3GDHA

Methyltransferase domain of human trimethylguanosine synthase 1 (tgs1) bound to m7gtp and adenosyl-homocysteine (active form)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
211
structure length
211
Chain Sequence
LPPEIAAVPELAKYWAQRYRLFSRFDDGIKLDREGWFSVTPEKIAEHIAGRVSQSFKCDVVVDAFCGVGGNTIQFALTGMRVIAIDIDPVKIALARNNAEVYGIADKIEFICGDFLLLASFLKADVVFLSPPWGGPDYATAETFDIRTMMSPDGFEIFRLSKKITNNIVYFLPRNADIDQVASLAGPGGQVEIEQNFLNNKLKTITAYFGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Trimethylguanosine synthase homolog
publication title Structural basis for m7G-cap hypermethylation of small nuclear, small nucleolar and telomerase RNA by the dimethyltransferase TGS1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 74
structure length 211
sequence length 211
chains with identical sequence B, C
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09445 Methyltransf_15 RNA cap guanine-N2 methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3gdhA00
3NW9A 4RTPA 3OE5A 4ER7A 1XXLA 3VC1A 1DUSA 4PIMA 5K03A 3R0QA 2NP6A 3LKZA 4QVKA 2YTZA 4HH4A 3REOA 3X0DA 1XDUA 1YUBA 4OQEA 1X19A 3E23A 3GWZA 1BC5A 5K01A 4PGHA 5HOQA 5CD1A 2PY6A 5HZMA 4DCMA 4M37A 1RI4A 1ZGAA 1ZG3A 3S68A 1SVUA 3EPPA 3GRYA 1R00A 3KKZA 4FGZA 5K0JA 1N7IA 4RYLA 4ATNA 4E2XA 5IH3A 1RI2A 5BW4A 5MHTA 4AUKA 3OFKA 3ANXA 4AZSA 4CTJA 1X1DA 5JR3A 3NMUF 3CJQA 2GAFA 3Q87B 4AZWA 2BM8A 5FA8A 3KHKA 4BP3A 2YQZA 3ERCA 5EQJB 3UJCA 2YVLA 2VP3A 2XYQA 3DOUA 2EFJA 2N47A 2ZBRA 5FQNA 3EGEA 3HVIA 4X41A 3RW9A 4YV0A 2AOUB 4P7JA 1G60A 4QPPA 1MJFA 3PTAA 3HCAA 3EMDA 4QTUB 3EVGA 1BHJA 3I64A 1EIZA 4FP9A 4XUEA 1XJ5A 3BGIA 3FUXA 3FTFA 1FP2A 1XCLA 3G88A 4HGZA 4CXMA 3DXYA 5EZQA 4YUZA 1SUSA 1XDSA 3LBYA 3BUSA 1JQDA 3M70A 4OBXA 2G72A 2VDVE 2ZZNA 2E5WA 3ID6C 1SG9A 2DULA 1AQIA 3DMGA 4BLVA 4F84A 5HIJA 4FSDA 4PCAA 4CKEA 2EX4A 1M6EX 5DX8A 3KR9A 3P2IA 5M5BA 2H1RA 1SKMA 1WY7A 2R6ZA 1ZQ9A 1WG8A 5LQAA 2GLUA 5JUWA 3MCZA 3UJBA 4DZRA 1G38A 4U7TB 5T6BA 2P40A 2YUIA 1SQGA 2VDWA 1QAQA 3GRZA 5E9WA 4KRGA 3THSA 3UJDA 5FULA 3SSNA 2IBSA 1AV6A 4IV8A 5GIPE 2OYRA 5EC8A 1RJGA 2EJTA 1G8AA 1ZGJA 3CJRA 3GU3A 5HIKA 2OPBA 3KR0A 3TRKA 5FCDA 4X63A 1YZHA 4MQ4A 4FR0A 3CVOA 3G8AA 2PT6A 4QQNA 4C08A 5E8JA 5P8WA 3I5UA 5E1BA 3TR6A 4GF5A 3ELYA 3OZSA 2XVAA 5FA5A 3GGDA 4YUYA 4MHTA 2AVNA 3ER8A 3LKDA 5DSTA 3IYLW 5DX0A 5CCXA 4MTLA 5E1OA 1NBHA 3MTEA 1L3IA 3HCEA 1KHHA 2JH9A 5BXYA 5K09A 4RX1A 1YB2A 1PRYA 3B7PA 2ZSUA 2AN5A 2B25A 4PYQA 4RVDA 5DWQA 4YMHA 4GEKA 5IKMA 2PXCA 2ZCJA 2NP7A 2ZLBA 4A6DA 4C05A 3B3GA 4PINA 5FHQA 2ZULA 3LHDA 2FCAA 3BWBA 3NDJA 3CC8A 2CKDA 4QVGA 3BXOA 1L9KA 1YFLA 3DMHA 3QOWA 1EQAA 1NV8A 1H1DA 2K4MA 4OBWA 2FYTA 1VL5A 2HMYB 3OCJA 2ZVJA 5DRTA 3SM3A 4E31A 3GNLA 4GOMD 4E30A 3HCCA 1I9GA 3KPWA 5E2AA 3O31A 5F2OA 4P58A 3ORHA 3HVJA 3AJDA 1VIDA 3B3FA 3KQYA 4FT2A 4QTTB 1M6YA 2JH8A 2P3LA 5EHGA 2AS0A 4R8SA 2UYHA 1EJ0A 3KR1A 1TPYA 3CJTA 1JQ3A 2YXDA 2NXCA 2YXEA 3FPEA 3JWGA 4RTKA 1HNNA 1RI1A 2ESRA 3DMFA 3HCFA 8MHTA 4AZVA 4PYNA 5E8RA 2GB4A 1BOOA 3DP7A 3G5TA 1L1EA 2G71A 3E7PA 1NW7A 4DM3A 4E2WA 5GIOE 2O05A 1JSXA 4F85A 4RVFA 5FWDA 2NNWB 5DM4A 5BW5A 1NE2A 2AZTA 3EVAA 3SR4A 3DR5A 2ZZMA 3PFGA 2GA9A 4PYLA 2OKCA 3SX0A 3NJRA 3TFWA 5DT2A 2C7QA 1X1AA 1NV9A 2JHAA 3EVDA 3KQTA 2A14A 3G5LA 4DF3A 2GPYA 1VQ1A 2JHPA 4E2YA 3KQMA 2F8LA 2OBFA 5EPEA 3AWIA 3R24A 5HIIA 3FYCA 3KU1A 4EK9A 3EEYA 1VP9A 1SQFA 2V74B 3B5IA 1VLMA 2ORED 1KPHA 4WVLA 3SSOA 3R3HA 4EKGA 1KP9A 1EAMA 1JG1A 3M6VA 5G02A 3D2LA 3HA7A 1KR5A 3GO4A 2PWYA 5DTQA 3C3PA 4B17A 2H11A 4C07A 4RTSA 3NWBA 4RTJA 3MCTA 1TW2A 1RI3A 2FPOA 2PT9A 2C7PA 3T0IA 3KPJA 2NYUA 3GRVA 3QOXA 3VYWA 4ER3A 4BP1A 4BLWA 3CBGA 1QAMA 2BR3A 2IFTA 2YX1A 3TMAA 5EMKA 2IH5A 5F2KA 3FUWA 3LCUA 1T43A 1XCJA 4HRAA 1Q0TA 2OB2A 2PJDA 4GOOD 4GUAA 1KXZA 1JSZA 3EEOA 2ZBPA 2C7RA 5E1DA 3VC2A 4YUXA 1KYZA 5CUQA 3H2BA 4POOA 2QRVB 4P7KA 1O9HA 4LWOA 3CKKA 3G2OA 2OB1A 1JTFA 2EJUA 4KW7A 2O0LA 5DTMA 1IY9A 1U2ZA 3BKWA 3BKXA 3DXZA 2YXLA 3GCZA 3O4FA 10MHA 1VPTA 3P8ZA 1RJFA 5CIYA 5K0GA 2G70A 4K6MA 2FK8A 4FS8A 3UBTA 1R8YA 1WXWA 3A7EA 2HWKA 3O7WA 4HSGA 4PNEA 3UA3A 2HNKA 2IDKA 1PJZA 1I4WA 4EKIA 5LQCA 5EEGA 4X60A 3BGVA 5KQSA 4C06A 2HTEA 3UFBA 3NVKI 3E8SA 3M4XA 1QYRA 3BZBA 1F3LA 3DTNA 3BT7A 4CKCA 1Q0SA 3HP7A 4KVZA 4M38A 4U7PB 2PLWA 3HM2A 1B42A 2P7HA 3R6TA 1KIAA 2C7OA 2R3SA 3JWHA 4MWZA 3NWEA 5EVJA 5C9ZA 3KPYA 1UWVA 2AR0A 3AXTA 3GJYA 3FYDA 1YF3A 5DXJA 5LSAA 2QM3A 3GDHA 1P1BA 2I62A 4ZTBA 3UJAA 1P39A 4V0RA 5C0OE 3HVHA 3LDUA 5EMMA 4HGYA 5EZSA 4RTNA 2PSSA 5K0CA 4A6EA 1JG3A 5GOZA 3TM5A 5K0EA 2BZGA 1N7JA 3P9NA 4C4AA 3KQOA 3RIEA 1Z3CA 2PGXA 3ELUA 5EEHA 3HCBA 4KDRA 3V8VA 3EVZA 4RSRA 3MERA 5D1HA 4DMGA 2B2CA 1KPIA 4R8RA 5K0NA 2AOWA 2PX2A 4RTOA 2AOVA 5D1NA 2PV0A 1FBNA 2OO3A 5GP1A 1JQEA 3G7UA 3KPUA 3EVFA 3KQWA 3G2PA 4CTKA 2XBMA 3P9CA 4Y2HA 5K05A 4OQDA 5E2BA 2AOUA 4GOLD 3DULA 1F38A 2ONYA 1P91A 2QRVA 2NXJA 4PYKA 4Y30A 3LECA 3SSMA 4PYMA 5F2NA 1DCTA 3PB3A 4YMGA 3FPHA 1JR4A 2BH2A 2OY0A 3IHTA 2B78A 3C0KA 1NW3A 2O06A 4AX8A 4R05A 3I58A 2NXNA 4XUDA 5T64A 3R9XB 1QANA 2WA1A 3EGIA 1D2HA 1JTEA 1ORIA 2AN4A 3MTIA 1INLA 2ZBQA 2ZW9A 3ELDA 4PGGA 4BLUA 4X61A 4ER6A 1G8SA 1G6Q1 4E2ZA 2FRXA 3FPFA 5DPMA 5ICFA 3HA3A 2I7CA 4C04A 3V97A 4E70A 3PT9A 4XUCA 5DXAA 2H00A 3UJ9A 4P7FA 1RI5A 4QQKA 3NVMB 2ERCA 3K0BA 4R6XA 5DX1A 3SMQA 4PWYA 5T67A 3A27A 3MGGA 3TPZA 4RVHA 3PS9A 3P2EA 2CMGA 3FUTA 2P3QA 4DKJA 1ZKDA 2G8NA 2BM9A 2XVMA 1WS6A 2OXTA 2Z6QA 2QY6A 3GXOA 5FQOA 5DM1A 5DM0A 1NBIA 1P1CA 3LCCA 3A25A 5EIWA 3LGAA 5K0LA 3ER9A 3ELWA 1YFJA 4OX9Y 5LQRA 3LCVB 3E05A 5FHRA 3KQQA 9MHTA 1KYWA 4O29A 3GRRA 3DUWA 4HG2A 1JG4A 5GWXA 5GINE 5CCBA 5CVVA 3BWCA 2VZ9A 1UIRA 2AN3A 4CKBA 4YV1A 5HEKA 3TLJA 4ER0A 4CWAA 3HEMA 3FRHA 4L7VA 4DQ0A 5LQKA 5CVUA 3L8DA 5C1IA 2VDUE 2PX5A 5HIMA 3HVKA 4XCXA 5CM2Z 2AOTB 4RTMA 5EIFA 2ADMA 5EKXA 4E32A 3I53A 3OU6A 4RV9A 3WSTA 4JXJA 2GS9A 4M7RA 3HA5A 4IWNA 2ZTHA 1YZ3A 3MHTA 2PXAA 3T7RA 2ZIGA 3EMBA 2P7IA 1L3CA 1NT2A 3C6KA 1R18A 3M6WA 3SGLA 3EGVA 3FTDA 3KQPA 3BWMA 2Z6UA 2LD4A 1RJEA 1I1NA 3OU2A 2ZWVA 3PFHA 4YUVA 2PX8A 5LQNA 4GOND 1R8XA 3VSEA 3M33A 3KQSA 3U81A 4C03A 3B3JA 2P1DA 3I9FA 1X1CA 4EVIA 3FUVA 1RJDA 3T7SA 3RODA 2WA2A 4KWCA 4PYJA 2XYRA 2CMHA 1JG2A 3IEIA 3M6UA 2HR1A 5BP7A 2B3TA 3TQSA 3UJ7A 3BWYA 4H0NA 3LBFA 4ISCA 5U4XA 4FSXA 3FTCA 2PX4A 3LDGA 5K0FA 1MHTA 1QAOA 3FPJA 1NW5A 5GM1A 4RTQA 5EMLA 2VS1A 3OZRA 4IV0A 1NKVA 2I6GA 4OA8A 3K6RA 2IPXA 3LDFA 2IGTA 3M6XA 3TKYA 4AZTA 1OR8A 1NW8A 4KIFA 3LSTA 3LL7A 5DRYA 5HFJA 3HCDA 4DCGA 1M0EA 2ONZA 2DPMA 1FPQA 3BGDA 3OU7A 3KR2A 3OE4A 2HV9A 3AY0A 3EVEA 3ME5A 3HNRA 3LPMA 3MQ2A 2IP2A 5E9QA 4M36A 3P9IA 5H02A 3DH0A 3UWPA 5ICCA 2NXEA 3A7DA 3FPGA 3GRUA 2V7EA 5LR6A 4BY9E 2BR4A 4E33A 2AOTA 3AXSA 3C3YA 3OFJA 4HC4A 1IXKA 1TW3A 2Q41A 2ZIFA 3FRIA 4LG1A 4RWZA 5FADA 1AQJA 4OA5A 3DLIA 2CL5A 4DA4A 4QPNA 5ICEA 3PLAE 2PKWA 2P8JA 5CVEA 3NTVA 2AOXA 2PBFA 3MAGA 4HTFB 2ZZKA 3P2KA 5DSXA 3UZUA 4EMSA 4GC5A 4LECA 2ZWAA 2IIPA 2JG3A 1R74A 4LWPA 3UJ6A 2JHCA 2YR0A 3UJ8A 1Y8CA 3KQVA 1R6AA 2QE6A 1NW6A 1ZHFA 2O57A 4MIKA 4P7GA 2FK7A 1XDZA 3LX6A 1G55A 4FZVA 3G2MA 3PX3A 1D2CA 2EG5A 2XYVA 5EKUA 3Q7EA 5CVJA 4IKPA 3C6MA 3OZTA 3P71T 1EJ6A 4GQBA 1VE3A 3G8BA 3HTXA 3NDIA 1IM8A 5GM2A 1O54A 5E9JA 2JJQA 3GIWA 3P97A 3B89A 3G89A 4X1OA 5DLYA 2B9EA 2ZFUA 3DXXA 2P41A 4Z2YA 3FUUA 1DL5A 2OZVA 2UYCA 1HMYA 3P9KA 5CVDA 2ZIEA 4RVGA 4V0QA 3F4KA 4KDCA 4PCLA 2P3OA 3T7TA 1O9GA 5FUBA 2AVDA 4QDJA 5LQUA 1FJXA 5B1SA 3FTEA 1FP1D 2P35A 1AF7A 3CCFA 3DLCA 4PYOA 4PIPA 4F86A 3TOSA 4QDKA 2IDJA 5DTRA 1ORHA 1XTPA 1EG2A 2BR5A 1KPGA 2I9KA 1VBFA 1QZZA 3SVZA 2FHPA 3QV2A 3PVCA 1SUIA 1UFKA 4KIGA 5FWAA 5HILA 4YUWA 2IH2A 4WXHA 5KS2A 1N2XA 3EVCA 3TM4A 3IV6A 4G56A 5KQRA 1V39A 5EOVA 4FT4A 5LQJA 4GBED 5EG5A 3A26A 5FTWA 1L3BA 2UYOA 3MB5A 1WXXA 5E1MA 3SXJA 5EGSA 4ER5A 5ICGA 3EVBA 4YV2A 4UOEA 2UZ4A 2IH4A 5ERGB 1D2GA 3UA4A 4PONA 5K0BA 2Z6AA 4HTFA 2KW5A 3PX2A 2Y1XA 3KPVA 5KYGA 1XVAA 2Y1WA 1X1BA 5DM2A 5KVAA 1WZNA 2GH1A 2PWPA 3G2QA 4RTLA 4GC9A 2QYOA 3JWIA 3TKAA 2PXXA 1VP3A 4R6WA 3CGGA 2UYQA 1BKYA 4EQZA 3OPNA 2O07A 4PYIA 7MHTA 3FZGA 3A4TA 2IBTA 2G1PA 3THRA 3JWJA 5EMJA 2CWWA 5EHIA 2WK1A 2PVCA 5K8VA 4RTRA 4NECA
chains in the Genus database with same CATH superfamily
4L75A 4EO9A 2VEDA 2NPIA 3N58A 1U6JA 1XXLA 4HV4A 1KMIY 4EW2A 3A36A 2AFIE 1L7RA 2FR1A 1QDUA 2JEZA 4QVKA 3SZGA 5AHXA 2PNJA 5I5EA 3MLEA 2J8ZA 4OQ4A 1NKSA 1BC5A 3GC6A 4O1MA 2OBXA 4ZVMA 2E49A 3UJPA 3FAZA 1WZEA 2CVOA 2PUTA 2V7BA 3ESBA 3HWSA 1YBVA 1UMCA 4RXTA 4WNYA 1DI0A 5EUBA 1II8B 2D1RA 3DE1X 3WIEA 3EPPA 4ZEMA 5G41A 1E5VA 5K0JA 2J5RA 4M1MA 4X1YA 3OZEA 5BW4A 4DR2B 5MN4A 1BGWA 3HZRA 1S4MA 2O2SA 5B1EA 1N6IA 4D2IA 4W8HA 4ENPA 2A0YA 4JBLA 4N6GA 1DO0A 2YQZA 5CNIA 1BFUA 2DR2A 4WFJA 2VP3A 3OHMA 2X5KO 5A4AA 4HLUA 3U09A 4RXUA 1RLIA 2QVGA 4XTRA 2PJRA 1P75A 2ECKA 4N49A 4A0QA 3LNTA 1UINA 1H6BA 2O2IA 4D8WA 4CLOA 3EVGA 5TGZA 5CFOA 4IIJB 3SC6A 1OH7A 2FG7C 3NIWA 4ND3A 3F1KA 3HJFA 1EZ1A 5TMPA 1LPOA 1A5ZA 2W2XA 3M1AA 4ND2A 2JGAA 1U6IA 4MO2A 2RIPA 2NW6A 1TTQB 4QFMA 1XO1A 4Y6LA 3QKTA 3ID6C 1MNQA 1PZMA 2W83A 5E3HA 1IVYA 1G42A 5D3QA 1AQIA 1YNSA 2J85A 2FPLA 2VUHB 5FF9A 5BV2P 4IR7A 3FSGA 4CLRB 4Q16A 3OZBA 4FSDA 2FX3A 2WLSA 4NI5A 1IOWA 1Z7EA 3ZD7A 1NJ6A 2IPMA 2IEIA 3PQFA 1EM8A 3N75A 3Q3VA 5JMWA 2ZAMA 3SYMA 2CCKA 1K8QA 4U7TB 3AVVA 1W25A 1DKQA 1KJNA 3DO6A 2W71A 4OTZA 3UXEA 2AMYA 2FJPA 4PZ0A 1ULSA 1W59A 4X45A 5A3RA 3C6BA 3STXA 2ZTVA 3KUKA 3NH6A 3EA0A 4G8JA 4KXQA 1ZGJA 4UE2A 2GD0A 2IVZA 5ULLA 3L8HA 4G5OA 1UC4B 3EAGA 4JL5A 3RNOA 4AUEA 9ABPA 5C52B 1EVIA 2N46A 3KAKA 4C08A 5JRDS 5P8WA 4WBSA 1ZMBA 4M0PA 3IX7A 3CNLA 4QULA 3EBOA 4ZOQI 3ZR4B 3T7DA 1TAGA 2CDCA 3AVYA 1OZ0A 4UBMA 4IF4A 1IC6A 2OQIA 3VMFA 2RAUA 4EG6A 5ALQA 3N53A 2UVQA 4CHTA 3LWBA 3OPQA 4B33A 1DC8A 1YR2A 3KB8A 1HBJA 1PRYA 1D04A 2B25A 3H2KA 1FXSA 3HDQA 1RRFA 3OY2A 2ZCJA 3VJRA 2IF0A 5AKLA 2VUTA 1T5LA 1TL7C 2QD5A 3BWBA 3O8NA 1DAHA 3RVMA 4D9GA 2QPTA 2J0UA 1E6MA 4AJJA 4A0HA 2OUKA 4YYZA 3AVWA 4GMXA 1C50A 3RARA 5CURA 2DF8A 5CYPA 2ILVA 3PQ7A 4E31A 3B5JA 1SUDA 1RR6A 2JARA 3ODPA 1ESDA 2J30A 2X14A 4QBGB 1VI6A 2AUTA 4C29A 3T3HA 2J3IA 5F1PA 1L5KA 3U3XA 1VIDA 1L8OA 3S7TA 5H59A 3WK4A 4MUKA 1NLZA 3CRNA 4KSYA 1I8TA 3B1ZA 5IKEA 3FSGD 3KKMA 4ZC1A 2ZUSA 1JB1A 1QFJA 4TQ9A 3JAWA 3AUTA 1HK7A 3NEAA 4XOUA 5A1JA 4EHIA 2H1HA 4XGQA 8MHTA 4N7BA 4PYNA 1OWMA 4Y9UA 2VJOA 4Q19A 2GB4A 3PDJA 4J0IA 4RQBA 2H48A 3JAKB 4WCFC 3NOXA 4X00A 2JZCA 1VHDA 2ZSAA 3IIMA 2PRKA 3ILHA 1QWSA 1Z2CA 1JWAB 3EVAA 4HQ6A 1SVWA 3D6UA 2AJLI 3DEIA 3IDSA 2PX6A 3PFGA 1H94A 3A32A 3HYNA 4ZO4A 3SX0A 1Y7HA 3NJRA 4L9SA 4TS9A 4PQYA 4B7UA 3SE7A 4BX8A 3RRZA 1YV9A 3G5LA 3OF5A 1EK1A 3VH3A 3VAYA 5CXUA 4G5XA 2GJAA 1U8UA 4NH4A 3ZV4A 1RRCA 2IKSA 4RD3A 3I9OA 4C2TA 3BSWA 2VF8A 3V9AA 3D9QX 3MD0A 3TNYA 4QKQA 4EBFA 4LF5B 4EECA 1SKYE 4O08A 4MLPA 3UMJA 1K0FA 1LLCA 3DNFA 1W5SA 4QPZA 4R3UC 5EQFA 3B6EA 2OHFA 4LDRA 4C07A 2P5TB 1CUVA 3JYNA 3C3PA 4H1HA 5TVGA 1YE3A 4CCYA 4RTSA 3RC8A 3C7KA 5FPHA 3G8YA 3QVKA 4Q1VA 1C0IA 2NYUA 4GP7A 3A1UA 1ZOLA 3KC2A 5JDIA 4ER3A 3M1LA 3EY9A 1FFHA 1XKTA 2J67A 4IHAA 5JC1A 4FI3C 2YJZA 3T3DA 3W1VA 4ZJZA 3GLHB 3BE5A 1N2CA 1NJ8A 1DMRA 3UYKA 3UW3A 4A27A 5JT1A 1QDEA 4PGMA 4PLYA 5EE1A 5FTKA 1UMKA 2XHZA 1NVBA 4M87A 1IXRC 3L4EA 1O9HA 1HQKA 3EZXA 3RIYA 4D9MA 3H04A 1U2ZA 1U5AA 4DNXA 2JFWA 4U7GA 2C9MA 4H7PA 5FBKA 4AKEA 2QS9A 4UVHA 2MYUA 1FOEB 2AT1A 2IJGX 2POCA 3RSHA 1P1JA 4E5DA 3H5RA 4FS8A 2AQIA 4PZDA 2OMEA 2WV7A 2YJTD 5EUMA 4GQIA 4H77A 4GI1A 3VOBA 4FEGA 4FONA 4TKMA 3NC0C 4S0ZA 3N5CA 4LXYA 1PJ2A 1BD3A 4EKIA 1QYXA 3I2YX 5EVCA 2FX5A 1UWKA 4WESB 3ZK8A 2UUBB 1DDIA 3QVXA 4HB4A 2WU3A 4DPMA 3BT7A 1W35A 3D0QA 2CNKA 3A9WA 3R6TA 2DOKA 3OH8A 4K6CA 2JFVA 3NWEA 3NFRA 1GDDA 2KBFA 1NBME 5JG7A 3WLOA 5FH9A 1XZGA 2FN9A 2R6AA 3FKSA 4MQ6A 4S05A 1X9IA 1J90A 2O1WA 4BVFA 5LQMA 1HGXA 1E7QA 4DG8A 5J4HA 1L7NA 3PUVA 1A9XB 1LK7A 5C0OE 3QBDA 4XIGS 3WK6A 4E5PA 4NSNA 3LT2A 4XM2A 4ETIA 5KQMA 2LCIA 2JLRA 5CAEA 5GOZA 4UJ3A 1UFQA 4ZODA 2KYRA 2WD9A 3HKDA 4CFYA 4KOAA 4DE5A 3CM0A 4B45A 1UXOA 3LXXA 1JPNA 5H7XA 5FI5A 2JCSA 4KSCA 1RYFA 2WJPA 2GRAA 3N8NA 3AEKA 5DO9A 3TIVA 4ESHA 3PHCA 3QUBA 4RTOA 3NIGB 2JAUA 4N5MA 5GP1A 4ROSA 5AI4A 1M2OB 2A7QA 2R00C 3G7UA 3QU4A 3T3EA 3UAOA 3WB0A 3D4PA 4I7EA 1TMGE 1AF4A 1ZD8A 4QTYA 2QRJA 4X3CA 3F7NA 3VOAA 1SCAA 3VV2A 4B3IA 2CDNA 2AMFA 3OZAA 4RVCA 3V6MA 3AZOA 2BMWA 1ULTA 1XR3A 2EWWA 3NIFB 1Z0DA 2G1JA 3OQ1A 4MARA 4RENA 4F3TA 1M66A 2XRYA 1JR4A 2HCFA 2QM0A 3OZCA 3QXHA 4FGSA 4JLBA 4KNVA 1NW3A 4KQWA 3QY9A 1Q44A 4NABA 1P29A 1WB5A 2NXNA 2J3QA 2QL7A 5T64A 5CB6A 2JFFA 4BNJA 4M9ZA 5FAXA 5EJ2A 2P90A 2V0GA 1KP3A 4BMVA 2ZKLA 3NUGA 4U8GA 2W6PA 3M9XA 4CGZA 1GNPA 3OJEA 1Z4OA 4RGYA 1U0GA 5JUWA 4L8GA 1VC2A 2I7CA 3G2JA 1HNXB 3KTAA 1A8IA 3EGWA 1QU2A 3KXPA 3PPYA 3U17A 4EW1A 1H0RA 3NVMB 4LNAA 5ILOA 5JJCA 2OAGA 3K32A 4FDVA 5JQWA 3UMGA 3VTKA 1L4LA 2XF8A 3QBEA 4I55B 2EKZA 2WZBA 3IQXA 4ARBA 2P2CA 1X1SA 2GAIA 4TLEA 3FKSD 4DWOA 2SKDA 3DHVA 1ULZA 5BUQA 3CZAA 5IJAA 3RF6A 1VPDA 4XM1A 1KBZA 5JDCC 5K0LA 3ODGA 2W2VA 1GPYA 1JE0A 2WSMA 1P3Y1 1W0JA 3AUAA 1C0KA 3LOUA 4HDAA 4HMQA 1X94A 2Q27A 5CVVA 4EMTA 1UC8A 2HJHA 5DGIA 1XRLA 4BDSA 1A8PA 4LE2A 1QGED 4UM9D 1GZ5A 2I1LA 2BTQB 3AFHA 4AQ7A 4XCXA 2XUZA 4Y0VA 2EQBA 4QLBA 1E1DA 3G2NA 3E84A 1MIOA 4G1UC 1TRHA 1WV0A 2PXAA 4OKIA 4IRMA 1HDYA 3VSDA 3FOFC 4CDRA 1PJSA 1OLXB 1TF7A 3LCJA 5CTAA 3RSFA 1UJMA 1IWBB 4MS3A 1TAHA 1W46A 4E94A 5C53B 1J5PA 4LWQA 1HLFA 3K8YA 3EG9A 2ZBDA 2HX1A 3CS3A 1KY3A 1UP6A 3D8TA 3KQSA 2JL1A 5BSUA 3S40A 5B36A 1A9SA 1KZYC 1RP1A 1OZHA 2BW0A 2ODTX 3AV3A 3D4BA 3HKCB 3N8KA 4IAOA 4IOKA 4UTXA 2I34A 2VL7A 1FP4B 1P17A 3L1UA 3PKJA 3O94A 1K63A 2A7XA 2PMDA 2R751 4HYQA 4HS4A 3AR6A 3I39X 4P3XA 4CHGA 5B2EA 2ZJ3A 3BWYA 5LC1A 3VJLA 3C6YA 3CGWA 2W2TA 4DDUA 4I55F 4R1TA 4UZEA 2ZYGA 2AF4C 2PMFA 4HNAA 3ASUA 2ID4A 3CH6A 5JZOA 3I2HA 3K0AA 4J0JA 3BPSA 3ZDDA 4ZQIA 1Q50A 2FZVA 1BXGA 1DKNA 1ADBA 1DQZA 1TVMA 1Y5MA 2A30A 5DHUA 4TKVA 3PC2A 3CN7A 2P65A 2NU8B 5DRYA 3WZMA 4ACBA 1LBHA 5FORA 2ONZA 1YACA 3PJFA 2B5OA 3B36A 3T7EA 4OX9B 4NCAA 3E3AA 3M6LA 3K1AB 3AY6A 1UMBA 3AR7A 4FTWA 3RK0A 4D99A 3AY0A 4UVEA 1ZD4A 4FE4A 4WCVA 4LZOA 1T9ZA 3I1YA 2ES4A 2H08A 2XE6A 3HNOA 2ID7A 3TVYA 1W0JD 1B8OA 5H02A 4TYNA 4Q6BA 2H4HA 1KH3A 1OU4A 2ERXA 2UKDA 2DBQA 3S28A 2KLHA 3CTMA 2IE0A 4OCZA 4L5YA 4NHOA 4ZYXA 3L8EA 4HN4B 1JSLA 2YS6A 3LUDA 1T29A 1UADA 2W5UA 2GBLA 5DCYA 3PLAE 3RTCA 4CE6A 2GF2A 5CVEA 1W4RA 5E7JA 5B4TA 3ZWYA 3BXFA 3BXHA 3N70A 1AM4D 2PBFA 1XTVA 3PSAA 1U3WA 3VKUA 1Z88A 2MSEB 4LNUB 4Q1DA 1YU9A 2JD1A 3QMPA 2O5RA 2XF2A 2JHCA 4RIEA 1ODSA 3EXEA 1GTJ1 4O5AA 1C3LA 3JU3A 1J8MF 1XDZA 3CB2A 3RYIA 2YBEA 3G2MA 4K9QA 5HSGA 2WHXA 2Y67A 2YZ2A 3IEKA 3IUYA 2FMTA 2RK4A 4TN1A 2BHRA 1JEOA 7REQB 2W42A 4JYPA 4UXHA 3NHRA 3FDZB 4KKXB 1PQYA 3HKBA 3Q0IA 1C29B 2PLRA 2IHJA 3RVSA 1T3LA 3KZVA 3RV4A 3G89A 5LNK1 3FOEC 1UXHA 1H6DA 2RMKA 3AW8A 4Y2SA 5BSFA 1FY2A 2QN7A 4LTMA 3QNWA 4KAJA 3W3AH 5K0SA 1BX1A 3DYIA 4PLPA 3SPXA 1LBIA 1W6UA 4DMFA 5JI2E 4OYYA 3AKEA 4PAWA 5FUBA 3T7TA 3TTSA 1V1RB 1HSZA 2FRVA 3A1WA 1MH1A 1C9MA 3PXAA 5DNDA 5AVQA 3M5PA 3ABSB 1CZOA 1B74A 5J4LA 2HLNA 4JQSA 1R0LA 5IXJA 1PDWA 5DYTA 2ZRJA 3AF0A 1QGUA 1M0TA 4R2XA 5KYYB 3L77A 3RFCA 5A5DA 1GPAA 3A1SA 3JQFC 5KMGA 3IAFA 1XEFA 4OP2A 3ZHVA 4C4YA 3B7GA 3JV7A 3NT5A 4KIGA 4YUWA 1WNTA 3QPWA 3ROGA 1DDOA 2FZLA 5EJ4A 5IG2A 2SKEA 3DDHA 1I0IA 2XD4A 4CQLA 2H4FA 4OQPA 4HWGA 3UIEA 2XMCA 3DVAB 3CLSD 2J9GA 4B5LA 2CHEA 3MT9A 1R9GA 1S8OA 2GHQA 1NDQA 3BXZA 3SXJA 1GQOA 1WHSB 4B9EA 1FJ2A 5LDDC 1ZIXA 3EVBA 5ERGB 2X8JB 1CTQA 4J0KA 5ALZA 1NYLA 2O9JA 3PPIA 1YJQA 2QYSA 3H84A 5HFAA 5K4HA 3BRWA 1J2EA 3IQDB 4BX3A 1LDEA 3GG9A 1R4NA 2J9XB 2B1JA 3EZLA 4ETWA 5KQGA 1KI1A 1KI8A 1Q7EA 4PBTA 3WMWA 3EWNA 4PYIA 5AKHA 1NQVA 2P6MA 3DDNA 5EP2A 2B8TA 3I3OA 3TNJA 2CXTA 3AUXA 3C2QA 16PKA 4DLPA 2O7VA 1OXSC 2C2OA 4J03A 3U4CA 2FNAA 5CDTA 1WB9A 1QVAA 1MUUA 3E58A 2UZAA 3NNSA 5ALHA 5JFOA 2VDWB 3QLJA 4MUHA 5KBYA 2VNAA 4XH9B 3UGKA 4CQJA 1R6UA 2HXYA 2ZB7A 2SBTA 3R0QA 3ZNQA 4C4ZA 1XDUA 4XZ3A 3NHSA 1THTA 1X19A 4NQZA 4OQEA 4P2BA 4WZBE 3GWZA 4F45A 2HIGA 4IGIA 4D9FA 4JIMA 1R0SA 1WDMA 3L8CA 2PY6A 4JLUA 5EIOA 5IANA 3AKDA 1ZG3A 3S68A 2VDLB 4QUIA 4RSGA 3DNMA 1AURA 1XZ8A 2KI5A 3MFYA 1LV7A 3M3HA 1E9DA 3MAJA 5JZSA 3GN1A 4CLOB 2NQTA 2C4HA 4X1IA 1S96A 4Z4IA 3ISJA 1S2DA 3V4PB 5KTPA 4N41A 4PAQA 1RJWA 4YRZA 1L4GA 5D1NA 3K71B 2VAXA 4QASA 2N47A 1WEKA 5FQNA 3T4UA 3QEMB 5D6OA 1K7YA 1OROA 3I0ZA 2IEGA 2AOUB 1G9TA 2ZS8A 2Q2WA 3EGDA 4YXWA 1MJFA 1FBTA 4BL5A 3O8CA 2PXHA 5L3VA 4O4IB 2FZ5A 3U31A 2CL6X 1XJ5A 4DJAA 3ENKA 5KYUA 1H69A 2V5AA 5GTDA 4HGZA 4HUQA 1CZHA 1SOVA 2JCBA 3GOHA 1ORTA 4QHTA 4TWAA 3HB7A 2R8BA 1XTJA 2G72A 2VDVE 1T3HA 4XD7D 2POQX 3JZAA 1XXHE 4AS2A 4BLVA 1G6KA 1DKUA 4LCBA 3BRWD 4Q1FA 2RSLA 4KLNA 4V0LA 2FUNB 3ZWWA 3UN1A 1FCJA 3KZMA 3HJCA 4X1KB 4AYTA 1SC1A 5M5BA 3ZDCA 3WL8A 2WOJA 2DT5A 4O25A 4YCSA 4RA9B 5FOWA 3MCZA 2IWRA 4EUFA 1ZGHA 2I91A 3WNQA 1KL7A 1SK9A 1CRPA 2YCLA 3FSRA 1P5FA 3ET4A 3ICVA 1U3UA 4B4WA 2DYKA 2KPOA 1PYOA 4WERA 2OCPA 5LXTF 3VZSA 4AJ1A 2DX7A 3VZDA 2XUFA 2PGJA 3KKOA 5KWEA 1PT7A 1ZA2A 2GZ2A 2NUPB 1N9GA 2NVBA 4GO1A 4L8LA 3WR5A 4BKRA 4G63A 3LK7A 4IUCS 4U2CA 1ICIA 3K9NA 1MV5A 1P45A 3MOIA 1OFTA 4DRZA 5AXBA 3QVMA 1QB7A 4TV8B 3ER8A 4U1RA 1BMDA 1EBFA 3LKDA 4MV6A 1UK7A 1H2HA 5IPFA 1V16A 4BQIA 2IQIA 4HDKB 3GT3A 3I8SA 5LZ2A 4QYTA 4HNSA 3L9XA 1Q3HA 5B3JC 1WCIA 1I24A 2GCNA 1VFNA 2BBWA 4FGWA 1V8PA 2XDAA 4WFQA 5BXYA 2ZAIA 4I3HA 3FJYA 1W36D 3QJ5A 2AN5A 3FVWA 1SVNA 1NHGA 2VZEA 4E03A 3TL6A 2OESA 1G6OA 2V45A 4O4IF 5KU1A 2Z4SA 4C05A 1DZIA 4K1LA 4LDZA 4B80A 2HJGA 2R44A 1BVRA 3LKVA 3DZDA 3M4NA 4I99A 4INAA 4EVQA 4YXWD 3DNPA 5C32A 5DNEA 2HMYB 4Q9HA 1GAWA 2GILA 3EFOA 4DV0B 1X1TA 5HJ7A 3O31A 1Z2AA 2VVTA 3K0SA 2Z8YA 3EOBI 2MMGA 4RA6A 2BFEB 4X3PA 2P3LA 3CKYA 4KG7A 1JI0A 2RDMA 5CK4A 2QGFA 2XJ4A 4EYQA 4WE3A 3ITNA 4CIXA 2R6R1 4FJ0A 5G0UA 4PS1A 2WTBA 3A4MA 3N0TA 4J3JA 5I8PA 3HQ4O 1HYEA 5E8RA 4DFDA 3V7NA 1IOVA 1QKIA 3FYUA 5L3QB 5J63A 4GM1A 3E7PA 5FRDA 3D0RA 4BQSA 1Z0KA 1I3KA 3BMNB 4O4LB 4IH9A 2PHZA 2QZSA 2Q5CA 4RVFA 4WNCA 5G1NA 2ZRGA 5CFPA 4AM8A 1NE2A 4V1CA 4XPIA 1L5HB 2CNLA 2LDXA 3EULA 1IUOA 4TV8F 4Y3UA 1G3IA 2Q29A 2I3DA 4O4JF 2JBAB 5AIAA 5I45A 1J8DA 4RU1A 2VP4A 5JS6A 5JJIA 2FLWA 3GFSA 5FNVA 3LRTA 6REQB 2ZPUA 4FLFA 3I6IA 3MGCA 1YB4A 4MDFA 4YRBA 5KYTA 3AI3A 4F7DA 2VWGA 1CZLA 2FEAA 4ZHQA 2AXNA 2IW3A 2QI9C 3KWJA 2PUCA 3P94A 4GE3A 5TDHA 4L50A 1D2EA 1KP9A 2C4MA 4URUR 4KB5A 2JASA 5G02A 1CS4C 1CQZA 1RXSA 2IYOA 3E9ZA 3JYLA 4G65A 3KJXA 2PMEA 2ZUBA 3PXEA 4GU5A 2C2ZA 4W99A 4TVSA 1XYVA 2QJOA 5BSMA 4CF7A 4X90A 1E1KA 1E6CA 1NAHA 3L6DA 1PDOA 4HADA 2QAIA 3WLEA 2HWUA 5CVCA 3X1YA 2X1LA 3PQ6A 1MAUA 1AQNA 1QHIA 4D9HA 1JIKA 1FYWA 2WHRA 2RHHA 3ZXIA 2VH2A 2C7RA 1UAYA 2Q3DA 4U7JA 4M54A 4HSEA 4U02A 1NL3A 3D6MA 1EEXB 3NEJA 3RBXA 3RHSA 4BDTA 4CL3A 2Z1NA 1V5IA 2D1YA 4MV0A 4ZAYA 2ODNA 2Q1SA 4FK8A 4UE6A 3MHPA 3SLRA 4O4LF 5KTMA 3V4RA 1RLTA 4L4RA 5K3DA 1FFYA 1ZJZA 4ZCQA 4I19A 3REQB 3U4IA 3W5JA 3IIKA 1CUCA 4CF3A 5BV1A 5KDLA 2RHWA 3HJUA 5IMBA 3BG5A 2R1UA 1AA9A 2IDKA 3TVTA 3UT0A 3A2NA 3OZWA 1J7KA 5HRUA 1EVJA 3JZIA 4WEOA 4AKHA 2YC4C 1T3GA 2VPXA 3HP7A 2BFBA 3DAGA 3STYA 4I9FA 2RHLA 3VDQA 4B6EA 3B2EA 4LWZA 2FW0A 4C20A 3ZKAA 2FJUA 5HE9A 4M8KA 3ZY4A 1NTRA 1P72A 1LBQA 4WGGA 3NIDB 2XCRB 4D5GA 1L7DA 1C0EA 5THQA 3GDHA 1PZGA 3HCWA 3IVAA 4L8VA 1TUIA 1U2PA 4LE1A 3LPLA 4KRXA 4BV2A 3PHHA 1XVVA 5JQGA 3HXQA 4OJMX 2Q0HA 3TI7A 5EZSA 3NDRA 4RTNA 1KZ9A 5L3RA 4AB1A 3IP1A 3R6LA 2REBA 2BZGA 5I7WA 4C4AA 4PN7A 3BRQA 4BNXA 1E2KA 3OP1A 5FBQB 1MQ9A 2Q1XA 3D1VA 3GJ0A 5FBZA 2ETXA 4HL6A 3ICOA 4YAFA 2JGDB 2Z30A 3W5AA 3Q3HA 3V6LA 5LZ7A 5ALVA 5DLQC 2IS1A 4IPTA 4YP1A 3LGXA 2I2XB 2XZDA 2OO3A 1I2CA 4UTOA 3WICA 5JLAA 2IXGA 1SIOA 3D8BA 4KPUA 3WGJA 2PKXA 5E2IA 1XAHA 3JYQA 4V03A 2NZXA 4IG9A 5CGQB 3MUFA 2G6BA 5DYIA 5L6MB 1KRWA 1E61A 1F38A 2XT0A 3PGLA 1GKIA 3NWJA 1YDGA 2VWQA 3LHIA 121PA 4Q15A 3GA7A 5AXAA 5A0TA 4FGUA 5KTYA 3DM9B 2VDMB 2XGJA 1SVMA 4RD1A 4WN9B 4Y1GA 3Q85A 4ZOAA 2JW5A 1GAEO 1H8EA 3PFCA 4DR3B 5JH7B 4CG2A 4PLZA 2MINB 2PH1A 2RFLA 2C83A 2XUKA 2ZR9A 2ZWIA 3NHZA 4R8VA 4F96A 2ASVA 4MB2A 1DQNA 5JE8A 1ZONA 4KQFA 2QX4A 2R9VA 2X41A 3H9EO 3JYHA 2OV3A 2WYVA 3OOEA 1G1AA 4H3SA 2GF0A 4OH7A 4JVNA 4ZVRA 4MUMA 5ICFA 1A82A 2XUAA 1G0NA 3LX8A 2H1CA 4CCSA 4Z7NB 1NMSA 2FSHA 2QAGA 1WP4A 3RKRA 4QHYA 3V55A 1RI5A 4YCAA 1N4DA 1GG2A 2OOKA 3I32A 4GZ5A 3WZLA 4BFCA 2OEPA 1P9OA 3MGGA 2OV4A 1E63A 3HCPA 3NRCA 3PS9A 3R3WA 5C4MA 4XI9A 2BM9A 2H1SA 3Q8LA 1SZPA 3PFFA 3IP7A 4FINA 4Q7LA 4NBUA 1L7QA 4FYKA 2OK8A 5CK5A 2JVKA 5AK5A 4CLDA 3A1NA 4NQRA 1E6UA 1SIUA 3ZX4A 3DWFA 4C4SA 3ELWA 1PS9A 3LCVB 1KSFX 3FFXA 3MYYA 1MC1A 2XGOA 3OE7A 3RJTA 3TLMA 4B4VA 1B6GA 1JKIA 3IAS1 2YYYA 4LRQA 3NCHA 3OT1A 1K2WA 1F5NA 3WMEA 3VC3A 2QQGA 4CEJA 1FU7A 4PXYA 4EY6A 4L7VA 2PUEA 4BMNA 5CVUA 2XOKD 5EP1A 4N01A 1PD0A 4CM8A 5KYXB 2XEXA 3P1JA 2ANCA 5CM2Z 4RQTA 4E32A 2E0IA 2J5QA 3JALB 2EP5A 3PHBE 3DTVA 2UUOA 1J7JA 1QH8A 5LLDA 1G64A 1V5WA 5FTLA 1PEYA 3DV0B 3MHTA 3VUFA 4W9MC 5EGNA 4G0QA 1SBNE 1R0YA 3C6KA 3CYFA 3BIXA 3IPXA 3PA8A 5JH7F 3FR7A 5KNCH 4Z7QB 2FW7A 2WHEA 4LHYA 1NU6A 3TQFA 2ZSHA 3KDAA 1R8XA 1THGA 1AG9A 1O0SA 3OKCA 1H8ED 4C03A 4TZKA 3AUSA 1EXDA 1F2TB 4RL6A 3U3KA 4M9CA 1EGVB 5CYFA 1T1GA 2HK7A 4BMDA 1Y4DE 2JAQA 3I2JA 3VX3A 4ZYLA 3THYB 3HXTA 4YRCA 3U39A 4DMCA 2D5LA 2FPIB 4U7FA 3LTNC 2H1OA 1GLNA 5A0FA 4OGKA 4R81A 1ORVA 1ZRSA 1XAJA 4JL6A 5EQTA 4DDTA 5I4IA 1OA1A 3LG2A 2A1UB 1X7ZA 1NR5A 5K0FA 1XZFA 3GDGA 3HSSA 4M0DA 3I5MA 4IQ0A 3OZRA 4IV0A 4FKZA 2I6GA 3N2IA 1AS0A 1FDIA 1NYTA 3R7SA 3ZS8A 1YUNA 4EO4A 4FQ5A 2X7HA 2EEZA 4D3YA 2YWJA 5HQJA 3O0TA 1JFFA 3PHJA 4IXTA 3RYTC 5I48A 2ZSIA 1J07A 3DPIA 4P1ZA 1K3FA 3Q7QA 1KO5A 3ZIDA 1ECLA 1LWNA 5F1KA 1H5UA 4HDMB 1VKJA 1KEEB 1SBHA 3EVEA 3W2EA 4WBNF 5DCLA 3OE7D 4PSVA 5MN5A 3LPMA 1EX9A 3NM5A 1YB6A 3DOOA 2KBEA 5TSDA 4QQFA 4EJSC 1R12A 4A1OA 1TYEB 4CMEC 1OCEA 2G82A 4BBZA 3DM5A 1FYDA 4BY9E 3ORSA 3TX6A 3U48A 4E33A 2P1ZA 3L7AA 1ZICA 1I01A 3DZBA 4HDNB 4DA4A 1CZUA 3AGPA 4P34A 2IE8A 3OEEA 3BB1A 4GR5A 4WVFA 1UBCA 1GITA 3DTVD 2WZCA 2FJ0A 2XVZA 4CQMB 2ZSFA 3HMKA 3O90A 4NNJA 2JI4A 3A6GA 2HU5A 2NX2A 3KEFA 2PMBA 1H4QA 2IIPA 4FFVA 3ZE1B 2PZLA 5B30A 3PQ5A 1MB0A 4UNQA 1TQ8A 5CYOA 1ZOOA 2SCUB 4DEYA 2Z9DA 5IBRA 1R8JA 4EUKA 4FZVA 5JW6A 4EB8A 3DEHA 3PX3A 3C3DA 4KN5A 2PRYA 2OD9A 3QHQA 5JSZA 5MGBA 1BCSA 3O8LA 1FDUA 3PWSA 4JWTA 5IF3A 3CONA 1JU9A 2COKA 1VE5A 3GZNB 2GK4A 3QBTA 5CVTA 1F8XA 3ZHOA 2VDPB 3LY8A 4F9TA 3MINA 1QM5A 3K1ZA 2C99A 3FUUA 4D9EA 4KPGA 2DFVA 4F3NA 2AYYA 4KYIB 5EE9A 3F4KA 3F74A 3FFAA 1BVYF 1D8TA 1TIKA 4ZDKA 4R2MA 2P3OA 3W8NA 1ZD1A 2I2WA 3TD6A 4OYHA 3SBXA 3C48A 1AF7A 4MHOA 3RO7A 2V8OA 2W48A 2GESA 3WMXA 5LU9A 4QDKA 4KPFC 3TR5A 1XEXB 1C7RA 2XYHA 3BJIC 1NRXA 3UCFA 3GPIA 5FPSA 2AA3A 1GSAA 1E0AA 5F7ZA 2BN4A 1A9PA 1NI5A 3OMLA 2WVAA 4R71A 2DQSA 3F46A 5CIWA 1P7PA 3UANA 4D42A 4YDQA 2X3UA 3HJBA 2CB9A 1NNUA 1V41E 3CTPA 4YJ3B 5F73A 2E4WA 1Z73A 4B3FX 1K1EA 3S1LA 3QVWA 3AIKA 3OHSX 3DE7X 3G8DA 3RUIA 3FF4A 2QZ4A 3WO0A 1IZ8A 2GD2A 3FVVA 1YRQA 4TYYA 4MYHA 1EP9A 3TDNA 3SDBA 2ZRMA 1P6QA 4OAQA 4LQ4A 4DW8A 1JYFA 1DVRA 2QTCA 1UKYA 1KOFA 4EEXA 4BNUA 3OEED 2P6PA 1FYVA 1SQSA 2A5FA 3R5TA 5FFNA 3DEYX 1GL6A 2ECFA 1XI2A 4ALMA 7ADHA 5EJMA 3WWOA 1ZLXA 1KARA 1SULA 4MSUA 2EARA 2PWPA 2RI6A 1X80B 3ORYA 5DISB 5TMEA 4WHMA 9ATCA 5IAOA 4KL8S 4KMOA 4CKEB 1MVOA 2AV6A 3OPNA 3IVMA 1C8LA 2QRKA 4GGOA 4GX2A 2V97A 2HC9A 3C8UA 1YVRA 4ZEVA 1JQJC 1MNAA 1A9OA 1V1JA 2RGWA 1JPJA 3G6WA 3I2GA 5A06A 2GN1A 3WDMA 1PJ8A 4PQGA 2IZZA 4OQXA 4EFMA 1P3DA 2VZ8A 2JVJA 1N8TA 4MVJH 4IDDA 4ETMA 2YV5A 3ZXYA 3DBOB 1A96A 1ZQ1A 2PZAA 2H5IA 3P19A 1NUUA 1B1AA 1Y8QA 1ZKMA 3L0PA 1ZEJA 4V39A 5KSZA 3U62A 4E3ZA 1GU7A 2QNIA 4JEHA 3BH6A 2ACEA 1NUTA 1XWFA 2IWHA 4RQUA 4UBNA 4REQA 5HIAA 4YJ3F 1DIBA 3K8ZA 4E1VA 2W2KA 1DIOB 2J41A 1KTIA 2C54A 4LRYA 2I7DA 3K0CC 2NUTA 4KV7A 3EZFA 3C98A 5JPIA 2XYQA 3VO2A 4CTNA 4GEGA 4LYDA 1R5JA 5E3JA 1T9GR 1I6MA 3K09C 4WACA 4Z49A 2EL7A 5KOJA 3E9DA 3TQTA 1E8NA 1UH5A 3SBOA 1N5IA 1U94A 1JHZA 3LA6A 3NAMA 3RT9A 3TL3A 3WOHA 3P26A 2ZRDA 1TZKA 2O4CA 1XZAA 1X7WB 3IR7A 2DVMA 3BDIA 3ZDEA 3G88A 4BMZA 2FR8A 3I04A 1RRVA 1EP3B 1X77A 1EP2B 3E9MA 2A8YA 1YJXA 1GO2A 2QK4A 3QE9Y 3C39A 1G8PA 1L7OA 2R96A 4IHQA 4QAJA 4TTRA 4ES6A 1TM7E 4MVJP 4BWVA 4BRWA 2C8LA 2HRZA 4JVOA 2B35A 5HKAA 5DX8A 1K6MA 1KYVA 3P2IA 5KO2A 2O1SA 1C8KA 2C29D 2EGUA 1TLFA 5CHYA 4ZAFA 5KPDA 2IU3A 4MAAA 3SJ7A 2HHLA 2Q5IA 5T6BA 3VKVA 1RM4A 1XPJA 4I1VA 4ZWNA 1UBEA 5C34B 4EEZA 1QAQA 4QT4A 4RZXA 2JK1A 3THSA 4KXFB 4O4HB 2PCLA 1G5RA 3K8OE 4BS9A 2D7DA 1R3DA 2Q5QA 1UBGA 3IS3A 1JIUA 3W2IA 4AMVA 1PWYE 5EXDA 3WV4A 2PQMA 2BOVA 4DABA 2EZ4A 2XA9A 3WHIA 2BEJA 5AKJA 4BYGA 1CR1A 4MQ4A 2WPNA 4INOA 3WBFA 5JAIA 2DSNA 1IWPB 4GF5A 1QWOA 1II8A 2CZCA 2FRDA 3D43A 2E89A 1PGJA 4KQEA 5CEJA 1ISIA 4M0MA 3FD8A 2DCMA 3G3EA 2RC6A 3HCNA 3OAAA 3TDMA 3KAPA 1VECA 4DYDA 3CX3A 3UWDA 2PZFA 3MTEA 2FPGB 5A6VA 1IG3A 3GFGA 1PV1A 2BKUA 3C8MA 1ZJYA 4H1VA 2ZSUA 4UBLA 1NPTO 3MCVA 5F4ZA 5TV2A 1Y1KE 5CFZA 4NBLA 4K6FA 4ZREA 4ZCLA 2EWMA 3E5NA 4IXNA 4AY5A 3LHDA 2NO6A 3K9BA 3QTBA 4OJKA 3WWZA 4B3DA 4DQVA 5AVSA 1H9CA 2BCGY 4TSFA 3BFKA 4IIJA 5L7WA 3W6UA 4MCIA 3Q40A 2TRSB 4JMLA 1VRCA 2ODQA 4FU0A 2PT7A 1RKQA 2A92A 2VC2B 4P33A 1C14A 2MIIA 2V7XA 2FSIA 2O14A 4GOMD 4PR3A 4ZO8A 3TNFA 4DG9A 4W9NC 1UDCA 2O2CA 1XQ6A 1AZSC 3GAFA 2BRUA 1WY5A 2WIBA 3C6QA 4G1MB 1CIJA 1G3MA 1IVSA 1NM5A 2JH8A 4CLRA 3L41A 4M2LA 1U0BB 4HYYA 4P38A 1GL3A 4M1SA 4F5WA 3FPEA 2P77A 4IQ8A 5DXFA 2YY7A 1RRKA 2ATXA 4R3WA 3RIGA 2GK6A 2E4XA 2QX8A 4O4HF 3Q41A 4XWOA 5MN6A 1FLDA 3SHFA 1BQ4A 2O6LA 3E7FA 2WG0A 4FMPA 2WIKA 1UBHS 4Z0NA 4DIOA 4C01A 3NATA 5EESA 1MA3A 1WDWB 3BTOA 2ROQA 1N7GA 2AZTA 1GNTA 4BTEA 4H7FA 3SR4A 3AVUA 1AA6A 4BNHA 1GZDA 3AZPA 4W5JA 1NV9A 4H31A 1XUOA 3NWPA 1IYZA 2Q5EA 1UBOS 4W82A 4LFCB 5BQFA 5KJ6A 3N5KA 2P0YA 3ANMA 1QRDA 4PRYA 3OQNA 1ZL0A 2PRSA 4WFIA 2Q7DA 3PPXA 3HRKA 1U5BB 4M86A 3QIAA 5HIIA 2VQ6A 1NOJA 1ESCA 1ORRA 1RKBA 1V45E 2VSFA 2RHJA 3FHJA 3OAAD 3SSOA 1SRRA 1B3RA 3RAPR 3DGEC 1GOTA 3W0LB 4QXPA 4RV4A 4KXMA 3U7RA 3W5SA 4EI2A 3GO4A 4XWAA 4WUTA 4AN0A 1YBFA 5E6UB 4F1WA 1RZUA 1TW2A 4MX8A 4L78A 1N2OA 1T5HX 4Q9JA 4J9VA 3T7CA 1M0SA 3ECCA 1XRSB 1ZUIA 3QMMA 3VKFA 4EFLA 1S9HA 3KK0A 4TSFD 2QQ0A 3LC0A 3U3OA 1CZKA 5FLYA 1BNCA 4KGXA 1TUBB 1SO8A 2IQ5A 4DIDA 4Y1RB 5J4VA 3VTZA 1DRKA 1ZC3A 4GOOD 2HDNB 4X92A 3MTGA 3LM8A 4BWYA 1Z68A 3CUVA 5ENVA 2XA2A 3R9WA 1O5IA 4Q12A 1RZRA 4KREA 1XZPA 1G8YA 3OJOA 2JIBA 3FI9A 1E4YA 1KI2A 2V6MA 1PT6A 3IPYA 4BBAA 1EEHA 1M33A 3HXOA 3JVIA 3W9SA 1BW9B 3FOCA 1BU5A 2WV9A 1OIWA 3M2TA 4V0ME 3PC6A 2AMVA 4X6YA 1XFAA 3JAKA 1A3CA 4EYKA 4F11A 4KZKA 2ZROA 3IULA 1IUKA 3TCXB 1DHRA 3EGXB 4F7WA 1KWKA 4TVOA 1TT5B 4HY3A 1VLVA 1O6FA 5K3FB 3MRSA 1PJZA 1WB4A 3GJ8A 5I9MA 2WIDA 5KVQA 4CMCA 3S8YA 4NONA 2WWGA 2GM9A 4WZAB 3VM6A 3GJZA 3IJ5A 3IO3A 3WIVA 2QTGA 2XNJA 4LUCA 3ROEA 1I4DD 2JGIA 2R65A 4HF7A 4MA5A 4MYDA 2XITA 2C9ZA 3K2IA 1UJ2A 4W7HA 5C1BA 3VNRA 2ZB2A 1T8RA 3CNBA 5LL6P 1SOMA 1PT5A 4XYEA 1YZKA 4BNYA 4JT4A 1GFZA 1W29A 2CN1A 3Q6NA 4X9XA 4FDAA 1IAQA 1DIRA 3NKLA 2HIMA 4RKFA 1O8BA 2AG6A 2PGXA 3RIEA 4OHYA 5AQ1A 4YK7A 1GV0A 3LL4A 2JAHA 1QYCA 2FHSA 3R3YA 4C22A 1JILA 2XBUA 3MERA 4DMGA 1F60A 2QG6A 4B8YA 4S1PA 3O93A 5HM8A 1QPBA 1NMYA 1U7XA 1QJCA 3WLAA 5A4DA 4R54A 2H5EA 1KIMA 1UKBA 3NTQA 3W2FA 3P0FA 4PE5B 3GLHA 4HLUC 3BIOA 3AHFA 2GXQA 3UK2A 4N18A 4N0QA 4BU1A 1EYZA 2Z8YM 3DVRX 3LCMA 5KHOC 3STUA 2JCXA 2HOQA 1VCOA 1IN7A 4JGBA 5I6DA 5IT4A 2HGZA 5KDDA 4D6PA 2G1AA 5E9AA 1RZRD 4G0UA 1HDEA 1I9CA 2JAPA 1E20A 1FTGA 3C3AA 2PZ8A 4NULA 2EBHX 2HA7A 3HH8A 2M6LA 1YZGA 2UZ0A 3KV1A 4AX8A 1CQWA 1X7HA 1LD3A 1QHNA 1IBSA 1M2GA 3W77A 1B0PA 3W5VA 4UTVA 1ST2A 5HF9A 3RRXA 2YFYA 4ER6A 1G8SA 3G1UA 2Q9AA 4HAWA 1TAQA 2ATVA 2WR8A 3LFUA 2XY4A 4HAVA 4OREX 3C7AA 3CF4A 4WESA 4ZT5A 5LZ8A 1X7YB 3W8FA 5AW7A 1PVDA 1TLTA 3ONDA 3Q10A 1Z6XA 3FNGA 1SHKA 1XALA 3JD0A 3L84A 4YRDA 5K6AA 1OGYA 2R11A 3ESDA 3IJEB 5DK4A 3U1TA 3HJGA 4G1BA 4PW0A 4BCCA 1AKUA 1ISHA 3AHIA 3P2EA 4FHCA 2V7PA 4GUDA 3H2SA 4XIYA 5IAGA 4CRWB 1SQ5A 1X0XA 1OU0A 2D4AA 4A16A 4BGIA 2PWAA 4NJEB 1I7QB 3EQ9A 1A9XA 1Q7GA 3COPA 1THZA 3HYTA 4LDAA 1ZYUA 3ZVMA 3KQQA 9MHTA 4E2FA 1BU8A 3DT9A 4HG2A 3FW1A 3ZCUA 2G9QA 5CJJA 1N0WA 5BXQC 1JFSA 1R4ZA 1IJBA 1CF4A 2DUNA 2GMWA 3N1UA 3KBBA 3R74A 1F2UB 1ZN7A 2W8ZA 4QJ4A 4J16C 3WBBA 4L5IA 1NUAA 2XQIA 3MMZA 4HD8A 4K2AA 5CW2A 4A36A 1M2OA 5EL0A 2OAEA 1GPDG 1LPSA 3B2QA 3KWLA 2VYQA 3AFGA 2JFPA 1T0HB 4GLFA 4CIYA 5YASA 4DLSA 1MF7A 2PGAA 4HMPA 2NU7B 1M1UA 3IURA 4S1WA 5AJYA 4AMBA 1ISJA 2IT1A 4Q48A 1K5GA 4WK0B 5F5LA 3W7BA 4D57A 1VYVA 3ZPXA 1MJGA 2RGRA 1XAGA 2A5GA 4M98A 4BX9A 1TJ4A 2GETA 1F0PA 3VSEA 4FJ1A 3BJZA 3U81A 2PR2A 4EY4A 1J99A 5SZHB 2DFNA 1BO6A 1ZIPA 2WA2A 1GYPA 2HI0A 3VR1A 3WRWA 3SF8A 4CMJA 1MFPA 2YJGA 2PUVA 2BPOA 2V9CA 5BP7A 4PX9A 5CT9A 1SG0A 4OSEA 1DPFA 5LP6C 5K0TA 5BR8B 3PEYA 3LBFA 3DBLB 3IMEA 4KQHA 1UJNA 3KHTA 4PHCA 3ZDAA 1YJAA 3CRZA 2PFSA 1E92A 3P2MA 4BBJA 2VQSA 4I55A 1TK3A 3AONB 4E51A 4ML3A 4OQLA 3M6XA 1U28A 1B3BA 5ECGC 3LL7A 4UATA 2WAAA 5FUVA 4B76A 4EGQA 1VE7A 5KJCA 1C1YA 3BB3A 2B4RO 2XTNA 4XVHA 2ZKIA 5JAOA 1ULUA 1ZI9A 4G09A 5JNWA 5LMNB 1JFTA 2WJ4A 4QC2A 3TSWA 2HZ7A 5B53A 2HHJA 3OA0A 1VXRA 1GGFA 2H2WA 4ALIA 4FFBB 3W7AA 4R9UC 1P1IA 2GPTA 3J81k 4MIEA 2E6KA 3TLYA 1H4VB 1YNOA 2Z2IA 4PSAA 1Q7BA 3MJRA 3D31A 4RMJA 4LYEA 4ND1A 4XDZA 5E0KB 1KORA 2H9AA 2BTQA 3A7DA 4MYSA 4K7JA 3ZWPA 4N8EA 3KZ1E 2GASA 5FOTA 2ENUA 3KE8A 4AF8A 1NVGA 4JMPA 1EWTA 3TCKA 3EZYA 4BB9A 2BSXA 5ITWA 4B0OA 2FN4A 1TFRA 3MAGA 4HTFB 3P2KA 1OLXA 4MJXA 3U26A 3O82A 4HMOA 4IVRA 4ZCSA 1XFDA 1O94A 1PW5A 1VIVA 1YR6A 4G0WA 3TSZA 2A2ZA 3RR2A 3DTYA 3ZJ5A 1HTWA 3A2MA 5DT9A 4L07A 4WLUA 4P83A 5EKUA 2PVPA 2VH5R 3A9UA 3HKCA 4IXDA 3U9LA 3Q8WA 4B3CA 3H9GA 4FZRA 1XCOA 3QXXA 1QOZA 1HT3A 1MO6A 3P9QA 1V9LA 4JLNA 2IEDA 4KBFA 2AD5A 1ADCA 4Y8VA 2VDQB 1MO4A 3DXXA 4GMKA 1O4WA 3PE4A 2ZYHA 2LIVA 4XDYA 5HZGA 4FDLA 2O0JA 5FJIA 2YOHA 4LYHA 4EKEA 5HKBA 3AYXB 4P0TA 1G3RA 3O4VA 2NU8A 5AM0A 1XLTC 1JFRA 1NLUA 1S89A 3ROXA 4BX2A 5ABPA 2FU5C 3LUCA 2VLBA 2Z5GA 5ICSA 4KDEA 4ENSA 3MGBA 2Y92A 3CIOA 1WO8A 1Z6PA 3K1AA 3OI7A 1I5EA 3PV0A 4IJ6A 3H6HA 1OYVA 1AB6A 2WSYB 1ENZA 3K70C 1H2XA 3KAJA 5AR1A 5TF0A 2WFLB 5FWAA 3FB1A 5KNLA 2VATA 2FEWB 4ZC8A 4RDXA 5JS2A 3FIUA 3VPHA 5TC4A 4YVFA 5LMZA 2HT1A 2ZB3A 1MOQA 3FSJX 1ZJ6A 5EJ7A 2OAP1 4F2WA 5DHRA 1PV4A 4LTNA 2IPNA 1L3BA 1O5TA 3I8OA 2ORWA 3A9SA 3U1BA 1JZTA 1R2QA 2XCLA 3WL4A 2IUSA 2QLLA 1XRPA 4YAIA 4MRMB 5ALOA 4U39A 3WWPA 1H2RS 2MSLA 4FOTA 5KKCA 4LNUA 1LZLA 1Q0QA 1Z75A 3KPVA 1YONA 2OG1A 2A3NA 1XLUA 2R6DA 2WT9A 3F9RA 3LCRA 4IEFB 3KOUA 4ZT6A 2JLZA 1WW2A 2VHTA 2AKEA 4BRUA 2AH5A 1O94D 4HQNA 1MTZA 4JOCA 3CGGA 4WK4B 4OI4A 4Y2XA 4YECA 3MWDB 4W9RA 4HK4A 5EWJB 4EARA 2VSXA 7REQA 4PG6A 4XX1A 4C78A 1OWOA 3D6FA 4OVKA 1P2DA 3GRFA 3FDZA 4OFBA 5IXSA 2WK1A 1Y1RA 3I9V6 3ZWDA 3EF1A 2CJFA 4UNNA 4Y67A 3IMKA 5E4TA 1EFLA 5F77A 4DEXA 4K9RA 4AJHA 1Z08A 1GZ7A 1VMAA 2IUTA 2X9VA 3ZZMA 5BMOA 1KAGA 1ZSVA 5F33A 3B85A 4CG3A 1NOKA 3T1QA 2W6NA 3HKEB 3ADCA 4U8HA 1VJTA 3FWKA 4ZQBA 1V1RA 3CEJA 1NYRA 5K01A 4ZI3A 4OGLA 4XM0A 3FGPA 3T94A 3ZI0A 1NATA 3A4IA 2NNLD 2X6TA 3N74A 4MR9B 3QFFA 3KKZA 4RBNA 2J31A 2F9LA 2OFXA 4RVOA 2ZT7A 2YRXA 1E4EB 1F2VA 1E32A 2FQYA 4OGGA 2PAAA 5SY9A 4AUKA 5KYYA 4CKXA 2OC9A 1GTMA 1KH1A 2G40A 3F1LA 4PO3X 5BRJA 1YTLA 1SEVA 4M89A 4H6VA 3UQZA 2GSDA 3MBOA 3ORQA 3U4QB 1NRJB 2J3KA 3V4ZA 5TVKA 2OKGA 3DMPA 3PTAA 4OIFA 2CV2A 3DLHA 4LFAB 1WHSA 2X8JA 3FUXA 3LPNA 1Z4NA 1TKCA 5FV4A 1PFQA 5K0EA 5DM60 1XN4A 4U6SA 3QHPA 1NG1A 3DL4A 1P73A 5AVJA 2QU7A 4GMFA 3DBRB 3M70A 3V2UA 3NAQA 3LO8A 3RAFC 1JDPA 1D0IA 1HL7A 2FH5B 4QBIA 2XDWA 3HFSA 5HK8A 3CW8X 3ANYB 1RWBA 5AJHA 2BFNA 2R6ZA 1ZQ9A 3ZWAA 4UPEA 1XCBA 4F5YA 4F60A 3TDKA 2Q7OE 2HQSA 5K3CA 3DFKA 3O1HB 4ZVQA 4KH0A 2PLNA 2BGLA 2VDWA 3L18A 5E9WA 4WOCA 5LWHA 2RGXA 1L5GB 3NTUA 2HPVA 4AAYA 2NQ8A 2DTDA 4IV8A 4LMPA 2FSFA 2I2AA 4MINA 1G8AA 2XGSA 3OJWA 1QG0A 3USCS 4DMLA 3NO4A 4JEIA 3NBFA 4X63A 3ZZNA 4NYIR 5CLGA 3EF3A 4DV6B 4Q66C 1OF1A 1ZVVA 1F2DA 1JHVA 1H42A 3ELYA 1CVLA 2GEVA 4G5QA 4WJZA 3ZVRA 2GJKA 1ETHA 3V4LA 1YJCA 1Y3IA 2JLBA 4K86A 1A2KC 1MJ5A 1T3SA 3F9CA 3AW9A 5F1YA 2BMEA 1J9EA 1R66A 4LGCA 1K4KA 3UHJA 4BP9A 1Z62A 5AUPB 3WLSA 3HPQA 4IKEA 1COWA 1JTVA 1GZ4A 1M34E 2WHYA 1NBHA 2ZU0C 3DF9A 4LJ8A 1WKVA 4UM5A 3L79A 4XUGB 5DTJA 1KHHA 1OAAA 2V7VA 3IBCA 3A28A 2FQ1A 2P5SA 4CCAA 1CD5A 2EEPA 4PTZA 5HQTA 4HGPA 4JOSA 1OWPA 1XZDA 2ZULA 4BMCA 1VMEA 2A59A 1ZJ5A 5FPQA 4O4IA 2C5FA 3DB2A 3DMHA 1ENYA 3K4HA 3I2IA 2R2AA 3BSSA 3OICA 3WDLA 1RXVA 4CTOA 1MJNA 2IU6A 5HCUA 4FBGA 4OAPA 4LXQA 1YT5A 3OX4A 1SCKA 1GDTA 3IELA 4BWGA 3NB0A 5B58C 1KK0A 4RIFA 1LPAB 2VT7A 4P8RA 4M6WB 5TQ0A 1MB9A 4LHWA 1N0VC 3CEMA 5ALLA 3SQLA 4TYQA 4X1KA 3PUHA 5JAQA 4EHKA 5IZCC 5J1SB 2RGAA 1NUHA 4DV4B 5KAMA 5JECA 4Z8XA 4RA9A 3KLPX 4LQCA 1T8UA 2QHXA 2OHXA 1KI7A 3JQ7B 1C7QA 2JI9A 4BNDB 4LI3X 1ZL2A 1L1EA 2J5BA 4PC7A 3YASA 1VJ0A 4Y7CA 3AYZB 5T4EA 3C43A 1FRFS 1Y3HA 2PGLA 1BD4A 2MSNA 2NUPA 5B1DA 3PBKA 2O8VA 2E4UA 4TL8A 1FDOA 3INNA 3F7MA 1P7WA 4KV9A 3GB9A 3V8BA 3QBVA 2WYWA 2RHBA 3F6BX 4TV8A 3HUEA 1W2GA 3F3YA 3W8RA 4E2YA 4IZHA 1TCBA 1HF3A 3UENA 3GARA 3L7MA 4HDKA 4YMIA 1E8MA 4W63A 3H87A 4OU4A 5HGJA 1QVZA 2YRWA 3JSXA 4JJZA 4OK5A 3UFXB 2PEZA 3VR0A 4ZCIA 4Y2GA 5DNVA 3TL2A 1FP7A 3AETB 3H8VA 1COWD 3BE4A 1JDBB 4MVJI 4UNSA 4MYUA 1CQPA 2Y0EA 5BMVF 3U5TA 5CBKA 3AFMA 3S1AB 4Q34A 1EUYA 4RLQA 2VSYA 1YMQA 2XZLA 5HRCA 2BHSA 3OOYA 3AVPA 5HCNA 1U2DA 4A2PA 1OKKA 2OFPA 1VHQA 4CMKA 3NKVA 3MWEB 1QFZA 1L7EA 3U60B 1J5EB 3KB6A 4MQFB 3DE6X 3I6BA 4ZT2A 4YP0A 4JJ8A 1F48A 1P4GA 4DC0A 3AF6A 1I4EB 2BFEA 3GLGA 2R8RA 5M34A 2G3YA 4YJDA 1E6EA 3F5QA 4ZU3A 5AI5A 1DKPA 1KS2A 1R4MB 4GLBA 1AMNA 2BISA 3ACDA 5BPHA 4WINA 2O1XA 1DBVO 2ZTSA 1ILEA 5EIBC 2EJUA 2X4DA 2PQ6A 2F90A 4ZVPA 3T5MA 4EA6A 3BKXA 1WXFA 3BVPA 1PAUA 2YWRA 1JJFA 4XDHA 5EE3A 2C5LA 2P27A 1M6VB 2IOFA 2YWXA 2WQ6A 1N6LA 5L3QA 4OB7A 4OJTA 5JJBA 3BMNA 1KO1A 1IN6A 4O4LA 4YRNA 3Q9SA 3GUZA 4BFUA 1SMKA 3UA3A 2O4UX 4DCSA 4Y9TA 3SLGA 4HZUB 4F91B 1X0VA 2X0DA 2JBAA 2EKBA 2C5BA 3QXSA 3QLTA 1T6XA 4FFOA 1QRUA 3REFA 6REQA 1CJCA 3LA8A 1PR4A 1E6LA 1TEXA 2X0RA 5FEUA 3I1IA 3JWHA 3NHBA 1XVLA 5EVJA 2XHEA 1U04A 5AW8A 5KTKA 5C9ZA 1P3JA 5HP4A 4P0QB 3CCBA 1ZGZA 3LZDA 5DXJA 5LSAA 2ZJ7A 1RXEA 4K05A 4H1WA 4MW2A 3IQWA 1JFVA 1PLLA 1KY5A 1P9LA 1ENPA 1EB9A 2XADA 4N0EA 4NBNA 1TMOA 1M8KA 3DEFA 5A4FS 3JQQA 5EMMA 3TEJA 3IOMA 2HNAA 1FVXA 1T26A 4RPJA 6CHYA 2G04A 3C4VA 3O47A 4RH3A 5EE0A 2VZLA 1EVZA 2ANBA 4R8LA 4EMBA 4MVYA 2XE4A 8ABPA 4YH1A 1HDXA 1BEEA 4BPRA 4FQ8A 1OKKD 1IVNA 3DONA 3FIJA 3SFTA 4BO6A 4F5EA 5I51A 2QN9A 1AN9A 1WIWA 3V80A 2AI2A 3G2PA 2R1VA 2YWCA 1I3CA 5K05A 1E6KA 5EJIA 2FWIA 1F12A 1PGOA 2WYIA 3ND6A 4LOKA 5T3UA 4GPZA 3AO0B 2I71A 3JQBC 1EFKA 3UB2A 4JU8A 3GRKA 4AYXA 1FUKA 3TPFA 1CUGA 2O06A 2FMHA 2RGDA 5MDHA 1HT0A 4MCJA 1Z0UA 3REQA 2DKOA 4JI5B 3D4OA 2NVUB 1AUQA 4AJPA 2AN4A 4KK4A 3X1MA 1WSDA 3F5SA 4QDZA 1JBQA 5HQ3B 1NWCA 1CHDA 1IBKB 2GBGA 1ICEA 2GD6A 3NAZA 1GHTA 4KIWA 4P5PA 1UP4A 4FR2A 4Q3KA 3TZCA 1FK8A 2B7CA 1KZ6A 3R2JA 4BVKA 2P9ZA 4I6EA 2PWZA 4YC7A 2I4MA 3RABA 4PZLA 1E64A 1JUDA 2Q5JA 4MUAA 4UHFA 4M7PA 1FJGB 1ZVJA 3VHXB 2VNSA 4OUDB 1V43A 1FFXB 4AJOA 4P4LA 2RKBA 5DX1A 1KGSA 4PWYA 4DJDC 4AZTA 1WWKA 1CUSA 2D06A 2Q5FA 2ZJ0A 4KNWA 2I4LA 5DB4A 1WOMA 1Z4JA 1SXGA 2TECE 4EG1A 4K6GA 1ZWKA 5WRFA 1I2AA 3CEAA 3IVGA 1DRWA 3M7IA 2QLTA 1CR4A 4AK9A 1YFJA 2F9MA 3AVQA 4OFWA 3D7RA 1LF0A 4PLHA 1K4YA 3I3SR 1SQ0A 3ZHTA 2JGDA 4G5RA 4QO7A 2VZ9A 1UIRA 3R4CA 3ADPA 4JVLA 2NLOA 3A58B 5D5HA 4MRNA 3VVCA 4B85A 1IPEA 4YY3B 3LBNA 1XNRB 3RS5A 5JD5A 3R7LA 4WASA 1N2CE 1UZNA 1UWLA 1U0TA 5CB0A 1ZJWA 3EZNA 4JWKA 3PEVA 3WTCA 2AOTB 2GZHA 4U00A 3TECE 3X1WA 2H57A 3GFPA 1FQKA 1OIXA 1PFVA 4EUEA 4FBLA 2VJYA 2GTPA 3EB9A 2NO9A 3H6KA 3WYAA 2R62A 2CNOA 3RJ5A 3U19A 1EVKA 2VJCA 4A8HA 3SJAA 2O48X 3UAGA 4EHNA 2QXYA 3OLVA 1Z2EA 1NT2A 2H7VA 3NHAA 4GHWA 1BRTA 4WN9A 3M6WA 3UUFA 3EGVA 3W4KA 1WUIS 2L18A 4YAWA 1SCQA 1ECCA 1RJEA 1UK9A 2VCYA 1VSTA 1V8FA 2ZWVA 3AERB 2EC5A 3FKJA 3QKUA 4IMPA 2WAMA 3FB4A 5JH7A 5HX7A 1QGDA 1W7AA 3GA0A 1BCRA 2OBLA 1J9GA 3IT3A 2NZYA 2CY0A 4G97A 4KLAA 4ZI5A 4JGGA 2Z3VA 3SHWA 1SUBA 3SSNA 4RJIA 3KSUA 4YT2A 4ESVA 2R6GA 3FBGA 4NV0A 1FFWA 3SOZA 4C5AA 4I9GA 4E07A 5KYKA 2WHPB 3LPDA 3BWVA 4ZV4A 3A4NA 3UHPA 1A98A 1X3LA 2YZNA 1ZCFA 3MIIA 3OKFA 4Y9RA 4JYCA 1Z0JA 3ELBA 4RSHA 4J3NA 1GZ6A 2XMSA 4PCUA 3Q4GA 1WTCA 1ZX1A 2H92A 4F4HA 1ZR2A 5BSVA 3AEYA 4RVNA 1R50A 3OTOB 3CRVA 1QIGA 3QYAA 4TOIA 1DX6A 5AUQA 1MD9A 1SXJB 1PHPA 1TO2E 3JXEA 5BO5A 3GLKA 1IG0A 3OU7A 3OX3A 1K06A 1BEUB 4O2AB 1P8AA 2YC2C 4PGFA 4B8WA 1GSHA 2C4UA 2RGNA 3C70A 2HV9A 1V0JA 2Q28A 2EF1A 3OE4A 4HS9A 3FSEA 5ESDA 3FOWA 3OLZA 1GT91 5K2MA 3AB3A 3CH7A 1BIFA 4AMUA 3L0SA 1H8HA 3T7KA 3GRUA 1C0LA 1HY3A 5DBFA 1O77A 1U0HC 3GAAA 1DC6A 4NFSA 5KYXA 1DZ3A 3OMWA 3FRJA 3JALA 4MEAA 1Q57A 3IJPA 1L2TA 4XQEA 1SUWA 2Q50A 3DV0A 5I9IA 4KVAA 2AOXA 4GYKA 1KQOA 3UXHA 1GUBA 2PO5A 3EX7C 3B1VA 3L6EA 2DUUA 4GC5A 4LHZA 2H7CA 3EE6A 4MLCA 2QT0A 2I4OA 4HWKA 5C51B 4BTLA 4NE2A 3VO9A 4J2HA 1UKEA 3ZI4A 1P31A 2FXVA 3JWEA 2H18A 1MP0A 1F2TA 1A9RA 2HN9A 3FLEA 5TGTA 4PICA 4TV9B 4MW5A 4LC1A 1T2AA 2PZBA 4J1TC 4UEOA 3C6MA 3FROA 3HEAA 1EJ6A 4P35A 4B81A 3THYA 4O3MA 2COUA 2H3EA 1CLUA 3IVRA 2JCYA 5F9MA 2Q6TA 1H4SA 4I8IA 2FPIA 1VLLA 1UJCA 2NV0A 4Q3EA 4XGRA 1T8WA 4C4PA 1L4YA 1UZUA 3H2YA 1JEQB 4O6VA 1EA7A 3RYHB 3X1KA 4E5YA 2A1UA 2EL9A 1YVPA 1H22A 5KSWB 4OXRA 1TU3A 4C7VA 3D2AA 1LVUA 3QEBZ 1FJXA 2BBTA 2M98A 4QUEA 3F90A 4A5SA 3TCNA 4O2AF 1NNLA 2CLSA 2PBRA 1OBCA 3ASZA 3ZHBA 1G59A 1L4FA 1D3AA 4BZWA 1AXEA 1M1YB 5LIRA 1TT7A 1ORHA 2BR5A 1U3DA 3LMKA 3LU1A 2WT8A 1CS0B 3FGOA 3DDUA 4HDMA 2F3QA 4JLOA 4BE9A 1KEEA 1OB5A 1QZZA 3HBAA 3RPEA 4D9NA 5M04A 3R3ZA 1EM6A 2AFIB 2YUTA 2ZIVB 1EIWA 1UDXA 2WUVA 2WOOA 4EVRA 1OGIA 1HZZC 2FA9A 2TS1A 4Y98A 1DOZA 1SOWA 3N8GA 3G82C 1DOHA 2JIRA 3RC2A 5TIIA 2X0FA 2OM2A 5E1MA 2J45A 1SKQA 4HDNA 1FMTA 1Z37A 2JVIA 3CKMA 3IDOA 4BN5A 3HU1A 1CJVC 5B4VA 3UQYS 1ZITA 4FD2A 4CQMA 2Q4TA 2Q6KA 1L5QA 2BHLA 4LYGA 3WO1A 2JPDA 2QTHA 2OYSA 5HMLA 3QU7A 1WKBA 1ZH4A 2BFOA 5TS3A 5KVAA 1MJGM 2SCUA 2Q3FA 2WNHA 2WVJA 3ROFA 1Q3KA 2OV8A 4B7ZA 5IYZB 2HA0A 3BHMA 4NPHA 5CT4A 1FFDA 2BF7A 3GYBA 2IYYA 4QFCA 1BKYA 1TYDE 2J1LA 3E5RA 3R09A 3WYGA 4EQZA 3A6FA 5J1TB 3SLKA 4HT3B 2XQJA 3MIZA 3OWHA 4JP8A 1ONPA 3I01A 5B7GA 5CG1A 3ZLBA 4DKJA 1D4FA 3N05A 3P2OA 3GZNA 4F4DA 4DNPA 3NW9A 4F9FA 4RTPA 1I1HA 5DYWA 4CEHB 5IX8A 5AK0A 1RCFA 2FFHA 3GD7A 2JHGA 4IP0A 1LTKA 4ZANA 3TK1A 2IYUA 1P62B 1U0SY 2QUKA 4DVJA 3MWKA 3WE7A 3F5DA 1T1EA 1R0ZA 1U8CB 1P1KA 2BI8A 3CUUA 3KUXA 5EHZA 4UDYX 1ENOA 2D13A 2GCOB 1PKXA 4IDGA 5HOQA 5HZMA 4B2YA 4HNQA 1D0SA 2D5BA 2PLFA 1HQYE 3TEMA 1BN7A 4HBGA 3CG0A 3VR6A 1XEXA 5IM4F 2VR1A 1SNYA 3WRXC 4IGKA 4Z9XA 3EIUA 5IVDA 5JANA 2Y4OA 5ALIA 4J0GA 4JT8A 1X1DA 2XDYA 3QWFA 1JHRA 3FNIA 4KN8A 4QARA 4LF9B 1U8FO 4N0MA 1LBSA 4XSVA 1ECFA 3GBVA 4PCVA 3COZA 4JHXA 4LX8A 3F67A 2I80A 1X9HA 1CP3A 2XJ9A 1Y5IA 1J09A 3N0RA 4IRXA 2P9QA 5CFNA 1ABFA 2JLSA 1QLWA 1Z83A 3VSBA 1BHJA 2TMKA 1VTKA 1VKZA 3BGIA 5L3SB 2CLEB 2I6TA 2C2YA 3OVMA 1XCLA 1B8VA 2QMEA 2ZDHA 3G2KA 3S6JA 5IYZF 1F9EA 4D44A 3GFVA 3F6CA 4CQMD 3D6JA 3AU9A 1X80A 1TZJA 1YR9A 2DULA 2QD4A 1YB5A 2XKBA 2FFJA 3DMGA 3PC8C 5ADUS 7ABPA 1ZCJA 3C8ZA 4CKEA 3T7IA 2VHVA 2P9FA 3O8QA 3VR4A 4ARIA 1J0EA 1OV4A 3RNLA 1AHIA 1PR1A 2NVWA 2V54A 1PHRA 3NJ8A 1AC5A 1M54A 5C8XA 4DIBA 5DNCA 4D8TA 2YUIA 3GI1A 1X86B 1AHHA 1XCPA 2QJWA 4FUQA 1SY7A 2IIQA 1P0MA 1DQSA 4ON9A 2OYRA 4BMSA 1RJGA 2B21A 5CJPA 4LMAA 5F7JA 1MX3A 2PD6A 2HJ9A 5CYGA 1NLMA 4Z9AA 3TFQA 1DARA 4KVGA 2FAXA 1YZHA 2WWFA 3OD1A 2JJMA 4XGIA 5G4KB 3G8AA 4JK3A 3GVHA 5HF6A 1EWVA 4BUCA 1X1RA 3RVRA 1XDWA 4EHAA 3EPLA 2AWNA 2PPLA 4RAQA 5IJWA 1FSFA 3C3KA 1NKTA 1I2MA 3GX1A 3VR6D 5K8LA 3OJLA 1PN3A 1FDWA 1G1MA 4M0LA 3WXMA 3I1JA 5CFRA 5IT5A 5IULC 3AG5A 3ASYA 3B7PA 1Y37A 1OFIA 5F9HA 1G20E 2V4ZA 5DI9A 4RH0A 1P2GA 5B6IA 1CJKC 4AY6A 3CUSA 2W93A 4P7BA 2CKDA 2QY9A 3HU3A 1Y80A 2WFAA 2G17A 1J4AA 4MRSA 2VOJA 2X7XA 3IP9A 5D00A 3FZEA 3T34A 3JVUA 1EHYA 2QN6A 1GXSB 1R7RA 1X7WA 2A57A 4MR7B 1A71A 3DW1X 3WTBA 4QEKA 4FB5A 2VEOA 5KQPA 2ZVJA 3B1WA 5HJ5A 4FCWA 1M2EA 2Q3CA 1C3VA 1DT5A 2H0RA 2PU5A 2VHQA 3D64A 3EGOA 3HRIA 1N3YA 3LVQE 4MVJF 4QQRA 1ORWA 3QE0A 5F2OA 2MWMA 3OFNA 3AJDA 5EHGA 4HVLA 3HYSA 3CRMA 4IIFA 2HWWA 3ZWVA 3DYBA 3DEAA 4NU0A 3KR1A 4OP1A 3HFGA 1CUJA 3ZGVA 5KTTA 3MRTA 1VPWA 4TUYF 2WMYA 3JWGA 2BFDB 2XOXA 4MCHA 5ISMA 1TXGA 3IPCA 4RTKA 1Y6GA 1XJQA 1QSGA 3F5FA 1QH0A 1V7CA 3GPDG 3IIIA 3KHUA 2NYVA 1V4BA 1ZNYA 4M1OA 2ESRA 3DMFA 2IP4A 4MWOA 2OSBA 2VP0A 3ZV3A 3CVWA 5A02A 3DLBA 4O4HA 1EUZA 1QV6A 1E5LA 3I4CA 1JR3A 4FNGA 3O38A 4IDHA 4MITA 4N9QA 3RB8A 2ZJ8A 2Q5OA 4U6NA 1BQEA 2NXWA 5GV8A 5TJ9A 2G9NA 4N40A 4NEQA 3SR3A 1HLGA 1WXDA 1VPEA 1USWA 2EYUA 1VB3A 2KSQA 2Y1EA 3DR5A 1JT9A 2PYIA 2PN1A 3EZ6A 2OM6A 1CHNA 4PU0A 5B3AA 2VAWA 3DCYA 3KQTA 4XJXA 1J33A 3PEWA 1XKLA 2H2IA 3ICWA 4DF3A 1EFAA 1GV1A 5DJ5A 3F4LA 3IHLA 1EE9A 2Q0XA 3PKZA 3WIBA 2O5CA 1S7GA 1VLZA 4R2HA 4OQMA 4IOJA 4BFLA 5J58A 2VQ3A 3K5WA 4EK9A 3ZBTA 2FPGA 2V74B 2Y1CA 2ORED 4DREA 4O59O 4LIPD 4MAFA 3PG5A 4F1KA 1D4AA 4MO9A 5AH0A 3HY6A 2BUCA 3OZIA 1BGXT 1J8FA 4JJKA 1OX6A 2FEKA 3JCZA 4JENA 3HP4A 1UM8A 2OILA 2C5HA 4H18A 1UBLS 3D4IA 2P9BA 2BKLA 3AV0B 3MGAA 3D2BA 4FKMA 3R3JA 1OXTA 1QAMA 1GRVA 4FZ5A 4G0MA 2IU0A 2JFYA 1Y5LA 4HXGA 5ESWA 5F4BA 4JP1A 1T43A 4O02B 4R83A 5E0OA 3IV7A 3UT6A 3ZK7A 3T3NA 4JZYA 1Q0TA 2IS6A 1RIIA 3LKBA 1OHHA 1TF2A 1IK4A