3GDHA

Methyltransferase domain of human trimethylguanosine synthase 1 (tgs1) bound to m7gtp and adenosyl-homocysteine (active form)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
211
structure length
211
Chain Sequence
LPPEIAAVPELAKYWAQRYRLFSRFDDGIKLDREGWFSVTPEKIAEHIAGRVSQSFKCDVVVDAFCGVGGNTIQFALTGMRVIAIDIDPVKIALARNNAEVYGIADKIEFICGDFLLLASFLKADVVFLSPPWGGPDYATAETFDIRTMMSPDGFEIFRLSKKITNNIVYFLPRNADIDQVASLAGPGGQVEIEQNFLNNKLKTITAYFGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Trimethylguanosine synthase homolog
publication title Structural basis for m7G-cap hypermethylation of small nuclear, small nucleolar and telomerase RNA by the dimethyltransferase TGS1.
pubmed doi rcsb
source organism Homo sapiens
total genus 74
structure length 211
sequence length 211
chains with identical sequence B, C
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09445 Methyltransf_15 RNA cap guanine-N2 methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3gdhA00
4P58A 4BY9E 5D1NA 2FHPA 3BGIA 2P3LA 3PVCA 4FZVA 1WS6A 3LGAA 5EMLA 4ER7A 2N47A 5FADA 3OU6A 5FWAA 2V7EA 4OBWA 3V97A 4FR0A 3P9NA 3LL7A 3OCJA 2HTEA 4GUAA 1FJXA 2G72A 3B3FA 3FRIA 5LQUA 3NVKI 5EOVA 3HVJA 3AJDA 3UJ7A 1FP2A 3KQMA 5DWQA 1DUSA 2KW5A 3DUWA 2AR0A 5K8VA 3I9FA 3FZGA 4XCXA 5F2KA 1KYWA 1D2CA 5LSAA 1DL5A 3X0DA 1XJ5A 1G6Q1 2ZIFA 5EMKA 1ORHA 1R6AA 5FA8A 3THSA 3FUWA 3KQTA 3ME5A 2LD4A 4C4AA 2AOWA 2PVCA 2PJDA 2C7QA 2PKWA 4KVZA 5EGSA 2C7PA 2G71A 3EVEA 3GRRA 3FRHA 2PT9A 4CKBA 5EZQA 4WXHA 5BP7A 2PX8A 4V0QA 5ERGB 3NWEA 2ZBQA 4MTLA 3TOSA 2PWYA 4AZVA 4P7JA 3EEOA 5HEKA 2ZZMA 3OPNA 3H2BA 1KPHA 2Z6UA 3K6RA 3KPJA 2HWKA 2ZWAA 4P7GA 3FPJA 1AF7A 2QRVA 3FUVA 2BZGA 3DMGA 1NV8A 3GIWA 5ICFA 3JWHA 1XVAA 3A27A 3PX3A 3EVDA 3GRVA 3R0QA 4ER5A 4ATNA 3TKAA 4YUXA 3KQQA 5HIMA 1NBHA 3FYCA 2UYQA 4F85A 2ZZKA 3DMFA 5DRTA 3HM2A 3PFGA 3OZRA 2CMGA 2VZ9A 5CVUA 4RTOA 4AUKA 1I1NA 2NXCA 3PLAE 1XDZA 2B78A 2ZBRA 4QTTB 1D2GA 5E9JA 5GM2A 2AN3A 3GXOA 5DX8A 3UA3A 4IV8A 5DRYA 1R8YA 2K4MA 1KR5A 4C05A 1NKVA 3DLCA 3C3PA 1MHTA 3EGEA 3EVZA 3MB5A 4C08A 2O07A 1VL5A 3HVHA 4FS8A 2GA9A 2GS9A 3G5TA 4EQZA 1QAQA 3P9IA 4FP9A 4LWOA 4E33A 3EVGA 2ZFUA 3G2QA 1R8XA 5B1SA 2GH1A 3FTFA 1VQ1A 2BR3A 3HCEA 5HILA 4YMHA 3HA5A 3HVKA 4PCLA 1X1CA 5E1OA 1G8SA 4U7TB 5EG5A 4DMGA 2JHPA 3PS9A 3TQSA 2IFTA 2YR0A 3JWIA 5DX0A 3OZTA 3HNRA 2DULA 1V39A 2XVMA 3MAGA 4XUDA 5FULA 1WY7A 3LX6A 5FQOA 2EX4A 2P41A 4QTUB 5CIYA 5FQNA 1AQJA 1YUBA 2AOTB 3TMAA 4E2YA 1TW2A 1R18A 5DXJA 4KDCA 3SGLA 3UJCA 2PXAA 2BH2A 3TKYA 4GC9A 4QDKA 2AN4A 3CJTA 4PYJA 5GIPE 4BLVA 4KWCA 4EMSA 5K01A 3LBYA 4FGZA 5KYGA 1NT2A 1FP1D 1G60A 3KQVA 2H11A 4NECA 3JWJA 3AWIA 2ZULA 3R24A 4PYIA 5HIJA 2P8JA 3NMUF 1P39A 1L3CA 3SVZA 4RTSA 2V74B 2Y1XA 3CVOA 1AV6A 1JG2A 2P35A 4PCAA 4C07A 3O31A 1M6EX 3ANXA 4HRAA 5T6BA 4YMGA 2UYHA 3GJYA 3DXYA 3P9KA 5EVJA 5T64A 1X19A 2Q41A 3S68A 4OA5A 2YQZA 3U81A 2OZVA 1R74A 4QVGA 5GM1A 2ZLBA 4DZRA 4RTQA 1P91A 2G70A 5EHIA 5CVEA 3UJ9A 4CKCA 3GNLA 3GO4A 3KR2A 4IKPA 4YV2A 3SX0A 4GOND 4YV1A 3QV2A 3L8DA 1ZG3A 4GOOD 3G89A 3NVMB 5K05A 2A14A 5CD1A 1VP9A 4U7PB 4OQDA 3GRYA 4CTJA 4RSRA 3G8AA 1N7JA 2GAFA 3ER8A 2EJTA 3MERA 5E9WA 2UZ4A 5DTRA 1ORIA 1H1DA 4RX1A 3SSMA 5EZSA 4AZTA 5C9ZA 3DR5A 3ID6C 4R6WA 5C0OE 1QYRA 3MTEA 7MHTA 4BP3A 5DM1A 2ZTHA 3EGVA 1EJ0A 3SXJA 4E2ZA 5LR6A 3NDJA 3M4XA 1F38A 1JTEA 2IDJA 4MIKA 3KPVA 3KPUA 1SKMA 5HIKA 1IXKA 4CTKA 2PX2A 3KPWA 5E1MA 5U4XA 2PT6A 3CBGA 5FA5A 3EVAA 3T7RA 3KPYA 1O9GA 1JQEA 2I9KA 1VE3A 3G2MA 3LECA 5LQAA 1WG8A 3G7UA 4O29A 5EC8A 3FPHA 3FYDA 1NV9A 4DCMA 3FUUA 2PGXA 3AXTA 3LCVB 1L9KA 3PFHA 4Y30A 1SUSA 5GP1A 3T7TA 4E31A 3HCCA 4XUEA 5K0EA 4PGHA 1D2HA 2QE6A 1MJFA 1VLMA 1Q0TA 3B7PA 3DXXA 3O4FA 1Y8CA 4P7KA 3LBFA 1F3LA 2AVDA 5BW4A 1X1BA 3V8VA 2OB1A 5JUWA 1L1EA 3Q87B 5DM2A 3F4KA 3E7PA 4E32A 5DSTA 2ZCJA 2ZW9A 4C04A 4ISCA 4QQKA 1XCLA 3BWYA 3ER9A 4HGYA 3C6KA 4PNEA 2EJUA 3ELWA 3BWMA 2CKDA 3LDFA 3PT9A 1KXZA 3BWBA 2QRVB 1RI2A 1EJ6A 1KP9A 2VDVE 1JQ3A 3HP7A 3UWPA 4PYLA 4PYMA 2CL5A 3G88A 2F8LA 5HFJA 2OPBA 3E8SA 3TR6A 2AOVA 3RODA 2JH8A 3HEMA 4IV0A 3BXOA 2ONYA 3EGIA 1XCJA 3HVIA 5DTQA 4ER3A 5K0CA 4PYKA 2ZWVA 3OU2A 2OB2A 3ORHA 4PYNA 2YX1A 5E1DA 3PB3A 4DCGA 1DCTA 3LKDA 3I64A 5H02A 4FSXA 3MCZA 5F2NA 5CVJA 4DQ0A 2VP3A 1RJFA 2ZVJA 1EAMA 2OY0A 4RWZA 4A6DA 2HR1A 2AOUA 4F84A 3B3GA 1JG1A 4R8SA 3HCAA 5ICGA 4M7RA 1SVUA 2IIPA 5LQKA 1JSZA 1L3IA 2HV9A 2R3SA 3FUTA 3P71T 4RVGA 4CKEA 4LG1A 4HSGA 1QZZA 4QPNA 1SUIA 1EQAA 5K0JA 4OX9Y 3DOUA 2NXEA 2PBFA 5K09A 2C7OA 5FHRA 4E30A 4MWZA 5HZMA 3KHKA 4K6MA 3AY0A 1UFKA 1Q0SA 2BM9A 3GRZA 3NTVA 4RTKA 3QOXA 5FWDA 4EVIA 2UYCA 3MGGA 3B3JA 1N2XA 1SQFA 1N7IA 5EIWA 4RTNA 4CXMA 5EPEA 1QANA 4X41A 3O7WA 3MCTA 4HTFA 1NW5A 1Z3CA 2UYOA 4RVHA 5CCXA 1WXWA 1XTPA 2JJQA 4PIMA 3FTDA 4F86A 2VS1A 2ERCA 4A6EA 3LDGA 1NW7A 3P97A 9MHTA 1RJEA 1SG9A 5EIFA 3REOA 4DM3A 5DM0A 2XBMA 4DF3A 3CC8A 3CKKA 5P8WA 1WXXA 2O06A 2PXXA 4YUYA 4RTJA 2QY6A 5DX1A 4CWAA 3GU3A 1NBIA 3ELDA 2XYQA 4FT4A 3TM5A 1XDSA 3IYLW 4RV9A 2HNKA 3CCFA 4GOMD 3UA4A 3I58A 3TRKA 3BZBA 4E2XA 5LQCA 4RVDA 3CGGA 8MHTA 2AOXA 5HIIA 4GF5A 2JH9A 2B2CA 3HCFA 4FSDA 4HGZA 3R9XB 5EEHA 1RI4A 2QM3A 3HA7A 4G56A 5EMJA 2PX5A 2CWWA 2P3QA 2O0LA 3KQSA 3KQYA 5KVAA 4HG2A 2P40A 2IBTA 1RJGA 3LHDA 4RVFA 5DPMA 4R6XA 1XXLA 2VDUE 1RJDA 3CJQA 5F2OA 4RTRA 1JQDA 2P7HA 5D1HA 3GWZA 3PTAA 3UJ8A 5KQSA 3KU1A 3Q7EA 2PLWA 5GWXA 3M70A 3DP7A 3KQWA 2ZIGA 5K0LA 3EVCA 5K03A 3UJ6A 2XYRA 3G2PA 1JG3A 4C03A 1M0EA 1JR4A 3R6TA 2YVLA 5E1BA 3BKXA 3OFKA 4GQBA 3HCBA 2PWPA 1B42A 3P9CA 3OZSA 3T7SA 4RTLA 1ZHFA 2B25A 4X1OA 5DSXA 5DXAA 1VIDA 4AX8A 1FBNA 2OYRA 3FPFA 3I53A 3BKWA 2FYTA 2XVAA 1JG4A 3UJAA 1XDUA 3M33A 3P8ZA 4XUCA 5IH3A 3DLIA 4BLUA 3PX2A 4PONA 3TM4A 2IH5A 4RTMA 3UFBA 2ZIEA 5E8RA 2GLUA 1RI3A 2OKCA 3G2OA 1INLA 3BGVA 4RYLA 3KR9A 3RW9A 5EEGA 4JXJA 1VBFA 4GC5A 1BOOA 3OE4A 5FCDA 5K0BA 4R8RA 5JR3A 3T0IA 4PYQA 2H1RA 3MTIA 4QDJA 2B3TA 3C6MA 4ZTBA 1WZNA 1YB2A 1ZGAA 3LCUA 3LSTA 1HMYA 4IWNA 4PWYA 2YXEA 3GGDA 4DKJA 4E70A 1G38A 1PJZA 1YZ3A 2IBSA 1NW6A 3SR4A 5KS2A 3I5UA 3HA3A 4X60A 1SQGA 4LWPA 3SM3A 3UJBA 3EPPA 3GDHA 4X63A 5EKUA 2PV0A 1X1AA 2PSSA 3B5IA 3KKZA 1RI5A 5EMMA 5K0NA 4YUVA 4YV0A 3EMDA 3BGDA 4KIFA 5G02A 1HNNA 2FCAA 4KDRA 1QAOA 3C0KA 3EVFA 2ZSUA 4GBED 1FPQA 1G8AA 5LQNA 2IP2A 1P1CA 2BR4A 4OBXA 4QVKA 3ERCA 4KW7A 3P2EA 3R3HA 4M36A 4B17A 1EIZA 3NWBA 1YF3A 2HMYB 2H00A 1AQIA 4BLWA 2BM8A 1KYZA 4PINA 4V0RA 1T43A 1UWVA 2ESRA 3E05A 3THRA 2IH2A 5EHGA 1YZHA 3M6UA 2PX4A 3VYWA 4E2WA 5GIOE 1JSXA 2O57A 1IM8A 1I4WA 4KRGA 4PGGA 4BP1A 3NW9A 5DT2A 1U2ZA 3OU7A 2YUIA 2NXNA 2CMHA 2ORED 3NJRA 3IV6A 1NW3A 2AN5A 1BKYA 2FPOA 3P2IA 1YFJA 3TLJA 4H0NA 4M38A 1VPTA 3HCDA 3A25A 4EKIA 2JG3A 2AOUB 2I7CA 3KQOA 3MHTA 2XYVA 3G5LA 3VC2A 1PRYA 1IY9A 4HC4A 3OFJA 4FT2A 3SMQA 3UZUA 2NP6A 2YXLA 3LKZA 1R00A 5LQRA 5M5BA 1ZQ9A 3AXSA 4AZSA 2GPYA 1OR8A 3A4TA 5T67A 5CCBA 4OQEA 4EK9A 3FTEA 2JHCA 4YUWA 2AZTA 2R6ZA 4L7VA 2QYOA 3A26A 3B89A 4GEKA 1UIRA 3DH0A 3ELYA 3P2KA 3K0BA 1X1DA 5CVVA 2AVNA 3G8BA 1I9GA 1BHJA 1ZKDA 2PXCA 2P1DA 2OO3A 3A7EA 3C3YA 2IPXA 1L3BA 4WVLA 3KQPA 1BC5A 3JWGA 4PYOA 2I62A 4MQ4A 4HTFB 5EKXA 2OXTA 5C1IA 3FPEA 2I6GA 3NDIA 5ICEA 5K0FA 2YXDA 5GOZA 10MHA 2GB4A 4OA8A 4RTPA 2BR5A 3D2LA 3DMHA 1JTFA 3WSTA 4PIPA 3BT7A 1P1BA 3QOWA 3FTCA 4P7FA 1TPYA 4GOLD 3IEIA 4C06A 5BXYA 5FTWA 3UBTA 4MHTA 1YFLA 3EEYA 3LDUA 5CVDA 3DXZA 1RI1A 2EG5A 4M37A 2WA1A 1NW8A 2ONZA 4Z2YA 3M6VA 4QPPA 4QQNA 2AOTA 3UJDA 3HTXA 4Y2HA 3RIEA 3ELUA 2NNWB 3BWCA 4UOEA 4ER0A 5E2BA 2P7IA 2IH4A 2IDKA 1KIAA 3IHTA 2B9EA 4X61A 1ZGJA 2WK1A 2G1PA 5IKMA 5E2AA 3BUSA 4YUZA 2Z6AA 3A7DA 2JHAA 4EKGA 3EMBA 5KQRA 5GINE 3OE5A 5E8JA 3TPZA 2NYUA 5DTMA 2ADMA 2E5WA 2ZZNA 2WA2A 3E23A 2NXJA 4R05A 2Z6QA 5BW5A 2ZBPA 5DLYA 3FUXA 3MQ2A 3DULA 3M6WA 4KIGA 2NP7A 5LQJA 3FPGA 1O54A 1KHHA 5FUBA 3SSOA 3EVBA 4LECA 2C7RA 5CM2Z 2IGTA 3KR1A 2PY6A 2FRXA 2O05A 1M6YA 3DTNA 3M6XA 5E9QA 5FHQA 3TFWA 4POOA 5DM4A 3GRUA 4ER6A 1EG2A 1NE2A 1O9HA 2FK8A 2VDWA 3CJRA 3KR0A 3SSNA 1QAMA 3VC1A 1KPIA 4DA4A 2AS0A 3LCCA 1VP3A 3VSEA 2OBFA 3GCZA 5MHTA 2FK7A 2Y1WA 5CUQA 5EQJB 4AZWA 1G55A 5K0GA 4HH4A 5HOQA 1TW3A 2YTZA 2P3OA 2DPMA 1KPGA 2EFJA 5ICCA 2G8NA 3LPMA
chains in the Genus database with same CATH superfamily
1F4LA 3I8OA 4EB6A 4KPUA 4J75A 2E5FA 2FHPA 3LD9A 3WFZA 3MBOA 3UHAA 1PR3A 3C7TA 3GJTA 4FZVA 4LYEA 3N2IA 4TLAA 3UH0A 2OV2A 2XR1A 1HDCA 1KMHB 2GXQA 4XWOA 2G7MC 3EOZA 3BK1A 4I5FA 4BS9A 4IDEA 3V97A 2WIJA 4ZJZA 4MB2A 1V41E 2HTEA 2XPCA 3B1KA 2Y99A 3BHMA 3CH5A 5JANA 4QXOA 2OXFA 2A0WA 2VJMB 4YBRA 2AJ8A 3H2GA 5ED0A 3A4NA 3BIJA 3TVTA 4C7BA 3PWZA 5K8VA 1EJBA 2PWAA 1QH0A 3MIZA 1GUBA 4EJFA 1FFXA 2F1HA 1G6Q1 3NAZA 1XNQB 4ZO6A 3K5PA 3L1IA 3F2IA 3FPKA 1M8KA 2KX7A 4QUGA 3TAHA 1XMPA 2VSYA 2QL7A 1OA0A 2CD7A 2FR8A 2QZSA 4HYQA 5HF6A 5CA1B 1ZI8A 1KMCA 4GD3Q 4E13A 2PT9A 3U3XA 1AKVA 2G67A 2IP4A 2CB0A 4DCTA 5CB4A 1YVDA 4NICA 1WDLA 1A04A 3EEOA 4K81B 1V3VA 3TTTA 2G4CA 1RRFA 1LV8A 3KD2A 4NCHA 5IFLA 1UPTA 3OHMA 4LMRA 5ADUS 3WYBA 5IVKA 1I2AA 1KI9A 2EBWA 3BBPA 3NBKA 1DRUA 3OQVA 3QMPA 1KOLA 2BZGA 2EL9A 3UQZA 1NV8A 1PV1A 4PQFA 1NXTA 5CA0A 3W4JA 4BRWA 4ZIRB 2FR8C 1XJ0A 3K9CA 1S4MA 4Q3KA 1Y0BA 2B8TA 5AJUA 4YUXA 2GKGA 4O8ZA 1AQUA 2C2YA 2H1SA 2Y92A 3WQHA 1ZU4A 5F3RA 5GQSA 2O5RA 1XELA 3PEFA 2ZZKA 4GM0A 4LNUA 4Y7DA 3M6LA 4OLAA 2ZJ2A 1UQTA 4DSTA 1LDNA 1TVKB 3RARA 1TJ5A 1H2WA 1D2GA 1T9BA 3U56A 3UOGA 5GM2A 4KOEC 4HXYA 1BQ3A 3VR5H 1SCAA 1QZ3A 1VRWA 1ISFA 1X9GA 1MHTA 1Y4AE 2G7ZA 5CVCA 1T1GA 2ZYRA 1E0JA 1RWPA 4HWTA 2HMVA 1HETA 1OBHA 4D7AA 1AXRA 4Y98A 5LWHA 3K71B 3MJFA 1E6EA 5ADWA 2HYDA 3FI0A 4L07A 2WSIA 4NYMR 3AUTA 2BR3A 2DFKB 3E0XA 1CLEA 1G2PA 4PBSA 1TQHA 3X2SA 4ZC8A 1SXJE 1DOZA 1M1YA 2WFLB 4QOGA 5J23A 3K70D 2VQDA 3L05A 4S04A 2H65A 2QTFA 1KRHA 3H18A 5DGXA 3OM8A 1P0IA 4NENB 4RDHA 1G4UR 2WWVD 4DIKA 2YS6A 4CEIA 3NUGA 1GXSB 1ESZA 4IDHA 2XMRA 1FJ2A 4Y2TA 1Z3IX 1IJBA 4MPTA 3RROA 2JAWA 4DZZA 1QFZA 1A96A 5B7PA 5ILGA 1KJZA 4YRQA 2CCKA 2ADOA 2VDJA 2ZWIA 4PYJA 4OHBA 4CM8B 1TM4E 2CMKA 1WD5A 3L07A 3N8KA 3QXJA 1BGXT 4GGMX 1VM6A 1QHHB 5HZHA 2SNIE 2JEOA 3AWIA 3JWJA 5H3HA 5CDYA 1JZQA 3CVJA 1KMNA 2ST1A 5AH0A 1MR3F 4M7OA 3WV4A 1Z8NA 2CWDA 2PS1A 4MRVA 3R3XA 1DXQA 1COZA 3VNVA 1CNFA 4TWJA 4EBFA 4H7EA 3WK8A 2BBSA 1YUMA 3G9UA 1KYIA 4L78A 5EJ7A 4CBVA 3IAEA 1DBWA 1GRQA 5E4TA 3S5JA 1XAGA 3DXYA 1U3WA 3FD8A 2FEOA 2ZS7A 4BFLA 4BRUA 2ISQA 1AKWA 3AP1A 1K2WA 1XZQA 4OA5A 5BN4B 2OZVA 3U81A 2HBYA 4MGHA 5GM1A 4F5ZA 4DV3B 4B4OA 2F9LA 3GN2A 5D85A 4B3DA 3TGPA 4LOJA 3OIVA 1GG8A 1KVTA 2VDWB 4P35A 1R37A 3GVXA 4C0WA 4C3UA 2Q9BA 1EIWA 5AYVA 1RIIA 2NZUG 4DXAA 2H4HA 5BOSA 3O3NB 2PWZA 4FR5A 4KZPA 3H8WA 1DT3A 4U00A 4UEJA 3CLSD 1I2ZA 4PZAA 4G4IA 4MW1A 4WOJA 4XM1A 2PUDA 1CHNA 1N7JA 2GAFA 2R62A 3H2SA 3MERA 4YRBA 4B1FA 4WKCA 4L8WB 3U39A 1LUAA 4CUZA 1EA7A 4BP3A 1OFVA 1Y1TA 5KHLB 3D8BA 1IZZA 4E2ZA 5B1DA 3V34A 1K8YB 3UK2A 4BNDB 4IG4A 3N7AA 3B36A 3B2QA 1D03A 3L46A 4KXYA 1MRZA 1NXQA 3QOYA 5DHFA 3WFJA 4M21A 4CN9A 3ZJTA 4L8GA 5EHNA 2HW8A 1EWYA 2ZIAA 2C1XA 4B4DA 5ALMA 1UAYA 3T7DA 2Y93A 1A1VA 5CXUA 1Y6JA 1UXIA 4ALNA 4HFNA 3ZWWA 3AXTA 1VIYA 1FY2A 3IQGX 1MZPA 3OCXA 3KL4A 5CT6A 3CF6R 3EFHA 2RSLA 3OUTA 1TLLA 3X1JA 3IKLA 3QU5A 1JHDA 4H6VA 2FX2A 1G66A 1UPAA 1W6UA 4KOAA 4MUAA 4U8HA 4RQAA 5JD3A 4XGIA 5BSVA 3HN2A 4BQNA 4GKKB 2NIPA 3P9SA 4ZCRA 4GVXA 1T2NA 3R0VA 3ZJUA 3S6JA 3UG6A 1J42A 1TYZA 2RGYA 5EXXA 2NQTA 1JYFA 1PHPA 1LK0A 1FL9A 2FGKA 3QU4A 3V8EA 3VA7A 2H08A 3AHGA 3JVDA 3NO4A 3SIRA 1JTVA 1NUQA 2FQQA 4CDRA 5KYNA 4JLDA 1S5PA 4RPCA 2D6FA 3ZV5A 3HU1A 3RVQA 2FETA 3KXKA 3V9AA 1HKHA 4DABA 1IRXA 1E1MA 1GQSA 4LF5B 4PYNA 2A67A 1NOJA 2YQ4A 5FPHA 1X0XA 3TD6A 2DFTA 2POQX 4C2UA 3U44B 5AM5A 1YJXA 2YY6A 1E5TA 3OT1B 4AW9A 2P5UA 5JPDA 4Y2PA 2JCVA 3K73O 3R7WB 4HMPA 2IV3A 4IDOA 1Q2XA 2I03A 5ER9A 2FDCA 3N58A 4M7RA 1GZDA 3N6XA 1OWNA 4LOLA 4O4HF 4CMAA 4DG5A 3MUFA 1QRSA 4LG1A 4DM4A 3K5IA 1KIMA 1TGYA 1QV7A 3L0OA 3GCXA 3LMKA 3Q3CA 4TN1A 3FR7A 4I08A 4G0XA 5GOTA 3D1LA 3K9NA 4NIMA 4ZVLA 3CCBA 3CNLA 5AK5A 1JLSA 1QCDA 1VXRA 2J9FB 5AM0A 3EB9A 2W2TA 1RM3A 1VPEA 3VH1A 2Q46A 1JDVA 1XD8A 2J5KA 3K9LA 5IAEA 4JEHA 3HHEA 1XZLA 1ENPA 2XD9A 3TXYA 3V8PA 1GUAA 3Q3GE 3C3DA 3MCTA 4R9VA 5KYUB 2PHZA 4FFPA 3E2MA 1RQRA 4W5QA 1NN1A 1UBMS 5JLAA 5CCXA 2PLAA 2JCBA 2MSCB 1LY1A 2G83A 1CUCA 4PIMA 1CJVC 4WA7A 3IOMA 2H2HA 4I4TB 1JKJA 4H3KB 4X1YA 2RB5A 4EJ6A 1MJHA 1PZEA 4ETWA 5H7XA 2WIFA 5AKZA 2C29D 2QN7A 3F5DA 4RA9B 3LP6A 4I1VA 4DWJA 2YJ4A 5ALGA 2XQVA 1GN9A 2W6ID 2NUBA 1R0ZA 3A1WA 4FJ1A 1V5FA 4GMFA 4XDGA 3UAZA 3ELDA 2O2HA 4X1KB 5HKLA 5AW9A 3KNZA 4IIYA 3Q7TA 1H5QA 1AKEA 2JJ1A 3IEPA 4OHRA 1U2PA 1KI7A 1QPZA 5DOVA 3AOGA 2AOXA 3CVVA 1CE8A 1FYFA 3O9MA 1TA0A 2GNOA 1J8YF 1QVZA 3FSJX 2FZWA 2B2CA 3HCFA 4HWKA 2UV8A 4NFYA 1M1UA 1PO7A 2AI1A 2AF3C 2WM2A 4NE9A 3B1FA 2GPJA 1XTJA 4PAOA 1DBSA 5IHXA 2GN9A 8OHMA 3S81A 4X8HA 1QHYA 1RT9A 2NVWA 4GMHA 4CF3A 2VHZA 1G8JA 2ZAIA 3IODA 1VMEA 2P7HA 1F4PA 3EF1A 1B6SA 1S8FA 4TQGA 1COWD 4BJ1A 5KQSA 3QGMA 3P9ZA 4QSHA 4W5TA 4DC1A 4B73A 3KQWA 2ZIGA 2DFVA 1XROA 5DYIA 4BP8A 3LT5A 5LC1A 2DH5A 1E0AA 3KSAC 2JAQA 1JAYA 1Z75A 4LHWA 3IVMA 5KI6A 4PHHA 2OTCA 2Z5FA 3V2GA 3WGZA 1IULA 3HXPA 5DNUA 2B25A 3U3KA 1KZ6A 2GYYA 4JBYA 1Z8HA 3QXXA 3O8QB 1FBNA 1VJ1A 1VG8A 4W8OA 5EJFA 3BKWA 2FYTA 2QQGA 2VDLB 3U4QA 3R7FA 3QNUA 3M33A 4F9TA 2EWMA 4Z4HA 3E5MA 3BXEA 2AZDA 4YASA 1EQUA 1REQA 3DUFB 2DPXA 3HP1A 3KFXA 3VO1A 4CE6A 2CNKA 3LBIA 4CFYA 3F90A 1G3UA 3ETHA 4JVOA 3KSBC 2IYNA 3W7VA 4C0XA 4EA6A 2HSDA 4COOA 1R4MB 3VPGA 3L01A 1D7AA 3I72A 3PJRA 2Z98A 1V5GA 3EUWA 1VBFA 2XDYA 5GTDA 2XYPA 3W6ZA 4R8RA 4RLHA 4UHBA 1EFAA 4MAFA 1Y4UA 3Q9LA 1FYEA 4KITB 1ZJ6A 2UAGA 3H7IA 4BUZA 2UUCB 1KO5A 2FKAA 3BCRA 4O2BB 1RCUA 1ZH4A 2FWMX 4C21A 1I2BA 3QLUA 1MB4A 4DR5B 1ZISA 4LWPA 2GZAA 3ZGLA 4DOMA 2BEJA 1QQ6A 1ZLYA 2F00A 3C85A 1Q3KA 4AYWA 1KDRA 1HUQA 1NXSA 2ACKA 1DGQA 2PV0A 3B5IA 5JAOA 3I6QA 1NX9A 1ZI9A 2P2LA 3S1LA 2CF5A 3N2NA 3I1FA 4A6PA 3LZCA 2HIMA 1YJQA 2VYQA 1DKNA 1KXJA 5A7FA 4OBXA 3RWMB 4NJEB 1JFTA 3PUWA 5U9CA 1AE1A 4GPEA 1KYZA 2CB9A 5KYWA 1L6RA 5EZYA 1BU8A 4BX2A 2IH2A 1JDZA 2PL9A 4BKUA 3UMCA 6GPBA 2XF2A 5F23A 1U2RA 4YWJA 1K3FA 2YUIA 4B0PA 4MUEA 3DQQA 4P86A 1POWA 3U0VA 1JLHA 3WWDA 1OT3A 5I6DA 1BFKA 2HSEA 3LKVA 3WYCA 1JT2A 2JG3A 4KPYA 3T3NA 1WUYA 1EE2A 3TNJA 2RHLA 2HA2A 3KB2A 2F1OA 4L5CA 4CM4B 1N2OA 2ES4A 4EUHA 3PYMA 1ZH8A 4DYHA 1YOVB 1MMFB 3LOPA 3SAJA 4XIFA 2DFNA 1H9BA 3OCVA 4LY3A 4IILA 1QONA 3YASA 1FDRA 2QG4A 5EJ5A 3BMCB 2AZTA 2W4IA 2O52A 4GBMA 2AEEA 2QYOA 3A26A 4XD7D 1JPVA 4V1CI 3CNEA 1E94E 1ZAYA 2XNHA 3NCTA 4LF6B 1ESCA 2PCLA 2GJ4A 4PLHA 4ZXFA 3CSUA 1SUPA 3RFUA 1D0SA 2QRGA 4IIXA 4PYOA 5KNDH 4F21A 5H70A 2LE0A 2J33A 2XKJE 3AP2A 5IAOA 1T34A 2I6GA 1NX6A 3I4LA 4BUCA 4EEXA 2GHIA 4DCJA 1A69A 10MHA 2ZPAA 1C7IA 2WAYA 4PLPA 1MFPA 4CODB 3K9QO 3DVAA 4RIGA 1XD2A 3Q7SA 2O20A 5JLJA 1C3VA 4I99A 3UO8B 3BD7A 4LK3A 1PR5A 3IESA 1SQ0A 4IHJA 1WOMA 1R1DA 2V03A 5E6UA 2M9MA 4BGVA 4FGKA 3T7AA 3N8NA 3V3KA 4LI3X 1EFTA 1PFKA 1KIAA 3DE4X 4TUYA 5F9FA 2YYZA 2VCEA 1TJ3A 2PG3A 1POXA 5BQ5A 2VF5X 3DYVA 4D3YA 4P1ZA 4M7WA 5J40A 1P9LA 4YUZA 3KKQA 1DINA 2HMWA 2NTYC 3QVOA 2J7PA 2R8BA 3I32A 3RYCB 5L4NA 4RXUA 2AJBA 3DKPA 4LX8A 5CX1B 3BH7A 2XUPA 4IJUA 4BKQA 4H1TA 4W9NC 2HCJB 2ZR9A 3MQFA 5HCUA 4IIJA 4RL4A 3ESAA 4KWIA 3N7UA 2XSZD 3S1AB 4RIIA 3FOEC 3IGFA 4FHCA 2R47A 1A8HA 1E3LA 1KQOA 1H2AS 4MA0A 4OJTA 5JFTA 1YRHA 4QSMA 3UFXA 2YMMA 3G79A 3VC1A 4ZOBA 1Q1ZA 3AG5A 1UBLS 2CFCA 1P1FA 3LUKA 4JQYA 4GXQA 1M2EA 1VP3A 2ODNA 3PZBA 2C94A 2OBFA 5SY9A 2J41A 5EA2A 1D04A 2BT4A 5EQJB 4YPVA 2JIZD 4WWHA 3N28A 3QFFA 4WKPA 5LZ7A 1ZXBA 2AN9A 1TZJA 1UBEA 2ECPA 4TPKA 2NMVA 1Z5VA 4E6EA 2QSJA 3OMXA 3F6RA 4M76B 3VYVA 1MOPA 4D0RA 1SC4A 4Q15A 6REQA 4EVSA 4CEJB 1X92A 4RLQA 3R7BA 2FPPA 4MQFA 1WXFA 4UHFA 4HR7A 1X39A 4JV5B 1T6BY 2ETXA 2O4CA 2PU5A 1RE1A 3V7YA 2MU1A 3STTA 1V8OA 2XECA 1NUAA 2RHMA 3TZBA 2F2TA 3ILVA 1S3GA 3OPXA 4PXSA 4PIVA 5A4DA 1HH4A 5LP6F 1M54A 3JW8A 2G72A 4GUAA 4HUJA 1V7PC 1AX9A 1KJ9A 1ULBA 4KGVA 2XNCA 4IXTA 3X1MA 5BQFA 2FP4A 3U17A 4B2PA 4R68A 3FKSA 2AMFA 4C4OA 2V65A 3I9FA 4U3JB 2DUUA 4LJRA 4W7SA 3C6XA 5IM5A 5JRDS 2R4TA 3H19A 1Q0QA 1SCJA 4NBSA 1UF9A 2P65A 4Z5XA 4Q1BA 3GLIE 4J7UA 1WCIB 1ZK3A 3MT9A 1V48A 4ZAZA 3ZHRA 4WZBA 2FN4A 3FRHA 4AG5A 5J47A 4NHOA 4HGNA 3NTQA 2XB9A 4RY9A 2C3YA 3I2IA 3R3ZA 2FN9A 3EQ8A 3P20A 1HA3A 1C41A 5FXMA 2W8ZA 3GLIA 1YL6A 3KPJA 1J8VA 1XYGA 2R97A 1KZGB 4IQFA 3CLTD 4HJRA 4O4LF 1L5LA 4MS1A 2REBA 1T6NA 2FKNA 2JHGA 2OV6A 2VBGA 2W9XA 2ID7A 3JQEA 3OPVA 5FTKA 3JR3A 3ZDFA 4YV1A 4KXWA 4ND2A 4ER5A 2X6RA 2G04A 1V16B 1V37A 1YOBA 3E9RA 3QPBA 2QN9A 1S1MA 3VOSA 4F85A 4OQZA 4AY4A 2BKUA 4TTTS 4QGHA 4ZI7B 1WXHA 4AUKA 5KNBH 1WLYA 1VKHA 5JVDB 3H5AA 3AVYA 2I4MA 3JALA 2OV8A 3ZV3A 2A9RA 2DFDA 4JSRA 1R0RE 2ZYWX 3KXPA 4P4NA 2OFFA 2EKLA 1UT6A 2GMWA 4X8OA 1R5JA 4GLLA 2EYUA 5DGCA 1RZRD 1ZMXA 2GS9A 1OKKA 1HZJA 2W11A 4OKIA 4OYYA 4ZHQB 3WLSA 4LWOA 5BWOA 2XQFA 2XF8A 1CUUA 1W0KD 4AKTA 3W7AA 2V6JA 1BH2A 2VZ0A 3REQA 3KOYA 4UHEA 5JSZA 1QP0A 1HSZA 3D8RA 3OLXA 4Z51A 5CD9A 2C4VA 1UXHA 4E46A 3OOHA 5HJEA 1U0LA 1YFZA 1JDSA 1H2EA 2JAHA 1VL0A 4AUMA 4DA9A 2O8NA 2GUGA 1FYVA 1X1EA 1G8YA 5FI3A 3MTQA 2F8MA 5FLXA 3A3YA 3N6RA 3D2BA 4LRUA 3H9QA 2HDHA 4NYJQ 1DKPA 4KDCA 4MQUA 1W29A 5LP6A 2C61A 1RDFA 1DAGA 1NJ6A 1V2GA 4B7CA 5EKDA 3HSKA 1WTAA 5B1YA 2ERYA 5I48A 4U2BA 1G17A 3JASA 4HADA 5K01A 3ZY3A 3KQUA 5H8WA 1BW9A 1ODSA 3PPWA 4NS1A 5LWQA 1GGHA 3ZH9B 3NOQA 4YAOA 5E6RB 5EPOA 4NOMA 2QD1A 1N2CA 4TL9A 5LU9A 3VX3A 5LP6C 3WQSB 1G7CA 3KYCB 5CB8A 3EASA 4ZP1A 5DTJA 4KQEA 3AKYA 4MGEA 1QV9A 2JEZA 2V0CA 3P2MA 3PRYA 3TQIA 4PC3A 3DCYA 1GT6A 2C0PA 3EGXB 2C78A 3HDGA 4C1BA 4RJKA 4RTQA 1OV4A 4G3XA 4M86A 4NFSA 3X2FA 1WPRA 4IJMA 4ZREA 4JUIA 3ICEA 1LJLA 3D7MA 3TAXA 1A5BB 1ZG3A 2NO6A 4UVIA 2ZYSA 5BMVF 3EW7A 2QB5A 3TFQA 2PS0A 4TWBA 2UXDB 5KAMA 3KQHA 1YTUA 2CUTA 3TZCA 3EW9A 3ZE9A 1UFRA 3ID6C 2I65A 3KRTA 1ZUD1 3MTEA 3UMGA 2HFJA 3W2IA 2OSBA 3UVEA 2VK8A 4G8CA 4PG6A 1VFNA 3ZNOA 4IRXA 1R12A 5CDUA 1XZCA 5FBHA 3C4JA 4CT4B 3DDUA 3GRKA 1X2EA 2YN0A 3KLNA 1TZKA 4KYIB 3UXEA 4M8KA 4LF9B 4YRLA 3M0EA 2H6EA 2PT6A 2PMBA 2Q6TA 4M54A 5JCJA 1ZD1A 1SXQA 4PC6A 4KTTE 3OZIA 5HK8A 4BNIA 2Q3JA 4JI3B 3UOWA 4EX7A 3JQBA 1I3CA 1NQOA 2JHFA 5FPQA 2C4WA 4Q16A 4M2LA 3HCCA 2VNAA 1U8XX 4TMTA 1D2HA 4V24A 3W3AD 5C5EA 4LFCB 1NDQA 1GFZA 2DTEA 3E4DA 3IMFA 4KFUA 3NH9A 4TL6A 4MX8A 1Y8CA 4M1YA 1CUJA 2GD6A 3KKPA 4LAFA 1J2UA 2X1HA 4K6KA 4WIAA 5BW4A 4HS9A 5JEEA 1RFLA 1S02A 2QTNA 2JB9A 3AVTA 2VBCA 1YK1A 4Q47A 5DM2A 2R6JA 3G02A 4CKBB 4M8IA 4HH1A 4QHTA 2PX0A 2IQIA 2V0NA 2DYKA 2H1WA 4RKYA 3JQBC 5K8UA 2Q5FA 4DTIA 1OYYA 3ER9A 4ZAGA 1VPWA 1H6DA 2PNFA 3IUPA 1DT5A 2ZCUA 3KJEA 3IULA 3E9CA 3ONWA 5JDIC 2ZG6A 2CL5A 1W2GA 2VBIA 3VR0A 4ZJPA 3ANSA 2NU9A 5FB3A 3IA7A 2C84A 3CNOA 2VATA 3PDIA 4G36A 4BB0A 5LBTA 3OU2A 4UDNA 5FWXA 5KBYA 3D8TA 3C8MA 3PB3A 1IOVA 1BX1A 3L7IA 3SZ3A 4X92A 3SYMA 2PLRA 1N3BA 4INOA 1RVDA 5CJPA 3J81A 1BXRA 1H8EA 4RV4A 3SX2A 3D4NA 2QXTA 3RSLA 4EELA 3HLYA 5KDDA 1Z5UA 2AOUA 5K3FA 1L4MA 1T8TA 1AN9A 1W8DA 2GT1A 1I33A 3CZQA 3NHUA 4HPJB 4XZ3A 4BO8A 2YY7A 4F0JA 1FF9A 1YQQA 2VJPA 3AEUB 4NU6A 3MJ4A 3W9BA 3QM1A 4BQRA 4RGVA 5BMVA 3D81A 1IUOA 3ITNA 1E2MA 2EV9A 3X43A 5JNUA 2IOYA 1I24A 1HGXA 5E3JA 1JB1A 2PS9A 3NHYA 4OK6A 4YXFA 5HZMA 1VJDA 1V8ZA 3ZWCA 3CWCA 3ZTWA 3FCAA 1T9AA 1T9DA 1W5EA 1YAJA 5A6VA 4BWVA 2CXPA 1N2XA 2OP1A 4ESOA 3MB8A 1Z5WA 3AL3A 1AGRA 2KSQA 1QOQB 1FPMA 3P32A 1QRTA 1PFGA 3CSDA 2ZSFA 4PZEA 4X41A 2YDXA 1J0XO 3NI2A 4EATA 1I4OA 2Q07A 2W6ZA 1RPAA 4M0PA 4QXAA 1N1MA 1MV8A 3UOAB 3H5WA 3MGCA 3O91A 4XPZA 4Q7EA 2XTNA 3IUBA 4Q9NA 1K68A 4V0SA 4R7GA 4R8KA 2WUVA 2ERCA 2JIMA 5KU7A 5AVWA 4MIEA 3JVIA 1ULUA 4MVJM 4JU8A 5EIFA 3OCCA 1Y3CE 1B74A 2A78A 4FGSA 4H6XA 2QE7D 4TKLA 3L2OB 3NXKA 5JNRA 5HX7A 2VP4A 1I5RA 1ZD9A 3LUPA 2VF2A 3OLYA 2FSSA 1ETHA 4DR3B 3TW8A 2PLFA 3NT4A 3L40A 4Q4HA 1I5OA 2P1ZA 3LWDA 1XKQA 4INPA 1H8HD 2G1UA 5IX8A 2VYNA 3GJ7A 1QCZA 2VPXA 3W6NA 1G1AA 2K6GA 2VXCA 2JW5A 2OILA 1VSBA 2BKVA 1MXHA 2CJWB 3OLCX 3QWHA 4TRMA 1J06A 1OJLA 5EEHA 4U39A 1EVKA 4ZZ3A 1ZSNA 1T8YA 2Z1MA 3NQ41 5KX5F 2CWWA 4WK6A 2B4QA 3KQYA 5DP2A 1CY4A 5DPMA 1FDVA 1VIAA 1I4LD 5KJFA 4F2HA 3B1XA 1NLZA 3GP8A 1ZIPA 3O5AA 5L3ZA 2VNSA 2ZJZA 1W85B 1H1LB 1UKAA 4TTVA 3MMPA 2Q9AA 2GYVA 1SD1A 1DAKA 3KOZA 3N0TA 4QLBA 5HW0A 2FOIA 1YU9A 3HA2A 1KYVA 2JDID 2YZMA 5FBZA 4AJ4A 2CV1A 2QN2A 2CN1A 4RPKA 2WWTA 5M29A 1R0KA 4MI6A 3VX4A 1X77A 1YV9A 4R5HA 1E5VA 2OCIA 5DXAA 1DFGA 1Z26A 2BEUB 3NM4A 4K9LA 1X15A 1UWLA 5H16A 3KTFA 4BNXA 4NPCA 4A2PA 1GRNA 1XV5A 3UJAA 4FZ5A 2IUFA 3ZE7A 2YHIA 1PEKE 3T95A 1IVYA 4PN3A 1ZMOA 3DLIA 1OY1A 4H7KA 3PX2A 3T6KA 4RTMA 1DIHA 1Z34A 1GFSA 1AT1A 3I34X 5HVNA 3C16C 2H51A 4JB3A 4YAKA 4Y2XA 1YC5A 3DL2A 4FMDF 3W8DA 3PQ2A 4FINA 3IAAA 4BCCA 3K8QA 4TLDA 3RBAA 1P2BA 3GCDA 3HV0A 4FYKA 1OLOA 2QVBA 1A5SB 1NNUA 1JA1A 2OHIA 4EDFA 1LBSA 4AG3A 2BFAA 2EX1A 2ZJ0A 4FNGA 4G4SO 1LTHR 2A1IA 3C6MA 4PWYA 3OZVA 2PVSA 4FGUA 3RQSA 4YJHB 5FOSA 3NX4A 2FEXA 3KBOA 5JJBA 3CHYA 2BUBA 1EFLA 2HUPA 3CUYA 3PFKA 4TYNA 1T9CA 3JQRA 4A8JB 4TLMB 1BCRB 3AFMA 2BRUA 1TIKA 3G5UA 4OYLA 2HWUA 4NG5A 4BIIA 1VBNA 1C0IA 1JHQA 1PJRA 4AAYA 3S8YA 2FJPA 5D7NA 3KOXA 5FF9A 2CEAA 5DHUA 3W2EA 4BWYA 2BAGA 3FFBA 4C4PA 3ANTA 3INRA 2X8AA 2WM8A 2FWRA 4C22A 1MOZA 4GMDA 4HL6A 4AWBA 3PUXA 1NMYA 4B2LA 2ESRA 4C87A 2YWRA 4MVWA 4Z4GA 4RDCA 4XGQA 4WESA 2ZOSA 3VHXB 3KXLA 5ED4A 1JE0A 1L8OA 3EPLA 2XT6A 4V3CA 4P08A 5LPNA 2AN5A 3DYBA 1UT8A 3MJEA 2QQFA 2E4WA 2BONA 3BA6A 4BTVA 2XITA 1GSIA 1RXYA 1Q74A 2VP2A 1DHRA 3TQFA 4IIUA 1D0VA 4JHLA 4K5QA 2CNWA 3RSFA 3VC2A 1P19A 3M9WA 3OFJA 2XE6A 5A1JA 2O8CB 4CKEB 1R00A 5I7AA 3RT9A 2ZT5A 4S1VA 1Q83A 3OAAA 4HDNA 2HPHA 5BN3A 1E3WB 1WF3A 3VZDA 1VBKA 4I8XA 521PA 3RFFA 3KSMA 3H4MA 3HUUA 3PEUA 2KB0A 3TZ6A 2C96A 1KJ8A 2HV8A 5FOUA 2PGIA 3OUZA 2VJLA 3EXIB 1S3FA 4OYHA 3SWWA 1U7UA 1GTL1 1KEEB 3LCJA 4GM4A 5FBWB 3WY9A 4BFUA 4DLBA 4KMRA 3RM3A 5JASA 3KQPA 3V4FA 4X85A 4OXIA 3DJFA 3F6BX 3GI1A 4J0GA 4N5LA 3UJNA 4JLMA 4DSUA 2QN1A 3O6VA 1AB5A 2JANA 2ECKA 3ED5A 3Q1LA 4OP3A 3BGSA 3UY4A 4AY3A 4EKEA 3AM1A 2VNIA 3HBNA 1MB0A 1O6ZA 1ZNYA 1GNPA 3WSTA 5AW8A 3GDFA 3TTUA 3EDCA 1TTTA 1NLUA 1G8PA 4BECA 1V11B 1ZEMA 5KWSA 3JS5A 2EJVA 3OJLA 3HXKA 4G2TA 4Q3CA 3VSAA 4A0QA 3ECSA 2E89A 3A1EA 4BL5A 5CFZA 3A05A 4EGJA 3GEEA 2JVJA 1L0BA 1NC3A 2JJ2D 4V2UA 7MDHA 2B7CA 3CE6A 4UOEA 4ZTZB 1V6SA 1EKXA 4OB6A 1PK9A 3UUWA 1ISGA 1JA0A 4YRCA 3RHTA 4W5OA 4BO3A 1GZUA 1KI6B 1RYDA 4LOKA 4URHA 4XYEA 4PWZA 1CKEA 4H3VA 1EBUA 3AI3A 3IBYA 1XLVA 1U1GA 3M3PA 1ULTA 2EQAA 3IBCA 3PNYA 1EH5A 1RYZA 3D8NA 4HATA 3N1UA 2FJUA 4EKGA 3GLGB 2BFDA 5CFPA 1RACA 3REFA 3TOXA 2GCNA 1XR3A 1Y48E 2EQBA 3ZHZA 4MW6A 2RHHA 2XZLA 3KYDA 1NLFA 3EUAA 4L5AA 2AMLA 4K9QA 5DWDA 3TOZA 3VMMA 1O2DA 4LCBA 2NXJA 3QVSA 2HQSA 3Q98A 1L8QA 4QREA 3QI7A 4FYWA 5LQSA 1QP4A 1GRRA 3CR3C 3WIDA 4RCVA 1XTKA 3BCHA 4HGPA 3W1WA 2CLIB 2PY6A 3IV7A 3IT3A 5CT8A 5ERYA 4EKYA 3I3OA 4KN6A 3TFWA 4P53A 4TLCA 2WJIA 4YRZA 3CF4A 4KI7A 5AVTA 2OQVA 1Z25A 5DVZA 4AJ9A 4DTCA 2IHNA 4Z0NA 4QARA 5HM6A 1UMBA 3OG9A 1KPIA 4O8CA 4F60A 1HL3A 1QMGA 2IW1A 3I6MA 3IUEA 4QELA 2NUAA 2ZE5A 4IINA 1UC5B 2R5NA 5BYAA 3ZEIA 1EDEA 1EUCB 3D1VA 5IT5A 1AV7A 2KBEA 2RHJA 3DLBA 3AY6A 3D5QA 2Q49A 2HLPA 3ZK7A 4BO9A 4EIWA 1G20A 1ZUNA 4Y6OA 4X64B 3CZ4A 3ZCQA 3UKDA 1XLUA 2DFPA 4ERNA 5EMKA 5KOJB 1U9IA 2R8EA 2YL2A 3T41A 4FEEA 4NBLA 1TC1A 3OHSX 2HEIA 4QECA 5KWIA 1PZMA 5AP9A 3SN6A 5B3JA 4IXWA 1P7ZA 4CUKA 5A0VA 2PZAA 2EFHB 3BJIC 3VJMA 4CG3A 3DDWA 2GEUA 3B6JA 2R6R1 4QPDA 1RJ9A 5JSQA 1IONA 1KGDA 3PQ3A 1Z88A 3I4FA 4B40A 1BOFA 4DXHA 3EVNA 5E6SB 1A97A 1XIVA 2RJOA 3O0TA 5JQWA 2D13A 3A04A 3U3RA 3H1BA 1G2OA 2AR0A 3ORRA 4HH3C 1O94A 4DCSA 1SIBE 1C30B 3IIMA 4DYDA 3EZ6A 3ESQA 1TK9A 1MW9X 2X76A 3H4VA 1V9SA 3HNOA 4TTQA 3PXAA 1XF9A 2B5OA 4LYJA 4QYMA 3BS4A 5B3JC 4DUZB 3H6HA 4KNVA 3SIPA 2WTUA 1XZBA 4K46A 4QJ5A 2PJDA 5ULLA 2O48X 3V33A 3UUGA 4F91B 3PR3A 3HVRA 1YD7A 2WVAA 4M98A 3TOSA 1HPLA 2ZTVA 2D5LA 5IMBA 4MTCA 4A1FA 3ZZ1A 4C0QC 2MINB 4I1UA 2I66A 1ACMA 1Z6PA 3D3WA 3F71A 4X0EA 5TPWA 1WV1A 2OCLA 4P7GA 1A9XA 2QRVA 3B5JA 1J97A 2NZ2A 3QA3E 2QD3A 1DRVA 2QX7A 3DBOB 1GTJ1 3TEMA 4BTLA 4BLRA 5BVHB 2B98A 2OCBA 5KHOC 1XB2A 4MARA 4HSEA 5REQA 5FR2A 4ATNA 4EHNA 1M34A 5LBIA 3ZHVA 3ZDYB 3A6PC 1G0OA 1TKCA 1JIKA 5EJIA 1BWQA 1CEXA 2QT0A 1G4HA 3HM2A 4GXTA 4YJGB 3WYEA 1NVUQ 4JELA 5BWCA 2R1ZA 5LZ8A 3ZWVA 2OECA 2VPTA 2ZRMA 4P4UA 3GXOA 4J6EA 2G08A 3U1VA 4R2JA 1CB7A 1F6DA 4OMCA 1LNSA 2O3UA 1EG7A 1P73A 2DWCA 4QHSA 3CO0S 1TCAA 1SB9A 1ZMBA 2J30A 4HZUB 2FA9A 3T1YB 4Z4IA 4QNRA 2WSYB 3NBAA 1QK4A 1O95D 1PL8A 2FHSA 2PZ8A 1JMYA 2Q6VA 4JFAA 1R4NB 1QYWA 4M46A 4RKQA 5TVGA 5IJXA 3TIIA 1JJAA 4C9BA 3HCEA 3BFPA 4BFYA 3HVKA 1D1QA 2HRZA 3A9WA 3EYAA 3LNCA 4Q0MA 4BNFA 1E4OA 2H2DA 2ZAMA 8GPBA 3GLVA 4K9KA 1N1GA 4HVLA 4TMYA 1XE3A 1P1KA 1RQGA 3N2YA 2C8VA 1WMDA 1U81A 1XZAA 3HYLA 3L6DA 3HNRA 4M0LA 1RBQA 1A7KA 1RYFA 4HWGA 2JLZA 4ZV4A 1ZSVA 3TL2A 1UKBA 2CFRA 3HQ4O 2Z56A 1WKCA 2BI7A 2ZI9A 3ORYA 5DW0A 3CM0A 3OEHD 4EHFA 1ANKA 3RRMA 1TW2A 3M3HA 2IT1A 3KEFA 4W1RA 1KYXA 3AU8A 3UT5A 3U1TA 1YZGA 4GMGA 4RCYA 2FOLA 3LP5A 3TLAA 3ZGVA 3RVLA 3TX6A 3VPCA 3K6SB 3WJAA 2AG6A 1HLPA 2DBVO 4XGKA 3K1YA 1NSYA 1YC2A 3RYHA 4I14A 3IOCA 1OFUX 2H48A 1SH7A 2C4KA 4K28A 4RF2A 4UE3S 3RVBA 1KOGA 4HQLA 1WB5A 5FTLA 3JAWB 4HLCA 2JD1A 4JITA 2IQ5A 4HX5A 3O31A 5TV2A 2BFEA 3QEOA 3CPSA 2CNOA 3RJ5A 2PT7A 3RT1A 3T3PB 2LCFA 3A31A 3VR1A 3G0GA 1JXQA 2C9DA 2ZE8A 4X6YA 5LUAA 1UMDB 4CIXA 4QBFA 5AHKA 3DF7A 2GGSA 3KZOA 5H0IA 4EABA 1Z4IA 3S68A 1ZVJA 1ZL2A 4JJFA 4DT1A 5CR9A 2JIQA 2M98A 4B5KA 2P0YA 1U5BB 3FOFC 4DR6B 1DO2A 1MAAA 3ZBUA 3PGVA 4RULA 1L7QA 1K7SN 3K8YA 2GNPA 3GLTA 4YRTA 4DBLE 4MVCA 1M76A 2DF8A 2HU8A 2DAPA 3UJPA 5CD1A 1BE6A 2GKOA 4PRKA 2CDRA 2ZJ6A 4ARCA 5FD8A 3M5CA 4KO3S 5EE9A 3WZLA 2IUEA 4WOKA 1WVGA 5F1KA 3RTAA 4BIMA 1FNDA 2QU7A 1ZCZA 3BWVA 1N3YA 2EJTA 5T4BA 1NBMD 3WLMA 2EP8A 2YWHA 2QG9A 4RPHA 4D0LB 4HH0A 4KAFA 2WB2A 3GB9A 2OFWA 1LI5A 3G85A 1IWOA 1RYBA 1WW2A 2FEWB 2ZTHA 1UADA 2HJHA 3NKVA 4TWZA 3TQRA 3UB4A 5A5VA 3G2NA 3COPA 2DWOA 2XWJI 1YA8A 4JX8A 1VTKA 4WCVA 4R1SA 3L41A 1QGAA 4UMDA 3JAKB 4DRXA 5BWMA 2Y0BA 4KYUA 2XJ9A 4JGIA 4X44A 5JFOA 4BMPB 1BS2A 1NY5A 3G2MA 1QHSA 2MT9A 3LP8A 5IPFA 1AK2A 4JD5A 3HKCB 4YHHB 4WUVA 2VWPA 1NAHA 4CCSA 1GNRA 1IIBA 3EUFA 2RGRA 5AVQA 1UFOA 2JI8A 4XVHA 2QUZA 5LDGA 5ADHA 2QLMA 1SIOA 1ZY2A 4LJAA 1WQ1R 3FSRA 5G0SA 1M7GA 1TRHA 2Q4RA 4FI3F 3VNSA 3B7GA 4F7WA 2JJYA 2B35A 1J6UA 3MINA 5GJWC 2O8EA 4RVCA 4HFJA 3GFGA 5JUWA 3DE1X 3Q9SA 2AUNA 4E14A 4TXNA 1NRXA 1NI4B 1K8QA 4NDNE 1CEEA 1M2VB 3WFIA 5AIBA 5KEIA 4OXRA 1J8DA 1FNSA 5CTAA 5EFOA 4MV8A 4I1PA 1GA1A 1SC9A 3P26A 2PRSA 3U7RA 4DCOA 5AD1A 5IMSA 3HP4A 5LA6B 4S0ZA 5DYTA 2QSUA 3URMA 3BWBA 1VGRA 3DLPX 3N8IA 1EJ6A 3UWPA 1JQ3A 1RYMA 2A6PA 3HP7A 2PAFA 3UYLA 2V8OA 1J00A 3L8EA 4YCNA 4JZKA 2OPBA 4LC0A 2GHQA 2JH8A 2JLSA 3BICA 3HEMA 3KQLA 1KO8A 4PSCA 1MP0A 3I37X 3KJIA 5DBFA 2O6LA 1PHRA 3OIGA 5CPFA 1OX5A 1LDYA 1A82A 2VDPB 3LWBA 2WJ6A 2C5LA 1J0BA 4AZTA 3OHPA 2N0SA 1LI4A 4RWZA 4E51A 1GR0A 3FN4A 2X8LA 4R8SA 1P1HA 1VPVA 4XYMA 1H2FA 1W34A 2R87A 2Y68A 3GH3A 2RDMA 3LQKA 1P3DA 3EWIA 4OGLA 4OREX 4RE5A 4DJFC 4OQ4A 2AT1A 2GJ8A 4YVFA 2HV9A 2BEWB 2H8KA 4B4VA 2DCUA 2GAJA 4HAIA 1EQAA 2YJGA 3IVRA 1IXSB 3AI1A 3VOBA 1VPLA 1Q7GA 2OV3A 5AO9A 3N2KA 4OB8A 3NBFA 1CDOA 1Z6GA 2CHUA 3WDMA 1OREA 4S12A 2ZR7A 4TYPA 4DUGA 3TG8A 4XEUA 4RTKA 2HQ1A 2QTVA 3DBHB 2QMEA 1PQWA 3EXHB 4A6XA 4I1IA 1PQ4A 3K2BA 4MCAA 2AXPA 5KKCA 3MMXA 1ZN8A 1LZKA 1K86A 2HWWA 2OCDA 2FMXA 3FHOA 4ZGGA 4RCZA 3VNQA 3BXZA 4CDGA 2HFKA 4UMEA 2Z0MA 3LLCA 3AU9A 4EF4A 3CEAA 3BRQA 3PGJA 1EFUA 2QK4A 3O74A 3ADPA 3R5SA 4W9RA 2HLDD 4RGBA 3T5AA 4UBIA 4QPCA 1CDZA 2PXXA 4MR8A 3QKUA 5DX1A 1QDUA 2C03A 2B4RO 4TV8A 3NIBA 3TM5A 4X20B 4KQCA 3AOEC 3R2JA 1RRVA 2HNKA 3GBVA 3WBKA 4C0KA 2QENA 4KQWA 3F9RA 3BJEA 4U2EA 2O3QA 1TUBB 4P8RA 1VHJA 4C6HA 5B3KA 5JH7A 2YW2A 4OAQA 2C2HA 3QXCA 5L3RA 4BZWA 4UM5A 2MSDB 4MRSA 4S35A 1P4AA 5H68A 5IDVA 4V0OA 3L84A 4ZVSA 1J49A 3N0XA 4WRRA 3KWJA 1TU4A 2O0LA 3TYXA 1CQIB 1ESNA 3DOHA 4XOUA 5K0TA 3E1GA 3KWLA 1BROA 3CKYA 2WWHA 4FI3C 2N46A 4H08A 3VAZA 4B84A 5CYGA 5C7IO 1VIMA 5D1HA 4R1OA 1XU7A 4H17A 3AC0A 2H18A 1M67A 2V5AA 3DP7A 1O97D 1LVUA 4NV0A 2UUBB 5K3BA 3MFQA 3T5GA 1RLUA 2J46A 2NU8A 1JR4A 1BKSB 1OLXB 2A30A 1VLHA 2PWPA 3BOSA 1Y5IA 2WIGA 2AXEA 2GN0A 3BJZA 4M87A 1A88A 1KHTA 2GNAA 4OSEA 1E59A 4PAMA 3Q11A 2OCGA 1KSFX 3W3ZB 1W36C 1TMGE 2ZT7A 2Z4RA 4RFLA 1CLUA 1PFWA 4PONA 5I7WA 3B51X 3PGLA 1RI3A 2WEKA 1CS4C 5TGTA 4NXNB 2JAPA 2YOGA 4MWGA 3AQ4A 1JEDA 3ES9A 3MGBA 3QKSB 5FUYA 4B71A 1E1YA 2NTVA 3AP3A 5IM4F 1J09A 3FBGA 2ADFA 4HTAA 1W88A 4FFBA 2ZBGA 3L4EA 3TGWA 3G9TA 4Y2UA 2AKYA 5T6MA 3WRVA 4BNVA 2QT9A 3DTYA 1QG6A 3IFSA 3W9UA 1Y8QA 1KP3A 2RC5A 3OZEA 3PSHA 3ZJVA 1C0EA 1JAZA 2QR2A 1A8PA 2V8BA 2EHJA 3FCXA 3COZA 3FY4A 1DIGA 4X45A 1QE5A 3N59A 5EL0A 3UUEA 4CMEC 1E2FA 5J58A 5EWLA 4DR2B 2EOAA 3U7QB 4ITRC 1G98A 1UPBA 2X0KA 3NWPA 4IIBA 4POAA 4P4LA 2R44A 3LRTA 5BVGA 2HF8A 3ZZ0A 4BMOB 4LDQA 5CNIA 3DD5A 4KDRA 3EVFA 2GD0A 4LCEA 4UULA 1UDWA 1BGWA 2X3YA 3KVYA 1OBVA 1Y1QA 4C5AA 3WRYC 4B79A 3MGKA 3RYIB 2PD3A 4ZA2A 1EVJA 2C5FA 2ONCA 3QXHA 1W581 2LV8A 1ADJA 4NK4A 2I4LA 2ZP1A 5E7JA 2O5EA 5CP8A 3WYAA 3ZD8A 2Y1EA 3QI2A 3C98A 1TU0A 3KZVA 4QODA 3V46A 1GKLA 1I4WA 1KDPA 3II6X 3MWEA 3PWKA 2BSAA 4Q34A 2RFLA 1U2ZA 3OU7A 3SFZA 2NXNA 3RNOA 4DZTA 3UH1A 1JR2A 3PI7A 2IU4A 5FH9A 4CYMA 3AYXB 3GLQA 1TK2A 2DUWA 4NR0A 3MHTA 1T5LA 2IUSA 3UKJA 4MOWA 1M1NA 1KVRA 2Y3IA 2ZVPX 3SMQA 4EFKA 3OQPA 3L06A 4CQLA 1FMFA 3V4SA 2W4QA 3TUJC 3D2AA 3WL3A 3R9WA 3PJFA 4IMJB 2ZIXB 4JIGA 1GTG1 1P5FA 4NRDA 3ILYA 4ED9A 1TUEA 5F1OA 1JEOA 5AKJA 1T1SA 4OGGA 1QYIA 4CR7A 1F1BA 4JI4B 4O3MA 2NV0A 4HNSA 3CX7A 2OKGA 3AVVA 3IQXA 5FUMA 4CCYA 2RAVA 3MCAA 3QBTA 2G80A 2X22A 3NTOA 1EINA 3TCXB 5KVCA 2FG5A 2CXQA 4JJGA 3TWOA 2CDAA 3FLAA 4UC0A 4YP6A 4I9NA 4N18A 3IVAA 4LRYA 3NDIA 2LR0A 5FOVA 1M2NA 1KOJA 4QJ4A 2BTQB 2X40A 2YJTD 3DVSX 2CVHA 3H3XA 3Q9UA 4OA8A 1A2BA 2OHXA 4I50B 2GCPA 5IM4A 3I6YA 2DCMA 5CEEA 4OFXA 2FEAA 4TRRA 1NZDA 1QHEA 2V97A 1JDTA 1UL1X 5CGQB 5FWYB 4LYYA 5FFNA 5BXYA 3ZJYA 1RAGA 2ATVA 1RI1A 5AUNB 1FX0A 1AB6A 1UJ6A 3BREA 3HLKA 1E2UA 1Y89A 3M6VA 4GL4A 1PTJA 3B1JA 4F04A 2FOXA 1Q44A 3G3EA 3CZPA 5LQMA 1RQNA 2X9QA 4RDIA 4YQEA 3ZWOA 4UNRA 3KO8A 3R0XA 5CH8A 3KZXA 3ENWA 3QPVA 4K05A 5E2BA 3ZCUA 5A9SB 2JFGA 3UNXA 5IK2D 2BFNA 4LUCA 2B9EA 2V98A 3F7TA 4XJXA 1DDGA 1FTWA 3S99A 4FB5A 4UTNA 5JWRA 3G7NA 3L7OA 1E58A 3I2FA 1R4ZA 4YP7A 1SR8A 3GGPA 5SZIA 2VEDA 3VRHA 2HDWA 3S2YA 1PFVA 1RRKA 1W73A 4RKWA 3QUBA 3DE6X 2ZRCA 3SC2A 3WK7A 4PCUA 4F5DA 2ZUTA 3H9UA 2VQFB 4EJMA 5LOVA 4G0VA 3V7FA 5C35A 3WL7A 2M6RA 3DB1A 5C3UA 1H6AA 3C6BA 1T4CB 3LX8A 3UQYS 4DM7A 3EQ2A 4QJ3A 4IM7A 1MVLA 1R15A 3I39X 5HGJA 5LL6P 1GA6A 1N6IA 1KI2A 4RU1A 1JLLA 1O54A 3F74A 3T0GA 3EVBA 4TKUB 2ZS8A 4CNQA 2V4MA 1UBHS 2EVWX 2O05A 4FXOA 4JDUA 1FYWA 2FN7A 2GM5A 2QLJA 1D0IA 1BCSB 1OD6A 2ID4A 1F48A 1S2OA 2PRZA 3GK3A 4ER6A 1NE2A 1TVCA 1LVGA 3RWBA 2M2IA 2PA3A 3DVQX 7YASA 4PLGA 4X7BA 4F2DA 3FBWA 3VSEA 3W78A 5DNVA 1Y8AA 1O6BA 1LW7A 4AZWA 1A72A 5IUJC 1ZRHA 2GPSA 1OBOA 4KEAA 3WC4A 4UDYX 2JLXA 1O0SA 5TGZA 3ESDA 5IFKA 4MVJP 1TT7A 3G13A 4P3OA 3VVBA 3J7AC 1EM8B 2QJOA 3KQKA 3HXOA 2FZKA 3AEQA 3GLHE 3RANA 4A73A 3NZEA 3A4LA 1W30A 3G9ZA 1B16A 4MI9A 2CLLB 3TMKA 4ZI5A 1FDUA 3JVVA 1WS6A 2DQKA 1N8KA 1W93A 3PC7A 1YB6A 2V7EA 4A5OA 4ZEWA 3PE4A 5DOZA 3GLHA 2HGZA 3MPUA 3Q5EA 4NG4A 1M2FA 1XK6A 2VNJA 3B3FA 3FRIA 2VUTA 4OHXA 5AKKA 1SUFA 3ZKAA 4ZZ0A 2KMLA 3PFBA 4JA2A 3B52X 2QNIA 1Q21A 4TVOA 3DUWA 3NJ4A 4GX5A 3ZX4A 2N3ZA 3K9HA 3ZCSA 4J94A 3OZCA 2ZTMA 1ZAKA 3GT7A 2QQ5A 3OD5A 3HBJA 3VZSA 3T1TA 1FFYA 1D2EA 1G19A 1R6AA 4AD8A 5DM70 2PTGA 1ECCA 3B6MA 3FUWA 3ME5A 2LD4A 3PXDA 4AJHA 3CVXA 1XFDA 1OB2A 4FCVA 3WAGA 3LAWA 1KNXA 4Q9IA 5MFZA 5LD2B 2C7QA 3DTVD 3FWYA 3VR2A 3OEEA 3WRWA 5JJIA 1UKYA 1M83A 4ETMA 2ZXFA 1NF8A 4LRXA 1Q95A 1PJQA 2PPLA 4IIGA 3PQ6A 5ALHA 3IR7A 4LOHA 2ZBQA 4MTLA 2XUOA 3ZKWB 1VXOA 4MI3A 4J8PA 1GFWA 4MWSA 4FSHA 3CURA 4EQ6B 2BMJA 5JAQA 1C0KA 4R2MA 1C9KA 4MRPA 4R2KA 2AV6A 2FR0A 3HS3A 221PA 3IP5A 3STVA 4EL5A 1OAOA 1L6IA 2ZITA 3GIWA 3PVZA 4QT4A 2XCSB 3OCWA 4PLCA 5TQ0B 1XVAA 3HDQA 1FXWF 5EMHA 1NDHA 1SBYA 5C2JB 3E2IA 4BEBA 4OLBA 2WNHA 4OI2A 2OA0A 2UYQA 1GGNA 4ZWNA 4IHQA 1XCMA 1YB7A 3HXTA 3EJWA 4RL6A 1I1NA 2XNJA 1EBFA 4PX9A 5E9JA 3IQHX 5AVKA 4K0KB 4U63A 2C42A 4FDUA 3MWKA 1UBGA 3O1JC 1E1CB 4DAEA 1KR5A 2Y0PA 1YAHA 1G64A 3VBEA 4BMVA 2NT3A 5CDFA 2W83A 1QC5B 1T6YA 1GV0A 4OGWA 2P90A 4RZHA 3TMYA 4V1CA 4IJQA 4RQTA 1L4GA 3TLMA 3ZR4B 3GT0A 4QD3A 4D3DA 2CVOA 3A1SA 2O6HA 4N3GA 4IX9A 2PRJA 3D0OA 1CUFA 3LLMA 3AB7A 1V8BA 3D6TB 3PFNA 1HYHA 1UEIA 2PGLA 2GXAA 2HX1A 2Z83A 1KZ4A 1UANA 3S3TA 1Z22A 4PPNA 1G8SA 4H60A 4LXXA 3TQQA 3V4LA 2I4IA 3HADA 4DEXA 6ADHA 1L5SA 3JQAB 1G4AE 4RMHA 2IUUA 3UHPA 1K6XA 4W8HA 3BGOS 4CMCA 4YRKA 1YZYA 1LPPA 1ZNZA 1WD7A 3T5DA 3VR4D 3LYAA 3RUIA 1TNDA 4KLRA 3ECCA 3OJCA 1XKXA 4GW3A 4OXQA 3GMTA 3HZOA 1E2PA 3OCUA 4D9NA 2QD4A 2H0AA 5D3MA 4MIYA 3SR0A 1UBKS 3I1YA 2HPVA 4FPXA 2VDNB 3SXUB 4EMSA 4HRYA 4DLXA 4UTOA 1H3FA 1KZ7B 1NT2A 1T1EA 4ZT7A 2PJRA 3DGEC 4E5PA 3IPXA 4DV1B 1IHPA 1MD9A 4DREA 3SBDA 3GBSA 4L9SA 3ZUPA 3A6DA 1Y6GA 1WV0A 4XCVA 3WB9A 2RONA 4KVFA 5GV8A 1KMQA 2C9OA 3BWEA 4Q7KA 5A0FA 4HRAA 4ZOCA 4C5CA 4F06A 2QRJA 1ACLA 1YBHA 3NETA 2H2GA 3P9KA 2WV7A 3EZ9A 3PFFA 4D98A 4A8TA 3QW2A 3FYUC 2QSZA 2UYYA 4NCJA 4MO9A 3GGSA 3NPMA 4ZOLA 3TVDA 1F5NA 2A1TS 4DDWA 1G0NA 3WISA 4DZRA 1LBIA 1DC4A 4DJ5X 2DQYA 2FX5A 1VJTA 4Z86A 5BRJA 1I01A 2MR5A 1F06A 3ZGOA 1B0PA 1R9JA 3NUQA 3THXA 4Q93A 3BN3A 4DN6A 2I34A 3DWGA 1UOEA 2IHTA 3QV2A 3L8DA 2GSWA 3NVMB 2MWMA 3PC8A 4L4SA 1YULA 4Y2RA 1ZWKA 4PZ9A 1XZKA 3WLPA 5JYBA 2IITA 5GVRA 1R8QA 3AF2A 3ZGNA 3LPCA 2EGUA 2J87A 5AI6A 4UXHA 1EDDA 2WTNA 1R8JA 2FSVA 2R8OA 3DR5A 3K9BA 1CULC 7MHTA 3TRHA 5JZBA 3OOWA 3EGVA 2XOXA 1H65A 2FUNB 4QGBA 4WH0A 2D7DA 2VLBA 4PX3A 4EHLA 3PXEA 3H9BA 3M4XA 1VMIA 3OQ1A 3PC8C 5FBVB 3JQPA 1ZD2P 1M5RA 2CXUA 3P45A 1JFSA 3CBGA 5B7NA 3HB5X 4GI2A 3FDFA 3WMRA 1O9GA 2OG2A 5SICE 3K70C 1G8FA 2EP7A 4AU1A 2I9KA 1C3XA 1JG7A 4W5JA 2BGIA 3BQMB 2RK3A 1X70A 1CQJB 4PNEA 4RZ3A 1FOEB 1VGQA 2OHHA 3JYNA 5ESDA 3IB6A 2AX3A 2XIQA 1V5EA 1UBJS 5BR7A 3B7PA 1QVWA 4LDNA 4V38A 4X6UA 3NHKA 2LGJA 4ZYUA 4J0CA 2CLKB 2X4DA 4O4IB 2ZYTX 4BMXA 4QGFA 1YCGA 1B23P 2EFYA 1R16A 3SJBA 3FDZB 5I9SA 2H7XA 1QGOA 2O2ZA 4R0MA 2IHUA 5EP1A 4UEQA 1U1FA 1L5VA 1RC1A 2R6CA 4WMLA 2B1RA 3B6KA 4FJ0A 1E6MA 2HQBA 4B85A 2BFMA 3CV3A 3FGZA 3GPIA 3KUDA 2J31A 2VDVE 2WUWE 3HXLA 1WDWB 2O54A 1QCYA 4PYMA 1MC1A 1DPFA 4QOIA 4Z0PA 1T5DX 3O2JA 2WT4A 3NGMA 1S8AA 2F1IA 4LHZA 4PYRA 5K6TA 4BCDA 1VMDA 1B14A 4GRDA 2Z09A 3EZNA 2CKMA 2FPKA 4EPTA 6LDHA 2R8RA 4IQGA 4UNQA 3FHTA 4LY9A 3AR4A 4NH4A 4F84A 3T5BA 2WHPB 1KSHA 3HCAA 5KYTA 2D0OB 2OZPA 2Z4TA 5EVCA 2YOHA 3LW7A 4YXWD 1SQ5A 3CLSC 1S9HA 2QAGB 3QENA 4PW0A 4JL6A 4P82A 1BIFA 2JD2A 3VH2A 1N92A 4OO3A 4F8JA 5HQ3B 2LTAA 4L57A 5IC5A 5AT1A 3T4UA 4IO1A 4DDUA 4BWGA 2XD4A 2W2LD 3UB3A 4W9MC 2RGEA 4ZU1X 3STXA 3C24A 2CXNA 4G0WA 4RPIA 1LPAB 1WP4A 3R0IA 1PWHA 2VPIA 2VOEA 2WE7A 2H9YA 1CFZA 4EEZA 3H4TA 4B83A 1QHXA 4C7XA 3ISTA 3ZU3A 2DLNA 3OIUA 3F6CA 3PGMA 4A2CA 4F86A 3GLFA 3D6AA 4NCIA 5T57A 3CPHA 2GCOB 4FC6A 4ZDJA 4AS1A 1WUKS 2O7QA 4TWIA 1JIXA 4JUAA 3IPRA 2CZGA 5BV1A 3CC8A 2QTGA 2QTRA 2BTEA 3AJ8A 2MSEB 1Y5RA 1QORA 2JCSA 3HGMA 2BDTA 3GU3A 3KG2A 2HA5A 2XYQA 1DSSG 3HWRA 2X5NA 3QIVA 3DBIA 4JENA 4PR0A 3CGGA 1BHO1 4AJIA 1B93A 4AVYA 3ROXA 3CVYA 1YRBA 2FLVA 1RI4A 1R9GA 4Z3DA 2PX5A 5LN1A 3KQSA 4P3NA 4RZIA 5KVAA 2QDKA 2H1HA 1A50B 4PSVA 4FBMA 4JMLA 1RD4A 2WG0A 3AESA 4IIVA 2VDUE 3OTHA 3DVLA 4KSCA 1JMVA 2OWEA 4YP9A 4TM8A 1ZWLA 3CG4A 3GWZA 4S05A 3PTAA 4JI5B 1J5PA 2UUOA 3UXHA 4P54A 3WRXA 5KINB 2W2PA 1ZM4A 5K0LA 4N03A 3KB1A 4AN1A 1Z6YA 3EXG2 3G2PA 5LXTB 1II8B 1Y9ZA 4EHAA 2E4YA 3IXMA 5HRCA 1VJCA 2FLKA 2REQB 2Q4EA 3NM5A 3TRFA 2PPVA 3V1MA 2CFSA 3AL0C 2GRAA 2CVPA 2XXJA 3MWGA 1UM8A 5IC6A 4HGQA 2VPQA 2AYZA 2BM1A 3NV9A 1ZHFA 5AQEA 4QBGB 4KI0A 2CVZA 4MS4A 4Z1OA 2ZYDA 1F0NA 5AVZA 2R7NA 1WIWA 5CYPA 4X7RA 4BN0A 4CEHA 2H9AA 3BDIA 4R1QA 3ZX5A 2OXIA 1A4IA 4DCUA 2HADA 3R44A 3DAPA 5E9AA 1QGUA 2G17A 3HMKA 4KLNA 3RKSA 1HEUA 3G2JA 1TQ6A 4ZDIA 3LX5A 5E8RA 1PNRA 1INLA 1EMDA 5JC1A 4JXZA 1HNXB 4R3WA 2PFKA 1NPTO 3CQ9A 4KPFC 2BFCB 4B6GA 4D41A 1XWWA 1D2AA 3FW1A 4BGIA 4Q6WA 1MOSA 3M6FA 4H1HA 4AQYB 5CM9C 1KMHA 4JC0A 3TX2A 1SMKA 2OWDA 4IR7A 4NESA 1NSTA 4RE6A 4B09A 2Q3BA 4XQGA 5J2TF 2Y67A 2VAMA 4IOLA 3WL6A 3ZK9A 2PVPA 3L1KA 5AJHA 4Y7CA 2YWFA 3EPPA 2A57A 2XTZA 4X63A 4UE2A 2IW3A 2Q4TA 5B30A 4UVDA 2QTHA 5EMMA 3ZY4A 1DAIA 4YMVA 1EWQA 1TTQB 5G02A 2AG8A 4GMXA 1HNNA 3WDLA 1QAOA 3BK7A 1CJBA 4YI5A 1FPQA 2YVAA 3NFYA 4FYVA 1L4KA 2AMVA 1N0WA 2IYFA 3R41A 1QYDA 1E9DA 4N49A 4NYJR 2YYYA 4L5YA 4F4HA 2XDQB 3LC7O 3ZCXA 4CN8A 5G1NA 1N7GA 1N0HA 3VUEA 4KODA 3BQNB 4PINA 5TMPA 4GDFA 1U99A 2CNLA 1AO3A 3IURA 3WLFA 4DKXA 2O0HA 5AJTA 2PZLA 4UTPA 3TBKA 2ZWPA 2FZ4A 3D64A 3ZQUA 1OE0A 5BSFA 3D6NB 5FAKA 1W75A 3JZFA 5JG7A 3UC9A 4ZIRA 4FOTA 5JHGB 1NJ5A 4HVCA 1Z8FA 3HCDA 4J1SA 4X94A 721PA 3T35A 1H2RS 1KTVA 1PL7A 2QYSA 1PE0A 5DCWA 4B4UA 3O8CA 1SUEA 1RQLA 2ZE7A 1H0HA 3Q7PA 4HC4A 4OXNA 3JX9A 5TF4A 1X7ZB 3BH0A 2ENUA 1IUPA 3DMTC 3FOBA 4UTZA 5LQRA 3HKEB 2FXIA 1JFFA 3DBVO 1ZQ9A 3KB6A 1TVKA 3FNIA 3U19A 2BUAA 1ODFA 4YUWA 1C1YA 4DILA 3B89A 4PPQA 3VVCA 3RTCA 5J4YA 1SFRA 2DSTA 4GX2A 1P9OA 1Z4PX 3SMVA 2RAUA 1E6WA 1XMVA 2F9FA 4K6HA 1ZKDA 1SAYA 2RH9B 3RIXA 4BOYA 2A86A 5MDHA 4OHYA 2VSQA 1P9WA 2OO3A 3PFIA 1H2ZA 4JJAA 3NNDA 1R2QA 4DADA 1HE3A 4YC7A 2WD8A 5HKBA 1OFHA 4HTFB 5C1IA 5LQDA 3FPEA 4HAYA 1RCTE 4DIUA 1W5AA 3CH6A 3GG9A 4LZLA 3T7IA 3E61A 5KUTA 4LNAA 4TN5A 3JQFA 1BYIA 2MJLA 4GKVA 4NENA 1R5NA 1DADA 3ZE6A 3ZY5A 1YFLA 3LDUA 1GXSA 1MB3A 1NVWQ 2F3UA 2Q1YA 2ONZA 3BL5A 4IS3A 4EDHA 2MSWA 4KXFB 1IXYA 4PX2A 4QIHA 5J2TA 1NR5A 1KVUA 2BTOA 2NAPA 3O3OB 4J4TA 1NWHA 4N3NA 4OU5A 3U5ZB 3BWCA 4FGJA 2HK8A 3V5NA 1R4AA 2IH4A 1Y81A 3QKRA 4ALKA 2J6CA 3CUVA 1U8AA 1ELOA 1JU9A 3JY6A 4U2KA 2EARA 1MG5A 1SOUA 1Q17A 1PT9A 1AMNA 3EEBA 5D6OA 4L8YA 2ZETA 2EZ8A 4XWGA 3R8FA 4XRRA 5E8JA 4DIBA 2C1ZA 3AV3A 3L0YA 2DWPA 4KXLA 2E6KA 4L3OA 4NDZA 4QE3A 4EYGA 4GM1A 2Y76A 421PA 4RYDA 2QLLA 2ZSEA 3DFFA 4HN4B 3E15A 1WRBA 5EIHA 2B4KA 4YGXB 3LS2A 1GP2A 2W43A 2EEZA 4GICA 3K2IA 4OM8A 1MT0A 1NQXA 1AKUA 3HEAA 1MA3A 2AWNA 2AC4A 1KHHA 4XD7A 5CHEA 4LECA 5A4FS 1KEKA 4EKNB 5BN4A 4IEEA 7GPBA 4BO5A 2QUKA 1K7EB 2VXOA 5FHQA 3I01M 3FLMA 2GETA 2C3MA 4I2VA 2VDQB 1FA9A 1SCQA 1J9GA 1EG2A 1DJOA 1F2TB 1FU7A 1NP3A 2VDWA 3DYIA 3NRCA 4JKIA 1XRRA 4Z6KA 3B38A 1VZ2A 1Z7GA 1T24A 2DTXA 4KVGA 1UBRS 1JSCA 1U2QA 1UT5A 4M1ZA 4MUIA 2MMCA 3H84A 5C8YB 3ZTTA 1WPGA 4KGZA 1QHFA 4JGBA 4LHVA 2B7LA 4MUMA 4TMZA 5LNK6 4UZSA 1BHSA 4MV1A 1U7XA 1C2TA 1JEQB 3W1EA 4WLNA 3T61A 2P3OA 4M1WA 2EFJA 4QUAA 3H0EA 2EFEB 1ODIA 2TYSB 3FDJA 3WIUA 4U7HA 2O2IA 3AHCA 1ICIA 1TCCA 3H2IA 4EFMA 5BNWA 1Z17A 5L3SA 2Z2ZA 4NNJA 2PH5A 4FOLA 5FWAA 4YP1A 5JHHB 2GBPA 1CYEA 4EJSB 2J4DA 2P68A 3BZUA 3VPDA 5I4CA 5I9NA 3PEVA 2BEKA 1N34B 1ZN9A 2ZAYA 3TTXA 3NIGB 3W2TA 3AJDA 5CXSA 4HT3B 4B46A 3CY6A 1II9A 1TA4A 2J0UA 3J7TA 3FPAA 4PS1A 3DE0X 5EN4A 3JQGB 3HDYA 5F2KA 3CLHA 2RARA 1KYWA 1GFIA 4LGYA 3VBCA 1P1IA 1VA5A 5EFZA 2ET6A 2ZIFA 2WJPA 5J1SB 1WXDA 2IS1A 1H9AA 3E22A 4MO2A 4YDHB 5C4GB 3A6GA 3QBDA 3BYZA 1ZK2A 3ITDA 2DG2A 2O0KA 4WFIA 4OP2A 4RZQA 4WXHA 3W8EA 5BR1A 1GSHA 1CNMA 4M1QA 4CLRB 4RK6A 3R76A 4BJ5A 1T5HX 4RKEA 2PWYA 1EFKA 3PD7A 3X3HA 1ISMA 5A6SB 4XJTA 3ZLUA 1O6FA 1Y1SA 2B8JA 5DIFA 1PQUA 3R6GA 2ECFA 4Q3DA 1SOWA 2XB8A 3JWHA 2ODQA 5TXGA 2W4MA 2X2FA 3DLTA 2P4SA 2INGX 5IT9A 2JIZA 3WWYA 4AECA 2P11A 1J1IA 1P3JA 1EWVA 1MUUA 1QX4A 1WO8A 2JJ1D 2ZUUA 3FYCA 3QG5A 3OZRA 1FUEA 3U44A 5I4KA 1G63A 2EW1A 2ZQZA 4CKYA 2QY9A 1Q3HA 1RPJA 1UMCB 2R00A 3B20A 2Q99A 1GO2A 3V80A 1WM1A 1ESDA 3R7WA 5JDCA 4M49A 5KSZA 1B7GO 3OKPA 2BF7A 2BFBB 3AERB 4P0PB 1TCUA 3C3PA 3GW8A 2H1VA 2WICA 3BX1A 2GF0A 3EGEA 1DC7A 3GELA 1PQPA 4KYVA 4MVJG 4FS8A 1P0CA 5SYAA 4C08A 4HNTA 2VH2A 4US2R 4DCPA 2L0XA 4NMMA 4D92A 1XVIA 3IBSA 4LE1A 2J3KA 1XAJA 2IL1A 4IJ6A 4W82A 3ESBA 4KDFA 2ZQ5A 1ONNA 2J9FA 4RNCA 5JDCC 1EVZA 1IHXA 1R66A 3I73A 4IEFB 3PUZA 4GPIB 2AD1A 4YNBA 3OIWA 5D5HA 2YR0A 4IGAA 3ET4A 3MXOA 3OZTA 1MQSA 1UDXA 3AFNA 3TLCA 4KHPB 3TQOA 2Q0QA 4GQIA 4HDSA 2HA0A 2ZM5A 1ZD3A 4FVTA 2WWXA 4HCJA 5I7HA 3Q8WA 4QNNA 4MINA 2FE4A 1RAFA 4IZHA 1KWKA 3V8NA 4JODA 4X3PA 1OGYA 4M8NE 1BSVA 4GC9A 1YJ5A 1VOTA 4XGRA 4CGYA 3V42A 3P4YA 4BLVA 3FOAA 2O59A 2FWPA 2P6OA 3OF3A 4YCMA 4RA9A 5DI9A 3GR6A 3KQVA 4MJ3A 2C2WA 1KYQA 2RC6A 4X1KA 3RVMA 1OGJA 3HLTA 4UAGA 1AGNA 3T34A 4JQZA 2IDMA 3H6KA 4AIIA 4ZOAA 2G0NA 2Q3FA 2FPIA 3ANXA 4FKZA 1NBAA 1DJLA 2XMDA 3S28A 2Z30A 1PEAA 1MABA 3QELA 4M0EA 2G9NA 2HRRA 4YAIA 4LW8A 1K7YA 4X3OA 2X9GA 2TMKA 1K88A 5JZ9A 1GT91 4KQFA 5JJKA 3NG1A 5AMXA 1FFWA 4MRMB 2ZUWA 4C0LA 2PSDA 3RI3A 4UATA 3GO4A 1RZRA 4B6PA 1TM2A 1AVTA 3IQZA 1D4OA 1PNTA 4P22A 1F6WA 1HZZA 5B3LA 4D57A 1DOAA 2Z1DA 2HMSA 3VKVA 3KYBA 2DB3A 3H2JA 1ODLA 4MV0A 5EHXA 2EU8A 2OQIA 3P9RA 4MYUA 3BD8A 2V7QA 1FB5A 3A1NA 1VBMA 1H1DA 1DAFA 2PGDA 4HQFA 3LOQA 1CT9A 1QGZA 4RFVA 2CSUA 3O8QA 5TS3A 1L5HB 2H7CA 1SVNA 1Z2EA 2R68A 1NOKA 2L18A 3QPDA 3MLEA 1UDAA 5LR6A 1TB4A 1T2CA 2ANBA 3DUFA 1CIPA 4CLOA 4EI9A 1IXKA 2JGLA 1YDMA 4NCKA 1GCAA 2ASVA 1Z15A 4MVJI 1R4MA 4PAGA 1P0MA 1JECA 1XX6A 4YACA 1VE3A 3SKVA 4EUKA 2FW1A 1WVMA 2I6TA 3O95A 2C2MA 1U5AA 4RA6B 1X9IA 5EC8A 3OY2A 1Z4KA 2QORA 3A11A 4DCMA 2BE7A 1DAOA 3A1CA 4UM9D 3EC7A 4YAEA 2R7MA 2ZRDA 5H1YA 5EWJB 5ENVA 3IAUA 4PFJA 3OTOB