3O75A

Crystal structure of cra transcriptional dual regulator from pseudomonas putida in complex with fructose 1-phosphate'
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
270
structure length
270
Chain Sequence
b'HTRTLGFILPDLENPSYARIAKQLEQGARARGYQLLIASSDDQPDSERQLQQLFRARRCDALFVASCLPPEDDSYRELQDKGLPVIAIDRRLDPAHFCSVISDDRDASRQLAASLLSSAPRSIALIGARPELSVSQARAGGFDEALQGYTGEVRRYQGEAFSRECGQRLMQQLIDDLGGLPDALVTTSYVLLQGVFDTLQARPVDSRQLQLGTFGDNQLLDFLPLPVNAMAQQHGQIAATALELALAAIEEKRYEPGVHAVGRTFKQRIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose transport system repressor FruR
publication title Fructose 1-phosphate is the preferred effector of the metabolic regulator Cra of Pseudomonas putida
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Transcription
total genus 101
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00532 Peripla_BP_1 Periplasmic binding proteins and sugar binding domain of LacI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o75A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o75A01
2YHBA 1D1PA 1U8TA 1F51E 3Q7RA 4ML3A 1GLGA 2IPMA 2ZAYA 5IBQA 5EWJA 1BDJA 1TVMA 4D74A 4EYGA 2PUCA 1UDRA 3K9CA 4KFCA 3EQZA 2R48A 1J56A 1Z2EA 2VYCA 4D6YA 4Z4HA 3S99A 3I45A 5TQ0B 3T6KA 2JBAB 4ZJPA 4RWEA 4W5TA 2FQWA 3F6PA 1QO0D 4HNSA 4IF4A 4JAVC 3W9SA 2PE5A 1MB0A 4YCSA 1EFAA 4H60A 3NNSA 1EWTA 1JWLA 3CRNA 3RH0A 5CNKA 1P2FA 5ABPA 1DZ3A 3JPYA 3C3KA 3QLVC 2L19A 4EYKA 5I4CA 1BA2A 1K66A 3HUTA 3IP5A 4IGAA 3RVOA 5KC8A 1D4ZA 5D2CA 4ETNA 1QKKA 3OLZA 4RV5A 3EDCA 1JX6A 1BDHA 4LE0A 4S05A 4YP9A 3NBMA 4Z9BA 4W5RA 4Z4FA 4KK3A 1NXXA 6ABPA 1DBQA 2PUEA 2P4UA 2PMCA 4KREA 2CD7A 4F8JA 2LBPA 3NHMA 1QPZA 1CEYA 3LUFA 4KV7A 4IMIB 4TMYA 1VLZA 2QV0A 5KQPA 3H1EA 1ISSA 3O2QB 2GKGA 3SY8A 3HV2A 4RK0A 2QSJA 1GCAA 4LDAA 5JS1A 4Q7EA 3A0RB 3JPWA 1SXHA 4QPJC 3Q7TA 3N0WA 2PKXA 4RKQA 2FVYA 4F06A 3GV0A 4N0PA 4EYQA 3JS5A 2LUOA 3LUDA 1JFVA 4MGEA 4MQFB 5CNIA 3D02A 2NT3A 4F12A 3BRQA 4MRMA 3MQ4A 4EVRA 1B00A 2ID9A 2RJOA 3M9WA 2FMHA 1NXVA 4DQDA 1NY5A 3OQNA 1YVUA 3CTPA 3IP9A 5FBKA 1ZH4A 5HKOA 2WJAA 2FW0A 3RVQA 2JVIA 3R0JA 5KQLA 2JRLA 1ZN2A 3IPAA 4OLAA 2OQRA 4LE1A 2QZJA 2E4XA 2L18A 2R25B 2V0NA 1USKA 5TPWA 3HK2A 1OXBB 5BRAA 3QLUC 2MYNA 2A9RA 3H1GA 1FFWA 1K68A 5TPZD 4EVQA 4N47A 2H0AA 1CHNA 4W5NA 2PL9A 5KI6A 3DGEC 2NZVG 1M5TA 2GX6A 1XHFA 2FTKE 1NXTA 2WY2D 4HNRA 3E61A 3HDGA 1ZHHA 5JNRA 1ZH2A 3C3WA 2AYXA 2VUHB 3RVRA 2O20A 4MR8B 4MLCA 4Z4EA 5DLEA 2A9PA 3JY6A 3JVDA 1DC7A 1VRVA 5GOTA 5FWXB 5HM6A 5TQJA 6CHYA 3QELB 2PUBA 1ZITA 1M5UA 3ROTA 3BBLA 5CNJA 3MM4A 4MR7A 1LJLA 1JLKA 4RS3A 5BQ3A 4IMJB 1W9HA 3Q7SA 1U0SY 4KVFA 4WUTA 1JYEA 3T38A 3EAFA 3FDFA 5JNTA 4Z4GA 3KHTA 3CNBA 5TQ2A 2MSWA 4RDCA 1M2EA 3HZHA 4FE4A 3FMVA 4G0OA 4WXMA 4F11A 5BR1A 1FFSA 1SXIA 4MR9A 4G0PA 5IX8A 3CG4A 3SG0A 4XASA 4Z0NA 5GQSA 1ZGZA 3OLVA 3QEKA 3LUKA 1L5ZA 3E3MA 5IUKC 1Z2DA 3L6UA 1MB3A 3OMWA 3CZCA 4KK4A 3G1WA 4OLBA 1JL3A 3RVJA 4YGXB 1EWKA 5EWLA 3DGFC 4RK7A 4RK4A 3O74A 3T95A 5EWLB 4M88A 3FFTA 3MYYA 1E2BA 4YWHA 2NT4A 4TN5A 5EWJB 4YR7A 4IRXA 1DCFA 1Y1LA 1RXIA 1ZESA 3KYJB 3O2SB 4ZYLA 4Q6WA 4WZZA 4QYWA 4Z4CA 3CHYA 2FLKA 4FB4A 3IP7A 1USGA 3MF4A 1QO0A 3RVKA 2E4VA 3I42A 2FMKA 3TX6A 1Z15A 1KMIY 2AYZA 3ILHA 3Q15C 5KQGA 4KQCA 3JTEA 5KWSA 3HJFA 2NZUG 3GRCA 1U04A 2FKAA 3KLNA 4G0YA 5HQJA 1YK0A 1LJUA 4KRFA 2PUGA 3FFXA 4G0MA 3OLYA 4ETIA 3QEMA 4G86A 4EVSA 4L4UA 4RK5A 3QEMB 3EODA 4LX8A 2FQYA 1USIA 3DBIA 3URMA 4OTZA 3NNNA 4N41A 3QLTA 1RZRA 1SRRA 2GI4A 4NCBA 2CHEA 3T8YA 2B1JA 2B4AA 5T7BA 1XHEA 4H3KB 4NV3A 3IPCA 4RU1A 1VPWA 5C5EA 4E7OA 2XDYA 3GWGA 2FN9A 5F64A 4MYRA 1YK1A 3CG0A 4KZKA 3IDOA 3K4HA 1F4VA 3HVRA 2W42A 3O1HB 1E6MA 4L85A 3BREA 2WMYA 3CZ5A 1ZDMA 2FMIA 4XAQA 1DP4A 1L5YA 4H3HB 4YRZA 4S04A 2FMFA 2R47A 2WRZA 4XFKA 3A3KA 2HQBA 1Z17A 3H6HA 3C97A 4QYMA 4RK6A 5B3JA 3RVPA 5IUJC 1NXSA 2OENG 4MRMB 5JNUA 2NUBA 3O1IC 1BDIA 5CNMA 5PNTA 3VNBA 1QP7A 2Q5CA 4JB0A 4G0QA 1PUXA 2CWDA 3HEBA 4KPYA 5B3JC 2IPNA 4N76A 2WJWA 4N03A 5C5CA 4KQ9A 2JVJA 2N9UA 1D1QA 1RPJA 5IC5A 3LOPA 3OM1A 3KTOA 1APBA 1A0OA 4NCAA 4PEVA 2JK1A 1ABFA 3LFTA 4E7PA 2HSGA 4MPTA 3D8UA 3G85A 5TPWB 3F73A 1YS6A 2FN8A 4Z9AA 3F6CA 1D2AA 3MIZA 5TPZA 4MS4A 1NXPA 2LPMA 3GL9A 5KQMA 3KS9A 4OG2A 3O1JC 4XXHA 1FQWA 1XWWA 1S8NA 2MSLA 2TMYA 4EY3A 1Z12A 1YIOA 3OMXA 4ZMSA 4MLDA 3GT7A 2E4UA 3OO0A 1MAVA 2PJUA 3H75A 4JOQA 4MS3A 1WETA 3HXMA 2A9OA 4G97A 1YS7A 1ABEA 2HQOA 4NICA 3ROFA 3RVSA 3A0UA 1DBPA 4MQEA 1T34A 1Z25A 1FSPA 4LRQA 4GPAA 1JFTA 3NNDA 5JS2A 2I6FA 2IPAB 5EWMA 4MR7B 1RNLA 3GYBA 4JP1A 3KKEA 4WWHA 3EQ2A 3H6GA 3HUUA 3LUJA 4DADA 1JH9A 2KYRA 4RZSA 3H5WA 2MYPA 3BILA 3M9XA 4MS1A 3HDVA 3O21A 4PZ0A 3EJWA 3QK7A 3BRSA 3CS3A 5TQ2B 3LTEA 2FEWB 2LIVA 3DZDA 2F8TA 2J48A 3SAJA 2PUDA 2JCGA 5FWYA 4MR9B 4Z4IA 1M2FA 5JNWA 2VUIB 3P9YA 1Z16A 4RK1A 1YMUA 4N0QA 1LBHA 2FEKA 3LUCA 4F3TA 4ZMRA 1MVOA 2QR3A 1E6LA 1I3CA 4D6XA 2L2QA 3HS3A 5JNVA 4RSMA 2JB9A 2MSKA 1NXOA 3RVNA 4Z99A 3H1FA 2BGGA 1JF8A 2LP4Y 4YV7A 3L49A 3Q41A 2PL1A 4TLLB 1D5WA 3LMKA 1QP4A 3QX9A 5E3JA 4B09A 4UHKA 3OQOA 2HJ9A 5IUNC 3JVIA 3OLWA 4OBBA 3KG2A 1QQBA 3C3MA 2WB4A 3RVMA 4DN6A 1EWVA 3VNAA 2GWRA 1PNTA 5ED4A 2E4YA 4QICA 3CLKA 2PUAA 2IYNA 3H5OA 1PHRA 2RDMA 2MYTA 4W5QA 3GA5A 3LUGA 3KYIB 1NXWA 3N0RA 4G0ZA 4UHJA 1KRWA 1GCGA 1DG9A 1MIHA 4JA2A 3SNKA 2L17A 2YHAA 1Z13A 1QQAA 1EHCA 3KCNA 4RKRA 5TQ0A 2JBAA 5IEJA 4RY0A 3H5LA 3QLVA 1GUBA 9ABPA 1C0EA 3UUGA 5T3YA 4LZLA 1AB5A 4FE7A 5DKFA 2JVKA 3HO1A 4EYOA 1AB6A 3TO5A 1LK0A 1DRKA 2H3HA 4KMRA 4RY8A 2PAFA 1GUDA 4LE2A 1SD5A 1TMYA 3M6MD 4ZPJA 2DRIA 8ABPA 3SQNA 4RXTA 3EULA 3SM9A 3N6VA 4PYRA 3NHZA 1W25A 3KLOA 3RVLA 4IILA 3CFYA 3C6QA 3B2NA 1RZRD 1NATA 3GBPA 3UKJA 1U2QA 2R4QA 4RXMA 2IDMA 4LDZA 1JFSA 5KC9A 1JYFA 4YO7A 4W5OA 1VKRA 1TM2A 3DLBA 4GNRA 3F7NA 4EGSA 2ID7A 1QP0A 2QXYA 2IKSA 5IEBA 3HSYA 1TJYA 1Z26A 1YTUA 3TD9A 3I09A 4XLTA 4MQFA 3LKVA 2WWVD 1DBWA 2M1ZA 3OQMA 1ZAYA 4P1ZA 3N0XA 5DTEA 2IPLA 4P98A 5JNSA 2X7XA 4NQRA 3N75A 1JHZA 4MS4B 3CKMA 4KNYA 5IULC 2FLWA 1KRXA 4RY9A 4YLEA 4MAAA 3O75A 1HEYA 2A9QA 5CHYA 2PLNA 3QLUA 3HM9A 3LUAA 3H5VA 3LUHA 4HNQA 2FXIA 2GBPA 3HCWA 4RXUA 2MYUA 4MS3B 1DJMA 2M98A 1OXKB 3KSMA 1ZY2A 4HYEA 2PUFA 2QW1A 3OM0A 3GBVA 4OATA 4YS6A 4Q6BA 1ISRA 2RGYA 7ABPA 1JDNA 5HSGA 3DLHA 4MQEB 1A04A 3O2JA 4WXEA 2CHFA 3RQIA 1ZGGA 1R8JA 2QVGA 5BRJA 3KJXA 5DGCA 1JDPA 3MMNA 1FFGA 2ZWMA 1DCMA 3TB6A 5EWMB 1BAPA 5FBHA 1A2OA 4G0XA 1DRJA 3QX8A 4Y9TA 2VK2A 4CBVA 4MR8A 2E4WA 3FGZA 1KGSA 4JB2A 2F8SA 4MS1B 4O1IA 3H5IA 2P9HA 3ILYA 4O5AA 4O1HA 3EGCA 1BVHA 5FWXA 5TE9A 3LKBA 5FWYB 2QU7A 3QELA 3OO1A 4PE5B 2HQRA 1QNLA 1P6UA 2IOYA 2FQXA 1ZVVA 3FFWA 4PICA 1P6QA 1RXEA 1Z18A 2HPHA 5DCLA 1C4WA 4TLMB 3H5TA 1LBIA 4JASB 3UK0A 1YMVA 1PEAA 2E4ZA 1CYEA 3N8IA 4ETMA 1QMPA 1DCKA 1U2PA 1TLFA 3TMYA 3OLXA 1IIBA 1NTRA 4EUKA 1URPA 2FEPA 4XARA 1SXGA 4WT7A 1JBEA 3MA0A 3A10A 1E6KA 3CU5A 1PNRA 1EAYA 2FSPA 2RJNA 1H9CA 3I5AA 1DC8A 3N53A 2QVCA 1PEYA 3Q9SA 3IP6A 1P8AA
chains in the Genus database with same CATH superfamily
4XSGA 4ZARA 4AM8A 2JHPA 3DHNA 1DQYA 2AZTA 2EDAA 2J67A 2J9YB 3K9CA 5LQDA 4XR9A 2ZWVA 1LBSA 3GVIA 4M0UA 4YMSA 3IP1A 1ESDA 4IL5A 3HR4A 1F4LA 1AKTA 3F4KA 1WXIA 3MEQA 2VDWB 5JAZA 4P3OA 3R44A 3J81k 5FRDA 1VJRA 5DPMA 1RYEA 1N5KA 3T1VA 5BV8A 3AM4A 2PWPA 1I30A 4HDKB 4TV8A 3SSMA 3ZWOA 3VPCA 4INAA 3U7EB 3UAOA 5JZ9A 1EWTA 4DC0A 2ZM6B 3CNHA 2C8KA 3QLVC 2QRUA 1W36C 1K66A 3FLMA 3D6UA 4DCVA 1I51A 1E61A 2CV0A 2FZLA 1TCVA 5KYXB 1E69A 1QFMA 2XQKA 2QDXA 2UZAA 4LIPD 4J9UE 2GHRA 4Y0VA 3GLHA 3JSAA 4S05A 3TRKA 3Q9LA 2GYVA 2ZIEA 3H1TA 4B1FA 3N2EA 3FOFC 2BMEA 3QU7A 2O1EA 4PYKA 4OUDA 1THTA 1T5LA 2B94A 2P4UA 2PUEA 1UKZA 3H9EO 1KDOA 1BX0A 1TA4A 5JI2E 4EBBA 4LF7B 3NUZA 4Q82A 4WACA 1JAIA 1GT6A 1W0JA 1AH2A 2P2DA 2JK0A 2R5WA 1VCIA 2J1LA 3A4MA 1XJWA 3C7AA 3ENKA 3H1EA 3HLYA 4IH9A 4MDYA 3SS7X 3AJRA 1IZZA 2B6HA 4S3MA 3IAEA 4RK0A 2YYZA 5JASA 4JI6B 2JHCA 3U9LA 1MRZA 4O0MA 4L5CA 4DB2A 1Z35A 1EXDA 1SXJC 4JQCA 3ZDXB 3JQ8A 1COWA 1DG3A 3ELUA 3N1UA 5LVAA 4CPDA 1OHHA 1PK8A 1Y48E 4LWPA 1VE6A 4GRDA 4F1KA 4TKVB 3GJXC 3DEJA 4UDNA 2XGSA 4NFLA 3BRQA 3H4IA 2JIZA 5EKTA 2HNKA 4NH0A 5TGTA 1EG2A 4D7AA 4EBFA 2AJTA 4IY1A 4OHMA 2GM4A 1C14A 2B61A 5ALOA 4P5EA 5CVDA 3H9QA 1G8AA 3QE4A 5IS2A 4LNUA 4M98A 5DE3A 1U0LA 2W2NA 4YJHA 2ZPAA 1M54A 2O2XA 2BGUA 3E3OA 4B47A 4B7ZA 3VU1A 1NBWB 3WBBA 2CJYA 2HR1A 3G8YA 2ZS9A 1QFZA 4MUHA 5BRAA 1YHYA 3DE7X 3QLUC 4G89A 5CM2Z 2VDLB 4H1HA 3QEJA 1G20A 3PNPA 2QOEA 1UXHA 3BQNB 3TR5A 3I0MA 4XA8A 4OV6B 2H08A 1O0BA 1N5RA 4HATA 1J6UA 1L5WA 2AG1A 1M5TA 3IPYA 1QYCA 3HYSA 4ON9A 1OX4A 2IELA 1Y4ZA 4E5KA 2ORIA 3V97A 4IYJA 5CUQA 4O4JF 1L4EA 2XGMA 1UBOS 1VQ1A 3RGWS 1YZYA 4BE9A 2JGDA 2ERXA 3RDPA 4IV8A 1J2RA 2QZSA 4KQWA 4M1TA 4CT0A 4M3NA 3J7TA 3IT0A 4UHEA 5GIPE 4D3DA 1DOHA 4LQ4A 3H2HA 4HEHA 1G4HA 3ETLA 4PFKA 3EWIA 4JQYA 2X9LA 4G5YA 4JUBA 2OD9A 2E6KA 3TVYA 5K0JA 3JZFA 3W1WA 5DFAA 3H8WA 1FMLA 2ONYA 4AYWA 2E5LB 3L8GA 4EA6A 1W9HA 3VI4B 1RPZA 3WLRA 2D1YA 3AJEA 1T6XA 1CNFA 4LQDA 4KCGA 2CXXA 3FR7A 5SZIA 5JNTA 4AY5A 1IXKA 1V7QA 2YVLA 1AZWA 3MGBA 1E60A 3H6KA 2YW9A 2OLEA 4RQTA 3A26A 4ZCSA 5I7OA 2F1KA 3RODA 4J29A 3QE9Y 5JSUA 4D92A 1N77A 5LDDC 2ZI9A 4HNHA 2RAUA 1D9ZA 3ZE9A 3BH7A 4UKDA 1C0IA 1L5ZA 2D3WA 3HM2A 2DTDA 4LTNA 4NARA 3GPBA 1QFXA 1AURA 1H2EA 3TTTA 5C81A 1BE1A 1GNSA 4O4HF 4KK4A 3DZCA 4D0RA 4OLBA 3M49A 3MIIA 3DGFC 1E98A 2FH5B 3O74A 4NJOA 5JWOA 3RYCB 3DYBA 4EI9A 4KQXA 1UFRA 2AE2A 2COEA 3T1YB 1FNBA 4IRXA 3L4SO 2QUBA 3O2SB 1ZPDA 5KQRA 4JEHA 1CS0A 4QFCA 1LDBA 3H16A 4JUDX 4MVWA 1Z36A 4IDCA 1NMZA 2XNJA 4H0NA 4FB4A 2Q2VA 3B7GA 1C1XA 2XXJA 3TX6A 1GFZA 2AMFA 4MOWA 1AZLA 1Q44A 1R5NA 3RASA 4BXOB 3NATA 1WVMA 2QLTA 3HRKA 4JY7A 1TB4A 2O3SA 3AR2A 5BY2A 1H6CA 2CEAA 4QUGA 5EINA 1GTG1 1MO4A 1S02A 3MTAA 3I58A 1YDMA 5LQJA 5A6VA 1A5TA 4CQMA 1HLDA 5JR3A 2C2XA 3EODA 1UMBA 3MGGA 4QL3A 4LX8A 2IZ5A 2XQIA 2X1HA 3CUEF 4IINA 3ZDFA 4I9UA 2IOHA 5DYYA 3I73A 1EFRA 2GI4A 3KT8A 4OGKA 3ZW8A 5GONB 3BICA 3AFIA 4MVJA 3A4VA 4XSHA 1REQB 4V0MA 1IJBA 3NYQA 3L7CA 4YRFA 2GF9A 4UU0A 2Q99A 3LJKA 2GBLC 3FSJX 4HAWA 4QELA 2EP5A 7GPBA 3VPFA 4RU1A 5LP6B 4EUHA 1RI3A 1M34E 1ORRA 1V11B 1Z88A 1ZM3A 2W2PA 3ICWA 4MO2A 2Y2VA 3O1HB 3V5NA 4ES6A 4LMRA 1IFXA 5CYOA 4X3OA 3WLJA 3UJ3X 5DGIA 2B9EA 2I1VB 2X5KO 1KJ9A 3FB4A 1EDDA 4JDUA 5KREA 3OQVA 3PUYA 4XFKA 4AIRA 5CB4A 4WZBB 4MRRA 5LJLA 2HQBA 4O2LA 4QRHA 5E4YA 1FP4A 1XTPA 3PRJA 5F7ZA 4DGQA 4QJ4A 4NAVA 5IHPA 4F38A 1D9XA 2Q5CA 1SUCA 3QP9A 5CVTA 1PUXA 2WA1A 2F6RA 3DKRA 3R6WA 3FUTA 1BS9A 1A8HA 1NURA 2CWDA 4QNNA 3B8EA 3REFA 5CYFA 4AUNA 5C8DA 5KYYA 3S2ZA 3OJEA 1TUBA 4DMCA 2E85A 1I1QB 3KQKA 2B4TO 3R9KA 2A0YA 4P7KA 3GQVA 4JD5A 2ZBGA 3UB4A 3LWZA 3KVVA 1Q1AA 4ZCIA 5TPWB 1FYWA 3SDBA 2I8CA 3U4GA 3FPGA 4Z9AA 3KALA 3AR3A 1EX1A 2F3QA 1NIJA 1EX9A 2ZYUX 3D3JA 4XX1A 3VKUA 3S1LA 4Q4LA 1G0NA 1UBFA 3LLMA 5KQMA 1F06A 4QOHA 1YH3A 1YL5A 2J6CA 1YKSA 3K1ZA 4ROTA 3TSZA 5FTLA 5CVEA 3WJ1A 1S8NA 4LYFA 1A2QA 2GXAA 5E8RA 3L0ZA 2TMYA 1MOSA 2NSYA 1CLUA 2WWTA 3AUFA 4U02A 4ZMSA 5IF9A 1Q1ZA 2J0QA 5TLSA 3HXMA 5JH7A 1FRVA 1P1FA 3BL6A 3I9OA 4UUNA 1CNEA 3HUFA 3AY3A 4C7MA 1W2HA 2VQSA 3ZVLA 4EKEA 4DV5B 2VSXA 1QIDA 1XZAA 3AF3A 1HQDA 1JQ3A 4GMGA 4ESOA 2XGOA 3TTSA 5C8YF 5I4KA 1W4LA 3S28A 1DQPA 3T1HB 5I7AA 2X9VA 2FN4A 2ZS8A 4LZAA 3GWZA 4AJ9A 1C9JA 4KMMA 4BNKA 1A88A 2J0VA 2YZMA 2YY5A 2SBTA 2C0CA 1W5AA 1ZSNA 3BSWA 2EP8A 3IR7A 2ZIXA 3A11A 3LC7O 3NC0C 4HDOB 4JJFA 2J9ZB 2Z3VA 3NVDA 1JQ5A 1FRZA 2CZQA 4GNKA 2FEWB 2HCJB 3BA1A 5EE5B 4O59O 2X4DA 4AN4A 5FQNA 5ALXA 1O9BA 2OD2A 2ZB3A 4ISCA 2J9FA 3GFRA 1U5BA 2ZUBA 4AF8A 2VUIB 1TQ8A 4EK9A 3P9YA 5EJ2A 1A8PA 3RO7A 3V2UA 3SF8A 5EJ5A 5J4HA 4HNVA 1LBHA 3RSCA 4RTOA 3V2GA 2GYWA 3I0NA 1WKCA 2A0FA 4YCMA 1S7GA 4D45A 3D7LA 2XNDD 3QMMA 3DW1X 3N2YA 2XVAA 2P90A 1Y82A 2F1RA 3KJFA 2LRHA 4O29A 2YJNA 3JCZA 4CNQA 1T8PA 3MWLA 3VR0A 3R7AA 2Q50A 1E2MA 2PVPA 3C3MA 1Y3BE 4KUHA 5I3ZA 5EVJA 4F3RA 1HYGA 4FW9A 1UJMA 3OQIA 1J2JA 4D81A 4KYVA 3A7EA 1YHZA 2Z2IA 3WX0A 3C41J 5JIBA 1FCJA 1PHRA 4ZYZA 1I10A 3QXJA 4GMDA 2ZPTX 3VR2A 1NFFA 1SZPA 4UTXA 4ENRA 4CV1A 1BFDA 3C5EA 2A8YA 2D1FA 3NVKI 3MFYA 3NT4A 3JRNA 2D3TA 5HF5A 4L72A 3CIFA 3AH8A 4CODB 3ICVA 1D7OA 1P1IA 2B2CA 1SD2A 4JFAA 2W00A 4HH1A 5GMOA 5HEKA 1FY2A 3B1YA 1KO8A 5EP4A 3LP8A 2KHZA 3RVDA 1S4QA 2IVFA 5B6PA 3VXKA 1PQ4A 1Y4UA 5AM2A 4WFKA 3NOOA 1GAWA 1E66A 3UUGA 1NQ5A 4M1WA 2DLCX 2Q62A 3V8QA 4C0AC 2HSZA 1XMPA 3NYRA 1ZGAA 4NDNE 4AJ1A 1U3CA 3N28A 1C3OB 3T7KA 4P93A 2C07A 4FMBB 5AXAA 1DRKA 1LRKA 1OBCA 1QHXA 4WJZA 1UEJA 3UAYA 2WD9A 4EKNB 1J8DA 4G84A 2VKQA 3EULA 4L0MA 1S2DA 1H9BA 1Q3HA 4QTUB 2G9ZA 3DBLB 2PT9A 3WKAA 5G0SA 3W79A 1B8VA 2GN4A 3UV7A 1W25A 5JDIA 1CJVC 1VECA 2FZWA 4E12A 1YBFA 2ZAOA 2J30A 4QO7A 2VNAA 3M6XA 4KH0A 2P2GA 2VAXA 4PAGA 1U2QA 1FRNA 3EZ7A 4HWRA 3UICA 4DCOA 2E9SA 4WBNB 5IDVA 4BLVA 2EOAA 5G1PA 1YZNA 2ATIA 4BNYA 2DKFA 2GXSA 4G1MB 4GEGA 5AK3A 1KTVA 3DBOB 4ARZB 3VDMA 4CKZA 5JU6A 3CSSA 1N36B 1JR3E 1CDOA 2QG4A 1H3NA 5IJWA 3HJGA 1KQGA 1Z68A 4HDRB 4PGAA 4QPCA 3FMIA 4DIMA 4HTFA 1EBBA 1R3UA 2GPJA 3SZ3A 3BORA 2IXAA 5LU8A 3OF3A 3QXGA 2YR0A 5H9WA 2Q1SA 4Z7QB 4BB6A 3FPKA 1TM3E 4BZXA 5HQ3B 3HI4A 2Y3IA 2HJSA 2D2IA 2JDIA 1X80A 4M0FA 3BXEA 4CTKA 1CIPA 1NSYA 3O8RA 3AUTA 4AS1A 5IDWA 1IYZA 4I66A 1PZFA 1LSSA 4GE0A 1IC6A 1B8UA 3WLSA 4CKCB 2FOXA 5SV2A 3ELDA 3G9UA 5DMHA 1EG7A 1EFPB 1KP9A 2W22A 2AZXA 3AVPA 4RCYA 4ZCTA 3QEOA 4QTXA 1RI1A 2VRWA 2ZJ8A 4NBTA 1RZUA 1W4ZA 2J3MA 2JFWA 3A7DA 3M1AA 3MRSA 4YCLA 1ILEA 3DDZX 5FYDA 3LPDA 2I3ZA 5CDFE 1XK7A 5HILA 3CXRA 7ABPA 3IUNA 4DLPA 1S2IA 3RTGA 1UADA 4BNZA 1U2SA 1L7OA 1JT9A 5DU2A 2YFKA 4DIBA 1Z0DA 3KUDA 4M89A 2B2XA 3FNEA 2P75A 2D1TA 2ZATA 4BQPA 1MXHA 4OMDA 4ZEXA 4DLYA 2POCA 4KE9A 2JD0A 3FB1A 3ETJA 3TPZA 1X1TA 4HSEA 4Q1BA 4R2LA 2I9KA 2IE0A 3K2IA 3UJNA 2HWWA 3M81A 2GEDA 4MKIA 4NR0A 4BNJA 4O1HA 3FGPA 1J7KA 1II8B 2GYUA 4TLCA 3LKBA 4WN9A 1I2MA 4IH4A 1IHUA 1TU0A 4Q7KA 5EIFA 3UG6A 4EELA 3V34A 3PXUA 1BGVA 5FPHA 4R2KA 3E22A 2XUZA 4DDWA 1HYQA 2B5OA 5DNUA 1JKXA 4ZJUA 1S0UA 2DULA 4KLZA 2QUJA 3DR5A 1WL8A 4A9AA 1QVAA 4QBTA 2HCRA 3C3YA 2BFFA 1DCKA 1C3LA 1XBTA 1DC3A 3HA7A 2PZEA 2EHJA 3NGLA 2FW8A 2P1DA 2F17A 5KCMA 4A82A 5JQGA 5IAEA 3HY3A 1JDJA 2XE7A 5SZJA 1U7DA 3JYPA 5KTKA 3DKIA 4YTEA 1I4DD 1K2WA 5LBUA 2JGFA 2IY9A 2VAVA 1TUGA 2WJPA 1FNDA 3PRHA 4UW9A 3AUAA 2RJNA 4QUAA 2WJ6A 3FHJA 1T3TA 2YV1A 5I7WA 3IP6A 1PWEA 3DFIA 3KS9A 3NFYA 4IIHA 5HKLA 5T4FA 2PS1A 3ZG6A 5JZOA 5FTJA 1UJCA 4MUXA 1BDJA 1TVMA 3A14A 2F4NA 4RULA 4P32A 2Z6QA 1Z4QA 2JFVA 5KYWA 5K6TA 4LRUA 3SF0A 4ZHQA 3IAXA 4ZAFA 1ZJYA 1XRLA 4OBWA 1UPBA 2PLAA 3SZMA 4D98A 5BUZA 1VG9B 1SPBS 2Q4BA 1RKVA 3HCFA 4WZAB 3NG1A 4YXWA 2WKQA 5TQ0B 1S2MA 1BOOA 1UPAA 3LLUA 4ZJPA 4P33A 3I01M 5CBPB 5LYJA 4OO3A 3WNZA 1C80A 2BW0A 4MI6A 1QYRA 4Q15A 1EFAA 2OZLA 2N42A 1QH9A 1P2FA 3TPCA 4P4SB 1DTWB 1ZZEA 4H2DA 4EF5A 5HP4A 5AKKA 1BA2A 1YL6A 1FJ2A 3AI3A 1V39A 3O6VA 1QVZA 3NRBA 1N2SA 4I5EA 2G9QA 4BMVA 5HGJA 1SVKA 3TMAA 1U80A 1I80A 4LG1A 1PWHA 3EW9A 5C1PA 2OGUA 1NTOA 2GDZA 3O0TA 4MWSA 5DWQA 4XWKA 2R6JA 4QM7A 4DUYB 4W99A 4YPOA 2FWJA 5D5PA 2J4FA 4MTCA 3STUA 3H2BA 3AKYA 2LIPA 2HA7A 4KP7A 3P94A 4B6GA 3PEYA 1LW7A 2IHNA 4GM1A 3ZZTA 2O8BA 3KKQA 1N78A 5H3LA 1JA9A 1MTOA 1C50A 3G5AA 2WF7A 1VLZA 3S81A 5HZKA 3OG9A 4UHHA 4C4YA 4KN6A 4BE7B 1CUYA 1QXSA 3HV2A 2DPLA 4KFRA 5J4VA 4RJKA 4NCIA 5JFTA 1DAKA 1PVDA 3BK7A 4JP8A 5AM1A 5IJ9B 5K4GA 3KV1A 1KE1A 2JH9A 3HFSA 3N0WA 4GGOA 2CLMB 1SG6A 3HN2A 4DIKA 2I6UA 1HBJA 2IV3A 3T7JA 1I5EA 3RSGA 5EHZA 4CMEA 3ABQB 5F98A 1BMFD 5JG7A 4F12A 4X1KA 1Z28A 2K7FA 3BXPA 4CHGA 3AVQA 4DQUA 2VJBA 5BYKA 4ITUA 1WABA 5TEVA 4QTYA 1RT9A 3OQNA 2IXFA 2BEWB 5LD2C 4RVFA 2WD7B 2FOIA 3CBGA 1N9KA 3E84A 3FW1A 3QYAA 2H9AA 3SHVA 3D9QX 2PX0A 4JGGA 1MHPA 1Y8ZA 1OKKA 4KXFB 2FMTA 2E4XA 2DR3A 3IR5A 2G63A 1YGPA 4J0KA 1YC5A 2C04A 1A8IA 4ZAZA 2GXUA 1AK2A 1PT6A 1ZI8A 2LGJA 2X7HA 4FZ5A 3CONA 1Q0PA 3CC8A 4Z8XA 4PCUA 5K45A 4LBZA 1H23A 3TQSA 1V3VA 3QVWA 4Q1FA 5CH3A 2ZJ5A 1JR3D 4ALJA 4W5NA 4Y6LA 2LR0A 2IOQA 4MJXA 1RU3A 1CZOA 1WNFA 2JGKA 1WTAA 4ZAGA 3PR1A 3TOCA 1R6TA 4PLCA 1JBQA 1XDBA 4RIEA 4UZSA 3CUKA 1LBEA 1HNZB 5IKMA 1RWBA 2V9CA 3U3JA 4B7AA 4Y2GA 2GK7A 5GOTA 3WB1A 1L0BA 2H6EA 2P3LA 5J5VA 1ZMXA 3X3HA 2RAVA 1FUEA 5F2KA 1FUUA 2JLRA 4E32A 2UYHA 1AE1A 2HIMA 3DYIA 1YQGA 1LI7A 1RI5A 2ENUA 1R6BX 2FPRA 2QB5A 5EJ9A 3CLTD 3FPSA 2HM7A 1N92A 3U7IA 3A6GA 1UK8A 4RDIA 1H2HA 5CA1F 3KOXA 4A1FA 4LHEA 4BKQA 5D6OA 3W4JA 1P39A 4I9HA 4IGFA 2AEFA 2G88A 3WXBA 4KE8A 1FTSA 1WCXA 3BCRA 1UT6A 1ID1A 4U4AA 2FGJA 1IY1A 1WBDA 1OIXA 3PL1A 1UM9A 3ICCA 1BYUA 4TS4A 5IUKC 4QVIA 3THXA 4BCBA 4HLUA 3O82A 5HKKD 4YGXB 5ICCA 4JBWA 2V3CC 1ZJWA 1T2VA 3FX2A 3TOVA 2AC4A 3PUVA 3V8PA 4U0KA 1J07A 4C5CA 4BVEA 1GKYA 4C21A 1V48A 4K9RA 4GI5A 5IBRA 2IS4A 1NL3A 3IPXA 1W29A 4AKTA 2YN0A 2DCUA 2EZTA 4X71A 1YFKA 3QPBA 3DDNA 3SHFA 4PG5A 2P3OA 2O4CA 3EGWA 3V42A 2AG6A 4CLOB 5AFSA 4DXAA 4M55A 3DWEX 2ZAMA 3Q15C 5DBOA 5DM60 3VVLA 4UTNA 3WBFA 1CUBA 1E6EA 1EX7A 2NTVA 5GVSA 3AF5A 4G0YA 1PDWA 4IM7A 2ESRA 3OZCA 5CLHA 5IAOA 4YMLA 1O87A 2VZ0A 1V1MA 3MB8A 3RS0A 3QEMB 4CIBA 1B14A 4O33A 4U3JB 5FOUA 4WMLA 2HA3A 1Z4LA 1PS8A 4NJEA 4EG1A 1C81A 2WIAA 5H59A 4FZVA 2VG8A 3LLCA 3N8NA 1DINA 3L1UA 4MYCA 3AC0A 3FCYA 4NU5A 4JGIA 1BO6A 4NCBA 3WDSA 4B5LA 3IALA 4CI9A 2C3MA 2QRJA 4OXQA 4ERXA 3QLJA 1QB7A 4RO0A 4U2EA 4YAOA 2B1JA 2ZETA 1CYDA 1NI4A 3QW4B 1MNAA 4EW3A 2ZCJA 4TXLA 5C0OE 1DAGA 1PT9A 2PYIA 2TECE 5CIQA 4OMCA 3IR6A 3Q10A 5B3LA 3VPXA 5F12A 1P3DA 1UZUA 3I2FA 5CM9C 1VCHA 1IN4A 3MT7A 1RAFA 1Z07A 1ZH0A 3PICA 1KORA 1PD0A 3H9GA 4DCTA 3TL3A 4G1VA 1GU1A 1PJCA 4ETWA 3LRXA 2QNIA 2ZYAA 3F67A 1LGYA 1DO2A 2UDPA 1ZJ4A 3BK1A 3GLVA 2FQQA 4IIEA 2IQ5A 3P9ZA 1BDIA 4A8HA 3QY0A 1T8TA 4F4FA 4XDYA 4CM8A 3GG2A 1I2BA 3IV7A 5KAMA 4AO8A 1E4OA 2WHYA 4Z1MD 4TXHA 4L1KA 4U39A 3VNUA 3LF1A 1NUHA 1A1VA 3TNFA 2FPIB 4B6EA 2IHTA 2FN3A 5T4HA 2VK8A 3PF8A 3LOPA 3RUAA 1COWD 4C4TA 2YS7A 1OVMA 1VKZA 2EIHA 3LCCA 2GSWA 3P0FA 4MA4A 4ZI2A 5DYWA 4C7VA 1H66A 1PEDA 2NO9A 2Y4NA 3NW9A 4WCDA 3ZU3A 3BE8A 4RMGA 1YS6A 2VTBA 3EEOA 1UDXA 3P2EA 4YEDA 4LY0A 2FDCA 2CN1A 1SQ6A 4RENA 1CR0A 1R0ZA 2KBEA 2QLMA 3N58A 5DF1A 4OG2A 3U5TA 3L0IB 2Q0SA 4JBHA 4AUMA 3UH1A 5CT4A 1XWWA 1PTKA 2V1UA 1BNCA 3AV3A 3HFRA 5B1DA 3QKSB 1XRSB 3GDHA 4LJ7A 3RSSA 4DEVA 2JF0A 4NYMQ 3KEMA 2HKIA 3F8TA 1Q7BA 4GGMX 1K08A 1FP6A 3JD1A 3VTZA 3L7KA 5KSZA 2P4EA 4H1TA 3PIDA 4EPYA 4FYYA 2H31A 1KMHB 5CRIA 3UA3A 5KB3A 3BYZA 5CYGA 2EKBA 1Z25A 1D6JA 1TKBA 2J7PD 2VP9A 2ZP1A 5SY6A 4WX2B 3H05A 1CE8B 3ON5A 3ZJ4A 1WUYA 3G1UA 2HJHA 3FPLA 3Q2IA 4RIGA 3RKUA 2CVQA 3W8EA 4TQGA 4UU1A 2Z5LA 5IARA 2H2WA 4NU8X 2WB2A 3MUFA 2CNNA 2AN4A 2JLQA 2FU5C 3GUHA 1PLLA 4LC0A 3K9GA 5TQ2B 4CR6A 1XAIA 3GT0A 2HWUA 4DPKA 1IXYA 5TSDA 5I7FA 1OXSC 1KPGA 1E79D 2AI1A 3SLKA 1SBZA 1QZTA 3VZPA 3IP8A 4C1NA 1NJ1A 1Q0SA 2ZE7A 1Z16A 4PWZA 1JTFA 3VPDA 4B8WA 1RM0A 3T1TA 1DIAA 3GDFA 3I64A 5CJJA 3D5EA 1XDWA 1L7DA 2JGJA 3I9FA 3NM6B 1KOJA 4LFCB 3AX6A 3S1AA 4B3HA 3OPNA 3TGLA 2IV2X 4AZ3B 5LMZA 1XDGA 3U7GA 1RWPA 3CINA 3H1FA 2BFBB 2Q8NA 2ZYSA 4RJ2A 5JO0A 2H07A 1NDQA 1F20A 4JXXA 1LVUA 5GZ6A 2ZUEA 3LMKA 2I2XB 3CUSA 4LF6B 4BTVA 4HNGA 1HWYA 2KSQA 3TUJC 1R1DA 3HBNA 3V1TC 5LZ8A 1XCBA 5EJGA 2JFNA 4YMVA 4HMPA 4COKA 1VG0B 3I04A 2C9MA 1T1GA 1E0KA 3QA9A 2GN1A 2RDMA 2QXTA 4KXUA 2O8FA 1J5EB 3CQ9A 4MUBA 3W2FA 2IYUA 4IHJF 5DNEA 3FCUB 2CLLB 5KKAA 2PBRA 1OF1A 3MUEA 3FKSA 4F7DA 3WK6A 5BUCA 2W6CX 4UHJA 2NUTA 3SVTA 4DCSA 2JKZA 1SUEA 3KJEA 3V4RA 3BTUA 3WA6A 1MIHA 2BBTA 5D87A 3VISA 2PSJA 4ND3A 1FQKA 4MDEA 3EDQA 3P0HA 4CN9A 5E1MA 4Z4QA 5F1OA 4I36A 1MO2A 3QFTA 1XIVA 3DUFA 4AUKA 4DBLC 1PZNA 2FZKA 4MWCA 4MWTA 3SYTA 1Q95A 2IL1A 1K7EB 2FEMA 3UMSA 2EBHX 1RWOA 4ZC8A 4BHTA 4LJKA 3ETCA 5HDBB 3U3MA 1YDWA 4ZDKA 3EASA 1P81A 4OGFA 3AUXA 3AERB 5EJFA 3WYNA 5FP0A 1J90A 2HV8A 1DBRA 1TD9A 4PO8A 2WU8A 1C4OA 2FPUA 1QWOA 1HNXB 4CKBB 2GFQA 3VZDA 4KN5A 1TT5B 1IRXA 1E3TA 4QHSA 3WHLA 5KYTA 4WW0A 5G3ZA 4PYRA 1ZD3A 3FRIA 3PFNA 1J06A 3P9RA 2BRUA 2MSCB 4OM8A 1RIFA 3IMGA 4R98A 2PZ8A 4BOYA 1SQ5A 4YRKA 3QTTA 1SVIA 3FCAA 2NU9B 3D7SA 1F9EA 2ZIAA 1J0DA 3ANSA 3OCVA 3OT1B 4PXYA 1I4LD 2D00A 1T35A 1V7CA 1UCFA 4RW0A 5KC9A 4L02A 1Q83A 1JB9A 4QIHA 3V3KA 4UE3S 5EKSA 1KFCB 3DBHB 3DLBA 4GNRA 4D8YA 3RHFA 4IDQA 5B4UA 4EYSA 2QJWA 3MTQA 2GAFA 4NU6A 2YWEA 4PSCA 4XW2A 3E35A 1Z22A 4FYIA 3S4YA 3TAUA 4YUYA 4RMNA 2ZT6A 3OY2A 1GDHA 5FX2A 4JLDA 3PYLA 1OFUA 2I6TA 4D25A 4G07A 4NAUA 4ATNA 1LC0A 4NXMB 5F9FA 1HFWA 3DXZA 4WCVA 3ZWMA 1T6NA 1X1CA 5CD9A 3VX3A 4RZ3A 2M6SA 1BRTA 1C3XA 3UH0A 4MGYR 4L73A 2VIIA 5HZMA 1KVQA 1U3TA 1DLJA 1ZI9A 1WZUA 1HT3A 2ZJ2A 3DOFA 3DOIA 4UNNA 4C9BA 1F6DA 1XDUA 3DE0X 1ZA2A 1WKVA 1Z2PX 3WQSB 1HETA 3NETA 2OGZA 3MFQA 4RA6A 1ML4A 3V4PB 4Y6QA 2MYUA 2G6TA 3PFKA 2XXAA 1ZY2A 3H0CA 1UFQA 5B7NA 1Q0HA 2W37A 4Q16A 3WB0A 1FP7A 4Q6BA 5JT1A 2PEZA 1QHHB 4ER5A 1Y8RB 2C61A 3QNWA 5DGDA 3QVOA 4EHJA 2GCOA 4LGCA 3IYLW 4UVEA 2H9YA 4A0SA 3EVFA 5EZYF 4C3VA 4L9AA 3MCUA 4L9RA 4DJTA 1IEQA 1VG1A 3PGMA 2GDJA 3EXFA 1EEHA 5DHRA 3FCOA 1A2OA 5ALQA 1MABB 4BCCA 1LS1A 1RJ9B 2VK2A 4HLDA 1VSUA 2O2CA 2XCSB 1UWKA 2PKQO 3FGZA 3OURA 2IZOA 4Q9DA 5JRZA 2XUGA 4IG4A 1SQ0A 3GLQA 3QVSA 3M3PA 1L5OA 1UPXA 4B83A 4R6XA 3JZMA 1WTCA 3LXUX 4ER0A 3WGYA 4EG4A 3HWRA 4CIAA 4FNMA 4FB5A 2JEOA 2HO5A 4QQFA 1RWMA 1Z0KA 2VHQA 2HQSA 5GONF 3UMJA 1P6UA 1C7JA 5HHTA 1W5EA 2I8LA 4WLFA 4F91B 3MBIA 1IOWA 3SS8A 3P26A 3E7FA 2HB6A 2GRAA 2WUEA 1B93A 3QBJA 1OXTA 1MOPA 3EXG2 1JSZA 1YAJA 4D4KA 3HR8A 7REQB 1VIYA 3A3YA 5LP6F 1VMIA 3OLXA 4BNUA 2LDXA 1VZ2A 2DE0X 2GPBA 2JI6A 3ACDA 2R44A 1Y5RA 4D6PA 2JJ1A 4ZCMA 1Z8HA 1M8JA 2QX8A 1ISIA 1LTKA 1SCAA 3A10A 2OFOA 5H81A 3L7BA 3OOWA 5B57C 5BV0A 4B5KA 2O7NA 2OC9A 1FRFS 3N53A 4F2HA 2JJ8A 2QVCA 2YY7A 3KT3A 3GFBA 5ITZB 1ZUNA 2GBFA 2IS6A 1CU1A 1F51E 4GFDA 4KE6A 4ML3A 4W5WA 1Z45A 2A88A 2V0CA 5LQRA 4EB0A 2C4KA 4OI2A 5ESWA 4ZJYA 2PUCA 3AV0B 2WQ6A 1JLHA 2PBZA 1EB8A 4Q9LA 1VOTA 2WVHA 5CB0A 2HA4A 1NOKA 4URUR 4HNAA 2VWPA 3JQBC 1KFEB 2YWCA 3CZMA 1UOPA 1EWYA 2EV9A 3SYRA 2C42A 2HA6A 3JARB 4HNSA 1ZEJA 3O4IA 1SJ9A 5A2QA 4EFKA 4JYZA 4PZAA 1W8IA 2R60A 1K75A 5CLLA 2OV2A 3CRNA 5JJIA 4NE7A 1X7WB 1IPEA 2YNMC 4L8VA 3HZOA 2H5EA 4GYWA 4MIYA 5FTWA 4EYKA 1V5WA 2G6BA 3ITKA 2CZGA 1U1CA 1YOBA 1QRTA 5IYZF 4KQKA 3NLLA 3AI7A 4M9ZA 3IUSA 5KC8A 3CZ9A 3ORYA 1E2FA 4QYIB 1JX6A 4JCOA 3ZE1B 2D5LA 2EVWX 3T35A 3E05A 2SNIE 2VRNA 1RRKA 3GNSA 4PNHA 4G1EB 1R4AA 1TZJA 2ZRLA 3T7TA 3E7XA 4HL6A 2ZB2A 2ON6A 1EGHA 4CG1A 2WHPA 5GGYA 5G53C 3ETEA 3W5DA 1ISSA 1GLVA 1I0ZA 1M2NA 4KSBA 3SDZA 4D0SA 4CKWA 3GLFB 4X1IA 4CIWA 2IH5A 1S7CA 2LWIA 2DPYA 4X44A 5DN9A 3WLTA 1ENZA 1R4MB 1Y1RA 2LUOA 4ITRC 1C1DB 4DQXA 4E4RA 4E51A 2XF8A 2GD6A 3ID6C 1CY2A 1ELOA 3D02A 3FUVA 3UZUA 1ITZA 3IE2A 4U7TB 3PGVA 5EE0A 3AEQA 4MRMA 4EJMA 1H0KA 2JCBA 2ZWPA 3FWZA 2X0EA 3WGVA 1GYRA 3KKPA 5F76A 4IMPA 1XVTA 3CR8A 2FSSA 3PJEA 4OA5A 4UDXX 4ZP1A 4F92B 3A58B 4RQUA 2BGMA 2IOFA 1AF7A 2GEBA 3E0QA 4L50A 4LJ8A 4WLEA 3V1UA 3K70B 1QGZA 4OLAA 3INNA 3JD2A 2KX7A 2POQX 1YHNA 1CZHA 3MT9A 4KPEC 1JDVA 2WU4A 4YREA 3JTMA 1RBZA 2V0NA 3A1SA 2V7EA 1A97A 3KQWA 4NPHA 4MW6A 1NP6A 1WDMA 1Q92A 1PJ8A 1X7YB 2HY7A 1ZM4A 5EMNA 4OLHA 1NR7A 1W0KA 2V4MA 2H0AA 1U6IA 2P9EA 1B16A 1K6XA 1N7IA 2YZGA 3EXHB 3F8WA 3I83A 3NRCA 1V25A 2K87A 2P0YA 4ZOLA 5DNYB 3OEHD 4CCYA 4N9QA 3SC2B 1KI4A 1T3HA 2QMYA 4BZWA 1A9XB 1J23A 1ZH2A 3R6TA 2AYXA 2VUHB 4LX0A 4GOLD 1U98A 2OXCA 3FTEA 1RVV1 3M9LA 5HIJA 3T1OA 4A4DA 3BK2A 1CQJB 2FSVC 5I7SA 3K1TA 1B6SA 1G4AE 1XZNA 1T6BY 3LWNA 6CHYA 3E9EA 4X8LA 3LGSA 3BBLA 1M2OA 4BFSA 5A4AA 4FCTA 3G9XA 3ZOKA 2A5LA 2A35A 3E82A 1GZ7A 3LVRE 3QVTA 4MQUA 2ODEA 4IP0A 1CV2A 4L7QA 3JWPA 2CJPA 2Z2ZA 3ER8A 4Z4GA 3PX7A 1VKJA 1K7FB 4PIPA 2BFDB 2MSWA 1ZHFA 3K09C 3HZHA 5DNDA 1T5OA 4JWKA 3ROMA 3C7CB 1TW2A 1T91A 3FYTA 5EMJA 1FFSA 3H7IA 1WW2A 1L5GB 3AVWA 1E1NA 3E0XA 3U48A 5HOEA 3TAXA 2OXIA 1TUEA 2WWIA 2I9PA 4JLAA 5BORA 2VBFA 4KVAA 4WBNF 1ONOA 3NMUF 2I03A 2XNCA 4MIKA 1F48A 1MB3A 2VDQB 1DKOA 2IPXA 3AJ9A 1ZH6A 4N0EA 3UGKA 4UTVA 4DEYA 1EWKA 2AFIB 4RAOA 4OHZA 3UXYA 4C87A 3GB9A 4BWVA 3KL2A 4LQCA 3TXAA 3HYLA 5F35A 1XZPA 2AFRA 2KMLA 3OOJA 3EDYA 3K0FB 4WTOA 4ZYLA 3WGNA 4B85A 1PUJA 3L7LA 5JD6A 5JY1A 1EE2A 1T8UA 3KNZA 4U7GA 1XAHA 1EDZA 2P1RA 2QTAA 4GMXA 5DP2A 3PHHA 3FOWA 2WBLC 1IQ0A 1E3IA 4QD3A 3SLRA 3C74A 3PQ4A 4OU5A 4UD2A 3UMRA 1GZDA 1QHGA 3PHBE 1EXNA 1LUAA 1SUDA 2I7CA 3QHPA 4DARA 2WPNA 3BFPA 2IHVA 5AK4A 1R8YA 5K1ZA 1R9JA 4TRJA 2GPWA 1MR3F 2O8EB 4K0RA 5CLFA 2MMCA 1OJ7A 2R5NA 2ABWA 5G41A 1L5HA 5K0FA 3OX4A 3ADKA 2VK1A 4XPIB 4N41A 4HDAA 3VQTA 3VR6H 3K5HA 1GAXA 1XMVA 3TJZA 1ZICA 4XUCA 3HJBA 3BH0A 4R7ZA 5AOCA 4S1TA 4CR8A 3CXUA 3QQ5A 4F6RA 1BHO1 1E0JA 5KNDA 1ZVKA 2FWPA 3MOSA 3LFUA 3KR2A 4N54A 2FEAA 4CMHA 4MYHA 3WQBA 3ZC3A 3DDSA 3FG9A 4HZUA 2CXTA 1GQRA 3TD2A 3PKIA 3IDOA 3PXDA 4MUAA 1NBAA 4IIDA 2CDBA 2B1QA 1L5RA 1J42A 1FK8A 2WE7A 3I6QA 3KQMA 4LVNA 4OYHA 1N2ZA 5B58T 5A3VA 4BYGA 4YRZA 2UYGA 1KR5A 1L5YA 3VPAA 3MB5A 2JANA 3JRXA 5TF4A 2FUG6 4Q7MB 4BWYA 2O2JA 1Z17A 4K1LA 3GUZA 3RYHA 3HCCA 4QT4A 4OHRA 1VE7A 2OO3A 3ZHZA 3ND6A 2ECFA 2FFAA 3C6KA 3MT8A 2YJ3A 3R09A 4V38A 4KQJA 5DBEX 4BLWA 3GEEA 5DEIA 3EGXA 1WB6A 5CW1A 1HF3A 3ZI0A 4KOEC 3JYHA 1ISJA 1QS0A 3D7NA 4RLSA 4K6OA 4UMDA 1AJEA 2YBDA 1UBHS 4ICIA 3CEPB 3RROA 3TUIC 3ZZ0A 4OVKA 2P9QA 2HSGA 4NCAA 1QRDA 1X87A 3AJ8A 3LQ2A 4N8EA 3K0BA 1WKBA 4MPRA 4OSOA 3W8NA 4EUSA 5JPIA 3ESYA 5AXCA 1F17A 3DVQX 1Q77A 5DBIA 1OE0A 2IEAA 1U9CA 4HKTA 3ZWWA 1N32B 1QIMA 4D2IA 2VH5R 4BC1A 4KAFA 1W5SA 2HF8A 4FONA 4NJMA 2W11A 2ZTSA 9ATCA 2MSLA 3VOBA 2WOJA 2IEZA 4CG2A 1JFLA 4YRBA 4L5AA 4OB7A 4G5GA 2VTEA 4G63A 1OKKD 2FPSA 1NT4A 2ZYDA 3DFKA 1OGIA 3HLTA 1EUDA 1W49A 5AJYA 2HQOA 4U63A 5EPEA 1NU8A 1RM3A 3V9PA 1OY1A 2HU5A 4MZDA 4B74A 4COOA 2F90A 1NHWA 1CWUA 3NAGA 3NOVA 4WLVA 1J9EA 3K0EA 1XP5A 1X0VA 4LMPA 1MXFA 5J2TB 1X1RA 2WZCA 4HYYA 2NZXA 4UBIA 5HIMA 1PUIA 2OOKA 3GMSA 3LC1O 4GOXA 3KKEA 5DXFA 3IT1A 1JHMA 1LD3A 1IXRC 1I36A 1DE0A 1YE5A 4GOOD 2VTVA 1PYOA 2KYRA 3VVBA 4L6IA 2YHUA 1ZR2A 4HJRA 3OF5A 4FKZA 4MS1A 3O21A 4EO4A 3FNGA 1GFWA 1QCZA 4F0JA 3HCNA 2ZR8A 2QE7A 4XUEA 1E2UA 1TJ3A 4RABA 1FSFA 1U0RA 1E2LA 1L7BA 4KEAA 2EFJA 2G5CA 2O3UA 1AO3A 1YRYE 1MB2A 1T2UA 3M3HA 2MIIA 4ZV4A 4B3CA 4O8CA 3A70A 3ITNA 1I8TA 5LQSA 4B84A 1WU7A 5FWAA 1U63A 2UUBB 3BIJA 1T5IA 3RFCA 3RAPR 3NC4A 5AJZA 1TMKA 1PI3A 2L2QA 5DXAA 5JZMA 3B20A 2I6QA 1X70A 2VAMA 2FG5A 4CM3A 2QQEA 1QFYA 3DEAA 1K92A 4RVSA 2PL1A 4YV7A 2Q5HA 5DYNA 4BNGA 1QP4A 1UP7A 2G07A 3Q1LA 3WYCA 1HE3A 1U7ZA 3F6YA 1HZZA 2GWHA 4OQQA 3O4HA 3NDJA 5FO0A 2NNLD 3NBKA 2OCPA 2QP4A 5K05A 2TSYB 2W2XA 1E59A 2RHGB 3D2AA 3LYLA 1O96B 3GJTA 5ED4A 2ADFA 1MDFA 3VH4A 1Y6FA 1GSHA 1PR3A 1P77A 5A6SB 4P31A 3P2JA 4A8JA 4TRNA 2OCLA 4XKJA 1PW5A 3KTDA 1RQLA 2P0EA 4GO1A 1E1CB 4ADSG 1LLQA 5IABA 5ALZA 1CY4A 2HTFA 1OLUB 1DKMA 3W7BA 2ZRPA 4GG1A 4IR7A 1Q2UA 3E9ZA 3IIMA 3TLXA 3WLIA 3ZE0B 4C01A 1P0FA 3NHYA 4DANA 1YRBA 4DBVO 4DSZA 2P11A 2P2LA 1P29A 1SFRA 3EYWA 3ZWBA 3BDVA 4R1OA 2AFHA 4PHFA 2JVKA 2HQ1A 3G2LA 4KNVA 3MJEA 1R6DA 1K3UB 3TO5A 2PZAA 3AM5A 2QN1A 2WP8J 1XRNA 2ZZKA 4JJGA 5FTNA 1XNRB 1X1EA 1Q12A 1B7GO 5F5XA 4DIFA 1VPDA 4CLDA 1OT3A 1EJBA 1V5FA 3TZEA 4ED9A 2BHTA 5J59A 4BX0A 1KOFA 1A7UA 4LY6A 3WLKX 2RKBA 3BGIA 4MKXA 2H1CA 3SR3A 3GHYA 4AKHA 4DABA 2WIJA 3LHKA 1ULHA 4HQ0A 3GYGA 5AXBA 1R7RA 1G0OA 2JEYA 3VJRA 4QOGA 4EQ6B 2Y8EA 1TQ6A 1GAQA 1M1YB 3NJ4A 3O8NA 1SKQA 4ND1A 2V6GA 4P8RA 4JN6B 4OCZA 2IJGX 3GNLA 5ALSA 1JFRA 4MV5A 2EKLA 3VPBA 1YL7A 4L8LA 1X0XA 2GVNA 1HE1C 5BYAA 1GV0A 4TKMA 4JT2A 1KZHA 1BH2A 2FK7A 3BWVA 5D84A 1BXRB 2NMVA 1AXRA 3B9PA 4Q4HA 1UJ6A 1ZCAA 1PR4A 4HXYA 3IQEA 1QIFA 3PDIB 3HXOA 1OB2A 4CLRA 1T8SA 3KXIA 3U4DA 4J0IA 4HB2A 1B6GA 4P3YA 1ZD2P 4TTIA 4TSFA 4LC1A 2AL7A 3CWCA 3JW8A 1EDBA 1MUUA 2XSZA 5FUYA 4ZT5A 3YASA 2RHMA 3ZD9A 4EVIA 5B7QA 3LY9A 4IGIA 5HYVA 4ACAA 3WADA 3OQPA 1S1MA 4MUMA 3VU3A 4ENPA 4PX9A 2A33A 4HDSB 2WF8A 5L7TA 3FSGA 5AR1A 4JR0A 4CEHB 3CBQA 1QIHA 5JVDB 1W19A 3AESA 3ELBA 2JI4A 3GJRA 3ORRA 4I9GA 3VJLA 5H16A 1NQXA 3ESAA 4LOIA 5JSQA 1VJCA 1N0WA 5HX7A 5J4YA 5LZ7A 3X2FA 5KWJA 3B1XA 4MS3B 2C78A 1T2NA 1U8YA 1MV8A 2CLIB 1JYSA 5JJ5A 2J3KA 3VR4H 1G9SA 3ZD8A 3GDWA 4DRZA 5B7PA 4MIEA 5G0UA 5IMBA 3EQ6A 4C5AA 3N3BC 3WYEA 3G5TA 4EJ2A 2C7QA 4Z49A 1KTIA 3OY7A 2IF0A 1GWNA 2QIOA 1JT2A 4I5FA 3U0BA 4TYMA 4QVGA 4UCXA 4EOGA 1NE7A 3R0XA 1EBFA 1FFXB 2P4QA 2Q5EA 3H83A 3HVJA 4BMPB 1YJ5A 3D7MA 4FYXA 1BAPA 1HZJA 1XXHB 3FE2A 4RFVA 2OG1A 5ER6A 4UHBA 4EB6A 1XI2A 2DUJA 2VDVE 3QX8A 2X3YA 4JJKA 5DSXA 3O03A 4QUBA 3U4AA 3H11A 2OZKA 1VSBA 1MJFA 4N5DA 2F8SA 2OK8A 1T4MA 2QORA 1HMYA 4OK6A 4NCJA 2HXGA 1CVRA 4RPGA 3ILYA 3C15C 4TLDA 4C0JA 1L5VA 1AQNA 5F5LA 3UJ7A 1WNTA 4FGUA 5BMVA 6NULA 4P3XA 1KKUA 1R6VA 4FHZA 1OVGA 1NNI1 1QH0A 4X66B 1Z18A 4I50A 3HCAA 4MVYA 4NCNA 3FDZB 2OECA 2AD5A 2PMDA 3E58A 4LXIA 5AW0A 2IBTA 2X9QA 5KINB 4JL8A 2XT9A 4TT3A 4YB8A 1GADO 1L4HA 2Q29A 4D46A 1TLFA 1LJ8A 2XB8A 2PPVA 4IXTA 4RYLA 2DHRA 1KF0A 5SY4A 1U99A 4RHFA 1EFTA 4OM7A 1PTJA 4TS1A 5KNLA 1S9DA 2IGTA 1MO6A 1TD1A 3T0IA 4YP7A 3TLYA 3LO5A 3MA0A 1E6KA 2AIRA 1IUPA 4WADA 4G1BA 2PJDA 3TKLA 1VYUA 4K9DA 1V16B 2JI9A 3UMYA 1BD3A 1J9GA 3HH8A 3Q9SA 3MWGA 1XQ6A 2AQHA 5LIRA 2CDAA 1EVQA 1HQYE 2J7KA 3KELA 3PL5A 2C9CA 5LXTA 1WCIB 2ZPUA 3L79A 4BCDA 4W82A 4H7FA 4BNVA 4DLXA 1KJJA 3DC7A 2CY0A 2J9GA 4DQLA 1OLSA 5ELLA 5I4IA 1R9NA 1IVYA 2JFGA 4EA9A 1T15A 2H9IA 2I2CA 2O4UX 3FPEA 4LI3X 4AJ4A 1P2SA 2EL9A 1MV5A 1EUZA 1FLVA 3K8QA 4N3AA 3R75A 3HTXA 4DV7B 1DRWA 4FMDB 3OQHA 1ZYUA 1H1LA 4B3JA 1KSFX 4F1WA 1XQ1A 3COYA 1EXVA 4KN9S 3AVXA 1Z6PA 2YFQA 1W94A 1YJAA 6Q21A 3UAGA 2J0UB 4P3PA 3FKSD 4QSMA 3FCSB 3BIWA 2M2IA 3RF7A 1Z34A 2VDKB 1XJQA 3IOYA 4NL4H 2OB1A 3BPSA 3O91A 4FKBA 3JQAA 3G17A 5ITWA 1YBVA 3ONVA 3EAQA 4Z9BA 1V8DA 4YRTA 2BFCA 1QG2A 2Z83A 3OM9A 5JMOA 4UDYX 2SKDA 1DMRA 3ILVA 3WKCA 4QKQA 5K09A 2EBWA 4LOAA 1JQEA 2H4ZA 2LD4A 2OHXA 3BGWA 1H69A 2VBIA 3GVHA 4WH0A 4CV3A 6REQB 2VP3A 2C7RA 3EA4A 1OZFA 3R3SA 3T4EA 2CHQA 3IUPA 4QQ8A 1QTRA 3E70C 2DLDA 2EERA 1SCQA 3LD9A 3UQZA 4Q7EA 4WOCA 3MGAA 5EXEA 2V6FA 3OQBA 3G8AA 4ONEA 2PKXA 2AR9A 3ABRB 3CR3C 4PCVA 3ROKA 5T8KC 1P4JA 3ER6A 3LZCA 4LWOA 3RREA 4JL6A 1LBTA 2JAQA 1VCNA 4JVMA 2VZLA 4M7PA 3KDPA 1ZRNA 7MDHA 4FIZA 3H1BA 4NAHA 4UBJA 3TZCA 4MW0A 1N0VC 5K8VA 4FFSA 1E9FA 4GM4A 3E15A 4M0KA 3SEAA 1WO8A 4JI0B 3OETA 3OU7A 2PSDA 2XQFA 3S8EA 1QLWA 5DXJA 5L7YA 4M8SA 1Z74A 1ADJA 1ETUA 4TS9A 5H0IA 1KYIA 1X92A 1RWVA 2X40A 3PEVA 4PPGA 1XXHE 3PB3A 5I45A 3KOOA 4UUPA 1YE3A 1E9DA 1KHTA 2Q27A 5JFGA 2A9RA 2MYNA 1LV8A 3RYIB 4JK3A 2G1JA 1OPXA 3DQPA 1A76A 5DLYA 3JQGB 1SBTA 4DUPA 3HB4X 3B6JA 1LTHR 3IKVA 4DT1B 1AO0A 4A0FA 4R9SA 3Q7IA 4B3IA 2QY9A 3BJIC 3I6YA 4Q21A 4XB1A 5HFAA 3D3WA 5JNRA 1RJDA 5K3FB 3ZYZA 1RLIA 1T5BA 1FS4A 3F8SA 4QTTB 3QKUA 1ACLA 4M1SA 4MLCA 1E9AA 1W47A 2XRMA 4TS3A 3ZWAA 3IIJA 4RE6A 2C8JA 3C2QA 2UYOA 3GEMA 1DC7A 3ILSA 4UARA 4B3XA 4D3YA 4KXWA 3AVUA 2G5TA 5JDCA 2Y1WA 5F33A 2F9LA 4MEBA 3SOPA 4BFYA 4X54A 5KTPA 2G71A 1UOOA 2H1FA 1OWOA 2X8JA 4RZXA 5CDGA 1FS5A 4A36A 2VPWA 3QMVA 3UUWA 1AMOA 1RMTA 1KJQA 1UBRS 1H5UA 2CDRA 5GOZA 2NV6A 3SBOA 4PWYA 2C3PA 3VHQA 2PKCA 1YQWA 2UUCB 1TYDE 3EAFA 3P32A 4JMLA 4E09A 4IG9A 2BEJA 1E4EA 3LPCA 4S2EA 3FF4A 3KR0A 4G0OA 4GR9A 5A9SB 3ZJVA 4PGMA 3WGOA 1PP4A 5DK6A 4UUOA 3SE7A 4F11A 3ODGA 2NUPB 2WVJA 3CG4A 2B5WA 3KTAA 4FEAA 4KYIB 2GPNA 4O4LF 4OQNA 4XASA 5CG2A 1PF7E 1AX9A 4AZ0B 1CTQA 3IJEB 3AZPA 2OO5C 3SC6A 5IFKA 2PM8A 1DIRA 1P7PA 1YVRA 1R0CA 3H9BA 3SJAA 1KJNA 4HI0E 3D4BA 4FD2A 3UYLA 1WX1A 1EESA 2P40A 4CCAA 1BEEA 1KI3A 2JGNA 3O95A 3P97A 4CTMA 5E6SA 3FFTA 1GZVA 2CFOA 2PNFA 5FDFA 2ZM5A 2HU2A 2ZIGA 4PG4A 5BSGA 1G6Q1 2HDWA 2Y1EA 2Z1DA 3I2KA 4I8IA 3CVOA 4B0OA 4FOSA 1MTZA 4Q6WA 4RKFA 2ZBEA 2C8VA 4Z7JA 3BHJA 2JJ1D 1JEQA 5KQGA 3ILHA 1HOXA 4CTNA 5AKGA 4TV8B 4ZI5A 4DMHA 1LWNA 4FEEA 2E89A 3NI2A 3TLGA 1JNYA 1P0PA 1QHNA 1T2FA 3NDRA 1M0WA 2C03A 4D99A 3BFJA 4GDFA 1EZ4A 4M83A 2ZRNA 1XNJA 3QRWA 4P35A 4D9FA 3MWYW 2YVUA 1YOVA 1TYBE 2EJVA 3KXPA 3IAS1 3BCUA 2QPLA 3QVXA 3KHSA 3WYAA 5BV2P 3HUEA 1PJAA 4QC2A 4G65A 3QLTA 1U11A 4JELA 1M6VA 4B6FA 4OUDB 2H5JA 1BWQA 2CVHA 4NEQA 5KVCA 3Q0IA 1OI7A 4LDNA 3IEMA 3H97A 1BOFA 2Q1WA 2B4AA 1B76A 2MR6A 1JIXA 1UQUA 3HCDA 5LA6A 1D0VA 2GPAA 2E0IA 2SECE 1U1IA 4PQRA 5AKZA 4CLEA 5C51B 2B0JA 3C3JA 2DY1A 4QTZA 4J03A 3KPUA 4M0MA 2DU8A 1C9KA 2JFUA 3BUSA 4IS3A 2MCFA 1ZOIA 4IPTA 3GHHA 1KZ1A 3JQ8B 1VB5A 5LP6C 2H1WA 3CGGA 4M9CA 4XWGA 3NORA 3VH2A 4ZTUB 5K3CA 4S12A 3TVTA 2NX2A 4TMVA 1OH6A 4GL2A 1KZYC 1Q7GA 3TQIA 1PDOA 1LK5A 2YZ7A 4HTAA 4K2HA 2JNWA 4JUAA 1I1HA 3K31A 2C9OA 4G9BA 3Q8MA 5EIEA 1DJOA 1N1GA 4G0QA 1ECCA 3FETA 1L9XA 4LXQA 1CR6A 5B1YA 1KVUA 2JVJA 3IODA 1A27A 2NTYC 4F5DA 1VL1A 2NO7A 4LNUB 3X2EA 4YJHB 1U4SA 5DTQA 1Y6RA 1WOMA 4HAOA 4E7PA 1PFQA 3DMTA 4QARA 2Y99A 3BZBA 3KB6A 2XX3A 4ZEWA 4PZ0A 2H11A 2HEIA 3NHRA 1TM4E 5TPZA 1N0UA 1QIGA 5F7JA 2PZGA 1G20B 4WKNA 3N76A 3U60B 3LXRA 4BVBA 4UMVA 2AH5A 3P2YA 2F9FA 5MHTA 5KEIA 4DC1A 5KDDA 1AV7A 2DT5A 3DOUA 1HR0B 1P0CA 1G7RA 4PN7A 1KPHA 1V8BA 1E6CA 2C4WA 2GZMA 5EEGA 1CUVA 4E07A 5IT5A 2R7NA 1X9GA 4DV4B 2W7TA 2ZW9A 3MXTA 1HEIA 1XTBA 2JGDB 3B60A 1CY7A 2I1WA 4EP1A 4CDMA 2X2FA 3KHKA 4FBLA 3ZH2A 2WLSA 3BXFA 1KDPA 3IJPA 1IEVA 5ALNA 1PN3A 2NV2B 4MI1A 1V6SA 3AKCA 4II2A 4C7JA 3TG8A 2DWCA 1BKDR 4F6LA 2QTGA 3LDUA 3EMKA 1FQJA 3JQFC 2N3ZA 2IHYA 1U8UA 3ND7A 3RS4A 3NU1A 1RFLA 2CJXA 2BBWA 3CE6A 4QECA 4AKEA 2OORA 3H5WA 4I55A 1GPBA 4TOIA 1GUAA 3MILA 4IDOA 4D8VA 1E5XA 3A05A 4E1VA 3FOZA 4Z0HO 3TJMA 3VSBA 1YBMA 2XZOA 5ALIA 3TSOA 3DDUA 1UJ5A 3TSWA 2G77B 1V5EA 1CJMA 4C07A 2W2MA 3TGWA 1O94C 2ZDQA 1TK3A 5JHGB 1QR2A 5ADVA 4FD3A 2VYVD 5DWVA 3QEAZ 1YR9A 2HH9A 2CUZA 4FM9A 1YRAA 3FTPA 2F7SA 4IDNA 4FILA 5DGTA 3DZBA 3W7AA 4BJ3A 5A2GA 1ULBA 2JB9A 3UCEA 4Z99A 4DWWA 1GG2A 1NN1A 4XGNA 3RIEA 2GNOA 1VSQA 2VEDA 4UVHA 3U4HA 3VSAA 5GZ1A 1QORA 1KK2A 1YC2A 3R7FA 4D56A 4CMKA 5IUNC 1CS0B 2B99A 3F3YA 4JGBA 4JENA 4OQPA 2IXBA 4R8KA 4ZVPA 5JJBA 2AXNA 4F3NA 1BXZA 4P7FA 4BKPA 1C1XB 3FRHA 2EZ9A 3LL7A 1YULA 4UAJA 5LQUA 2WE8A 3ZXSA 4LYAA 3AUYA 2OBBA 3EXIA 2RH5A 4DBLE 1QVRA 4IX9A 4K9KA 1SVLA 1QE0A 1I3KA 3KSZO 3DH0A 1XEWY 3FR8A 1C2YA 1RP7A 4D96A 3K0KA 1TRKA 4MKHA 1SZJG 1XCGB 3H2SA 3DAOA 3ET5A 4CQMB 2WTNA 1KNQA 3HJTA 1UMBB 1E3WA 3L84A 3RV4A 3ENVA 1VL2A 3ZHYA 4ABYA 3GPLA 1TNDA 3ZU4A 1GL3A 3NH6A 3ROZA 3OWXA 4JEUA 2EYUA 1OBFO 5FIUA 3KJHA 4C4PA 2W6PA 1GUBA 2H3EA 4ZDIA 3O3MB 4PS1A 4BY9E 2VJLA 5T3YA 3RC8A 2Z30A 3DHWC 1E3DA 3EIUA 1I5RA 5K0LA 5IPFA 4EYOA 3HA2A 1M6WA 2WJYA 1YF3A 1ZOLA 3FHCB 4YIKA 5C34B 3FIJA 3ECCA 3JASA 5L51A 3N74A 2IZ7A 1FJGB 2FPKA 1OFUX 5A7GA 4YQEA 3NHPA 4RHYA 3RWBA 2C31A 1NM5A 4L51A 1KDYA 1OC2A 1OYVA 2H4FA 1ICIA 4RD1A 3KAKA 4DM3A 2CHVA 5F2OA 1T4GA 3IHWA 1LDEA 2AOVA 3DMNA 2IRWA 5KJ1A 4YJ3F 1GGNA 1Q0QA 2YIMA 3IDFA 2P9TA 3DHVA 4H0CA 5CB4B 5AIBA 5KNDD 1FP4B 2HT1A 1Q20A 4GYKA 3CLSD 3KB1A 3WRYC 1EUYA 1QU3A 2WAMA 5IEBA 5CDYA 5KYYB 2QRLA 1W581 5FNVA 1TUBB 5KS2A 5J2UF 1XVIA 2NPIA 1RRGA 1ZIYA 2A4MA 3Q4GA 4O5OA 4MQFA 2XMDA 2J6IA 4C0LA 5KIAA 1QPGA 3ZD7A 1VBNA 1QYVA 3CPSA 5ALLA 1B41A 1R50A 1PQUA 4M2LA 4ME6A 3TLJA 2IPLA 3OH8A 4PZZA 2XVYA 2CVPA 5HGXA 2AMVA 4CF7A 3PFIA 2Q07A 4L28A 2RD2A 3IMEA 2BGJA 3A1EA 2NACA 4NZZA 4OHKA 2VS1A 3VSEA 4XIIA 3TKAA 3UWOA 4BRWA 1X9IA 2QYSA 1YB2A 2WG2A 2EJBA 3CKYA 4MQBA 4MW1A 4R4JA 2H29A 4YRJA 2PRKA 2C29D 2R1TA 1G291 2FR8C 3LUAA 5TT1A 4OUKX 5ICMA 1XWIA 4YRAA 4ALNA 4QXMA 1NIPA 3AEYA 4MLPA 1OXKB 3QXSA 4KFSA 3LIPA 1IXSB 5FBQB 1HPLA 5JH7B 2CNBA 3JAMA 3OWHA 4YS6A 1FEZA 3I5XA 1JDBB 4Y0AA 4ZAYA 4PSKA 2QVGA 4RESA 5J5CA 3HSKA 1PFGA 1U7HA 3TW4A 1OXUA 1HE4A 3TECE 1QRRA 1Z38A 3L7MA 3O4VA 1RCTE 4HZIA 4JDPA 3ZPXA 4PC3A 1Y98A 1JA1A 3PD0A 5KTOA 2DOKA 3H5RA 2GAOA 4B6PA 4ZT6A 2C7PA 2ZIXB 4I0WB 1PWXA 5F1KA 3U49A 2UYQA 2Q49A 3ZZ1A 5JWHA 2ZSJA 5HWSA 4GZ3A 1XXLA 3SYMA 3TXXA 5KQSA 4OQEA 3KXDA 4DR3B 5EGSA 1QK5A 4PZUA 2J9FB 4AUEA 1U5BB 1SO8A 2VNKA 1ENPA 1WD5A 3ZCPA 2YMLA 2HQRA 1QNLA 3CISA 2C3UA 2IOYA 3ONFA 5D5HA 1FYEA 4Z8YA 5T67A 3SF8B 4GMFA 1ZNWA 3OZ7A 1GGKA 1K7XB 2HPHA 5IKOA 2AOUA 2QV7A 5FV7A 4BVLA 2WSBA 4UPEA 4PM4A 2XUJA 4IV0A 5IZCA 1AZSC 2O6LA 1F5NA 4Y6OA 1CEQA 1NOIA 4PN3A 4G4GA 4I9NA 3R2JA 1ZIXA 3QVVA 3AKDA 4QUJA 5IVKA 4TT8A 3UAXA 4LGVA 2Q21A 4URZR 4OQDA 2XUIA 1RE1A 1Y81A 1ZW1A 3SOZA 3CRW1 1AKEA 2DG2A 2PUJA 5B4VA 1EAYA 3OQIB 1PNRA 1SC9A 1DWPA 4BNHA 5LKRA 1DO8A 4EG3A 1UQRA 3E1GA 3F5QA 4JI8B 2OZPA 4UZFA 4MVJE 4MW4A 2OP0A 3NM5A 3UOWA 5L3SA 2X76A 2BF4A 2ASEA 1UJ4A 1P2GA 2ZJYA 3PNSA 1J4AA 3MTBA 1TPZA 4W8HA 1JHAA 5IBQA 1SHJA 3F7TA 4QUHA 4D74A 1FSZA 2P68A 3MQ2A 1AK1A 4TN1A 5ALYA 3MS2A 2JLSA 1YRHA 2DFVA 5HOQA 4RPCA 4BNDB 5K0BA 2VHYA 4Z4HA 5EMHA 4KDRA 1YNOA 2WG0A 1PJQA 2DJ5A 2O14A 4B87A 1ATIA 2FRXA 3PC7A 4CM7A 3UCFA 3EG9A 2ZFUA 2B9VA 3PSHA 4B8YA 5LB4A 1VLQA 1JWLA 3HB0A 1Y7LA 2X1VA 1DZ3A 3C6XA 3H1PA 4KL8S 4YO8A 4ZAVA 5ETJA 4Q4CA 1T24A 4RD4A 5CCXA 3M1LA 4RCZA 2OKGA 4N6NA 3UJBA 1QDUA 3G8BA 3RVOA 3WLQA 1KGDA 1V9LA 3GJSA 4WOJA 2Y9MB 5E0KB 2ZRBA 3HMKA 1Z4JA 1A8UA 1N6RA 2PHZA 2PH7A 2K5UA 2IZ6A 4R2MA 3S6JA 1IOLA 4Q3NA 1NXXA 2Y1XA 1CUAA 4GP7A 4CM4A 3NYWA 1FU4A 2B37A 1XDZA 1OV4A 2BUAA 4UEQA 1Y5IA 2BHLA 1KVSA 2J9RA 4Q47A 4FUQA 1HOTA 4I3FA 621PA 3FUCA 2JLUA 3EWSA 4W7HA 3O2QB 2GKGA 4B48A 2GJ9A 4ILKA 3ZY5A 3VPSA 5AVWA 1YQEA 1TPYA 2HRCA 1HL3A 2VF5X 3MXOA 4XYGA 4NU0A 2GT1A 3AR8A 4D02A 4KPYA 4FCCA 4HTFB 3L0CA 4FC7A 3ZGOA 1JFVA 1UKCA 3H87A 3ZVNA 3Q8XB 1OGYA 1H2WA 1LV7A 4XWOA 1SC4A 1KDZA 3S2GA 3ZQJA 5JZSA 1QC5A 4NC9A 2GPSA 3HWSA 3SQWA 1CZUA 2BDEA 1FUKA 2PR2A 1T1JA 1N6OA 4IUCS 1Q1BA 1J8QA 1X80B 4Y6GB 3RJ9A 1KBZA 4EVRA 9GPBA 4W9MC 4GBJA 2WVAA 1NNEA 2W6JA 3CSUA 3URKA 2J5XA 3U4MA 5CBKA 2AUNA 5LJIA 1MQ9A 2XCIA 4ZRMA 2JRLA 1NN0A 2XUPA 3UW1A 1U2DC 3PE4A 4YBZA 1SKYB 3PNLA 1LDYA 2V97A 1J49A 2RE8A 5FWNA 2OC4A 1CETA 1HDXA 3KR9A 2XBLA 4DSUA 1IUKA 4OOFA 2H54A 5TGDA 1E2NA 3RC9A 3ZNPA 1G64A 3PUZA 4N0MA 2LV8A 1WUIS 1XRPA 3O8QB 3SSNA 2BSAA 2WMDA 3KSUA 1ESNA 4Y30A 5C3MA 1AQLA 2NOAA 2P5SA 2WQZA 2WY2D 4DCUA 1UZLA 4G09A 1J20A 4G41A 3NBZC 2XUFA 4L0CA 2XZLA 2H1OA 4HYQA 4LQLA 4IIVA 5TR9A 4KO8A 4N6OA 4ASUA 2QLBA 2EZ8A 2I0FA 3NTQA 2RI1A 1MNQA 3PLRA 5AK6A 3NR2A 3R7NA 4OQLA 5ILGA 1FDVA 4XIYA 1XCMA 1YQXA 4MQMA 4LXYA 1DEOA 3BERA 4LJ6A 4IIJF 5LKAA 4Y18A 4WN9B 4C2TA 1PWZA 1R6XA 5HFNA 3OTGA 1XEAA 2IYXA 3QSGA 1NMQA 1T2DA 2QLNA 1AU9A 3E22B 1UL1X 2QYOA 2V7WA 3AFOA 3N2KA 3QJGA 4PHCA 5CNJA 4P54A 1BE8A 1ZH8A 1Q1EA 2AHRA 4E2ZA 1ULAA 1BU5A 3FA2A 2Y1DA 3VC2A 3WXMA 3FDIA 2CCJA 3T38A 4R1TA 5CFRA 1E7RA 4BEVA 2BFFB 3FDFA 1CRZA 1OTXA 1FMCA 4FFDA 3KUUA 2QN6A 2R1VA 2A7QA 2YIVX 3CM0A 1ZBDA 4RAQA 1SCBA 5IX8A 2NO1A 3MJ4A 4GPIB 3FMGA 2NO4A 4ECAA 1IWOA 3V8NA 2D74A 1R12A 2F67A 4F04A 1Q2XA 2G7ZA 1G18A 1SBHA 1JXOA 4B0PA 5JWRA 2XYGA 1G3QA 5ECYA 3KYCA 2PK3A 5EZ5A 3UVEA 2HA0A 3CCBA 1ZJJA 2BI8A 3BFVA 4R1SA 4M53A 1L4NA 1BROA 1NLYA 3IA7A 4RK4A 4C6HA 1NLFA 4MICA 5CIWA 5COAA 1Q0ZA 3T95A 5KYNA 2EYQA 1RRVA 1GLNA 821PA 5JLJA 1RXIA 4BP8A 1E0SA 2ZIUB 4HO1X 2CXUA 4JUIA 1ESCA 5BSUA 4ZHQB 5BWOA 2HWYA 4OREX 2PUHA 4NMXB 4DYHA 3HCBA 1WPGA 1YA6A 2QP9X 3EOZA 3DEZA 2FMKA 4OYLA 3ASYA 3FVRA 1OU4A 2VCYA 4BFTA 5LYJB 1C41A 2B34A 3A9UA 3GMTA 3W6ZA 1YFJA 5KWSA 2EL7A 3K8ZA 2OZLB 1YS2X 3WWCA 5KVVA 4BWGA 3CY6A 3NO4A 2FKAA 3T34A 2B35A 4KRFA 1U9JA 2VP6A 3RYFB 4E11A 1PJSA 4AG5A 4FPXA 4YP0A 3SVZA 1C30A 2PX6A 1ZK1A 2C77A 1XV5A 3G5LA 4OK5A 3IS3A 3QG1A 2FCRA 2WYHA 4NYJQ 4YAWA 3AILA 4F4HA 2UU9B 1M6YA 3PI7A 4RPIA 1JI3A 3SXJA 1W36D 5DVZA 1XMXA 1UAYA 3VO1A 4U9IS 2YJ6A 2JHFA 1PZMA 3IEUA 1NUAA 1XTSA 4OHXA 3RU2A 5AUOB 1VL5A 5K0NA 2C98A 1YTLA 4AMVA 4EMTA 5LP1A 3AHDA 1BX1A 1K9VF 2O8BB 3SHOA 1RBYA 3OJWA 4NV3A 2NVWA 4BJ6A 3HJHA 3F6BX 3O8BA 4XVRA 3V9AA 3TF5A 1HRKA 2FN9A 4Q24A 1GPH1 4Q66C 1KKLA 3HUDA 3M1YA 4NFYA 4CDNA 3I32A 2DHQA 4J16C 1L4LA 4Q3OA 5F73A 4C43A 1WQ4A 1AMNA 3BREA 4BNNA 4YACA 3AHEA 1ZDMA 3K15A 1SKYE 1MJ5A 2BISA 5F51A 4GX0A 1TAUA 4JU8A 3TMKA 4B9AA 4BMNA 3U6BA 2DFTA 4ZVSA 4LRXA 4JXJA 1WP4A 3RVPA 4X1KB 1B8PA 2C5BA 1SXJD 5AM0A 3WSVA 4GH5A 4IXMA 3ESCA 1RI4A 2XWBF 4PYQA 1NXQA 3F90A 1VIAA 2QGFA 1GA1A 3QWFA 4FINA 4XQ0A 3RRZA 1JJVA 4H31A 3VU9A 3WMGA 4EJSA 3K96A 3GRVA 4KQ9A 1VIDA 2FRDC 4N3NA 3RIMA 2O2ZA 2GZAA 3OA0A 4JKIA 5A3RA 3EEYA 4HMQA 3BWMA 3JATA 1ZX1A 1ULTA 5EXPA 3HQ4O 3EZFA 4QOIA 1MAWA 4LGYA 5AVQA 4V0NA 2Z8XA 5SYAA 1PEKE 5IN4A 4XQGA 2VZ9A 4PPYA 3IVAA 1U6JA 1NHGA 3JQPA 3C4VA 4MARA 2PT5A 2X22A 2CB9A 1JHYA 2ZROA 2ZI3A 4MI3A 3ZIUA 1H0SA 3D0QA 2YWGA 4JYMA 4HN2A 4XH9B 2Q9AA 1NBME 3DHYA 2B21A 2BY4A 1EFVA 2FKNA 4G5OA 3M70A 4FWIB 2VQFB 3DLIA 1SBIA 1V8ZA 3OO0A 4O4IB 1IRIA 3T4UA 3TRFA 4BGVA 4DZZA 2C0QA 3WLMA 3JQ9C 3AF6A 4LXUA 4NV0A 4DLVA 4DQVA 3QUQA 3PC4A 4NICA 3L18A 4EG5A 1E63A 4CUKA 1ZNZA 4A1OA 3ZDCA 1A3CA 5E9QA 3QUBA 4MQEA 3VYTB 3W8RA 4J0JA 4X6UA 4FMDF 1SXQA 1LLDA 2ZCVA 4GPAA 3GFFA 5FTMA 5EMKA 3V1MA 1N6HA 1P7YA 2GEFA 2W2QA 3UIEA 5INTA 3WC4A 1MFZA 2BZ0A 3C43A 2N75A 3E7PA 2Y0CA 2XXAB 3INYA 3VFDA 4ZGGA 3GYBA 4JP1A 4WWHA 3EQ2A 1VGRA 2GAIA 4YRDA 5I9BA 5JYCA 4RM3A 3FUXA 5KX5F 1N57A 5H8WA 4ABTA 1JXQA 3VTFA 3EF1A 4V0LA 4NE9A 3ANMA 3PZBA 1Q11A 3G8DA 1VBMA 2DTEA 2A9JA 4WOKA 3NT5A 3FNBA 3RRXA 5FWYA 4J0FA 1EK2A 2YRXA 3LLSA 5EJEA 2GLXA 3E1KA 1NR5A 3HJUA 1AKMA 2CL0X 3PFHA 4BWFB 2QL9A 3EFHA 2IIPA 4JSYA 5ADUS 2YYAA 3I9KA 1JHXA 1CR1A 4J49A 4XD7D 1E6LA 2WWRA 1ONNA 5KWVA 5IC6A 4DXDA 4UM8B 2MSKA 1V41E 2ZB7A 1UOQA 3MPUA 2BGGA 3UK1A 1ZKDA 1Z5ZA 2DSNA 2LP4Y 1CP2A 4JCCA 3KSBC 2R8RA 2EKZA 1CJSA 2QR2A 4RS4A 3B6EA 1K27A 1SUPA 3LW8A 4OBBA 2JLYA 3RVMA 2WB4A 4DN6A 1KQFA 4XM0A 1TECE 1QTIA 2IIBA 4NBRA 2OAGA 4MH0R 4ESVA 2C0PA 1MF7A 3ZWDA 4YN3A 1JMKC 3GJ6A 3V4OA 3ONNA 2FE1A 2JIOA<