3GDHA

Methyltransferase domain of human trimethylguanosine synthase 1 (tgs1) bound to m7gtp and adenosyl-homocysteine (active form)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
211
structure length
211
Chain Sequence
LPPEIAAVPELAKYWAQRYRLFSRFDDGIKLDREGWFSVTPEKIAEHIAGRVSQSFKCDVVVDAFCGVGGNTIQFALTGMRVIAIDIDPVKIALARNNAEVYGIADKIEFICGDFLLLASFLKADVVFLSPPWGGPDYATAETFDIRTMMSPDGFEIFRLSKKITNNIVYFLPRNADIDQVASLAGPGGQVEIEQNFLNNKLKTITAYFGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Trimethylguanosine synthase homolog
publication title Structural basis for m7G-cap hypermethylation of small nuclear, small nucleolar and telomerase RNA by the dimethyltransferase TGS1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 74
structure length 211
sequence length 211
chains with identical sequence B, C
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09445 Methyltransf_15 RNA cap guanine-N2 methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3gdhA00
1HMYA 1XTPA 2O07A 2ZIGA 3HCDA 3OU7A 1SQGA 5CVUA 2AN5A 2EFJA 3TOSA 4QQKA 2ZW9A 1JSZA 4YUYA 4P7FA 5EKXA 3GRYA 5GWXA 1JR4A 2HNKA 3FRIA 4ER7A 2Z6AA 4FSXA 5JUWA 4GOND 4DMGA 4ER0A 3DH0A 5CUQA 5D1HA 5K03A 2ZWVA 5CIYA 3ELWA 1RJFA 4QPNA 4FR0A 3FUWA 3CJTA 5E8JA 3D2LA 3FPJA 1JTEA 4OX9Y 1ZQ9A 2AOUB 3BGIA 3BGVA 3HVHA 1ZKDA 2PX8A 2G1PA 3M6VA 1NW6A 4CXMA 3OZRA 3M70A 2FYTA 3I64A 3SSOA 2VDUE 2G72A 3HNRA 3MQ2A 1KPGA 4MQ4A 4RVFA 2QM3A 2FK7A 2PT6A 2YVLA 3Q7EA 3R0QA 1TPYA 3HTXA 1G6Q1 3FUXA 1Z3CA 4R05A 2PWPA 5T64A 5KYGA 3DUWA 3OPNA 4X61A 4WVLA 5C1IA 5T67A 3OFKA 3OZSA 3QOWA 4RTLA 2BR4A 5GIPE 3KPVA 3GRRA 2ZVJA 1TW3A 3G2MA 2AOUA 2YTZA 3P2IA 3ANXA 1INLA 5EMMA 7MHTA 2AOXA 1R18A 4KWCA 5FTWA 2HR1A 2UYQA 1X1AA 1UIRA 3BUSA 3GO4A 4YMHA 1L3CA 5HZMA 1NT2A 3DXXA 3LGAA 3DR5A 3SVZA 3FTCA 3LBFA 4M7RA 3FPFA 5DXJA 2HTEA 3LDGA 5EEHA 3GGDA 3WSTA 2G71A 1UWVA 3HCEA 2ERCA 3KQYA 4C06A 5DT2A 1XDSA 2XYRA 1O54A 3RIEA 1EG2A 1N7JA 3I5UA 1RJGA 5DWQA 3EGVA 1PRYA 1WG8A 2AR0A 3IV6A 2Y1WA 3FUTA 3HA7A 3VSEA 3THSA 1HNNA 2LD4A 2NYUA 2WK1A 4IV0A 2P41A 1B42A 3KQOA 3PB3A 5MHTA 4P7JA 5FHRA 1L3BA 2AS0A 3G89A 4XCXA 3SSNA 5LQJA 4G56A 2AVNA 2UZ4A 3P9IA 5GIOE 1JQ3A 3P71T 1KIAA 3EVDA 4ATNA 3KQTA 4R6XA 2OXTA 4JXJA 2FRXA 1G8SA 1VE3A 1MHTA 2EG5A 4PYJA 4RSRA 4Y30A 3HCFA 4F86A 5T6BA 1RI2A 2NNWB 5EHIA 4GUAA 3DLCA 4A6EA 4GC5A 2JHPA 2UYOA 3L8DA 5IKMA 5HFJA 3HM2A 3LKDA 4PINA 5K0EA 5F2NA 1XCLA 2BZGA 2N47A 3FRHA 4LWOA 4GF5A 3FTFA 3EPPA 2H1RA 1M6YA 1FJXA 2PXAA 2PXXA 4PGGA 1VLMA 4MTLA 1RI3A 5K0GA 1R8XA 3KPJA 2PY6A 5F2KA 1I9GA 1N2XA 4RTJA 3A4TA 5DX0A 3A25A 3LCUA 2PKWA 4C04A 3BWMA 4V0RA 3LPMA 3BKXA 1NW3A 4E2WA 3MERA 3FYCA 5HIJA 5KVAA 5FHQA 3NDIA 3ORHA 1RI4A 5HIKA 3JWGA 3TQSA 1L9KA 1X1DA 4P58A 2FPOA 2PSSA 3B7PA 5FCDA 4RTMA 5FA8A 5FULA 3KR0A 3OE5A 4HRAA 4OA8A 1FP2A 1IY9A 1JSXA 3DP7A 3DULA 5E2BA 3UJ7A 2YR0A 3ELYA 5ICEA 4EKGA 3VC2A 1G38A 3SGLA 4L7VA 3BWCA 3DMGA 3KKZA 3OFJA 1OR8A 2PX4A 3KQSA 5LQUA 3LSTA 1JQDA 2YXEA 2Q41A 5FQOA 3JWHA 3NTVA 4KIFA 1XVAA 2AOTA 2IBTA 3PX2A 2AVDA 1R8YA 3KHKA 5U4XA 2UYHA 4E33A 5CVEA 3HCAA 3FPHA 3OU6A 4DZRA 2KW5A 3A7DA 2PLWA 3BWYA 3G2OA 4EK9A 5KQSA 4RTSA 3HCCA 3P2EA 2WA1A 3TKAA 3ELUA 5GP1A 3BZBA 2CMHA 3BGDA 5EMLA 2ZCJA 3UJCA 2P3LA 1NE2A 3FTDA 3G2PA 3KR1A 3T7RA 2CKDA 3K6RA 1JTFA 3KPWA 2QRVA 3RODA 3F4KA 4F84A 5DM4A 3CGGA 1WS6A 1FBNA 2ZSUA 2GS9A 4FT4A 5M5BA 2NXNA 3EMBA 3E05A 4X63A 3UBTA 2NP6A 2O57A 2VZ9A 2PT9A 4HGZA 2VDWA 3UFBA 4POOA 2Z6UA 5G02A 4YV2A 3HCBA 2JH8A 4V0QA 3R9XB 4XUCA 4YUVA 5EMKA 2OB2A 5DM2A 3M33A 4PYIA 2E5WA 3GRZA 3BXOA 5DX1A 4E70A 3BT7A 5DTMA 4X1OA 1V39A 1VBFA 2GB4A 1X19A 3SXJA 2BR3A 1KP9A 5LQNA 1NBHA 1F3LA 5ICCA 2XVAA 5LSAA 3CBGA 3LDUA 1BC5A 1YFLA 3ME5A 5EEGA 3DMFA 4YV0A 2IDJA 2IPXA 2YXLA 5K01A 2GA9A 2OY0A 2P7IA 3ELDA 5E1OA 3TR6A 3X0DA 3CVOA 4IWNA 3VC1A 4GOLD 1H1DA 2B2CA 2C7QA 3FPEA 2O06A 3NDJA 5LQAA 1R74A 4P7KA 4E2ZA 2YXDA 4RTRA 2JG3A 2R3SA 1IM8A 2B25A 4NECA 5K05A 3G8AA 2B3TA 2ZTHA 5FWAA 3R3HA 3UJ8A 4E32A 3LCVB 5K0LA 3H2BA 4C03A 3TMAA 5K8VA 3BWBA 3PX3A 5E9WA 1JQEA 2IIPA 4PWYA 4RYLA 4RTKA 3EGEA 5C9ZA 4KVZA 4PONA 5EKUA 4LWPA 8MHTA 4HG2A 5GM2A 4ER6A 3KPYA 4M36A 4C4AA 1QAOA 1D2GA 1T43A 1L1EA 2AZTA 2WA2A 4FZVA 5BW5A 3KQMA 4QDKA 3B5IA 2GAFA 2XVMA 4PCLA 1D2HA 3JWJA 4QVGA 2CL5A 5CVVA 4BLUA 3PS9A 4BP1A 3PFHA 1XDZA 3P9KA 3G8BA 1O9HA 2PVCA 2IDKA 2IP2A 5EHGA 1ZGJA 1XDUA 5HILA 4K6MA 2H11A 1JG3A 4C07A 3O31A 4QPPA 1MJFA 2IH2A 2QE6A 2GH1A 4RV9A 5HOQA 4GOOD 3AXSA 1RI5A 1YUBA 4FP9A 3E7PA 5FQNA 5C0OE 5CCXA 2DULA 3TFWA 2IH5A 5E1MA 4PCAA 2P8JA 3Q87B 4GC9A 3UWPA 2B9EA 3OE4A 5E1DA 4BP3A 3DLIA 1VQ1A 5FWDA 2VP3A 5DM0A 4C05A 1XCJA 1YZHA 2PV0A 3FZGA 5LQCA 2P3OA 5EZQA 1YB2A 3OU2A 3PT9A 3A26A 3DMHA 2EJTA 3T7TA 1KYWA 4AUKA 4RTOA 3LBYA 5DRYA 5F2OA 1SKMA 4HH4A 3MCZA 4M38A 3B89A 5HIMA 4DQ0A 1KHHA 1UFKA 1DCTA 2OZVA 2IFTA 3K0BA 5K0FA 3IEIA 1VPTA 1ZHFA 2AOTB 3GRVA 5EMJA 4X41A 4CKBA 1JG1A 4A6DA 3FUVA 1Q0TA 3IYLW 3EVBA 1YF3A 3KPUA 1P1BA 4PYMA 5EVJA 3ER8A 4GBED 4BLVA 2ZBQA 3LKZA 3E8SA 2HMYB 4CTKA 10MHA 3SSMA 1WZNA 2ZBRA 3EVAA 3MTIA 3HEMA 3CC8A 4CWAA 2HWKA 3OZTA 3UJDA 5LQRA 5EPEA 3G5LA 3TLJA 1AF7A 4DF3A 5DTQA 1DUSA 2QRVB 3KR9A 5BW4A 4GEKA 5E2AA 2OYRA 3UA4A 4BY9E 3C6MA 4GOMD 4P7GA 3FUUA 4BLWA 4YUWA 3UJBA 1QAMA 2P3QA 1JG4A 4PGHA 3I53A 3MTEA 3AXTA 1I1NA 1Y8CA 2F8LA 5EIFA 3PLAE 1BHJA 4Z2YA 4YV1A 4EKIA 2QYOA 4PIMA 2BH2A 2PX2A 3MAGA 3DTNA 1N7IA 2XYVA 1XJ5A 4PYLA 5DLYA 3C3PA 3BKWA 1WY7A 3B3GA 2ZIEA 4U7TB 2BM8A 1NV8A 1KXZA 4OBXA 3LDFA 1VP9A 4QVKA 2ZZMA 1EJ0A 2VDVE 2ZZKA 5K0NA 3PVCA 5DPMA 4DA4A 2PWYA 4EMSA 2A14A 1KYZA 3LECA 1NV9A 3EEYA 4E2YA 1QYRA 3EVFA 1ORIA 5CVJA 5FA5A 3EGIA 3CJQA 4R8RA 4R8SA 5EIWA 1EJ6A 3NW9A 5LR6A 2IH4A 3DOUA 3NWBA 2I7CA 3UJ6A 3G5TA 3MB5A 4GQBA 4X60A 1JG2A 4E31A 3KU1A 5KQRA 5K0BA 2VS1A 3EVZA 1EQAA 4PYNA 1SUSA 2ZBPA 3P2KA 4RTQA 3PTAA 2YX1A 3EVEA 1G55A 2ONZA 1P39A 1VP3A 5FADA 3HVKA 1X1BA 4PNEA 2OPBA 4FGZA 1KPHA 4QTTB 3ER9A 3E23A 1FP1D 3LL7A 4RWZA 4PYQA 1M6EX 1X1CA 3KQWA 3OCJA 5D1NA 5EOVA 3U81A 2P1DA 5K09A 4IV8A 2CWWA 3GIWA 3GDHA 5EGSA 4CTJA 1DL5A 1I4WA 3V8VA 2PX5A 2UYCA 3S68A 3PFGA 2EX4A 4OQDA 5K0JA 3UJAA 5CD1A 2ZFUA 3G7UA 3HP7A 4OA5A 2C7RA 1R00A 3SMQA 1SQFA 3GJYA 2ZIFA 2P7HA 2K4MA 2YUIA 3FPGA 4O29A 2NXEA 3B3JA 3UZUA 1F38A 2V74B 3ID6C 2P40A 1SUIA 3GNLA 3I9FA 3DXZA 3HA5A 5GM1A 1L3IA 3HVIA 1SVUA 3G88A 2P35A 4HTFB 2JHCA 1PJZA 2IGTA 4F85A 3JWIA 4FSDA 4QTUB 5ICGA 3AJDA 3KQQA 2C7OA 2HV9A 5H02A 1P91A 3NVKI 4ER3A 4DCGA 4AZWA 2XBMA 3LX6A 4HGYA 2B78A 2O0LA 1R6AA 4YUXA 4H0NA 2PGXA 1ZGAA 3G2QA 3QOXA 5DTRA 3GCZA 3LHDA 4AX8A 2AN3A 3EVCA 4KW7A 3KQPA 5DSTA 3TKYA 5DXAA 1EIZA 4HTFA 3T7SA 2NXCA 1RJEA 3THRA 4OQEA 1G60A 2NXJA 4E2XA 2I9KA 2PXCA 2Y1XA 4RVDA 5GOZA 3MHTA 3M6WA 1NW8A 3FTEA 2C7PA 4AZSA 4XUEA 3I58A 4RVGA 4CKCA 4RX1A 3GU3A 3MCTA 1Q0SA 5ICFA 5EZSA 2YQZA 2ADMA 4RTNA 4E30A 3GWZA 1ZG3A 2AOVA 4CKEA 3P9CA 5K0CA 2EJUA 5FUBA 5BXYA 1O9GA 1RJDA 1FPQA 2AN4A 3C3YA 5DM1A 3SM3A 3O4FA 1XXLA 4MIKA 4YMGA 4ISCA 1YFJA 1AQIA 1BOOA 2O05A 4U7PB 3C6KA 4HC4A 5E1BA 5EC8A 1D2CA 4KDRA 2ZULA 3AWIA 4AZVA 4FS8A 1AQJA 1WXXA 1EAMA 2JHAA 3DXYA 9MHTA 5DX8A 4LG1A 5CVDA 3TPZA 3CJRA 1VIDA 3FYDA 3SR4A 3NMUF 1QZZA 2ZZNA 3GRUA 3CKKA 3SX0A 1NW5A 3UJ9A 4RTPA 2ZWAA 4PIPA 4EVIA 3EMDA 3ERCA 2G8NA 3TRKA 4WXHA 2DPMA 4UOEA 4AZTA 4C08A 5DRTA 1NW7A 4XUDA 1G8AA 3NVMB 1VL5A 3A27A 3R6TA 5E9QA 2PBFA 2FHPA 5E8RA 3EEOA 3M6UA 2FK8A 3A7EA 4ZTBA 4KIGA 2IBSA 2FCAA 5B1SA 2I6GA 4KDCA 3V97A 2JJQA 4DKJA 5EQJB 5EG5A 5HIIA 3REOA 2OKCA 4RVHA 4KRGA 2V7EA 3KQVA 4R6WA 1SG9A 2NP7A 2XYQA 1QANA 1QAQA 1BKYA 3MGGA 1NKVA 3B3FA 2BM9A 2H00A 2ZLBA 4PYKA 2ONYA 1ORHA 5BP7A 4PYOA 1WXWA 5IH3A 5CCBA 4M37A 4QQNA 3P97A 5JR3A 4ER5A 2ESRA 4OBWA 3M6XA 4MHTA 5E9JA 1KR5A 2I62A 3IHTA 1YZ3A 2OBFA 3P9NA 3KR2A 3AY0A 4QDJA 4DCMA 3TM4A 4DM3A 3UA3A 2ORED 2QY6A 4FT2A 4Y2HA 1U2ZA 3LCCA 3NWEA 5LQKA 3CCFA 1AV6A 1RI1A 2AOWA 2R6ZA 3O7WA 3R24A 5P8WA 3HVJA 3T0IA 3VYWA 2PJDA 3QV2A 3M4XA 1P1CA 2GPYA 1TW2A 4IKPA 5GINE 3P8ZA 4HSGA 5ERGB 1M0EA 2Z6QA 3HA3A 4LECA 5CM2Z 4MWZA 4B17A 2CMGA 3TM5A 1IXKA 3C0KA 3EVGA 2BR5A 2OO3A 2G70A 2JH9A 3GXOA 5DSXA 2GLUA 4YUZA 1NBIA 5KS2A 5HEKA 2OB1A 3NJRA 1KPIA 3RW9A 4EQZA
chains in the Genus database with same CATH superfamily
4WCFC 2AR9A 2CLLB 3A3NA 5LMUB 2BN4A 4KAXA 2RGNA 5DDIP 1ODFA 5J40A 5HQ3A 1ZI6A 1I3NA 3MMSA 4IIJF 4RCYA 3RVKA 5E3JA 4C30A 3FRIA 2AJBA 1ITZA 3GGGA 4TS3A 4OH1A 2FX5A 1WQ1R 4YT5A 2DYKA 1VJ1A 1NVXQ 2WYWA 3WI7A 5JJKA 5AI5A 1A4UA 1ZMTA 2AXEA 2XMBA 4OXKA 1FFAA 1XB2A 2YMPA 1X86B 2IK8A 3JU3A 3QEMA 4ZJYA 3U7FB 1HGXA 3EZNA 3Q3HA 2GNPA 5I7UA 4B8ZA 4IDOA 1Y9DA 2BUBA 2W8BB 4LY0A 1MIHA 2FEMA 3AIKA 1OHHD 5IF9A 3MQ2A 2HLPA 1JIUA 1GQQA 1TPYA 3P4XA 4FDTA 1T3LA 2X9GA 5T64A 3QEJA 1YHZA 3S7ZA 1L7EA 4X61A 2G06A 1OGJA 4L9AA 3ICQB 3DEIA 3FGOA 3OZSA 2BIFA 1BEUB 2D0DA 2XNDA 3D6TB 4GWLA 1BVHA 2IYYA 4DLUA 3PC8A 3Q98A 7MHTA 1CUFA 2X9QA 4RQUA 1B8NA 1BGXT 1XD2A 1R12A 1ZC3A 4PZCA 4Y2SA 1G3RA 3ZE9A 5HKKD 5B6JA 1ZJWA 3HQ4O 2I34A 4EY4A 2NUPB 1I5RA 3F5MA 3ZXYA 1YI0A 2XOXA 1IRXA 1T1EA 2V6IA 1TQDA 2GM3A 2ZRMA 1SGWA 3C4QA 4IZIA 4DLRA 5IVPA 1L8LA 3L04A 4COOA 4BFCA 4GRIA 3TIGA 3SVZA 3GLHA 1F20A 1T5HX 2WYHA 4HZIA 2Q0XA 1KZGB 3DF7A 4P22A 2R6AA 3WLOA 4CPDA 4OB6A 4KQJA 1D2NA 2H29A 2IEAA 4OAQA 3F2VA 2I8CA 1G6HA 3KQYA 1Z45A 5ABPA 4Z4IA 1RLOA 3LXRA 3PIIA 1ZRHA 3TIVA 1QK5A 3JQRA 4QRIA 2XT6A 4Q7KA 3EARA 1FRZA 1W6RA 5KDDA 3WADA 3AR5A 3I04A 1JDBB 3G89A 4II7A 2GHIA 2O19A 1KYQA 4WNAA 2Z3VA 2NVUA 2Y1FA 1JDSA 1M10A 1C81A 3EXAA 3IVGA 4TKUB 4UUOA 5E9AA 1VE5A 5AP9A 4WECA 1YTUA 1OLOA 4CCWA 1KDPA 1W8IA 1OT3A 5AQ1A 2QAGB 2R79A 1MO2A 4LRYA 3VU8A 2B8NA 1THMA 3IDSA 5T6BA 1E3IA 4KB5A 1HDOA 1WULS 3FMIA 4M21A 2W70A 3P2YA 4EY6A 3EUWA 5C4GB 5GZ1A 4XD7D 5HXAA 1XCLA 4P5DA 4K2HA 4G5SA 1KXJA 3J7AC 1XZDA 3CISA 4IPTA 5T8KC 3ND8A 1S02A 2V8BA 1BEZA 1JPJA 3FIJA 4UJ5A 4DUYB 1FNSA 4A8PA 1RI3A 3GELA 4JKYA 2HK9A 2H3HA 4ZVTA 2N0SA 3EXHB 1LRLA 2JFOA 3A4TA 3L79A 4NU6A 4TXNA 3SXUB 1N32B 1S2LA 5JSHA 3FHOA 3IMGA 3QG1A 4LISA 1FP4A 1EX1A 2YZNA 3AG5A 1GG2A 4URWR 3G8CA 5KVAA 1GQRA 2AFRA 3K92A 2C54A 2J0SA 2M1XA 4MYHA 1II0A 3IOCA 2CE2X 1ICEA 1EUDB 3NJ4A 1A8IA 1XZJA 2DQYA 3V4OA 3TECE 4D0SA 3TTSA 2XR1A 1QF7A 3DC2A 5EUCA 2R6R1 3OT4A 4FX2A 3H2YA 2W4MA 5A0TA 3BWCA 3HV0A 4UTNA 2ZWPA 1I9CA 3OFJA 4I6GA 2X0FA 1DAOA 1VJTA 3DCIA 5I8PA 1D0IA 3M34A 1C9JA 3NTVA 4RJJA 4EAQA 1RYEA 4F1JA 2XUQA 4D4MA 3LOQA 3R40A 1YDHA 1FK8A 3AUFA 2FZGA 3KB8A 5AXBA 5ITZB 2TS1A 2ZRCA 4JXZA 2PLWA 2GXQA 4P7BA 4K81B 1Z2EA 4H27A 2ST1A 3ITNA 1CUEA 3QWIA 4QBFA 2ZCJA 5H83A 1HDZA 2HF9A 5BN1A 3E7XA 4NULA 3DB1A 3ZD8A 3KL4A 3B9BA 4BKRA 3F98A 3L43A 4Y6SA 1NBMD 2A57A 2QP3A 1NXXA 3H0KA 3LPNA 4PO8A 4QUEA 1ZH8A 4G1VA 2IL1A 2QTRA 2YJ3A 1PBNA 1YJ5A 1H1LA 2FP4A 2P5TB 3OLZA 2GS9A 4RZIA 3VGJA 5K2MA 5K6RA 3EBOA 4X8HA 1CRQA 3OSZA 4HGZA 2Z58A 5A3QA 2FSHA 1EB8A 2OHIA 4O63O 5T8KA 4Q9AA 3HDVA 1U3WA 1J0DA 4IMPA 4QEZA 1YR8A 2PCLA 2ZYAA 1N9GA 1DBSA 1VYVA 1FF9A 2PS3A 1QHHA 1NYLA 1ONNA 2FR8C 3W77A 4RY2A 1GDHA 1PTKA 3GN1A 2VHYA 4HT3B 3I09A 5SICE 4G1UC 1GFZA 4X44A 3EG9B 4MJ7A 4QAQA 3ILHA 3DMFA 3N2YA 2J8ZA 5JC1A 4XPIA 3RT7A 1PJAA 3OP1A 2QT0A 1YDWA 3T3GA 2VNHA 1FA9A 1EK5A 5BV0A 2F1OA 1UBNA 4C0BA 4XE5A 2Z57A 1MC5A 4MKHA 1UK6A 3VOTA 4C7OB 5TIIA 4GOXA 1H5QA 1I3KA 3I3OA 2EL7A 1XEWX 2B25A 5KVCA 4G4JA 2BFFB 2G1JA 1E59A 3A04A 1QH9A 3ZHYA 5JIBA 1BFDA 4JP2A 3OPVA 3HJGA 1A9XB 2J3LA 4ZP1A 3QPWA 3TLAA 4QQFA 2GSWA 1QH8A 3B13B 2DECA 3H9UA 2V9ZA 4ENSA 3A11A 4M36A 1ZK2A 4OFXA 3PKJA 1E89A 1HE4A 3PXAA 4BGIA 2GAFA 4PCLA 1D2HA 3E9CA 5IXJA 1LVGA 4QVGA 4IEFB 1ZOLA 2D1FA 2YXNA 4YAEA 5J4HA 5E6RA 2RARA 3WRWA 2YRFA 1FDSA 4B6OA 5H3CA 2IP2A 1YZFA 1DGQA 3AF2A 4ZMBA 3MWKA 4O1HA 5I01A 4P4SB 4G5OA 3H1FA 2VBCA 5DKFA 1ODJA 6LDHA 1AKWA 2A7QA 3HG7A 3KE9A 4DMHA 1E1MA 1A2OA 1ZUHA 1LI5A 4HLUC 4XOIA 1RC8A 2YMLA 3PDJA 3EHDA 1XTUA 5E6SB 4GQAA 2FR8A 4M9QA 2XB9A 3TFWA 1H85A 5HHTA 1X38A 2NTVA 1DTEA 1UJ6A 2G63A 1NBME 2Z6VA 4IMIB 2YOHA 4Q1EA 4RA6A 4B4WA 2GT1A 4DEVA 1NMEA 2IWRA 1VQ1A 4JHXA 4RKQA 3K0FA 5AMXA 4B3FX 4BKQA 5KX5B 1ULBA 2HK7A 2AKEA 5C1BA 2F9MA 3MNFA 4YJDA 3MRSA 3KB1A 1EG7A 4NF2A 3URMA 3ZTWA 4C0HA 3E82A 1YUNA 2ZI6A 3K20A 2P9BA 2IQIA 3OQHA 4FHGA 4IIXA 2QBYB 1CEXA 3GZ4A 4ZVOA 4P53A 2ZITA 2GVZC 4YQYA 4EJSC 3TG8A 1U2EA 2QX6A 1BE6A 4XQ9A 5C18A 1QHXA 3KOWA 1YF3A 1M33A 4MQ6A 1PD0A 4CEIB 2FUNB 3TNJA 5BN3A 3E9NA 5JD4A 1JKMA 1VE1A 1EGAA 4CTKA 3VR4D 2FDRA 3ULKA 1XZKA 4YMVA 1PJ4A 2BFDB 1NXOA 4RGVA 1XF1A 3EVAA 3DFKA 4S1VA 1GRQA 3RT1A 3QBEA 4X93A 2PK3A 1GRVA 1H22A 6ABPA 2HMWA 5C8VA 3QVOA 3COSA 2YCLA 3LLMA 1DEOA 3QTLA 3GJ8A 5I9IA 3ADOA 3OEHA 1KSJA 2RB4A 1Y5MA 4P7GA 3ZHRA 2PUVA 3KWFA 1V0JA 1YKSA 5D84A 3L7NA 3OLVA 3T5CA 1R7RA 1WW8A 2UZAA 4NCAA 2JDIA 4Y2VA 2P30A 3LC2O 4FMCB 2PX2A 4NPCA 4IIJA 4QLOA 4LF7B 3QXJA 5EJ6A 2XYVA 2CBZA 3C3PA 4XSVA 3S2FA 3TR5A 1QYWA 1MOZA 1UMDB 3JY6A 3QNUA 1CT9A 3EGCA 4OBXA 5H3HA 1EVKA 3IAS1 1A7JA 4J0KA 4R51A 3RYCB 3VH2A 2VDVE 5BVHB 4U6QA 3QITA 4HLUA 1EVEA 2OBBA 3DCNA 3O26A 3FPBA 1PS8A 4MWEA 1PN3A 2W6JA 1Y3FE 1ESCA 2ZT8A 1YCDA 1TA0A 2C98A 5HKLA 5EWLB 1G21E 2ZAGA 4OU4A 1U8XX 4XR9A 2QN7A 4IP0A 5JZ9A 2G1KA 4HGOA 3PHBE 4P4LA 3O8NA 2X3YA 2IV3A 5IKEA 5FDFA 4UVDA 1T1SA 2EEZA 3WRYC 3F8TA 4J0JA 1W4RA 2WJVA 4WJZA 1MAUA 121PA 1NUTA 3HVKA 3L0PA 1X1BA 4EJSA 1MQSA 4QDTA 2JCXA 4FGZA 3V4PB 3OMWA 2IIQA 2KHZA 3PDCA 2BCEA 3CX3A 4CQLA 4YACA 2J85A 4F04A 1QH1A 5I9TA 4IL5A 3FB4A 5B1HA 3B1KA 3NPMA 2RGEA 3B1FA 3O0DA 2PX5A 3CIFA 3QXGA 3SS7X 4C5AA 4DXHA 2W2OA 3UJAA 3LVFO 2I99A 1VG9B 4C2AA 1FE8A 3V4SA 2C7RA 2W22A 3AHIA 5AWFC 3OOHA 4LA4A 3SMQA 3VFDA 1XR3A 5CMLA 3THYB 4YRRA 4HRYA 1YL5A 3IR6A 3WLQA 3E8XA 3GLFB 5H4GA 4LFBB 2X4DA 4LYJA 4YJGA 3G0IA 5AI9A 1F1JA 3TXYA 2QMYA 1IU9A 3R3UA 4GR4A 1NAIA 1Y48E 4TSFD 2V74B 3EEIA 2K87A 4AURA 3DXZA 1NXPA 1GM5A 2W2LA 3G88A 3UANA 4HTFB 1JHPA 1EVYA 1PV2A 1U6KA 1ZQ1A 2P9TA 4R1QA 4UDYX 3WLJA 2W9XA 4CVNA 4ZCTA 4ZMRA 2ES4A 4MQUA 2AIRA 1C1DB 3IR7A 2AJDA 5TARA 4C4XA 2WOJA 3JAKB 1RFGE 2O7RA 3CV3A 3LT5A 2GJ8A 2QLMA 3H9BA 4GLJA 4F2GA 3CLHA 4HFMA 4CKCB 4TZ6A 1K7CA 2PGXA 2REQB 1PQYA 1ZGAA 2FUEA 3E7FA 1A98A 3G3EA 3RARA 4EPTA 5JATA 5EP4A 1BW9B 3IO3A 3RRYA 2AN3A 3BHIA 2VTBB 1Q21A 3UAZA 3B1VA 4N8EA 4RXUA 5KNDH 2V7XA 1XROA 2J3DA 3JQFC 1XL1A 3A1DA 2NXCA 2RGGA 4WLEA 5FBLB 2GPAA 4PRLA 4BNFA 4YXWA 3M6WA 3NDPA 1I51A 2RHDA 3AZPA 2O0KA 3N76A 4R69A 3I28A 4E0BA 3F46A 3GU3A 3MCTA 1OSNA 4BVJA 1PT8A 1K6IA 1XTQA 3TTTA 4LQCA 3ZZ1A 4FI3F 2QA5A 4PC6A 3EEFA 3G79A 4Q6WA 1PK8A 1P5HA 4K40A 2EJUA 1TT7A 4BBJA 1EE1A 3QVLA 2JGLA 4L0MA 2YIJA 1XMPA 4TTAA 3RUFA 5I8WA 2QL5A 3ENVA 1VB3A 5AKXA 1TM4E 3OX3A 4Z3DA 3PL5A 5EC8A 1UIMA 4P08A 3D6UA 3ETLA 1LEHA 2WI8A 4QXRA 2BEWA 1CQIB 2Y1DA 4RIEA 2WP0A 3RK0A 4CM7A 3AVVA 1EPUA 4Z4HA 3TPZA 4URXR 5C7OO 1THGA 4Z7JA 1X2EA 3O9VA 3MM4A 4JJ6A 1YRYE 3NATA 4OO3A 1WF6A 3BXHA 5FOWA 3SC4A 1B00A 1YU9A 4NICA 1QYVA 3LWNA 1CR2A 3ANYB 3SJAA 4JJ4A 3N2EA 1HZZC 2Z4RA 3T3MB 3E8MA 2G8NA 2ERXA 1Z63A 5L45A 5A4AA 3W79A 1NKSA 4ARBA 4UFPA 4B75A 4US1R 5AM2A 1UK8A 3QWBA 2UV8A 3PQ6A 4HK4A 3L5KA 4ESEA 3A7EA 3GVIA 5EPOA 2DF8A 1DX9A 2IOHA 1DBIA 2RHHA 3V97A 2J5KA 3F6CA 3GBSA 4ND3A 3Q72A 3CO5A 3VHXB 4HXYA 1F6DA 4GBGA 1WOMA 1L8QA 2NO0A 1EJBA 1YGYA 2NZVG 3CLSD 4PGAA 4RA9A 2FWPA 1SBIA 1PR0A 4DGQA 1K7EB 1R27A 2YKGA 4JD5A 1MA3A 1TCBA 1FYVA 4DMMA 2BHRA 3JQFA 1FJ2A 5HYVA 4BFUA 4PYOA 1WXWA 1MFPA 2EYUA 3T6KA 3JWEA 3ISVA 5HG0A 1YHNA 3WL6A 4OM8A 2PKQP 4YP7A 1FZQA 2ESRA 1KEEB 2GDZA 3IJPA 1FY2A 5EHNA 4CLRA 4OHYA 2QW1A 3TRDA 1T4GA 5C7YA 4MCHA 5JH7B 4LFAB 3KR2A 1NPTO 3V4LA 3GDFA 3W5DA 1BG6A 3DA8A 3NKLA 4W6QA 3KZNA 1UJMA 2CK3D 1D2MA 1OILA 1QO0A 2DBZA 4Y2HA 2AOWA 2IYEA 2QIOA 1NFRA 3SZLA 5AM4A 1OAAA 3FDFA 2CLMB 3OE7D 2YFKA 4OOEA 3STTA 4NWIA 4EJ0A 4HSGA 1XVTA 1UFOA 3WGZA 2KSQA 4C0LA 3OZUA 1QCZA 1RWQA 3CINA 4RGQA 2C9OA 3OKAA 1A77A 3DNMA 3E70C 3AF5A 5I5EA 1DKLA 1Z5VA 1RAEA 1YS4A 4BLOA 1CW2B 1NVUQ 2I33A 2ZE7A 4QXOA 1Y89A 1UOPA 4NG5A 4U6NA 4OIFA 3T7KA 5DN6D 4IR7A 1AHHA 1K88A 1HZZA 1A97A 2DJ5A 2Y66A 3GNSA 3Q9NA 3WZMA 2AZ4A 2OA0A 3RHTA 4HDOB 1FXSA 1YRQA 2PVPA 3LLCA 4GOND 5AKKA 4DXAA 5L6LB 2O59A 3T5MA 1OXMA 2WD9A 1OV4A 1P3Y1 2EGGA 3ZCSA 1T9DA 5ALHA 3V1KA 1C7EA 3B6MA 3CX4A 2QVBA 4L5BA 4BEBA 1JS1X 3MG9A 3HVHA 1U2DC 4MV1A 4IZ6A 1ZMRA 4HUQA 1MJNA 3GZJA 4PV7A 2B92A 3O8OB 4HB4A 1USGA 4DSOA 3E48A 1XBTA 4MDYA 4J90A 2F3TA 5AVXA 4CIDA 5DYTA 4C2TA 3ER6A 2PZFA 4QGHA 1LKZA 2BFBA 4TM7A 5DBGA 5ESRA 3UAXA 4A5SA 5ALEA 4B7ZA 4EG4A 2FEXA 4LYDA 1BMFD 3SBOA 4MUAA 3VU9A 2WWRA 4UU8A 4QNRA 5FFMA 3IP7A 1GITA 2X13A 2YXBA 2Z9CA 3WBJA 4F2WA 1B0AA 4I6JA 2HZBA 3HKDB 1GZSA 3IUBA 5EMHA 3I1YA 1A76A 2IVFA 1LY1A 3LVBA 1JYFA 3KD2A 5DP2A 4DABA 2C88A 3CPHA 3LTEA 3RANA 3CCCA 1RRMA 5IJZA 1G5FA 3E0QA 2R8BA 3BXEA 5ETJA 4HWKA 1GZDA 5GONF 2P6MA 3I32A 3PNMA 1Q1AA 1R0XA 3OUZA 4XX1A 1CEQA 1UDRA 2H2FA 3LDGA 4MHOA 4D82A 1NZJA 4TMFA 4EGAA 1W88A 4GL2A 3R23A 4HB3A 3HCEA 4FDLA 4AECA 3EDQA 2WG0A 3BDIA 3QW2A 4O4JA 4W99A 4Y6RA 3RIEA 4C87A 1D07A 5AO9A 3SVLA 3D4OA 1JA0A 2AR0A 3IV6A 2B7LA 3RVMA 4AKHA 2XVXA 1B2RA 5ES4B 3I9KA 1Q1GA 2XJ4A 3QKSB 3VO2A 3WICA 1B42A 1LBTA 1F2TA 3GH3A 5EE3A 5EIBC 5C4IA 4DB4A 4PW0A 3LCRA 5F5XA 4LSGA 2GCNA 3SJUA 1GGMA 3KWLA 4TTSA 3WQQA 5GIOE 3VTKA 3RC9A 1A5AB 1F9AA 3K72B 3PENA 4KBFA 2I1VB 5DHSA 5DZSA 4DANA 5IWAB 3DV0B 2R48A 4DADA 2PM8A 4BX0A 3F90A 1KEKA 1BU8A 1FFHA 3PEVA 2AYZA 1NFQA 1U2DA 4GM4A 4JP8A 4PRZA 4TVKA 3WYDA 5JY1A 3VSAA 2JZCA 1KI8A 3RLIA 1L4MA 1P18A 2DB3A 2OHXA 1JBQA 4U2CA 4OLAA 2IS4A 2ZRPA 1HDXA 1SU4A 3JD0A 3UW3A 1KVQA 2BDEA 1JT2A 1FJXA 4LJ9A 2OCPA 5FTNA 2GSDA 5K0GA 1UCFA 1E2JA 1XDBA 2FVYA 3GJ5A 1QUFA 1I9GA 1N2XA 3O92A 5A4KA 4YDRA 3UPDA 2GCOB 2VH5R 4KMSA 3STWA 2FAXA 2Q62A 3QY9A 1R0ZA 1XJCA 4EHLA 1A4IA 3OFNA 2I7DA 2SKEA 4ZI7B 1VE9A 2J87A 4PN7A 1PEYA 2Z2YA 2OGSA 1ZR4A 1PZFA 1DMRA 2PDAA 3K9GA 3LZCA 4QBHA 3HGQA 4TVOA 3L1UA 2PFSA 2PR7A 2JGMA 3NYRA 3WWDA 3AUKA 2O8BB 1G38A 3ONNA 4DIKA 3FNRA 3ROQA 5ITSA 3WBKA 3FKSD 2HQRA 4NFLA 2QJOA 4ALMA 5LZ2A 4BO0A 4BKMA 1G2PA 1W85A 4Z4EA 3GLSA 4WKOA 5FQOA 4HNTA 1DV1A 2W2KB 3I0MA 4MS1B 3VR5D 2LKCA 5LA6F 4NBLA 4FFNA 1B73A 1DHRA 2HEIA 2JIPA 2II6A 1KYVA 3HKBA 1D2AA 3KHKA 5EFOA 2PD6A 1GPKA 1H6BA 1VOTA 3EWIA 4J91A 1FNBA 5PGMA 1YZVA 2A9VA 2R8XA 4DRXA 2QQGA 2B69A 3A7DA 3BWYA 3QFHA 5IBQA 5CFQA 3ZH2A 3T1OA 2ZT5A 4AB1A 5JPCA 3R5HA 1A1SA 2WSLA 3BCUA 2ASVA 4RMIA 3ADKA 1N57A 4UBNA 3TLEA 5LJLA 4ED9A 2VO1A 3UVEA 1QCCA 5D5HA 4WT7A 2H1LA 4F6RA 3F4KA 1E6LA 2CY0A 4LOKA 3CG0A 1V1JA 3AP2A 1WS6A 1KDOA 2GOYA 2J0UB 4K9NA 1PT5A 3AH8A 4G2NA 5JCJA 3IUMA 1Y8QB 1YI1A 1YB6A 2AC4A 4RLSA 3PC7A 2ZU6A 5BUCA 2VDWA 2ZUCA 1JAYA 5K0TA 3IQGX 1C1XA 3JVUA 3H1BA 4QTXA 1HT0A 3AP3A 3C7AA 4DV2B 1A8SA 4EQ6A 2P78A 4HDQB 4LYGA 1YC5A 2JCBA 4DJFC 1V7PC 1QIEA 3WLFA 1G20A 4IJWA 3BXOA 4KUEA 3HP1A 2HBYA 2I71A 2ZAMA 4NNPA 1D6SA 1S01A 4R5HA 2J3EA 2WVAA 5AW8A 1KO1A 2BC9A 4EHAA 1P4RA 4TOIA 1QE5A 1DIHA 1O5TA 3G9ZA 5TNXA 4L78A 4MROA 4RIHA 1BC5A 5KU7A 4M99A 4LK2A 4GPEA 2J9RA 3GJRA 3U4QB 3CEJA 3RV3A 1XVVA 3W4IA 3Q3GE 3LBHA 3BSWA 1E7RA 5I9LA 2PX0A 4JN6B 2O7QA 3VOBA 5K3FA 1RWWA 1O94C 5H7XA 2JLWA 2QRLA 2RHWA 2O5CA 3HBJA 1JZSA 5CFPA 1KBZA 1H8HD 4HJXA 1U7OA 1TA4A 3IALA 4RS3A 1BDMA 2IU4A 4P7KA 2OKGA 2YXDA 3UBMA 3S8YA 4NS4A 1W7AA 1N3IA 1X92A 2R1TB 3CZPA 4HKTA 3GQBA 1NMZA 5FWAA 1WQ4A 4LE0A 5FLKA 1BQ4A 1LSJA 4DLWA 1JEOA 2ZSHA 1H9BA 5ALVA 3GB9A 3K9QO 5GVSA 3DL7A 2O54A 1C8BA 1U8FO 4EPRA 3ROZA 3I23A 4MYCA 5DBFA 2DKNA 3K5HA 2OT3B 4FZVA 5BRNA 5JYEA 1NLUA 1HLGA 2A59A 2YNMA 3N2KA 4KR0A 3KQMA 1KERA 1DXQA 1OXSC 1DQNA 2XA1A 3OT1B 3ZHQA 2JRCA 3GCGA 1Z36A 2CL5A 3A1SA 1HK7A 4BLUA 3PFHA 2QXYA 1W87A 3PDIB 1K5HA 1OX6A 2ECPA 3CPEA 5AOCA 1N5MA 2ZJ4A 3WE7A 4BB5A 6ADHA 4OB8A 4M1ZA 1SXJD 1WL8A 1ZGJA 1EUCA 2AG0A 2HU2A 2R60A 3LMKA 3TSAA 2O2GA 2VJKA 4D56A 3R0VA 2AK2A 4EEXA 3RAEC 2LCFA 4RY8A 3LP5A 3EDOA 2BY4A 6GPBA 3OLCX 4FKMA 2FEWB 3OOSA 1Q0ZA 1C4WA 4XWYA 3VR6D 4AO7A 1J0EA 2FW0A 5IH7A 1TKCA 4FXOA 4E4TA 5K4GA 1F8XA 1K8ZB 1EDBA 3EULA 5LQCA 3KTAA 3ZIDA 2ZRIA 1BVRA 5IKPA 3FLAA 1PS0A 4MUXA 4RXTA 2H4FA 2K7FA 3DMHA 5BWOA 4LMBA 2H9AA 1IIRA 4Q4HB 4ZU6X 4JI5B 5F2OA 2Z98A 1HV8A 1C8KA 1RE1A 1PW5A 3QG5A 4K6KA 4OJQA 4NYJQ 5DCUA 2ZR9A 1W52X 1QIJA 2P2LA 5CB4B 3KAPA 3FUVA 1KORA 4DV5B 2CMKA 1P2FA 3LY5A 1GAXA 4MMXB 1P1BA 1UJCA 3ML1A 4DJ5X 4GFDA 4YDHB 4M53A 4F9FA 5KTKA 3PVSA 3BQNB 3R8FA 3TBKA 4UW9A 1JIXA 1U7XA 3PR2B 1FCJA 1LFDB 3DT8A 4JOSA 1OREA 4JELA 2HSWA 3GYBA 3HFRA 3V1UA 5D85A 5JPIA 2WW8A 4AP6A 4MULA 3LUHA 4OJKA 4DKXA 3KB2A 4GEKA 3Q8XB 4NDNE 3TQCA 2JS7A 3E35A 3CZQA 1Z0KA 1EH5A 1XTRA 3B6ZA 3D3EA 4OQZA 4PGHA 1AGXA 2WPDD 1N0UA 3AXTA 3P27A 5CX4A 3RK4A 4OXRA 3PFWO 5EJMA 3NV7A 1SBCA 5F77A 1W59A 4QGBA 3BZWA 3ZDFA 4HNHA 3GDWA 3A9TA 3PQ4A 1C30A 3MPUA 3I4LA 4X8OA 2OV6A 1NQTA 2AEJA 2WE8A 4GG1A 3D5TA 3UUWA 4J2TA 5F98A 4TKZA 1U2SA 1GGNA 4GP7A 3T7CA 1SD2A 5SYAA 3MGCA 3SYNA 4M55A 1WTCA 1NV9A 1XVLA 4PHTA 4RESA 1QC5B 3ETEA 4MV6A 4CKWB 3ZWKA 2WTUA 1B2LA 1ZOOA 4HDMA 4IXNA 3E84A 1YDEA 2HADA 2CXQA 1E79A 5TDHA 3NWBA 2GPBA 1T4MA 4GQBA 1NG9A 5AXAA 1BXGB 4XJSA 1DKUA 3HE3A 2YJGA 4ENUA 4DDUA 1E0AA 3EVZA 3G5UA 1DJOA 1FTGA 4HH1A 1TM1E 3P2KA 3RFTA 1DU4A 1G42A 4DBLC 3T3OA 1VIAA 1UMCB 3X1JA 3LKBA 2UXDB 3L5OA 4FMBB 4MRSA 1IN8A 4YONB 1T3HA 1VKNA 3IS3A 3C74A 4PZ9A 4UATA 1FVFA 4XIYA 4GX5A 2IPNA 2WJ6A 3DGEC 2WMOB 3HV2A 3OO0A 4BC1A 4IV8A 5K8UA 3GDHA 4L5IA 1R2QA 1L4GA 5LKRA 1RYYA 5ARDA 2Z5FA 4Q4JA 4INZA 2KYRA 3AR7A 2CSUA 4OQDA 5GJBA 1K0UA 1W47A 3SLGA 4EPYA 3PJDA 4TZTA 5I6DA 1T8UA 2VYND 3AHJA 2K6GA 3S1LA 1GPJA 3L7AA 4YUAA 1FOEB 3IUEA 3JAMA 2WTAA 4EABA 2X0JA 3VOAA 3TW8A 3L84A 2AR7A 1WV1A 4F6LA 4B45A 4HN9A 2BCGY 5GY7A 7GPBA 2PWBA 4JVSB 1QDLB 3PE6A 5BSUA 2P4EA 1YZTA 1MHPA 2D4HA 2SNIE 4JOCA 4MCJA 5TPZD 4NNOA 2JFQA 3M83A 4YR9A 2EL9A 3IP5A 3F5QA 4ZVPA 5GZ3A 5C52B 5CEJA 1WMAA 2UZ0A 2RK6A 4MV9A 5LQNA 3EA5A 5LP6F 2B78A 2D2EA 1U0NA 2SCUA 4LZPA 4RNDB 1B0ZA 1OFVA 2D3WA 4E1VA 2GZ2A 5HPYB 5LB4A 1F14A 2JEZA 3LHDA 4CTOA 1W6UA 4H6PA 2IHVA 1S3SA 5JAUA 1Y1PA 2I78A 3M4NA 3VPCA 2GWHA 3GL9A 1KOJA 4OHXA 4TRNA 2N3ZA 3W2IA 4AF8A 2NXJA 4DG8A 3MHTA 3WLNA 4EP1A 2XMGA 4XYEA 1B43A 1OYYA 4CZ2A 2OYCA 1TYEB 2WF8A 3WZLA 1AO0A 5TT1A 3T3NA 3ZJUA 4XVRA 1FSPA 1F51E 2GN4A 4L6AA 4JLNA 3O8CA 1YWGO 1K27A 2EQ5A 5EZSA 5KJEA 1G8PA 1GKKA 3HRHA 3CLTD 3E22A 4Q1DA 1NBEA 2GZ1A 1Y5IA 3GWZA 1EX7A 1WTAA 3ZHUA 5K0CA 2HXSA 3F73A 1OH5A 2D1TA 4ENRA 1QIFA 4MW4A 5KJFA 3L6CA 3KOMA 2A0XA 3H6KA 3THWB 2RMKA 4KLCA 2POCA 3C3MA 1QIIA 1ISGA 3U31A 2Y1CA 4AZVA 3ABZA 1P61B 5CT9A 3HJFA 2XMSA 3ADBA 1S4QA 4JLMA 5F1YA 3W3ZB 1WJGA 3GLKA 1H4VB 3SDZA 2QX4A 1GPDG 2VEOA 1U8EA 3CJRA 3ZQKA 1E62A 2MOKA 1L7QA 3NCHA 1RLMA 4P2BA 4EUNA 1JMYA 2AFIB 3FW1A 5LA6A 5DNCA 1ID1A 1T29A 3V4RA 1Y5RA 3R6WA 4PFJA 1SQ6A 1RT9A 2J31A 2VQ3A 3DTVD 4YJFB 3SNHA 4Z4CA 1AE1A 2C4VA 5E7IA 4PAMA 1V41E 2EYQA 4BO4A 2R0QC 2QHXA 2CKMA 4YRDA 2ACKA 4IHQA 3UW1A 5HQTA 5TX7A 2A7XA 5E9QA 3W04A 3WLMA 1ADGA 3GGPA 1H42A 4BGDA 1VHQA 5AKZA 4MDEA 2AMYA 3DG9A 1OD6A 2WIJA 3RSLA 5BYAA 3FR7A 3O8RA 1NYQA 4RFLA 1I7DA 1X42A 1SVLA 4R6WA 1SHTX 5BSWA 2Y1LA 5JU6A 4PY2A 5B30A 4HQRA 5HS4A 1BKYA 1XU7A 2PLRA 4EL0A 1T2AA 2FRVA 1JJBA 1CIPA 1MB9A 2VHUA 1UBMS 2W2PA 1LLFA 2ONYA 2BE7A 1I1HA 5EJ4A 3IELA 2DFTA 4HDNB 1IN7A 1ONPA 2HCTA 2ETVA 3M89A 1BMTA 1SVMA 3P97A 4PRYA 4AJEA 1NXSA 1RWBA 4H0FA 4Q1BA 2I29A 4E12A 1Z28A 1NSYA 4DHWA 4YNBA 1ZH2A 1I6KA 3VYVA 1O08A 1PFWA 4KQ2A 1THTA 4PLPA 1NJSA 5DHAA 3VR3A 1AZWA 3S81A 1FRFS 4O33A 4UULA 5FTKA 2IZOA 5LM3A 1JHZA 2NIPA 4I8IA 3K15A 3KO8A 2OECA 2V97A 4N5IX 5K2OA 2ZYUX 2X6RA 4IKPA 3RJZA 1WV0A 3RVRA 3AGPA 2O1XA 1M7HA 3BICA 4R7GA 5ALWA 2ZKLA 4LJ6A 4JIMA 2G5PA 2P90A 1FSSA 2IQ5A 3SQOA 4H18A 1NIJA 1LNSA 2Q0SA 2UKDA 1PWEA 5EIOA 5BVHA 4NOMA 3KP1A 5CIQA 4V1CB 2C07A 3NHJA 5JXWA 1G6OA 2V3VA 1H0KA 2I4MA 4GDMA 2BPOA 2H1SA 3MTGA 2X4IA 5NLLA 5CVTA 1JZQA 1UOEA 4XKJA 1SY7A 3WYFA 4A23A 1M2HA 3D9QX 4G5RA 1LPSA 3D6MA 1CRLA 4R31A 5K8IA 1MAHA 2YMQA 1HDGO 3OQPA 2GZDA 1C14A 1DI0A 3HH8A 4TV9F 4EUKA 1TM3E 2WHXA 3H0EA 4YAGA 1KJQA 5TS2A 3V33A 4JGIA 4ALNA 2TSYB 1U0SY 2WHPB 2YS6A 2HNAA 4WXRA 2ZUDA 4XFDA 4YALA 3WL5A 4G8JA 4C01A 2W37A 4RS4A 3JYQA 5J5CA 1QHNA 4Q9NA 3HUEA 5CCEA 2ZRDA 1EBFA 1M1UA 3FPLA 3RPEA 3GFBA 2DHDA 2FDXA 2FWJA 1M83A 3CCBA 4JQOA 5DGIA 5IAJA 4BEJA 4BZWA 2V0NA 4MR8A 1WP4A 2H0RA 3DL4A 3NWPA 1QGUB 3A4VA 3K35A 3SYRA 4J4BA 5C1IA 3UJ3X 5C7IO 4KR2A 3EYWA 3K70C 1ZRSA 4FBLA 3G2MA 4ZXFA 1BXRB 2P77A 2VJLA 1NDUA 1CQZA 3KVRA 4D5EA 1FNCA 1FTQA 4PX9A 2WUGA 2JGDA 1G21B 1QHFA 1C4OA 3AETB 4UHFA 2QPAA 3QPDA 4B0PA 2G83A 4C2BA 4AWBA 3KIPA 4DARA 3DEHA 3FVRA 4PZYA 1K7YA 3NB0A 4IGEA 5JO9A 5B7NA 2XTJA 4UM7A 3NYIA 3LBFA 2JH3A 2O0JA 1RLTA 8ABPA 5JNVA 2HTEA 2JPDA 3GGDA 1V8DA 3CN7A 1DEAA 2CVFA 3NAGA 3TKLA 2PZ8A 3KJFA 4N03A 4Q47A 4RYDA 2HU8A 4W5JA 1BGVA 1KL7A 1A5TA 5BUQA 4Q9DA 4LXIA 4YDQA 2LD4A 1Z4OA 2HU7A 2NTEA 3WO0A 5MF6A 3ZHSA 2C7GA 3P0RA 3I73A 1L7DA 3BTVA 3QQPA 4MXDA 2NUAB 5LQJA 1BX1A 3HXKA 5HS6A 5IDQA 2UYYA 4HD8A 5D3MA 2XGGA 1GTJ1 4WADA 1DIOB 2WABA 2UZ4A 2YWBA 3NT4A 3P94A 4R1NA 4Y2PA 3UOWA 3NUZA 2BFEA 2PMFA 4DR5B 1BH2A 3HCFA 2OVBA 2I87A 4KE7A 3ZCVA 2NU8B 3GRFA 1XZMA 4D0GA 1WNFA 5CT4A 1ODSA 4YCCA 2R96A 3CN9A 8AT1A 1EFCA 3K09C 4I08A 5TJHA 4D3DA 1UKAA 3LQYA 3UWKA 1DBQA 1EM8A 3P9RA 5F23A 4Z0PA 1L1QA 1EMDA 4TS4A 4D46A 3DNFA 2DG2A 5CR9A 2RK3A 1XJWA 2CUZA 2WHRA 4GWKA 1UM8A 4BE9A 4CLOB 2DFLA 3MFYA 3C6BA 1GPBA 4EA6A 1UZAA 5LP6C 4CM4A 1BDIA 4DNPA 3KG2A 1SCIA 1DC7A 1VG1A 1WLSA 3PC3A 3UGJA 1EP1B 3U3MA 1UADA 1KI7A 4LHSA 4WIAA 4AW9A 5KOIA 4WN9B 3OJEA 5C5CA 3BSYA 3NIGB 3G2NA 4XJVA 1WDLA 2QZZA 3AI2A 2PUDA 2B2XA 3KYDA 4RIGA 4O4IF 4Q9IA 4ZKEA 1U0FA 5HJEA 3VKHA 1IZZA 2IS1A 1X7XA 4N48A 1FW8A 4IQFA 1YVEI 1GPH1 2J9XB 4GX2A 4PSAA 2OXRA 3VC2A 5JJCA 4UVGA 3VUFA 1VHJA 1A72A 4S12A 2WWXA 5TR9A 2WNSA 2BKUA 1BN6A 2NU7B 3OKPA 4HLQB 4AJPA 4NZ9A 1QTRA 1XMVA 2IXDA 3DD1A 3OA0A 4FBGA 4GOJA 2EFEB 4OSPA 4U2KA 5JSUA 4QXAA 4DN6A 2CXSA 5JNTA 4LJRA 2HMSA 1FYFA 2IXTA 5EJ2A 3SF8A 2XEDA 5CT5A 4D0LB 1G0NA 2KW5A 4RTSA 4FWIB 4HATA 3D31A 4CIVA 1L7PA 1QG4A 4PSCA 2WNHA 1P45A 2H1CA 3E3MA 3OJXA 4A2WA 2YQ5A 5EWJB 4BL5A 1P3JA 1NE2A 2P3LA 3JYPA 4PZ0A 3ITDA 4ZYTA 3K6RA 3CT6A 3HXQA 1U4NA 4YP6A 5LYJF 2BMAA 4V3BA 5IMBA 1XK7A 2O0MA 3CY6A 2FU5C 4AIIA 3K09A 1CJVC 4RMNA 3WP1B 1KJZA 1B93A 2EVWX 3KJHA 4B32A 3GT7A 4Y9RA 1VI6A 5A62A 2WJWA 3E3OA 3UV7A 3NAZA 4J1TC 3QXCA 1MR3F 5EMKA 1K6MA 1EBBA 1GG5A 4YJ2B 2QMUA 1QFYA 3T7IA 4OJMX 1XKXA 5LP6A 5BWCA 1DFGA 2V3WA 2XW6A 1SUDA 2Y99A 1AB5A 1ISHA 4JP5A 2F3RA 4RVSA 4ZPJA 5EKDA 4ENTA 5KOYA 5B2EA 4ENVA 2Z8ZA 2PFKA 4A6PA 1Y81A 2QT9A 3DOFA 1DNPA 2BFCA 2I54A 2IEYA 1QO7A 2Y0CA 2J4FA 1YAJA 1YQGA 1NVGA 1E6UA 2XYHA 3IQZA 1USWA 5B3KA 1YRBA 4UMDA 4CETA 5KYVA 1G8GA 2HRBA 3TR6A 2EWVA 3I12A 3R0ZA 3X0DA 1CJMA 4A92A 4EARA 2NZUG 3NC0C 4EYKA 3FNHA 2AUMA 4A0HA 1UQUA 4BNIA 1MX3A 3A1VA 4N65A 3ZKAA 4AQDA 3PYXA 5K0SA 3U61B 4D5GA 3H2GA 1WR8A 5LXTF 2EV9A 4IW3B 2M6LA 1T9BA 1DPGA 1MH1A 2YFHA 3CZRA 2P9JA 4QGAA 3V1LA 1YBVA 1RAFA 3A4LA 2GYWA 1XZQA 2Q3JA 2UUOA 3IQXA 3RHZA 1Q20A 2XUHA 4MV3A 4RKRA 4ZAYA 3GDOA 1U1EA 2WA2A 1XCGB 3MQFA 1OGIA 5B64A 5J4KA 4B3SB 1OWLA 3DTYA 1A96A 1GSIA 1KNXA 5LNK1 3LP8A 2OHFA 2VPIA 4H1TA 1UDAA 2Q1XA 4N3BA 5ANRB 3PEFA 1Y6JA 2K5UA 1XT6A 2X2FA 3VTAA 4CDRA 2FN3A 5KI6A 1GP2A 2CVHA 2ATXA 4U0KA 2BGTA 3RGGA 3DVAB 3TE6A 3ASVA 5CPBA 5F33A 4J1TA 5C8ZA 4IF4A 5JSQA 4UFNA 1Z9BA 6NULA 3NKFA 4TMYA 4MO9A 1E3TA 2GBLC 3EXEB 2DU8A 5JMPA 4B46A 1OXVA 2WMNB 3M5PA 1E2IA 5KINB 4LGYA 3OE4A 5FWDA 1JFFA 2QM8A 2R1ZA 4WK0B 5TB5A 1JI0A 2AGVA 3UYKA 2ZSDA 3VHRA 1XDWA 2G40A 2QPOA 3Q5EA 2NUBA 2ZR0A 2DTEA 4M9UA 1FXWF 3Q85A 2A0KA 3AR2A 2RHBA 2EJTA 1KYWA 2EKPA 4TN5A 4G26A 4FB4A 3TNYA 1OI2A 4RC9A 4HUTA 5A9SA 1HX7A 3OIDA 5HIMA 1KZ9A 1MENA 2O2XA 3G5MA 3UYLA 1Y8AA 3S6JA 3U2QA 1RCUA 3Q7RA 4G24A 4G5XA 1IBSA 1WHSA 3D59A 2F64A 4HWRA 4Y3UA 2A92A 2G67A 3A6JA 1IWOA 5EVJA 5AW4A 2OM2A 1N1MA 3L46A 3LKZA 4UHDA 3B2QA 3ESBA 4KWHA 1DJPA 1VLZA 2O2IA 4K0KB 3CVJA 4YJ3F 1LK5A 1VPEA 3OCUA 1AK9A 3DKRA 4PHFA 4F60A 1QOQB 1UM9A 1P7YA 4L8VA 4OMFG 1IYZA 3MTIA 1ONSA 2PGJA 4ZDJA 5KNCD 2Y0EA 3KELA 1DKNA 2ABWA 4KLZA 1UDCA 2XT9A 4BFVA 1C0LA 1VKZA 1DX4A 1VKRA 1EWRA 2XCIA 4YT8A 3MC1A 3H7AA 3P0EA 4DMKA 4F2HA 1QHGA 3FWHA 3PHGA 3WZ2A 1IVSA 1GZHB 2CV2A 3GAAA 4OATA 2VRCA 2ZE8A 1IOWA 1JJFA 4MVJG 1ECCA 1X3LA 2O2EA 2QYOA 4YV1A 3PX7A 4WBXC 1AUXA 4PS0A 3HWRA 2HSDA 3HPQA 1N9KA 3DB2A 3KT0A 3R6GA 3JW8A 4PX2A 3JASA 3SZRA 4TV9A 4URVR 5L53A 4KODA 2XUIA 1VP9A 1N3YA 3RNOA 3OIYA 1SC1A 3LE8A 1F6WA 2EW2A 4X54A 3JQAB 1E1RD 5HBGA 2CVOA 5I7VA 3LECA 3WGLA 2VH1A 3B51X 3FROA 4LQ4A 3IE0A 1CU1A 5D51S 1DX6A 3PPVA 4IJMA 4DCVA 1T5SA 3DLHA 3ZGOA 3ND6A 4J3NA 4MZDA 2OFOA 3LWBA 1OBVA 4G5HA 3VYRB 3QFFA 1I8TA 1JT9A 3BMOA 4HEA1 1D1TA 2M32A 3ZS8A 3CLUC 4E6EA 4EW2A 3PFNA 5DIZA 1ZVMA 1DUIA 2VK4A 3DE4X 3DMYA 4PYNA 1SUSA 5KVQA 3RRMA 1AZSC 3CE6A 1C9DB 2A1UA 4AJLA 3IRUA 2Q29A 3EVEA 3ZYCA 1VP3A 2H52A 4FK8A 4U39A 1Y0BA 1IVYA 3PQ8A 3VYTB 5I7RA 3GCWA 5D5QA 3UB4A 4DEXA 2J5QA 1ZJ4A 4PG4A 1RXSA 2ECQA 3WL4A 3HXMA 3GIWA 1U5CA 4GO1A 4CTJA 4YN3A 5HQJA 1EXNA 1QGYA 1VGRA 1VC2A 2O3JA 1FJHA 3FHLA 2QSJA 1OA1A 1P4SA 5KJ1A 4TMTA 4KI0A 3ABRB 4CKXA 3MJDA 3NTXA 1E2NA 5A4MS 5IJ0A 1JQLB 3C45A 4R2IA 5KYNA 4ENWA 1WSBA 1W36C 2I4TA 3RWBA 1J0CA 2HHHB 521PA 1X7ZA 2AJ8A 4WOCA 3T9DA 4K2AA 4OI4A 4JC8A 1QTQA 5CA0B 3Q11A 1COZA 1E20A 1M2JA 2EJWA 1ONBA 1IY0A 4NBVA 2FMIA 1PYOA 1WCIB 1XEFA 3BH7A 3ENKA 4MUKA 4MRPA 1F9EA 1YD7A 3PPWA 2KE5A 5EUMA 5FBWB 4BXOB 4FN5A 5KSWB 4BWVA 3TG2A 4P36A 3A9SA 1DT5A 1Y63A 3V8PA 3K73O 3NVKI 4WLFA 3L2OB 2Q5OA 1V5GA 2AXNA 2I9PA 1S2NA 2ETXA 2OZLB 3C3BA 3QXHA 5DOVA 3T95A 5BWBA 4MDFA 3H5OA 2W6NA 1GT91 1J00A 2A33A 1A9QA 2OP1A 2V0CA 2X1LA 3AB3A 4NONA 3B2EA 3RVOA 4EMTA 3GLIA 4II3A 2HBQA 2HCFA 1CY1A 3E5HA 1CF4A 2W2TA 2AUTA 4OQEA 1CIJA 1MF7A 3W2GA 2PXCA 5GOZA 4D79A 3DD5A 5JNLA 4XIJA 1AN9A 2VSNA 1OLUB 1QZ3A 1FUYB 4RF5A 3I37X 5IYZF 4L7QA 4NCKA 2O6LA 3QKRB 2XE6A 3OC0A 2DPGA 1VA5A 4OD0A 3LHFA 4OY3A 2IYZA 4RMJA 4TLDA 3V1YA 5HDBB 1DTSA 1LLQA 3CWQA 2PKXA 4L9RA 3W34A 3WYAA 1ABBA 1VA4A 2AZDA 4F0JA 2IYAA 3K0AA 1YB4A 4CV2A 1GZ5A 3VZQA 4TZKA 2HPAA 1Z7YA 3H75A 4IXTA 4BNMA 4D2IA 4O4IA 4D02A 1LSSA 4MIKA 4W1RA 3O1IC 4LJSA 4TTIA 3REFA 4MLCA 4BNGA 4HVCA 2FE1A 1CJTC 4KDRA 1L5LA 4EUSA 1D4ZA 5JNSA 1B16A 2BGJA 5A7HA 3DXYA 4LZJA 3CEAA 1XU9A 4FFRA 1GUAA 3ZK8A 2O8FA 4QU0A 4O4HF 3UMCA 3NC4A 4NXNB 1L4NA 3HZZA 4BLTA 3RYTC 2YHSA 3KXIA 1E1QA 3TZKA 1ORRA 2PKCA 4HYQA 3PRKE 3UATA 2GNOA 3ZKWB 3TRKA 2IIVA 4LZAA 4WXHA 1KOGA 3ERCA 4AKEA 4CIAA 2DWOA 4IICA 3PKIA 3C7TA 4O2BB 1KEWA 2O23A 1BCSA 5E4YA 3UMFA 5E8RA 2NGRA 3OJOA 1W30A 4PVCA 2H5LA 4KDEA 4UEQA 1XE3A 5B53A 3DLBA 1XP8A 3CH7A 1BKSB 3EGXB 3AX6A 4KDCA 4GMKA 3REOA 2NO5A 2Q3MA 5ECWA 4EPWA 4A0FA 4DT1A 4EWLA 1D1PA 4ZCIA 1M2OA 1KFEB 2CNKA 3KQVA 3L92A 3AR3A 3HA2A 4V2UA 3WKDA 1WPQA 2ERYA 1Z39A 2FEAA 3DBVO 4DUZB 2BM9A 3ZHZA 1VDMA 4TMZA 1I4TD 3RS2A 3U3JA 4XB1A 1PGJA 5J3JA 1GEEA 2QTAA 3GGCA 1FNNA 3I9V1 2WM9B 3D1LA 1E6MA 3NHBA 5EWMA 1G4HA 3RRZA 3RTAA 1A8UA 3TLXA 1CZKA 3A9CA 5LPNA 1HE5A 4IDHA 5E9JA 3GMDA 3GLHE 4TLEA 2I62A 5EXSA 3SQWA 3LGXA 1NTRA 1KAQA 4RADA 2NZ2A 1A9PA 1XVUA 2KX7A 1NAHA 3RF6A 4TUYF 4B48A 4KTVE 4ABYA 3JZDA 5JS1A 2GN6A 2WIDA 3GJQA 2HX1A 3DF9A 4XLZA 1ECGA 2CB9A 1PQPA 1HA3A 3A2LA 2GPYA 1XEWY 1NPYA 1D8AA 2B1IA 4HXEB 4I55B 1XHEA 1REQA 3AF1A 1O6CA 2X19A 2EG9A 1AS0A 7REQA 2HK8A 1IXKA 4L73A 3EVGA 4BQPA 2OO3A 2ORYA 4S35A 2GRJA 2GLUA 3IAAA 2FPLA 2P9CA 4JFRA 2DH5A 4C3UA 3ZUGA 2XZOA 1YTLA 1IBRA 2MSKA 2Q7XA 3ILYA 3EUEA 3U7IA 5LXTA 4HAZA 1HMYA 3KE8A 4PANA 1WHTA 5JWHA 3SC2B 3TPFA 4E2FA 4MEJA 2C4MA 3GFSA 5T4FA 3O1JC 1D03A 4JWKA 4EF5A 4L5CA 1SOVA 1T2EA 3FM9A 3K2BA 1HLDA 3DM5A 1A8PA 3QVKA 3WTBA 2JJ2A 4ABTA 1UAGA 1YE8A 1BYIA 4UM5A 2FSPA 4WOBA 4M1EA 2XRYA 2X8BA 7YASA 3AFGA 1CUZA 1H93A 2NN3C 3BGIA 2IC5A 1K4MA 3DOJA 3TZEA 2VHWA 2JLVA 2HUPA 1AH2A 1NN1A 3GLRA 4E5YA 2CHQA 3NWOA 1LPNA 2XLBA 5KVVA 4Y1FA 2G72A 3QVUA 2FN4A 1ATIA 2QL9A 4B7UA 1I2BA 4B85A 1U8YA 1UEIA 3KLBA 4JVOA 2PWPA 2W6PA 3LT1A 4KOEC 4S04A 4RPIA 1MOQA 4ZAGA 3JD2A 1DRJA 1Z83A 5J2UF 3NHRA 5TS3A 4Q4CA 1JHYA 1INLA 1VKHA 4I5DA 4UBIA 4E22A 5KOHB 2WINI 3OQIB 4RPKA 4HGPA 1YQXA 3A1WA 3BH6A 4L0CA 1SURA 1TCCA 2M6SA 5DHQA 3WXBA 5AW7A 3X44A 3CYFA 4YS6A 4BATA 2IW3A 2TECE 3FOWA 2Q2NA 3ESQA 4IDBA 1SXJB 2AI2A 3DDCA 1GZ6A 2WIAA 4ZOEA 1NVTA 3EZXA 1TVKA 3DLTA 3UICA 1GLVA 2IODA 1E7SA 2IHTA 2WSYB 3I2HA 3IRVA 4MMYB 3HL0A 4N0QA 3WSTA 3ZXSA 4WY5A 2Q0HA 2OBMA 2YV5A 5IAKA 3FYTA 1EG2A 4E5KA 3IBTA 3L4BC 3LNCA 3MBOA 3BFJA 5CNMA 4YVFA 3TZ6A 3BHJA 3EPJA 2VZEA 2ZDHA 1YNSA 4XR4A 3KDPA 5IP5A 1AMUA 1AC5A 4Z6KA 4RW0A 1TQ8A 5JQWA 7MDHA 1BMQA 1O0SA 1E1YA 4PAQA 1JQ3A 1MMFB 2ENUA 4RJLA 4UDOA 4W5HA 4YJ3A 2D6FA 4ND5A 1N6LA 3GVCA 1S8AA 4UAVA 2E4YA 3HB9A 1K98A 4C76A 4KE8A 1P2UA 3GLUA 4X92A 3RGWS 2JNWA 5IKMA 3L8DA 4DUPA 3F6EX 5HFJA 1OYVA 3V55A 4TYNA 1TM2A 1RSZA 2FSFA 4GSKA 1R9NA 2A30A 2KB0A 3M1IA 1CUJA 1Z82A 4FM9A 1T2FA 4C5BA 1JEYB 3HY4A 1O95C 2QV7A 1T6BY 5C8YB 3GC6A 2XUDA 5CH3A 1YIAA 3OZBA 1SC9A 4ITVA 1U3VA 1WB4A 5TF4A 1CVRA 4BNHA 1E9VA 3E3AA 3R3XA 4LW8A 4ZVSA 4JI6B 3E2PA 3VTFA 1PWXA 5CIWA 1GCGA 3GV0A 1E2LA 1ZIYA 1SCDA 1RXEA 2QD3A 4EDFA 3EC2A 5CD9A 4QPCA 5FHQA 2QTMA 4K9KA 3OEHD 4J2HA 5AJUA 4ROTA 3TQSA 5E2IA 4G37A 4CV1A 4KMMA 1D0VA 2ZYWX 3EW7A 4JGBA 3PWTA 2JDID 3DULA 2BZSA 4JFAA 1I0IA 3UJ7A 5ICEA 2CBXA 1JLSA 2Y1EA 1A5BB 4WKNA 3L0ZA 1TZCA 5SY6A 1H5NA 3ZH9B 2QMEA 4E15A 3SQNA 2I66A 4UBMA 4F8JA 3ZR4B 4F7WA 3E03A 1GKIA 3AYXB 1U7TA 3AR4A 1E5XA 2M98A 1F0KA 3L4BA 3C70A 4INJA 4P6VF 5G0SA 5A3RA 3CSSA 1QM5A 4DLVA 5BORA 5J4LA 5AOBA 4E33A 4AS1A 4BC0A 3VZSA 1QYXA 2ODNA 2ZIUB 3ZE1B 1M5RA 2Q5HA 1E5QA 1RQNA 3P2EA 4PEVA 4QFBA 2V54A 1YR3A 4KV7A 2JGAA 4MS4A 4HH3C 5FB3A 4GYWA 4ZGBA 4D7AA 4YXFA 4PR3A 3FOFC 1AURA 2CEKA 4WWHA 4BPBA 2QRVA 4QWMA 3RODA 1WM1A 4UE2A 1W73A 3MMPA 3DFMA 4CUJA 1TUBB 3ZWYA 2OCLA 3AL2A 3N75A 3TBHA 4CM8A 3D8RA 3AVUA 1MW8X 3D0QA 3ICCA 4ARZA 4GKJB 5J59A 1O95A 3RSZA 4ZI2A 1CUSA 1RKVA 4AC9A 4RNCA 4BX8A 3LBNA 1EP9A 4JVLA 2C5GA 3D5QA 1TQ6A 3F7NA 1QKJA 4LZOA 5B4VA 4ME6A 4XRRA 4DLPA 4BY9E 2C77A 1EU1A 4MIYA 4FFVA 1CR1A 4RZHA 1DIGA 4E70A 1XDGA 2AK3A 1EBUA 2GB4A 4OVKA 4X66B 4K3UA 5FWXA 5I4KA 1TEXA 3AO0B 5EQFA 4U8GA 3ZDQA 1RXVA 4AM8A 4QM6A 1ST2A 2ZJFA 3ME5A 2IZ1A 3HB7A 4I1VA 3HM9A 1NP7A 1QFJA 5KC9A 1EESA 1HOTA 4QIHA 3S7TA 1PJRA 2HYDA 1AQLA 2W2LD 3VM6A 5HCIA 3CIOA 2R7AA 1S2IA 4LDAA 2I1WA 5J5AA 3R7WA 5IYZA 4I1OA 5KWJA 4FYWA 1XO1A 2PH7A 4LV5B 1Y8RA 5AW3A 1M8GA 4M0EA 4Y0AA 2B2CA 1UXJA 1R5NA 4BLRA 1JGTA 1V5EA 3NOQA 4H3VA 2ECKA 4HUJA 3ESYA 3B53X 1QWSA 1HNZB 4QOSA 1D5CA 2J9GA 2ZCUA 3H2BA 3UK1A 1CS0A 1HF3A 3O47A 3O8DA 1B74A 3LUJA 4ZT6A 4HVTA 3MLAA 5C9ZA 1JAZA 2J45A 4B47A 4LWPA 2JC3A 4CV3A 4HG2A 5J63A 4O3MA 3DZFA 4N47A 4UBKA 4YXWD 5ISMA 5JXIA 4K0RA 4KAAA 4UNPA 4LOLA 3USZA 4FNMA 4OSOA 1L9XA 1ZUWA 4QYMA 2C5BA 4O4HA 3LUDA 3QELB 4IUCS 3OZXA 1A7KA 3JARB 4MQFA 4BP1A 4QJ3A 3RVSA 1V3UA 5CLIA 2WT8A 3MT0A 3WB0A 5BY2A 4MW9A 5BYJA 2DCMA 3UQYS 4YJHA 4K9OA 2VHTA 2QTFA 4G4SO 2G1UA 3I3SR 2WU1A 4LNUB 3HCOA 4C0XA 4DJAA 2LV8A 1M72A 2JK1A 2R47A 3CNBA 2E18A 3PJEA 3AUYA 4JL5A 2FX2A 1ZD2P 3KSAC 4C07A 5THXA 4P80A 1Z8NA 3AVXA 1T0JB 2XOKA 4IIHA 2IH2A 1QG2A 4EY7A 2XKAA 3PNYA 5HOQA 1Q22A 3BE6A 3E7PA 4KXUA 1JE0A 1V1RA 2FPWA 1Z6XA 2WFAA 4YRGA 3D3KA 3DTVB 4NYIR 5FOSA 2P8JA 4BMNA 4DLXA 1U9IA 1E7WA 1OI4A 2IX9A 4HQOA 2GD1O 2JAWA 3PXXA 2CLKB 4NOKA 4D3ZA 1FYDA 4D8VA 3Q2OA 3R6DA 2HPHA 1X77A 3EODA 1T2NA 2ZUSA 4MKZA 4H6XA 3OEWA 4J8PA 1B6RA 4NS1A 3SOZA 5CG2A 3WL8A 1U3TA 2J30A 3EW9A 4ZO8A 2YYZA 5C1PA 5IUJC 3Q1LA 1P72A 4HH4A 4ANFA 1OBCA 3LRXA 2I3DA 1I6LA 2MSNA 4MUMA 1DCTA 3MXTA 4G01B 3ZDRA 5IKOA 4TUYA 1UZMA 3LZDA 3UH0A 3IH5A 3SYKA 5YASA 3K0KA 3CE9A 3W78A 3E9EA 3IIMA 1SBQA 5T7BA 2HK6A 4RZUA 3T3EA 4KQKA 1ZL0A 2F1RA 2KPOA 4KIWA 4BLVA 1E98A 5JQGB 3A31A 1Q7EA 4J0DA 5KYUB 4X94A 1XQ1A 1WZNA 4KGXA 1H4SA 2WDZA 3COVA 3IBYA 3JVDA 1JKIA 5JFOA 2XYGA 4KACA 2HA7A 4OP3A 5KNCH 4OFBA 4DF3A 3OPYA 4F12A 3SEQA 5CBPA 1HTTA 1T2UA 5E2AA 2BE9A 4LJYA 2GD0A 2C8KA 3S27A 4ZGGA 5EZYF 4D6YA 8OHMA 2C0QA 2M1ZA 3I53A 1QZTA 1KRHA 3QMWA 2F8LA 3WWOA 1V7CA 4WBNF 4HWGA 1G3UA 3KVVA 4PS1A 4L5YA 4NQZA 1JDJA 3D7RA 1P0CA 2E48A 2JIRA 3A6FA 3RVLA 1NV8A 5A2QA 2MTBA 1YK0A 2GEUA 3GUHA 3Q9LA 2VK8A 3KSZO 4M8NE 3ZIAD 3ZLUA 1TPZA 4ECAA 1P31A 1YA4A 2X8JA 5K0NA 4ZJPA 1OZFA 3DO5A 4UQLA 2H8GA 4ZQHA 5HSGA 5A9RA 1BN7A 2H1VA 3O4GA 1NC3A 3RASA 1F8GA 3EVFA 4ZCSA 1ZN2A 3TUJC 3T12A 4AKSA 2NU6A 2DBVO 5I7OA 4K9QA 4JQYA 4K9PA 1M6HA 1EJ6A 4YBRA 1Q14A 1KFKB 3E9QA 1M0SA 2WZCA 3BK7A 1RQGA 2AKAB 4HCJA 2O6HA 3O2NA 2CDNA 4KN5A 3NBUA 4WH0A 5D3ZA 3EC7A 3UJ6A 1MAVA 1UPAA 2WJZB 4K7JA 4R0NA 1Y6RA 3AOGA 3OEYA 1W49A 1KYTA 2WWIA 1SCJA 2DSNA 4IJVA 2CXUA 1GV1A 1RWNA 2PS0A 1OROA 2OCIA 2O5RA 2QVXX 3HVUA 3KEMA 3I4FA 3RLFA 4H15A 3S2EA 3LAWA 1SB9A 1NRIA 3PT5A 4TKVB 1ZVJA 1WBBA 1U81A 1L8OA 1KAOA 2ZPAA 3FN4A 3U81A 3WJ2A 2L19A 4HHEA 2NLOA 3ROXA 4FEAA 1VPLA 2NYRA 1NQ5A 2WM3A 4F4IA 5IVIA 3S68A 2W6OA 1VGQA 3E53A 5FNVF 5KYXB 4LXXA 3N2NA 4NI5A 1JSRA 1EFLA 5AK6A 3KJXA 3CWZA 1X3SA 4B6QA 5JSZA 2ZQ5A 2JFFA 4MWGA 1TZBA 4HDRA 4K26A 2R6DA 3EDMA 4JJKA 3IUYA 3PUKA 3SFZA 4YA6A 2CV0A 3B3JA 4PZEA 1PZNA 1Q3HA 2CWDA 3C6XA 1GGVA 1TJ3A 3RSGA 2B0JA 4REMA 4G63A 5GM1A 3OQVA 3K9HA 2ZM5A 2FXIA 2POQX 4OGWA 3K8OE 4LYEA 4WESB 1FS4A 3JWIA 3CR8A 4D45A 3BD7A 2AMVA 3CLKA 4HX5A 2XCSB 1UXIA 2H48A 3DWFA 2WFMA 3OF5A 4QQRA 3ANSA 3PZBA 4AZWA 1B6TA 1KAHA 3OCCA 3NIDB 3DUFA 4IYJA 3ZQ6A 5B3JC 3OF2A 3QOXA 4HGNA 4QL3A 2R44A 5AKLA 3NBKA 4QZVA 4AX8A 2A58A 3AUXA 4N1AA 4CMIB 1ZJ5A 4KW7A 3D5EA 3ECCA 4MI1A 4IRXA 3VPFA 4D3YA 2A1TS 4LYYA 1JNYA 2A9FA 1J0BA 3FH0A 2GJ4A 2JKZA 5A6SB 2Z5LA 2NW6A 3KZCA 4LHWA 4KQGA 2B3DA 1F0YA 1N2JA 2OBYA 2QLNA 3W3AH 4I50B 1ZGBA 3I58A 1RAAA 1WXFA 4DPLA 3D7SA 5AHOA 5FWYB 2EW8A 3A6PC 1JB9A 1NJ5A 2WBLC 1L7BA 1Z2PX 2GZHA 4FXPA 1JHXA 2W93A 3F6BX 1UJ2A 5L9AA 4FONA 1YL6A 5A6VA 5KNDA 1P73A 4ZTUB 3HSSA 4Q34A 1KGDA 1Z2CA 1FPQA 3C3YA 1LW6E 2O3TA 1DOHA 2X0NA 4OCZA 3UNXA 3UTCA 3V5NA 4YMGA 3ODGA 1DCMA 1P4HA 1VXRA 4I5EA 1UBSB 3ZLBA 2ZULA 5H81A 1WXXA 1ARZA 1XXHE 3M3DA 1YZKA 3LHKA 3N6VA 1JIQA 3N58A 4ZU1X 2A8YA 2CZGA 2XQFA 3FYDA 3FYHA 4KXQA 3VH3A 1VLJA 4QU8A 2EAUA 4DM7A 2PEYA 1XCOA 2TYSB 2ZZNA 2O4CA 1P0MA 3OFND 1VSQA 3KZMA 2R2AA 4QECA 4B35A 4U4AA 4P3KA 2ZDQA 2OWEA 2FSIA 3OECA 1R6TA 4KQCA 2B8WA 5TQ0B 3IAEA 2R97A 2DQKA 3HP4A 2JFBA 3EUFA 3LPDA 3EEOA 1LD3A 2CBGA 1N4DA 3JYLA 3QOFA 4ZVUA 3BCRA 4L76A 2XX3A 4JXXA 3VX4A 1E3WA 1Y3BE 1GRCA 2OV8A 1ESEA 1X6VA 2QGFA 2Z1MA 5EG5A 4PAOA 1YDMA 5F7JA 3VJKA 2FSVA 4B7AA 3U5ZB 2XGSA 3I1JA 4R3WA 5J43A 5ED0A 1TYDE 2B4AA 1MJ5A 4NCHA 1NRWA 4A1OA 2GAJA 3AINA 2ZKIA 5CK4A 2CLDX 2AFHA 3N0VA 2WZDA 3MN1A 4GGMX 2HHJA 5D3KA 4DAEA 3GLGE 3MMXA 1MJGA 5EIBD 1KOFA 3TDMA 1HTBA 1KC1A 1XPRA 3I1FA 1Z47A 2PQ2A 1KI4A 4ZTZB 1JH9A 3IT0A 3EK2A 1KK3A 3OA2A 4FCCA 5JI2E 1UPXA 2FWRA 2Y0DA 4Z0HO 4P83A 1SC6A 4MB0A 3B7GA 4QDJA 3V3TA 2FZLA 2HDWA 5KQMA 2B4RO 3NWEA 3ETJA 4KWTA 4WDRA 3TRIA 1Y6QA 5FJJA 3R24A 4BQRA 5JCJD 4C89A 4IX1A 4NMHA 5JCXA 2B4KA 3NHLA 2Q4RA 1U1CA 2XD4A 4BNDB 4EHFA 1JLLA 2WFLB 3MD0A 3VPSA 2OSBA 3BB4A 1CQJA 4IKOA 4JLAA 4KXXA 5FUWA 3IFSA 2QRUA 3Q0IA 1PZMA 1XMJA 3VZBA 2QYSA 3N2GB 4L2IB 4LXUA 1YJAA 2B21A 5I9SA 1U0GA 2X14A 2O1EA 3HHEA 3A2NA 4I1PA 2YOGA 4ZEOA 4B3MB 4WEOA 4FQ8A 1AUVA 2O8DA 3IQIX 2UUBB 2N42A 4XM0A 2GDJA 1E3LA 1AKYA 2ZXEA 3FI0A 4EZBA 1T9CA 2IVZA 1GDTA 2HNKA 5GV8A 4E1BA 3SZ3A 1L5RA 4F72A 3HLTA 1BSVA 2X7HA 2NO7A 2XTZA 3A8TA 3FR8A 3H11B 3QFTA 4IILA 4JJAA 5JG7A 3T9EA 3LYLA 2HWUA 3NNDA 3K7EA 1QVRA 4KXMA 1ISPA 1WMSA 2Y6UA 2IKQA 3UPTA 2PX8A 1YBMA 3DDSA 3MAJA 2R1UA 4LXYA 1HT3A 1OB5A 4BMSA 4I1YA 4MQ5A 1Y7LA 1HT2E 2FRDC 1IWBB 1E9AA 1V3QE 3TLGA 1YBHA 1W48A 3PD1A 4QE3A 1FDWA 2JGRA 2VDKB 3E4DA 4HY3A 3W2EA 4JMPA 2HMAA 2WTEA 4NJEA 2EIXA 1A5SB 2C5LA 4IHJB 5KC8A 4WLUA 4RGBA 5JCZA 2XWPA 1JEDA 2FQQA 1JWLA 3HMQA 3L0DA 2YNMD 4AIRA 4B80A 3O8BA 1F17A 3K31A 3GYGA 3TAUA 3BRSA 3OPQA 4XFJA 1W4ZA 3O4HA 3OD5A 4WTOA 3S8MA 3RTGA 2P4QA 2BMWA 3HWSA 6YASA 3DEKA 2I2DA 2OAP1 1V6CA 3N5KA 4QFMA 5AI0A 3QOYA 3UM9A 4UVHA 4F3YA 3QMMA 3X43A 1WF3A 3IODA 2ZJ8A 1F12A 4C06A 4UTVA 3RSSA 2QR3A 3A1CA 2YWCA 4NL4H 4YRBA 4TTQA 2HQOA 5EP3A 2CMFA 5K20A 4MLZA 4IVNA 4UCXA 4MCIA 5L3SB 3M3HA 4TKMA 1GPMA 5BRAA 4K46A 2ANCA 1MT0A 1XRSB 4XCXA 4IYRA 3VMFA 4G56A 3RTEA 3WGOA 1KIAA 3DAYA 3IAM1 4BUZA 3HZHA 3JVIA 3STXA 3HJCA 2LTAA 1QGOA 3EZ2A 3IEPA 2R1VB 2ZTSA 4GS5A 1O94D 1RI2A 2HY7A 2NNWB 1GU0A 4HNGA 1QJCA 2PV7A 5TQ2B 4YCMA 1B7GO 1G20E 5EZYA 1XZ8A 3OEEA 1YO6A 4LK3A 5GV7A 4WBNA 1XRLA 1Z0AA 3K0EA 4PSDA 1CEEA 1UMBA 2CCKA 3DBHB 3EEBA 2FRDA 3GT4A 5HFAA 1OU0A 2GCPA 4HXGA 4LPKA 1P0IA 3D81A 3OQJA 3BA6A 4ML3A 4NMMA 4IX9A 1QVWA 4FE4A 1E1LA 2EXXA 2X0EA 1H23A 5LKAA 1FFYA 4H1VA 2D8AA 3AKZA 1DWOA 2CHUA 1VSVA 4RWEA 5EMNA 4MQEA 1QGED 1GCUA 2AZMA 3LL4A 4M6WB 4NMXB 2W5UA 3WL3A 3WLAA 4LIPD 1L7AA 3BL8A 1H0SA 4H7DA 4R1MA 2Z3WA 1T0BA 4ZT5A 5FULA 1KBQA 1BXKA 2WAAA 2FH5B 1OI3A 1SXHA 2YHAA 1VCNA 3NNSA 4HQ6A 1HKUA 1R4NA 4J0EA 5B2ZA 3SGLA 4FOSA 1JLHA 4LBZA 1AGYA 1CB7A 3ZG6A 3DOCA 1JR3A 5JNWA 3LWZA 2PMKA 4IUBS 1L5HA 2F3QA 4DHEA 1K89A 2WDPA 2OLJA 5U4XA 3LU1A 3OBBA 3N28A 3RREA 4AZ3A 1AO3A 1N5LA 4QXQA 4XX0B 1JHUA 5TQJA 2WA1A 1E6WA 1ZA1A 4PGMA 4EY8A 2YDYA 2A1IA 3KWMA 3OTIA 4IIUA 5FNVA 1E79D 2VG8A 3WNVA 2QMOA 1H2XA 3NETA 3KXDA 1NLMA 2AD1A 1G3QA 2CKDA 1V26A 2H7CA 4NZYA 1DEKA 3FPSA 3PJFA 4YP9A 4DMFA 3DE2X 2FUCA 4F84A 4AJHA 4TLCA 3AT1A 2R84A 2J3HA 5IEBA 1XQWA 3ET4A 4RL4A 4JASB 3ENNA 1M5TA 4CIWA 4IY1A 3E05A 5BPFA 1IEWA 1USIA 4HDCA 5G02A 3CURA 2F3UA 3M4JA 4RETA 3GLQA