3O75A

Crystal structure of cra transcriptional dual regulator from pseudomonas putida in complex with fructose 1-phosphate'
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
270
structure length
270
Chain Sequence
HTRTLGFILPDLENPSYARIAKQLEQGARARGYQLLIASSDDQPDSERQLQQLFRARRCDALFVASCLPPEDDSYRELQDKGLPVIAIDRRLDPAHFCSVISDDRDASRQLAASLLSSAPRSIALIGARPELSVSQARAGGFDEALQGYTGEVRRYQGEAFSRECGQRLMQQLIDDLGGLPDALVTTSYVLLQGVFDTLQARPVDSRQLQLGTFGDNQLLDFLPLPVNAMAQQHGQIAATALELALAAIEEKRYEPGVHAVGRTFKQRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose transport system repressor FruR
publication title Fructose 1-phosphate is the preferred effector of the metabolic regulator Cra of Pseudomonas putida
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Transcription
total genus 101
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00532 Peripla_BP_1 Periplasmic binding proteins and sugar binding domain of LacI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o75A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o75A01
4W5RA 4RS3A 2LUOA 1JYEA 1KMIY 1MB3A 1Z17A 1QQAA 4N76A 1LBIA 2PUFA 2IKSA 4MQFB 3M6MD 4Z99A 3EQ2A 4QYMA 1T34A 2E4UA 3HCWA 4XLTA 8ABPA 1NXXA 3O1IC 1DC8A 4G0MA 2B4AA 4JP1A 3T38A 3O21A 3URMA 3H5VA 3JS5A 3EQZA 5IEJA 2NZVG 4HNQA 4MR8A 4Q6BA 2WRZA 5EWMB 1VKRA 5FWXB 3I45A 5KQMA 1U04A 2PMCA 5EWLB 4M88A 3CTPA 3JVIA 4L4UA 2J48A 3E61A 4HNSA 1JWLA 1MAVA 4G0YA 3IDOA 5I4CA 4YR7A 5JNWA 3DLBA 2B1JA 5TQ0A 1RZRD 1ZH2A 4RXUA 5HM6A 4N03A 3EULA 5HSGA 4S05A 4YWHA 3FFXA 4D6XA 1PNTA 2CHEA 4MR9A 3LUFA 2N9UA 4KV7A 4ZJPA 4G0ZA 4O1HA 1H9CA 1XHEA 2A9PA 1Z2EA 3H5IA 1NXTA 5TQ2A 3OM0A 4FB4A 2R25B 5KQGA 2JK1A 3G85A 3MMNA 3T8YA 1DBQA 1NATA 3L49A 3TMYA 4Z0NA 4FE4A 1S8NA 5JNVA 4Z4FA 4Z9AA 3UKJA 1GUBA 4E7OA 3QELA 2F8TA 1BAPA 1D1PA 2FEKA 3FDFA 3C3WA 3NNDA 3Q41A 1YTUA 4Z4GA 4YP9A 4DADA 3TB6A 2MYUA 3O1JC 3RVPA 4GNRA 2FN8A 4LDZA 3F73A 1ZH4A 3LTEA 4MGEA 1U0SY 3Q9SA 3BRSA 3W9SA 1IIBA 2GKGA 4KMRA 1KGSA 4RK5A 4F3TA 1ZGZA 3EDCA 1C0EA 4MRMB 4XAQA 4KK3A 3LUAA 4L85A 3GRCA 2LPMA 5B3JC 4D6YA 1BDIA 3N0XA 5ED4A 3HEBA 3GL9A 3F6CA 3GWGA 5FWYB 1VLZA 6CHYA 1K68A 4JA2A 3OQNA 2RJNA 3O2QB 3VNAA 5KC9A 1KRWA 4E7PA 3HV2A 3LUHA 4H3KB 3H5WA 2XDYA 3LKBA 3KLNA 2QV0A 3CU5A 3FFWA 5T3YA 4RK0A 1JBEA 3MF4A 4W5NA 2JBAA 5KQPA 2BGGA 3HO1A 3RVLA 3DGEC 4IMJB 2QVCA 2FLWA 4EGSA 4F8JA 3FMVA 5IULC 2FMKA 1BA2A 5CHYA 4YRZA 3GBPA 2HQRA 4Y9TA 3IP7A 5CNKA 3VNBA 2A9RA 3CS3A 4ML3A 1MVOA 4LX8A 1AB6A 1MB0A 2NUBA 4MYRA 4TLLB 3H1FA 4W5TA 2PUEA 4W5QA 3KS9A 1RNLA 2MYTA 2H0AA 1LBHA 3K9CA 1Z25A 4D74A 1KRXA 4WWHA 2A9QA 4MS3A 1EWVA 4NCBA 3JTEA 1GCGA 3HUUA 2E4ZA 1L5ZA 1FFWA 4O5AA 1USGA 1ZVVA 1ZY2A 2JCGA 2AYZA 5CNJA 1DCFA 2VYCA 5HQJA 3GT7A 4RSMA 1FQWA 3BBLA 3OMWA 1YMUA 3CZCA 1DRJA 4RK6A 3RVNA 4RXTA 1FFGA 3L6UA 5KI6A 3IPCA 4EUKA 3HXMA 4MLCA 4G0OA 3JPYA 5GQSA 1F4VA 4PZ0A 1R8JA 2HQBA 1VPWA 5C5EA 2GI4A 5HKOA 2IPMA 1RZRA 3JVDA 2L17A 2FXIA 2RJOA 2PL9A 3TO5A 1QQBA 2L2QA 1D2AA 4NV3A 3HDVA 3Q7RA 1LJLA 1YMVA 4WXMA 1NXPA 2IYNA 2ZAYA 3KG2A 1ABFA 2IPAB 4O1IA 4EVQA 1W25A 3B2NA 4N41A 4OLBA 1M2FA 1DCKA 2NT3A 4Q7EA 5TQJA 5E3JA 1JX6A 3OLVA 1DC7A 3HK2A 1YS6A 3H5OA 2FQXA 3H5LA 1SXGA 3H5TA 3O2SB 5FBHA 1TLFA 4YGXB 1Z2DA 3KYJB 2R4QA 1B00A 4RU1A 5IEBA 1Z18A 1FSPA 3KTOA 1VRVA 4KK4A 3GBVA 3BILA 4G86A 5DKFA 3CRNA 5EWJA 2PUAA 3LUKA 4MQEA 3KCNA 3O1HB 3CFYA 3MQ4A 3HDGA 4YLEA 2WWVD 4YCSA 1OXBB 2FMIA 4MS1A 1OXKB 3DGFC 1DJMA 2OQRA 3OMXA 3H75A 4RKQA 3IP9A 1QP7A 5JNRA 2HPHA 2WMYA 1NXVA 1ZITA 1D4ZA 4LDAA 4MS3B 4Z4HA 5TPWB 3QLVA 5JNSA 1SXIA 1DCMA 1USIA 1ZN2A 2FKAA 2VUHB 4ETIA 3NHMA 2AYXA 3MM4A 5JS2A 5IUKC 2QSJA 2YHBA 1JHZA 3GYBA 2PKXA 4Z9BA 4MS4B 5KC8A 3NHZA 1TJYA 2GBPA 3D02A 3OLWA 3MIZA 2FMHA 4WZZA 3CG4A 3DLHA 2PAFA 1PNRA 3OQOA 2VK2A 1A2OA 2VUIB 4QYWA 2QVGA 1RXIA 1W9HA 3QEMA 2FN9A 3BREA 5JS1A 1QMPA 5DCLA 1PEAA 2L18A 4RK1A 4F06A 1DZ3A 1LK0A 5F64A 3MYYA 3RVOA 3SAJA 2FSPA 1M2EA 1QP4A 4KVFA 4MR7A 1JH9A 4YV7A 4HYEA 3K4HA 3RQIA 2ID9A 1NXOA 2QW1A 4MR8B 2IOYA 2FTKE 2MSWA 2QU7A 2GX6A 2KYRA 3MA0A 4EY3A 1UDRA 3T6KA 4RZSA 5DLEA 3KKEA 1M5TA 3F7NA 3OO1A 3OM1A 1JLKA 1P2FA 1D5WA 2LP4Y 3A3KA 3KYIB 4H3HB 4FE7A 2CHFA 4KZKA 5TQ0B 4MAAA 4ETMA 4IGAA 3Q7SA 4RDCA 4TN5A 3C97A 1PHRA 3JY6A 4ZPJA 5KWSA 3QEKA 2A9OA 2QXYA 2ID7A 5FBKA 3OLYA 2E4XA 4MR9B 4RWEA 4CBVA 1A04A 2HSGA 4MQFA 1ISSA 3N0RA 1CEYA 1ZHHA 4KQCA 5TQ2B 5KQLA 2O20A 5CNIA 3DZDA 1SD5A 3H6GA 1ISRA 3IPAA 1BDHA 4NCAA 2IPNA 2R47A 4PE5B 4YO7A 1DRKA 1PUXA 1FFSA 1E6MA 3HSYA 3DBIA 2HJ9A 3EODA 5EWMA 5FWXA 3GV0A 3TD9A 5EWLA 4DQDA 1GLGA 1E2BA 2E4YA 1AB5A 3HVRA 1DBWA 1J56A 5IX8A 3QELB 3RVRA 2MYPA 1EWKA 4W5OA 1JDNA 4G0PA 3RVKA 2FW0A 1USKA 3CHYA 4XASA 1JL3A 3M9WA 1QPZA 3RH0A 3LOPA 3M9XA 3I5AA 3QLUA 3QLVC 3F6PA 2JRLA 3H1GA 1PEYA 4RY8A 3N6VA 4IMIB 3I09A 1NY5A 2JVIA 5TPZA 5T7BA 3LUCA 1K66A 1DG9A 3QX8A 1NTRA 2PJUA 3RVQA 2PUDA 2FQYA 1DBPA 2R48A 3HZHA 4JASB 3UK0A 4NICA 4XFKA 5JNTA 3KSMA 3T95A 4ZYLA 1E6LA 2WY2D 3TX6A 1RPJA 2FMFA 2NZUG 3OQMA 4KFCA 4KNYA 3HJFA 4Z4CA 2M1ZA 3NBMA 4ETNA 2I6FA 2QZJA 1CYEA 1QO0A 4KRFA 4MLDA 4OLAA 2QR3A 2CD7A 3NNSA 1ZDMA 1M5UA 1SXHA 1Y1LA 1ZESA 2JVKA 3A0RB 3Q15C 4PYRA 2F8SA 3LUGA 2JBAB 1NXWA 1C4WA 1EWTA 5DTEA 1L5YA 1I3CA 5TPZD 1JDPA 1EAYA 1E6KA 3CKMA 3P9YA 5IC5A 4WT7A 4OG2A 3EGCA 4GPAA 4MRMA 4N0PA 4DN6A 3LUDA 2PUGA 4RV5A 1TM2A 2GWRA 2HQOA 3OLXA 4RK7A 3D8UA 5PNTA 5CNMA 5FWYA 2OENG 3RVMA 1TVMA 3RVJA 4S04A 1P6QA 1P8AA 2L19A 2X7XA 4WXEA 2P9HA 4EVSA 1QO0D 1U8TA 1SRRA 3HM9A 3KLOA 1YK1A 3CG0A 5JNUA 1P6UA 5IUNC 2E4VA 2M98A 4N0QA 4WUTA 5GOTA 4UHKA 2W42A 1MIHA 4P1ZA 3LKVA 1NXSA 4QPJC 3O75A 4EYGA 3ROTA 1U2PA 1QNLA 3NNNA 4XARA 3C6QA 1LJUA 4XXHA 1JFTA 2RGYA 1APBA 2MSKA 3E3MA 4JB0A 2FEWB 4F11A 2Q5CA 4LE2A 3CNBA 3SG0A 4JOQA 2TMYA 5IUJC 1JFSA 3SM9A 4QICA 3ROFA 3N8IA 2MSLA 1JFVA 1ZGGA 2FLKA 2CWDA 3G1WA 3IP5A 3LMKA 2FQWA 4JB2A 4KQ9A 5TE9A 3Q7TA 5BR1A 1WETA 2PLNA 3H6HA 3QLUC 3JPWA 3O2JA 1U2QA 2LIVA 2WJWA 4G0XA 1GCAA 4KREA 4IF4A 4PICA 1JF8A 1YS7A 4ZMRA 1Z12A 3IP6A 4G97A 4JAVC 3OLZA 1QKKA 3CZ5A 1Z13A 2PL1A 2PE5A 1HEYA 5EWJB 1ZAYA 4IILA 3QLTA 4LE0A 3LFTA 2P4UA 4MQEB 1BDJA 3GA5A 1URPA 4OTZA 2PUCA 3A0UA 4N47A 2JVJA 2IDMA 4MS1B 4OATA 1ABEA 4RY0A 5C5CA 2JB9A 2FEPA 2PUBA 4G0QA 1Z16A 1TMYA 1DP4A 2ZWMA 4Z4EA 3SY8A 4HNRA 4IRXA 1YVUA 4Z4IA 2FVYA 3N53A 4PEVA 3C3MA 3I42A 4ZMSA 4Q6WA 4EYKA 1XWWA 3QK7A 3RVSA 4F12A 4RKRA 1Z15A 4OBBA 1YK0A 4P98A 3HUTA 3OO0A 4EYQA 4UHJA 5DGCA 2V0NA 4LE1A 1EHCA 3N75A 3UUGA 1D1QA 1RXEA 3BRQA 4B09A 3ILHA 9ABPA 3LUJA 2E4WA 3QEMB 3A10A 3R0JA 4LZLA 2WB4A 3S99A 3SQNA 2NT4A 2MYNA 5BRJA 3EAFA 3H1EA 1BVHA 4EVRA 1GUDA 3O74A 5ABPA 3HS3A 1CHNA 5BQ3A 4LRQA 3CLKA 5TPWA 4YS6A 1Z26A 5IBQA 5BRAA 4MR7B 5D2CA 2WJAA 3SNKA 2YHAA 1XHFA 2RDMA 4KPYA 3KHTA 4H60A 1JYFA 1YIOA 2LBPA 4RY9A 3C3KA 4TMYA 4MS4A 5B3JA 3EJWA 4EYOA 3KJXA 1QP0A 1F51E 4RK4A 4NQRA 1A0OA 3FFTA 3QX9A 4RXMA 3N0WA 1EFAA 2DRIA 3FGZA 7ABPA 6ABPA 4TLMB 2H3HA 2IPLA 3ILYA 4MPTA
chains in the Genus database with same CATH superfamily
3VR6H 2A0WA 2EFCB 3KHUA 1WXEA 3PE3A 2EJTA 1OLOA 2FWBA 4HADA 3SQMA 2IHTA 4MVJA 4IXDA 5E1DA 2XUHA 4I5FA 3RTBA 2RCNA 4AICA 4XD2A 1A9OA 1T34A 1FYVA 3G6KA 3NM6B 1FNBA 1CUAA 3WAGA 1Z5OA 2QTNA 2HCBA 4RD0A 4BV8A 4MR8A 1HT0A 3G2IA 1ZD5A 1JS1X 1VKRA 4OKIA 2WICA 3NGXA 2O19A 1U80A 2ANBA 2BFEA 2IOFK 1LLDA 3A6EA 3CT4A 2X0RA 4M88A 4UZFA 1RLOA 1QRTA 3CONA 2NP7A 3E2IA 3R7BA 3G8DA 1Z45A 4M0PA 4MV3A 2ZKLA 4BP3A 3AZOA 4JEIA 3IAHA 3WL6A 1FP4A 3UJ7A 2O1EA 2WM8A 3QVKA 4C2TA 3OY7A 2DR0A 1BXZA 4C0QC 3ICWA 4D6XA 4BNDA 1U9CA 3TIVA 1IUNA 3LF1A 4P4LA 3VZSA 5K0GA 1RU3A 9LDTA 1Y37A 4RSHA 3AIKA 2AEEA 3N8DA 2IEBA 4DREA 1XCJA 2ZYWX 4DB2A 3M6WA 3NBKA 1Y1PA 1GV0A 1YCFA 3B1YA 4QYXA 1TIPA 3G9UA 4Z0NA 2JIZD 3PLNA 4BYGA 5KEIA 2GJ4A 4GAEA 1T4BA 2NTNA 1LQ2A 3CPJB 3U62A 5JSUA 1L8XA 2ZW9A 1XD2B 2J8ZA 5GMOA 4DMFA 4NULA 2EFDB 5IVKA 3UC5A 4LJLA 3GRUA 9LDBA 3Q41A 4K81B 1XL1A 5IM4F 3A6FA 4F4DA 1N0IA 3ZE1B 2HO4A 4TS9A 1HXHA 1L8OA 2OHFA 1I7QB 1Y6FA 3TZEA 1WUHS 1ZL0A 3JRNA 4LC0A 4WI1A 2WM2A 3MFYA 2H7XA 4GOMD 5AKKA 1VCMA 2QJFA 1F0PA 4IM7A 1BRMA 2HSZA 3DLCA 2YJTD 1NJ2A 3OX3A 2IHJA 4NOMA 4PCLA 3THWB 2OV4A 2PYIA 5A6VA 3CLRD 5SZIA 1O4VA 1I01A 5G1NA 1UJCA 4P82A 1YL6A 1WUIS 2C98A 2IU6A 4L85A 1MH1A 1IHXA 1QZTA 1VCHA 4M7PA 1VRWA 5BWNA 2QVLA 3AEYA 4X8OA 4REOA 3EX7C 1V9CA 4R9RA 2YUTA 1CB0A 4HQRA 5ALPA 2JZNA 4EG6A 2POCA 2CMGA 4KFUA 1S0UA 2Y2UA 2A14A 3C24A 3SJCA 5KC9A 2YDXA 3EC7A 5LL6P 5E9QA 4DR1B 5GP1A 4F9EA 3OIWA 1XWIA 2VF4X 2ENUA 3CU5A 3I9OA 3PXEA 3BE5A 1F8FA 1YOVB 2I80A 3UICA 1G4HA 2QTWB 1ODSA 4GSLA 3KQHA 5EERA 1VIVA 4P4SA 5FULA 2PBRA 1SVWA 4JVMA 2Q5EA 4UTVA 5CFZA 1CW2B 1Y1RA 3F5MA 4ILEA 2RH4A 2HMVA 4QVGA 4UKDA 1TAUA 3TNFA 3AG5A 5JZSA 1KYZA 1ODIA 4DSUA 2XMCA 1JVBA 1VJCA 3TQFA 2DUWA 4ZVUA 1QPBA 2R7NA 4KGVA 3UMRA 4ML3A 3FPJA 5E6RA 4YRJA 4UNRA 1MB0A 4PNHA 2A57A 2ZT8A 2J7KA 1KK3A 1SHJA 3GJ4A 5B36A 5MFPA 2X9GA 1JJBA 1RHRA 2WF5A 1QYXA 3ENNA 1AHHA 4OKSA 4J9UE 3F96A 4ZI5A 2GR9A 1D03A 4AQYB 5G0SA 1QCZA 2MDTA 1H2ZA 5DSZA 4M1QA 4POOA 4QTZA 4R69A 1J1ZA 1ZVVA 4NV1A 3PUXA 2WR8A 3CZ4A 3KOUA 4ZOBA 2VYCA 3JD4A 3TMAA 4CQMA 3CRMA 3USCS 4BUJA 1TVKA 4RSMA 3PXUA 2W6ID 2Y0BA 2GDZA 1BS1A 2WOJA 2X13A 3OM9A 4IQ4A 4O4IA 4BMSA 4E46A 1QZZA 1XQ1A 1YCGA 3DOEA 3QKSA 4I5IA 1O7JA 4OHZA 4HR7A 1X7ZA 2B4KA 5L6LB 4X8MA 3E3OA 1L5GB 2PBFA 3VGJA 3ZNQA 1GQQA 2R6CA 2ZYRA 1ZOOA 2H00A 3AF2A 1T8YA 1QBKC 1XG5A 4OOFA 5H4HA 5I3ZA 3EXHA 1YF3A 1K27A 1U8AA 4I3GA 1R4MA 2ZSAA 2QRZA 3I6IA 2IPMA 3L0CA 3P9PA 4TQ9A 3HFRA 5THQA 7AT1A 4C4OA 2PA3A 1ZIXA 2PR2A 3EPHA 2H8GA 1YDMA 1PGOA 4JEHA 2YV2A 4LJSA 2DHDA 4WQMA 4BVHA 1SCUB 4C0SA 4CG3A 5A2GA 6ADHA 2D3WA 5JJ5A 2OD9A 3ZJVA 4JLAA 4LYJA 5HF5A 1UBTS 5ADVA 4FGSA 3HR4A 3NAQA 3JQ8B 3T7EA 3AI7A 3TIIA 1DCKA 2O0LA 4D79A 1Y6JA 3PEWA 2XB9A 1F9EA 5AJWA 2HEIA 3DTVD 1K6IA 1TYZA 3L7AA 5LZ9A 2O14A 5IAEA 3WLLA 2QUIA 2QZ4A 3N0TA 5JI3E 1TJ5A 2PFKA 3OBIA 4MW5A 4NIMA 4WK0B 1F38A 2PBLA 3M81A 2JFNA 2QJOA 3N7UA 3NDBB 3FYUC 4HXGA 1JEQA 1N5IA 2ATIA 2BEUB 4YLEA 1RAGA 1IMJA 4TLAA 4M76B 1OIXA 2UU9B 4B34A 3L7OA 2HDWA 2Q1XA 1DJMA 4BNFA 3WLQA 1NYQA 4QT4A 5B7QA 1GUZA 4M49A 3IQGX 2QTRA 3WQQA 2WKRA 1ZITA 3I6YA 5ESWA 1SU8A 3RTGA 1DLJA 1NDUA 2YFHA 3FCAA 5JEEA 3ICEA 1FDSA 1ORHA 1XTZA 3VUFA 3RE1A 1QWSA 3ELUA 2X3YA 3FDJA 3LX8A 2DC1A 3LK6A 4ND5A 3TNYA 1H1DA 4YONB 1R6AA 4NARA 2REXB 3OWHA 5F4BA 4DA7A 5CAEA 5L3ZA 3ZJTA 1NC3A 1IUPA 3D02A 3WKAA 5AICA 1G21A 1I1NA 2FMHA 1T25A 4GKVA 1E3IA 4LC9A 4Q34A 1HFJA 2GXQA 3S29A 4YLGA 3MJVA 4BN4A 4BNHA 1ZK3A 4E1BA 3LWZA 6ABPA 3AI3A 1DHRA 2CB9A 3VFDA 1Y82A 2B8WA 2VPTA 4LX0A 5IP5A 3ZLTA 5AW3A 4YUYA 3UJCA 4S0XA 5A3VA 2ZWOA 3KD3A 1EUZA 1LI4A 4L9RA 1PSWA 2I2AA 4WJKB 3EWIA 3JVVA 1HNZB 3ASUA 3IDZA 5J40A 3B6EA 2E82A 5EP4A 1NT4A 1LK0A 4F9FA 4QPZA 1X87A 2QTAA 3A1CA 3R09A 2JATA 3OCUA 4K26A 2GK7A 1TM7E 4GXTA 3W0LB 1E1LA 3V4SA 1UAGA 2ID9A 1CJBA 1MB9A 3VTZA 4A27A 2FSUA 4CKXA 4D8TA 3NHUA 1V1RB 4LIPD 3AM3A 2QN3A 1IBMB 1CXZA 1N3BA 1VL0A 1GZUA 6REQB 2O6HA 1GILA 2BGRA 4BO5A 4AO6A 2KM1A 2W6QA 3FAKA 4PY2A 4A6PA 5LXTA 3HB1A 2FPKA 4CMJA 4JYCA 5KBYA 3JRWA 3DTYA 3OCZA 1F6DA 3FIJA 4C05A 1TYDE 3A14A 3LG2A 1SU4A 3NIGB 4IOKA 4LSZA 4NFLA 1LPOA 1T8PA 5JMTA 1NTOA 1NOIA 2JLUA 4I9NA 4TN5A 5IN5A 3VHXB 1PHRA 1WBBA 3ZVMA 3L4EA 1H2XA 1LS6A 3WKEA 3QEKA 3THXB 2HPVA 1RZUA 1T6NA 4YQFA 4L9WA 1Z5ZA 4D26A 1GPBA 1ZZEA 4DDWA 3SFVA 3L1KA 2VP3A 3GLSA 1RJEA 2W0SA 5L3SA 1CJCA 2EL9A 5EZYB 1C41A 1NBMA 1SRQA 5A4FS 4NCAA 2ZQYA 1IY0A 1G60A 4PZDA 5ALZA 4K3VA 3B1VA 5C34B 3GV0A 3LYUA 1JAIA 1H2YA 4HDSB 1V2GA 2DQYA 3WZ2A 1LDNA 3RVRA 4FNAA 2JASA 3NIFB 4B6QA 1ES9A 2FOLA 4OMUA 4B3DA 1DQRA 1M2VB 3STHA 4LF7B 4IGFA 3SYNA 2Q6KA 5E4TA 2FUEA 2YMLA 3M9XA 3QKWA 2H31A 4IGIA 3MZ0A 1W93A 3PD0A 1GTVA 3NUGA 4JC4A 3VQTA 4AIIA 1K1EA 3JD1A 3I09A 3GUCA 1E3JA 4J49A 5D3ZA 2AG8A 2PUDA 2QDXA 2UVQA 4UE3S 1QH8A 4K6FA 5KPJA 2H1HA 4WZBB 1ZNYA 5AIAA 1RRPA 2XDQA 2E48A 3GCWA 2J1LA 1ML3A 2I2BA 4UARA 3TLZA 4YRBA 4ZN6A 9ATCA 1T91A 3L40A 4CKZA 1OWLA 1FYWA 1V3VA 2BFNA 1V11A 2AK2A 3S2UA 1UZLA 2XKBA 3W6UA 2PD4A 3SF8A 3EW7A 3JQBA 5I7FA 5EGSA 2IYUA 4ETNA 1TQ2A 5JYCA 3KOYA 1ZSNA 3BTUA 3RPEA 3IUBA 1W47A 2LKCA 4IO0A 4YY3B 1QRUA 1IN7A 3AP3A 8GPBA 1YR3A 1J8MF 4KYTA 1WHSA 3B38A 4P54A 4Y9RA 4YAJA 1B0UA 1UXIA 3IH5A 3AHGA 1W581 3KQTA 3W90A 1VIYA 3PCXA 1I2AA 5I4IA 1C4WA 1EWTA 2CXNA 5JFTA 1EVYA 2W6CX 1XMPA 4LJ8A 5LN1A 2YWXA 3IPXA 2AFHE 4IDGA 4R1LA 3WSVA 2E5LB 1E6KA 3UF0A 3O9ZA 2Y1OA 4X8LA 1GKLA 4OB6A 1IBLB 3KEFA 1IZYA 4DN6A 2F9FA 4DVGA 1TM2A 4ZVOA 2D2IA 2KB0A 2H0RA 4U02A 1ZC4A 3QKIA 4YJHB 3IAXA 4GI3A 4HEQA 2WSIA 3MINA 1QWOA 1U63A 2WAAA 1K9VF 1OFUX 2XDWA 5FWYA 3QUAA 2IIPA 2Q9CA 3INRA 4A0QA 2JKVA 5DNAA 3GB9A 3RO7A 4PYLA 2J9ZB 3R77A 4ND4A 4X1KB 2SHKA 3S0JA 3DHVA 1FXUA 3OFNA 1BMFD 1YKGA 2MSCB 4ZTBA 1F06A 4WBNF 4MIYA 3L46A 2IYEA 1DZIA 4KQHA 1JA1A 1FDUA 2E4VA 3RHTA 1R18A 4F3NA 5EIXA 3VR2A 2EDAA 2NO9A 5FHRA 3UVEA 1GYPA 2XYPA 2ZKIA 4J6EA 2KS6A 4FXPA 3PUZA 3WNDA 4ED9A 5JEDA 1PS8A 1P5JA 3EF3A 2HZBA 4JC5A 3REGA 1Y3FE 1ZISA 4JODA 1B8OA 3VO2A 4CLXA 1UOEA 1E0DA 1K0UA 4TGLA 2B5VA 5BQXA 2VTBA 3ZDQA 4N7MA 5TJ9A 4BCDA 3UAZA 3G2MA 1XZBA 4KGDA 4U2EA 4UBIA 5HGJA 1Q17A 5BURA 2QGNA 2NXWA 3H3FA 4RSRA 4HDQB 3L2OB 5ALFA 2VSQA 2A3RA 4KR9A 2D5BA 5D3KA 1E5VA 2IP4A 1DC3A 2D7JA 3IMGA 3N70A 4S24A 1BX0A 4BO3A 5JWOA 1RWVA 2Y9PB 3N3BC 3Q6IA 4W1QA 4R2MA 4YEDA 4ZWNA 4EKGA 3GF4A 6LDHA 2A0FA 1E58A 1ZI8A 1XKXA 3WGKA 4JFRA 3UQYS 3WMXA 1JHAA 4FE3A 1C14A 4WK4B 5FAXA 5KSYA 5M29A 1PFYA 1YFJA 5JJIA 1E0AA 1FTQA 1WXFA 3TL3A 4TWIA 5BV7A 3C3YA 1V35A 5ALGA 2X58A 1PGNA 1RACA 2V9ZA 3H17A 3JTMA 5J43A 2H63A 2YCLA 3U7QB 3B51X 4ECAA 3F0TA 1XJ0A 5KVCA 4FCVA 3S27A 1E7QA 5JJLA 4F0JA 4WCVA 1JDTA 1UOOA 2J33A 3CEMA 4O6VA 1O0CA 5KYUA 3L6RA 4N47A 5F2OA 3AUKA 4OQEA 1Z0FA 3PE4A 4L4YA 1FBTA 2VDKB 4B80A 1YA8A 3A9SA 3D4IA 5J59A 2FPGA 2ASEA 1Y42X 3VH4A 4U00A 4D46A 2RAFA 4MP6A 3LQRA 4RAOA 5C5IA 1PN3A 1Y1TA 4B6JA 1YVUA 2Z6UA 2J5QA 3L8DA 4Z7QB 5JASA 3AK4A 4ZANA 1KBOA 1YHNA 2WVJA 4RO0A 1KZGB 4EP1A 3WWZA 2QA5A 1ZN7A 3KBBA 5IG2A 2R1TA 2KLHA 4WASA 4UXJA 1AXRA 3G88A 2ZRPA 1D1QA 1NE2A 2DPLA 2HADA 3A4YA 1LSSA 4TUYB 2YN0A 4OQNA 1MAAA 3ABOB 2VTKA 3SX2A 3H6KA 3TZBA 3O8OB 4G8DA 2M2IA 5DBIA 2W5UA 5FI0B 4PCAA 4H4CA 4KE7A 4PZEA 1IOVA 1U11A 4RHTA 3SI7A 4AQ7A 4ZVQA 1V6CA 1XLTA 2BFWA 3Q2KA 1JV2B 4KGXA 4PLCA 5TJHA 3MJ4A 4LMPA 2GZRA 3VO1A 3ICOA 4PLHA 5FFNA 1KXJA 4CKWB 5AVOA 2BJVA 2YHAA 2D1FA 3LT0A 4PPYA 4B35A 3CKLA 4CIAA 4KPYA 3U19A 4JXXA 2EZ9A 4BMXA 2F3SA 2P6NA 4H60A 2PR7A 2LBPA 1ZOIA 1N25A 4EATA 2I4NA 1XTTA 4M21A 4W99A 2YWRA 3DBOB 5IMBA 3WFIA 3WIUA 2OY0A 5EP2A 5GJVC 1Z74A 2D1TA 3OUZA 2ZUBA 4Z7OB 1A2BA 2O8DB 1XDSA 2GN0A 2V7QD 1A0OA 4IUBS 2AJBA 3ABIA 4RZHA 1PD0A 1EDOA 3QVXA 3PC2A 3I23A 3DYBA 2I2FA 1JWAB 4KRXA 3SWWA 1Y33E 4G0WA 1U7DA 3L93A 4YA6A 4D9HA 2H3HA 3AUFA 1EJ0A 4XLZA 5K0BA 3TZKA 2OAEA 3WY9A 2VHWA 4P58A 5DX1A 1GFIA 4XQCA 1H85A 3FFAA 4KWTA 4QREA 3RS4A 5KNDH 4KN9S 2D7CA 2WD7B 3ZVNA 2Q21A 1G8SA 1MPTA 1JGTA 1EIWA 2G4CA 3E53A 2DCUA 1H65A 2O5CA 3MD9A 2E4UA 4Y1GA 3HCWA 3F4BA 5TR9A 4RTOA 1F3LA 4I5DA 3H5VA 1MNQA 3TEFA 3DCJA 2GLUA 1DXOA 3V8NA 4P7FA 3JU3A 2Z2JA 1UQRA 1HWYA 5T8KA 4PINA 4WKNA 1KI6A 4CUZA 1UJ2A 2WA1A 2I6SA 4TLCA 4IIJF 2WZDA 3R5HA 3WP0A 1KK2A 1NJ5A 3JWJA 2C2YA 2VCYA 4ZYVA 1C29B 3PX2A 2EIHA 3B5JA 2IY9A 1N3IA 2B1JA 1U28C 2X2PA 1UC9A 3V3TA 2B8JA 1HY3A 3BMQA 1C1HA 4HH3C 2ZVJA 5IF3A 2J59A 3JWHA 1JECA 1CFZA 4RVHA 4W1SA 2Y92A 1K7YA 2OR3A 4MWCA 3QTLA 1I3LA 2Q6OA 1T6BY 4F97A 1KQFA 3DFZA 3QTTA 4M6WA 2NIPA 4EI2A 1YUBA 1GPJA 2C4MA 1PJQA 1TRKA 3BULA 4PLTA 5ALRA 4L2IB 4TTSA 1Q0ZA 5K2MA 1UBEA 3MERA 4UAGA 3EGXB 4YCJA 2HF9A 2ZB3A 2FWJA 1BQ3A 2JFVA 3D31A 4M1ZA 3UJ3X 3IKLA 1GGNA 2I5PO 3TAXA 2F8TA 1M0SA 4E7OA 1WMAA 5HRCA 5IBCA 3PWZA 4AKSA 2CHVA 1FUYB 4D4MA 3SKXA 1RBMA 2VDWA 4BAUA 2G4LA 3FYTA 2BE9A 3LX4A 4DC9A 2DUNA 1QM5A 4NMWA 4P34A 4PSKA 2AG0A 3B70A 4N3CA 2EW8A 4IDBA 2DFTA 1YNOA 3RDPA 5CH3A 1DL5A 1ADJA 1N2CB 4IUDS 5IK2A 2DFDA 2I6XA 2P9EA 1C0EA 1OAOC 5D00A 4D97A 3GRCA 2LPMA 4INZA 2J6BA 2QQ5A 3HU3A 3R6WA 3G2JA 4WK6A 3V1KA 1TOAA 2F43B 4NR0A 3LRTA 4JITA 2P3QA 4PN7A 1SD2A 3ZD7A 5AI8A 2BH2A 2VWQA 3OPXA 3LZ6A 4HB4A 3W5HA 9GPBA 4UXIA 4TT3D 3IUSA 4NL4H 1KFJB 3TEMA 2YICA 3CTMA 3V4RA 2OB2A 3BICA 1RLTA 3OETA 4XIYA 1U3FA 2XYHA 1C2YA 4LJYA 1W0CA 2YYZA 5JH7F 3WG9A 3IPRA 1O94C 3UKDA 2G1UA 1Z73A 1U9JA 2QVCA 2ZGVA 4NATA 5ER6A 5F33A 3V55A 4WZAB 3L7NA 3RG2A 1AQJA 4AY4A 1M2OB 3ROGA 3WA7A 1EU1A 2RE8A 4OX9Y 4PCUA 1M8KA 1G2QA 1D2CA 1SUWA 1P4SA 3PGXA 2YQZA 3J80A 2HDNB 3HBLA 3MS4A 3DLHA 1R0CA 3NEPX 1Z36A 3MCUA 1B8VA 2D0PB 1L0BA 1OQAA 4RVFA 4G1CA 1O0BA 1EE9A 4W5TA 1EHIA 4BVKA 2EKDA 5MDHA 4V0NA 5T4BA 4CM9A 3HCRA 1S2LA 2FPIB 4D74A 5LYJF 2C2ZA 2HYIC 2QTCA 4NCBA 2XBUA 3G2HA 4FILA 3EZ6A 3B3QA 1H69A 1FFWA 2NO1A 2Q6IA 4JR2A 5JLAA 2BJHA 4DMRA 4Q1FA 1H9BA 4GX1A 3LF2A 3MRVA 1T6ZA 3NVAA 3OOJA 2GBIA 3Q7EA 4OXNA 4U3JA 4LKOA 4L8LA 3FVTA 1YJBA 1IDN1 2JJMA 2ZUVA 4HLCA 4M1TA 4TX1A 5A4JA 4R0NA 2FPMA 3HJNA 4KAAA 5AI5A 2P5SA 3RFUA 4R84A 3V48A 4RHXA 1AE1A 2IVZA 3CIOA 1P18A 3UQZA 5JJBA 3TNJA 4P3OA 3PIDA 1NPYA 1BOFA 2PIAA 1YB2A 3KKQA 4RPHA 2YMMA 2NO5A 4TMWA 3WBBA 3EW9A 3SHWA 5C3MA 4IDQA 3IP3A 2P35A 1XTRA 1GPAA 1WE2A 2Z57A 5FA8A 3RFTA 1FRNA 2HJGA 5JXIA 3R76A 1E66A 3WYNA 4DMLA 1WBDA 2RJOA 1XYGA 3A9VA 4HQ0A 3O3CA 1KE2A 2BZGA 4CLOA 4CLRA 2RGCA 1GZ3A 2DKOA 3E5HA 1RWMA 4WXMA 5ILGA 1JG1A 4C4RA 1CP2A 4YJKA 2Q9AA 1KZ7B 3FH0A 2FAXA 1ZNZA 2QORA 3D7SA 1GKYA 1TT7A 4L8FA 2P0AA 4YJGA 3W9UA 5TQJA 4PAWA 3RTCA 5CCXA 4X6XA 1AMNA 1OFGA 3MWFA 1DOHA 2NXNA 3BMOB 5THKA 3DAGA 4CKYA 4YJ2B 4M9SA 4EZBA 2OWDA 1N2CE 5SZKB 3ZHVA 3SBDA 5IKEA 5IPFA 1P9NA 3A1SA 4KSBA 1T3HA 3VDRA 4J2OA 1UXKA 3ZV7A 1JNYA 4QQ8A 3AHDA 4TYYA 2XMPA 3O1HB 4NYMQ 4OGWA 3ONNA 4YGYA 4HGPA 4MVJH 4JCOA 5BMVB 2BGUA 3VH3A 5FOQA 4LXQA 1QX3A 2JLQA 4L7QA 4U2CA 5DW0A 2PXCA 2CNOA 1O96B 3R40A 4EB6A 3GLQA 3H13A 4NECA 2LV8A 4OHFA 1A96A 4KPFC 1I6WA 4O4JA 4C4AA 1UEXC 3FRIA 4CIDA 2AHRA 1PJ2A 1SXIA 1USIA 3FZNA 4G1VA 4GMFA 4E30A 3F2VA 1VMKA 3UO8B 8AT1A 1M73E 3PEVA 1X92A 1YZVA 1W52X 3SEQA 5FAKA 2MT9A 2QBYB 2FPRA 3OPVA 5G3ZA 4CMIA 1SA0B 3U1BA 4WZAE 2DETA 1TJYA 1QKIA 4JSRA 4HQKA 3FZYA 3IT0A 2GD6A 4WFIA 4EHHA 3RJ5A 4JSTA 3NDJA 4CZ2A 3MRSA 5AVXA 2F9LA 1P4RA 3B36A 1PR1A 3INNA 1KAMA 3FB1A 3GEPA 3ZHQA 5KYTA 2IZ0A 3KOOA 4OFWA 4R8LA 5CCEA 1VHQA 1U2DC 4NJEB 1BKDR 3FSEA 1QMPA 4OVKA 5EUCA 4FOLA 5HHTA 3NAGA 1G291 1N5LA 4DR2B 1XRNA 2QLNA 1ACMA 3GEHA 1JALA 2YJZA 3WLSA 4OI1A 1TAQA 1XCGB 1N1EA 2IXFA 1RJGA 3FSGD 4YDRA 2IGBA 1EXVA 1M1XB 1RADA 1GQOA 2OORC 1RRKA 4RJ2A 4XSVA 4A6EA 3IV6A 4P36A 3IJEB 1WV0A 4QHSA 4QDZA 4C6TA 1QBGA 3NDPA 2MHCA 4MR8B 3U3ZA 4CG0A 1N0VC 3V4ZA 1KZHA 3M5CA 4FYVA 4JI7B 5KJ1A 2BFEB 3HRIA 5L3QB 4M1WA 1E0SA 2QRLA 2B30A 5LU8A 3AR4A 4IFIA 4PXAA 5LZ2A 5MN4A 1L5OA 3C4VA 2EFEB 4KV9A 1LF5A 5DM2A 1E1RD 2VHQA 4JBGA 1KFCB 4YRGA 1RAIA 3FPGA 1Y8ZA 1FP4B 1ND5A 1VL5A 2FN4A 2VI5A 1PJTA 4XWGA 3WWEA 3PGJA 4YVFA 4MUKA 1KI1A 1NI5A 1XRMA 4UM9D 2O7QA 2XHEA 1I5EA 4OXQA 4ZQFA 5HF9A 1I7NA 3R7SA 5JJKA 1USVA 3I9MA 1ULHA 5FWAA 4BNDB 4H59A 4HDKA 4NSNA 2VPQA 3BE4A 3WK5A 5K4HA 3VTAA 4A2WA 1A5ZA 5H83A 4L07A 3KWMA 4YUVA 2QG4A 2HH9A 3OCCA 2JAHA 2XF8A 3DONA 3GLRA 3IPAA 3H0EA 5D3QA 1QDEA 3HSYA 1IYZA 1VL1A 3LWBA 1K88A 4HAYA 1GLGA 3KFVA 1C1YA 1CZNA 4GZLA 4IIYA 1S3GA 5IX8A 4CR6A 2JI4A 4FHDA 2B25A 2NYVA 1Z4IA 1RAEA 4HH4A 4K46A 3ZWNA 5CFQA 1Y8AA 4LOIA 4CMGA 1RKVA 5AD1A 5DTQA 4CMAA 3GUZA 2DH5A 1WW3A 1T2CA 2P68A 2JRLA 3L0PA 3QLVC 3UN1A 3CLHA 1E9EA 3KALA 2CJYA 2E37A 1NY5A 4OQYA 1UIRA 2HTEA 1CJSA 1U94A 2XT9A 1Z38A 2FDRA 3JZAA 5AI0A 1A95A 1KP2A 1NJ8A 2V65A 3HZHA 1A7KA 1P2TA 3BXXA 3GX1A 4P9NA 2OBFA 4EENA 4LYDA 3FZEA 5B4UA 2A7XA 5IKMA 5B3AA 4KFCA 3TX6A 4XWKA 3LO5A 3O9MA 4Z4CA 2KW5A 2P2CA 3KPJA 4W4TA 3NTOA 5KSOA 3ES9A 2WHQA 2O1WA 1CR0A 1CTQA 4KSCA 3TI7A 2P9TA 2WLTA 4DDMA 3LWNA 2ZRAA 2MR5A 1IJKA 3QE3A 1N9KA 2PT9A 1UXHA 3GGGA 5EUBA 3V4VB 4EEZA 3SZMA 1E9CA 1IWPB 3PGLA 2EJVA 5EP1A 4DVJA 3FZGA 4P4SB 1JFLA 1TTQB 3AEKB 3E3AA 1JDPA 2RSLA 3IODA 1E1NA 3BXHA 5DNUA 2W2KA 4RZXA 2AWNA 1G59A 1NLUA 4GM1A 1ESZA 3AKEA 3E7DA 4MVJE 3ADBA 5AP9A 3Q8WA 1AOXA 2IE0A 3O2NA 4JXJA 3HN2A 3W5DA 3LQFA 1VZ2A 5E6RB 3OUTA 1FTNA 1G3IA 3GOHA 4QGBA 1FW6A 4BX9A 5CA0F 2YY5A 2A58A 4PX9A 3QYJA 5E38A 4NS1A 5C81A 4O0MA 2J4DA 2F3QA 2QLMA 3WLFA 1WM1A 2JIDA 2XZTA 1TCVA 4MYSA 1NVGA 4NZNA 1MG5A 4YCNA 2J3QA 2FX2A 2R97A 3G49A 2M98A 3OFKA 2GPSA 4PG7A 1TKAA 5GOTA 5L53A 4CQMB 3PU6A 1TVKB 1LQUA 3KPUA 4O4IB 3VI4B 4BE4A 4F1KA 1UJ6A 4D9NA 1HURA 1QO7A 2AZDA 3QKSB 1U2PA 3NNNA 3K09A 4I4LA 4ND2A 4DA4A 5K01A 2DSTA 1X7ZB 2EZUA 2OBXA 3GROA 4FFVA 4ZCPA 1CU1A 2WYIA 1O94D 4KZPA 3IALA 2C1EA 3GXOA 3O0DA 2JANA 3OPYA 4K88A 4OYRA 3EXHB 2VJNA 2YV3A 5EE1A 2ZXFA 3FZQA 1R4MB 1YBAA 2VF5X 1E63A 2XW6A 4G07A 1THZA 4X0EA 1ZGGA 2FSIA 3GLTA 4ZO7A 5A04A 1OBHA 1SUAA 4RVCA 3NHWA 5FCDA 5TX7A 5TLSA 5CCDA 3O8BA 4RE6A 4QATA 3MLAA 3JYQA 5B6IA 5LQMA 4PC3A 5ESDA 1QR2A 4LVOA 3JYNA 3HYNA 4HFRA 1TA4A 2PGIA 3A8TA 3B6IA 1PT5A 3SHTA 4DGQA 2ZATA 2PH1A 1C80A 1W87A 2BCJQ 4WSOA 2MOKA 4UDXX 1KPHA 4QSHA 5DU2A 5EUMA 4TXMA 1R2QA 1GGJA 3SN6A 5INTA 1JTFA 2EX4A 5GV7A 1JSRA 1QK3A 2EGHA 6YASA 2QD2A 3HN7A 3FG9A 4IDOA 2JAWA 2GH1A 5A02A 4BL5A 2WT9A 4MUXA 2QM0A 3B9PA 4N3GA 5G0WA 3CLTC 2F3PA 2OXRA 1JEQB 1ZD9A 3GHHA 4UM7A 4Q3NA 1URPA 2A6PA 4FKZA 2A59A 3A0UA 1MFZA 2JVJA 2W11A 4PYNA 2XNSA 4QFCA 3TFQA 4J3NA 3C3XA 4TZTA 4B83A 5F23A 1ABEA 2XVAA 3UWOA 3EZ7A 1NJGA 2M6KA 3HWRA 2AK3A 1DRUA 1MQAA 1QIKA 5CLQA 2DWCA 5KYYA 3LV8A 3PG5A 3CWCA 3ZIAA 2BISA 3N58A 5AM4A 2VAXA 3PP8A 3SJAA 4IRXA 3N76A 5HW0A 1ZXBA 3NHBA 3RHSA 4C4ZA 4XJVA 1B1CA 5JZOA 1KAGA 3DB1A 3DBHA 3KDSE 2GZAA 4O0LA 1PF7E 1W35A 3X1JA 2JFFA 4KRYA 4EYKA 2I34A 1NONA 4MTCA 2AC2A 4WECA 4B3JA 4F91B 4YRFA 2Q2VA 4NBSA 5E6SA 5K8VA 5CAEB 2H92A 3JZMA 4ZQBA 4AJNA 5K0TA 4HAWA 2ZVPX 2J5BA 3C3JA 1MVLA 2B4TO 3AP2A 1AGXA 1G21B 1WA5A 2VC2B 3M1AA 4ZQCB 1UKZA 5DRTA 1KYIA 2VPIA 3KU4A 1AV7A 3O94A 4ARBA 3WR5A 4BFTA 4UTPA 3THYA 2Q99A 1QG0A 2J3IA 5BUQA 1E8MA 4UPDA 2HPZA 3OAAA 4HZUA 1ODJA 1KJZA 3PWKA 3AO0B 1SY7A 3GJSA 3NV7A 5TNXA 2G04A 1GNTA 2IYPA 1K7SN 5JBQA 4OH1A 2AJCA 3UA3A 4US1R 4ARZA 2CL6X 3OTIA 2QSZA 1J5EB 3CLKA 2P4HX 2PJDA 3ESAA 4K5QA 5BRAA 3GC6A 1PFKA 4NENA 3Q3HA 4XVRA 2FFBA 1M76A 1SQ0A 2VHYA 4OYLA 5EJAA 4FX2A 1WOYA 3P0EA 1VPEA 3SNKA 4CQJA 1JU4A 2D5IA 2NVUA 4G84A 5LQAA 2COEA 3UMBA 1XVVA 3BJEA 1T5DX 4JUIA 4RY9A 1V71A 3M1IA 4Y2RA 2PGAA 3WGGA 2C88A 13PKA 3INYA 4QBHA 4IFTA 1XZKA 2PWPA 1IFXA 3DT8A 4AXBA 1B41A 4MV1A 3QX9A 4IJQA 1EFRD 5LXTB 1ESMA 3WRYA 3WGNA 5H59A 3IXLA 4HVLA 1TJNA 3OEEA 2H9YA 3QYPA 3ZYZA 1FMTA 3HU1A 3VSAA 4XYMA 2A86A 1SCIA 2C78A 1YZ3A 2DOKA 4MPTA 1ZD8A 2FW8A 2O2EA 1EQAA 1MB3A 5HDQA 4D0NA 2VZ0A 1WUTA 4ZYUA 5DNYB 1CJKC 5E3IA 2WPNA 2FQQA 2Q2WA 1XA0A 1PJZA 3BQNB 4HCJA 5FPSA 5CK5A 4OHMA 2C9OA 2CNWD 4RFLA 3PIIA 3B82A 3JD2A 2IBMA 4N3AA 5LBIA 2AMLA 5L3SB 1O95A 2B7BA 2B1GA 3KLMX 4YJDA 3EEBA 2A9FA 4G41A 4W63A 2ZROA 3EXEA 2HHJA 1K4KA 2C4TA 4L3VA 2ODQA 2Q28A 1RKUA 4FZVA 1JQLB 1RWNA 3G8YA 3FRJA 3RS0A 1JWLA 3GFQA 4UCQA 3AVXA 3DHNA 2Q62A 2WAOA 3WFZA 3HUEA 4M8IA 3VNBA 4MAFA 1VMDA 1CJUC 4C20A 5CB4A 2V0GA 2FGJA 2F67A 4I3HA 2V58A 2X8WA 2Y4NA 4N5LA 3QOFA 4J0GA 4PAOA 4YWHA 4KR6A 4ALKA 4JJFA 2AFVA 1C81A 3LUFA 4BNVA 1TK2A 4ZGWA 1SU6A 4G0ZA 1H9CA 3GG2A 2XUQA 1IC6A 1GLVA 4UNSA 3PQ3A 2Y1CA 3CX3A 4RE5A 3G5TA 4LBZA 4ZRMA 2XDQB 5DXAA 1SBYA 2SKDA 1TTPB 2D13A 3F98A 4M36A 2PBZA 2NTJA 1HDEA 5G02A 3SNHA 5AXDA 1V11B 1WSBA 1HGXA 1G7SA 1L7XA 3H2YA 1WO8A 4UBNA 2BFFA 2GKOA 5CX4A 3RSSA 3SF8B 2VA9A 4QU5A 4GLFA 3GLFA 4RJIA 3DDNA 1PWZA 1G21E 3RJMA 1FS6A 1ZUHA 4WJZA 5JAIA 3LXUX 4NMLA 4Z4GA 4ZMBA 5LP6F 3OTGA 1OB2A 1IXZA 3U49A 4HYTA 2YHSA 3FOEC 4EITA 2WTEA 3AR6A 5FTKA 3RJZA 5HVNA 4UE2A 1KO7A 5AKIA 4KMRA 5BR7A 2RC5A 2PKQO 4EI7A 4PG6A 3EDCA 2RG7A 4WEQA 1T1IA 1CWUA 1ZIDA 3RAEC 1NVEA 1UWCA 2FSVC 3P8ZA 4B6EA 1BHQ1 2BBOA 3KXPA 1UKEA 3KK0A 3MINB 4DA0A 2GLXA 5FWYB 2N75A 1M7GA 5HF8A 5BORA 2WVAA 3O2QB 1KRWA 4N9WA 1QANA 4JHLA 4WFKA 3VVBA 4U7JA 3LIPA 2XDYA 3RUHA 1P60A 4ZO8A 1DIRA 3SSAA 4PO9A 2F00A 4ND8A 1SIUA 4DLNA 1VHDA 3UMFA 3FKJA 4J7XA 4ZHQA 1ADYA 1N75A 3N8GA 4GP6A 4KUEA 2A88A 4EY8A 1QGAA 4W5NA 4EG3A 1R74A 2HRZA 5K8UA 4ZAWA 3UB4A 3DGEC 4GUDA 4MUAA 4TMKA 1J9GA 2VRCA 2X6QA 3LC0A 3VU3A 2PS0A 4UAUA 4I4TF 4Z9XA 3GPBA 4US0R 1KVRA 4P22A 3RTAA 2AFRA 4TKMA 5KINB 3W1VA 1E94E 1K5PA 3W4KA 5LCXA 3CZ9A 2YH2A 3PX3A 3D0OA 4HYYA 1P1HA 1YQDA 2QB5A 2H9AA 3L7BA 5FT9A 4A73A 2DUMA 2EHJA 4GPBA 4N7BA 5BN3A 2NQ2C 4HNHA 1S8FA 2RHGB 3HBJA 4MS3A 2Q8NA 1YBMA 4HUQA 2D00A 1KPIA 1T0UA 1YR1A 3QW4B 4S1TA 5ITVA 1L5ZA 4B4OA 3D8BA 5DFAA 5A9SA 4FN5A 2A5GA 4HGOA 3G0OA 3ZXIA 4D9JA 2ZWVA 3ZJ4A 1C4OA 1G7TA 3GMDA 4DS3A 2B6NA 5CIYA 1UQUA 1Y98A 4NDNE 2NUPA 5FTJA 3WWOA 3ANTA 2UZAA 3RVNA 1OGYA 1FFGA 1GAJA 2H17A 1AKEA 2IDZA 1OXXK 2JGMA 1Y4AE 1B14A 2JHPA 2XOKD 3VC7A 4DW8A 4ZI3A 1E32A 1TKRA 3GRZA 4X66B 4UQOA 4QBTA 4NE9A 4C9BA 1R0KA 3B9BA 5CRIA 3EN0A 4HX2A 3K1JA 5KYUB 4UQLA 2JAXA 2QRKA 2Z1MA 4BRZA 3CXUA 3FNQA 1HDXA 2BR5A 3ILSA 4AMGA 1CVRA 4HQOA 3HL4A 1F7UA 3MJFA 4G2TA 4MB0A 3Q7RA 2FPGB 1XROA 3SYTA 1J33A 4V0OA 4LF6B 5A4KA 2C9CA 1P33A 2RHDA 1U0HC 2WWGA 3SQDA 1KPGA 3JATA 4D3ZA 1OR8A 1GL3A 3ENVA 3EQ7A 2YZMA 3QIAA 4OUKX 4JLWA 4N41A 3HK2A 5E3JA 3ZC3A 1DC7A 5JMOA 1ZX1A 3V1LA 1GEGA 3U7FB 4WN9A 3INGA 4EX6A 3RKUA 2WTBA 4M0MA 1L3BA 4AU1A 4C01A 3K5PA 2V7TA 5LZ5A 1KU6A 4CM4B 2B0JA 3BFXA 1QO9A 3CRNA 3D7RA 3QBVA 2R1TB 3MB8A 1GKUB 4XGQA 4GXNA 3AHFA 1LX6A 4GM4A 1ZGHA 2N47A 3E05A 4CEIA 3F6BX 3HO6A 3MQ4A 3AL0C 4B40A 1ST3A 3NCTA 5DULA 5C35A 3NETA 5F73A 3GLHB 5HJEA 1AQIA 3CLTD 4E1AA 3I61A 3UXHA 1NZFA 3HDHA 2YYYA 3KJNA 1NUAA 2FKAA 2I4OA 4AO7A 1JSLA 1W8IA 1ZM2A 1PO7A 2ZVQX 3K9WA 3LFUA 3O92A 3COSA 2A9JA 4HGRA 3FBGA 1WVGA 2ZRFA 3D8SA 3SICE 4YRQA 3ZU3A 1VLHA 1V2HE 2CN1A 4M38A 5HZKA 1M6EX 4GPTA 1P5FA 4LXXA 1TZ2A 2BEWA 4P7JA 5DIZA 3UWKA 4QECA 1T4CA 4YUWA 4PSDA 4HKTA 1W9HA 2HGSA 1M0EA 2VJMA 3S4YA 1JXMA 4HC4A 4LN1A 1ZRMA 3PK0A 2L42A 1U7OA 5EGNA 1M33A 2HBZA 4HDNB 4DIDA 2QN6A 4C43A 5HZGA 1JLSA 2B92A 3AOGA 3KJFA 4D56A 5FWNA 1D2RA 3NRJA 3PLAE 1B23P 5CVEA 4B4UA 3WYAA 5CA1F 3CC8A 3NAZA 4MX8A 1K8YB 1SOMA 4DJJA 2NAPA 1EK1A 4HQ6A 3WRXA 3SP1A 2TECE 4CHTA 2IYQA 2XRMA 4HAVA 4ISCA 1AK9A 4WDRA 2IZZA 4QWWA 4CLDA 3HQ4O 4P35A 4BBPA 4YR9A 3KIPA 3T5MA 1KI6B 3FPHA 2VHZA 3VNUA 2Q5QA 2OWEA 4I9FA 2EBHX 3OO1A 4JGIA 2CF6A 3DULA 3LE8A 4J29A 2W83A 4MYDA 4F72A 3MTAA 3NT4A 4KZKA 1Y4DE 1YZGA 4FZ3A 3RYIA 1R3UA 4LHSA 3C97A 2G7ZA 2DPXA 2YJGA 4BCBA 4W5JA 3CJTA 1MJFA 3OLYA 3H0CA 4PTYA 4N18A 2JRCA 3EYAA 4AWAA 4M6WB 1P9OA 4MUIA 5BOVA 4AJEA 5CFMA 4IIEA 2RARA 3DZDA 5T3UA 1YJAA 4GFDA 3M1YA 4GP7A 4BU0A 4BQQA 4MV9A 1ZCZA 2HJ9A 3UATA 3STXA 2GN8A 1OX4A 4Q9LA 1E2BA 4MIOA 2WAMA 5BY2A 1JILA 4KXMA 3W8RA 5TIIA 2CLHB 3R3SA 1SIBE 1EA5A 2VDWB 4U6QA 3JAMA 2HOQA 1MEJA 1E9AA 3UXYA 1PV2A 2ISQA 5AJVB 1LV7A 4KQ6A 4HK4A 3HP1A 4CFZA 3GLHE 5FUWA 1Y6RA 1YCHA 3DVLA 3DEFA 3D3JA 3QRWA 4RF3A 3AX6A 1UZUA 1VJ5A 2OCDA 3T35A 1QYRA 2P5YA 4KO8A 1FU7A 3TH5A 1WAMA 1QQ5A 3AF0A 3Q88A 3UK0A 4NICA 3EIHA 2BKUA 2EL7A 1QV6A 2WZBA 2CK3D 1X42A 1FRQA 1ZUWA 2FOIA 3Q10A 2HK9A 3AONB 1HSOA 1P2VA 1UUFA 2OHIA 3PFCA 4MUJA 4TMFA 4UATA 4Y2PA 2Y0EA 3M83A 2V55B 2EKLA 2C61A 2XGMA 4NCHA 5FI1B 3R9IA 4QGHA 3COVA 1R8QA 2P8SA 5EMNA 3USZA 1CYEA 3ASYA 3PEUA 4KRFA 2Q5FA 2BF4A 2J7PD 2PY6A 2VXOA 3CPSA 4JI3B 3LIIA 2PZMA 4KXWA 3KWJA 1SCJA 3GVHA 5L6MB 1T9ZA 1TVCA 3P2YA 4XD7D 3TOXA 5HIIA 3M6IA 2ZSHA 3RV4A 4LMRA 4LDNA 1RDFA 4BKUA 4MO2A 4KQJA 1MPXA 1DIOB 3H2SA 3L04A 2XYQA 1G42A 4KBFA 4H77A 3HG7A 4TL9A 2ZAMA 2O2ZA 4MA0A 821PA 1C4KA 1U0BB 4HMPA 2P2GA 3O4JA 1RKXA 3DWFA 3ELYA 5KOIA 1U9IC 2HXGA 2OMKA 4JMPA 5E2BA 1YGYA 1P31A 4FW9A 3RK0A 3KXIA 3FTQA 2FHSA 5IBRA 1DPFA 1P6QA 1P8AA 2GB4A 1PLLA 1NWHA 2GUGA 1R6XA 2OAP1 3PQ5A 4HH0A 4WXEA 4EVSA 3SE7A 3VVMA 3I32A 4UOZA 1NHGA 3CG0A 3MTEA 5JNLA 1RSZA 3E2PA 5ENVA 2JLXA 3EEOA 1THMA 2HAEA 3K96A 3R44A 5IUNC 3IBCA 5DNWA 5JAOA 2ZAIA 5KKAA 1YS2X 4UNPA 3DPSA 3ROXA 1R3DA 3GIWA 3LP8A 3QG5A 3QNUA 3LKVA 4U3JB 1DI0A 3L8EA 2D5AA 1G1AA 5KJEA 3M3HA 4JBWA 4G26A 3SJBA 2YOHA 2W8ZA 1LA2A 5CDSA 1RP7A 1T1SA 2QAGA 3QFCA 3H9JA 4KLRA 4PQEA 1Z5GA 4XXHA 5EINA 4B4VA 3O8LA 4GI5A 2IOHA 3N39C 2AUMA 5A4DA 2CNLA 1NX9A 4D3SA 4LE2A 1Q3KA 1TFUA 3KRTA 3LY7A 4NHEA 4YMIA 4RHFA 5IUJC 3K70D 2H2WA 1JFSA 1PGJA 1PNOA 2W2LA 3E7FA 3NONA 1M6NA 1VYHA 1NRJB 3ND6A 2EERA 4FMDF 3I8OA 4PZYA 1T9CA 4LZAA 3RLIA 4AFNA 4AWXA 1G64A 2O05A 2PLNA 4G9GA 3F9IA 1Z9BA 2OYSA 3QQPA 1SUBA 4ZGBA 3K0BA 4YJGB 4EB0A 2IJGX 2G40A 1HFKA 3O4IA 3RW9A 2RH9B 2HDOA 1JF8A 2VHUA 3QF4A 3IP6A 3QUTA 3ZK9A 1Y4ZA 3OEYA 5EJEA 1UBFA 2IYRA 2BGMA 1RKBA 4PSUA 1KZ4A 2MWMA 4II7A 1C50A 4LGVA 2XKJE 3R3JA 2PE5A 3U1TA 4Q39A 4RJTA 2PSJA 3V4PB 2AYYA 1JVSA 4Y67A 2XY4A 2UZ4A 1QQ6A 2FCAA 2NG1A 1YI1A 2DHCA 1P9LA 4E5VA 1B6RA 2QR2A 2ZUCA 3BEDA 2PUHA 4AJ1A 5EJ9A 1C0IA 4ISBA 3NS7A 4X65B 4AY5A 5JOQA 3COYA 4W7SA 4EB6B 4FD2A 4MI1A 4QU9A 1UKCA 2YZ7A 3MSXA 1BFUA 4P4NA 3S7ZA 4BFZA 3DLIA 1TMYA 4X20A 2ZWMA 4O4JB 1XMOB 3QVGA 2PZ8A 3SXPA 4RZ3A 1TEVA 4BNLA 5F9HA 4I50B 2BKVA 4EUEA 4X7MA 3GCXA 4M1OA 2E55A 1ULZA 4IFEA 4AP9A 5A0TA 5JVDF 4L0CA 3GIDA 1HE1C 5JC8A 3NDRA 4ESVA 3RS9A 1GUAA 1FA9A 4QYIA 1N1DA 4K1LA 2O23A 3ZZMA 3KKLA 3SKYA 3S70A 3CF4G 1P2UA 1Q21A 4OHVA 4WLVA 4X1YB 4OSEA 4X93A 5TDHA 4CKBB 2ZDQA 3T1TA 4MV7A 3RF7A 4F1WA 4DLKA 1A4UA 1UBLS 3UMMA 4CTOA 4DOMA 2VPXA 5ALOA 2CFRA 4M83A 2BSQA 4LZLA 3WRVA 2WB4A 2O7RA 3KKMA 3I6QA 4JLJA 1YBHA 2IXDA 3ND8A 3P2OA 4FOOA 1L7DA 2X6TA 2AJLI 2GM9A 3PNYA 4Z3OA 2IPOA 1RLUA 2IKQA 1ETUA 4RFVA 5F3WB 3D4LA 4BMVA 5KWVA 3CZMA 4G2NA 5DHUA 4BATA 3TFOA 2F8MA 1T0PA 4IVQA 3WK6A 4WKPA 1JPNA 1E61A 4CEJA 5GGXA 1X2EA 1X1TA 3AVYA 1DAHA 2QRUA 3NOXA 4ZCIA 3ENKA 1SR8A 4C6TB 1AZSC 2Q41A 3O31A 3QVJA 5GV8A 1GAWA 2WUGA 4PW0A 2H4HA 1I10A 4G89A 4S35A 3H5NA 4F4UA 5G40A 4OQZA 3V4FA 2ODTX 2IZ6A 3KE8A 5TGDA 3A70A 3NANA 4W5RA 3W2GA 2WUWE 3NX4A 5FQOA 1A7AA 3WISA 4ENPA 5HUHA 3RADC 2Y6VA 3BX1A 5BN1A 4F6RA 3B6MA 2J4CA 1GA6A 1SJ9A 3A9TA 3PHCA 4HDKB 1DAKA 4OHKA 4R54A 3M6MD 3PXDA 1P75A 4I36A 5CYFA 1TKBA 2P9JA 2EJBA 4FSHA 3LSTA 4FFLA 3CO5A 4FGKA 3AM1A 1C7EA 2A0KA 5AHRA 2X23A 4YACA 3IAUA 4OXYA 3RFFA 4XB1A 4FR0A 4LK2A 2X4IA 1P3DA 1Q84A 2O9JA 2QT0A 4NDZA 4UU8A 4EPWA 2YOFA 5D84A 1AGNA 5UKDA 4DANA 2C0CA 1B8NA 4UU0A 4ZYYA 4MDYA 1MAVA 1MO3A 1QOPB 3I5YA 4PG4A 1JDVA 4UTNA 3RC8A 1X9GA 1H9AA 1N0WA 3EVZA 5BUSA 4IIBA 1TQHA 1R16A 1SKBA 1T3LA 1ZMOA 4OMCA 2VLBA 5B3KA 4NTZA 5CD9A 2CJXA 2HU5A 3CR7A 4DQ0A 1G6Q1 1TZMA 2PQ6A 4M8SA 4N5DA 4QYSA 2I6GA 1XU4A 4JLBA 5FNVB 1I2DA 3IQWA 5KKCA 4TVKA 4E1VA 4E31A 1TECE 1Z4OA 3EOAI 4A1FA 3N86A 5KDOA 1QUEA 1Z2EA 3OJXA 1KHHA 4JQYA 2XMRA 1QE3A 4PRLA 3BXPA 1ZYUA 4MKZA 2I87A 3FF4A 3RGWS 4FZRA 5HIMA 2X0KA 4XTCS 3HYLA 3PT9A 1GRVA 1AT1A 2BEVA 3GI1A 4DY4A 4K1XA 4M53A 3DLAA 1PT8A 3GVXA 3UKJA 5EKSA 4ROTA 1J8YF 2WILA 1D1PA 3R4CA 1EAMA 3FDFA 4K6OA 4NV0A 4X7BA 1UBNA 4TXLA 4UNQA 5AVWA 1XJCA 1N6HA 4RIHA 1JHVA 3I9LA 3I0ZA 1HG1A 2RHHA 4M1YA 4BKRA 4BQOA 4G9EA 1B8UA 4IJMA 2QX6A 5F21A 4Y2TA 1W0KA 4R5HA 1GM5A 2QP4A 2W2KB 1ZGZA 4GWGA 2FUCA 2NZXA 4GDFA 3DC7A 1XZHA 3N8HA 3WLKX 3TW0A 1NUTA 2PKWA 3N0XA 4CNQA 3PGKA 3UAWA 5C7LO 1DIBA 4N49A 3HP4A 4NNOA 2DB3A 2GT1A 4OPMA 1BD3A 1EEHA 4DUGD 1QIIA 1IXYA 1QGED 1PAUA 1JA0A 2BKLA 2XNDA 3AM5A 4FC6A 4LWOA 4UTRA 2JIOA 2UDPA 3WWCA 2IUTA 4YJ3A 5LMNB 4V2IA 1IULA 3DAFA 3TM5A 4NH4A 2CCGA 1VB5A 2XQKA 1Z6XA 2BTQB 5H5JA 3RU9A 4ZQHA 1KI3A 3RHFA 3STTA 4O02B 4MW6A 3GJ5A 2FLWA 2HA0A 4R40A 4RSGA 1OY1A 1DJQA 1YHZA 4NRDA 4DRXB 1DKRA 1YHYA 2PGOA 4R81A 1OF1A 3I1YA 1WSAA 5ER9A 3KZMA 4G8CA 5AOVA 4BJHB 5G1OA 2PM8A 3OPYB 1U0RA 2BI8A 1G8YA 3PDWA 4M0EA 4J75A 5HMMA 5C1IA 3T1YB 2PDAA 3Q72A 5KYXA 5KJFA 3SCZA 4YJFA 2YWEA 3VU9A 3WB1A 5EVCA 1IB6A 1MRZA 4CM7A 2OE2A 4XWOA 3K4QA 1LK7A 1QNFA 2V54A 3PL1A 4EW1A 3U09A 1KY2A 4PZPA 2QNRA 1VE1A 1YBFA 3ZDFA 2GN4A 5BR8B 4QU8A 1GXSA 1ZNQO 3G89A 3GEEA 3P0IA 4EECA 4J07A 4RPJA 1J9EA 4BUZA 3FF1A 3RSFA 4E14A 5F7OA 4NU5A 2JJ2A 4DEXA 1ICIA 1EK6A 2HLNA 4ZZ2A 1U7XA 1BMTA 4A5OA 4ZI7A 5IXSA 2IA5A 2WJVA 1DWPA 2XNCA 3I01A 3NO4A 4BNTA 5ITZB 4KODA 1QE5A 3E7WA 3LVFO 2AI2A 1XMSA 2B34A 3EUAA 3GMSA 1NBMD 4HFJA 2BC9A 1P4AA 4EW3A 3CRQA 4FUQA 5EIHA 1XP5A 4FGZA 1I4WA 4UASA 2K2QB 2QT9A 1JHPA 4NV3A 3MNFA 3ITEA 3UUEA 4BY9E 2FR8A 5KYYB 1NVVQ 2VYQA 2CNDA 3HJGA 1KTVA 3OQNA 5MFZA 3S40A 5TEVA 3DBHB 3MJRA 1EFHA 2H7CA 4GVLA 3NBYC 4QFMA 2Z4RA 3H5TA 4GYKA 1X8JA 2PLAA 3RRBA 3CA8A 4DXDA 5IEBA 5E6SB 2H1FA 3Q7IA 3ENZA 3RR2A 4KK4A 3QLEA 3QQ5A 1NRIA 3PF8A 4QLBA 4YT2A 1L1EA 2AH5A 2H5IA 3DVAA 4CL0A 2CXPA 2P9BA 2W90A 1Y3AA 2D0DA 4IG9A 3THYB 1B6TA 3I5UA 5BOSA 2AN9A 3CFYA 2ARKA 3PVZA 1DJPA 3EBOA 4BO8A 4HZUB 4EDHA 2HMUA 2RGNA 1SXJE 2FMIA 1PIWA 4TYNA 4IPTA 3SKVA 5A3RA 3KFXA 3M1LA 3H75A 4RKQA 1Q0RA 3QF7A 4PIPA 2Y1LA 4ARZB 1OI7A 1ESNA 2YX1A 3M6XA 7REQA 4U7TB 5KIAA 2QRQA 4NMXB 1VSUA 4HQLA 4NU0A 3UAVA 4EA7A 1IBRA 1Q6ZA 4NENB 3TRIA 1N8NA 3DF7A 1Y3HA 2VTVA 1DKPA 2H1SA 3DZGA 4FOTA 3BK2A 3W9YA 2CLLB 4C0WA 3HCPA 2JW5A 3DZKA 1O3YA 3MEQA 5ITWA 2XCRB 2QL5A 2NV6A 3PDIA 2QSJA 3C6KA 5CTAA 2FVXA 1EX7A 3AB8A 3M49A 4WL0A 5DLDA 4AROA 3FTFA 2DPMA 1CEXA 4KTTE 1Q12A 2WYUA 2NZWA 1B6SA 3CZPA 3D7MA 3ZGNA 1TC2A 2QNBA 3P2KA 2WM3A 4OFZA 5A4AA 5K0SA 5LIRA 4B75A 5EZ6B 1A2OA 3A1NA 3L7YA 4F4JA 2BDTA 5KTPA 2CFIA 3DDWA 2QRVA 3B8EA 2AXNA 1Y81A 2RG1A 1TW3A 4GC9A 4IOLA 4PF1A 4Q1EA 4LZNA 3GCDA 1X80A 4LKRA 1X3SA 5CEEA 2HIMA 4RK1A 4F06A 3RYCA 4RZ2A 3IFSA 5BWBA 2IH2A 3FJOA 3G5AA 2B6HA 4L76A 4UZEA 3VVLA 1Z4PX 2FSPA 3KM0A 5B1EA 1VHTA 4MKXA 4ZAFA 5FYDA 2QD5A 4MARA 3SC2A 2G83A 1FYDA 3UJBA 2ZB8A 2IXAA 5A4IS 2JH8A 1TFRA 3AW8A 1UJ4A 3WOHA 4CIWA 1MBZA 4Q24A 1XPJA 2X0IA 3LU1A 4C76A 3EXEB 3TJRA 1F0NA 2CNNA 5HBGA 3S2IA 4A9AA 5BSVA 1RCFA 3AXTA 2O3TA 1SQSA 5AVJA 5EKUA 1JLKA 3A3KA 3LQKA 4AKEA 4CM8A 3H0KA 4HFNA 3OE4A 1YZUA 1HV8A 1ISHA 3N2KA 3VNVA 1X1AA 2AOUA 2YRFA 5CB4B 2FG5A 3RRFA 1JG3A 3PQ4A 3FCEA 3AQIA 1G8JA 1NFRA 4WNIA 1Q95A 2XDAA 4H15A 2WVGA 4L02A 1NQAO 4MRPA 5GONA 3IC5A 2XCIA 2D06A 1IHPA 2NQTA 3P4YA 1NAHA 4KQCA 5KQLA 2O20A 2OM6A 4BPRA 4D4JA 2PX3A 1SD5A 1KS2A 2WMDA 1MW9X 2GBLA 3PSAA 3QPWA 3N5CA 4KO1S 5FPTA 5AQ1A 2B7LA 2HA3A 3BAZA 3I30X 4FI3C 4HN2A 1XU7A 3QUSA 3NH6A 1QCYA 5C5DA 2BFFB 3GLFB 2V6FA 2WW8A 4OHRA 1U02A 2E5FA 2ENWA 1F4LA 3X0DA 1G7RA 4EGCB 1KYQA 2H8KA 1WWKA 4BC0A 3ISTA 4RIFA 3PFWO 2WEKA 3R0QA 1IG0A 2SECE 1OAAA 2GLTA 5IAGA 3F6PA 4JL8A 2ATVA 1PEYA 2XQGA 1ZLYA 3P2EA 4HSGA 4K3UA 1WZUA 4DJFC 4OGLA 5TPZA 5DTMA 4IHKA 4G24A 1OTYA 2MMGA 3KUCA 3LUCA 1NURA 2BJWA 2XUFA 4PNPA 5ALHA 3ZXXA 3PL5A 4WOPA 3UHPA 3VTFA 1FW8A 3TX2A 5NULA 4QKQA 2VJDA 2CDAA 2RAVA 3OQMA 3BMCA 2JFGA 3OESA 3M3PA 4QJ5A 1J70A 2ZRCA 1EYZA 3FTEA 4FGLA 1OX5A 2F2TA 1XZAA 4PLZA 1EGAA 1NJSA 1N5KA 2NNWB 3BXEA 2MSDB 3ETNA 4GH5A 4E12A 5ADHA 4G4SO 3UW1A 1DEAA 4D3YA 4ZHQB 1FFYA 2H2FA 3RAJA 3T4UA 1DKNA 3LUGA 3IP8A 2IZOA 5C8YA 4RPLA 4MXDA 1QOQB 5IJXA 2WIAA 1Y7LA 3CX7A 4HP8A 1GA1A 3G7NA 1R64A 5EA2A 3KR0A 3MGBA 4BZXA 1M1YA 1CR4A 2R7KA 2OHGA 1BZYA 1CVIA 4YAWA 3MLBA 4YCLA 1ZGAA 4HGNA 3H5AA 1U31A 3SIPA 1BG6A 1SXPA 1WIWA 3WGVA 3BF8A 2XZLA 2HPAA 3RG8A 3U5ZB 2NZYA 1KJ8A 1WXQA 1Y7PA 4PO3X 4C4PA 5TQVA 5BN3B 1Z2OX 1QO0D 2C57A 3DOJA 4F04A 1GZDA 4HUQB 1IEQA 1OBCA 4D0SA 3OU7A 1JDBC 3H9UA 1ID8A 5LQRA 5A9SB 2IELA 3E7PA 4NK5A 4NFHA 4V39A 1EX9A 3QY9A 3F9RA 3I92A 4N0QA 5CVDA 1U7HA 3ZX5A 4AAYA 4OM8A 5BYJA 2R00A 4MJLA 1CUWA 4DRXA 5FFMA 1EXDA 2NUPB 3I5XA 2H7YA 1DQNA 3LHIA 1HLDA 2O2YA 1P1CA 4AS1A 2Z3WA 1LJUA 2QTMA 4HSEA 4KXQA 4TV9A 5SYAA 1M72A 2RGYA 2WIJA 3FKSA 4QZVA 5CLHA 4F5WA 3ZGOA 3VVCA 5J2TA 1Z6GA 2X8LA 4MOWA 1WJGA 5C31A 4HWRA 4Q7MB 1VPVA 1R15A 1II8A 4BNIA 1J8VA 1QIDA 3K6KA 1DG3A 2F1JA 3DMGA 5FUQA 1RFGE 2B8NA 3B6JA 2AV6A 2VJLA 4UBJA 1ESCA 1LPSA 1MP0A 1TCCA 1S7CA 2Y27A 3B20A 3GEIA 2HFKA 3IQXA 3KJEA 3Q4GA 3HHPA 3DWEX 3W8EA 1E2IA 1WETA 5BRNA 3ZK8A 5AVZA 2Q9UA 1JDJA 1FXWF 4A5SA 1RAFA 2OV2A 2QL6A 1U2QA 4ZCRA 3JALA 1MU0A 4MUBA 4TLBA 5B7NA 3H9EO 3UJDA 4U7DA 4UJ3A 1DXHA 4HRVA 2OM2A 5J1SB 4HUJA 1WMSA 2BMDA 2GOYA 3PHLA 1NKSA 4NYJR 5G0UA 4ZMRA 3TSAA 2WNSA 4OHBA 1V96A 4EJ0A 5DCWA 4Q16A 4PVDA 2Q3LA 3G9XA 3QLTA 1ORVA 4DCVA 5J58A 2OBNA 3Q9LA 4LGCA 4B4KA 2YBEA 2FMUA 3OCVA 4XA8A 4DA9A 3F1KA 1D2NA 4CEIB 4U9IS 4WA8A 1KMHA 3AHIA 5I7RA 1JSZA 2W71A 3C5HA 2PT6A 3MXOA 1V95A 1NULA 3SS7X 1WCIA 1Z29A 2IOFA 4D4GA 4F85A 2DH6A 2OOSA 1IEXA 2XT6A 3GK3A 2PX2A 1BHJA 2GCIA 4JFAA 2IWRA 4CM6A 1ENYA 3WGIA 4AY3A 3CWZA 2VQSA 3PD1A 4X97A 5C8DA 1N2JA 1F5NA 1FLNA 1QONA 3PC4A 3ECSA 1AZTA 1Y7TA 4F12A 2GZSA 2XGJA 3MC1A 5D01A 2QZ9A 5FORA 2G0NA 2XVXA 1E3SA 2BGNA 3EAQA 1ETHA 4C3VA 4MHTA 2XQJA 5LIPA 4WINA 4COKA 1KTIA 5DPMA 2YC2C 2BEWB 3ILHA 1T4CB 2R7LA 3FWYA 5C46F 2G80A 3U7RA 5HK8A 4MWOA 2O8NA 2VJMB 3W34A 4NXMB 5ALLA 4NPAA 1BIFA 4B32A 5EE3A 5CD1A 4FR5A 5MGNA 1G38A 4YV0A 3VHLB 2LTAA 1VL8A 2HMWA 3VOAA 4ER5A 4ACBA 3ET4A 3VMMA 1WDWB 1BJTA 4D43A 2RIPA 4DKXA 1CB7A 1Z26A 5LQCA 3U4QA 3K09C 3EZFA 5IVDA 3UB3A 2VTDA 2B61A 2SKEA 2RDMA 1FNNA 3GRKA 2ZB4A 4Q47A 4UUPA 1UC4B 4HRYA 3DFMA 2FSFA 5DN9A 1EXNA 3GFFA 1XELA 4EYSA 2F4VB 3RU2A 1MORA 1KSHA 1P1FA 1TJ3A 3WDSA 4C7JA 2G71A 2V96A 4HPWA 1QLHA 3IQIX 4M87A 3JYLA 5GZ1A 3MS2A 1WV1A 3LJKA 2UYHA 2NV0A 3EVDA 4MA4A 3ZV5A 5FO1A 2O06A 3IT1A 2PEZA 3NP7A 3I73A 3LDHA 3BB3A 3FMGA 2GM3A 3GNLA 1ZI9A 1KMIY 4WBXC 2J4FA 1XI2A 3ZY6A 2CY0A 3ZHXA 4EG7A 1AMUA 2D59A 3KQSA 3OF2A 2PUFA 4NBUA 4KXVA 5J2UA 3BGIA 4PHTA 3LL4A 3RKSA 1EVLA 2Q27A 2CLKB 2JCSA 1PDOA 4CTMA 3KQLA 5TT1A 1L4UA 2FWPA 5EIEA 4HNQA 3DAHA 2WRZA 3PUJA 5T64A 4Q1VA 1OX4B 3WKCA 2VPYA 1OV6A 1LDEA 1RT9A 2IS4A 2QIOA 1H05A 3TD6A 5EIAA 1WPRA 3FI9A 1YH3A 3HXLA 3IR5A 5CG2A 2QM3A 1ZUD1 1XV5A 2ORED 2ZJ3A 5JNWA 2ORYA 4YK7A 5L3RA 1L7EA 3IEKA 2I55A 5ALNA 3HUFA 1LPPA 1L1RA 4DDVA 5BPHA 3UNXA 3LL7A 1JSXA 2H2HA 5FTWA 4Z1OA 3KZOA 5TVKA 1C7ZA 1Z4JA 2N9UA 4R3UC 4WY2A 1TA0A 3S28A 4I1IA 4YCCA 1PX2A 1REQA 4Z7NB 2WC1A 5TQ2A 1XAIA 4NBWA 4ESOA 5KQGA 2R25B 1KH2A 1UBCA 1NI4A 3NHRA 2ZTUA 4GWKA 2FMTA 3WHPA 4ESHA 1UK9A 1Q15A 1RYDA 1YR7A 4AUEA 4PHCA 4MGZR 4B47A 1SVKA 2H7VA 5HQ3B 4R8VA 1LW6E 1X8XA 4DCSA 3JZFA 1OFHA 3O90A 5JNVA 3T9EA 2C2KA 4NNPA 1WZIA 2WJ6A 1V25A 2QZZA 3R3HA 3KT3A 3WYDA 2XNJA 1HOXA 5TS3A 4ZJZA 2IYSA 3L02A 3W5IA 4LV6A 1EGHA 1ESEA 2AEJA 3ETEA 4RTQA 4D0LB 2E7ZA 3IIEA 1D1SA 4BIMA 1U3GA 2PKEA 2GKGA 2RHRA 2HNAA 2A7QA 1TL7C 2IUYA 3C6YA 1GTRA 2ZTLA 3L06A 1C7JA 1HR0B 4KK3A 3EQ6A 4TKUA 3WGYA 4J0JA 3IS3A 5EEGA 5BNFA 4J0EA 4BEWA 2R6HA 4PX2A 4JLNA 1PTJA 4QDXA 2JFUA 1T8WA 2OO5A 5HFNA 3AR3A 1TNDA 5FBRB 3WRYC 4E11A 4FNGA 3TQTA 1N9ZA 3ZCSA 5DOZA 3M4XA 4BBAA 4J6FA 3MCTA 4GVPA 1KVTA 3LUHA 4RFSA 3ZQKA 2GHQA 2Y2VA 2E49A 2VNSA 3RRJA 2ZRMA 4AJ9A 3N0VA 3AB3A 3B3AA 4K6MA 1DARA 3KOZA 3QE2A 2XNKA 3ZR4B 4R0MA 4W9RA 1SZPA 3PQ8A 5H4GA 3ETCA 2J45A 1L5MA 4I2VA 1DCTA 2NO4A 4O2BA 3VYUB 3OSZA 4JKYA 3AWIA 1IXRC 1WB9A 1V7QA 4PV7A 3C3PA 2ZI9A 1W1WA 4U39A 2UYQA 3U3RA 1UODA 1G8GA 5F76A 1V8FA 1TI7A 2QAGB 4BEJA 2I3AA 5FEMA 1ZQ1A 1BVRA 1BFKA 1V9LA 1BGVA 4O2AF 4IIDA 4CCSA 3CS3A 1RXCA 1LD3A 2I8LA 3HJUA 4A0SA 3QEOA 1RWWA 5KTTA 4LBVA 2C0PA 4QDTA 4YRKA 2VJPA 4U2BA 3SHFA 3K9CA 4J4TA 1NJFA 3KZNA 4B7CA 3GZJA 4L6CA 1KRXA 4GM0A 2QK4A 1ZINA 4XQGA 2HSJA 5JRZA 4OQMA 4D92A 3TGLA 3BWEA 1SZJG 5CH5A 1USGA 1E2LA 3TDMA 3CMMA 1UOQA 2QLBA 5BQOA 1O8BA 4IHJA 1TD1A 1WG8A 1MIOA 3M4NA 3VTKA 3QF4B 1UMBB 2BW0A 4RZUA 4EO4A 1KZ6A 3L1VA 4J3JA 3I4FA 1U0TA 3IBFA 3WV5A 4DCUA 3OIDA 1CF4A 1ZA2A 1ANKA 2CL0X 1V3UA 2HC9A 2XODA 1LNSA 2Y68A 1JT9A 1L7BA 4G5HA 4MQ5A 5FOUA 3CNOA 2Q3EA 3UY4A 5GQSA 1F4VA 5EIBD 3TQQA 5JPDA 1E2HA 3EXIA 3RS2A 3F46A 3DPUA 3IQHX 3QU7A 3TWOA 4CLRB 1CK4A 4FFDA 1UP7A 2H4XA 1ADGA 1VI6A 3FPEA 1M2NA 1NVXQ 4MUMA 1IQ0A 5F1PA 3K2BA 4FYHA 1J8DA 4U63A 4NBRA 5K0NA 2VWHA 3QVLA 4BAGA 1OVGA 3HDVA 3DOUA 3TCKA 1BNCA 3O8NA 2FZ5A 2AG5A 2GYWA 1JPUA 4KN6A 3RM3A 4X20B 2X0EA 3QVGB 5JZMA 4IGEA 4Q1DA 4O1IA 2ODAA 3H99A 4NZMA 1CY4A 2B4RO 1UFKA 1Q0LA 3U4IA 3B9QA 3IVXA 2YV5A 1DX9A 4MLZA 4EY6A 2Z5GA 5HG0A 3SZ3A 1LSJA 2GD2A 1Z2DA 2ORIA 2V6BA 3NBZC 4QYIB 3DJYA 1H22A 5IWAB 4GO1A 1LPNA 1NVUQ 2ZBEA 1T2DA 4KYVA 4BNMA 2BFOA 5K1ZA 3EJ6A 3MW8A 2PSEA 4HDMB 4P7KA 1LVHA 1GN9A 5MN5A 3T4PA 3I8XA 4UHFA 4O2LA 4L5JA 4QPNA 3HDGA 1NVAA 4Q3AA 1ST2A 3HRHA 4J1QA 1T9KA 2QUBA 2I99A 3JD3A 4P4UA 3QTBA 5HKLA 1XU9A 3ZG6A 4AZSA 1OA1A 1GZ6A 4ZK6A 1GSHA 2CLIB 4FHCA 1VE9A 3LVRE 2PZAA 5BW8A 1H3FA 3KYDA 1KERA 521PA 3R7AA 2WTUA 5LB4A 4BMOB 3GFGA 1XZ8A 2AFIA 2AUTA 2FSHA 5DMXA 5ARDA 1IPFA 3ZBQA 2H1RA 1ZN2A 2ZYAA 5CBKA 4CEJB 1FDWA 4K9PA 4L4SA 2YN2A 2VPPA 3KTFA 2AT1A 2GCPA 2HWWA 1SGWA 1WCYA 4ABTA 2PKXA 5EHXA 4RPKA 5KC8A 4AKIA 3MXTA 3E9ZA 3EGEA 4KBGA 4MPRA 4Z4QA 2WUDA 3ZVRA 2QYOA 4G4GA 5JCOA 3SVTA 1NFQA 2AN3A 1UFRA 3MTIA 1YVRA 5AYVA 3RBZA 4MQLA 3BTVA 3G59A 1LW7A 2FNAA 3WK9A 2J5RA 3VRHA 2CV0A 3E48A 3RYFA 4LDPA 1FEZA 3OH8A 1LS1A 1B93A 2Z6QA 5FJJA 1C1XA 2COUA 3A6JA 3FCYA 4NHOA 1CX9B 1JH9A 5A0VA 2P9YA 3PSHA 3A9UA 5TGZA 4YV7A 5DNEA 1X14A 5LXTF 1QLWA 2OXCA 1ZG3A 4LS3A 1VMAA 2VWPA 1DUVG 1YDGA 1SCDA 2AOVA 2P3SA 4M89A 4B48A 3OFSA 1CUZA 3T7AA 4EF6A 4H0NA 1E0KA 3DO6A 5E6UA 3W79A 4EY7A 5DX8A 1OGIA 4PS0A 2MSWA 4U7WA 5EVJA 4V1CA 2ZI7A 4B33A 2OZPA 4HB3A 1XCPA 1MX1A 4O8CA 1UDRA 4Z86A 2YQ4A 1T24A 3WYGA 3IKJA 5DLEA 5A05A 2VDMB 1L2TA 3T61A 4DV4B 4HN9A 1IDOA 4LJ7A 1G3MA 1GRNA 3QJGA 3TFWA 2BFDA 3TKLA 4DM7A 2P0EA 4FHGA 4YV2A 1AO0A 2Y0DA 2IUFA 4OP2A 2ZBDA 3PNPA 2P3OA 5DJ5A 1ZK4A 4KQMA 4NAHA 2XB2A 2IYYA 4KPUA 3ICQB 2X8BA 2O52A 2X9NA 3HXTA 4RVOA 4LY9A 5BUCA 4XB2A 4NLLA 5CB6A 1CEYA 1UT8A 4XEUA 2ZJ4A 2H9IA 2FF5A 4EFLA 3QH4A 4JI6B