3GDHA

Methyltransferase domain of human trimethylguanosine synthase 1 (tgs1) bound to m7gtp and adenosyl-homocysteine (active form)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
211
structure length
211
Chain Sequence
LPPEIAAVPELAKYWAQRYRLFSRFDDGIKLDREGWFSVTPEKIAEHIAGRVSQSFKCDVVVDAFCGVGGNTIQFALTGMRVIAIDIDPVKIALARNNAEVYGIADKIEFICGDFLLLASFLKADVVFLSPPWGGPDYATAETFDIRTMMSPDGFEIFRLSKKITNNIVYFLPRNADIDQVASLAGPGGQVEIEQNFLNNKLKTITAYFGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for m7G-cap hypermethylation of small nuclear, small nucleolar and telomerase RNA by the dimethyltransferase TGS1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Trimethylguanosine synthase homolog
total genus 74
structure length 211
sequence length 211
chains with identical sequence B, C
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09445 Methyltransf_15 RNA cap guanine-N2 methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3gdhA00
1O54A 3M6WA 3GJYA 3GO4A 2IH5A 4PIMA 2ZBQA 4Y30A 3A26A 4FSXA 5K05A 2NNWB 1BHJA 4BY9E 3NVKI 4G56A 1WXXA 4KDRA 1SKMA 4BLWA 2P3LA 3SSMA 1VL5A 3A7DA 2PT9A 5LQAA 3SX0A 1EJ0A 3EEOA 3HNRA 1M0EA 3U81A 3EVDA 3R9XB 1R8XA 3I64A 3LCVB 3P9NA 3OU2A 3PFHA 3QOXA 3B3FA 1YZ3A 4XCXA 3R6TA 1XCLA 5E9WA 4CTKA 3LDGA 4M38A 3T7RA 2PWYA 1IM8A 2O05A 2AN4A 4P7KA 3BWBA 4UOEA 2ERCA 3M6VA 3MCTA 2YXEA 2OYRA 3DTNA 4QPPA 4OX9Y 7MHTA 3UA4A 2VDUE 2O57A 1ZGAA 1I9GA 2P3QA 2PXXA 5HZMA 1XXLA 2N47A 3HCCA 3SSNA 1R8YA 3FTFA 2WK1A 4FZVA 3GRRA 1AF7A 2ZBPA 4DQ0A 2WA1A 3OZRA 3LSTA 5LQJA 2IIPA 4KRGA 3EVCA 4PYJA 1TW3A 3DR5A 2AOUB 3GU3A 3B5IA 3P9IA 2ZIGA 2BR5A 3B3GA 3C0KA 1JQ3A 4M7RA 4X61A 5JR3A 2JHAA 3EMDA 4E2YA 5HIKA 3PFGA 5DSXA 2EJUA 1ZG3A 4ER7A 3ER9A 3EGVA 5EEGA 2ZZKA 2VZ9A 5EZQA 4RV9A 5EG5A 3E8SA 4XUDA 5GOZA 2GS9A 3SM3A 4AZSA 2C7PA 3EVZA 3NMUF 2IFTA 4P7FA 2BZGA 2A14A 4PYNA 5DSTA 4E2WA 2JHPA 2AVNA 1PRYA 2HNKA 1ZQ9A 2H1RA 2ZWAA 4DF3A 5DWQA 4ER6A 4F86A 2ESRA 5HOQA 1JR4A 5BW4A 4FGZA 5EOVA 3KQOA 2HTEA 3DLIA 5EEHA 2E5WA 2P7IA 3DOUA 5E8JA 5EMKA 5LSAA 1JTEA 4GUAA 2P1DA 2PXCA 2DPMA 2OKCA 1MJFA 1QANA 3B3JA 3CJQA 3D2LA 4BLVA 5K0FA 3IV6A 5EIWA 3LCCA 2G71A 2Q41A 1NW3A 3LKZA 3KQMA 1JTFA 1NBHA 3ELYA 3O31A 5K03A 4LG1A 4ER0A 3CBGA 2DULA 4MTLA 1JSZA 3JWGA 4GEKA 1R74A 2QM3A 3SGLA 2O07A 4PYIA 5ICCA 4CKEA 3NW9A 3BGIA 1ZHFA 4E31A 1V39A 4EMSA 3NWBA 5K01A 3ANXA 4MHTA 2G8NA 3UJ7A 1RI4A 3MERA 5LQKA 3G2MA 4DZRA 4KWCA 3RIEA 3P97A 2Y1XA 1P91A 1UWVA 4FT2A 5CVJA 2AZTA 3GNLA 3UA3A 3MB5A 3KR2A 4PGHA 3LPMA 1QAQA 1BKYA 3F4KA 3ORHA 3HM2A 2FRXA 4EVIA 1QAOA 3HVKA 3G2OA 4DMGA 3DULA 4X1OA 4ER5A 1JG2A 5FWDA 4DCGA 2VDVE 2PX4A 2P7HA 2XYVA 2CKDA 2XVMA 2ZULA 3I53A 3KR1A 3M6UA 5DTRA 5EGSA 3G8AA 3P8ZA 3C6MA 1T43A 3KQWA 5DM0A 5E2BA 3UJBA 1RJFA 1WY7A 3HA5A 3P71T 4WXHA 4KVZA 3DXXA 3UJDA 3I5UA 5GIPE 2YUIA 3EVAA 3O4FA 2ZSUA 3OPNA 1Z3CA 1YFJA 3G7UA 5T64A 1R18A 3DUWA 1Q0TA 3NJRA 5D1NA 3UWPA 4C4AA 2YQZA 3SR4A 4PWYA 2BM9A 2PJDA 3HCFA 3LECA 5DX8A 1DUSA 2R3SA 1N7JA 3BWCA 4MIKA 5EKXA 3TKYA 5BXYA 5EZSA 1YFLA 4FR0A 5CCBA 3FPEA 3B89A 5HFJA 1YB2A 3BGVA 1VPTA 3BGDA 5CCXA 3UBTA 2EG5A 4C03A 3FPHA 2EX4A 2FCAA 3DMGA 4FT4A 4OBXA 4QQNA 4C08A 1KPHA 9MHTA 1KP9A 3JWJA 4RX1A 1JG3A 1EJ6A 5GP1A 1L9KA 5DXAA 1G8AA 3EGEA 1YF3A 1EAMA 3RW9A 3TPZA 4BP3A 1NV8A 3KPWA 3ME5A 2IDKA 4RTPA 1X1BA 2B2CA 2JHCA 4RVGA 2ZZMA 2ONYA 2UYOA 3EEYA 2IPXA 3HCDA 4QVKA 1NBIA 1UIRA 4IWNA 3HEMA 1NT2A 4DKJA 3TQSA 1EG2A 1SQGA 2I62A 2AOTA 1G60A 3TR6A 4F85A 5EQJB 4C07A 4RTSA 3PLAE 2B9EA 3HP7A 3CJTA 3NDJA 4P7GA 4AZTA 3LCUA 1P1BA 1SVUA 3A27A 3LX6A 2BR4A 5KYGA 2BH2A 1JQDA 4OQEA 2NXNA 5HEKA 5EMMA 5P8WA 3T0IA 3H2BA 4GOOD 3KR0A 3OZTA 4X63A 3GGDA 5K0LA 1XTPA 1VE3A 3PTAA 2PXAA 1L3BA 2ZIFA 3MTIA 3AXSA 4RYLA 5BW5A 5F2KA 2PKWA 2YVLA 1QAMA 5DT2A 4POOA 1XCJA 3ERCA 3OE5A 3TKAA 2AOXA 4RVDA 4YV0A 2P41A 3KQSA 3UJ8A 5M5BA 2IGTA 2PY6A 3LBFA 3WSTA 2QE6A 3FUXA 4JXJA 5EPEA 3FTEA 2XYRA 1AQIA 5CD1A 5FCDA 3GWZA 3HCBA 2FK7A 3MQ2A 5T6BA 4RTNA 2F8LA 4RTMA 3DLCA 1KPGA 4RTLA 4E70A 3LHDA 2AOTB 5CM2Z 2PBFA 1M6EX 1F3LA 2P8JA 4OQDA 1WZNA 5FQOA 5FTWA 3OU6A 1TPYA 2YXLA 4HGYA 2ORED 1MHTA 4XUCA 3L8DA 4MQ4A 4QPNA 3CCFA 5DX1A 3DXZA 2BR3A 3KQYA 4YV1A 2FHPA 4U7PB 3BZBA 4M37A 5FUBA 4E32A 4QDJA 3VYWA 2HMYB 5E1OA 4YMGA 4L7VA 5DTQA 3NDIA 2IBTA 2LD4A 3GXOA 3MGGA 4RVFA 4EQZA 3HVJA 3HVIA 1D2GA 2B3TA 4E33A 5K09A 3IYLW 3FUVA 5CVUA 3I9FA 3HTXA 2ZZNA 4V0RA 5B1SA 3PVCA 1X1DA 4E30A 1VQ1A 4OBWA 1RI2A 1NW8A 1Y8CA 3P2IA 1FBNA 4V0QA 3SXJA 2H11A 3A7EA 5GINE 3C3YA 3LL7A 3EVBA 3THRA 4KW7A 2OPBA 2AR0A 3M33A 4BP1A 4P7JA 5F2OA 4IV8A 3A25A 5MHTA 1X1CA 4PYLA 5HILA 2K4MA 4A6DA 2UYHA 4HGZA 3DMFA 3EPPA 1VP3A 1INLA 2PX2A 3NTVA 3SMQA 3JWIA 2ZBRA 2IH2A 2XBMA 1HMYA 1NV9A 5EC8A 3DXYA 1F38A 1YZHA 2HV9A 2ZCJA 5FULA 1O9HA 4PYKA 1P39A 3PX3A 2P35A 5DRYA 5K0CA 2OZVA 2Z6QA 3CJRA 3V8VA 1ORHA 2GAFA 5FWAA 4CKBA 3PS9A 4GQBA 3LDUA 3TM5A 3AXTA 3B7PA 4YUYA 2ZTHA 4LWPA 1Q0SA 3P2EA 1KXZA 3ELWA 2NP7A 4QTUB 5G02A 4PGGA 5FADA 8MHTA 5FHRA 5EIFA 3VSEA 5IKMA 3S68A 2VDWA 5H02A 1KYZA 3RODA 2AOUA 2PT6A 3FPGA 1H1DA 4QTTB 5GWXA 5LQCA 2NXCA 1R6AA 2AS0A 3EVFA 3FPFA 4ISCA 2EFJA 1EIZA 1XDSA 4GBED 4M36A 1ORIA 4MWZA 5KVAA 2IBSA 2IDJA 4FS8A 3KQVA 4QQKA 2PLWA 2C7RA 2PX5A 3BWYA 5GM2A 1G55A 2V7EA 4O29A 4R6XA 5FA8A 1PJZA 4FSDA 4E2XA 3ER8A 3GCZA 2JH8A 2QYOA 1RI1A 2NXEA 3CKKA 4WVLA 1FJXA 2ZIEA 2Z6AA 1JSXA 2AN5A 4XUEA 2NYUA 4AUKA 1D2HA 3EMBA 2XVAA 2OBFA 1ZKDA 2I6GA 2PVCA 3KHKA 1KIAA 5CVDA 2JH9A 5ICGA 3KPVA 1NW6A 3VC1A 2OXTA 2G72A 5DXJA 4GOND 1FP1D 1XDUA 4YUWA 3M6XA 1O9GA 1YUBA 4GC5A 2XYQA 4K6MA 1U2ZA 2G1PA 5KS2A 2QRVA 4CTJA 3BXOA 1VBFA 3AWIA 3IHTA 3EVGA 4QDKA 1NW7A 5E2AA 4GOLD 3FYDA 3PB3A 4PONA 1RJGA 3P2KA 5F2NA 3E23A 3GRZA 2ZW9A 3HCAA 1RJDA 4E2ZA 2PX8A 4R6WA 1VLMA 3QV2A 3EVEA 3T7SA 4AZVA 5K0JA 3GRUA 5E1BA 2OB2A 2PGXA 4HRAA 1BOOA 3VC2A 4F84A 1OR8A 3LBYA 2G70A 1EQAA 1X1AA 2VS1A 4PINA 1KHHA 1JQEA 1WXWA 5EKUA 4HSGA 5FA5A 1RJEA 2ZVJA 3DH0A 4RTQA 4ATNA 5CIYA 3BWMA 3LKDA 5ICFA 2ZWVA 1G8SA 5LQRA 3UFBA 3TM4A 3ELUA 5K0BA 4FP9A 4DA4A 3FYCA 1QZZA 3ELDA 2QRVB 1AQJA 3ID6C 1IXKA 4R8SA 2PSSA 5HIIA 3DP7A 2O06A 3T7TA 4DCMA 2UYQA 2B78A 2FK8A 4YUXA 1G38A 2IP2A 5GM1A 5DTMA 1SG9A 1KYWA 4KIGA 4YUVA 2B25A 4HG2A 5C0OE 4YMHA 4DM3A 3G5LA 2HR1A 3GRYA 3KR9A 2OB1A 3NVMB 4EKIA 5E9QA 1B42A 2GB4A 2UZ4A 2NXJA 1JG4A 4NECA 3LGAA 3OU7A 2WA2A 4C04A 2IH4A 3BUSA 1AV6A 5EMLA 4KIFA 3X0DA 5IH3A 3V97A 1SUSA 4R05A 4BLUA 3SSOA 3JWHA 3P9KA 5EHIA 1ZGJA 3CVOA 3OCJA 2ADMA 3PX2A 4AX8A 4CXMA 1KR5A 3TRKA 5K8VA 2PV0A 1X19A 3HA3A 3OFKA 5LQUA 3E05A 4LWOA 4PCAA 1TW2A 3OZSA 2GH1A 3BKWA 1I4WA 1XJ5A 5U4XA 1UFKA 4YV2A 4GF5A 5JUWA 3FRHA 2P40A 1XDZA 3DMHA 3KQTA 2CWWA 4Z2YA 1HNNA 3G2PA 4B17A 2BM8A 3FUWA 3OFJA 2EJTA 5CUQA 4RTOA 3KQQA 3FZGA 3REOA 1XVAA 4R8RA 2ZLBA 3Q7EA 3UJ9A 2GPYA 3FUUA 3A4TA 3K0BA 3IEIA 1BC5A 3M4XA 3KQPA 2YR0A 4RTKA 3O7WA 3OE4A 2CMGA 2R6ZA 4C05A 3CGGA 5D1HA 5E8RA 4C06A 4U7TB 2OY0A 3FPJA 5K0NA 3EGIA 1RI3A 2ONZA 3FRIA 1N2XA 3GDHA 5T67A 4PYOA 4EK9A 3TOSA 2H00A 3LDFA 3SVZA 1VIDA 2FPOA 3Q87B 4GOMD 3G5TA 3TLJA 3UJCA 3CC8A 1NE2A 1R00A 2V74B 3NWEA 4OA8A 5GIOE 4HC4A 4HTFA 1L1EA 4IV0A 5DLYA 5LR6A 4QVGA 4A6EA 1D2CA 1L3CA 2GLUA 1WG8A 3THSA 3UJAA 1FPQA 3BT7A 2HWKA 5KQSA 4PNEA 1RI5A 2GA9A 5CVEA 4X41A 1NW5A 3E7PA 3BKXA 2I7CA 5HIJA 4P58A 2NP6A 4CWAA 2KW5A 2AOWA 4EKGA 5BP7A 1I1NA 2OO3A 3FTCA 5K0GA 5EMJA 4RWZA 5K0EA 3C6KA 3I58A 1WS6A 1DL5A 5DM2A 2Z6UA 5DM1A 3KPYA 1SQFA 3KU1A 2YXDA 3R24A 1NKVA 2AVDA 1M6YA 3C3PA 5CVVA 3R3HA 5C9ZA 4RSRA 3UZUA 10MHA 1SUIA 1JG1A 5FQNA 4RTRA 4RTJA 3K6RA 2JG3A 3P9CA 2AN3A 3FUTA 3GIWA 3MHTA 2QY6A 3AJDA 5DM4A 5EVJA 4ER3A 2C7OA 3R0QA 3FTDA 2AOVA 3HA7A 3KPJA 5DPMA 5ICEA 4PYQA 5EHGA 3MCZA 2UYCA 1G6Q1 1DCTA 2VP3A 3HCEA 3QOWA 4HTFB 5DRTA 2C7QA 2FYTA 1FP2A 1L3IA 3MTEA 5E1DA 5ERGB 5FHQA 3G89A 2JJQA 2ZFUA 4IKPA 3HVHA 4GC9A 4Y2HA 4RVHA 4AZWA 3PT9A 1IY9A 1N7IA 5E9JA 3TMAA 1P1CA 2O0LA 4PYMA 4YUZA 2I9KA 2PWPA 5HIMA 5KQRA 1VP9A 3G88A 2YTZA 5C1IA 3G8BA 3GRVA 2Y1WA 2YX1A 4OA5A 4X60A 4CKCA 3AY0A 3G2QA 3M70A 2CMHA 4PCLA 2CL5A 4HH4A 1KPIA 5LQNA 4PIPA 3MAGA 3KPUA 3KKZA 4KDCA 2P3OA 5DX0A 3TFWA 3UJ6A 4LECA 5E1MA 4ZTBA 1QYRA 4H0NA
chains in the Genus database with same CATH superfamily
5FD8A 2CFCA 3I01M 4PF1A 4WKCA 5EERA 4A16A 2JH3A 4G41A 3W3ZB 5KWIA 1G7CA 4OHUA 3G0DA 2YHIB 2O7RA 3D4LA 2V7QA 3KOMA 2F3PA 3CRNA 3OAAA 4FE4A 1WXXA 4G56A 3RU2A 1TLTA 2PH7A 2JA1A 4G89A 4EGJA 9LDBA 3R0JA 1R88A 3TBHA 3GGSA 5DMXA 3GAAA 1C3OB 1DGQA 4YLEA 1L5RA 1FXUA 4BO8A 3LCVB 2Q3DA 4XCXA 2WJWA 1XCLA 3AEZA 5ANRB 3UWKA 4CTKA 1F8XA 5DOZA 2OVFA 2Z2IA 3T7RA 3PTLA 5IJ0A 3ZI4A 1ODTC 3DHYA 3GD5A 3VDMA 4JJAA 2D4AA 3NIWA 2D3WA 1GG9A 3ZE9A 2WY2D 3JD0A 3GJTA 2WWRA 3ONFA 3LRXA 3ORRA 3LLSA 3PGA1 2RI6A 3PNOA 2CEAA 4I1VA 2N47A 2QRZA 3RK0A 1M5RA 2BGGA 1XDDA 1G98A 4H7IA 4IRXA 4KRXA 3ABZA 1U0NA 4G07A 8OHMA 3OOHA 4WFQA 2OSVA 2WP0A 2E89A 1NUHA 5J59A 3IIEA 3HK2A 4TTRA 2RHLA 3TAXA 3DE7X 4GH5A 2K7FA 2QP4A 1H4VB 1MH1A 1XDWA 4AKHA 2HA2A 3KOOA 4CL0A 2D0IA 3LP5A 2JPDA 2G6TA 3WAGA 4LY9A 4KO3S 3TGPA 4DUGA 1P6QA 1R8SA 2YWXA 3DO5A 3EAFA 4HAVA 4RY9A 5KX5B 3VKHA 3TLGB 3TTWA 4K1XA 3OZGA 1R4NA 5EKDA 4BKOA 1N78A 2E1RA 2D5AA 3CEAA 1N1MA 5I3CA 1U6IA 1P3Y1 1UBJS 1W36D 3A4MA 1Y5IA 3HWRA 3FTQA 4KFSA 3A1TA 3D7SA 4FGZA 1P81A 1NF8A 2FE4A 2X5JO 4LWZA 5LA6A 4EGQA 1YOVB 3AUFA 2V54A 3D0OA 3NEPX 1PE0A 2BYTA 1IBKB 3ONNA 4MKFA 1GEGA 3KWFA 4W5TA 2V9ZA 4P4SB 5DNEA 3SC6A 1H2EA 1VL8A 3B3JA 2DQZA 3AGPA 3DF9A 3VU0A 3MPUA 1OY1A 2Q2VA 4JBXA 3WGOA 3E3OA 3WG9A 2CLEB 3IILA 2PRSA 1G3MA 4IQGA 3E4DA 1G5TA 3EFBA 3HMKA 3I6ZA 3SJAA 5I4KA 1GN9A 1YD7A 1JSZA 2E87A 2J9FA 2Q3JA 3I6IA 4K88A 3P0FA 2A9QA 4LCJA 4CMBA 1TYDE 2JKZA 1Y80A 3N1UA 1UOEA 1Z25A 5JSQA 3NOXA 5H0IA 2C5SA 4OQNA 3I2JA 3IIJA 3L4EA 2OXRA 1NWHA 1XCMA 1V3TA 2SCUA 3CB4A 3G23A 3RM3A 2PQ2A 1A9ZA 4IIEA 2GVDC 2XVYA 5FP0A 2YRWA 4H6WA 1FQOA 2VPIA 1RI4A 3OD1A 5J2TF 3H4VA 3I0NA 5KU1A 1DKLA 3EZGA 3AFMA 1KKUA 3C8ZA 1ZM2A 1I7SB 1NBEA 1N5KA 4G1VA 4EW2A 1KFBB 3HVKA 4KGDA 3IVRA 4OJNA 4U9HS 4MUJA 3ZZ1A 5DHSA 4AJ9A 4DDKA 3H97A 3D6UA 3S1AB 1L1FA 2MINB 1JKJB 3DD1A 4DMHA 3P8ZA 4JI2B 1RXIA 1NR5A 2YHBA 3HJAA 4K81B 3WNQA 2XTAA 3I5UA 2QD4A 7AT1A 3CNNA 1TKBA 3I37X 2J33A 4N7BA 3TTXA 1C50A 2W11A 2WZDA 4IH4A 3WK4A 4L5BA 1YBAA 1SC3A 3FCAA 4KLCA 4DRZA 5DTIA 5H3CA 5C7IO 2GPNA 2QSJA 4JQZA 1ISPA 2PJDA 3ZHCA 1EFKA 2BEUA 2PFSA 1XVTA 1IUKA 4G0VA 5EZSA 2FWBA 2WT4A 3WWPA 2HHLA 4YXWA 4N6GA 1CQZA 4ITUA 1I30A 2X6RA 3NXSA 2AX4A 3ECAA 3FMFA 4HLUC 3A1EA 3BGDA 3OQJA 1A0OA 4MUAA 1GRQA 4I5IA 4OBXA 2C94A 1DAEA 2J4FA 1LNQA 3DL7A 3BMOA 4G01B 1QNFA 2QOEA 1EMDA 5DYTA 4AJ1A 2G25A 4I55F 4J2HA 2JHGA 2DKFA 4M1WA 4YJ3A 2QTFA 5IXYA 5FDFA 4ZAGA 2F59A 1JMKC 1WIWA 4FFBA 2XUAA 4R7ZA 3FX2A 4IMJB 3HCDA 2XF8A 5KYKA 2C7VA 1N6OA 2LPMA 3HXLA 2ZB4A 1LBHA 4NS4A 4Q12A 3NVDA 4RKRA 1LBSA 1LTQA 1SQGA 1A9PA 5TEVA 1G60A 1KEZA 3IPRA 1N5OX 5IZCC 2L2QA 1DC7A 4WMLA 2BEVB 5H4HA 2E85A 4YN3A 1ONPA 4KNVA 2QJOA 3U3KA 1EFUA 4M54A 1SBZA 2X2OA 5B3LA 3BF7A 2CD7A 4NONA 1S8AA 1TE2A 3KR0A 3HDTA 4ZVKA 2PZ8A 4YRTA 2SNIE 3T99A 4DJTA 1UMDB 4EA6A 3AR4A 4L8YA 2GD1O 5EINA 2VKQA 4B2PA 3FHOA 1OAOC 1N0UA 1S8NA 5DT2A 2QTVA 3P2JA 1G4AE 1WW3A 3A6FA 1NULA 3AR7A 3BG5A 5DE3A 1XTZA 1XZQA 2AC2A 3AF1A 1QPGA 3GD7A 2W22A 5FFNA 1O5TA 2ZJYA 3KZ1E 4YJFA 1M2KA 4R98A 5CD1A 2GI4A 1GCIA 1PZFA 4YRJA 3TGWA 2QM8A 3EG9B 3FYSA 1RM0A 4ZAXA 4C1NA 4RTNA 4BNUA 1CP2A 3L6CA 4AICA 1HDXA 1E0KA 3AINA 2AOTB 1VYTA 2DAPA 3ABSB 4E70A 1MX9A 2NX2A 2IP4A 2REQB 4ZVOA 1LW7A 3LPDA 4HUQB 3T3DA 4MK4A 4CMAA 5HJ2A 1DJNA 3F6PA 4K9OA 1DDOA 2WU0A 1P9RA 2R1VA 1BXRA 2G82A 2ZM5A 4C14A 3S55A 1NJ8A 4AKGA 2LP4Y 4BN0A 1M7GA 2DKOA 4A2QA 3ZHTA 4UQLA 5JDIA 3PC7A 4NZZA 4U7PB 1UT8A 1WX1A 4X6LA 1GQYA 3FPAA 5M7EA 2B4YA 1SC4A 3B12A 3H3FA 1PL7A 2HMYB 5IVDA 1ZP6A 2WW8A 3GBVA 4HNGA 1JDJA 4NX2A 5HBRA 3CUKA 7GPBA 1LQUA 3TL2A 2C9OA 3IPXA 1DMSA 2R66A 3N6VA 2AUMA 2VTKA 1YIDA 3GDGA 3D8HA 4DJJA 3I9FA 2HK7A 1E7MA 2Q4EA 4C7MA 2V6GA 5IVIA 3GLTA 4E30A 2JJ1A 3DUFA 1FBNA 2BBOA 1G2QA 2GM9A 3PQ7A 1NQ5A 5B1EA 1IY2A 4L0MA 3L7YA 1OI2A 4UTPA 4MRNA 3SVTA 3D4BA 2ZJZA 3ADOA 4F6RA 4XWYA 1I7NA 1H2BA 3BS4A 2O2XA 2R25B 4PZUA 5AXAA 1XTSA 3IUMA 3ZGVA 4WUTA 5AMXA 4HFRA 3D6JA 3OH8A 3WB0A 1THMA 2PX2A 2IVFA 2QTMA 2C4TA 3H04A 2BGRA 4XPIA 4YIKA 2ZJ5A 1N92A 1IK6A 3ZJ5A 2V7TA 1SUCA 3TVDA 2XVZA 1ZK1A 3MUOA 4FFWA 5DJ5A 3DE2X 1MVNA 1P39A 1MOQA 3AC0A 3IUSA 1YBMA 4HMPA 4LZLA 1V8FA 3KKNA 3CJRA 3PIIA 1EFCA 3ZKWB 3E6AA 4B4VA 4E14A 3GUHA 1Y82A 4L02A 2BFCB 1O6GA 4BB0A 1EGAA 2R84A 4XCVA 2F8TA 1YQGA 4PHGA 3NDBB 1JA0A 1JDBC 2XTZA 1ZXLA 2WTEA 3QF4B 1KJNA 4U00A 2I8AA 1IH8A 2REQA 3E8XA 3KETA 4JDPA 3NH9A 3MQFA 3RTDA 5KTRA 2XXAA 4Q9HA 4CUKA 3TOXA 2OZLA 4OHXA 3NJ4A 1GN8A 5KPJA 1UXOA 3LY7A 3PIDA 1PAUA 3W2IA 3EZLA 4W7SA 1NURA 4FOPA 2ODWA 721PA 1XDSA 4TTIA 3M6FA 1AKUA 2Y68A 2BP7A 2YYSA 2PX5A 1FFEA 1M6VA 4LIPD 5ILQA 1GZ3A 3EXG1 3ZEIA 4PZLA 3AG5A 3A0RB 4X0EA 4XH9B 4NCKA 1AUPA 2A5LA 4FSDA 3HQ4O 4B5LA 1YZVA 3CKMA 1Y1SA 3CKKA 2N9UA 2AZXA 3K70B 4IHKA 4N5MA 1YDGA 5KSYA 3BTOA 2FEWB 2X42A 3DL0A 3LCJA 2OE2A 1NQOA 2XVAA 2E6KA 4GR4A 2NTEA 4Q6BA 5JS6A 1BWRA 2QUZA 4ENVA 1GGNA 2X7XA 4WN9A 4MPJA 1BHQ1 1XZCA 2VP6A 4DRYA 8GPBA 2GBLC 2QE7D 2LNDA 2PS1A 2WNIA 3IMGA 2HZBA 1CJVC 2YVAA 3OUZA 4KWTA 4BVHA 2G1UA 1PI3A 4RPGA 5LWHA 2YJ4A 2DKNA 4URXR 1C4KA 1XXHB 2JEYA 2PUFA 1WY5A 3EIWA 1Q74A 2ROQA 3DQQA 3PKJA 4U7FA 1N2EA 2XCUA 4GOLD 5SZJA 3ZJVA 4K1LA 4BVKA 1RJGA 5HGJA 1IL0A 4MVYA 4ZGGA 1HQCA 2Y1CA 4DVJA 5KNCD 2W6JD 4MJ3A 1ZC3A 1R4ZA 3GRUA 1JU9A 1MDBA 1S7GA 1U04A 2ODTX 2VJPA 4HB3A 4HRAA 3ZK8A 1L4YA 4NMWA 1W0KD 4DG8A 2YFYA 2OG1A 1KHHA 4ZOAA 5KMGB 3GLUA 1YZQA 1D8TA 4X8HA 3K53A 4PFSA 1K0UA 5U4QA 2GSDA 3WO1A 1DG3A 1DEOA 4LRXA 1BO6A 5K0BA 1G20E 5DW3A 2NSHA 2A9JA 4H31A 4M1EA 3VI4B 1A9OA 3DFUA 3AV3A 1QKJA 2CLIB 4W8HA 1Y5NA 2PSSA 2WP8J 4GNRA 4LYEA 2Y0DA 3V2HA 3RUPA 4DCJA 1G38A 1U2SA 4L4RA 1N36B 1KYWA 1QE5A 1U98A 2XEDA 3ZDFA 3DZJA 3ZZ0A 4MGYR 4ZYLA 4K8RB 4KLRA 3RGGA 3AHGA 2IOFA 4EZBA 2QTGA 2VPWA 3CH6A 4XPIB 1UDAA 1B42A 2GB4A 4Q4JB 1FFXA 1WKBA 4EO7A 5BQ5A 4HHEA 3U09A 1I0IA 1E1CB 1GSAA 1JVNA 3FCUB 2XR1A 5DIZA 2GZ1A 3V97A 4D4GA 3KAQA 4S1VA 2YBEA 3OX2A 5DTEA 3K20A 2UU9B 1UC9A 4OMDA 3O8RA 1F5SA 3BJRA 5HS6A 2WVAA 1L4HA 5FOWA 3BKWA 2D1FA 4A3SA 5M34A 4NCHA 2IOHA 3C1TA 2ECQA 2X2FA 3L1JA 3BMCB 1Z16A 2X9VA 4MS1A 4TUYF 3PF9A 4Z1OA 1UAGA 1X0XA 4RKYA 1QF7A 3EG9A 1KL7A 2DQ4A 3FB4A 1O87A 3HKBA 4OBEA 3LZ6A 1MOSA 2QTAA 4P5DA 4XTRA 3U9SA 3AYXB 4YRLA 2RHMA 3FRJA 3UCFA 1X8LA 3SS8A 1UZAA 4FOLA 5LCXA 3CF6R 1ZO8A 1PG5A 4R9SA 1O8BA 2P4QA 3EZ2A 1P1RA 3OE4A 5CLJA 3V00A 2PR2A 1BXRB 2WF5A 3CLSD 3CGGA 4GX5A 4TL9A 5ALKA 3W04A 2X3FA 1RCFA 3UC5A 4Q82A 3WRWA 5JYDA 1ICIA 1PNRA 5BSRA 2HA3A 1UOQA 3B70A 5A4FS 2Y2VA 2BFBA 4H0FA 2HO5A 1X6VA 2DM6A 3UXMA 1EXVA 1DC6A 1QCYA 3QKRB 4XW2A 5AJUA 1I13A 2IEZA 4QL3A 2C9ZA 4IV0A 5DLYA 4DMLA 2X0RA 4RV4A 4FMCF 1PZGA 3KKMA 2VQ3A 4YXFA 2ISQA 1RYHA 3PE3A 4HKTA 2KHZA 4QQFA 1BH6A 4PNEA 1U8AA 1SEPA 3WL5A 1PHRA 3PQ2A 4PLHA 4N76A 2C54A 2WG1A 4BZPA 4BQRA 5A5EA 2OUKA 2ETXA 2IBMA 2B20A 4ZMSA 2ATEA 3C6KA 1EB9A 2BTEA 4J0HA 3C3DA 4CL2A 1VIMA 1VKOA 4LXYA 1GNTA 3KPYA 5IT5A 4AUNA 5GY7A 2R1ZA 4MPRA 5EE0A 3C3PA 5B53A 3WIVA 5KTYA 5MN5A 1YA8A 1Y4ZA 2VJBA 3E5MA 4MW9A 3GLIE 3ZQJA 1UWLA 2R6AA 2NTNA 3TLYA 4Q66C 2P9QA 1X7XA 1FS5A 3T4UA 2RAPA 2G08A 2P6PA 2H7YA 3VGPA 4RADA 2ZBUA 2ARKA 4MW6A 3TE6A 2J41A 4IFTA 3W5CA 2PYIA 3HCEA 1AKMA 3A58B 4G0QA 3R9IA 4UNPA 3AF6A 2MIIA 1K88A 3E22B 1EVEA 3G89A 3U7QB 1PJCA 1GQ2A 3IQZA 4HAXA 2MYTA 1V7QA 3PQ5A 4GC9A 1Y3FE 4RHTA 4M99A 1DO2A 3TMAA 1N7IA 5E9JA 2WJZB 2J30A 2EGGA 4KREA 2QPOA 2A7XA 4KUEA 1ATIA 2I4LA 4BQEA 2G1KA 2GZMA 2V6BA 3K30A 5AVXA 3KFLA 3QUQA 2O0JA 5FTJA 1R0RE 1N2ZA 3E7WA 1U3UA 2KBEA 2Q1TA 4G24A 3EE6A 3VVCA 1YA6A 1I0ZA 5AKLA 1XV5A 1EE1A 4ZMRA 1LBTA 5JD6A 3D4NA 1WV1A 1O54A 4V38A 1F06A 2E4XA 1ZUD1 3CE6A 2QDXA 2IP1A 1A76A 3KSMA 3QEKA 4WECA 3ZDRA 4KDRA 3DB2A 2GSWA 4DIOA 1FTSA 4I9FA 3N0XA 2HAEA 5SY9A 5H3LA 1U0FA 5A3RA 1MAVA 2A9RA 1ZJ5A 2GN1A 2CJYA 1Z5VA 2X76A 3LQYA 5HJ7A 1U0SY 1BIFA 1OTYA 3MJTA 3TCNA 1JNXX 1Q11A 4UCFA 1M8GA 2ETVA 2WEKA 3LUKA 3NHFA 4WK2B 2NPFA 2TRSB 2VNJA 1N4DA 2CL0X 3GFQA 5EXDA 2HHJA 3OTOB 4GP9A 2ERCA 1JWBB 4WV3A 1W59A 4CIVA 4JKYA 1P72A 1UZNA 1N3LA 1SCUB 1YAHA 4AO8A 1CLUA 3MIIA 4HYQA 4JGIA 1AQYA 4YVFA 5C52B 2GFQA 1KEEA 1QMGA 1PSZA 4H60A 2FPPB 3O03A 2W37A 4PR3A 4UBNA 3HXMA 1GPUA 4KTTE 1IXZA 1EEXB 4NG4A 4PC3A 4JASB 1K86A 1UMCA 2D2EA 3I9JA 3OZBA 4BS9A 4P82A 2GNPA 2FU5C 2H5EA 4V0MA 3NX4A 3ZWPA 2BR5A 1X15A 1AS0A 1JAHA 2B5OA 2ZYDA 3R7DA 5KTNA 5DSXA 2NT4A 2AFHB 2QN3A 3RF6A 3K9LA 1J8VA 1UMBB 1ADBA 1HDCA 3L06A 4XYMA 4ADSG 2WJYA 3DYIA 1RZUA 4FCWA 3WAJA 2FOIA 2A14A 3E7DA 2J0UA 2X8AA 4CCYA 2NQTA 2DH6A 2B35A 2OXEA 1VB5A 3IUQA 4DHEA 5C1OA 2O8DB 1VCHA 3QLUC 1IHUA 3NP9A 2Q8PA 2IQ5A 2VSOA 4MIEA 4NYIR 4D9BA 1LI5A 3DOUA 5LNK1 1P2DA 4JLWA 4NPAA 2VZLA 1YC5A 4W9RA 3HZZA 4BO6A 5JNLA 3UJNA 4CEJB 1J70A 2YDYA 4B2IA 4LRSB 3VOBA 4UJ5A 3U9LA 4JUFA 1CR0A 3T3EA 1LLFA 4D5GA 1X92A 2QRLA 4EA7A 3ELYA 5HFAA 1TJ5A 2H1LA 3B9RA 4G09A 5EHQA 2IUUA 1M54A 2NTVA 1ZU4A 4AJPA 3WGJA 2JIMA 3SR0A 5JI2E 3QE0A 3I05A 1XCGB 2LE0A 4PYIA 1W75A 2EC5A 4U4AA 1XN4A 4ERXA 1V39A 1RQGA 3GEHA 4NOMA 1OGJA 1YHNA 1QIIA 2PBRA 2VSNA 4QDOA 3GLIA 3K09C 4EELA 4IM7A 4BX3A 3O83A 3PEVA 5KSWB 3NAQA 3COZA 4QUKA 4RPJA 2PUCA 4ALJA 1XRQA 1BDMA 5I7VA 4LEIA 5DU2A 1CX9B 2PKQP 2W6CX 4O8ZA 2ZTSA 4LVOA 3IUEA 1T3SA 5JAUA 4CFYA 3CUVA 4PZAA 4ER5A 1GQSA 1SHKA 1QF6A 1UEJA 1OH7A 3SQNA 5KHAA 5F78A 3IMCA 3SC3A 1H2AS 1VJ0A 2OOKA 4PTYA 5FUYA 2HRDA 4PLPA 3VR3D 3W2GA 5BPHA 4DUYB 2Z56A 2Q8NA 3ICQB 3PUYA 1KOLA 3ZWWA 1K06A 4CIXA 1FJGB 3QYJA 3OPNA 3VO2A 1Z3CA 4M1OA 3QHQA 1W5BA 3MZ0A 2B8EA 5B55A 1ZCJA 1ZN8A 1PTJC 4DCSA 2NGRA 3GLIB 1ESEA 2GBGA 3V6LA 3VU3A 3DDUA 4H7JA 4KAFA 1EFLA 4GNKA 4PBTA 5CCBA 1AM4D 2D0OB 2J08A 2QXTA 1NMZA 2FFQA 4OSEA 4LDAA 3R3UA 1V7ZA 3BQNB 1DHRA 1TTPB 2RGAA 3AZQA 3HCRA 2C42A 2EFCB 4DUGD 2E37A 3ASYA 4HPXB 1YQDA 4QUIA 3EMVA 1NY6A 4X92A 5CNMA 2VPXA 5DXAA 3A1SA 3A4IA 1QG0A 2JFQA 3EEFA 4MUIA 4TTAA 3L3BA 3NNDA 4J91A 4Y1EA 4Q3AA 4MKIA 4JBGA 3ZCRA 2UUAB 1P5RA 1JT9A 3FJ1A 3JVDA 4UHCA 3TQCA 2DBQA 4TQ9A 5LXTF 4A8HA 4CG1A 2UZ4A 1OFVA 4C0SA 4KGZA 3H1BA 3TNYA 5HUQA 3R5JA 1XQWA 2ADFA 3ABOB 4DQUA 4P7GA 1VL0A 1P1BA 3TL3A 3ZTTA 1NVTA 4PO1A 2YFKA 5HEKA 2FQWA 4J4TA 3DHWC 4I5DA 3WYFA 3GP8A 3LC7O 4K0KB 4CT5A 4I5FA 3URMA 2AE1A 2AHRA 1X7ZA 4MW2A 1VE3A 2YZGA 1RABA 1DELA 3NS7A 3RC9A 3USES 1AJEA 1USKA 1FXSA 2NO7A 2X22A 1OOEA 5HRUA 4M0PA 4FDVA 4O5OA 4TOIA 2QRGA 4R8LA 3EUFA 3K0EA 4PZPA 3CX7A 2I6TA 4IEFB 4KIJA 4MVJD 3QG5A 1U0HC 2V6MA 1JHZA 1YRAA 4PC1A 3T12A 4DGSA 5AKKA 5CBPB 1M1ZA 1XD9A 5B6PA 5M29A 1CR1A 4FBGA 3AIKA 5CM2Z 4O59O 1ODJA 2I03A 3ZI0A 3B1XA 4RLHA 4Y2PA 5FI1B 5FQOA 1E1RA 5KTOA 3PXCX 1SC9A 3I8XA 5AVUA 1VYVA 2CXXA 4LXUA 4PNZA 5FBHA 1MNQA 5AHXA 4FZJA 1DIAA 1USVA 2IUSA 1LPNA 3LKBA 4RMJA 4Q1DA 2QJTA 3W9SA 3BSFA 1I3LA 1DBPA 3A9RA 4M0EA 3BJZA 3TUJC 1WCIA 4YCJA 3DZCA 2Z0MA 3IJRA 4V0SA 1KVRA 2QX7A 1XZMA 2V7XA 1VCNA 3AKEA 3KB1A 1E3QA 3GGJA 3DW1X 3GXOA 1NJ2A 4U3JB 3WMEA 4P83A 5LU8A 5BN5B 1ZBQA 5B6JA 5CNIA 3PUZA 4M1SA 3HTXA 4ZI5A 4UULA 2JLXA 5BOVA 3H05A 1PR2A 1T8YA 2YL2A 1AKWA 2BI4A 4F1JA 3THRA 3PQEA 2D0PB 3QYAA 1CT9A 5LBIA 3L1VA 5AVQA 2ZS9A 2P77A 3PUJA 4DLUA 2D2XA 4XQCA 1T9AA 5L51A 3K96A 2YW9A 1UOPA 4A73A 3ESAA 4CN9A 2QVYX 3DZDA 1IJBA 4ZOLB 3SHVA 2K4MA 3ZDEA 2H5LA 3L1KA 4HGZA 1KS9A 4TSFA 3E9CA 1QCZA 3AJ9A 2ZBDA 3CQ9A 3JY6A 4H15A 2IH2A 1HMYA 2WWVD 5JV5A 2WAYA 3T4XA 3VZBA 1PFWA 3UOAB 1UKBA 1YZHA 2FW8A 5FULA 3WKAA 1SBYA 3PX3A 2OYCA 3WWEA 1F48A 1MB3A 2OVBA 1YVPA 4CKBA 2EYQA 2CLMB 3L7KA 1E2GA 1GTVA 3LDUA 4J3FA 3SHTA 3WB2A 4JEUA 1T26A 3O3CA 1FFAA 4ZVLA 5C7YA 3H8VA 4R2KA 1MA3A 4JQCA 3INNA 4LXXA 5BY2A 3W5BA 4GPAA 4TRJA 4WJLA 5IKMA 2GYWA 3D6NB 2FUNB 5TRTA 3PQFA 9GPBA 4Z3OA 2XBUA 1RWWA 1ZD9A 1EVLA 2B30A 2ZI3A 4IMIB 2GRJA 4L07A 3A10A 1YACA 5AK4A 3D1JA 1WW2A 4MWZA 2Q6VA 3LHFA 1QGOA 1NLZA 3B20A 2C5LA 3QUTA 2VF7A 2XE6A 2IXEA 4WA7A 4YMTA 3AVTA 1CZOA 4IH9A 3UXYA 4R6XA 1QFXA 4D45A 4ZAFA 2QYOA 1B8NA 4AMUA 2JI8A 3KSBC 5JY6A 5TF0A 2VG8A 3VX3A 4KXQA 2WKQA 4NNOA 4Q3OA 4DWJA 4IHAA 3VDNB 3LE8A 4UTOA 4Q1CA 4D9NA 2I6GA 5A2GA 4LZJA 1KIAA 3IE1A 1QDUA 1T29A 3OHSX 3PWKA 3HN2A 1F2TA 2JCVA 3PWTA 3QQ5A 3IULA 2I66A 3T8YA 4R1NA 4EPXA 2K2WA 2GT1A 3OTWA 5JQWA 5JD4A 3S28A 1XWIA 4Z4GA 2RHDA 1G8MA 3ZJ4A 1KI4A 4ZARA 1Q0ZA 2JHFA 1J8QA 4JIGA 2H54A 2VOEA 3L46A 4B84A 4O5AA 3RR2A 5IK2D 2A1TS 5BOSB 3P2KA 2RK6A 4DA6A 3T9CA 4QRHA 3HCAA 4E2ZA 4BMZA 4U7DA 1OT5A 3DE5X 5M5BA 4Y1FA 4HH1A 5J2UF 4GZ3A 3K6JA 1WSWA 2ZYHA 3GF4A 4XWOA 1RP7A 1T5SA 2CVOA 3VR4D 4E6EA 3UCEA 2QUIA 2HXGA 2Q5LA 2K7ZA 4H7DA 1JQEA 3LPCA 4M1YA 1T4MA 2DYKA 2AC4A 1FUUA 1LX7A 4E51A 3M6AA 1L7AA 3LKDA 3RAGA 3DWGA 1OWMA 3RFVA 4WD3A 1JALA 4TYMA 2C98A 4ZDIA 2IPMA 2Z58A 3ZGOA 4TSKA 1RMYA 5EY5B 4CLRA 1HNZB 4BB6A 1R10A 1ZSNA 1Q1AA 1YHYA 2GPBA 4TWJA 2P4HX 2B5VA 1CK4A 4IDGA 2DCUA 2YY7A 5K20A 1S2DA 4IIUA 3VTZA 3ZW9A 3K9CA 4GOXA 4KIGA 3G5MA 1H2ZA 4XQEA 5BQXA 4H08A 1JDPA 3IR6A 4C7BA 4EKIA 1JYSA 5DV9A 3IO3A 1NNUA 4IDCA 4H17A 3ZV5A 2EIHA 3KZCA 1VHDA 3O1HB 2DFTA 2F90A 4WERA 4BNYA 5A06A 3QRWA 3RBVA 1F4PA 4OU4A 2J6CA 3KFXA 5K0SA 3QLEA 4P53A 1Q0LA 1Z0DA 1E1NA 1W19A 2FH5B 1PDOA 5COBA 3SXPA 2QUHA 1DJMA 4LWOA 521PA 4EAQA 2PX6A 2PKXA 3F5DA 1FOEB 4B8WA 2HSWA 2H7CA 4GMHA 3AO0B 4I1PA 1G6KA 2RDMA 4NBRA 3TCKA 2QQ0A 1GTZA 2D6FA 4MMZB 2CWWA 5H9VA 3F5FA 1P7VA 2C4NA 2G0NA 3OQ6A 2HLDA 3UPDA 5KQGA 3IPLA 4KN6A 3OOEA 1GNPA 1SXPA 2FOLA 2AT1A 3SKVA 3KYCA 1BC5A 2Z2JA 1QHSA 1SCKA 2WSBA 4YONB 5DT9A 2GPAA 3QV1A 2GDZA 3OC0A 1AHIA 1WD7A 1QF9A 4UATA 3TLXA 1ZY2A 3MJRA 2XD9A 5EYPA 1IZ8A 1QQ6A 4FWIB 4U0KA 3R7BA 4B81A 5I4BA 2PRZA 3AKYA 1K6JA 3Q87B 1XYYA 2GZHA 3KP1A 3DM5A 3VVMA 2QI9C 4GU5A 4NEGA 1RPJA 5EXPA 4QDZA 3RARA 1D3AA 1YI8A 2JLRA 4L51A 3EB9A 5JVDB 1MC1A 2VK8A 1RXSA 4MWBA 5H83A 5IARA 5MGNA 3G5AA 1IEWA 2H7VA 4HYEA 4ZMBA 1J0DA 3QVWA 5DYWA 1Z4LA 2PK3A 4BKRA 3NUQA 1AT1A 3BCHA 3CIFA 3SHWA 4KO2S 4RM3A 3ISVA 4EG1A 1H9BA 1VSUA 1O0BA 3N5KA 1O6FA 3TQHA 2GM5A 1OJLA 1HGXA 1QFSA 2PFGA 3KUKA 3KVOA 4IWYA 4KV9A 3SJCA 3V7YA 3U16A 1ECFA 2G09A 1X1EA 3QHPA 5F9HA 3L41A 2HQBA 1TFRA 4JBLA 4KAXA 3UNXA 1EI9A 2WWTA 2WKWA 4L5YA 5DM1A 1B41A 2HK9A 2JL1A 3CNBA 3MPOA 2WDPA 1Z6PA 2P90A 2QY9A 2YXDA 3CZ9A 3HV0A 1YS6A 4Q4AB 2W4IA 4GE3A 4JFRA 3ZU4A 2PO7A 4D9MA 4XRGA 2A78A 2WOOA 3FUTA 3TQIA 1ZD3A 1CZUA 3RC1A 4DQXA 3QTBA 3BJEA 3R75A 1A7UA 1JVBA 4I2VA 3GFPA 4EMUA 2FR0A 1K75A 4N0DA 4OAQA 4X6UA 3QOWA 4EI9A 3SQOA 2OORA 2HDWA 5E1DA 1UOOA 2I6SA 3C5CA 3MTEA 4JOBA 3RLFA 4C2BA 3SM9A 4ASUD 5LXTA 4FYIA 1XA4A 1D2RA 1DOZA 2ZFUA 3T95A 1OFGA 2E2WA 4POAA 5AHRA 2ZRDA 3KOZA 2PVSA 1GKKA 2FSSA 2VSQA 1IUOA 1PUIA 5DB4A 4FWTA 4W63A 1K63A 3BIOA 5DK6A 4CMGA 3KXKA 4L2IA 1Z4KA 1P74A 2J7KA 2YTZA 3AB3A 3DE0X 4J49A 4L3WA 2AKEA 1RACA 1UBEA 1PR5A 2R5NA 1C3JA 3QWIA 1NC1A 1V1JA 5A4JA 4KHPB 3B6IA 4D0NA 1W4RA 3TFWA 4OXKA 4REQB 1I01A 4FXOA 4B7ZA 1NP3A 2C9DA 4EYKA 2FPPA 3BL6A 4JJZA 1YOBA 4JT8A 1HLFA 3NT5A 4KMSA 4B44A 2FW0A 5AHKA 2VBIA 5DZSA 5L8VA 3EPLA 5E7QA 3KALA 3MK31 3L43A 2NNWB 4YCMA 1DRJA 4LJ9A 3AM1A 2SBTA 4LOJA 4IEEA 4RMHA 5EIBC 2EVWX 2YVQA 1UL1X 4K7JA 4MWOA 1ULBA 3A7DA 3IRUA 3K0SA 3DDNA 2PCLA 4HGNA 1EHIA 4Z4FA 3EEOA 3AIOA 2C2WA 4QUHA 3LK7A 4BE4A 3PFHA 4Y1RB 1V35A 1WB6A 1R6DA 3QOXA 5I7OA 2O8CA 2IQIA 3TOVA 4BCDA 4C4XA 5AKYA 3OTHA 1TTQB 2WHPA 4MI6A 3SBEA 2WJ4A 3S7ZA 4LF7B 1KRXA 1WSAA 2HSZA 2PWYA 4MR8B 4TMZA 1DT5A 5LOVA 1GL7A 3IC5A 1YXMA 2XNSA 4KKXB 3P32A 4ZD6A 4B6FA 2WAMA 2AN1A 2HPAA 4C0JA 4TZ0A 1SKAA 5EWJA 2DQSA 3UA4A 3OZDA 2Q1YA 1D7AA 2F62A 2P3QA 3OBIA 4YJGA 1JFRA 5AM0A 4C4RA 3CZCA 5D00A 4K05A 4MO2A 2QSZA 1RS0A 2VWPA 2FAXA 2ZOSA 5JAQA 3CEHA 3EULA 3I83A 3UM9A 1GZ7A 1NJGA 4YLGA 4CQMB 3JAKA 4CKYA 1MRSA 3Q9NA 5LVAA 5JOQA 1RW4A 1P0QA 2MOKA 1ZH8A 2J85A 3V8MA 4QU5A 1OYWA 1XNRB 3A31A 2V7UA 1DKQA 4ZQIA 1XPJA 4X61A 1QKIA 4DLYA 1N5JA 5AQEA 2I67A 3QMVA 4PICA 3RKRA 4BQPA 4W6QA 1E5LA 1GAEO 2VHZA 3HVUA 3WTBA 2HOQA 1NXVA 4GSYA 2JI7A 3E8SA 3FLBA 1J1IA 4XKJA 1Y6JA 2JFXA 3OG9A 5DXFA 5DN6A 1K68A 2IFTA 3D81A 2HHCA 2RFLA 4UQOA 5DSTA 5G4KA 5BW6B 5KOJA 1V6AA 2AVNA 1RDFA 2HH9A 3NKLA 4WOPA 4HLUA 1GU7A 2ZPTX 5BSGA 5IZ4A 1N8KA 5GVSA 3IDAA 1ZESA 1BWQA 3GJXC 4EDFA 5E8JA 5FPKA 3TW8B 3DWFA 5ELLA 5LB4A 2VSXA 1PWZA 1Z5NA 1M1UA 2P9EA 2VAWA 4FYVA 2W98A 4KOAA 2GARA 4OQFA 4WFJA 5EMHA 4OYHA 3CXUA 5AI5A 2Q4BA 2CKMA 3E82A 1AKTA 2B1JA 5REQA 5I9BA 3JV7A 1X7YA 3ONEA 3KQMA 1AZLA 3U4IA 3OA2A 4XX1A 4Q5IA 1MOPA 4D97A 3CBGA 4TLDA 4P3PA 2AJ8A 4ND6A 5CX4A 3KCNA 1SR8A 1VGVA 2HBYA 4MQBA 4LC9A 1HSZA 3I32A 4QFBA 3D8BA 2OFWA 4FDLA 1G21E 3GUVA 3IHWA 4DEXA 4QICA 1XRRA 3ZV7A 1IQUA 2R4UA 3PI7A 1MAUA 1WOYA 4KWCA 1DTWB 2VTBA 4H1VA 1PIWA 3A3OA 1XAJA 3P4UA 4LPSA 2BHLA 3UA3A 5IKXA 2RGUA 1IEXA 1LA2A 3J7TA 4PLCA 1NNLA 2BFBB 1TNDA 2FRXA 4WIAA 4N54A 1I3CA 4AJIA 4DCGA 2C5GA 1IN1A 2DUNA 3EWIA 5CXXA 2IXGA 4FGSA 3EGOA 3NCTA 3T61A 3UAGA 5H16A 2FEMA 2WE7A 1LU9A 2OWEA 2CD9A 3R4CA 4JU9A 4OJQA 4RD2A 4TVBA 5TNXA 1RXUA 4EWLA 2XCSB 2XZLA 4RK6A 3IRVA 3ET4A 1RLUA 4A5SA 4W7HA 2GYYA 4KI0A 4U2BA 1E63A 3EJ6A 3ESYA 1E5QA 4QJ4A 4KR3A 2A33A 4MI9A 2GO7A 2QRNA 4PANA 1LVHA 4LHWA 2OLJA 5A5VA 2CDCA 9ABPA 2CXOA 2RG1A 3RC2A 4G0ZA 5KEIA 3UUWA 3RIYA 2QW0X 3K0AB 2GCGA 4HLNA 4QE3A 5EKXA 1P75A 3LGXA 3RRFA 2OQVA 3UWSA 3EZNA 4OIFA 4V3BA 4DYHA 3ZGLA 2ZG6A 1QV9A 4XQGA 2YHAA 4JDUA 3ZVRA 1KI9A 3BGVA 5FL7D 2I3ZA 3H5WA 3UHJA 1X77A 3F46A 4ND2A 1Y1RA 4E5YA 1QNLA 1KSHA 5GJBA 2BH9A 5CFMA 1PG2A 3FPSA 1K7YA 4MLZA 3TW0A 2YFQA 1S2MA 4RQBA 1P77A 2JANA 1R3DA 1AK9A 2AZ4A 3ITDA 1EAMA 1F2UB 5DM60 3ECCA 4L95C 3RB8A 5BWBA 3UAWA 1EXNA 1PJ8A 1GPJA 2IDKA 1HYGA 4LA4A 1MB4A 1P4RA 3ECSA 4H2DA 1X9HA 1N2GA 2JGEA 5LM3A 3RJZA 1PR3A 3DBRB 2ZE8A 4V39A 1ZUIA 2HSEA 4OSOA 1AG9A 4B3HA 4RANA 4KMMA 1T6ZA 2ZBEA 1MB9A 3WX0A 4DSNA 3O38A 3A27A 1E9FA 1UJ2A 2NG1A 1DKNA 5DNVA 4D9GA 5LYJF 5CK5A 2WM8A 1E9CA 3N2KA 3SWWA 3C3JA 3A2KA 5B1YA 3B9BA 1P2VA 3F7OA 4J3JA 5LKRA 2A0WA 4DB4A 5ICSA 2BMDA 4H27A 2IHBA 4B3FX 3GGDA 3I9V1 3L1HA 1C4OA 1E79D 1YZFA 1KQ3A 3ZIUA 4Z3KA 3PC8C 2WG2A 3DMPA 2QT0A 2GN6A 2Y1GA 2YVLA 3OPYI 4HX9A 4K9DA 1EFTA 3H2ZA 4QHYA 4U1RA 4N0PA 4E2FA 1RFGE 3GRKA 1KP2A 3H9UA 2DHQA 4YV0A 4BMXA 5BV8A 1XOIA 1P61B 2G17A 1Z0FA 3WSTA 1JHOA 1PEKE 3A70A 3WGHA 1T9HA 2XYRA 2NUPB 1YDHA 3FUCA 3GQBA 1OE0A 2PGAA 4FDMA 3GEDA 1CJCA 3D54D 4R7TA 2BVNA 3LHDA 5BN4B 1HV8A 5KQPA 5G41A 1M6EX 1XHEA 2ZRCA 1KAGA 3QI7A 4KHZA 1TEZA 5JDCA 4ARSA 5F9FA 4S0ZA 5ITVA 2WIAA 3KYDB 2MU1A 3CVJA 4X8OA 1TK2A 7REQB 1ZUNB 3O4RA 3DEKA 4Q19A 5FJIA 1E3LA 3AUAA 4D9JA 1UPBA 1JDSA 3HN6A 4QFCA 3OO0A 2BT4A 3KQYA 1EGHA 4YAEA 2OP0A 2HF2A 2ZXEA 3I45A 1TUBB 4TWAA 3D0KA 5DTQA 3KXIA 3EXAA 2JAWA 3U62A 1D4FA 1BXGA 2BI7A 4X9XA 5IRCD 1LCIA 4UPVA 2X58A 3TSCA 4B6OA 3JVIA 5K09A 3IYLW 1FTNA 1WP4A 5A9SB 3DBHB 5CLFA 2PPLA 3EZ7A 4MV1A 4OBWA 4GI7A 1JLKA 1N2CE 1NQAO 2NVOA 1U1GA 3TB6A 1V0JA 1Y81A 5HBGA 4JR1A 4DDMA 4D0SA 2C9YA 1QYCA 5EQFA 1M2OA 3TDMA 4B3IA 4PZDA 3GAFA 5C51B 4AYXA 2GZ3A 4CIDA 4D6YA 1BEUB 3C48A 1FRQA 3PD1A 4P4LA 1F6WA 4BJ3A 4A6DA 3IGFA 3MGBA 4OP3A 1B0ZA 3JWIA 3OKPA 4Y6PA 4Z7QB 2GR9A 3BM5A 5E6SB 3B1KA 4P3KA 2R8BA 2I2CA 3DXYA 2YQ5A 4UREA 4ZGBA 5B58C 1RXCA 5F12A 1G0OA 4W9MC 4Y0NA 3ZWXA 2RAFA 1O96B 4DY4A 1L5FA 4ZAYA 3UG7A 3TM5A 3ENQA 4UMDA 4FUTA 3OM1A 4BQIA 3U1BA 4WADA 3P0JA 3QX3A 2I2FA 1FMFA 1Q0SA 3P2EA 3ELWA 3GPLA 1GCAA 1VBNA 3EYWA 2MINA 5FPSA 5TQJA 2O7SA 4YCLA 1TKCA 3MSCA 3PQ6A 1SCAA 1VKZA 3DL2A 2P2ZA 3S68A 1XJCA 3E58A 3SHQA 1XLTA 3RYIB 2LTAA 4ZOLA 3Q3EA 4X90A 2UZ1B 4OQQA 4EOGA 2O5CA 3A6ZA 2PMKA 1A50B 3GJSA 5HKOA 3LYHA 2WYVA 1ZGBA 2H2FA 1IZ7A 4AWXA 4XR4A 1XAHA 5AUNB 5HHTA 5KVAA 5HTOA 2WYWA 3FAKA 3EARA 4M4SA 4C3OB 4CM9D 1VM6A 3OLYA 5I9NA 3UHPA 4MEJA 4LDPA 3EFEA 3Q2OA 4Y6GB 2NSLA 4X64B 3SLGA 3ZWBA 4UFPA 1NI4B 3AM5A 2Q5EA 3GGGA 2CXNA 4IVQA 1TQ4A 4E4TA 3UK7A 4QHSA 5BQPA 4NH4A 1SK9A 3PFBA 1E7WA 3DL4A 2RGGA 3WLPA 4IGAA 1IFXA 5K6AC 1G6HA 4PPYA 2RARA 2JH9A 5AIAA 3SZGA 3WNDA 1WB5A 4Q4DA 4XIIA 2GNAA 5D3KA 1RHRA 4RXMA 4G97A 3GWGA 1GCOA 3ZLUA 3S2GA 4HUQA 2IWRA 3VPXA 1JBQA 4J0DA 1P7PA 1IDOA 1XDBA 3IAEA 4PONA 1M8JA 3CX8A 4B9EA 2ODQA 3GRZA 3PBKA 2FN9A 2Q4DA 4GYKA 1UBSB 5SV2A 4GGMX 2ZIXA 4RIIA 4NOJA 3SXUB 1Y3HA 3T9EA 3MWLA 4CDNA 4AF6A 2I80A 3H9BA 1OAKA 2XWJI 3CXRA 3DVAA 4X1KB 4WZBB 4HK4A 2EZ9A 3N05A 1P3DA 1A2OA 1Z6XA 4JUCA 1NQWA 1E6MA 4ZCIA 5ICFA 3DFFA 4D81A 4L85A 1OGIA 1L8QA 1TC1A 3EAGA 2ODNA 4BC1A 3GI1A 3LUDA 4PM4A 3HDJA 1PJRA 1QZZA 4QPJC 5FWYA 1D8AA 4M98A 3T7TA 4K8OA 1E5TA 3JQ6A 1GL3A 3PCTA 3PJEA 4LRWA 3KO8A 4DCMA 2WZCA 5E3HA 2WTUA 2PU5A 1XBTA 2IU6A 1K8YB 1R9MA 3MJSA 3PDWA 4IFIA 5ALTA 2L82A 4LJ6A 5AJZA 2VZ0A 1SG9A 4O1IA 1Z4IA 4OJMX 4DG5A 3N0WA 2VH1A 3WV5A 3G5LA 4CNQA 1AQ6A 3LBNA 1HE3A 2QT9A 1U5AA 3DTYA 4PX9A 5A5FA 4L9RA 5EIEA 4BXOA 3PGKA 1I6MA 1T4DA 1VPVA 2QUBA 3VHXA 5HRCA 5BSVA 2D7JA 5LFAA 4OXQA 5C8YF 3NO4A 4LVCA 1GDHA 3IOCA 5BWOA 4ALNA 5AK5A 3Q8KA 4CR8A 1BFKA 2P4SA 5IH3A 3UTDA 4R05A 1D1PA 1OXXK 2PGNA 2BW0A 4A1FA 1O6ZA 4X3PA 4S1TA 1TD9A 2ADMA 5B12A 2A3NA 2HJWA 5CDYA 1ZRSA 2DHEA 2QVLA 1C0PA 2W43A 4PCAA 4YFVA 3SBDA 1DRWA 3GT0A 3I1YA 2Q8QA 2J3EA 2QMYA 3DJYA 3GDFA 3QP9A 4WZAE 1K7CA 5IC6A 4MYDA 4YV2A 1RAIA 1C9KA 3PFWO 4G0MA 1OA1A 2BMJA 2RJNA 3DE1X 1YUNA 2ALJA 2B4TO 3FF1A 4DCOA 3GFRA 1CY8A 4HDMA 4S1OA 1R2QA 4DMKA 1FFYA 2EZUA 1JXMA 3M89A 2XQGA 4FZRA 1ZWKA 5IG2A 5JBQA 1P0CA 4Y6OA 1ZHOA 2PUWA 4KSBA 2QMEA 3E9RA 2Q99A 1QRDA 1BWPA 1TJPB 4FB5A 2QP3A 4ZHSA 4F6RB 1TMKA 3HCOA 4LRQA 3IT0A 2IW1A 1OYVA 2CMGA 5BYKA 3DEHA 3ZBUA 5K0NA 3GFBA 1KOJA 2X4GA 3BWXA 2H1SA 3SC2A 1GGMA 1TQDA 4D4KA 1SXJC 2FZLA 2ZSFA 1X7XB 1I2ZA 3K6KA 1TTTA 2EKDA 2CXHA 3EC2A 4QXAA 3UJCA 1U63A 2OV4A 1KWKA 2PUVA 1R00A 2DBVO 4EF4A 1U3VA 4EGCB 1T1SA 1EM8A 1CB0A 3IXMA 4E22A 1NVUQ 5IN5A 3I6BA 2EJWA 5LYJB 4OSPA 3RYFB 4R31A 3PGMA 1PVVA 2MMCA 3NONA 1H2RS 3AUSA 1L7EA 1NM5A 2BEJA 4WOBA 2OBYA 3K2QA 4R41A 1LUAA 5KYWA 1Z0UA 3CO0S 2FDXA 3L18A 3PDUA 4X45A 5C8VA 3FVQA 2YC4C 4OHPA 4PBRA 1MDFA 3P52A 5HMLA 4EKGA 3QJYA 3VTKA 4WINA 1OX4B 2HLPA 3OURA 1DAHA 5C8XA 1J09A 5HWSA 2B3DA 2VH5R 1U2TA 4JLVA 5H5JA 1NU6A 4BUCA 2D1YA 2QR5A 3IHKA 2C1XA 1YJXA 3UQZA 2IITA 1QQBA 4RSRA 5JSYA 5I8WA 3OQNA 1PR0A 1BX1A 1K8QA 2AC7A 1Y4DE 2ZANA 1DAPA 1ELOA 4AVYA 4DIFA 4RD6A 3MHTA 1S2GA 2ZI5A 1T9GR 1W96A 4WFIA 4JLBA 4K6GA 3INRA 1SG6A 1TECE 4ON9A 1DUVG 1FUEA 5CB0A 3NUGA 4RD1A 1CPYA 5JS7A 2P0YA 5M3BA 4ZTZB 4LTNA 1S89A 2FYTA 4AS2A 5ERGB 3TZEA 3KRTA 2V7WA 3EFHA 2WD7B 3AKCA 4Z53A 2AFIA 1CD5A 3ROPA 4B1FA 5JRZA 5IT0A 3H2SA 2G06A 3M3PA 3OF5A 4BFZA 3COSA 4YRKA 3RV4A 4COOA 5JAZA 5HIMA 3RE1A 4TYWA 1AKVA 1J20A 2EWWA 2J4DA 1EWRA 4H3VA 1G3IA 5KYVA 5LP6B 1CY1A 3M6IA 3K7EA 4NYIQ 4GPBA 4EA8A 2EG9A 2O6HA 1RBMA 2CL5A 3QU5A 4H9GA 1T3GA 1KPIA 2HSDA 2ZXFA 2C84A 3F2IA 1C30B 4FHGA 4QDUA 4XDHA 2P5UA 3L4KA 1T9KA 1ZISA 3LCMA 3STHA 3WR5A 4Z6KA 1Q5PA 5L45A 1OJ7A 4RM2A 3KJHA 1K5PA 3TR0A 3AOEC 3GO4A 2XUPA 1FDVA 2YY6A 1CJSA 1ZI6A 1KEEB 2VP9A 3GK3A 3AHHA 3Q1LA 4RIEA 4J90A 4Y30A 3M1LA 3RFXA 2YCBA 1KMCA 5ADWA 4BAZA 4PPNA 3ZDZB 1F60A 5FLXA 2BM1A 3KEMA 4MA0A 3TH5A 4Z9BA 1EZZA 2B99A 3TW4A 3WLTA 3THXB 4B80A 4FHCA 5H59A 1YHZA 1Z75A 1M66A 2EP7A 2HMWA 2VKTA 4FCVA 4O4IA 4P2GA 3V1MA 4C1BA 3R9XB 2Q6OA 5DGIA 3UATA 3O3NB 1HRKA 1WDWB 4REMA 2XZTA 3ZYCA 3DQZA 3WXBA 4PGMA 2HUPA 4BGUA 2CZQA 4BFCA 2IUYA 2OMKA 2XMDA 1I8TA 3AETA 3G0GA 5AVKA 2Z9DA 1G2IA 4R1UA 2AN4A 4UVGA 5EJIA 1YR6A 3RAFC 5JJBA 1JMYA 4FCCA 2IK8A 1V11B 1XMVA 4NDNE 4MLDA 3DV0A 1DLIA 3DKRA 4N5NA 4PU0A 4QODA 1NYLA 1KSJA 2QVBA 4XE5A 4QYTA 5J2TA 3CRMA 4ND8B 4DQ0A 1E18A 1W4BA 2HSJA 2I3AA 1GTJ1 1NHWA 1JZQA 4H7FA 5LYJA 3K0CA 4F91B 1WVIA 1PGPA 3P94A 3TAUA 3WL8A 5KPDA 1EBUA 5BR8B 3T7JA 4HGRA 2ZE5A 1IQRA 3DR5A 1TI7A 1RPAA 1U9YA 2AG0A 5AVVA 1WSBA 1G19A 4YBZA 5DBHX 1D9ZA 4I50B 3QXHA 4IDOA 1UXIA 2QRUA 2JHAA 4JK3A 4NZOA 4AJKA 1XZIA 3KL2A 4IQFA 5DLQC 3PFGA 4D02A 3BQMB 1CNFA 3NPAA 4XASA 4GWLA 4WKOA 1NPTO 4B3MB 3RRNA 3CVVA 1V2HE 2TYSB 2VHJA 4JEMA 5EJEA 2QN8A 2JARA 3DWIA 1DINA 4EB8A 1KOFA 2ZR8A 1CU1A 4OAOA 2HK8A 1NE7A 2Y1FA 1QB8A 3A06A 4Y2TA 2AHOA 4RC9A 2IELA 3LF2A 3FSRA 3NORA 1AMUA 4OX9B 2F1OA 4Q6WA 1DFIA 2P7IA 3JD2A 3WBJA 5C5CA 2P62A 5CHYA 2AUNA 1Y6QA 4P22A 1JPVA 1W4AA 5G3ZA 1O95D 4DA0A 2OFPA 3SICE 1NUPA 4FHZA 4IRMA 1X1QA 4Q4HB 2BGTA 5K0FA 4ROTA 3TTYA 3EGDA 2KPOA 1J8YF 3QITA 1JEQA 4RDXA 4BFTA 2VPYA 4RDIA 1E2JA 1IONA 1XTTA 1UAAA 5FO0A 4EVRA 1OLOA 3L0SA 3GRFA 5ALFA 3VBEA 1G8YA 1T5OA 3DMRA 2NV0A 3F0TA 4MTLA 4BGEA 5HJEA 4C76A 3JWGA 5C7LO 1TTHA 1QQTA 2ZB3A 3JQBC 4M1QA 5CDFA 3A6PC 3TBKA 4D26A 1Q92A 2CLHB 5LP6A 1N5DA 1SURA 2XQKA 2YINC 2C5AA 4BPRA 5DYGA 1U7HA 3D3WA 1O57A 2F8MA 4MUGA 4C3VA 1CEXA 1QUFA 3IBTA 4L76A 4R9RA 1VG8A 1DWUA 2BE7A 4MO9A 1GU1A 1XTIA 2O8DA 4ZT4A 4A23A 2GESA 1OA0A 1JKXA 1SU6A 3D3JA 3IKJA 3GNLA 3L0DA 3MWFA 4FEAA 4J03A 4MVJF 3W9UA 4ACBA 3FZYA 1DFGA 1XD8A 2PUJA 1JPNA 2PLFA 4KRYA 2JIZA 3I52A 4E5PA 4OQZA 3LUAA 1D2MA 1B6GA 2P30A 2WHYA 2G76A 1OBCA 5FWDA 3VSCA 4AJOA 2H2IA 2B1RA 5I7SA 2PX4A 2XYVA 2ZJ4A 2OHGA 3WYBA 2I1QA 5EGSA 3OEEA 5JJLA 1GA6A 4YDSA 2FLWA 3TIGA 4QEDA 4KVZA 2PKYX 4R9VA 3D3KA 3WGUA 3PD0A 4U02A 4ZALA 4GX2A 3T4EA 1SZPA 1ZI9A 2WIBA 4D98A 1H22A 1U8CB 1VTKA 2D8MA 3GMIA 4D41A 4XWKA 2CHQA 1Y48E 3UWPA 5FR2A 1UODA 3EPHA 1RPZA 3NIFB 2FZ5A 1V26A 4KFUA 4MIKA 4D80A 4UUPA 1GAJA 4YT5A 4MUNA 1NG1A 2ZUSA 1R6TA 1Q15A 4KL8S 3FTNA 2OILA 2GHRA 1U0GA 2WU1A 4G1CA 4KO4S 3ILXA 4TKVB 5CYPA 4ZCQA 5T3UA 1KDZA 1V5IA 2FX2A 4D4MA 5K8TA 2BMWA 4FNAA 3HJHA 3V46A 1XROA 1GO2A 4JYMA 3W79A 4LW8A 3JWJA 4ESEA 1JG3A 1EJ6A 2JFNA 4NJMA 4JI4B 2B8WA 2WF7A 3HYRA 3PXUA 1BE1A 3ZWYA 3TPZA 1P9NA 1TD1A 3FLEA 1JPJA 4RV5A 1I80A 1GGKA 3ME5A 3QPAA 3H75A 3MG9A 3STXA 4NXNB 3LOPA 3P9RA 4UZEA 5IVHA 4IDNA 1RQRA 2KB0A 5D84A 3MYRA 4HXEB 3JQ7A 2QLTA 3HEMA 1FYDA 2XUQA 2HV8A 1EG2A 3COYA 4KNYA 1RJWA 1AHPA 4QD3A 2WU4A 5K3CA 3AUUA 5KHLB 2QW1A 4G8DA 5GJWC 4CIBA 1JDBB 2AEMA 2Q9UA 2X41A 1GYRA 1RQPA 1E9RA 5EUBA 3CZQA 3X2FA 3RC8A 3WIUA 4ZRNA 3AW9A 3KE8A 3HU1A 2WMYA 3IJEB 4UU0A 5P8WA 2R47A 2XW6A 1OGYA 2BUBA 2JIOA 3R7SA 4CM8A 4REQA 4JNCA 2ATIA 2AYYA 3GPDG 4PS0A 1YMVA 1XTPA 1Q0PA 3DC2A 1BCSA 2WC1A 4MI3A 1U28A 1G9TA 1Y3BE 2DF8A 4UCWA 2PKWA 3I2HA 1PSDA 5A3QA 3T7EA 1L7PA 4ZI3A 4ZV7A 5IUJC 4MW5A 2AOXA 2JJ1D 1KI2A 1YDWA 2DFKB 2P41A 5EMNA 1IBLB 3F4LA 4QC2A 3UJ8A 4TYQA 4IJQA 2G9NA 3HP1A 4NE2A 1EUDB 4CLXA 3C7KA 2FNAA 4B45A 1X14A 3VC3A 1JFFB 4ZJUA 1W0CA 3EH1A 4CJXA 1MU0A 5TMBA 2RBGA 1C0LA 2NO6A 3DBHA 4UNNA 4RJKA 1MAWA 2BFWA 2FV8A 4EITA 1E98A 4RQUA 1FYFA 1PW5A 2X0NA 2ZJAA 5ARBA 1TAUA 2OCIA 3OU6A 4WEQA 3GNTA 3ZH2A 4HGYA 2CSXA 1EVZA 4RVNA 2VF5X 5C3UA 5B6IA 5I48A 3PLNA 2P4UA 1KNQA 5EESA 3W1WA 1CDEA 1U2GC 3OTGA 16PKA 2VJQA 3FHLA 4ZJZA 2AJDA 4P36A 4AJ2A 3B1JA 4K3UA 1NVFA 1PKEA 3CZPA 2VP5A 4JOSA 4KQFA 2PBZA 3QLVC 3TNLA 3OPYB 2BY4A 4DN6A 3U3ZA 3HVJA 5DTJA 4ZHQB 1Y6GA 3JQQA 2PKQO 3QPUA 5CVUA 5IJ9A 1NMQA 4GMGA 4HWSA 1ZJZA 4KMRA 5HF8A 3GAMA 3ZWCA 3KQUA 2YV3A 4FC7A 4ZXPA 2H11A 3SOZA 5CA1B 4LGMA 1VG9B 3WKBA 2YWHA 3FSGA 3IOYA 5HA5A 3A25A 1MABA 1F1JA 2GXQA 3AM4A 2HCBA 3BD9A 5ITWA 2UYHA 4ARZB 2C0CA 2XB9A 4J7XA 4XVUA 1VP3A 3HFSA 4N7JA 5BWLA 1QJ4A 3TZHA 3X2EA 5KU7A 3CLUC 2I6UA 4GKAA 3A9UA 1U9ZA 3CO5A 4ARVA 1JAZA 1PJ3A 4U2GA 1YZLA 1UP4A 2KX7A 1PTJA 2J5XA 1A8HA 4ND3A 3F3MA 4PYKA 4OHZA 1EUYA 5L7WA 4L1KA 3HEBA 1V1MB 4NOKA 4F3YA 2XH8A 3M6MD 4YHHB 1H85A 3RS4A 4YDQA 1C7ZA 1J5PA 1VYHA 2A0KA 3A4VA 1E8MA 3B7PA 4NCNA 4NJMB 1S0UA 4WCVA 5ECYA 2Q7OE 1A8SA 1VIAA 1FZQA 1Z0AA 3N0VA 3U7RA 3QKUA 3DHVA 4FFMA 3O3MB 1TXGA 1GTRA 3REFA 1PT6A 5G1PA 1I3KA 4WK0B 3WIOA 1JLLA 1XZAA 5EJ5A 4I6JA 1ORIA 3F7MA 4IDDA 4NFLA 2W00A 3N2KB 4QNRA 5SYMA 5IHPA 4GXTA 4GDFA 3GW8A 3SIRA 1ZH0A 5A4IS 6ADHA 2H8GA 2FMHA 3X1YA 3WLHA 1DIOB 1VLQA 4KG7A 4LYHA 2QRPA 2EJBA 2OCPA 1MUUA 3E2PA 2PV7A 2B1IA 1TGVA 4IIYA 1MO3A 2HK6A 3ABIA 4FCTA 2NQ8A 4MVCA 4U39A 4UQPA 4V24A 3ABRB 3UEOA 2CXUA 4EUHA 5JNWA 1I4TD 1IWBB 5IP5A 1O94D 1CUFA 2QB5A 3D2AA 4BO2A 3MSXA 2G72A 1QSGA 1I4OA 1TUIA 2H7XA 2IF0A 2VXCA 4PGAA 4CU2A 4DLXA 5JWOA 5KCZA 1O9GA 1YUBA 1KFCB 5D8DA 1T3LA 4QUGA 2VHWA 5C4IA 1PVOA 1IWPB 4JH0A 3KFVA 3M5DA 4PSAA 4GPZA 3ETDA 4ZPJA 1T3ZA 1LS1A 2WV9A 3HBJA 3RBZA 2VUSA 4ZRDA 1D2EA 1U1FA 4I4TB 3FMGA 4II2A 3T7SA 3ET5A 1GZSA 1E6CA 3L7DA 4O2BB 3H5IA 3PC8A 3TTUA 3UKJA 4DNQA 1NVVR 3RJMA 3Q6MA 3L7OA 2IWHA 5AVZA 3NIBA 1PUJA 3P2OA 5EKUA 4AMZA 2J0QA 1RYEA 2HRZA 1K5GA 4MQMA 1C3XA 1CZHA 3B13B 1TVEA 3C39A 1QZXA 1WUYA 2EWVA 3BERA 3DJFA 3F9CA 3MS7A 4FDAA 4M1ZA 3UFBA 1A88A 2WPDD 3ELUA 4BFYA 5GTDA 5G3YA 5KKCA 1BNCA 1JKIA 3I76A 2YBDA 2LRHA 3PCRB 1HZZA 4FFPA 5HDQA 5DOVA 1P9WA 3RSFA 3EQ8A 2R6GA 4AIRA 4BTLA 2O06A 3QWHA 5C81A 1QP0A 4QJ5A 2DB3A 4ZXFA 3C7DB 1E3EA 5GM1A 4JI6B 1QPZA 3GLFB 4DIEA 2RG7A 4MUFA 5SICE 1WB4A 4XDYA 4DZZA 2D00A 1DQPA 1UJ5A 2EV9A 5IFLA 2PYDA 1V3UA 3UB3A 3M0EA 2FW7A 2Z8YA 2P9CA 3NVMB 1K2VN 2C1EA 1ORRA 1QX3A 2QVCA 3LJKA 4G25A 4RXTA 1RAHA 2ZYTX 4LQ4A 3SJUA 1E96A 3UPTA 5HF5A 3CSUA 5AFSA 5EMLA 5SYNA 3CRRA 3P7MA 2JFYA 1JDVA 2W90A 2B9VA 4QOEA 3ZE1B 4BLUA 1FNSA 4D3XA 5H4GA 1YQEA 1VIYA 2PO5A 2YN4A 2F9FA 1KMQA 4DXHA 1X19A 3AOGA 3H4MA 1GU0A 3BN3A 1O8CA 1AY0A 4QAQA 1JBEA 1OVMA 2IYOA 1XJ5A 4IIJA 3GLHE 1XK7A 5H7XA 5K1ZA 1EFRD 3RC7A 1WKCA 1QVRA 3K5PA 4EY4A 5EQTA 3KQNA 2ZSAA 3FJOA 3V1YA 4RTOA 3HB1A 2VJNA 4Q7QA 5JWRA 2G0AA 4UC0A 5JH7F 1XVAA 4L6AA 2GAAA 1UPXA 3FUUA 1O6BA 1L8OA 3OCZA 4OQXA 1K8ZB 1CJBA 3ZHBA 2ZVDA 5G40A 3HA2A 1OBFO 5CB8A 4BTVA 1RHQA 3BXHA 3VPGA 3UH1A 1EK2A 4XIJA 3H18A 2CNBA 5E8RA 2O2JA 3K15A 1YK0A 3C3AA 5IYZB 1RI3A 3ADCA 2KMLA 4JR2A 1QLHA 1WTCA 1QZTA 1SY7A 2WKSA 5IN4A 3JCZA 3LLMA 4X20B 4C21A 3T5GA 1ECPA 1OPRA 2WSLA 3RHZA 1PKXA 2G7MC 2GNOA 5JCPA 2QZ4A 4DR1B 4TS3A 1H9CA 1YMUA 2G3YA 3B1ZA 1CJUC 3DNPA 3GDWA 3OQVA 2ET6A 4J0QA 4J0CA 1MX3A 3SYTA 2IYEA 3T7IA 3WFJA 2N75A 4YV7A 3WLIA 3ISJA 5SZIA 2X5XA 1GAQA 2IJGX 4HDAA 4K28A 3T1VA 3PHIA 5FIUA 2LKDA 2GA9A 4YI5A 2XMGA 1FBTA 1SWVA 3AKDA 3D31A 5LQSA 4CUJA 3BKXA 4ARZA 2SCUB 1CUJA 1OTHA 4P58A 1EWQA 1F2DA 5BMVB 5L3SB 4WSOA 5LZ9A 1WDTA 2PGJA 1M1XB 5E95A 4L6IA 2VUHB 4XLZA 3SYNA 3D4OA 1KO7A 4HQ6A 2J9YB 1DL5A 3EQZA 2FFRA 1DJOA 3F7TA 4IUDS 1FVOA 1A9XB 3KU1A 2HYIC 3ZWKA 1WEHA 4QNMA 3R3HA 1U99A 3QWFA 1KZYC 1F1BA 3UV7A 4MEAA 4EGFA 3ICVA 4JQOA 4W9NA 3U7GA 3JQAB 3K4PA 5KNDH 3O9VA 4BPBA 4CLRB 4PSDA 4GKJB 2D4HA 4QFDA 3MLBA 1IZYA 2X9LA 4L4SA 2FN8A 4CDMA 1YKSA 2LDXA 4BZZA 5B64A 1UQRA 1Y8RB 4EZEA 3AESB 3QPCA 3ORQA 5HUJA 5HTKA 4KDEA 4LHSA 3OQOA 1XEAA 1FE8A 2AMYA 2Q29A 4XJSA 3C97A 2Q21A 1T0JB 5FHQA 1CFZA 3HWX1 1TA0A 2FQYA 2Z4RA 2XMSA 4XJTA 3ZYZA 4KR6A 2FETA 2AFVA 1KC1A 1THGA 3Q5GA 4HWPA 4RZQA 3EZ9A 2OENG 1MENA 3TPCA 2O19A 1KDYA 3Q8WA 2VYCA 4FHFA 4D8XA 1GWNA 5C1IA 1NVGA 3NBUA 1AKNA 4P3NA 3O3OB 1UEXC 5I7HA 1J9EA 5FLEX 1QC5B 3BMOB 2ILTA 3CISA 2D5IA 4LECA 4ZTBA 1U9JA 4LXIA 5LOVF 1C8KA 2V4ZA 1SWWA 2ONKA 1GFZA 5KDLA 3SCZA 3SEAA 1TDJA 1PR1A 3R3XA 1CHDA 3IA7A 3VR5H 4LBZA 4AY4A 2ZQZA 1RBYA 1GGVA 1Q7GA 1XXHA 2J5QA 4LRYA 2VDPB 3CUTA 3ZK9A 5JQGB 1DLJA 1CKEA 2OC9A 1QOPB 4YMSA 2XKKA 3QVGA 1T6BY 2AA3A 4LHXA 5G4LA 5AW1A 1R8XA 3U5ZB 4JHXA 2CBXA 3AF3A 4J0JA 5CEJA 1DX6A 5IJAA 4DCVA 2Q5IA 3U7EB 2P69A 3U7JA 1HE8B 1QIJA 2ZI7A 1N1DA 1F51E 1AMOA 2OTCA 4PLVA 4ZO9A 4EATA 1JQLB 1SCDA 4CQNA 4FXPA 3N07A 4NAVA 1PU2A 1QBKC 1PG0A 2I7TA 3MCTA 4JENA 1ZJ4A 3VGJA 1W2HA 1YL5A 2RB5A 3K0HA 4DLNA 3OOSA 5BSFA 1KTIA 3GVXA 4E11A 1ZGAA 1I9GA 4YAWA 2ZS8A 2H0RA 5BNWA 4OY3A 1SC1A 3T1YB 1GPKA 1J90A 2FWRA 2WE8A 2A58A 4MRRA 1LY1A 2DR3A 5CYGA 5IFKA 4N1AA 2CHFA 1ZEJA 1J5XA 4KRGA 3QVUA 3OEHA 3KBBA 5A0TA 4IFBA 3S8EA 3JQBA 3SZOA 4PZ9A 3MBKA 1P1FA 3QKIA 4ENQA 3PL1A 3OZUA 1JQ3A 1C9JA 1PW7A 4V3CA 1S8OA 3TLCA 3N75A 5AI9A 4LNUB 1OXTA 2HUNA 2PEZA 1NXPA 5ALZA 2HC9A 3EGVA 4YHBA 5IBRA 2I6QA 3PEFA 5E4TA 4IP0A 3S7TA 3SM3A 3VHXB 2H1VA 2J87A 2A1UA 2ZSIA 3DGFC 3JYQA 4K46A 2VK1A 3KIPA 5JSZB 4ASUA 3AUKA 3AGQA 3CIOA 4KE6A 1V41E 2ZUCA 4NNJA 2P79A 4RCZA 3ENZA 3O75A 3ZR4B 1JDTA 5HOQA 1MW8X 3EXHA 4IG9A 1NP7A 2CK3D 3PXDA 4ZVUA 4D3DA 5EMKA 1CB7A 3FNHA 4PX3A 5FI3A 4ANFA 5EIOA 1MTZA 5FYQA 2O0KA 2VH2A 2P1DA 3NTUA 4P4NA 2AX3A 2OKCA 3E35A 3WFIA 1GL9B 5TS2A 1Q77A 2CFIA 1DJPA 1ZITA 3MOGA 4PXYA 5AYVA 2X86A 1RWOA 4GIBA 3VOAA 1XEFA 4QG7A 1ZFNA 4FYYA 3LT1A 4EUFA 4UW9A 5I4IA 1JIQA 4KK3A 4L15A 1EESA 2C4HA 3WP1B 2FW9A 4QELA 3TQQA 4RH0A 3RVSA 1R74A 2ACKA 3ZK7A 1JE1A 1M75A 5CU7A 3ND7A 3HR8A 3K0CC 3I1IA 4NV0A 1G2OA 2AKYA 3OFVA 2A9PA 1SKMA 3FMPB 2W6OA 4XD7A 1DFHA 3LP8A 2QDKA 3D4PA 3PNVA 3OIUA 1FNBA 2DPGA 3F6BX 4MS3A 4ND1A 3ZDYB 1I14A 2PWZA 1UMKA 1V96A 3FLAA 3P97A 4FT2A 4N82A 2AZTA 4A8JA 4ZRMA 2C2HA 3PNBA 1T2CA 4K6OA 4BKUA 4OCZA 2CLDX 2ZCUA 3R3VA 2Y0PA 4F1KA 1SUFA 3H13A 2ID9A 2W4QA 2I7DA 1OPXA 4JU8A 4NZPA 3VKFA 2ECPA 5KYGA 1CRWG 1N57A 3AQIA 4WTOA 3C6MA 3R8FA 1UPTA 2AFHA 3L8ZA 4DB2A 5JMWA 5ALLA 4O3FA 3HA5A 2XE4A 1PL0A 3D1VA 4PRKA 3PSAA 4OK3A 4WXHA 5U1PA 3U4QB 1N6HA 4WESA 5HFNA 1CDZA 4YJFB 4X5OA 1KJZA 1GIAA 2IYYA 4E5VA 5CA1A 4KFCA 1RCTE 3EDMA 2ZWOA 5CPFA 2NU8A 1N6PA 2CW5A 2JFPA 2V6IA 2I22A 3BE8A 3G6WA 3WGNA 5C31A 5DLEA 3LA6A 3TKYA 1MNAA 4F8JA 4YR7A 3CT6A 3GZTB 1NVEA 2QYHA 1NXQA 2YYYA 1KHTA 4QOFA 5HF9A 3FPEA 1TZCA 2RH9B 3I73A 3UKDA 5BOSA 5JSHA 1UMDA 1Q0UA 1MBZA 1JILA 1M6NA 1VPTA 3PQ8A 1SCUA 2BFPA 5D01A 4AFNA 3UBTA 4GP7A 3RVJA 1U81A 3VYUB 1BVUA 2QMOA 4G8JA 5LPNA 1QGAA 1ZAKA 3D4IA 4DV6B 4YP0A 1Z63A 5HOEA 4R8MA 2C04A 3F98A 5F2EA 3EGEA 2A57A 2ODPA 4NMXB 1IN6A 5L7TA 1PNTA 5HF6A 4LMPA 3TTTA 2E5LB 3KPWA 1MXFA 4RTPA 1QQAA 2OCYC 3EASA 2J67A 2VPPA 3RIGA 2A0YA 3EEQA 4DEVA 1UIRA 5F7XA 1NT2A 3AJRA 3VYVA