5CW1A

Proteinase k complexed with 4-iodopyrazole
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Proteinase K
publication title Rapid experimental SAD phasing and hot spot identification with halogenated fragments
doi rcsb
source organism Engyodontium album
total genus 99
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2015-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 5cw1A00
1OYOA 1TECE 1SCJA 5FBZA 1ST3A 2XRMA 4HVLA 3DE1X 2W2OA 3LPDA 2SICE 1ZVJA 2Z2ZA 1NDUA 1P7WA 1AU9A 1C9NA 2SBTA 3VV3A 1Y3CE 3DVRX 3A3OA 4LVNA 2W2MA 1AV7A 5K7SA 3DVQX 3VYVA 1SBCA 2DUJA 1BH6A 1HT3A 2V8BA 5FAXA 1AVTA 1T1GA 1WMFA 4DZTA 4OMCA 3A3NA 3PTLA 1TM7E 3SQOA 5AVKA 4CG0A 1CNMA 1OT5A 4ZOQI 1R64A 1DUIA 3Q5GA 1SIUA 3DWEX 4KPGA 1EA7A 1PJ8A 5ARBA 2SECE 1SH7A 4AKTA 4WOCA 3T41A 4I0WB 4M1ZA 1TM1E 4K8RB 2X8JB 5JXIA 1VSBA 4C3UA 1GA6A 3SICE 1ST2A 2G4VA 1S2NA 1C9JA 2Z30A 2PQ2A 4ZARA 1GT91 2PMWB 1R6VA 1KDYA 3TECE 1Y9ZA 1SBTA 3WIUA 1SELA 4GI3A 3I34X 3H42B 2WUVA 2W2QA 1TM5E 4H6VA 2DQKA 1SCBA 3L1KA 3QTLA 4OMDA 2WWTA 4H6WA 3ZXYA 5JXHA 3F49S 3WHIA 3DE6X 1YJBA 1XF1A 1JEAA 4MZDA 3DE0X 3D43A 3D9QX 3GT3A 5B1EA 1P8JA 1MEEA 1S01A 1Y48E 3TI9A 3DDZX 3VTAA 2HD4A 3AJ8A 1TMGE 3DE3X 2W2PA 5JMOA 1WMEA 1WSDA 3LPCA 3DE7X 2QTWB 4YN3A 4CFYA 1EGQA 5AMXA 1NLUA 2ST1A 5FFNA 1DBIA 3EIFA 3GT4A 2E1PA 2P4EA 2B6NA 1Y33E 1SUBA 2IY9A 1IAVA 1GNVA 4BWGA 1TO2E 2ZWOA 3ZXXA 3EE6A 1KE1A 1SIBE 4KG7A 5JXJA 1AF4A 3PRKE 2Z2YA 1GA4A 5CW1A 2W2NA 1PTKA 1SUPA 3A3PA 2ZWPA 4DWWA 3LXUX 1SN7A 1BFKA 3DW1X 4Z2AA 1GA1A 2Z2XA 4AKSA 1WVMA 2X8JA 1PEKE 4B5LA 5I9SA 3I2YX 3DE4X 1AH2A 1LW6E 4NE7A 1CSEE 1TO1E 4NE9A 3BGOS 3CO0S 1NDQA 3DVSX 1SPBS 1BFUA 3I37X 3AFGA 5SICE 1SVNA 1IC6A 3F7MA 1UBNA 2PWBA 4NMXB 5ARDA 4HX2A 3TI7A 2WUWE 4DJ5X 3WIVA 4JP8A 5JXGA 1BE6A 4C3VA 3DE5X 3UNXA 1ZVKA 1THMA 2ZRQA 4WOBA 1AQNA 1GTJ1 3Q40A 2WV7A 4KB5A 1SIOA 2PYZA 2PWAA 5AQEA 2IXTA 1P7VA 1Y4AE 4J94A 3CNQS 3VV2A 2Z56A 3VSBA 5ARCA 1GTL1 1V5IA 1WMDA 1S02A 1T1IA 1TK2A 2XTJA 3P5BA 1YU6A 1SBNE 1Y3BE 5B1DA 2Z58A 1Q5PA 5AVJA 1BE8A 1Y3FE 1KDZA 4FONA 1Y1KE 3LPAA 3I30X 1SUDA 2TECE 1T1EA 1GCIA 4H6XA 1SBIA 1KE2A 4CFZA 1A2QA 3DW3X 1PFGA 1Y34E 1GNSA 1SCDA 1OYVA 2SNIE 1YJAA 3GCXA 1BJRE 1C9MA 2ID4A 1MPTA 2DP4E 2Z57A 3AJ9A 1KDVA 2PRKA 3EDYA 3QMPA 3WQBA 1SCNE 4LVOA 3DYBA 1Y3DE 1V6CA 1SUEA 3BX1A 2ID8A 1R0RE 1AK9A 2HPZA 1C3LA 4OV6B 1TM3E 1YJCA 1GTG1 3OSZA 1TM4E 3F7OA 3QFHA 2GKOA 1Y4DE 1SBHA 3DE2X 3HJRA 3VHQA 1SUAA 4RYDA 3GCWA 3BPSA 1SUCA 2PKCA 1SCAA
chains in the Genus database with same CATH superfamily
2QM7A 1U3VA 5A06A 5E6SB 5ALNA 3SQMA 3U6KA 4GM1A 4BB6A 1D4AA 4CKEA 1R5OA 2WZDA 3Q4GA 2CXPA 2CNWD 3I5UA 4BECA 3HKDA 3Q8LA 1D2RA 1SKYE 3A1EA 3B6MA 1MW8X 4UNSA 3DE1X 1CZRA 3DV0B 5JMWA 1NR1A 2VHUA 3FYUB 5A4IS 1UFRA 2NN3C 1R6UA 4HQOA 3GLHB 2M6LA 1FE8A 2RHGB 5HK9A 3WWEA 5EZYA 1BXZA 3CNBA 3KV3O 3QBTA 4ARSA 4Q4JB 2BFDA 1C80A 3UHJA 4BMCA 3SX2A 5A4JA 3VV3A 3RYHB 1LI5A 1ZOIA 3OM9A 4PRKA 4ZA2A 2EZTA 2BE9A 5CDFA 3Q8MA 5ALTA 3OOHA 1Q6ZA 1NKSA 2NUTA 2JGFA 2ARKA 4BC1A 1WXIA 1GFSA 2GZSA 4H7EA 2O8CA 1PL0A 1J06A 3E3OA 3H6KA 2M1ZA 1VKRA 1V8OA 4QT0A 4ER3A 2EKBA 1N1DA 1A9SA 1B74A 5D5PA 3TAXA 3D3NA 3INNA 4JT2A 5EWLB 5HM6A 2OKGA 1K6XA 2CT8A 5E4YA 2A3RA 3RQIA 1CF4A 4EM6A 2HQRA 4EJSB 3BF7A 4EHFA 1YS6A 3IEKA 4BNGA 3ZUGA 3GAMA 3SKXA 1EEXB 2VRCD 3FUCA 1ZSYA 4O4JA 1IXKA 2PT9A 1JQJC 4TLCA 1BGVA 2B4RO 2C84A 2YFQA 1P5FA 2VJBA 4HZIA 4OYYA 4HV4A 2P5TB 3WHKA 4ND8A 1X38A 3AF0A 2K87A 4YRFA 5IASA 5M34A 3W34A 5FOQA 1BVRA 2IYTA 5TPZD 4MKFA 2WMOB 4BBPA 4IXNA 2UUOA 3AEUB 3RC7A 1KU6A 3EBLA 1F2VA 4TT3D 1THTA 3T3EA 1N2ZA 4F71A 1RM0A 4NMWA 1F7VA 4ZOQI 1V1RB 5KYWB 4Q3AA 1YZYA 1YL7A 4MVJP 4NMHA 3L1IA 3OTWA 2PWPA 3RODA 1AKMA 1PF7E 4LBVA 5IUNC 1GSAA 1JXQA 2PZLA 4GZMA 1KGSA 4NFYA 2DPYA 4CEJA 3AVVA 3EVCA 1Z12A 3URKA 3V4LA 2XMBA 3JQDA 5A9TA 3O8CA 4WNAB 1QM5A 3BK1A 2HJVA 1VMDA 1MTOA 1YQGA 2ICAA 3NBYC 1CZUA 1UZMA 1UMCA 2RGNC 4HDKA 1V3QE 4DJAA 2ATVA 3MYRA 2BSAA 3GIDA 4O59O 5JAMA 1W49A 1I4LD 4JYCA 4D4JA 4QOJA 2GBLC 3AP3A 2IHVA 5BSVA 1N32B 3TBHA 4C4OA 2ZBGA 4YLYA 1TM1E 4URXR 3DAPA 5HIJA 1NI5A 3MGCA 1T24A 3VSCA 1I2CA 4DIKA 4ZU1X 4DWJA 4ZHQA 3L84A 5CXXA 1A9XB 3QOWA 4AS2A 3EUFA 4NFSA 1B41A 2PUBA 4F60A 1FRZA 2GWHA 5DB4A 2BISA 4N03A 4D4GA 2QYOA 4QUDA 1EM8B 2G09A 4NLLA 2XXAA 1GCGA 3IAXA 2ZAIA 5DYTA 3KTAA 4C20A 3ASYA 2P5YA 3PGLA 4FD3A 5AVTA 1PT9A 2E2WA 2VZEA 2R79A 2I3GA 3LKVA 1Y6FA 2QTVB 4YAKA 5FBQB 1R6BX 3C3KA 3ZHOA 3M1AA 3D1JA 4HGNA 4LJ7A 2ZUWA 3RIEA 1W36C 3BGWA 2B98A 2JCVA 2YJ4A 1NQVA 3LZDA 2PMWB 3F96A 3WAJA 4C2BA 1EU1A 4KPUA 1I2DA 4NV1A 4C3OB 1B8UA 1OXKB 1QYCA 8AT1A 4JBIA 1LSOA 3A11A 4DLNA 1N1GA 3N2GA 2ODWA 4ZMSA 3TQTA 5C2JB 3FR7A 2BEJA 3EJWA 1ZX1A 5CYPA 2II6A 2JGKA 4RWZA 4OHBA 1Z56C 3F71A 1DWOA 4HC4A 4MQFA 3C3PA 3SEFA 3U3XA 2KM1A 3QUQA 4YX9A 4P31A 2ZUFA 3IB3A 1N6NA 3BIXA 3TFQA 2F55A 7MHTA 1P2DA 5HXAA 4UFPA 4N82A 3LBIA 3LSTA 3ORRA 5LDHA 3U7FB 5JJLA 5BWOA 1ZLYA 4DYDA 3L1KA 5LSAA 3BZUA 5FUYA 4OMDA 2Q6OA 4XR4A 1KEVA 3X2EA 1CRZA 1P0FA 3PDHA 3PU6A 3ZR4B 1GU0A 2BJHA 3BGIA 4E6PA 5BN4A 1HQCA 4DXDA 3K32A 3FH0A 3SBXA 1LH0A 3WB0A 3F5QA 3OEWA 1BXGB 1W5FA 1XTZA 1LSUA 2VO1A 2LRHA 2RHTA 3TLGB 2R00A 3D6AA 4WZ6A 5LXTA 3GGJA 1KIFA 3PB3A 3NHSA 1EEHA 2ZUUA 4WDRA 4XCXA 3T94A 4A91A 3SYRA 2IYPA 5B1EA 1YDMA 2HK7A 4OXKA 2AZDA 3RAPR 4CKCA 2QRLA 5FA8A 2ZBFA 5T4EA 1NVVR 3LE8A 1DPFA 1YZKA 2VBCA 2H4XA 4JIGA 1FNNA 4K81B 3X1WA 3JQQA 2O8FA 1A72A 4PO8A 2Q0QA 2ZU6A 1DC3A 4I6JA 3HU1A 3GWZA 3H3XA 2ZDHA 4AMZA 3FVTA 2YZ7A 1UEJA 4KBYA 4Q01A 2AFIE 3QLUC 1JEQB 2IPAB 1UFQA 1C30B 1XN4A 1YU9A 4UU1A 1TTQB 1E66A 5DNVA 5AXCA 2WIFA 3GOQA 3UJHA 2HHHB 5HHTA 3W7BA 1OI4A 3BSYA 2HPVA 4P54A 4R1QA 3IV7A 4I9HA 4KFSA 1QG0A 1L4HA 1G8MA 1R5JA 4MPTA 1ENYA 2O57A 2W4IA 5A5FA 3UTDA 2HH9A 4AXXA 2H59A 3Q7TA 4MUKA 2VDUE 1VMIA 1GGFA 5WRFA 5EEHA 1EFDN 4IQ8A 1VP3A 3N05A 4PZEA 1Q17A 3HB5X 4YPOA 5TV2A 1A76A 3TL6A 3T06B 4LJ4A 3H2ZA 5B2ZA 1B7GO 2Y4NA 2X3UA 2P68A 2R2AA 3JQ7A 2WAOA 4D80A 2CL0X 1JL3A 1WUIS 4OJYA 1P9NA 2X8WA 4HQRA 2FJPA 4EUHA 1EP1B 3I6QA 5HZMA 2HJGA 1WL8A 3O8DA 2OCBA 4ESVA 4ZCMA 2P4EA 3BCHA 3RHZA 1XAGA 4NFHA 1NXQA 2AG6A 4A15A 4HN4B 3FHCB 3HBAA 3JQ6A 4M38A 4TUYA 5EPUA 3B6JA 3I9NA 5F64A 1HT1E 4B82A 2OM6A 4ZZIA 1H0HA 2IU6A 1GV1A 1NM5C 1XJCA 3GJRA 4HH4A 1KR2A 4ETIA 2F1JA 4XYLA 3CVXA 2VAWA 2ZCUA 3H5WA 5KWJA 1X7WB 1B8VA 2NUAB 1CK4A 2LTAA 2VP2A 2QG4A 2QNRA 4OQQA 1FFSA 1T5BA 3G7SA 4KWEA 3SIRA 3TLMA 2QIPA 3ENKA 4EMUA 2G1PA 4BPRA 2QR3A 4ER5A 4DBZA 1B1AA 4ZOEA 1FPMA 1XZIA 2PRZA 1ZO8A 4MAMA 4MQEB 5F98A 3IBFA 4H3VA 4GX0A 1VL8A 4Y9DA 4FGLA 3TIVA 4BX0A 4EB6B 2P1DA 2QTBA 1XTIA 1XZGA 2QL6A 2P69A 3MINA 2YWJA 4GQBA 4UHHA 2QYHA 1SUWA 4Q4HB 2QQ0A 3HWWA 3NYQA 1WOMA 2ZWPA 1LNQA 3B20A 3KJEA 4PIVA 3TR6A 3EY9A 3L6DA 4BO7A 4D6YA 3KLMX 4P5PA 4DWWA 1Z13A 1W35A 3KZNA 4KQGA 2OO3A 3SXUA 2D4AA 1WXFA 4DABA 3CZAA 4H31A 5CW2A 5BVGA 3L6CA 2A9VA 5HJ7A 2XCUA 4IVNA 1E9AA 1N2CE 3B36A 2FEOA 3FFAA 1G21E 1U0TA 2PX8A 3BIOA 3CQ9A 2C3YA 5C4IA 1K8QA 2NYVA 2XNHA 3I2JA 3WWZA 3MBOA 5KWEA 5FOSA 2CV0A 3KJZA 1YGYA 2ENUA 1CUIA 2ORIA 5THKA 3TR5A 1L5KA 1UJ6A 2YJZA 4YCDA 4MS4A 2CLEB 4LY9A 2I7TA 1ZESA 1S8AA 4CXMA 3ET4A 5U4QA 3DE4X 5EHIA 1ZK3A 2N1BA 2Y2UA 5FQNA 4BVGA 2ISQA 4BNYA 1H4QA 1NLFA 2Y1GA 1JQBA 4JI1B 3RVPA 3SDBA 2V5VA 1B73A 2VYQA 3V7WA 4GR9A 4QGAA 1AUVA 3ILVA 1RC1A 1Q92A 4JENA 1O0CA 4B6PA 2XQFA 3A6LA 4ZU3A 4BRUA 5IYZA 4IWXA 4ONEA 3T34A 4C0WA 3RE1A 4KXWA 1NF2A 1X7YA 3O7WA 1Y5NA 4P7GA 4PTLA 1RWMA 3CT4A 4WK2B 5JZSA 3LXRA 2WLSA 3ORHA 1VJDA 3S4YA 1IZ9A 1M66A 2NVBA 4H16A 3X3HA 4A2QA 4H6PA 3G8DA 3FAZA 4KXLA 2E85A 3GCGA 2JARA 2FP4B 1A1SA 2Z1DA 2C31A 3P45A 1IH8A 4HX2A 4OHUA 4DCJA 1NSFA 3HP1A 3L06A 1T6BY 3NOOA 1CQWA 3PGA1 4Q7JB 3S1SA 2IYAA 4DKXA 3RFCA 1ZVMA 5AVVA 3UATA 4FD2A 1G9XA 1RQ7A 5CPBA 3UAZA 4IP0A 2GEDA 1IFXA 1YDEA 3W79A 4L8YA 4E2YA 1UBMS 4IIBA 1CBUA 2H4WA 2DPLA 1RYMA 3V2IA 1QPZA 3R9XB 3DE5X 4CV2A 4DG8A 1CRQA 4GVXA 1GLGA 1YBFA 5GIPE 1VLJA 3ZCVA 1UF9A 4D6PA 4TXHA 3E22B 1K2VN 3P9RA 4ND4A 1UINA 4J9UE 4JFAA 5AT1A 3VR3A 3NAQA 3KL2A 1O97D 1Z5NA 3F97A 2VNHA 3UO8B 3CVYA 1J20A 4GE0A 4ZWNA 2QYTA 3EGIA 4XSVA 3M1YA 4TYYA 3PZRA 3AXTA 4PX2A 4QVKA 1C3XA 4HWGA 1DO8A 3SQWA 2I9KA 3HRIA 1G8FA 3S2ZA 1NY6A 4BV3A 1Q2UA 3F8TA 5REQB 3NHKA 4AMVA 5BRAA 5U9CA 3FHJA 5H16A 1B6GA 3RYHA 3EDOA 4CT0A 1A9PA 4DCPA 3G0DA 2JJ8A 2JGRA 2Y1LA 3L7CA 4ETMA 3GGGA 1NFFA 4U9IS 4TYWA 4DIUA 2JK0A 2EC5A 2LCIA 2NXEA 3PUYA 4M89A 1NFQA 4PGGA 1LBEA 3F4BA 1OREA 3LK6A 2CEKA 4HBZA 2I87A 4EJ0A 5B58C 1E2QA 9ABPA 1SEVA 3F6BX 3H5AA 3L18A 4ZFNA 1EFLA 1MEJA 1TTHA 1T36B 3WGZA 3K4HA 3RS4A 1VE5A 2IBMA 4IUCS 1R9MA 4YJGB 3MRXA 3GYGA 4O3FA 5AI6A 4MVJD 2XMRA 2ZXEA 4EARA 4F8EA 4FXOA 2OAGA 2GRJA 4J29A 5I4IA 1SHZA 4CE6A 1Z7GA 1O0SA 2P79A 2PAFA 1ZUHA 3OQPA 4Q3CA 4AZ0A 5F23A 4L5BA 1TLTA 2C9BA 4MEJA 3LUKA 1ELOA 1O6FA 1M2VB 3I4CA 1Z38A 1Z6TA 3WIEA 1XAJA 2O1EA 1I0IA 3E7WA 2HX1A 5IP5A 2JNWA 3NHFA 1FU8A 4I5DA 4CCSA 2G80A 2V7BA 3IE2A 3LHDA 3T7JA 5DOZA 1PR6A 4NZPA 1TFUA 3VGJA 1GEEA 2GZAA 3VTFA 4JB0A 4KSYA 2IW3A 1DQRA 4XX0A 3T7SA 3W9BA 5M2QA 3HU5A 1PQ4A 3ADPA 4WK6A 1XHFA 2Q3JA 3GLUA 4JB2A 3PJDA 2XRZA 4M9ZA 1NXOA 3CLUD 3QLVC 1PWEA 4OM7A 3LW7A 2AX3A 2DQZA 3NYRA 2JI4A 3OZXA 3UCEA 3DBIA 2NSDA 1E9CA 1PJCA 4HMPA 4K87A 2C83A 1HTTA 1U0OC 5CDSA 3SOPA 1UBLS 1QR6A 1Y1LA 3AINA 3V7UA 4LJKA 3DTYA 4NBRA 5EE9A 3W7AA 5JVDA 4PCVA 4UPVA 3DTTA 4YALA 3IAFA 4JLSA 3K53A 4W82A 3SM3A 3FOFC 5HUHA 3LT2A 2IEYA 4C0SA 3A9RA 1DC8A 4JVMA 4B7XA 4V0QA 2W93A 4EKYA 1E58A 3LNCA 4R3NA 3PWSA 2XCOA 2C94A 3JWIA 3UYKA 1DC5A 5LLSA 3DL0A 1G8GA 3OJEA 1QIKA 1ZMOA 4URUR 4HRAA 2RI0A 3LCVB 3O75A 1DBQA 3OJCA 4JUDX 5EIXA 1A9XA 1PR2A 1TZ2A 2XAAA 3GVPA 5FYDA 3NCTA 3OWOA 4KN8A 1KMNA 2O2XA 5J9FA 4NJEB 3UGTA 1UPTA 3O3NB 3AJAA 2GESA 3VR3D 3FMPB 4I6EA 1L5NA 3A6EA 3UCXA 2FFQA 1E2EA 3ZY2A 4M0PA 3UM9A 3G02A 3QEMB 1LJ8A 3QMWA 1VCHA 1P81A 4WFIA 3SYLA 1OKKA 2O07A 2JZNA 4D8TA 1NG9A 1FS4A 3BHIA 4M9SA 1ML4A 3COPA 4P8RA 3OQVA 4XPIB 3TQIA 3UAGA 1O54A 1Y7HA 3H9GA 1V4VA 1VRWA 5C81A 2EZ9A 2ZVPX 1ICEA 3J81A 1T4CA 4OPMA 4FI3F 1BDHA 4ITRC 5KVCA 1AM4D 1T0HB 1QO0A 3PWZA 4BQRA 1GTSA 4A8PA 4EEKA 4PLGA 2J3MA 4EBBA 3H9CA 1EE9A 5D84A 3IELA 3NRJA 1WDLA 5AVRA 1SCJA 3SS9X 1KJYA 4LZAA 3V1MA 2V0CA 3EIOA 2J45A 3OMLA 3M9WA 1FYVA 2HNAA 3K0HA 3UGKA 3GH1A 1ZPDA 2C9DA 3ZV6A 3LC1O 4JA2A 5JO9A 4ZEVA 4CNQA 1HDCA 1PAUA 1A9OA 3K9FC 1QPGA 5JI3E 1E2BA 1Z2DA 2V54A 3INGA 3F7NA 2GFIA 5EXPA 3GZNB 1T8YA 1XWWA 3FDIA 3IUNA 5ALJA 4CPDA 3U1BA 1GFZA 3A3OA 3GG2A 1HBJA 5DIZA 2VLIA 3UAWA 4PYOA 2W2MA 1T8SA 1COWA 2EP5A 3JVDA 3QUSA 3KDPA 4Q37A 3SE7A 1CRPA 3FSJX 4TL7A 3ZU3A 3EEFA 4UBNA 4YFYA 4Y9SA 1UM9A 3SMQA 4TWJA 3DNMA 3WWOA 2HU5A 3R3UA 1C3OB 1LWOA 1Z4OA 2DBRA 3BJMA 5A1TA 1Z6ZA 4URYR 1RI1A 1U1IA 2HI0A 5BXQC 4MR8B 1I80A 1PK7A 2RC6A 3U1TA 4W9NC 4ANFA 2CXOA 2HA5A 3SIWA 1QFXA 2VJCA 1GRCA 3MWLA 5HS4A 2QUAA 3EIHA 2PKRA 2CSXA 1ZGBA 1QMGA 2CVHA 1M8KA 4X94A 1S3IA 1XU4A 3NHAA 4NOLA 5EJEA 2FE1A 1JSZA 4GOJA 1JSXA 3OQOA 2IWRA 1YJQA 4MRMB 4RVUA 3RG8A 3SIXA 3T0GA 4P83A 2EJTA 4F1KA 3R7AA 4UNRA 2ZE7A 5BNWA 2V58A 4DV7B 1FMFA 1OV6A 3WLTA 3OESA 3OT5A 1DCKA 4DVGA 3V9AA 1IZZA 3GR6A 2FZGA 3MMXA 1JA1A 2ORWA 4YT8A 3ZZUA 4ATNA 4MUAA 2B5VA 3GGDA 2FEPA 5E1DA 5A9SB 4NCBA 3CLKA 1IE3A 1JR2A 2H4FA 3GUUA 2FKAA 1RHMA 2O5CA 2X6RA 1N6HA 1D5WA 2GWRA 1UBTS 3GNSA 1H2ZA 3HCRA 4KQ6A 3U7IA 4J0JA 2PUGA 2NSLA 3RFVA 4YMTA 1YB1A 1Y8RB 1H2AS 3IVCA 1HFKA 4HDMB 4MPJA 1DB3A 1E8DA 2AI1A 4GSKA 3VKVA 1WB4A 1R3UA 1N4DA 1ZIOA 2RHBA 4UXHA 4MWTA 3QFTA 3SVLA 2AUMA 1UQTA 3ODPA 1C0IA 2BUBA 1RLTA 1OKKD 4MW7A 1XD2A 1PEYA 2IU3A 3QYAA 4RV9A 4Y6GB 2R68A 2ACEA 2ZJ6A 2ZUVA 4WOCA 4IDQA 4RA9B 5KAPA 3PC2A 3TN7A 4MI3A 4K9QA 2PPVA 5FNZA 4D4HA 4G1BA 3IDSA 1KRXA 1R12A 1Q1GA 3O91A 2J9FB 3CNHA 4ZCTA 1QO0D 3LL7A 1GITA 2XDYA 3B38A 3CLHA 1X7WA 3W8NA 1YB5A 2HLNA 2JA1A 5LMZA 4GGMX 2XT0A 4ZVOA 3IIKA 1O87A 1PS8A 2AYYA 4GM4A 4YGYA 4OFXA 3UJ6A 4QELA 4RM2A 2C5HA 3AVOA 2G4VA 1S8NA 4MS1B 1K5PA 1UDRA 1Z5WA 2VF7A 4P35A 4DV5B 4J0HA 2ETXA 2IEZA 2HU8A 3B1JA 1RKVA 1VB5A 2RI1A 1PHPA 4FYPA 2B8EA 4G5HA 4TTVA 4UARA 2VHTA 2ZJBA 5IT5A 4Q4HA 4F3CA 2HMSA 3A37A 3VTZA 1NU8A 1Z33A 1UANA 4LDAA 1U0JA 1WF3A 8LDHA 1JZQA 1N6KA 5F7XA 2E48A 3EQ7A 1R6VA 3PFFA 4P1ZA 4P5DA 2YMLA 1L7OA 3G2QA 1VC2A 3IUYA 1COWD 4MCHA 2B8JA 2EERA 2H7VA 1HTWA 1R0YA 1PDOA 1SBTA 2EP8A 2P78A 2QQ5A 3H9BA 4YJ3B 4ZGBA 3KX2A 4N54A 2RH8A 4PWYA 5I7FA 3AETA 1PJTA 4GXTA 2P4SA 3KK0A 3MELA 4HAUA 2C78A 3B12A 3N2KA 1A5BB 4KOEC 4B35A 1UJCA 2O20A 3DVLA 1P1HA 3HADA 2AW3A 3SR0A 1Z4IA 1NPYA 5EXSA 4KYUA 1E60A 2ZYRA 3LM8A 1V16A 3N6VA 4EDFA 4OO3A 4E2FA 4QJIA 5LA6F 5DLPA 2HKIA 4QDZA 4PYJA 1WSWA 1JRLA 2H4ZA 3AL2A 1VKHA 3O8OB 4H0CA 1LTKA 1IZ8A 1KARA 2FPMA 4A23A 4GMHA 1ADJA 3A9UA 3VC3A 5EP1A 5JIBA 1J6UA 2AV6A 2ZBDA 4GX5A 3LVRE 2IZ6A 1FK8A 2ERXA 3FZNA 1R4ZA 4MJ3A 1ECFA 3VOSA 1GYQA 1ZGZA 2OQ2A 4YP9A 4D4IA 3ZWWA 3FVQA 4OSOA 4MQUA 4WERA 1R9NA 4FQ7A 1ZI6A 2IZOA 2NWQA 4H3KB 1J8FA 1BH2A 3GEDA 3I9OA 1GGHA 3OZIA 2TMYA 1JAHA 4HAXA 2Q4OA 4H9GA 5LQCA 3REGA 3IDOA 1IHDA 1W4RA 1ZRNA 3U4DA 2Q7OE 1Z5GA 2P75A 3AJ8A 1GU1A 2LIPA 4JOSA 1QK3A 1QOZA 3I61A 2BZ0A 1GZ6A 1QUEA 3ZKWB 2FWIA 2AR9A 4PV7A 3DE3X 4MCAA 5KYUA 1U0LA 3K5IA 3R5XA 1K8ZB 4DC1A 3E22A 3ICCA 3HL0A 4FHEA 2NTJA 4DA9A 3D8TA 2GOYA 1G7SA 1WMEA 2AN3A 3FYTA 3ZWXA 3OCWA 4JDPA 1DJNA 4LJYA 4BGIA 1TUIA 3ZC3A 1SZDA 1T9HA 3E9NA 3HDHA 1OZGA 121PA 1Q1BA 2PL3A 3BL8A 3OU7A 3GFPA 2BWJA 2E1RA 4LVCA 2V8OA 5KYVA 5JNRA 2YV5A 5GADl 2F4NA 5AW0A 4B3GA 4Z9XA 4X64B 4HS4A 4LZPA 3CKLA 3CRVA 3KO8A 4CFSA 2NZUG 1LPAB 1Y8QA 2FUG1 2O7NA 3C3MA 1C29B 5AI8A 3UMVA 4D7AA 2UXCB 1FLNA 1D6MA 4PC2A 1QKIA 3TIFA 2ZRIA 4XLZA 3P20A 3T1OA 3F3YA 4OFZA 5EYPA 5CA0F 3N8HA 4F5YA 3SDSA 1XVTA 4XSHA 4D3SA 3R5KA 2WZBA 4W6ZA 5DEIA 2QN8A 2IU0A 4GOMD 4LI0A 5CFLA 4GW3A 4J6FA 1JHRA 1IBRA 4IV8A 1WB9A 1UR5A 1HY3A 4YJGA 4O02B 1OROA 2OXFA 2PL5A 3G3EA 4QBKA 1Q0RA 3HR4A 2E4XA 3BXEA 5DHUA 2PSDA 2CHQA 4FFWA 4X1IA 4AN0A 1JUDA 3VC1A 4ZRNA 1Z6GA 4NBTA 2RHOA 1OY1A 1OA0A 3W3ZB 2AF3C 1NMZA 2FPOA 1M2VA 1YCDA 2GZHA 3ZYCA 4WJLA 1CJKC 3DDOA 2V7TA 4HH1A 3I9MA 1E1DA 1L1QA 4DA4A 3FCYA 5CW1A 4FOSA 4J16A 4LK2A 1NUUA 4QPPA 2GHRA 2QT1A 3FNRA 1T5TA 5BURA 5IWCA 5ILQA 4COOA 1SUPA 4RF3A 4QFDA 5B3KA 2LKDA 5IVKA 4LCJA 5CB4F 4RKYA 3R5FA 2V3WA 2JIPA 1NVXQ 3G85A 3K8QA 4QQNA 4FFRA 4D1YA 1YMVA 2F59A 3I0NA 2XOKD 1OAOA 3CW9A 2EYUA 3FUUA 2POQX 3JD4A 2HXGA 3LYLA 3MOSA 4ZO9A 3H4VA 1L4KA 1Z0FA 5F5NA 4H4EA 3SC2B 1K5HA 2C5BA 2R5NA 3ESYA 2IOYA 2UZIR 4ZTZB 4X66B 5KJ1A 3QENA 3OLWA 1M8GA 4UUQA 2XHEA 4DDTA 2HNKA 3F6CA 9LDTA 3VJRA 4JBYA 3VHLB 2H07A 5AK5A 3D4OA 4BP8A 3L6RA 5GP1A 3KZCA 1U8FO 4FOTA 1IEQA 5K3CA 1KYXA 4LX8A 3FLEA 1PEKE 3PD7A 4RHTA 5ALKA 1WDWB 3U62A 5AJVB 3EA0A 3DFKA 1NBIA 2EDAA 3GGPA 2YIDA 3K5HA 4J49A 2F48A 4H1WA 2Q6LA 5K0LA 1ZWLA 3EBOA 4HWPA 1T0UA 3VR4H 4BP1A 2QG9A 2P2YA 3ROMA 2HT1A 4Z7JA 1XA3A 2YNMC 4UEWA 3OBIA 4LW8A 5FOXA 4EY8A 2A9FA 2PD4A 1RCFA 1RT9A 3BMNB 3FD8A 3MWKA 1VGRA 3M49A 4IUYA 3AFGA 4J90A 1VZ2A 3R20A 3RREA 1UOEA 4N41A 3QQPA 2NADA 1KEUA 2GTPA 2HN9A 1CUYA 4F5ZA 3F3SA 5BUZA 4Z4IA 4IJ6A 1O9BA 4FNMA 1OVGA 3G0BA 4KQFA 4U0JA 5AW4A 1BDJA 2OPHA 1O3YA 2BGKA 2LDXA 3CNEA 3GXOA 1CRWG 2JS7A 4JSTA 4PSKA 3PUZA 2HREA 2Y66A 4G2NA 4C2UA 1QZ3A 3I52A 2AZTA 2ECFA 4W8GA 3EXFB 4PYNA 3OCYA 3BCRA 4BU1A 2H29A 4JQCA 4XPIA 1E9DA 1ANKA 2PUFA 1K92A 2F3UA 2P3OA 4LRXA 3DFZA 5EJ5A 4GKVA 1TMYA 4CM5A 2WR8A 1BVUA 3RUPA 4GAEA 3IEXA 3KALA 1XZKA 1FSFA 2J5XA 3M81A 4CF6A 4QLOA 1XMSA 2BVNA 4MX8A 1BWQA 3AF4A 1AO3A 2O50A 1JG4A 1NJFA 2O0JA 4WFKA 4XUEA 2WHPA 3TZHA 4NPHA 3T1HB 3O8NA 1AKQA 1JQEA 1UPFA 5A2QA 4UHKA 3VPCA 5FTNA 3T95A 1Q0PA 2GK3A 5JO0A 2QAGA 2HMUA 5TARA 2UZ3A 1I9GA 1CR4A 1DP4A 5I7HA 1UC4B 1ISJA 1PK9A 4H4DA 4CMHA 2MOKA 3QKRA 3SZRA 3V8NA 5CM8B 3PDIA 4L3WA 1OC2A 2XWSA 2HADA 3HG7A 3ZWOA 2GYWA 1UMDA 2QB5A 2DWQA 3I8OA 4HGPA 4UFNA 1OT3A 2CVPA 1DAMA 1SC9A 4Y2TA 5BN5B 1NBMA 1CEYA 1WV1A 4DR1B 1OU0A 1W6RA 1ATZA 3P97A 4ND6A 3PT5A 4QAJA 4Z0TA 1AUQA 4TWAA 5I9BA 3FTNA 5JZOA 3KCQA 4JI8B 4EO9A 1SWWA 4KEAA 3V2GA 5KQLA 1SXQA 1OFUX 1YCGA 2OB2A 4MR8A 2X2OA 1MDBA 2I1LA 3L92A 4M6WA 4V0KA 4WK0B 3TVYA 4QKQA 1UBSB 5HOQA 1DIOB 1AGYA 2PFKA 4RQAA 2BHNA 2CN1A 2FSVC 4AKHA 3TRHA 4K6OA 2WKRA 1A7KA 1K08A 3R3HA 2BN4A 3E7XA 4QTTB 1V25A 2XCLA 5JI2E 4U6NA 1KAMA 2VRNA 4IZHA 4CG2A 4OM8A 1YL5A 2AN4A 2TECE 5ECWA 4QTUB 1T1EA 1YRBA 1KZ7B 3AGPA 3LBHA 4G09A 4IY1A 1SBIA 1G6KA 4QHYA 1FSGA 3D4IA 3ZCQA 4CFZA 5BSWA 4UE3S 1A2QA 5GGYA 1KC3A 3NP7A 4PYMA 5F33A 3CZMA 3IIEA 5CH8A 5HRUA 3HPQA 3CKKA 3EA4A 3MCWA 3D1VA 1SCDA 2SNIE 3K1AA 3MTJA 3PQ7A 4JC4A 2ZRPA 3HR8A 2B7LA 2VJLA 3IQWA 5F9FA 4GKAA 3B70A 3NFRA 1GPMA 5G3ZA 2WQZA 3MWYW 1X19A 4LMAA 1DRKA 5DE3A 3U7JA 4X97A 2BEVA 5DGDA 5JNSA 3LDUA 4QOIA 1VL5A 5GJBA 4D9HA 1J00A 1HPLA 3G9UA 4BLSA 1YQUA 3O4HA 2CMFA 5FJIA 2WQ6A 2Q29A 3TRDA 3WBFA 1JEEA 4UDYX 2N0SA 1N8SA 2E4YA 3QXXA 1VCMA 4X5OA 4EI8A 2QMEA 1HDZA 1PGPA 1Z47A 1ZK0A 4QX6A 5C8YA 4EB0A 4G0XA 4EHDA 4QJ4A 2J9FA 1NVDA 1NN5A 2YICA 4JP1A 1TQ4A 2OTCA 3IH5A 2QAIA 3Q3VA 5DLEA 1NZFA 5GJVC 4AP9A 2FB9A 5JT1A 3P9NA 4BNUA 1ECJA 1OH7A 2P0EA 2G72A 4KNVA 3I5MA 1YFZA 1XALA 2YWXA 3ADKA 1Z35A 1Q83A 3GRVA 4FJ2A 2W0SA 2GASA 1II0A 4J0KA 4O25A 3EF1A 1ODCA 2UAGA 1QFJA 4FYHA 3WJ2A 4D99A 3THXB 3ZS9A 1JDUA 4B4KA 5G4LA 4E03A 3ZGZA 5CBPB 1BQEA 3VJLA 2I7DA 2JFFA 4H2DA 3KYJB 4J1TA 4L8LA 1B4DA 4QSMA 5FF9A 5K0TA 3IKMB 5B53A 1TQ8A 4HB2A 1R88A 1XVIA 3F0TA 1E3WB 2XT6A 3KT6A 4LHZA 2Z9DA 4YO8A 3UJ9A 4B47A 1EGVB 3VDXA 1V26A 2JI6A 4O33A 5CG1A 4R2MA 5ITZA 4U7FA 3EY4A 1YF3A 1AURA 3H2BA 2IGTA 4LY3A 4XQCA 3GDFA 4NYIR 4L7QA 3RVBA 1DBPA 4RA6B 2YDXA 4ZI5A 2JGJA 1M8JA 3UUFA 2XE7A 4CMIA 4DNPA 1NBMD 1SBZA 4C5AA 1QXSA 3Q0TA 1CV2A 3AF5A 3Q87B 4YLGA 2UXBB 1NRJB 1QTIA 1D0VA 1USVA 3DMGA 3G2OA 3Q11A 5JD3A 2YVAA 3KFLA 3UGQA 4DF3A 3EXAA 1J5XA 2PGLA 5AO9A 2C58A 3JR3A 4XJVA 1Q3KA 3RVNA 1U0HC 3RU3A 2HDOA 4R8KA 4GL2A 1OXUA 2B4AA 1N2BA 3HN6A 5JWHA 4NBLA 3R7NA 2Y0DA 1ZIPA 3UJDA 4QBIA 2ECOA 3ETHA 3PFKA 4MI1A 4N3GA 2IOFK 3O8OA 4JJZA 1V4BA 1IBKB 5GM1A 3K0CC 2IV2X 4NAUA 2XLCA 2J9RA 4E1BA 2GHIA 1Z6YA 5JS1A 4NL4H 5C1BA 1CZNA 3GLGE 5CNIA 1JU3A 1K97A 3D3QA 2BMVA 1JFSA 2QWXA 2GO7A 4P3OA 3KG2A 1TEVA 1RJGA 1DV1A 3I04M 1IMOA 4W7HA 1PZGA 5EL0A 4XQ9A 4KO3S 2BJWA 5JPDA 3RSSA 5SY9A 1E3DA 1P19A 1I5EA 1ZRMA 2I6FA 2VYVA 3R41A 2M32A 4FMDB 1TYCA 3UJCA 2XMQA 2YV1A 3RUDA 3CF0A 3F73A 3NT4A 3QUTA 4L5AA 4CM8B 4JVLA 3UXHA 1I9CA 5CFQA 1TU0A 1Z06A 2VEOA 3ZKWA 4PONA 4DN6A 4QWWA 3AERA 3HGMA 5DULA 5LIPA 3K4QA 2QD4A 2DQSA 4M2LA 2Z98A 3MS2A 2A14A 1DHTA 1PFWA 2COEA 3GN1A 4GF5A 4D3YA 1ISMA 5KTTA 1LEHA 3KCNA 5A02A 5F3WB 4NENA 1TAGA 1U63A 1UXIA 4MHOA 1JZTA 3EFBA 3SJAA 1XJ5A 1LQTA 2ZJAA 3K96A 3QBVA 4I4CA 3HO6A 3ID6C 3R3WA 4DARA 2J5BA 3OECA 1BVYF 2H1HA 3AVXA 4R2WA 4AZTA 3MTDA 3A0UA 1LRLA 1B15A 4QGGA 5I7WA 2F43B 1RTKA 3R7SA 1VB3A 3SX0A 3T3IA 3KJGA 4AZVA 4TVSA 1IPFA 1JJFA 3R3ZA 2J7KA 2IHKA 2ZWMA 2ZPUA 2JAWA 1DJMA 2B1GA 3UV3A 1PR3A 1ITZA 2H06A 1N1EA 4WZBB 3UCFA 3ZIUA 1Q12A 3CN7A 3G2KA 3B8EA 5JBQA 5D3ZA 1SH7A 4MPDA 4XVQA 4DJJA 4E14A 3CV3A 3TOVA 1UP6A 4ARUA 3EASA 1XZ8A 2IT1A 5EMKA 3RRMA 1P4RA 4AKIA 2IHUA 3R5TA 1Z8DA 4KX5A 3OBBA 1V45E 3MAAC 3DXFA 1BJKA 2A94A 1FFDA 4TKVA 1QF6A 4CU5A 4DR3B 3AF3A 1M5UA 2Q1WA 3R0VA 4B71A 5K3EA 2XTNA 1RLMA 3QY0A 2OZEA 1GAJA 1F48A 1M1YB 3DHYA 2GETA 2I6QA 2ZQ5A 5D5HA 2O8EB 3VYWA 2Z6VA 4TXNA 1RPTA 5KX5F 1IBCA 3GY0A 3S5UA 3PLAE 1JIVA 2AVNA 2YOHA 1J7JA 2I7VA 3MEQA 1EUDB 2JLYA 1CY4A 1M34B 2ZIXA 4PR0A 3L5KA 5TXGA 5EQTA 3BIWA 4KO4S 1P0MA 3KPVA 4OTZA 1AC5A 3VH4A 1UJ4A 3VZRA 4FZVA 5LP1A 4HNVA 4JLWA 5CLGA 4UU8A 1C1HA 4O4HB 2O19A 3QUCA 1A88A 2QP4A 2JF0A 4D5GA 3RD5A 4JL5A 5T7BA 4G0VA 1I3OA 5L3RA 2ONJA 3AY7A 4MV7A 3F78A 3LIIA 5HF6A 4K9KA 1Y9ZA 3IFSA 4ZT7A 2JCBA 4AY5A 2GJ4A 3HFJA 3PA6A 1M1NA 4GI3A 4A92A 1SXJA 1LLFA 4W6QA 2XBUA 3ROKA 3KLNA 1O6CA 3RGWS 3E2MA 2VYVD 4UBLA 1TM5E 1ZOPA 3L8YA 1WZEA 1JEYB 2Y67A 4E5NA 1JQKA 1SCBA 2JIQA 3TOSA 2WT4A 3EQ8A 4X7PA 1JLSA 2VPYA 4JSRA 1XVVA 2LBPA 1EK2A 4JBGA 5A1JA 1A1VA 5SYNA 2AOTA 2H1IA 4WESA 4RX1A 2QRQA 4MQMA 5E8RA 1KEEA 1IB6A 2N46A 1CTQA 3G49A 5JG7A 4OI0A 3EVNA 1TCBA 4DB4A 3Q8XB 3NTLA 2EKLA 3X1ZA 3L8HA 3FTDA 1GGKA 1G4UR 2IKSA 2WD8A 4O1MA 3TNFA 2IHYA 4YROA 1SVWA 1YJBA 2BD0A 1F0NA 1PO7A 3FI9A 3CMCO 5K99A 3OLCX 1YQDA 4U2CA 2J9YB 3EK2A 1CS0B 3HJCA 1YVDA 2DJIA 3DE0X 5AYVA 3M4XA 1BTOA 4K9NA 4DRXB 2RBEA 1G8PA 3BAZA 1FUUA 1XRRA 1ZSVA 3EXFA 3A1SA 1Z4KA 3F9CA 4RVSA 4X90A 2V9CA 1YWGO 3LLMA 4HEA1 1I7LA 2GA8A 3IUSA 2DJ5A 3LDFA 3PQEA 2R44A 5LP6C 2X8BA 3X0DA 1FS5A 3AUFA 1W5BA 2V4UA 4L7VA 3H2HA 4PLWA 3PS9A 4R2HA 1B0ZA 4Q9DA 2QJRA 2DUMA 2JFNA 4DDVA 3HSSA 3AHIA 3KP1A 4HNAB 4RK0A 3OP1A 2BH2A 1V7PC 3HU3A 4FC6A 3ZI4A 1XRMA 2GTHA 3CG0A 3DT8A 1H9CA 4N3NA 1XYVA 2PUEA 5TMPA 2PWZA 3HWRA 2Q2VA 4YXWA 1H6DA 5CCXA 3CF6R 2CYBA 2PSEA 2YDYA 1ENZA 4IV0A 2A1TR 2YH2A 5KTYA 1DEXA 3NM6B 2GBLA 4O1HA 2BI4A 4A5SA 5IT4A 4XGQA 3Q5DA 1NLYA 3O0TA 4CMEA 3I8XA 2B6HA 4NYMQ 5TEVA 1X14A 2F64A 1RI4A 2SKEA 1RI5A 2ZR0A 1DWQA 1L4FA 5EWJA 3QPUA 4WASA 3V4ZA 2ZGVA 1BE0A 3FVWA 5AVOA 4Q4AA 4BNTA 4I1SA 3WYEA 3AJRA 3M2TA 1RRKA 5EHNA 5BN5A 4RFSB 1NQAO 3PUIA 1NRXA 2D74A 2FUCA 4MW1A 4NEGA 4RY8A 4EL0A 1AMNA 1NHWA 3V32A 2WZQA 2HBQA 3DOIA 3H2GA 1XAHA 2PANA 1DXYA 1F12A 4JGIA 4Z8XA 3QIAA 1TEHA 1DKOA 1U28C 1VECA 3ANNA 1WCXA 1YR2A 2ZTHA 4TV8F 3KQLA 1XEXB 1ES9A 2D2FA 1M0TA 2PY6A 5DX8A 5K0FA 1CVLA 2H2FA 4N39A 2DLDA 3F8WA 2WC1A 3G0CA 5B36A 2DVMA 1SXJD 1AF4A 2WD7B 2YXLA 3F2VA 3K6SB 3AHJA 4LXIA 2GNOA 5F5XA 4G8CA 2F9MA 4I7EA 4F56A 4KGDA 3O9VA 4HDQB 5AKYA 5I8PA 2W2NA 4YH1A 5DYWA 3UK2A 3ZE6A 3WIOA 2YIJA 1J8MF 5C7IO 3NBKA 2FG6C 1IJFA 4QFMA 4N8EA 3RUHA 4DM4A 4MUXA 1FPQA 2D06A 3DO5A 1U11A 2QVXX 3FDZA 3QKUA 4YT5A 4MGYR 4DIFA 4BCBA 3U4MA 1JTFA 1SN7A 4IGKA 3MUEA 4UTNA 3FFWA 1W8DA 3QVKA 4TX1A 3BA1A 3PSHA 4OHCA 4PYKA 1XTSA 3B1KA 3E9MA 4I55B 1DAEA 3L07A 3PQCA 4HWTA 2CJWB 2NO1A 4TSRA 2IV3A 2JLWA 4UVIA 5CDTA 2WU8A 3IAAA 1J8VA 1PJLA 1U2GC 2NACA 1ZQ9A 1XU7A 2OPBA 4HWKA 4PBTA 2H08A 2J4FA 3TSAA 1GPBA 1SOMA 2CF5A 3FOBA 3O31A 5AK0A 5MN6A 1S3SA 3PFIA 3OQHA 1G7RA 2QN9A 4CM6A 1GTVA 4PCLA 4OHPA 4NX2A 2XUJA 4Q9NA 1VPDA 1Q3TA 3MJTA 3T3GA 1TCAA 4Y2JA 2OO5A 3BMOA 2NU8A 1ESMA 3BSWA 2YS7A 4YB8A 4D0RA 5F35A 4EQZA 3RF6A 2WICA 3SQLA 1ZD8A 2HLHA 1WEKA 1IUPA 3MERA 1NJSA 2AC7A 4LF4B 2RHJA 5CDHA 4C5BA 5DI3B 3S7ZA 1U4OA 1DUSA 2J41A 5L6MB 2JLQA 4XVRA 2IBSA 2A4MA 1D6NA 1ZONA 4AG6A 4RTJA 3THXA 4M9CA 3D6FA 4PLHA 4BL5A 1XP5A 5J47A 4YXWD 2QVCA 4RAOA 2PWBA 4GZ3A 2Q8QA 3KBOA 2VQ3A 1RLJA 3ZKAA 4YRSA 4IHJF 4BAUA 3IT3A 1NE2A 4LE1A 3TM5A 2RHDA 5M04A 2YZNA 3HJNA 4XJTA 2DMRA 2PIAA 4HXEB 4LBYA 3I23A 3PRJA 2P7IA 1XZDA 4QNNA 4TXLA 3OY7A 1M0EA 5EXDA 4H1UA 3RJ5A 2QMOA 3R09A 2HF7A 4NPAA 4WLOA 1KI3A 1I2MA 5AVXA 4QRDA 3M6IA 4BDTA 4FI3C 3BWDD 4RA6A 2GJKA 2JGEA 3L6OO 1YVUA 3HZZA 4C7XA 1A8IA 1AN9A 4NZNA 2WKSA 5ALHA 3FJ1A 3RASA 1ZVKA 3TTXA 1B2LA 2G5CA 4JMLA 2JKVA 5FNVA 4HQFA 1TD9A 4PSAA 1BWPA 4X6LA 1P0CA 2XYQA 1PT8A 2J07A 4J75A 3AI2A 1ZKMA 3ZDDA 3LLSA 4PPYA 4Y1GA 2WAYA 3NM4A 3VU1A 3IVRA 3PC4A 3RRNA 2YMPA 3LPNA 4DREA 5LIRA 3PUJA 2OCYC 1IUOA 3VM6A 4IH1A 4K1LA 1FP2A 2WT8A 3ZGXA 1NOJA 1ID1A 4PLYA 3HB7A 3I09A 5JANA 1J5PA 4LDZA 1NF9A 1OW3B 2JFVA 3USES 4MLCA 1IN6A 4DZRA 2F2TA 3CLRD 3QU7A 4M8LA 4DPMA 2HW8A 1XRJA 3PC8A 2NXCA 1IY2A 2Z56A 3MWDB 4XSGA 2J4CA 5EZYF 1TB4A 3WG9A 4AO7A 2Y8EA 3JZMA 4AW9A 1PBNA 3NEYA 5JH7A 2CNKA 3ENVA 1BWRA 1MIHA 3PL1A 4NI5A 5LA6B 2CLIB 5JAHA 5F52A 3Q7RA 3EJ6A 2F1OA 1HK7A 1N78A 5IKMA 2BFOA 2QP3A 4BB5A 4W5NA 4AD8A 1DLIA 1OCEA 2NXWA 2P4UA 5DTEA 2FRDA 1MA3A 1Y3BE 3GRYA 2Z58A 4PC7A 1V2HE 3PITA 4BCDA 1QU3A 3TTVA 3EIWA 3GLHE 1Z5VA 1RHKA 1YUBA 4KIWA 4UC0A 4GQIA 4G8JA 1TT5B 1FC0A 4X1YA 4CM8A 4CRWB 4YQZA 1X70A 3HY6A 3A36A 2CL5A 5ESXA 3V1LA 2Z2KA 2O1SA 2Z4TA 4WZAE 3SF0A 3I30X 1KDOA 4HQ0A 5JSUA 4F1WA 4XQEA 5B6PA 2QN7A 4ARCA 4O4JF 2HHJA 1CF9A 4N01A 2DAPA 2Q8PA 1DGQA 3ILYA 1DRJA 5IAEA 4FS3A 1EP3B 1LCIA 4I1VA 1CIVA 4R2XA 4J0FA 3TMAA 3SEZA 1MJFA 1GM5A 5CUQA 1XDUA 1WZIA 1PWHA 2W6ZA 1E2GA 1T2UA 4LRWA 4S1OA 4JI3B 1LLCA 1T3GA 2WPDA 1HDIA 5HTKA 4A9AA 4C0KA 1IQUA 3A1TA 1AS0A 3ZV4A 4QLBA 2JB9A 3AW9A 5HCNA 1K9VF 2XUAA 5DM60 1S1MA 4FDMA 1SD1A 3W5IA 4ACAA 1I3KA 4NCAA 4DM3A 5KZMB 1AQUA 3MHPA 4MQ5A 2EKDA 5E8JA 4CVNA 2VPTA 4LTMA 3GFSA 3H5VA 2PV7A 3EUAA 1EK6A 4IXWA 4XB2A 4JEMA 4I3FA 3FFBA 1AUPA 4GMFA 2ZKIA 4PSCA 1QIFA 4QDUA 5CA1A 4Y7DA 4K9SA 2EAUA 4Q05A 3ZWCA 3A27A 2GARA 1DKQA 2H9YA 3BDIA 3CU5A 5C5CA 2YHIA 3AF2A 1VBNA 1M1YA 1NRIA 3BTSA 4X8OA 1H8EA 2EFJA 3KB6A 3PHHA 1AK9A 4MW6A 1N0VC 3RBVA 3WKDA 5B3LA 2J3HA 2RJ3A 2ETVA 1PJBA 3OKAA 2XKJE 5L4SA 2IZZA 4ZHQF 5H8WA 3ZWYA 1EUDA 3ZJ4A 1IHYA 2BFFB 4MMZB 2GHQA 1IM8A 4G23A 4WXMA 1T3TA 2GYYA 5D7BA 3E8MA 4Y18A 4YRJA 3RR2A 4Y2XA 1BO6A 4D0GA 2VP6A 3Q0IA 4PEVA 4HAWA 4IAOA 3S2YA 4ZRDA 4ZAZA 4CN8A 1H5QA 4DJEC 1Q11A 1US8A 1Y6QA 1U02A 3C24A 3PQ4A 3NH9A 3BQNB 4RHFA 3BXZA 3LIPA 2QTTA 4CM3A 4D9GA 3IP7A 1LVUA 2X9NA 3IP1A 3H13A 4R84A 1N0WA 4P3YA 3RIMA 4OHXA 2XYGA 1KAHA 3G7NA 5BSRA 2FEXA 4B3HA 5GVRA 1K86A 3Q7IA 1O5IA 1OYOA 4MQ4A 3RS2A 5LQUA 2H2IA 1RJFA 2DWPA 2HWYA 2XRMA 5AHKA 2VWHA 1Z0KA 1TFRA 2J5QA 1SB9A 4JT4A 1KH1A 4YS6A 1H65A 1JALA 3EGDA 3LPDA 3BB3A 3VZCA 1UEIA 2YJGA 2A1IA 3G9XA 4V03A 3ZHSA 1ZVJA 2Z2ZA 1PGQA 4N0PA 4ITUA 4OB8A 3PXGA 3U60B 1EQ2A 2AJDA 2ZS7A 3IAEA 3TGWA 1P7WA 4JXKA 1NQTA 2XR1A 1AU9A 3Q3EA 4DCSA 2QTAA 4JASB 4L95C 2UV8A 1P2SA 4Y7CA 4YDHB 2P9YA 4X44A 2HM7A 5AI0A 4QQ8A 3W2IA 2XGGA 1SY7A 1W7AA 2V4ZA 4U2EA 2R60A 4PC3A 4UTOA 1KY4A 4JVOA 2A8YA 3CLSD 5L7YA 1BSVA 1X8LA 2CHGA 2EOAA 4ECAA 3OX1A 3WGTA 4Z54A 1FTGA 2XBLA 3IIMA 4TZTA 3HCBA 1M6VB 3RLFA 3JW8A 3ELBA 3K1ZA 1RJ9B 5DKFA 1DTWB 2JI8A 3KYBA 4DRXA 5JTTA 1I4TD 1M76A 2VPXA 4WKNA 2CUNA 4OXYA 5KKAA 2WPDD 2FR8A 1RKXA 3HJAA 3OKPA 2ZXFA 4Q1BA 4REMA 4TS9A 1GUDA 3JQEA 4MV1A 4RD6A 3FZYA 4RFLA 3UMSA 4EI7A 1KOGA 1PTJC 5LXTF 1M54A 3H0EA 2ENWA 4GC5A 3RSQA 2ZYSA 3A6JA 4CIBA 5K6AA 5KC9A 3UJNA 1KZ9A 3CN9A 1ZCFA 2GPJA 1AVTA 2GA9A 2P65A 3AVPA 3QLVA 3HZHA 3ITNA 4G84A 4KGVA 2FWBA 5EZQA 4K8OA 4WBNF 3O2NA 5DBEX 2DRIA 3M34A 3SZUA 1E94E 3PHGA 4KNYA 2MT9A 1EVZA 1NVWQ 3AK4A 1V39A 4YCAA 3S40A 3SHTA 4DA7A 4EG0A 1HDXA 3BVPA 2QMQA 2FSFA 1OIWA 2GH1A 2RBKA 5AW5A 3UEOA 3FMVA 3J7AC 1KI1A 4PCUA 2NV6A 1XPRA 3UFXA 4R3WA 3AHFA 3FTFA 3CUVA 1H85A 4ZO7A 1E9FA 1UBUS 2YV2A 1R50A 1KZGB 3NRCA 4IMJB 4ZVRA 4ZEXA 2ZI5A 1R8QA 4BIMA 4E5VA 1H8ED 3INTA 4HJRA 3RC9A 4HGOA 1OLXB 3CUSA 3OC6A 4RH1A 4B85A 4BMVA 5KTNA 3IEUA 1DUIA 1TF2A 4FDVA 4XDHA 4TTTS 3BF8A 2OFFA 5ICFA 3V4OA 1JDBC 1J09A 4WCFB 1FB5A 1R18A 1TZJA 4KU4A 2EX1A 3RKSA 1QMPA 2H52A 4JXZA 3DM5A 4DMUB 3THYB 4Y1EA 2IPLA 5JZ9A 1SUIA 2PJUA 1E2KA 2FPIA 3LY5A 3NHRA 4B75A 1RM3A 1UOPA 1UBJS 2GLXA 2I9PA 4MA0A 2BEUA 1S6YA 1JHXA 4FW9A 3RSGA 1L4BA 2H11A 2HU7A 4FKBA 2AYZA 1TT7A 4EPXA 5L8VA 1KERA 1R66A 2AUNA 4JJFA 3VR5A 3R0ZA 1Y8ZA 4FSHA 2PN1A 1EM6A 2AE1A 4GI5A 2I7XA 2CL6X 3K9NA 4NCKA 2ZG6A 3LP8A 2WB4A 3TBFA 2CJPA 1DAPA 4TUYF 2JG3A 2C2OA 1YFLA 5K8VA 3UB2A 3G59A 4JLOA 2WD7A 2BEKA 4KRFA 2I5PO 1DPGA 5EHXA 3OPNA 5IF3A 3ZE1B 1H2XA 4R1PA 1QB7A 2GZDA 2DFVA 1JTEA 1P4GA 3UYLA 2GEKA 2L17A 2Z5LA 3KJQA 2YN4A 2BFMA 3OOJA 4LECA 3WLFA 5L4LA 2IHJA 2OSVA 3SBDA 3U09A 1FUIA 4FGKA 5L9AA 1QZTA 4NBNA 2G1AA 4WFJA 5DTMA 1L7VC 4EA6A 1O77A 5KAMA 1GT91 5DHFA 1NUTA 5SZKB 1T9GR 2B0JA 2RKBA 3W90A 4UU7A 1N6IA 2G9UA 5KOHB 4B84A 2LXNA 1RWXA 1JXAA 1NPTO 2GJSA 3WRYC 2D6FA 4OQEA 1A77A 3RPEA 4WY2A 1NKTA 4HAIA 3T6KA 1S2LA 3EPHA 1FVHA 3JQFA 1C8VB 4WXHA 4CCYB 4I55A 4KR0A 2NVUB 1PG5A 2CJWA 1FFEA 4TRRA 2G9VA 4M8IA 3CB2A 5K9ZA 1H8HA 2IYNA 2GEBA 4F4FA 1VCOA 2WUVA 4FEAA 3RKUA 2J09A 2AMYA 4TTIA 4BO8A 1IOLA 1CEQA 4JOCA 1I4DD 1Z4QA 2OG2A 1NN0A 4I5EA 3BFXA 4UOEA 2ODEA 3OIWA 2WFAA 3GLTA 4MMXB 3CW8X 5AHOA 5AOAA 2IBTA 1SCUB 3ZWKA 1EBUA 4JL8A 5KOJB 5BR4A 2HK8A 2OMEA 1G7TA 1IY1A 3U16A 4PO1A 2BGGA 1IY8A 4I1OA 4ETWA 5DI9A 1UMBB 5JSQA 5DI3A 1XMQB 4DBVO 1EDOA 1XYYA 1U9CA 4RORA 3HGQA 5IVIA 4EQ6B 3IPCA 3WLOA 1EXVA 4OBXA 1SBYA 5CAEB 2FQWA 4FJ1A 4XB6B 5IYZF 2GNPA 2FQ1A 4UAJA 5AJUA 5HFJA 2OA0A 4AWBA 4Q7QA 4CKXA 1Z6XA 3AUSA 1N75A 1PG0A 5IBRA 5C1OA 1A8QA 1I30A 2PR7A 1JILA 2ZTUA 3QYPA 3WGLA 3S0JA 3UPTA 1LXCA 4LRTB 2PKQO 4E4RA 2AG5A 4JB3A 2BGNA 4QBGB 1QTRA 3NGXA 3PQFA 1CUHA 4I9NA 1NY5A 3DDZX 1WZCA 1N9ZA 1ZY2A 1HOTA 4TKUB 1ZNZA 2BMFA 2ZYUX 3VTAA 1QYRA 2N42A 2Z4RA 3PUVA 3HM2A 4N40A 5GGXA 5I6DA 5KYNA 1RLIA 2UVQA 3RJMA 4FYYA 1BU8A 2B2XA 4BE4A 3QBDA 1FYFA 1PZFA 2XF8A 3NWPA 4RVHA 4HADA 4OHFA 2L2QA 2IOFA 4CLOB 2W4MA 5JDIA 4KXFB 2ZRMA 5ALRA 3A4NA 1N2EA 1P5JA 4I4TB 5IDYA 4KO1S 2ZTSA 2VTEA 1U2EA 4IX9A 5CYOA 4ZKEA 1XQXA 3C41J 3VR5D 4BAGA 3IKLA 4TKMA 4P9NA 1JMKC 1LNSA 4DV3B 4ZAVA 1QHEA 4G1FA 4MHSA 3IPLA 4PN3A 2GZMA 2BM8A 5J3JA 3DUWA 1KR5A 3DAHA 4AX4A 1NNSA 2ST1A 3IDQA 3L4BC 3QELB 3V7NA 1OPXA 5J43A 4PSDA 4DCOA 4BQPA 2XWQA 2OV4A 1JLMA 3QVMA 3L7DA 3EQ2A 3JAKA 4C7BA 1R00A 2EKZA 4N0EA 1MN6A 3PJGA 2Q5EA 3ROQA 5AI5A 5DN9A 3CEJA 1LU9A 1N0UA 1RYYA 4P92A 5HRAA 4OXXA 5A4MS 1YZFA 3H84A 3GBPA 5TT0A 1POXA 2MYUA 1DADA 1TVMA 3BE5A 2I2DA 4DLRA 3LUCA 4BWGA 3HSYA 3OLZA 4FYWA 5LQDA 1GOTA 3GHHA 3DTNA 5C4GB 4QPDA 2OVBA 5AJYA 1ILEA 4JJ6A 4U7JA 1E1MA 1SRQA 4CM9A 3TK1A 2WA2A 3JATB 2ZIZA 4RVFA 2J46A 3ISVA 2D7CA 2I33A 3QKSB 3UWDA 1EFRA 1H8HD 2G04A 1RAAA 2WM3A 3CRW1 4FE7A 3B9QA 1DV2A 4MLPA 4QM7A 4I50A 2NTNA 1DX4A 4HDRA 4KQWA 3BSSA 3VUFA 4X3OA 3REQB 2I2BA 1LS1A 3GQBA 1JKFA 4KYVA 3P0JA 3A3PA 1JG7A 1F1JA 1T8PA 2G8NA 2X7HA 3INYA 1C0PA 3Q6NA 3R0IA 4JC8A 3DEIA 1F51E 3REOA 4O4IA 3ZGLA 3HDVA 3VZBA 1E1CB 3JAWB 1GKIA 4INOA 4QG3A 4G5SA 2OG1A 3VYRB 2MYNA 1PZNA 2H1OA 3QBEA 2IDMA 4GPBA 5KB3A 4RBNA 2AEMA 2P9FA 3O4GA 4EFNA 1PNOA 5F73A 1IBSA 4JLMA 4FGZA 4IDGA 3V00A 1TA4A 1R4NB 1X94A 2ZBUA 4PU0A 4YCJA 1SHLA 2BFCB 2LNDA 3RTCA 3ZY4A 1L0BA 3OQIA 4DLZA 2QRHA 4NBVA 3B5JA 2ONKA 3HXTA 1GUFA 1OSNA 2DCMA 4OYRA 2ZWVA 4WBSA 4Y2PA 4B5LA 2IP1A 2QE6A 5JVDF 1G5PA 2D1YA 3BUSA 4PPQA 3ZHRA 1SU8A 3ABRB 3D6MA 1ZJ5A 3QVVA 3CVWA 1CPYA 1NW9B 4U63A 3DONA 3Q3IA 3CO0S 1TF5A 4IIFA 4TL6A 4XDYA 4HLDA 3VYUB 1K8XB 3L9WA 3ZDYB 4BMXA 4Q12A 4CMGA 1OZFA 3QLEA 5AWFC 4RULA 1P31A 1H6CA 3BQMB 3OPMA 3W6NA 3E9QA 4O2AA 3K0AB 1EFVA 1U6IA 3RADC 1ORIA 2QP9X 4JCCA 4YWJA 2O2GA 1JNYA 1HR0B 1V7QA 4RPCA 4BFTA 4HCJA 4H15A 2A78A 1T26A 1MOSA 3JQGA 1DQNA 2C4TA 4FDAA 5JCXA 3BYZA 1MB0A 2R751 2J0UB 4R6WA 2X86A 5FI5A 4ZVPA 3V4SA 1S8OA 2XYRA 4G0ZA 5HJ2A 2HEGA 4KDCA 2PS3A 1Q84A 2ZSEA 3Q5EA 3VMMA 1WQ3A 2G6BA 4U9HS 4ZOAA 5BSTA 1E5LA 3WGVA 2JZCA 5JXGA 2YXBA 3VNUA 4OSPA 4GGOA 1WXQA 2V96A 4L9AA 5HBRA 4CDNA 1DAHA 1EVKA 1OZAA 3KOYA 4KWCA 2DHDA 3I45A 2PUWA 4V0OA 1NWHA 5T64A 1JWBB 3CBQA 2DM6A 3S2GA 1ZI8A 5KNCD 2PGOA 1XVUA 3AEQB 1TYBE 3CZQA 3GH3A 1ZEMA 4H4CA 4NBUA 4O4LB 4CW7A 2RG7A 3M6FA 1YIDA 2DSTA 1S2IA 2ZSJA 1KETA 5G3YA 1KNQA 1XFDA 3F1KA 4DSTA 3FPKA 1VG0B 3KPWA 3P0FA 3O4VA 1KI9A 4CM9D 5KSYA 4OKSA 1NVAA 3QVUA 1V11A 5CR9A 4O1IA 5DHAA 3LZ6A 3ZGOA 4IMRA 3BTVA 2P1RA 1D2GA 2OBNA 3G17A 2OL4A 3PHJA 1PJ3A 3PKZA 1EFRD 1V3UA 4QU8A 4YCNA 1BMQA 4ZCSA 2Q9BA 1OXMA 4FFOA 4OH7A 3FMGA 4Q3EA 4EG3A 5JQGB 1B00A 2HIAA 1ULUA 3O8BA 2I34A 1O6BA 1CUSA 1WWKA 4RESA 5AR1A 3TIGA 3TQFA 4F4HA 5IAOA 3LRPA 4DQKA 3FPGA 1T1IA 1OX5A 4LXHA 4R8RA 3ZGVA 1P8AA 2EQBA 1W4BA 2Q9UA 1ADYA 3KKNA 3DUFB 4JUFA 4D57A 3CURA 1X6VA 1ZK4A 3IAUA 3P5BA 4B8YA 1Q44A 3L8MA 3HUEA 5BW6B 4PZPA 2R8PA 3RUEA 5JU6A 2RGBA 3DV2A 1ESNA 1S9DA 1A5AB 2EYQA 2VKTA 4QA9A 4TPKA 2VAVA 3I6BA 1ODTC 1DJQA 3DQQA 4K9DA 1U5BB 4UVGA 5CT9A 4LHEA 1ID8A 2Q1SA 1Y3FE 4MO2A 2ZJ7A 1I4WA 2WJIA 5FPYA 3VR6H 1KDZA 1TTPB 1YS9A 3A8TA 4B4WA 4C6TB 1ZZGA 3ZU2A 1JR6A 1E0KA 1VRVA 4OF4A 4JZKA 1OX4B 4LJ9A 4UFOA 1XMOB 3BKWA 4AYTA 3EVBA 4JMPA 3ASZA 2VDWA 3M3HA 3DKRA 3HZOA 2Q5QA 1KQGA 4F6CA 4PE5B 3E2IA 4A4DA 2C7QA 3HXMA 3R0QA 3KD2A 2X0RA 4G1EB 1DELA 4Q24A 1LZLA 4RANA 4G4GA 4ARVA 3DC7A 4F5DA 3TZKA 5KOYA 3D6HA 1E6KA 2V6MA 3P9PA 4ADSG 1QANA 2I29A 3DCYA 3RVMA 1ZGJA 1DXQA 3NHPA 1HEYA 4WCFA 4G8DA 3OETA 1KDVA 1H1TA 1G1AA 3I05A 4MXDA 1QH1B 1PGOA 1Y5MA 3M1IA 3SZLA 4OL9A 4AJEA 1UC8A 2VYNA 4KQEA 2D3TA 3T5BA 3EDYA 3I5YA 2WUDA 4HXFB 5TDHA 3IUMA 3QMPA 4F86A 3PQ6A 3L04A 3RFUA 1I51A 1N4AA 2PDAA 3VHXB 8GPBA 3OCJA 3PF9A 5HUJA 4I1RA 3HBNA 5C3MA 4EG7A 1XZLA 3OF5A 4GL4A 3P96A 3QWBA 3CA8A 4UEOA 3MMNA 3U0BA 4KOAA 5BUQA 3QLJA 4OGFA 3LGAA 3GELA 3VDMA 1UKBA 2SCUB 5T6BA 4EHJA 3BMQB 1G3QA 2BMAA 1X1BA 2HWKA 2RH4A 5KTOA 1EUYA 4MUBA 4HXGA 1VXOA 1YJCA 2DH6A 3NR2A 5A3RA 4AIIA 1D03A 2QTFA 3VU3A 1RAHA 4PG7A 3FHTA 4X3PA 1UDXA 2IZ5A 2CLMB 4RMNA 1GPJA 1UKCA 2EL7A 1LPBB 4TXMA 2PUHA 1M8FA 1DE0A 1SXGA 4RYDA 1CQJA 4JY7A 4WSOA 2RKWA 3NKVA 4KO2S 4E12A 1R0LA 4M7OA 4MP6A 2UZ1A 4ZVUA 2R7LA 3C15C 3WLMA 1XUOA 1QFYA 5TF0A 1W9MA 3E4DA 3MGGA 4N8DA 4A6DA 2VTKA 5K51A 1UXOA 4CCYA 1Z5UA 1LV7A 1FYDA 1PV1A 2NVUA 1MIOB 3UENA 4HOYA 2PGXA 5FBZA 1YIOA 3LWBA 2R1ZA 1U5AA 1J39A 2CEAA 3O4RA 1YZVA 5DYNA 4BVHA 2X4LA 1TL7C 3ANSA 2REOA 2WIJA 3PV0A 5C3UA 2Q3DA 3ZHZA 5LZ9A 4QG7A 2WINI 1QE3A 3W0LB 2K6GA 1MAVA 3OQBA 4WA8A 1DKLA 1P7PA 3LCMA 4M22A 4BO4A 1V7ZA 3DMYA 2ZATA 3M5CA 5LR6A 1TU3A 3QHAA 4JA0A 2PMFA 1VYHA 1TDJA 3VO1A 5KOJA 4PX9A 1BXRB 3IV6A 3O73A 3SSAA 5IJ9B 1NBHA 2H5JA 3B89A 1SQ5A 4ZO8A 4DMFA 1KS9A 4HVAA 4L28A 1FS6A 4LTNA 4OFBA 2YINC 2I6XA 3R8XA 1WIWA 1ULAA 3PLRA 3T5GA 2NZXA 4BGEA 6AT1A 3B6IA 4R1MA 2YMMA 3P94A 4XWWA 2YKGA 1KQ3A 2WJAA 3L02A 2P3SA 1W88A 2PL9A 3UWOA 2EJUA 4YCBA 1CQIA 2Q49A 1GQYA 3HRKA 1T1JA 3NEJA 4YDRA 2FA9A 1V9SA 5K20A 1FW6A 4GLLA 2IC5A 1LRKA 3QWAA 3N28A 2XUIA 1EVYA 2C9YA 2DFPA 1UIMA 2CB0A 1RKUA 2GCGA 2OT3B 1JQ5A 2YUIA 2ZTVA 3AHHA 3HEAA 3PP8A 4EHKA 4BFUA 3P2YA 2Y68A 5KYUB 4M76B 1OOEA 1T2CA 4I1IA 3CX6A 3A4LA 4F9GA 5J1SB 2H65A 2FPLA 2VYND 1RXIA 2XDQA 2YIVX 2NOAA 4D6XA 1Z0JA 1J07A 1VHDA 1XPJA 4DQ0A 5B7PA 3AY6A 2EL9A 1WUTA 3I01M 3MIZA 5AXAA 1M0WA 2VPIA 1K75A 1MRNA 4R2IA 1U1FA 3RM3A 3SQNA 4RHEA 4AY3A 1RYDA 4U9UA 2XGSA 4KVAA 3SQOA 5K05A 3Q9LA 1RBQA 2ZJ0A 2QKYA 3F46A 3MW8A 4QPCA 4TYQA 4ZAFA 1L5GB 1ESEA 3AKEA 1ARZA 2ZUBA 5A7GA 3TD6A 1YMUA 4AI6A 4PX5A 4ZP1A 3EOZA 4E21A 1HM5A 1X9HA 2QY9A 3EBPA 1FRNA 4D79A 3FN4A 1MTZA 1JAIA 3JARB 3AU9A 4X6XA 1PRYA 4F97A 2ID9A 1OLUB 3QELA 4Z4EA 4J0CA 5BSHA 3ET5A 5AHRA 4B4VA 4MYHA 3RYCA 1CUFA 3KSAC 4FHCA 1ZCAA 4EI2A 3GU3A 1FF9A 1U3UA 3TLCA 2AC4A 3E0XA 2XOEA 5DMHA 5KNCA 1QAMA 1CHNA 1KFJB 3EGCA 4XD2A 3H3FA 1T8WA 5BMOA 3D7LA 4IUDS 2IPMA 4AKTA 2X5XA 4Q93A 4PBRA 1LLDA 1F9AA 4X7BA 1X0VA 3T9FA 3DBLA 1I8TA 1R7RA 1HX7A 1XK6A 3F9IA 4NYMR 2PTHA 3EG5A 2GM3A 2AZXA 3QUAA 2BZGA 2XT9A 3LRTA 1FSSA 1RACA 3ISTA 1GA6A 4CODB 2ZQZA 4C7VA 1ZCJA 3MJVA 4MUMA 2V45A 1FDRA 3FF4A 1LPNA 3CUUA 3QKSA 5AJXA 1Q74A 4E32A 4R9SA 2JLRA 3MB5A 2W0MA 4MGZR 5CLFA 1Z3IX 1NE7A 5EIAA 4W99A 3B2EA 4QUIA 4D4MA 3GEGA 2VHCA 2HXYA 3K6KA 3ZVNA 4BX3A 2BE7A 2O3RA 4IJUA 1ZXXA 2FJUA 2J0EA 2FPUA 4FBMA 1GZ3A 1PS9A 2JFOA 3CO5A 1WE2A 2PR2A 3DD5A 3IGFA 5EIFA 4V2UA 3ED1A 3V1UA 3JYPA 3OMXA 5FEMA 3ND9A 4NEHB 4HLUC 4XH9B 5FWXA 4R51A 3G13A 5I5GA 5H3LA 4KIJA 5EC8A 5BNFA 5FUBA 1JPJA 3HNPA 3JAWA 1YRAA 4RTMA 5IX8A 5A6VA 1KDYA 5JCOC 1U2QA 4XTRA 3CX4A 4G4SP 3SBOA 2KB0A 5J4LA 3YASA 3T61A 3OIYA 2QIOA 1MO2A 5TVGA 4EPWA 2JAHA 1OR8A 2AMVA 1OWMA 2QXTA 4NOJA 1CUXA 1RYNA 5G0UA 1G20E 3HEMA 5IG2A 2R8BA 2AL7A 4F92B 1OD6A 4BTLA 1RLOA 3HV0A 5TPWA 4A2WA 1R8SA 3TEMA 3JWPA 4ZT2A 3WDSA 2BKLA 4DVJA 1Y9EA 1ZP6A 3JD3A 4UD2A 1OLSA 1N6OA 1UFVA 3H05A 3TXXA 3I9V1 4B79A 4DCCA 1D6SA 3QU5A 2PUVA 4MV4A 4LDPA 4O2LA 4RF2A 2FFJA 1JFRA 3Q7PA 1YVEI 3T1VA 1MA0A 5LWQA 3O4IA 4XM2A 2X4IA 5DSXA 4NESA 1YQWA 2BRUC 2O6LA 4OCZA 3KKEA 3WO1A 3FIJA 5LYJA 1VHQA 3LUDA 4WDQA 1KVSA 3KEFA 2A0KA 1U9IA 2XGOA 3WSVA 3KTFA 2A9JA 4X7MA 4NJMB 4HSEA 1WD7A 5G1NA 3ZHTA 2AT1A 3NIBA 2P91A 2IV7A 1WHSB 1A4IA 4KWTA 3T7AA 3ZY6A 5M7EA 1Z68A 1MEEA 3LFUA 4P0PB 3DNFA 2O2IA 5EP3A 3K05A 4GNKA 4WCDA 2OOSA 4EG6A 3EYWA 5CD1A 2NPOA 4LXQA 3E9EA 1H4VB 4EF4A 3VOAA 1JJAA 2IUTA 1E3EA 1VL0A 2QN2A 2UZAA 2W2KA 2JH9A 1O96B 3DVAB 3C7CB 4KXXA 1X42A 3I0ZA 3O8QB 4QGBA 4Z1MA 3GJ7A 3U26A 3EGVA 3HO8A 4C07A 3DGEC 4FYJA 4ZI2A 5L6LB 1C8KA 3GLKA 1R15A 4W5OA 1PUIA 3NGLA 3U3RA 4AJJA 4DLSA 2OP1A 1LPOA 3AR9A 3DAGA 3DKPA 3BZWA 2R65A 4II2A 4O4LA 4MGIR 4GOKA 5T5QA 4UDOA 2ODQA 3AEYA 4CF4A 5GINE 3HVIA 4DNQA 4X3CA 1F8XA 1PSWA 4F11A 3VDNB 3B82A 3I2KA 5ESWA 3AFIA 5CLLA 4ZGGA 1Z34A 2FAXA 1TPYA 5DIFA 4YASA 4D92A 2PAAA 5BUSA 1QFMA 2RBGA 2HRBA 1EJ6A 4UBKA 1M6NA 3PUKA 5P8WA 2ZZKA 4FYKA 5B2EA 4LXGA 5IAKA 3IQDB 2I1QA 4RGVA 1X80B 13PKA 5LNK1 2FCAA 2QD2A 2EXXA 1XAIA 1JU4A 4NHEA 2XYHA 1D1QA 3H8VA 1AS2A 3ETNA 4AJ9A 3FTPA 3DLIA 5JPCA 2B34A 4JLKA 4KMSA 1T5SA 3ZCXA 3ZWBA 1SUBA 3OM8A 1EP2B 4P4UA 1F1BA 1BW9B 1IAVA 1RAFA 4GU5A 4RE6A 1E89A 3BHNA 1ZA1A 3E03A 1ZNXA 2J9ZB 3DR3A 3K8ZA 3P2OA 3EZ7A 1LF5A 4IQ0A 4MH0R 5CJ2A 3N0WA 4MV8A 2VP4A 3IAHA 5ALZA 1LSJA 2DTDA 4HDSB 1KE1A 1XHLA 3MIIA 3HI6A 2GD6A 3K1YA 5JXJA 2YUTA 4TSFA 3SKYA 1C3EA 2V9PA 2R11A 1J0XO 3H5IA 5HUQA 1M10A 4C6TA 2JGIA 3KHKA 3SYNA 2B3DA 2PGJA 4NK5A 4HT3B 5EMLA 1X15A 521PA 1L1RA 2F1KA 4C5CA 5ICEA 3MUNA 1OE0A 2ZJ2A 4MB0A 4DB2A 1UP7A 1QNLA 1U7ZA 3HFSA 3GLVA 4IL5A 4NQZA 4J2TA 4NZMA 5ERXA 1WXXA 4GUDA 5IDVA 3S29A 5L7TA 1X7GA 4EO7A 3EGXB 1AHNA 1GGEA 5HQTA 3PHIA 2A92A 1NRWA 4RTQA 4LYJA 2FN9A 4BO1A 3AUUA 4CMJA 3TS1A 5JMTA 1EBFA 3PR2B 3IR5A 4PG6A 1W96A 3RRFA 3SJ7A 3WK8A 4L6CA 4R2KA 4XB1A 2YXDA 4HMOA 2NO7A 3EISA 3SN6A 4I3GA 3T4UA 5JFGA 2CHFA 3W77A 3WI7A 5I9NA 4IS3A 2DQ4A 1K8RA 3C7TA 1ORDA 3I1FA 1ZBQA 3QQ5A 4EYGA 4CIWA 2FLKA 1E2FA 3GLIB 4E7OA 1QORA 2YWGA 3C74A 4DYHA 1GZ4A 2X8JA 2VJAA 2EKPA 2X0KA 3CH7A 1ZRHA 4KZPA 1E69A 4NABA 2VI5A 3SVZA 2FMUA 3K2QA 4MVXA 4Z6KA 1F14A 3RSZA 2WF8A 2YWRA 3Q9NA 3VHXA 4ZVVA 1WULS 1Z73A 2XMCA 2HFKA 2ZRFA 2FN3A 3BRSA 4NE7A 4V0RA 5E9AA 4J1SA 1U0BB 4MROA 2R8RA 1Z0AA 2EDCA 3CH6A 1A4UA 1S2GA 3LQRA 4OJTA 4RK5A 4IINA 5EMNA 4Z1MD 6REQB 2UUCB 4S24A 1KK2A 4X92A 2P8JA 4RPLA 5C8YF 4Z4FA 1I2ZA 2HK6A 5LP6A 4R9RA 2CLSA 4FHGA 4L3OA 2QTCA 1F06A 1VE6A 2JFBA 4AF8A 1NKVA 4BVBA 2SCUA 3F7MA 2G7MC 3LCUA 3VSAA 1J5EB 3BMQA 1F0KA 1UBNA 2H85A 3HBLA 2E4UA 1MMFB 4HH0A 4R9UC 2R6AA 1PI3A 2A0XA 1E64A 3PIRA 5CX4A 3E3AA 3NJRA 3P2KA 4AURA 1H0SA 1FXWA 3SJZA 2PMEA 4HUJA 5EP2A 4Z51A 4LUCA 1J7KA 2HCTA 5FI0B 2O7VA 3ZOZA 3ZLBA 1UKAA 2Q27A 2DT5A 3I9V6 3KAQA 1DDIA 2X14A 4IXMA 5AICA 2WWVD 3ZK7A 5L40A 4DLLA 4GMKA 4U6QA 5E3IA 4HF7A 4EG1A 3ZDFA 4DV2B 3FOCA 2J0SA 2WU0A 3C7DB 3L77A 4TYMA 2LP4Y 4B40A 4ZQBA 2QXYA 1DKRA 2YN2A 1AV6A 3N6RA 3GMIA 3ZU6A 4ZDKA 1MIOA 5F77A 4EVSA 5JSZB 4ESOA 4FKZA 4QU5A 4DAEA 4RJLA 2HA4A 4C05A 1TW3A 1SHUX 3LLCA 4LNAA 3PA8A 4OMUA 1MRSA 2H4YA 3W5BA 1YL6A 2A5LA 3UA4A 3A04A 2K7FA 1BCSB 2OBBA 3PZBA 1MXHA 4BMDA 3IPYA 3Q40A 2O2CA 3BBPA 2DWUA 2DSNA 1SHTX 3DMFA 1G0NA 4NU5A 1ZJ6A 4RZHA 3RC1A 1OQAA 5CT5A 2Z6UA 4UUMA 4WKBA 1T6NA 1GRRA 1ZH8A 4TSFD 1L5LA 5KO2A 4ZCQA 3H5RA 3FOEC 3OKCA 3SSNA 3DXZA 1GPNA 1PL6A 3KYCB 1Y4AE 3DKVA 2M2IA 1RABA 1IUNA 2WG2A 4MR9B 4AUNA 3PJRA 1G0OA 1MC5A 4OJNA 3X2FA 4KI0A 2H1RA 2NUBA 2OQRA 2Y92A 4KRXA 4ZQGA 2EJVA 4D8YA 4YXFA 1KAEA 5FWNA 4DSNA 4XPZA 2ZITA 5CB6A 4LQDA 1EGMB 1ODFA 3IMGA 3WICA 3NC1C 2CBXA 3HUDA 3OUZA 1M1UA 4R6XA 5TRTA 4KPFC 1XLTC 1B8PA 3WQQA 4MVJM 4Q9LA 1RWBA 2FSIA 2XTJA 4BX2A 4LC9A 2Z9BA 4PRYA 5CLIA 2GYVA 3JWGA 2RI6A 4BKQA 4E5YA 2WP0A 4NH0A 5EXXA 2W2LD 4TTSA 4NOMA 3SLRA 5FWAA 1TTTA 4ENVA 3WSTA 3U3JA 3OZCA 3AR8A 2R00C 1U7TA 3Q6MA 5CFZA 4B44A 4QARA 2CGEA 2R66A 2RHMA 4I3HA 4UMVA 2NSYA 5A9RA 4MPRA 5EN4A 4E51A 4C0HA 2JHAA 3ZD8A 2O52A 3OM0A 1HE4A 4IGAA 1ZOSA 2P6NA 4OD0A 3RWBA 1CS4C 1EFPB 5HEKA 4QXPA 5LD2B 1T25A 6ABPA 4LSWA 2CNNA 2OILA 4H1TA 3TAHA 4QD3A 1U2GA 2YCBA 1A8HA 2FW7A 3MF4A 3MJDA 2ZPTX 5KHAA 2A84A 3WGKA 5IKPA 1W8IA 1Q1AA 7ABPA 1GXSA 2J32A 1JW9B 2PL1A 2W8BB 4OEHA 2TYSB 3F1LA 5G02A 3RUCA 1QK4A 4YIHA 1ABBA 5NLLA 2Y1WA 3AB7A 3TMYA 3SOZA 3OZWA 4BKPA 3B78A 3O4FA 3JARA 3O5AA 1LD3A 1KRHA 5BYAA 2DB3A 1FUEA 1KSJA 1TLFA 2DP4E 2C5EA 3QHPA 3RRXA 2Q21A 5K3BA 1Z4NA 4HFRA 3GNQA 4MA4A 5H82A 5D1NA 2V6FA 2AEEA 3L4SO 1KY2A 1REQA 2CXRA 1KZ6A 2XUHA 3ICPA 3ILSA 5H3HA 4HS9A 5BN3B 3REFA 4UCWA 3WL3A 1I1QB 2J30A 3B52X 4YAJA 4B3CA 4DBLE 4EWLA 3CPEA 2VFAA 4V3BA 3HXOA 1SR8A 2X13A 4UE2A 3WL7A 4V0NA 3PC6A 1VJTA 3RU9A 4DA6A 2G3YA 2F9LA 3KEOA 4LGMA 2LW7A 1CLEA 1Y3DE 3GVXA 4YJ2F 2EHDA 3U39A 1KK3A 2H16A 3ZD9A 2AQHA 2H8KA 4YRLA 5U4XA 4F46A 3KDAA 3OIDA 4LV5B 2HCBA 4GNRA 4IG4A 4IIHA 1GL9B 3RV4A 2PZEA 4UBIA 4QDKA 1O97C 1SIWA 2Q3HA 1RIFA 3GARA 4IX1A 1JLRA 4UNQA 2IYFA 5JS8A 1TNDA 3HSKA 3TO5A 1EA5A 1QO9A 2GF0A 1UT6A 1L5ZA 3V46A 2ZEJA 1XEWX 3QX3A 3KE9A 1P0PA 4NU6A 4WZBE 4RZ2A 3Q7QA 3T3PB 4B3MB 4F45A 1Y4DE 1MFZA 1DAKA 2C42A 4WNYA 3DF7A 3TRFA 3K0BA 4DUZB 4CR8A 3GCWA 3KUXA 1WW2A 4KFUA 3SR3A 2PKCA 3SWWA 2NU6B 4WPGA 5ECYA 3RSCA 4WVFA 3ZHQA 5IJ0A 3H83A 1AUOA 4XAQA 4Q9KA 4FWBA 2OCXA 2VRBA 2XVYA 4PQRA 3T7IA 7REQB 2Z1NA 1QOPB 1JVSA 2ZJ5A 4QOFA 1KYYA 2ZI3A 1FP6A 3BE6A 1ZUNB 1GNPA 3ES9A 3ZG6A 2QJFA 4AS3A 5CD9A 4WD3A 5DSZA 2B1RA 2F1RA 1R0WA 2O2SA 3K09A 3VH3A 3P5SA 1LFDB 2KYRA 4JR0A 4Y2GA 4YC7A 4YQFA 5FI1B