4RV5A

The crystal structure of a solute-binding protein from anabaena variabilis atcc 29413 in complex with pyruvic acid
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
364
structure length
364
Chain Sequence
NTIPIGIALAQTSNVALLGQEQVAGAKIAEKYFNDKGGVNGTPIKLIFQDTAGDEAGTINAFQTLINKDKVVGIVGPTLSQQAFSANPIAERAKVPVVGPSNTAKGIPEIGDYVARVSAPVSVVAPNSVKAALKQNPNIKKVAVFFAQNDAFSKSETEIFQQTVKDQGLELVTVQKFQTTDTDFQSQATNAINLKPDLVIISGLAADGGNLVRQLRELGYQGAIIGGNGLNTSNVFAVCKALCDGVLIAQAYSPEYTGEINKAFRQAYVDQYKKEPPQFSAQAFAAVQVYVESLKALDTKNKVSKIQLPELRTELNKQLLTGKYNTPLGEISFTPIGEVVQKDFYVAQIKMEKDGSQGKFTFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amino acid/amide ABC transporter substrate-binding protein,
publication title The crystal structure of a solute-binding protein from Anabaena variabilis ATCC 29413 in complex with pyruvic acid
rcsb
source organism Anabaena variabilis atcc 29413
molecule tags Transport protein
total genus 138
structure length 364
sequence length 364
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rv5A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rv5A01
3GL9A 3BBLA 2ZAYA 4MS1B 5EWLB 5HKOA 4L4UA 3O1JC 1QP7A 4OTZA 1LJUA 2L2QA 3Q7RA 3C97A 1PUXA 4RK7A 2LUOA 4MRMA 3O1IC 1J56A 3HJFA 1DCKA 1JH9A 5B3JC 4NV3A 2CHFA 2WY2D 4LX8A 1PNTA 3LFTA 4HNQA 4FB4A 1FSPA 5TE9A 2B4AA 2PUBA 4MR8B 1XHFA 1NXOA 3FFTA 3D02A 1JFTA 3MM4A 1RNLA 1DBQA 2PL9A 3MIZA 3URMA 2LIVA 1D1QA 3LUHA 2IPMA 4EVRA 5BRJA 4MR9A 4EYQA 3SY8A 4F11A 1L5YA 1T34A 3R0JA 1KMIY 2FLWA 1OXBB 3JPWA 1BDHA 3K9CA 2RDMA 4IGAA 1PNRA 5IC5A 1ZN2A 1JHZA 4MS3B 5IUNC 4E7OA 2PL1A 3N0RA 4RK1A 3OLZA 4LE0A 5FWXA 4MR7B 5ED4A 1Z2EA 5TPZD 4YV7A 3T95A 3CTPA 2NZVG 4W5NA 4W5OA 3C3KA 3QEKA 2R4QA 2AYZA 4KK4A 3P9YA 8ABPA 1KRWA 2FN8A 3OMXA 4P1ZA 3QLUC 2Q5CA 1D5WA 1YS6A 3KCNA 4F06A 3D8UA 3MMNA 3CNBA 3TD9A 2OQRA 3CG4A 4YGXB 5TQ2B 4ZYLA 1YS7A 3QLVC 2OENG 2FEWB 6CHYA 1USKA 4JA2A 4RK5A 4G0PA 2TMYA 1RXEA 3DLHA 2AYXA 5DKFA 3EJWA 4TMYA 3F73A 4HNSA 3HSYA 5DCLA 3GV0A 5TPZA 2XDYA 5JNTA 4FE7A 1DRKA 2A9PA 2E4WA 4N0QA 4MPTA 1QMPA 4F8JA 3BRSA 2FMFA 3F7NA 1DG9A 2IOYA 3A3KA 3OLWA 4NCAA 3Q9SA 4NQRA 4YCSA 2I6FA 2YHBA 3LUAA 2A9OA 4JB2A 2KYRA 5JNWA 1DRJA 3DGEC 1DBPA 1MB0A 1S8NA 3NHZA 4RV5A 3JY6A 4LDZA 4F3TA 3EODA 3O74A 1RPJA 4EYOA 4Z4GA 1M5UA 3RQIA 3KS9A 4KFCA 3M6MD 2FKAA 1LK0A 3HO1A 4JP1A 1IIBA 5KQGA 3KTOA 4YRZA 4XASA 1HEYA 2H3HA 1Y1LA 5E3JA 1DJMA 1FQWA 2PJUA 2VYCA 3BILA 1PHRA 1SXGA 4ZPJA 3H5LA 1EAYA 3H6GA 2WJAA 3C3MA 3SQNA 2MSWA 4PICA 3EQZA 1NXSA 4RKQA 3HUTA 1DP4A 3RVQA 2L17A 1NXWA 2R47A 1C0EA 3CRNA 3KLOA 3VNAA 4Z4FA 5EWMA 2PMCA 2FEPA 3M9XA 3KG2A 4Z4EA 2FQXA 3I5AA 2A9RA 1TVMA 2YHAA 4NICA 3FGZA 1JFSA 4F12A 5KI6A 3O75A 3TB6A 5KQLA 2WRZA 1FFGA 2RJOA 4WZZA 4RK6A 5GQSA 2JB9A 4QPJC 2IYNA 4LDAA 2M98A 2HQRA 2GWRA 1DCFA 3H5IA 3ILYA 5TQ0A 1JDPA 2CWDA 3QEMB 5IEJA 3T6KA 2QXYA 3I09A 5KQPA 4JB0A 3UK0A 4TLLB 4KQ9A 2WB4A 2B1JA 4KVFA 3E61A 2IPNA 3OO0A 1W9HA 2FN9A 4YO7A 3NNDA 3CS3A 4W5TA 5DLEA 3H5OA 3MYYA 2WJWA 4ETMA 1XWWA 2HQBA 4H3KB 3HVRA 1JBEA 3MA0A 2QW1A 3CU5A 5T3YA 1JWLA 4UHJA 5IULC 1YMUA 2L19A 2NZUG 3G1WA 4PE5B 1ISSA 5JNUA 5TQ0B 3I42A 3QELB 2E4YA 1AB5A 1MVOA 3EULA 1D2AA 1PEAA 4YLEA 4P98A 4RY0A 3NNNA 2RGYA 1SRRA 1URPA 1NY5A 4HNRA 4RU1A 4EVQA 4EVSA 2N9UA 4G0YA 4OLAA 4MRMB 3FFXA 4QICA 5I4CA 3HDVA 3DBIA 2FEKA 1Z2DA 5IX8A 3EGCA 2GI4A 2BGGA 1LJLA 3F6PA 5JNVA 5CNJA 2DRIA 5KWSA 4WT7A 3NNSA 3JTEA 3LMKA 4OATA 3QK7A 1SXHA 3UKJA 4MR9B 1QQAA 1QQBA 1Z18A 2E4UA 3TMYA 3TX6A 1JYEA 2CHEA 2FMKA 4H60A 3A10A 4KQCA 1ZH2A 1U2QA 5IBQA 3RVLA 3HS3A 2PUFA 1YMVA 1DCMA 2P4UA 4G0OA 3H5TA 2X7XA 3LKVA 3OLXA 4QYWA 3LUKA 1U8TA 2MSLA 1QPZA 4RZSA 3QX9A 1LBIA 5FWXB 3EDCA 1FFWA 3RH0A 2IKSA 1A0OA 1Z26A 4MYRA 2H0AA 4G0QA 3SM9A 4EGSA 5FWYA 3OQMA 2M1ZA 4N0PA 4MQEA 4W5RA 1BVHA 5IUKC 4YS6A 1P6QA 4JAVC 1JDNA 4GNRA 3KJXA 3MQ4A 1BA2A 3JPYA 4MQFA 2FQWA 2FTKE 2R25B 1MIHA 3O2JA 3GRCA 4MLDA 1PEYA 2IPAB 2JVJA 4IRXA 4RDCA 5BQ3A 3GYBA 1RXIA 1NATA 1DC7A 2E4ZA 2MYUA 3LOPA 4IMJB 4H3HB 4Y9TA 4Z99A 3N53A 1L5ZA 3FDFA 3QLTA 3KHTA 2QV0A 2R48A 4E7PA 4D74A 3HK2A 3Q7TA 4YWHA 1MB3A 3RVOA 4DN6A 1ZH4A 4MQEB 3RVJA 1M5TA 3HZHA 3N0WA 4KNYA 1ZHHA 1DBWA 1UDRA 3CLKA 3Q7SA 1TJYA 1U0SY 1YK0A 2GX6A 3QX8A 1E6MA 4LE1A 4WXMA 4XFKA 5B3JA 5TQJA 5BRAA 5FBKA 3RVNA 1JYFA 2F8TA 5HM6A 1CEYA 1NXXA 2QU7A 3OM0A 4S05A 1VPWA 3KYJB 4G0MA 1APBA 1ZITA 1TM2A 1ZESA 2QVCA 5EWJA 1XHEA 1GCAA 4KK3A 4JOQA 3RVPA 2HPHA 3G85A 3JVDA 4N47A 2LPMA 4Z4HA 1C4WA 3OMWA 2FMHA 1LBHA 4RY9A 1K68A 3HM9A 5TPWA 4Z9AA 3Q41A 3LUJA 5T7BA 3VNBA 2HJ9A 1ABFA 2WMYA 3B2NA 9ABPA 3H1EA 2QZJA 6ABPA 3E3MA 3IDOA 3OM1A 1RZRD 1JL3A 3H1GA 1Z15A 4O1IA 1E2BA 4KZKA 3IP7A 4Z4IA 3LUGA 2VK2A 5KQMA 4IF4A 4WWHA 3QLUA 2CD7A 3C6QA 2PLNA 5HSGA 3W9SA 1Z16A 4MS4A 1P6UA 1W25A 3O2QB 3KSMA 1A2OA 2PUAA 3QLVA 5JNRA 1Z12A 3BRQA 2PE5A 5EWMB 1USIA 5C5CA 4MAAA 1QNLA 3LKBA 1MAVA 1E6LA 1VKRA 2RJNA 4G0XA 3RVSA 1QP0A 4Z0NA 3OO1A 3T8YA 2PUEA 3A0RB 3HDGA 5DGCA 4QYMA 1A04A 2FVYA 1Z13A 4ZMRA 2JCGA 4G86A 2FSPA 2W42A 4EYGA 3S99A 4XARA 3H6HA 2VUIB 4MR8A 4PEVA 1WETA 3IP9A 1GLGA 2GBPA 1SXIA 3TO5A 2JK1A 3I45A 3IPAA 2FMIA 2ZWMA 3HEBA 5DTEA 4D6YA 2NT4A 5D2CA 5HQJA 4TN5A 1ABEA 2QVGA 2WWVD 3SG0A 1EWTA 2GKGA 1P8AA 4YR7A 2PUGA 1U2PA 2MYPA 3GBPA 3LUFA 4KV7A 1ZGZA 4MS3A 4O5AA 4ETIA 2NT3A 4MR7A 3HCWA 5JS1A 1B00A 4N41A 2ID7A 2IDMA 3CKMA 4ZJPA 1TMYA 1BDIA 2O20A 4EYKA 2F8SA 1USGA 3O2SB 1OXKB 4CBVA 1NXVA 3CHYA 3IP6A 4O1HA 4XLTA 4G97A 4EY3A 3N6VA 3CG0A 4MGEA 5C5EA 5CNIA 4W5QA 1GUDA 5BR1A 5JNSA 5TQ2A 1EWKA 3BREA 3GA5A 2PKXA 4PZ0A 3SNKA 1DC8A 4OBBA 3NHMA 5CNKA 3MF4A 3EAFA 2LP4Y 3KLNA 3RVKA 1CHNA 3GBVA 3ROFA 3GT7A 3HV2A 1BDJA 2FLKA 5JS2A 2JRLA 3H1FA 4S04A 1K66A 2E4VA 4RK0A 1DZ3A 1EHCA 1VLZA 2MYTA 4Q6WA 3T38A 1F51E 3N75A 1EWVA 3UUGA 4NCBA 3OQOA 4DQDA 1BAPA 1R8JA 3OLVA 1ZAYA 2JVIA 1EFAA 1M2FA 1NXPA 3JS5A 3LTEA 4EUKA 2QSJA 4LE2A 4Z9BA 4RK4A 5ABPA 2HSGA 4RWEA 1JFVA 3O1HB 5CNMA 3KYIB 3LUDA 4KREA 1ZDMA 5FWYB 4Z4CA 1YIOA 4XXHA 3IPCA 4LRQA 1KRXA 3DZDA 2PUDA 4N03A 1H9CA 1ZGGA 2V0NA 5IEBA 2FXIA 1TLFA 2MSKA 4MQFB 1ZY2A 2FW0A 2L18A 4RY8A 3RVMA 4Q6BA 4IILA 2IPLA 4OLBA 4KRFA 2E4XA 1D4ZA 3Q15C 4RXMA 4G0ZA 4RXTA 3FFWA 3CFYA 1U04A 4GPAA 4LZLA 4RXUA 1F4VA 3RVRA 3JVIA 3DGFC 2JBAA 2JVKA 4PYRA 5KC8A 2J48A 1GCGA 3O21A 2FQYA 3KKEA 5KC9A 3K4HA 4M88A 2PUCA 3N8IA 1QP4A 3C3WA 4WXEA 4TLMB 1Z17A 1YVUA 1SD5A 3FMVA 4RKRA 5PNTA 5GOTA 3GWGA 1JX6A 4FE4A 4B09A 3N0XA 1I3CA 3CZ5A 1QO0D 3ILHA 5EWJB 4MLCA 4ETNA 5FBHA 1D1PA 1P2FA 3H5VA 5CHYA 4XAQA 1GUBA 2VUHB 3F6CA 3H75A 2LBPA 2NUBA 1NTRA 4N76A 1JF8A 4RSMA 2JBAB 5IUJC 1YK1A 3DLBA 5TPWB 3QEMA 1QKKA 3ROTA 2QR3A 2ID9A 4HYEA 4MS1A 3H5WA 5EWLA 4RS3A 1ISRA 4DADA 4UHKA 4D6XA 1FFSA 1VRVA 1NXTA 4L85A 1YTUA 1KGSA 5F64A 1AB6A 3SAJA 2A9QA 4IMIB 3CZCA 2MYNA 4KPYA 1M2EA 1QO0A 1E6KA 4KMRA 3OQNA 3HXMA 2HQOA 1RZRA 3EQ2A 1JLKA 3LUCA 3OLYA 3L6UA 4ML3A 1ZVVA 3M9WA 1CYEA 4WUTA 7ABPA 3HUUA 4Q7EA 4JASB 3NBMA 3QELA 4MS4B 4YP9A 2P9HA 3L49A 3A0UA 4OG2A 4ZMSA 3IP5A 2PAFA 1Z25A
chains in the Genus database with same CATH superfamily
4MVCA 2XYPA 1KDZA 3GP8A 1HGXA 3D6MA 2I7TA 4IYRA 4MPDA 2FUEA 4ND2A 2AK2A 4PZZA 4O25A 3ZWBA 4C7XA 3CRZA 4FR5A 3R7WA 1SIBE 1TM1E 4I1RA 5EE5B 1NFFA 3MILA 2QD4A 4HX2A 3SC3A 3BDVA 2OVBA 1KE2A 4DEXA 3H16A 5G41A 2PUBA 1NRWA 1W19A 3FFTA 1KF0A 1PZEA 3A11A 3ZVRA 3ZBQA 5AK6A 2JIBA 3MIZA 3ZUPA 3OU6A 5AW1A 1CDEA 1J2JA 4JBHA 9LDBA 4PPFA 4E5MA 2ZETA 4EYQA 4C43A 2G77B 3CISA 3STWA 1YQXA 1CQJA 4KLAA 1TKCA 3R0JA 1IEXA 1TQHA 4LRYA 5FQOA 3QYFA 2PH7A 3GGJA 4KYVA 2R6JA 1JHZA 2IYWA 1KKMA 2C78A 4M76B 5EHIA 4JI3B 1UWVA 2ZCUA 4TVKA 2H4XA 2G80A 2VPPA 2VWGA 2PMFA 4X8OA 5EC8A 5FBWB 2XQJA 3ZNNA 4BTVA 1ZR4A 1TYDE 4IAOA 4KBGA 4R0NA 5J4YA 4YRKA 1IWOA 3E3LA 1WKBA 2E6UX 2IDZA 1LJ8A 1PDVA 4IJ5A 4YRQA 5JVDB 5ARBA 2HZBA 2QKYA 2R4QA 3E8SA 3PT5A 4FC6A 5CVCA 1NUHA 2DUUA 2BF7A 4TLEA 4LSMA 1ORTA 4N8SA 4OXIA 4D98A 1KO7A 2GTIA 3ESYA 3P9PA 1S7GA 1UMDA 4NRDA 1PG5A 4P1ZA 3OOWA 1K9VF 4KR3A 4QUIA 2F1RA 1QRAA 1KXJA 3GDFA 3TXXA 5IDWA 1KC1A 2ZS7A 4I1VA 3HH8A 5M34A 4U3JA 1GZ5A 1GR1A 2GKOA 4C21A 4DJEC 1VL8A 4WZAA 5JXWA 1CR6A 1ZL2A 4NK5A 3SBDA 1WPGA 3B52X 4XLZA 3PSAA 3BS4A 3FPGA 5E3IA 2OHIA 2AFHE 1TZJA 1E77A 4H08A 1EBFA 2XXAB 2NUTA 1HURA 1TJPB 3PDIB 2FSUA 4FWIB 2RGNC 3U09A 2Y0EA 4TM7A 4F8JA 4QYIA 1TM3E 1XEXB 3F7NA 3V2HA 2DT5A 2GFHA 3C7AA 2PVSA 5DHFA 1EX9A 3LUAA 1ZMBA 4IV0A 1I51A 3JAKB 2WFLB 1NLZA 1W85A 2AEMA 2CMHA 5CVVA 4AKSA 1I3LA 1KMHA 1MQAA 2CNKA 2BEWB 4WA7A 3ZXYA 1U5AA 1M72A 1ZO8A 5G4KA 4DBVO 1S3SA 1ZRHA 2F8LA 3HO6A 3L6BA 3QKTA 1IY2A 1ZR2A 2FG5A 4XWYA 1RPJA 1SB9A 5JE8A 1J5XA 2XRFA 4GI3A 5JPDA 4LYEA 5BNFA 2PT5A 2SCUA 4JP1A 2ZROA 3ZKAA 1MQ8B 4XASA 4FXPA 5LDHA 1IZZA 4LF9B 3VSAA 2CXSA 5D3MB 3EPLA 5C8DA 5ILQA 3NBYC 4Z1MD 1SXJC 2JD2A 3G8DA 4O2BF 5DYIA 3SKVA 1HT2E 3BMOB 4KWEA 2P6PA 5L40A 4QDZA 4EP1A 5EHQA 4P80A 2RB5A 1O97D 3KV1A 1NVFA 4MB2A 2MSWA 2EJWA 1IQPA 3IB3A 3DQPA 3EVZA 4JHLA 1SU6A 4ZP1A 4N0DA 1I4OA 3BXFA 3IQHX 4Q4CA 1MDBA 4WKGA 1BC5A 3SVTA 1NNI1 2WUDA 3OLCX 1YFKA 4P82A 5GONF 5IDYA 1Q22A 1QAQA 3WMGA 3AVWA 3EEFA 4ZK6A 3HXPA 1GG8A 1HYHA 4IJVA 5FOVA 3M4NA 1UPXA 1LA2A 1F12A 3SI7A 4QVKA 4NCHA 1NBOA 1T3ZA 1XELA 3B3GA 5FTJA 5YASA 3RWMB 3N9IA 3SMVA 5DYNA 2PQ6A 1IHPA 2DOKA 3BWEA 1FDIA 4U7TB 3TB6A 5KI6A 3VMFA 4V1CI 1Z0SA 4N0EA 2BV3A 1TRKA 5GQSA 4YP5A 1ISJA 1XP5A 3ABQB 5FYDA 4HB0A 2J41A 2MOKA 2HQRA 4QASA 4RVHA 2ZZMA 2WIBA 1ZVMA 3MWYW 2OQVA 1YR2A 3WGVA 2AG5A 5TQ0A 4AQDA 2D2XA 5LXTA 3QHQA 3BD9A 3LYLA 1M2NA 5KYVA 3CEAA 1GKYA 1HQYE 3EWNA 2YXLA 1W0CA 2FJ0A 1ZK2A 4V3BA 3DDWA 3BGWA 3F8TA 4KVFA 4XI9A 4YJ3A 2ZOSA 1ANKA 1D6NA 1FXUA 1QDUA 2A7QA 4ALLA 3CS3A 1SCKA 4M0CA 4UJ3A 1C2TA 5HKKD 2ZRMA 3NTXA 2Q4OA 1PK8A 4KRYA 1P3Y1 1JBEA 2MSCB 3BTOA 4QYSA 5JS7A 2QD3A 1CE8A 3DBRA 3TIGA 5M7EA 1I4TD 2IIBA 2C2HA 1N7GA 1R9GA 2M9MA 4OK5A 1CRZA 4DTIA 3TRIA 2QI9C 3J7TA 1XZDA 1P33A 1JA0A 3GPBA 3N2EA 4LXQA 1EFKA 1FP2A 2JIZA 4Q9HA 4XIGS 4YLEA 4CMEC 1DX4A 1XNRB 1KS2A 2ZRNA 3C45A 4KNWA 4XB6B 3E9QA 1B42A 3Q9LA 1NY5A 3HXKA 5SY6A 5JSHA 4E94A 2O0HA 3K6RA 4M7WA 4PSKA 4Y6GB 5KKNB 5CCEA 4GT1A 4RTNA 1RPZA 4OLAA 3X1DA 3JASB 2XGOA 4OGWA 5CYOA 4WKBA 5L51A 4QODA 3ONFA 5ARDA 4R51A 1Z29A 1YL5A 2BH9A 3LKDA 521PA 1U3FA 5LJIA 1SCBA 1ZI6A 5JJIA 4Y6PA 1MU0A 4BEJA 3UMGA 2I55A 4LCBA 5CNJA 3IVCA 4MYDA 2WYHA 4HAUA 2FSVA 2I1QA 3TB4A 3A3PA 4XWKA 1G8GA 1KFJB 2ET6A 2UV8A 1E60A 4TS1A 3CEHA 3EGXB 2WPDD 4I1IA 2GOYA 5BUSA 2GASA 4Q3NA 1SCAA 3G88A 4YAGA 2GBFA 3A10A 5AVWA 5KVSA 3FETA 3OZVA 3RVLA 4DQXA 3AYXB 1DJLA 1ZQ9A 3IHKA 2X15A 2PUGA 2X7XA 4PX9A 2XUZA 1EGMB 3QX9A 1ECGA 5CMLA 3BX1A 1J1ZA 5FYQA 3EZ6A 2QLJA 1Q91A 3B82A 1XG5A 3EWIA 5KJ6A 3HABA 1B76A 4FJ0A 1EDZA 4OMUA 1UWKA 5AVOA 1K7XB 2QGFA 1GVHA 4NSNA 1YRQA 2VYVD 5C52B 1QGUB 3RGGA 1KEWA 3R7FA 1BA2A 5I4CA 2R25B 3BVPA 1MIHA 2Z8ZA 2WG2A 3RFUA 4HWGA 5DB4A 1MQ9A 1ZIDA 4GX2A 4LNUA 2H08A 1NATA 3LOPA 4A0SA 4BLSA 4EA7A 2C9BA 2ZPUA 2XWQA 3HM2A 4H3HB 3GLGE 2ZJZA 3SIWA 2A1TS 1SQGA 2OV3A 3ASZA 4UU0A 5TB5A 5HZKA 2RE8A 4CKWA 2DECA 2ROQA 5FD8A 4CLHA 3HK2A 4BLTA 1T2CA 1WE2A 1ZH4A 1I2AA 3CX4A 3CVUA 3OPVA 4JNCA 4YV1A 1C4OA 1PJ4A 1EUQA 4YAOA 1Y8QA 3W2HA 4FMDB 4TMFA 4U2FA 2HYDA 2WAYA 3HNPA 3KRTA 1AX9A 1NF8A 2C5SA 3MMPA 1ZITA 1TM2A 3NRBA 3STYA 3L8EA 1GCAA 1GPDG 2P8JA 1AO0A 2IH5A 3WMRA 5KNCH 4YRPA 2G3YA 3RDPA 1WXDA 2IBSA 1TAGA 1NT4A 2P5SA 4QBHA 4ZO7A 2LPMA 2ONKA 5FA6A 5K4AA 4EF5A 2XDWA 1RFLA 2FMHA 3HBNA 1TAQA 3M33A 3PA8A 3AZPA 3CKLA 5KWVA 3BIOA 5A0FA 3V00A 4X41A 2OLJA 2QM7A 3RS8A 2VATA 4Y6OA 2C9YA 3A1VA 3I0NA 2XUQA 5HDQA 1UBRS 4D8VA 5CA0F 1RMTA 2AG6A 4JZKA 4DQ0A 4V02A 4NCNA 1WP4A 4FD2A 1ZX1A 1XLVA 1Q95A 4CHTA 4PO3X 3PQ4A 2CMDA 1PFUA 4IIXA 4O1IA 4BV2A 5FPPA 3EEOA 3KT6A 1P5FA 3QVXA 1G2QA 3L46A 1T9ZA 2Q5LA 2VXYA 2GM4A 2YR0A 4HEQA 4MV8A 3FTCA 3QLUA 3WQSB 3AJAA 3M70A 4ENVA 1JN0A 2GPWA 4QQNA 1U3UA 5B6JA 5AJHA 1AXRA 4MVJH 4JVNA 2BFDA 3K09C 5HRUA 1F2UB 3QBTA 4XPIA 1RS0A 1T4MA 3BEDA 4TMTA 5CA1B 3GUZA 1A8PA 4F9EA 1MIOB 1QNLA 2IUFA 221PA 2JZCA 2MSEB 3G0IA 4PRLA 1O7JA 4WKCA 3TR6A 4BUZA 2ORVA 3KOMA 3NDBB 4U4AA 5IM4F 3LA8A 4K40A 4F7DA 2FVYA 1CQXA 2HM7A 2QENA 3DH0A 5BW8A 3O3CA 2YZKA 3ZE6A 4RZ2A 4PEVA 1TJ3A 1YOBA 2HF7A 5BN3A 2F1OA 2AFIA 1KH2A 4Z9XA 1C2YA 3TO5A 2ZBQA 1PKXA 2ZE7A 3TJMA 2KM1A 1JSLA 3B48A 3UW1A 1MBZA 3T5BA 4PXAA 4XGNA 4FHFA 4KHPB 1C7QA 4TS9A 1W0JD 3B3JA 4YJ2B 1W6UA 1C3EA 1TGVA 4DBLC 1Z0FA 4PC1A 4WZBB 2JFZA 4W5JA 4F4UA 2ZK7A 3JYQA 4JP3A 4ZZ2A 4OHPA 4ARVA 2NT3A 2REBA 3DMTC 2YWRA 4MUBA 3BXOA 4XYMA 4YRGA 4MOWA 4EFLA 2FOXA 4M1YA 1CBUA 1LPOA 1MABA 2ID7A 3HGTA 3I2IA 3ZDFA 2AXNA 1KSFX 1A7UA 4DSTA 3QF7A 1OOEA 1KVRA 2JF0A 3O2SB 1Z8DA 2ZR7A 4AXBA 1LLUA 1YSCA 1MH9A 2DBVO 1DBIA 4O1HA 4BX3A 3GZ4A 5JD4A 2JCBA 4HFMA 2R84A 4IS2A 2OVFA 5LZ2A 3W34A 2ZTMA 3PENA 3HP4A 4XQ9A 2SICE 5FBVB 2HK9A 3HEMA 4DLAA 1Q15A 4NPHA 3SVZA 4PZ0A 5CHEA 1M0SA 2I03A 1G5PA 4MA0A 3IDZA 1O94C 1N2GA 1RVDA 2LP4Y 3NXKA 1S89A 4UEOA 5KHOC 2KHZA 3F3YA 4PRZA 5DTRA 5ARCA 2Y99A 2H5JA 3NWJA 4JD5A 3T9AA 3VPCA 4RPGA 3SDBA 2AD1A 1Q0QA 2I8AA 3HA3A 2FMXA 4NE9A 2PL5A 4X8HA 3IT1A 3JWEA 6REQA 3OTOB 4X6YA 2R9VA 4BFLA 4D9EA 1RZ3A 1K2VN 2OCYC 1P1KA 5KTPA 1YI0A 4WX2B 4D0LB 4WNIA 4F56A 4H1VA 1KYWA 1PFYA 1VE9A 1NHGA 2LE0A 2JVIA 1CQIB 4YHHB 4J9UE 3GAZA 1NJ8A 1PN3A 2OR3A 2PX6A 2VTBB 1XQXA 2QSJA 4IHJB 4Z9BA 1NR7A 3AFIA 2M2IA 1PJ8A 3TG8A 4LXIA 3S0JA 1L6RA 5KTOA 5FWYB 2DFTA 4R2WA 5CM8B 3KLMX 2CL0X 5CXUA 2PUDA 5SICE 4RA6A 1AKEA 3DDCA 3ONNA 3WNVA 1AC5A 5D3KA 4MHTA 2HB6A 1GFSA 2G06A 1QYWA 2FYTA 1V5IA 5AI4A 2FWJA 2FW0A 2Y1CA 3ZS9A 1K7CA 3BHJA 4B4KA 5AMXA 2V4ZA 4I9UA 5J1TB 4DV0B 1O95C 2HU7A 3GRZA 4GPBA 2O6LA 4FYIA 4PG5A 4B32A 1PJAA 2PJZA 4QTYA 2V7TA 4MVJE 2OCGA 1N6NA 3F5QA 5AXCA 1BD3A 4EF4A 2Y9MB 1AOXA 5I7OA 3V8PA 1YJ5A 1J8YF 2WTEA 2OYCA 3VAAA 3ZTTA 3E1SA 4D9MA 3ICQB 2VEDA 3U26A 2FW1A 1LX7A 2JL1A 3C3WA 3QJYA 5BUQA 5JEDA 1QP4A 3BSWA 5CB8A 5HK8A 4BWGA 5GVSA 3PQ3A 4KSBA 3NOXA 4MA5A 4FS8A 4XGKA 5FT9A 1QF7A 1SBIA 2HFKA 4QPCA 5K9ZA 2ZRJA 2CJPA 2NAPA 2Q6IA 1EB9A 1QH1A 2HIAA 4RCZA 4J7AA 5IARA 4KQIA 4P0TA 1TA0A 1US8B 3CLTD 2CFSA 1XOIA 3D6TB 1FP7A 3G2HA 3OZSA 2OQIA 2LBPA 3AHGA 2ZZKA 3LBIA 3O4JA 1QTQA 1E96A 1UT8A 2O3RA 2Z9BA 3AO0B 1U7DA 3G8YA 3RANA 4ZT7A 5C8VA 1TTHA 3OTHA 5TPWB 3CWZA 4XM0A 2ZI6A 4TS3A 1N5DA 4I55A 4B81A 2OHFA 5JAUA 5KOYA 1JEOA 5H5JA 1AO3A 5ALXA 5CFOA 3H5WA 3I3SR 4G37A 4R84A 4GL4A 2IZ5A 3IUYA 5K6AC 4EHHA 1YE8A 4DZRA 3A4IA 3DP9A 1C9EA 4MUJA 1VE3A 4DJDC 5KREA 3CEPB 2GJAA 3UUWA 1JJVA 3MWDB 1JLKA 5KX5A 2Z9DA 1ARZA 4TZ6A 5HGJA 3DW3X 3IFSA 3UHOA 1X7DA 1REQB 4MS4B 4C7OB 5KDLA 1XRSB 3D6JA 3GOQA 1RRGA 2P9YA 3UMFA 1C81A 3BB4A 2W6PA 3TBKA 2VWPA 4X3PA 2A0WA 3OBIA 2GRUA 3F4KA 3C97A 1KDVA 1PQ4A 3GYGA 5B12A 1ID1A 3GEPA 1EJ0A 1KDTA 1THTA 2X8JA 3AW8A 3ST7A 1TCUA 5GV7A 3PNKA 2JI8A 3RNLA 3ZCTA 2P5TB 4LX8A 4AFNA 2SNIE 2BHLA 2BMWA 4L5AA 2DQ4A 4MW2A 1N7JA 2PNJA 1Z3CA 4C7MA 4P3XA 1QOZA 2ZZNA 5DHUA 1LSOA 1ZU4A 2F64A 1A9ZA 5H3HA 5KYWA 3D5TA 2J9GA 4HB3A 4BRSA 1WD7A 2C9OA 4Y0NA 3WIOA 2GZ1A 4PZEA 3WLOA 3F9IA 5ALLA 4US0R 4CLXA 4BFSA 1Q74A 2BISA 4JI5B 3SY8A 1M7GA 1UKAA 2GD6A 2ICAA 3QUBA 1ESZA 2Q2NA 4GVLA 5H68A 4Z3KA 3U7IA 1UFKA 3KJIA 4G8DA 2XMGA 4TQUS 3D1LA 3M4JA 3DPIA 5IC5A 4LFBB 5HOQA 1Z06A 3G6WA 1DKPA 2B1GA 4E7OA 4OHYA 2AFHA 2NO6A 1P1IA 4LGYA 4IYJA 5F52A 1OH8A 2OBYA 3GP5A 4V0KA 4WAUA 1QVAA 3KZXA 1G8KA 1DV2A 2RHWA 4PYNA 1W29A 2OV4A 3DM5A 3DMYA 4H6VA 1J33A 4H7IA 3AWIA 4QARA 1OAAA 2W11A 3C98A 4BNUA 5JV5A 2WTUA 1W47A 2QE7D 2NYUA 1QH9A 3HMQA 1VCOA 3IAS1 3OMXA 3O3OB 2HSEA 4A03A 2J6HA 2PX2A 5B3AA 5I7EA 5K0ZA 4H7JA 4G4SO 1O08A 3V8NA 2GBLC 2IPXA 4FIZA 1JXMA 2C4UA 1SCQA 4DIBA 4AY2A 3KWFA 1PSWA 4DLPA 1GEEA 2Y2UA 5DRTA 4C7VA 2CBZA 3K8OE 5I4KA 1RHJA 1T4CB 3NTQA 5L7YA 2XSZA 4ZT2A 2QJFA 5IH3A 5IJXA 5CDUA 5K20A 5G53C 3LT0A 2IXEA 4MCAA 2Q2WA 3W8FA 1INLA 3BJZA 2QLLA 4ZCPA 1P7YA 2EKPA 2J3QA 4NQRA 5FWNA 1JJFA 4RPCA 2YHBA 2A0UA 5IKMA 1EUCB 1KFEB 2JEYA 2R1VB 3OOSA 4I4NA 3WWCA 4FSXA 5L3SA 3TGPA 1E9DA 2PBLA 4KFRA 2F9LA 4EUFA 2FDXA 1MB0A 3KQLA 5DSXA 5DT9A 4OU4A 2Q3DA 1LNQA 1O87A 2R44A 1WXFA 5I8WA 4PPGA 3O74A 3MJVA 2JD1A 1XU9A 2CYBA 4C05A 1G8FA 4Z4GA 3U9SA 3UBTA 2QR5A 1G20A 5DBFA 2P2LA 4H1HA 2HF8A 4K3VA 3CB4A 3T7JA 3UPDA 4BLUA 4E33A 1M8FA 2OQ2A 4J07A 4L4SA 4H6WA 1TZMA 2H3HA 4CR8A 1Y1LA 4CCYA 1J2RA 1ZKDA 3MBOA 2QTFA 2W2MA 3LGSA 3R09A 1EK5A 3OX1A 3X44A 4DV4B 3P2IA 4R2JA 2WJAA 1DAPA 3KT0A 2QQEA 2OEPA 4JENA 3WSWA 5TR9A 3K0KA 4H3SA 4PICA 3HYCA 5HF8A 3GRFA 3V1LA 3S70A 3ISTA 1YRYE 2BGWA 1RAEA 3QMVA 3Q6NA 4FMPA 4F6CA 4AY6A 3OJLA 1W5SA 1C7JA 3FMFA 1SVKA 3CRNA 2DJ5A 1SUIA 2I7VA 1I5RA 1FTQA 1HFJA 3CLUD 4ISBA 3WYGA 3T5PA 2GHIA 3KBOA 1AA9A 3OCWA 1KNQA 4WCFB 2Z2YA 4J7UA 3D9QX 3AV3A 3RW9A 4X7PA 1HDEA 3LYAA 2O3TA 2HK6A 3VNSA 5DIFA 2QBYB 1C3JA 5K8CA 2CUZA 2I1WA 2RJOA 4WZZA 1BW9B 3B85A 1UXOA 4G56A 3VDQA 3NJ4A 1PBTA 4YRAA 2XLCA 5LB2A 1H2AS 4IFBA 3A28A 4I7EA 3IULA 3NGLA 3T54A 2I2FA 1H1LA 3H5IA 1FC0A 1CIPA 3I9JA 2RHHA 3R5TA 4DCTA 1R5NA 5A3JA 1N6IA 4OK3A 1RQLA 1XVTA 2RBKA 3SIRA 2BMEA 3UHJA 2OMKA 2HO4A 1WEHA 2IPNA 4IDOA 3UHFA 3CZ4A 3IE1A 5EMLA 1B2RA 3A1SA 5B1DA 3D0QA 2FZVA 1J5EB 4FFRA 1ZVJA 1P0IA 1EIZA 1ZBQA 4BNJA 4CTNA 5FUBA 4NATA 3CU5A 1UK7A 2WU0A 2I4OA 3CO0S 1GAXA 3OKFA 4AF7A 1QZZA 2ZG6A 3BFPA 3I62A 3S68A 2CD9A 1HLDA 2IVZA 3E5MA 2H4ZA 4C6HA 3B1WA 4PHGA 4OSOA 5LYYA 1UDBA 1S1CA 2PQ2A 5A9TA 5LBTA 1I6LA 1OYOA 1Q1BA 3R6LA 1LWOA 4ZK2A 4DDHA 4UZSA 1ZXXA 1PJCA 3MJCA 1N2IA 1C9DB 2AW5A 2FPGB 3LLVA 3DKPA 4BNIA 3LBFA 1YRHA 4MYTA 2C03A 1KOGA 4J9VA 3MOGA 4ZYVA 1GEGA 4H6XA 1NMEA 2ZB4A 5ADUS 1W49A 2WJVA 2HPVA 3IAXA 3UB4A 4QBIA 4MP3A 3ETEA 4QFBA 4GGMX 3EF1A 1KYXA 3FYUA 2GAJA 2IHZA 3VR2A 4K0RA 3L4SO 3OG9A 1XDSA 3NM6B 1ENZA 5DW3A 1RMYA 4K9PA 5ALDA 5HDBB 3BF8A 4FKMA 3O8QB 3RK4A 3V8VA 2P40A 4MB0A 2VKTA 5L3RA 2V7VA 3E4CA 3IBFA 8ADHA 5UKDA 3GLGA 3TINA 8LDHA 2BSQA 1UBJS 1CIVA 1T2EA 2BWJA 2VZ8A 3MCUA 2O8NA 3D0KA 2O2XA 5F51A 3D8NA 4DMRA 4A36A 2FK7A 4ZVUA 3ZHRA 4BQPA 1FFWA 2QN8A 3RH0A 1ZJWA 1N75A 5H7XA 3S2EA 2WLTA 4MYCA 1ZONA 3R9XB 3E23A 3QBDA 5KTYA 3BIXA 4PLWA 5IUKC 4YS6A 2D5IA 2XCTB 4TL6A 1BHSA 5C51B 4UZFA 3BGSA 1W4AA 1FYFA 2OGWA 3DE3X 2QL6A 1CF9A 3JQBC 4OYRA 1V2HE 4UOQA 3H2GA 2HA6A 3PXAA 1JE1A 1DIOB 2YJGA 1YS2X 2E1RA 4NMHA 4R54A 4DIKA 2JFWA 4GQAA 3MTDA 1YDEA 1P31A 1EGQA 3DJFA 1WSBA 5FTWA 3B1YA 3VKFA 2I1VB 5A4MS 1TK9A 1CZRA 3EC7A 4KU4A 3T1OA 5IANA 2BFBB 2IX9A 4HH1A 2RHBA 3C43A 1ESEA 1PK7A 1Y4DE 4LJ4A 3EZ9A 3R0QA 4GZ6A 2YRXA 2CNOA 3HZHA 3PUWA 4ENPA 2P1RA 3ZE7A 1CQWA 3MFQA 5A4KA 2HOQA 2XB6A 5DNAA 1GNVA 5NULA 4DT1A 2OM6A 5CJPA 3KB1A 3MJ4A 3FHLA 1M6VA 1VPWA 4W1QA 5C81A 1WWKA 2GYVA 2EFYA 1OI4A 2QVCA 4XGQA 4AYWA 4S1WA 2HO5A 5BSGA 3LHDA 2VJQA 2O2HA 3FNBA 1YNOA 5FFFA 1KWGA 3DDHA 3MLEA 3WO0A 4ZVNA 2ZVJA 4N47A 3V2IA 1VLLA 2O3SA 1P7VA 8AT1A 3PGJA 4M87A 4OL9A 4R7GA 3FI0A 3FPAA 5C4IA 3U61B 3PEEA 3WBKA 2YV2A 1KK0A 4GU5A 1RBYA 3JQFA 1PYGA 3LD9A 1FNNA 3DAPA 2GJ8A 2B8NA 1QGOA 5E0OA 3GJ5A 2AMJA 3AFOA 3Q8WA 6ABPA 3F67A 3IPLA 2VH5R 1OYVA 2Y1WA 1P4HA 1U1DA 3ZE1B 4UTRA 4DMFA 2KQUA 3HCAA 5D1NA 5TEVA 5AR1A 4EK9A 2VPQA 1QKIA 2FSGA 3LHKA 4EPVA 4CF7A 4KH1A 4EG6A 2PLNA 1U2GC 2JFQA 2AN4A 2CHQA 3SS9X 1PVDA 1M6EX 2O0KA 3NBZC 4N5MA 5JCOA 2BE9A 3OESA 1PLKA 3N8GA 4HY3A 4KI7A 4MAAA 2ZDHA 2OSVA 4N6GA 4BUCA 5K8IA 1XZCA 3PEVA 2C2YA 3E1KA 2C5FA 4FMBB 2YOHA 1SHZA 2FAXA 2NXCA 3L1VA 3W3AA 5T57A 3PPWA 1CS0A 2YC4C 4NU0A 1VE5A 1KVQA 3VR1A 4RHTA 2GEBA 1DUIA 3TMKA 3V8RA 1OAKA 2FSPA 2ZJ6A 1P1BA 1EK2A 1Y6FA 1WRBA 4HV4A 3H6HA 1E63A 2WVAA 3RFCA 5KVCA 1NQXA 2A0FA 2ZJ2A 3LCJA 4HDKB 1N8KA 1RHRA 1Z0JA 4D97A 4DG5A 1SUFA 1SXPA 3ANXA 5JR3A 3R3SA 2P78A 4Y1EA 1ECLA 5IK2D 3U4QB 4HGQA 3AKYA 4P58A 2D2EA 5FUXA 2IYTA 1I4WA 2VTKA 5HQJA 2WWVD 4EHFA 1EM8B 1LQUA 4MP8A 1EWTA 1SKUA 2GKGA 3R6DA 4BVKA 4BZZA 4YPVA 1U8UA 1L4EA 2NTNA 3HY6A 4HYYA 3OE7A 2GNPA 3TCXB 4HLNA 4ENRA 1LCIA 3BZUA 4H6PA 1ULBA 4XD7D 2PWPA 2ZVPX 4OQZA 2VEOA 1B00A 5GMOA 1F6BA 1DO8A 2C8JA 3CKMA 4HXEB 4PCUA 3SLRA 4E15A 5HK9A 3LRPA 2FX2A 1SHUX 4KQXA 3IO3A 2GO7A 2PU7A 3TG2A 3WLMA 1MAAA 1VYTA 4G26A 4WY8A 5AI5A 1UK9A 1ODJA 3DD5A 3OZBA 3NGMA 4PIPA 3PNSA 3S27A 2X40A 3VISA 2PT6A 3VSBA 5C5EA 4JLJA 3QNMA 3VR3D 1JFFA 2DUWA 1EWKA 1OA1A 1PQPA 2BZ1A 5ALUA 4RHXA 4FVTA 1KSGA 4AC9A 2DY0A 4G5SA 4TKMA 3NHMA 2P2NA 4QVGA 3FCSB 1NLYA 2V54A 4G23A 3TRDA 2WD7A 4A8TA 4YT2A 2IS6A 2X2EA 3O93A 3MPUA 1WXHA 4U2BA 5ICGA 4N5HX 3J80A 2XDAA 3OZDA 1J2UA 4NF2A 3I39X 3C4QA 1KSHA 1K66A 4I4TF 3AOEC 3RTCA 3TSYA 5JALA 3RIGA 3AQ4A 5KJEA 3WGOA 2FQQA 1FNMA 2HMVA 1Y9EA 3MWLA 4B3IA 1JNXX 1LGYA 1Y8RB 1FBTA 2ODBA 2V1XA 4WBNB 3T99A 3OLVA 1JQEA 2DFKB 3SE0A 2XYHA 4AP5A 4B3HA 4K9DA 3LO8A 1MOZA 2D59A 2DLDA 4EUKA 2XOKD 1SQSA 1X19A 3O4FA 4IXDA 4X6LA 4XCVA 4ZVQA 2IXBA 2O8BB 5F7XA 1TU0A 3MK31 1EDDA 3CLHA 3FY4A 5EP3A 3UAYA 3OOHA 4R8VA 4KDRA 3WWYA 5JS6A 4DPLA 3DZDA 3A6FA 3JSXA 1N7IA 1MMFB 2JJ8A 3GJ4A 3ITDA 3K6JA 4D0RA 2HHHB 2GTHA 3KZMA 1XHLA 2JLRA 1FIUA 2BGUA 1A9YA 3K5HA 2GPNA 3GOHA 3NH9A 4B75A 1NGSA 2G71A 4EW3A 2Z57A 4RL6A 4Q6BA 3GO4A 2HMTA 1NJ2A 2BKEA 2PA0A 5AI6A 5FPYA 1SO8A 2G0TA 4P9NA 3Q15C 4Q9IA 5IAJA 4XOUA 3TQFA 5K0JA 1HE5A 1AJEA 3CFYA 4TTSA 5EJ7A 1NUSA 2G4VA 2P11A 2RBEA 1BQ4A 1TOAA 2FZGA 3DV0A 3H2HA 1JIUA 4I9FA 4M9UA 4P53A 4WLNA 4YFVA 4S12A 4ZVKA 3SX0A 1T13A 1ATIA 4AN1A 1HI9A 3OUZA 4MGHA 4NNOA 4MHSA 1I1OA 3ZXIA 2DHCA 1V39A 5KC9A 3D1VA 3IO5A 4OCZA 1RJGA 3CLVA 4KFSA 4F2WA 3C2QA 3I53A 4MMXB 4X6UA 3NDPA 2VJMA 2VQSA 5BXYA 3T15A 2KSQA 3NOOA 1JX6A 2F43A 3Q0EA 4FE4A 4KL8S 4NBNA 1A1SA 2RAFA 2X9NA 3N0XA 1IIRA 5ENZA 4EEZA 1QO0D 1GUZA 2H2AA 3FRHA 3G2PA 1DCTA 2J46A 1D1PA 2YWBA 3H5VA 4P2GA 1FYVA 1LX6A 3BFKA 4ZEMA 3DO5A 1V8DA 5C8YA 3VO2A 2QN1A 2VRBA 2JASA 1AGNA 2WAXA 2HHLA 1JR3A 2JBAB 1T9GR 2E55A 4ARZA 2QTNA 4QUEA 1ZGAA 4ZOCA 4DWVA 3BHIA 4U7PB 4W82A 1O8CA 1E69A 1VZ2A 2LD4A 3ROTA 1V1RA 1O5OA 3SP1A 2WTNA 4KQ1A 4MI9A 5SYNA 1ODTC 4CKCB 2Z8XA 3KLPX 5A3RA 1RXCA 1PE0A 2VNKA 3IHLA 4LKRA 5F35A 3SMQA 4DSAA 5HW0A 1QG0A 4AG5A 1KU6A 3ADDA 5CDFE 1DKQA 2FP3A 1YBHA 4I6EA 1Z5ZA 3QTBA 3M5DA 4DNXA 2FE4A 4OM7A 1EFRA 1PLJA 4BDTA 2EVWX 3NCHA 1UC5B 1G17A 1Z28A 2K7FA 5SZJA 4A2CA 3U7RA 3LC1O 1NXQA 1TKBA 4HQLA 1EM6A 2YWFA 4JL5A 5ER9A 4YLYA 3ZI7A 5KTMA 2B1QA 4OHXA 2CY0A 1Z5NA 4LXGA 5JWHA 1I30A 1AQUA 3UT5B 1Z25A 1S4QA 4FBLA 4MS1B 3NBKA 4L4UA 4G1CA 3OJOA 2Z58A 1G7CA 1TZBA 1IG3A 3H18A 1IY1A 3O7MA 3OJFA 1U2TA 3KYCA 4IIJA 4RK7A 4R2KA 1QZ3A 1B2LA 3GFGA 3I4CA 3HJFA 5L3VA 5LLDA 2FJUA 1U0JA 2Y68A 3MXTA 4JX8A 5ALSA 5AUNB 5FUQA 1BCSA 2GAOA 1J8VA 5GPBA 3WDMA 4WK0B 3B7GA 2I2WA 2XQVA 1DMSA 3LFHA 1M76A 3G0OA 4MAFA 4OQYA 4L5IA 3VJLA 1YACA 2X7JA 1U8CB 4PC6A 1B0UA 2ECPA 2YY5A 4JP2A 4LXYA 5BSKA 1RMQA 1FNDA 3P20A 1FU7A 2AJBA 4CIYA 3NVDA 3ZQKA 1KKLA 1L5YA 5KVAA 3EH1A 4RHUA 4WNAB 1WDWB 2FLWA 1CDDA 2WC1A 2OAQ1 3JPWA 2RDMA 1ZA2A 3DCJA 3FWNA 3S44A 4MVJP 2XKJE 4GOXA 3EXHA 4MS3B 4UMVA 5MDHA 2BEVB 3S2GA 5CPFA 1ZS9A 4MW0A 2D1RA 3CW8X 4R0VA 2X9GA 2MCFA 1OFTA 1OZFA 1YB5A 3NLLA 3C1AA 4M1TA 2H4FA 5ELMA 5A1JA 2BAGA 2IXDA 3GEMA 4RVUA 5D5PA 3SEZA 2E5LB 3QITA 3CVOA 1VECA 2ZI4A 3LU1A 4NS4A 1F2DA 3VTAA 1H69A 3H8VA 1DOAA 5K0EA 4KIJA 1ZD3A 5JH7B 2E18A 3DHVA 4JVOA 1GU7A 3RAGA 3L05A 1VJ5A 4E6PA 2ZR0A 4FGJA 5BXQC 3AEZA 1CY4A 4MUGA 2WYVA 2EBHX 1KRHA 3U7GA 1ITZA 3ZGVA 1G8PA 1THMA 2PXHA 2YIDA 1VHJA 2QM0A 2CDBA 1RIFA 1RZUA 1Z37A 4O8ZA 1H1TA 4R1PA 4LZZA 1Z0AA 3L4JA 2TMYA 1RXEA 3CLSD 3F5SA 1Y3DE 3W5JA 3ADCA 2HMAA 3C8MA 2EKZA 4HHEA 5HF6A 2WWYA 1MHPA 5IVDA 5JNTA 1ZNXA 1GYRA 5EGSA 3B53X 3DEZA 4TT3A 3ZLTA 3SHWA 1XZNA 4ZCSA 1LNZA 3Q9SA 3DZ8A 3HVUA 4KYIB 2HU2A 4C4PA 5IPFA 2ZIAA 1E1MA 2ZFUA 3V7YA 1XTUA 1WHTA 1DBPA 1F0YA 1HDRA 1T5HX 3C87A 2HH9A 2DH5A 2WA2A 1L5RA 4FHCA 2BP7A 4OQPA 4WI1A 3H4IA 3SZRA 2CJWA 3M4XA 2ZTVA 3O84A 3HBFA 4HNHA 3W6UA 3BFJA 4CQMA 1V3UA 1WVGA 3PCRB 5FR1A 2AQHA 4PR0A 4RPHA 3SDSA 3JCZA 4D4JA 3FOFC 3C3XA 1II0A 2HT6A 3IVAA 2VDMB 1U8ZA 1Q1ZA 1V26A 2HDNB 2XUIA 4GICA 3AR8A 3AEUB 2AOTA 3LXXA 4UMEA 2VVTA 1DJMA 4KRGA 4DKJA 4MJLA 4YLGA 5B3LA 1MX5A 3CW9A 3HWX1 2ZWOA 1RC1A 3GVIA 3DZBA 2H4WA 4MKIA 1EAYA 3ZN2A 3KEOA 1F60A 3DWIA 4MINA 2X8WA 5B30A 4P3OA 4P8RA 5CB4A 1BWPA 1XCBA 2WI8A 2QN6A 3AY6A 5B2ZA 4EH1A 4JV5B 5DOVA 3QQ5A 2PRZA 2VH2A 2I34A 5K8UA 1Z47A 5E8JA 2ZYIA 2G5TA 2OV2A 4F9GA 4O4IA 3KNZA 4KVGA 2C9ZA 2D0OB 4Q5IA 4FNOA 4W7SA 1CNEA 1XEWY 3RE1A 5EWMA 4C0LA 4DANA 4G0WA 1X42A 2DBQA 1FB5A 1R0RE 2P0YA 2FPMA 4PQGA 1L2TA 3DW1X 3ZLBA 3EMVA 1RAFA 3IOMA 3K0FB 2QN2A 2CLSA 4N54A 3SJAA 4TTVA 1UPTA 1J25A 2VSXA 1L4UA 1XNGA 3TE7A 3ZDZB 3S3TA 2WJYA 3JQGB 4LDAA 4EFMA 2WUWE 2FWAA 2ZI5A 1RWWA 1D2CA 3TCKA 1ECPA 1Q7EA 3BDAA 4E5VA 5BQXA 3AM3A 1I9CA 3HUFA 1BH2A 3GJQA 4V2UA 5ER6A 1PR5A 3EC2A 1OJ7A 3GRPA 1L5LA 2NU9B 4F46A 3T4EA 2Z6VA 1T8PA 4Z9YA 1PFQA 3LOQA 1J23A 3LZDA 5IJ9B 4OMDA 1U7XA 3QF4A 5H59A 3H5OA 1VE6A 4ZEWA 3RF7A 2AJCA 3VVCA 3BJRA 1XWWA 2HQBA 4YUVA 3MA0A 3UGQA 4L5BA 3SKXA 3B6EA 2P4QA 2J5BA 4MCJA 3OKPA 3ANSA 2XKAA 5CP8A 2BTOA 1JWLA 2O0MA 1T2VA 3AB8A 4LZAA 2C7QA 1P1HA 2OECA 2XIJA 1ISSA 1D6JA 2CJXA 5JSUA 7REQB 3K9FC 5IF3A 1D2AA 2GJSA 2WG1A 4QU9A 3E9EA 4R0MA 1YONA 3IQFA 2BHNA 4RIFA 3L6DA 4A82A 1T25A 3RYCA 2BFWA 1CJUC 1F9EA 1R0XA 5FWAA 3U49A 1L7EA 3K9WA 3N2NA 3PHLA 3U9TA 2OBXA 4WJLA 3PTZA 1Z62A 1SR8A 4I4CA 5FTMA 1YVPA 2NO9A 4B17A 4UULA 2ZBUA 4J4BA 4JU8A 4HUJA 5CYFA 1BGVA 2YZMA 4EG7A 1E2NA 1I2ZA 1QANA 4ZCIA 2NVWA 1TUGA 2XMBA 3DFKA 1CLEA 2B7CA 3KIPA 3C6XA 1R0WA 2PU5A 5CT9A 5EHNA 1QQBA 5EG5A 3ZHSA 2WZQA 3I72A 1R1DA 2NU7B 1H2RS 2X22A 2J3EA 3ZWVA 1B8UA 4ZHSA 5KVVA 4YDHB 5M2QA 2OO7A 1Y1SA 5ALNA 1ESMA 1NI4B 1O03A 1Q83A 2G76A 4NDAA 3DHNA 2VRNA 4NJMA 4QEKA 5GM2A 5CITA 5BR7A 4RSGA 3RIYA 2FWPA 1UFRA 4IH4A 1L5HA 1L7DA 1BCRA 1WUKS 2KPOA 1II8A 3B2EA 3BAFA 4MQBA 4MYRA 3ZE2B 1PD1A 1U5BA 3CIFA 4Y9RA 5BSHA 2F3PA 4J0CA 1BVHA 4N4AA 3ZJ5A 4XVRA 2E1PA 1UJBA 1CULC 1IBKB 3WTCA 1JHAA 2NQ8A 3WLAA 1UEXC 1RYDA 1CHDA 2Y6VA 3A1DA 3LY8A 3FPJA 4DLUA 3NIFB 1AV7A 2MYUA 4IMJB 1SOMA 3ZWNA 4AURA 1NJSA 4WCVA 1S2IA 1ID8A 2DFDA 2D2FA 1WHSB 3QLTA 1XA4A 4JEUA 4FCCA 2R7LA 2EERA 5LM3A 2O8VA 1I4LD 1NUQA 2VSQA 3A1EA 3C8ZA 1ZIPA 3ISJA 1U3CA 2J0UA 1VG1A 2ZBRA 1KQNA 3ZE8A 1S9HA 3GFPA 4KNYA 3CGGA 5IKEA 3DDOA 3Q7SA 1NBWB 3GLQA 3QUQA 1K5HA 2XPCA 3H11B 4TXHA 4RH3A 1MB2A 3RVNA 3LBNA 1TCCA 3RGWS 2ACWA 4KLNA 3LECA 2AC7A 1APBA 5FI0B 2IZ0A 4R68A 1GILA 1V7ZA 2XDQB 1KI2A 4DQLA 1WDTA 2HPHA 2GMWA 5DXAA 5JD3A 2HXSA 4GRIA 4NZ9A 2C2OA 5FUYA 5CT8A 1L4BA 3HGMA 4O4LF 2IIVA 1ZM7A 3ESAA 4P2BA 5HF9A 2JGJA 2AWNA 3TKYA 1GPH1 2H65A 3JD2A 2ZPAA 4P83A 3UAWA 3A9RA 3TLGA 7GPBA 4PPQA 1UZLA 2JFVA 2HJ9A 2PZBA 3LF1A 3FNGA 2VWHA 5JC1A 5LYJB 3G17A 3NT5A 4C1BA 1KC3A 4EITA 2AJTA 2NM0A 2PZKA 1Y8CA 4C5AA 1GNTA 4H31A 5JRZA 2P68A 2HJRA 2CZGA 2R8ZA 3A9CA 4HGOA 1TCBA 3GLHB 4JXKA 4Y9SA 5ESWA 3GWZA 3K4PA 2XWJI 4HQNA 4Q3BA 3VR0A 4IFIA 4A6XA 3IRUA 1PR4A 3L0YA 4OP3A 3T12A 5HRAA 5JAIA 3ZXSA 5KQMA 5I4IA 5DLYA 4EYSA 3P0EA 1XRLA 2OG1A 1U9YA 3C6QA 2HJVA 3OY2A 1XK7A 4HAVA 4P6VF 4R8LA 1N78A 1JDJA 3GRVA 4M8SA 3AIMA 3GUHA 5LQSA 4YRIA 3ZU5A 3MD0A 2X0IA 3M6LA 5A6SB 5GIPE 1K8ZB 2FFJA 4B3FX 4A23A 2O7VA 3I34X 4EQZA 2Q3LA 2YFHA 4HDRB 1HTWA 4WEQA 2E4AA 2UZ1B 2VJKA 5EE9A 5JAQA 1RTKA 3FUVA 3S2FA 3EX7C 1GOTA 1G8JA 2RGNA 2VQEB 1VL0A 4CN8A 3B1KA 2QYOA 3IOCA 3ZZNA 4TMVA 3OUUA 2VUIB 1HNXB 3IP9A 1ZD9A 4X20A 2APJA 4GR9A 5DBIA 2FMIA 5EFZA 2G5CA 5FOUA 2VLBA 2EIHA 1F8YA 5KOJB 2VPWA 2W7TA 4RNCA 1NIJA 3SG0A 5JZMA 2W8BA 4OHKA 2Q6KA 4BO0A 3V6MA 3E0QA 3GBPA 2D5LA 4FK8A 3LY5A 3CNHA 3ZHUA 4BBJA 2IZZA 4RMJA 4WZBE 3K20A 2W6ID 5BYKA 2I91A 1ODCA 2CBXA 1CDOA 3DZFA 1GAEO 4KPUB 1AF7A 4KFUA 5L8VA 3FNEA 4NMLA 3UAVA 5FCDA 3I76A 2C9MA 5J2UF 1KTVA 1SXJA 1DQSA 1QBGA 5PGMA 2F8SA 4FEAA 4CBVA 3CE6A 1NXVA 2AL7A 3M6XA 1N9GB 4M1SA 4RGYA 2MINA 4G97A 2EBFX 1G6Q1 1TMKA 2IBTA 1SD1A 4X00A 1HC7A 1E66A 3CG0A 4Q66C 1E64A 2I7DA 3K0CC 4PG8A 5EJ5A 3DM9B 1UKZA 3WDLA 4V0RA 2G9VA 4Q7LA 3OF3A 5GGXA 2WU4A 3LL4A 4R2MA 2GZ3A 3BDIA 2X2PA 4JJ7A 4E1VA 5REQA 4LVOA 4UBNA 2ONYA 4TWJA 2NXJA 3DE4X 3RYIB 3SDZA 3LBAA 1FDUA 2VPTA 5HTKA 3TJZA 3TLAA 4YTEA 3PR1A 2RAPA 4KACA 3M5PA 1I2CA 1V5EA 1X8JA 1GSHA 4U6SA 1E6CA 1ML3A 1UZUA 4WZ6A 2ZM5A 3BWDD 1MO5A 1NX6A 2XE7A 3AJEA 2CVZA 3P4XA 3MS2A 2G9NA 3TNJA 4GBGA 2I0FA 1IUKA 4HB2A 4FYPA 5DEIA 3HRKA 1XI2A 1ORRA 5A05A 1KL7A 5B7PA 1GPBA 1OVGA 3ZQ4A 2WM2A 4C87A 4P7FA 1IBRA 3S7TA 4RWEA 1GDHA 2JGKA 3QFTA 1R4MB 4CE6A 3G2IA 4MCHA 4ALNA 4ND3A 5F1OA 3KB8A 3KQNA 1TFRA 4ZT5A 2GFQA 1DRVA 2IEAA 3AU8A 3D3WA 4AN0A 3QX3A 3DLTA 2OYRA 4WOBA 3PGMA 1AGYA 3X2FA 1KZYC 2JHAA 3ZX4A 1OBCA 1Y5RA 2PL3A 1RD4A 4DDVA 3FG9A 2JLCA 3EE6A 4O2BB 1X7WA 1OASA 3H86A 4EG4A 2D74A 4HPXB 3ZWWA 2B6NA 2EARA 3P94A 4B6PA 1PP4A 3HCNA 2ZTHA 1PR6A 4CMEA 2CF6A 2XCLA 4DVJA 1WX1A 1WMBA 3I01A 4WJZA 5ECYA 3V8EA 2DWOA 4RV4A 4DMHA 2G1PA 2PANA 1AHNA 2WM8A 5AW0A 3E9CA 3HCFA 3SC4A 4EG1A 2OO3A 1DXQA 3SKYA 4B4DA 4OB7A 2FFQA 3CRW1 1ZLXA 1FL9A 2JAWA 1M8GA 4WXEA 5AXBA 4TLMB 2GR9A 1HZJA 3C1TA 4IZIA 4XD2A 4YMIA 2DFPA 5SYAA 3UWPA 4BGEA 4C76A 5BNIA 3BFVA 3F97A 3VPXA 3A31A 5KQRA 3AKZA 2V74B 2DJIA 4J3JA 2ANCA 2HCBA 1XLUA 1VA4A 1OX6A 5FFMA 4MVJF 4HFNA 1WOMA 1KOJA 5EWJB 3ZJYA 3HJCA 1B0ZA 3ZK9A 5FBHA 2D5AA 1KAQA 3I73A 4FMCB 3H42B 3WK5A 3H75A 3PBKA 4ER5A 2QRLA 1WCIB 5ALQA 2EF1A 1T2NA 2XECA 1Q7GA 5EP1A 1KO8A 4RZUA 4ZRMA 2JFFA 3I30X 4L72A 3ZY6A 4B9EA 2PMBA 1V11A 3IEVA 3L7IA 2IODA 4DG8A 3U44A 1HBJA 2EYQA 4TWAA 5CFPA 5JADA 4KIGA 4KXNA 2CHUA 2YQZA 1M1YB 1VGVA 4IJKA 4O59O 4UVHA 5JFTA 1MOPA 1UPCA 2N0SA 4ZAGA 5HIKA 4NBUA 3IUSA 3HY3A 3K2IA 2RI1A 3TL6A 1MVNA 1M2EA 4WOJA 5I9IA 2Y1EA 2B83A 1NE2A 3BRWD 4FDVA 3VU0A 2O3JA 5LKAA 1DELA 1TD9A 3PITA 3PQ2A 4H0FA 4IKOA 3NPAA 4KSCA 4ER3A 4NH0A 4Q7EA 4U0JA 1XFDA 1BNCA 3L49A 1TXGA 3VYTB 1AMUA 1JEJA 3T9CA 5LIPA 5HTOA 3I6IA 5AOAA 3ZVNA 5FRDA 3WLRA 1D4FA 3EZNA 5EWLB 3SYTA 3MRVA 2GUWA 5LA6F 5D1HA 3D2AA 4UASA 4PO9A 4BMOB 3ASUA 4ZYWA 2ZYRA 3MJEA 3Q7RA 3MCAA 1M2WA 1RZVA 3DFZA 1XDGA 1FTSA 2P62A 2E0IA 4QSHA 1PZFA 1JIJA 3ACCA 1TF2A 5HMMA 4UTNA 4LF5B 1D07A 3VR4D 2PTHA 4MYSA 4NE7A 5JVDA 1RNLA 2XYVA 4LDPA 1JYSA 3QPVA 5GJVC 1QTRA 2DQSA 3URMA 3VPGA 4PN3A 5BRJA 2RHRA 5C31A 1PGJA 3EJ6A 5GJCA 1DNPA 5E2AA 5EHXA 2XQGA 1PNOA 4V0LA 1JMKC 4E21A 4DA0A 1QK3A 4MEAA 4ZCQA 4BQQA 2HMUA 5FADA 1NJGA 2PL1A 3C6BA 3NYQA 5AWFC 2WHRA 1W44A 1OAOA 4QUJA 5MN6A 4DTCA 1IZYA 3IJRA 2YOGA 4WEOA 1CFZA 2J59A 4HZUA 2XMSA 1BFUA 4HD8A 4RF5A 3K6SA 3EIUA 5HIMA 2J5KA 2REXB 3PDIA 1IXSB 4RV9A 4WUVA 5EZYF 5DLQC 2DY1A 5LDDC 4KC0A 3UJDA 1PUJA 1XEAA 5M29A 2H18A 3HZRA 4ZC8A 5C7IO 4B6EA 4LJKA 1B8NA 2IEDA 2RGWA 2IDKA 1NNUA 2PNFA 3JAKA 2B4RO 2GCOB 1U6IA 3MTQA 3PXCX 2YHIB 1USKA 3ONEA 3OZ7A 3K09A 4QOEA 2AOUA 1G3MA 3BICA 4KX5A 4EHDA 2EWMA 3BMCB 4HGRA 1XQ1A 2I33A 1RT9A 3CLUC 2NUAB 4O2AF 3PHGA 4ASUA 1UKCA 4TTRA 5IXYA 3O8RA 4EPWA 3W78A 2J4CA 1A8SA 1YOVB 4UE6A 2A1UB 5E7MA 1DRKA 2ZRGA 1Z75A 2YJ4A 4BWYA 5IZ4A 2ZULA 4MPTA 3IKTA 1TW3A 4Q1EA 4RLHA 5D3MA 3ZU6A 4B0OA 1XZEA 4YBZA 1G5QA 1JQ3A 3IAM1 1EK6A 4UU8A 1NU8A 2D4AA 2QD1A 5CD9A 2QRPA 4ZI2A 5TS2A 3BL6A 4JJ8A 4EIWA 2AI2A 3DYBA 4LDZA 2B9VA 4QT0A 4AMBA 5LLSA 1O89A 3HP1A 1W0KA 4GC9A 4GYKA 3DUWA 3AHDA 4J1QA 2DVMA 3T9BA 2GT1A 5G4LA 2DHQA 3WJ1A 4EYOA 2NZ8A 3JQAD 4NV0A 2J0QA 2XD9A 1RQRA 3ZE9A 1TUBA 4MO9A 3M6MD 4N3CA 3DMTA 3IIEA 4KTVE 1LV7A 2BCGY 2PBRA 5CA0B 3F6BX 1BXGB 4JFRA 2XBMA 3GLFB 1PRYA 1HT0A 1E7YA 2CEKA 3MAGA 4CDRA 2V5UA 3F1KA 4JUDX 3RARA 3P9SA 2C9CA 1FJHA 3LWBA 4EHLA 4I3FA 1GU1A 4NG5A 3B6KA 3HJGA 4FT2A 3ZHZA 3SVLA 1DC4A 3FAKA 4FR2A 3ZG6A 2QTGA 1Z88A 2NXNA 3EQZA 4URHA 3AC0A 4TRNA 3R75A 4LXTA 3TLZA 1FRQA 1WW2A 1IM2A 3AW9A 4IY1A 4L07A 1YRWA 3QVJA 4G8CA 4BX2A 2PGDA 5K0FA 3QSYA 3M4YA 2HKIA 2XD4A 3AF1A 4NBTA 3KOOA 4UTXA 4ALMA 1GZ6A 4D3SA 5KTTA 5MFZA 2XXBA 1D8AA 3WBBA 4KRXA 3V1NA 2PMCA 1O94A 2GVZC 3UXEA 2PGNA 4P3NA 3S1AB 2QUJA 3BA1A 4P34A 2C97A 4I81A 4NICA 3KJQA 2ABWA 3MRTA 3LK6A 2YVKA 3F90A 4KIWA 1UJ4A 4MJ7A 3U4GA 1NDQA 1Q21A 3RSCA 5CAEB 1OWLA 1MV5A 1PJZA 1JBQA 2J9FB 2VJLA 1W36B 3K71B 4BC1A 3DVQX 2M32A 1NV9A 1A5ZA 1Z6PA 1B41A 1SG6A 1A5SB 2HMSA 5FIUA 1JDPA 3QEMB 2CK3A 4DAEA 1JHQA 5BMVF 4Q05A 3I09A 2R8OA 3AF4A 3RODA 2OAP1 2HGSA 1JWBB 3IAEA 4KQ9A 3W2GA 3VA7A 5DCWA 1RQNA 4P0QB 6NULA 5EIFA 1U1IA 3CXRA 5HM8A 3IUQA 2CXQA 4W5TA 1B8VA 4C89A 1WL8A 5JAPA 2W2TA 3Q3EA 4J4TA 3JASA 5AK5A 4M0EA 4D8XA 3IVGA 1LI5A 4JWKA 2VAPA 2B3TA 3OC6A 3EXFA 3P26A 3U6KA 2OHJA 4V0OA 2WOJA 1YMUA 4FYYA 4FWTA 5DNCA 1YL7A 4POAA 4UEKA 1TIKA 1O95A 1VG0B 4R83A 4NBKA 3WK6A 4BJ1A 3EULA 1NV8A 1SK8A 1PEAA 2ZB8A 2ZKLA 1QIGA 1IBCA 2IHKA 1Y7HA 3DXZA 2BRUC 3NNNA 3WE7A 5ADWA 1E9BA 2Q2OA 2V4UA 4BO9A 3IOEA 4LV5B 1RU3A 2LTAA 5BN4A 3R5FA 4AUKA 2FN4A 4HLUC 1HH4A 4HDCA 2O50A 2OPHA 5KYKA 4REMA 3S40A 1U63A 4HSGA 4C14A 4ZGWA 1DFGA 3Q11A 2YY6A 2G63A 5AQ1A 1KYYA 3RBZA 4ZAZA 3DBIA 1TKAA 3SHVA 3FUCA 5AHRA 4DGQA 4ZV4A 4KMSA 1NX9A 3NM4A 5F77A 3TZLA 4ZZ3A 2OHXA 1NP3A 3R2JA 1R6DA 2NWQA 1Q0HA 2R62A 1NPDA 4OFXA 1RE0A 3GLRA 3UKJA 1Q1EA 2IITA 3TW0A 1QGUA 2AXPA 4A0HA 2F62A 3OJXA 1V6AA 1ZWKA 4D4KA 2DFLA 3DV9A 4OGFA 1XEWX 2FFRA 4HH4A 1HA3A 3W1WA 3TTWA 5ESRA 1XZAA 4Q3LA 2P4UA 4A6EA 2EEPA 3GH3A 1U8TA 2YV1A 4CTMA 4AT1A 1KJIA 2A88A 4ALJA 3NDIA 4HS9A 4DNOA 1QAOA 4LJRA 2I4LA 1SM4A 4KAXA 3B5EA 3PWKA 2H0AA 5K6AA 4N0PA 4BGVA 3S8MA 4B82A 3L1HA 1KYQA 4JR0A 3MTBA 4D8UA 1PX0A 4QD3A 4JAVC 3D4NA 3SXUB 3P9QA 1DJOA 1CRPA 2Q5FA 1JHYA 4KUEA 4MLDA 4DSOA 2Q28A 1X94A 2IKQA 2HT1A 3O7WA 4OHOA 4B74A 5I9MA 3L7AA 3ZVLA 5AW3A 4P08A 5AK3A 5H9VA 4OJTA 3BT7A 1PCXA 4NVRA 2R48A 4BB9A 1Z5VA 2P9ZA 3I1FA 2RGGA 3CVWA 3GGPA 4C2TA 1PGOA 4Q9JA 5ALZA 3B9PA 4CMJA 1KJYA 5ES4B 2YCBA 3BFXA 1EJ6A 2Y4NA 4FFBB 4LHXA 4JLSA 4NQZA 5CK4A 3FZYA 4G9BA 2H1VA 3AY7A 1JR4A 2IS2A 4PYKA 1PYDA 2WA1A 3EW7A 3OM0A 3E7FA 4GQIA 4Q7JB 3KYJB 4G0MA 5JI2E 5KJFA 1L8QA 1VIMA 3FOAA 3B89A 1R0KA 2SKCA 2G8NA 5FO0A 2BFFA 4RELA 2IYQA 1B6TA 3TS1A 2ZUSA 3GMTA 3I52A 1TYBE 1IULA 2QN3A 1SOVA 1F8FA 5ICEA 3HXQA 3GIWA 4U5QA 4LYYA 1U5CA 1Y7IA 4UHEA 4GR4A 3Q3HA 3H8JA 2CVQA 2QQFA 4ZOEA 5AXDA 4AWAA 2JH3A 3KOWA 4AG6A 1NMYA 2B78A 3OE1A 1F2UA 2WR8A 3EC1A 4BMNA 2DPYA 2HDOA 4FQ5A 2C0PA 1G18A 1G19A 3FF4A 5G1PA 5KKAA 1MIOA 1GXSB 1GGJA 1C9NA 2J4FA 4J43A 4JJAA 3WLJA 3T3IA 1AUXA 2Y3IA 4OP2A 1FDRA 2ZKIA 4JB3A 5HQ3A 4GI7A 1ZICA 1JL3A 4C3OB 2WP8J 1NW7A 5E4TA 3TK1A 1IUNA 5KWEA 5JISA 1NVAA 2TYSB 5JANA 1PR2A 1Z0UA 4TZTA 5NLLA 2QT0A 1SCUB 4RJJA 5I9NA 1LEHA 4DL9A 4EZBA 4PZUA 2WE7A 2GBLA 4WFQA 3SZ3A 2B5VA 2FUG6 2FPPB 3OSUA 1XMQB 1QRUA 1NQOA 3IBYA 2BFEB 4Q00A 4TTQA 2QRVB 1S1MA 2JLBA 3T3MB 4BIIA 4J1TC 1CVRA 1PFKA 4LFCB 1L8AA 3DF7A 1MAVA 2GJ4A 3PXXA 3RUAA 4ZAFA 3TSWA 1AM4D 1I94B 1Q11A 3I9V6 1VI6A 1YB4A 1JEQB 4ONEA 4R2IA 4JQSA 5EE0A 2OAEA 1AMOA 1POXA 2BKAA 3FDZB 5KHLB 2R2GA 4U9HS 2QTHA 1X77A 1OBFO 2X5NA 3PQ6A 4MVJM 5KTNA 3RAFC 3RTGA 3WMFA 1MC8A 3AV0B 1AHHA 4O4JA 1Y3IA 4B87A 2EQ5A 1L7XA 3H84A 4ZYTA 3GJ3A 4U7DA 2B98A 2P9QA 3N2KA 1NQ5A 1G5FA 1YJ8A 5IZCC 4RULA 2R0QC 2O8CA 2HSDA 4BZXA 4DYVA 4LCEA 4ZCTA 1PIWA 4DCOA 5JLJA 5HCUA 1CD5A 5CXQA 4O6VA 1XRNA 1QWSA 3N76A 3QFFA 4CU2A 2OZLA 5BSWA 5IC4A 1KEEA 3KSDO 4O0MA 1A9TA 1D2GA 4KV9A 3SYMA 4DLZA 4RTKA 1P0PA 5HS6A 4H15A 4RX1A 5E9JA 4BTLA 5FFNA 4TQGA 4Y8VA 4ETIA 1PS8A 4CKZA 2XTNA 1FDOA 2X77A 4PVDA 3UJAA 5JS1A 2KS6A 5CYPA 2JRCA 1M34A 3AXTA 5M5BA 1T0PA 3GT0A 1RKXA 2IIQA 3T9FA 2V9CA 6LDHA 1DAGA 4L3OA 2AEFA 1ND5A 2XV1A 5CDGA 1WXIA 2Q41A 2VDRB 3DAFA 3DG9A 1SIWA 3QFCA 3RHSA 5CFQA 1TA9A 4O2RA 1PQUA 2PO5A 4IGEA 2WHPB 2WUGA 4JLWA 2P2ZA 1E2HA 1W36C 4WXYB 1WQ4A 2REOA 4P3KA 4ZVSA 1E8DA 1EFHA 2GD1O 1S8OA 4ZALA 1QHSA 3ESDA 4BN5A 3DDZX 3WRVA 5L3QB 1CQIA 5IDXA 4K8OA 2YXBA 3MQ2A 4YB8A 3P2OA 3TQHA 1V6SA 2VI5A 5U9CA 4IHJA 5ALVA 2QJWA 1DHRA 3HNOA 3PJDA 1XPUA 1GRCA 3DLCA 1X87A 3EFEA 4HG2A 5CW1A 1JB1A 1UBHS 1H66A 4GLOA 1BMFA 1KI3A 3R24A 1R15A 4ZZIA 4B6SA 3Q0TA 2Y1LA 3FB4A 1U0TA 1JHUA 2JRLA 3KFXA 5IU6A 1TTPB 2RC5A 3Q40A 5MGBA 4RIEA 3VRHA 3FD8A 4BVHA 2J9ZB 5I9LA 3D4OA 3GNQA 1JHMA 2H1WA 4UNQA 2XVXA 1ECCA 1NYTA 3ROKA 1E5DA 3RV3A 2QP9X 1PL6A 3LTEA 4CFZA 4ESOA 3GP3A 3G5MA 2VWQA 1JG6A 2HSGA 3BIJA 1JEYB 2VAMA 1E2JA 1T6NA 4P7GA 4AF6A 4LBWA 1BJKA 1PG2A 4M53A 1ZCZA 1YIOA 3VU9B 3AHJA 4DJFC 5CGZA 1NMQA 3RREA 1D1TA 1XNHA 3FLAA 2JLVA 2H1SA 1E1RD 5E2BA 1CY2A 1PO7A 2PT7A 2QG6A 4QJBA 3GFFA 5EERA 3A1WA 1ZY2A 1GVNB 4TTTS 2VK8A 3OU2A 2GJKA 1ZEJA 4C7KA 3L84A 2NSYA 4ND8A 2MSDB 1N33B 4YP7A 4ND1A 3DTVD 1GQ2A 3T0FA 4X97A 2PSSA 4UTVA 4FFSA 2JKZA 2JVKA 4L75A 1E6UA 3EGEA 5EXDA 5IFKA 3NEYA 5CJ2A 1IN6A 4BBAA 2P1DA 4BAZA 1XK6A 3I83A 3SGLA 1Z6QA 4E11A 1Z4IA 4D79A 2VNAA 2BIFA 2PV7A 1GP2A 3AEYA 4RGQA 2XA2A 2DEUA 1XDUA 4NU8X 2F7SA 5EUBA 1S4MA 1UC4B 4AMZA 8OHMA 2QLNA 3TX2A 3CZ5A 4P84A 1A9OA 3R0VA 3WLPA 1YZQA 1UWCA 4UHBA 5BYAA 3HVJA 5EE1A 4CDGA 4PC7A 1GUBA 2VUHB 3D0RA 1KQ3A 3FFAA 3MWDA 1AUVA 4KN6A 2MR5A 3QYPA 1JF8A 3D3JA 3GFQA 4RSMA 1CEEA 5G40A 1OX5A 4BO8A 1W1IA 2FPLA 5EEHA 1KZHA 3IMKA 4OA5A 4QGSA 3B9RA 3UAZA 1REQA 2VK4A 4OV6B 5A4JA 3PQCA 2CE7A 3T5DA 3PQ5A 4RD2A 5E1BA 1G3RA 2H5IA 3RT9A 4QUDA 1YJBA 4V2IA 1WV0A 2B8EA 3HDTA 4UHKA 3DT6A 4YRMA 5I3CA 2AI3A 3G9QA 3VYVA 2GA8A 3A9SA 4I1YA 5KU7A 4Y98A 4MPPA 1T9CA 5EPOA 3V1TC 4YCJA 1E6KA 3CUVA 3O6VA 5CD1A 5EIWA 3RUIA 4U6NA 4BVEA 5DI3B 3SIXA 2Z3ZA 5EJGA 1R6XA 4CI0B 4X1YB 3FYTA 5JARA 3JQBA 3QXGA 4M8LA 3SX2A 3TTXA 4TWRA 3QELA 3MJFA 1E7QA 2VBGA 2Q07A 3A0UA 1F0NA 4GKJB 5H3CA 5DASA 3GQBA 4L4ZA 1MAWA 3AUFA 1YVDA 3PYLA 2O7SA 3ZWCA 3TUIC 4Q7QA 3SC2B 2OD2A 5BW5A 4BP1A 5JXIA 1VHQA 4X1KA 2VHYA 1R10A 2PH3A 2PS1A 5HA5A 4XB1A 3ND5A 3ROPA 4B6RA 5B3JC 1FSFA 1PNTA 4FONA 2XADA 2ZJ8A 2W98A 1XTJA 4Q4AB 2OMEA 5JI3E 5TE9A 5KNCD 4JGBA 1OI2A 5KYXA 3GBSA 1NXOA 5JXJA 5LQUA 5KNLA 5BY2A 1CPYA 1HUQA 3MGKA 5HIJA 1HLGA 2FF5A 1ZZGA 2WKSA 2WSYB 3TM4A 4N1AA 4UOZA 1VCHA 4MR9A 2ONZA 4ZOLB 3A25A 1R12A 4BO6A 4HMQA 4NMWA 2ERCA 3EOZA 3FSGD 4WGFA 1WF3A 3HEAA 2BFCA 4A16A 1ZWLA 2FZEA 5DWDA 5JAOA 1VSBA 3ZVKA 2WVHA 3K9HA 2CFOA 3GVPA 3T0IA 2H51A 2BI8A 1COWD 2QJTA 1CNFA 1G55A 4U2CA 3I04M 1K0FA 5ALWA 1POWA 4MJXA 5ILGA 4D02A 4LBYA 2PS3A 4MR7B 4GX1A 3WWEA 1KJJA 4JT4A 4D46A 1E1QA 4K9QA 1P80A 4PZ9A 4CGZA 1GWNA 4D9JA 2WJ4A 1SC4A 4M1MA 1T4CA 1L6IA 2B4KA 2OGUA 4FEEA 4P4NA 2XTAA 1RWXA 4OQDA 2J3KA 3AIOA 3GD5A 4XEUA 4DS3A 1L9KA 4W5OA 3DAGA 4W9NC 2CNWD 1T2DA 3KXLA 4JS0A 4X8LA 4D57A 1T8YA 2AYZA 4O02B 4F86A 1QCCA 1XXHB 2WF9A 3D1JA 5F2EA 5FV7A 1KRWA 2FMTA 1T3SA 1KK1A 2P0AA 5DW0A 1CUDA 2XF2A 2CXHA 4ZCMA 4RDXA 1EUCA 2R1VA 2P9BA 2PGXA 3O73A 4RPLA 3TVDA 1U2GA 1V1MB 4P5EA 3IIMA 2FEWB 2G0AA 3K72B 1SKYB 4QUGA 3H87A 4IZ6A 4I5EA 3EDYA 4P92A 1AXGA 3SM3A 4L16A 2ZTLA 4YMVA 3DLHA 3G0HA 5DKFA 2G82A 4MRVA 5CTJA 2NO1A 3W5DA 1DTWA 4EG5A 5TPZA 2PIDA 2RGCA 3IOBA 1BE1A 4L7QA 4B6QA 2DF8A 1K27A 2XUJA 1C1YA 1RBMA 2PSJA 1MNQA 4M8NE 4QUBA 2SECE 1DC6A 4NZPA 4BO7A 4CG0A 1XA0A 4YUXA 2XVYA 3A3KA 3N2YA 5F5NA 1A9QA 4Q1FA 3B3FA 1XNJA 3SZLA 3NATA 4QOFA 5K0NA 4ESVA 4CIAA 2WIGA 3WGKA 2GXAA 3ZYZA 1DRJA 1U81A 4FKZA 3QQPA 5GAJA 1JIVA 1Z6AA 4JC5A 3JY6A 1DT3A 2EP7A 8ATCA 3WVNA 2HXYA 3EODA 5E9QA 3T3HA 8MHTA 4B09A 3P0RA 3NETA 4PV7A 1UKEA 1U8YA 3KS9A 3EXAA 3PJFA 3GT4A 2X0DA 2VK1A 4FYKA 5IT9A 5KQGA 2YFKA 3AFGA 3V8QA 1HEYA 1MO3A 2GD0A 2Q8QA 4XWGA 5CFLA 5B58C 3WYBA 4HJRA 3WFZA 1FQWA 1V3QE 1VJTA 2GK4A 2FRDC 2XWPA 3U3RA 3W9UA 3N3BC 2JI7A 4JKOA 3W3ZB 4IX1A 2FGJA 1OV6A 2VHVA 1A5TA 4RSHA 5HZMA 4UZEA 1UM9B 2KMLA 2IK8A 3I1IA 1YI1A 3BL5A 1V8PA 3KUDA 1RJ9B 3EMKA 3IHWA 3OE4A 3VNAA 1C0EA 3AESB 3O0DA 5ITVA 4M9QA 1DIBA 4MTCA 1F3OA 1R50A 4HWKA 2DPLA 2FEPA 3LQRA 4RM2A 3MJTA 4L78A 1YZFA 4R2XA 3E7XA 2XNDA 2BJWA 2ZIWB 4TSFA 2E48A 3HLKA 4UNRA 3LX6A 1Z6TA 1QIEA 1UBMS 2C0QA 3JYHA 4GWGA 4AKGA 1J22A 1OIVA 1FFGA 1TW2A 1PU2A 2G9QA 1RKBA 3DULA 1PS9A 2FI1A 5DNEA 4O63O 4HS4A 1JDBB 4QJ3A 5KWIA 2CFRA 3AOEA 1OY1A 1DCFA 2EFHB 4MQ4A 3L6CA 4IIHA 2X0KA 5F2KA 1CB0A 1KY3A 2QLTA 3WB1A 2BHRA 1D9XA 1Z4PX 3SZGA 3B7PA 4QLAA 4CM9D 1W88B 3CJRA 3F7MA 3N59A 4G89A 4YJDA 4P3YA 2EZUA 5CX1B 2ATIA 5C5DA 3RG2A 5TARA 2ETVA 3A26A 3E8MA 1U2SA 1KKUA 1V6CA 1DAEA 1VLHA 1YCGA 2A4MA 2QTLA 4IDCA 4QGFA 2WHQA 4I4IA 5CTAA 1BKYA 4YO7A 5TXGA 4TRJA 3H8SA 2PMWB 1JU3A 2X9VA 2VYFA 4YMTA 4BLPA 5K09A 2B1IA 3DEIA 4Z0PA 2H9IA 2QT9A 3OJCA 5HFAA 5GM1A 1KFKB 1VIYA 1UKYA 1WNFA 4GLLA 1QH8A 1P2BA 1LWNA 2P27A 2BMAA 4TKUB 4FX5A 5JNUA 1AB5A 2GK6A 3AR5A 1LF5A 2H29A 4MRRA 5EEGA 4F21A 5CH3A 1UKVY 3QPUA 2Z6AA 1ADYA 4B3TB 2DYKA 3WYAA 4Z8XA 2PZFA 3LGXA 4EVQA 5BWCA 5I8PA 3F8WA 2H0QA 2QZ9A 2YBDA 5I7FA 3GFSA 4X90A 4Y2XA 4QGAA 1AS3A 1RI3A 2VDQB 4TV9B 4C7BA 2QZZA 3OURA 1T4GA 5HF5A 2QMEA 4G07A 1P75A 3TOCA 2TECE 3M4ZA 3WNDA 1NSTA 1NW3A 2WE8A 4MROA 5JNVA 2P2DA 4IMPA 2XE4A 1IB0A 1OVMA 3UICA 1EWQA 4LQDA 4BO2A 2ZT7A 5KWSA 3U4QA 1W34A 1IPEA 2QNIA 3CUTA 421PA 5ERXA 3FKSA 3O90A 3O5AA 3QKWA 4KEAA 2Q4BA 1X0VA 4TL7A 1KI6B 1NW9B 4FTWA 2E4UA 2PIAA 2ZJYA 3AP1A 1JHDA 3TDKA 2O4CA 4KWTA 3HS3A 4A7PA 3ZJVA 1Y89A 3ITKA 1Y3FE 2IHYA 2YVUA 1P3DA 5HUHA 3D7SA 1QPZA 2FR1A 3MAJA 5HFJA 1M6NA 1RRPA 2HA5A 1Q0LA 2BFBA 1QE3A 2WEKA 1FK8A 3LQYA 4EY4A 3JVUA 4EUNA 2H9YA 2RKBA 3FHTA 2YFYA 1NW8A 3CB2A 3QPAA 4XR4A 3A4VA 3EA4A 4CN9A 1MT3A 1NSFA 1Q5PA 4YALA 5C8XA 4YRNA 3OAAA 1H22A 2OSBA 4K9OA 3X1ZA 4JBLA 3OEHA 1QCZA 2B37A 3U5ZB 3L8GA 1L7RA 13PKA 1U6KA 2GFIA 2JAUA 1CUSA 3BIWA 4B46A 1EVIA 3FLBA 4FZ3A 4KXUA 1OLSB 4Z99A 1LSJA 5E6UA 4OUDB 3O03A 2WF6A 4HSEA 2C3MA 1OB5A 3W6OA 1KI7A 4DLBA 3SYKA 1PZNA 1FMJA 1JHXA 1G9SA 1EDOA 3S7ZA 1QFXA 2EKDA 4L8WB 4MQEB 3N0WA 4BNTA 5IAOA 1M1ZA 4OAPA 1MGOA 2ZREA 4IQFA 3TM5A 4ECAA 1VJGA 5C18A 1ZIYA 1TJYA 2ZSBA 5E2IA 2DFNA 3SBOA 2VTEA 4DJAA 1TUEA 1G98A 1NXXA 3CF4G 2XUHA 3D7NA 1ZESA 3A06A 3U2QA 4KK3A 4KUGA 3UJPA 4ZVOA 4FQ7A 5ISMA 3LCMA 1P45A 1FFEA 1JU9A 1QK5A 2I8CA 1S3GA 1GTJ1 1W94A 4AJKA 1T9GS 3LZ6A 4EO4A 1WQ1R 2QGZA 3IGFA 4MXDA 3RIMA