4XARA

Mglur2 ecd and mglur3 ecd complex with ligands
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
479
structure length
445
Chain Sequence
RREIKIEGDLVLGGLFPINEKGTGTEECGRINEDRGIQRLEAMLFAIDEINKDDYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARLRNISIATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAASRANASFTWVASDGWGAQESIIKGSEHVAYGAITLELASQPVRQFDRYFQSLNPYNNHRNPWFRDFWEQKFQCSLRVCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPNTTKLCDAMKILDGKKLYKDYLLKINFTAPDADSIVKFDTFGDGMGRYNVFNFQNVGGKYSYLKVGHWAETLSLDVNSIHWSRNSVPTSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis and Pharmacological Characterization of C4-Disubstituted Analogs of 1S,2S,5R,6S-2-Aminobicyclo[3.1.0]hexane-2,6-dicarboxylate: Identification of a Potent, Selective Metabotropic Glutamate Receptor Agonist and Determination of Agonist-Bound Human mGlu2 and mGlu3 Amino Terminal Domain Structures.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Metabotropic glutamate receptor 3
total genus 153
structure length 445
sequence length 479
ec nomenclature
pdb deposition date 2014-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4xarA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4xarA01
2PKXA 2PL1A 3M6MD 1NTRA 2WJWA 2P4UA 2JBAB 1P2FA 2JB9A 2YHBA 3IP7A 3NBMA 4IGAA 4KV7A 4MQEA 4JB2A 1BDJA 4OTZA 5IEBA 3KSMA 3O74A 5TQ0A 4E7PA 3O75A 2PL9A 1JFTA 2AYXA 3KJXA 1DG9A 1ZN2A 1QQBA 3RVRA 5KC8A 3H5OA 5CNMA 3TX6A 2CWDA 1HEYA 4D74A 3E61A 3CNBA 3LOPA 1MB3A 3NHMA 4RK4A 1UDRA 4Z4GA 3HZHA 4G0XA 2FVYA 1TMYA 3QEMB 3ILHA 1MAVA 5GOTA 5KI6A 4LDZA 5IUKC 3HVRA 1RXIA 1JHZA 4N0PA 3KYJB 3GBPA 1SXHA 5BR1A 3H5LA 2WRZA 4QYMA 4WXEA 5DCLA 3RVSA 1DP4A 1NXSA 3OMWA 1ZITA 2E4WA 2E4VA 4MAAA 4MRMA 1P6UA 3H5VA 1L5ZA 3RVOA 2FN9A 3HK2A 1M5TA 1VPWA 1NY5A 4N76A 1Z16A 2A9QA 3T8YA 1P6QA 2FEKA 1PNTA 2JCGA 2R4QA 3RVMA 3GV0A 4Z4EA 1C0EA 3OMXA 5FWYA 3TB6A 2M98A 5IUNC 4JOQA 4ZYLA 3FMVA 1D4ZA 1JLKA 3MA0A 3LKBA 2A9PA 4MR9B 1IIBA 1JL3A 4MR7B 1YS7A 1ZH4A 3EODA 6ABPA 4IRXA 4GNRA 2MYUA 3QELB 3C3KA 2PUDA 5JNSA 5KQGA 2FMKA 3S99A 3VNAA 3KTOA 4MRMB 3OO1A 4RKRA 4RK0A 4MGEA 3CZCA 3QX8A 1KRWA 2PUAA 1BA2A 3E3MA 3NNDA 2PJUA 1GCGA 5FWXB 3R0JA 3N8IA 3H5TA 4G86A 3A0RB 3G1WA 2MSWA 3VNBA 4KZKA 2L18A 1EAYA 3K4HA 3I09A 4D6YA 2IDMA 3BRQA 1USKA 3L49A 3Q7RA 3QX9A 5IULC 5JNWA 2VUHB 5IC5A 4W5QA 5C5CA 1T34A 4O1IA 1EFAA 4RK6A 1BVHA 4YR7A 4XLTA 1JFVA 2IPMA 3ILYA 3QLUC 1Z17A 1BAPA 1E6MA 4MR9A 4OATA 4ZMRA 2HJ9A 3A3KA 2J48A 2JVIA 3GBVA 4G0MA 4KK3A 4G97A 3D02A 3FFWA 4UHKA 3B2NA 3KG2A 3O2SB 3KHTA 5TQ2B 4Z4IA 1Z2DA 1BDHA 4KPYA 1Z2EA 1JX6A 3T95A 5JNVA 1USIA 5BRJA 1XWWA 4JA2A 1DBQA 2R25B 4KNYA 5TPWA 2GI4A 1ZHHA 4PYRA 2LBPA 3SAJA 3TO5A 2LIVA 3QLVA 1MIHA 4MR8B 2Q5CA 1M5UA 3GYBA 1JBEA 4S04A 2HQOA 5EWJA 4UHJA 3M9XA 3DLHA 1C4WA 1NXPA 3RVLA 4RDCA 2E4ZA 3Q15C 5IX8A 2DRIA 1EWTA 4LE2A 2IKSA 4Q7EA 1NXOA 3F7NA 1Z25A 1ABFA 2VK2A 3HM9A 3QK7A 1D1QA 3EQ2A 1Z13A 3LKVA 4EYQA 3D8UA 4XASA 2L17A 1QKKA 2GBPA 4NV3A 3TMYA 3GA5A 3QELA 4IILA 3UK0A 3RVJA 4GPAA 3RH0A 1TLFA 4PE5B 3Q7SA 4HNRA 4LZLA 3LUKA 2QR3A 2QXYA 4MQFA 6CHYA 4RZSA 4RY0A 1PHRA 2OENG 5TPZA 3HS3A 4XAQA 5DGCA 2ZWMA 1D2AA 1RZRD 4MQEB 2VUIB 3A0UA 5KWSA 5T7BA 4ZJPA 1E2BA 4WUTA 4G0YA 3UUGA 4E7OA 3OQMA 4TLLB 1Z12A 4RXUA 4MLCA 4G0OA 4YV7A 1A0OA 1EWVA 1DBPA 4WWHA 4XARA 3EGCA 1U0SY 4W5TA 2QU7A 1JH9A 3IP5A 2FLWA 4RXMA 1ZVVA 1DRJA 4RKQA 4LRQA 4FE7A 4XXHA 1FFGA 4EVRA 3HEBA 2WJAA 4KQCA 1FQWA 3IPCA 2FEPA 2QW1A 4F8JA 2FN8A 4KVFA 4RXTA 5GQSA 4RK5A 4RU1A 2AYZA 1KMIY 5CNKA 1PEYA 4KK4A 2LUOA 3JPWA 3IDOA 4KRFA 4P98A 1ZY2A 3LUGA 3O2QB 1YMVA 4RY9A 1SXIA 3H1GA 2FQWA 1B00A 7ABPA 5HSGA 1BDIA 2QV0A 2CHEA 4HYEA 4Z9AA 2FMHA 3EQZA 2PAFA 3GL9A 3OM0A 2IPNA 3T38A 2MSKA 4D6XA 1XHFA 1ISSA 4WZZA 3SG0A 3N0RA 4EY3A 1PEAA 3KS9A 3N0WA 2GX6A 1DBWA 5EWLA 4RSMA 2QSJA 4Z4FA 5ED4A 1JWLA 3K9CA 1YS6A 4Z99A 4O1HA 2YHAA 3EJWA 1ZGGA 3SNKA 3HO1A 3C3MA 4N03A 4QYWA 4KMRA 3FFTA 1U2PA 2IPAB 2PUBA 1NXWA 1LBIA 2RDMA 3KKEA 2PLNA 5JNTA 2O20A 4F06A 4LDAA 1D1PA 1M2EA 2JRLA 4CBVA 4IMIB 5JNUA 1ZAYA 1QO0D 2PMCA 4MYRA 5D2CA 4XFKA 3OLVA 1TM2A 1U8TA 3FGZA 1YK0A 1ISRA 4MS3B 3BREA 3CKMA 3LMKA 2RJOA 2R47A 4RK7A 2FTKE 5JS1A 3I42A 4JASB 1K68A 2JBAA 4DADA 3QLTA 4YS6A 5EWJB 4LE0A 5KQLA 1VKRA 3QLUA 3RQIA 1VRVA 1E6LA 1MB0A 4PEVA 2PUEA 1YMUA 2A9RA 3MQ4A 2FMIA 3SM9A 1CHNA 2F8TA 5KC9A 3CG4A 3DZDA 3BBLA 4Q6WA 3H5IA 2CHFA 3HV2A 3O2JA 4EYGA 3O1HB 2NZVG 3HSYA 3LUDA 3BILA 1JFSA 4L85A 4Z4HA 2A9OA 3KLOA 4ETNA 4IF4A 1E6KA 4HNSA 4YRZA 2FMFA 3QEMA 4W5OA 2ID7A 4MS3A 3L6UA 5BQ3A 3DGFC 1Z18A 1KRXA 2ZAYA 5TQJA 4EVQA 3QLVC 1R8JA 3OLXA 4MR7A 1GLGA 1YTUA 8ABPA 2NUBA 5TPZD 4YP9A 4RS3A 1FSPA 3O1IC 1S8NA 3Q7TA 3H6GA 1F4VA 1EHCA 1DCFA 4Y9TA 3OQOA 3FDFA 4IMJB 1USGA 3CLKA 2NZUG 3T6KA 1XHEA 5I4CA 1CYEA 2HQRA 3O21A 4PICA 4NQRA 4RK1A 3RVKA 1DZ3A 4N41A 3Q41A 3W9SA 4RV5A 1ZH2A 3LUAA 5DLEA 1U2QA 4OLAA 2IYNA 3JVDA 5TPWB 5FBHA 3OLYA 1NATA 5ABPA 4MS1B 1LJLA 1QPZA 1W9HA 4LX8A 3SY8A 1LBHA 5EWMA 3IPAA 3MIZA 1J56A 5FWYB 5CNJA 3LFTA 5TQ0B 1DRKA 2PUGA 4MPTA 2QVGA 2FQXA 3DBIA 1EWKA 1YIOA 4JAVC 3IP9A 4TLMB 1PUXA 3FFXA 1MVOA 3C3WA 2LP4Y 4EGSA 4EYKA 2R48A 3HDVA 4Z9BA 3Q9SA 2QZJA 1AB6A 4N47A 2HQBA 5TE9A 5B3JA 4ETMA 3F6CA 2RGYA 1JYFA 1P8AA 1SD5A 3LUJA 3ROFA 4EUKA 2X7XA 1DC8A 1ZESA 3GRCA 2JVKA 2ID9A 5HM6A 3HCWA 3MM4A 1L5YA 1QP7A 5EWMB 3H1EA 3ROTA 2HSGA 2QVCA 4MR8A 3H5WA 4OLBA 1A2OA 1ABEA 2PUCA 2LPMA 1NXVA 3G85A 3HUTA 4RY8A 4PZ0A 2MSLA 3DGEC 3LUFA 2MYTA 1OXBB 4ETIA 2V0NA 4NCAA 2FW0A 4LE1A 5IBQA 1DCMA 4W5NA 2I6FA 4S05A 3NHZA 4L4UA 2MYPA 4Z0NA 2FKAA 1TJYA 4M88A 4QICA 1JF8A 1Y1LA 1OXKB 1JDPA 4N0QA 2FQYA 2L2QA 3OO0A 1TVMA 4KQ9A 3RVPA 4DQDA 4YO7A 3HJFA 4YGXB 2WWVD 3EDCA 5KQPA 1QO0A 5BRAA 4QPJC 2H3HA 9ABPA 1ZDMA 1YK1A 1H9CA 2VYCA 3EAFA 1RPJA 4WXMA 1RXEA 1QMPA 3M9WA 3QEKA 5PNTA 4EYOA 2IOYA 1D5WA 3RVNA 3I5AA 4FB4A 1RZRA 1I3CA 4O5AA 5JNRA 1URPA 3P9YA 1KGSA 4JB0A 4TN5A 4F3TA 3O1JC 3H75A 2IPLA 1ZGZA 5IUJC 1U04A 3LUHA 2WY2D 4OG2A 4MS4B 2E4XA 4ZPJA 5JS2A 3DLBA 3KLNA 3OLZA 1CEYA 1SXGA 3SQNA 1QQAA 2MYNA 2FSPA 1APBA 1QP0A 4F11A 1LK0A 1Z26A 1QNLA 4H3HB 3C97A 5FBKA 4MLDA 5IEJA 4YLEA 2WB4A 4P1ZA 3C6QA 4YCSA 5HKOA 3LTEA 3IP6A 1NXTA 1DCKA 3NNNA 2E4YA 5HQJA 3CFYA 3HUUA 3F6PA 1SRRA 2HPHA 3JVIA 4ML3A 4MQFB 1RNLA 3N6VA 3TD9A 1GCAA 1FFWA 2PE5A 5DKFA 1W25A 2N9UA 4TMYA 1YVUA 3EULA 5KQMA 1NXXA 2M1ZA 4MS4A 4G0PA 3LUCA 1GUDA 2H0AA 3BRSA 3H1FA 2E4UA 3CG0A 2BGGA 2L19A 4HNQA 3CTPA 3F73A 4NICA 4W5RA 3KYIB 3N75A 3JS5A 3A10A 5C5EA 2JK1A 4EVSA 3H6HA 3NNSA 4KFCA 4JP1A 5EWLB 3UKJA 4F12A 5F64A 4MS1A 3N53A 3CU5A 1AB5A 2FLKA 3OQNA 4DN6A 5T3YA 2TMYA 4YWHA 3RVQA 4WT7A 2P9HA 1PNRA 4NCBA 3CHYA 2KYRA 5CHYA 3GT7A 4G0ZA 1F51E 2JVJA 1GUBA 5TQ2A 1DJMA 3KCNA 2XDYA 3HXMA 1LJUA 4Q6BA 4ZMSA 1JYEA 1K66A 2FXIA 3GWGA 3JTEA 1WETA 2W42A 1JDNA 4OBBA 5B3JC 3JY6A 3MF4A 4Z4CA 3MMNA 3OLWA 2WMYA 4H60A 2PUFA 3JPYA 4H3KB 4B09A 3MYYA 1M2FA 2GKGA 3CZ5A 3CS3A 1A04A 2OQRA 2NT4A 5DTEA 3CRNA 1VLZA 1DC7A 5FWXA 3OM1A 5CNIA 4FE4A 3HDGA 4G0QA 2RJNA 1QP4A 2GWRA 1FFSA 2B4AA 1Z15A 4RWEA 2NT3A 2F8SA 5E3JA 3URMA 2B1JA 2CD7A 4KREA 3I45A 3N0XA 2FEWB
chains in the Genus database with same CATH superfamily
2XWBF 3LVBA 3EEYA 1M66A 4I9NA 3LCMA 3PRKE 4FMBB 1P6XA 3RGWS 4EY4A 3DTTA 3PQ8A 5FPQA 4IV5A 3KT8A 4OH7A 3TEMA 3BWVA 1FXSA 1RP1A 4MI3A 3WWEA 2XT6A 2AYXA 4CLOA 2VS1A 3UFXB 4BQNA 4WEQA 4ZQIA 1IJBA 4IOJA 2R6AA 1L7AA 4O25A 1B8UA 1T1GA 1NMZA 3BHMA 3MSCA 1G20A 1QQBA 2ODBA 1GZ3A 2XDQB 1ZMXA 3C6BA 1D2GA 4HGPA 1P5FA 3I6YA 3TR6A 3WNBA 4RK4A 2VQDA 5DN9A 4ZXPA 1MIOA 3ILHA 2QE7A 3LBIA 2P27A 3THWA 4LF6B 2JEYA 2BZGA 3PU6A 1JDJA 3T5CA 3STYA 3ADDA 2IP2A 1GV1A 4ZOLB 4DRXB 3CF2A 4WBNB 1EM6A 3AF4A 1N2CB 3RVSA 1IBRA 3TQCA 2A9JA 3TTWA 1SUIA 2NSHA 5KWIA 5JMOA 5JSYA 4FDMA 2EG9A 2QLNA 2ZSUA 1O8CA 1XAJA 3OQIB 4QXRA 1UZMA 3DXYA 5KYGA 3E0XA 1M5TA 5F1OA 3CINA 2WAYA 3FUXA 3LU1A 4YK7A 2IHKA 2FR1A 3SJUA 1OZHA 3SOPA 4EDFA 5KNBD 1E1NA 1A2BA 4R84A 1KZGB 4Y7CA 2IC5A 3TE7A 1R0CA 1NNLA 4JL8A 2J9YB 5B4TA 2JA2A 5AJZA 1QHFA 2R1ZA 1KK3A 5EESA 5B1EA 1K6MA 1Z5VA 5JJKA 3R3SA 1O89A 4DG8A 1DIBA 2JFHA 2XGJA 4IDOA 5E2IA 4BJ3A 5FI0B 2A9PA 3IMGA 4MR9B 4YACA 1G8MA 3CISA 4JDPA 3A28A 4RJIA 1O58A 1NX6A 3MFYA 4Q05A 1CR4A 4J7AA 3R9WA 2BM0A 3F2IA 4X85A 2O8CB 1AS3A 2VWQA 3PNKA 4BDSA 5IJZA 5K0BA 1UBSB 4X8OA 1U6JA 5IFKA 4FZ5A 1THTA 4UKDA 4UCWA 2PVSA 3CBGA 4ACBA 3NNDA 2P2GA 2FF7A 2GBIA 3JQPA 3N8IA 4N7RA 3C8UA 1TJPB 4NBWA 1HDEA 3GARA 1YRQA 3Q11A 4ROSA 1KPHA 1MC8A 2MMCA 3E27A 4QNNA 2HZ7A 3NRJA 4Z0PA 3I23A 1IAVA 5IKEA 3CNQS 2KLHA 4UUNA 1CUVA 2GJ9A 4J0IA 3AVXA 1MF7A 4MNTA 2B2NA 3TL6A 1EFAA 2J0UA 2O2GA 4RK6A 1PT7A 4PCVA 4JYZA 3IO3A 4QDJA 2VRCD 2X0EA 3DE3X 2DFKB 3DO8A 4NMMA 3UFXA 5AVWA 3R40A 1NNUA 3E8MA 1PE0A 1Z38A 1P1FA 4BBPA 2II6A 5JNLA 1JU9A 4KK3A 4BCCA 1J4AA 4EI9A 3PZRA 2IOQA 2OBXA 1EESA 3KZKA 1NQ5A 1O1YA 4LDPA 4NCNA 2GAOA 4BNUA 4C89A 4WMLA 4L4ZA 2PX3A 4WLUA 4ZGBA 1XD2A 1P62B 3HL4A 2FSHA 2Q41A 1JX6A 5JNVA 1USIA 1XDSA 4DQXA 3IAUA 1UDCA 3D4PA 2OHFA 1SHTX 2XVYA 3NT4A 4BGDA 3A9TA 3THXA 5ERYA 1KRHA 2F6RA 1AMOA 3GYBA 5FL3A 3R9IA 2ZYRA 3TDNA 4U2KA 3RVLA 4TQGA 1P5ZB 4O4LB 1V5FA 2DRIA 1NZJA 3AH8A 2P0YA 4LE2A 1M34A 1JPUA 1E1KA 2IKSA 3B1XA 3FPKA 4MI1A 5E7IA 4P4GA 4DCSA 2LKCA 3AVYA 2CXOA 4DRYA 4QGAA 3CH5A 3QPDA 3IKJA 5J2UF 2JI7A 2V96A 3D2CA 3L1JA 1CZUA 2FWIA 1XMQB 4YCBA 4ZXFA 5DHUA 2L17A 4E4RA 4FNOA 2XV1A 2BT4A 2EIHA 2VZEA 3I72A 2C3YA 1AQLA 1CQXA 1ZOPA 3U40A 2YWDA 5GZ3A 2YYYA 3KTFA 2ACWA 1SZCA 3BERA 4LJ7A 1K6XA 4P93A 2ZT7A 3N6RA 5JHGB 3VAAA 3NHLA 2GFQA 1CF9A 3PQ2A 4PS1A 4X3PA 2Y9PB 5ALHA 5TPZA 4MCHA 4BLOA 5HUHA 2B8EA 3RSFA 1UM8A 4EIWA 1IDOA 1XDUA 2NPIA 2PSHA 1GRQA 5F9FA 3C4JA 2YOHA 2PKYX 4HVAA 5DGCA 4TYWA 2IS4A 4UE3S 3H2IA 2DGDA 3A0UA 1LTKA 2AZDA 3JAMA 1E63A 3D7RA 3KZMA 4YMHA 3W2HA 5LB2A 621PA 3I2KA 1G2QA 4EQ6B 4NATA 5JSKA 4KLAA 3OY7A 3T9EA 4F4IA 1LD3A 2IUTA 3OZEA 2A5GA 1ORDA 2I7VA 2QG4A 1ZICA 2ILVA 3A3YA 1YCGA 2QMQA 4AG6A 5FJIA 4K1LA 2DWPA 1IHXA 2VCYA 3GGJA 1Y7PA 3HH8A 1WX1A 2BGJA 3KOZA 5SY9A 1SQSA 3TQRA 1L4FA 4A0QA 1G4HA 2X23A 3KOWA 4YJ2B 3OHMA 2VH2A 4G5FA 2VYVD 2A5LA 2BEUA 4ZT6A 2ZB2A 1TTTA 1XALA 2BR3A 2ZROA 1GLVA 2WJAA 3CNNA 1ND6A 4NS1A 4NMLA 4AS2A 3ETJA 4LSZA 1U8AA 1LB1B 2FEPA 3Q85A 3I52A 3ZC3A 4YRKA 3V1KA 1SUCA 3LA8A 4NENA 5T4EA 2F67A 1HFEL 1M0EA 5A05A 3NEAA 5FUYA 3U1VA 2AZXA 3DFUA 1GGEA 4WKCA 3NTVA 4HX2A 3GVCA 2QAIA 5AKLA 1PR9A 1TU4A 3KNZA 5FYDA 3H1GA 3I9NA 4R9NA 1W96A 4CV2A 3GQBA 5KQSA 2O8FA 2C4WA 4GM0A 4ENRA 4LGVA 2EHJA 3OCVA 1RYNA 2BTQA 3JAKA 4RVFA 5EG5A 1CEQA 2XSZA 4WLVA 3CLHA 3RUAA 2QG6A 4M87A 1ZUHA 4ATNA 5E8JA 4OHXA 4OXXA 1YVPA 4MYUA 5ALYA 4YXFA 2CVHA 5AJUA 1ATIA 1N0VC 3C3YA 1YS6A 1XZQA 2P79A 4DQVA 2G9NA 2QRVA 2GEKA 4X9XA 3PIRA 1Q5PA 4O2LA 1CUDA 3EGXB 3INNA 3P2EA 4WUVA 3SM3A 1NUAA 3WP1B 3WQHA 4DW8A 3IUNA 5FFFA 1U2PA 5C1IA 4RLQA 5TB5A 4RTQA 4NAVA 1QH8B 4CGZA 4GW3A 5DCYA 2NSLA 4O4IB 1NYRA 2BGRA 1EE1A 2EKDA 3GLUA 3OCJA 5AXAA 2O20A 4FMDF 2P4HX 4IUYA 1A4RA 1OR8A 4ER3A 4JU8A 5JC8A 4ESOA 5BV7A 2G4LA 1ZAYA 2B6HA 1RCFA 5HZGA 4AL4A 1IJEA 4GT1A 2C57A 1DTEA 1H2HA 2AN1A 2NU6B 3IUMA 3JRNA 2FPLA 5JAZA 1ISRA 2O9JA 2O3QA 4LF7B 5EINA 3UJNA 6Q21A 3O9MA 4KDFA 4ZYYA 5L53A 3FHOA 3BTSA 4AULA 5CLJA 5JS1A 1N3LA 3GH1A 2WWWA 3DYVA 4RJTA 5HBGA 4B82A 1OROA 3AJ8A 4X3CA 4OXIA 5ALQA 4EG5A 4EZEA 1BD3A 1SCDA 2B7CA 4OQNA 4OJTA 3UPTA 1AF4A 3U09A 3GOHA 5JDCC 3BQMB 3DE7X 3KALA 2JI8A 1DO8A 3DZDA 1KQOA 4Q6WA 3RHTA 3VV3A 4XM0A 4AG3A 1K27A 1CQZA 2NZVG 2AC4A 1JE0A 2QRUA 5ILQA 4I1RA 4F72A 4MQ4A 3BGWA 1JG3A 2WPNA 2Q8QA 3FUUA 1AGRA 4MWCA 4UAJA 4YRZA 1A9ZA 4K6CA 3ACBA 1E61A 1JQKA 3HUDA 2XWQA 1J5XA 2GFHA 2P35A 2UDPA 1KDTA 1R18A 5J40A 3NXKA 3LHKA 4BX8A 4JQSA 4YJKA 4K3VA 2COUA 1KA9H 2JCYA 2WM3A 2ZKIA 4MR7A 3USES 2CXUA 1ZD8A 2XCQA 4TPKA 1UANA 3WGLA 1W47A 4DHWA 1FSPA 1S8NA 4RM3A 1L5HA 5EGSA 1TRHA 4D3SA 4DG9A 4RZ2A 2HMTA 4RTRA 1T6YA 1PL0A 4HN4B 1RAGA 4LZZA 2VCHA 4RPHA 3QE0A 1J97A 1A5ZA 4KMMA 4R68A 5BW4A 5CCEA 4E15A 3F6EX 4QTXA 5K8VA 3RG2A 821PA 1XZIA 2F48A 2FR8A 4BNLA 3QEBZ 3HVUA 1GZ4A 2NZXA 4ITRC 1K4MA 1ZD3A 3P0FA 1LX7A 1X7DA 3T54A 4IWNA 1QVRA 2C2KA 1KP3A 3P52A 1USVA 3TL3A 4A8JB 2F3RA 3U3MA 1MTOA 1NATA 2J4FA 1FMJA 2Y6VA 3RI3A 3RKUA 3TLAA 1GEEA 1DQYA 2CEAA 3MT0A 3F8TA 4UXHA 1DRKA 5IVDA 3M6FA 4O2AF 3O8OB 4MPTA 3EHDA 3ZW9A 5DZSA 4M99A 2NU6A 2SKDA 3TD2A 5GZ1A 2YV5A 4DV3B 2IUFA 4D9FA 2AKAB 4WK6A 3VR1A 4DCPA 3K8YA 3CE6A 2INGX 5DBIA 4IIYA 2RB4A 1KL7A 2O2SA 2O57A 3D2LA 1CRLA 1S3FA 1QOZA 4BCDA 2CKDA 2E37A 3AUFA 1QLJA 2RBKA 3PG5A 1DRVA 1XTRA 1XXHB 1N5MA 2I4NA 2OORC 3F47A 1EP1B 4YLGA 4RSRA 4N48A 3WSWA 3WKCA 1U3TA 3KFVA 4EUKA 1QH8A 4P7JA 3NFRA 3EGXA 1O96B 2IKQA 4GIBA 4XIYA 2I4TA 2JVKA 4I50A 4CG1A 1OX6A 4B3XA 1RYDA 4B84A 1YCHA 3ZI7A 3QWBA 1J8YF 1MHPA 3WRXC 5SZKB 2BFDA 1IHUA 5DWVA 1DC5A 4GL2A 4P0QB 3CZ4A 3GAZA 3IEIA 1J8FA 1WPXA 5EZ6B 2O8CA 2RGGA 2C5FA 2PUCA 4YASA 2NO4A 3DMDA 3HUTA 1A7AA 4HNAB 4I81A 3SYKA 2CD9A 4JQCA 2WYHA 1DKRA 1E9FA 2CB0A 3ZV4A 2XUGA 2FOLA 2B8JA 2WZDA 3A6JA 3BICA 1CY1A 2ODTX 1GPWB 4QICA 4U3JA 4FC7A 5FNVB 4BVBA 1YHYA 1JIKA 1WMFA 1XRPA 1GG5A 1LQUA 3NJ8A 3A2MA 2C3UA 1QJ4A 4OGWA 4IICA 1CFZA 2RSLA 4P36A 2XDWA 1FZQA 1Y7TA 4TRNA 4YO7A 2HMYB 3ZWBA 3GRFA 3S55A 1B3RA 1GPLA 2H85A 2JL1A 4LTNA 1I1NA 1YK1A 2HSWA 2OSVA 5H5JA 4B74A 5IJ0A 3MT9A 1J00A 3EAFA 4IXNA 5JO9A 4HOYA 5KVQA 3DXXA 2Z57A 5LOVA 2B8TA 1D5WA 4V0MA 1G6Q1 2ODNA 4O4HB 5BT9A 5B6PA 2EKQA 5K9ZA 3K6JA 5DEIA 2O8EA 4EY5A 1B74A 1FEZA 2AV6A 4HDKB 1E3MA 4GKJB 2HBRA 1U3VA 2GYYA 4YRRA 3MRSA 3CEAA 2R7LA 5C1BA 5FV4A 5KYUB 4YI3A 1VC2A 4F04A 5MF6A 4ZHSA 2CDCA 1G8YA 1SVOA 3PPYA 1IIRA 1U7TA 1V3UA 4MEJA 2A1UA 4X1OA 1E4EA 4IVNA 4QE3A 4AMVA 1QQAA 3Q5EA 1KOLA 1ZW1A 4Q19A 3G8BA 2Z8ZA 3EOZA 3COSA 3UAXA 1QDLB 4QGGA 3LP6A 3LK7A 8GPBA 4UDYX 1EFKA 2O3RA 3VMMA 2QY6A 4EUEA 2F8LA 7MDHA 3HUUA 3UENA 1SRRA 5ICEA 2H4ZA 2QTMA 1EGVB 4W1SA 3TD9A 1NQWA 3L02A 2PE5A 4G84A 1Y48E 1AKTA 3FWYA 5FV7A 4TMYA 1NXXA 4TUYB 3L9WA 2ZYHA 4GE3A 4GG1A 1UMCB 4TV8B 4WGGA 1THZA 4AMGA 4BNHA 5D86A 2E4UA 4AJ2A 2C1EA 5HWSA 4HQLA 2XWPA 4NFSA 4HXEB 4BX9A 4J7UA 1Q7TA 1ZP6A 3D1JA 1ZM7A 3FCAA 1QCDA 1MB9A 4IBOA 5IT4A 1ICIA 1EXNA 2GAFA 2IE8A 1QTNA 4XQGA 3L77A 4JP1A 4CQMA 3GI1A 2YY5A 1A7JA 2Q1YA 3ELBA 5CCXA 1JWAB 3CU5A 1Q0ZA 4Q37A 4ZI7A 7AT1A 2DECA 3MINA 5KOIA 1YTLA 1MEEA 5KUTA 2VDMB 5C5IA 3FWKA 4QQNA 1RSZA 1MA3A 2BAGA 3KB1A 3FY4A 2W2TA 4Q00A 5K5EA 3KIPA 4J7CA 2IXGA 4O2AB 4Q7JB 1ZINA 1GN8A 3LK6A 3HUEA 1SPBS 3QXGA 5J47A 4RKYA 4RTNA 1VP3A 4KQKA 4P9NA 2DBYA 2UYCA 1CVLA 2D2XA 3L0DA 1I4DD 4OBBA 1ODLA 4BTEA 3MBKA 1ZUD1 1DLJA 4H08A 1ZGCA 1NRJB 1QIEA 2IX9A 5FFMA 4KPEC 1CJMA 3K8ZA 4CKXA 1MOSA 3RT7A 2C3PA 1I4TD 4O4IA 4TZ6A 3IDSA 1M6VA 4HO1X 4B09A 4NYIQ 3TOXA 4LKRA 4YAUA 3RG8A 3GO4A 1DV2A 3T5TA 4B9AA 1A04A 4O4HA 4M1OA 5EXTA 1R6XA 4LFAB 1GG2A 2H4HA 3OU7A 1JMVA 4NYMR 5E4TA 3OM1A 5TX7A 3SDZA 2RAFA 3VSDA 3DEKA 2G5CA 1UPFA 2AZTA 2QJRA 5AHOA 4ZI7F 2RJNA 3V3TA 1E62A 2H8GA 3TR5A 4AURA 2CBXA 3PDWA 5E3JA 3UV7A 5D5HA 2XXAA 2PRZA 2XMQA 1PGOA 1TPZA 2Q2OA 3RTBA 3ITNA 4CN8A 3OZTA 4EZIA 2EGHA 2QW0X 4M8KA 2WJIA 2EKLA 2YHBA 3IAFA 2GF0A 4K2HA 4KV7A 4ZVKA 5JD3A 1IY0A 1P9OA 1PZEA 3G8DA 4GP7A 4QJIA 1CY2A 5I7OA 2NTYC 2XI4A 3JYPA 5ALVA 1KY2A 1PV2A 1GPDG 1ZK1A 2XE6A 3W7VA 4DR3B 3OZDA 1E99A 2ZUSA 6YASA 4TMKA 3D9QX 4UHHA 5C7IO 3V4FA 4YTEA 3K8QA 2NTNA 3JZDA 1WOMA 2RB5A 1L4UA 4IIXA 3SJCA 1UKEA 1NLFA 3HKCB 5BV0A 1K92A 5ULLA 4J0DA 4L7QA 4YRNA 2P69A 1Q3HA 3VNRA 3VVCA 1EJ2A 2IU0A 3BUSA 1L1EA 2OAGA 3O92A 3OX1A 1XZAA 4CMCA 2VJCA 5CH8A 1IE3A 2BEVB 4B40A 4ETWA 3Q88A 4G25A 4BNIA 4G2TA 1CZLA 3JARB 5AOCA 1N8SA 2XDQA 2NU8A 1JAYA 3U56A 4X20B 1LJ8A 3D0OA 5FTMA 3DV2A 1Z2AA 1HDIA 2AUTA 2C3MA 4K6KA 4IIEA 4H17A 2JAQA 2OLKA 3M6AA 1OC4A 1ZVJA 1IDN1 4D9JA 4Z53A 1ORTA 3GOQA 3E3AA 1U0FA 1A8PA 4RORA 1P7PA 1Y5MA 1CTQA 4EKDA 3ZHCA 1NLYA 2VHZA 3LKBA 5ITVA 2JANA 4DUZB 1JKMA 1SOWA 4O2AA 1G21E 3V7YA 4RDHA 5JZBA 4MV9A 2YJNA 4OKNA 1Q7BA 1FMTA 1WW8A 2ZIVB 3GJ3A 5G2OA 3KT3A 4CI9A 3HA3A 4QDZA 4ADSG 1X7XA 5F35A 3A1VA 4IQ0A 2A3RA 1XRMA 1SCJA 1P2UA 3PCRB 3QBVA 3WGKA 1KF0A 3MAAC 5KBYA 2DPMA 5SY4A 2JKVA 3LC2O 4Q01A 4GKKB 4I0WB 3MTIA 3H5TA 4BLPA 5AK0A 1QK5A 1SKQA 1SIOA 3ER6A 4PTYA 4GHWA 3MELA 3OFSA 3LHSA 3FMIA 4OP3A 2Q7DA 3E05A 4CEHA 1VG8A 2H7YA 4J6FA 5HGXA 1I32A 1NVBA 2NUPA 1PSZA 2IDJA 2QGFA 4HLNA 1AKWA 1E2GA 2XMDA 4P3OA 4P80A 5EFOA 2B21A 3Q8WA 5FPPA 2B4YA 1AZWA 4OATA 3AQ4A 1UODA 3D6VA 3QVTA 3A3KA 3AC0A 3FLEA 5ALSA 2DJ5A 4YONB 2HA5A 5HCIA 3B6JA 3BA6A 3AVPA 3TQSA 2QYHA 3LHDA 3GDFA 4IKEA 3G9TA 2ZAIA 4E6EA 3CF4A 1Y1RA 1JHPA 1NYLA 2H16A 2QHXA 1ZS9A 2OHXA 3KHTA 5DM2A 1EJBA 1XQWA 1ZJ4A 1ZIPA 3L01A 3W2GA 4DLTA 1JEDA 5BRJA 4YP6A 5K7SA 4BZZA 2C29D 1A77A 3N05A 1TYEB 3ZV3A 3LYLA 3FETA 4HUTA 3RODA 1JWLA 1O6ZA 1NN1A 3K53A 3GFPA 3SC3A 2XCTB 2HQOA 4P22A 2AR0A 3BRWA 5KOHB 1BXKA 1W5SA 4IJVA 4GO1A 3SLRA 4OPMA 3IHLA 4UZSA 1GTRA 5CTAA 3OCCA 1G5QA 3O4VA 2AEJA 3R7DA 3HCCA 3NI2A 3O0TA 1SVLA 2F4NA 3VR4H 4NBNA 3CC8A 3SFTA 1Q21A 4YP0A 1JBQA 2VXCA 3D5QA 4QAJA 3WLLA 4Y2RA 2R96A 1QYWA 2J6IA 3KLPX 1EXMA 2OZEA 3IAM6 2EHDA 3BPSA 3JW8A 4MUMA 4QPZA 4REMA 1KI1A 1W87A 3U16A 2JFBA 1OX5A 4CUKA 1TOAA 2AJBA 2HCRA 2WZBA 1Q1AA 3QMVA 1Z2CA 4GDMA 4XWAA 4FZ3A 4RIFA 2JGAA 1F9EA 2RH9B 3C98A 1NKVA 3I58A 4FFLA 3NOXA 4MQFA 4QX6A 4HDRB 3RAPR 1K5GA 4R05A 1DARA 2QMUA 4D4LA 4DIEA 3HS3A 2AOTB 3T7RA 5A1JA 4D9KA 5TJHA 1OBFO 3NV7A 1DIRA 1L5NA 2EKPA 4WUTA 1HV8A 5BMVF 4R81A 2XRYA 3GEBA 4NXMB 3MJ4A 4YCNA 1EGMB 2RI6A 3OPXA 4KXMA 5DYTA 1GRCA 3AJRA 1GZ7A 5CFZA 4R98A 4DLSA 1CUAA 1O9BA 3KCQA 4FMCB 3PHGA 4LHWA 4YV7A 2PN1A 4AKTA 4JNKA 3CKKA 3IRVA 3BDAA 4YC7A 3T7TA 4FFBB 1EX1A 2CK3D 2Z09A 1M6WA 3GRUA 3TLCA 4R2XA 5KPJA 1JH9A 4P3XA 5E7JA 2P8SA 4ZYUA 3V4RA 3NIWA 5IANA 1RE0A 5KU7A 5T5QA 3GVXA 2V59A 1W4LA 1TM3E 1BKDR 1YL5A 2WHRA 1FFGA 1IEWA 3CSDA 4PCUA 2X0IA 1G3RA 1KJ9A 4HZGA 1XCLA 5E6RB 2RH8A 1O6GA 2PGLA 3F5FA 3HWWA 4RESA 2TMKA 1FSSA 2V97A 2E82A 2WWXA 3BZUA 4ZQGA 3U7IA 1KYVA 4XGNA 4CLHA 4FQ5A 1J2JA 2POCA 5AM4A 2WLSA 2YZGA 4RFLA 1JFLA 1PEYA 1UCFA 3IS3A 4GLFA 5EMNA 1E8MA 4ZCQA 5CYOA 4FPXA 1GL9B 1ZY2A 1DINA 5HSGA 1BDIA 2UUOA 4LJRA 2NVUA 4ACAA 3LE8A 2JG3A 1BTOA 2J08A 5JATA 1L8AA 2WZCA 5JBNA 5K0JA 1YUNA 4L5JA 1PD0A 3RW9A 2PAFA 4YV1A 3T7AA 3CW8X 1STOA 1PHPA 3W8RA 3O4JA 4WZZA 4M1YA 1MJNA 2GXAA 2DCUA 2UZ0A 2V8BA 1QGYA 3UKOA 2OO5C 3GN1A 1D03A 1ID1A 1FYWA 3DULA 2C2BA 4URWR 3W4IA 4DWJA 4HXYA 5KZMB 2ZE5A 5KAMA 1U8XX 3DZIA 3BDVA 1BXRA 4KMRA 3AR5A 1Q0UA 1XJQA 5KX5B 4S2UA 4BO8A 3WGNA 5BUZA 3I5UA 3PNPA 3ZWDA 2ZDGA 4PSKA 1B14A 4GI3A 1S2IA 4TVBA 2V7PA 3ICOA 5FR1A 4P35A 4F5ZA 4CQNA 4AS3A 4M4SA 4GX5A 2PMCA 4IH4A 4TS1A 3GLKA 2C4VA 3LYAA 5LUAA 2I3ZA 1Q3TA 1RU3A 1Y80A 1RS0A 4PO9A 4ZC8A 3FOWA 3HZOA 3RUCA 4MWTA 1E2HA 5EYPA 1P72A 1GQQA 1C7IA 4Z8XA 1Z28A 1SRQA 3E5RA 4MDYA 3TFOA 1VKHA 2JBAA 1T2NA 2PR2A 1DXQA 1SUDA 4B81A 3H7IA 4URVR 3HMQA 1G2IA 3OQ1A 1R1DA 3UUEA 1K08A 3FR7A 1SKYB 2EBWA 3HEMA 3NC0C 1FSGA 2XE7A 4H4EA 4LUCA 3TQFA 4GOMD 5B7GA 2HUNA 5J4LA 4HTAA 3C8DA 4IJ5A 5FTJA 4PRKA 1VRCA 4R1PA 3SM9A 3UN1A 3G02A 4D41A 1TF2A 3B1ZA 4FDAA 1ECBA 2ADMA 4BECA 2XIJA 5H83A 5CA1A 9ATCA 2CJWB 3WP0A 2VHCA 4OIMA 1CRWG 1XEWX 1LLQA 2GK7A 3GWZA 4J3JA 4PTLA 5IXJA 3UMRA 2R86A 4HQ6A 1WCIA 2ID7A 1CIPA 4BB0A 5FWNA 4RH3A 1TUIA 2I5PO 1UR5A 1Z18A 2FPPB 4WE3A 2IUUA 2ZAYA 4KJXA 5TQJA 3Q0IA 1AXEA 3HFRA 3HRHA 4TSFD 5KKNB 1RFLA 5KYNA 4YP9A 3RRJA 2J31A 1WTAA 1Y4DE 4JXZA 3AK4A 2XR1A 1F4VA 1PF7E 3GPLA 4NRDA 4TV9F 3MWEB 4ZOQI 5DDIP 4ARSA 3ABIA 1YJQA 3CLKA 3O4HA 1QH1A 1I6WA 2BKVA 4JJ4A 4OFZA 1Q95A 3VR5H 2DP4E 1XHEA 1YQWA 1JHOA 3HBJA 4JA0A 4TM8A 4F71A 2GVDC 4JOSA 3QU4A 1VBKA 4OGGA 4PICA 4BZQA 4RK1A 5CDSA 4MULA 2GAJA 2ERYA 1WD5A 4M0MA 2IZ7A 1P81A 1U2QA 1M6NA 2ZIFA 5CT4A 4H7FA 1FNSA 4WADA 2P2LA 4QHSA 3FJ1A 4E2YA 2R6JA 4ZC1A 1T8YA 5ALKA 3VPDA 3B8HA 1MORA 2JHGA 2ZR8A 2TRSB 4N0DA 2A4MA 5IDVA 3VDRA 3J80A 5COBA 3LXXA 3LFTA 5FTNA 1GFZA 3C3JA 2X2FA 3CURA 3W7BA 2FNAA 3PYLA 4ZT7A 2GBFA 3VJLA 3QE4A 1MAWA 1EWKA 1YIOA 4B79A 2JI4A 2XA9A 3VR3D 4DREA 4EY6A 1E9DA 3EGWA 1AMUA 2GCEA 4M3NA 3A14A 3BKWA 4AJNA 4EMBA 3ZDBA 4EYKA 1OXSC 1DUVG 3BULA 3Q9SA 2C5LA 1JLSA 1DX6A 1NT4A 1OTYA 2Q99A 1Y42X 3EVZA 4X41A 2VAMA 1DJQA 4ETMA 2R11A 1E59A 1JYFA 3LUJA 3N2EA 3L2OB 3HCWA 2CDRA 2C78A 3E7WA 3IQDB 4KV9A 3W5SA 3H0EA 3VZCA 3AHJA 4JEHA 2JHAA 3Q3JB 3WK8A 3LCVB 4YUYA 4HQKA 1ML4A 3K0SA 1E3LA 3L93A 1L4LA 3ZWPA 4LYGA 4UD2A 3SE7A 4MA0A 4LVOA 5EOVA 1UMBB 2R5WA 5CG2A 4L74A 4WJZA 1U80A 3L5KA 2ZQ5A 1XCPA 3DGEC 4MRVA 2MYTA 4UM7A 5FPYA 1ZUNB 3W8FA 1WSDA 3A3NA 4DCJA 4NCAA 1NVWQ 1M9NA 3D64A 2FR8C 3NWEA 3O2NA 4LCEA 4XIGS 1FS4A 1U8CB 3CO5A 5BWNA 4ASUA 3P8ZA 4P7BA 4V0SA 3HMKA 2QMHA 5SYMA 4EHNA 1I13A 2VPZA 3BF8A 4GXTA 1UEIA 2HEIA 2MOKA 5DXJA 5CDTA 1WPQA 2AOWA 3DVAA 3AO0B 4QOGA 1JR6A 1D07A 3WLMA 3PVCA 1RAFA 4KH0A 1PQWA 2GEDA 3M1YA 2FEMA 3IEXA 1LFDB 3FWZA 4F2HA 2AFIB 5CJ2A 4DR2B 3L40A 1KORA 3MAJA 4GZLA 1GNSA 1V2HE 3HBNA 3LT2A 4E5MA 1CZHA 4DL9A 5EI5A 3PDJA 2KLBA 1BDMA 1JNYA 4KN8A 1L8OA 1KGSA 3O9ZA 2GASA 2G9RA 3R3WA 3R7WB 4EEXA 2GEJA 1NQUA 1ISJA 5AD1A 1BA3A 3EB9A 2W43A 5ALPA 2HQ1A 3ZU2A 2ZI3A 1VJ1A 1YZTA 2HNKA 3SSNA 2K6GA 2Z30A 4NMWA 4Y0VA 5AVQA 3DDZX 3MSXA 2F3PA 2G80A 3LXRA 1TM4E 3WC4A 1UFVA 1DG3A 3DVSX 1OSNA 1G8KA 3HPRA 3SFZA 2WIAA 4JHXA 1SBQA 4H0CA 2RMKA 3FAKA 3LTEA 3RV4A 4RH1A 3PQCA 2BR5A 4Q15A 3AGPA 3EN0A 4A1OA 2FW1A 5BR8B 2NUPB 4PO8A 2N9UA 3ODPA 3ZDFA 2IQ5A 4ZYWA 3E70C 4UPEA 1CNEA 1LH0A 1UKYA 1ZKDA 2GO7A 1QLHA 3VU1A 4V1CI 2CYAA 1ZUWA 3FYSA 1GPAA 3C5EA 2IEDA 1XU9A 1YR6A 2HJWA 2Z3WA 3ACCA 1R6BX 3NH9A 4H35A 2ZBGA 4L08A 3S4YA 121PA 4MQUA 3W5VA 1ELOA 4GXRA 4U63A 4ECAA 1EUCA 2JIZA 5J5AA 4NONA 4E30A 5KJFA 3BB1A 3GY0A 4C7XA 1BWQA 4JNCA 3N53A 2GILA 4ZREA 4YREA 1ZISA 1AZSC 4RQAA 4WV3A 2W70A 1TUBB 5JOQA 3NBYC 3EFOA 1EWQA 2SBTA 2C9MA 4ENSA 5J2TB 1E77A 1YB7A 2GPTA 2DH6A 3AY6A 3OCZA 3R7WA 2Z6QA 2GEVA 1ODKA 4BHTA 4TSFA 4J0CA 4GZ6A 5GIPE 2PUWA 3ABSB 2OLJA 4HRXA 4PPYA 2HRRA 4KQ1A 1PFUA 2VH5R 5DX1A 4Y1RB 1CDEA 4D9IA 4HWPA 1JN0A 1LJUA 3G8CA 5AKZA 1BDBA 3HPQA 1CUWA 5J43A 3U3RA 4DR6B 3QG5A 5DTIA 2VDWB 2PYDA 3D8RA 3R2JA 3SHFA 4L0CA 1EJ6A 5CMLA 3MRVA 2B8NA 3LV8A 1ZLXA 3Q6IA 1E5VA 2B25A 2Z1MA 4R2IA 3FYCA 2IGBA 1WB9A 3MFQA 3AFIA 5HTKA 1EHYA 1KQ3A 5K3SA 1NUHA 1ZRNA 2CMHA 2XUQA 5FPKA 1J25A 2O7NA 3U9TA 2K7FA 1ZN7A 2YVUA 3ZBQA 4X92A 1C14A 4GSLA 1EB8A 4JGIA 4C87A 3TE6A 2PWZA 2ZSFA 1SOAA 5ITZB 4QXPA 4UHCA 4WNIA 2OXTA 3PNYA 1J2YA 3HDGA 1MOZA 1RWPA 1ZD4A 3A3PA 3A6LA 4W1QA 2GWRA 4MICA 4C76A 5AHRA 3GUHA 5FUXA 3EARA 2AFHE 5ALRA 5IG2A 3U4QA 3NBAA 4ARCA 1CP2A 2QF7A 1GTVA 1M72A 2VZLA 2WVGA 4OGKA 4RPLA 4ARZA 4DC1A 3CH7A 4IYJA 1ID8A 2XYGA 3FMPB 4DBLC 3R09A 2O23A 1DXYA 1EA7A 2W6OA 3TZLA 4OTZA 4ZKEA 3V6LA 1O96A 5DBFA 4YCAA 1XVLA 3V33A 3PCXA 5E8RA 1XD9A 2EL9A 2V7QA 3NM5A 2X1MA 2JGFA 4GQBA 1XVTA 2QLMA 3A26A 4J1QA 4F91B 3OICA 4ZO9A 4BIIA 5A06A 2FHPA 2J87A 2XXAB 2ZSAA 5AJYA 4BVEA 2BFFA 1HE4A 3CV3A 3NO4A 4C2AA 4YECA 1RQLA 3TGLA 1N7HA 2Y1FA 2AWNA 3CNBA 3OE4A 4ITUA 5TC4A 4CCAA 3PHHA 4F7DA 2XEXA 1QANA 4DLAA 1G4UR 4M1QA 4D4HA 5FI1B 3AFMA 1FW6A 1GQFA 5B7PA 2A14A 2X1LA 2GNOA 3L7AA 3KYJB 2IEAA 3H5LA 3KB2A 5HDBB 1GPJA 3S70A 4YRIA 4QYIA 3BM5A 4TRRA 2FW6A 2VKTA 2A67A 3C85A 2O19A 2YZ7A 1NE7A 3WYBA 3T7DA 3EBPA 5LBTA 4NAUA 1U90A 3X1YA 3KSZO 4OU5A 1EQUA 2QENA 1N1EA 2CHUA 1O94C 3KWLA 2GZMA 3C16C 2ETXA 3HVIA 3L7DA 4OQFA 4ZVOA 3ZIAA 1FPQA 5AVJA 2JCGA 2BSXA 2ZRFA 3I05A 2PZAA 1SBHA 2YJ3A 4IZHA 1P9NA 3OLCX 5LA6F 1OHHD 1FFCA 2XUJA 4LYAA 1IN7A 1D4FA 4ZA2A 4C7JA 3GC6A 3RTEA 4CNBA 5BXQC 3REFA 4WKOA 1T9DA 3VPGA 5K99A 2RGUA 1G8HA 3MTEA 5AMXA 2QTVA 1EUZA 3BA1A 4BV3A 3AYXB 4CQLB 4FEAA 1OMOA 1QVVA 2QE7D 3AMVA 5CPFA 3HY3A 1BSVA 1MAAA 3S99A 1UXJA 2WE7A 3IMCA 2Z3ZA 1K0UA 1QFYA 4MGEA 4DIBA 4DIFA 1B7GO 1MBZA 2QN1A 4JUAA 4GX1A 2FE4A 2ZXFA 4NJEB 2Y66A 5F33A 3NGXA 4B2LA 4CMGA 2X76A 2OV6A 1Z5OA 4MTLA 5AWFC 3H1BA 4RULA 3WB1A 1W88A 2ZJ7A 2VK1A 4MW9A 3LCJA 3UKDA 3PL5A 1GARA 1NOIA 4K87A 5C31A 4PHHA 5CB4A 5I47A 2ZSJA 4R9SA 5FCDA 2IVFA 3DFKA 4ER5A 5KWJA 1YGYA 4F3CA 3JQBC 3FTDA 4BNMA 3E5HA 3JZAA 3FHJA 1U9JA 1HT0A 1SCIA 3X44A 5JT1A 2R0QC 2VP2A 2WYVA 4LQLA 5CVDA 4M7RA 4GOLD 2EX1A 3W1WA 1UZAA 3T5BA 3EY9A 2WD7B 1Z68A 2JJ2D 3IPXA 3KL2A 2NO9A 4ARBA 1BDHA 3ZNQA 5CYFA 2A1UB 4G5RA 1XWWA 2CUTA 4LOLA 4XLLA 2QGNA 3I4CA 4PONA 3ZU5A 2E5WA 1ZHHA 2FSIA 3BWDD 4Q7LA 3SAJA 3DBLB 4WQMA 4ZODA 4CEIA 3QLVA 2HCJB 3B13B 3ER8A 1UC9A 3GLHB 4QYIB 4L16A 5T4HA 4WLOA 1CUYA 1QS0B 1ECGA 4RF5A 2YFKA 1KVRA 3M6IA 2PUHA 4U0JA 2YOFA 4EB0A 5A3SA 4NJMA 1T29A 3D6NB 3EMDA 4ZO8A 1Z13A 3DDCA 3WSVA 4BU1A 4IV8A 2V5UA 4DLLA 2DETA 1X7ZB 4D4IA 3KB8A 2OBFA 2BI4A 4G8CA 4GYWA 1E20A 1P44A 1B6RA 1RLJA 1U0GA 1WSAA 1GYQA 5DI9A 1M8PA 1RWXA 1PCXA 1ZL2A 2QL5A 4QUEA 4R6XA 1FSZA 3C8ZA 1PS9A 1UP6A 2UAGA 3GPCA 1V41E 4FXPA 2V7QD 2KHZA 3B7PA 3IV6A 4WLNA 1YZKA 4QFCA 1YFKA 2H7CA 5AK6A 1P1JA 2XECA 4ZT2A 2P2YA 4O1MA 4A6DA 4ZJPA 4BRUA 1YR3A 4ZANA 4EB8A 1I24A 2ODPA 3ONNA 4EG1A 1KKLA 2BL4A 2DFLA 2LRHA 3NHJA 5DBHX 3TMAA 4LBWA 3T34A 1K5HA 4M1WA 4YALA 4DQUA 3UHAA 3QA9A 5FL7A 3FZYA 3GCGA 4RXUA 5EP4A 3RRNA 4BQQA 4L6AA 1O0BA 3ZCSA 4ER7A 1Y1KE 5G3ZA 1OB5A 1WDMA 1JB9A 4YT5A 1NVAA 4KCGA 3OD5A 3PD0A 1RKXA 1IPEA 2RC5A 2CBGA 2PO7A 5EYPB 4QM6A 1ZMBA 4KI7A 4LHXA 3DAYA 1OAOC 1U2RA 6PFKA 1QRTA 3CUTA 2AKEA 1PWYE 2C4MA 1E7SA 2DUUA 1W93A 5T6MA 3TGWA 4YDQA 2O3UA 2BKLA 1GGFA 1E7QA 1LBEA 2Y68A 3D43A 2UV8A 1WHTB 3N8KA 4FCVA 2EP5A 5AI0A 1SFRA 2JGEA 2WTUA 4L8WB 4EB3A 5SY6A 5JCOA 2ZRLA 3WAGA 1T6ZA 1CC1S 4L2IA 2PM8A 3MN1A 3GUYA 4MVJI 1S3GA 3EH2A 3OKPA 3O2QB 4OQLA 1KGDA 2EBFX 4ZD6A 4MLPA 2REQB 4KKVA 4EL5A 1NR7A 5KB3A 1VSTA 1QRDA 2HGZA 2XAAA 3HLYA 5I9MA 2L42A 4W1PA 5BT8A 5AI6A 1HNZB 1ZAKA 1CG6A 3D1VA 3SLKA 4D6XA 1SGWA 3WGGA 3SG0A 2PEYA 4J1TA 3A2LA 4RJKA 2GX6A 4I3HA 3IUSA 2WNIA 1IEXA 2QTCA 2A0UA 4H31A 4G1VA 1CETA 1DWPA 3RU3A 4DXHA 1RIFA 1T8SA 4PX3A 1E94E 1VBNA 1Y9EA 4PNZA 4FJ2A 4X54A 3EFBA 1Z5WA 1YDMA 3E9YA 4C1NA 2QK4A 5AESA 3OHPA 3C1TA 3DUWA 3FVWA 1WWKA 2ZYDA 5EJ8A 1GAEO 5JCOC 1AKMA 1N77A 1DCTA 4UEQA 1TAUA 2WFAA 3ASZA 3N8DA 3WNVA 1E7MA 1K7EB 2HD4A 2PLNA 1FBNA 2V98A 4WESB 3THXB 2JW5A 2FRDC 1RFGE 4M0EA 1P7ZA 4UQPA 3QY0A 4JJ8A 5D2CA 3FVRA 1CB7A 4XUEA 1AQ6A 5BWLA 2M2IA 5JI2E 2NQTA 4YGYA 1Q74A 3IPRA 4LZPA 3RBAA 1EK5A 3SQOA 2GA8A 4R6WA 5DXAA 4FC6A 2XD9A 4NYMQ 4EWLA 4CKZA 3PHBE 3GFVA 2W8BB 4JASB 2ZE7A 3QWAA 4Q21A 1ZIYA 1QFMA 4DYDA 2BN4A 1NX9A 4Q39A 3WNCA 1BROA 3HADA 1I3NA 3I30X 4RV4A 4BCBA 1UBRS 1IN6A 1ZX1A 1YE8A 3KVRA 4HC4A 1JEQB 1BQ4A 4F4FA 4DXDA 3L8DA 2X19A 4NZNA 3STUA 3EGIA 2FY8A 3CNOA 1JBKA 1IY9A 3CG4A 4FT2A 4UVEA 4LHEA 1XF9A 1FDVA 3TW8B 4Z4HA 3BWEA 4F3NA 4IX1A 4ZKDA 1MX1A 2CFSA 3W6UA 3Q4GA 4HDRA 1I0ZA 4COKA 4INZA 4ND4A 4E1AA 1I8TA 4MS3A 2V8OA 1VHTA 4MARA 4Q9NA 1KKMA 1V2GA 2DT5A 4S35A 4EG4A 4PLWA 3VYWA 5BPHA 2CN1A 4M7WA 3ZGNA 1Y3CE 4EW6A 1R5BA 1C41A 1BVRA 2NTEA 5C2JB 1SCBA 2ARKA 3DR3A 1JXMA 3EWNA 3UWSA 4UE6A 4YY3B 2FZCA 5HZHA 2RAPA 4NBTA 1T0IA 3IUJA 1N6KA 4ED9A 3OTWA 1EHCA 1U7XA 5CX1A 3RV3A 4UUBA 3CUVA 1SC6A 1XCMA 2B35A 5ALXA 7MHTA 3AEXA 4JODA 4LBYA 4JP8A 4RWZA 5AYVA 2QMOA 4JZKA 4Y6OA 4DLNA 5H81A 1FUYB 4OFXA 3LY9A 2EDCA 4MINA 3QTBA 5IC6A 4K8OA 2FDCA 2X4GA 3G17A 4OHWA 4IUCS 5CM9C 5FPSA 2YC2C 4LG1A 2OZLB 4DFDA 4JC5A 1SAYA 2F3QA 4NL4H 3RJMA 1OFIA 2A58A 4P3KA 5TQ0B 1VI6A 2C7GA 3C1OA 5FLXA 3HDYA 1YR8A 2H9IA 3RS8A 1W0CA 2OUKA 16PKA 2V7XA 1XQVA 5G0UA 4NESA 2Q5OA 3PC4A 2QORA 4JBIA 4PX5A 3GG2A 1GZHB 1K8QA 4LBVA 5DGIA 1D7AA 3INTA 3FMGA 4PQYA 5T8KC 1GRVA 1FCJA 3GYGA 3KTDA 4N5MA 3TTXA 1JNXX 1N6HA 1JT9A 1B93A 2Z9DA 4HDAA 4KXXA 2HA2A 4E2FA 2QN9A 3DNPA 3K0BA 5E3IA 4LNAA 3WV4A 4ILEA 3P4YA 2IYAA 3H11B 3JD4A 3L07A 3WYDA 2COKA 1MC1A 3GJTA 2GJKA 4KO3S 4UNPA 3UCFA 2C31A 2E48A 2ZIEA 3OEHA 4YRBA 5KKAA 2PU7A 1AOXA 1CQIB 3VISA 3WLNA 1J42A 3FZGA 5JASA 4M6WA 2AB0A 4O2BB 2R5FA 2HSGA 3USZA 2R7NA 3ZEAA 5ECGC 3KZNA 4P08A 4DNQA 5FORA 1ZMTA 3AONB 4A8JA 3R1IA 4UTNA 1WXQA 1Z6GA 2UVQA 3WO0A 4RY8A 5JADA 3FIUA 3P9IA 4KXNA 3BGDA 2BGLA 2DHCA 4BO7A 1DMSA 1JIJA 2OCIA 4YRMA 1HFWA 5FO1A 1MQSA 1PR1A 3WQBA 3DLPX 3VNVA 3PIIA 1EVIA 3WOVA 3HCEA 2GD2A 2HJRA 4JX9A 4A6XA 3PDCA 3C5WP 2PK3A 1JZTA 3OOHA 1ZQ9A 2PH7A 2IIBA 3UF0A 1OTXA 3A4IA 4KQ9A 1ZXXA 1BGVA 3SZUA 3W04A 3ERCA 3ANTA 3B9BA 4L73A 2CEKA 5B12A 4B43A 2PGNA 3VPXA 2D00A 2RARA 3DONA 3UJPA 4LXQA 1FE8A 1A9QA 5JZ9A 2ZUUA 2P90A 5H0IA 1RPJA 2XLBA 3UV6A 1OGIA 3NHYA 4EMSA 1RXEA 2XA2A 1YT5A 1TFRA 3Q9UA 2CJWA 3QGMA 1G5PA 2HRDA 2JAUA 3AIIA 3I5AA 2DQZA 1W4ZA 1Y4SA 1NPYA 2BIFA 1RLTA 3OZIA 3PP8A 2P9QA 3QUCA 3S2ZA 3HKCA 2Q5LA 4X7BA 5LQUA 3EG9B 4JENA 2GT1A 2PYIA 3QPAA 2LCFA 1Z0UA 4ME6A 2IGTA 5CAEB 4B3CA 5JS2A 4E1VA 3WK9A 3P0EA 3KLNA 4WJKB 1T5DX 4BFYA 2C54A 4G8BA 4JI3B 5KYXB 3QI7A 1SELA 1T5LA 2VQ6A 3U19A 4YLEA 1RPNA 3KJFA 3TXXA 1HY3A 4JLDA 3C6QA 3CTMA 2AFRA 1T8WA 5P21A 2UUPA 2IW1A 3KV3O 1W19A 2Z2YA 4RA9A 4GEKA 1AZLA 4ML3A 4QXMA 2P11A 1P45A 1G98A 2VTEA 1RNLA 3T0GA 2NZJA 1FFWA 3HFJA 3QXSA 3MCZA 1TCCA 2WV9A 4XB6B 1DFGA 1NVGA 2X5KO 1ZR4A 2QMYA 4EHBA 1W85B 5LP6B 2I8CA 4GZ5A 3CRZA 3EWIA 4BRZA 4Y1GA 4LV8B 1EX9A 2Q3JA 2XOKA 5AJHA 4R9VA 1CU1A 2XXBA 1GGHA 3K0AB 3GX1A 1MG5A 1QG2A 4QFMA 2VHVA 4PG6A 3H9QA 4AP6A 4RUKA 1R0KA 1BG6A 4Y9UA 1EP9A 4I5IA 3BEDA 2W0MA 3K0AA 4KFCA 4MVJD 3DZCA 1SBZA 4MS1A 4RA6B 1WD7A 4F46A 3DBLA 4XR4A 5G41A 1KOJA 1GCUA 1V5WA 2KBEA 2AN5A 2QV7A 5A9RA 2GDJA 3R0QA 3KSBC 1JLLB 3LXMA 4XD7A 2BFPA 4DIKA 2C9CA 2X9QA 2XVZA 4EH1A 5HQ3B 3C70A 4OI1A 3K1JA 1WUIS 2NV0A 3GLFA 2GBGA 1G9TA 4GFDA 3EUWA 3PDHA 4YH1A 1C1XA 4EB6B 2JVJA 4CKBA 3A9WA 3ZQ6A 5KU1A 2XQKA 1T5SA 4MB2A 2GMWA 3DZ8A 1Y9AA 1ZIDA 1RJFA 3W05A 1OVGA 1V48A 2R85A 5DBGA 2RHCA 3TFWA 1WETA 4FFOA 4BLQA 5B3JC 2QX7A 2BFEA 2WYUA 1WB6A 3IOYA 2FWAA 4OIFA 5T4BA 6REQB 1P2GA 1CJSA 3GFRA 2VJMB 3FNFA 1DQPA 1BXZA 1V11A 2PA0A 3MMNA 4MZXA 1L5KA 1JQLB 4H60A 2GZHA 2H9YA 4DNOA 1T6BY 4ABTA 3KV1A 4NG5A 3PNVA 3VPSA 3WMGA 2X8BA 1ZW6A 2QA5A 1F2VA 4B6PA 3CS3A 1YB1A 2V6MA 3QBEA 1DQSA 4WFQA 4YMIA 2GOYA 1LCIA 2ZUDA 4MO9A 4MUIA 2H6EA 3GEGA 3IAM1 3UAOA 5K8UA 1ONBA 1L4GA 1I9CA 4HAIA 3V8QA 2K5UA 3GLTA 4CPDA 1FFSA 3T3MB 1E8DA 2G88A 3G0GA 2AMYA 2F8SA 1JHRA 2OO7A 3URMA 3D4NA 3IVGA 2JD1A 5EKUA 4QOFA 2XZLA 2C2ZA 3JVEA 3MHPA 4IS3A 5ELLA 4TYNA 1SCNE 1XEWY 4QSMA 5JV5A 1W34A 4OJQA 2W71A 1QG0A 3MMSA 1BEEA 4Q4HA 5AJTA 3TUJC 4JB2A 4AN1A 2ZPTX 4QATA 1RLMA 4DAEA 3K71B 2DE0X 1LTQA 2PX0A 3U80A 4BO3A 3O74A 4CMKA 3L79A 4FN4A 5E2AA 1I2ZA 1L5RA 4KDRA 1ZN2A 1ORHA 3LDAA 4OYYA 3UOWA 2EAUA 2J6BA 4FGSA 4GP6A 4ID9A 4D96A 4P4NA 4YT8A 2REBA 2IU4A 4I6GA 3JSXA 3UXHA 2CWDA 3QFSA 3VSEA 1G18A 4EHHA 1A96A 1G7TA 1T8PA 3PUHA 3ST7A 4IQ8A 2ZTHA 3U4QB 3UUWA 2IX3A 2I2BA 1V1JA 3BJMA 1ODIA 2CMDA 3L7JA 4LDZA 4NH0A 4LMBA 4HVTA 2H3EA 5AW0A 3MW8A 2Y67A 8AT1A 2HV9A 3IJPA 4GOKA 1SXHA 3FSEA 1JECA 3D2AA 1Y8CA 2WJVA 4JQZA 5KDLA 4P2GA 2CVOA 1GZDA 3IE2A 1SHUX 2RHWA 1Q6ZA 2YWJA 1P80A 3OBBA 3OJWA 4RDXA 4RS4A 6NULA 1WVIA 4XRRA 1E3DA 5JVDB 2P9BA 5T3UA 3MRTA 1BWSA 2VHEA 3F71A 4D3YA 3K5WA 2W5UA 4F56A 5JDCA 5I4BA 1RWWA 3CLUD 4IH1A 4QPPA 2JFVA 5L9AA 3DE5X 3LOQA 4CMIB 2BFEB 1EDEA 1OLXB 2JLSA 3T7KA 1E2UA 1G5TA 4LA4A 3VAYA 1WL8A 2JJYA 1VGVA 1II9A 4GPIB 4PZAA 3LFUA 2EX4A 1NVVQ 1JI0A 1FU7A 2RGDA 1XZNA 3ESDA 3OMXA 4JVLA 5K8TA 1J07A 2HGSA 5HF9A 4IGIA 4ZYLA 1E9EA 5L3SA 2PA3A 1HXHA 3I0ZA 1J20A 2O5EA 3R9KA 2FPWA 2YUTA 1GSOA 4MR7B 3ZJ4A 1OY1A 2C83A 2QTFA 3N2GB 2HXSA 3R5HA 4WN9B 2ZB7A 3FUCA 2GVNA 3IEUA 3KAKA 4IIUA 4KN5A 4UHEA 5F5NA 5AFSA 3VTAA 4PHTA 3VNAA 4DJ5X 1JG2A 1G5IA 1KOFA 2R1VA 3SVTA 5CX4A 2BCEA 4GICA 3J81k 3UJHA 1PR6A 3FTFA 1Q7EA 2R6CA 2A1TR 4Q66C 2C4UA 3BF7A 3L7CA 2GKSA 1DBIA 2WI8A 1Y0BA 4JLNA 2B94A 1FX1A 2PANA 4DEVA 1LLUA 1OXXK 4LXIA 3B2QA 4G0NA 1JU4A 3V34A 2A9KA 1EFPB 1NQAO 1T0BA 1YZYA 1SIWA 2FMTA 1JHUA 3KFLA 1RI1A 1GNTA 1FVOA 3L7IA 4LXXA 2YYAA 1HQYE 1T34A 4CMJA 4E08A 1A9XA 3AVVA 4LMPA 1JRLA 4RYLA 4HUQA 3TIIA 3UEOA 3W4JA 1Z6QA 2ICAA 4A23A 3SCZA 4MX8A 3ZWOA 3IERA 5FNZA 2XUIA 4D0LB 1SC4A 1DEKA 4FYKA 1TM1E 3K30A 5CA0B 3ENWA 1IQ0A 2QX4A 1R10A 2WD7A 2VKQA 3O8OA 3QEOA 3D02A 4JYCA 2IUSA 1WS6A 5JCJA 3X1DA 2FE1A 4PNEA 3O2SB 4RVDA 4FWIB 4KPYA 2JFXA 4MDEA 2C0CA 5ALLA 1ZUIA 4TWRA 1LTHR 3K1YA 3I01M 3KZOA 4TMWA 4AECA 1KMNA 2PY6A 1DADA 1T5TA 1A2KC 2BMEA 4MR8B 4E21A 5C37A 1V26A 2UU9B 5JW6A 2OXIA 3PV0A 4L72A 3JD1A 4RDCA 2HWYA 3GJRA 4PSUA 1ODTC 1DELA 2C20A 3PWTA 3ND9A 1DWQA 1O6CA 4QUJA 3TJRA 4GSYA 2ZWPA 1G5FA 5I5EA 3VPFA 3H8WA 1AKUA 4WCFB 3NHRA 4DIOA 3CLRC 3E4DA 1MUUA 1N2CE 2NXJA 3GAMA 4PGMA 1EGAA 1FDWA 1QQ7A 1JUDA 3GLSA 1V16A 4YBZA 5CLFA 3N2KA 3ZWQA 3RIHA 2KI5A 4FX5A 3WBKA 1VYUA 1T1RA 4C7KA 1J1ZA 1WKBA 2OSBA 3AEYA 4FYVA 4XD2A 1QZTA 1J8DA 3KLBA 1CULC 4JELA 4EDHA 3RTAA 4NR0A 4AZ3B 1QB8A 2J5BA 3TW0A 4KHZA 1AGYA 5I8PA 5LQNA 5CBKA 3ANSA 1GNQA 3A32A 3GUVA 1T1EA 3TVDA 4BVGA 4MUAA 3BMCA 2PBLA 4OM8A 4ZVUA 1LC0A 4HDCA 4NE7A 5HJ7A 2A2ZA 2YXEA 2FX5A 4XEHA 4EG7A 4NI5A 5IJ9A 4IUBS 4GI5A 3C3BA 1CDOA 1U63A 1SKYE 1R6UA 3Q3IA 1QAQA 2ONCA 2NYVA 3SX0A 3UJ3X 2WDPA 5JARA 5JTUA 1AQJA 1N5DA 3S2IA 4ALNA 1U3CA 1BVUA 1DRJA 1NYQA 2CLIB 4L75A 3PWKA 4L2IB 4B47A 2VXOA 4EPTA 2Q21A 2HF8A 1V6CA 3MHTA 4KQCA 3ZQ4A 5L3VA 3EC7A 1C7JA 2Q3FA 1BFUA 2FN8A 2CFIA 2WG0A 3ESYA 3H2KA 4RK5A 4B7ZA 1GYRA 1U2SA 5AKKA 2H2GA 4A15A 2LUOA 2NN3C 2ZPUA 2AJ8A 3M1IA 3KUXA 1E3SA 3K09C 1EU1A 1NF8A 3IDAA 4PYMA 2FQWA 4EW1A 1KMCA 4NULA 2A92A 3F1KA 4E31A 4RTOA 2HRZA 5DHTA 3E82A 2JHPA 1DAMA 4MIKA 2C2OA 4DJDC 4Z86A 1RRPA 1E32A 1YV9A 3EQZA 2VTDA 3F6RA 3JASA 3NUZA 3V8NA 3ZWNA 4ZTZB 1KRXA 2OZPA 2PWBA 2EW2A 2O1WA 3A36A 1QQ6A 1W8IA 4HRAA 3RS9A 1P4SA 4H0NA 3TSWA 4C3VA 1QB7A 4CQMB 3KEGA 2EW8A 2EKBA 2GD6A 1ZD9A 3QV2A 3NORA 4MDHA 4N0MA 5EKDA 3VJMA 3U60B 4NS4A 3OVMA 3RRYA 4QULA 2Z83A 3GJZA 3OP1A 1U28A 4ZVMA 3CCCA 5NLLA 1ZM2A 2YMPA 4ND5A 2PG3A 1KBZA 1JPJA 2YHIA 1M76A 4HZUA 5IPFA 4FHZA 2JFYA 1MO5A 4BRSA 4EJSC 5F3WB 2JEZA 2YTZA 1XNQB 3AKDA 1PQ4A 3M33A 4JGGA 4DJEC 4NU5A 5JNUA 1H5NA 1KSHA 2AFIE 1QO0D 1S02A 2QUJA 1T5IA 3ULKA 1AQYA 3LQFA 5A62A 1QHSA 5M7EA 1NI4B 3D8HA 2WJ4A 1SUPA 4MS3B 4EKGA 4W8GA 2JCVA 2WQZA 4IPTA 4RA9B 2WM2A 2GO1A 3ESXA 2LD4A 3ND5A 3IILA 4PZYA 3EIEA 3QRWA 1IWPB 3R5FA 4LVCA 3QVOA 3REGA 4LE0A 1E3QA 3CKLA 5FLEX 4ZZ3A 1I94B 4DXAA 1CUSA 3E8SA 3FPJA 4RPJA 5BPFA 1B2LA 4GLBA 4KQIA 4CR8A 3WS7A 1E0AA 4FFRA 4U39A 4IOMA 2FPSA 4URZR 4FILA 5B1SA 3UC9A 1CUBA 2C7RA 4R8LA 2HZBA 2D8AA 4C0HA 1C3LA 1O0SA 1Y4UA 1NY6A 2DFVA 3NHAA 1X9GA 3PNOA 1MXFA 4FOOA 4RHTA 3L6BA 4OGFA 2C92A 5IXYA 1EQAA 4UUPA 1C30A 3KWFA 4TWIA 3W9YA 3IXLA 4F0JA 1P0MA 1EBFA 1Y3HA 3G2PA 2BVNA 1SOUA 5GONB 3WIDA 1E6CA 4RL6A 5EXPA 3O9VA 1KI6B 1TPYA 4JT2A 4ZOBA 3E22A 4X95A 1QZUA 2VP4A 3WJAA 1JDBC 2PWAA 2BDUA 3NYRA 5HKKD 2MIIA 3CNHA 3TSCA 2FZEA 1NDHA 4CF6A 5FAXA 1RAEA 3PE3A 2HHJA 4LJKA 2H4XA 2NUTB 1B1CA 3T1YB 1NMSA 3F90A 4J43A 1OLXA 4QO8A 1MV5A 2WUGA 3JQ6A 3RCBA 3WXBA 2FAXA 3U6KA 2HFJA 2D0IA 2D74A 1N5JA 3KJZA 4R69A 3RVKA 3TBKA 4Y3UA 4D8VA 1I4OA 4N41A 4PYQA 3ZNNA 2VAWA 3JTMA 2ASVA 4JDUA 4OI4A 1YMQA 4Q1CA 4RKWA 3WYCA 4EABA 4R0NA 2EYQA 1JA1A 3OFJA 1WCYA 1XDZA 3A6EA 3T12A 1GPMA 2JFGA 2AK3A 2E0IA 2X9VA 3FVQA 4MUBA 1S6YA 4ZGWA 2DKNA 4G1FA 5H68A 3SY8A 1IQRA 1HDZA 2IOFA 4G2NA 4Y6PA 1DXHA 5F1KA 2AA3A 3OPYA 1EXVA 3A1FA 3UHFA 2QSYA 2H5IA 4D1YA 4TTIA 4TKMA 3D1LA 4RQTA 1YVRA 3CRVA 4IL5A 2FGJA 2ZT8A 4JAVC 4XEUA 2CB9A 2EWWA 2RBEA 2AX4A 2VDQB 5F9HA 3C3WA 3UAWA 2WT8A 1DBRA 4JC0A 1J1IA 3GRVA 3RRMA 3NC4A 2PS1A 2J0QA 2W2KA 1YJCA 4H3VA 4FNAA 1XR3A 2EX0A 3IQXA 4TMFA 3IAHA 2BMWA 5DB4A 1N6PA 2I4OA 1NBEA 2FWJA 5K0LA 4KE6A 4KR7A 1L9XA 1PJ8A 1QM5A 3HXPA 1LVHA 5EJ7A 1HX7A 5AM3A 1A69A 2ZJ6A 3DC7A 1RRKA 4QO7A 2CNKA 3FOAA 2VPYA 2NTVA 3QJGA 2D1FA 3ON5A 2O59A 1XTQA 2QGZA 1OA1A 1IBLB 2P9EA 3R24A 2A59A 1A8UA 2FU5C 3U5TA 1VLMA 3QSYA 3I9V6 4TVSA 3V8EA 1Z6TA 2BZSA 3PFKA 2XF8A 1KETA 4DMFA 1DIAA 3IHKA 1NBIA 2WIDA 3GJ0A 2NU7B 1CE8A 2C88A 5FOXA 1JI3A 5KSYA 5GY7A 4W9MC 4YDRA 2BLLA 4MV0A 3LT4A 2WJYA 2RK6A 3RJ9A 3OM8A 4H7EA 3ADKA 2QKYA 5K0FA 4FUQA 1XLTA 5KSOA 4OA8A 3CRRA 1LWOA 2WUEA 1L5WA 2PZEA 9ABPA 2VPTA 1MNAA 2ZSIA 3QNWA 1WABA 3S8MA 1R6DA 2DMRA 4J94A 4U5XA 4EPRA 1O7JA 4KG7A 4DBVO 2Y1XA 1S7CA 4ODIA 2O5VA 5AW9A 3IRUA 2WJZB 3KUCA 1YRWA 2YXPX 4C6TA 2CLHB 3C8HA 1W48A 1W1IA 1MGOA 4BY9E 1N9GB 4KUGA 2VJLA 3V80A 1E98A 2QYOA 4XTCS 3ZS9A 5JD4A 2IPLA 3I6ZA 4RENA 3F5MA 4OK6A 1Q92A 4LJ6A 3OLZA 4F3YA 3TJMA 2JJ1D 4FS8A 3RF7A 1QQTA 3H3JA 2GAIA 2GLTA 5FBKA 1CJVC 4HG2A 2B6NA 1ZD5A 3JZMA 1XKTA 1E79D 1VGRA 4RYDA 4ZRMA 5HKOA 2AXQA 1D1SA 5L3ZA 3DZFA 5D3MA 3GH3A 1B41A 3ITKA 3O7WA 1QH0A 3GZNA 2EFJA 3W3AH 2OCYC 2VJOA 1TMKA 2VNAA 3PUWA 4ARAA 1O57A 4ICIA 1GAXA 2CYBA 4L7VA 3E2PA 4F4JA 3I04M 3WDKA 1JMKC 3I3SR 3SVZA 1DWUA 3DA8A 1NAHA 3HA7A 4UU1A 3K9GA 1DIHA 4IP0A 3AL0C 2F4VB 2UYHA 4HPJB 4B75A 1ULUA 4ZEMA 4QA9A 1FFEA 1U8ZA 5M5BA 2V9CA 3OZ7A 4TROA 5C4MA 3TUZC 2HUPA 1U9CA 4HQFA 4I6EA 2FR0A 4KQJA 1R37A 5F7ZA 2FX3A 4BO2A 4D98A 3R77A 3Q9LA 4HVLA 3JS5A 5C5EA 3DEFA 2JK1A 2Q4BA 4ITVA 1QGDA 4D80A 1BNCA 4UPDA 3B7WA 1P19A 3TLBA 1Q84A 3ZBTA 4BKUA 3AESA 2G0NA 4O4JA 1WF3A 4TRJA 5FFNA 4MW4A 1UFRA 2KBFA 1KO1A 1UKCA 3HB5X 4J2TA 4DMHA 3UW1A 1HDRA 2HCFA 1XGKA 2BFOA 5C3MA 4YWHA 5CBPB 4DY6A 1BMFA 1BOFA 4IW3B 3TFQA 3HNPA 4TYQA 4C7OA 4I9UA 3V42A 3VX4A 3OE7A 1T2DA 2OGZA 3AUXA 5IDWA 1Y3BE 1U7DA 3F8WA 3L82B 4GH5A 3HXMA 1GDTA 2CV0A 4EKYA 3ZU4A 2B9VA 4GAEA 3G68A 2DAPA 3LX5A 3HA5A 1Q1EA 5D3KA 4P4SB 3U7QB 2JFPA 3CCFA 4BNGA 1QF7A 4HT3B 3MF4A 4KPFC 1S96A 1IK6A 1BZYA 2V58A 1EUQA 3RABA 1M75A 5TXGA 2KW5A 3ZGZA 4UNRA 3HJUA 4FFWA 3WA6A 4HQNA 3ENZA 3KB6A 3HNOA 5B55A 5KTTA 1E69A 3DP9A 3FNBA 4OU4A 2C97A 3WIBA 2ZRCA 3KQNA 2BRUA 1IBMB 4C3UA 2OV3A 1OGYA 3QQ5A 3DLBA 1N32B 2CW5A 4HAOA 4OYLA 2VYVA 3RREA 4QHYA 3SS7X 2YWHA 2ZBRA 1OH5A 2JAOA 2IA5A 1ZQ1A 1N0HA 4E5UA 4EUHA 1I3OA 4OP2A 4DA8A 8MHTA 1H4QA 3IR5A 2W2XA 4G4GA 1S4MA 1BFDA 2R6ZA 5CW2A 2GDZA 4MQBA 1TU0A 5L7TA 4W7IA 1ZHFA 3NPAA 1LQ2A 2VHTA 3ILVA 4QGSA 2NT3A 3DLAA 1WXDA 1CT9A 1U2GA 2K87A 1JKIA 3OPMA 4TQAA 3HRKA 4A2CA 4ZJYA 3KVVA 3LPNA 2VSYA 3M2PA 2ZQYA 2B4TO 1RKVA 1NN0A 4MI9A 1XV5A 3U4HA 4XB1A 1P2FA 3AJEA 3VOAA 1T4BA 3Q1KA 1GG8A 5BV1A 5TQ0A 5A02A 2IOFK 3QENA 5DN6D 1RZ3A 3EVTA 2IS1A 3II6X 1VQ1A 2VP3A 2ZUWA 4II3A 3LPLA 3TNDA 4G4JA 5AW7A 1IUOA 5DHQA 4FBMA 2JD2A 5C8YB 4R1QA 3IQIX 4CF7A 1K6EA 3LBFA 4NSNA 1HEYA 3ZD7A 4KBGA 5GONA 2OR3A 3R6LA 2CZGA 5LM3A 3S8YA 1EG7A 3FFBA 3Q5DA 2ZJ0A 1SKAA 1RWVA 2BBWA 1DBSA 2XB4A 2AH5A 3DV9A 1K2VN 1RYBA 3PRYA 1XZDA 3HVRA 3S7ZA 1VXRA 3L8ZA 2MWMA 3B9RA 3RPEA 2LCIA 2YJ4A 5ED0A 4ZTBA 3QYJA 4WZBA 3RWBA 4DYVA 1XZLA 4LCJA 4LPKA 4D9CA 5BNIA 4DLRA 3WVNA 2HH9A 1UBTS 1FOEB 4MAAA 3AKEA 1PJTA 4FYXA 4JL6A 2QL7A 3H5VA 1I10A 3KQMA 1X8LA 4BQSA 2ZM6B 4Q9LA 1ZRHA 3QKSB 3TLGA 3IT1A 3TOCA 2QP4A 3GJ4A 3MTAA 1Z16A 2PBFA 2W6ZA 3QP9A 3T8YA 4AJPA 2PZMA 1Z4IA 5A6VA 4LC9A 2OV2A 3V4ZA 3D0RA 1MH1A 3P71T 3WDLA 1IULA 3FGPA 4MEAA 4OFBA 1Q19A 1MABA 2AR9A 2HSDA 1OIWA 2IY8A 3SSAA 2EQ5A 2BTOA 3QX3A 4EA7A 1D7OA 3ONDA 5CTJA 1KFEB 1FYVA 5IUNC 3DKRA 1VL1A 2G7MC 1NVUQ 3FW1A 5I9SA 2QAJA 2HMUA 1IIBA 3FLAA 4JI7B 1XMIA 1OUMA 2R87A 1V7CA 3OJOA 4QBIA 1OI3A 4TN1A 1EG2A 3GLIB 2CJXA 1KMHB 1GTL1 3GLHE 1MW8X 4EG8A 1EUYA 5CIQA 1Z0ZA 4YDSA 2QAGA 2WIFA 3V4VB 4BQEA 1UAYA 4PLZA 5EQTA 3O90A 1GGNA 1JDBB 1E2LA 2P77A 4Z1OA 3IKMB 1QH1B 4LS3A 4CVNA 4UD6A 2XQIA 3A1NA 4LRWA 4U4AA 3WMEA 5LDGA 3G1WA 3HYNA 3HBLA 1U11A 1P77A 3I53A 3UGJA 2J30A 1TK9A 2XY4A 1I7PA 2DWQA 3N2GA 1RWKA 5IULC 2YYZA 1IOVA 1SU7A 2IDZA 3AY3A 5DCUA 2RHMA 3ZTWA 4D4GA 2C2GA 4N49A 2B3TA 5IM4A 3I0NA 1HEIA 1K9VF 1BVHA 2WM8A 3LWDA 4JEIA 4N39A 5D1NA 4UM8B 5DASA 4AB1A 4GMKA 4KMOA 1XT6A 1UINA 1WR8A 1AXGA 5IJAA 3TRIA 1H22A 1V1RB 3PRJA 4UTOA 3BGVA 5K4GA 2CJFA 3CX4A 4LOHA 4JP3A 5E7QA 2ZIZA 3LPCA 2BHRA 1RXVA 221PA 4X64B 2QLBA 4XIJA 2CNNA 4L8LA 4PN3A 3K0CA 1WUTA 2CDBA 4CRWB 1B0ZA 2YR0A 4C0BA 4Y98A 2VP5A 1AHHA 4U7PB 4Y0NA 3ORQA 1PLKA 2FFQA 2LBPA 3H1PA 4WPGA 5DK4A 2XGSA 2QD2A 2G83A 1OFGA 4LHYA 1AQIA 4QYXA 3V1LA 2JAPA 2YN0A 2YY7A 4AS1A 5BSUA 5KS2A 2HLPA 3U48A 3VZPA 2Q3HA 1I6MA 2JGKA 2LXNA 2OAEA 3NBKA 1OYYA 2GXUA 3INRA 4NPCA 4FKBA 4XJTA 3AQIA 1PG2A 3EW9A 3V7FA 1ZLYA 3RS7A 2VF5X 1FRZA 1H6CA 3WYFA 4WVLA 3GD7A 2P30A 3CUUA 2J0EA 2LV8A 3RVJA 4GPAA 1A50B 3RH0A 4PY2A 3JQRA 3R3JA 4LZLA 1F8FA 2YXLA 1Q14A 3MD0A 4C14A 1K7XB 1TQHA 2BC9A 2OP0A 2P75A 1TU3A 3AI2A 4KFUA 2HIGA 3TM5A 1O97D 3OPYB 4RY0A 3DOEA 3WGUA 3DH0A 5FP0A 1WO8A 3HR7A 3UT5A 5A5EA 2O2DA 2X7JA 1S9DA 3PC8A 3OT4A 3KAPA 1RM4A 2BM9A 5M34A 2ATCA 1IUNA 4FP9A 5TF4A 4Q4DA 3B3FA 3PA6A 2B34A 4OQ4A 2X4IA 4Y9RA 4BNTA 5JISA 3TR0A 3S2SA 4HNTA 4YBRA 4B4OA 2RGEA 3ZE8A 1ZN9A 3OQMA 4CKWA 3V1MA 4Q12A 5FDFA 2VQFB 4YMVA 2AVDA 1RJDA 3MGAA 3TAUA 4QYSA 4MLCA 1RTKA 2D1RA 2R6GA 3A4VA 1QO9A 1DFHA 1ITZA 3JXEA 4ZO6A 4AW9A 1PYGA 4FBLA 2JLUA 3KE9A 1K86A 4E11A 2GN1A 4G1UC 4JJAA 4K05A 3SR0A 4D8YA 4W5TA 1DJPA 1BC5A 2FLWA 1Z7EA 4RKQA 4DSAA 1WEHA 1VECA 4XVHA 2CC2A 3K70D 3EXIB 4G36A 4LIPD 4KQWA 4DILA 5DYYA 3OTIA 2H18A 2OHHA 4Q02A 4E3WA 3JALA 5ITWA 3FB4A 2IYUA 5DI3B 3OIWA 1G8JA 3IJ5A 4CR6A 5INTA 3UIEA 2L82A 3L0PA 4CETA 1KMIY 2V1UA 1KJJA 1Y1PA 2ETVA 2QUBA 1U5BB 4O33A 5KHAA 3SF8A 2Z8YM 1XVIA 5E0KB 2KM1A 5CT8A 5ELXA 1B00A 2R84A 4FFBA 4J0GA 5FH9A 1MD9A 5DTQA 5SV2A 4DCOA 2IW3A 4HYEA 2ZANA 4TL7A 4ZCIA 3P5BA 3L7YA 5C4GB 1GT6A 4J03A 1I36A 2CXRA 5D84A 2H1SA 4J0KA 3OM0A 4KUHA 3N5KA 5HCNA 2A88A 5AH0A 3ZYCA 1DO0A 3N0RA 4TTVA 1HQKA 1NKSA 1ZGAA 3A6PC 2ZT5A 2B83A 1CB0A 2HNAA 1J0EA 1YRHA 4OHMA 4BQFA 4G0VA 5A0FA 3QH4A 3WLQA 2EP7A 4PYJA 2NO0A 4HS9A 4UHFA 1GKYA 1EFRA 2J9GA 2FEXA 3JU3A 4CDNA 4NYJR 1U81A 3THYA 1JQDA 3NTQA 3FFTA 4EPXA 5CFMA 2IBSA 2F7SA 3L84A 1QCZA 1TJ4A 2P0EA 5KX5A 2XJ9A 1ULBA 1R88A 2P3LA 2ZRKA 3EY4A 3C7CB 4P34A 3U7EB 4FLEA 3ROPA 2BHNA 2ZYGA 2PH5A 3L4BA 4PBSA 1EUDA 1OYOA 3T5AA 4A8HA 3JQ8B 2DFPA 4IQ4A 1W76A 3QE9Y 4RHCA