1AKQA

D95a oxidized flavodoxin mutant from d. vulgaris
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
147
structure length
147
Chain Sequence
PKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEGFDLVLLGCSTWGDDSIELQDDFIPLFDSLEETGAQGRKVACFGCGASSYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FLAVODOXIN
publication title Crystallographic investigation of the role of aspartate 95 in the modulation of the redox potentials of Desulfovibrio vulgaris flavodoxin.
pubmed doi rcsb
source organism Desulfovibrio vulgaris subsp. vulgaris str. hildenborough
total genus 51
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 1997-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1akqA00
3QFRA 5F12A 1WSWA 1FTGA 1SG0A 3ZHOA 1AKUA 3K20A 4LA4A 3QE2A 3U7IA 2HNBA 3GFRA 4CETA 4LTNA 3F6RA 2OYSA 3NHJA 2M6SA 1AMOA 1WSBA 2QX8A 2WC1A 4ZVMA 1VMEA 1YDGA 5B3KA 3SVLA 2FLVA 3NFRA 3RPEA 5LMCA 2AMJA 1JA1A 2X2OA 4Y9RA 4BMOB 2BMVA 5JROA 4C14A 4U7HA 3EDOA 3OWXA 3F90A 4D02A 3GAMA 5EAIA 3OWHA 2QMZA 2Z9DA 2Z98A 4ESEA 3FX2A 4GI5A 2F1OA 4NULA 4S24A 1B1CA 4PTYA 2FAXA 1FLNA 1BU5A 4YAFA 1RLIA 1AKVA 1CZHA 2FX2A 1OFVA 2R97A 4DILA 3TE7A 4C0WA 3U7RA 2RG1A 1J9GA 1AKRA 1KBQA 2BF4A 3O73A 1RTTA 2OHIA 1FX1A 2D5IA 3KLBA 1D03A 5F51A 5LJIA 4N9QA 1RCFA 4F8YA 5BUCA 1FVXA 3NLLA 2FDXA 1BVYF 5F4BA 3OJXA 1DXQA 3S2YA 4BMPB 6NULA 2HNAA 2MWMA 1CZNA 1ZX1A 4YAWA 4YALA 3TZBA 2GSWA 1XYVA 2QX6A 4YAOA 3L9WA 1QRDA 4LTMA 4U7FA 5A4KA 1YCGA 3HR4A 5TGZA 1DXOA 4OXXA 2M6RA 3D7NA 4N82A 1YOBA 4C76A 4NLLA 3HLYA 5B3LA 2QR2A 1FLAA 1YCHA 5LVAA 1QBGA 4H6PA 1KBOA 3KAQA 4LTDA 1CZLA 2QX4A 3O2NA 2N1MA 1T0IA 2XODA 3P0RA 4U7GA 3OVMA 4FGKA 4QOFA 4Y7CA 4CF6A 1FUEA 3TEMA 4ICIA 4QOGA 5LBUA 4ZVLA 2FZ5A 1GG5A 4FX2A 4Y9UA 3R6WA 2V5VA 1E5DA 4R81A 2B3DA 1CZKA 1FLDA 2ARKA 1YRHA 3FW1A 1CZRA 3FNIA 3FVWA 1NNI1 1AHNA 1SQSA 1AKWA 4N65A 1QHEA 1J8QA 4HEQA 3ES9A 3GFSA 1D4AA 2Q62A 3ESZA 4HS4A 3NHPA 1XT6A 2QMYA 5EMNA 3NHLA 1OBOA 1AKQA 4XDGA 5NULA 2A5LA 3UXHA 3W78A 3NHSA 3NHUA 2Z9CA 2FVXA 1C7EA 3W77A 1XI2A 2FOXA 5LBTA 3QFCA 4QOJA 4PTZA 2V9CA 3KEGA 4ZVKA 2HPVA 3KAPA 4FGLA 1J9ZA 5NLLA 2W5UA 1ZWKA 3N3BC 3K1YA 3OJWA 2Z9BA 2BPOA 3N39C 3OX3A 1D04A 3LCMA 2ZKIA 5FA6A 1QR2A 2Q9UA 3NHFA 3HA2A 3F2VA 4GR9A 3B6KA 5FX2A 3JSXA 2MT9A 1ZWLA 1YKGA 3NHRA 2OHJA 3NHKA 1AKTA 4YQEA 1JA0A 1AZLA 4H2DA 4XDHA 2MTBA 3GFQA 2FCRA 3N3AC 2V5UA 3OX1A 3F6SA 5EA2A 4J8PA 1CZUA 3W79A 4FGJA 2KLBA 1RLJA 1OBVA 4QODA 2OHHA 1FLVA 2R96A 2X2PA 3UXEA 1YCFA 3NHYA 3EYWA 1TLLA 4QOEA 4DY4A 3W7AA 4ZVNA 4YAUA 5LLDA 3ESYA 2XOEA 3L9XA 3B6MA 1AG9A 4DIKA 2QX9A 4C0XA 2MOKA 4QOHA 1F4PA 5LJLA 1X77A 1I1OA 4LAFA 5FUQA 3OX2A 2BZSA 4PU0A 2BN4A 2KQUA 1H66A 4GQIA 1J9EA 5ULLA 2QWXA 3B6JA 3NHWA 1H69A 3LT5A 1CZOA 2FZVA 1TIKA 1C7FA 3G5MA 1T5BA 1DX9A 4QOIA 1V4BA 1XYYA 4M0CA 3ESXA 3FJOA 3B6IA
chains in the Genus database with same CATH superfamily
2FR8C 5LZ7A 2JGEA 5LKAA 4PZ9A 1WSWA 3VPGA 1MIOB 4IUYA 1FRQA 1OH7A 4MP3A 2HEGA 4WCVA 3WLJA 4A03A 5JMTA 2C5SA 2GBPA 1TU0A 1W30A 2B8WA 2IYPA 2OFPA 1KMQA 3C3CA 3H3JA 3JQGB 1K7CA 1MIHA 2IYQA 5DB4A 2P6UA 3K20A 1YUMA 4LOHA 1WB6A 1T9DA 2DTDA 3W3ZB 2D2IA 6AT1A 1Y6RA 4PVCA 1TPZA 3KJQA 4UVDA 2VPXA 2P4SA 4R1TA 1DP4A 4L9WA 2OAGA 5K7SA 3PD7A 3RHZA 1W85A 2DETA 4GOLD 2O2XA 2M6SA 5LMZA 5DXAA 2RHJA 2X0IA 3HJBA 1Y37A 2JK1A 1KDRA 1ODIA 1GNRA 2VBGA 4IJWA 3GA7A 3C3AA 5AJUA 3U0VA 2GEVA 1DAOA 4FHZA 4GECA 1HYHA 1Q16A 3R40A 4MV1A 4OMCA 3QUSA 4KAJA 3BKWA 2NAPA 5E4YA 2ZZMA 1VMEA 1XQWA 1BRMA 2E87A 4LRQA 2QRGA 3OIWA 4PC3A 4WINA 4DXAA 5JD4A 2O8CB 2VPZA 2FLVA 3AEQB 2CLHB 3G59A 3Q3CA 1YC2A 4X7BA 3ZDYB 5CFLA 2D2XA 3ITKA 1JEEA 1K8ZB 2NSHA 4B6OA 1Z75A 2X2OA 1C3VA 2ZS8A 3B1KA 2XQFA 1UBFA 3W05A 1PYOA 4N7JA 5AIAA 3VYVA 2C2GA 4HQ6A 1QC5B 4G1MB 3ELDA 4V2IA 3RT7A 2R2AA 1QQTA 1SQFA 1TXGA 1ICEA 5DLPA 5TMBA 3ZDQA 3LZCA 3HR7A 4OH7A 1UOQA 1KARA 3EDOA 5CX1B 2GNOA 1SBCA 3ZZUA 4S05A 1QTQA 2AOUA 1QU3A 4S1WA 3B5JA 4NFYA 3SX4A 3VU1A 4D02A 2O3JA 1GZ4A 5CFZA 3K4PA 1N5LA 1HL3A 2Q6TA 4IHAA 3SZ3A 4AMBA 3ANYB 5EAIA 2WPDA 3AHDA 3OWHA 1N2CB 5EWJA 3EVAA 1ZD2P 2JGDA 3IHTA 1N77A 3ERCA 3NU1A 1ZK3A 2IYAA 2NU6B 3DOJA 2ERYA 3W90A 3IEMA 1C41A 3AF4A 2IE0A 3LY5A 2BM9A 2WFLB 2HPHA 3G9XA 4MZDA 2X13A 4TSRA 3BCHA 3A8TA 3I9NA 2WKPA 4IZHA 5IH3A 3ZQUA 4KRFA 1UMDB 3HSSA 4MVJI 1XDUA 4ZT5A 2QDXA 4YXWA 1TZ2A 2ZQZA 3LDFA 5K6AA 3B9PA 5AHWA 3TPFA 4DRZA 1RJDA 4L2IA 2Q1UA 5LP6A 4A7PA 1GDDA 4JLKA 1BU5A 2ORED 4DUGA 4LV5B 2RONA 3BXPA 5FOQA 4L85A 3EWSA 4PC2A 5AJTA 3N2KB 4L9SA 5ECDA 1FSGA 3DV2A 4M1TA 1SPXA 3ZJUA 2OYCA 1WXFA 2F3RA 3TE7A 1WW3A 1VHWA 2H3HA 13PKA 5FI1B 4AKGA 4NYJR 2GNAA 3ZD7A 1NI3A 3LIIA 4KYUA 2OD7A 2QRNA 2XCLA 4UCXA 4Y8VA 4KH1A 4YCDA 3IPAA 1HQYE 2AHRA 2QN8A 2YJ3A 2VL7A 1W35A 3JQ9A 1JLKA 4I55B 4ARVA 1U2DA 2FZKA 1R3UA 2JVIA 2QG4A 5ICSA 3PS9A 5HILA 4BKUA 2WQ7A 1MIOA 2OO5A 3ZG6A 1AURA 1E2UA 3KKQA 1INLA 4JT8A 5SYMA 2CVPA 1N57A 1PZGA 1YB2A 3AKCA 3JQGA 1P80A 1M1YB 1T2EA 1GARA 1MJ5A 4QGGA 1HETA 1O57A 4L6CA 3E18A 3GBPA 3VGJA 3CRRA 4RVHA 5LDGA 5LQCA 1DDOA 3UGJA 4JEUA 4TMYA 1LWOA 2P5UA 2PT5A 2ZWIA 3CEAA 4TXLA 1DKMA 1M2GA 2WDPA 3GCDA 4JLAA 1UANA 4N0QA 4M8IA 1IHOA 2XHZA 4FDUA 3K31A 2YASA 3L0SA 3O8DA 3FUUA 3A7EA 1SKYE 2CWWA 4U00A 3IV9A 1NZJA 2C92A 3BN3A 5CYOA 2C9MA 4HNAB 5L4SA 5HJ7A 3FZGA 3S2EA 1RKXA 4N9WA 4D4HA 2ISCA 2O8CA 3CWQA 3OMXA 2AN1A 1T5IA 2PH5A 1RRGA 2ATCA 2WILA 3AEQA 3NYWA 5IF9A 3PEVA 3E9DA 3GLTA 1G5TA 1YDFA 2Q46A 2WAXA 2UXCB 3TFQA 1O9BA 3DMTC 4J0GA 1NMXA 2WD9A 2AI2A 3THYB 4YAOA 2HJHA 2XA2A 3O1HB 4XIJA 5B3AA 1OHHA 1RMYA 3FBWA 4B6QA 3D7LA 4YRDA 1N5DA 5CX1A 1GYRA 2HMTA 2ZI9A 3QNMA 1RMTA 3I6IA 1L1EA 2DQKA 4ZVPA 1XJCA 2QUIA 5FRDA 4DOMA 3I04A 1OW3B 2PLRA 2GT1A 1E6WA 2FQYA 4TM8A 5LC1A 1R8QA 1N2CA 5AYVA 2FEKA 4G0MA 5BNIA 3JAKB 5JAZA 1YWGO 2NU6A 3HMQA 3FTQA 1SGWA 3MT9A 4Q47A 2WT9A 1G2QA 3OEYA 1RRFA 3HBFA 5AUQA 1EBUA 2WFLA 3CEJA 3TM5A 3UNXA 1GTRA 4JP5A 5TQ2B 4TUYB 4XKJA 3A6HA 1UMDA 1LNZA 1CUBA 3DL2A 4N8SA 3WMRA 3ZHTA 4MKZA 4X8LA 3UUEA 4BVKA 1OWLA 2FWRA 1DQPA 4DV5B 3ZHUA 4QICA 3QUCA 1I5RA 2V7WA 4IVQA 3KPJA 3JAMA 3PHJA 4JBLA 2HSGA 1USKA 2NO7A 2PEYA 4KXQA 2Q7OE 3VJLA 1GZHB 5E3HA 4H31A 3N2KA 3HRIA 2XUHA 1FF9A 3A2MA 1KSJA 3GF4A 4HH0A 4OI2A 4BJ6A 3ZWBA 3B36A 1G6Q1 1VKRA 2GEJA 1KQPA 1HFJA 1X42A 3MMPA 1RKQA 3OM1A 4WWHA 5B1HA 4Z9YA 3C8UA 2BBTA 4AECA 2VBFA 1NPTO 2CYBA 4J16A 3CX7A 1ONOA 5KTMA 4RJKA 1BQ3A 4EA6A 1R50A 3LU1A 4N48A 1K8RA 1I7DA 4FNAA 4I55A 2D0IA 4IWNA 5B4UA 4ZCIA 4NV0A 3LUKA 3PNQA 2VHVA 1KRHA 1ATZA 1J0EA 2CXNA 2DTEA 2P62A 3EGCA 3IX7A 4BLPA 1EHCA 2FSVC 1W5SA 1FYWA 2FW6A 2I2AA 3ILSA 1M1YA 4PNHA 2G5GX 3M70A 2GPAA 4WZAB 1N4AA 1JEQB 3RTCA 5DN6D 4Z53A 4BTLA 3N0WA 3ZQ4A 3TEMA 1K7XB 2P8JA 3AR5A 3DR5A 4MGEA 1AHHA 4BYGA 3QBJA 4YRZA 4KV7A 2EKPA 2GPNA 3CLSD 5DNWA 1JDJA 3SKYA 1DZIA 1WXIA 2QZJA 2B1QA 4TS9A 1I0IA 3PSHA 4HNVA 2FEOA 1U9IA 2PBFA 2PAFA 2Q0SA 3PCTA 4RE6A 5LOVB 2VPYA 3CLSC 5IMSA 2W2QA 3FR8A 4HNAA 1CNMA 1FU7A 1Z7WA 3IQZA 3OZGA 2FPGB 4EM6A 3NX4A 5IUNC 2EJUA 3HO1A 1JA9A 3PNBA 1JSCA 4K2HA 1MF7A 3P2YA 4X6XA 2OYRA 2RJOA 5KPDA 5EERA 4IXWA 3AFIA 4BP3A 3NOQA 1NXWA 1Z74A 1ILWA 3THYA 2J09A 1NW9B 1YJBA 5CLIA 5EXXA 1WLSA 4ZDJA 4XLZA 521PA 3LVBA 1QF7A 3LH5A 2RI1A 2V8OA 4U63A 3L0IB 4CVNA 3V00A 2WJGA 4U2EA 4X63A 1C2YA 1USGA 5JS1A 4JCCA 1VPTA 3N2EA 4HDOB 3H0KA 5FTWA 3RK1A 2QD5A 1AKWA 3NRBA 3R20A 5B12A 2WF7A 3PQCA 2JI8A 1NLFA 5E9JA 3CVXA 1G8MA 1RYNA 4L72A 3A1EA 4JVOA 1ZESA 4R9NA 1QYWA 1KWKA 2WWHA 5EPEA 1JMYA 3IP7A 4BO1A 3JAKA 4R84A 1S7CA 3UXMA 2ZWAA 3AH8A 1RXCA 1UJ6A 1OKKA 3VPDA 3FB4A 4YRCA 2ZUWA 4AC9A 4DKJA 2B7CA 1G6HA 3QE0A 1Z4MA 1SC6A 3BB1A 3QOWA 4J1TA 5TQ2A 4N0EA 4TUYA 3FSJX 3SPXA 3GP5A 1XMIA 4WBNB 4B3IA 4WASA 2BCGY 4EGCB 2CLSA 3OEWA 2Z5GA 4GPD1 3T35A 2WKQA 4S1PA 4JI4B 3QPWA 4MWSA 5EIEA 4IRMA 3QU9A 2GTPA 4MIKA 4BVFA 1DMSA 1EFLA 3ESDA 4OYRA 5C5DA 2YRWA 2BZ1A 3I30X 2QTRA 4L5CA 4Q3KA 4JI5B 3REOA 2RAUA 3AFNA 421PA 4M22A 2YXEA 3GJ7A 3WQBA 3UAZA 4K81B 3BFJA 4DQUA 2OCXA 3D2AA 4NOMA 3WQSB 4B81A 5BYKA 4MVJD 2WAAA 3U3RA 4R8VA 1E3MA 4P83A 4TVBA 4MAFA 1IPFA 1EVZA 1KZ7B 1QH9A 2X6TA 5LD2B 1NC1A 3NBFA 3W2TA 1QG6A 2ZPAA 4TMWA 2Y6VA 1FP4B 1QXSA 2LCIA 5IN4A 2DF8A 2BBOA 4JYPA 3D8RA 1JXAA 4P53A 5DU2A 5TIIA 1FW8A 3K73O 4UM9D 4WZAA 1EVIA 2QVGA 3WGMA 1MZPA 1JEQA 5TQVA 2CXQA 3DLBA 4RXMA 3KHSA 3QEMB 1QZTA 4RKWA 4DEYA 4DR5B 2FUG1 2J3JA 4BB5A 2H85A 5LBIA 1M5UA 3RLFA 5GZ1A 3UG6A 4DBZA 4DNXA 3G82C 1RC0A 1A9QA 1Z4OA 5AM5A 2IVFA 4GOMD 2FUG6 1N2HA 1NJGA 3A7DA 1PEDA 3BIFA 3LIPA 3E03A 1TGYA 3O03A 1NKVA 5JCOC 3TLCA 4BX2A 4FDAA 4MLPA 2VH2A 5K4GA 2JCSA 8OHMA 2Q7DA 3ZR4B 3HB5X 5LOVA 3N3BC 1YR3A 5TNXA 1D9ZA 3DR3A 3RS0A 1E69A 2FPGA 4Y2GA 5FWXA 4OIFA 1VXOA 3RIMA 3EZNA 1H5UA 1XROA 5IVDA 2I6QA 2A7QA 4DANA 4PIPA 3E23A 1SK8A 3OTWA 2FNAA 3LCMA 3VNAA 1IL0A 1OC2A 1RM0A 2VCYA 4QTTB 3ZDXB 1JFRA 1DWOA 4JLJA 1EMDA 1S2GA 3IAAA 3LO5A 2VNSA 5GWXA 3TW8B 4E32A 2ZUFA 4JL8A 4R01A 4UASA 5BSMA 3N7AA 4DY6A 2AB0A 4KI0A 4R40A 3W3AD 4Q24A 4C5CA 4E5UA 1NN3A 1ENPA 2GCEA 3V55A 1TM4E 3BULA 1U81A 4IPTA 1N6KA 5BRJA 1LDNA 4XW2A 3O3CA 2BD0A 4PS1A 5KVSA 5F33A 1KO4A 2I8AA 4UFPA 1X3SA 1BGVA 1NN5A 5H7XA 5AW7A 2IWRA 1U63A 4QPCA 4ZI7F 3PJRA 3WJAA 3HRKA 4WBNA 4HGOA 4MP8A 1GAJA 1ULBA 2ZTVA 4X3CA 3NVAA 2AJ8A 4BEJA 1S8AA 4EZBA 1I7QB 3IAM1 4RU1A 1H3NA 4J1QA 1BEUB 4O02B 3GWZA 1AA6A 2VZ0A 4BXOB 1EQUA 5DX8A 1ZH2A 1S3GA 3IAM6 4AS3A 4NAUA 4NBKA 5SZKB 4F8EA 4OFBA 3HN7A 3GLVA 2KI5A 1Q22A 3GJRA 1BU8A 1TZJA 5HS6A 3A2KA 2J1LA 2G25A 3KWMA 2DPMA 2WF6A 1JKIA 4OQEA 3T38A 4GPEA 5E9WA 1A2KC 4WLUA 2F00A 2LIVA 3FNHA 4CKEB 4JT9A 4QHTA 5L6LB 2VP0A 2BIFA 4XWWA 3AL0C 1Q0RA 4GD3Q 4PF1A 3B6EA 2ZYGA 3PQDA 4TVSA 1FP4A 3MPUA 2YMQA 3AY7A 1DL5A 3LOUA 3ZCPA 5DJ5A 1RU3A 2GZ2A 1KFCB 1HF3A 1KJQA 3OLVA 5FBWB 1RAGA 4BLQA 1Y3DE 3I34X 3NWPA 5ALHA 3TRJA 3WYFA 4PFSA 3PUYA 3QEMA 1MAVA 3G9UA 1XTKA 5FLKA 4ZVQA 2ZDHA 3WIDA 4Y9TA 4RPIA 4DPKA 3GDWA 3VSEA 1KORA 5IC6A 3KXPA 4ZQBA 1TRHA 3N6XA 2OV2A 5I9LA 3NOOA 4G86A 2WWWA 4Q4AB 1PN3A 3L5KA 1U1EA 5L4LA 2AMYA 2CLDX 3MF4A 2ZDGA 1WPGA 1F17A 4GIBA 5EHGA 2R1ZA 3TX2A 5BV8A 5AVYA 2FXIA 3I6BA 2UXBB 1KYYA 1LTQA 2VK2A 4OYLA 2WAOA 1JFLA 1UJCA 3GAAA 3N05A 2CHEA 2L82A 2OCDA 2PGXA 4Y30A 3H86A 4H7PA 5F35A 1GUFA 4ZJYA 2C04A 5CDFE 4LAFA 2J3KA 2YH2A 3GRUA 4Z7JA 1YACA 4DHEA 5HZGA 1D2RA 5EC8A 3ECCA 4AKSA 4PU0A 2UZ4A 2DBZA 4HQ0A 2ZRLA 2ZBVA 2FRXA 2EDCA 1CUDA 1LC0A 4M21A 4BVAA 4O6VA 1TAQA 3H9GA 4XGKA 1PKEA 4Y2YA 2OHGA 4GR5A 3TW8A 3H1GA 5JFTA 1W2WB 2HCBA 2FGJA 1FIUA 4CMEC 3GGCA 3LPAA 1RABA 4JKYA 4P1ZA 5KJFA 3HEBA 3NAQA 1NT4A 2AJLI 1AUQA 1JH8A 1C7FA 1Z83A 3Q0EA 3ZWPA 3WKCA 3G23A 4PGHA 2CUZA 1WU7A 1AUPA 2KMLA 2HFJA 3L8FA 4MR8B 2HHLA 1BVHA 1DIAA 5AVWA 1MEOA 3PSAA 1KVRA 1Q21A 4E5VA 3CZPA 2R00C 1UKBA 2IYTA 3QIAA 1DX9A 1VPLA 5CH8A 4BV9A 1R00A 3EDYA 4QIHA 4LHEA 4J0HA 4IGKA 1L4MA 3L6OO 1SULA 3RAPR 4M0CA 4EHDA 1E5VA 4DIFA 3HMKA 3RVOA 4M8SA 4YQYA 4BNJA 2NVWA 4Z99A 3SC6A 3H97A 5ADUS 5BSEA 2ZI4A 3COWA 3LUHA 1J99A 1JPUA 5FPYA 3VKFA 2HHJA 4PSDA 4UHBA 3LTNC 1HEUA 1PS8A 4W1SA 4PYLA 4DT1B 5IUJC 5GM1A 4BDSA 1QGDA 2BHSA 4DQXA 3N9IA 1Y6GA 4BXOA 3NYIA 3OJ0A 5EMMA 3HJRA 3GRYA 3R3JA 5GINE 1WBBA 4EBBA 2VWQA 3NT4A 5ECGC 5KDLA 4HBZA 4ZVRA 1B0ZA 4TV9F 4OXKA 1KIAA 3DAGA 4V3CA 4CKEA 4CETA 1VLQA 1SKUA 3H6KA 2WV7A 2W11A 1LFDB 3NAMA 4PG7A 4ACAA 1DCTA 3QYFA 4J03A 1Y8AA 4DLSA 2GJ8A 4A1FA 4PX5A 2PEZA 3M6XA 4HDQB 5BQ3A 4ESVA 4LF7B 4NZ9A 3A4LA 1MR3F 3E7FA 3K4QA 4DAEA 3P0FA 3L1KA 2FRVA 3AFGA 4I3GA 3AIKA 1DOAA 4NEQA 1KAEA 3TOZA 1HLGA 4F56A 3AF6A 1R9NA 5IC4A 1LA2A 1SZCA 3BSWA 4DJEC 1KPHA 3QMWA 4Q9IA 5KKAA 2H1OA 1GAXA 1RXSA 4Q4AA 3EISA 2A5FA 3N1UA 5BNTA 2ALJA 4AUNA 3ZYZA 4NEGA 2IXAA 1G5PA 5FEUA 1BGXT 4ZRMA 3LOPA 4EKDA 3PA8A 3DTTA 3PICA 2GHQA 3W9BA 4KIGA 4F3CA 2BMVA 2YHUA 3T1OA 2PGJA 2X5KO 1Q20A 2QL6A 4AY5A 1RWNA 3T9AA 3Q6IA 3LD9A 4LNUB 1N5OX 2DM6A 4FE3A 1U6KA 3BGOS 3K5WA 3PL1A 5AI4A 4CMHA 3DFIA 1DAEA 1AGXA 4JENA 1YVEI 3RTEA 1JLLB 1IK4A 2VOEA 1CY1A 2ZSAA 1UC4B 3C8HA 4YP0A 3OF5A 2IPMA 3L7JA 4K0KB 3TDNA 1M0WA 1T5SA 1DKLA 2CMGA 2YQZA 4GI5A 3QWHA 4QUDA 4M0PA 2HWYA 1DFHA 1C50A 1GFSA 3I05A 4PANA 3VV2A 1W52X 1TVCA 3EZ9A 4DV3B 5F3RA 1Y6ZA 3BK1A 2ZT5A 4Y3UA 2FAXA 4L8GA 4ZANA 3T0GA 4DN6A 2C84A 4MR8A 3G0OA 3TTVA 3WOVA 4H9GA 2ID8A 5L7YA 2Q0HA 3AM3A 3AOGA 1RLIA 2BY4A 4QJ3A 3ZZTA 4ZT3A 5DWQA 3LX8A 5SYNA 1UFRA 2HMYB 5HE8A 2EKQA 4BKQA 3VO9A 1CEXA 2H2HA 3EAQA 3B60A 5JAUA 5AK5A 2Y92A 4MI3A 1AKRA 2GVDC 2JNWA 3C3PA 3PGXA 4GHWA 2P3OA 5JRJA 4FFWA 3RRFA 4CT4B 1SCBA 1DO0A 3RK0A 1J00A 3VH1A 2Z3ZA 4M9UA 4NPCA 1VLVA 1WEHA 1NULA 2A9QA 1OCEA 1JAYA 2OV3A 2ZIXB 4O4JF 4QQRA 4DT1A 2R86A 4B3JA 1KDOA 2XDYA 3GEEA 1PDWA 3M4XA 3PYLA 3ROMA 3HCAA 3T3GA 3RYCB 1HNWB 1MJGA 2CHQA 4Y2QA 1Z2PX 2DFKB 3Q5GA 4QM7A 2TRSB 1E66A 2X5JO 1U9YA 4URVR 2HYDA 1WULS 1RSZA 2RGBA 1HC7A 4LF8B 1NRWA 2EGGA 5KWJA 3GLGE 4G0NA 3ORRA 2IPXA 2OLEA 3ELWA 5HTKA 5F21A 1V8OA 3KDPA 4FYXA 4H6VA 1PGQA 4QPDA 1NVKA 1XEXB 4PG4A 1RVV1 4OF4A 2WYUA 3OM0A 4H7HA 4EUHA 4D26A 1QANA 2ZSDA 1DKUA 3E84A 3OQVA 3E8SA 2C2ZA 4M89A 4XCXA 1O95A 4O2RA 1E3QA 3LFTA 2JAUA 3COYA 2CL6X 3DWFA 1FZTA 3SIWA 2XGMA 1BTOA 4CMBA 3F46A 2ZZNA 2AFHB 4KR6A 4MW1A 1CW2B 1BS1A 2VZLA 4IV8A 4KDEA 2PX6A 3GLHB 2A9PA 3UYLA 2IUEA 2VSXA 4MSUA 4P22A 4XX0B 2H4ZA 3WWYA 5A4DA 4YCJA 1LBIA 3R76A 1BX3A 2EU8A 4RETA 4B80A 2JI4A 4HDKB 2Q5CA 4LNUA 5PGMA 1A9XB 2NSYA 4S3MA 5HQJA 4REOA 2I6GA 1NXOA 4YR7A 3IXLA 3TH5A 1ONPA 4DLYA 4IG9A 5A4IS 2VEDA 3D7NA 2F9FA 5I7RA 1XMJA 4DJTA 1HK7A 3B1JA 1JLLA 4IGIA 4Z3KA 2WZDA 5JEEA 3WK4A 3U3ZA 2BFPA 2V7VA 5AICA 5MN6A 2O07A 3HVUA 4A0FA 2GF2A 3A25A 1M72A 2IXDA 3E22B 4EW3A 4B3CA 1Z5OA 5IXJA 2QMOA 2XNKA 2AJBA 2OGZA 3AZPA 2QR2A 3GCWA 4CQLB 1G7SA 3B3QA 3P9QA 4IH4A 2WSMA 4KZKA 2EJTA 3M6UA 1ZYUA 3DKIA 3LPLA 4C7OB 1A82A 2Q4BA 4TT3D 1ZMBA 1N4DA 4NTZA 5KYNA 3M4YA 1BQEA 1TAHA 1RBQA 4LBYA 1IOZA 1YL7A 3ZH9B 2X1HA 5HIMA 5AK6A 1M2OB 1C1DB 2ZE6A 2RBGA 1V9LA 3A58B 3NM5A 4FZ3A 4WXEA 3KETA 3NC4A 2GEFA 4UBNA 5A9SB 3JZFA 4RK4A 3CG0A 1ND5A 1QYXA 3DB1A 2ZIXA 1JR4A 4DQDA 2QP4A 3CWCA 4Q3AA 4BRWA 2Y0CA 4DRXB 6YASA 3TUZC 4KQ2A 2YS6A 3RYCA 5HMMA 1M5RA 1BKYA 2I67A 2NWQA 3NHZA 5C4MA 2XVXA 3OCWA 1SZPA 3D8UA 4Y6SA 3TRFA 4HDSB 3ZIDA 2JH8A 4G4JA 3I92A 4FLMA 4MW4A 1MC8A 4NICA 5TT1A 4I36A 2JAOA 1PDVA 1JN0A 4NQRA 4HS9A 3A0UA 4FHDA 1X8XA 2GD2A 2EBWA 3H2IA 5IU6A 1UOPA 5EE5B 2HJWA 2ZPUA 4MKHA 5FBQB 16PKA 1Q11A 1XEXA 4R5MA 2QRQA 3P5SA 4RSHA 1DIGA 3I8OA 5DOZA 4ZTUB 3AUXA 4ZI3A 5EL0A 4AP5A 2V5VA 1E2KA 3INGA 3IQDB 2NTYC 4WLNA 1RZVA 5CM2Z 5EZYF 4ZAYA 4DREA 5KJ1A 3EXFB 1QHYA 3DLTA 4NH0A 5EXPA 2AFHA 2WYIA 2ZTLA 4FN5A 2W0SA 2OFOA 5BXYA 4KO8A 3G2KA 2AX3A 4AWXA 5AJVB 3C8MA 2DBYA 3GLHA 1NR5A 4NBRA 1HDRA 2C8VA 1AC5A 2PX5A 4UULA 3E7WA 3PRHA 1HFKA 1TKRA 4XX0A 2XMRA 1N1MA 2NTNA 3DKPA 1DUSA 2PH3A 1EFTA 5FNVB 5KB3A 4X84A 3T1QA 2PM8A 1ITZA 4HDKA 1T2DA 1U65A 4EMUA 1AHNA 1A9XA 4TT8A 2GPBA 4D43A 1T5TA 3WLQA 2JG3A 2XNDA 5L53A 1O2DA 2LP4Y 1BVUA 3LVFO 4N65A 1WNTA 1E2GA 3PPIA 5C37A 1E7QA 2NTJA 3BILA 4D9FA 3ADKA 1SWWA 2WEKA 1T3SA 3KE8A 3CGWA 3M8KA 1QHEA 2XHEA 4AG6A 1NUHA 3ESQA 4FQ8A 3UWKA 2JEZA 4F3KA 3AB8A 4KAXA 3E22A 1P73A 1ZD4A 3QQPA 2D13A 4QJ4A 4REQB 5K99A 1PR1A 1CP2A 3EZYA 4IIVA 2WA2A 1JEDA 4EL0A 3ESZA 4B31A 4MRRA 3FUWA 3FZQA 1E1QD 3TQRA 1A8PA 1U2GC 3PHGA 1YMUA 4IFIA 1PZHA 5JSYA 1OAAA 1KMNA 4C7OA 1CSEE 5EVJA 4MA4A 3SMVA 2VHTA 5DBGA 1LPAB 1Y1TA 2WT8A 5IC5A 4FYPA 3JQ8B 1HG1A 4RVSA 2YZ2A 4F84A 1EFDN 2J33A 4N3BA 2OPBA 1UFOA 1GSHA 1C1DA 1M2OA 3DOOA 1U8AA 1GT91 3W78A 1XQ1A 2AZDA 3TDMA 1TT5B 1W7AA 4HYEA 5A9SA 4KVZA 3VDMA 2XCTB 3NTRA 2QHXA 3AO0B 3HB7A 4BZZA 2TECE 4G5YA 4W9NC 3RIHA 4QM6A 2QV0A 4DRXA 5JZOA 4DQ0A 4BLWA 4EMBA 3KQUA 1I24A 3I2KA 4M0UA 3ELYA 2Z6QA 3WGYA 1KGDA 2HF8A 2QLTA 4MQ5A 3TUJC 3AILA 3DZ8A 3U9LA 3EPLA 1Z88A 5ERGB 1A7UA 2IHUA 1UF9A 3DC2A 3I64A 4HDSA 4OX9Y 3GP3A 1P19A 5BXQC 1RQPA 2HD4A 1RIIA 4ZVKA 4JROA 1SVUA 4R1SA 3OIFA 3UJNA 1R0RE 2JJQA 3KP1A 5AVUA 1NVTA 3OZ7A 1Q0LA 4N47A 3IP3A 3CCFA 5JADA 4B74A 5G0SA 4BIIA 3WMFA 5ALXA 1JWLA 2SKDA 2UUOA 3B2QA 2CBZA 5I7OA 3EMKA 3SNKA 3U1TA 1QAMA 3RSFA 4DS3A 1ZMOA 1K4KA 2CMDA 2GCGA 4OQ4A 2W5UA 3UWSA 1UBCA 1OLOA 1XDSA 4JBXA 3EXFA 4OMUA 5ITZA 4PS0A 2WVHA 1GILA 1Q5PA 1UK7A 4HQOA 2XCRB 2IXFA 2FWJA 2G09A 2VH5R 2W2XA 1NSTA 4DM4A 5D3QA 5JYBA 1UBKS 5KSWB 1ESZA 1PR3A 1SVNA 4L0MA 1CRLA 1NBIA 4FOPA 3HPQA 2YDYA 4MMYB 3RRYA 3NTUA 5FNVA 4BKMA 5AM2A 1VGRA 3RIEA 2P0EA 4UOEA 3NHFA 4IIJF 3C3MA 3HA2A 4LHZA 5A9TA 5L6MB 3A6FA 2PMEA 1T9ZA 3VR1A 2JFNA 2QTZA 3PGA1 2MT9A 3D7KA 4B46A 3BHMA 3DDNA 3KLPX 2PX0A 4UAGA 1WD5A 1AA9A 1KEWA 3OT1B 1BE1A 3BA1A 1NVVR 1R4NB 3KXIA 3AW8A 3DS8A 1U2SA 3ONWA 2PLFA 2BMAA 3LY9A 3N2LA 4YQEA 4AKHA 2QAIA 1T9HA 2QZSA 3C7DB 4REQA 5COBA 4YO8A 5AMXA 4C6SA 3U13A 1BVRA 2R66A 4Z8XA 4UNRA 2CLFB 2JLUA 5HBRA 3FTPA 2ZCJA 5BP7A 3F3KA 1ORIA 3QOFA 3SN6A 2BDTA 4CKCB 1GL6A 2CVQA 4FEYA 5CYPA 4BBJA 3CZMA 3I8XA 1Y6QA 3LDHA 4YCBA 3FOAA 4KRYA 3JQ8A 3QELB 3F6SA 5E2AA 3WZMA 4BVBA 2EAUA 3IULA 3TIGA 3H13A 1XTQA 3V4VB 1OB5A 5FTKA 4W5RA 5BR7A 1YQWA 2KLBA 1RLJA 2EKBA 2YR0A 1EGAA 3ETHA 1TT5A 3EWIA 3VOBA 1U28C 3SK0A 3ZYCA 2ZT7A 4MVJG 3OZUA 1FSFA 4HEA6 3S2FA 3V2IA 1JDZA 3IOMA 4DCOA 4QEZA 3B2NA 4R1NA 2ANBA 1X1SA 2OCBA 4JXZA 3A1TA 4TV8F 3PE6A 3ZWAA 3AHEA 3W8RA 3INTA 5LP1A 1ZY2A 4NYJQ 4QYMA 1OIXA 1UBTS 1WUTA 4RH0A 4WOCA 3SD7A 2J8ZA 1FTYA 1FXWF 2Q3JA 4Q05A 3HFGA 2Q2NA 4K87A 3A1CA 5EHXA 5LLDA 1O08A 3FCAA 4AI6A 4G0WA 3OLCX 4YUXA 2JS7A 3RRZA 2IZ0A 4ZC1A 3T61A 2ZSEA 1SVSA 4N1AA 5F1PA 2QX9A 5C4GB 3A1SA 3NEAA 1PF7E 3TQIA 4OYHA 1L5QA 4QOHA 1VZ3A 4GQAA 2ZRFA 1GY8A 3GCXA 3GH1A 2HDNB 1D2NA 1PJZA 3EC7A 3OFVA 1Z13A 1A2OA 2CNDA 4Q9DA 2VHCA 4PIVA 4B7UA 1C8BA 2YHBA 4XTCS 4AKTA 4ILKA 1D6JA 3R7FA 1O97D 2UYHA 1B23P 1R0CA 4EF5A 2CF5A 3HJFA 3WLNA 3C1UA 1QGAA 4DNFA 3O2SB 3JQPA 1P39A 4HNTA 1RE1A 4XRGA 3DW3X 4EG7A 1GUZA 2IS4A 5ADVA 1HDYA 3BZUA 4RPGA 2VXBA 3TF5A 2OCYC 3QU7A 1NVFA 2Y1KA 1JDBC 2IZ1A 4JGGA 3LT5A 5ESRA 5G53C 3TQSA 3WLOA 5CG1A 4IJVA 2A14A 3FPKA 3KKKA 3DMHA 2XTNA 1I94B 5E7IA 3OT1A 1C0KA 5KNBD 3H1TA 1R4NA 1EFHA 1Y80A 2B99A 3QSGA 4PR0A 1JU4A 2GEUA 2CMFA 4OATA 3B53X 4OIMA 3B78A 4JP1A 1MORA 3BXFA 3R7LA 2GD6A 2O2SA 2PUVA 2WF9A 3H42B 5DX1A 5EESA 5ICCA 3WE7A 2ZBQA 3UXYA 5FWYB 3T94A 5TV2A 4MK4A 4QDOA 4FFLA 3RVLA 3RSHA 2VF4X 2YVAA 2C3UA 4N40A 2ZI7A 3QPCA 2OZPA 3UPDA 2BZ0A 2Q3DA 3T9FA 1QGYA 3M6AA 5EIBD 5L40A 3T9EA 1R0KA 1GZSA 2IEBA 4YDRA 4CKCA 2IYWA 1ZK0A 5I7HA 1LW7A 4DQKA 3QELA 4MV3A 2DKFA 2FE4A 1N3YA 3ENZA 1JV2B 1Z8DA 1MBZA 2CFOA 3SQDA 4PLCA 4K26A 3BRCA 1ZHFA 4BNIA 1JG6A 3IVAA 4C7JA 2ODPA 5IANA 5T4BA 3WNZA 3A9WA 2DECA 1G21B 1ZI8A 5EEHA 3ZCUA 2ZIUB 4ABYA 5HRAA 6ADHA 1YXMA 3O8QB 3PE3A 2ZROA 3R7AA 2ODNA 5EJAA 3IFSA 3C1OA 1EG7A 2XIQA 4KXYA 3RYFB 5AKXA 2N9UA 3JTEA 4BGVA 1AQNA 2WABA 5EUCA 1Y1RA 5BOVA 2BC9A 3WRVA 3I9OA 2ZUDA 4YLGA 4P2GA 3IVCA 2WNSA 4Z9AA 2ADMA 1WA5A 1V7ZA 4QDKA 1V41E 5IVIA 4EFMA 3C3WA 2QD4A 1C0PA 2X58A 5DVZA 3SY8A 3URKA 1UK9A 1RLUA 3AVQA 4FDVA 1V1RB 5LMCA 1G7TA 2CL5A 3N0VA 4H18A 1KI7A 1S9DA 5EXEA 4UPEA 4KSBA 4XWKA 1ZH4A 4PLWA 3F6EX 2ACEA 2XMZA 4L51A 2NQTA 3IUJA 2AUMA 3M9XA 3BM5A 2P1RA 3BRWD 1KYQA 1QYDA 2VJYA 3EBLA 3UK6A 3RW9A 2W2TA 3GV0A 1IXZA 4HLCA 1BJRE 1RQLA 2PX3A 4WFIA 3F90A 2B1RA 3IA7A 3OBIA 5C8DA 3EQZA 3IP8A 3W6PA 2XEDA 1L7EA 1ZG3A 2GZSA 2ONCA 3CWZA 3EHEA 3KLNA 4NY1A 4DV4B 4ASUD 4MDEA 1A9TA 1W76A 4MI6A 4ZZIA 4TLMB 2PL9A 3Q0IA 4FNGA 3ZK7A 1XZCA 3SYLA 4UM9B 4WFKA 1AKEA 3F5SA 4NYIR 3WDSA 3VR5D 4DR3B 3ICCA 2ECQA 3M6IA 1UQUA 4OHPA 2G9QA 1AK2A 1Q0ZA 1Y1QA 2F7SA 2JJ1D 3GD5A 3RF6A 4MRPA 3ZY5A 2H6EA 5JCJD 1OAKA 1UIMA 3FCEA 4MH0R 3ZVLA 4E14A 2VPTA 3ROTA 1NVUQ 1RADA 1P77A 5IZCA 1Y0BA 2JFYA 3AESB 4P0TA 3KB8A 3LUAA 2J5XA 4WOJA 4KP7A 2HF2A 1ISRA 1EEHA 2PUJA 2JLRA 3SYKA 4D0RA 1FJXA 2JFZA 4ZAWA 1N36B 2FSHA 2NZWA 3FPAA 4WECA 2IYOA 3E27A 3VRHA 5CDHA 2W6JD 3NVDA 3JYLA 4D6YA 5FWYA 3H2YA 4A8PA 4K9RA 3WFZA 2L42A 3RUDA 2BF4A 2BKVA 3ZI0A 5JFOA 4GP6A 2D7CA 3H2GA 3B8HA 4D3DA 1NRJB 2PVSA 1MVLA 4B84A 1QDUA 3TSCA 5HUJA 2VQ6A 3WL6A 3ZW7A 3R7WB 3DOCA 4E6EA 2ETVA 4IZIA 4R2KA 3L4KA 3AM1A 2HSJA 1P3DA 2ATXA 1KL7A 2HBRA 4EHHA 1U8TA 2G83A 3D6UA 3Q7QA 5FL3A 4LDRA 2CCGA 1RCFA 1GFZA 3KJEA 1YR6A 1GKUB 3SZRA 4CYMA 5DW0A 1KEKA 2B94A 3KT8A 2WTAA 3DKRA 5E95A 1FJGB 4PC7A 4V0QA 1SCUB 2D8AA 3NLLA 4ME6A 3O8QA 3VSBA 5FOVA 4Q1AA 3U62A 3VU8A 1P2GA 1K5PA 4FQ7A 2XIJA 3TNLA 1A3CA 3RYFA 1TYBE 1KYIA 1YL6A 2QE6A 3D81A 3PC7A 2C1XA 5KNCD 4WY5A 2PUWA 1F9AA 1J2EA 1JLSA 2NO6A 4HGPA 5C52B 4B6RA 3KXDA 1ZX1A 3JR3A 1XRRA 5C8XA 1XU4A 4E2ZA 4DMLA 1SO8A 2PKYX 1GAEO 2NZ2A 1KETA 5DBEX 1IXSB 4QGSA 3BSYA 1V1RA 1KR2A 2OD9A 4X3OA 2CV2A 1Z5GA 4DB4A 2WW8A 3G49A 1T2VA 3GC6A 5EIWA 4H6WA 1Z16A 2QMUA 3UOAB 1VPEA 5BSKA 4D9JA 4CN9A 3UATA 1TC2A 5DBOA 4MVJA 2J0QA 1Z68A 1YFJA 5A4KA 3H2KA 2XCIA 1TIPA 3NB0A 1JVNA 3CNQS 1W2GA 2AYYA 5IT0A 1N7JA 1RBZA 1PKXA 3LWZA 2C4UA 3FZNA 3TZQA 7YASA 2Q5IA 1TQDA 4YK7A 3HHEA 4ZT7A 1VG0B 4N5IX 5CVTA 2HRRA 4WW0A 4RPJA 3R9KA 4AP6A 2B25A 4BKOA 1KI1A 1W6UA 2CFSA 3EIFA 3FHOA 3RODA 4BRSA 2V0CA 4TKZA 4IUCS 1QFSA 1QUFA 4F91B 4QUHA 4QG7A 1XDDA 1YDWA 2C4MA 4F5DA 4F6CA 3ET4A 4BBAA 1K66A 3GRKA 1U31A 3Q7TA 2Q8NA 3AESA 3ECAA 2QRJA 3IEVA 1BAPA 1R4AA 2NUPB 2VYVD 2R60A 3BIWA 5J5CA 3V7FA 5GONF 2XBMA 1KA9H 4MIOA 3THWB 3AJRA 3GNSA 3FPEA 1YZ3A 4QNMA 1ULSA 1PX0A 2C96A 3K70D 4ZQIA 2GILA 1ISGA 5C5EA 4Z3DA 2VAPA 1WPQA 2DFNA 4M8NE 3UHPA 5FIUA 1C5KA 1RWPA 4LBVA 1E1CB 3OQ6A 3K70C 2BLLA 2C4WA 2P2LA 3A06A 4RK1A 2D54A 4W4TA 1Y4SA 4G2NA 3WLRA 2X41A 4GZLA 1E32A 2EL7A 2GD1O 3R7WA 1OFUX 4EYSA 1IZ9A 1MDFA 1D4FA 3ANMA 4NG5A 2ZTHA 1CUYA 3ZCXA 3S8MA 4PHTA 2FZ4A 3MRVA 2ZYRA 3ND5A 5JWHA 2P1DA 4CQMD 4X41A 5KTKA 1AO3A 2X5XA 2XWPA 1P61B 1WCXA 2B0JA 2D2EA 3W3AA 1S2OA 4JBYA 1P91A 2Q41A 5F1KA 4ZCQA 3V2HA 3ZW9A 1FX0B 4PLFA 3UAGA 4MGHA 1IZ8A 2R8BA 1SCUA 2R7NA 3F98A 3DVAB 5I9SA 3V8EA 4AJOA 5EQJB 3UHJA 1XTTA 1LLQA 4ZK2A 3RJZA 3DE1X 4FSHA 1V45E 5E7QA 3T99A 4E31A 5JUWA 5CIYA 1CWUA 2CDNA 1DQSA 1K9VF 2OLJA 4TXMA 4X7MA 5H3LA 3DEKA 1IZZA 2G1UA 1IUOA 1ML3A 1J7JA 3AK4A 1Q74A 5L4NA 3HNPA 3D59A 3ND6A 1USVA 3UB3A 4LZOA 1PE0A 1L8LA 3M49A 4POAA 3OUUA 4TKMA 5CD9A 2D06A 2FPUA 1U5AA 2GBFA 2X8BA 4NXNB 2X4LA 5DTMA 1A7AA 2NN3C 5IM4A 3EMDA 1FFWA 1T26A 4HDCA 2BYTA 1LLDA 1WMEA 3GWGA 4M87A 4PV7A 1LDBA 2REOA 3MQ4A 1E99A 2JKYA 1Z0ZA 3A05A 4OHCA 4UNIA 1K6IA 2C9ZA 4URFA 3OESA 5HM8A 5TR9A 4EB6B 4RS4A 1NATA 3DP9A 4F21A 5EUQB 1N8TA 4KX5A 3N8NA 4GOOD 4TL9A 3CQ9A 1PFGA 3NORA 3OUTA 3T52A 1JPJA 1LS1A 4JLWA 3L4BC 3OZFA 4LDPA 1GRCA 1EWRA 4WRRA 5SZHB 2O8DB 3ZJVA 3EULA 3UK0A 2ZB4A 3IJRA 2ZJFA 3PDJA 4KV9A 4NMXB 4ZAFA 4RVUA 4ERXA 2V7UA 4WV3A 1GTG1 2XDAA 2P90A 3RABA 4BFLA 2JANA 4BPBA 2Z3WA 1Z0UA 2NUPA 1HEIA 2VSQA 1JHOA 4P35A 3OM8A 2WSSD 1U3CA 3V8NA 3VHXB 3UC5A 3THWA 1GTL1 2XCOA 3HJNA 4B79A 4DYDA 3PQ6A 3L6EA 1QX3A 2WIBA 3H8VA 1W94A 3W8EA 4U0JA 3QA9A 2XQKA 1C7EA 1E1CA 4QT4A 4XWTA 3RVBA 2QM7A 1KAMA 5K3SA 4GAEA 3K0CC 1PR9A 4K86A 2HQSA 2J9XB 2OV6A 1XVTA 1LZKA 5B6PA 1D2CA 4MYHA 1TKBA 2ZU6A 4CCWA 3UBMA 4JDUA 4LXXA 3HZOA 1J1ZA 2BV3A 2MR5A 2WJVA 2P9CA 2AJCA 3Q1LA 2X0JA 4RQBA 1GPNA 2OCPA 4HR7A 4O2AF 2WICA 3D8HA 4KXUA 4MTCA 3PJDA 4HFJA 5EHIA 5IAKA 4UCFA 3M1YA 1WY5A 5DRYA 1WNFA 4DIEA 4DLKA 4ZHQF 1FX0A 3B5EA 3D4BA 1RWXA 4ZYUA 1U8YA 1E8DA 2KM1A 3KAPA 4G2TA 5JD6A 2ZVQX 1BWSA 1S01A 1YQTA 3DVAA 3GLIE 1J97A 4QPNA 5K3EA 1XZLA 3PNKA 2QLLA 3PFGA 2CLKB 3QX8A 4N03A 4ML3A 1DDGA 1N5RA 1XP8A 5F9FA 3SGLA 1ECFA 2H7YA 1AXGA 5EJMA 2FPXA 2H57A 5TB5A 3S2IA 2WFZA 5DYNA 5CB8A 3EVGA 4DLPA 2W58A 2ZB2A 3RH0A 5JY6A 1VE6A 1WS6A 1IQPA 5FDFA 2NP6A 2BPOA 5DGTA 4MULA 2HYIC 4OU5A 3V80A 1Z37A 1P9RA 2X4IA 1GSIA 2Q2WA 3LQKA 1G3QA 4JVLA 1G0OA 2A0WA 2Q7XA 2IZ5A 4QUJA 3ZNPA 2O48X 2E4YA 5IDWA 3BJZA 4R2LA 1P4HA 3C5HA 3KBOA 1QHGA 5AKGA 3ZIUA 4Z4QA 2FMKA 2VDMB 5IBQA 4BVEA 4UZEA 5C7YA 3SR0A 5DNUA 3U17A 1FSZA 2DVMA 4UMDA 1EFUA 1W49A 1JEYB 4B6JA 1EVJA 1ULHA 3H1EA 4P4UA 4EB6A 5KX5B 1T0JB 3BMXA 3L02A 4EYOA 5BNWA 1YZKA 2C97A 2ZJ2A 2VDUE 4HAXA 4BYMA 1XA0A 3PVCA 4XDZA 2NU9B 1X9GA 4IDQA 3U1BA 1VE7A 3BDVA 3ORQA 1G6OA 4JBIA 4UD2A 3MJDA 4WJKB 2DULA 3RU2A 3ESBA 4QXRA 1N33B 1ZJ6A 3QMVA 3IB6A 2I76A 1ZGHA 3FDXA 1JTVA 2GLUA 1GV0A 2MSLA 3H65A 1VHDA 3LK6A 1PFWA 3ZDZB 2PQ6A 3HSYA 4AICA 1TZMA 3E8XA 5B37A 5GAJA 2O19A 2PJDA 2VJNA 3LBIA 5G0WA 3OX1A 3ZE0B 4CG2A 1W1IA 1E8MA 2H06A 3IALA 3O8LA 3JRXA 1Y4DE 1AE1A 1ZXBA 3HNOA 3VHXA 1HLFA 1UODA 1VKOA 3WK5A 3RAEC 2WJ3A 4GX5A 3H1FA 5DZSA 1W29A 2BGGA 1LXCA 1CZUA 5FO0A 1LW6E 4V03A 2FPSA 4FR5A 4YONB 4ZTZB 1E9RA 2J9YB 4ZMSA 4LX8A 1EP1B 3JYQA 3VH4A 3NDBB 5U1PA 2GO1A 3ZJTA 3IUPA 4WIAA 2R96A 3PDCA 1PJCA 4X8OA 3KTDA 3WGZA 2BMFA 4J2HA 2X2PA 2IYZA 4MHOA 3RUCA 2GRUA 5DOVA 3T4PA 2WIFA 4EO7A 2AWOA 2HU2A 1O5OA 4X45A 3DFKA 2P2YA 3PZBA 3JTMA 2ICAA 4JYBA 3LPMA 1E58A 5TRTA 3AXTA 4DY4A 2HWXA 1P7VA 3VUEA 2Y66A 3LHDA 2V59A 4O5AA 1RYHA 4EI7A 3JD0A 1CIJA 3OD1A 2W6OA 2E5LB 2FRDA 4C0HA 3AF5A 1KH2A 2P9BA 2NM0A 2VT3A 3D3QA 4JFRA 4L16A 1L5LA 4PICA 3TCXB 3UJ6A 3DFFA 3ZWMA 4C0XA 4CNBA 4DIUA 2HIGA 3UMSA 4EEXA 5CT4A 5JS7A 1GQYA 1KDPA 1ILEA 3DNFA 4L27A 2BI4A 2QE7D 6REQB 1T8WA 2PKXA 4H1VA 1HT1E 5EE1A 3B5IA 1OSNA 3TLXA 3IC5A 5JOQA 1FVOA 1BEZA 2AS0A 3NONA 3UT5B 4JYMA 3MTJA 3NYQA 4N7RA 2CLLB 5JO9A 2NT4A 1NP7A 2W6NA 4AM8A 1XLVA 4RTKA 4E7OA 2G82A 1JXMA 1PGPA 2KQUA 1EU1A 4KO2S 1YKFA 3GCGA 1YNOA 3JZDA 2PSEA 4NDZA 1SXHA 1DBQA 3PFFA 3QV2A 1PWHA 5ULLA 1UT5A 3UPTA 4A8TA 2OGUA 4E2XA 1P8JA 1E1RD 3EPHA 4FMDF 4A8JB 4C2UA 3B13B 4F1KA 2YOGA 3FWNA 5AR1A 3NWEA 3HGMA 1R6VA 4KTTE 5AOAA 3WLAA 2PUEA 2GQ0A 2AFIB 4IEIA 3GLUA 1JEYA 5LMUB 2GPWA 3RUEA 5KX5A 1FUKA 1YQXA 3T5MA 3HVRA 1B41A 1LPPA 3L8YA 4A15A 4QJBA 1KJ8A 2DSTA 2RKWA 3M5WA 4MKRA 2NU9A 5DSZA 4CTKA 5BPHA 1AZWA 1D0IA 4ZQHA 4OB7A 4OYYA 4QOIA 1V4NA 5E6SB 4G1CA 1V4BA 1LPNA 1G2PA 3A1NA 1QFZA 3I3SR 1TM3E 3QLTA 4LNAA 2RGDA 3QP9A 2WVJA 3IUNA 3OTQA 1NJFA 5ALOA 1AH2A 4JUCA 3I76A 3NNDA 2V4MA 5LQDA 2O8DA 1QTRA 1XU9A 3IAHA 1FMFA 3EQ2A 3QQ5A 2FZCA 3UUGA 2LVBA 4C0AC 2XTJA 4EL5A 5KBYA 1FUIA 1YS1X 5IT4A 5C7IO 4PX9A 3AR2A 4Q7JB 3AI7A 3SHFA 3DVQX 2YW2A 1M66A 1Y3CE 4X90A 5DCYA 4ZU1X 2O9JA 2CD7A 2H5IA 2NVOA 5FR1A 4PXAA 2FMUA 1I8TA 3HXOA 1JHDA 3BH7A 3ZE2B 3IHLA 2J85A 1D6SA 2I65A 1XD9A 1ZN2A 2R84A 2WK1A 3KFLA 3OF3A 5EJIA 4MVWA 1CUSA 1N6PA 1IOVA 1D09A 4I4NA 3RREA 3VVBA 1E18A 1BS2A 1QZ3A 2CKDA 3U4HA 4U3JB 5A06A 1NOJA 2I54A 3OQ1A 4MV6A 1YFZA 1N6RA 1SUEA 5A7GA 5J23A 1P2VA 3E81A 1X7HA 1P7PA 1T3LA 2WWRA 3ESAA 5AOVA 1AMOA 3EQ7A 1WSBA 4KN9S 4TTQA 1SVLA 3T3NA 2OHXA 2BM8A 1M6VB 5CVUA 1NUSA 1CP3A 2ZSHA 4DWWA 3SZLA 1M8JA 3Q7IA 2OK8A 1YDGA 3G2OA 4MPPA 3A04A 2VJPA 3EJWA 4CIWA 4KSCA 4Z4IA 1UBOS 3QWAA 3VR4D 2PSDA 3T0IA 3DHEA 3LOQA 1YS9A 3INRA 4US1R 1RM4A 3L40A 4X97A 4TT3A 1IHPA 5WRFA 3M82A 4LJ4A 1QIIA 4II2A 2Z2JA 3MWDB 2I2CA 4EKNB 3W5UA 1T8UA 4W6ZA 4Y9RA 1DC7A 5G40A 4EY5A 2GN2A 3DKKA 4OK5A 6REQA 1C9DB 3MJEA 1KH3A 1B15A 2RKBA 2YINC 4PYIA 3W06A 2ENWA 4PCVA 5ITZB 1IWPB 5GQSA 4OM7A 1JUDA 3LUPA 4PX2A 4XI9A 3UT5A 3MAGA 3W2FA 2Y0BA 3H1AA 4PYQA 1AX9A 1Q50A 4YGYA 4E03A 2HRBA 3RS3A 3LSTA 4RELA 5THXA 2C94A 2CMKA 5CGZA 4BLVA 5K0BA 1MQ8B 5KSZA 2PZJA 2C8JA 3H9EO 1JNXX 3JYHA 4RTNA 5I6DA 4INJA 1NURA 1EQ2A 2QQ0A 2J5RA 2H4JA 4P31A 4ENVA 1HG0A 5EP3A 4A8JA 2AQ8A 4TRNA 2I6UA 2O52A 1Z15A 5IAOA 4ZMRA 5EHQA 3KQVA 2BCEA 2OILA 4O4LB 4C4XA 2AFIA 1I13A 1XXHB 3KT6A 4E1AA 4HLNA 2FHSA 5DWDA 4RAQA 4U39A 1XZBA 3D4NA 5DV9A 5DLEA 4B2IA 4DM3A 1LVHA 2M1XA 3DOEA 4PWYA 3U2QA 1RFGE 3P7MA 3R5TA 4DILA 2G40A 5E6SA 4C0WA 2RG1A 4EPXA 1OYVA 2ADOA 2NQ8A 3AL3A 3B9QA 1TT7A 3OZWA 3MCWA 4K9OA 5FBLB 4LXHA 5TQ0B 2WMYA 4Q16A 4QAJA 3ZH2A 5AVXA 1DB3A 5ALDA 1RAFA 2VQ3A 4RIHA 2DUNA 4D44A 3S44A 1HE8B 5KNBH 2NZYA 3LBYA 1US8B 1POWA 1UUFA 2AC7A 1FDWA 1Z6PA 2QSZA 1BE8A 5CPBA 3NC1C 2RIRA 3PUWA 4OBWA 5LLSA 4E88A 2NP7A 3S70A 2XB6A 3LQYA 2EFCB 3AEZA 5FPKA 1EK6A 3WWDA 1QLJA 3I1JA 1Z5ZA 2ZYDA 3TXAA 1XDBA 3DNMA 1MV8A 1E7YA 3NHMA 3OPYI 1FY2A 3VR6D 3N86A 3PENA 4MRVA 1COZA 2FJ0A 4U3JA 1TYDE 4F9TA 3PKIA 3TQCA 3U6KA 1YJQA 5E0KB 4C0JA 4GP7A 4EYQA 2Z6AA 4P0QB 5BV2P 1JFTA 4Q9AA 2GPSA 3E48A 2A9VA 3TXYA 1L7XA 2P9FA 2PXAA 1Y89A 1NVEA 1E7RA 3KWLA 3SBOA 4PG5A 1EA5A 2ECKA 1M6VA 4TGLA 5CVCA 3IPYA 2L19A 5A4JA 3UJ9A 3VOSA 1TLTA 4YAWA 2Y1OA 3FDZB 4PW0A 4G0ZA 2J9GA 3SHWA 3U26A 4D9IA 1OLUB 3N2GA 3QVVA 2W22A 4U6SA 2E3JA 1KO8A 4JUDX 3LVQE 1L8AA 1T2CA 4ZIRB 5K45A 2DB3A 4BO2A 2YZGA 4BZWA 3DMPA 3MWDA 3VAAA 3HU1A 5DE3A 3SS9X 1X15A 4W9NA 2CN1A 2QQ5A 3O95A 2RHHA 1X7ZB 4EJ6A 3CW9A 1GL9B 1WZUA 3B3GA 2GZMA 3BWDD 3I6QA 2RBEA 4LG1A 4MVXA 2PGOA 1Z7YA 1HBJA 3GB9A 4LOJA 1PL8A 1P2BA 2ZVPX 2ATVA 2E5WA 4P4TA 2Q5QA 3L1UA 4EJSC 4TL6A 3L4EA 3OE5A 3BAZA 9ATCA 2H48A 1DKPA 4N82A 4XFJA 3E7XA 1BDBA 1KSFX 2I1WA 3IQGX 2AR0A 4Q9KA 1HORA 2VYND 4RIGA 4TLAA 4HOYA 4ZC8A 3T6KA 1J22A 4NDAA 4IY1A 1NQTA 5L3RA 4ZGWA 2VUUA 4IS2A 3DCYA 4QUEA 4EKYA 5G0VA 1X1EA 3D02A 3QVXA 3NI2A 4DMKA 4RTRA 5JXHA 1XEAA 1PFKA 1NBWB 4GEKA 4O4LA 1NOIA 1XXHA 1UPFA 2PJUA 4DR6B 3BPSA 3BF7A 4JLUA 2YHSA 3L7YA 3VPAA 3WZLA 1H22A 3ZS9A 1UC8A 4FYWA 4FW8A 3ENWA 4H15A 4FWIB 3CJRA 3W1VA 4ENQA 4JC4A 4ZOEA 4NCBA 1XUOA 1E94E 3MRSA 2IU0A 1J2RA 2C4TA 1PT9A 1IEWA 2Y2UA 4K9LA 1L4FA 1WZIA 1O6BA 3VR5H 3K92A 1E6KA 5F7XA 2BUAA 1T8YA 2A1IA 1SU8A 4YCCA 2GM4A 2IYYA 3SZGA 2NGRA 5TQ0A 4ZICA 3EFBA 5B7QA 1ZHOA 3V1NA 3FCCA 1KEEB 4FHCA 1AT1A 2ZJ6A 4DV6B 4QPPA 2C03A 1NBMD 2O1WA 3RF7A 1A1SA 1US8A 4L5JA 4C04A 4HXEB 1F0NA 2GFIA 5HIAA 3M7IA 1UBEA 4OEHA 4F06A 1JDBB 1M34B 1K3TA 1ISMA 1XELA 4FGKA 2P5YA 2WE8A 4NOJA 5DIFA 4IH9A 3QLVA 1JE1A 3SAJA 4YRIA 4A91A 1LZLA 1F6BA 2DPYA 1LQTA 3HUEA 3MIZA 4PZLA 3WMWA 1QPZA 2ZRDA 4RVDA 3HYLA 2VK4A 1J8DA 3Q3IA 4FW9A 1FYXA 1T8RA 4PWZA 2HHHB 1OH6A 2EEZA 3H4MA 4ZD6A 1QP8A 1YQDA 2UUCB 3GZNB 1QOQB 3ZE1B 5JNVA 3HXLA 5CAEB 4D0LB 2R7AA 3AFOA 1XEWX 2J3QA 3FYUC 2IU4A 4XQ9A 4ZODA 3LKDA 1XPJA 4RO0A 2H52A 3KC2A 1EUCB 4FKBA 4A2QA 5JC1A 5G3ZA 3FDZA 4UE6A 4ACBA 2QU7A 1OLUA 2MJLA 3ABQB 5HF6A 4XYLA 4YJFB 3IDQA 1Y5LA 5EJFA 2LIPA 4UEOA 4L3WA 5KAMA 5IXSA 3WDLA 4ZIRA 2YJ5A 1GYQA 5K2MA 2P9HA 1SRRA 4P7FA 1U28A 4MPTA 4LOAA 1J0BA 1Z34A 1PNVA 2E9SA 5KNCH 1Q92A 4KI7A 1JKMA 1GN9A 1X7ZA 2F1JA 4C4ZA 1JQBA 4I1OA 1VCOA 5IDQA 3BRSA 3QMMA 4JXXA 1NNI1 3VC1A 1JHYA 2APJA 1XD2B 2WZQA 3HKEB 1AMNA 4M7WA 1B3BA 1M2VB 3JVDA 2NUAB 3OPNA 4UJ3A 4PY2A 5ESWA 4FK8A 3S99A 1VMAA 1K7FB 4DMRA 4YAEA 2I4LA 1F51E 2X4GA 4ARBA 1CLEA 1JBEA 2WJ6A 5HUQA 3MRTA 3CX8A 3DULA 3I23A 4AO7A 4BRZA 4B3BA 1J6UA 3PHBE 1CQIB 2V96A 2R8RA 4M98A 5FAXA 3IHWA 1HQKA 2H00A 1WW8A 3PXGA 3UOWA 1R0WA 1L5YA 4A9AA 3UO8B 3ZZ1A 4CWAA 3NANA 4DUPA 4LY9A 1T24A 4K9MA 1R8SA 4HDNB 5EVCA 3U3XA 3DDOA 3UANA 4B3SB 2XF2A 1FA9A 1NMEA 2BMJA 2QSUA 2YFKA 2ZT8A 4I14A 3ME5A 5EMNA 5G0UA 3PQ2A 3DVRX 3ITDA 2AUNA 2DXIA 2VBCA 1F2TB 2ON6A 3TSOA 1NDQA 4RAOA 2ZP1A 3HB9A 3WGTA 2IUTA 1SZDA 1M73E 2A5LA 1FTQA 1VJTA 4DA4A 1KEEA 5DRTA 3ZWQA 3P4UA 1FE8A 4M0FA 4U5QA 4U7JA 4ZVOA 3EEOA 3ER8A 3QEJA 4RCVA 3IGFA 2YWEA 2ZR7A 5JASA 1G59A 4YJDA 3K1ZA 3NCHA 2B7LA 3WWZA 2GSDA 2PXCA 4TZTA 3QVSA 1JMVA 2ZUCA 1ZLXA 1M34A 1T1EA 1YZYA 3G79A 4GXTA 1KOLA 4B9EA 4G0UA 1YE8A 4IJKA 4YREA 3CRZA 4B5KA 5JNWA 2YJ4A 3UJHA 3ZVRA 1E3TA 2J32A 1TJPB 4BX0A 5EHNA 2YIDA 2V9CA 1FQOA 1Z6YA 2ZBPA 2Y67A 3DEHA 2A59A 2PL5A 4CFYA 1VPDA 5DK4A 1S1MA 1F1BA 1R0ZA 4WK6A 2H1WA 3N0XA 1UAGA 3P1JA 3TD2A 3GZNA 3NDJA 4EEZA 4EGFA 1U1DA 1MPXA 1SAYA 2PHZA 1NBEA 1XHLA 2ZU0C 4OQPA 1WKVA 1XDWA 5CAEA 2UXDB 4HYQA 3HXTA 4PC1A 3MBIA 3OIUA 5EFZA 4RULA 1FFCA 3SVTA 2Z30A 3VMFA 1IE3A 1EUCA 1RHRA 1G3MA 2ZR9A 4OHOA 4Q02A 2DFVA 3WTBA 5BT8A 4RGYA 1EG2A 2NXNA 3IAFA 4NCNA 4AU1A 1E96A 4AJ4A 4YJFA 1RPTA 3DGEC 4ITRC 4UUBA 1A98A 1D04A 2HZBA 4BFSA 2D62A 2FLWA 4BMDA 3LAWA 5K8UA 3X1WA 2L69A 1U7OA 3NCTA 2XYRA 1FP6A 2RCNA 5FL7D 3RC1A 5K05A 1K4MA 3DWEX 3H2SA 4N0PA 1XDZA 2EFGA 2GM3A 3ILXA 4ZZ1A 4EAAA 1W44A 2D5LA 3HKEA 4R7ZA 1XD2A 1PFYA 2REXB 5KJEA 4NV3A 3R74A 2NSDA 3JSXA 1M2VA 2GYYA 1TPYA 1YKGA 2FB9A 2NUAA 1OWMA 2ZAYA 4IIHA 4TLLB 5B57C 3FSRA 1U3TA 2XITA 5ALLA 3NH9A 4K8OA 4QLAA 3KKMA 3SJZA 3DBIA 4B75A 4YPVA 3T3OA 3ZNOA 4U2CA 2EBUA 2GUGA 4I0WB 1AZLA 3KOMA 3ZVNA 1RJGA 5C1DA 1CQIA 1XKLA 3P9NA 4DQLA 4FN4A 2NU7B 4TWAA 5ERXA 4OG2A 3U3OA 4XDHA 4J2TA 2C0PA 4KQHA 5CLJA 4DV2B 3MB5A 5FP0A 4HDNA 3I4FA 3QA3E 3B1YA 3ROPA 5FO1A 4CM5A 4G65A 5K8TA 4QVGA 2RC5A 4JSYA 3K2EA 4LFAB 1GFIA 5B3JC 1V9CA 4NYIQ 3K8YA 3GT3A 3IBCA 3IT3A 4C08A 1EFKA 1U0EA 2PZBA 2D1YA 221PA 2XUAA 1F2TA 2Q3MA 3HU5A 3DZCA 5CFOA 4BFXA 3KKLA 3BRWA 2IXTA 1NXQA 4U7TB 5HE9A 3GZTB 3O21A 4W9RA 2FEPA 4RQAA 4KE8A 1Q6ZA 2A9KA 2PQ2A 3H9BA 4HJXA 3I6YA 2Z43A 2JA1A 1YC5A 4ASUA 2H9YA 5GJBA 1I33A 1ZOOA 1TAGA 4ND5A 1CRZA 4IXDA 1Y9DA 2J4CA 3AG5A 3I9MA 1Z3IX 2MSNA 1E5QA 4GI1A 4K9KA 4LYFA 5GM2A 4OCZA 3BB4A 3VR5A 3L82B 4QOEA 5AVTA 2EWMA 2UU9B 1BHO1 2XUZA 3KXLA 4ISCA 2JJ1A 4EA9A 3CH4B 4OJMX 3SEAA 2UZ1B 3H5VA 3NNNA 2JH9A 2K4MA 3O1IC 1PG2A 1RRCA 1QHFA 4FHGA 4JOQA 1S2NA 3BC1A 4HX5A 1WDLA 1PSDA 4JVSB 3UAVA 2XMDA 3OO1A 2O8VA 3HVHA 1TAUA 1NYLA 4BP9A 1CVIA 4GBJA 3TTUA 3TW6A 1Z6TA 2FU5C 5DP2A 5BRNA 3GRFA 3N59A 4EJ2A 3KSDO 1U0GA 3GVHA 1ZPDA 2W6JA 2XYVA 1XJ0A 3KPWA 1S96A 1RJWA 4WK0B 3K70B 3N7UA 4PO9A 2CSUA 2V6BA 3D54D 3MWLA 5F23A 5CHEA 1MHTA 1I1OA 1I6LA 2CXHA 3P2EA 2OP1A 3CLTD 3O0TA 2PL1A 4I1IA 4DSZA 2EZ4A 4AQDA 4RJ2A 5ECWA 2BZSA 3LF2A 5J1TB 1OWNA 3ZW8A 2BN4A 3DT6A 3RWBA 5K6RA 3VFDA 4L75A 1DINA 4D9HA 1KKUA 1ECBA 4BMVA 1QR6A 2FUEA 3LF1A 3Q12A 2PRIA 3KDAA 3WLEA 2R6DA 3AUAA 4IFTA 4WVLA 1EWKA 3SX2A 5CH3A 3VPSA 4EYEA 4OQQA 5KAPA 1SXJD 4ZK6A 3O4HA 4L50A 5FOUA 5BR4A 2IC5A 3E3OA 3FOBA 4U0KA 5K3BA 2JFQA 5C5IA 1P1FA 3W8DA 4WACA 3TYXA 1E0DA 4MX8A 2PA3A 3G9TA 4HUJA 3KUKA 4W7HA 4A3SA 1NNLA 1VA5A 1YDMA 2HREA 4XD7D 3RVDA 5J2UB 2QRVB 1UWVA 2NU7A 2XZDA 3DMGA 3MWKA 2JKZA 3AUFA 3PC3A 4LZLA 4R2HA 3IB3A 4MNTA 2Q21A 1GSOA 3OOEA 1U1GA 1SBIA 2Z4SA 3B6IA 4JSRA 2GJAA 2W90A 3ZD9A 3NBUA 2J9ZB 1C9YA 3M9LA 3CVYA 3EVBA 5EIHA 5JD5A 5TEWA 2HLNA 1VG1A 5JDCC 2GZ1A 3F8TA 4JI1B 3ZUPA 1AF7A 1JDPA 3DEIA 9LDTA 5LFAA 3U19A 1KKLA 3WRXC 3EOBI 3SJCA 5ILQA 4UMEA 1FFGA 5IVPA 3OIGA 4I9GA 2HCJB 2NO0A 1IWOA 2Y4OA 2VNHA 3T34A 4UAVA 4CHGA 5M3BA 6Q21A 1CJTC 1GL7A 1T3TA 5A6SB 3N74A 1P4RA 3AY3A 4RKEA 4G67A 3ZU4A 2PX2A 2FTKE 2I4IA 4H6XA 3S2ZA 3AKZA 2PS9A 2BE7A 4RA9B 1OROA 4LTNA 3E2PA 5DGHA 2QQEA 1CUZA 5KDDA 3F6RA 5JAQA 1XZHA 4PFKA 4ZV9A 3VYUB 4EUSA 4WA8A 1PYDA 2UYQA 3AB3A 5C5CA 4I50B 4M1YA 2ANCA 1OTYA 3ZHRA 2AR9A 2C61A 3HM2A 1PZMA 4M1MA 3R0ZA 3B9RA 2EJCA 1EWVA 2UZ1A 1I3NA 1XJWA 2GLXA 5DGXA 2OQIA 2A0UA 2QS9A 4FDTA 3UFBA 4WUTA 2EBFX 2QMEA 2R9VA 2GBCA 4HP8A 5CM8B 1JS1X 3WVNA 2FPRA 1G8YA 2UZIR 4UHDA 5CX4A 1NJ5A 2RHCA 4Y2HA 5D00A 5DFAA 5EOVA 3RU7A 1RXWA 3LI2A 5I9BA 2AG5A 3WGHA 4PN7A 1ORWA 2MSDB 3VXKA 5KCZA 4YFYA 4C2BA 3KYCB 2QYTA 4QPZA 2JIMA 4BQQA 1LX7A 5A3VA 3ZY6A 3JVEA 4D99A 2IITA 3ETNA 5HFNA 2DR0A 1Q0SA 5ALSA 5ILGA 1WKCA 4AG5A 4BU1A 3L01A 3NDRA 1M1UA 3UC9A 1YH3A 4BC1A 5ICMA 5JWOA 3AJ9A 4XFKA 4ESEA 4B2LA 2O14A 2IY7A 2ZULA 4B4KA 2G63A 5LKRA 7MHTA 4N5DA 3O84A 1CNFA 1GUYA 1S8OA 4AKEA 1PS0A 3GUYA 4W5WA 1Z5PA 3RDPA 3E15A 5JBQA 1GPH1 1DG3A 1TCBA 2ZANA 1IJEA 3OLQA 3UUFA 4ZCRA 1F6WA 3FZYA 4BIMA 2ATEA 5IFLA 4AJHA 3MBOA 1Q91A 5CVJA 3TZCA 1JZSA 4LCEA 5K5EA 1N0WA 3A3KA 4Q1BA 1O9HA 5AJHA 1D8TA 2QRVA 3FLAA 4EB0A 5J2UA 1DAIA 4V1CI 5IXYA 5THKA 1PJTA 3W8FA 2JFWA 2IOHA 1K9SA 2OCIA 1KBQA 2IHNA 4WOKA 2BKUA 4B43A 4N3AA 3KQOA 3GI1A 4KLRA 1FEZA 1OBFO 5DEIA 1E2NA 1QYIA 3FPBA 3IKMB 5LIPA 4TX1A 3DYBA 4LCBA 3ROKA 3LRTA 3Q9SA 3C85A 2Q3EA 5JSQA 3BL6A 4R8RA 1N3LA 1EJ2A 3FGPA 2H9IA 5A6SA 4LOIA 2CLOB 1U8FO 4H4CA 1RE0A 2W4QA 5JANA 3LT2A 4GO1A 1EDOA 4RA9A 1G9SA 3LL4A 4NAVA 5ALNA 5JU6A 1ODFA 1WAMA 3C8DA 3JW8A 3JWIA 4URWR 3ZGNA 3SX0A 1YB7A 4YDHB 4DUYB 4JBNA 2JCBA 3R4CA 4I50A 3O90A 2Y93A 3R1IA 1UQRA 3F78A 4BMPB 2H2IA 6NULA 4KEAA 3ZD8A 2QT1A 2AW5A 3IQWA 3TJMA 4C4PA 3L7IA 4UUAA 2CL7X 4GWLA 2XMPA 1Z0IA 2HV9A 1KO7A 2C8KA 1O3YA 3AU9A 1I5EA 1JSXA 5TEVA 3I83A 3VQTA 4WGFA 3OQJA 3PJFA 4J7XA 2WSSA 3VI3B 2QX6A 2ZEJA 3MSCA 2ILVA 3GFBA 4KH0A 1GTSA 4D57A 4HXFB 3IUEA 2CVOA 1OWOA 5KU7A 1QF9A 2JCVA 4KQIA 1QRDA 4JXKA 1GNSA 2G76A 4WADA 1A4IA 1K97A 2PGAA 1FVHA 1ZGZA 3I09A 3KYCA 4L5AA 3RSSA 4JUFA 1H2AS 4IICA 1JDVA 3SKVA 4A5SA 3MGCA 3NOXA 2PV7A 5J2TF 3EQ6A 5KJ6A 1Q7RA 2LRHA 3LMKA 3P5BA 3U60B 3HN6A 3M5DA 1HNZB 3V9AA 5KTRA 1N7HA 1ZD3A 1YRAA 1U3UA 3L7BA 1GP2A 4HNRA 4EKGA 5JSHA 3EDCA 1K6MA 2NTVA 3U7FB 1Z0AA 4R1LA 3PGVA 2JFBA 1ADCA 3TVDA 2YDXA 4GLLA 4IF6A 2IUUA 3U09A 1YRQA 1R5BA 2C4NA 3AGQA 1NN1A 1HT0A 4NLLA 3A32A 2QRLA 4ZJPA 5GVSA 1GSAA 4N12A 4G4IA 2EJVA 4JBHA 1JI3A 1EXNA 2XJ9A 3WGJA 4RPHA 3HU3A 4C43A 4XWOA 3NBXX 3U4IA 4F1WA 1KTIA 1YMVA 3QGMA 3A4MA 3S68A 2A9FA 1QP0A 4QRHA 5HRUA 4B2PA 3FLEA 1K86A 4JLNA 1CJVC 1EVLA 3D8TA 4KFUA 2OUKA 5ALYA 5BQOA 3TRDA 1SOAA 3WAJA 3Q2IA 3VJKA 4F4FA 3DZIA 1PL0A 2PIDA 2QUAA 3WL3A 4H6PA 1ZIXA 3ZLTA 2ZTMA 3HQ4O 3ZXUB 5I01A 1XQXA 1W1WA 2JJ2D 4F46A 2I4OA 3V4RA 3G2NA 3TAXA 3QK7A 3D3WB 2A33A 2WHPB 2HX1A 3R09A 4Z1OA 4WDRA 4ZZ0A 2ZJZA 3QF7A 3FWPA 4IMIB 3E1SA 3UM9A 1LLFA 2YWFA 2X8LA 3BE5A 4JLSA 4BNYA 1XL1A 3ROEA 5G02A 3ZDAA 1OJLA 2G7ZA 4KN8A 4C3UA 2O0JA 3LUDA 4FGZA 1RBYA 2B4QA 1RS0A 4MV9A 3S28A 4ZGGA 4QYTA 3H17A 5IJZA 3ROXA 2VNJA 1Z47A 4WH0A 5GTDA 1XPRA 1ONNA 4M9CA 3GHHA 3FA2A 3G2IA 2EGHA 4C07A 3GOQA 2I29A 1KYWA 1MGOA 3SLGA 3P97A 5IBPA 3C6KA 2HK6A 4M86A 4ZVLA 3LWDA 2E2WA 2J3LA 3ILVA 2WKSA 1KO1A 3QE4A 1E5LA 2J08A 2MYPA 1BN6A 2QN3A 3BIOA 5AKZA 4AROA 3R6WA 5JJBA 5LWQA 4V0RA 2E37A 2PMCA 1BMQA 3V1YA 1W75A 2Z6VA 3U4AA 1DIHA 4C0BA 5JLJA 2FZWA 1YZQA 2P6NA 5IVHA 4X7RA 1L1RA 3P9KA 1V95A 3PYMA 1JAHA 2Z2YA 1ZN9A 5IJXA 4B85A 3I0NA 1G3RA 2Z56A 3VR6H 1YQUA 1CZKA 4COOA 2OQRA 4BQIA 1FLDA 4CL8A 1POXA 4A6EA 3C3XA 4YB8A 1FS5A 1REQB 1BQ4A 3IIIA 3KUXA 4U1RA 2V6GA 3SYTA 1BDMA 4Z4FA 2ZJAA 2E1RA 3RRJA 4UDOA 4GS5A 4PCLA 3ZBQA 2UAGA 3ZLJA 4F96A 4RTMA 4O1HA 1YBMA 3MWJA 5BN4B 3G0CA 5HQ3A 1PLKA 3T7IA 4KU4A 4E4RA 1XDGA 1ZS9A 4WKOA 2C0CA 1NVDA 4XYEA 4Y18A 1Q0UA 3H19A 4NQZA 3QVWA 2JGFA 1M6WA 3QBEA 4IVRA 2HRDA 1JAZA 2HRZA 2O7QA 1GKYA 4D45A 4I5GA 3ES9A 4TMZA 3R24A 3UMVA 4E22A 2YIVX 1JKFA 2DFDA 3EXIB 4YMSA 4FYKA 1E6MA 3WMXA 2R751 2ZUSA 1S0UA 2QD1A 4HDRB 1YQEA 3G68A 5AVKA 3UBTA 3IVGA 4DV7B 5CTJA 4WA7A 4WXMA 3M89A 1EK2A 1RAEA 3SOPA 1EP3B 3UKDA 1GD1O 4X44A 1AK1A 4Y6PA 2QE7A 5MHTA 1HE3A 5G4KB 4AJIA 4RJIA 5HF8A 5NULA 2D4HA 2IP4A 1XI2A 1KI3A 2NPOA 1DOHA 1CUAA 2C5HA 2WHPA 3D3WA 3VNRA 3THRA 2XQVA 2YQ4A 5BSGA 2WU1A 1VZ2A 3VTFA 3RUPA 3SNHA 4ECEA 1PFVA 1JKJB 3RSQA 3KJNA 3E9RA 5ALIA 1BRTA 1YGYA 1U02A 3LPNA 4C4SA 1TF7A 1E1RA 2DSNA 4E70A 4XTRA 4C0LA 5LP6F 3SZOA 5CURA 5EKSA 1Q7TA 1Z8NA 2HPAA 1O54A 1JJBA 1GZVA 3F1LA 3F3YA 4K28A 3FFWA 4R9VA 4W63A 2G9UA 3DNPA 3SSOA 1TIBA 3DEYX 4ZKDA 4TTVA 2FSUA 2DUMA 1NRXA 2IHKA 1LD3A 1N2IA 3D6HA 4G5OA 1M6HA 3L7MA 4ZT6A 4JHLA 3RIYA 2WUWE 5E6UB 4F6LA 1NQAO 2OGWA 3OCJA 4QU9A 5CB4B 4O33A 2JIDA 1GPAA 3A36A 3CVOA 1QFXA 1ZD9A 2BW0A 4H0CA 4C9BA 1CJKC 5KYTA 4OX9B 1EXMA 2G0NA 1DARA 1YIDA 2ZXEA 2CLIB 3WNDA 3CZRA 3DDHA 3EZGA 1Y8QB 4YPFA 2C1ZA 2GMWA 1DV1A 3FWYA 5JYDA 2ZWMA 4BQOA 2Y0DA 3ZDDA 1PS9A 5T8KC 1L5SA 1F8GA 3KHUA 2Z04A 1GNVA 1REQA 2RHRA 4JFAA 1S3IA 3QHAA 1N2CE 4X71A 2Q9UA 3BHNA 3NV9A 4YNBA 4N8DA 3TTSA 3L7AA 4CU5A 2IYNA 1ACJA 4YLYA 3PC2A 3WV4A 1OE0A 1NMQA 3GEPA 4ZQGA 3ER6A 2RHMA 5J63A 3R41A 1XRLA 1DIRA 4BEVA 3S1SA 1XMOB 1VMIA 2E6KA 2WAYA 4BQEA 2V8BA 2YV1A 3RU9A 3DE4X 3TLZA 4W1PA 3D43A 3DF7A 2GCOB 3G7SA 4BP1A 3TLAA 3UUWA 3U80A 1NX6A 1J20A 3VYWA 4MROA 1OB2A 3KKPA 1NXPA 3AHFA 2RD2A 3EXIA 2IDJA 3HJGA 2LCFA 3FNQA 3DPUA 3O38A 2AJDA 2D0OB 3LKZA 3PJGA 4HDRA 4WBSA 1SCKA 2HQOA 1TYCA 4B76A 4P0PB 4DABA 3VR4A 3JQQA 1YZVA 4MYSA 5JV5A 4PNEA 1KI8A 2VFAA 2C58A 3LT0A 2WKWA 4FJ0A 3ZLBA 1CJCA 1GR0A 1JVSA 1S1CA 5JZBA 1D2MA 3M1AA 3STVA 4PAOA 3EFEA 2DJ5A 3AB7A 4V0SA 1BCRB 3I2GA 2B4RO 2P6PA 3PE4A 1P33A 5EP1A 2G72A 5G4KA 4DC1A 3I9KA 2I6XA 3PVSA 1J25A 2A9OA 2OBFA 3MTIA 3C3EA 3RD5A 5BRAA 5HGXA 1ORDA 3G88A 1M1YE 3AR9A 3FNFA 3LP6A 4BQPA 3K72B 4LSZA 4PR3A 2QJOA 2WR8A 5L45A 1XTVA 3X0DA 2DU8A 1QCCA 5FUWA 1WDMA 4GWKA 1JKJA 3TQQA 2QMQA 4CLDA 1CD5A 3QVLA 5A4AA 5BN4A 4WX2B 3QUQA 4NHOA 2CSXA 2JJYA 1KP9A 2FE1A 4UREA 4KO3S 1NLYA 3ED5A 1OZGA 4IGFA 4E5YA 2JFGA 1ULZA 3L9XA 5EJ5A 2SKEA 4PCAA 1V8FA 3V8QA 1ZUIA 3ETCA 4A2WA 1R8JA 3MT8A 4YT2A 3VR2D 2J0SA 5CB4A 2UV8A 3IE0A 2RHLA 3UV3A 2JGKA 3WNQA 2CUNA 4ZCTA 1X39A 4JP2A 2E89A 2J0EA 3GX1A 3NDPA 4OLJA 3NAZA 4I55F 4TLCA 1GU1A 5CG2A 4LOKA 5J9FA 1X1CA 1UJBA 1G19A 2ONKA 2G5PA 3NPAA 4FYMA 1DHTA 4XM0A 1Y8QA 4WNCA 1DFIA 3MCZA 6LDHA 2M9MA 1CY8A 3CG4A 4MUAA 2P6RA 2C7QA 3CSDA 3COZA 2O0HA 2QTLA 2C4HA 3RR2A 3ZX4A 4PTLA 2DMRA 4GQIA 1WABA 4UQLA 4IM7A 4GR4A 1EDEA 3FPSA 1T10A 4RFLA 3VYSB 3BCSA 1E3DA 4PO3X 1SUFA 1H69A 3PWTA 4LSGA 1GTZA 3AWDA 4DA6A 3HLKA 1X38A 2X0EA 3JYNA 3LECA 1AGRA 1R10A 1K6XA 4E07A 3EHDA 3FYUB 5CNJA 1BOOA 3MWGA 3X2FA 3C4JA 1QO0D 2FN3A 2O7VA 3D7SA 2FSSA 2JK0A 3WYCA 3M83A 1WUKS 2GCOA 4KO4S 2H51A 1JALA 3K32A 4OJQA 1P7YA 5CK4A 1E2FA 1ONBA 2GFHA 4ER7A 5DMHA 3KFVA 4P3PA 3E2IA 4DMUB 1F2UB 3WX0A 2PMBA 1X94A 1QLWA 3MTBA 3W0LB 1PJ2A 1TB4A 1PVVA 3CXUA 4IIDA 2ZS9A 3BIXA 1F0KA 3W2IA 4WBXC 4YT4A 3NGXA 1RHQA 4H7EA 2GN9A 4M55A 4TLDA 3K6RA 3Q10A 3A37A 2VLBA 1USUA 1XMXA 3DYIA 4NFSA 2HXGA 3RLIA 2YNMD 4DADA 5D7BA 3LE8A 4TMTA 5IAAA 1BCRA 3O82A 4DCJA 4L7QA 1OD6A 3JQFA 4JSTA 3ZHOA 1QFMA 1KXJA 1M67A 4HCJA