3O75A

Crystal structure of cra transcriptional dual regulator from pseudomonas putida in complex with fructose 1-phosphate'
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
270
structure length
270
Chain Sequence
HTRTLGFILPDLENPSYARIAKQLEQGARARGYQLLIASSDDQPDSERQLQQLFRARRCDALFVASCLPPEDDSYRELQDKGLPVIAIDRRLDPAHFCSVISDDRDASRQLAASLLSSAPRSIALIGARPELSVSQARAGGFDEALQGYTGEVRRYQGEAFSRECGQRLMQQLIDDLGGLPDALVTTSYVLLQGVFDTLQARPVDSRQLQLGTFGDNQLLDFLPLPVNAMAQQHGQIAATALELALAAIEEKRYEPGVHAVGRTFKQRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fructose 1-phosphate is the preferred effector of the metabolic regulator Cra of Pseudomonas putida
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Transcription
molecule keywords Fructose transport system repressor FruR
total genus 101
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00532 Peripla_BP_1 Periplasmic binding proteins and sugar binding domain of LacI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o75A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o75A01
3RVKA 5IULC 2LPMA 4Z9AA 5IUKC 5B3JC 1USIA 1ZHHA 1JYFA 2PL9A 1UDRA 3OO0A 3NNDA 3Q7SA 2JBAB 2JK1A 1D2AA 3H75A 3C6QA 3RVNA 4DADA 5EWLA 2M1ZA 5DCLA 4Q7EA 4JP1A 3BBLA 1K68A 4WT7A 3N75A 2LUOA 4IMIB 3HUTA 2VYCA 3F6CA 4N76A 4EUKA 2FVYA 1BVHA 3LUGA 2FMKA 4XARA 5E3JA 4KREA 1DBQA 2FW0A 5CNJA 1BDJA 1AB6A 3FFWA 4Z4GA 2QW1A 2JVJA 4MLCA 1ABEA 3C3WA 3KSMA 2FEKA 1PUXA 2QR3A 4RY9A 4MPTA 3P9YA 3DGEC 3QELB 3URMA 3UUGA 4N0PA 5TQ2B 3Q41A 1MAVA 4UHJA 3SAJA 1VLZA 5GQSA 3LUKA 5EWJB 4YWHA 4E7PA 4F12A 2GBPA 2VUHB 3GRCA 2GX6A 1DCFA 3O1IC 3DLHA 1CYEA 3KYIB 1JFSA 4CBVA 5HM6A 4RU1A 1JH9A 3LKBA 4Z4EA 1MVOA 9ABPA 1W25A 4IGAA 3CFYA 1XHFA 1P8AA 1USKA 2LP4Y 2CWDA 1JBEA 3OQMA 3H1FA 4D6XA 3LUDA 1JL3A 3N53A 1YMUA 1K66A 2A9RA 5FWXA 1NXVA 1ZH4A 4NCAA 1LJLA 3A10A 2MYTA 3UK0A 1Z15A 2QZJA 4ETMA 3IDOA 4LZLA 2L17A 3O2JA 1VPWA 2DRIA 3CZCA 2JRLA 1L5ZA 3M6MD 4YR7A 3L6UA 4NICA 3N0RA 4MS3A 1LJUA 3CG4A 4RXUA 1FFSA 1EWTA 4OLAA 3GWGA 3NHZA 3JPYA 4L4UA 4EYOA 1KRXA 4L85A 4MAAA 1PHRA 1ZH2A 4E7OA 3CS3A 2FKAA 3HM9A 1U2PA 3A3KA 4D74A 3QELA 4Z99A 2PL1A 1QP7A 1JYEA 1TJYA 3KKEA 1FQWA 4HNRA 5B3JA 2QXYA 3SG0A 4MYRA 3SM9A 2Q5CA 2GKGA 4ZMSA 3KTOA 4FB4A 4QPJC 5KQPA 2KYRA 1JFTA 1FFGA 2FEPA 3KYJB 2QVGA 2WY2D 2PLNA 5KC9A 5TQJA 1MB3A 2HSGA 2PUFA 2FTKE 3C3MA 4G0OA 4RK6A 5JS1A 2RDMA 5TE9A 4YGXB 2PMCA 2IPLA 3H6GA 2ID7A 2RJOA 3IP5A 5JNSA 1R8JA 4H60A 1FFWA 1SXIA 4FE4A 4IILA 5DLEA 5HSGA 2R25B 4JASB 2RJNA 1XWWA 4MS4A 4OTZA 1VRVA 4YV7A 2FLKA 2F8TA 4UHKA 1BA2A 1ZDMA 3OMXA 5I4CA 4KMRA 1KRWA 4N41A 3KLNA 1FSPA 2LIVA 4YO7A 3KLOA 4MQFA 3ILYA 5ABPA 1QKKA 3NBMA 3EAFA 3RVPA 7ABPA 1DJMA 1RZRD 5TQ0A 2B4AA 4MR7A 3N8IA 1M5UA 5F64A 1U0SY 2WJWA 3KHTA 3F73A 1LBIA 3GT7A 4FE7A 1F4VA 1NATA 1DRJA 3T8YA 3LUFA 1BDIA 1SD5A 1Z26A 5EWLB 2A9OA 1EWVA 1YK0A 2MSWA 4YCSA 4N03A 3RVLA 5DKFA 3CNBA 1M5TA 3EQZA 5IEJA 1E6LA 3HJFA 3JTEA 4MR9A 3OO1A 2RGYA 3MF4A 4MR8A 3RVRA 3MQ4A 4XASA 4EGSA 5FWXB 3HXMA 3RVMA 1YTUA 5ED4A 2NZUG 4IRXA 3LUHA 2VK2A 3TB6A 1EFAA 3MMNA 4EVRA 2CHEA 3FFXA 4RZSA 4MGEA 3EJWA 4ZJPA 4RK5A 1CEYA 3RVSA 3IP7A 4DQDA 1Z2DA 1NTRA 1RXEA 3H5VA 3LUJA 2E4UA 6CHYA 1JDNA 3QK7A 4LE2A 4LRQA 4F06A 2NZVG 3JVDA 5KQLA 4MRMB 3OM1A 3QEMB 4RKQA 1GCAA 3LUAA 4XFKA 6ABPA 4WXEA 4F8JA 1JF8A 2XDYA 4MQFB 1F51E 2WJAA 5BRAA 1ISSA 1NY5A 3O75A 4RWEA 3EULA 3Q9SA 5D2CA 1QO0D 4JAVC 4Q6BA 5C5EA 1PNRA 2PKXA 3Q7TA 2JVIA 4S04A 2QV0A 4G0XA 3M9WA 2ZWMA 4ZMRA 3S99A 2P9HA 3BRQA 3CG0A 2BGGA 3Q7RA 1DRKA 1B00A 2IOYA 1LK0A 3GV0A 3LFTA 4QYWA 4Z4IA 2PUBA 1JWLA 3SQNA 5FWYB 2W42A 5TQ0B 2PAFA 3LMKA 2CD7A 2ZAYA 3DZDA 3KCNA 4ZPJA 2JBAA 3RVJA 4D6YA 1YVUA 4TLLB 3OMWA 2M98A 4KK3A 3H5IA 8ABPA 3N0XA 4NQRA 1W9HA 2HPHA 1QMPA 4PYRA 3FDFA 1Z2EA 1SXGA 3H5TA 4GNRA 4KQCA 4YLEA 5IEBA 5JNTA 2FQXA 5GOTA 3ROFA 2NT3A 1ZESA 4EYKA 4NCBA 3A0RB 2PJUA 1M2EA 3HUUA 1Z25A 1ZN2A 4KFCA 1CHNA 3EQ2A 1DCKA 3TMYA 1Z13A 3LUCA 3OLYA 5CNMA 1SRRA 2GWRA 4MS3B 1D4ZA 4KRFA 4LE1A 4G0MA 3O1JC 2H3HA 2WWVD 2FMHA 3T6KA 4ZYLA 2OQRA 4WUTA 1EWKA 4NV3A 1DP4A 2FMIA 5CHYA 4EY3A 5IX8A 1JLKA 1QQBA 2YHAA 1TMYA 3VNBA 3H1GA 4RK0A 5HKOA 2HQOA 1ZAYA 1GUBA 3JS5A 3E3MA 1H9CA 1VKRA 4KV7A 1ZVVA 1ABFA 4KVFA 5TPZA 3MYYA 4KZKA 4MRMA 5FBHA 1Z18A 5KC8A 1DBPA 2TMYA 3CLKA 3OLVA 4RK7A 4F3TA 3F7NA 4LDAA 4H3KB 3JVIA 2MSKA 4RKRA 2MYPA 3HEBA 3H5LA 1YMVA 3OM0A 3QLVC 4JB0A 1L5YA 1AB5A 3NHMA 2E4WA 2GI4A 1E6KA 2FSPA 3DLBA 3C97A 1OXBB 1MB0A 4LX8A 4RS3A 2IPAB 2R47A 2A9QA 4N0QA 4DN6A 2IYNA 2L18A 3HVRA 3HK2A 1PNTA 4MQEA 4F11A 3K9CA 2HJ9A 1RXIA 1QNLA 3IPCA 3QEKA 3TX6A 4TN5A 2OENG 4MR8B 2MSLA 3LKVA 3QLUA 4JOQA 3RVQA 3GL9A 3KG2A 1S8NA 1Y1LA 4RY8A 3K4HA 2NUBA 4TLMB 4GPAA 4MS4B 5FBKA 3JY6A 3OQOA 3CHYA 2O20A 3LOPA 1RNLA 4MS1A 5TPZD 5FWYA 4W5RA 3IP6A 5BRJA 3H1EA 2WRZA 3RH0A 1KMIY 3C3KA 5TQ2A 3GYBA 3HO1A 3O1HB 1GLGA 2X7XA 4IF4A 1GUDA 2JCGA 3UKJA 2E4YA 1QPZA 4RXTA 4Z4FA 1NXTA 2E4ZA 4W5OA 2AYZA 4OLBA 2PUDA 3O2SB 4Z4HA 1QQAA 3MA0A 2PUAA 1ZGZA 1EHCA 4JB2A 4ML3A 3F6PA 2LBPA 3HDVA 3QLVA 3QLUC 5KQMA 5BQ3A 5CNIA 5PNTA 1LBHA 2IKSA 4OG2A 2CHFA 2L2QA 3SY8A 2JVKA 4HNQA 3A0UA 2E4VA 2FQYA 3BREA 3HDGA 5IUNC 2IPNA 5EWMB 1DZ3A 3N6VA 2IPMA 4W5QA 4RK4A 1DC8A 4G0QA 2N9UA 5DGCA 3JPWA 4RY0A 5IUJC 1E2BA 3OQNA 3GBVA 1YS6A 1U04A 4QYMA 4IMJB 3O2QB 2F8SA 1YIOA 3H6HA 3H5OA 5JNUA 2IDMA 4PE5B 1QP0A 3QX8A 4MQEB 2QVCA 2P4UA 2VUIB 1C0EA 4PICA 3BRSA 5JNRA 1A0OA 1PEAA 1JX6A 2FN8A 3OLWA 2FXIA 1BAPA 1NXWA 4RDCA 1YS7A 2L19A 2FLWA 1QO0A 4M88A 3CKMA 1P6QA 4QICA 2YHBA 5T3YA 1M2FA 1APBA 3SNKA 4KPYA 2E4XA 2QU7A 2MYNA 3O74A 2A9PA 4Z9BA 1OXKB 3FGZA 3M9XA 4RSMA 3DGFC 4LDZA 4B09A 4WXMA 4O1IA 3GBPA 4JA2A 2FMFA 1TLFA 1SXHA 3CZ5A 4XXHA 2WB4A 3TO5A 4KNYA 3DBIA 1Z12A 2R4QA 1URPA 1Z16A 1TM2A 1ZY2A 2AYXA 3D8UA 5KWSA 3G1WA 1MIHA 4EVSA 4EYGA 3QLTA 3E61A 2PUEA 1U8TA 1KGSA 1HEYA 3L49A 3O21A 3MIZA 1EAYA 2FQWA 1BDHA 4YS6A 1XHEA 3HS3A 3QX9A 1A2OA 1JHZA 1PEYA 3HCWA 3NNNA 2HQRA 5TPWA 3LTEA 2V0NA 1JFVA 1IIBA 2B1JA 5DTEA 3B2NA 1C4WA 2PUGA 4WZZA 3IPAA 5EWMA 4W5NA 1DCMA 3GA5A 3Q15C 1D1QA 4MS1B 5CNKA 3EODA 3T95A 2FEWB 2H0AA 2MYUA 4XLTA 1ISRA 5BR1A 3I09A 3ROTA 4EVQA 1ZGGA 4RK1A 1DG9A 4ETIA 2PE5A 4PEVA 5JNVA 3MM4A 3BILA 4OATA 4PZ0A 4S05A 1J56A 3HSYA 5TPWB 3RVOA 1P6UA 1WETA 4KQ9A 1I3CA 3OLXA 4N47A 2NT4A 4W5TA 2WMYA 3KS9A 4LE0A 1T34A 1TVMA 1U2QA 4Z0NA 3T38A 3HZHA 4ETNA 1Z17A 3HV2A 3CU5A 1D1PA 2JB9A 3EGCA 1DC7A 3IP9A 4Y9TA 3TD9A 5T7BA 3D02A 5JNWA 3QEMA 1NXOA 4O1HA 4Q6WA 5KQGA 4G0PA 3OLZA 5JS2A 1P2FA 4XAQA 1QP4A 1RPJA 3H5WA 5IC5A 4MLDA 5HQJA 4Z4CA 2HQBA 5EWJA 4YRZA 3RQIA 1YK1A 4G97A 3CTPA 1DBWA 1NXSA 2R48A 3KJXA 4P98A 5IBQA 4G0ZA 4G86A 4WWHA 1RZRA 1JDPA 4HYEA 3W9SA 4MR9B 2I6FA 3R0JA 4P1ZA 3N0WA 4TMYA 4KK4A 1A04A 4O5AA 1ZITA 1GCGA 1D5WA 3I45A 1NXXA 3I42A 4OBBA 4G0YA 4EYQA 3EDCA 1E6MA 4YP9A 3VNAA 2PUCA 1USGA 3ILHA 2QSJA 5KI6A 4H3HB 3FFTA 1NXPA 4RXMA 4HNSA 4MR7B 3I5AA 5C5CA 3FMVA 4RV5A 2FN9A 2ID9A 3G85A 3CRNA 3NNSA 2J48A
chains in the Genus database with same CATH superfamily
3MINA 2PBRA 2LPMA 4B4OA 4MYSA 1ML4A 1NM5C 3OZTA 3HBAA 4BQIA 4ZDKA 3KALA 1UDRA 2BDUA 4RM3A 5M5BA 3CZ9A 2YXLA 2F48A 2R68A 3BL6A 2PSFA 3E9MA 2XHEA 2QTVA 2APJA 3SQLA 4N5MA 4CM7A 1WV0A 3I5YA 3SC6A 1AN0A 5B4UA 5J23A 4PLTA 1P9RA 1PV1A 4Q66C 2VYCA 2XGOA 2HMVA 4MW6A 1X14A 2HXSA 2FUG1 3I1FA 4ICIA 3F6RA 1TQ2A 3GRVA 3KVYA 2XXJA 2B6NA 3H0KA 4Y8VA 4QOSA 3I4LA 3TSCA 1SUAA 3QMPA 5LZ4A 5CNJA 3GF4A 3UXYA 3UBMA 4MVJI 5FTJA 4B79A 2H48A 4WADA 4MROA 4Q12A 3AGPA 1PJLA 2NZ8A 3GVCA 2EBUA 2HI0A 3LPDA 2O0LA 3ZDBA 1TD1A 2QR3A 1KC3A 2R3SA 2XSZD 1C1XA 3BWMA 3DFZA 2C8KA 3DPIA 1T10A 1ONOA 2PGDA 5FTWA 4AMGA 3IIIA 2IDZA 1WKCA 2WF7A 3JSAA 3OCZA 3IRVA 4TQ9A 4BKQA 2WZBA 2V97A 5FOWA 2HADA 1S3FA 4UEWA 4A8HA 1T0BA 2AHRA 2G9UA 1WKBA 2O2SA 1H3FA 2A1UA 2VCHA 2XCQA 4E7PA 1K4YA 4MV1A 1MGOA 4O2AA 1UK8A 3PDJA 2QQEA 3T9BA 2WINI 4X1IA 4QG3A 3C3PA 2OVFA 4UCWA 4DTCA 3B12A 2C31A 3G8AA 3T7EA 3O8BA 4JB3A 9ABPA 2OG2A 3K6RA 5FEMA 5JJLA 5EZ5A 1J2TA 1DBIA 1GCUA 1FRZA 1KWKA 1J1UA 1Y7LA 3K0AA 1XTSA 1Z39A 2FMXA 2QAIA 3DL0A 5K20A 3N53A 1GFIA 3KHUA 3F3YA 4RANA 3EVZA 1TUBB 2ZJZA 3FTDA 3HPQA 3UK0A 3L4SO 3SSAA 1CS0A 2ET6A 3ZE8A 2O8DB 3CZCA 4XB2A 1I0IA 3IUNA 5DU2A 4INZA 1VJ5A 1DV1A 3PUKA 3CVVA 4Z7JA 2QXTA 3D8NA 3LSYA 1IEXA 1WQ1R 4RNDB 4TPKA 3QVVA 4ZYZA 1D1TA 4DG9A 3WQBA 1DPGA 4Y6SA 3ANSA 4JXZA 2XMPA 4L4UA 4QDKA 4RSHA 5F4BA 2KJQA 4L85A 3TR5A 2JGIA 5BO5A 1JEEA 1ZH2A 2G0AA 2G76A 4XB6B 3W06A 1JMYA 3DULA 4EMBA 1UP6A 1X1QA 3UMCA 4CM8B 1I3OA 1AT1A 1B23P 4TWIA 1LI7A 3GA7A 3KKEA 2PGNA 3QVXA 4GPBA 3SG0A 4QO7A 2ZWOA 1HE8B 2DLNA 2FNAA 4WKNA 1P9NA 1YJ5A 4TYWA 4HEA1 4ZT4A 4DEVA 5LPNA 5BYJA 3V4OA 3CF0A 1JIIA 3HFRA 4KUHA 2XF2A 1HFKA 1JLHA 1XTKA 2WTNA 2ZP1A 4UCXA 1L5LA 2NU8B 5HILA 3W8FA 1GDHA 4J1TC 2HD4A 3E35A 4ZTZB 3O3CA 5E2AA 4NDNE 4ZI7B 3LPAA 3IP5A 2QRPA 1PTKA 4R5MA 4FIZA 2YMPA 2A7QA 3DZGA 4JASB 4PAMA 4QUHA 2GOYA 3H1AA 3HDJA 2C2YA 4IHJA 3FNHA 1WA5A 2VPTA 3DE3X 2Z4TA 4UHKA 2VK8A 3P4XA 5A0FA 5I4CA 1KZ6A 5ITVA 1A96A 2Q4EA 1JG4A 4AJJA 3EEFA 3AKCA 3U3MA 5ER9A 3U7EB 4TYYA 3RTAA 2I2BA 1YR9A 2JI9A 4D0LB 3JZMA 5MGBA 3DBRB 2HLDD 5KNLA 3EAFA 1TYEB 1FX1A 3HUEA 3LWBA 4CQMB 1YCFA 4CIBA 4LX0A 3BEOA 3FFBA 3U16A 3VR2A 2PWZA 1TDJA 1J0DA 1JI0A 4MWEA 2DY0A 4IHAA 1XP8A 3RG2A 1L3IA 1UBMS 1FB5A 3BE8A 1EAMA 2YRXA 3HCBA 4B48A 2V5AA 5E9QA 1NC1A 3L0YA 1S02A 2CXXA 2MSWA 3BJMA 2BBSA 3EXEB 4JJGA 4O8CA 5EJMA 3CNBA 4ZVLA 1HORA 2EZ4A 2C61A 4V2IA 3RVRA 1PVVA 2PMBA 1ZXBA 1JQDA 3F8WA 4C30A 2ZJ5A 3WE7A 1RHMA 3CMMA 1GARA 4HMOA 3FLMA 3DFFA 2YFHA 1K8YB 1ADJA 4WECA 4BMCA 1QIJA 1YI1A 2CJFA 4MYCA 2H92A 3MSCA 2VLBA 3GJTA 4G5XA 4P4SA 1OWNA 1WPGA 5C31A 4AICA 4CL3A 3TOZA 1BVRA 2WZQA 2AFIA 2I91A 1KK1A 1T43A 4WV3A 1I6MA 1T9ZA 1BE1A 2AI1A 1SWVA 2HIAA 1Q15A 1T4MA 2I6GA 4RX1A 1L7AA 2PO7A 3O84A 3E22A 1JT2A 2CL7X 4TYNA 1YR7A 2BSAA 4JC0A 4YRAA 1E5LA 4FN4A 4ND2A 3GFBA 3NBKA 1I2AA 3TK1A 2LRHA 2ZVPX 1FLNA 5TDHA 5KX5B 3NTRA 1L2TA 4FR0A 3PKIA 3BGIA 1HH4A 1QDUA 4HQ6A 2CCJA 4KYVA 2HA3A 4B76A 5ICEA 1Z2PX 4QPCA 4BB6A 1GKKA 2GF9A 2JJ2A 521PA 4HGOA 5K0LA 4G25A 3UT0A 2G06A 3BH6A 3WSVA 1UMBB 1J25A 1UPCA 1WPQA 1MQAA 2IP1A 2JANA 2W6CX 3DQPA 5CT6A 4PLGA 3S99A 2UUAB 3ZCSA 3BRQA 3EQ9A 2CCGA 4LOJA 1WCYA 3AF6A 3UTDA 3L7MA 3MG9A 2BKLA 4DT1B 3PUJA 2FZEA 4YAWA 4Q93A 1EGMB 4UEQA 4GFDA 1ZNYA 3DJFA 3NDPA 4LOHA 3ERCA 4Z3KA 2H5LA 2Q45A 3MWKA 4DBLE 3KRTA 1AC5A 4LBVA 1HTBA 2ZG6A 4PSVA 4U1RA 3D6NB 1RMYA 4BMYA 1T6NA 3I6IA 4H6PA 3FNRA 4H16A 1K5HA 5DXJA 4PGAA 1SXJE 3WO0A 2QNBA 1QMPA 1SBYA 4PYRA 3IXLA 1EWQA 4ZMBA 5IZ4A 5B1EA 1CRWG 1W0JD 2JAXA 5J40A 5T6MA 2XMZA 4BKMA 1AX9A 1R6BX 1XJ5A 1UOQA 1K8ZB 1UXJA 2IX9A 1B42A 1CHNA 1E60A 1UJCA 1G98A 2I7CA 2WFMA 3GP5A 3NKVA 4BIIA 4ZGGA 2ERYA 1AZTA 2IYLD 1N9ZA 3DAOA 4WK2B 3VTAA 1KIMA 4FHZA 2XDQB 4M7PA 4Y2VA 2H3HA 4F97A 3EGXB 4A03A 4BUJA 4LMAA 4OGKA 1R5OA 3AFIA 3OOYA 3RVBA 1CY8A 2JFYA 4OQEA 5JH7B 1L4LA 1SCBA 4OV6B 2O5VA 5KJEA 1A5SB 1OI3A 3CY6A 1XLWA 2VJPA 1AKEA 3ZYCA 1ULZA 2AE2A 4MQ5A 3QEBZ 2ZBEA 5JZBA 4DSZA 3DAGA 1M66A 3V8EA 2FP3A 1ZUD1 3FPAA 2DUWA 4R2JA 4EGAA 2EKLA 1QU2A 5ESXA 4ZOQI 4NXNB 1NR7A 4PRZA 4FBGA 2XZLA 1PJ2A 1Z18A 4GP6A 3HY6A 4FFDA 2C5HA 3JSXA 2YQ5A 4DCCA 3IE0A 1PL8A 4Y9UA 5JLJA 4RHCA 5DIFA 1ECBA 4CHGA 1JWBB 4RHTA 5DSZA 2H2HA 3LQ4A 3EZLA 1RP7A 1TZ2A 3V6LA 4ZN6A 3QSYA 4ZPXA 3VV2A 4ALKA 3CLSD 1M8GA 2GPJA 3JATA 3K0BA 3GEBA 1UBKS 4J16C 1PU2A 1RP1A 2CJWA 4LMBA 4NHEA 3U7RA 4F84A 3H86A 3W4KA 2EEPA 1UOPA 3RRYA 2GZ3A 3BD8A 5AW0A 1E0JA 1MAHA 4MQEA 2FDRA 3P2IA 1OIVA 2AYYA 1XVTA 1ZS9A 4B4DA 1KEZA 1Q7RA 2ZK7A 4B2IA 3STXA 4FFPA 4QSMA 5D1NA 3W8RA 1ISHA 3IUSA 3H2HA 3G6KA 1KBZA 3OZRA 2WFAA 2VJBA 1RQ7A 3B2EA 4QDXA 5DK6A 2O8NA 5FNVB 3CHYA 1SU7A 5BNTA 4BPBA 3LOPA 5DTIA 1SBQA 4X1YA 3MS7A 4GSYA 4EPRA 1XL0A 5BRJA 1M5RA 1IXYA 4A9AA 1FYWA 2C77A 5H83A 5SY6A 1VSQA 7MDHA 3GYBA 2JFQA 3VR5H 1V8OA 2ZYRA 3BS4A 4YK7A 4JLUA 1W29A 1Y37A 3PV0A 2GBLC 4ZAFA 1JJVA 4DBZA 3J81k 5KYVA 1ZU4A 4C4AA 1KVRA 1QFJA 3KLPX 3QLJA 3AW8A 1B43A 3ER6A 1Q77A 3BVPA 4JDUA 5FWAA 4Z4FA 4OLBA 1R6DA 2C3OA 3KELA 4G4SP 4KIJA 1QVAA 2IEDA 1IN6A 3N8KA 4WUVA 2QPAA 5COAA 3N8GA 2YYYA 2PMWB 4MKZA 1XBTA 2A1TR 2PZAA 4LQCA 2FE1A 1CRZA 4WLUA 2E6KA 3P9PA 4BFYA 3PL1A 4RVFA 1YVPA 4OG2A 5ALIA 3IBTA 4CR8A 1YWGO 5I01A 4GP7A 2B98A 4YP7A 2O59A 2BDTA 1X1RA 1P2GA 4BO4A 4DNFA 3B82A 2BAGA 1Q3HA 2A5FA 2WP8J 5LC1A 3OFND 1BX1A 4FCVA 3WGTA 3QTBA 1MZPA 2OHFA 3FN4A 2H4FA 3MBOA 3OPMA 3NJRA 5CBPB 1ZSNA 3ZDXB 5FFNA 2CY0A 2WHYA 3D7NA 3TQFA 3DOUA 4YUXA 1Z0FA 5CK5A 4AK9A 4X62B 3F4KA 1E4OA 2WE8A 4LQLA 3D0KA 3LVFO 4P93A 1YR8A 4DSOA 1G6OA 1Q74A 2CXTA 2F7SA 3ETEA 2X4DA 1EFKA 2ZANA 1SUDA 4YMSA 2B69A 4MW2A 4YPFA 2R60A 4Y0VA 3FVQA 3IAHA 3K9BA 2JASA 3WFJA 2FZ4A 2D6FA 4F4UA 2PKRA 5EL0A 2VPZA 1CUAA 3TTYA 3NM5A 1E1MA 4HEHA 1JLRA 4UAUA 4WKCA 5T3YA 1XDDA 4TRNA 5ALZA 4UCFA 1JB9A 3A1SA 3HKCB 1EX6A 2HSJA 3L6OO 4NESA 4TZKA 3PNBA 4BVFA 1OXKB 4G1MB 2YY6A 5EMHA 4CM9A 3D2LA 3LF2A 1A1VA 6REQB 3EAGA 3F97A 3G89A 1QBGA 1RHRA 3GBPA 4QYTA 5KWVA 4Y2TA 1D7AA 2ZQYA 3O03A 1SRQA 2JAOA 3A4LA 2OBXA 4JY7A 1C7JA 1CWUA 2IPXA 3BGOS 4NTZA 5LB2A 3ZHXA 2SBTA 4UUNA 1S96A 1J09A 3RSFA 4CVNA 1VKJA 2ISQA 4FMBB 4X8MA 1IZ8A 5F78A 3D81A 1WAMA 4R4JA 4R8MA 1EK1A 4E31A 3TI7A 5L4LA 1EUCA 3TOSA 3GGSA 4I1OA 2GDJA 4CR7A 3JVUA 1F2DA 3CZPA 4EB8A 3SVLA 3EA0A 1JU9A 1RYNA 4C0KA 2R6FA 1EVKA 1O94C 1YS1X 4QFCA 4KQ6A 4YS6A 3OZCA 1A2OA 1T8YA 2G5PA 4AWXA 3BKWA 2JGJA 4M7WA 3SXJA 1R16A 2VJCA 2PHZA 4X54A 2VSNA 3LIIA 3DTNA 5AVTA 2J9FA 1FLDA 2CFIA 3E82A 1BS2A 1KARA 1TTPB 4UPDA 4QJ3A 3ETNA 3RF6A 1KEEA 1TYBE 2E7ZA 3Q0EA 5BV0A 5H59A 3ITNA 4ZAXA 5IMBA 3FR8A 3I9LA 3U44B 1TMGE 2QYSA 3EMKA 1PT6A 5ARCA 2PE5A 5E6UB 4TLEA 4H6VA 4LXIA 1RBQA 4BMOB 3LD9A 3S68A 3ZLJA 1P6UA 1BYUA 1GPUA 3VOTA 2WT4A 2ZYVX 3KAJA 3L0BA 2ZJ1A 5HUQA 4GS5A 2XMGA 2IWHA 2GHTA 2VQDA 3L8HA 3UQZA 3SLKA 4YAIA 5L95A 4ETNA 5MFZA 2RE8A 1ZOLA 1V8ZA 3R5HA 3L82B 5IKPA 3A9CA 3IGFA 4XLLA 5ALXA 4R05A 5E7IA 5INTA 5EJ8A 4BKRA 3E53A 3R3VA 1UC8A 1FBNA 3EQ8A 4LJ6A 1P2FA 1X3LA 3I92A 3O73A 4ETWA 1TPYA 3S27A 1N3YA 1XQ6A 3RTEA 4DL9A 1QP4A 1KDTA 1PJQA 2GEBA 5IRCD 4Y2GA 2ERCA 4MLDA 4LKOA 2LDBA 3CLUD 4KXYA 4QQFA 1PWZA 2B99A 4K9SA 3R7DA 4BAUA 4LG1A 3FSRA 2Q1WA 2YFQA 3IUBA 3FDJA 2AN1A 4F04A 4BLUA 2PLFA 2GZRA 1FXWF 2G72A 1JKFA 1BVYF 1YR6A 4H1TA 5LQNA 1ZRHA 1G1MA 4LTMA 5EQJB 4ZC1A 5I6DA 4WD3A 1TW3A 1VCIA 3O4FA 1QVWA 3D8SA 4CCWA 1Y8RA 1GDDA 3FSEA 2O8BA 4D9JA 2WI8A 5CYFA 1W19A 3HFGA 5CFZA 1MOQA 2NNLD 4S12A 3FCYA 4I08A 4PU0A 3TEFA 1WXFA 4BNHA 5A4MS 2C8LA 3Q3JB 3OEHA 2RIRA 1GIAA 1N6PA 2A35A 3I5AA 1C9YA 1UJ5A 3MCWA 5JWOA 4UTXA 3FPEA 3M1LA 1PG5A 1JSZA 2BFDA 3RUEA 1ADBA 5MN6A 3A28A 1IBLB 1M2HA 3OG9A 2J9GA 3H2ZA 1GKUB 1Q0PA 1GL9B 1C80A 1WZEA 3MT8A 4OJTA 1YCDA 4GZ5A 4WLVA 5ALKA 3UG7A 2Y1EA 4IR7A 3NNDA 2P27A 1XOIA 3DLCA 3JAWA 3LX6A 2BFFA 2H4HA 2C1XA 3NHYA 4LWQA 3IAS1 4QASA 2XKKA 5EGNA 1M2KA 1ODJA 1NVVQ 3B6MA 4RDHA 1MT0A 3QVMA 3DL4A 3RC2A 4BX2A 2VAXA 4BJ6A 4MCIA 5TGDA 3T7IA 1ZIOA 4FFOA 4NH4A 2FPLA 2OZLB 5AI8A 5AR1A 5BXQC 4KLZA 3W2FA 4DT1A 2NUTB 4YJHA 5KVCA 2GSDA 4XARA 4JBNA 3W5VA 1RKUA 1N2ZA 3ZR4B 1WCWA 1AB6A 1EWYA 5ADWA 1UMBA 1AK9A 3WTBA 4OK3A 3RU7A 3M6LA 3W4IA 4B83A 1F4LA 2AUNA 4KSCA 1R00A 1WXDA 3KQWA 3ND5A 5L7TA 1AMOA 1T3LA 3KB2A 4QU8A 2TYSB 4ZU6X 2RH9B 3B3AA 3G3EA 1JEOA 1IHOA 2UAGA 3N39C 4U8HA 5C4IA 3HNPA 2XQVA 1DTEA 1OROA 2G0TA 2YNMC 4LISA 4NQZA 1NONA 4XWTA 1ZRNA 5LXTF 1L5GB 1K98A 2HT6A 5DDIP 4UTVA 4ZI7A 4B80A 1W52X 1VE5A 2XX3A 5EKTA 1I2BA 3FH0A 5G4LA 1VHLA 2J09A 4WLOA 1BVUA 4F5WA 3KYIB 2JZOA 1DKLA 2O8BB 4RQTA 2HDWA 1PR1A 1XLVA 3CF2A 3FPLA 3H84A 5LB4A 3LT4A 3UJAA 5KPDA 2ENWA 1ZMOA 1NMQA 4IGAA 4LHXA 2G1JA 3A14A 4W63A 4N5DA 3TVDA 5EHZA 1JDJA 4MVJD 3WLAA 4KXWA 3LUDA 5HKKA 4EBBA 4PBSA 4RHEA 1YUNA 2HLHA 5E6RB 1K66A 4BN0A 5JOQA 4WZ6A 2ASEA 2PL3A 2CW5A 4PGHA 3RE1A 3SC4A 1OH5A 4NCAA 3FSJX 4E3ZA 5BV2P 3ST7A 2I4TA 4G0WA 5FCDA 4TVKA 4YR7A 3FCAA 1GNQA 1J0BA 1M0SA 2FP4A 1IN5A 1GT91 2FYTA 3JD3A 3KZNA 3NEJA 2VXBA 5LDGA 3EY9A 3E3OA 1OFTA 1ZC3A 3KQLA 4HDMA 1HYBA 3GAAA 2EWMA 1GT6A 3ANMA 4JKOA 5I9LA 1EM6A 4RH1A 2W2PA 1WTAA 4QULA 1XLTC 4TM7A 2X1MA 2CMGA 4FQ7A 3CLRD 4KE8A 4O4IF 2KI5A 2ZBFA 4WOBA 2ZDGA 4FIDA 4XJVA 3I6ZA 1R4MB 2YXPX 3QELA 1R5NA 4TUYB 3RFTA 3S1AB 4HX9A 4AXXA 2JFWA 4XYEA 4ARUA 5FA5A 4E5PA 1OLUB 3H9QA 4HDNA 1VGQA 4IYRA 1QF7A 3X3HA 5CA1B 5DTMA 5LKAA 1KZYC 4ZZ0A 2QAGA 5KQPA 3DTVD 3UFBA 1G20E 1KI9A 1JLSA 4U3JA 4MV4A 2OB1A 4BCBA 1EK0A 2ZB4A 2L42A 1VLLA 4RK6A 2PLAA 1YZFA 4RPLA 4BBAA 2CNOA 2X6QA 1E3JA 3FX2A 4YGXB 3SSNA 1G21B 3CJRA 4ZQFA 4B8WA 2B7LA 2YR0A 5FA6A 1IOVA 3S2IA 4E5MA 5T8KC 5DI3A 4EARA 2GZHA 2B9EA 4H60A 1Z0KA 1R88A 1GR1A 1X7DA 3E5MA 3KHKA 4U0KA 3PQ4A 5JCJD 2OP1A 1K4MA 1SK8A 4N3AA 2JLWA 1I7NA 1DWQA 3OMXA 3RHFA 1TT5B 1P2TA 2VDQB 5AVRA 1CR2A 1SC4A 1OLUA 3N2KA 1DOZA 4WJZA 3FUCA 4E70A 1AXGA 2OAP1 1H2WA 3RARA 3MGBA 1XQ1A 1FEZA 2FOLA 3TKAA 2AOUA 3NBMA 4CEJB 3DOIA 1DPFA 5AW5A 1TL7C 3MIIA 2GASA 4QATA 5HGJA 1A5TA 1T3GA 4GWGA 1SQ0A 3O8DA 1BS9A 3D54D 3UOGA 5L3QA 3F73A 4LY6A 3F5QA 4OQDA 5KTRA 1BO6A 1Y5IA 2IYYA 2TMGA 1NATA 3QKTA 3ZWCA 3K9QO 4INJA 4YMHA 4PPNA 4R6XA 2JHAA 5JRZA 3M5WA 2B5VA 5CH3A 5BYAA 4DAEA 1X7XA 2QN8A 4I9HA 2ZUTA 4O08A 2VWQA 3H2YA 4XASA 5TV2A 1WUIS 3HJGA 3FTCA 1YB6A 2NZUG 2QF7A 1CS0B 3K15A 3MB5A 4IIXA 4ZVQA 5HOQA 3AUJB 1Q12A 2CUNA 3M6IA 1NQAO 3ZV5A 1DIBA 1UWLA 3PQ2A 1RKQA 2XHZA 2GGSA 1Q7CA 1ISIA 1JLMA 1HDXA 4HP8A 5ERXA 4XR4A 2GKSA 5EXXA 3SJCA 2JA2A 4S3MA 5J2UF 4FYIA 3DR3A 4RQBA 1D5CA 2F43B 1XP5A 1ZM7A 1II8B 1LB1B 2RCYA 3QEMB 1VIMA 1EZZA 2ZUVA 5TY0A 4WXEA 6ABPA 4Q9JA 5DGTA 2N42A 5EC8A 1ODLA 1QPGA 1M7GA 3PHGA 5SYAA 2D0OB 4DILA 1E7MA 4TXHA 3QWBA 2Q3JA 1QB7A 4LJ9A 2OFOA 2XD4A 3NP9A 1MX3A 4JK3A 3GIDA 2QRHA 4FZ3A 2GYUA 4G1BA 1DXQA 1VHDA 1NNI1 2JVIA 3L8FA 4FC6A 3T34A 4GI1A 3VSDA 5JASA 2ZKLA 4U5QA 1XXHB 1TNDA 4BGIA 2P2LA 2P9HA 5IVHA 5JCOA 5DGIA 4FDVA 1V7QA 3A05A 1VKNA 2QJRA 2J5BA 1YHYA 3IAS6 5BOVA 4BV3A 4Z4IA 1OX4A 4M89A 1FDTA 2PAFA 3GUCA 3QBEA 5AJUA 3SLRA 4C5BA 2NPIA 5BURA 1SQGA 1VLHA 3NRBA 4HLNA 4ZPJA 2Q3CA 3Q3EA 4D6YA 5KSWB 4DDHA 1V95A 3OMWA 3ZCVA 2QTGA 4JX8A 3FNBA 1I6LA 1M34B 2OE2A 4UXJA 1QJCA 4OHYA 5D85A 1YD7A 1J24A 1Z82A 4NMMA 3S4YA 1D4AA 3FDFA 4UUMA 3RS0A 3B3QA 1GVHA 1V2HE 4GVLA 2HRBA 3AF1A 2PRZA 3ES9A 3PGKA 4YJ2B 4CT0A 2BMVA 1P2SA 2DH5A 1CDEA 1U31A 5K8LA 1XZNA 5K99A 5BWNA 1HQCA 4AAYA 2VPIA 5HF8A 4ZEMA 5FL3A 4ND6A 4PNPA 3IVRA 5C8DA 4BLQA 3BKXA 1JKJB 1UDWA 1HFWA 3D2BA 4MINA 3S28A 1AKYA 2FMHA 2C9OA 1M2WA 2FPOA 2O1EA 3TTXA 2XGJA 3JWEA 3LW7A 1JJFA 1EWKA 1Z4OA 1HZZC 2QTMA 3CUTA 3KBOA 4IEIA 4RJJA 4AJLA 1HDRA 4EY3A 3EF3A 1L4BA 2GEDA 1DO0A 3EA5A 4KVAA 1YQUA 3KEQA 4OQXA 3V97A 1P5RA 4YNBA 4BVGA 1ZUNA 2YVUA 3R1IA 5F76A 4WVLA 1UWKA 2FGJA 2ECFA 5D5PA 1XQYA 5JDIA 2QUIA 3NANA 2VG8A 3H9UA 3T0IA 2W4QA 3KB8A 2Y4NA 3P0IA 2EKQA 2D59A 3NCTA 4MRMA 2XVMA 1CPYA 5ES3A 4YJDA 3N2GA 3OT5A 4C22A 5BWCA 1G6KA 5L7WA 2V7UA 4LZZA 3WB1A 3BFVA 1QZZA 2DBZA 4LDRA 4UZFA 1RRMA 2FPKA 4WCFC 3WYCA 3FKSD 4MH0R 4X91A 5HCIA 3LDAA 3CBQA 3Q3IA 2C98A 1EUDB 4WEOA 1VJ1A 2ERXA 4S1PA 5F2NA 3V5NA 2B6HA 3K5WA 3GMSA 4NK5A 4CKEB 4WI1A 1A27A 2XMBA 4CNQA 3MJ4A 1WTCA 1C4KA 1DWPA 2A4KA 1MNQA 2Z43A 3BL8A 3TDNA 2UYOA 2MIIA 4FHEA 2VDWA 1U0HC 1VE6A 4OAPA 4B7XA 2YVKA 2AUTA 2B7BA 1P80A 2MSLA 3B3JA 3QE3A 5DX8A 4Z2AA 1IK4A 3KJHA 2PZJA 5EXDA 1TKAA 4PXSA 4IGKA 3WL6A 3ZWMA 1ISJA 1C8BA 2ZI3A 3SIRA 4MS1A 3AC0A 1PZNA 2YBDA 5AVUA 2Y1OA 3VGJA 1QSGA 3UAVA 3HXPA 4IDAA 1WKVA 4CEIA 4CM9D 3HO1A 1L4KA 5CT5A 4P9NA 5JUWA 1R0ZA 2PR7A 3HGMA 4EZEA 1L9KA 1E2LA 2H5JA 3IMGA 1TXGA 4R2WA 1VZ2A 2Q5EA 3L6CA 4WN9A 1SUFA 1PGJA 2ZEJA 5ERGB 2AFRA 4RGQA 3T3MB 2XVZA 2R7AA 1ZGZA 1K6XA 1L0BA 2O05A 4QELA 2JD0A 1YO6A 4F3KA 2BBWA 2M2IA 3GP8A 1ID8A 1WP4A 3E9CA 1T3TA 4YECA 1XTPA 2HBRA 3BXEA 1UWCA 3VU9A 5C8YF 5L40A 4L8WB 1LH0A 2JGDA 3KJZA 3U9LA 3PCXA 3MQFA 3D5QA 3R0QA 1FDVA 2IYUA 4DV3B 5G0SA 4L5YA 1TD9A 2ZE6A 4Y98A 3OKAA 1FXSA 4RL6A 4TKUB 5T64A 3ZJVA 5E3IA 1V43A 1T5BA 2Z8XA 4X1OA 2Q2NA 2EZ8A 5KJCA 1O0BA 1ULTA 1ZEMA 3E9YA 1MNAA 1H0RA 1ZWKA 1UDBA 3OIFA 4JBGA 2HNKA 2NACA 4M54A 4H7EA 4BEWA 2WD9A 1E9SA 2CDBA 3ZDDA 1CXZA 2O1SA 2XWJI 2RHWA 3G7UA 5CDFA 2GA8A 3LPMA 5HCNA 1R74A 1SGWA 4XGRA 1D0SA 4NYMQ 4PGGA 5GAJA 1E6CA 3S1LA 4PPYA 4DIFA 3K6SB 1Q2XA 2Q0SA 2VJDA 2WIGA 4M1QA 1YZYA 4D8WA 3ESZA 4KE9A 1CUWA 5IJZA 4XIFA 4WNIA 3OLWA 1Q0HA 4RSRA 3BGDA 1R5BA 1GRNA 4TZTA 3HA2A 2Q8QA 3IR6A 3RB8A 2H07A 4D0NA 1ODKA 1YA8A 4NL4H 4YA6A 4YQEA 5C7IO 5LCXA 5FBRB 1SXPA 1YRWA 3HCAA 3SJAA 2QQ0A 4KR7A 1GPLA 3PXBA 1SC3A 2CL6X 2Y3IA 1USUA 2A9PA 2XUKA 3DA8A 2B0JA 3JQ7A 3O74A 4S1WA 4PY2A 3SSMA 4Z7OB 4AX8A 1ORRA 2PT5A 5A3RA 3DGFC 3MOSA 1LPPA 4F1JA 5AVJA 2JGFA 1Z6ZA 1UOEA 3TSWA 3VZPA 2Q6IA 4I8IA 4LV5B 5CB4F 5F1OA 4RQUA 4ED9A 2ZCVA 2FRVA 1R1DA 5LD2C 4D81A 4R1OA 4IEFB 4BP3A 1E1YA 2XY4A 5CX1A 3UAZA 2I4RA 2XKBA 4RTSA 1WZCA 1ZGCA 4ND3A 5ITWA 2YOFA 4QUAA 1PZXA 3T3DA 4ZV4A 3TBKA 1TFUA 1KGSA 1DXYA 3NTOA 3NC4A 4AO8A 4ER7A 4LC0A 3FYCA 3WV4A 4B0PA 3G7SA 3IDQA 3PR2B 3R6LA 3NO4A 1PEYA 3TXXA 1DHRA 1ZIDA 1BW9A 4IDPA 4MI1A 4KOEC 3AFHA 4D3SA 5A5VA 3WP0A 1ZKMA 1ECLA 1ZISA 5C35A 3EG9B 2X2FA 2WVAA 3VHXB 4B40A 2IEBA 1AHPA 3DVAB 3UNXA 4U9UA 2RFLA 1DCMA 1XAHA 2JFPA 1VECA 2Y1WA 3DEJA 1DADA 1FLAA 3D4NA 2E87A 1ISRA 1A1SA 4J0IA 4TV9A 3W6OA 5KNDD 3K0KA 1ZGGA 1W1WA 1V25A 3HHEA 4X9XA 3X1WA 4G23A 5IT9A 4RIIA 3NCHA 3BILA 3O8OA 1HLFA 5BWOA 4YI3A 3R9XB 1MH9A 2DPXA 3DC2A 3FVTA 4JEIA 4S05A 4NMHA 1REQA 1U99A 2WSIA 4KITB 1HURA 1QFYA 4UOQA 4CIDA 5KINB 2JHGA 1WD7A 3QVGB 1LNZA 1I5EA 4E03A 1VG9B 5IC4A 4D4LA 5KYYB 4C7XA 3HO8A 1UKBA 3ED1A 4OSEA 1IOLA 1YUMA 1F0PA 1U1GA 4NOMA 2IS6A 4AJIA 6ADHA 1OFVA 4QOHA 3CU5A 1NJ2A 5REQA 1VB3A 4WACA 2O3QA 1JS1X 1M2JA 5JFOA 4AIRA 1DDGA 1UJNA 3RT7A 4BB5A 4CKCA 5IJ0A 1IEVA 2CLEB 3GDOA 4YALA 3BMCB 4JI8B 5IC5A 2VSOA 5CW2A 3HDTA 1E4YA 3T7AA 2BFMA 1K97A 2PUTA 4B44A 4YRZA 5FI1B 4KI0A 4UATA 5KCZA 4ABTA 5DMHA 4KNWA 2ILTA 3AFOA 2R4TA 1VCOA 1XVIA 3A2MA 3BIJA 4C0XA 4LYYA 1WJGA 1UBRS 1PNOA 3AL3A 1HT3A 4P1ZA 5F3DA 3KPVA 3RAGA 3H3JA 1MP0A 2F62A 4JSYA 4L8YA 2BHRA 4TWAA 4DUYB 2E3JA 4HRXA 3JQBC 3FWKA 4J75A 1RI1A 2OCIA 4JI6B 1VL5A 5IJ0B 2JIZA 4EL0A 5I9NA 2JDIA 2QB5A 3USCS 2D06A 1NSFA 2FVXA 2H11A 3RFXA 1DO2A 3Q2IA 4QXQA 4C4YA 2GEVA 1JMVA 3GK3A 3K32A 5EIOA 2I8AA 4CDRA 5IF3A 1IZ0A 4WCVA 2RHCA 4R8SA 3U7QA 2B94A 5B6PA 3NIWA 4FOLA 4YLGA 1W0JA 3P0EA 1TEVA 2G08A 4Z9FA 3NATA 1Z73A 5IJ9B 5IULC 1A71A 2ISCA 5K3SA 5EPOA 1ZHHA 5BWMA 4US1R 1OX5A 1JEYB 5AKYA 2RGNA 1E0DA 4RD0A 4QDUA 4Y2JA 2LTAA 3RS5A 3RVNA 5JJCA 4A0SA 1PG2A 2IFTA 4TRRA 4YMUA 3U1VA 4L8VA 4M9XA 3MGKA 3WAGA 4JU9A 4K9LA 3GZJA 3ZH2A 1H8EA 5BR8B 1XA0A 2ONYA 2Y9PB 3C7AA 4MW5A 3ESXA 4L08A 1GNPA 1XDBA 5IAGA 2IYWA 1FFBA 1KJWA 2FW0A 4J6EA 4LYFA 2RHOA 2V9CA 3LU1A 3BQMB 4JJ6A 4OQQA 2XB4A 2CSXA 4BXOB 2WDPA 3UGTA 2VZ9A 5KJ1A 4LJ8A 4NZOA 2X41A 4G37A 3FUTA 3JD1A 5K3EA 1F6DA 3P9YA 4J1TA 1BRMA 3ZIUA 1G0NA 3GT3A 1OPRA 4MULA 1TZBA 1C2TA 3V8RA 4K8RB 4FHFA 4TQAA 1JBKA 1KMNA 5EN4A 4KAJA 1RBZA 2HGSA 2V5VA 5EWJB 3AZQA 1XD2A 2AWOA 4R1SA 4YREA 2UZ0A 2O2DA 3DLHA 2WHPB 1E79A 3AHCA 2GJ4A 4DJAA 3ZXXA 4RADA 4HFMA 2GJAA 4O2BF 4Z4EA 4Y6RA 3HU2A 2RHDA 2ZTLA 3TN7A 3QUTA 5FRDA 3A4MA 2LP4Y 3LJKA 1G21E 1QIMA 4BUCA 1H0HA 3RK0A 2E1RA 4FEEA 4L8LA 3CRMA 1YMUA 3VR6H 1E6WA 1XTBA 5JROA 2QGFA 2OHOA 3CSSA 3MCUA 3ICOA 4LDJA 3A10A 4R51A 4RTLA 3VU0A 2IIVA 3VUFA 1G5PA 1JQ5A 1L5FA 2IXEA 2MJLA 2QP4A 4KE7A 4QPDA 3NORA 5DCUA 2JI8A 4BO7A 4BRZA 4DRZA 4Y2UA 1I5OA 2WJYA 5JADA 1LRKA 2VTEA 2ACWA 1A2BA 4AO6A 2PBZA 4C21A 2GJ9A 2IV3A 2R84A 4EKGA 2VF7A 2RI0A 4JNKA 4K87A 3PDHA 1OFHA 3ETLA 3DCJA 2F1JA 1C3OA 2HTEA 4XX0A 5CX4A 3VKUA 5EHQA 4ECAA 5CLLA 2AEFA 1VCHA 1M1NB 1K08A 1XQWA 3EW7A 2W90A 3GLQA 1IG0A 4L1KA 4D74A 2A5GA 2MINB 4JCCA 2EG5A 2BEJA 4RWZA 2Q5OA 2QXYA 5FTNA 4Q3DA 3SM9A 3TAUA 2OV4A 1PRYA 4RE5A 1V0JA 2QHXA 1U7UA 4V0RA 4C1NA 3URKA 3I52A 5TGTA 2D4AA 2FEPA 4CF6A 4M1YA 3KYJB 3IJPA 4RW0A 1TTTA 4OYHA 5DPMA 1RQLA 4FILA 4TV8A 1ZN7A 1HDYA 4ZV9A 3QOFA 2XUZA 4EDHA 4H4CA 4OQYA 5EJAA 3FBTA 1MOPA 1X86B 5K3FA 1L5SA 4FYYA 5JS8A 5DYGA 4RLFA 4L27A 2PGAA 3BMOA 4JQCA 2I4IA 4IICA 4LI3X 3U3DA 2DOKA 4REQB 3UK1A 3KQQA 3PWTA 3KLNA 4JJKA 4DGQA 3UB2A 3Q98A 3LXUX 4MQLA 1RACA 2VHXA 1JA9A 4EMTA 1BE0A 3B1WA 5KKAA 2FWMX 4P0PB 2R1UA 2EAUA 3GFVA 4DLWA 5J3JA 3I5XA 3HCNA 1KH3A 2XAAA 2ZPUA 4HQKA 1G60A 5AW2A 1O0CA 5U9CA 5J47A 3HBFA 1C3VA 5EFZA 3CIFA 3MT7A 1C14A 3S44A 1RWXA 3VC1A 4HGZA 1RRCA 2H65A 2M32A 1HR0B 2BF7A 2WF6A 3GHYA 1N9KA 3CSUA 3OSZA 1IOZA 4Q34A 2QBYB 3OO1A 1G1AA 1EE2A 4GF5A 2FEMA 3JW8A 4I1PA 3WBJA 3FETA 2F8MA 3P4YA 1VBKA 3MERA 1Z36A 3A04A 1XTJA 2REXB 1GILA 4BGDA 1BMDA 1XKTA 1E3IA 3DC7A 1MVLA 1EU1A 3HVHA 3ENWA 1KO4A 2H59A 4MCAA 3H9CA 1E0KA 4AUKA 3UV6A 4QUDA 4OAQA 4JFAA 3ZE0B 3WYAA 4KR3A 3GXOA 4I19A 1DTWA 1YQEA 1RMTA 2HIGA 2W0SA 4PLVA 1F1JA 3C87A 4K9NA 4MRMB 4IIHA 1WW3A 3LUAA 3P9IA 5TX7A 4C05A 5KHAA 1CZNA 2R00C 4TYMA 3K8OE 1GWNA 2WE7A 2RAUA 3AEQA 3VV3A 1ZUNB 1ISSA 2A5YB 2B4TO 3FZYA 3N05A 4I4TF 4LJAA 4X3OA 2M1XA 3W7VA 3ZXUB 1FF9A 2GYWA 4MW0A 3JQFA 2BL4A 1E61A 3QXXA 3DLPX 4HB3A 5EXEA 2RC5A 4KQKA 5TNXA 4RPHA 1S89A 3L7IA 4DQXA 5C5IA 1K2WA 3PJFA 1Z9BA 4C7JA 1R8YA 3PNKA 2R5FA 4LK3A 2G0NA 1G5FA 4RFSB 5CM9C 4BNKA 2QP3A 1MZVA 4J43A 3Q8KA 2BEWA 1S2NA 3B5JA 1XDUA 3LFTA 1LK0A 2XA9A 2HRRA 3ZKWA 4LHSA 1AO3A 4NJEA 1FNNA 2AXEA 4FSDA 3DZDA 3NVKI 2W00A 2AF4C 4N7BA 3UUEA 1YT5A 5B58T 3KT8A 1IMJA 3CKKA 4NRDA 3T3HA 1P7YA 1KVSA 2H7YA 1AQIA 2QVXX 2WNSA 1YB4A 3BC1A 2C8JA 1V7CA 2RK6A 1Z8DA 3IILA 3ZDYB 3VR6D 1UJMA 3ZIAA 4ZCRA 4BNXA 4TLAA 1C3JA 4U3JB 1U80A 4WY2A 3SI7A 3K94A 3N2YA 3C7KA 3K35A 1FU8A 2FCRA 4C6HA 1XT6A 2JIZD 4EYKA 1ZESA 1FYFA 1NA5A 1AKWA 1JIVA 1TYZA 2P35A 1CVIA 1LZLA 4OBWA 2W5UA 3FCEA 2J87A 4L3VA 3ZX4A 2FRXA 3G8DA 3MOGA 3RC3A 1HYHA 1DIGA 4J0CA 4GXQA 2CVOA 1ZI6A 2VUSA 2D1QA 3IBCA 3THXB 4G2TA 5HBRA 4Y6LA 1EDZA 4TKVB 3UJPA 4G0MA 3QMVA 4IVPA 5JEDA 1ZVKA 2G09A 3NG1A 3RKRA 2V7GA 4A0QA 3TLGB 4BNMA 5CJ2A 1NF3A 4MSUA 3F67A 2PFSA 3LA6A 3OPYB 4HY3A 4N54A 2VATA 1TVKA 4WESA 1Z6GA 4QNNA 3PDIB 1T6XA 5GZ3A 3DR5A 1VBMA 3H1GA 2FWRA 3KZMA 3TE6A 4NZPA 1JBQA 5AIAA 5CRIA 1L7OA 3OM9A 5D3QA 3SJBA 4EECA 1V8PA 3A2NA 3F6YA 2E49A 3D0OA 3O31A 2BZ0A 2MR6A 4H6WA 1Y6ZA 5EMNA 4KTTE 4TTAA 1Y7PA 1G8KA 2ZIGA 4EA8A 5C8YB 5TF0A 5FBHA 5KDLA 3OHPA 1DBPA 4H0FA 2CLOB 3OQIA 3PLRA 1SQ6A 3Q0IA 2Q8PA 4XDZA 3WYBA 4AJ4A 1B2LA 2EL9A 4TWZA 4CLRA 2D3WA 4LY0A 3BT7A 4F3TA 4JUDX 3PTAA 4AKIA 5H9VA 3G2MA 4C5CA 4LHVA 4LECA 1EP9A 1KFEB 1JG1A 4FBMA 1EFDN 1E6KA 4NBSA 3ZDCA 1K5DA 3MYRA 4XEHA 2PS9A 3GG2A 2TECE 2XXAB 3VYUB 3P32A 5DOZA 3QFCA 5SY4A 1SEVA 3G0GA 2IH4A 1A8UA 2L18A 3K31A 4XWGA 4F11A 3QXGA 3F1LA 4NU8X 3PKJA 1M6HA 5LQSA 1Y3IA 2E85A 3Q3GE 1YGYA 2GN2A 1I4LD 1YSCA 1YS4A 1UT6A 2Y9MB 3IL2A 1KY4A 2C1EA 3NAGA 2J33A 4JUBA 3PQFA 3MD9A 3EZ9A 1OXSC 2V4MA 4RAOA 2TSYB 1K6IA 2RGCA 2NM0A 3V4FA 2EX0A 3GRRA 4OA8A 3TI9A 2IH2A 1E8MA 2HL6A 4B82A 3ESQA 5A03A 4H3VA 4YXWA 3KIPA 3SDSA 2NPFA 1KMIY 1U28C 2EIXA 2WVGA 3IAM1 4WDRA 4TV9F 3O1HB 1A8IA 2PYIA 2HF9A 2XNJA 3M6UA 2QD3A 4ZARA 4NAUA 2B82A 1JE0A 1A9OA 3GT4A 4ZD6A 2J6BA 3DBRA 3U4AA 4KYUA 4BMNA 1GG9A 2BMAA 4PHFA 1GTRA 1PWXA 2YV5A 4LF5B 1IN4A 3ZY2A 1P5ZB 5K1ZA 2ZSJA 2BFDB 4E2FA 4Q7LA 2JJ1D 3RHZA 4RMHA 4DWJA 4NZZA 3OU6A 3EXIB 4RHXA 1H66A 5DLQC 4LSZA 5BQ3A 5ITZA 3ZWVA 4AIIA 1W47A 4Q5IA 5AO9A 4ZXPA 5PNTA 4DR5B 3SY8A 4MGHA 4B3BA 3C8MA 2WWWA 3FPCA 2V6GA 3GRKA 1BHQ1 1PJ3A 4HNQA 4CU5A 4F2HA 4KH1A 2IYTA 2R2AA 3W3AH 3GAMA 3R3SA 2IPMA 4NLLA 1XPOA 1NURA 1SVLA 1YDFA 2J3QA 1DEXA 3BTUA 4CNBA 5IUJC 2FUG6 1MRZA 3IALA 4ZVNA 4DR4B 3N7AA 5CGQB 1NKSA 1UXOA 3D3JA 5JNUA 1QP0A 1HDZA 3WQRA 3LZDA 1UPBA 2YW9A 2HCRA 5JXIA 4MQEB 4CFZA 1MC1A 2L82A 1CLUA 1DJLA 3WRVA 3T1HB 4PLPA 3TNFA 4XE5A 3SDBA 3JYNA 4HN2A 1I0LA 1P7WA 4W8OA 3RNOA 4B6EA 2YIJA 2J5KA 2FWAA 3WRXA 4D56A 3A9WA 1E96A 4MA0A 3HI6A 1YS7A 1U0BB 1XA3A 2FPSA 2FLWA 4YRTA 2GAOA 3D8HA 2ZJOA 1W88A 2P62A 2IXGA 1DC3A 1P6QA 5D51S 2GEUA 3FOWA 2AT1A 3W2HA 4K9PA 2CLMB 1BMTA 2XRMA 2J4FA 3OU2A 1QZXA 1J97A 1E9AA 1BXGA 1RTTA 2HK6A 2XE6A 3BJIC 2YFYA 2JKVA 4CIVA 1M2VA 2WV7A 4B09A 1C7ZA 1LPNA 1V4BA 2GN6A 1JH8A 2P1DA 1E99A 5G3YA 4JQOA 1Y9ZA 2PXCA 3BIFA 1TLFA 1ID1A 3O9MA 5B7NA 2BJVA 2PH7A 4B8ZA 2XNCA 4IQ8A 1E89A 3JZDA 4RS4A 2R4QA 4U7FA 5D86A 1IZYA 1CE8B 5DTQA 3VNSA 4DMRA 4L51A 2FW9A 3WL5A 1EDBA 3TSAA 3WYDA 1EVLA 4XD7A 2XUOA 1S5PA 2DC1A 4RO0A 4OHZA 4D41A 4EGFA 1FIUA 4IQFA 4C89A 1Z4JA 1IHUA 1E69A 5LYJF 3L6RA 4JUAA 5GGXA 2F17A 2YXEA 1D8TA 4Q00A 1T4GA 5HF5A 1VIDA 4AM8A 2A78A 2JFBA 1YHZA 2P3LA 2WF8A 2P4SA 3PC4A 4HLUA 1T9KA 6PFKA 1M34A 2QDKA 4PIVA 2E4AA 4OIFA 3KYCA 1UQTA 5GONB 3KWJA 4LBZA 5J2UB 2BGNA 4TL7A 3DKIA 4TSKA 1RWNA 3DF7A 1GEGA 5JMPA 4K05A 4DJDC 1GLVA 2UU9B 4LXXA 2GAFA 3UKOA 5ICCA 5I9TA 2DKNA 2FR8A 3B3GA 2H0AA 2QL6A 3IESA 3SEQA 3VC3A 4LY9A 1GQRA 2IYQA 1GPH1 2CB9A 1ZBQA 1ZLXA 1KKMA 4GZMA 1MFZA 5DP2A 5KMGA 1PNVA 3AY7A 1MORA 3PRHA 2YICA 3B38A 1ELOA 3VI3B 4O3FA 4PNZA 5HK8A 4CUKA 3CVWA 1TM1E 2PKEA 5DW0A 4JGGA 4XVQA 5DYIA 2VDUE 3VTZA 5A6VA 1YVRA 3CVUA 3R74A 4G56A 3COZA 3FWYA 4C29A 2UZAA 2QZZA 3OHMA 2V6IA 4J2OA 5F7JA 4BNVA 2I2AA 5COQA 1D6NA 4LN1A 1DKQA 3U39A 3FSGD 2DJ5A 1EVYA 3EIHA 1VMAA 4CEHA 4ZYVA 2P6MA 5T7BA 4JVSB 4OJQA 4Y9TA 1ZINA 3ETJA 4KW7A 3UATA 5KAMA 2X6RA 1HFJA 4GBED 4OXIA 1LVUA 3K6KA 2JCBA 4DREA 1WMDA 4QYXA 5CB4B 2HN9A 1RWPA 4QGHA 2H0QA 4ZICA 2EW1A 3B5EA 4Y0AA 5G2OA 3SWWA 2XUQA 5H3LA 4H6XA 4KRXA 4TTRA 4HGQA 1VTKA 2FPRA 3C1TA 3L40A 4Z1MA 4BVEA 1T2AA 3BB4A 3QF4A 1MT3A 5DNVA 4H7KA 3I1JA 4BAZA 5A3QA 4YDRA 1WOMA 1MX5A 3DOOA 3T5AA 1PJZA 2Z5GA 4Q1BA 2CV2A 3D4PA 5IAKA 1B8NA 1E2BA 1Q1ZA 3A1NA 3HGTA 3JQAA 4FJ2A 4ENUA 1PZMA 3N0WA 1XVLA 4INPA 4KK4A 4J8PA 3INNA 2PRKA 2VBIA 1TZCA 2PFGA 4IM7A 3EIOA 4KIGA 1P73A 1GRVA 4WESB 2IHYA 1FNMA 4LYAA 3ITEA 4R84A 2NX2A 3TLGA 1OLOA 4HAYA 1QE3A 1USGA 2VDJA 2QSJA 1KH2A 1RZUA 3HKDA 1QHYA 3ONNA 3P9NA 3DOHA 1QHHA 4LYHA 3CM0A 4YO8A 4B34A 4CHTA 4F5EA 2RKWA 5SZHB 3AHHA 1S2GA 3HBMA 1UJ4A 3AB7A 2WG1A 4MYDA 3TRIA 2JDID 2PH5A 1YZUA 3QPCA 4M0LA 1IJFA 2I7XA 4DIDA 2MDTA 4L8FA 1QUEA 5KWIA 1M0EA 1QTQA 1MEOA 3UM9A 4YRGA 4XW2A 3J7AC 4EG5A 5LQAA 4QOEA 5CEFA 2YJGA 1WHSB 3PIRA 5GM1A 2V6JA 2ODPA 2JF0A 2JH9A 2K2QB 2PZGA 1OAOC 4MZXA 3G0OA 2FZCA 3LRXA 1ZGBA 3MMSA 3C6QA 3SR3A 4ZANA 4BNZA 1KY5A 1UPAA 4KGDA 2NWQA 1EGQA 3LYUA 3UANA 2COUA 2BH2A 2LKDA 2QVZX 3IQFA 1SAYA 3FWPA 1FVXA 4ARAA 1Y4SA 3QXCA 4UNNA 1W36D 4GKVA 3MCVA 4ZCPA 3ZKWB 2NW6A 3HCRA 4C0HA 4P4TA 2ACEA 2DVMA 2QEQA 1VPEA 3NX4A 4E11A 3UK7A 1QGED 3MBKA 4KCGA 5DXFA 3CZ4A 1QTNA 5F21A 5KTOA 4KAFA 3W8DA 4I50B 3RJ5A 1ABEA 1PWHA 2HY7A 5AJHA 4RY9A 2WW8A 4XVCA 1K8XB 1AU9A 2OMEA 1J42A 1GPJA 3R4VA 3AVPA 1TYAE 1MGPA 2HQ1A 3DDHA 5BPFA 1C30A 3UJ7A 2G7ZA 4H9GA 3PT9A 2AW3A 3NOOA 3SAJA 4BRSA 3S2ZA 3DE7X 5HRCA 2ZDHA 5BY2A 2G28A 1AHNA 1Z4NA 1PBTA 3BTOA 2P6OA 4GLFA 2WK1A 4IZ6A 3ZDEA 1PR0A 2PV7A 2X1HA 1V8BA 3LYLA 3C6MA 1K7CA 3LQRA 3NEYA 3TZLA 2IODA 4D6XA 3NFRA 3AMVA 3HDQA 3TW6A 4PV7A 3R9KA 3IB3A 3EQ6A 1T3ZA 1YB2A 2BGWA 3KM0A 2QRJA 2P6UA 1R4AA 3RYIA 4EKDA 3NYIA 3ZDRA 2QZJA 2WBLC 1P5JA 2ZAIA 1VPWA 2I62A 2DSTA 1EXNA 2EBFX 4YRDA 1WUHS 2GTHA 1LF5A 2NO5A 1Z7GA 2ONKA 5BT8A 1T25A 1ESMA 3P0RA 2B20A 3OCUA 3QGMA 4OQFA 1FFSA 1EWTA 5BYKA 5M04A 2JLYA 1KKLA 3ZK7A 4B2YA 3LK6A 2VBFA 1JI3A 2W2KB 3KK0A 1G55A 2OZPA 2B92A 7REQA 1FY2A 1KFKB 5AOVA 5REQB 2DJIA 3OCWA 2PX8A 3A3KA 2IZ5A 3QH4A 4R7TA 1NDUA 2C3MA 2VAVA 1SQ5A 2PL1A 4X3PA 4ZOCA 3E7DA 1TJYA 1MV8A 3UV3A 1U8ZA 4GR5A 1Z7EA 4HGRA 4KVZA 1FW6A 2Q5CA 1RXWA 4Z9YA 1L5WA 1MF7A 4WNYA 3DDWA 3ZHVA 3LBHA 4IJ6A 3IAM6 1G8YA 1Z35A 1T91A 2BGKA 4FP9A 3UIEA 3DSRA 3PICA 3WGVA 2HSGA 4L16A 4AJ2A 2BBTA 2XF8A 4B2PA 2O1XA 3Q7PA 3B6KA 2YJTD 2Y1XA 1PEDA 3PF9A 1MG0A 1Q0RA 5HA5A 5AW6A 1XI2A 3MJRA 3QLEA 1GYRA 1QOPB 2WT9A 4OTZA 4PW0A 3E7FA 4ZTBA 3K6JA 3NVAA 2DHRA 4YV7A 3IBYA 3LBIA 3C3BA 3RK1A 2GVNA 2D8MA 4NBKA 2R5WA 2OFXA 4MWTA 1SQFA 3KQSA 3WC4A 1V9CA 4ZK2A 3VVLA 1ZW6A 1KY3A 1L7DA 1PQYA 2VEOA 3E0QA 2QU8A 2FSHA 2VAWA 1EA7A 3REGA 2P5UA 1ITZA 5EQTA 1JG3A 2FW1A 5J43A 5LFAA 4MR7A 2GF0A 1UP4A 1M5UA 2F1KA 1A5ZA 3K8ZA 3QPAA 4U2GA 4X45A 3GARA 5EZYB 1F4VA 1EFCA 1NIPA 2FUCA 2GK7A 4AP9A 1K7SN 2OSBA 3L5KA 1JXQA 1ORHA 1EWVA 3DHWC 4N03A 4PCAA 5AXDA 3TIIA 1LCIA 2Q2WA 2E5FA 4GKJB 3W6NA 3EDYA 3HWWA 3KOXA 4MR9A 4Q3LA 1RR6A 4IG4A 4UAJA 3ZJYA 4CMJA 3NFYA 3ESRA 4G1CA 2G80A 2FUKA 1QHIA 1W5FA 1K6EA 3L4KA 4N40A 2HK7A 2XVYA 3IDSA 2CJWB 2GEKA 3MMZA 1FZTA 3G9UA 2GPTA 1E79D 1PR6A 3L6DA 3PDIA 4KN8A 2PUJA 4FYHA 3H5VA 1X1AA 1GV1A 5BV1A 2Z6UA 4JMLA 1XE3A 3PXDA 4RPCA 3ORRA 4EJ0A 1P2BA 3T5MA 4C88A 4P32A 5DTJA 3WJ1A 3X1JA 1MEJA 1WW8A 5LU9A 3GNQA 4D3XA 1CNEA 1L8OA 2HQSA 4M98A 1CZRA 4M38A 3ZJ5A 3UWSA 2OCKA 4Z2YA 5LP6F 3QV2A 1LBSA 4Y2YA 3P7MA 4QPNA 1JDSA 1VSTA 2D00A 1P77A 4Q1CA 2VTDA 4RNCA 3GLGE 2QZSA 1DUSA 2JATA 4RWEA 4AJPA 4IFTA 2ZCUA 2D2IA 4MWGA 5D2CA 4YMWA 2HR1A 3IQZA 3DT9A 1Z29A 2J6IA 4HDSB 4KDRA 4AZVA 3N6RA 3PUZA 3WAKA 5P21A 4S04A 3ZWDA 4ZMRA 3COWA 2A92A 1U6KA 3F5MA 1DFHA 3N2LA 5DTRA 4WBSA 5FUWA 5ILGA 2NV2B 4GM1A 4RYDA 2C5SA 1PL6A 3NGLA 4Y30A 3V4ZA 1MEEA 2BHSA 4RF2A 2EP5A 2D5IA 2IYFA 3G2KA 3PRKE 1XTIA 1XLTA 4FNMA 1T4BA 4FSHA 3BXOA 5FAKA 3C85A 3CH5A 3HBJA 1YOBA 2I67A 3DCNA 4G01B 2FSSA 2GN4A 3TG2A 1JEAA 2NQTA 3RYTC 2DBQA 1QG0A 3V00A 1N7GA 4LXUA 4MMZB 1J9ZA 2I71A 3ZZ1A 3RHSA 3FRJA 2GJ8A 2BRUC 1AKRA 1BX3A 3U56A 4UJ3A 3UPUA 3AQ4A 3HUUA 4CM8A 5EVCA 2WG0A 1F7VA 2R85A 3EQ2A 1JHYA 3RWMB 3EFHA 1G4UR 4S2EA 3W1VA 4PR0A 4IDGA 1F8XA 2CLDX 1GA4A 1SC6A 3NHUA 3QFTA 1R15A 4BL5A 5CD1A 4XCXA 1ZRSA 2O9JA 3O47A 2BFWA 1BWSA 1JDVA 4YDHB 5JDCC 2VH5R 3T35A 3LBYA 4YJFA 4DDWA 1C8KA 1E2MA 4NCJA 4L3WA 3AEUA 3AJRA 1H1LB 5YASA 2FB9A 1IDN1 2JPDA 2FK8A 4PINA 2F2TA 4GMFA 4LV6A 3P1JA 4JEUA 3H2BA 3P5BA 3DOJA 1OOEA 3BQ9A 5JIBA 5L3RA 4CKEA 2UXBB 1QH9A 1R9JA 1Y4UA 1SZPA 1SUPA 5JMTA 4OQ4A 2EYQA 4G67A 2XJ4A 2QX4A 4RTMA 10MHA 3TR6A 2P3OA 1SULA 3GO4A 2FSFA 3NM6B 4H3KB 4LJ4A 3BMCA 2Y8EA 2J3LA 3ZEIA 3OQIB 4RF3A 1G3QA 3G5MA 3LA8A 4B3GA 6NULA 3EVFA 1A97A 1AB5A 1QGUB 4MUBA 3DLBA 1F9AA 1EXMA 1QE0A 2ZR0A 4F9TA 2FEOA 5AJTA 4YRNA 3HKBB 3TYXA 3R9XA 5EHNA 2Q4TA 2QG9A 5EERA 4GYWA 4UMFA 5BT9A 3NHPA 4REOA 1FUYB 4DLUA 3LW8A 3D3WA 4RKEA 1H85A 2P5YA 4UBMA 2AF3C 3RVQA 2PWPA 3FTQA 3ZW7A 2B2NA 1M1YE 1AUXA 1LF0A 2CXRA 3GLSA 4JITA 4PBRA 2HMYB 2ZTSA 1W35A 2NUBA 3O8OB 5BN4B 3VISA 4KWTA 5K3FB 2QMYA 3NUZA 1Z4LA 5I8WA 5FAXA 2X5KO 4XSVA 3SBDA 3HP7A 4K86A 5FWYA 3VYTB 3HJCA 4MWDA 3ZDZB 3SHOA 4YV2A 5DNAA 3NTVA 3JAWB 3KOMA 3RTCA 5I47A 1FUKA 1TAGA 2VEDA 4YP5A 5AHRA 4ZP1A 3DVAA 3YASA 3ZYZA 3DMPA 4YJ2A 4MLZA 4FFNA 3CZAA 4B2LA 5EP4A 2TMDA 3QKIA 3W1WA 1PZEA 3B85A 5B3AA 1PTJC 3A8TA 4B4KA 4E1AA 3KO8A 3VO9A 5KUTA 1PZGA 1SCJA 1Q0UA 2WKWA 5D6OA 4C0LA 5TLSA 1JQ3A 4K28A 5DULA 1M54A 1QF6A 4KN5A 3ISTA 4L15A 4QQNA 3UF0A 5I9MA 4RORA 1FS5A 2QJWA 4YQFA 1TCUA 3V8BA 2QRVB 1OA0A 3LX8A 1ULBA 3LLUA 1U11A 2HJWA 4NFSA 3UA3A 4HXGA 5AK4A 4BN4A 1DKPA 3FA2A 3VHQA 1RSZA 3K09C 3LT1A 3O4RA 4M3NA 1Y7IA 4G0QA 1RAIA 4Q21A 5BN4A 5LLSA 2ZYHA 4D96A 4NYJR 4ARBA 1QYIA 3DFIA 1AG9A 4PG4A 2QX6A 4IIBA 2PY6A 1OSNA 1BU8A 1RAEA 2MT9A 1ZN9A 2FWJA 3O2QB 2IDMA 2OFPA 1NBAA 1Q1NA 5EFOA 3W2TA 5EKDA 2FI1A 4LHZA 4WZBE 3JXEA 4DMFA 4N8EA 2XIJA 1A0OA 2CBGA 2Q29A 1NBIA 1SIUA 4XGQA 3HSSA 1VDMA 5G3ZA 3Q8LA 5A4KA 4JR0A 2IGTA 2H00A 1EDDA 1TO1E 1QHFA 1Z6TA 4LDQA 5UKDA 4B7AA 1T2NA 2YV4A 2HRQA 4B87A 1U8CB 4DLNA 3MT0A 4F96A 1JJ7A 3WK9A 4F7WA 4J3JA 2UZIR 2XYQA 5I7SA 3M1AA 5KTSA 1XMOB 4EGJA 2DULA 4DYDA 4HTFA 2ZTVA 3HY3A 2YY7A 3UGJA 1NLFA 4HNGA 3PEUA 2EWWA 4QIHA 4Q03A 2X5NA 2MYNA 1MA0A 1ZOOA 3V7UA 5JI2E 5F3WB 2IGBA 1XJQA 2J6CA 4ZYWA 3V3KA 2EFJA 2D1YA 1SEPA 2I3GA 3QVTA 3PX7A 2NP6A 3GYGA 2GXQA 3JASA 3FAKA 1T35A 4S1OA 1ISMA 1MKYA 5EJ6A 3ELDA 2X22A 1HSOA 1FSFA 1UM9B 1TM2A 1WUJS 3DNFA 4U2FA 4UZSA 5ELLA 3G0DA 3OFVA 3IJ5A 4L95C 1UMKA 3EC1A 5ES4B 4Q48A 5KOJB 3AL2A 1AQLA 1GG5A 1E1RA 2J0SA 2ADMA 3FCXA 1T8SA 2FPIB 2BUCA 4UMEA 3G49A 4LJKA 3SXPA 2IBSA 4YXFA 5FJJA 2ZIEA 3TEJA 4QJ5A 3PDWA 1EBFA 4CDGA 5K7SA 2REQB 2EV9A 2P9JA 1RC8A 1RI2A 2JK0A 5C1PA 1QYXA 3UPTA 2BGTA 3HBNA 2BR4A 3EDQA 4KXUA 5JU6A 1JTEA 2Z83A 3PE3A 1JU4A 3RLIA 4IZOA 4AU1A 3BDVA 4BQRA 4WZZA 3ZXSA 2DR2A 4TYPA 1YRYE 1W4CA 2HC9A 2HJHA 3WMEA 1DJQA 3OQJA 1W6UA 1G2QA 2MYUA 2VDVE 4YRQA 2WFLA 2NMVA 3VFDA 3ND6A 2WIBA 4PYIA 1X13A 2N1MA 3LQKA 5SY9A 5LOVA 1F12A 3KPUA 2GD2A 1N6OA 4GPTA 2RGGA 4RK1A 5FO0A 3F4LA 5EXSA 1GVNB 1DKNA 4ZRDA 3S0JA 1KQFA 3UMFA 1P33A 1K6MA 3BWDD 4ISBA 3ZU3A 5JVDA 3CISA 3KJFA 5TPWB 2VSQA 1KK0A 5M3BA 4OP2A 3WRYC 4W5TA 4R16A 1Z47A 4C7BA 2H3EA 4K8OA 2HA0A 4KR9A 3PR1A 4UUOA 3MFQA 1MCZA 3MTJA 3EFBA 1Q0TA 2IY8A 2CXSA 3C5EA 3OEWA 4Z0NA 5EXTA 3V1NA 4YT2A 2J0UA 1E2JA 2W2QA 1E5QA 5THKA 1U2GC 4W9RA 2C7RA 1EBBA 1QOQB 2Y76A 4DA9A 4HDOB 4G4SO 4P5DA 3PFGA 4X41A 1RWMA 2ZM6B 3EMBA 3OE7D 3I4FA 3KZ1E 3NTUA 2GZDA 4JGBA 2WAOA 2BZ1A 1TYDE 2DFNA 3H5WA 3MWDB 3U61B 1KI2A 1OAAA 1XMVA 2A1UB 3TE7A 3I2IA 2XZTA 4JDPA 1NUTA 4NYIQ 2H2WA 2M6LA 1DBWA 1MRNA 3IEIA 3JQQA 2HMSA 2NVBA 1FMLA 2AMVA 2G77B 3HJHA 3KJEA 3JQ7B 4PSUA 1SOWA 2A94A 3PUHA 4Q05A 2QJTA 4F4HA 3SFTA 1VSVA 4QXOA 3R3UA 5EIEA 2D1RA 2OO5A 3D5TA 4DQUA 1EDEA 1YQ9A 2A9JA 4M1ZA 1RC1A 3GAZA 3KZVA 3M4XA 5D1HA 1O03A 4I4TB 5AUQA 1GM5A 5CH5A 1FVFA 2G04A 4G63A 5IKOA 3K73O 2H4JA 5T3UA 3WGOA 4OCZA 3WZ2A 3IV6A 5HE8A 2JC3A 3PNSA 4QJ4A 4AMZA 1ACLA 3BMNB 3L4EA 2HJRA 3KR1A 5BQXA 1P91A 3I83A 3QKSA 1WBDA 1IH8A 2WSSD 2RHBA 1W85A 1XTVA 2W6JD 4QBKA 4RACA 5HKLA 2JI6A 1YDMA 1TQ6A 4DWOA 4A15A 4CG0A 2WILA 3GFOA 2OHHA 3HR7A 3L0OA 3I04A 1YZQA 3UJDA 2Y99A 3PGA1 1FBTA 2Z3VA 4FR5A 1BFKA 1UXKA 4G5RA 2W83A 3OBIA 2NGRA 1Z5OA 2ZIAA 1Y4AE 2O2HA 3C4JA 4JLBA 5C8VA 2GTIA 1CY0A 5CLQA 5LZ7A 5KTNA 1JR3E 3I34X 1PWEA 5FTMA 1WMAA 2QMHA 4NDAA 4DJTA 4M0DA 5U4XA 3KJIA 2IITA 1MX1A 1BXKA 4GX0A 1VPDA 3TFOA 2QTHA 5JBNA 2RCNA 5LD2B 1N6KA 3QUCA 3UT5A 3K70D 1UIMA 3QBJA 2IPOA 4HWTA 2BCJQ 2VBCA 3DBVO 3VR0A 4P2BA 2FUEA 2DP4E 3JVEA 3LUGA 5A3SA 3W8NA 3WIDA 4E2ZA 4F4DA 4Q3EA 2RI1A 4H1UA 4V02A 5AKHA 1YQDA 1JHPA 1JKXA 2JVJA 2POCA 3EGDB 1ZOIA 3KU1A 1ARZA 3C3WA 5SV2A 3GCXA 2JI7A 4YJ2F 1NVBA 4I6JA 1H5UA 1R7RA 3C3EA 5IN5A 3QYPA 3GN1A 1MJ5A 1L7XA 1B8UA 2C58A 1Z06A 3BB3A 4W6QA 3ROXA 4P3XA 3FGOA 1MABB 4DF3A 5CK4A 4EB6A 3BF8A 3H4MA 1QIFA 1Z7WA 4INOA 2NADA 5CVEA 3GRCA 5DHTA 5CLIA 3EPPA 5TVKA 2C5FA 2H5EA 1RTKA 3IPXA 4D44A 2BC9A 1KR5A 1VYUA 3GHHA 3JD0A 5DM1A 1VGRA 4CBVA 2ZBGA 4LF7B 5B1YA 2ZWAA 4OQMA 3LKBA 3UEOA 3D43A 2BEUA 1RT9A 2GYYA 2RKBA 3M3DA 3KKMA 2ZJFA 1VXRA 2IHBA 1P8AA 1RWOA 3I2HA 4DIEA 3ZNQA 4R9VA 2QRZA 3BZBA 4TT3A 1UH5A 1VL0A 3BMXA 3F7TA 4AJHA 4HGNA 2FA9A 3FNGA 1NYLA 3FJYA 4UM5A 1GTL1 1O9BA 2QE6A 5A4JA 3KETA 1L5ZA 1QOZA 4GUDA 4YAJA 1CS4C 2CNNA 2YCBA 3EGXA 2W93A 3L6UA 4OM8A 3RRBA 1SOAA 2QN9A 3WKBA 3CLRC 5HE9A 4ZIRA 5B3LA 1ZVJA 1GPKA 3NHWA 1LJUA 1SXJA 3QUBA 3G59A 3TS1A 1L7VC 4EHAA 4AQ7A 2QZ4A 3WAJA 1I24A 4PX5A 3JPYA 3T54A 4Y2HA 3WNQA 2G4VA 4KXXA 4DJ5X 4EYOA 4D02A 3I73A 1F7UA 1X1BA 2DUJA 4WNAA 2ZAGA 3V9PA 5CBKA 2VHCA 3LSTA 4B6RA 3HM9A 4BVKA 1U94A 1PT9A 4FE3A 3I9KA 4Z99A 3JD4A 2POQX 4L72A 1KMCA 3G8CA 2E37A 3PHCA 2IU4A 2MSDB 3U7JA 1C3LA 4J49A 3AT1A 2R11A 1BH2A 1YE5A 1RM5A 5P8WA 1MB3A 2PUFA 3ECAA 2J6HA 1DS6A 4JBYA 2IYVA 1UMCB 1X9GA 4P3YA 5JCJA 2YASA 4AMYA 3I0MA 2YDXA 1C41A 5FPKA 4IXNA 3FKJA 2IPLA 4L5IA 4EATA 1XRNA 1V8DA 3LHKA 1W6RA 1QHEA 2RJOA 4WH0A 1NW7A 1FFWA 2SCUA 3GMTA 4G81A 5ALUA 5TMBA 1RJ9A 3U3JA 5L6MB 4EI2A 2OXIA 1QR6A 2OORA 2PMFA 3L77A 3R20A 4N82A 5ITZB 4HL6A 1F20A 3Q7EA 3PENA 1ZDMA 2W2LD 3C8HA 2IZ1A 1QIKA 4IWXA 3PPXA 1MPXA 1U8EA 4HPXB 4BQSA 4CM4B 3CRQA 1HEUA 4JA0A 3WXBA 3TLKA 2ZU0C 2OK7A 2ZUSA 2NIPA 3OETA 4GVPA 5AVKA 4BS9A 1PV4A 1G64A 1PI3A 3T1NA 3ACBA 2CVHA 1A95A 5B37A 1L8LA 3T1VA 5BSMA 4RTNA 2EATA 4XTCS 5DYYA 4QM6A 1PYOA 1T0IA 3R0IA 4W82A 3FYUB 3R44A 3GLGB 2IEYA 2RBEA 3F6SA 5JG7A 1YJXA 4BV2A 1Z38A 1EUCB 5EE3A 3GT7A 1Z6YA 3OIDA 4JX9A 3C24A 4RM2A 2R97A 4X8LA 1B0AA 3GBSA 4DPKA 4KH0A 5JAZA 5LP6B 5BQ5A 2O2ZA 1W48A 2O0HA 4NJMB 1EKXA 2J9ZB 4DARA 3ZJUA 4R7GA 1TJ5A 1WPRA 1K7EB 4HJXA 2IVZA 4I8XA 2I1QA 1PR5A 1VRWA 4UREA 4BMDA 4XQEA 2ONCA 1N75A 2DR0A 5FWXB 5K03A 4TUYF 4XYMA 3WHLA 3I64A 4YDQA 1XRQA 3GDFA 3O5AA 3RAEC 3DO8A 4HCJA 2FZWA 1W5BA 1IHDA 1A5AB 4NNJA 1XZKA 3U40A 3QXHA 2AKEA 3EJWA 4ZJPA 4HYQA 2CNBA 3KKQA 3TGLA 1T9BA 2QL9A 3RVSA 3IP7A 3W3AD 1EXVA 1B3RA 3AVYA 1NI3A 3O38A 3A27A 1O54A 2H63A 1KHHA 3QU5A 3AY3A 2GCOB 2QGNA 3L7BA 1JNXX 1NQVA 3REFA 1AKUA 1N5RA 2R62A 4WJKB 4YV1A 3N2NA 2ZT7A 4DIKA 4HB4A 3Q10A 1YA6A 3KEFA 2C88A 3HACA 4F8JA 4QQRA 1I01A 3BMQA 4OGGA 1V5FA 2Q3BA 3AV3A 3FKSA 5DSXA 4BNTA 2P40A 1FJ2A 3NP7A 2PK3A 3B52X 3G2IA 1CSEE 1NULA 2I34A 3BJRA 4FS8A 4R2LA 2VNIA 5EE5B 5C5EA 3KEMA 4YVFA 5BSKA 1JQLB 4MI3A 3HHPA 2V8BA 3PXGA 3PYXA 3EIFA 1QYVA 1MB2A 1XR3A 4DLTA 5IT4A 1L8AA 2G8LA 3CW8X 5D87A 3Q7RA 1TE2A 3RSHA 1SA0B 5C4MA 1B00A 3M5PA 2Z2ZA 2P6RA 2UVQA 4BLVA 5LP6A 2JH3A 2C2OA 4X8HA 5FWYB 2W42A 1FP4B 2YZMA 2AC7A 3D6JA 3LMKA 5BV8A 1KA9H 1CLEA 1YZHA 3VPSA 5IDWA 4G36A 2PS0A 3MUFA 1DAMA 2EARA 1Z0AA 1S9DA 4ENQA 4JXXA 2Q2OA 4ES6A 1B0PA 1M2OB 2PQMA 3PUXA 3IP8A 2Q7OE 1G7SA 5A4DA 5A3JA 2J46A 4MVJM 4B3XA 2REQA 5F12A 1T36B 4BPRA 3UCXA 2BE7A 3PNOA 1TCVA 4GPZA 4WXPA 2YFKA 3H87A 5EGSA 5CLGA 1SG6A 1IM2A 3QHAA 1PJ4A 2PGJA 3KQNA 1ZN2A 3MC1A 2WSSA 1CHDA 1Q17A 1CY4A 2PVPA 2X2OA 4MVJP 4YC7A 4EEZA 2GKOA 5DHFA 4HO1X 2VXCA 1Z33A 3GRPA 2IF2A 2RHRA 3Q5GA 1ZGHA 4FLEA 4V0QA 4O8ZA 3WHPA 1KIFA 3DTYA 2B35A 4KPUA 1YQQA 2J3DA 4FGUA 4QWMA 4TSFA 4WDQA 2PGIA 1E64A 1T0UA 4DDMA 4II2A 4HAOA 1A3CA 4EB0A 5AKXA 2O0JA 4WE3A 4D79A 1Y3HA 3RGGA 4P3PA 4BMSA 1GU0A 4UQLA