5CW1A

Proteinase k complexed with 4-iodopyrazole
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
279
structure length
279
Chain Sequence
b'AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
molecule tags Hydrolase
source organism Engyodontium album
publication title Rapid experimental SAD phasing and hot spot identification with halogenated fragments
doi rcsb
total genus 99
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2015-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 5cw1A00
5SICE 3DE1X 5AVJA 1Y4DE 2ZWOA 2ID8A 3VYVA 3EDYA 3TI9A 1YJBA 3WHIA 4CFYA 4DZTA 2Z58A 1TECE 3GT4A 1SIBE 2XTJA 3BGOS 1EGQA 1TM4E 3VV3A 1V5IA 1GT91 3T41A 5ARBA 5AVKA 3DE7X 2PYZA 1TM7E 3A3PA 3VSBA 1Y4AE 1SN7A 1SVNA 1P8JA 3WIVA 4KB5A 3SICE 1SCAA 5ARCA 4C3VA 4WOBA 1UBNA 3DW1X 1Y1KE 3DVRX 4CFZA 5I9SA 4J94A 4BWGA 2SECE 1BJRE 4DJ5X 2HPZA 4AKTA 1SBCA 3I30X 3ZXXA 1WMEA 5ARDA 5JXHA 3EIFA 3DWEX 5FFNA 1GTG1 1GTJ1 1GA1A 1ZVKA 5JXJA 1TM5E 3A3NA 1WMDA 3QMPA 1V6CA 4RYDA 3LPCA 1C3LA 1SBHA 1GA4A 1R0RE 3HJRA 3DW3X 1KDZA 1AQNA 1SIUA 1ST2A 3A3OA 3DE5X 4LVNA 5AQEA 3DE4X 1Y3CE 3DE0X 2PQ2A 3DYBA 2IXTA 2ID4A 4HVLA 1DUIA 1GNSA 1WSDA 4ZOQI 4Z2AA 3VV2A 3BX1A 3TI7A 1TM1E 2TECE 1PTKA 1YJAA 2PRKA 1Y34E 2SBTA 1VSBA 4H6XA 3CO0S 1PJ8A 2X8JB 2WUWE 4HX2A 3GT3A 3WIUA 1C9MA 4KPGA 1Y3FE 4AKSA 1T1EA 1KDVA 3VTAA 4DWWA 3LXUX 5JXIA 1BE6A 1Y48E 2P4EA 2ST1A 4LVOA 1NLUA 2Z2YA 1Y3BE 1S01A 3OSZA 5B1DA 1SCBA 3BPSA 1SPBS 4KG7A 4B5LA 1THMA 3F7OA 1AVTA 3D9QX 2WV7A 5CW1A 4ZARA 1WMFA 3DVQX 2W2PA 1GNVA 4K8RB 1Y33E 1CNMA 1HT3A 3L1KA 2WUVA 3DVSX 3P5BA 1AU9A 1PFGA 1TK2A 3QTLA 1SUEA 3SQOA 4C3UA 1BH6A 3I37X 4H6VA 4YN3A 4GI3A 1EA7A 2W2OA 4JP8A 2W2MA 2PWAA 1Y9ZA 2Z2XA 1SCJA 3WQBA 3DE2X 4FONA 1S2NA 1SBTA 3DE6X 4NE9A 1Y3DE 1SBIA 3F49S 1IAVA 1T1IA 1SELA 1OT5A 1SCNE 2SICE 3ZXYA 5JXGA 3AJ8A 3LPDA 1SUDA 4NE7A 3Q5GA 4OMDA 1T1GA 1YJCA 3H42B 1SUPA 2PKCA 2PWBA 3AJ9A 2DQKA 3CNQS 1GCIA 3DDZX 2X8JA 1Q5PA 3PRKE 3QFHA 5B1EA 1KE2A 1KE1A 2IY9A 2V8BA 5K7SA 3D43A 1SIOA 5FAXA 1DBIA 1MEEA 1OYVA 1GTL1 4OMCA 3PTLA 2Z2ZA 2Z56A 1NDQA 2G4VA 1A2QA 1BFKA 1WVMA 2Z30A 1JEAA 4NMXB 3EE6A 3GCXA 4CG0A 3I34X 2W2QA 2WWTA 1AK9A 1LW6E 1MPTA 2W2NA 4WOCA 1SH7A 1PEKE 2QTWB 3Q40A 1SUBA 1AF4A 1C9NA 1CSEE 1GA6A 1SBNE 3GCWA 4OV6B 3TECE 1C9JA 1XF1A 1R64A 2ZRQA 4I0WB 4M1ZA 1KDYA 1BFUA 1SUAA 1P7WA 2DUJA 2ZWPA 1TO2E 1S02A 2PMWB 3DE3X 3I2YX 2DP4E 1SCDA 2HD4A 1NDUA 1AV7A 2E1PA 2SNIE 1SUCA 1TO1E 5FBZA 3VHQA 1ZVJA 1R6VA 1AH2A 1OYOA 1TMGE 3UNXA 2GKOA 2Z57A 4MZDA 5AMXA 2B6NA 1P7VA 3LPAA 3AFGA 3F7MA 4H6WA 1BE8A 2XRMA 1TM3E 1ST3A 1YU6A 5JMOA 1IC6A
chains in the Genus database with same CATH superfamily
4XGKA 1Y4DE 3IEUA 4PPNA 4IEFB 5AI8A 1G5QA 4ZTZB 2GCNA 1KZ9A 2O50A 3EGVA 2WWYA 4B5KA 5JNTA 2PPLA 3L8GA 4ZT6A 3SVTA 1FYWA 1IPEA 1YIOA 1JBEA 2IYPA 4NEHB 4BVBA 1TM7E 3B3AA 3FKJA 3VSBA 3H2ZA 1R12A 1T8SA 2OBXA 3KJQA 4QTZA 3KSBC 1JV2B 4P08A 4HB2A 4CTJA 2BC9A 3PQCA 4NVRA 5ED0A 1MVOA 1I2ZA 2DBRA 3WA7A 3QWBA 3HMKA 4KLZA 3ZE9A 1CEYA 1OHHA 2ODWA 4IKOA 1A9YA 1DAPA 4UM9B 4ZJPA 3Q88A 2R6CA 3S1LA 1I5RA 1JEOA 3CR3C 1T2UA 4ZCRA 5KYNA 4WXEA 5DBGA 4A27A 4DLZA 4P53A 4JBNA 5JH7F 4KHPB 3IESA 4DBZA 4IWNA 5AWFC 1DC7A 2G5GX 3ZKWB 3LQRA 1N2CE 3ZG6A 1T3GA 4DUGD 3RRJA 1HX7A 3TTYA 3EWIA 3IV9A 3OM1A 3O9ZA 1TNDA 1VPEA 3HGMA 1V41E 1XD9A 3BEDA 4KXXA 3AEUA 4G4JA 1L7XA 3AEQA 4ZXPA 4Z86A 1ZH0A 5L7WA 3EGCA 3D5TA 1IUOA 4IQGA 4Z0PA 4CM5A 1B6RA 5E2IA 2XIQA 5J63A 4XCVA 1OGIA 3OBIA 3R5FA 2Z2YA 3O1HB 2ATCA 4OHFA 4DOMA 2AUTA 5TPZD 2FV8A 1RBQA 5H4HA 1HRKA 4CW7A 1HXHA 3HO8A 3LV8A 4EGAA 3F9CA 4NULA 4J1SA 4MO2A 3F1LA 1T4CB 3ONEA 5AOCA 3MRXA 3V7UA 3IC5A 3UBTA 1R6AA 2OSVA 1F2TA 2K87A 3C45A 3EISA 3HI4A 3UJCA 3PDUA 1JI3A 1Q3KA 3R6DA 5E6RA 3UWKA 5J2UF 4B7CA 4LCJA 4OSEA 3NEJA 2VHXA 4G23A 5FWAA 4O2AA 4IF6A 2OZPA 3EWSA 4DCOA 1CHDA 4ZGBA 4YY3B 4D9FA 4HAVA 1NJ5A 4LV8B 3SZGA 3KTDA 5KAMA 5HE9A 1GTRA 1MHPA 5KYWA 1DO8A 3KB6A 2AFHE 2GGSA 4JROA 4LYYA 1TA0A 4PCLA 5EYPB 3RAGA 2FUKA 3PUZA 1GCIA 3W2FA 4ED9A 5ALVA 3QFHA 2GYUA 2GJKA 4PZLA 4YHBA 3WISA 3I0NA 1YS6A 1P2BA 3OLWA 4MYHA 4QPPA 3MPOA 2DHDA 2BFEB 3QKUA 4FHGA 2WWVD 2X9LA 2IXEA 4ZVSA 4JNCA 1YDHA 2GHQA 4YGYA 5IVHA 5AQ1A 1UKAA 5G3YA 1K08A 4Q7EA 1P0MA 2VWGA 2DPMA 3D0QA 4P3KA 2FDXA 3ONFA 4P84A 3RSQA 2DMRA 1U2PA 4BDSA 5LMUB 3FSJX 2ODAA 2J0QA 2ADMA 3BGSA 5CLHA 2OBNA 4RH0A 3UC5A 2P1DA 4NPHA 1KZHA 4BO4A 3MILA 4HY3A 1OQAA 5IDWA 1SUCA 1DCKA 2H1RA 2ZI3A 2EWWA 2P77A 1WU7A 4TQUS 4CGZA 3QFFA 3UNXA 1DINA 4HNGA 5C5IA 3K9QO 2JJ2A 1KK2A 1NYQA 2AUNA 2IYSA 5JY6A 4U3JB 4AZ3A 1L8OA 2QMZA 4IIDA 1QYDA 3UV7A 3HWRA 3EUWA 4ZZIA 1X1CA 4UQPA 4FCTA 4Q3OA 2HDNB 2WVJA 1PYOA 1DQNA 2QM7A 1GUDA 2R6JA 3A04A 5CK4A 3BXXA 4K9RA 2FX5A 4DB2A 3A6HA 1TMOA 4JA2A 5A4MS 1FP1D 4K28A 3BF8A 4YCNA 1E9CA 2CFTA 3BFPA 2BFCB 4YRBA 5JFOA 3PENA 4FCVA 2BMAA 2GNPA 4X3OA 2B99A 2C4HA 2CHQA 2VRWA 3DOEA 4CL3A 4YCMA 1JKFA 2FSVA 2Q8QA 2ZRDA 3B3FA 4W9RA 4C0HA 4QDOA 5ADVA 3RF6A 5F7XA 1L4KA 5HQ3A 2GCOA 3F8TA 1CJVC 1JEYA 1ZR4A 2VTDA 4U02A 2EJVA 5CDSA 5EZ5A 4Y7DA 5KX5A 1A8SA 4NAVA 3HVHA 2EZTA 2BGNA 1E89A 4L1KA 3A4LA 5EP2A 1CYDA 5DYIA 1MU0A 1RWPA 3HVUA 4NCXA 5ESDA 5FI5A 1RWBA 3VH2A 5HVNA 4F06A 1JR6A 4HWRA 1YMQA 1VPLA 5CA1A 1EXWA 1ZCAA 3GVPA 4CMJA 4Z2AA 3KB2A 5KYTA 3AMVA 5JZOA 4DBLC 3BHNA 2IOQA 2I4RA 3DV9A 3K7EA 1K7FB 1PW5A 4ZT2A 3SG0A 1TZKA 2FF7A 4MVXA 3ZV6A 2Z83A 1AN9A 1GAEO 1T1EA 2AYZA 1WDKA 3M4NA 4MPPA 5GV8A 4EY4A 2NUAB 5B55A 1Y48E 3PGLA 4JFAA 5C8YB 4O1IA 4ZQEA 3SI7A 2PMBA 2E2WA 1KVSA 1JS1X 5K1ZA 1WV0A 2R8EA 2XCIA 2IH5A 2XCOA 4FW8A 4CQMB 5C4MA 1Z7EA 1SA0B 4OHBA 1GPWB 2Y68A 3KFVA 4S35A 4QSHA 5BV1A 2YWJA 3OESA 1SUFA 5AKKA 3T8YA 1X15A 1ZMTA 2X5JO 4MEAA 4PYLA 3R09A 3BZBA 3GN1A 5IASA 5IBRA 3U1TA 4KDCA 3U62A 5ALXA 1XZIA 2IHJA 3DCYA 4FLMA 2O3SA 4MMZB 1NN0A 1QX4A 4XDHA 5KHAA 3VR0A 4ZYWA 4M83A 1QRUA 1E0AA 1KYYA 2AG8A 2G0TA 4J0KA 3DUFB 1YO6A 1E3MA 1EFAA 7ABPA 1YRYE 5CT6A 3E58A 1J0AA 4RQAA 1MT3A 3WGGA 3HRHA 3RSCA 3AH8A 1ZEMA 1ZOPA 3CEAA 4NNOA 2C3PA 4RHEA 5EWLA 3TEFA 3QUSA 1AQJA 3I73A 1F8XA 1M2GA 3E4CA 3EULA 2ZVPX 2E49A 1EIWA 5LQUA 2PTGA 1HZJA 3GNSA 4PE5B 2Z9BA 5H7XA 1A72A 2H1FA 2HCBA 3TQHA 4E4YA 2YJZA 5EMNA 3OTWA 4TM7A 5AICA 5BWOA 3LKDA 3O0DA 3FROA 1G2IA 4FJ1A 4K0RA 4MS4A 4QTXA 3ZWKA 5IAOA 4UEWA 3OEEA 5CHEA 1SBQA 2QLMA 2VPYA 2WUGA 1QF9A 4UHCA 1P5FA 3MS2A 5H02A 4CWAA 1ABBA 1KVUA 4YMLA 3LZDA 1PGNA 3KPWA 4TYPA 5J1SB 2O6HA 4MUMA 3JQAA 1OAOA 1LBSA 4WOJA 1PWEA 3ADCA 2Z43A 4LBWA 3WB1A 1YTLA 3KDSE 5K4HA 4EGSA 1V1RB 4BC0A 2IP2A 1JG2A 3ETDA 3HCNA 3KQVA 1ZD4A 4EAAA 5LOVA 1Y3HA 3C85A 4RXUA 1F4PA 5BRJA 1NBWB 721PA 1RP7A 2QVCA 4KVFA 4DNFA 4ZIRB 3MJSA 4NENA 1BTOA 4HS9A 1W85B 4BNJA 4IVPA 5FYQA 3S44A 3MMSA 2J59A 3DKIA 1IB6A 1OZHA 4RA9B 4C7VA 4DJJA 4U5QA 2OXRA 2ZZMA 3ZGVA 4AQDA 4EYGA 3ILYA 4BZQA 2EJCA 2J3QA 3AJRA 4HAZA 4ZVTA 1NURA 4TT3A 2GN4A 1T4DA 2HT1A 2W2KB 2BTQA 4IQ0A 4EVSA 1U6KA 2OVBA 3DHYA 1I2BA 2QJOA 2XDAA 1THGA 2DKOA 3AK4A 4X6LA 1RLMA 3FLEA 2AR0A 2DB3A 1M5UA 3URKA 4JD5A 1EJ2A 5TNXA 4CDRA 3NETA 2I3BA 1AOXA 3VUFA 1IHYA 5TIIA 2A9OA 3VC1A 4DCNA 4ND6A 2E5WA 3PBKA 3I58A 1AKNA 1NVGA 4I1IA 1L5WA 3T3MB 4JBWA 2LCIA 4Z3DA 5U1PA 3EA0A 3X1XA 3H2BA 3IQEA 3QENA 5ABPA 5BOSB 3VU3A 2RHCA 1XEXB 5TQ0A 1M66A 4HBZA 4JVNA 4JP5A 5BQ3A 3CO0S 3DV0B 2JLWA 2ZWMA 1MABB 3B9RA 2IHZA 3HCAA 3WBFA 5K0FA 2IZ0A 2P2LA 5K3OA 3T7DA 3GEEA 4KO3S 3MF4A 5HJ5A 4TS9A 3PUYA 2A1TR 1U0RA 3B78A 4C5BA 3PEWA 4OYYA 4IVNA 5G41A 2FR8A 1H93A 4F8YA 2II6A 3NEYA 2CNDA 3RI3A 1JFLA 4DIEA 5AOAA 2C92A 3HABA 2ZDQA 4B4WA 2P69A 1QQ5A 4F9EA 2GTPA 4YJ2F 3HZRA 5JSYA 5AH0A 3UMBA 1L5RA 3LRPA 4U8GA 1NT2A 1EQAA 2GSWA 2V7VA 5HUQA 2PX5A 1VI5A 4XDYA 2O2GA 1RC1A 4V0SA 1MO4A 5LMCA 5FWXA 4TTJA 4XGRA 2XADA 2A0UA 1EP9A 1R2QA 3A1DA 1FF9A 3T0IA 4PLZA 1EEHA 1V2HE 2F8MA 3N6RA 4TV9A 3KPJA 4UCFA 5EZYF 3E5NA 3RVNA 4CEJB 4YQFA 1E0DA 3ZBQA 3LP8A 4OQQA 4O2BA 4QJ5A 5DCLA 4I1SA 3W9YA 1XEWY 1E77A 1R1DA 2BJVA 1GDHA 1K9SA 4NBSA 3C4VA 1HGXA 3G3EA 1OPRA 4OEHA 3WGTA 2CFRA 2WUEA 5M5BA 3TW8A 1GO2A 3OCXA 2CJPA 3RHTA 4ZODA 1CDOA 5DTRA 2WHQA 5TSDA 5DNUA 1W1UA 2AR9A 1Q7BA 1NR7A 4MITA 1ZM3A 1FFCA 4N76A 3W3AD 5GZ3A 2H9IA 2QK4A 1RXYA 2B4TO 3D8HA 4D46A 1CRWG 2H85A 2ID7A 2Q0QA 3GAFA 3LUCA 3L6DA 3M4YA 3ZK9A 1EFRA 1L4UA 1P18A 1E66A 1Y1SA 2FPXA 2VLIA 3NAMA 2CB9A 4PZUA 1X13A 2Q4EA 3N2GA 4QQKA 1A9XB 1KFJB 4BE9A 2IDJA 3QKWA 5AUQA 1H1LB 3H2IA 2ZANA 3DO5A 3E1SA 3TNJA 1M9NA 5EPUA 2BCJQ 4P58A 4FI3F 1T2CA 4UJ3A 1BW9B 4PHTA 2NACA 4HDSB 4OHYA 1GAJA 3D8RA 3IIIA 2GBLA 2QRGA 4RPIA 4EG4A 5AXAA 4S1TA 1USGA 1DG9A 1TW3A 3RVJA 4RJIA 2XB9A 2NM0A 1D2RA 1YVDA 3AETA 3QPAA 3WLQA 4E1VA 4N3AA 2IX9A 3ZHCA 4Q3EA 1WMSA 3RC1A 4IGKA 1EDDA 4L5BA 621PA 1NXXA 3IP5A 4HDRB 4YRQA 2AXPA 3VDNB 4FD3A 1YKFA 3QX8A 4PHHA 3FB4A 2R7MA 1X9HA 4EX7A 1LLFA 3IQHX 3B6EA 1U4OA 3G2NA 5E6UB 3ZXXA 2ATEA 2RAVA 3JS5A 3LVFO 4TUYA 5KU7A 3RIXA 1UL1X 1NTOA 3I9NA 4D9BA 1DOAA 4FHDA 5B2EA 1DMRA 4IINA 2AJTA 3E9RA 4H1HA 4PONA 2GRUA 4LHXA 2V6GA 3DAOA 4M7RA 1Q1AA 4J7AA 1ZU5A 4KBGA 3TAUA 2FPPA 1K0FA 4NQRA 1NV9A 3NLLA 3OLVA 3FWYA 4H59A 1WSDA 2UUCB 1GNLA 5T4HA 3TRIA 1MZPA 2AC7A 1O54A 3WFIA 3AUAA 4GRIA 1VJDA 1Y1TA 4KFUA 4Y2YA 5D7BA 3U7RA 2QW0X 4B09A 2Q1SA 1U3FA 5IULC 5IYZA 4IHKA 3RYCB 1UFOA 4MV4A 4MDEA 1O8CA 3AFHA 1RM5A 5M2QA 1QRAA 4H4CA 3ZHYA 1MC8A 1R15A 2FN4A 4HGNA 1VKZA 4Y8VA 4QYXA 4YRZA 4UUAA 3EIHA 1Z4PX 2Z6VA 3BD6A 1Y33E 1EPUA 3C3DA 3OOHA 1KI9A 1MEJA 4QXMA 2G7ZA 1NW7A 5CX4A 4YAWA 1GL3A 1MGPA 1C81A 5DISB 5F5NA 1FY2A 4DT1B 3GB9A 3I37X 2QROA 2CNKA 4YXFA 1YB1A 4RTNA 2D1YA 4ZFNA 3BM5A 5DE3A 1T9GS 3JWEA 3EVEA 4Y3UA 4M1KA 2PLAA 5ERXA 5EZ6B 4ZV9A 4FX2A 4EB6A 3P5SA 4DV6B 2HQSA 2CLEB 1C5KA 3MTBA 4Y6QA 3RVMA 4C22A 3ADBA 3QKSA 5CVJA 4OJKA 3FZGA 1ENOA 2I4MA 2XA9A 5IF3A 3C1UA 5HOEA 1U0TA 1Y80A 3PXAA 3QPVA 3WLAA 4EYOA 4N03A 3ZXUB 1BSVA 4UVHA 1R3DA 2IFTA 2OYSA 3PWSA 2L0XA 1X1SA 3O90A 1OWOA 5CURA 1OH5A 2AOVA 3C3EA 4BLWA 3AFIA 5AHXA 2VHQA 1F7UA 1COZA 2ZRJA 4FSHA 4KBFA 5DNWA 3E82A 3VKVA 3PEEA 1BHO1 4N5LA 4HOYA 3TLGA 3DKKA 2RAPA 4D4JA 2AEMA 1TT5B 1LBEA 5FBZA 1QYCA 2BFWA 2JAHA 1ZVJA 5JFGA 5KHLB 3JASA 3ZQJA 4A82A 2VDOB 3GLRA 1NASA 1L5FA 1UC5B 4NR0A 3RTAA 3U7EB 4E09A 3MMNA 3JVUA 5A4FS 4LF7B 1X1EA 3ECSA 2O2XA 2CD9A 2WTNA 3GMSA 1M2VA 3PT5A 4IHJB 3OIVA 3VOSA 4NJMB 2EHDA 1MAHA 4ARBA 5K05A 3RKSA 4IX9A 4AUMA 4DZRA 1ILWA 2VTBA 5DKFA 4ZRNA 4QT0A 5BYJA 3KKZA 4P93A 4BLVA 1I51A 3PLNA 2YR0A 3NDPA 4TV9F 4G3XA 3NDBB 4RGBA 4GOOD 1CUUA 3HJGA 1UWVA 2PIAA 2I71A 2GCGA 2YHSA 2HA7A 5CT4A 4TS3A 1QBKC 1U7OA 2A0YA 3FGPA 4F3KA 1MT0A 1AK2A 2CL0X 2CXOA 3QLVC 2I1WA 5G0UA 3BL8A 5A02A 1T3TA 4OGGA 3V1NA 4REQB 1AHIA 2CUTA 2FP3A 4PSVA 2H1IA 2N1MA 3LTNC 3IYLW 1HY3A 2QTFA 4E3WA 1TRKA 3KZOA 1KO5A 3F4BA 5CVTA 1G3RA 5D00A 2A4MA 2C4UA 2J85A 2CFSA 3U3XA 3Q12A 4PLTA 1DG3A 2QR2A 3OZAA 4DXDA 1MZVA 1AMNA 1V5WA 2WSSD 3K5WA 4M1ZA 1IWPB 5FUBA 4D43A 4FFWA 3Q9LA 3GYGA 2W58A 4D9NA 3LJKA 2DJ5A 1L3CA 1QM5A 3OD1A 3P7MA 3V4FA 1VJRA 1CEEA 4TSKA 5GIOE 2JFBA 4WKGA 1AGNA 3Q9NA 4U4AA 4UU1A 2EC5A 4PGFA 3ZD6A 4BO1A 2FK8A 2ZIGA 3MAGA 3KJFA 2JIZA 1IUNA 1E3JA 3P52A 1P7CA 3MELA 4A8TA 4JI8B 3FNHA 4L3OA 3O21A 1ZS9A 2F4VB 5KPDA 3FCYA 1EEXB 3HUEA 4R6XA 5KJ6A 4Q4LA 2XWQA 1UAYA 4CCYA 2X0RA 2Q6LA 2RGUA 5CEEA 5DNDA 2GYYA 5DHPA 2Q1WA 2ZATA 1V5GA 4Q4HA 5HIIA 5A4DA 5AVRA 3CF0A 2W2MA 3EZXA 5EJ7A 5EJ5A 4CG2A 1IN1A 3WOHA 1D2MA 3B1KA 4GP6A 3ZXIA 5A0TA 2BP7B 1CS0B 1EX1A 2VSOA 2ISQA 1UBCA 1NF2A 3ND5A 3D5EA 4EGCB 4WY8A 1RR6A 2AVNA 1W52X 4YEDA 4E1AA 1H2EA 1X6VA 3CF4G 1NJ2A 1NBMA 3PHIA 4OMDA 5LKAA 1KWGA 2JD1A 1IHDA 3DFIA 4RD1A 1ZC4A 4JB2A 3K73O 4F3YA 2AI3A 4AURA 3QVTA 3RT9A 1SC9A 1Q0PA 3FTFA 3GT7A 4FYJA 4XVUA 1TU4A 1AY0A 2CLMB 3K92A 1QHHB 3A70A 1ZUHA 3KDPA 5A5FA 1B26A 2A9VA 1N5IA 2FPIB 5IW8A 7MDHA 4C0WA 2GARA 1H0KA 3MIIA 3QE3A 4U1RA 4YCBA 3WGHA 3UTCA 2HYDA 4QAQA 4L0DA 5TB5A 3WFJA 3ISTA 2W37A 2FMTA 5KKCA 3VFDA 1FFEA 2IJGX 1GYQA 4G0YA 5DYYA 4P32A 2JVJA 2VHYA 1BQ4A 1R6BX 3CVWA 4WWHA 1RRKA 1Z73A 1U80A 3NTUA 4FWIB 4KQXA 4ZC8A 2ZYAA 4C05A 5A4IS 1NFRA 1ONSA 1TM3E 1UXOA 2O8CB 2HR1A 5K8VA 2HWXA 3AF1A 4YACA 4EZEA 5KMGB 1CR6A 4KBYA 2H4XA 2DQYA 2JZOA 4LX8A 1XHLA 4DR7B 4ARVA 3CBGA 4QXPA 1SBYA 2QLLA 2OXCA 1K0UA 2VUSA 5K3CA 3DLBA 3S40A 4KO4S 1T8YA 5CLJA 2AA3A 2EQBA 4XQEA 1GL9B 3CNHA 4HQFA 2YJ3A 5IBCA 1Y4AE 2AG5A 3K0AA 1FC0A 4TXLA 2PT7A 5DEOA 5IC5A 2C4WA 3B1FA 5DBOA 3DPIA 5ALNA 3U81A 3UUWA 4O3MA 1UP6A 3DNFA 2WJPA 3NI2A 2FPMA 4LJ6A 4Y0NA 1XLUA 5HTKA 3UMCA 2ADOA 3AUFA 1Z2AA 2Y1WA 3LW8A 2I3AA 4IIFA 4N9QA 4R81A 2EERA 5CBPA 1L4YA 5K6TA 2BI8A 1AQUA 1BE1A 2RHGB 1JKJA 1RHMA 2APJA 1GZUA 3UT5A 5BSKA 4CF5A 4Z7QB 3WKDA 2W11A 1DFIA 2PLFA 5IN4A 3RHZA 2GN0A 2V5VA 1AF7A 1C9DB 2V4MA 3C1OA 4O4HF 1HSZA 3CE9A 2FG6C 2ABWA 4MTLA 3C98A 1QH1A 4RCYA 4ETIA 3P27A 4ILEA 3DCNA 3O8DA 5GTDA 5L3QB 1NR1A 4ZI7F 3RS7A 3O4VA 4DEXA 2BM1A 4DLNA 2F1JA 3CZCA 3DJYA 4JT2A 4TGLA 5A1TA 1T9KA 3FR8A 5CXSA 4A5OA 4D4LA 4INOA 4WCVA 3KE8A 1LSJA 5ALQA 3UZUA 4RTLA 3KZXA 2DXIA 4OCZA 4OH1A 3KOXA 5E4JA 5TQVA 1WIWA 4KO8A 1VLHA 1RABA 3ET4A 3O0TA 4G89A 5F33A 1W75A 2GJ4A 3OUZA 5KWSA 3OZSA 3L40A 2VYFA 2CWDA 1KYWA 4L95C 4G41A 5C3MA 3IIJA 3I04A 2ZBDA 3RK1A 2B20A 4YVFA 4ZJYA 1NIJA 1JLMA 1N4DA 2JCBA 4PLGA 4C6TA 3TEJA 2CDAA 1F3LA 1QK5A 2OHJA 2WLSA 3CR7A 3FGZA 3GIWA 1V8ZA 2M6RA 1J2JA 2YHUA 1AN0A 3OU7A 5D7NA 2XAAA 4TKUB 1E63A 4D96A 5JD5A 2BFFA 5EHZA 5EI5A 1M1YA 4LXTA 3DTVD 4FEAA 1C3VA 1L9KA 2PO7A 4XIIA 4NE7A 1H9BA 4FHCA 1DX6A 4RQUA 3G9ZA 2RMKA 4Q48A 2JGAA 4LTDA 2NGRA 5CXQA 2QP4A 1M10A 1E2IA 4S1NA 4EKIA 2IPXA 2QX6A 2RHLA 3L84A 1RC0A 2ZJ0A 4OQNA 4MW9A 4RKEA 3TLKA 3TUJC 1J25A 2XECA 4JLUA 4N6OA 4M0CA 4OMCA 2IHYA 2JHCA 5SY9A 3SMVA 3H0CA 1PYDA 1E8DA 3O8BA 3K9FC 1C7JA 1U8YA 2OILA 5D01A 2GEUA 4ND4A 1UZMA 4D3FA 1F4LA 4K9KA 3LDAA 3LL7A 4UTZA 4KREA 4DEVA 4GQAA 1E2EA 5U4XA 2XYPA 1LSOA 2H57A 4B6GA 2B0CA 1MX1A 1T26A 2XIJA 4I5FA 5INTA 3IUNA 3VHXA 1U8TA 1U02A 1X14A 3DE3X 1DIGA 1NG1A 4R2HA 3WLMA 1NI4A 3I5MA 3P1JA 4UJ5A 2AK2A 7AT1A 1TF2A 2QPAA 2IXDA 3B7PA 1P44A 1TC1A 3E61A 4LE2A 1BMFA 1ODFA 2OL4A 3ZYZA 5PGMA 3OMXA 2DPHA 2IDMA 3DZIA 4HATA 4RZHA 5P8WA 1L1FA 4MR9B 3NHWA 4UKDA 4CTOA 2Z2KA 2ID8A 2BKUA 4JJ8A 3UKJA 2DFTA 3KWJA 3MLAA 3N8NA 2H9AA 1PBTA 2BMVA 4ZVMA 3LFTA 2PH3A 2EIHA 3UAOA 4TLDA 4NEQA 1RMTA 1IXRC 2XA2A 3ZVRA 2EFDB 2X2FA 1H8ED 2ZGVA 3BKXA 5LBIA 4WOPA 1KYVA 4D81A 1NWHA 2B37A 3C0KA 3VJMA 2RC6A 3BBLA 3BIOA 4AJEA 2FHPA 1E1LA 4QL3A 2OM2A 4R2WA 5U4QA 2H4WA 3ASUA 3WB9A 4I5IA 3KKLA 3RFXA 4CI0B 3OQOA 1JRLA 4D8TA 4L8FA 4C4XA 4ESEA 3QBEA 2J7KA 2XQKA 4KFCA 1RPTA 3KQOA 2Q5LA 4RFVA 3IBGA 2VZ9A 4UBJA 3CXUA 4B31A 4BFXA 4EGFA 2I7XA 2W43A 3F6BX 1PL8A 3UA4A 2HH9A 3UAYA 4RTMA 4YJ2B 3BXEA 2H08A 3TOVA 3G7NA 1H2XA 1CLEA 3PIDA 1NNI1 5JBIA 2JKYA 3F2IA 5HZHA 4BWVA 3AOEC 3PUXA 3S70A 4IQFA 3OJOA 5JUWA 2PUEA 4W5NA 3UTDA 2Z04A 3MLEA 3U7IA 4C14A 1H9CA 5A9RA 1FE8A 2GEFA 4AJHA 4KK3A 4EG3A 4S05A 3KEFA 3WO1A 3FN4A 1ACLA 3LCCA 4KL8S 4MXDA 4M9RA 1QKJA 1I3MA 4JP3A 4LQDA 5DYGA 5J2UA 1XAJA 2IWHA 1AMUA 3D8UA 1EVYA 2QAGA 4DLUA 4P4NA 3ICWA 1TT7A 5CFPA 1KKMA 2V6MA 2QE7D 3MMXA 1GG5A 2CJWA 2OBBA 4MUJA 2VR1A 3ZE0B 4UHKA 3KQHA 2A7QA 1JT9A 1X8LA 3CYFA 4PX3A 2HQBA 1GSOA 1VGVA 3I09A 1KI8A 1E6CA 3K1ZA 2WHEA 3WMXA 1WW8A 1T4GA 1U7UA 2XODA 3HUTA 3WK8A 4BLOA 1HFWA 4C6TB 1YFLA 1DELA 1DIRA 3BMCA 1SQ6A 1T4MA 2YBEA 1YBMA 3ORHA 2RCYA 3KETA 5FO0A 1JMKC 4DKXA 1LDNA 1TW2A 2NU8A 1PCXA 1O1YA 5JAUA 1N6KA 2ACWA 2GZ1A 3I2JA 1UMDA 2MT9A 3PPXA 3O7WA 4B43A 4GX5A 4D8UA 2W00A 3KPUA 4BE7B 1PFVA 4PPYA 3TGPA 4N0PA 3C87A 1Y6FA 3R3HA 2WINI 4A4DA 1TFRA 3IKMB 3FFWA 3ICQB 4Z9XA 3WV4A 1GEEA 4NMXB 3TAXA 4EH1A 5FWDA 1QTNA 3CB2A 3RJMA 4OYLA 5DBFA 5CIQA 4K9DA 2FA9A 4EKYA 1HMPA 3FPKA 2GA8A 4KLAA 4QTTB 3QF4B 1Y81A 1OFTA 1VSTA 2CCKA 2JAPA 1XA4A 4CMKA 2I0FA 4FN5A 1OYYA 1YS9A 1J5XA 2EKLA 4HRYA 1KMCA 4J7CA 2FJPA 2HKIA 2WJHA 4W9NA 1NW8A 3A9VA 3HEMA 3NQ41 4D8XA 5A0FA 3MJTA 1A96A 1RQXA 3FHLA 4GLBA 4XAQA 3ZCQA 3WIOA 5DM60 2PZMA 1E9EA 2KM1A 1IN8A 4LTNA 3BMOB 1XZAA 3BSFA 1QP7A 1RHJA 4PQYA 1ZRMA 2OSBA 2IYAA 3IODA 2CB0A 1U8XX 4LIPD 1GP2A 3VO8A 2QX9A 3A9SA 2NN3C 3NHUA 4BS9A 2Z58A 5BRAA 2B34A 2C5GA 1YOVA 2IE8A 3BGOS 5JI3E 3WGOA 4IH1A 4AJ9A 3TBFA 6NULA 1HE3A 4FKMA 3FWNA 2IDZA 3KAPA 1XQ9A 4RY0A 2XWBF 5G1NA 5CNKA 4QVKA 2RGEA 2YN0A 3DEKA 3J81k 2P27A 4B80A 1XTBA 1GPKA 1RXCA 1V4NA 4G9EA 3HQ4O 3DVAA 1ULHA 1PT9A 4FE7A 4Q47A 3HBNA 1HV8A 2ZRMA 4G8DA 4H7KA 4HI0E 1BCSB 5DTQA 1QTRA 1ENYA 4OUDB 3W6OA 3P71T 4NOMA 1K27A 3GLIA 1CF4A 1S5PA 4KWTA 5LDDC 1VSUA 4GOJA 2OFFA 1Y9EA 1FMFA 4NOLA 3OZDA 3OPVA 2CZQA 4LSZA 2VJPA 1FVHA 4H17A 1WXHA 4KXQA 4WLVA 4DLRA 3KIPA 4HAYA 3DAYA 1I8TA 4QO8A 1PWZA 1F06A 4GIBA 4ZHQA 1UR5A 5T4BA 1A95A 3QBTA 1XNRB 1RYBA 1QYWA 5FF9A 1ODIA 3FW1A 2J9FA 1FUIA 3L5KA 2G9NA 1L7MA 3QG5A 2YY7A 3RS4A 1MLDA 1Q20A 3A4VA 3TZEA 3WP1B 2IU6A 3ZCUA 2UXBB 3D3EA 3FWHA 1F0PA 3K2IA 4OA5A 4B1FA 2UYYA 4OIFA 1RFLA 5KSWB 3ESDA 3ED1A 4PAGA 1ZC3A 4RDXA 1RXWA 4I9FA 1DRKA 3UCEA 1TCBA 3IAEA 1TYZA 4Y9SA 5JLAA 3KBOA 3TR6A 2VAXA 4QIHA 4F45A 5D84A 4TYMA 2MCFA 2HA6A 5I5EA 5KQPA 1ZRNA 3JYHA 5KJCA 1CUDA 2IIQA 3HU2A 4YN3A 1EM6A 1ZISA 1ZOLA 2ZOSA 3WGZA 1U8FO 4FT2A 5T4EA 1NC3A 2NW6A 4EJ2A 1F1BA 3N05A 3T7KA 2IIPA 4FONA 3W3AH 4WMLA 2OHIA 4LQLA 4GL4A 3IAM1 3OAAA 5LBUA 4CNBA 5BR4A 2ZB8A 3D6TB 3WSVA 4JP1A 3LY9A 5K2MA 2VK4A 2EL7A 3ILHA 5CR9A 3COYA 1DC6A 1W49A 3A2KA 4WKOA 1QRDA 1U81A 1W4ZA 2QD5A 3NOVA 3QNUA 3HVJA 4OQLA 4D6XA 1M8GA 1B23P 2VPPA 1FXWF 2N47A 3ND6A 1A1SA 4RD0A 4HMOA 4C88A 1EAYA 2VDWA 1RIIA 3EWAA 2FWBA 4ARZA 1MIHA 3L0DA 3ODGA 4QEZA 5TJ9A 3RWOA 4LXGA 1G0OA 3ZWQA 2YFYA 1IK4A 3ORYA 3VPAA 4RTRA 1Q0LA 1I5OA 1OASA 3AX6A 1PAUA 1MJGA 3MG9A 3VH4A 4X7RA 4F9TA 3VSEA 3HM9A 1A4RA 1SFRA 4HF7A 3GBVA 1MOSA 1N0WA 2BBOA 2C5EA 3A6PC 1EFLA 4OO3A 1JAHA 4CNQA 2E5LB 2QSYA 3GJRA 1SQFA 3F46A 1N9GA 2WTEA 1F8GA 3TNLA 1IVYA 3NVMB 5KNDH 1KJ8A 2O3TA 2WYWA 2O2SA 4IJ5A 1HDXA 3KSUA 2XMGA 3TLCA 2FFRA 1GKLA 2R1ZA 3LUGA 1ODKA 5K8LA 1GPLA 1Q2UA 2HN9A 4HH4A 4EPTA 4IJKA 5B3KA 2QUBA 3VISA 2OP0A 3R7AA 5AKEA 4TTSA 2QMQA 4ID3A 2I2DA 1B0UA 1QDEA 2HBQA 2X9GA 3GPDG 4TTPA 3FYTA 4Z0TA 5L3VA 5A2GA 1Y8ZA 1RRGA 2C9YA 2V54A 4QPZA 1KOFA 3SGLA 1C9EA 5KZMB 2Y1GA 3U40A 3IPYA 5DM0A 1ECGA 2RKBA 3AR9A 4C3OB 5BMVF 1OJ7A 1D3AA 3QEMA 3DV2A 4UOZA 1C3OB 5FLXA 4FJ0A 1HLGA 4MP6A 4BWGA 1NDHA 1AUOA 4N7JA 4CI9A 3ZVKA 4ZAGA 1VHTA 4U8HA 2NUPA 2Y93A 1V8DA 4BMPB 3WLEA 1B1CA 1ZD8A 1NI4B 1S3FA 3A4TA 4II7A 1KQ3A 3TIFA 1CHNA 3JQ9A 2AG6A 3KJIA 3PSHA 2ZKLA 1OAOC 3NNNA 3B9PA 4YMGA 5CA1B 3QU7A 4JGBA 2PT6A 1F6BA 4Z4GA 5F64A 3LK6A 1E6EA 1LPMA 2AQIA 2GVNA 4GZ6A 4ZU6X 3WHLA 4CTMA 5BWMA 2Q5EA 5CW2A 1Q7EA 3L0YA 1YZLA 1ZMOA 3G9TA 4QUGA 5ICMA 5BN4B 1A5BB 3TI7A 5IAGA 3ZE6A 4A2QA 1HOXA 5TS3A 1OI2A 3EOZA 3RHFA 2HO4A 1UFVA 1JEYB 2R6FA 5I7AA 1OX4A 3AL3A 2PGJA 3HBLA 1NMSA 3QWIA 1O4VA 1SPBS 2X4GA 2EJTA 1ITZA 3N6XA 3PX2A 3QVJA 4QOFA 2LUOA 1W73A 3N75A 4UTXA 2ORVA 1JIVA 3NEPX 1EU1A 2FPSA 2HHJA 2O8NA 2CVQA 4RLFA 3HDHA 4RV5A 1Y89A 1LU9A 2QAIA 1Z08A 2VZEA 4Q3BA 5AM4A 4ZHQF 5T7BA 2ZRPA 3SHVA 3AETB 4NSNA 3LK7A 1OD6A 1AU9A 2G28A 4R2JA 3RGWS 4OBEA 3B53X 5ITZB 2FDRA 3NHPA 4TSFD 1L4BA 1V8BA 2AT1A 1Z2OX 2BONA 3NXKA 1ZD9A 3HLYA 4GECA 3B3QA 3RFTA 4CIVA 1R5NA 4RQTA 4YJFB 4JL8A 1ZKDA 5H3HA 2EFGA 3HKDB 1Y3DE 5BWNA 2DQ4A 4QU9A 5GM1A 4PINA 5D5PA 1QXSA 1V4BA 1SVMA 2LW7A 1BS2A 1M74A 2Y77A 3DQZA 2JEYA 3OX4A 1LRJA 2FPWA 4M89A 3X1MA 5DT2A 1RD4A 4PRZA 4BTLA 2ECOA 3GG9A 4Y98A 1I3NA 3OE4A 4JHLA 3VNAA 3DTVA 1QOZA 1XD2B 5FPHA 2OT3B 5H5JA 4AMBA 3QH4A 3UH1A 2H1VA 1RQ7A 3DPSA 2Z56A 3F3YA 4QJIA 3TFOA 1WTAA 5F5XA 2I76A 1WBDA 1CUVA 3GV0A 4H7DA 1C1XB 1GADO 3AI3A 1XSEA 3A1TA 4GPD1 5GGYA 1DDGA 2I62A 3H9UA 4B47A 2GBFA 4QQFA 5JZMA 2RBKA 1YI1A 1DKRA 5K3SA 1QR6A 4L75A 3A0RB 1RAFA 5E4FA 1G2OA 2MINB 2UDPA 3P2OA 4FNGA 1ORTA 3EUAA 4I9UA 5E1MA 3ROFA 5FR1A 4C0LA 2YXDA 1UC4B 3MUEA 4NJEA 3BMCB 3MTQA 3VA7A 5EJ8A 2OPHA 4MQEB 1W96A 3KK0A 4OXQA 1UEIA 2H2IA 1VMAA 4OKNA 4DJAA 1BE0A 1CT9A 2FN8A 4OQEA 4X8MA 4PCAA 3ASZA 1KZ6A 1D6NA 1U7TA 2ARKA 2XWSA 5IXSA 1IOWA 1DGQA 2C4VA 5IK2A 1V9SA 3MM4A 1XTTA 2TSYB 4YK7A 4YP5A 1TM4E 5DP2A 4TVKA 5EP3A 3UAXA 3WK4A 1OXUA 3IPCA 3OWHA 3PA8A 5DRYA 4BLRA 4E2WA 3I4FA 1GOTA 4EB6B 1QCZA 3NW9A 3U17A 1HNZB 2IXAA 1RZUA 5IAAA 1LI7A 4S0XA 4KNWA 1Z2NX 5K8UA 3DW1X 3QZUA 2O1XA 4GOKA 1RBMA 3K9HA 4FOPA 4JT4A 4MAFA 1FSZA 3UWPA 2H52A 1K7XB 3PQ3A 1UBJS 1NATA 2WHPB 3WGMA 4E6PA 1I94B 1JHDA 2QRVB 5FFNA 3GHHA 4QBFA 4XYBA 2B61A 5BNFA 2HEIA 3L5OA 4Z4FA 4ZZ1A 1ZGCA 5EINA 1GL7A 4HPXB 1G3MA 3WVNA 2A9RA 2X3UA 4IIJA 3KQKA 3AC0A 3THWA 2HQRA 2EJBA 4MAMA 5CBKA 3DGFC 1X7DA 1OGYA 5IU6A 2XUFA 1CJTC 3VU9A 1ZGBA 2QYTA 3IAS1 4QATA 1IXYA 5ALWA 3PC8C 1W4BA 1SXIA 2WWRA 2CVFA 4I5EA 3ZNOA 5H3CA 1AGPA 4FDLA 2R8RA 4V0LA 1VPDA 5HILA 2GN2A 3SMQA 4CMIA 4XM1A 1ZFNA 5ER9A 1IEQA 1XTSA 3HCCA 4OHMA 4XLTA 5IKXA 1NF8A 2HQOA 1SHKA 4PQGA 1JAIA 1SCKA 3CCFA 2PUGA 4PX2A 1C2TA 1W5TA 3C8UA 1SXJB 1GXSA 2QN7A 5DTIA 1O87A 1H2YA 1SCUB 1AXEA 3ROTA 1PNRA 1LQ2A 2Q4BA 4HAXA 3JRXA 4HNAB 3QXXA 2DWPA 4JI7B 4IQ8A 5FCDA 2ZBFA 2P2GA 1W0KD 3I0ZA 3MZ0A 2YWHA 3C3WA 1JQ5A 3MOIA 1DT3A 2GFHA 3BMOA 3K72B 3OX2A 4JIGA 1BS9A 2FCAA 1G6Q1 1PNOA 2JJ1D 4YQZA 1ML4A 3TZ6A 4YRGA 1YDEA 5JBQA 3UGTA 1E6WA 1GFSA 3EDMA 4KJZA 4KQ2A 3B1WA 1H0SA 4IZHA 1EE9A 2R1UA 3DO8A 4KQKA 4RABA 4JKOA 2ZJ6A 2GAIA 3VNBA 4C01A 1SELA 1R4AA 1LLCA 1CY0A 3JY6A 5DU2A 3WZLA 2G71A 3O2JA 4Q39A 4B4UA 1JG7A 2C5LA 2X0JA 4O2AF 1ISPA 2HB6A 2WD9A 2C88A 3A25A 3NVAA 4FHEA 5TEVA 4EY6A 3ZNPA 1Q77A 2X4DA 5J4VA 5K99A 1LFDB 3RJTA 5C8VA 1Z0UA 1YI8A 2FYTA 4KPEC 4Z9BA 3NANA 3Q8MA 1UWKA 1ZMRA 2X4LA 2GO7A 2R4QA 3G49A 4LY3A 2XHZA 1X87A 4PHFA 5AW2A 4XLZA 5JNWA 4LJKA 4QUDA 1CZKA 1IATA 2C9ZA 1N5JA 2O4UX 4F6CA 2FKNA 2B1RA 1V1MB 1UQRA 2WICA 4Z1MA 4Z8YA 3II6X 5DGXA 4KYIB 4LXHA 4A2PA 3TXAA 4B45A 3EGOA 4EY7A 1VPVA 2JDIA 3PTAA 1ZSNA 3C39A 4GE0A 4YDRA 1TFUA 3WJ1A 2DBQA 3KEGA 1ZPDA 5F2KA 5AVUA 2OAP1 2HQ1A 2G1JA 4PZYA 4M54A 3ASVA 2D0DA 4LJAA 4N4AA 3SX2A 1QRTA 5JRDS 4W7HA 3NT4A 3U1BA 1T0JB 2COKA 1N7JA 3NP9A 4HMQA 1ID8A 3TGLA 1GYPA 2REQB 1CETA 1VYUA 5IT9A 1MRSA 1SOMA 2MR6A 3MOSA 4G37A 2P7IA 1Y0BA 3WIDA 1KERA 1XZDA 2XMBA 2ZLBA 3DHWC 1Q7CA 3JQDA 1YIAA 2BMWA 2RHBA 4AS2A 1UBLS 3CR8A 2OAGA 1B74A 1O5TA 3OHSX 4J94A 4GP7A 5ALOA 5K4GA 1H3NA 4KH1A 3H2KA 1IM8A 3QF7A 2WFLB 4YO7A 3MAAC 2Y3IA 3B6JA 1N8TA 2WSIA 3MVEA 4RX1A 1JGTA 1KA9H 3PKZA 4U39A 1WVGA 4GMKA 5T41A 5UKDA 1FTYA 3P32A 3QBJA 1UMKA 3COSA 1I1NA 4QJBA 5JNRA 1KQGA 1CY8A 3DW3X 3G2MA 5H9VA 2NVBA 2R6HA 1K4YA 2GF0A 2MWMA 2PS0A 3DD1A 3WSWA 1R66A 2JFFA 3I8XA 4KXNA 1T5IA 4J03A 4UVGA 1XD8A 2V9CA 5AK5A 1XP8A 2ZITA 1MB2A 4R9SA 3T7AA 2KWIA 3RSSA 3ICEA 4AKSA 1C0EA 3JQPA 1BDJA 1MB0A 3PG5A 2ZAYA 4JI6B 4BKOA 2YV4A 4BNWA 1USUA 5JXIA 3UJ7A 1IDN1 2XCUA 1MO3A 2EDCA 3THYB 1CK4A 3FF4A 4XYGA 5L7TA 3EIXA 3I62A 4UM5A 4KRYA 1F12A 1WB6A 4LC0A 1V11A 2WYIA 1ISFA 3ICOA 3E18A 3QVGA 1NAHA 2FSUA 4PS1A 5FOSA 5CEJA 2HU7A 2EDAA 1BX3A 2D2FA 1GD1O 3DSRA 1KEUA 5EMMA 1TXGA 3LCUA 4WFJA 4CCAA 1ESEA 4QNRA 4ARAA 5FBVB 4XTCS 1XU7A 1O94C 4F0JA 1HTBA 3HY4A 3ANLA 3WQBA 5BY2A 4BBAA 2IZZA 4YGXB 1S7CA 3PDIB 3MJCA 1GNRA 5ER6A 4YDQA 4J91A 1RAGA 1E2BA 3PJFA 4DUGA 2JPDA 4C04A 2VXYA 3SHQA 1E3EA 5HIJA 1U2GA 3JATA 1EFVB 1USKA 4Z3KA 5DOZA 2CL7X 1QORA 4P82A 2VWQA 1VIDA 2DCMA 3G5TA 4MI3A 1GRNA 2CKDA 1GTL1 3R9IA 5C7OO 3OZCA 5KDOA 3U31A 1L5MA 5E3JA 1R8SA 2FE1A 3O8QB 4X3CA 2P6RA 4J0EA 2QT9A 1EGAA 3HN2A 1S2MA 1SXJC 2A30A 3COVA 4FQ8A 2JKVA 3V8QA 3X1YA 1DKUA 2OKCA 1WABA 3KOYA 3RF7A 3OJCA 4HGYA 4PYJA 3I3SR 4I4IA 4WGGA 1QU3A 2J6IA 2ZJ7A 1GUYA 3KV3O 4MQFB 3WLSA 8ATCA 3UUGA 2QRLA 1PL0A 2NO9A 4X44A 1KFKB 2X8AA 3L0ZA 3TVTA 5JBNA 2GN9A 1N33B 3G82C 1U94A 2ZRBA 3AFMA 1W59A 3D7SA 3DLIA 3NX4A 5DF1A 2ZSIA 1TI7A 3ETLA 4IUDS 3TBHA 4DCTA 1CIVA 1NXPA 1VGRA 2JGDB 2YICA 3DOCA 3G0IA 4MZDA 5EUQB 4EHHA 2MYTA 1GGEA 3A8TA 3Q7QA 1CJMA 3A6ZA 3I6QA 3L6EA 4F97A 5AVVA 2C84A 4B4DA 2VDRB 5LU9A 4EOGA 2OPBA 1EUDA 1YJBA 1JILA 5D6NA 3D4BA 5CJ2A 2BT4A 1LFAA 1XQ1A 3T5DA 1R6UA 2JVKA 2YYAA 1ESDA 2GEDA 3CZAA 1GHTA 3QUCA 4HDSA 3FNFA 4WKBA 5ALSA 3ZWVA 5K0CA 1U11A 1II0A 2ZT5A 3IT3A 2D74A 3C6KA 3PPVA 4HH0A 2E6KA 3OQIB 5B3AA 2I7TA 4F3CA 3MEQA 2CEKA 1UBUS 3RUDA 421PA 2OD2A 3FNGA 1BEZA 4RBNA 1T36A 2FVYA 5JXHA 3IEXA 3GCDA 1JN0A 3G68A 4PZPA 4BRSA 5JNSA 1TVMA 5EIXA 5GJVC 4FU0A 5KNBA 5I7WA 3JV7A 2JLRA 4P6VF 4BJ5A 5IDQA 1NRWA 4ER6A 3FIJA 2JAXA 2HLDA 3ITKA 4TN5A 4BO7A 3OIDA 1M1NB 1AA9A 1O0BA 2O7QA 2AWNA 3LXRA 3MJVA 4GL2A 4M0KA 4XQ0A 4DPLA 2FQYA 1GQ2A 1KSHA 2XUAA 3FTDA 1O96A 4JBGA 1J0EA 5EUCA 3UJ8A 3ND8A 2IUTA 5C1PA 3U60B 2QBYB 3LU1A 3IKJA 4YAEA 2HU2A 2O7NA 5B1YA 4R7ZA 2BPOA 5A6SA 1CCWA 2LVBA 2W22A 5F52A 4D57A 1XROA 3L7LA 4FZJA 1R9GA 4R1TA 3FA2A 2WZBA 4M3NA 4P35A 5A9TA 4M7PA 4QARA 5HCUA 2JEZA 2PAAA 2L82A 1N36B 1T0HB 3QXCA 4QE3A 2OLJA 2WTBA 1UOOA 4R3NA 2IOFK 4U7HA 1BKDR 5ALMA 1K89A 2H5EA 2IGBA 1UODA 1LNQA 2PJUA 2AWOA 2VF4X 2ODNA 3QPUA 4LE0A 4Q66C 4RVDA 4DIDA 1GPYA 3A9WA 4P3OA 2CJWB 3RIMA 3T94A 1RRVA 2MSLA 5EXSA 2Y99A 4N3BA 4D9JA 1MAAA 5FJJA 3IXMA 4EW3A 1XU9A 3KT8A 1N2ZA 5C52B 1XPRA 3JTEA 3V9AA 3BCRA 3GH1A 4MDYA 4AZVA 1REQB 3W6NA 3ZW7A 5FAKA 3HR8A 4E22A 1NUTA 1TF7A 2WD7A 3A1CA 4IJ6A 1KYZA 4GMDA 5E1OA 3MTGA 4ZK6A 3HXQA 4DABA 2UU9B 3CGGA 1I4DD 1IH8A 4KOAA 4JQZA 2R6GA 4R41A 3EAQA 3RVBA 3I72A 1WMAA 2VDPB 3DCIA 3FPEA 4FFRA 5ADHA 4JYAB 3E7PA 4EJSA 3W06A 1K75A 4HRXA 1TJ3A 3IT1A 4JUIA 1KHHA 4ICIA 3Q87B 4DM4A 5CB6A 2XE4A 1YSCA 4CLOA 1JJAA 4REMA 1SVKA 4G85A 4UUOA 5I9BA 1T8RA 4F7WA 1NDQA 1W4RA 2X3YA 5EJMA 4H1WA 3PFGA 4H1TA 3HACA 1GXSB 2BGRA 1WOMA 3I83A 4EO7A 3SF0A 3PGA1 3B36A 3LQ1A 2I66A 3WLFA 1XPJA 3VMMA 1W1WA 3QMMA 2I4NA 1COWD 2AOUB 2BUCA 2VF2A 1U7HA 1XKXA 4QC2A 4QYTA 3D6NB 1YRWA 3O7MA 4W1SA 3I9LA 2A9JA 2O3RA 4URFA 5EIEA 5K8TA 2H54A 1UMDB 3CSSA 3TX6A 4E5KA 2XNHA 3WAKA 3AHGA 4WACA 4EEZA 1EVEA 1XL1A 4W9NC 1VCIA 2OV3A 2QAGC 2D62A 4O25A 3HFRA 1VSQA 3SLRA 1NQXA 2FWPA 2WYOA 3QKRA 2DEUA 1RBZA 5DGHA 2X9NA 3F6YA 3NHYA 3VDRA 2OG2A 1FUYB 4LY0A 4A8JA 4DE5A 5JDCA 1A9TA 3NB0A 4KWCA 2ENUA 2C99A 2E5FA 4IQ4A 5K0NA 4NJMA 1DCMA 3H13A 1NYLA 2VYVD 1YK1A 4MKRA 1CUAA 2VWPA 4AY2A 2I99A 3C3AA 3N6VA 3W5HA 1C41A 1E4YA 3DMTC 3L77A 4P4TA 4MVYA 4WZBE 4RA9A 5FUMA 1WE2A 3GGJA 4IDDA 3KZVA 4IXTA 2VT3A 1JQEA 4B7XA 2O05A 1WUHS 1B4DA 5FWXB 1FFSA 4J4TA 3PNBA 4RL6A 4TKMA 4AD8A 4KN8A 5HF5A 2BKXA 5A3SA 3RU7A 4B6RA 3DEHA 4CU5A 3OCWA 2DSNA 1GU1A 1FFAA 4EL0A 3GRKA 2BRUC 2VBCA 1FFGA 3Q5DA 4D3DA 3W5VA 1EUQA 1EA5A 1Z6YA 3PIRA 3RYIB 2FLKA 4O5AA 1IBKB 3JQAD 3FUCA 1OU4A 1Y1PA 1OBHA 1V1RA 1GKKA 2I6UA 2XR1A 3BE6A 3CPJB 3FJ1A 3N39C 3OX1A 4S1PA 3V7YA 2Q5HA 4XQGA 5EERA 4OXYA 2OENG 4OP2A 1D1TA 1G19A 1WW2A 4WVFA 3RS2A 2HF2A 2XBLA 3GDHA 4C4RA 5C8YF 4RJ2A 4Y30A 3O75A 1FW6A 2B5WA 3FTPA 4BN0A 3ILSA 3F5QA 4HGOA 3I5AA 1YB2A 2M6KA 1M7BA 3T1NA 5GVSA 2QGFA 2ZRKA 3DZKA 5TVKA 4TKVA 2CCGA 1Y5NA 3TF5A 1C9KA 3IA2A 2KSQA 1W44A 3AKCA 4RW0A 3ZCVA 1L3IA 1NUUA 4OFWA 1EHYA 4BAZA 4GEGA 2QZ4A 3EXHA 4GD3Q 4IWXA 3RUIA 4OHUA 5BV7A 4A92A 1JI0A 1WDWB 3FDXA 2IH4A 4K9OA 3W1EA 2C7RA 1IN5A 1QLHA 2RD2A 1PZNA 3EQZA 2GMWA 3GNTA 4V0QA 4QRIA 4YV7A 2H6EA 4D8YA 2Z1DA 2JLYA 3F6RA 3UPUA 1KZ1A 4Q1DA 1DUVG 1P45A 3O1JC 4KQEA 3EWNA 4I6GA 2JAOA 3ABOB 5G0WA 1TJYA 3F1KA 3TSAA 4DB4A 2KB0A 5I47A 5FYDA 3GMIA 2DLCX 2BUAA 3D4PA 4NV0A 3WC4A 1X1DA 5HR5A 1AX9A 1N6OA 1PUXA 3U3RA 1X39A 1XWFA 4C3ZA 4ENUA 4MPDA 1H4VB 4ZYTA 2CUZA 4W5JA 4XPIB 4BVAA 2HGZA 1J06A 1MXFA 1NIPA 4Q3AA 1E2UA 3SF8B 4QXRA 3NOXA 1V3QE 3AM4A 4MVJA 2BEUB 1M2WA 2P11A 5DI3B 4GSLA 2CXTA 4GMGA 3NVKI 4RZQA 2ZEJA 3CPSA 3JAKB 3L7NA 2GB4A 3OMLA 4P38A 3UM9A 3C3CA 3GUVA 2F3SA 4TN1A 2O8VA 4L16A 4WXMA 2IU3A 4DM7A 2VJOA 2ZXUA 3IKLA 2P6UA 4ZYVA 2VH2A 4EJMA 5J4HA 5EJEA 5B6IA 2HIMA 3D54D 3VUEA 1L2TA 3GJYA 2AG1A 1GTZA 1T8WA 1U9ZA 4JSTA 2HWKA 3V1YA 2NQ8A 2WB4A 4BN5A 2HRQA 3P9XA 3O2QB 2K6GA 2AF3C 4WN9A 1HEIA 2GBIA 3N5KA 4HDNA 1WNTA 2ODPA 3M9LA 4WN3A 2IY7A 3RIYA 2XNKA 4FQ5A 2DAPA 4G24A 4WZAB 2ZCJA 3F97A 2RG7A 4WKNA 4LAFA 2H4YA 2ZB7A 4UVDA 5JXWA 1CUWA 3G8BA 2O8DB 2AMLA 2C54A 3MRTA 5AIBA 3T3NA 1EFHA 2I7DA 2HPZA 1J7JA 3IVXA 1D0VA 5EG5A 3FCXA 1DX9A 5JC8A 4PSDA 1E2QA 1MF7A 1R0ZA 1F3OA 2O0JA 2OB2A 2OE2A 2QLNA 5ALRA 4K9QA 5ALIA 3UC9A 1SB9A 3OY2A 1XXHB 1T0UA 4MWSA 3QVLA 4UDYX 3ZJ4A 4BNNA 5CYOA 4I4LA 4MRAA 4N0EA 4LC9A 4NTZA 1OI3A 4BQEA 3PVZA 1OLOA 3LUAA 3WRYC 1DEAA 1D1PA 4LCBA 5HJEA 4PLHA 4RS3A 1QHGA 1FNMA 2ID4A 3R5XA 1Z28A 1GNSA 4H16A 4IZOA 4JEHA 1T5TA 2EQ5A 3NU1A 4HAOA 3BX1A 4L4RA 1N9GB 1M2OA 3ZN2A 2JI6A 3AHFA 1DMSA 2OOSA 4DANA 4UULA 4LSWA 4XD2A 1JUDA 1NLUA 3L7BA 3BTOA 1BXGA 1SHTX 4IIEA 2PUFA 1EGVB 5ALKA 3SR4A 2ZQ5A 1QE0A 4C7KA 1THMA 1WEHA 4LHVA 1DKLA 2WZQA 1TU3A 1I2CA 4KRXA 4X45A 4IRMA 3ZOZA 3UOGA 4Y0VA 2JJQA 3C1TA 4ACAA 4MICA 4XOIA 5JEDA 1Z6ZA 4EJFA 1N32B 4BCDA 1U9IC 5K09A 4XFJA 5CNJA 2I6SA 3KT0A 5CU7A 1I0LA 1ODLA 1U2DC 3I1FA 4JGIA 4LWOA 3RFCA 4CVNA 4ZDIA 2Z4TA 2GZRA 1SURA 2C5BA 1JR2A 2RONA 5CMLA 2WDZA 4MQEA 4MS3B 3CUSA 2ZS7A 1G5PA 3M1LA 4C4AA 3FI0A 4DG5A 1T8PA 3DEAA 3E7WA 4EWLA 5TY0A 1WSWA 3Q3CA 5HZKA 2OORC 2AIRA 2ON6A 2WMNB 5DCWA 4PYIA 3S4YA 2WFMA 3PFHA 1B6SA 2HJ9A 4UAGA 4EB0A 3A9CA 3LRXA 4GWGA 1GDDA 1RU3A 3ND9A 3UG7A 3UWMA 1IN6A 4COKA 4H7JA 3AVXA 1TJNA 2CJYA 1V26A 1OH8A 2GBCA 3BC1A 3O8LA 5EMHA 1Z47A 4BX3A 5ELLA 3DAPA 1NM5A 4UCXA 2HPHA 3RTCA 1U28A 1FP4B 3CRRA 4GM4A 4QBTA 5E7JA 1RIFA 4MVWA 4DQLA 3O31A 4YFYA 3QOXA 3Q8XB 2FETA 4FR0A 2XGGA 4RZSA 1RWXA 4EG1A 1P7WA 2WA1A 2QD3A 4HUTA 2XCRB 4NCBA 3O38A 2QUZA 4RMGA 1L7AA 1H2WA 3VHQA 3QTTA 2X40A 1L0BA 3L0OA 1PS9A 5FT9A 4B84A 1Z4IA 2G1KA 2NUTA 2R87A 4LXIA 5CA0B 1VE5A 3CBQA 3LPAA 3UQZA 3OH8A 2I4TA 2ECKA 3AHCA 3LYAA 4S1WA 4ADSG 3S1AA 5FADA 4O4JB 3DBVO 5ESXA 1V8PA 3E0QA 2F7SA 3VZPA 4F85A 3V4RA 3OECA 5DI9A 1TRHA 5HQTA 1C29B 1WKBA 4YCLA 3GROA 1ZH8A 3IP9A 1P1BA 5ISMA 1BKYA 1BN6A 1SCQA 4OQXA 4PQFA 1D4OA 5AK6A 1T2EA 1Z4MA 5GM2A 3EGEA 5BSVA 5FX2A 1JHXA 2F4NA 1TDJA 2FWIA 1FLDA 2GRJA 2I4OA 3ISJA 3F3SA 3IUSA 4R01A 3ZWPA 5FOTA 4BIIA 1FS4A 1MRZA 1YU9A 3K1AB 4DJ5X 2KI5A 4AKTA 4LOIA 1DO0A 2Q2QA 3E53A 2JLVA 1GTSA 2CHUA 3DLCA 2Y1EA 1ZM9A 1WUKS 4KLNA 3B9QA 3U0VA 4P5EA 3T5PA 2YZ2A 4U9HS 4MVJF 5EUMA 1QQBA 4FBGA 1KI6A 3BH0A 4OQYA 3CPEA 3D7NA 4KX5A 3R9XB 2IC5A 3LX5A 1OA1A 1Q0UA 1IBRA 2XZOA 2N0SA 1BEUB 2OV2A 3H3FA 4NF2A 1WZNA 3RKRA 3FZEA 4G0ZA 4LHYA 3WLOA 1RMQA 5DN6D 4GX0A 4M38A 3VTAA 4XVQA 2V9ZA 3G17A 4QOEA 1X77A 4ALJA 3S8YA 1OSNA 2V7PA 5BR8B 3V1MA 2YZ7A 3K96A 3TQRA 1P1JA 1MJ5A 4R98A 4DVGA 1B8VA 4NXMB 2R6AA 4XXHA 1JU9A 1XXHE 1ZGHA 4A2WA 3DEZA 3SBEA 1GNVA 3F90A 3HJTA 5ALPA 1ONOA 1U8UA 2ZTMA 3DBHB 3FGNA 3VPGA 3EF1A 5REQB 2I29A 1OB2A 3AYXB 5HK9A 2WTMA 3IALA 2J9GA 5KNDA 4PFJA 4B81A 2JARA 3EAFA 4REQA 2BELA 1MJGM 3HA5A 3WGUA 1W4LA 4QTUB 3SVZA 3GLVA 3QWAA 4J29A 2Q1UA 1OY1A 3UYLA 1G8PA 2JC3A 3DFUA 2ICAA 2G40A 3ELUA 4CQMA 4Z4QA 1SIWA 1NU8A 3TTVA 1QVVA 4QA9A 5I9TA 4FFVA 3H42B 2YUIA 1TZJA 4DCCA 4DC9A 1UPBA 4IGFA 2REQA 3BT7A 3OP1A 2ZP1A 1HG1A 2IQ5A 4ECAA 2YIJA 5EXTA 4C30A 4B4VA 3N2KB 5NULA 2QT1A 3CLVA 2C78A 5FBQB 3QFTA 1ZAYA 4E07A 4G0XA 6GPBA 2UUPA 4YT5A 3Q3GE 4YRRA 4G8CA 1K8XB 3V80A 4X6UA 4RE6A 3TQFA 1HPLA 4CUZA 1YZFA 3ZE2B 3EVFA 2AOXA 1VHWA 4Y1RB 5EAIA 5GWXA 2XGSA 2QS9A 1APBA 2W8ZA 4AL4A 4LZJA 2GBGA 5DWVA 4KUHA 3ZY3A 4DIMA 3L4JA 4YCAA 3BD9A 5EQFA 1EWQA 2C1ZA 2X1VA 5EGSA 2YN2A 3ZUPA 4GICA 4M1EA 3IH5A 4DQKA 4INJA 1EK0A 2I54A 1CJSA 1N25A 2LGJA 4BV8A 4CIAA 1V43A 1OJLA 2SKCA 1KIAA 2ZSHA 3F7MA 3NALA 1MB9A 4R05A 4UHBA 1FNCA 1WF3A 5AKXA 5M04A 3DKRA 2VRBA 2G8LA 1HLDA 1FVFA 2XQFA 3RAJA 1LZLA 1ETHA 3TQSA 1VIYA 2O1WA 1LBHA 2BZ0A 3H9EO 1E9VA 3PC2A 4UMVA 5J2TA 2ZYVX 4LBVA 1M0SA 2OCLA 1YCHA 5E6SA 3D6UA 3EZGA 3IJRA 2E85A 5HQ3B 3GP8A 3G59A 2GXQA 2ZI5A 2JVIA 4N0MA 3P9YA 4LFCB 3P9QA 2W6CX 3RW9A 5EKUA 3DVRX 3L6UA 4RV9A 1QS0A 1I10A 4MVJP 1KH2A 4GHWA 3EEOA 2EYUA 1JFFB 2Q2OA 5ECDA 3S8EA 2A5DA 2GPYA 4CDNA 4PNPA 5B3JA 3ZK8A 4M55A 4GR5A 1UJCA 1RXIA 3ADKA 4C0KA 4ZCIA 4KI7A 3JVDA 5G2OA 1K4KA 4QU5A 4YALA 1U3TA 3A1VA 4FKBA 2Z2JA 4MKFA 4QEKA 5E3HA 4Y2JA 1JTFA 2LNDA 1ZNYA 1BEEA 2W2TA 4QDJA 5A62A 6ABPA 4AQ7A 2JZNA 1G3IA 2FZLA 4QJ3A 3D6JA 2YFHA 1XJWA 1X0XA 1HL3A 3RU2A 3Q72A 2JJ2D 1LTQA 4R40A 2CYCA 4Q9JA 3DD5A 5E7QA 3LSYA 4B74A 1ZBDA 2FXIA 4NV3A 4P86A 4QEDA 4R84A 4S0ZA 2BHSA 4K86A 4UQOA 4E5YA 5F7JA 5JD4A 3ROQA 1X70A 1PX0A 3AJEA 1ARZA 1UK9A 1K7YA 1YVRA 1DJMA 5HM6A 2O8DA 4UREA 3SZRA 2QP9X 3OETA 4YH1A 4QDZA 3DDNA 1AS2A 1ZLYA 4F6LA 2C98A 3WLIA 1IPHA 5DTEA 1IWOA 1HNNA 2NXWA 4TLAA 5BN3B 1OFHA 3RSLA 4ON9A 1GRQA 2PN1A 1WCXA 3RVPA 5K8JB 1T2DA 4CYMA 1RRCA 3L4BA 3NUGA 3BWDD 4YJ3B 2WSLA 3D3NA 1JDUA 2GFQA 3JZDA 3N8DA 4NE9A 2QP3A 1E3DA 5EESA 1C1YA 1E69A 4Y9UA 5LXTF 4DPKA 4K6FA 3OOWA 2JASA 1T1IA 4QYMA 3HVRA 1VI2A 2YVAA 1XTJA 3SDBA 4EVQA 2BISA 2P2DA 1SXHA 2J3JA 3DWIA 4S24A 5C35A 5CNMA 1KYXA 4M49A 1BMDA 1I1OA 4RTQA 3EPKA 5CA0A 3AO0B 2RHMA 3BAFA 5TEWA 5K7SA 3OKCA 3VKWA 4M0MA 2Z0MA 3ZDZB 1C7EA 1KKUA 1VG1A 3GRPA 1OXSC 4NZYA 3Q4GA 1ZD2P 1AZLA 3CMCO 4WKCA 1C1HA 4AX4A 3CW9A 4GLFA 3GLQA 3AVTA 1RKBA 2FWRA 4HUQA 4KFRA 3L1VA 5DP1A 4GR9A 3IOCA 4K8OA 2FDCA 5CIYA 1AXGA 1QUFA 1QP0A 5E9JA 4X63A 3P0JA 4HX9A 2W5UA 1KEWA 4XIGS 1LJUA 2ZIUB 5CIWA 2Q29A 5KQGA 5FHQA 5TMDA 3R9KA 4AO7A 4C6SA 2QYSA 1YQEA 3HN6A 3I4CA 4NBUA 3TTSA 1XMXA 4D82A 2GASA 4M46A 4D1YA 3HCRA 4JCOA 5IDVA 3WAJA 2VCYA 2XDQA 2PRJA 4ZCTA 3ERCA 1HYGA 4AJJA 3AJDA 3E6AA 4BNLA 3VPCA 4EHNA 4UMEA 1Y3BE 1ST3A 4JOQA 4AKHA 5TS2A 3A6FA 3Q11A 2PXHA 4OXNA 2IIBA 3RSOA 1Z7GA 2Y0PA 3W8RA 4OREX 1R50A 1ZR2A 5K45A 2RK6A 1CX9B 3TE6A 1NZJA 1CQJA 3CUTA 4TMYA 3FMOB 1AC5A 3A3YA 1W36B 2B2CA 2PK3A 3MN1A 3HDYA 5FFFA 4YJHB 3KUXA 4A15A 1SXJE 4PPGA 4YAIA 3WJAA 1GGJA 2DFVA 3EOBI 4A03A 4B2PA 4PLPA 3PD1A 2C8VA 4R1UA 4E2XA 4PAMA 5F4ZA 4HQOA 2AC4A 1DX4A 1WCIB 3OPYI 2V03A 3NIWA 1T6BY 2RGNA 4OTZA 3T3OA 3V4OA 3RS0A 5JVDA 2FPKA 1GA4A 3D4IA 5IC4A 4RNDB 1JQDA 3F6EX 2WFAA 1WXXA 3H4IA 1HDEA 3PDWA 1OA0A 4HWGA 4A91A 1JQLB 5JO0A 5JVDB 4A0RA 2IL1A 1KI6B 1DKOA 3G7SA 1MQ8B 1SVOA 1Y7TA 5LP6C 3UK0A 2F67A 2RGXA 3JQ8A 4AO6A 4PWYA 1DBWA 1W94A 2EKQA 8OHMA 3IXQA 2FMXA 4QLOA 1EK5A 4PZEA 1VJGA 1BDMA 1ULZA 4AF6A 3P4YA 3ZTTA 1E3TA 1KY5A 1AQ6A 4N49A 1SCBA 1GM5A 4G26A 4R8LA 1PFYA 4HDOB 4BQPA 4BNZA 4O2LA 4DF3A 1UXIA 3IQXA 4K40A 3PNVA 1MA0A 5IVIA 2QRMA 4YC7A 4LMPA 1SKUA 4D80A 4MV7A 2XCSB 4OQ4A 1UZNA 4LOAA 5LLDA 5LLTA 3PU6A 5F9HA 2XDYA 4RHFA 1EAMA 1FX0A 2CC2A 1XTRA 4L5AA 1VCOA 5JALA 4H3VA 4Y1FA 1Y4UA 3MRSA 3T12A 2INGX 1XNQB 2PS3A 3RSHA 4QRHA 1A7AA 2AMYA 1UDRA 1IJKA 1PFKA 1SG0A 2VPXA 3LNCA 3LX8A 3GF4A 3MB8A 4M36A 1SCNE 2B4QA 2B78A 5B58T 4E32A 2FQWA 1SUDA 2VTKA 4G1MB 4BP8A 1BA2A 3QYPA 2QZ9A 2ETXA 1E2HA 3AEXA 3AOGA 2BMDA 1SVUA 2LRHA 3MXOA 2B3TA 3HCEA 5HUJA 4EYKA 4NENB 1T9AA 2I2AA 3MJEA 4GX1A 1TKCA 4OB6A 2PSJA 3M82A 4ZIRA 4Z4IA 1U0FA 3I92A 5IXJA 1J00A 4RZ2A 4ETMA 1T5SA 2R85A 2R8OA 3O74A 4RDCA 1L8XA 3FPBA 3ZGXA 2WWTA 4P31A 1TZBA 3OURA 2C2KA 2J0VA 3OF5A 2O2IA 4K6KA 2QSZA 3H4MA 1O6CA 3N87A 4QHTA 4CMEC 4NYIQ 1GZ4A 2ZRGA 3P9KA 4BMNA 5JISA 1ISHA 4DSZA 3HWX1 1Q19A 2PY6A 4IIYA 4FYYA 4F5DA 5HDQA 1JPJA 1N2OA 3M1IA 3VR4D 4J9VA 2BEVB 1Z13A 4TMTA 3NT2A 1MAWA 2WAMA 3SC3A 1VHQA 1NMEA 2AHRA 3OEED 5CFQA 2KJQA 3GR6A 3QY0A 2IYXA 2IZ6A 3ITDA 2DR0A 5LUAA 1YE3A 3TCNA 4JQYA 2GCPA 1ABFA 2O9JA 5IKMA 5HCNA 1KI4A 2OV6A 1EXMA 2IXFA 2XVXA 1YV9A 3ESZA 2VJMB 2PBRA 1H6DA 3ZX4A 3CA8A 1FNSA 2NTNA 2O8EA 2VUHB 1EP1B 3OWOA 3OQPA 1IHPA 4QUKA 4DDMA 4XIJA 3CNEA 1U2TA 1T5LA 2YVQA 5HRAA 1LBQA 4Z9YA 2BMFA 3AFOA 3CUWA 3L8CA 4HWKA 5ARCA 3SQXA 3ODPA 5FBWB 1UAGA 1JR3A 4WUVA 1UAAA 5KAPA 3TZBA 2O14A 4MMYB 3RYTC 3D1LA 4X9XA 5L6MB 4A23A 4Q7QA 3EYWA 4H1UA 1FEZA 3FUXA 4II3A 4MQ5A 4QPNA 3D6HA 4R31A 4YAKA 1PWYE 3KWMA 4Q18A 4ECEA 5FPKA 1V4VA 2I4LA 4B82A 1K5HA 1UMCB 1SZPA 4PX9A 1RQRA 3IUBA 4BVGA 3Q15C 4A26A 5LZ8A 4HVLA 1CY7A 4UEJA 1YBAA 1C30B 3GA5A 5C8ZA 1AK1A 3N2GB 3VHLB 4PSAA 2WZDA 1UBKS 4JYCA 5DHUA 2OZLA 4DYHA 3AKEA 2PX4A 2DUMA 1J8YF 1AG9A 2NSDA 3N70A 1L8AA 3ZDYB 1IMOA 2CL6X 3M33A 4ALLA 1U2RA 4O2BB 5HX7A 4L72A 5CP8A 4BB9A 1VXRA 4QHSA 4D7AA 4JLKA 3F7OA 1ZA2A 5ITWA 1NOKA 2H59A 4OJYA 3WL4A 1JWBB 2ADFA 2EVWX 4YRFA 4PO8A 5ICCA 1V35A 1W5EA 3LCVB 3LQ2A 4RVHA 1HK7A 1J8DA 2XUJA 1DAEA 1EWYA 2HIAA 2IYWA 2V5AA 4HN4B 3V8NA 4L9RA 4D02A 1UDAA 4GC9A 2BBSA 2X7XA 3CM0A 3E5RA 3EIWA 4RACA 5EMKA 4L7VA 3Q7TA 5BN3A 1YA8A 1VE7A 5CPFA 5KWVA 3ABQB 1UP4A 4MRNA 3DMRA 1D1SA 3OCUA 4I8DA 3HA7A 1TD9A 1XVIA 3QLJA 4M22A 3TZQA 4C9BA 5JQGA 5KYKA 1QZZA 2P4UA 3K05A 2XNDA 4B6QA 3F9IA 2CHFA 1JLRA 3AB7A 2EKZA 4JYPA 2WR8A 2I1QA 1XRMA 4R2IA 1ORRA 1LY1A 2PKCA 4CMHA 3CZ5A 3AEQB 4RY9A 4WXHA 4YREA 3VZSA 1DL5A 3RANA 4G25A 1YC5A 4INZA 2ZSAA 4J16C 4NICA 4MR8A 1NN3A 4OHVA 1SXQA 1ACJA 3CISA 1DT5A 5T67A 2AL7A 5LMZA 2R60A 3QEAZ 4KACA 5E0OA 5BPFA 4YPOA 4N41A 2FW1A 4EELA 1GZDA 3KVRA 3UANA 4J2HA 4OKIA 5FI0B 2AD5A 1DXQA 2WT4A 2D1QA 2AI1A 3M6AA 2GR9A 1QFXA 1F48A 3LS2A 3JATB 4FYKA 2YHIB 4HWSA 3I2YX 2D06A 3NIBA 1UJ5A 1JW9B 3FCEA 2B1GA 3FVTA 3OT1A 1X3SA 4LDZA 4OOFA 5BN4A 1P91A 4Y18A 2YWEA 3LHKA 3Q8LA 3EMDA 4HO1X 4YRMA 4UEQA 4LRTB 2YV2A 4JXZA 4C20A 1VRVA 4CT5A 4WGFA 1FTGA 2RHRA 3T35A 4AMZA 1US8B 2X58A 3NYRA 1ZMBA 2HA2A 4WN9B 4Y2PA 3U3OA 4A10A 4HHEA 4DZTA 2HZ7A 3AR8A 5CFMA 2VP6A 5KC9A 3RC3A 4JZYA 1BWQA 1H4QA 3E8XA 1Y7LA 1PK8A 3PUJA 1N7GA 2CN1A 4KB5A 1GJRA 2DBZA 2HSDA 3JARA 4FYPA 4MWCA 1DXHA 1PWHA 3UWOA 3TLJA 4FR5A 4QDUA 1ZQ1A 2JEOA 2NZUG 1P5ZB 3JZIA 4ND8A 5FBHA 1BJTA 2M9MA 1NI5A 3HI6A 3VKHA 5DN6A 4FYVA 5EKSA 4Q7LA 1IHXA 4EQ6B 1IN4A 2PJDA 3TLYA 3JQQA 2VBIA 1JLLA 2VAMA 5JDIC 4IG4A 3OFNA 1VIVA 2FNAA 2D5CA 3R4CA 4UU8A 3TOZA 3VVLA 2DR3A 4LVNA 3VYSB 2FMKA 1R6TA 3DE4X 3IRUA 1XWWA 3ITNA 4OJMX 4V24A 3U3DA 2VH1A 3OBBA 5LNK6 3M34A 1C3EA 1QHSA 5CM2Z 5AI9A 3VV2A 3B13B 1EDZA 4G56A 3NBMA 4FOOA 3R76A 4XVHA 4MUXA 4HAIA 5ALUA 3ZU5A 5I4BA 5J4YA 3L18A 5K0ZA 2J87A 1E1DA 4R8VA 2CW5A 5SY4A 4DAEA 3KCQA 1ZSVA 1WLSA 3MYRA 1BIFA 1D8TA 1QJCA 2XX3A 2YRWA 2H1WA 4AT1A 3N59A 1J0CA 1E1QA 3RT7A 3HB9A 3C4QA 5IT0A 3K8ZA 2PZEA 2HOQA 2QTTA 5TPWA 3BXFA 3ORRA 4X5OA 1F5SA 1VL5A 2J32A 3GJSA 4KE7A 5BW6B 3NORA 1CUHA 2FP4B 4KE8A 2DLNA 3GA0A 1B41A 3JW8A 1Y1LA 4B2IA 4LYGA 3V7NA 4TTQA 3E70C 5KIAA 1LSUA 2B5VA 2PRYA 3UEOA 4YMVA 1W46A 1ZA1A 2H18A 1NHWA 3QOWA 4KGZA 2BN4A 1NSTA 2P6PA 2VJBA 4EFNA 2EARA 4RH3A 2GAJA 5MHTA 4TQAA 2VXOA 4IHAA 2AW3A 2P5UA 3OZVA 2P65A 2F55A 1XQVA 4G1EB 3QHQA 5MN4A 1QH8B 1XMSA 5H3LA 4MSUA 5CDUA 3P0IA 3MBIA 2H92A 2J67A 1ZK1A 4R2MA 1SUPA 5DTJA 5AO9A 2V45A 1HEYA 2R8ZA 1TL7C 4P4SB 4POAA 5CVVA 3TW6A 4WSOA 4FUTA 2ASEA 1KE1A 4Q7KA 2I3DA 3TTTA 3C3YA 4XJTA 2GF2A 4TV8A 1P29A 2DWOA 2HT6A 4RKRA 5H16A 4RFLA 2FSVC 1X94A 4ZAFA 1X80B 2PUDA 2CF6A 4OL9A 3HRKA 5CX1B 2ISCA 3H9QA 3FLBA 2D59A 3C5HA 3JD1A 3OCZA 4FFBA 4DMLA 3JX9A 4RIIA 1EK2A 4WEOA 2HSJA 4X8HA 3TDMA 1WZ2A 3W90A 1TK9A 1Z6AA 3KE9A 4GR4A 1ZICA 3QI2A 4PAOA 1ZNZA 1QDLB 2PLNA 3TJZA 4GNKA 3U9SA 1KRWA 1FMLA 2NYAA 4D9EA 5T57A 3WAGA 3EHEA 1RYHA 4WCDA 4CIYA 1CUGA 4MJ7A 4H0NA 2D13A 1P7VA 1Y7HA 1EB9A 2F9FA 2YHBA 4YRTA 5EZSA 3KALA 4MW2A 4NE2A 1GSIA 1A9SA 2IOHA 3GFBA 2B25A 4QU8A 3MS7A 2QDKA 4MKIA 2QGZA 2DWCA 3TCKA 6PFKA 4CFYA 1S9DA 3A3KA 1Z7WA 1WY7A 3IBYA 2CD7A 1CV2A 3AQIA 3E9ZA 3RFUA 2FZ5A 2Z1MA 3CG0A 3F67A 3ROXA 1QC5A 2Z4RA 2DLDA 4HFMA 4LYJA 3NRCA 3PSAA 4Z7NB 4W9MC 1ZK2A 4YRJA 1Q3TA 2PM8A 4WFQA 1P9LA 4N48A 4M98A 4RK7A 1ND6A 4RWEA 3EZ2A 4EI8A 4IKPA 2DERA 2W6JA 2NUTB 4ZA2A 4Y9RA 5HBGA 2J4CA 4K9PA 5ESWA 3STHA 1YRQA 3EFBA 2NYVA 2BWJA 3GGPA 4WNAA 4DR4B 1OROA 2EKBA 1C1DA 3BZUA 4KXFB 4QG7A 4IO1A 1WHSA 2BHRA 2VRCA 4ABTA 2R86A 3WJ2A 1Z4NA 1NXOA 3RRMA 3KYDB 2HNAA 3F7TA 1ZLXA 3ZHRA 1NLMA 1KEVA 5GONF 4ROSA 4AWXA 2CZCA 4CM1A 4EHLA 2EP5A 3MYYA 5AUPB 4W5OA 4KQIA 4B17A 2NV0A 1IJEA 4RKQA 2P3QA 2L19A 4US1R 4PZZA 3IIMA 4PLVA 2VAPA 1FNBA 1JEJA 4KRGA 1PTKA 3V9PA 3K9GA 4JJZA 1DEXA 3IKTA 3NVDA 4MROA 3MTIA 4R3UC 4Q4AB 4B34A 2QVLA 1DDIA 4XPIA 1TB4A 3FDJA 3C8ZA 4WFIA 3PVSA 2PXAA 2R79A 4RYLA 2XVZA 3IP8A 1Q21A 3EPRA 1D9ZA 4HXGA 1Y4ZA 1A5AB 1H2AS 3C6MA 4K88A 4ZV7A 1XL0A 1WF6A 3HGTA 2VL7A 3ZEIA 2ZE7A 1BWSA 4FINA 4UBMA 4DV3B 1Z8DA 1PVVA 1TOAA 2P2NA 2P5YA 3BG5A 2X0EA 1ZESA 3M0EA 3O9MA 3ZDQA 4KWHA 1HDCA 3VR5A 4BC1A 3WMGA 3L06A 3LDUA 1GZ6A 1PUIA 4P4LA 1ZGZA 2Q0XA 3JCZA 2F2TA 2X4IA 2VF8A 4DSUA 5JANA 2Z8YM 1NVVR 4B3JA 1H85A 1MTZA 2JW5A 3L8DA 3NGMA 3RRFA 5DNYB 1WZEA 3F47A 2QE6A 1KEPA 3T1OA 1POXA 3ONNA 3PEUA 3UXMA 1IJBA 3S7TA 1KOGA 3LVRE 1S9HA 1E7RA 1G64A 3U61B 3BZWA 4HFNA 4DZZA 5KTNA 1YJCA 3GAMA 3O4IA 5CCBA 1QONA 3D3QA 4Y6GB 5TDHA 2EATA 4A1FA 4AP6A 3ZGLA 2XRZA 1RI2A 1PR5A 1Q1QA 1FB5A 2WF9A 3WWCA 2PT5A 4ZKDA 1JA1A 2FF5A 4KQ9A 3BMNB 2W2XA 1PGJA 2DQSA 1J56A 2R47A 1IONA 3AOEA 4JJEA 4ENPA 4BNXA 1DC4A 1N5RA 1FTNA 1TQHA 1J33A 4R8MA 5JPIA 2NP7A 2ODBA 3LOQA 3MTDA 2D4HA 5EVJA 2Z4SA 4JGGA 3MJ4A 3AG5A 4UAJA 1JJ7A 4QGSA 1BHJA 4S2UA 1EVIA 3SQLA 1FW8A 2P75A 2XXJA 4ZO4A 4FZRA 1Z2CA 3TD2A 3JSAA 1JG4A 2PLRA 4MH0R 1TKAA 1AH2A 1XOIA 4L5JA 3DXZA 1SPXA 2OO7A 2QRHA 3BIFA 5F12A 1J2YA 4W5WA 3UKOA 1E2GA 5BMOA 1C1DB 4EPWA 3GT4A 4WLUA 4D5GA 3UICA 5A5GA 1II9A 2GEJA 1SOWA 4II2A 3K6JA 4BASA 5GJBA 3A58B 1LPPA 4ENSA 5ILOA 1N6RA 3SQDA 1ISSA 2C2MA 1XQ6A 1Y9JA 1XRJA 2FTKE 3ER8A 2GN8A