1AKQA

D95a oxidized flavodoxin mutant from d. vulgaris
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
147
structure length
147
Chain Sequence
PKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEGFDLVLLGCSTWGDDSIELQDDFIPLFDSLEETGAQGRKVACFGCGASSYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
publication title Crystallographic investigation of the role of aspartate 95 in the modulation of the redox potentials of Desulfovibrio vulgaris flavodoxin.
pubmed doi rcsb
source organism Desulfovibrio vulgaris subsp. vulgaris str. hildenborough
molecule tags Electron transport
total genus 51
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 1997-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1akqA00
2V5UA 4U7GA 4Y9RA 3QE2A 2FLVA 4LAFA 2D5IA 5TGZA 1YOBA 3OX3A 4YAFA 1QR2A 4QOIA 3HR4A 5FX2A 4F8YA 2W5UA 4ESEA 3ZHOA 3W79A 1FLVA 5FUQA 5F4BA 4BMPB 1OBOA 3GFSA 4J8PA 4GR9A 4FGKA 1J9GA 4YQEA 5FA6A 4PU0A 1YCHA 3B6JA 5B3KA 4QOFA 4DIKA 2HNAA 3FW1A 4QOGA 5LMCA 4DILA 3ESZA 1RCFA 1TIKA 5F51A 4ZVKA 5A4KA 4LTMA 4N82A 3NHKA 3TE7A 1FLDA 1T5BA 1CZOA 3NHWA 3B6IA 1RTTA 5LBUA 5BUCA 2OHHA 2MOKA 4LA4A 4GQIA 2FVXA 4ZVLA 2QX8A 3NHRA 4N65A 2ARKA 2MT9A 3KAPA 1D4AA 2OHIA 4ZVMA 2QX9A 3ESYA 4FGLA 1OFVA 3O73A 4Y9UA 2RG1A 3L9WA 5LJLA 1J9ZA 3OWHA 2Z9BA 3OWXA 4YAUA 1CZRA 1AKVA 1F4PA 1GG5A 1AG9A 2V5VA 3RPEA 1KBOA 3OX2A 4QOHA 4OXXA 1FVXA 1RLIA 2HNBA 4XDHA 3W78A 4Y7CA 4C0XA 1AHNA 3SVLA 2QX4A 4S24A 1DXQA 1I1OA 5F12A 3F90A 2Q9UA 4DY4A 1C7EA 1B1CA 4HEQA 4ZVNA 1BU5A 6NULA 4QODA 1DX9A 1AKWA 3S2YA 1J8QA 1CZLA 5NULA 3UXHA 2XODA 4HS4A 2QX6A 1YRHA 3NHLA 5B3LA 2M6RA 4YAOA 4CETA 3U7IA 3KLBA 2ZKIA 3B6MA 4U7HA 3W77A 4PTZA 3NHSA 4FGJA 3NHPA 3K20A 4M0CA 3NHJA 3FJOA 5LBTA 4C14A 2HPVA 3OX1A 3FVWA 1YCFA 5ULLA 3NHYA 1WSWA 3R6WA 1CZUA 2B3DA 2FOXA 2MTBA 1QRDA 2FCRA 2Z98A 4GI5A 2FZVA 3KEGA 2KLBA 4XDGA 2R96A 3F6SA 3LCMA 1ZWLA 4YALA 3U7RA 1SG0A 2XOEA 1FTGA 3F6RA 1FX1A 1DXOA 3ES9A 4ICIA 3GFQA 1CZKA 2FZ5A 3D7NA 2A5LA 4NLLA 1YCGA 2FX2A 4LTDA 1NNI1 4BMOB 1C7FA 5EAIA 1T0IA 2WC1A 3GFRA 2BPOA 1X77A 1XYYA 3HA2A 1FLAA 3HLYA 2Q62A 4R81A 2OYSA 4U7FA 5LLDA 3G5MA 3GAMA 3UXEA 3TZBA 2MWMA 1YKGA 3NFRA 3FX2A 4YAWA 3TEMA 2X2OA 3QFRA 3K1YA 2QMZA 1QHEA 2BMVA 2FDXA 3NLLA 2FAXA 1XI2A 2F1OA 4LTNA 4H6PA 4PTYA 1BVYF 3L9XA 3KAQA 5EMNA 1D03A 3QFCA 1J9EA 2M6SA 1H66A 5LJIA 1D04A 1AKUA 1AKQA 2N1MA 1SQSA 4C76A 1V4BA 1KBQA 1AKTA 1QBGA 1JA0A 1RLJA 1CZHA 5EA2A 3OJXA 5JROA 5LVAA 3LT5A 1AZLA 3F2VA 1H69A 1FLNA 2QWXA 3JSXA 2BF4A 1VMEA 1CZNA 2OHJA 5NLLA 4NULA 4N9QA 2QR2A 3P0RA 3NHUA 2KQUA 2GSWA 1JA1A 1FUEA 3O2NA 2AMJA 2BN4A 2X2PA 1XYVA 1YDGA 4QOJA 1ZWKA 4D02A 4FX2A 3NHFA 3EDOA 3EYWA 1AMOA 2QMYA 1WSBA 2BZSA 1XT6A 2Z9DA 3OVMA 3N3AC 3ESXA 1OBVA 3FNIA 2R97A 3OJWA 2V9CA 4QOEA 2Z9CA 3B6KA 3N39C 1TLLA 3N3BC 1ZX1A 4CF6A 1E5DA 1AKRA 4C0WA 3W7AA 4H2DA
chains in the Genus database with same CATH superfamily
4IGEA 2W6JA 1P0PA 3C6YA 3LCCA 1DIRA 1N6HA 1VLZA 3MTJA 4V1CA 4RA6B 2QRQA 5KZMB 5J2UF 5TQVA 1G4HA 1RI1A 4FHEA 4GOJA 3WO1A 1M8KA 2RH4A 1CJCA 3LPDA 3UMVA 4YAFA 3JX9A 4RA6A 3OQPA 1NVAA 3OHSX 4NDZA 3BGWA 2PL1A 4WKCA 3FXAA 4KO8A 1SOMA 2RGAA 4L5BA 1TXGA 4QDTA 4F3KA 1ABBA 4EY7A 1DI0A 4YMUA 2ZAIA 4EG8A 1M2EA 2JEZA 3G0DA 1AO0A 1VRCA 1S89A 4R8MA 4TYQA 2DWQA 3T9CA 4BRZA 2QE7A 1UBSB 4IPTA 4RVCA 4RCVA 3ZHXA 1YNSA 3ZW7A 4DDVA 3RSCA 2FW9A 5IYZF 5A4FS 4EF4A 1QQ7A 1Z74A 3T34A 3FKSA 2C2WA 3AYXB 4ZI5A 4K40A 2CK3A 4FGKA 4H6VA 4D6XA 2R8XA 4X61A 3EJWA 5BWNA 3SEZA 3VUFA 4QTYA 3Q98A 1WLYA 1RDFA 1WSAA 1MR3F 2ZT6A 3O8QB 4J43A 4HWGA 5A62A 1R8JA 1RFGE 1LLUA 2HBRA 3L93A 3MLEA 4OH7A 4U2DA 3TUIC 3V55A 3WLEA 3O8QA 4HH4A 2FI1A 3EBOA 2OCGA 5CB4B 1U2EA 4XQ9A 3ASVA 2DHEA 4M54A 3VYRB 3LZCA 4OGGA 1ML4A 3UPUA 1O54A 3MTAA 1Q20A 1KZHA 5CB4A 1U6JA 2GNOA 5F51A 5TVKA 2PUJA 3QUCA 2X2EA 4HB0A 4KDEA 1EHIA 1YU6A 2JGIA 3C1UA 2AQHA 3C3CA 5AM2A 3OZEA 5C4MA 1CUHA 5LP6F 4KPYA 2AD1A 2ZJ0A 3H9QA 4LTMA 5HKBA 4A23A 2ZRKA 3HDTA 3OETA 4YP1A 4E30A 2AMLA 4QELA 4A5OA 1LBSA 1XA4A 4E1AA 4OLFA 2IXTA 3AKCA 3L0OA 4FPXA 1I4WA 3EEYA 1NUTA 3MHPA 4AC9A 3EMKA 4OHZA 5CFMA 4URZR 1LD3A 2XTNA 2VUIB 1F8GA 1YRAA 3GD7A 3SP1A 2XV1A 2ZTHA 2C07A 3EVZA 3HWRA 1SQ0A 2I0FA 3OZGA 4LV8B 2OO5C 3ZD8A 4EPYA 3NT5A 4R40A 1IM2A 1JG1A 1LPNA 2Z43A 3ND6A 4HMOA 4LBVA 5GONB 4CUJA 5JNVA 1C4KA 2ODAA 4ID9A 5EFOA 1LSOA 1OW3B 2R7LA 3CU5A 3D0RA 4FXOA 4TLMB 4RCZA 3DBIA 4LPSA 2X14A 4MQ4A 4N65A 1PVVA 2IPOA 5GONA 3RRMA 1MU0A 5LMZA 4JI5B 3ZHSA 1UODA 4CIAA 2YV2A 1U1DA 1XE3A 4FFPA 1DKRA 3R7LA 2I80A 4F5WA 1RPZA 3CVYA 4JJKA 5FCDA 4NXNB 1T10A 3ZOZA 4BX8A 1FBTA 2GJKA 2R25B 2FZEA 2J5BA 2FRDC 4FUTA 4M0FA 1DBQA 1D0SA 2VPTA 2X1LA 4NTZA 3AEQB 3HJNA 5DTRA 1Q95A 3NTLA 1Z0ZA 4WK0B 3L9WA 5TT1A 2V8BA 1M2WA 2ZAGA 3DUWA 3MS2A 1I6KA 2J41A 2PWZA 3TX2A 4P83A 3MA0A 1A4RA 1FEZA 4MITA 5FD8A 4CLRB 2PAFA 4AKGA 2CLSA 3MQFA 2C8LA 2QZZA 3DMTA 3MJ4A 4U7WA 4C4OA 4KRXA 1A4IA 4L07A 1JXQA 1LDGA 2PO5A 5COAA 5AM5A 1P3JA 4CLRA 3DWEX 2R8PA 4RW0A 3KOZA 2NT4A 2Z5VA 3MS4A 3Q7PA 4OFXA 4OXRA 2IX3A 3H5NA 3K2EA 4L0CA 2H1FA 4HQLA 1TRKA 4HGPA 2MYUA 4LKRA 1W94A 2YWGA 3CLSC 4R6XA 3V46A 3F67A 4F1WA 3GEDA 5F7XA 5IULC 2B0JA 3U3DA 4Y0NA 2Y1LA 2XGJA 1BMFD 3CRRA 2QOEA 4AWAA 2GBIA 3IESA 3V8VA 2EQAA 2V74B 3BZUA 4QOHA 1A9QA 3JALB 2O3RA 4ZGBA 5ITSA 1Y4UA 2JVIA 4LDPA 3EF1A 4PO3X 4E08A 4R31A 1C1XB 3L6DA 4IWNA 3P9CA 3ZLBA 2Q3HA 2PX0A 4GO1A 4W7HA 3W3AD 2NT3A 3ORFA 1YOVA 4DREA 4YHHB 1G5TA 1NI3A 1C1XA 5DV9A 1Y8RA 1I33A 5GQSA 3UAZA 3ZS8A 5LYJB 4FN4A 3K9WA 3ETCA 3N8NA 4AY3A 3PEVA 4PGFA 3QUBA 3W5DA 4IDEA 1FDUA 1GVHA 4PQGA 2HJ9A 2QX4A 5BQ5A 1TFUA 5LYJA 2BCEA 2L69A 2G7MC 4ND3A 1SVOA 2BP7B 4R1TA 4P9NA 1C7ZA 1VPEA 3KSAC 1I1OA 2VYVD 3BQ9A 5FV4A 1W5TA 5BUSA 3LQ4A 3CPJB 1NF3A 4F84A 2BP7A 4QICA 1GDTA 3CZMA 1JVBA 3T1NA 3HFSA 2XUDA 5BPFA 1S2LA 1N4AA 4WFQA 2C97A 2HHLA 1D07A 2I33A 4LBYA 1HMYA 3PNPA 4YO7A 5EVCA 4BNKA 1QWSA 5C4IA 1KAOA 6NULA 2ZQ5A 5FTJA 2X7JA 4JBGA 4E12A 1NJ8A 1TK3A 5AVUA 1HYEA 5ILQA 1DVRA 2HAEA 4ALNA 1SC6A 3PNVA 3GBSA 3K0KA 4HNUA 2NN3C 1IPHA 4ZRDA 4C03A 5L4LA 3ZHVA 2DE0X 2D0OB 2Z6VA 3FOBA 1PZFA 4P58A 1GUAA 1QC5B 1XG5A 3OOHA 2WF6A 4JI4B 4QFDA 4ITVA 1HLFA 5K6RA 4GH5A 1R6XA 4PFSA 4Y6RA 5SY4A 1QGDA 1QC5A 3I04M 4U9UA 1PL6A 3OF5A 3QVLA 1UWLA 4O8CA 1L7AA 1QLHA 2C4HA 1J4AA 3GEEA 2JC3A 4ZOQI 1NC1A 2ZJFA 3C1OA 3BMXA 1VE6A 2AFIB 2IHVA 4U7HA 4UM9D 4E7PA 5FI0B 2I71A 3S8MA 2ERXA 2YJNA 5HZKA 3IP7A 4KQCA 1UCFA 1XRPA 1EXWA 3M9WA 2HQBA 2NSJA 1LVUA 1AC5A 1LX6A 2AFIA 1UZLA 3HB7A 3M6UA 5A05A 2CEKA 2WSSD 3E3MA 4GSLA 3ZQJA 1N3LA 2BFDB 4A6DA 3PLAE 2HGSA 1VPWA 1GRRA 4GYJA 1N6NA 3OCVA 4ZPXA 1CUXA 1HZZA 1NDQA 4EJ2A 1QRTA 3PX7A 3B2NA 3OTHA 2I6GA 2JGEA 2M2IA 3NS7A 2BFDA 5IVKA 1OFUX 1JZQA 2LKDA 4HAYA 4CMJA 3PTLA 1BE6A 2R5FA 1BKSB 1T4CB 2H1LA 2PGXA 3A3PA 3CKLA 4NPCA 4ZEVA 3SEQA 1XMVA 2FOXA 2R85A 5EIBC 1KO1A 1QTIA 3ETEA 3VNSA 1Y3DE 1T4CA 3EA4A 1MVNA 4UM5A 5CW1A 3NX4A 3WAGA 1IYZA 2BCGY 1Q12A 5FWAA 1Q0TA 4JQYA 2VQDA 2ZQYA 2NZWA 5HJ2A 2H2GA 4EG5A 4NU8X 1RHMA 1UBJS 2J7PA 2GBLA 2Q27A 3QKRA 4EYGA 1P8JA 4UPEA 1E8NA 3EFBA 4XM2A 4X1KB 2XCUA 1EFKA 1YUNA 3B6EA 1BFKA 1S9DA 5KVVA 1PQ4A 3F9RA 1IVYA 2E49A 1IIBA 4X9XA 4X1KA 4BLWA 5ERXA 4GMHA 1VJCA 3IFSA 3HTXA 2OE2A 2JFGA 5KAPA 3D7LA 3V1YA 1P7ZA 4S1PA 5AKHA 3WK9A 3BOSA 2RMKA 5LA6B 3D3KA 3JQGB 4GDMA 4DEXA 4EO7A 1HE1C 3QW4B 1S8OA 3GWZA 3HDYA 1QIJA 2WTXA 3K73O 4TV9B 1RI3A 5DYIA 5GJWC 3ZEIA 2H1OA 4QTXA 5LA6A 3JQGA 1UJ2A 5FF9A 4C0JA 1DKUA 1UBNA 1VRWA 3L1JA 4FC6A 1PR3A 1IC6A 5TJ9A 3V4LA 3CUUA 4J0QA 4KNYA 1YS9A 4LQLA 2QD2A 3BZBA 1FUYB 4HF7A 1C7FA 1ORRA 1SCJA 3D3WA 3I09A 1X8JA 2Y9PB 5AOBA 3I5UA 3SM3A 4DWVA 2RC5A 1KL7A 3BGOS 1CIJA 2VYFA 4EG1A 1MRNA 2E89A 3HLYA 4KGZA 5DTQA 3NPMA 1EX9A 3R3JA 4LMRA 1JSLA 2NZUG 4RVUA 4D25A 2M1ZA 4W9NC 5IDYA 1RSZA 5KPJA 3BG5A 1EP1B 1C0PA 1SVUA 2W6NA 3WK6A 1JLRA 4DWOA 4L15A 2XPCA 5IAJA 3FOZA 3ZTTA 4F04A 2E48A 1JSRA 1YZHA 4FWTA 3H2YA 5I9SA 1ZRMA 1YB1A 1NXSA 2Y0CA 2QKYA 2V3WA 4KPUB 3ZJYA 1RQNA 1CUCA 1R1DA 5FOTA 3RYHB 1UXJA 2OG2A 7REQB 5JDCC 3IAUA 3K2IA 4NXMB 3EGXB 4XGRA 3VJMA 4TTPA 4GMDA 2DRIA 3IR6A 3RYHA 3W4JA 5C53B 1BOFA 1T8PA 7REQA 1TVEA 5HNKA 3P0IA 1SC1A 1VSVA 3SWWA 1ZP6A 2ZSFA 1X38A 1UEJA 3EA0A 4U2CA 1XN4A 3BFJA 1IJBA 3X2EA 2AI2A 2GAFA 4FJ1A 4MLCA 4TL8A 4OEHA 1MEEA 1EK5A 2FSVC 3B2QA 1I4TD 4Q39A 4Y6LA 1VSUA 3PG5A 4K0KB 1NNSA 2XDYA 121PA 4RXTA 3ONDA 1DBSA 1U7UA 2AHOA 3GLRA 4IH9A 3K4QA 4JVLA 4ZAVA 3TH5A 4KX5A 2IBSA 2N1BA 3PPIA 5E6RB 1J39A 3A6EA 4KR7A 3QYAA 2EL9A 3N6XA 3T1OA 4BTEA 1KK3A 1J9EA 1HL7A 3OT5A 1ICIA 5E6RA 3C7CB 4C2UA 1JQ5A 2CXTA 1KI4A 2HD4A 5LJIA 4L8GA 3ZLVA 3EZ2A 1A69A 3OIUA 4TXJA 4M0MA 4UMEA 4EL0A 4NU6A 1T9DA 3FLEA 2Y1EA 3OZSA 2DQ4A 4ZICA 4OK5A 3RUIA 1GNTA 1LFDB 1PGJA 1W87A 1DFIA 1SA0A 1ILWA 1T2DA 1WF6A 3B38A 1A76A 4TL6A 4AO7A 3PCTA 5A6VA 1FZQA 2EKBA 2FE1A 1HURA 1W1IA 4F97A 3OJCA 4EHJA 2B9EA 2P62A 5B58C 2I3BA 1SXQA 1IHOA 3HPRA 3PDIB 1UEXC 3GRPA 2LCQA 4AY2A 1XZ8A 1FDTA 4S05A 3FMOB 9GPBA 4B46A 1HQYE 1TT7A 3LX4A 4PVDA 1I0ZA 1QSGA 1V3VA 5AVZA 2FKAA 1SVIA 3PDIA 1PBNA 2YYZA 4AP5A 5A1JA 3TGLA 3DE5X 4L6AA 4L8YA 2ENUA 2X0RA 4LZNA 1P1KA 5F64A 2ID4A 1G66A 2WJGA 3FYTA 3JQCA 3NDPA 3UJ9A 1FXWA 2B2XA 2ZFUA 3JQ6A 3UMJA 1UUFA 2FPIA 4J3FA 4GLJA 1R3DA 1F6DA 4XI9A 2C0QA 3PGVA 1PQUA 4XZ3A 4HMQA 1A2KC 2EKZA 3DXFA 4LY0A 4XJTA 3ZYCA 4UU0A 1RYMA 3ZGYA 1KVUA 2CDAA 4LK3A 3PZBA 3ZVNA 1EUQA 1J2YA 1K6EA 4NJMB 4A3SA 2O0JA 5AVWA 1T0BA 1R9GA 3W5SA 1A88A 4OBWA 1L5GB 3SJ7A 4UPDA 2I7XA 3CS3A 4DV6B 4DZRA 3O2NA 4OB7A 4XVHA 5ALPA 4O8ZA 4IUCS 5KJFA 4MR9B 1V8BA 4B2LA 1T4BA 1QIEA 2Y77A 4F12A 4BNIA 4D96A 1IWOA 4MR9A 4RDXA 1F51E 4I1SA 2PMBA 4NAUA 2R84A 4Y9SA 2A58A 4HRAA 1JDBB 3BIFA 5CA0F 5FI3A 3A4NA 2O2DA 1BXRB 1W0JD 1P91A 1WMFA 2BGKA 2DBQA 1Z25A 5KYWB 5HZMA 1GKYA 1U3DA 3LLMA 3QA3E 4DF3A 4MHSA 5KYYB 5K0EA 1GITA 3BFPA 1AMOA 1W9MA 2HCRA 4II7A 3DC2A 2VT6A 3GRRA 5J5CA 2QMYA 4OMCA 3DFFA 3H2ZA 2HDNB 2G72A 3L4EA 5JAIA 5KYWA 5E4YA 4LECA 2GBCA 3JD2A 5FAKA 2KI5A 2PXAA 2W98A 3R0IA 3GV0A 1ANKA 2ATVA 1AQUA 3F46A 4R3WA 1VL8A 4E1BA 4EJFA 3NVKI 1YK0A 4MVJP 3PFWO 1R00A 4LZZA 5JSZA 1VJRA 2O2EA 2BDEA 3DTTA 1FYVA 1G16A 2P67A 3OOSA 4RK0A 2IHNA 3T9DA 1UDAA 1B43A 2RONA 5DYTA 2N3ZA 1KE2A 5JRJA 4PYMA 3E22B 3ESBA 2WQ7A 3K9NA 2VA9A 4U39A 5DN9A 4RL4A 5KQPA 1FRNA 1WV0A 4FWBA 1FDRA 1FJ2A 1G7SA 1ZH6A 3OT1B 3BIOA 1GZ6A 3V8BA 4BZQA 4YPOA 3ZXSA 5CD1A 1L7EA 3E22A 5GGXA 4CF6A 1PL7A 2NO9A 1Q1BA 1V95A 3OT1A 4NZYA 4QX6A 3CLTC 2W4MA 3DL7A 1P2VA 3PQ6A 3SJBA 3ZK7A 2HK7A 1HO3A 3BCRA 3ZV5A 3OEHA 1GZ3A 3V5NA 3SE7A 1E1RA 1RRGA 1E4YA 4W1QA 3PC2A 4ZT6A 3EAFA 4WXEA 2XQJA 1A97A 2GHTA 2WA2A 2WJ4A 4EGJA 3HB5X 3PS9A 3O3NB 3GH3A 1VGRA 4RMJA 2P7IA 3HFRA 2BSXA 2GF9A 4H3HB 4MVJF 2GB4A 4QUDA 5GY7A 5HGJA 2CNLA 5KNCA 4CFYA 4YRCA 3OU7A 2C4UA 2XQGA 4QXPA 4IJ6A 2I1LA 5CUQA 1SC3A 4V38A 5IFLA 1QJ4A 4AG5A 5JI2E 1TDJA 4HCJA 3RGWS 3CX6A 1YBMA 1VQ1A 3RUEA 3W79A 4MEBA 4I1YA 1IWPB 2EKQA 4B4KA 7ADHA 2GDZA 2BUBA 3HU1A 4EM6A 4D82A 1Y3CE 3I1JA 3R0JA 4J3JA 1QTNA 4N5LA 4NCBA 1KI9A 4UE2A 1D2AA 3OIGA 2YKGA 2CEAA 2GNPA 1YNOA 2JNWA 4IQFA 2KBEA 2WWYA 3BDAA 3FTEA 3B6JA 2PZKA 4BKPA 3ON5A 4EJ6A 3E53A 4BXOA 4PPNA 1SBTA 4CQLB 2RD2A 2EKPA 1QGUB 521PA 3RIMA 1P4RA 4XSGA 5BMVF 3INYA 1DARA 3WWEA 3MLAA 1NW3A 4CQLA 3RO7A 3P97A 1QGUA 4G5QA 4JP1A 4O2AB 5FR2A 1JIXA 3G8BA 4KUGA 3VC7A 5HZGA 4NBKA 2FOLA 2ZXEA 4JI3B 1LH0A 1NMSA 2OCBA 4IZIA 5DRYA 3STTA 4A0GA 2Y4NA 2HTEA 4EZIA 4BLOA 1IQUA 4O2AA 1FA9A 3M7IA 4QJ4A 1QUFA 1WUIS 4ZVKA 4BCBA 3LPCA 3RE1A 3MG9A 4D9NA 3UV3A 1U8EA 4RDHA 3QEMB 3TRHA 1BSVA 2ZBQA 3V2UA 2WE7A 4RH0A 4ZTUB 2GAOA 4R16A 3L8YA 5IP5A 1EX1A 4KE7A 1J8FA 4HDKB 4X41A 1VE1A 1X1QA 2PRYA 3QEMA 4NBLA 5LIRA 1BX1A 4I36A 1C80A 1ECJA 4CQJA 5BUCA 1RS0A 4TPKA 1T9KA 2FUG1 2GAAA 3PQ2A 4LJRA 5TT0A 4TKVB 3WIOA 5I7SA 2QDXA 2XWSA 5H0IA 4CNQA 1U02A 1YA8A 2JI8A 1IOVA 1KKUA 1ZSNA 4B7UA 4CRWB 1A5SB 1QHIA 3W2FA 4LOIA 3IMFA 1NM5C 1DBVO 1KZ6A 1U7OA 3AUUA 3MWJA 4IIVA 2VTEA 5AD1A 3GT4A 4YJDA 4MARA 3EGOA 4DIUA 4RY9A 1AQLA 2GR9A 2F7SA 1SB8A 5TSDA 3CZRA 1DO2A 3T0FA 5AVVA 1ZK4A 1N5OX 2FEXA 3HUDA 5JHGB 3FUWA 2LXNA 4LCBA 4WFJA 4B1FA 5EUCA 1KMCA 3MGCA 2JCGA 5B1IA 3B36A 4EWLA 2VRCD 4C21A 1JDUA 1EXMA 3NUGA 5DK6A 3IQFA 4I4LA 4ZVMA 1NT2A 4Y2GA 5DEIA 5KU7A 2QX9A 2CFOA 2WD7B 5DNWA 3JZAA 2LIVA 3JU3A 4AJ4A 2G8LA 1GO2A 2JIPA 4BX2A 5BORA 1L5FA 4ADSG 4K9QA 1R8XA 1U2GA 1UMBB 1JLLB 1OROA 2WD7A 3C3WA 4FGSA 4IV8A 4UBNA 3TOCA 4F1KA 4HFMA 2R60A 5K8IA 4P53A 1EFTA 1EDDA 1R0RE 1R0ZA 5BQOA 2FW0A 1D7OA 1QANA 1UMBA 2ESRA 3VAAA 3U16A 2OGTA 4DPMA 1IM8A 2JL1A 3MJRA 5K1ZA 4YRMA 3W5JA 3ZJUA 1TECE 4CG0A 2PH3A 4DQKA 1U0HC 2C9CA 4DR1B 4C0LA 4J0FA 2IXAA 5I47A 3GPDG 1YVEI 2E7ZA 3DVAB 2WTBA 3CKKA 4B5KA 2YFYA 3B85A 4MVJH 4WOCA 4P38A 5BXQC 4YRJA 1KP2A 2A1IA 3AGPA 4KQXA 4B5LA 1Q92A 1RM4A 2CNWA 1ID8A 3KQUA 2ZIEA 4E3WA 4NQZA 3E9DA 3FTNA 4UU7A 4EEKA 5MN6A 3EH1A 4P98A 4I81A 4CKWA 1W30A 2WKSA 4NFYA 2X9VA 3QWAA 3UA4A 1LTHR 3IBTA 1GP2A 2B1QA 3QUTA 4KRGA 4DMMA 4P8RA 1S4QA 1GG5A 2PSHA 3I45A 4BNXA 5CYOA 2D7JA 5ELXA 1FY2A 1VIYA 3MF4A 5JEEA 4URVR 4IIJF 1SVLA 5KJ1A 4XVRA 1FFXA 1FB5A 4JX8A 3DO6A 4EA7A 3LA8A 2A33A 3CR7A 3SQNA 1M75A 1YD7A 3OEYA 2PL5A 4E5UA 2AMVA 2WTUA 3WVNA 4W5NA 3ZX5A 4BN0A 3QPCA 2QTAA 2HO5A 1ESZA 1NVMB 5INTA 1U8FO 4RQTA 5I8ZA 3T38A 2FZCA 1C5KA 3N8DA 4KMMA 3RHSA 1SD1A 2C96A 1CUUA 3Q0IA 2D8MA 3BMQA 4G25A 2GYVA 2NAFA 3QIAA 1A82A 3FZYA 4JR2A 4RZ2A 5FA5A 3T8YA 3QXXA 4B34A 3D6NB 1Z17A 1X3LA 1IN6A 2IV3A 4EQ6B 3GJYA 2OGUA 4BC0A 5LKAA 4MP6A 1O1YA 4J0GA 4CEJB 3V8QA 4Y9DA 4BNUA 3RF7A 2Y6VA 3ZWDA 1RYHA 2OFXA 4HEQA 1LUAA 2V6IA 3ONFA 3PQCA 2L82A 2IU0A 1GPAA 4GM4A 4IO1A 1IM5A 3KVNA 1ZNWA 2ZT5A 3CHYA 3CNNA 4TQUS 3MFQA 4J29A 1TAGA 1CY0A 5HFAA 5K3EA 1UAGA 3LQ2A 4U00A 2JCXA 2AD5A 2W6IA 3H9GA 4JT8A 5GZ1A 1NX9A 1C3OB 3G2HA 1ZD2P 2ZIUB 3QWBA 3QX8A 1C8BA 1Z6YA 4JBLA 4PHHA 1GRVA 2X1HA 2JEYA 2XMSA 3VDXA 4BTLA 2YUTA 1II8B 1SXJB 3RYIA 5CB0A 3EOZA 3CF0A 3IBYA 1KYVA 1C3OA 3E70C 4PTLA 2Z6AA 3GDHA 5ANRB 3CKMA 3UJNA 3GRUA 1YVPA 1II8A 3CUEF 1AV7A 1MPXA 2IZ7A 4INZA 1WQ3A 1VBMA 1WW3A 3QEOA 4IY1A 4N18A 4JYPA 3ASUA 1L7BA 2FUG6 4Q9IA 5FIUA 4BMSA 5HQ3B 4QU0A 4E5PA 4LY9A 4OMUA 2LPMA 1PR2A 1MC5A 1EGQA 1V7CA 3RFTA 4EMSA 2BSQA 5KKNB 4BFZA 2HA6A 2BMWA 3I9V1 2PA0A 4MJLA 3UUFA 5LQRA 5CDHA 4F60A 4YXFA 2X9GA 3ECCA 1YJBA 4YAKA 5DHUA 3TLKA 4F9GA 3HGQA 2CD9A 1OWLA 4NU0A 2V7UA 1Z73A 4XCQA 1M74A 1E2DA 1KZ4A 4ZOLF 2BLLA 2VSYA 3TMYA 1RQLA 5G41A 3LQ1A 3ZZTA 1XTBA 3LVBA 4OQDA 5IXJA 2P2GA 1JDZA 3CTMA 1JEEA 3AUAA 4JJEA 2XKJE 3RSSA 3CJRA 3FVWA 3DZJA 1K3UB 4Z9YA 5FNVF 3TYXA 5B2EA 2ABWA 1CZUA 1I5EA 3TXXA 3JQRA 1NKSA 2OB1A 3KDSE 5CH3A 3ZHZA 3NTUA 2E2WA 3KKQA 4ZPJA 4CLEA 5KQGA 4CL2A 1PV4A 1QGOA 1CXZA 1R16A 3BMOA 4MS3B 1I6WA 3WLOA 3HK2A 3P9QA 1ISGA 1ZN8A 2X0JA 4R1SA 2KBFA 5FOVA 2NIPA 4YALA 5KNDA 3OPMA 4MS3A 4RJLA 3W8EA 3WGQA 1LB1B 3EC7A 1IHDA 3MJFA 3NTXA 2MYNA 2O7SA 3O2SB 5FTLA 3BGVA 3PXAA 1UF9A 4IHJB 4DA4A 1S3IA 2W4QA 1Z0UA 3BXPA 4MMYB 4XM1A 5H9WA 1WPQA 4K9PA 3RJ9A 3ZU5A 2FEWB 4EPVA 1Y1SA 4J1SA 5FUWA 1J56A 2BHNA 3QUQA 4L6IA 2JJYA 5HKLA 2HHCA 3UCFA 2ZBDA 1KQPA 3O82A 4I50F 3T15A 3MRSA 1H6DA 2O8CA 5KC9A 1R5NA 3EDMA 4JIGA 1FDSA 1WHSA 2C9YA 1M1UA 4WE3A 4DL9A 4RD4A 1YT5A 5B6IA 1CEEA 1T4DA 3ZH2A 3OAAD 1BWPA 4YJ3B 5AI6A 3QPBA 1OWPA 4NCXA 1ULAA 1V8FA 1V2GA 1WZCA 3IMEA 3KUXA 2F3QA 1U2QA 1EFHA 4YJ3A 3HZZA 2RCYA 4QPNA 3EZLA 4BVJA 5DBOA 5KIAA 3LGAA 5EAIA 1EFVB 3TZLA 4PX9A 1NLMA 2BPOA 3DDZX 3O93A 2CL7X 2XB8A 5CVUA 2OA0A 5F98A 3I4CA 1J33A 1FLAA 2LIPA 4IMPA 1J6UA 3IDAA 4UEJA 5AJVB 4FZJA 1XZQA 3SZRA 1NXXA 3VR1A 2PT6A 1O95C 3KVOA 4M36A 3AH8A 4OXQA 2GJ8A 3ZIAD 2HA4A 2BGMA 4J0CA 5K0LA 4PGAA 1GNSA 4PLHA 2ZATA 2BONA 4BV9A 2R7NA 1A7KA 2D4HA 1NW8A 2J5QA 4M87A 4PNZA 5AJWA 5TRTA 4BBJA 4D8XA 3GAMA 4DQLA 3AKEA 1NTOA 2A5YB 2AGVA 4P4SA 3MYYA 5B12A 3SJZA 4YTEA 3K6SB 2JFVA 3P96A 3Q9SA 5CDTA 3NM6B 4BO2A 1IUOA 3DKPA 2YOFA 5KHAA 3HGTA 3K30A 4MP8A 2HMWA 4LNHA 4TL7A 3K70B 2C2ZA 1HX7A 3K6SA 1PGQA 2B78A 3CR3C 1B23P 1SG9A 1HYHA 1PEKE 4UBKA 1ULTA 2WHPB 4EI2A 4YRIA 3N6RA 2RKOA 3X43A 3K1YA 1W59A 1UINA 2WHPA 3C6KA 5ENVA 4Z4FA 4IAOA 2QE7D 2Q0HA 3S2ZA 2ZGVA 2VWHA 1V41E 4JUCA 5JQGF 4N76A 1AKMA 1GPUA 2O3JA 4Z8YA 3N59A 4KUEA 2R7AA 3AFNA 3DUFB 4I1OA 2ZE7A 1L5KA 3ZG6A 2CK3D 2II6A 3I9KA 4FDMA 3W1WA 3P2OA 2IYFA 3LPLA 2ZB8A 4AO6A 3MOGA 5CJPA 1S5PA 1M2OA 3DUFA 1U2SA 4V0ME 4ISCA 4X84A 1RMYA 4PN3A 1KIFA 2C4VA 2PKQP 3CCCA 1H66A 1KWKA 1V37A 3R9XB 4CEIA 4DCMA 2FHSA 1J7KA 3A4YA 3AI2A 3IQEA 4IO0A 4RFLA 4JC8A 3NUZA 1X39A 3VU0A 2GCEA 3QV2A 4D8WA 3P9XA 5AR1A 1QE5A 2FEAA 1VJ5A 3GOHA 4RWZA 1CUBA 1JWBB 2EU8A 5B3AA 2A4KA 2BKXA 2PL9A 2CHUA 3AF5A 2RAPA 3I9V6 4GPEA 4WCVA 4YRFA 2OORC 3D6JA 4I1IA 2C5AA 2EZTA 2RGEA 3LUPA 4KDCA 2OV8A 4YCDA 2HPAA 2HSEA 1FP7A 2UVQA 1YULA 1GAJA 2ZYIA 4IJVA 1SXHA 4JENA 4JIMA 3DTVD 1ZJ6A 2R47A 2IVFA 2YRWA 2BY4A 4LYYA 1QO9A 3EVDA 5H02A 5J23A 2JK0A 3AKYA 3N2NA 4NCAA 1OU4A 4FFRA 3MT8A 2IHTA 4TYWA 3GCGA 4MW7A 1RP7A 4EATA 5IM5A 5G0WA 2VJOA 4KW7A 5FORA 2ZYAA 1GN9A 2R6GA 1UIMA 4P5DA 3E9MA 2AZMA 3PE3A 4HAUA 2P68A 3PA6A 5FA8A 1E0JA 4IYJA 1IEXA 2RGCA 3GZNB 4KIWA 3SQXA 2ZRAA 3R24A 3CURA 1RPAA 3FYUA 1VMEA 4CMHA 1CZNA 1E6WA 4ZQHA 1GPNA 3D2LA 5DFAA 4PPYA 1V8OA 1X2EA 4QO7A 2QR2A 3AERB 1BMDA 2H48A 3BIJA 2MINB 4N5MA 3VO1A 3OICA 3VH3A 1G8FA 4KFSA 4Q7QA 1YBFA 3A1NA 2XA1A 4KP7A 4R69A 4KMOA 1XAGA 1UP7A 4O4LB 2MINA 4I0WB 2ZJ3A 2CNDA 1G5HA 3C24A 1NP7A 1Z4OA 1GILA 3KWFA 3MD0A 3MWLA 5IJAA 3VR5A 4B84A 3OOEA 2YW9A 4K0RA 4KBFA 2IYPA 3DXXA 1ZH8A 1RQ7A 3IVCA 3Q41A 4DA7A 1XTQA 4A92A 1ZWKA 4H1UA 1L4GA 2X9QA 4HWRA 1ODFA 4ENPA 1PT5A 4FOTA 1MKYA 4ZU6X 1ZOOA 1QAQA 2Y1FA 3KYBA 4MI1A 3UEOA 5GIOE 5JVDA 3EDOA 4Z54A 4FMDB 1A9OA 2I03A 2YWHA 3IVMA 3ILXA 4ZD6A 3V00A 1WKCA 1C0IA 2QAJA 2WNIA 1BJKA 1NVBA 4WZAE 5CNKA 1ZIXA 4CFSA 4QRDA 4EPTA 1SBYA 2R4UA 2ACWA 1JKXA 1AV6A 1SD5A 3C3DA 3KVRA 1O96B 3M83A 4AJ9A 3HBNA 2HU2A 4D5GA 1GLVA 3CRW1 4KLAA 1W5AA 4K3VA 3WDMA 2YXPX 2Q7OE 4HXGA 2ZYVX 4WHMA 3HBLA 1FFBA 1O96A 1U3WA 2Q6KA 3SLKA 5A5FA 1ZRHA 4LHZA 4AKIA 1UK6A 3ANLA 1PX0A 3RC8A 1V3TA 1G20B 1N1EA 3ZBQA 2V98A 3MILA 4JL6A 4P5EA 4Q7MB 1T36B 4Z2AA 3K15A 2WHRA 4CM5A 2YRXA 4HX2A 5MGBA 3HYRA 1G20A 1NZDA 3PHIA 3NRCA 3SN6A 3UM9A 1VE9A 1NYRA 4LNUA 1ULBA 5ECWA 3PC3A 2W2LD 3CN9A 2LRHA 3IUYA 4I4TA 3N3BC 4LJ6A 4M0EA 3ZN2A 4A0FA 4BGEA 5I6DA 2INGX 4KAFA 4RESA 3DQQA 2E5FA 4G07A 4KFUA 1SQGA 2VDNB 4HKTA 3RC2A 2QPOA 3KR2A 3V4VB 4DMKA 2P2NA 4CTOA 2FE4A 2OY0A 5BRAA 3PPYA 4BQFA 1YQQA 1NKTA 2KS6A 5DGXA 3N5CA 4QQNA 5E6UB 5LXTA 1KDTA 1NMZA 3UMYA 2Y0PA 5H8WA 3ISJA 1IE3A 1M34B 3ANTA 3BGSA 2P6PA 3I73A 3O4RA 2FLVA 3QOYA 2PZMA 5E6UA 2D5IA 5FR1A 4UUOA 2NYRA 3WLJA 2HJHA 3K6KA 3L4BC 5AKXA 1M34A 3P9ZA 1QR2A 1BJRE 1MVOA 1PTJC 2P8JA 4G36A 1JAHA 4CV1A 1Y5LA 3PHBE 5C4GB 5C3MA 3RVBA 5I9TA 2AG1A 5ALYA 4BLUA 1K08A 1OLSB 4DPLA 3B5JA 2CF6A 3DEJA 3M0EA 4HDRA 4LC9A 3TF5A 3ABIA 4Z6KA 1SN7A 4Q7JB 1OBOA 3OIFA 2VDKB 5EUQB 4J0EA 4MW4A 3ZHUA 8OHMA 1VL2A 1FE8A 2OENG 1E99A 4LXHA 5HK8A 1YCHA 2L19A 4G4JA 4BYGA 4YS6A 3TXYA 3CSDA 4URHA 2J6HA 3KTAB 2WMDA 3NCTA 2DEUA 1XNQB 5ICCA 3U40A 1PT6A 1YWGO 4UNNA 1EWRA 1C41A 4GU5A 5I8WA 1N0WA 2AN4A 1LPMA 5T4FA 3HVJA 4YRRA 4J0HA 1Q1QA 1NC3A 3MTEA 1JXMA 1NUUA 3B9BA 3I5YA 2VNIA 4YJHB 1XDGA 1WE2A 3QBTA 1OI2A 4XIIA 5C8ZA 2IH2A 2Q3FA 3V8RA 2PBRA 1K97A 2IUSA 4YJHA 3A58B 5H4HA 1J8YF 2FXIA 2HX1A 4WBXC 1XKQA 3A3OA 4OK3A 1WZEA 4XARA 5KVQA 4B6QA 4KRFA 3M3DA 1CDDA 2C9OA 3U48A 3WLFA 3IAS1 3D6MA 2QN9A 1QRRA 5BQ3A 1ZGHA 4HZUB 2CWDA 3TUJC 5K9ZA 1WDLA 1W0KA 3AL0C 3GIWA 1NQOA 2GI4A 4ISBA 4UD6A 4BP1A 2QR5A 2QA5A 4HZUA 3KL2A 4NBNA 1P39A 4DV4B 1LS6A 1EBUA 3KT6A 2XXAA 5JYDA 4BAGA 1MZPA 2O0KA 2QN3A 3QEJA 4L76A 4ID3A 3R74A 5T4HA 4RF2A 1YGPA 2F3RA 1XJCA 4ZVRA 3HU3A 1V4VA 4YUYA 2Q5HA 2RHWA 1EVZA 1AA6A 1Y1QA 1O8CA 1REQB 1SUWA 2DBRA 2DTEA 2HLHA 2J7PD 3IB6A 5F2NA 1A5AB 3L7MA 3FCOA 1DE0A 2XHZA 3PICA 4BNTA 1OXVA 4JL5A 4HVCA 2UYYA 4LF8B 1I01A 1REQA 4RIGA 5HDQA 2OZLB 1JALA 4C0SA 2ANBA 1NJ1A 2C7VA 4XPZA 2HRCA 5ALZA 1YRLA 3HG7A 1MW9X 2PD4A 5ALLA 1JG4A 2C42A 1WWKA 1CR4A 1E5VA 2OZLA 2G1UA 2MYTA 1EZ4A 4K86A 2IUFA 3O8DA 3OE7A 1QZZA 1P33A 5HIAA 2BZ1A 1VB3A 1WDWB 5K6AA 2Q8PA 4W6ZA 3AWDA 2R5NA 2JI7A 3IIKA 1ESDA 4IDFA 2CDNA 3WNVA 3E8SA 5L8VA 4M1YA 3T1HB 4TV8B 5I7WA 4QGAA 1JHDA 2BR4A 1TYEB 4RVFA 4QWMA 5AHRA 4F4CA 4FFWA 4K6MA 2QTLA 5IG2A 3FHLA 1RXUA 1U04A 3LUKA 3WYGA 1J9ZA 4RKEA 3ZQUA 4G81A 1CG6A 4M89A 1Q3HA 4F4JA 2D1TA 3EOBI 4HDNA 3T54A 3NM4A 3THSA 2YV5A 5EXTA 5HP4A 1P7VA 3HB9A 3M4JA 4JQCA 1N7IA 3D8BA 4HVAA 1YUMA 4N7RA 4R1MA 3HV2A 4WWHA 5JSKA 1CVIA 2XJ4A 3ECSA 3IV7A 4RPIA 3LBHA 1YA6A 2VT2A 4DM3A 2DBYA 3PFCA 1F4PA 2X6QA 5HBRA 2X3FA 3WJ1A 3K0CC 5ER6A 2H4WA 4Z0HO 3QNWA 4IDOA 3ZCVA 1GAXA 1HK7A 1HZJA 2QU8A 2REQB 1JIVA 1OC2A 1Y6JA 1LRKA 2HWYA 2JAUA 3NBKA 1KDPA 3L07A 1AZWA 3ROMA 5FPTA 5EJGA 1HWYA 4ZJYA 2X15A 5C5DA 1GRNA 4ZYZA 2REQA 3VI4B 4KTVE 1L1RA 4QE3A 3ULKA 2R79A 2VZ8A 4H35A 1Z3IX 4G4SO 1TQDA 4UZSA 1I10A 1PYGA 4CI0B 2X23A 3FPLA 4WKNA 4YCJA 3STHA 3W0LB 1P1CA 4XEUA 5C51B 2CVOA 3SBOA 3GFGA 3N8HA 4ZI3A 5KVAA 2OHOA 3COPA 4O4HB 3TRIA 2ZJYA 3S28A 1F3LA 4F8JA 1TK9A 4FYHA 5IXYA 5M04A 5CCEA 2YY6A 4OGLA 1B76A 4Z9AA 3H2GA 4R6WA 4X8HA 5FV7A 4E21A 2XTJA 3PV0A 4YCMA 1HF3A 3WQHA 3OHMA 9LDBA 1I14A 3JYOA 3SFZA 2VNAA 3LUHA 1YHZA 4B4WA 3CVUA 1TEXA 1VLLA 1ZNQO 7YASA 1CIPA 3JZMA 3U44A 1AH2A 1Q0SA 1QP8A 5IH3A 3DZ8A 1MB3A 5JSYA 2QP4A 2VDOB 4CM9A 3GGJA 2PX4A 4TT8A 3A10A 2D2EA 4WOPA 3HJTA 1TRHA 3TGPA 3BICA 4DFDA 3ZW8A 1ABFA 3E7XA 4BN4A 4CKXA 2EF0A 3AZOA 2I7VA 4HGNA 4P4LA 2FN3A 3GXOA 4Y2VA 1AGYA 1J8QA 1GXSB 4JLJA 4R4JA 1CZLA 3KUKA 3IAS6 1RYYA 2VZ9A 2XYRA 2H4JA 5DHFA 1SJ9A 3UXHA 3A1UA 2WMOB 2WOJA 3CNHA 4IIHA 4UJ5A 2DY1A 3STXA 1GXSA 1MORA 4H59A 1VYVA 3NNSA 2VAWA 2ZUUA 1DMRA 2AK3A 2O1WA 2R8YA 2RK6A 4IIFA 3DDUA 1NBME 1ENZA 4PCVA 1YKSA 3S4YA 1L7DA 3P2YA 2F3UA 4N39A 4QO8A 4WPGA 5DOZA 2BI7A 5ENDA 4MW9A 1Z45A 3U7JA 4EX7A 5K0GA 4X90A 2EW8A 2G9NA 3SZ3A 1HQCA 1MN6A 4KQKA 4UVGA 3QY0A 4NICA 5DBIA 2CFSA 4BOYA 1CF2O 3KXIA 3KO8A 3WLRA 2RHDA 3QE4A 4MTCA 4P34A 3REFA 3ZX4A 2VH2A 1KY3A 3FE2A 3WIDA 5KNBD 4NCIA 3DAOA 3T5TA 4MGZR 2AXEA 1QVVA 4BFVA 2W70A 3WLPA 4F7WA 5J2UB 2WG1A 4IX1A 5KCMA 5KDLA 3URKA 1GGMA 1EGMB 1SMKA 2NU6B 2E82A 3SIXA 1OGJA 2RBGA 2HMVA 2HXSA 1DNPA 3FTQA 2WFAA 5J2UA 4M7WA 1U2TA 2CLFB 1VLJA 2H2IA 3ESRA 4P7JA 5BRNA 4XA8A 3T3OA 4F11A 4RA9A 2QQ0A 2X0FA 1GRQA 1WP9A 3QXGA 3R77A 3GARA 4AG6A 2IYYA 2V03A 4LQDA 1G3QA 2JG3A 2JZOA 4AIIA 3ACDA 1UKAA 4FE4A 4H1VA 4B4VA 3IQXA 1XP8A 2M98A 2PZLA 1FSFA 2QSYA 4Z4CA 5IYZA 1ECLA 2RHJA 4PC7A 4KH0A 5TJHA 2I99A 4ATNA 4F92B 5IZ4A 2HQOA 4WDQA 2BISA 2OM6A 3IUQA 3LPAA 3I1FA 3OM9A 5EZYF 1CK4A 1PFQA 3ROZA 1UPFA 1VYHA 2AEEA 2XB6A 4FFBB 4LYAA 2PX8A 5TPWA 4EA9A 1LA2A 1P0MA 1Y4AE 4ICIA 4CWAA 1LDMA 1UPTA 1Z2AA 3QX3A 1RJ9B 3N0WA 4B6OA 1J97A 2C92A 2FWIA 2WYIA 5K3SA 3ROPA 4LYEA 4EGFA 3G9UA 4FFBA 3LD9A 3UJHA 3T5AA 1W25A 4NLLA 1RJ9A 1T3ZA 2G40A 3C3KA 3L6RA 5JYBA 3I92A 3NJ4A 1B1AA 1MAAA 1OX5A 1YONA 2J3HA 5DVZA 3RK4A 4AWBA 5LP6B 4IFEA 2HY7A 3REOA 2O7VA 3VU9B 4R7ZA 1D4FA 5LSAA 5AW8A 4E4TA 3C7TA 3O8CA 3GJ8A 4JGIA 2BFCB 5LP6A 5BRJA 3VU9A 3PJRA 5DM2A 1Z6AA 1MHPA 4HYEA 4Z1OA 4GS5A 3TNFA 3FKJA 2IH4A 3TBFA 3MJEA 1ZN7A 3EVNA 1I9CA 2VH5R 4KGVA 4U6QA 2RJOA 4G8JA 1QH9A 3MYRA 1Z6PA 2V7EA 1EVQA 3DKIA 3GVCA 3L6OO 3D7KA 3KEQA 3LKDA 1NXWA 1K8RA 2OWEA 2QP9X 2X77A 2Z8ZA 3CT6A 4LRYA 4WA7A 4ZVTA 4OFBA 4B3JA 2GM4A 2FXVA 3PGA1 2IOFK 2VP0A 5B2ZA 4DXDA 5A2QA 3Q7RA 1ZXLA 1U9IC 3D8UA 3T6KA 3NFRA 4GWLA 3NCHA 1JDPA 3H5VA 3NAQA 3VC3A 4I2NA 1MO4A 1XEXA 1IULA 4S1NA 2WD8A 5C8DA 1LF0A 3QUAA 4FX5A 5KNCD 3KYDB 5BSWA 2HDWA 3CT4A 3H83A 4JJ4A 4IDQA 3C3EA 4DV3B 3OEWA 2XH8A 3WA7A 3KB2A 5TQ0A 1D2RA 1BVRA 3U9TA 1AK1A 2FQ1A 3KYDA 3K09C 4NMWA 3LVRE 3K9BA 3NIWA 5DSXA 5L53A 2V6MA 5CK5A 3D6UA 3FG9A 4BJ3A 1S8FA 4AF8A 1T25A 1ND6A 3HYLA 1XI2A 2F1OA 3AY3A 3E9EA 5FO1A 3MTBA 4BX3A 3I05A 1Z15A 3P4YA 4EW3A 4XTCS 1EGAA 1KKLA 3AZPA 4RE5A 5E95A 5BW8A 2HV8A 4MDYA 1M2FA 4UUAA 1EEXB 1VPDA 3QHAA 3MAJA 3WADA 4MJ3A 1T0JB 5EMNA 1TO1E 2D1FA 3LXXA 4YP6A 2V7QA 4BQNA 2PGOA 4BJ5A 1D1SA 5E9WA 1YL6A 3A9SA 3BRQA 4Q4DA 2ZDQA 2I4NA 2BL4A 2FUCA 2H1CA 1E3LA 1ESEA 2EGGA 1W5EA 1Q14A 4MROA 5CLLA 4HDAA 5FDFA 5LQUA 4CE6A 1SQSA 3D6FA 3NEYA 4RJTA 1XVTA 3I6QA 1TIPA 3OG9A 4KXNA 3VVCA 4ZO7A 3MJSA 4F6LA 1B74A 4HQNA 2OO7A 1USWA 3ENVA 1QBGA 1XRSB 2XNKA 4FWIB 4NY1A 4TZ6A 1L5WA 4UBMA 1GDDA 4X64B 5AVYA 1RLJA 1QQAA 2P1RA 3FIUA 3PNBA 1AUOA 2CUNA 4QQRA 1OX4B 1S2MA 3OUUA 1L7PA 3QLVC 3G5TA 4JB3A 2ZWVA 4PX5A 5EA2A 4Q05A 3DAYA 4HRVA 4D3SA 4F3NA 1P5JA 2SECE 3D3NA 4FQ5A 1RYNA 2QYTA 1A9PA 2P3OA 5HVNA 5ENZA 1KMIY 1YXMA 3EEIA 3H6HA 5IHXA 3BM5A 5FTKA 1IUKA 2PH7A 3BSFA 4OHMA 3SHWA 4MR7A 5LD2C 2WM2A 2ZB4A 3DE0X 3FVVA 1OPRA 5K20A 2JLZA 1Y1PA 4BIIA 1XZFA 3KEOA 4LN1A 3W9BA 2EFHB 2BF4A 2PIDA 1EP2B 3JSAA 2D1RA 2VPZA 3LBAA 4CCWA 2DVMA 1WABA 4YJFA 3OPYB 1H8EA 4CXMA 4LF5B 2GJ9A 3D54D 4FT4A 4TS4A 4G1VA 4C0QC 4LF6B 4IMIB 1E63A 3GAZA 1XDDA 1QQBA 7MDHA 1IBRA 2V45A 1DKQA 1TD1A 3U1TA 1A04A 4HI0E 1CEYA 1VG9B 4WNAB 3JAKB 1SZPA 3AVOA 1Z5OA 1ISFA 1BNCA 2VXYA 4KVAA 5IBRA 3VR6A 4FZ3A 4DLZA 2WW8A 5CP8A 3KSMA 5BNTA 4L4ZA 4KYVA 4CN8A 4KXUA 4RH1A 3FWKA 3EE6A 3M6FA 4LYFA 3L7LA 4IKOA 5AVJA 4J03A 3ZR4B 4E2YA 2BGTA 3UPTA 3GMSA 4ZAXA 2IS6A 2J3DA 2R66A 2XMZA 2JFUA 3A6LA 3MTQA 5FPPA 2D3WA 1Z0IA 5DN6D 3J81A 4MCIA 4S0XA 5KJEA 4PBSA 4Q16A 5BYBA 1EFAA 3NUQA 4C3UA 1F12A 4XJVA 3WL5A 4GYYA 1L0BA 2FPGB 4X93A 5DYWA 3UC9A 4H17A 2IHUA 2V3CC 3JYLA 1SIUA 1WPGA 1N8TA 3UYKA 1GSHA 1UXOA 1Z0JA 2P69A 1OZHA 3D64A 3I34X 4ZVPA 3HV0A 2B1RA 2OO5A 2DLNA 1GTJ1 2FPGA 1N2GA 4FKZA 4MQLA 1E61A 3G02A 5H3HA 2ZSDA 3RRZA 1ZKMA 4D4JA 3Q3GE 5JXJA 5KMGA 4UASA 2VJMB 2YXLA 3CZQA 3WIBA 1T5DX 1KYXA 2XT9A 1LPAB 3W9SA 5AVSA 2CNBA 3QMMA 5EHGA 3FRJA 3IUPA 2DKFA 5HE8A 3A2LA 1Q83A 4IDBA 4BMVA 2I7CA 4EUSA 3TSAA 2OT3B 1OB5A 4OX9Y 5CMLA 5BY2A 3WISA 1AXEA 5FLYA 4ARVA 1NXTA 4FOLA 1KDZA 3M2TA 3E0QA 4QOEA 1GZUA 3WBBA 1CQWA 4NOKA 3HJFA 2NU7B 5FBWB 1PK7A 1S02A 3SX2A 4FQ7A 2ID8A 2FRDA 3FZEA 3BIXA 2QROA 3H9UA 1YQ9A 2J3IA 2KW5A 3COWA 3DL0A 3LXUX 4XRRA 5THQA 3U4AA 2W00A 4C6TB 2NU7A 3TMKA 1O94A 5FQNA 2VPIA 3K0AB 3VNRA 1LFAA 2FG6C 3U1BA 1X1AA 1HFJA 1X0XA 2YOHA 4YI3A 3D6TB 3STYA 4C6TA 3LSYA 1L8AA 4J1TC 3K0AA 5LM3A 1FU7A 1H1LA 1OBHA 4MYCA 4OQLA 4OHPA 3Q3CA 1T1IA 3NPAA 2IQ5A 5H70A 2C7BA 3OQIB 3TRDA 2R6JA 4XB6B 2JGFA 3REQB 3SS7X 1MEJA 2QTMA 5GTDA 1T3HA 2QT9A 2YBDA 1N2SA 1NW5A 1RXEA 4JUFA 3OZXA 1NP3A 4G41A 3OQIA 4QYWA 2AWOA 2GKGA 2ZWOA 2AJTA 5ALFA 2IZ6A 3REQA 4BMDA 1P5RA 5G3YA 2DLDA 5F35A 5SYMA 2VZLA 3U5ZB 3S27A 4O2RA 1GSOA 2P6RA 4N6NA 2BEVB 3DYBA 1C9DB 4FCVA 2ZIFA 5IZCC 1MHTA 3CRVA 3I1IA 4XWTA 2O5RA 1VJDA 3CLVA 5LC1A 4ITRC 1JF8A 3X1YA 1ODTC 1X8KA 3CRNA 2ZAMA 3D5EA 3VBEA 4H1WA 2BEVA 6Q21A 4GRDA 4JLBA 3L8FA 2W6ID 3HRKA 4GVLA 4IJUA 5A3SA 4PRLA 3WNCA 4OJTA 4BLQA 3L7KA 1XKTA 2OQVA 1UDXA 1M1ZA 4FS3A 4JYCA 5MDHA 1ZSYA 1GAQA 3DW3X 3SS9X 1ESMA 4QOFA 2DPMA 1GTRA 4HG2A 1NF9A 5J2TF 4DDKA 3IQHX 4R41A 1SXJD 3RSOA 4RTMA 3ZGZA 4G8CA 4F4IA 3EIHA 1UDWA 4DILA 3A27A 4P4NA 3JQBA 4IOKA 4TKUA 2RGYA 3ZQKA 1BE8A 3E23A 4HUTA 3HNOA 3BMNA 5JV5A 3CZ4A 4F21A 2KMLA 4JKYA 5IW8A 2HRDA 5CB8A 4UTNA 1EX6A 4M9QA 1HBJA 3HWX1 3NBUA 4G56A 3W3AH 2XUFA 2WLSA 1BD4A 3VJKA 1NUAA 4QA9A 3SKXA 4GMXA 2IKSA 3QFFA 4HK4A 3H18A 3MSXA 4JLUA 5AI9A 3ENWA 4EHKA 5L40A 1P31A 1WUKS 4EUNA 2O2HA 1XL0A 4XYMA 3Q11A 1ZJ5A 1ZBDA 1GPWB 4LNAA 4I1UA 4BUZA 4TTQA 1VHDA 2VHYA 3PUJA 4RPJA 1DV1A 4C22A 3F3SA 1TJPB 2IEAA 2IYOA 3GLIE 1GGFA 5DASA 1HNXB 3PFKA 1Q19A 2WFZA 1OYYA 3EMDA 4NCKA 1SKMA 4QU9A 3W8DA 3EIQA 3IAAA 4JUAA 1VCMA 1GNVA 1MB9A 4MW1A 5D01A 1TM4E 4IQ4A 1YQXA 4HWSA 3ABQB 5EINA 1RP1A 4ZC8A 5CXXA 2F8SA 2Z2IA 3C45A 3AINA 3I2YX 3NHRA 4L5IA 2Q5JA 1E8DA 4UHJA 1L4FA 1GCUA 5KNDD 5TGTA 1WHTB 2XOXA 2DQSA 2VS1A 4LXXA 2CUKA 5JG7A 3TLMA 3UHOA 4ALJA 2W0SA 2BE7A 2LNDA 3DVRX 4Y0AA 5EXSA 3WGJA 4JUDX 2IYSA 2E0IA 2QRJA 4ND4A 5CNMA 4UXHA 5DLPA 3DBHA 5EJFA 2WG2A 1K7FB 1N9GB 3GUZA 3ZHYA 1U7HA 3G1UA 1Z5NA 1NN5A 4XLLA 2XWPA 2DT5A 3GGOA 1BS9A 1VYUA 1ZMRA 2XUZA 1N9GA 3CMCO 3R4VA 5REQA 5CNIA 3UQYS 3V1UA 1UKEA 2P79A 5JXHA 1JL3A 3QZUA 3KQKA 4PNHA 1SUAA 4XIGS 4L3VA 3WQSB 2YWEA 4XVCA 1J00A 3LP8A 4ENVA 5C35A 3WP0A 2WZDA 4MAAA 2WYVA 4POOA 2WJZB 3AL3A 1XZMA 4OMFG 1HEYA 2WKQA 2HIMA 4P08A 3GC6A 1GFIA 2VDUE 1MIOB 2WWFA 2A9JA 1CY2A 4X24A 3LS2A 3L4JA 1I24A 2GF0A 3C5VA 3OFKA 3RASA 3QRWA 2B35A 1P0QA 2Q1SA 3K4PA 1KU0A 1T2NA 3N2EA 1QORA 1LGYA 1TI7A 5BW5A 1NZFA 3AO0B 3VR3D 4JNKA 1I5RA 2VL7A 2UXBB 4RGVA 3T12A 2YJ3A 1C9NA 3AEUB 5E7MA 3VZSA 4KX3A 4J9UE 5ERGB 1G291 1YRQA 5E2AA 4IIGA 4Z0PA 4B75A 1APBA 3I8SA 2BGLA 5E3HA 1XCGB 4AN1A 4Q4AB 1XEWY 1U3TA 1UQTA 2WQZA 4I4NA 4KQGA 3RG2A 4BL5A 2G17A 1TUIA 4CTJA 2IW1A 2W0MA 4V24A 5DNVA 4F85A 4RX1A 3U39A 2J9RA 3PJEA 4OREX 2JIBA 1UKVY 1Z18A 4Q4AA 3EBPA 4IG4A 4YRTA 2I4OA 2A86A 5K4GA 2X4LA 4J0KA 2E3JA 3QFHA 4NBRA 3TLGB 5AKYA 5D85A 3KKLA 1QYVA 3GELA 4BIMA 2PU7A 2OSVA 3KQHA 2XE7A 2OV2A 2PUEA 2G04A 1VMIA 4EP1A 1EFDN 1ISPA 1CPYA 1DTEA 1HTTA 1MBZA 2GEVA 2QMEA 3IDSA 1CR1A 1BS2A 1DLIA 4K6KA 1P1JA 4PZPA 2WKWA 1PJ3A 2MJLA 4TMTA 1RC0A 1M6YA 1XJ0A 1WD7A 1SOAA 2WLTA 5KREA 1DT3A 1E1DA 1W85B 3IHTA 5DW0A 4DDUA 1MXHA 4QTTB 3PF9A 3QXSA 2E55A 2HQ1A 2CDBA 1NI4A 5L7TA 4QBIA 4ARUA 1OBCA 3G59A 4B0OA 1CQIB 1W85A 2TRSB 5CA0B 3IXMA 5GJBA 2W8BA 3LW7A 2BEWA 5LWHA 2CYBA 2X41A 2GCPA 3E2PA 5CA0A 4N48A 1CQIA 1V3UA 1V5EA 3D4NA 3GDWA 4YJGB 4A82A 1W1UA 3EPKA 5A0FA 2Y4OA 2JGLA 2Q7XA 4I3GA 4GMKA 4RJKA 4OAOA 4WACA 4X3OA 4DTCA 1DC3A 1F9EA 4N3AA 2CLMB 4BV3A 2Q6OA 3TOXA 4RTLA 5C81A 1P2SA 4TMKA 4FKMA 2CLLB 1YB2A 2I29A 3Q0TA 4UU1A 5CX1A 5EWLB 5C31A 4DA0A 1XD8A 3HDHA 2HWUA 4RHCA 3GHYA 3S2YA 4EYOA 1QIKA 2ZLBA 3OLWA 5FWXB 2FMUA 2H2DA 1CP2A 4Q1DA 3IBSA 1H6AA 5EWLA 2D0DA 3K9QO 3R6GA 3UG7A 1S2DA 3NOOA 4MGKR 5HUHA 1G3MA 1X9GA 1AT1A 1Q3TA 3LT0A 5FWXA 1N6KA 4CKCA 3RLIA 1WZIA 3X2SA 3RUDA 4WW0A 3KZKA 3PEUA 1QAMA 3AOEC 3NO4A 3ZE9A 1BW9B 2FSVA 3E2MA 2HEIA 2Q46A 1D4ZA 1W5BA 3T94A 2Q8QA 2FPUA 4YRQA 1R0BA 3SNHA 4S04A 1GKIA 3OPXA 4G2NA 3UT6A 3R6LA 1B41A 1UFVA 2IPXA 5AVQA 2GN8A 1Z13A 2Y0BA 2HBQA 4OUDA 4NV1A 4R2IA 2YZKA 5CFRA 1HORA 2GZ1A 3FTCA 2IU4A 3KQSA 3NHPA 4K7JA 3PXEA 5KYXB 1PS8A 5FYQA 3U3ZA 3IDQA 1YF3A 1C9MA 4KMSA 4DCSA 1XMXA 4C14A 3N7UA 1KMQA 1SKBA 3RR2A 2PO7A 3R3YA 4HQOA 1L5SA 3NHYA 4PVCA 2QAGB 5AXDA 5K05A 1A9ZA 2PD3A 3R3UA 4MVJA 4JUBA 3T06B 1B8VA 1JDVA 1GR0A 4KWCA 1EJ2A 1XGKA 2C2KA 3WSVA 4DB2A 4DMLA 2QJRA 2C3YA 3HM9A 2QRGA 4GYKA 3CGGA 1OR8A 1R12A 1UPAA 3LDFA 5K99A 1C7IA 3OO1A 5KTNA 4I4IA 2AF3C 1BFDA 3HCWA 2IUYA 4V0OA 1I1HA 1WPXA 4WXMA 5DGCA 1FSPA 4LISA 1QV9A 1NN0A 2WTMA 5IJ0B 2ZR7A 3KE9A 2DHQA 3GN1A 5HMMA 4LF9B 2V7XA 3NTVA 5EZSA 3WG9A 4IRXA 2OCKA 2P77A 3AIKA 4ZVVA 3UF0A 5IJ0A 3MGBA 4OIMA 3F6RA 1JFLA 3DGFC 3ES9A 3GRAA 3AI3A 2C95A 4NABA 1OXMA 1LVGA 2DULA 3QX9A 4TWIA 4UTZA 2HSZA 4KQJA 4RTQA 5CDGA 4D9MA 1ZAKA 4QG3A 4P1ZA 4CJXA 2IOQA 4M8NE 3D7NA 3OF3A 1SRRA 4MRNA 4ANFA 5AW2A 5BMVA 3MUEA 4DARA 5C7YA 3K0HA 2Z2YA 4RXUA 2WKRA 1ODCA 2B92A 10MHA 2ZR9A 3WMFA 2G67A 2DKOA 1KO7A 2VQSA 2X0NA 1PL8A 1UBUS 1HDXA 2OBYA 2VHWA 3AY6A 1N1MA 4RLFA 3IVAA 5DLQC 5HILA 2FFRA 3T3EA 4IVRA 5IS2A 4S3MA 2ZT7A 1H5UA 2KE5A 4MRSA 4XAQA 1NXQA 1LLCA 2EQBA 4MQMA 4PSKA 5KQMA 1YAHA 5JPIA 1YZTA 3DBOB 3DB1A 4IWXA 4BX9A 5BV1A 1JFSA 2PTHA 4I9UA 4DN6A 1QJCA 4CCYB 5TV2A 1GGKA 3GW8A 4R8SA 2WZCA 4CCSA 1AMNA 2BZ0A 1W73A 1CCWA 4F2DA 4LJ7A 1UBKS 1JEAA 1YJ8A 3W2EA 2FR8C 1EU1A 4CCYA 1CE8B 4EIWA 4Y2JA 3CNLA 4L51A 5C1IA 4Y6PA 5LLSA 2JZNA 5B55A 1K8ZB 3N87A 3MCUA 5IK2A 5JI3E 3NC4A 5LDGA 1J09A 4TWBA 3RKSA 5K0FA 1IN8A 1CE8A 2FWRA 3HJHA 2P6UA 1ZHHA 2ERYA 3KT8A 4UXJA 4YAWA 4QGBA 2ACEA 3V97A 5E1BA 2VDVE 5JJKA 1YH3A 3BMCB 2YMLA 4FYWA 2JFFA 4MXDA 3X1ZA 2DR2A 3ACBA 1XLUA 3I6MA 2OBLA 3RKUA 2DQKA 4GNRA 5IAOA 3BTUA 2XNHA 3BMCA 2Z1MA 3FCSB 4EVSA 1JLMA 1NXPA 2WUFA 3HB1A 3FUUA 2VUUA 2GEJA 4ENWA 4O63O 2NGRA 4U2KA 2MMCA 3CMMA 3PC7A 3WHPA 3GLHE 1IAQA 4HGQA 5U1PA 2PKXA 2O8BB 1I4OA 3NB0A 5A0TA 3NIGB 3I2HA 2JAOA 4HX9A 2UXDB 3DFKA 5DHAA 4I5EA 4F93B 3ETDA 3HI4A 3HNPA 3IR5A 3A4VA 4RZSA 2IHJA 5KOHB 5EWJB 3RVDA 1NBHA 3WYAA 4N3CA 3TD6A 4EB8A 9ABPA 5GAJA 1AUQA 4KAJA 3H99A 2OQ2A 3LO5A 3BXHA 5AM3A 2GILA 1E20A 3HMQA 2RG7A 4N1AA 3T4EA 2IC5A 5C1DA 2GJAA 1AUVA 1E9FA 4HFJA 3KB8A 3KU1A 4QGSA 3MINA 1RABA 1JA0A 1XALA 4EFKA 4PGHA 4HGZA 2EFCB 1DQYA 1WS6A 4NG5A 2VPPA 3A26A 4QTZA 4V0MA 1L5ZA 1CZHA 1FX0B 3MERA 1Z2CA 4ZOBA 5FUXA 4WKBA 2Q6VA 3ZDXB 4K1XA 2QENA 4R05A 2GPTA 2J3KA 1HI9A 4IIJB 4JZYA 3GZ4A 4KLNA 3QJ5A 3P71T 4COOA 4F6RA 3D1JA 1W0KD 3W3ZB 2GD6A 3I01A 4IIJA 1O4WA 2R8ZA 3DMGA 3D4IA 4KG7A 5DTIA 2GVZC 1L7RA 4MQUA 3K3PA 4DNOA 1AQJA 1NHGA 4FGWA 3AW9A 2PM8A 3DMHA 3K8YA 1H69A 3B8HA 5HR5A 4I6JA 1H0RA 2QWXA 4A8PA 5SZKB 4PLCA 3VTKA 2YIJA 4MZXA 1EUDB 4E6PA 2QTCA 3RRFA 4TSFD 4TWAA 4I3FA 4PX3A 1EUDA 1VZ3A 1FYDA 2GZDA 1M6WA 4WLVA 2A9FA 2PRJA 3A6ZA 1Y7TA 3LQYA 4NULA 3OOYA 4RKYA 4O0LA 5J4VA 2CLEB 2ON6A 1YJQA 1YR9A 1Z6QA 4XQEA 8AT1A 3QKIA 1VG0B 2GSWA 3CH5A 3R75A 5I7OA 3HE3A 2BFEB 2ROQA 3AR6A 3EIWA 3F5DA 3HJGA 1YA4A 3AW8A 3QA9A 1RYFA 2AI3A 4I8XA 4JLWA 4CUZA 1PE0A 2QTVB 4TXHA 5ICSA 1DAGA 1RW4A 4U3JA 1UT8A 3GUHA 1XFAA 3LC0A 3BXXA 2JLAA 2FYTA 4PHTA 1W47A 4DIMA 4N54A 1QDEA 5AVRA 2RB4A 1S2OA 2OBBA 4LY3A 2P40A 3FMFA 5KYVA 3ZWWA 2M9MA 3IAEA 5AM4A 4F46A 5C9ZA 4EJSA 1H65A 3DPUA 5BSEA 4W8GA 1ADCA 2ZVPX 1YRBA 2V97A 1W19A 2Q07A 1A98A 5F9FA 2A9VA 5K8VA 1EXVA 1PFVA 3QE9Y 1YS1X 2C5BA 1WSBA 1V39A 2P9GA 2ZRHA 4QFBA 4U7JA 3BS4A 3LMKA 1NM5A 4DQUA 2PUFA 1ZO8A 2QRHA 1M8GA 1L9KA 1L5OA 1DBWA 4CQMB 2H9IA 2JI4A 1KI6B 1VFNA 2TMKA 3QVXA 1YJAA 3OY7A 4JEMA 3IP5A 4EJSB 3TK1A 4WZAB 1EK1A 4O25A 2FWNA 1QB7A 3VI3B 2AN9A 4F5ZA 5FNZA 2XQIA 3FN4A 3M6IA 1KI6A 3L6UA 4NWIA 4E5DA 4HNSA 2C7PA 1C0EA 2FUEA 4I9NA 5IBQA 4WZAA 4KO1S 2BGIA 4R5HA 3UJBA 3OJWA 1GGJA 3VPBA 5L3RA 4PN7A 4DGSA 4N41A 1XPUA 2X9LA 3TTSA 4FHZA 4JJ8A 3IO5A 1SK8A 4ZOLB 1D09A 5IHPA 4E14A 1VE3A 2PRKA 1A7AA 1ORWA 1W8IA 4RHTA 5J1TB 2XKKA 2WICA 4URYR 4MSUA 2Z5GA 3PX2A 1QF9A 2Q41A 1R7RA 1C14A 1E5DA 3A70A 4ZOLA 5FNVB 4A0HA 2YASA 3VZBA 4G63A 3ELWA 2JLCA 1GZ5A 4JI6B 4CL0A 3AR4A 3AP3A 2FPPB 2TMYA 5FNVA 2GZAA 1L7NA 5IARA 4CF3A 4M7RA 2H6EA 2J09A 2SKDA 1BWQA 2Z09A 1U3GA 1Z9BA 4U7DA 2PWYA 1Z5GA 4IDNA 4N5NA 5E1OA 1P7YA 1EE2A 4OQ4A 2VQ6A 4NE7A 2P9HA 4BQSA 4I6GA 4DIDA 5HYVA 5ICEA 1Y6GA 4HYTA 3UH1A 1N6LA 3A36A 4A8JB 2VP9A 3FUXA 5KC8A 3M5PA 1YR2A 3GFPA 1U9JA 2O6LA 1G6HA 4MV6A 5TLSA 3HUEA 3VNQA 2CXQA 4P33A 5HTKA 1PWXA 2Q3EA 4DVJA 4FYXA 2IYXA 3HXKA 4LQCA 1PGPA 1KRXA 1N5JA 3QJGA 4PZLA 3SS8A 1HLPA 3ED5A 5C8VA 5DPMA 2JFBA 5F4BA 1ZKDA 4R2HA 1WCWA 1K98A 1OWNA 4I50A 4E2ZA 1OWOA 3PPWA 4YDHB 2FKNA 4FC7A 4YQEA 2ORED 3IPCA 3G68A 4BVGA 4MV4A 5HIIA 1Y9JA 4FMPA 2W9XA 4JZKA 3STWA 3K05A 1NR5A 2PX2A 1PUIA 1ZPDA 2FPKA 4HTAA 3S7ZA 1NBEA 4DNQA 1E2MA 3WDKA 3G1WA 1P6XA 1Q5PA 4ZA2A 2QZPA 1EFRA 1DC8A 2JGRA 4DRXB 4P4TA 4ND7A 4GBMA 2VG8A 1NJ5A 2ZQZA 2VNKA 3OE1A 1WEHA 4FK8A 4KAAA 1P17A 1VKHA 4MUIA 3ZCRA 1TYDE 3GLFA 4ZP1A 1V5GA 4LHVA 2AUMA 4INOA 1TIKA 3WE7A 4XQGA 1KSGA 5P21A 3AVPA 3RUHA 5IN4A 5J4KA 3E35A 1V7PC 5IJWA 3LWZA 3FTPA 3PT9A 3D5TA 3FHOA 2FFHA 3TW8B 3WRXA 4OQFA 5AH0A 5DSTA 3IEPA 1W6RA 4U4AA 4B33A 4X20B 5A71A 4TRNA 3F4LA 4INJA 2K6GA 3PSAA 1T5BA 4FBMA 5EE0A 3TW8A 3NHWA 2RH8A 1U1GA 1IK6A 3DDCA 3ZXUB 1SIOA 1T2CA 2A1UB 1OZAA 4AK9A 4ALMA 3GT3A 4X20A 5D3QA 5F77A 2H06A 2GD2A 3LM8A 4BC1A 3OQMA 2X8JB 1SPXA 2OHHA 4RBNA 5DP1A 1MO5A 3UAWA 4DLBA 4D3YA 1CNEA 4HNRA 2SKCA 4RUKA 1XBTA 2GLTA 2QTGA 3LF1A 1KTIA 2XMPA 3ZE8A 3O9ZA 5IAGA 2FVXA 4LXQA 3BD6A 4EO9A 4IOJA 3FSEA 2OZEA 1WY5A 4II2A 5LN1A 2WE8A 1QYIA 3IA7A 4WLNA 4YK7A 4XYGA 2W7TA 4OQPA 4UAVA 2JGNA 5JQGB 3ICCA 3EPRA 4DLKA 4QXOA 3WGYA 1VHQA 2I1QA 3ZVRA 4D4MA 4E33A 1GPJA 1N6OA 2MT9A 3DZCA 5JQGA 2AXNA 3BD7A 2PG3A 3HC7A 3AV3A 3DMTC 1HKHA 4DA8A 1SUDA 1TYBE 2EWVA 4OA8A 2EAUA 4JLPA 4D1YA 1L4NA 1XNHA 4JMPA 5HS4A 2H7YA 2QLJA 4DJ5X 1KGDA 1XDWA 3CRZA 3BK1A 4FNGA 3LW8A 4LHXA 2IEIA 5B1SA 1DT5A 1NVTA 4PX2A 1BKYA 1UJMA 4YAJA 1MO3A 3L01A 4D92A 5A03A 3LUFA 3LT4A 4B9EA 3U81A 1V6SA 3ZWKA 1L4BA 2VXCA 2W43A 3HYSA 4EGQA 4IIBA 1A27A 4MV0A 3EGEA 3FPCA 2RHHA 4CFZA 2AOXA 1S2IA 4NKRA 3VISA 2X0IA 4D9GA 3V9PA 4XASA 4E7OA 1SUBA 2YWBA 2J1LA 3FSGA 4OL0A 1M5RA 2VJAA 3E58A 1LBHA 5ABPA 3O4FA 5JNRA 2N47A 1IN1A 1XDBA 1KNQA 1CYEA 4M0KA 4CLXA 1FK8A 2E4ZA 2B82A 1GPYA 2VOJA 3P9IA 4PZ9A 5LR6A 4TXLA 1XTRA 1OFIA 2AC4A 3ADCA 4FOSA 1Y9DA 2Y76A 1HE8B 1UADA 4LYGA 5DIFA 4RJ2A 5LB4A 4I9HA 5JCJA 5A4MS 4AJEA 3C8ZA 1FRQA 2OV6A 2W6PA 5ALSA 1NN1A 5B7NA 1M0SA 4OLAA 2Q9AA 3BERA 3JQ9C 4MYDA 4PLTA 2Q21A 5T67A 4WGGA 2YMPA 1W4BA 2G25A 3KJZA 3CH4B 5CLHA 3D8SA 4OL9A 4MCHA 5CLQA 4QREA 3B1WA 3VZQA 4EEXA 3DWGA 4REQB 3TQRA 1O5IA 4Q34A 5DLEA 3FSJX 1I4DD 4IHAA 4MVWA 2P4EA 1VCOA 1SR8A 4OXKA 3CVVA 5FOUA 2J3LA 1MZVA 4REQA 3EVGA 4ZZIA 2H0RA 2D62A 3THXB 2Z58A 3H8JA 4MQFB 3NIDB 3AVUA 3OCXA 2ZANA 3W2IA 1Z63A 3KQNA 3GA0A 5FI1B 2BH9A 2P4UA 4ZAGA 3DW1X 4LSGA 4RFSA 4FKBA 3ZW9A 4DCOA 3SICE 5BV2P 3F90A 3D31A 2D54A 2Q9UA 5CT5A 1CRZA 2ZYHA 5JNSA 2CCGA 2FV8A 2PY6A 2R68A 3EG9B 3L06A 5ALDA 1YZLA 4OUKX 4BP3A 1O95A 2WB4A 1E4OA 1E98A 1KPHA 1XF9A 2V7QD 2VFAA 3ANXA 4IL5A 1DAFA 3C5WP 4ZVNA 2ZTMA 5BSMA 5HQTA 1UM9B 2QRPA 3AB3A 1FVFA 1PL0A 3C8HA 1DUVG 5EQTA 1PJCA 4OMDA 5HEKA 2Q9CA 3H13A 3NDRA 3NDBB 1UM9A 2DHRA 2OFFA 2O54A 3VPCA 2QUZA 3QELB 3RC9A 5E7QA 2PIAA 1JTFA 4HGYA 1Q7TA 5A5GA 3E05A 2XR1A 1UFQA 2J48A 2DAPA 3A9CA 3O91A 2AKYA 4MINA 3B1XA 1HZZC 4F9EA 5TNXA 3LBYA 5C5CA 7ABPA 1BQ3A 1GGNA 4U7PB 4P35A 4AXBA 4NG4A 5CPFA 2L2QA 1VPLA 2K7ZA 2R86A 4Q9KA 5GJCA 4RTOA 1SOVA 4X63A 3RAFC 3G9TA 2V59A 3HB0A 4J76A 4F3YA 2BSAA 2C2OA 3KLBA 2WIFA 4UE3S 5LZ8A 2EJBA 3ZHCA 3W77A 1A8IA 5DE3A 2W6ZA 4AI6A 3U6BA 1DS6A 1NE7A 2GBLC 1DG3A 5F3DA 3VAZA 1FMLA 4ZANA 4LCEA 4BUCA 4IXWA 2IP2A 3LG2A 1DG9A 1WCYA 3FLMA 4MWGA 4O1IA 4XQ0A 4KVFA 1N36B 3H5OA 3F73A 3UGQA 4FR2A 3IE1A 1ZY2A 2BGRA 1VCHA 3GX1A 3V3KA 2ATIA 4I7EA 1Q84A 1NBMA 5GINE 1B16A 3EQZA 4GIBA 3VHRA 4E11A 2I2BA 1KDRA 2NO4A 4DBZA 3KJHA 3GNLA 3R6WA 4ZHSA 1RMQA 5B1DA 5F52A 2GUGA 2BHRA 2RE8A 2MTBA 3PQ3A 3UK2A 1RT9A 3M9XA 3M1IA 4UVHA 3RWOA 5ELLA 2VRWA 1FP4B 3FVRA 2VJCA 3TXAA 2WJJA 2ZUVA 2NV6A 5G0TA 1J8VA 3F3MA 4AMVA 4HFRA 1CUZA 2P2DA 4YEDA 4ENUA 2CL6X 1DWQA 3W04A 2MCFA 2V96A 3SYMA 5IUNC 3CLUD 3CIFA 5IMBA 3LAWA 3WP1B 5B6PA 3TI7A 5FOSA 1KU6A 1Q44A 3DO8A 1T8UA 3AFIA 5EPUA 4AS2A 4Z1MA 1Q1NA 3IO3A 4YUAA 1Q1EA 4KGXA 1WDMA 4REOA 1VSBA 2IEZA 2FGKA 4R9VA 2JKYA 5TX7A 4GOKA 3RVPA 4C43A 3OQHA 2WTAA 4HAVA 4NI5A 1ZLYA 2ORWA 3H5WA 2AJCA 3GFQA 1UKBA 3C39A 1U2PA 1UXKA 1GTZA 3EVAA 1TMOA 1ODKA 2O3TA 2MDTA 3DMFA 2KJQA 3G88A 1MQAA 4RGYA 3DV0B 4DR7B 1Z4IA 1R4NA 1X1CA 3RV4A 2JFQA 3M4NA 3ODGA 4HY3A 5EPOA 4A1OA 2E1RA 4GQBA 1F0NA 1RBQA 4W1PA 5BURA 1JVNA 2JVJA 3L04A 1GGHA 4N40A 4BO1A 4CM8A 1HFWA 3RJTA 3FOCA 1H3NA 1AD2A 4BFSA 5F2KA 4B76A 1CC1S 1X77A 3EQ8A 4ZFNA 1GOTA 4MB0A 4R1PA 5CGZA 1E79D 3SHVA 2WWRA 5LDHA 1KYZA 4ARZB 4DM7A 5TQJA 2VF8A 1BA3A 4AZVA 4ZHQB 1TM5E 1Z7EA 4L75A 4ZGGA 2P9YA 2YCBA 3UVEA 3AHJA 1O94D 2VDWB 3UFXA 2NYAA 2Z2XA 1KY5A 2LE0A 4KN9S 5CCDA 3VV2A 1AURA 1KTVA 4NK4A 5JAHA 4OQZA 1ACLA 3RDPA 3SSAA 4XM0A 3T1TA 4XFKA 1DDGA 1L7MA 2VDWA 3IXQA 2E21A 4D80A 2C61A 5CVJA 2ONJA 3UA3A 3C2QA 4HXYA 5CH5A 1B3RA 3TLBA 3X1XA 1PAUA 2CXUA 1GQ2A 4JLOA 4DLSA 2HK9A 1HSZA 3HHPA 4QUEA 3SXUB 5FH9A 2VI5A 3W5AA 4KPFC 1NW7A 4P3PA 3JRWA 1RJGA 4N49A 1O2DA 1ZK2A 4G1BA 2RCNA 1C29B 3SXUA 2GK4A 2PGDA 1ZOLA 3G9ZA 1ZM9A 2BFWA 5KKCA 1GQYA 2QBYA 1ZFNA 1LI5A 2QMZA 1YZKA 4NBWA 1PQYA 4LYJA 5J63A 1Q7BA 1X7ZB 2BMVA 1TM7E 4U2GA 1Z88A 3GFVA 3ITKA 1WB9A 3T7DA 2JI9A 3L5OA 13PKA 1X7ZA 1IBLB 5D86A 3HCDA 1JT9A 1R9MA 1JG3A 1HNWB 1BVYF 1U94A 2AL7A 2G4CA 2ZBPA 3Q9UA 1X7GA 3Q7IA 4IXNA 2WSYB 1D9XA 2JVKA 1CUFA 3U31A 2H3EA 4GWKA 4XRGA 3DF7A 1V7QA 3FGZA 3WGHA 1W5SA 4HYYA 1RZRD 1NYQA 3TAUA 3IAHA 5JOQA 1M2KA 2WAYA 4B8WA 4LOLA 2H7CA 1A9TA 2HSDA 1E3MA 1UL1X 4PYLA 2YZ7A 3ORSA 5BNFA 4ZCPA 1JWAB 1MH1A 4QWWA 4EKEA 1GNRA 4MLDA 1C1YA 3KV1A 1B2RA 1E4VA 2XTAA 1TO6A 2BMFA 4W99A 5FUMA 4MV1A 4HLNA 5AWFC 1LPOA 5ALGA 3VYVA 3HCEA 1ETHA 2YJGA 3RIXA 4V03A 1JR4A 4HH0A 2ID9A 1UOEA 3SY8A 1HTBA 1UBMS 4TV9F 4Q02A 1H9CA 4TMVA 1VHLA 3L7DA 3ROXA 3IKTA 4LIPD 6REQB 5JXWA 4OF4A 1TCBA 2XNDA 3PHGA 1GCAA 5LVAA 4UDOA 4CG3A 2ZR0A 2C82A 5EXPA 3GBPA 5MN4A 3I0NA 1B42A 4WJLA 1TYCA 1IQ0A 2QXUA 4LOKA 1NSYA 1Q0PA 3T1VA 1LDYA 2GX6A 4G1FA 1XXHA 1W8DA 2ZBEA 1F60A 1C1DB 1P9WA 4GD3Q 2GN4A 3BWEA 4WAUA 2PGLA 5B30A 2DQZA 3IC5A 3DE1X 5IM4F 2JLXA 3HXPA 3TSOA 2O14A 2JGJA 4ZYWA 4RTRA 2HJVA 1JDBC 1RPNA 2A6PA 2B1GA 3P0JA 3LBIA 4N9QA 2X4IA 3FR8A 1RQXA 3DOJA 1TO2E 3IERA 4L95C 1YV9A 1S7CA 4RETA 3ZDAA 1C30B 4M1ZA 2XMCA 4JT4A 4OG2A 4WASA 4DXAA 2VF4X 1Z07A 1LPBB 3NH6A 4M9ZA 3UCEA 5CDUA 2QQGA 3A8TA 4WFIA 1C8VB 2JBAB 5JW6A 3K71B 4LHSA 4G97A 4G5YA 2PL3A 3FDJA 2VNJA 3V8EA 1FP1D 1XYVA 1YB6A 3TIGA 1QFYA 2NMVA 4XPIA 3FPSA 3HXTA 3COJA 4AECA 1E6KA 1P4HA 2QTTA 2X76A 2CJYA 5FWDA 4EJ0A 1L2TA 4JXXA 2GLXA 4CV3A 1KIAA 2WMYA 5ADVA 3AY7A 4IFTA 1CNFA 1KYQA 4V0SA 5EC8A 4OOEA 2HH9A 3HWSA 3H2HA 3LHDA 4JCCA 3TJZA 1COWA 2RH9B 5LZ2A 2ZI9A 4RPLA 4GI7A 4ER5A 2NSYA 2CXOA 3JVUA 1V0JA 4H0FA 3A2NA 2GTPA 1KHHA 2JPDA 2J9FB 4WKGA 4OX9B 3B48A 1RQRA 1IHXA 1Y5IA 4M9SA 5DLDA 1YDEA 4C20A 4CKZA 1A8SA 2WM9B 3FMVA 3NAZA 2J9FA 2NADA 3WFZA 4PY2A 1HLGA