICA 3V1TC 2E37A 2B4TO 1M2JA 3T5PA 2G80A 4R01A 5H7XA 3UKDA 3PPYA 4QUJA 4F9EA 1AHIA 5LP6B 1N6IA 1UP7A 5CT4A 1EX9A 4BZZA 2PUEA 3UAOA 3D59A 1UJNA 2CHGA 3FLEA 1VLMA 3P2IA 3ZQ4A 1KEKA 2WSSA 3TLKA 1MFZA 2WYOA 3EY9A 4EENA 3L01A 2DC1A 2XIQA 4MRSA 5CP8A 3D4LA 4BJ5A 8ATCA 1VZ2A 4MULA 4MYUA 3TXYA 1FW6A 2XT0A 1OLUA 2JIDA 3LFTA 3PHLA 5JLJA 2ECPA 1QTIA 2EJTA 1QJ4A 1XXHE 1DJPA 4NAVA 2I3DA 4TXLA 3MIIA 1M8KA 1D7OA 2Q6TA 4A0RA 621PA 4P53A 3WLAA 3WNVA 4G5RA 3PXAA 1UWKA 4RIIA 5FPSA 4KTTE 5E3HA 2XB6A 4H7IA 4IS2A 2HMVA 4WASA 3UHPA 4IIEA 4OM7A 1IXSB 1G7SA 4TXJA 3VH1A 4A6XA 4LJ6A 3C3EA 1EFRD 1ZM2A 2PWBA 2XUGA 3FR8A 4NU6A 4TLAA 3CPJB 2R7AA 3GELA 2IDMA 3HB9A 2WW8A 2MSCB 2J0UA 2WTAA 5K3CA 1E2PA 1QTNA 3QTTA 1WLSA 1W4RA 1YI0A 5IN4A 5A02A 4EYEA 2G1UA 5BVHA 4E7PA 3JQQA 3DMHA 3RT9A 3GROA 3U62A 4DDHA 4RMGA 2I9PA 3QFSA 1EFVA 1Y3DE 1KAGA 1ZN9A 3C85A 1UPBA 5KYNA 3GDGA 5JQGB 5EJ8A 4QGGA 1PL0A 1PYOA 1NMEA 5DBEX 4DNFA 2XODA 5EP2A 4DA0A 3L7IA 4IO1A 3WHIA 3D4PA 3WKDA 5HGXA 1JJVA 5F51A 5TQ2B 4MQEA 3EZLA 2CUZA 1F14A 3W5UA 3NIFB 2CL0X 1UT8A 2QZSA 1Y5LA 3DXFA 3G7NA 1GV0A 3ZDXB 2MINB 4XDZA 5JAZA 4LAFA 1LTHR 5FUVA 1CUXA 1EB8A 1NW3A 2MTBA 4B9EA 2QJRA 4A8JB 1HT2E 1UMCB 4F93B 2Q5HA 3MGAA 2J7KA 2UUPA 2WLSA 2P2ZA 5DNDA 1E6CA 2Y1OA 3AHJA 3KTOA 1N9ZA 3ZZTA 1N6OA 3OZTA 1QIFA 3A9TA 3FNEA 1SVSA 3RTEA 3ZWQA 3NM5A 1V3TA 1X8XA 3DXYA 4BGUA 5JYDA 3OU6A 4U7WA 2WWGA 4MKRA 1II9A 5AW4A 1EZ1A 1VJGA 4UEOA 3BWVA 2AFIA 4N01A 4OHPA 4CUKA 2OORA 1CZHA 5FEMA 3HXKA<