3GDHA

Methyltransferase domain of human trimethylguanosine synthase 1 (tgs1) bound to m7gtp and adenosyl-homocysteine (active form)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
211
structure length
211
Chain Sequence
b'LPPEIAAVPELAKYWAQRYRLFSRFDDGIKLDREGWFSVTPEKIAEHIAGRVSQSFKCDVVVDAFCGVGGNTIQFALTGMRVIAIDIDPVKIALARNNAEVYGIADKIEFICGDFLLLASFLKADVVFLSPPWGGPDYATAETFDIRTMMSPDGFEIFRLSKKITNNIVYFLPRNADIDQVASLAGPGGQVEIEQNFLNNKLKTITAYFGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Trimethylguanosine synthase homolog
publication title Structural basis for m7G-cap hypermethylation of small nuclear, small nucleolar and telomerase RNA by the dimethyltransferase TGS1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 74
structure length 211
sequence length 211
chains with identical sequence B, C
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09445 Methyltransf_15 RNA cap guanine-N2 methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3gdhA00
4A6EA 1VP9A 1XCLA 3UJCA 5ICGA 4RTNA 1RI2A 3NWEA 2AOXA 1DCTA 3CGGA 5E9JA 3G5LA 5GWXA 4YUVA 4P7JA 1R00A 2I7CA 1YB2A 2ONZA 3NVMB 1FPQA 4RWZA 5T6BA 3HVIA 2PX5A 4HG2A 4PWYA 2AN4A 1Q0TA 1I1NA 1BHJA 1SG9A 2N47A 3GO4A 2CKDA 2JHAA 5DXJA 4RV9A 5GM2A 2HR1A 3GRZA 1FJXA 3ELYA 4O29A 3R6TA 4RSRA 4F86A 2VP3A 4R05A 1X1DA 4EMSA 2PBFA 3UJ8A 4HH4A 4MTLA 4LG1A 3FTEA 3Q87B 2BM8A 1JTEA 4IWNA 2OO3A 3ELUA 3MERA 3G2MA 3NMUF 1KR5A 3P2IA 2QE6A 1NT2A 1WZNA 3OE5A 2PKWA 3GGDA 2XYRA 3D2LA 3O4FA 3PT9A 4M36A 3HCBA 3AXTA 1QAQA 5FWDA 4HC4A 4HRAA 3TKYA 3R0QA 4BP3A 4DM3A 3SSOA 3V8VA 4CTJA 1PJZA 3E05A 5E9WA 4AZWA 3PFGA 3G7UA 4KDRA 5E2BA 4OA8A 1JG3A 4RX1A 3OZSA 4CWAA 3UBTA 3TMAA 4CKEA 2XVAA 4E32A 4OA5A 4X60A 2I9KA 3BT7A 2BR5A 1WS6A 1NBHA 2EG5A 2NXJA 5FADA 2C7RA 1WXXA 3M6VA 1VPTA 4AUKA 3DXZA 1KYZA 2VDUE 3KR1A 3BZBA 3FZGA 1L3CA 5U4XA 5CIYA 2ZBRA 3PVCA 2ZLBA 2GPYA 4BP1A 5EIFA 3DLCA 3NW9A 5C9ZA 3KQWA 2R6ZA 5CVDA 5FA8A 4FSXA 3I5UA 3IV6A 2JHPA 2K4MA 2I6GA 1R8YA 2YR0A 1EAMA 1X1BA 4QPNA 3ER8A 4ER6A 2PVCA 1UFKA 2GLUA 2AZTA 1RI5A 1R18A 2AN5A 4DCMA 4E2YA 3KQPA 3TKAA 4OBXA 4MHTA 3C3PA 3KQQA 5FHQA 3MAGA 3RIEA 5MHTA 5K0CA 4HSGA 4PGHA 5EGSA 2GA9A 1JG1A 1QAMA 3E23A 3KPYA 2FHPA 2FK8A 5GIOE 5CM2Z 3OFJA 2PX2A 2HV9A 5DSTA 3GRYA 1N7JA 3KQVA 4X63A 3CCFA 2GB4A 3TLJA 3TQSA 4GUAA 3DMHA 3M6UA 4PYIA 4QPPA 2ESRA 2AR0A 3EVGA 4EK9A 4RTMA 3UJDA 1JQEA 3G5TA 4FGZA 2PV0A 3G8BA 3M6WA 2UYQA 3HEMA 5E8RA 2V7EA 5C1IA 5BW4A 2I62A 3DR5A 4PGGA 4ER5A 1NV8A 3EGEA 1L3IA 3OFKA 3TR6A 3CJQA 3KQSA 4YUWA 2EJUA 2JJQA 3HCFA 3P97A 1NBIA 3BGDA 2V74B 5EMMA 5DM4A 3HNRA 1WG8A 1Z3CA 3F4KA 5KQRA 2ZIGA 5EEHA 1AV6A 3HTXA 5K0EA 3SGLA 1KPIA 1AF7A 2PXAA 5K0BA 2XVMA 1B42A 4K6MA 3FRIA 3QV2A 5JR3A 1RJEA 1DL5A 4V0QA 4KIFA 3U81A 3HVKA 4R8RA 4KWCA 2P41A 4A6DA 1SUIA 3P9NA 3UFBA 1G6Q1 3KQTA 3LKZA 2EX4A 5GIPE 4C4AA 2G72A 4RVGA 4CKBA 1G8AA 5KVAA 3C0KA 5LQRA 4C08A 1VE3A 3G8AA 2XYVA 4F84A 4PYJA 1KPHA 3FUVA 1YFLA 1KXZA 2FK7A 3AXSA 2BZGA 1IM8A 3EVDA 3FUTA 5T67A 3LDUA 5F2NA 1UWVA 4P7KA 3LGAA 2EFJA 3BWMA 5K0LA 7MHTA 5K05A 3AJDA 3SSMA 4RTOA 2YXLA 2PGXA 3LCUA 4ZTBA 4P7FA 4Y30A 2IBTA 5HIJA 4E2XA 4HGZA 1P1CA 1IY9A 2YTZA 3LBFA 1AQJA 3LSTA 3FTCA 5KQSA 3B3FA 2B25A 5LQKA 3DXXA 3OE4A 3E8SA 4GOOD 3A25A 2JH8A 3ORHA 5D1NA 3SXJA 3CJRA 3LBYA 5HZMA 3TFWA 1IXKA 1WXWA 3NWBA 3BWYA 3WSTA 4EQZA 1RI4A 4KDCA 4QVKA 5FQOA 5P8WA 5HFJA 3UZUA 4YUYA 1O54A 2BR4A 4RTQA 2DPMA 2PT9A 3L8DA 1DUSA 4PYMA 2PLWA 5FULA 3HVJA 1D2HA 1RJDA 4GOND 4EVIA 1NE2A 1BOOA 1JG2A 1EG2A 4HTFA 3TPZA 1X1CA 3B7PA 1ZG3A 2OB2A 2G70A 2Y1WA 3KR2A 5H02A 3I53A 2VZ9A 5DM1A 5C0OE 4LWPA 3ELDA 3CJTA 3EPPA 3UJ6A 4E70A 1U2ZA 3KKZA 3LDGA 2AOTA 5DRTA 1L3BA 1QYRA 2PWPA 3BWCA 3KR0A 1VP3A 3KPVA 4YMGA 3LECA 1L9KA 5DRYA 2YVLA 1PRYA 4FS8A 3X0DA 2XYQA 2ZBQA 3R9XB 1HNNA 1I9GA 1NW6A 2DULA 3ME5A 3OCJA 3THSA 3V97A 2XBMA 2QYOA 3SVZA 3P8ZA 5DXAA 2OZVA 3DMGA 4RVDA 5DT2A 1XDUA 5K0FA 4RTPA 3KR9A 5LR6A 4JXJA 3DUWA 1RJFA 1TPYA 3C3YA 2ZZKA 4PYLA 4QTUB 1MHTA 3OU7A 3CVOA 1M6EX 2OY0A 5DM0A 2ONYA 4HGYA 5IH3A 2IDJA 5DLYA 5HILA 1TW2A 1JQ3A 5D1HA 3G2PA 2VS1A 3MCZA 5CVUA 1T43A 5ICEA 1R8XA 3G2QA 5KS2A 2UYHA 2F8LA 5EMJA 3PS9A 1H1DA 3LX6A 4OX9Y 2QRVB 4RVFA 3I58A 3NVKI 4E31A 5BXYA 5HIIA 5T64A 2JH9A 5CCBA 2IDKA 4KVZA 2ZIFA 5GINE 1QANA 2Q41A 4XCXA 1XDZA 2UYOA 2AOUA 5DWQA 1VIDA 1KYWA 5F2KA 1VL5A 3A7EA 3BXOA 4FT4A 1M6YA 4U7PB 1XJ5A 2BM9A 3EVBA 3MQ2A 3THRA 4YV1A 4C07A 2PXCA 3TRKA 4AZSA 3EVCA 3B5IA 1JQDA 3GNLA 5DX1A 5BP7A 2WA2A 3A27A 4BLVA 2OB1A 3NDJA 3EVFA 5CUQA 3T7SA 3HP7A 5DTRA 3GIWA 2NP6A 4X1OA 3G88A 4P58A 4PYQA 1X1AA 2AOVA 2ZZNA 5EEGA 3EVEA 4KIGA 4F85A 3O7WA 2IFTA 2G71A 3QOWA 2YUIA 2P7HA 1NW8A 3GWZA 1OR8A 4DCGA 5GOZA 3T7TA 1BC5A 2O07A 1G60A 3JWIA 4PYKA 4LWOA 1NKVA 3PFHA 5EG5A 5EKUA 4GQBA 5GP1A 2GH1A 2H00A 2ZVJA 2GS9A 3VC2A 5E1BA 2ZW9A 2UZ4A 2O05A 3H2BA 2ERCA 2B9EA 4GC5A 3ERCA 3FYCA 1EIZA 3PX2A 1X19A 3AY0A 3BGVA 1G8SA 4MQ4A 5K0GA 4FP9A 5DTMA 3KPWA 5EVJA 3MCTA 1ZGAA 1D2GA 1XDSA 4GC9A 4XUDA 3JWGA 4FT2A 3JWJA 5E1MA 3KPUA 2C7OA 3CC8A 3DXYA 3EMDA 4GEKA 3GRVA 2ZWAA 2CWWA 3KQYA 4M37A 3C6MA 4M7RA 4QVGA 3T7RA 3T0IA 5CD1A 5ICFA 4CKCA 4YMHA 4GOMD 2KW5A 2AS0A 1G55A 1ORHA 2YQZA 3P2EA 2EJTA 2LD4A 5FHRA 4BY9E 2YXDA 3QOXA 4QQNA 1N7IA 1NW3A 5E9QA 4YV2A 3OU6A 3P2KA 4R8SA 5HEKA 4KW7A 1MJFA 1SQGA 2AVNA 2HTEA 3NJRA 3O31A 4RYLA 3C6KA 3GRRA 4QDJA 2IH4A 2B3TA 1F38A 3MGGA 1EJ6A 4C06A 4G56A 5ERGB 3EMBA 3ER9A 4AX8A 4RTLA 2PXXA 4E2ZA 1QZZA 4E2WA 2H11A 2AOUB 2ZBPA 3P9IA 3A4TA 4BLWA 4OQEA 2PY6A 1KHHA 3FUWA 3ANXA 3A26A 1ZQ9A 3CBGA 4DZRA 1BKYA 3B3GA 1Q0SA 3GU3A 5FUBA 4AZTA 4AZVA 4PNEA 3M70A 5DX8A 4ATNA 5IKMA 4E33A 5CVEA 2NNWB 2NXCA 5DX0A 4OBWA 2YXEA 5B1SA 1FP2A 3KQOA 4QTTB 8MHTA 4H0NA 5EIWA 5E1OA 3SX0A 2P3LA 3BUSA 4DF3A 2WK1A 2H1RA 1AQIA 3EEYA 3EGIA 4Y2HA 4PINA 5DM2A 4YUZA 5K8VA 5CVJA 4CXMA 4MWZA 2G1PA 2NXNA 2P3QA 1WY7A 3OZRA 4NECA 2OXTA 3LL7A 2P3OA 2ADMA 3Q7EA 5EQJB 4DMGA 3K6RA 3FPJA 3HCCA 3KPJA 5F2OA 2UYCA 3RW9A 1YFJA 2B78A 2NP7A 3HA7A 2FRXA 3DTNA 2FCAA 2HMYB 5EZQA 5HIMA 2BR3A 2ZWVA 3OZTA 5EC8A 4IV0A 3E7PA 3HA5A 3LPMA 1F3LA 3LCVB 1NW5A 3REOA 3SSNA 5K01A 1SQFA 4CTKA 3FRHA 3I9FA 4RTSA 4IKPA 5E1DA 2IGTA 4RTRA 1G38A 4GBED 5K0NA 3BKWA 3KHKA 5EHIA 2IP2A 1I4WA 3AWIA 3MTEA 1JSZA 5CCXA 1KPGA 2AN3A 2PWYA 3OPNA 4C05A 2QY6A 5HIKA 2B2CA 5E2AA 3SR4A 3TM5A 1JG4A 3VYWA 4XUCA 1NW7A 1XXLA 5FTWA 2ZSUA 1SVUA 5K03A 3P71T 1V39A 2CMHA 4M38A 4V0RA 2VDWA 3FPHA 5DPMA 3FPFA 3MHTA 2PX8A 4IV8A 4YV0A 3FUUA 5EPEA 1VQ1A 3DH0A 2ZCJA 1HMYA 5LQJA 5DTQA 3CKKA 5EOVA 2GAFA 1O9GA 1RJGA 1ZKDA 4POOA 3KQMA 5HOQA 3DOUA 4WXHA 4ER3A 2ZTHA 4PYNA 1FP1D 5LSAA 2OPBA 3EEOA 3KU1A 3B89A 3FTDA 1L1EA 1Y8CA 2VDVE 3FPGA 3TOSA 1ZGJA 1NV9A 2NYUA 2PX4A 3PX3A 3HCAA 3UWPA 1SUSA 5EMLA 1P1BA 3PTAA 3VC1A 5FCDA 2E5WA 2Y1XA 1RI1A 4GF5A 4QDKA 1YZ3A 5EHGA 4P7GA 1P39A 5EKXA 3RODA 1XTPA 4WVLA 2AVDA 3BKXA 4PIPA 3UA4A 3G2OA 5EMKA 3ELWA 4DQ0A 4FR0A 2G8NA 4PONA 5ICCA 4HTFB 1INLA 4EKIA 5BW5A 3LCCA 2NXEA 1RI3A 4ISCA 4C04A 3GCZA 3TM4A 2JG3A 3P9CA 5LQAA 4FZVA 4FSDA 4MIKA 1ZHFA 4U7TB 2FPOA 2AOTB 2WA1A 2ZIEA 10MHA 2P40A 5E8JA 1R74A 4R6XA 3NDIA 4UOEA 5LQCA 2QM3A 3FUXA 3P9KA 3HCDA 3MTIA 2O57A 3IYLW 1KP9A 4BLUA 2P8JA 4RTKA 2CL5A 3NTVA 2PT6A 3HM2A 2ZZMA 1JSXA 2ORED 3SM3A 4KRGA 2ZULA 3UJBA 3EGVA 3UA3A 4YUXA 2OYRA 5FWAA 3UJ9A 2YX1A 5M5BA 4Z2YA 2IPXA 1EJ0A 2FYTA 3GDHA 4PYOA 1XCJA 2CMGA 3BGIA 3GRUA 3LKDA 2BH2A 1EQAA 1QAOA 5KYGA 3HVHA 2Z6AA 3FTFA 1R6AA 3HA3A 3UJAA 2O0LA 4L7VA 2IIPA 1SKMA 3A7DA 3SMQA 2R3SA 2IH5A 1M0EA 4R6WA 2P7IA 1JTFA 3UJ7A 4RTJA 4DA4A 3GJYA 1YZHA 2HNKA 4PIMA 5GM1A 3R3HA 5JUWA 5K09A 5G02A 4E30A 3PB3A 2Z6QA 3FPEA 3EVZA 5CVVA 3LDFA 4EKGA 2IH2A 2C7QA 3S68A 3BWBA 2AOWA 1JR4A 3DULA 3IEIA 5DSXA 4QQKA 5EZSA 3HCEA 4C03A 1N2XA 1XVAA 1VBFA 3ID6C 3IHTA 4PCLA 4ER7A 4PCAA 5LQUA 3OU2A 3DMFA 3LHDA 1O9HA 4X61A 5FQNA 2O06A 2HWKA 1ORIA 2PJDA 2C7PA 3G89A 2ZFUA 3DP7A 4XUEA 1P91A 5LQNA 3M6XA 4RVHA 4X41A 2P1DA 3DLIA 3EVAA 3I64A 1YF3A 1VLMA 1D2CA 2QRVA 1UIRA 5K0JA 1FBNA 3M33A 2A14A 4ER0A 1KIAA 3GXOA 4LECA 2PSSA 3MB5A 9MHTA 3FYDA 2OBFA 4GOLD 3JWHA 4OQDA 5FA5A 1TW3A 3M4XA 3VSEA 2JHCA 3R24A 3PLAE 2IBSA 2Z6UA 4DKJA 4B17A 2P35A 1YUBA 3K0BA 3B3JA 2OKCA
chains in the Genus database with same CATH superfamily
3B85A 3QEMA 4GI7A 4X24A 3O21A 4ALMA 4FB4A 1UFQA 4ITRC 5TMEA 1ISHA 4LJ6A 4M1YA 5EGNA 5I7EA 4OFXA 4KHPB 1GNLA 2ONZA 4MCHA 4FNAA 3HVIA 3HYLA 3CT6A 2Q6KA 3HQ4O 3MWLA 1OPXA 1IOZA 3N2EA 4HG2A 4J9VA 1EWQA 2G17A 3ZKAA 2QSYA 1XAJA 5BT9A 2HHJA 2W6MA 3ELYA 4YJ2B 3UCXA 1AKRA 3HLTA 3ON5A 4FFWA 3UJ8A 2N1BA 1SZJG 4BO0A 3DQPA 4LG1A 5HK9A 5JRZA 1N6HA 4GPBA 3ELUA 2WZBA 3G2MA 2J0UB 3MERA 2VSXA 4N39A 3PQ5A 1ZX1A 3P2IA 4RY9A 3GEDA 4HFJA 4TS4A 4JT4A 3FTNA 4CF4A 3I6MA 4RLFA 2HCFA 2R8PA 5AJZA 3SDZA 3R0QA 2RGXA 3OLCX 4BP3A 4CDRA 4BQEA 4EKYA 4IZ6A 1T5TA 1H2ZA 3ESDA 3IPCA 1TAQA 3AOEA 2B69A 2C31A 2VJNA 4IIJF 3V33A 5AVRA 2EYQA 2WUDA 2ZE6A 1DINA 4ITVA 2V3VA 3F46A 1RRCA 1GL3A 1OI3A 1SKYE 2V9CA 1YA4A 5JEDA 1M34A 1S2OA 5L95A 2V3CC 1VHTA 3E4DA 4RZ3A 4UHEA 2RC5A 4YJ3A 3ZR4B 3Q8XB 3PCXA 4Y9DA 1NBME 3LWZA 4JR2A 4EGFA 1NXOA 3O82A 4GNRA 1KGSA 1XD2A 2ZLBA 4Q9DA 3TG2A 3TX6A 3L49A 3LX5A 3RC3A 2LCIA 1U5AA 3AUXA 5D6OA 3QELB 4UU8A 4WNCA 3ESQA 1R8YA 4NCKA 2GXUA 4U2BA 1EAMA 3ANMA 3HUFA 5JJLA 2GLUA 2J3KA 3C1UA 4YQYA 5IFLA 4DCMA 3DZGA 3L05A 3OAAD 1ACLA 2VP5A 4QUJA 3ZLJA 4MHTA 4I1OA 2CFIA 1K6JA 2RGDA 4KR3A 4IINA 1OASA 121PA 1SCNE 3B60A 4NARA 5D3QA 1NZFA 5EZ5A 3ILVA 4PC3A 3R5KA 3RUCA 5HWSA 2PZJA 1V5EA 3QNWA 4WVFA 3C6YA 5KEIA 4UAVA 4MV3A 3U6KA 2DJ5A 1ZWKA 1USKA 2ID9A 3H3XA 3FB4A 3HUDA 4DHEA 1GAEO 3G8BA 2V7QA 2RGGA 2QVYX 4DLBA 5H0IA 1AK1A 1KI9A 4NBSA 1MJGM 1PTKA 4UTVA 2FSGA 4NOJA 1KFKB 1R4NA 2R1VA 3AR7A 3VJMA 3DFFA 2PH1A 2M6LA 2XQGA 5HOEA 2YV3A 3N2LA 2LV8A 1LKZA 3EOBI 4BXOA 5SZIA 4WKGA 4EG3A 4DR6B 3JTMA 5I4KA 2R4UA 1PNRA 5D6NA 4JB3A 3ZVNA 3WL6A 4PFJA 4AP5A 2BFBB 1E58A 5K0EA 1KPIA 1ODKA 2EW8A 3FNIA 5FPPA 3OPYI 1Z33A 4ESOA 4L0MA 1O95A 2AF3C 5JNLA 4XWWA 1ADCA 3DM5A 2FWBA 2HH9A 3CIFA 4JA2A 1U31A 2Q6IA 3IIIA 3PENA 4Q6WA 5IDXA 1RKQA 2DT5A 4RTMA 1GIAA 2ZRFA 3PD1A 3WG9A 4C08A 1N36B 3AR6A 5LB2A 2P9TA 3WNCA 2DR2A 2ZIXA 4H7FA 2JJ2A 2OPHA 7REQA 2ZJFA 1PDOA 1W5AA 4WOJA 2I99A 3W5IA 1XB2A 3TLZA 1G5PA 1XD2B 3N8IA 3AY6A 4HLUC 1RKUA 2Q2OA 1QHNA 1X80B 2GESA 4IMIB 1A2KC 2XQKA 1XNRB 1YBFA 4P2BA 4MDHA 3AVXA 2OHHA 1JSLA 1J07A 4MRAA 1LF0A 4B6EA 5D1NA 1P6XA 4MUXA 3KDAA 2JGEA 4RHFA 1S1MA 2QQEA 1I7SB 4MIOA 5A1TA 4G84A 3W04A 3TD6A 3AETA 2J08A 2FX2A 1ULUA 4X20B 4YASA 4EMBA 5EHZA 5JECA 1MXHA 4H4EA 2Y27A 1PK8A 3FF1A 4AY4A 1X39A 3ZHBA 4Q1AA 1O54A 2E4YA 4YP7A 2IHVA 2IE0A 2OM2A 1NDHA 3WXMA 2B36A 3EBOA 3I9V1 4WTOA 4N8DA 5G2OA 3SM9A 3ZS8A 3A4MA 3BD6A 4GOND 4A73A 1SQSA 4BMOB 2HRCA 5KNBD 4OI1A 4QARA 1P19A 1OXUA 1CRZA 3L4SO 1KZHA 4TLDA 3X1YA 4AICA 7AT1A 4FVTA 2Q7OE 4QU9A 4NJOA 3BQMB 3ICQB 1T9GS 4E70A 2QVGA 4LWPA 1XPOA 1FZTA 1DAEA 2R1VB 1TQHA 5LP6B 3DGFC 4GQIA 3OC6A 3EIWA 5JZBA 2H4ZA 1A98A 2XYHA 1WOMA 1ICIA 3LPDA 5B37A 4YMGA 2GEKA 1DLIA 3AW9A 3FSRA 3HU3A 5IVIA 1PF7E 4EIWA 1AXEA 2CNBA 2Z5GA 3UEOA 1T2UA 1E3SA 3HJUA 5AM2A 3LQRA 2ZYRA 2Z58A 4FLFA 1QBKC 3PQEA 3HMKA 1HY3A 3SBXA 1DC3A 1TC1A 2V6BA 3MAJA 1GZ5A 2OZVA 3V8BA 1UWLA 2X9GA 1XDUA 3RR2A 1U8EA 1W4RA 1Z22A 2ZBGA 1KAQA 4LV6A 2A58A 3SQOA 4QFCA 2X8WA 4ND7A 2KS6A 1LSUA 3CVOA 4GR4A 3TQTA 2AZXA 2HSZA 1I2AA 4MQEA 4OGKA 4LNUB 1P0IA 2VLBA 3ANSA 2A5YB 2XB6A 3IMGA 4RCVA 2R7MA 4XJVA 5B1HA 3PI7A 1W94A 1JHPA 4EX7A 7REQB 3ZVMA 1YBHA 1JA9A 3L4EA 2DLCX 1JPNA 3LX6A 4OLBA 1ZUNA 4HDCA 3KJZA 3SS8A 1FTQA 2YICA 4K9OA 3FGPA 4BJ3A 2Y1OA 3QKSB 2BMFA 2PD3A 2PZMA 2Z4SA 1II8A 1HQDA 5JCZA 4A4DA 4CT4B 2DPGA 2O7SA 2Q41A 3QQ5A 4J3FA 4YMTA 3Q8KA 1E5TA 3R7NA 4J49A 2JFVA 1EX1A 3SYMA 4ZTZB 1NRJB 2DPXA 1Z56C 1DPGA 3AC0A 4BTVA 1JPUA 1NUTA 4YGYA 5KQPA 4FPXA 5KHOC 4C29A 3MQFA 3DFKA 1JQDA 4B34A 2XNKA 3KCQA 3EVFA 2PN1A 4RD3A 1NHGA 1WL8A 4IIGA 4A0GA 4KAAA 5B55A 2XMQA 3NX4A 4F60A 4KPYA 4L8WB 2AOVA 4LY0A 2OAEA 1N6OA 2EOAA 4QL3A 4PF1A 1CFZA 4NBKA 5FI3A 3AF5A 4RJKA 1SCQA 1DIBA 4RF5A 2HWYA 3ANNA 1TNDA 3VC7A 1TGYA 2GN8A 2HXYA 2VHQA 1HFWA 1K7YA 2X6RA 5I4CA 2WSYB 1SIBE 5CMLA 4RHEA 1ILWA 3AJEA 1OZGA 3DVRX 2J4DA 1UC9A 3U7JA 2HJHA 2MWMA 2P2NA 5MN6A 5ULLA 5ED4A 1MX1A 3RD5A 3ZY4A 4DTCA 2BCEA 3PC6A 3I2HA 1B6RA 1Q3HA 1M73E 4WXMA 4B3TB 1WZ2A 1OSNA 1SZDA 3INGA 5JSZB 1UOEA 3FHLA 2P78A 3H8WA 1XDSA 4YQEA 1NF3A 1N92A 2GEBA 4YDSA 4ZYVA 1RHKA 1TO6A 1Q7CA 4JP2A 2ZI3A 5D3KA 3S2YA 3ZZNA 2PBZA 2OHXA 4BMDA 3M1YA 5CFOA 2ZWAA 4MLCA 1XXHE 4O4IA 5EJ2A 3SBDA 1ZVKA 4TYNA 3IP1A 821PA 1N8KA 4MQEB 4MVYA 1ZGZA 1LDNA 3HCRA 4HJRA 1TDJA 1B93A 3V4OA 4V0SA 2WWXA 5BSHA 3TGWA 5F21A 3ZZ0A 5K6AA 1HR0B 3OIDA 1ZIXA 4YCJA 3UQYS 2ZPTX 1MJFA 2AVNA 2WJWA 4RD1A 3C6KA 1EFKA 2NN3C 3VSBA 1JQJC 1Z4JA 2EF0A 1P74A 1YQUA 4KLNA 1P62B 1YZYA 5DK6A 5FT9A 4HF7A 4ZO8A 4LZWA 4US0R 2WKRA 1R0LA 3IBFA 3OETA 3ZKWB 1GSOA 2X7XA 2LKDA 3H4MA 4RK0A 2Z9DA 5DP1A 3E82A 3IUMA 1HE4A 3E35A 1IMJA 2IHNA 5CEEA 1Y82A 5DASA 3UYLA 3ZCVA 3OZAA 1G98A 5JVDB 5KTOA 3L6UA 3NOOA 2E5FA 3GV0A 3RS8A 2DEUA 5CVCA 5FUBA 5B6IA 4RPGA 2BONA 4WZZA 2CMKA 4LI3X 4NMWA 3RSLA 1YJQA 4HN4B 4BVEA 1YI0A 2L0XA 3I9KA 1YI8A 3WTCA 3GPCA 5K2OA 5EIWA 1FTGA 1ST3A 1WXEA 4WESA 3GLGA 1V71A 5MGNA 4Y2HA 5BV7A 1DI0A 1EUZA 2A7QA 2AE2A 4GDMA 5CVJA 3HN6A 2P3QA 3QYJA 1HDCA 1KVSA 2C4KA 5TQVA 1DBSA 3YASA 3BCSA 2GZHA 3LL7A 2FF7A 2CVOA 3KPJA 4HTAA 4L8GA 3U26A 4XUGB 2WZQA 2W6PA 1XZPA 1HT0A 3BWDD 3KOMA 4O4LF 1MJNA 4UTZA 5TX7A 3RU9A 1E0AA 4Z4QA 2QRLA 4RAQA 1F3LA 1W5EA 5A0TA 3CUKA 1ACMA 4O5OA 2V7QD 1E2FA 4C6SA 3HYTA 3C7KA 1GFZA 3K1ZA 5EIBC 3I62A 1SQ0A 5EHIA 4LHXA 1FLNA 3FOAA 4UM5A 2PBRA 4D9FA 2BGIA 3ZCTA 1ZI6A 3R7LA 2FZCA 5CA1B 2QY6A 3ER8A 4JBXA 3FWPA 4UZSA 3CUEF 1AKNA 1WHTB 5DHTA 2WM3A 5TJHA 4DYHA 1GNQA 1T9HA 2VK1A 5D7BA 4DEXA 3H2IA 3PFCA 3W2FA 4F5WA 1M2JA 1QF7A 4ZHQA 3LC7O 2E49A 4LOJA 1O1YA 1PVVA 1AKVA 1DVRA 1RM3A 1SBIA 2VDWA 2IZZA 3G23A 3K20A 3NIBA 4KR7A 4IV8A 1JEDA 3TTTA 1MZVA 2CNOA 1VJDA 3WBJA 4LXTA 1N2GA 3CZ4A 1UXHA 3OLQA 4A2WA 4HGOA 4DLAA 5KYYB 1PNVA 4X0EA 1PGOA 5HCUA 3PUZA 2Q1UA 5D5HA 2AH5A 1XDWA 3H2KA 3ZHXA 4M0PA 2PRYA 4PXSA 3HRHA 3KTDA 4U7DA 2QPTA 3JYNA 4UJ5A 2Z3ZA 1X7ZA 4KGZA 3N8HA 2V97A 1G20E 1M8GA 1P2DA 1ZITA 1SC4A 4B73A 1HYQA 2MSEB 2YFQA 4B3RB 3OWHA 4COKA 4MINA 1A9XA 3ETJA 1U63A 4D6YA 1KQ3A 4H1HA 2OGTA 1GZ7A 5ED0A 4P7GA 3KHUA 3PC7A 4GMFA 3ZWWA 4WCFA 2AHOA 3A2KA 4B3BA 4KVGA 4P33A 4LYYA 3BRWA 1ZMOA 3MBOA 1X1TA 5EMHA 4WESB 3IAM1 2RHDA 3D4IA 4JB2A 2BGUA 4EJ6A 3DAYA 4QXOA 3BSWA 4QJ3A 4EA7A 4Y6PA 1Y33E 3HDGA 2JG3A 1G7TA 2RH4A 1N2EA 2V7PA 3S6JA 4AN4A 3RREA 1Q57A 2R8EA 4DNXA 2AOTB 1NXTA 3H86A 4JI8B 4IOMA 2V0NA 4NCXA 3I92A 3BRQA 4ZRNA 3QPAA 2PS3A 3PDIA 1C3LA 4UMVA 1X7XA 4CM1A 5CCDA 4ZCIA 1YRBA 5SY4A 1ZNWA 1OXMA 3L0YA 2CV2A 4DPLA 3GJQA 5K8UA 2PUAA 1U8UA 1UJCA 2WSBA 1G4UR 1XWWA 3HC7A 4F1WA 4F04A 4BQIA 1ENYA 5SYMA 2JFZA 3FCAA 2XGJA 1NW4A 2WFLB 2GJ9A 2QRZA 2OKGA 4ZRMA 2ZUDA 3SD7A 3H5TA 2PH7A 5B1IA 4CRWB 4LOIA 2V59A 2OXEA 2R4QA 4RKQA 1FU7A 1TM3E 1YU9A 1Z0SA 2BSAA 2QRKA 2FEKA 3GZJA 4ZHQB 3JQEA 4MW9A 4CBVA 3R5SA 2P2ZA 3HY6A 4LC9A 2V9ZA 3QUCA 3PQ4A 1A1SA 4C0WA 1LS1A 3IOCA 3DAOA 3F2VA 5EIAA 1FXUA 1P2VA 2QYSA 3ADKA 5J1SB 2UUAB 2XUOA 2BD0A 3O0DA 2XDWA 3D4OA 2BHTA 4M8KA 4MTCA 4RD6A 3H9JA 1NNI1 3HCEA 2D74A 4IHAA 4O1HA 2HWXA 5AI9A 4YT5A 1C3JA 1Q74A 5GV7A 3T12A 4DQLA 5FAKA 4F3TA 3U3XA 2FEPA 2BH9A 5HE8A 4N6OA 3R3YA 2CZGA 2IP4A 4PNZA 4WCDA 4B47A 3VYVA 4DQKA 2W2LA 1WMAA 1X7ZB 3BL6A 4DREA 1FX1A 4Y1GA 3M82A 4EYKA 2RGNC 3ZTTA 5I4BA 1OU4A 1A9XB 1L7RA 3KUKA 4GMKA 5IZCC 4JI2B 3HI6A 2QRVA 2ZOSA 3NPAA 5FD8A 2QTMA 3TLBA 5A4AA 4AUMA 3GXOA 1NOJA 5KYKA 3EGXA 4BKOA 1DE0A 1NURA 3LC0A 4QJBA 3N53A 2VYQA 2VRWA 4RVOA 4WCFB 1OKKA 4MW2A 3ZQKA 1ND6A 1XRJA 3EAQA 1NA5A 4XA8A 5AWFC 3ZDCA 1O5IA 4UXJA 5TPZD 1BWSA 1V37A 3D5EA 2O2EA 4EGAA 2WJVA 4Q7EA 1H1LA 2WD7A 3PNOA 1SVSA 2FW9A 4HH3C 3LNTA 3MT0A 3PFHA 5AJWA 1ESCA 1ZK3A 1AC5A 3PHCA 4JCOA 2ZUTA 2CV0A 1CVRA 2VVTA 4UCQA 4EP1A 1JT9A 1PJTA 1BS1A 1C1YA 4IF4A 3MD9A 4OL9A 2H31A 3MIIA 3U13A 4DGSA 1DKUA 3B8EA 3OQPA 1I4EB 1PR1A 4P7JA 1U6IA 1U0RA 1NP3A 4AKIA 1XZMA 2QTGA 1DOHA 3ZH2A 4E5KA 1OLOA 4DIUA 2RAPA 2ECFA 5E4JA 4DWVA 4U6QA 3GLIB 1WJGA 2XIQA 2FPUA 3OZIA 2H9YA 3PEUA 4UHCA 5AKEA 5L8VA 4C1BA 3FTEA 3SE0A 3ZGLA 1RTKA 1EH5A 4B6QA 4NENA 1GV0A 3SFTA 1BKDR 3EVNA 1MXFA 2JGDA 3OE5A 3IUBA 5HIAA 2JCYA 1RJ9A 3IHWA 3NHRA 1E1YA 4Z9XA 4HRAA 2QQGA 1U2DA 1OBHA 3NHWA 1DRVA 5A9SB 5IAEA 5CB0A 1SVNA 1R0SA 2QZSA 2X1MA 2HBZA 5AKJA 2YJ6A 3HHPA 3QXGA 4RCZA 4MV9A 5BWBA 4JJEA 4BU1A 2AD1A 2RB4A 5EL0A 2OYCA 3KAQA 3GGCA 4WOPA 5E4FA 1GA4A 1DIRA 1X38A 2JFQA 1T9DA 4HWSA 1AUPA 5AI4A 4OXNA 2OQVA 4E32A 4ARCA 1KXJA 1O0CA 1KIFA 5JC8A 1Y6FA 3BK1A 4K9PA 4UAUA 4CG1A 4R2XA 2A78A 2EZTA 4F96A 3QE4A 1VG9B 4XX0B 3OEED 3R7FA 4JYZA 3D7KA 2GN9A 3N75A 1BYUA 2OVBA 4BP1A 2ZRIA 4YREA 1QE5A 4LSWA 4KSCA 3FZQA 1ZW6A 1PFYA 2QRJA 3MRSA 4WZBA 3LOPA 3P26A 4LTNA 5BSKA 4XW2A 1YA6A 3EK2A 1E4VA 1T25A 2J3QA 4RMIA 5JQWA 4YDRA 1N6IA 4LRSB 4P5DA 4J3NA 5KI6A 5I9MA 4XWOA 3C48A 1JXAA 3VR4A 1ZN2A 4NDNE 4XDYA 3OLWA 4ZEWA 5IZ4A 4EZIA 4NYJQ 3EY9A 2GD6A 5KVVA 4FNOA 3PPWA 4JJIA 3JRNA 3OO1A 1DAHA 1N7JA 1X1SA 4JSRA 3PGLA 3JAWB 2QD2A 2EARA 3F3SA 4WZAA 5JISA 4RF2A 2M1ZA 4ZOLB 3ABQB 4GWGA 4A0RA 3FOEC 2R6JA 5E0OA 1EINA 1Q1EA 5H16A 1FJHA 5C1IA 4F3NA 2IITA 3PPXA 1YVPA 1VIAA 2OTCA 2PJUA 3EGEA 2HDWA 1DFHA 3BK2A 2C4UA 1Y8AA 3G2NA 1QHFA 4OGFA 3ZY6A 4AJLA 4ZOQI 5DYYA 2FQXA 3QF4A 3NXSA 1E92A 4R5HA 3JYQA 2IS1A 4LEIA 5DM4A 1HXHA 2D3WA 3AHEA 2B0CA 2PYDA 5CDTA 4QT0A 5EEHA 4CLOA 2RGUA 1H4SA 1ZUHA 3O3OB 3C43A 4XFKA 1EVZA 3H1EA 1I3NA 3TLGA 3W5UA 1TM7E 2P77A 2ZDHA 3MD0A 5GOTA 5J59A 1LFDB 4RQUA 1CQWA 1DX4A 4LKOA 2YYYA 5A6VA 3QVOA 4GRDA 2X4DA 1H2WA 1MEOA 3K05A 3NTOA 4KODA 4MYDA 4LJ9A 4OHYA 2P8SA 1BMFA 1NXVA 3JD2A 3WK7A 1C9DB 1RLIA 2SKDA 2IIQA 3CKLA 1IK4A 1OZFA 2I1QA 1Q6YA 4A23A 1MTZA 5A9TA 2LIPA 4PLZA 3ORQA 1TQ6A 2E3JA 2OMKA 3FKSA 1IZ9A 4LW8A 4UQPA 1MLDA 4D1YA 1E7SA 2QX9A 4DYVA 4YPVA 1JFFB 4YB8A 1QNLA 3AI7A 1REQA 2P2SA 3GOHA 4US1R 4WZBB 1BE8A 5FI1B 2CCJA 4JU8A 2QX8A 2GM4A 3OFVA 3HO6A 4QXPA 5TE9A 3WLRA 4F4DA 3U7FB 1HNWB 4AP9A 4WAUA 3KTAB 1E2UA 1RI4A 2O8BA 2WSSD 1N0UA 3BERA 4LPSA 1M66A 2HLPA 5JZMA 1IIBA 1JR2A 2A0WA 1EM8A 2OAGA 4PYMA 4R2HA 5AOVA 2DWCA 4D4HA 1DMSA 3HVJA 4HQOA 1HT3A 3HCNA 2MTBA 3RRBA 4ZZ3A 4XQCA 2RARA 1R10A 3KK0A 1C8VB 1FVOA 1ZZGA 3D3QA 5IARA 3RVPA 5LP1A 1X1CA 1O6ZA 2PRZA 3HVUA 3OKCA 3PK0A 3C3CA 2CXRA 4OG2A 1JJFA 4Q1FA 1BEEA 5DM1A 4FFMA 2HF9A 3WIEA 2GRAA 3VA7A 3Q5GA 4GICA 1T5LA 4BVLA 1I2MA 2DTEA 2FX5A 4HN9A 1ZSYA 4AJ1A 4ND6A 1IQPA 1TO2E 3LECA 3A2LA 2BV3A 1NJ1A 4URUR 4YJ3F 4CLOB 2JIDA 5ERXA 1K8YB 4MW0A 3FYSA 3ME5A 1QRRA 3V97A 4BFXA 5J5CA 1QUFA 1TU4A 4HR7A 5FOUA 3WVNA 5EJGA 4IGKA 3UPDA 1SM4A 4GL2A 5TPWA 5LCXA 4LSMA 4DFDA 2WNIA 3Q1KA 1N75A 2PX6A 5A3VA 4XD7A 3PGKA 3HXMA 1EE9A 2V5VA 4L2IA 1HT2E 4FZRA 4IY1A 4B7XA 1VE1A 3BZUA 2ONKA 4ETNA 1PV4A 1MVOA 5MN4A 4KOEC 5G0WA 2L69A 1PQWA 1PDWA 1W0KD 1V7CA 2VA9A 5ITVA 4N5IX 2VAWA 4QEDA 4GX1A 3CU5A 1YV9A 1K0FA 2VRNA 2O2IA 1W9HA 1U2EA 1SC9A 2IF2A 2QRQA 1LI5A 2Z43A 4NZOA 4N18A 4TL8A 3RT1A 3WSVA 2IDKA 3AR4A 4O5AA 1EGHA 2RHTA 5HSGA 1QANA 2JBAB 3EB9A 4RPHA 4PTYA 4TGLA 1T5SA 3KEFA 2GZ3A 2QXTA 3A7EA 3C3WA 3NHAA 3PNPA 2ZQZA 4N3NA 4BE7B 2W2LD 3V8QA 4YV1A 3AVYA 4YALA 2DY0A 5DLEA 3GDFA 1CJVC 4E21A 1NFFA 2O8BB 2X8JB 2VNHA 3QJ5A 1I0ZA 3AEXA 1FVFA 4CM4A 1PYOA 1KQPA 4NPHA 3A9WA 4W1SA 5I7FA 3A1VA 1M33A 3OT4A 5GGYA 1QK4A 2WHYA 1UAGA 3GIWA 4OBBA 4AQDA 4DY4A 1GCAA 3EG9B 4P58A 2XDQA 1X1AA 4O2BA 5CFNA 5JNWA 3M9WA 4GSKA 2EFYA 2UKDA 1NVEA 5KIAA 4ZOBA 3VH3A 4BYGA 3MRVA 3RYHA 4TUYA 3MTQA 3RARA 8ADHA 4V1CA 4US2R 4D8YA 4KR9A 3MPOA 1MDBA 1RU3A 2JAWA 3WFZA 2CB0A 4GPD1 2G6BA 4XSVA 4QICA 3U3KA 3EA0A 1JBKA 1OAOC 3RSQA 2QN9A 1FLVA 3WL4A 4UU0A 4DRYA 4X8HA 2CVHA 2X1LA 4LXIA 3U3OA 2Z2KA 1JEQB 4QNMA 4DL9A 2GBLA 3KSMA 5J5VA 1AGXA 2ERCA 1YRAA 4Y0AA 1VG8A 2OBMA 3DUFB 3UHOA 3Q2IA 5BQPA 1KZ4A 1LSSA 5KOHB 3IUEA 4W82A 2REBA 4QFBA 4AJNA 4AJOA 2HHAA 4HYQA 1OX4A 4RKFA 4CQLA 1YMVA 4KP7A 3VPAA 4CMKA 3BMQB 3SR0A 2NG1A 3M2TA 4DQUA 2VUHB 4GGPA 5D00A 3TW0A 2BEWB 5K9ZA 4GM1A 1PQPA 1HE3A 3MILA 3O3CA 3HWRA 4JENA 3X2EA 4CMCA 1NYQA 1L0BA 1OB5A 1SXJA 1ZESA 2CYBA 3IAHA 3OLVA 4L2IB 4E3ZA 5AP9A 4YMHA 1QE0A 1H5NA 1SBQA 3QPVA 1XBTA 3K9NA 4BY9E 4R71A 1JJVA 3PKZA 2YH2A 4CLXA 1ZN9A 4HDSA 5GM2A 1OHHA 4R8SA 4Z9BA 1DO0A 1CRLA 1L5WA 2HKIA 3RF6A 3PDCA 4XGIA 1LB1B 2QMOA 2QTRA 3H5NA 4JKIA 4KI7A 1IDOA 1UMCB 2CN1A 3I8SA 4FFPA 4MA0A 5BYJA 4IIJB 3UK2A 5JBQA 3ER9A 3STUA 1PDVA 1PS0A 1L4UA 2C1XA 4JSYA 3AIKA 1QR6A 2ID8A 1XAHA 2PRKA 1D7AA 1E62A 3HADA 3NYQA 2JLSA 4MP6A 2CDAA 3Q7QA 3SQDA 4HNTA 5JY6A 5ALRA 2YIJA 1TLLA 1BKYA 3L0ZA 3LZDA 1R8SA 3L7JA 4M55A 4PZEA 1JDUA 1A2BA 5I9SA 5DYGA 4E4YA 5JPDA 4CM4B 1ZVMA 3Q98A 4N0DA 1VYHA 1JQAA 2Z9BA 3GA7A 2RJ3A 2W6ZA 3KUDA 4JXKA 5ESWA 1P4GA 1YVRA 2ORIA 2XDQB 2YXEA 3JXEA 4QTTB 2R5NA 4EARA 1WUHS 2FXIA 3FYHA 3RYHB 4TUYB 2Y0CA 4BB6A 3LTEA 2WK1A 2JAPA 1RSZA 1NVDA 4DY6A 2G1PA 2B98A 2NXNA 3AU9A 3EYWA 3AQ4A 4WD3A 2QWXA 2GHIA 3AEUB 5JBIA 4RSMA 5F52A 4WKOA 1W4ZA 5D85A 3OZFA 1XP8A 4R1TA 4MUNA 1HQYE 3NRJA 1P61B 1G8FA 3HA7A 2FRXA 1WMBA 3DTNA 4WKPA 4AXXA 4D42A 2HI0A 1W88B 4BC1A 4DQDA 1JXMA 3TEFA 3REOA 1J2JA 2BKEA 3GCDA 1ND5A 1OX4B 2XEXA 4CQLB 4MDYA 4PE5B 1FFDA 5ALTA 1Q2UA 1CHNA 1X15A 4CG0A 4G8BA 4CM6A 4EBFA 4CETA 2WHQA 4KR2A 4UMDA 2R96A 3B36A 4JQZA 4B9AA 4F0JA 1K0UA 2GDZA 3IEKA 3D43A 1E3MA 3DCJA 3KLOA 2VF7A 4TRMA 3ENQA 4UEWA 3A6FA 3NGLA 2B4TO 4L6AA 5BWOA 1J7JA 4W7HA 4YIHA 3DWFA 2XUAA 4J0JA 1OIWA 1W6UA 4AYWA 1E4YA 3DEJA 4HDNA 1NI4A 4IVPA 3BTUA 3FBGA 3ZU2A 3OA2A 2PAAA 3CNBA 1XCGB 2WOOA 1WMDA 2J3EA 3Q9SA 2AWNA 4EG4A 3ZGOA 4OFWA 1C41A 3FKQA 3NC0C 2ZRPA 3NDBB 2H6EA 3RUDA 2P30A 3IALA 3TLMA 4DB4A 2VNAA 2ZT5A 3QW4B 4M60A 4Z1MA 1XQXA 4HXFB 1EA7A 4JBLA 3VR6H 3ZJYA 4HNUA 3EGDA 1L7QA 4LDJA 3P9XA 4KXUA 3UKOA 1D2RA 4OQQA 1E4EA 1MIOA 3FKSD 1RRKA 3Q88A 4TL7A 1YULA 1IEVA 2Q3HA 1BN6A 1PLLA 3IAS1 1W48A 1YZ3A 2RGAA 1T2FA 1P39A 3O4RA 4JQCA 3UC9A 5IDWA 3RC1A 1GKUB 3IMFA 3G2OA 1L7EA 1HDXA 1S3FA 3GZ4A 2RI6A 5HBRA 1NWHA 3KFVA 4DQ0A 1IL0A 4DZTA 4EITA 4UTPA 5HP4A 3DP9A 3NFRA 3QVKA 1LRLA 1NUUA 3LCCA 2NXEA 3TGPA 4V0LA 1NRXA 4NCIA 5GONA 3WGZA 4CCSA 4IJ5A 4NG5A 1CUGA 1KAGA 3ZI7A 3NLLA 1XTRA 1Z0UA 2XTJA 1C4WA 2D1QA 1KFEB 2C1EA 1ADJA 1BXRA 4OJNA 8GPBA 5LKAA 1TZBA 2WFAA 1IEQA 1QRSA 5ESXA 3HCDA 5IU6A 4O1IA 1L2TA 2F7SA 2VBGA 4XIYA 1M1NB 4GYJA 1DEAA 2PK3A 3IA7A 5J2UF 2PT6A 2R6HA 3TVDA 4B43A 2Z30A 4PAQA 2YWBA 3LXRA 1E8DA 2EJWA 3MYRA 5DNWA 1T8PA 5FWAA 1TM4E 4BRSA 4E13A 4YJDA 1BS9A 2IW1A 1IXZA 4AZ0A 2P69A 4RM2A 4J0HA 4LOLA 1DSSG 2CLFB 3TTVA 2M6RA 4ZANA 3BMOB 3A9TA 1XFAA 3DMNA 1M6WA 4DW8A 1V8DA 2HSJA 1VPDA 5ESRA 3L77A 4RANA 2F1JA 2D06A 2P7IA 4QUAA 1ZGHA 1HG1A 1M0TA 2WIAA 3KP1A 4HDNB 1NI4B 3TBFA 2G0AA 5K09A 2HPHA 4KG7A 3FPEA 4F46A 1Z4KA 3LDFA 2IH2A 4JR0A 3AKCA 4XD7D 4DMHA 4K6FA 3FYUC 5EZSA 5AVZA 4HAVA 2NO0A 1WLYA 2PU5A 4OSPA 4KH1A 5BV1A 3K9FC 4ZQEA 1JI3A 1JT2A 1MRNA 2HSGA 2ATVA 1MO2A 3MF4A 1VYUA 2JEZA 2Y68A 4LZOA 2YJ3A 5AJUA 1P4RA 2HPVA 3R44A 1VCHA 4I1VA 1R5JA 1IZ7A 5D3MB 5C34B 1E4EB 4I6GA 3ZGYA 2WOJA 4H16A 1TAGA 1YVUA 2WYIA 5JE8A 1NUAA 3BMCA 4M6WB 3HJRA 4DUGD 1E7QA 2RK3A 5IS2A 2OLEA 2J0SA 2EQBA 3RJ9A 5FJIA 2GBPA 2WDPA 4RF3A 3JWHA 1U04A 3VSEA 3R24A 5TVGA 1VPWA 3WLPA 2ZUFA 4KQIA 4WT7A 2CK3A 3N05A 1GNPA 2BBSA 5FPYA 1GYPA 5GQSA 3MSCA 6REQA 1I3KA 1Y9AA 1ISPA 5K3OA 2CUKA 1XD8A 1XO1A 2DBVO 1E5LA 1WZCA 1PL8A 2I29A 3DFMA 2IEYA 3EZXA 4QDZA 5HKAA 3ZCPA 3U6BA 1BXRB 1R37A 1KI3A 1VP9A 3IS3A 3P1JA 4L8YA 4OXIA 1UPTA 3UJCA 5IH7A 2JAHA 4JYMA 1OX6A 4X1KA 1COZA 1E2DA 1PZEA 1H85A 2RHGB 5NLLA 5AUQA 3TL6A 3R6GA 1E9EA 1T9AA 1Q0TA 3K8QA 5GMOA 4KDEA 3S5JA 3WGKA 2N47A 2CHUA 3OTIA 3ZDAA 3DTTA 3OEHA 4Y8VA 2J3MA 1E2KA 3HACA 4PICA 2I4LA 3ZK9A 1GU7A 1T5BA 1ZBDA 1GGFA 3DZCA 4U7HA 4N0EA 4W9NA 4YRTA 1UKZA 5U4QA 4MVJD 3SS9X 4JI7B 1YQEA 4G4JA 4G9GA 2BLNA 3T7KA 2UUBB 1E1RA 1GUFA 1M67A 4MKIA 2HMUA 5DW0A 3RYFB 4BIIA 1EEXB 1F8GA 1QO0A 3I5MA 3QHAA 4OYHA 4KXNA 5GJCA 3SS7X 1GQOA 3K0EA 2IPOA 4L57A 2CLHB 4JT2A 4NG4A 5CYFA 4MOWA 4DR2B 3N2IA 2XYGA 5CRIA 1EUQA 3DNFA 1UPFA 4B9EA 4FQ7A 2NU9B 1EZZA 2C0QA 2BRUA 5B4UA 1JDSA 4KFTA 1GR0A 5LZ7A 4AG5A 2VYCA 1OT5A 1A2OA 3BILA 5JCOA 4Q4JA 1LX7A 1JV2B 3EIOA 1WXXA 1IAVA 1Y5NA 5HDQA 4DVJA 3SDSA 3T3HA 1UANA 3LY7A 1EX7A 4GKKB 4G09A 2EP5A 3IAUA 4OQZA 1U7DA 2ZBRA 1EU1A 1KEWA 4W1PA 5CIYA 4FM9A 1PSDA 4UBKA 4ZJUA 1N1DA 2NQ2C 2Z1MA 3BWEA 3KQWA 1WD7A 2CXOA 3V4VB 5TB5A 4FSXA 1IOVA 4DLSA 1ISIA 1XZKA 2B1GA 3T41A 1RHUA 3AJ8A 2NVUA 5T3UA 1ZMTA 2AN5A 2VWGA 5C3UA 3MTBA 2VQSA 3TKAA 4O6VA 3M4JA 4KXQA 4OBXA 3FNGA 2Q6OA 2COUA 1Y4DE 2JKZA 3L07A 1CS0B 3TD9A 5BQFA 3JD0A 1XX6A 2FK8A 1D0VA 1VHQA 2R86A 3L8MA 3QTBA 4IXNA 4S1WA 2PQMA 1M6VB 1D5CA 2HQOA 3GRYA 4OHRA 5CM2Z 1FFXB 1Z7YA 5HKKA 4ABTA 1KYQA 3KQVA 3A9CA 2GXQA 4X1KB 4L51A 1HYBA 1JQKA 2R4TA 1JQEA 4B75A 1NRWA 1OFTA 1QRUA 4D5EA 4FS3A 2Q6VA 1NV8A 5K5EA 4AMBA 3W6OA 1IATA 3LWBA 3L46A 1ZWLA 5TJ9A 4YA6A 3IQEA 3H4TA 2DBRA 4LDPA 4GX2A 3ZDDA 1XMVA 1YWGO 4KK4A 5DCWA 1O2DA 1PX0A 5EHNA 1RZ3A 1GUZA 5JD6A 1EFPB 1GZUA 1Q2XA 3LMKA 3RTDA 3HTXA 1OA1A 2A9PA 1L4KA 4BCDA 1B42A 1RKBA 4OKSA 4HPJB 1HDZA 1OCEA 3U81A 1GNSA 3OPXA 1OW3B 1H2HA 2C9OA 4QATA 1FRQA 4U4AA 3H05A 3H2HA 2IDZA 4X6XA 3WRWA 4INPA 3O8OB 3SJAA 3BXEA 1TVKA 3QX3A 2PRIA 3PIRA 1TZMA 1PX2A 1XEAA 3M4ZA 3N28A 4JBYA 4LCEA 4TVBA 1UFRA 4KUGA 3GVCA 4C88A 4C4AA 4UOZA 1U6KA 2O9JA 1IRXA 4JP5A 1HURA 1PR3A 1R0BA 1V7ZA 1XL1A 3VYTB 3DZ8A 2WWGA 3BWMA 1HE5A 2IF0A 4YAUA 1I4DD 3AJDA 5FA6A 3CLUD 4RELA 1ZHHA 3RVSA 4Q9IA 2WFMA 3W3ZB 4J0QA 4Q7MB 1CG6A 1W75A 2ZR7A 4FC7A 4GYKA 2DQYA 1Z4QA 2YWRA 1KI7A 1EFVA 1P75A 1JDBB 1PKEA 1RYEA 2SBTA 3KHSA 3VAAA 3ZXYA 2NO9A 1NDUA 4C0BA 4D0NA 3CH6A 4EQ6A 1JG7A 5G0VA 3NKFA 1XVTA 5DU2A 1Z4LA 1JB1A 1BX0A 4P4GA 3A25A 4UHFA 4WK2B 4Z1MD 4Z4FA 3GEIA 2IK8A 3NCTA 1TAHA 2AJ8A 1CUZA 3NOXA 3VKWA 1G19A 4W5NA 1H0KA 3KSAC 2M2IA 3PDHA 4MB6A 3P9QA 4P98A 1TCUA 4BUJA 4ECAA 3MB8A 2VPTA 5EYPA 1MT3A 1P33A 3A0UA 2PT9A 2P91A 3MS7A 2DHRA 4JLOA 2C4VA 3VR5H 1JUDA 2YNMA 4R0MA 4NQRA 1NYLA 4X3CA 2HX1A 3A3PA 1S2MA 1B6GA 1HE1C 1V95A 4BNUA 5JSUA 4YJGA 4EA6A 2UXCB 1VZ3A 2E4XA 2G70A 3S2ZA 3N6RA 3QEAZ 1L7NA 4QDOA 1QV6A 2O52A 4B40A 3EXIA 3QY0A 1CR2A 3KYCA 4AFNA 2OCPA 1KORA 3TRJA 1F0YA 4CEIA 2J31A 2NO4A 3COSA 5A02A 3DV0A 1RYFA 2WZDA 2OFOA 3A0RB 1AVTA 2VN8A 2YVLA 4IRXA 1WNTA 2IYQA 4TKVB 1QF9A 1U7PA 4FK8A 4BVHA 4B2LA 5B7GA 2XBMA 5IUJC 2J6HA 3NUGA 4B6PA 4C7MA 1GTVA 4R2WA 4YRIA 3L6DA 2X14A 4RVDA 3M6IA 3NWJA 4OB6A 2G5TA 3HH8A 1A71A 2B61A 1H6AA 2RGYA 5FUMA 4OAPA 4KXVA 3W3AH 3R09A 2IJGX 3JQCA 1XRMA 2PSFA 3NHFA 2AYZA 3AYXB 4ASUA 3S2FA 4XWKA 2IHYA 1EUYA 2XUJA 3ZH9B 2H48A 2WD8A 1RVV1 2MSCB 3AM4A 5KTTA 3HBMA 2ONYA 1ZW1A 1T5HX 2IHZA 1TW2A 2V54A 4AS2A 5H8WA 3IULA 5KS2A 4YQZA 3O84A 4YP0A 3SZOA 5FR1A 1Y4AE 3MJEA 4OVKA 5F78A 1H1DA 3BL5A 3ZCRA 3TQCA 4EFNA 3HCPA 3F6EX 2OHOA 4E31A 3KE9A 3BQNB 1R64A 2AUMA 2L19A 2C3MA 1P80A 4EQ6B 5M7EA 2V8OA 2AOUA 1DBRA 2GETA 3Q3EA 1Q91A 3KTFA 3BXOA 5I9BA 2H4YA 4DV7B 2DGDA 1JNXX 3E9ZA 3K09C 4ME6A 3RTEA 3L1UA 2CLCX 3KQHA 2E2WA 4ZCTA 3NOQA 4QYWA 3ZHUA 1OC4A 3ETCA 4N3AA 1LD3A 3ZIDA 5KKNB 2Q0XA 2VJQA 3FNEA 3LBIA 2H9IA 5G3ZA 1LSOA 1NI3A 2VQ3A 5A5EA 1IEXA 4WINA 1N7GA 2MINA 2VAVA 5KB3A 2IU0A 3NBZC 3QWHA 4QYSA 1UC8A 3MBIA 5AVYA 2IFTA 2ZIWB 2FFQA 4D2IA 4OHZA 2ONCA 1BEZA 2GHQA 4RQAA 4U8HA 4D41A 2FPGB 3NT5A 3I9JA 2CK3D 4CJXA 3BCRA 3ZDXB 3K15A 2O07A 4N3CA 5F7JA 3ZU6A 4LWOA 2O48X 3N5CA 1O57A 4HNQA 4CEJA 1T0PA 1PFKA 3WGJA 4AN1A 4AI6A 2PDAA 2JHFA 4G1FA 1EJ2A 4GC5A 4KMOA 3N7UA 3AY0A 3ICCA 1Z6XA 4P4NA 3O2NA 3NHJA 1V48A 1F6BA 1HE8B 3MCTA 3MUEA 2R00C 4CF7A 2OBYA 5C8YB 1SOVA 1QDEA 5E1MA 5CLJA 1O4WA 1GPYA 2R65A 2WI8A 1KF0A 2PMCA 4JT8A 5HQ3B 2C7OA 1RRVA 4KYIB 3GP5A 5UKDA 3RC7A 5FOWA 2VK2A 4HS4A 4RCYA 3VO8A 3A6GA 3VFDA 2AFHE 2NQTA 3WLNA 5GZ3A 2EJTA 3U49A 4AJ2A 2QMUA 2PJRA 3AUYA 1ZLYA 4ENVA 1SXQA 5COAA 1Q6ZA 1QVAA 2IEDA 4GPIB 4AN0A 4KQFA 4IOLA 4B4OA 4YFVA 5DV9A 3AJAA 3DZJA 3F1KA 4Y18A 1WMFA 1T6ZA 2IVZA 3JU3A 3BXHA 1CEXA 1N3YA 3F8TA 3ORYA 4C06A 4R3WA 4IYRA 4AX8A 1XEFA 1CP3A 4UE3S 1NC1A 2AOUB 4UUQA 4X71A 4ERXA 1RXVA 4N47A 4E22A 1W0CA 3MHPA 2VCHA 2EQAA 1U0LA 5REQA 1NQAO 3OCWA 1J90A 3RM3A 3MMXA 3P0JA 4NYIR 2C1ZA 3GRCA 3QU9A 3AIIA 5LMCA 5JASA 3BHIA 3EA4A 1GU0A 2MINB 1YS7A 3TO5A 6GPBA 1PR5A 3EC1A 2EG9A 3G02A 4ZAZA 1ORDA 1PJAA 1T8TA 4QJ4A 3EXFA 4EDHA 3GAMA 2JLWA 3DLAA 5GGXA 4F6RA 5ICSA 3QFRA 3RAEC 1ZU5A 2XCOA 2VQFB 2J0QA 4MLPA 1N5OX 2YOGA 1UBNA 2FQWA 3LPLA 2O4CA 4MWEA 4QUDA 1USVA 3DEIA 3JS5A 4KPGA 5LA6A 3EH2A 5FPSA 2XKKA 4DMGA 3K6RA 2B1QA 1MZPA 3RW9A 2NP7A 2O8FA 1ORWA 3A4VA 4RLHA 2ZWVA 5JAOA 1WV0A 2BDUA 1GADO 4O33A 4KH0A 3SLRA 5A3SA 4HWGA 2WILA 1FPMA 1PJ3A 4RTSA 4YRLA 4HEA6 1F2TB 4N9QA 4GBED 5I8PA 1F8YA 3KQUA 3RYCB 1B0ZA 2FZKA 2DFTA 1U65A 5L3RA 3OTWA 3R7DA 3RLFA 4Z49A 5A3RA 2VUTA 4YRDA 3PJFA 3PHGA 1XNQB 1IBRA 3D4BA 3STVA 3WO1A 1X8JA 2QU8A 2UVPB 5I47A 3PSHA 3WLQA 1Z34A 1AM4D 5TS2A 4DV5B 3K16A 4XQ0A 5F98A 1HM5A 4IDQA 4NSNA 2FPPA 5K3CA 4V2IA 3P71T 4FILA 2X0NA 4R1MA 3MHTA 2Q3MA 1JWBB 3FUUA 3H9BA 1U9IC 4KO4S 4M87A 2WMYA 1CY4A 2HCRA 3G2LA 5BMOA 1SUDA 4E09A 2OFXA 1UDBA 4O2BF 3ST7A 2X9QA 2XNCA 4Y2VA 1YB1A 1J24A 1KP3A 2I6UA 3NNNA 5LLTA 5F64A 5JS2A 2V6IA 4GEGA 4WOCA 3KU1A 4TTQA 3FTDA 5LB4A 5GINE 3TOSA 4FMCF 1H2AS 2HV8A 3WYEA 4YCAA 3GCWA 2UZIR 4D5GA 5TLSA 3PX3A 1IQ0A 2H1VA 1UP7A 3HCAA 4FFRA 4DUPA 4URWR 3MC1A 1XZAA 1RT9A 2H59A 2VDLB 1Y1PA 1LPBB 1D04A 1N6NA 2ZBVA 3Q3VA 5AM5A 5G40A 1XVVA 4JJ7A 4MVJF 1J0CA 2IH4A 3BT7A 2VSOA 3R4CA 1JL3A 1RXIA 5LOVA 3DBRB 3FJYA 3TTUA 4CL8A 2F9MA 5DZSA 4PRYA 4CL0A 3HJHA 4FR0A 4GXRA 3KAPA 4JOBA 1TPZA 2VHYA 2GR9A 3L6RA 2OCXA 2RBEA 4YR9A 4AW9A 2RHRA 2OXRA 4M1QA 4Q47A 5JSQA 4Z8YA 4L3WA 4CMHA 1BU5A 4LSGA 2GZSA 3B7GA 1BWRA 3I37X 3L9XA 3GT0A 1Z37A 4ENSA 2DFLA 2WP8J 3JD1A 5KYUB 3JAMA 1TX4B 2EQ5A 3RTBA 1E3DA 1O96B 1B16A 1S6YA 2WJ4A 3DOEA 3IJEB 3ND5A 4MUHA 5ILGA 3FUXA 2QUAA 2OMEA 5HJ7A 2RGRA 2PGAA 2YNMD 4HH0A 4JX9A 2O8FB 1ZVQA 1SHUX 2X0IA 2D7DA 1B8OA 2XCTB 4QRHA 4TV9A 4Y1FA 4BO1A 3NRCA 4P3YA 1AQNA 4OXKA 4RKYA 4BAGA 3HRIA 2WYOA 2GUGA 2XOXA 2Y8EA 3GH3A 3O9ZA 3OQIB 4IPTA 4RE6A 5E38A 4MKGA 2Q7XA 2JJYA 3DV9A 3F8WA 4NZYA 5KKCA 3QSYA 1IPHA 2A9KA 4CM9A 3LQ2A 2GPWA 2AJDA 3TD2A 3OT5A 4ZFNA 4W7SA 1L5HB 3EEFA 4BTEA 4FLMA 3QKRB 3QV1A 3KWMA 1QG4A 3AKYA 4PIMA 2A0YA 4MQ5A 4Q4DA 2AYYA 3KB6A 3FDIA 1D0SA 2AHRA 2A1TR 4JVOA 1NG1A 1D9XA 4JJ6A 1NVUQ 1UC5B 4ASUD 2YDYA 4DSUA 1GPH1 3VO9A 1QOZA 3KETA 2QLLA 4CG3A 4EH1A 3LHSA 4FUQA 4UHBA 1NI5A 4MJ7A 4RH1A 1QIDA 3REQA 3RT9A 3GNTA 1F4VA 3VH1A 3DOHA 2GK3A 4EUEA 2C7PA 2NZUG 5H5JA 2CV1A 4X41A 3O38A 1R0KA 1X7WA 3KTOA 5SV2A 2WLTA 1RNLA 3LPAA 4LC0A 3ZHRA 5JI3E 5KOIA 2FA9A 3D3WB 4DNQA 5J23A 2X3FA 1WWKA 4LX0A 3FVVA 3V46A 2A14A 4LFCB 4M7OA 2ZVDA 4IUDS 5CXSA 1XKQA 2CHVA 1YS4A 4LRXA 1DAIA 3VAZA 1B73A 1G21E 1Q14A 3CLVA 3ESBA 4LMPA 2DM6A 2IXAA 2JHCA 3WYGA 1RPZA 2QGFA 1GQRA 3PLAE 2IBSA 4KX5A 3RKSA 1XQ9A 4DNPA 2CC2A 1F0NA 1I3LA 1U1IA 4B17A 4GZ3A 4DV6B 3SN6A 1SWWA 5KVSA 3ZE6A 1GUBA 1W2WB 3M1LA 1Z7WA 2K7ZA 3N8DA 221PA 1ZN8A 5ILQA 5IBCA 1XZFA 5ICGA 4EF4A 1CDOA 2XUDA 3M6FA 3BJZA 2MU1A 5BOSB 3O3NB 4MIYA 2QJFA 4E5YA 2P6RA 2IS6A 3KELA 4WN3A 4OATA 7MDHA 3QXSA 2QM7A 3MTGA 3FCEA 4BFSA 1WRBA 2F1OA 4CR6A 2O2XA 1D03A 3I52A 1VJRA 4RSRA 1TA0A 2NUBA 5BMVF 1G1AA 1PGPA 2PBFA 4G1CA 2CE7A 2YVAA 1ZJ5A 3HG7A 1EFTA 4B3FX 2GLTA 5C8VA 4OSEA 1S0UA 2F9FA 5HMLA 4YAKA 1H5QA 1Z5NA 3B2QA 2IYVA 3QTLA 3CM0A 1QAQA 1GNVA 4I50A 3T94A 1Z4NA 3LHIA 2HQBA 4NULA 2W83A 2YYZA 4HY3A 1NJ2A 1M6HA 2GKGA 4B81A 3ICWA 3ZWCA 3F98A 4LHWA 2W6QA 3TMAA 4MUIA 3T4XA 5CT5A 4I3GA 3EIFA 2QRHA 4UU7A 2NXJA 4I4IA 1IN5A 1NBHA 2QXUA 4W4TA 4YRQA 4M9CA 5GONF 4YRMA 3BN3A 4HQKA 3CPHA 3BF8A 2PMKA 5SICE 3MFQA 4NAUA 1JI0A 2NTNA 1U3VA 4JNKA 1U3GA 4G3XA 4M0DA 3V1LA 5BR7A 1J1UA 5T4HA 1GPNA 3WWZA 3DTVB 3EC2A 4BU0A 4RD2A 5C4IA 5IAAA 1G5TA 4W5HA 1C7IA 3U7QB 1AOXA 1ZAYA 2ORWA 2V7VA 4HKTA 4CMGA 3MFYA 3STYA 2OSBA 3WJ7A 4EY3A 2HU5A 2A59A 1TI7A 2FMFA 1K4MA 2YINC 2Z2YA 4XQEA 2JJ8A 1L7BA 4YAFA 1JMKC 1PWXA 3OM0A 1ZVVA 3EGCA 4QOIA 4S3MA 5H68A 3JQAA 3Q7TA 1JG1A 2AA3A 2CXSA 1EFRA 3DDNA 1ULTA 3PHLA 1NXPA 4DR1B 2W2QA 3AVWA 5JTTA 1IB6A 2RCYA 3LQ1A 2HV9A 2RIRA 2EDCA 3KVYA 5DSTA 3W5SA 3TQSA 2J48A 2QUBA 1A4XA 3TK1A 3AM1A 4YYZA 1C8LA 2I7XA 2QR2A 2UZ0A 5EA2A 1SU6A 3GRAA 2QT9A 4WADA 5FPHA 1UM9B 3H2GA 3LF1A 4I55A 4ER5A 3QENA 2IELA 3X1WA 4DV3B 5EJ4A 1L3IA 5FBRB 1RPTA 5L7YA 1UOQA 1FFAA 2JJQA 3B2EA 4YJHA 1HH4A 5GADl 4MXDA 1DV1A 1UBUS 1SUPA 5CNKA 5FJJA 1AG9A 6PFKA 2YBDA 3ZHVA 3RHZA 3MRTA 4MVCA 3NTLA 3IUNA 3DZKA 3UY4A 1EZ4A 4C7XA 3FMPB 5IW8A 3V8NA 1AHPA 1DWPA 1ZD3A 2AJTA 4AMYA 2DERA 3I6ZA 4G8CA 4KITB 1YGYA 2YQ4A 3U16A 3UFBA 3DOCA 3GUHA 1KKMA 4KBFA 4IDEA 5DHQA 3SKXA 1G8AA 5KVAA 5F9FA 3GT3A 3N87A 4XH9B 2Z8XA 5EN4A 4M1EA 5HBGA 4CV1A 2ZJ1A 2FK7A 2W90A 1Z5ZA 3PZRA 1K5DA 3WRXC 3MJRA 2XGMA 4NOMA 2AEEA 2HJ9A 3GARA 3LPNA 3LYLA 4ZODA 3I8OA 3K7EA 2JFHA 2W6ID 3PQ6A 4P7FA 5K51A 3BM5A 3T52A 2JC3A 1J2RA 3K32A 4ND8A 1RYNA 1CJCA 4G37A 1O6CA 7ABPA 4PLCA 1H4QA 2V1XA 3O4HA 3DDSA 4J0DA 4BNWA 4BUCA 4L5IA 2OCLA 3HY4A 2CF5A 3LBHA 3ZGNA 4MPPA 3RHTA 4CLRA 3DXXA 1ZEMA 4BRZA 1AHNA 3AHJA 2EVWX 1QQ5A 2GPJA 4GGOA 4GOOD 5KJCA 1CEEA 1D4FA 1IN4A 3L1HA 4W9MC 1HZZC 1KO7A 1SCAA 4KACA 1IXKA 1CE8A 2J32A 3COYA 1A9SA 4X20A 3TFWA 4L07A 1ZD1A 2A9OA 3OY2A 5FQOA 1SVKA 2BISA 4NU5A 3A1TA 3VKUA 1UBMS 3SF0A 3QH4A 1Y48E 4J4TA 3DE0X 2CLEB 3EEIA 4JOCA 1K5HA 4QPJC 3PNQA 2O1EA 4RY0A 4YHHB 2XXBA 1Z2PX 4TYMA 3A9VA 1MPXA 1QS0B 2VHEA 5DNCA 2C58A 5ENVA 1J00A 2JF0A 1EG2A 2C5GA 4IX9A 4KBGA 5BPHA 5FTLA 2Y1WA 3LQFA 5EZYB 4CR8A 4ARVA 2JRLA 4OMUA 1F4PA 2CFOA 2VHVA 4MMZB 4UBIA 1KJJA 5B3KA 1L3BA 3CTPA 1D0IA 4JS0A 4YJHB 2BVNA 2B5VA 2Q3BA 3EZ6A 1Z0ZA 4IMPA 4JBIA 5SZHB 2PUBA 3CVUA 3ZG6A 1XC7A 5DRYA 1POXA 1PRYA 3WL8A 4G41A 1AQUA 3RIYA 5DHFA 4AG6A 3CW2A 3TNDA 2HHHB 2WINI 1BE6A 2QYOA 1PVDA 2K87A 3CN9A 3SAJA 1BTOA 2N42A 3AHCA 5K0FA 3BHMA 2GT1A 4BOYA 1I0IA 5BN4A 3WAKA 2IYAA 1TPYA 1G3QA 2W71A 3IQWA 2GCPA 2EJCA 5EIOA 1M6EX 1YA8A 5FR2A 5KCZA 1O89A 3HP4A 3CRZA 1E9CA 2R97A 4DXAA 5DVZA 3QLUC 2QAGC 4RV5A 2L17A 3H9CA 3TNFA 1U0NA 1R8XA 1BJTA 2HADA 1ZI9A 2RBKA 2SKCA 3P52A 3G5UA 4HO1X 5J1TB 5CG1A 1X7YA 1TECE 4FZ3A 1W87A 4EI9A 4FKZA 3NVKI 3QWBA 4X1IA 1VPVA 2F1HA 2GFIA 3F9IA 4H1UA 2GDJA 2ZIFA 4JBWA 1KEEB 3RWBA 4PHTA 3ZDRA 4AJIA 4E03A 2FPWA 5DWQA 3D6HA 1I13A 2Z09A 2AW3A 2OZLA 3IUQA 4JLUA 4M3NA 4RJLA 5AHKA 5IKEA 4JLWA 4LBZA 5JZVA 3QEBZ 4E14A 1L8XA 3EVBA 4HVTA 4R54A 4HAYA 4C07A 1NBMA 3KKQA 4GW3A 9ABPA 4PV7A 4LJLA 2HY7A 2WIKA 3LFHA 1KAOA 1F0PA 3OWXA 2FX3A 3DBHA 5BP7A 2JD2A 1O4VA 4BEJA 5CUQA 1SEVA 5IC5A 4BMNA 2HL6A 2XI4A 2V5AA 3EXEA 3NHYA 1X7GA 3FHTA 2QLJA 3RAJA 2QT1A 3UMGA 4FHZA 4L3OA 2JDIA 1JFRA 2EW1A 2I34A 3OX1A 4V0KA 3ZE8A 5LWHA 1P8AA 3W7AA 5PNTA 2YUIA 3NO4A 1NW8A 3K9WA 2BBOA 5BR1A 1UKEA 2GFQA 3F78A 4JGGA 1T1EA 3U9LA 1F9EA 4XSHA 1GKLA 4X6YA 2XRZA 3MLAA 1ZONA 4FEGA 5IN5A 3TZKA 3LZCA 3X1DA 3H0KA 5GP1A 1J22A 2AZ4A 3VC2A 2W00A 1T2NA 5E1BA 4ZCMA 4MZXA 2J5QA 2IL1A 4DLXA 2F55A 4DJDC 3A6JA 3K1YA 1K9VF 1CQIB 1X19A 3BGVA 2X3UA 2O8VA 2LWIA 2OR3A 1JEJA 3WGGA 1CEQA 1U2GC 1H93A 1HTWA 1ZGAA 1D2GA 4IRUB 4XUDA 1R50A 5DISB 4TTJA 5AW9A 2BFCA 2DLNA 3EQ7A 4KE7A 4LSZA 4ZQIA 3FIJA 1D4ZA 1OQAA 1QDUA 2NZYA 3L5KA 2VF5X 1RWPA 3L8YA 2JS7A 4C0LA 2CWWA 3NIDB 4ZI5A 2W9XA 3WKAA 5J2TA 3D64A 1I10A 4FQ8A 1CUSA 3ZHTA 4JI3B 1P2GA 1W1UA 2CMFA 2OQRA 4DBLE 4ZYXA 3JYPA 1XG5A 5BNWA 4MWDA 4CMBA 2KMLA 1N7IA 1O94A 1QR2A 3P9YA 4M0KA 2BKXA 4OLFA 3ZZTA 2HTEA 1LW7A 3ZXUB 2X5JO 4EEKA 4M22A 5ADUS 5CK4A 3OPYA 2I3BA 1Z7EA 4EW3A 2VBFA 3KZOA 1XMXA 1UT8A 1SBZA 4YP1A 2ECPA 2V45A 2WJIA 1I2ZA 1KH1A 5DGTA 1BU8A 1T1SA 1A7JA 1K92A 1CK4A 2ZRLA 1ZFNA 4MS4A 2WD9A 2JJ1A 4GKBA 4ND1A 4DZRA 4HB0A 3B3GA 3FBWA 4LDRA 4V02A 5CTAA 1ML3A 1N2IA 4RKWA 1WUYA 2G0NA 2I6QA 1ONSA 2GN4A 2B94A 2N3ZA 2FFHA 4R9VA 4BO2A 2YZNA 1GM5A 1HDEA 2FMXA 3T4EA 3DDZX 1MVNA 1EE1A 1ZK0A 2VWQA 2V7TA 1FYWA 3AWDA 2ZBDA 3GBPA 4QYIA 3WV5A 2QIOA 4BJ5A 3U2QA 2DECA 4MUBA 2HU2A 4PG4A 1XLUA 3CGWA 4E4RA 1ULHA 7YASA 4P08A 1ZSVA 1L5GB 1DG3A 1NVMB 1WXGA 4YUZA 5IVPA 4CXMA 3ASUA 3JQAD 1OZ0A 3PC8C 2GXAA 2NPFA 4BO4A 2ZDGA 4ZK6A 3QLTA 1YR1A 2YWCA 2VP9A 3WWYA 3NTRA 4AY5A 1D9ZA 2QJRA 1BCRB 4JI5B 4HQNA 2IHJA 3TIXB 2I1LA 2HMYB 5EC8A 5IN4A 4KB5A 1XF9A 4KNWA 1L1RA 1JIJA 4E15A 3QE9Y 3Q40A 2GYVA 2C5BA 4BB9A 5JHHB 3KOZA 3QPCA 4J7UA 1IXYA 1L4BA 3W1EA 5C1PA 3CNQS 1CW2B 1BKSB 1I4WA 3C8DA 3QNUA 3RTAA 2FOXA 1I1QB 4Z9YA 3ZQ6A 1O5TA 5AKIA 3ZJVA 4RUKA 3LQQA 2XUFA 3KD2A 3M5DA 1N2SA 3R4VA 4XUCA 4ZGGA 3PXBA 1BMQA 5FTWA 3BXPA 1EPUA 3FWNA 3AHHA 4J4HA 2GXSA 4JELA 3ZWNA 4JZYA 1K6XA 2PX8A 2AFRA 4BDTA 3PHJA 4M9ZA 4INJA 1R8QA 5DBGA 4OGGA 2FZEA 1HMYA 1S4QA 5LVAA 1D8AA 3NTQA 1YZVA 5HOQA 2B4YA 1A8HA 3NKLA 4WA8A 1NYTA 1DWQA 3U4QB 2Q5EA 3H83A 1RE0A 4PYNA 4EB0A 5JH7A 3HXPA 3BD7A 5EI5A 3B89A 4N49A 3KXKA 4E5PA 1FYFA 1U1CA 4NPAA 4HDMB 3FDXA 4GXQA 4S0ZA 4UC0A 3D7NA 3ZD8A 1GVNB 3EDCA 3NEYA 2ZJOA 2GCIA 2ZREA 3BCHA 5CP8A 2IX3A 1GUYA 1WW2A 3SVLA 3M3PA 4MR9B 2H1CA 4CCYB 4D8TA 1XJCA 5TC4A 1H2FA 1M3SA 2VXYA 3LYUA 4PANA 1GZSA 5D5PA 1C3OA 1UK6A 1OC2A 2Q9UA 3B9BA 1VYVA 2O23A 1ZMRA 2V7UA 4CR7A 2L42A 4UCFA 3AJ9A 2EKLA 5G0SA 2QQ0A 1YR3A 1ZIDA 2QYTA 4HWRA 1RI3A 2Y6VA 2M1XA 3DMTA 4BKMA 5AESA 4E4TA 1PUXA 1YS1X 2EV9A 3C5CA 3TZ6A 3X1KA 5KBYA 2WA1A 2VP0A 2G1UA 3CA8A 5LFAA 5GTDA 2FSVA 1BHQ1 1V8BA 3ITDA 4WY5A 4DDMA 2Y4OA 1IK6A 1WEHA 1Z26A 5CD9A 1PT7A 1PW5A 3JQQA 3UH1A 1RC1A 2JANA 2HMSA 4JJGA 5K4HA 1BO6A 3QA3E 3JR3A 2C2HA 3VNAA 4XCVA 4C0KA 3UA3A 4GSYA 4RK5A 3QFCA 2PZAA 2BFWA 4DPMA 4PLGA 1B23P 1XCJA 2OHIA 2CMGA 4M2LA 5EP3A 2PMDA 3AFMA 4PSCA 1ZCFA 3MMSA 3IPRA 1YOBA 3DKRA 3PF9A 1D6MA 3R3WA 4KGXA 2AK2A 3HA3A 3VHXB 5CLLA 1GRQA 1YQDA 4EWLA 3VU0A 4NEQA 4XRRA 3C1AA 5H3CA 4QTYA 2RHCA 4V03A 3RRNA 4RTJA 2O3TA 2EKDA 2ZB3A 4G1BA 3T3PB 1ULSA 2FUNB 4X91A 3AUTA 2HGZA 4JC5A 3L0OA 4Q93A 2FDRA 2PCJA 1YR6A 5C1OA 2YY7A 3DJYA 3F96A 2JK0A 3W2TA 4HAZA 2O1WA 1SR8A 2WWRA 1QWSA 2ZRKA 3OIYA 1EUCB 3IEIA 4MV4A 3TMKA 3DULA 1R9JA 4UDYX 2F90A 4A8PA 3G0HA 3EXG2 4NEGA 2JH3A 3WK4A 2H2IA 1VJ1A 1GPJA 3ET4A 1UQTA 3LHDA 1MC4A 1EXNA 1NP7A 2Z0MA 1P73A 5JH7B 1JZQA 5EIBD 2EJVA 2QXYA 3G89A 5TQJA 3ZV7A 2UU9B 3BB4A 3GK3A 4O8ZA 5BSGA 1HI9A 1UBKS 5JI2E 3QUSA 4D74A 2JLRA 1PJCA 3I64A 5EJ5A 5LZ4A 3HXLA 4AYTA 4REQA 4W99A 2G25A 3O1HB 4DILA 2H7YA 3MUOA 1Q1AA 3N8GA 4J16C 4YRFA 1ZLXA 5EESA 4B85A 1E9DA 2H63A 2QPLA 2GRJA 5J5AA 3I61A 2R60A 4JY7A 4Z9FA 1NBMD 3M3HA 3OZVA 4KYVA 3TS1A 4L95C 4GXNA 3OQNA 1JLLB 3FWHA 1H6DA 1YNSA 1FDUA 2WIBA 5AKZA 5LYJB 3M81A 4AZ3B 2RBGA 2FRDA 2I2CA 2R1UA 3S8EA 1J5PA 2VYNA 3EF0A 3G9XA 4JLMA 4WA7A 3T1OA 3TLYA 3H17A 1TK3A 5JCJA 1MX9A 2R5WA 2DOKA 1XNJA 2JDID 1A5BB 2SCUA 3HRKA 1MAWA 3D0OA 3OI7A 3VOBA 3NHMA 3F5QA 4LPKA 5ALXA 4PWYA 2IDMA 1I1NA 3E70C 3DKPA 2OYSA 3HYNA 1SN7A 2NTEA 3OTQA 4K40A 4ZVQA 3AUSA 3GLVA 1XZIA 4XJXA 1AZLA 2QJTA 1ZK1A 3OM9A 1TJ5A 4MAFA 1LU9A 4EMSA 1SBNE 2AUNA 5KWJA 4CKCB 1YJ8A 2QTWB 3IX7A 4C43A 1TZJA 3CR7A 5I3CA 3Q6NA 2PL3A 4OO3A 4PU0A 3AOEC 4RDCA 4TV8A 4XAQA 2QE6A 3DBOB 4I2VA 4IHQA 3PT9A 4YLEA 3TBHA 1FSZA 1H94A 1SVLA 3QBJA 2X40A 3CX7A 5AVXA 3DLBA 1USGA 1BAPA 2P0EA 3MQ4A 4KE9A 3ZJUA 2BCJQ 1DKRA 4S1OA 1T34A 1W0JA 5KWIA 1P4JA 1W2HA 2HK7A 2XODA 2EXXA 2W2KB 1ZISA 2XBLA 3WJ1A 4XYMA 1UINA 2R5FA 3HBJA 4LY9A 4E1AA 2VWHA 4NEHB 4U39A 3IA2A 4JNCA 1LPOA 1RLTA 3ROTA 2BR5A 1WDLA 3QJGA 3JQGA 3T1TA 1WB9A 3E9MA 1O94D 1W4AA 2JLAA 3T38A 4MI1A 1GSAA 3UT0A 1ODSA 1YB6A 2HA4A 2XOKD 4BWYA 2O8CA 1FNSA 1TJPB 2C2GA 3CX6A 3HV2A 5FV7A 3RDPA 2DR0A 1UBLS 3AEYA 4MCJA 3TUZC 4REQB 4IDAA 3R0IA 4N7MA 5ANRB 1JGTA 1IY8A 3EZNA 5C5IA 4JXXA 4EHJA 1PHRA 1Q0QA 2JHPA 3N8NA 1A7KA 4BO3A 2H85A 2IYYA 4QSMA 4TV9F 4UZEA 4TMFA 1J4AA 3K9CA 2LDBA 3KYDB 3L7OA 3UHJA 4DR4B 4C0XA 4XM1A 4E5VA 3PIDA 1BRTA 2AMJA 2D62A 2QVZX 3B38A 1QHIA 1VHDA 4RLQA 5MHTA 5K0CA 4G07A 1BE0A 4HSGA 4K9KA 1GLNA 4MO9A 2ZYWX 4G4SO 4QO8A 3OX4A 3RTCA 2BUAA 2PQ0A 2FHPA 5GJWC 4IG9A 1ZINA 3TQFA 4ALLA 2C4NA 2C9CA 2CBZA 1IZZA 3F5SA 4M86A 3EY4A 1U0BB 2FETA 4P32A 2CFSA 4XLLA 4CHTA 4ZMBA 2RG1A 4I19A 3RSCA 4HUTA 5K99A 3ITEA 3MS4A 4TXLA 2AR0A 1JYFA 2CFTA 2W4MA 2P4UA 4MP3A 3VTAA 4DHWA 1TJNA 3QQPA 3NB0A 1ZH8A 3DB1A 4ENQA 1RAHA 2V7EA 5BW4A 4EUKA 4JUDX 1DQNA 2DCUA 2BTQA 3ABOB 3AUFA 3TAHA 4D9MA 2GNOA 4XOUA 1Z36A 2D00A 3P94A 5EUCA 1IUKA 1WVIA 2DFDA 2PZKA 3L7IA 5A4KA 1CDZA 1WG8A 3NGMA 3D3KA 1IM2A 1JDTA 4CMIA 4YRPA 5EWMA 3QFSA 1ZBQA 4DBLC 1U8TA 3N0TA 5IC6A 1TUGA 4KQGA 3JQFC 2HZ7A 1I2BA 2TRSB 4GDFA 2ZYHA 3X2SA 1G7SA 1M72A 2HIMA 4MGKR 2JGAA 2HCTA 1Z5WA 3JAKA 3SZRA 1QC5A 2TS1A 4R1LA 1RZRA 1E98A 2HA2A 3JASA 1G5IA 4G63A 1P4SA 4JU9A 1JIVA 1UBGA 3R5HA 1YRWA 1NVVQ 3QUBA 1IY2A 1KPHA 1QXSA 1JIUA 1U2TA 3L3BA 5IJZA 3VHQA 3AY7A 3U61B 5DBIA 2HLHA 4RMNA 1Y37A 2EFJA 3P2YA 3ESAA 4ZTBA 4JEUA 2PE5A 2J7PA 2WWYA 2O8CB 1SB8A 3STHA 2YTZA 1A8PA 2UYYA 5EAIA 2FR8C 2G1AA 5EJIA 3F6BX 1OD6A 4MARA 1KFBB 1M2EA 1U3DA 2OGSA 3DPSA 3S29A 5KNBH 1E18A 1YAJA 4QUBA 4XYBA 5E6SA 4LYAA 3DQZA 3FAKA 4P2GA 3UJHA 1DAGA 4ZT5A 5A05A 2ZRNA 4ZEVA 2X7JA 5JARA 2W2TA 5KYTA 2CSXA 1F2UA 2NTJA 2WT9A 3RVMA 1JDJA 1NM5A 2IYTA 4FYHA 4L4XA 2ORYA 2J7KA 4TXNA 3HKCA 3LCJA 5FBQB 3DDOA 3D7SA 3LBNA 4KPUB 4EGCB 5FLXA 5HFJA 3FDJA 2G4VA 4PSDA 5TARA 4AC9A 3SC4A 3U37A 3G1TA 2IEIA 3DBVO 2HLDA 3CYFA 4BEBA 2AI1A 1GCOA 1T9ZA 4DN6A 5EKTA 5CFLA 1FJ2A 3O93A 1W19A 1K3TA 4IH1A 4QXMA 4EVIA 1FX0A 2E21A 1V43A 1CQZA 3FXAA 2NPOA 3NATA 1E8NA 1GZHB 4I50F 3HV0A 4UATA 2FPMA 3C6ZA 1F2DA 4MGYR 3E0XA 3TPZA