4XARA

Mglur2 ecd and mglur3 ecd complex with ligands
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
479
structure length
445
Chain Sequence
RREIKIEGDLVLGGLFPINEKGTGTEECGRINEDRGIQRLEAMLFAIDEINKDDYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARLRNISIATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAASRANASFTWVASDGWGAQESIIKGSEHVAYGAITLELASQPVRQFDRYFQSLNPYNNHRNPWFRDFWEQKFQCSLRVCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPNTTKLCDAMKILDGKKLYKDYLLKINFTAPDADSIVKFDTFGDGMGRYNVFNFQNVGGKYSYLKVGHWAETLSLDVNSIHWSRNSVPTSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Metabotropic glutamate receptor 3
publication title Synthesis and Pharmacological Characterization of C4-Disubstituted Analogs of 1S,2S,5R,6S-2-Aminobicyclo[3.1.0]hexane-2,6-dicarboxylate: Identification of a Potent, Selective Metabotropic Glutamate Receptor Agonist and Determination of Agonist-Bound Human mGlu2 and mGlu3 Amino Terminal Domain Structures.
pubmed doi rcsb
source organism Homo sapiens
total genus 153
structure length 445
sequence length 479
ec nomenclature
pdb deposition date 2014-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4xarA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4xarA01
3QEMA 3NHZA 1YS7A 4XAQA 1TMYA 3I09A 5KQMA 1U2QA 1RPJA 3HV2A 2RJOA 4RWEA 2MYNA 4UHJA 3CTPA 3H5OA 3RVOA 1DCKA 5CHYA 2GWRA 4M88A 2QXYA 3BBLA 3TMYA 4EYGA 3I5AA 1Z26A 2FEPA 4MGEA 1MAVA 1S8NA 4YV7A 4XXHA 4RY9A 4MR8A 4YWHA 3HS3A 4YCSA 3A3KA 3G85A 3BRSA 3H6GA 4KQ9A 5T3YA 4IILA 5T7BA 4ETIA 1JYFA 1URPA 2WMYA 3BREA 4G0YA 4L85A 4EVQA 3HDGA 3M6MD 3RVSA 2CD7A 3KCNA 1YK0A 1ZHHA 3CG4A 4Z0NA 4YS6A 1MVOA 1QNLA 1A0OA 1PEYA 3BRQA 1YIOA 4W5TA 1H9CA 1AB6A 2DRIA 3IP7A 4PZ0A 1XWWA 3FFTA 3OQOA 1JX6A 2IPAB 3H75A 4MS1A 3JPYA 4LDAA 4IMIB 1D1QA 3GYBA 1PEAA 2FLWA 3H1GA 2VUHB 3DGFC 3HVRA 1ZITA 5B3JA 3HJFA 2PUFA 4N41A 4G97A 4Z4FA 1ABFA 2L2QA 4N76A 4MS1B 1DBPA 4TLMB 5JNSA 2PLNA 2FN9A 3I42A 5E3JA 3JTEA 3MA0A 1TJYA 3CU5A 3H5TA 3O1IC 5F64A 5GQSA 1APBA 1K66A 3KLNA 3QLVA 3HXMA 7ABPA 5TPZD 1EHCA 1USIA 4WZZA 3KS9A 1ZGZA 3H5WA 5EWJA 5IEJA 2BGGA 5DLEA 2QR3A 4O1IA 1P2FA 1CHNA 1NY5A 3LUJA 5IC5A 4L4UA 4NICA 3TD9A 2A9OA 2IPLA 3EJWA 3RVRA 4EY3A 3KLOA 1I3CA 3JVIA 3C97A 3SQNA 2NZUG 3O1JC 4IF4A 2H0AA 2WY2D 4YR7A 1P8AA 2FQWA 5KC9A 4S04A 2HQOA 2P4UA 3HUUA 4RK6A 1K68A 5DCLA 1YTUA 2HJ9A 3O2JA 5TE9A 3LUDA 5IULC 5I4CA 4O1HA 3NHMA 3R0JA 1Z2EA 4QYMA 2PUBA 1ZN2A 1JHZA 5IUKC 3HEBA 3NNDA 3P9YA 4PE5B 4DADA 1QMPA 6ABPA 1XHEA 1RNLA 4MS3A 3VNAA 2GBPA 1PNTA 2YHBA 4Z4GA 1E2BA 3KYJB 1DC7A 2LUOA 3ROFA 5BQ3A 3FFWA 4W5NA 2ZWMA 1ZH2A 3HDVA 1SRRA 2OENG 3EULA 3GBPA 3Q41A 4MRMB 3TB6A 3H1FA 4RXMA 4NCAA 1B00A 3FMVA 3F7NA 1T34A 1M2EA 2PUGA 1QQAA 5JNWA 2R47A 3OQMA 3GV0A 4MS4A 4UHKA 3ILHA 4LZLA 5ABPA 1GCGA 1FQWA 1JF8A 3OLYA 4EUKA 4MQEB 5FBKA 1SXGA 2A9RA 1JWLA 2PE5A 3BILA 1BAPA 1DCMA 4RK4A 3GA5A 4LE0A 4RK0A 2RDMA 2FXIA 5HKOA 1ZH4A 2JB9A 2MSLA 1JDPA 1BDHA 5IBQA 3L6UA 3QX8A 5TQ0B 3RVMA 4WXMA 3F6PA 5FWYB 1NXPA 2JK1A 3Q9SA 2MSKA 3H5IA 4ZMSA 3A10A 4WWHA 5KQPA 4CBVA 5JNVA 4IMJB 5BRAA 5JNRA 2L18A 3FDFA 3LUGA 1JH9A 3C6QA 1TM2A 4P1ZA 4G86A 1BDJA 1QPZA 2YHAA 2MYUA 2IOYA 4KRFA 1WETA 2B4AA 1DRKA 4OLBA 1SXHA 3MMNA 5KC8A 3CKMA 4ETMA 4KK4A 1OXKB 1E6LA 1NXXA 2VUIB 5HQJA 1LK0A 2W42A 4F11A 3H5VA 3KHTA 3QEMB 2IYNA 4OLAA 1TLFA 4E7PA 3C3KA 2MYPA 5EWMA 4DN6A 5PNTA 4H60A 2CWDA 2F8TA 1DJMA 3LOPA 2IDMA 2QV0A 4RY8A 5IEBA 3CHYA 4MYRA 2PUCA 4MLDA 5FWXA 3F73A 2JCGA 2R25B 4MR8B 2PUEA 2XDYA 1D4ZA 1PHRA 1E6MA 3O2SB 1RXEA 2WJWA 4Q6BA 3IP5A 2QSJA 3S99A 2FSPA 2HQRA 3JS5A 4Z9AA 2PL9A 3GT7A 1Z17A 3TX6A 4ZJPA 1DCFA 2HPHA 3LUFA 3N0XA 2E4XA 1FFWA 1Z18A 5JNTA 4NCBA 1KMIY 2JRLA 4G0QA 3LUAA 1Y1LA 1USKA 4JAVC 4NQRA 4N0PA 4YLEA 1YK1A 4TLLB 3HSYA 3SY8A 2GKGA 4XASA 4O5AA 1D5WA 1LBIA 4W5QA 2FKAA 4HNQA 1M5UA 3JY6A 2E4WA 2FMKA 3NNNA 4N47A 4ZYLA 3KJXA 2RJNA 1ZY2A 1EWKA 1Z16A 1QKKA 3DBIA 3LKVA 5TQ2A 2LPMA 4P98A 1YMUA 1VRVA 1SXIA 2PL1A 1QP7A 2JVIA 4MAAA 1ZVVA 1P6QA 3OLXA 2HQBA 3M9WA 3LMKA 3MYYA 1Z12A 3N0WA 3QEKA 4H3HB 4MR7A 4RDCA 3MM4A 4RK5A 4RSMA 3OQNA 1R8JA 4MR9A 2V0NA 2B1JA 4D6XA 4Q7EA 1FFGA 3LFTA 5KWSA 2P9HA 3OM0A 1HEYA 3QLUC 4Z4IA 5EWJB 5TQ2B 1KRWA 1EWTA 1L5ZA 4NV3A 5JS1A 5C5CA 1NXTA 2L17A 3N75A 1F4VA 4JOQA 3DLBA 3QK7A 3RVLA 3QELA 5IX8A 1BDIA 4MR7B 9ABPA 2FLKA 3O1HB 3KSMA 2M98A 1KRXA 3Q7TA 4MQFA 5CNMA 3CRNA 8ABPA 3LTEA 4RY0A 2JVKA 1E6KA 4KZKA 2QVCA 1JFVA 2LP4Y 4KV7A 4YO7A 1EFAA 3I45A 1ZDMA 1DZ3A 4RK7A 4EYKA 4EVSA 5C5EA 1GLGA 1JBEA 3LUHA 2JBAA 3HUTA 4LRQA 4FB4A 3OLZA 3UK0A 4KPYA 5TPWA 1MB0A 4MS3B 3GBVA 4G0PA 2NUBA 3RH0A 5IUJC 4RS3A 5DKFA 3URMA 5KQLA 1J56A 1W9HA 3QLUA 3O21A 1U0SY 1BA2A 4LE1A 2LBPA 2FN8A 1NXWA 4PYRA 4TN5A 2JBAB 3SM9A 3MIZA 4RXUA 1A2OA 6CHYA 5HM6A 1GUDA 2HSGA 1JL3A 3KYIB 3N0RA 4JP1A 3IPAA 4JA2A 1M2FA 3OM1A 4JB2A 3LUCA 5JS2A 4MS4B 3UKJA 1FSPA 1GUBA 2FMFA 1NTRA 1CYEA 3EQ2A 1U04A 1NXSA 1VKRA 2FQYA 3MQ4A 3OLVA 4WT7A 3IDOA 5IUNC 1RZRD 2OQRA 2QW1A 5EWLA 3TO5A 3O2QB 4W5RA 1CEYA 2MYTA 3NNSA 3RVQA 3IP9A 3W9SA 2AYXA 2QU7A 4OTZA 3MF4A 1UDRA 2FEWB 2R4QA 3D8UA 5ED4A 3N53A 1JLKA 2N9UA 1DRJA 4QYWA 3OMXA 2TMYA 3KG2A 1PNRA 4JASB 4B09A 2FTKE 5TPZA 3SG0A 1YVUA 3N6VA 1LJLA 1ZGGA 4RKRA 3E61A 1KGSA 1FFSA 3L49A 3EODA 5D2CA 3H6HA 4FE7A 1USGA 3O75A 2PUAA 4FE4A 4KREA 4RU1A 4RZSA 3RVPA 5B3JC 3K4HA 2PJUA 4RKQA 3G1WA 4KMRA 3OO1A 5EWMB 2MSWA 3CNBA 1QO0D 4GPAA 5BR1A 1RXIA 3A0RB 2FW0A 3QX9A 4OBBA 1Z15A 3CFYA 4RK1A 2X7XA 1D2AA 5FBHA 3EDCA 2A9QA 3HK2A 1BVHA 1QQBA 5DTEA 4MPTA 3A0UA 4YGXB 3QLVC 3IP6A 4ZPJA 5FWXB 4S05A 4G0MA 1ZAYA 2NT3A 1QP4A 2PUDA 2CHEA 3DGEC 2KYRA 3HCWA 4KQCA 1C0EA 1ISSA 1DBQA 3FGZA 1SD5A 3GL9A 2ID7A 3VNBA 1LJUA 5KQGA 3NBMA 2O20A 4EYOA 2PAFA 1QP0A 3CZ5A 1U8TA 1OXBB 3OO0A 4GNRA 5KI6A 2ID9A 3CLKA 4EGSA 3M9XA 1DBWA 2L19A 3LKBA 3Q7RA 4E7OA 2PMCA 3T6KA 2E4YA 3CG0A 1ZESA 1LBHA 2NZVG 1EWVA 1GCAA 4Y9TA 1Z13A 2E4UA 1PUXA 2LIVA 4KNYA 3ILYA 3GRCA 4KFCA 4YP9A 3JVDA 1ABEA 1A04A 4HNSA 1NATA 3OLWA 2NT4A 1ISRA 1TVMA 1JYEA 3QLTA 2M1ZA 3LUKA 3DLHA 3RVKA 4IRXA 4QICA 1VLZA 5TQJA 1EAYA 4XARA 3RVJA 4LDZA 2AYZA 2GI4A 4HYEA 4WUTA 2E4VA 3ROTA 5CNIA 1RZRA 4MR9B 4Z9BA 4IGAA 4F12A 1M5TA 2FVYA 2JVJA 1VPWA 2GX6A 1U2PA 4DQDA 2WRZA 3EGCA 3HZHA 4JB0A 1D1PA 1F51E 2FQXA 4PEVA 1AB5A 4KK3A 4N03A 1C4WA 3D02A 3H1EA 4ETNA 4F8JA 5HSGA 3IPCA 2Q5CA 5CNJA 4HNRA 4F3TA 3QELB 2IPMA 4Q6WA 5GOTA 4W5OA 2A9PA 2PKXA 2FMHA 3N8IA 4F06A 3RVNA 5DGCA 1DC8A 2WJAA 1XHFA 4MQFB 1L5YA 4OG2A 4PICA 3E3MA 4KVFA 4MLCA 4MRMA 4XLTA 4D74A 2VK2A 4EVRA 1IIBA 2H3HA 4G0OA 1MB3A 4Z4HA 2QZJA 2R48A 3DZDA 2E4ZA 1DP4A 1NXVA 4XFKA 3HM9A 3RQIA 1DG9A 3Q15C 2FEKA 3F6CA 2IKSA 1NXOA 3C3MA 2I6FA 3SNKA 3H5LA 4RXTA 4MQEA 4QPJC 5TPWB 2FMIA 2QVGA 3GWGA 4LE2A 3EQZA 4N0QA 3T8YA 4Z4EA 1YS6A 3K9CA 1Z25A 4ML3A 1QO0A 5CNKA 1YMVA 2ZAYA 3CS3A 2WWVD 3FFXA 3KTOA 2WB4A 5TQ0A 2F8SA 5FWYA 1P6UA 4WXEA 2VYCA 4OATA 3OMWA 4D6YA 5JNUA 1JFSA 4G0ZA 1MIHA 2RGYA 3B2NA 1Z2DA 3Q7SA 4YRZA 3O74A 3C3WA 3SAJA 4TMYA 3UUGA 2J48A 3JPWA 4RV5A 5EWLB 5BRJA 2CHFA 1JDNA 4EYQA 4H3KB 3KKEA 3T38A 1W25A 3CZCA 4Z99A 3T95A 4ZMRA 3HO1A 4G0XA 4Z4CA 2IPNA 3EAFA 4LX8A 1JFTA
chains in the Genus database with same CATH superfamily
1JAHA 2WUVA 4II7A 4KJZA 2C2XA 4PR0A 2PXCA 3DMGA 4X44A 4KV9A 5CT5A 1W36B 2G5GX 5ICMA 1U63A 3OPXA 2ZRDA 4L75A 5IS2A 3K0CC 2GWRA 2OECA 4BVKA 2FEPA 1VPWA 3ERCA 4KKXB 4Y8VA 3MAJA 2OY0A 2ZUBA 1TC2A 4IDQA 1YDGA 3WBFA 4DRZA 2BUCA 4HTFB 4BNLA 4R0MA 2Z2KA 3B1JA 3E7FA 1T9GS 3K8YA 5LN1A 4JI0B 4QM6A 4LY6A 1CVIA 1GRRA 2IHBA 5K8VA 2EGGA 3ZIDA 5IASA 2FOIA 3FWKA 4G0YA 2C9BA 5REQA 1CS4C 4A73A 5ARDA 1HYHA 2HI0A 2ZVQX 3SHFA 4A3SA 5DHTA 4C08A 5BQXA 2IBMA 3JWHA 4XCVA 5CDHA 3T9AA 5MN4A 1VLHA 5C8VA 2A7QA 1YIOA 4ER7A 1JZSA 4NHEA 1PJCA 2DJIA 1H4VB 1NHWA 2H85A 4DM4A 1NKVA 4URWR 3WGTA 2EJBA 3NKLA 4OKNA 5AVRA 1A5TA 1C4OA 2F90A 2WICA 4WLVA 3UXMA 4LY0A 3E53A 1PGPA 3G2LA 1ENYA 4R3WA 2LXNA 2J46A 1KU0A 1MNAA 5B37A 5D8DA 1I01A 1RMYA 2XKBA 4I66A 3L0PA 4HAZA 3G5AA 2QAJA 1I7LA 3NTUA 3AO0B 2CWWA 3FNRA 3SQMA 3FLEA 2PLNA 4DCPA 2QRPA 1L6RA 2ASVA 3G02A 2QMHA 3GPLA 2DFDA 1E63A 1IY0A 2TRSB 3A2MA 3FSGD 3BRWA 4FLEA 4QUDA 4Z0PA 1I5RA 3CU5A 2G70A 3HHPA 4BJ1A 1RKQA 1K66A 3HDJA 3N5CA 3HXMA 4E5DA 1X87A 2QRKA 3NOQA 3WK9A 1YQTA 1EM6A 2EW2A 2HLDA 2YJ5A 3O94A 3PK0A 1R9JA 1W4CA 3KS9A 3FD8A 1AKRA 3GLGA 3IVMA 5DLEA 4BBPA 1C81A 2FUNB 3KOYA 4B71A 4BHTA 1HR0B 4Z54A 1O9HA 2CXOA 2DU8A 3AKCA 4BO9A 5KOHA 1EP1B 4KX3A 5IC5A 9GPBA 2WJHA 1ZCBA 5JAMA 3FDZA 4CG0A 5CXUA 1K98A 2GPAA 4DEYA 1U98A 4O2BF 1CUEA 1RDFA 3KM0A 5GM2A 5I47A 1KOJA 4OHKA 2AN9A 3DLCA 3KUKA 1IHUA 4I19A 3NTXA 2Z5FA 5K0SA 4K6KA 5EIFA 4XQ0A 3JXEA 5AKKA 2C03A 4JU8A 2BKLA 4AS2A 4EBBA 4JQZA 4MGHA 5L8VA 3G0OA 2CFRA 2CDCA 2A4MA 4HEHA 3SD7A 1E2EA 1SZJG 3LX6A 5SZKB 3DULA 4A6EA 1OXSC 2W98A 4WN3A 1DV2A 1EK1A 4M1TA 4DLKA 5I45A 1NWHA 3P2YA 2C2YA 4FDAA 1QIEA 4D1YA 1UJ2A 2OLEA 1FX1A 1E3QA 5K6RA 4DJFC 2ECFA 4LY3A 1GGVA 3DZHA 3FFWA 1WCWA 1L5GB 2DHDA 3JRXA 3MLAA 3ROFA 3C3AA 1SWVA 3PGA1 2BMJA 3NAMA 1P1BA 5ALKA 3RC1A 1V96A 1EDBA 2AJLI 2IEYA 5LWQA 1XALA 1I1NA 2W22A 3F7OA 2IGBA 2FR1A 4RJ2A 5A4IS 2WI8A 621PA 3MRSA 5KINB 4QLAA 4GAEA 2O7QA 2I65A 1UL1X 4W5JA 1R5OA 1B1AA 4V02A 2SKEA 5EJ2A 4Z49A 2QTRA 2OA0A 1FQWA 1WXHA 3S2YA 1A7KA 4RA9B 4PBTA 3VTFA 3VR3A 4NMMA 4MRVA 2A9RA 1QH8A 3VV2A 4KC0A 4RIEA 2DT8A 4Y1RA 3ZXXA 3MILA 2PE5A 3OLCX 2P9CA 1YRYE 4U7WA 1ZRNA 5HKKD 2XQKA 3DBLA 3KAPA 1IJFA 1FYXA 2IQ5A 3HVHA 4FEAA 4X94A 1ZH4A 3ZWWA 3NHKA 1E64A 1F0YA 3EQ8A 3H1BA 3HJBA 4K9SA 4EPRA 3WO1A 4RA6B 1J99A 1VXRA 5J4VA 3UF0A 3SC2B 2QVZX 3HEAA 1IU9A 4P5DA 5FUWA 1W76A 3FKSD 4O4JB 1BX0A 1G6HA 2P1DA 4RVOA 2XSZA 2YHIA 3PDIB 3Q10A 2CHGA 4H27A 4HTAA 3NCTA 4J0GA 4PRYA 5K3CA 3JATA 4Q66C 1DEHA 3UPDA 4AUKA 4JQCA 1N2HA 3EUAA 1OTYA 3BJEA 1LBTA 4Y67A 1VIMA 7YASA 1Z45A 3GZ4A 1GKLA 3K9LA 4NOMA 3OKFA 1P1HA 4LYAA 4KOEC 3FSRA 4BEVA 4RL4A 3Q2IA 4KWIA 2IZZA 4C3ZA 4YJHB 5JV5A 5HQJA 2O8FA 1T26A 3MGAA 4UEWA 4JP8A 5FIUA 1IDN1 3THRA 4BQPA 2MYPA 4UARA 1OA0A 3DZBA 3EYWA 2D4HA 2ZS8A 4IEEA 2H52A 5CFLA 3FWPA 2UVQA 1LD3A 1M2GA 5EY5B 3NX4A 4UBNA 2R1UA 4K9MA 3WE7A 1H4TA 2AX4A 2DYKA 5F2NA 3AEKA 5EPUA 2MR5A 1GYRA 1JXOA 4YRQA 3F73A 3ADCA 2HA6A 3OFND 1FRNA 3RSFA 2D2VA 2P6RA 1RXEA 1K7SN 4PANA 1UIMA 5IJAA 1RI4A 3IIJA 3VYVA 3H9BA 3L7JA 1OX4A 1J8DA 4Y1EA 2FUG6 2O3UA 4RTNA 2H4FA 3T9DA 4OYLA 5KSWB 3DH0A 2Q50A 5KYUA 1ZZGA 4O2AA 3RRBA 5AOCA 3IH5A 3RYIB 2QQFA 4PQEA 1ISHA 2H7XA 2OD7A 4HGNA 4L3VA 3SMQA 1DAMA 4Q24A 3VZSA 4URHA 4BQFA 2V03A 4F45A 1T3GA 2ICAA 3N2KA 3DHNA 3DONA 2ZBPA 3OIDA 3R7WA 2G0AA 4TV8A 4FGKA 2B4TO 3WSWA 4ZYTA 3WGQA 3O3CA 3HSYA 1SNYA 2YTZA 3DEFA 2D54A 2ZS7A 2WNIA 1RQLA 1KP3A 1NBMA 1TTQB 2EFCB 4M8LA 2NU9B 1QJ4A 2NZJA 1HNXB 3X44A 4MHTA 3CUTA 2C8VA 3OTQA 4I14A 4QUEA 4P86A 4Q1EA 4W7IA 1H5QA 1L7OA 3CNEA 4BNXA 2P4QA 2VYVA 5GJBA 5BSKA 1ONOA 1TTHA 2W6ZA 4P34A 2PU5A 4JI6B 1OASA 1YMUA 3QVSA 4MAFA 3GJYA 1HDIA 3CONA 1GWNA 2NACA 5CDSA 1Y8RB 2BJVA 4Z3KA 2WE7A 3ZIUA 3IX7A 3LMKA 3CE6A 3RK1A 4RK5A 1GADO 1L4KA 3GB9A 1FFXA 2XWJI 3QVMA 1JFRA 2GHTA 4O4HB 3T5PA 3UJCA 3WRWA 4KGXA 3X1ZA 1PL0A 3MXOA 3JQGA 3OP4A 4ARCA 4XR9A 2JFWA 1NUTA 4KXLA 4J0CA 3FJOA 4IV8A 4NV3A 3FH0A 1VJDA 4E2XA 5GAJA 5C5CA 2MT9A 3N75A 2A1UA 5AW1A 3EF0A 3PGXA 4GM4A 2C95A 4KQ6A 5KTOA 1I7NA 1T3HA 5F33A 2XNCA 4B7UA 3WV4A 1OR8A 3O1HB 3MTGA 2JIPA 4LIPD 1F8UA 2M98A 2W2OA 3EH1A 2OBXA 4F9GA 2YMMA 3ZDZB 3CLUC 3GFGA 4MITA 2ZRMA 4UAGA 3FOZA 3A3PA 3F5QA 2JVKA 2W2PA 2C4VA 3PQCA 4UU7A 3V7YA 2GCOB 4UFOA 5JYBA 1BFUA 5E7IA 1P2GA 2OGZA 4ZVOA 4B8WA 4QGGA 4BAGA 3Q0EA 1NQXA 1VPVA 2VRWA 3E1SA 3MRVA 4IHJA 5EPOA 3P20A 4EYKA 4H2DA 1JBEA 3LUHA 2BGRA 5B64A 1KYVA 1ZIOA 5EXXA 3UK0A 3W05A 5ELMA 4EABA 1G1AA 4OX9Y 4JB8A 4NFHA 1L4YA 1PFYA 3PVZA 2BWJA 5IF9A 2VRCD 1SBNE 3AM5A 4RQAA 5DHAA 3HUDA 3RH0A 5BN1A 1GG5A 1EX1A 4R1PA 4AO7A 4FM9A 5CLIA 2AEJA 2KS6A 1LBEA 4LE1A 1G0NA 4YCCA 2W6CX 1QKIA 2IUEA 2Q6TA 3QWBA 2WTEA 3UGJA 2ID4A 1NUUA 1V16B 2JIOA 2O2CA 3E8SA 1QHSA 3KYIB 4HADA 5D85A 4UD6A 4QNNA 2OM6A 2CGEA 4JB2A 1SVMA 1B16A 4P36A 4AF6A 2E89A 3UKJA 5JYDA 2FMFA 1C7EA 1OLXA 2O2YA 3I2KA 4AKHA 2EJUA 2VQ3A 4GFDA 1PZFA 3KKOA 3NEPX 3EVGA 1I0LA 1M0SA 5KYKA 3T1TA 3FCYA 3OE1A 3IP9A 1F4PA 1WPXA 1EYZA 2B0JA 2QZZA 3OJLA 5K9ZA 1E62A 2PLWA 4K87A 2R4QA 1X38A 3C98A 5H9VA 3WL3A 4FFSA 4O3MA 1PK7A 4V38A 4X3CA 1E5LA 4DUYB 5D5PA 4DQ0A 4D3YA 3I32A 4XD7A 2P5TB 4B09A 1THTA 1T5TA 1FSFA 4KO3S 4E5YA 4ER6A 1IQPA 4RKRA 1SVIA 1FFSA 1Y63A 3K4PA 1GZHB 4Q4JA 4J1TC 5KVQA 1SU6A 4FE7A 3CT4A 3UJ9A 2VH1A 2AXQA 3T4XA 3EAQA 1VI5A 3A6PC 1NLFA 1C4XA 2BHLA 3ZY5A 1LCIA 2PJRA 4YX9A 2CNBA 4F60A 2CNWD 1TT5A 3VDRA 1DKPA 4B3SB 3DJYA 4YP0A 2OPBA 4GPAA 4KVZA 1U8ZA 3VR1A 3ZGVA 1W5EA 1PFQA 3KTAB 2ZKLA 3TLXA 2FW0A 1Y5IA 4RTQA 4WY8A 4DJJA 4NHOA 4GX0A 5JZOA 3RYFA 3FDIA 2A9QA 2AF4C 4O33A 1PJAA 3FCCA 2NUPB 2HBZA 1UEJA 4MB6A 2PUDA 2JPDA 1FYFA 4CMHA 4A15A 2AZTA 1J25A 2PQMA 2JLWA 5BVGB 3EQ7A 4BV3A 1UKVY 1P1FA 1SXJD 3E7XA 3GL9A 1V95A 2ID7A 3PE3A 4IWNA 2ZSKA 3PDCA 1QCCA 4R2JA 3SHVA 2VYNA 3WWYA 2Q9UA 5ARBA 1GXSA 1P2VA 5C2JB 3EGDA 1JAXA 1J7KA 3ET4A 3JR3A 1YHNA 5BMOA 1ZR2A 1LZLA 1NFQA 4C14A 4TYWA 3L8EA 5A5FA 3NEYA 4EO4A 4TRMA 4CLRA 1EIZA 4Y9TA 2IWHA 4P7GA 1SBQA 4Q05A 2I1QA 3RREA 5BMVB 3FMFA 4L0CA 3G2HA 2BSAA 1Y6JA 4UU8A 2JIBA 4AY5A 1GG8A 3RODA 1IN8A 3FN4A 4OQYA 1AKEA 3EK2A 1F60A 1CE8B 1K3TA 1EVIA 1A04A 3OFKA 1XXHA 4PNHA 1EVJA 4QUKA 1IE3A 1GNPA 2V4ZA 1HYEA 1LRKA 3G0HA 4PC3A 2H5JA 2VNJA 4DJTA 4IX1A 5D87A 4CUKA 3X1WA 4NEQA 1M6VA 1YUNA 1Z0IA 3CRMA 4MB0A 5LC1A 4X85A 1LWOA 1XX6A 2JFGA 2YHUA 3STHA 4B5LA 2QX7A 5CNIA 5T8KC 3VSCA 2CK3A 3LUPA 1E1CA 1M5TA 3M5CA 4WOCA 4EBFA 4P54A 4HB2A 1HORA 1U2PA 1WMFA 3S8MA 2XYQA 4UNRA 4JB0A 5EUQB 5IT5A 2XT6A 3RC8A 3GJRA 3ZI0A 2REOA 2HRQA 4TKUA 1YJQA 2QP4A 4OQZA 4CT4B 3BMNA 1Y3FE 4CKYA 2BY4A 5DRTA 2I8AA 3OA0A 5I51A 4GBJA 2I4RA 2XXAA 3PCRB 2OZLA 3TRDA 4LV6A 4FYKA 2ODWA 2R97A 1PD0A 1KYXA 3LWBA 3NUGA 3PP8A 4MW5A 5BN4A 3KLBA 2PSJA 1B23P 2IYRA 5GV8A 2RHTA 1JIQA 4E07A 3OIYA 2VTEA 4FHGA 4I1IA 5CFMA 4MQ4A 4HGPA 5F78A 2BR3A 2Z2ZA 1P75A 4BCBA 1G3UA 4JFAA 2NTNA 1CEEA 3HM9A 1S2IA 1SWWA 3ETHA 1ATIA 1SQ0A 4Z9XA 1DG9A 3QFFA 3NPAA 2CMDA 2PUJA 3K94A 2PZJA 3KLPX 4KIUA 3DNMA 5D3MA 3BTSA 2OVBA 5A4MS 4U7JA 1CUVA 2Y1EA 1O1YA 2VJLA 2CXXA 4GOND 5EG5A 1CRLA 2QPOA 4ENWA 4BO4A 2E1PA 1JSRA 2HV9A 2VZ9A 3U3ZA 1TO2E 4UPEA 1MD9A 3FOBA 4N7MA 3DKKA 4EG1A 4EO9A 2PKEA 3W8NA 4WXEA 2WJ3A 2ZJAA 3EXHB 5K3OA 2PAAA 1HZZC 3IBYA 1WY7A 1TZBA 2P69A 4NZMA 4QAQA 4I9FA 5B57C 2HUPA 3UATA 1SH7A 1M1NA 1WMSA 2O0MA 2WTAA 2ZSDA 3Q7SA 5GONF 1KSJA 1L7RA 3NXSA 4B85A 1HRDA 2VT7A 5LQDA 5JY1A 4KR3A 5AVWA 4OXIA 3BTUA 2VZ0A 3AP3A 3CUSA 2F4NA 3KYDA 1Z68A 2BFFA 3D4OA 4JLKA 2WJYA 1G41A 1ZVQA 2Z83A 2J3EA 2VPWA 2Z57A 2ORVA 4Q01A 3LPDA 3KCQA 3SSMA 1QGZA 5E6SB 4Q7QA 4I3FA 1RCUA 2EIHA 2XXBA 4NBVA 1BMDA 1EFRD 4O08A 1J21A 3NBQA 3P9PA 3OU2A 4P3XA 4QTXA 1D2NA 5TMDA 5I7HA 4IO0A 4HG2A 1GV1A 4N6NA 4B6EA 4DIMA 4ZC8A 3L40A 2X1LA 3IALA 2ZSBA 3N7UA 4BATA 4EYGA 1DQRA 2FSIA 3HPQA 2AF3C 1S8NA 3EOZA 4LJ4A 4OHRA 2QD4A 1PV2A 4G5HA 4XE5A 1R6XA 4DHWA 3ZZUA 4N7JA 5JASA 4WZAB 3H6KA 3SEZA 4I9NA 1R16A 4Z53A 2GJSA 4ZEXA 2FX3A 3A6KA 3W04A 1FFDA 4URFA 3GELA 2H4HA 3EFHA 4FWTA 4YASA 2WT9A 4DSNA 1HT3A 2B35A 4IILA 1J07A 3BM5A 4N3CA 3TQTA 5ECDA 1O6BA 3DTTA 4YEDA 4EVQA 1O58A 3EVBA 3R5HA 1JGTA 3BJRA 5C53B 1BS1A 1A5SB 3H2HA 2MMGA 4YQYA 3KQKA 1LW6E 4ZT7A 4P4SA 1T8YA 2QRZA 3VPBA 4JLAA 5LXTF 4IH4A 4J76A 1U0JA 3PS9A 4TMWA 4RJIA 4YFYA 2A84A 4L4RA 4ENSA 4Z3OA 2BFCA 3V46A 4E94A 3S1SA 1VLVA 1PLJA 4MP3A 4GWLA 1QBGA 4EGFA 3PNOA 4U8HA 1JP7A 3AY6A 3AF1A 5FV7A 4ZQHA 4AG3A 3FJ1A 3WISA 1MB2A 4UU0A 4Y6SA 4C3UA 3OJ0A 1QBKC 3W3AA 1MF7A 3OY2A 3O95A 3ONNA 5JADA 1PLKA 4RGYA 1UMKA 4V0LA 3DLAA 5KQSA 3AC0A 5K0CA 4LBWA 4B73A 1SEVA 3QFHA 1FUIA 1J8YF 3L4BA 2F3RA 2CZCA 5BPFA 4JL8A 2GEVA 3CRRA 3PRHA 1LPNA 3VR2D 4ZDIA 1FB5A 2YVUA 5AVXA 3DHVA 3CXRA 4QRIA 4S24A 4A92A 1A7AA 2FZLA 2RGWA 5B1SA 2O3SA 4IIBA 4MGKR 1RKBA 3PNLA 3BL6A 5JZVA 3GJ4A 1TUIA 2BI7A 4OGGA 5KAMA 3PPXA 4O2BA 1EG2A 2BGGA 3EHEA 3BDIA 3P94A 2ATXA 1C1HA 3FZEA 3D3WB 2AFIE 1HL3A 1RJGA 2C7VA 4LUCA 3TTWA 3IEMA 3QZUA 1NY5A 2WSSA 1HE4A 1IG3A 1G5QA 3FGOA 1RVV1 2IPLA 1LV7A 4B43A 1I3CA 3JVIA 4OJNA 1PTJC 2X0DA 3ZGOA 2NGRA 1QDLB 1WDMA 3ABOB 4BP8A 1IQ0A 4JLBA 4EA7A 1WUYA 2RGCA 5ALIA 3VMFA 1XZ8A 3DEKA 2RHMA 3ONDA 5DMHA 5FBRB 2WAXA 4RVGA 3R44A 4WOKA 3H4IA 5IM4F 5CLJA 1QLHA 3LBNA 4K3VA 2VP0A 4PZUA 1EQUA 1MN6A 4LJ6A 4CKCA 1JAZA 2Q9CA 1IB0A 2A0KA 2Q8QA 3D2AA 3IEIA 3UIEA 3UK2A 2IF2A 5JEDA 3ABQB 4D25A 1M8PA 2XGOA 3DB2A 3EDMA 4UHFA 4DLXA 3Q8LA 1FW8A 1MO4A 1QK3A 1Y5LA 2Z9CA 4EJSA 2FLVA 1O5TA 1UJNA 1AHNA 3VI3B 7REQB 4TWRA 4M7PA 1B43A 1VSTA 3N2GA 4DAEA 2J9XB 1X9HA 1ITZA 2Y66A 2ZYSA 4C0HA 2GS9A 3TI7A 3VISA 2AOTB 1FDVA 4HB3A 3NXKA 2IXFA 3CUWA 1CW2B 1AXEA 1PI3A 3E2PA 2FETA 1YV9A 2ZU0C 3FPJA 3LVQE 4YFVA 5DNWA 1GCGA 2PGXA 1JF8A 2C04A 2HX1A 4C6TA 4H59A 3CW9A 2IH2A 1M34A 3GRYA 3H7AA 4MUNA 2B78A 4WK2B 4EW6A 4X65B 1S96A 1GZUA 5GGXA 4Q12A 3BIXA 1E0KA 2IPXA 1HFWA 3V8VA 2IBTA 2C78A 1OC4A 4J0EA 3HR4A 1BDHA 1CJKC 1UM9A 4OAQA 2QM7A 2X5JO 2XV1A 3AEQA 2XMCA 4C6SA 4M37A 2IZ7A 2YOHA 3OZRA 4EWLA 4CFZA 1NQVA 3NKVA 1KXZA 2W11A 5TS2A 5IKPA 3SKXA 2ZE5A 3W8RA 3B6MA 3UAWA 4ZCMA 3K2EA 4DE5A 2BPOA 3KHUA 3W2EA 1I6KA 1QH1A 3QVGB 4RESA 4RTRA 2J5XA 1FVOA 3FDFA 3E3AA 3EXEA 3W5BA 1TYAE 2CUZA 3M6VA 3ZHYA 1TVKB 4CKWA 4NMLA 3HVIA 2WINI 1LGYA 2CLDX 2IOYA 4O4LA 3DMPA 4KRFA 2PUEA 5EL0A 1RAEA 2V7PA 4GBED 3AUSA 4NR0A 3TTXA 4HWTA 4RLQA 4BMVA 1WMAA 2P2SA 1K3FA 1RE0A 1T13A 2GCGA 3FSGA 3L5OA 3M6UA 4KGZA 4KHZA 1QWSA 3U1TA 3UWDA 1ZINA 1ZNXA 3CVJA 1N6IA 4FSXA 5A5DA 2VTKA 1H42A 3WHIA 3CX8A 5EWMA 4YDRA 5PNTA 2A58A 3IAS6 4XDGA 3INRA 4OB8A 1S89A 1G3QA 1JG6A 1DJMA 3W8FA 4QDJA 3LOPA 3C5EA 5DGIA 3IUEA 4G9EA 1X7ZA 1Q50A 2FCRA 3H8JA 2LZ0A 3EIQA 3U4GA 4G5RA 4JXJA 3TNLA 4ARSA 1ESCA 2YUIA 3IQZA 3MTQA 2DTDA 3S99A 3RARA 2PG3A 4U2DA 2W8BB 3V97A 2BEKA 1DJOA 3ZHBA 5DOZA 3GEGA 2RGNC 1GNSA 3PXCX 1JR3D 4PCVA 2DKFA 3DKVA 2HH9A 3ELDA 1KARA 1JIXA 3JQBA 3WQQA 1Z4KA 5IJXA 1FLNA 4LRSB 3A14A 5EZSA 5DN6A 4TM8A 2W6JD 4LMPA 1JLLA 4ZI7B 5LP6B 4NYJQ 3KU1A 1ZICA 4N0PA 4ROTA 3H05A 1QYRA 4XASA 2P2CA 4DCOA 1KI6A 5C81A 3SK0A 5F76A 2BELA 3P52A 1C3OA 2GNPA 2I2DA 1Q19A 3NNNA 3ZJUA 2FAXA 5EQTA 4GOOD 1R0CA 1LPMA 3MAGA 2VQSA 1IZ8A 3RF7A 1GNLA 4UAUA 1UT8A 1ZLYA 3TZHA 4UHCA 3TEJA 2C2KA 3T9CA 1ZISA 1CT9A 3NGLA 2QTFA 3SU8A 4KXYA 3ZQ6A 3I6QA 2PRZA 2KBEA 2IGTA 4KR9A 4BMPB 5ILOA 1BHJA 1J2EA 2P30A 1TEXA 3IUSA 2NVUB 1UEXC 5I9IA 4GRDA 5A4JA 5ALFA 3RTDA 4H3HB 5CYOA 3G1UA 3QBDA 3KWJA 3CSUA 5T3UA 1YRWA 4X8OA 3VC1A 3E5RA 5DOVA 1KHTA 2I66A 4FDUA 1RYBA 2PUHA 1HEYA 1KU6A 3H4MA 4IV5A 4PG6A 5HKKA 4Z4IA 3FYUA 3WYEA 4ZYXA 4LPSA 3GJ5A 2PDAA 5A6SB 1WMDA 2VH2A 4DR2B 1S3FA 4CG1A 1R8YA 4L73A 3PEUA 4B80A 3BMQA 3I9LA 4P82A 9ABPA 5I3ZA 2ZQYA 1F6WA 3FKSA 4MJLA 4OSOA 4X41A 4XPIB 5H81A 3D6HA 1THMA 2FH5B 1AZWA 4KJXA 5EFZA 1RACA 4YYZA 1A5ZA 1ZCFA 1TM4E 2Q28A 3SCZA 4AXXA 4GYWA 4FHEA 2B9EA 1YF3A 3HPRA 1KYTA 4RVNA 1MOPA 1QAOA 1SCJA 1ZDMA 2AOVA 3IAEA 3MWGA 4RK7A 4G25A 4QFBA 4R2WA 1E3WB 4HWGA 4R1MA 4F4IA 2A3NA 3C1AA 2QN8A 4QPPA 1R2QA 4EQZA 4ND4A 4FB4A 1EX9A 2R60A 4EG8A 2ZSFA 1N78A 4FS8A 1A8PA 4RD3A 3HLTA 2EL7A 4V0ME 2TECE 5E1OA 3AESA 3BF8A 5JS7A 5JZBA 2OSVA 2GK6A 2GFIA 4K9LA 2WEKA 1YH3A 3QPAA 4F92B 3AONB 4PGFA 5K03A 2O59A 1VLLA 4ZYUA 2HPZA 4M9XA 1XMXA 2ZIFA 3R09A 2GPJA 4LF5B 3ENQA 3U3KA 1UFOA 2VPXA 3JVUA 1VLJA 2P62A 4M3NA 4ZZ0A 3OFNA 3WKAA 3VKFA 2R9VA 1A8HA 1IY1A 2YWXA 2HIAA 3KJGA 2PYZA 1ZH8A 1A97A 4JLPA 1UUFA 3MK31 3WSVA 4DR1B 5DU2A 2QT9A 4AVYA 1PG0A 3F8WA 2HCTA 3CMMA 1ZUD1 1LEHA 3FNIA 1A5AB 3PTLA 3TBHA 3W9SA 3TL2A 2E55A 4ITVA 1E18A 3KXDA 4N9WA 4CIDA 1WX1A 2YZGA 1Q92A 4FN4A 4X6UA 5ED4A 2J9RA 2WUEA 1WEKA 1UQRA 1WXWA 2BAGA 3AR6A 3F6SA 4MPRA 4U7FA 4XPZA 5D00A 5KYTA 3OMXA 4K6GA 4ALJA 2FWBA 2I22A 1GU7A 1CQIA 2IP2A 4AJOA 3PE4A 3AETB 1P4HA 4YP6A 1YA4A 3VAYA 3JD4A 3AI7A 3B20A 3TLZA 1UDCA 3SG0A 4C0JA 1E5XA 1WSDA 2SBTA 3DKPA 2BI4A 4PS1A 3SX4A 3WWOA 1TOAA 1YKGA 2AXEA 3BULA 3EODA 3TVTA 1BCRB 3KO8A 2H48A 1XNQB 1NIPA 1WQ3A 2HO4A 5T4EA 1L9KA 4RGVA 2Z8ZA 1Z74A 4BV9A 2BGNA 4RU1A 4TXLA 1JALA 4YUXA 3O93A 4M0UA 4P7KA 4C0QC 3O8OA 3L4KA 3I6IA 1Z63A 3V80A 2F59A 4L3WA 3FB1A 4CF7A 4FQ5A 1LPBB 3L6DA 1G98A 4MQMA 5GY7A 1RRVA 3A4TA 1NVEA 1ZBDA 2VJDA 3OLQA 4GSKA 1TZJA 3LHDA 4RLHA 3PJEA 3TLGA 4KRYA 5KYNA 3V7UA 3L41A 4FE3A 3GPBA 2PBLA 4E0BA 1I36A 2YOFA 3ZBQA 1E9CA 3WDMA 1GZ4A 1CB7A 1P4JA 3DVSX 3P96A 2PH7A 3A6ZA 4LZOA 1XLWA 3R3UA 4GW3A 1Q77A 5G1NA 1J8VA 1L5QA 2JGAA 3AY0A 3D5QA 5FHQA 4CCAA 5I9NA 1C14A 3RAJA 3GWZA 2JGLA 3LZDA 3ELWA 3DAYA 1OXBB 3ROXA 3B9BA 2XYVA 5KI6A 2ID9A 5ITWA 4TGLA 4DV1B 1XVIA 1IK4A 2XMPA 1M2NA 2QNBA 3L8FA 2RG1A 3B2QA 2V5VA 3FRIA 1ECFA 3W5SA 3KOMA 3VZPA 4OVKA 1YRAA 4CEHA 3E9ZA 1ZM2A 2JRCA 1RM3A 2NZVG 2OCGA 4GPZA 4F9FA 2NTJA 4GWGA 1U0LA 3FXAA 7GPBA 4HD8A 4K8RB 4P2BA 5GZ6A 5DSTA 2QPLA 2VRCA 1QIIA 3ROKA 2UVPB 1J1UA 2MSNA 1Z7WA 4B3TB 3GVXA 2NT4A 5IKOA 3UJDA 1RYHA 5BSTA 1TPYA 4EP1A 1OTXA 5JXJA 1OFTA 1RRMA 1UH5A 1V71A 3SXUB 2I3ZA 2JJ2D 4LC9A 1ZD1A 3GPDG 4JA0A 4MYCA 3L4JA 1R0KA 3KWMA 1HMPA 4OB7A 1XNRB 4J9VA 1OHHD 4DBLE 1E0SA 3GRVA 4TLEA 2GEDA 3OUTA 2FVYA 2G80A 5CR9A 4GKJB 1Q7GA 4Y7CA 4IDCA 4W8OA 2PKYX 4DXHA 3D3EA 1YR9A 2AIRA 2X2FA 3OU7A 1GPKA 2VDWA 4PLHA 3NVDA 5CU7A 3WMRA 2VIIA 4PBRA 4TSFA 1L7QA 4FMDF 4KKVA 4X92A 2WA2A 3MBOA 2NUAA 2IV7A 4BNKA 2EEZA 1XHFA 4D46A 3BWDD 1XNHA 4EJ0A 5A9SB 3GGGA 1KEUA 2CXUA 1F4LA 4QQKA 4RVSA 1Z06A 1H0SA 4FZRA 3N8NA 1G3MA 4NS1A 3DUFA 2H3HA 3I92A 1YFLA 2QUHA 2WC1A 4LRXA 1YE5A 4LYGA 5I48A 4D0GA 2C4UA 1VXOA 2V98A 1JR2A 3A37A 4EGCB 1US8B 5AKEA 5J3JA 1HE5A 5KKCA 4RXTA 4YWJA 1BEEA 4C4AA 5AKGA 2E6KA 4TMKA 4D2IA 2CNWA 2E5LB 4WN9B 1IUPA 4IEFB 3HDTA 4TTJA 3A1DA 3K9CA 1BWRA 4AIIA 4ZYWA 5IJ0A 3OE4A 2WWVD 4C4RA 1JFFA 4H7FA 4B47A 2ZB7A 5GONA 5G4KB 3NHSA 1Z4QA 3HY6A 1HT0A 4ZOQI 3OCJA 5F7JA 5KVVA 4ALMA 2BKEA 3LHIA 3ZE8A 1QONA 1DEKA 3MTBA 1V47A 1H65A 2J0EA 4CKEA 5JNUA 3VZBA 3C24A 2G5TA 1KF0A 5AJZA 3BGOS 3LT4A 4EHHA 1SXJA 1XRLA 2JIQA 1SKQA 1L5HB 1Y8QB 4Y9SA 4EI8A 3IPYA 2JANA 5IWCA 5LQJA 3K0BA 2XGJA 3VSDA 5FLXA 4A0SA 4V0KA 2A14A 2G36A 4FHFA 4AM8A 2PM8A 1DG1G 3HO1A 1RXUA 2QMZA 1YR8A 5CX1A 2DR3A 4DYVA 5C46F 1PW7A 2X8BA 2FY8A 1A9YA 3L1VA 3I01M 2BOVA 1NJ8A 2PH3A 4IY1A 2OWEA 5JRZA 1HI9A 2NQ2C 1J2UA 2V4UA 3F4LA 3V6MA 9LDBA 3TQIA 5LIPA 4WA7A 4M1OA 2MYNA 1TX4B 3DAHA 4UHJA 1ETHA 1S2GA 2Q99A 1BZYA 1NBWB 3ZZMA 2DQZA 1DWUA 2XRFA 4B76A 5ICEA 1U8EA 3QPCA 2VDNB 2WLSA 3D3NA 2CXTA 2YWFA 1RKVA 4E6EA 2XEXA 1MT0A 2OGSA 1P72A 2ZYVX 2HWUA 2VPIA 3I6ZA 3ZK7A 2D06A 3A3KA 4BO6A 1UPBA 2GHQA 5LXTA 3ML1A 1QCYA 1P29A 5KSYA 3LQFA 4F6RA 3ZVNA 4DCMA 5ALHA 3NRBA 1DV1A 1B42A 1G9XA 4BUCA 2P6PA 2GRUA 1UJ5A 1KEPA 1E79A 2WOJA 4BEJA 3BD8A 3C5HA 3W5JA 3SX0A 1H9CA 1QNLA 1EPUA 4RV4A 3ZBUA 1SIUA 2PR7A 2VDOB 1UBUS 1NZDA 1QUFA 2FPKA 2P65A 4G5QA 3TXAA 4BLTA 3SXPA 2J9FA 1S0UA 2CN1A 5BUZA 1CYDA 2VKTA 4RVHA 4DA9A 5AKXA 4MS1A 3GVPA 2ATEA 1Z5OA 3FHCB 2WLTA 2I4MA 3G8DA 1XJWA 4LSWA 1MJ5A 3SZGA 4AX8A 1FNDA 2X1VA 2FJUA 1M7HA 3DE0X 4FYPA 4HQ0A 1JDJA 2FLWA 4D3DA 2A59A 3FHLA 3H1GA 3HA2A 4URZR 4E5PA 5NLLA 1T2AA 3TDNA 3ZE7A 1I94B 3BG5A 1TO1E 5B3JA 3TFWA 5IC6A 3X2SA 2PUFA 1CUSA 1EG7A 1M3SA 3HJNA 3SHWA 1TJPB 2D7DA 3CNQS 5AVVA 1EUCA 3K96A 3OPMA 4FKZA 5TJHA 5MN5A 1V1RA 3EZ7A 2FGJA 2VJYA 1CETA 1UMCA 2ZANA 4QNRA 3HR8A 1N9ZA 1N6HA 1EK5A 1PR2A 3KKNA 3OI7A 3CW8X 4HLQB 1FP4A 3H1AA 4EJFA 2EHJA 3AB7A 1P0MA 3N07A 2R4TA 4D56A 3NTOA 1UXGA 4UASA 4V1CA 4I36A 3SFVA 4JT8A 2P2GA 3BOSA 4FYMA 3RS2A 1HG1A 4I1YA 3FFAA 3PNQA 4IXTA 5E0KB 5LL6P 1U28A 3HP1A 5IM4A 3LXXA 1GT6A 5AM1A 4L02A 2OORC 2GAAA 1SZPA 3U4CA 1RXWA 2QXUA 5HWSA 3P71T 1ST2A 2OFOA 3NBUA 3NWOA 1ZUWA 2CJFA 1SKYB 3JCZA 1AGYA 1TC1A 1DZIA 2RI1A 5I4CA 4KQXA 2MDTA 2G4VA 1H3EA 5AFSA 1CKEA 5ALZA 1I0ZA 1K6MA 1RRCA 4LRUA 1VM6A 4WZAE 1JB9A 1G2PA 5H3HA 2AWNA 3Q40A 4G26A 1DAEA 4JC0A 5JS8A 2HA7A 3RSZA 1XO1A 4G09A 3RKSA 5DNVA 4D0RA 1WDKA 2C4HA 2NAFA 2H2DA 4RD0A 2ZT5A 3EOAI 3KQVA 3OEWA 3TPCA 1KDTA 4RLFA 3KQOA 4GOLD 3W6PA 3ZKAA 4BQRA 2G8NA 4BNTA 5CD1A 4HYTA 2OENG 3PNBA 4J3NA 4DZZA 3W0LB 3P4XA 3N2NA 5BSRA 1VSQA 1U1IA 3LI2A 4DW8A 1XFDA 3OQMA 3GV0A 2VZEA 4DAOA 4BN5A 1QIMA 3DZGA 1W5FA 3K6SB 3OLYA 3QEOA 1SOAA 4LJKA 4MQEB 1GTL1 1FFAA 1CY7A 4PTYA 4C87A 4DFDA 3V4SA 1WHSB 2CHVA 2ZUVA 2VJMB 3O0DA 3MJEA 5A6VA 4XB6B 5G0UA 1IH8A 1RFGE 2FXIA 5HKOA 1BC5A 3AP2A 1J1IA 1YFKA 1GDTA 2DGDA 4I46A 4P92A 5THKA 1KI8A 2OHHA 2WF7A 4KXVA 5FJIA 2JK1A 4RJKA 5BO5A 1Q22A 3BERA 5KQPA 2R1ZA 4BFLA 1OWLA 4S1PA 2R1TA 4IMJB 4MW6A 2P27A 1J5PA 4UBLA 1VDZA 1GPAA 2FN3A 3OE7D 3V4VB 1WZNA 1J0AA 2BW0A 2IY7A 3V1MA 4KQJA 2DLCX 4ZDKA 1QH9A 3U80A 2WQ6A 1HE8B 1E2GA 4R7GA 4CLOB 3C6XA 3DHYA 5FX2A 4OL0A 1TECE 1XLTA 3S40A 4XW2A 3PGJA 2EVWX 5FOSA 1SXHA 3D64A 2GFHA 3VR2A 1XEWX 2WV7A 3I9FA 4EHKA 5KOJA 1T5DX 1V5EA 4YBRA 3VU9B 2AMFA 1UODA 5HA5A 4YMUA 3VZQA 3AVWA 3O4FA 4C4OA 3R9KA 1QB7A 2VP2A 4D9KA 1X19A 4DB2A 3I9JA 4H1HA 4IYRA 3ANLA 4TZ0A 4YJ3B 1T0PA 2E4AA 4KWCA 2VSYA 1YU6A 4Q9JA 1XDSA 5FV4A 1TO6A 3DBVO 1P2UA 3WLEA 2QUZA 2V6MA 1QTQA 2NYRA 3K0HA 2I87A 5FWXA 4ZCTA 3UANA 2Z4SA 1RIFA 3C48A 4X60A 2IHUA 2WSLA 5EJAA 2ZRIA 1KJ8A 4P5PA 3KEQA 2X6RA 4RD4A 3ZE2B 6NULA 3EGEA 3DKIA 2PEYA 1M2OB 3V42A 1MTZA 5LNK6 4UOQA 3ZGNA 1IVSA 2MJLA 1ZHFA 3IBGA 1FFWA 2G17A 1D7OA 2PUWA 4S1VA 1UPTA 4ZRNA 1LPAB 1SUFA 2CL7X 2EJCA 3K70D 1Z08A 4B8YA 4G0QA 5LDDC 2FU5C 3ZJTA 3RSQA 1JLRA 2NM0A 2V45A 3SBOA 4LKOA 4M0DA 2NAPA 3KZMA 5FBVB 4RQTA 1TU4A 2E4WA 4N47A 4F4FA 1SOVA 2VHCA 4ZYLA 1R6TA 2Q0HA 5E3HA 1Z07A 2V4MA 5FNVA 5FQOA 5FPYA 1SU7A 3B3JA 4HDQB 2RKBA 1B6GA 1S2NA 1WPRA 1JEYA 1Y42X 3MGGA 3LTNC 2WJPA 3GUHA 4CQMD 1BMQA 4HDMB 2PGDA 2ZG6A 4ED9A 3VKVA 3BAFA 4HUQA 4XZ3A 1BIFA 3D0RA 1UXOA 3ORYA 4NRDA 4AD8A 1LH0A 1XYGA 3S7TA 3ZNQA 5DYIA 2V0NA 3B2EA 4H0NA 2Q4TA 1K5DA 1ZU5A 5FBWB 2ODBA 3KSAC 2X22A 5DW3A 1T9AA 5DNYB 3DDHA 3DL0A 2A0XA 4WDQA 4CG3A 5CJPA 1Y4UA 3BXEA 5KNLA 4JBYA 3L0YA 4QHSA 4AZVA 4DPKA 1NXTA 2G83A 2HOQA 2NYAA 2CJWA 2QTNA 3QXXA 4FHCA 4FMDB 4FUQA 4B3BA 1OXVA 1EQAA 1UKYA 2Q07A 3QELA 2PR2A 3LHSA 4UNSA 4AMBA 1JJFA 2EAUA 1FPMA 2EC5A 4U8GA 3NBXX 4YAKA 3FI0A 4E46A 4MQFA 4D44A 1ZCZA 3LTEA 1R0BA 5K2OA 2Z6UA 3GMTA 1OI4A 2VWGA 3VTAA 2JFZA 4Q9DA 2ZOSA 1ZONA 3WNVA 1UBKS 3M6AA 2RH5A 4KIWA 3TJMA 1JMKC 3LDGA 4I6GA 2NSYA 3A4IA 4BZQA 4WBXC 2CDBA 1NR7A 3GEHA 4BX8A 2EKDA 4MEBA 2BGTA 2CMGA 5JD3A 3B52X 2QBYA 1XA4A 1UK9A 1FYEA 2HLNA 5GQSA 1W5BA 4PTLA 2W93A 5DXFA 5SY6A 3K0AA 1R74A 1L7NA 1K86A 1YZHA 1R4AA 3OQ1A 1QYCA 1P7VA 6ADHA 2AMLA 3DMDA 2XYGA 4KE9A 3VPFA 1H2AS 5HRCA 3RC7A 1HC7A 1A9OA 4PNZA 4JP1A 5K0NA 3RYHB 4YIHA 2C58A 4PONA 4L4XA 4Y2HA 3QPWA 3I8OA 4EITA 1D0IA 4YAJA 2RHHA 3EGVA 2H4ZA 3HRIA 5I7EA 5LU8A 4HQKA 1QGAA 4G4SO 2Z2XA 4PRKA 2WYUA 3JQEA 5LFAA 5M7EA 1Z6PA 3O2QB 2KLHA 2QLJA 4YRPA 3FTEA 1YDFA 1ECJA 1W9MA 2QUAA 3ROEA 2B1GA 4EF6A 1KDRA 3NHRA 1MHTA 4N3AA 2VO1A 3E3LA 2Y4NA 4UPVA 1VKJA 2HKIA 1KAQA 4JKYA 4M1EA 3UMJA 5FTLA 1UPAA 2G67A 5JCPA 1JLKA 5EJIA 1L5MA 5IJ9B 1S6YA 3L93A 5EE1A 3GLHB 2NSDA 2R6DA 4N3BA 4ME6A 2KX7A 3EQ6A 4AJIA 4HVLA 1W4ZA 5F2OA 2TMYA 1FUKA 1CJUC 2FZ5A 2CEAA 4C4TA 2NXWA 4WKGA 4LTMA 1EK0A 1BDMA 1LW7A 3B6EA 3E81A 3N5KA 3QMMA 1YVPA 4MVJM 4N54A 1FNMA 3HA3A 3AY7A 3JQRA 2G77B 4ARUA 2JBWA 1HDZA 3W3AH 1AKNA 3AF5A 1UKCA 5T4HA 3UPUA 4ID9A 3ZXYA 2WPDA 4BP9A 3UB3A 1R64A 4DEXA 5FP0A 4BQNA 4UAJA 3A05A 5BSHA 2ECOA 2G07A 1VHJA 4MWDA 1ACJA 1PFWA 3JD2A 3ZGLA 4NL4H 4W5WA 2MSWA 3LRPA 1VP3A 4EB8A 1V5IA 2AN4A 3CNBA 1MC5A 3F2IA 1YMQA 1XMPA 5ICGA 5G2OA 1E1NA 4KSBA 5E2AA 1FX0A 2G5PA 3TCNA 3DEAA 2VJAA 4ZPXA 1J9ZA 1U0RA 4GQAA 2EKBA 3HB9A 2NT3A 4CFYA 4DV2B 1DHTA 4J0FA 3ZD6A 3EH2A 1EGHA 3HR7A 5J2UF 1XKQA 3NJRA 3MS7A 4ITUA 5KYVA 1SD5A 3T7CA 2VLIA 4CNBA 1Z36A 3ROGA 4EKGA 1EXVA 5IT9A 2XITA 1BMFD 4TUYF 5CB8A 4B7AA 2VAXA 4B6OA 3WHKA 4P3YA 1I7DA 3L4EA 2WJ6A 5C51B 3IUYA 2O8CA 4R8MA 3FHTA 1NA5A 2WM8A 3L6EA 1Y1KE 3UFXB 3DC2A 2PMCA 9LDTA 1XYYA 2X2OA 1DX9A 4CMIB 3K70B 2PLRA 3F8SA 2J59A 4K88A 4DNPA 5AH0A 1ZIPA 4LQDA 1QHHB 4E15A 1VMDA 3G7SA 3PT5A 5HCIA 1O0SA 2FW9A 3S68A 4DWWA 4FCTA 1TU0A 4DY6A 3JVDA 3ZWCA 4Z1MD 3CCCA 4X1KB 5H68A 5I9MA 5CFPA 3WLLA 4AMZA 3B89A 3WGYA 1P0CA 1WJGA 3NFRA 2Q3LA 3AHHA 3THXB 3RUPA 3MLEA 1J06A 1EAYA 1UWCA 3QIVA 4Q4AA 2QRVA 3WAKA 1OFHA 2OB1A 2H08A 2QL6A 4X61A 3TZKA 1JG7A 5EQJB 2E4VA 3ROTA 2P5YA 2OO5A 4IGAA 1PE0A 4UPDA 3TSCA 1KHHA 1KEEA 1AY0A 2BM8A 3BDVA 3NBAA 2RFLA 4MVYA 2PD3A 5K8UA 2FQXA 4M9ZA 5LZ5A 3UKDA 2X0KA 3O4JA 3QOWA 4N03A 1YZNA 3X1JA 5CM9C 4LXYA 3ILVA 2GYVA 2GUWA 1JHVA 1XD2B 4DMRA 1SVNA 1N3YA 4GP6A 5KWEA 4MQLA 5MDHA 3N8IA 5L53A 5CPBA 1N2BA 5HFJA 5B1EA 2HAEA 3PDUA 1RFLA 3LYHA 1VYVA 5B58C 4GMDA 1CF2O 1LI7A 2VPYA 1O6CA 1YR3A 4NMXB 3O82A 5DB4A 1ZNWA 1OH6A 5AI6A 1MB3A 1OFGA 4JT2A 3HXQA 4L9AA 4FCVA 3A3YA 3RT7A 1I0IA 3RQIA 1XVTA 2QTVB 4JLDA 1GPDG 3Q72A 3BWMA 3RBZA 1R0XA 2INGX 2XYPA 3ZHXA 4HWPA 5AHWA 4D79A 3HP4A 1XZGA 4PX9A 4UAVA 2FHPA 3VC3A 1QFSA 3ROQA 1OYOA 5HIMA 1E6CA 4PAWA 1QYXA 3A58B 4QYXA 1TJNA 3U3OA 4YP7A 4PLWA 1EGVB 1VPTA 1SG0A 2DUUA 4C9BA 1SZCA 1I80A 1LX6A 3LDHA 1E9EA 2KPOA 2ZDQA 1KK0A 2PH5A 4JLVA 1CY8A 4WVLA 5FWYA 3BCRA 4M99A 1PJBA 4RC9A 1CY4A 2OFXA 1QGDA 1P2TA 2COKA 2Q4OA 5HQTA 1O94D 1Z9BA 1YOVA 2FP4B 1UMBA 4R0NA 3HMKA 4S0ZA 3TCXB 4XVUA 2GYYA 3QMVA 3VKGA 4FSHA 1IN5A 3IMKA 4WCFB 3M81A 4BLWA 2IIQA 1C8BA 3JPWA 1WA5A 3HRHA 3ZEAA 3IVXA 3DE3X 5AXBA 2GO7A 3WLFA 4LOLA 4QJ3A 8LDHA 5K45A 4O02B 4NYMR 2P6NA 1L5VA 2ZATA 5AKJA 4AJ4A 5IN4A 1O4VA 5CG2A 5JDIC 2Z43A 3DCYA 1A69A 3W8EA 1GL9B 4NCXA 1B0PA 2ZYGA 1FQKA 1LUAA 2G1JA 4LX8A 1U99A 5DX8A 1OPRA 1ZNQO 3QEMA 1X7XA 2EATA 4HTFA 2Q1XA 5H70A 3H5AA 4YMVA 1N7IA 1DUIA 4YQZA 1S7CA 2WJGA 1H8ED 5HDBB 3RKRA 5JFOA 2BRUA 4DLZA 5DEOA 2AT1A 4M8KA 3RROA 1RAAA 2JATA 3H5OA 3ZHOA 3DQPA 4MROA 4XSGA 5I7FA 4QRDA 1ESZA 3TMYA 2JEOA 4FGZA 4R16A 2QYSA 4HPJB 4Y18A 1ZUHA 1YJ5A 2YMQA 1Y3BE 3AOGA 4QHYA 2O3TA 3EE6A 4XUEA 5AW9A 3G8YA 1VJTA 2VYQA 3LNCA 5BSFA 2D1FA 1K9VF 3C1TA 4NU0A 1FTQA 1NN5A 1P2BA 1GZVA 2PZAA 1GR0A 1GPNA 1L8OA 2RKWA 2QJOA 5DBFA 5DYYA 2OKGA 3AI2A 3JQCA 5E6UB 4Z0NA 2C92A 2F7SA 2PXXA 1AUXA 1VE9A 2KB0A 4BZZA 2OMEA 4XFJA 3UPTA 3NZEA 4RNCA 4MWSA 2NZYA 2O8EB 1RJFA 1JWBB 3AI3A 2P6MA 4QVGA 3H75A 4KQKA 1U1EA 3U19A 1RAIA 3QKSA 3SEAA 3R9XB 4TYPA 1E66A 3BE8A 1ZGAA 5AI5A 1D1QA 1X74A 5EERA 3TRFA 1PEAA 4CODB 1H94A 1F0NA 2ZDHA 4NENB 1GNVA 1IN1A 1EVQA 3DDSA 3T12A 2IS1A 2D2XA 2ZWPA 4JYBA 1S8OA 3HXTA 1H5UA 4CM7A 2XMSA 3UY4A 4A0RA 5IABA 2Q3HA 2ZWVA 2I2XB 2BLNA 5CRIA 2FN9A 3SMVA 1W4RA 1XCOA 4DCCA 1X70A 5EHNA 3DMTA 4CTMA 5ERGB 1MV8A 4M9CA 3KR9A 3F9IA 1DRWA 1S2DA 4HDSA 5IDVA 3R40A 5TPZD 5THXA 7ABPA 2EKLA 1L7EA 4QBHA 2DSNA 3I73A 4MPDA 3BL5A 3O73A 2VXCA 2WF6A 2R751 4BMYA 4O1IA 2AC4A 1CHNA 2QD2A 1KK3A 4OJKA 4D99A 3LUJA 5LLSA 1A3CA 2QJTA 4NICA 2YHSA 4BGEA 3CM0A 3QUCA 3LSTA 3WMWA 5E6RA 4I4NA 1V35A 1ENZA 5LQUA 1CRQA 3C3YA 1T2EA 1AK9A 3G59A 1HSOA 5NULA 3ONVA 4RAQA 1F12A 1XFAA 4G2TA 4BPBA 2GEUA 2NP6A 1DWQA 5C1IA 4RHXA 4QYMA 5DO9A 5J1SB 3OEYA 3Q8KA 3TVDA 1ZN2A 1FQJA 3HXKA 4A5SA 1TTTA 4LW8A 1TGYA 3INNA 3QV2A 3RYCB 1N6PA 2G8LA 1QMPA 1QIFA 5A02A 2J8ZA 1IJEA 2VYFA 4BVGA 2JFXA 4EARA 4P84A 4Q21A 2HJSA 4P4UA 3TZ6A 4HXGA 2JC3A 1YGPA 4M36A 1ISJA 1YFZA 1Z6YA 2YRXA 3FMIA 5FTKA 3GMIA 4XDHA 4ZVTA 4D9CA 4QBIA 2GAJA 3EFEA 3RSHA 2CJXA 3D1VA 3C7AA 1XOIA 2BFNA 1M2EA 5ES3A 3TK1A 4CE6A 1WSWA 1FP7A 1Y48E 2COEA 3VDQA 4B87A 3Q1KA 3NAQA 4JROA 2F3SA 5HZHA 3ZKWB 1HDEA 3KR1A 4MGYR 1G8YA 3RSLA 3HBMA 3JAWA 4O4JA 4QDTA 4JKOA 4IUCS 3B1XA 3PF9A 1IBCA 1ISFA 1VB3A 3MCUA 3ZLUA 3G2NA 3P5BA 4YP5A 4E08A 1AU9A 1RKXA 4OYYA 4FCWA 2Y4OA 3LT0A 4YRJA 4EEZA 1XMOB 1ZD9A 2EZ8A 3MTEA 1PT9A 3PEVA 4K6CA 2OYSA 1KIAA 3SM3A 3FRHA 1BJKA 2VPPA 4US1R 3T7TA 2HRBA 3PD1A 1PT5A 1KKLA 5B6PA 1MP0A 1TM3E 2L18A 5JNRA 3U7HB 2YW9A 4JGGA 3WA6A 3I0ZA 1YS9A 4N0MA 4ZP1A 1U8XX 3T99A 2QN2A 3X0DA 4TSRA 5J4LA 4RCVA 4Y2GA 3SVTA 4R9NA 3G82C 3ZDAA 5IFLA 1IRXA 2C4MA 3B1YA 3RJMA 4E5MA 4JEIA 1QGOA 5JAIA 1Y1QA 1D8AA 3E7PA 3IAXA 4GZ6A 4L16A 1P31A 1OXKB 1T29A 1O95A 1XNGA 1XYVA 3FPHA 3HZZA 4F21A 1RIIA 3JQ9C 1OWMA 1NPTO 2OHVA 2XNJA 1JJAA 2I3BA 1HM5A 2XHEA 4YACA 3GLQA 4YAUA 1S02A 1WE2A 4DBVO 2GD6A 4L07A 1G7CA 1SOMA 2FSVA 1MAWA 1SKYE 4V0MA 2F8TA 1J1ZA 3D0OA 3WYDA 4JJ8A 2WM3A 5CFRA 4XTCS 3VH1A 3VDNB 5K4GA 2M6SA 2QV0A 2BTQB 2FZVA 4H18A 2LCFA 3T1HB 3W78A 1FZQA 4CU5A 5J2UB 1J4AA 5F9HA 1W7AA 4CW7A 1OZGA 2WM9B 4FEYA 1OGYA 4AP5A 1Y37A 2D2EA 1NT4A 3DBRB 1GG2A 4G5SA 4NATA 4ZVSA 2ZVDA 3N0VA 2OBFA 4L95C 4G1VA 1NI5A 2ZIXB 1G21A 1U4NA 1G59A 3WVNA 1MUUA 2AK3A 2CKMA 4WKOA 2DH6A 1HV8A 1I10A 1A8QA 1XZDA 4XEHA 2H18A 2GLTA 4J91A 3UYKA 1NNUA 1QU3A 2GWHA 3PYLA 1A50B 4P7FA 3ITDA 4AKEA 4CM4B 1PZNA 3FTCA 2H65A 1HY3A 5ALJA 4ZTBA 4TSKA 5KOIA 1KMIY 3AB8A 3D7SA 3UUWA 1N6LA 5AVKA 4BJ6A 1L7VC 4RHFA 3T3HA 1U2DC 1NW9B 4NDNE 1P19A 2X0EA 1NX9A 2FWRA 4TZTA 3M6XA 1OBFO 2FA9A 2EZTA 4H7IA 3R5SA 1Z4LA 3DBHB 3A9UA 1BXRB 2YIMA 3AF2A 4XIYA 4ZCQA 2FZEA 4LSZA 5I9LA 3KJNA 2JAUA 2CBGA 3ITEA 1TUEA 1SA0A 2PJZA 4TT3A 4RETA 3OIWA 2XT9A 5F1OA 3ZIAA 4ZD6A 2XUGA 1AO3A 4GMGA 2NO0A 4X1IA 5JSKA 4BNJA 1ZA2A 2RGXA 1DAKA 3FX2A 2FJPA 1VRVA 3EOBI 4FFBA 4NDAA 1OBOA 1XKLA 1S2LA 3LV8A 3PUVA 5EUBA 5CAEA 5GZ3A 2DPHA 3NGXA 2C5LA 4AY3A 3RABA 1VKOA 2HXYA 4HFJA 1JPNA 1KR2A 3EIEA 2DX7A 4MP8A 4CV2A 2GNOA 4OFBA 1RI1A 3O3OB 2IHTA 1C9MA 4D6XA 1KGDA 4XFDA 4H7EA 1L7BA 1RYEA 3CCBA 4J6FA 1EFHA 3JWIA 4NE9A 4YRLA 3U0VA 5G0WA 4DG8A 4EHIA 4ILKA 1TGVA 2C2OA 2B7BA 3W5IA 4FD2A 3O6VA 4NBNA 3MUEA 4HZUB 4JOQA 1AUVA 3ONEA 5DTIA 3WHLA 2EP8A 4PVCA 5G0VA 1YVRA 2FK8A 3GAZA 1PEKE 5C5DA 4YJGA 5JJCA 1BDIA 5F77A 3KJHA 1CDDA 3GGPA 4KRGA 1F9AA 1W29A 3BUSA 1UP6A 1WCIB 3O4VA 3OE7A 2QSYA 4PCAA 4Q0MA 3PB3A 1FL9A 3DTVB 3Q7TA 3CRNA 1QQTA 1E98A 4OK5A 5C35A 1LQTA 4OHXA 2CFOA 4BTLA 3HU5A 4Y9UA 4V2UA 4LXXA 4OIMA 4X7BA 3DF7A 4ARZA 4CF4A 3ADBA 4LBZA 3I9MA 4D9GA 3PXAA 4KX5A 4ZYVA 1DZ3A 4JMPA 4NBTA 2JLUA 1U80A 3TKAA 2BM0A 4BOYA 4R68A 1UAAA 1P39A 3HUTA 4JFRA 3KP1A 5FBZA 5JC8A 4DANA 4Y6PA 1IY2A 4O25A 4IXWA 2G9UA 5JSZA 1LLUA 1SCQA 1MB0A 2QUKA 1AKUA 2ADOA 2DKOA 1TKRA 1TL7C 1TADA 1TAGA 2V59A 3OM8A 1ZJYA 2QI9F 3WLRA 3ES9A 1YS2X 5LDHA 3L7YA 2BFDA 5E1BA 2FN8A 2O2XA 1JHPA 1Y9JA 4P8RA 4V24A 4PO3X 5AHXA 1EFDN 1HLDA 3AUKA 2HEGA 1A2OA 2J4DA 3H04A 3PR2B 1F0KA 1UJMA 2CXHA 2WTMA 3ED5A 2X8WA 3MMXA 1EWRA 3S1AB 3WJAA 2PVCA 4BVJA 2X5NA 4XCXA 2B94A 2H9AA 4IDPA 4AMUA 2M1XA 1Q2UA 3TR5A 3AVPA 4BMCA 4EOGA 4ZQIA 5DBGA 5LOVA 3ESDA 4DHEA 4N48A 4D6PA 2DR0A 5KTRA 3HWWA 3VJLA 3HN6A 1H22A 3MVEA 1C3LA 2ZTSA 1ZJ4A 3AKEA 2RGUA 1IPEA 4XOIA 2GBCA 3GY0A 4Q3EA 5AJXA 5JC1A 4XRRA 1N5JA 3T4EA 4KXUA 4AULA 4DWVA 2VCEA 4YPOA 3GDOA 2O5EA 1K7CA 1F1BA 5BSVA 5KCZA 4XDYA 1U7OA 3DO5A 3FBWA 1ZN8A 4MW7A 5DBIA 3R3JA 3ZJYA 2XB2A 3E2MA 1VI6A 4O4IF 1E99A 2C3OA 3D5EA 4L4YA 4D5GA 5KPJA 4CQMA 4GF5A 4YRGA 3H4VA 2O57A 2GJKA 2QN9A 4RF5A 3GLUA 1W88B 1E8DA 1WTAA 3BB4A 3OZVA 2H3EA 4AQYB 4QASA 3WIBA 3SYTA 5A7GA 3LC1O 1A9PA 3M4JA 3P9IA 4NP6A 1JDUA 3DFKA 4ERXA 3OPYA 2IJGX 4MV8A 5MFZA 1AGPA 4BBJA 4I3GA 5BVGA 1AZTA 3AMVA 3F2VA 2OCDA 3K0KA 4OKIA 3G0IA 4E1AA 1U2GC 2IU4A 2WK1A 3F6YA 1GZSA 4IZOA 5EXTA 3RAPR 1QHXA 4LOJA 4OXRA 3E9NA 1WZEA 3I04A 1T2CA 4CCYB 1AUQA 5FBHA 5HK9A 1QF9A 4TUYA 1JIKA 2DBYA 2VS1A 3IUQA 3IT0A 3T7DA 5K99A 3H9EO 1Z0ZA 2Q3EA 3M4XA 4G5XA 3FCUB 4S05A 2FMXA 1QP4A 2CHEA 4TS9A 4J2HA 5F9MA 5HQ3A 5HX7A 1IOWA 1TK3A 5H16A 1EIWA 3PC7A 3T5DA 5CA1F 2YN4A 4R9SA 2FW7A 4JDPA 1I32A 4P53A 3LSYA 3HU1A 2PAFA 5BP7A 1A4XA 1LSUA 4GNRA 4L78A 1P17A 3L8HA 4FVTA 1Y5RA 3ECCA 3M9XA 1DBWA 1LRLA 3QRWA 4KQFA 4AO8A 4HVTA 4ZO4A 1DU4A 4D5EA 3QEAZ 3EGIA 5DRYA 3CN9A 5KWIA 2XUKA 5E7JA 1EWVA 1KEZA 2Y92A 3ESRA 1GPH1 3I39X 4KPUB 3IUBA 5ES4B 3AFHA 5AYVA 1DJLA 1RLMA 1SM4A 2E5FA 1CUBA 3CRZA 2AJTA 4DZTA 2VTDA 2EHDA 2F2TA 3A26A 1A27A 2AMJA 2O0JA 5DHPA 1TYBE 1SB8A 2AFRA 1ISRA 1C1DB 2WWXA 1KQPA 3T1YB 2DVMA 2JFHA 3CRVA 4LZNA 1MLDA 3H97A 4RVUA 1XNJA 5JCXA 3ZD7A 1RYNA 3DEIA 1QV9A 2DH5A 4PPFA 1M2VA 3DHEA 2L42A 1AV7A 1Y8AA 2L82A 4MR9B 3MFYA 4QPDA 4DNXA 2JVJA 2DEUA 1H5NA 4HLCA 4MKIA 3GUCA 4MKXA 3K9BA 4RMGA 2B6HA 5BT8A 1EMDA 2Q6IA 3K8OE 3AUUA 2XF2A 3PEFA 5DI3B 4UCXA 5K7SA 1ENOA 4RPKA 3RRMA 4X7PA 3SNHA 4PG7A 4F4HA 3U3DA 4W5OA 1SVSA 2OFWA 5DCWA 3R8CA 5EE5B 3EXAA 1N8SA 1L5YA 5JAOA 3E23A 3FIJA 1ZHOA 2QG6A 2OBNA 1T4CB 1VJ0A 4F96A 5KSZA 2GLXA 4JU9A 2NADA 3VV3A 3K53A 3KXLA 1IIBA 1C0KA 4PSVA 3RAGA 4ZICA 4ZV9A 5IVKA 2PT6A 2C5GA 3WDKA 4XGQA 4L8YA 3DV2A 4UD2A 1G5RA 1W1WA 1S3SA 1UJCA 2GK7A 3H99A 5FB3A 3RI3A 4MX8A 4DBLC 1IJKA 3MTAA 5I3CA 4C5CA 4F7WA 1IL0A 2Z04A 4LFCB 3BFXA 2UDPA 1K8ZB 1FFBA 1E2HA 1TZ2A 2JARA 4GZLA 5IW8A 4YMGA 2OCKA 1HYQA 3CS3A 3JALA 2ODTX 5HZMA 4PLPA 1LLCA 3SE0A 3U7RA 3KEOA 4UU1A 5LYYA 3CB2A 2FPUA 2X77A 1VHQA 4F2PA 3ANYB 1GAJA 1DC4A 2O52A 1N7JA 4R2KA 3HADA 1QSGA 2R86A 1JEDA 1MC1A 1FTYA 1T6XA 5A3VA 3SVLA 1OXUA 2B25A 4G0ZA 1E2UA 4LCJA 2RGYA 4FFVA 5DWDA 3FHJA 1T6ZA 1VYUA 3ZGZA 1NTOA 4X20B 4MA4A 1NQUA 4BFUA 4EENA 5D7BA 4RD2A 3RGGA 1M72A 2C61A 3R5KA 4INOA 4RKEA 2CLSA 3UA3A 1HQYE 3MMSA 3OZIA 4H3KB 1JQEA 1QIKA 5CBPA 2VDQB 3QOYA 1JHUA 2ZYWX 2BE7A 4MGZR 3RSOA 2I91A 1ID1A 1NKSA 3LD9A 4JUIA 2CXQA 1KS9A 4PXSA 1GN9A 3NHZA 3COVA 1K2WA 1D0SA 1I3KA 2H1WA 4RPJA 3TM5A 4QUBA 1UMDA 2RJOA 4DCVA 4Z1MA 4R7TA 2XCQA 4JT9A 5KNDD 1TU3A 3L7LA 821PA 4GXQA 1Y1SA 2RAVA 5C8XA 4V0RA 1MABB 1OLSB 1T9BA 2YUTA 4K9QA 1K1EA 1J8QA 4R1NA 5HGXA 3IQXA 3WV5A 5HF6A 1VCHA 3ANXA 3M33A 4N5LA 2C9YA 3WK8A 1JG4A 4F5EA 1ULBA 5LZ7A 5T3YA 1NV9A 1U6JA 4KR2A 5G41A 4G67A 1JIIA 2O3RA 4GGMX 5HFAA 1IZ7A 3B9PA 4M89A 4PG4A 3S6JA 3U0BA 3FW1A 4F56A 3COPA 3BS4A 4YY3B 1H2XA 3OTIA 1B73A 1Z6ZA 3BRQA 1P1IA 3DS8A 2QM8A 4R41A 3OUUA 4D8YA 2DHQA 3KTDA 4L8FA 4B3FX 4MICA 2C3MA 3U49A 1EKXA 4MDHA 4EB0A 4ZGWA 1I3MA 1U1DA 2X6QA 3ENWA 5HGJA 4LYYA 1U3UA 4F86A 5AM2A 3EDYA 5BV0A 2NLOA 1HGXA 1UK7A 4PF1A 2PRIA 5LYJF 4TVSA 1YQDA 4JGBA 2P77A 2PBZA 3NYQA 2CD9A 4YJ2F 2W2XA 3V8QA 4K9PA 1SUPA 1Z8DA 2ZIZA 2PU7A 3RT9A 4X64B 3A6JA 3KSBC 2AOWA 4ZEMA 1DJQA 1RWMA 2R6FA 4ND2A 1GYPA 4FFLA 4C03A 2XTZA 2I7DA 2IF0A 2TMKA 3OETA 4I3HA 1EEXB 3HDHA 3MFQA 1TJYA 3H9CA 4LGCA 1OY1A 3LVRE 1C2YA 3CLHA 5FCDA 2F3PA 3W3ZB 5ITZB 3IEKA 2O7VA 1USVA 1XD9A 1K88A 1OU4A 1RI2A 2JHPA 4DWOA 3F7TA 1DX4A 1N75A 3MIIA 3TL6A 3CPJB 1ILWA 2D74A 4IP0A 4BNIA 4DCNA 5IRCD 1CUCA 2QZ4A 1D7AA 4URUR 1OFUX 3STTA 4HPXB 3T7JA 3VUFA 4DYDA 4GM1A 4RPLA 1SQ6A 1Q84A 1O2DA 3S2SA 2XA9A 3F9CA 5DYNA 2HK9A 4CDGA 3B7PA 2JZOA 1O94A 4UVDA 4M8NE 2CV0A 1P8AA 4H3SA 3S2UA 3CVVA 2YICA 1FXWF 1ECGA 1C1XA 5ITVA 3QFSA 1IUKA 4RK6A 2Z8YM 3LDFA 5HILA 4OAOA 4KODA 1EGMB 3TN7A 4AC9A 1P9OA 1PJQA 3C3PA 1XGKA 4ZOBA 3I5MA 1CBUA 4PC1A 4HZIA 2EG9A 3ZCQA 4BIIA 3THOA 3OESA 2DFNA 4Y2XA 2AZDA 2Q1WA 2W2MA 2W7TA 1EQ2A 4PXAA 5C32A 4FGWA 2Z08A 4KYTA 1QCZA 1ZO8A 3QKTA 1XZLA 3OQVA 2YHBA 5KX5F 5BV2P 1H8EA 1W2WB 1Y1RA 3HJGA 5BQ3A 4OP3A 2JJYA 3PFKA 2VSXA 1U9IC 1ORTA 4FNGA 3WWPA 1SRRA 1A8IA 2WT8A 5I8ZA 1UZMA 1DNPA 1ZVMA 5IU6A 2HD4A 3UYLA 1BMTA 3A04A 2P3OA 3X3HA 3TSAA 5AD1A 4UHBA 1C8LA 5CA0F 1N8NA 2PUGA 4GZ3A 4WMLA 5JSHA 3VVCA 3SJUA 4KI7A 5KWJA 1PX2A 2D5LA 3BTOA 4R4JA 4LZLA 2DCMA 3DM9B 1U3DA 3MJHA 3VR0A 4KACA 3WXBA 1OZFA 2RHDA 1UK6A 2WKRA 4U0KA 2B20A 5CLHA 1VMAA 1NRWA 2PX6A 3FZQA 1L4FA 2WOOA 3OZEA 3QBVA 2IU3A 2AN3A 4WRRA 1DCMA 3SC4A 4DGSA 5FOXA 5JO0A 5KS2A 5KNBA 1M75A 1EXNA 3ZDDA 2PGOA 2OCLA 1TDJA 3T1OA 5ECWA 1VFNA 2IE0A 4HDRA 3OCWA 4W8HA 1WCV1 4AMYA 2EX1A 2D1TA 1NXPA 2C57A 3UH0A 3WR5A 5AW3A 4Z7JA 2ECPA 1PVDA 1OW3B 2QS9A 2I67A 2LW7A 2CDNA 3SZMA 3NBFA 1WLSA 3O31A 3RFXA 4AQ7A 1CY0A 3H2GA 4O4IB 2OG2A 2JLBA 1NVGA 2FRDA 2NV0A 2QZPA 4XOUA 2G08A 4UE2A 5EIEA 3MS4A 2R7KA 1Q91A 2WFLB 5K0LA 4HAIA 1DIHA 1BDJA 4G86A 4KVAA 1MVLA 3U6KA 2FW6A 5A05A 4DOMA 2NXJA 1WETA 1BQ3A 4K9RA 3NDJA 2I6QA 1L4LA 3A9TA 4KBFA 3LFUA 2WIGA 1B6TA 1EGAA 3KJFA 4NE7A 5ESWA 4BO3A 1SC3A 1X7GA 3AIKA 1NE2A 3CKMA 3CVXA 3GI1A 4BBZA 1FUYB 2H06A 4IRUB 4Y7DA 3K32A 1UC9A 2GETA 1E4VA 4A8HA 2HV8A 4W99A 4AJLA 3ZI4A 5FEUA 3K09C 2W71A 2BYTA 4M9RA 4OGWA 4OEHA 3J7AC 2WG0A 1CDOA 1F38A 3QHQA 2IEDA 5BSUA 2PUCA 4E1BA 3PUKA 3WGJA 2AG8A 3ZQKA 4TRNA 4YRKA 4NU8X 3OZ7A 1F2UB 1XWIA 3ZJ5A 2AR7A 4GPD1 4LK2A 1EE1A 5LP6A 2V74B 5A5GA 4K26A 4IX9A 1RJ9A 2AI1A 2ATVA 4AURA 7ADHA 1MENA 1PSZA 1U8FO 4QHTA 5FFMA 2QTMA 5EMLA 3QWAA 3GW8A 2FZKA 4EF4A 1YQEA 2XKAA 3LZ6A 2E4XA 1LPPA 3AERA 4J3JA 1DIRA 2BLLA 2Y1FA 3L02A 1CQWA 1I7SB 3LBYA 4AZ3A 4JCCA 5FD8A 5IWAB 1JTFA 4Q4DA 1Y1LA 3DL2A 4E6PA 5KU7A 2DQSA 5BVHA 3NHFA 2GKGA 1Y3DE 1C8KA 2NVUA 3WIOA 3B1WA 1JNYA 3CRW1 3K16A 1GGJA 3GQVA 2WHPB 3KZOA 4HMQA 1LLQA 3PCXA 1XPUA 2IU0A 2EL9A 3I9KA 3W9YA 5JQGF 5FXMA 3BB1A 1FMCA 4NONA 5BSEA 3PL1A 2OAQ1 2OEPA 1Y3AA 3KVOA 2PL1A 1E1RD 1ZCAA 1DKQA 3IMGA 1RYDA 2J3JA 4PGGA 4Y2UA 2G72A 1DC6A 1EVEA 1BHQ1 2EIXA 2OBMA 2YX1A 3M9WA 3HN2A 2BC9A 3AR7A 1QC5A 2G1PA 3W8DA 3OQNA 3HM2A 1T8TA 1J0XO 2D7CA 3GUYA 1MO2A 3THYB 3QYJA 1A9XB 1WF3A 3RT1A 1CUXA 3IJRA 4U6QA 3QTLA 3UHFA 3VVLA 1PYGA 4DXAA 3MWDA 4RHTA 3WNZA 1PTKA 5EVJA 5JS1A 3L0ZA 4L15A 3WL6A 5KYYA 2PTHA 2CLMB 2PA0A 2ZBDA 3H8SA 3O91A 4UZEA 4FBMA 3GQBA 5JI3E 2QRMA 4MR7B 4RFSA 1BRTA 2XGSA 3BMCA 2Y0PA 3K1AA 3KSMA 4PS0A 4B3CA 3FUCA 1V1MA 1V2HE 4K46A 1MXFA 1ZSVA 4MINA 4OHVA 1OD6A 2G1AA 3ZWOA 3VYSB 4LISA 1H2EA 1U0BB 3UGQA 3NLLA 4CEIB 3PPWA 1L9XA 3F4BA 1OH8A 4JLUA 1XRRA 1XC7A 2O2JA 3EGOA 2G28A 2OXRA 4QQFA 2ZJFA 5DGXA 1LDNA 1E2JA 4UOZA 2VZ8A 5CB0A 2WSYB 4H0FA 1DBIA 2XY4A 4E1VA 2Y1LA 2OO3A 3PGKA 2GASA 2F3UA 2WHYA 1NPYA 1WM1A 2GO1A 5LQNA 5LDGA 1B0UA 5B2ZA 5JSQA 4B6SA 5JYCA 4XIFA 4MKRA 2H59A 1AHHA 2GR9A 1SIOA 4L5IA 2BZ1A 4IXDA 1A9QA 5LQSA 1D3AA 4MYHA 2RAFA 3DVAA 2GYUA 1EFLA 4HWOA 4L2IA 3RC2A 1TEZA 1U0SY 3HKEB 1XZIA 1KJQA 4IIYA 5IT4A 4RXUA 3TI9A 1KVSA 2JZCA 3G0GA 4A8JA 4BC1A