3O75A

Crystal structure of cra transcriptional dual regulator from pseudomonas putida in complex with fructose 1-phosphate'
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
270
structure length
270
Chain Sequence
HTRTLGFILPDLENPSYARIAKQLEQGARARGYQLLIASSDDQPDSERQLQQLFRARRCDALFVASCLPPEDDSYRELQDKGLPVIAIDRRLDPAHFCSVISDDRDASRQLAASLLSSAPRSIALIGARPELSVSQARAGGFDEALQGYTGEVRRYQGEAFSRECGQRLMQQLIDDLGGLPDALVTTSYVLLQGVFDTLQARPVDSRQLQLGTFGDNQLLDFLPLPVNAMAQQHGQIAATALELALAAIEEKRYEPGVHAVGRTFKQRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Fructose transport system repressor FruR
publication title Fructose 1-phosphate is the preferred effector of the metabolic regulator Cra of Pseudomonas putida
pubmed doi rcsb
source organism Pseudomonas putida
total genus 101
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00532 Peripla_BP_1 Periplasmic binding proteins and sugar binding domain of LacI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o75A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o75A01
2PUAA 1BDIA 2GBPA 3P9YA 5FWXA 1Z15A 1SD5A 4KVFA 1DRJA 3CHYA 1BDHA 4G0YA 1USIA 4HNQA 3E3MA 1ZGGA 3QX8A 1GUDA 3BRSA 3ROFA 4RK1A 1JDNA 4RY0A 3RVMA 1A0OA 1ZITA 2GI4A 1BA2A 1F4VA 2YHBA 4MLDA 5BR1A 4EGSA 3EGCA 3NBMA 1YS7A 2FEKA 3CG0A 2E4VA 3JPWA 2J48A 3OLYA 3TX6A 1Z2EA 1KRXA 3OLWA 4RKQA 1M5TA 5IBQA 3TMYA 2WY2D 2R25B 2MYPA 3KSMA 4B09A 2FN8A 4PICA 4S04A 4DN6A 4KNYA 7ABPA 3IP9A 5JS2A 3LUFA 3HDVA 2PMCA 1F51E 3T6KA 3MYYA 2PUDA 2X7XA 3H75A 1LJLA 4RV5A 3IP6A 1HEYA 1W9HA 2JK1A 1ZAYA 5GQSA 3F6PA 3O74A 5TQJA 4O1IA 6CHYA 3QK7A 4MQEB 5IUJC 3BILA 3KYJB 5CNIA 1C4WA 4KRFA 2LP4Y 3QEKA 4IF4A 1ZVVA 1VKRA 1RZRA 1YIOA 5HQJA 3O21A 3NHMA 2FEPA 3L49A 2FMKA 3GBPA 3RVOA 5D2CA 1W25A 1YMVA 3C97A 5DKFA 2FXIA 4MQEA 5CNKA 5PNTA 2FQXA 4W5QA 4IRXA 3HM9A 4E7PA 5KQPA 5TQ2B 2FMFA 2JVJA 3HDGA 1DC8A 1GUBA 1LJUA 5CNMA 1DBPA 3C3MA 3O1JC 4L85A 3C6QA 5C5CA 1BVHA 1PNTA 4F8JA 5EWMB 9ABPA 5IEJA 4N47A 3T38A 2HQOA 2MYUA 4TLLB 4PE5B 4WZZA 3QLVA 4H60A 4NCBA 1IIBA 1YTUA 1QO0D 3URMA 3O1HB 5TQ2A 2PUBA 1M2FA 1DBWA 4MS1B 4RKRA 1USKA 3GBVA 3GWGA 5GOTA 1YK1A 1XHEA 1FSPA 2QVGA 3KS9A 1DP4A 3KTOA 3MIZA 3G85A 5EWMA 3A3KA 4D6YA 3LUCA 4Q7EA 2PL9A 4MS4B 3C3WA 3CZCA 4P98A 2HQRA 5B3JA 1MAVA 4MS1A 2GWRA 3OQMA 3K9CA 3R0JA 1QPZA 3H5IA 4MR9B 4KQCA 1S8NA 3GL9A 4YRZA 1NATA 3OLXA 3H5VA 4LDZA 3MA0A 4MS4A 1C0EA 1VPWA 3C3KA 5BQ3A 4YGXB 1Z13A 4LZLA 2F8SA 2P4UA 2L19A 4MR9A 3A10A 2PL1A 2CD7A 2NZVG 2VUIB 4Z4HA 1Z25A 1FQWA 3KLOA 4JASB 3ROTA 1BDJA 1B00A 4QYWA 1ISRA 3BRQA 3QX9A 4QPJC 1OXBB 2FN9A 4HYEA 2HJ9A 2L18A 3MMNA 2E4YA 5DGCA 5DLEA 1NXSA 4F12A 1DBQA 3LUDA 2TMYA 2QW1A 4LRQA 5IC5A 1KMIY 8ABPA 3FDFA 4RSMA 3RVNA 1JYFA 2PKXA 4CBVA 2JRLA 5DTEA 4H3HB 1QP0A 3DZDA 5F64A 1RNLA 2IDMA 4LX8A 1E2BA 3EJWA 4IMJB 2B1JA 1Z12A 3DLBA 5KC8A 2HQBA 3HXMA 4XASA 4KK4A 4JAVC 4XXHA 4ZYLA 1P6UA 3SNKA 5ED4A 3QLUA 4OTZA 5KWSA 2QZJA 4JA2A 3LUJA 1U8TA 4WWHA 1SXGA 2WRZA 2MYNA 2PLNA 4MR8B 3A0RB 4RY9A 4PYRA 3HSYA 1LK0A 1MIHA 4IMIB 3KYIB 3RQIA 3HK2A 5HSGA 2NT3A 4N76A 1ZY2A 3H6GA 5HKOA 2MSLA 3QLUC 2F8TA 1EAYA 3F7NA 3LUKA 3KG2A 3VNBA 1AB5A 3HUUA 4YO7A 4TLMB 4N0QA 2FSPA 2VK2A 4MR8A 5IUKC 4EUKA 4KREA 1JH9A 3EQZA 3Q9SA 5JNRA 2LPMA 3O1IC 2A9QA 1NTRA 1R8JA 5TPZD 3Q15C 1ZDMA 5TE9A 1NXPA 1UDRA 4RU1A 2PUCA 3H5LA 1JHZA 3H6HA 3UKJA 1A04A 1DG9A 1K68A 1PEAA 3OM0A 5TPZA 5EWJB 4KFCA 4D6XA 3BBLA 4L4UA 3EDCA 3RVSA 3H1GA 3SAJA 2QV0A 3GRCA 3B2NA 4YR7A 4Z4IA 1QQAA 3N75A 3HS3A 3M6MD 3HEBA 3G1WA 3Q41A 2NZUG 3SY8A 4RDCA 3HZHA 2P9HA 3GA5A 5EWJA 1RZRD 1M5UA 1YVUA 1ZESA 3KLNA 2VYCA 2IKSA 5DCLA 4LE0A 4MRMB 4RXTA 3KJXA 3EAFA 4EVSA 1QP7A 2N9UA 3CLKA 3HCWA 1Z16A 2GKGA 2HSGA 1JBEA 4S05A 2B4AA 2CHFA 1VLZA 3JY6A 3F73A 2E4XA 2JCGA 3LUHA 1GCGA 5CHYA 4IGAA 4MRMA 3OQNA 1YMUA 4RY8A 2NT4A 4ETNA 1EHCA 2A9OA 2RDMA 2GX6A 1ZH2A 1E6LA 1RPJA 3NNDA 4LE2A 4MGEA 4RK6A 4RZSA 4WXEA 2FW0A 2MYTA 4E7OA 3I5AA 4KV7A 4YLEA 4MS3B 1JF8A 3LKVA 1PUXA 3FFXA 2OQRA 2KYRA 3QLVC 4Z99A 3HVRA 5EWLB 3CTPA 3LKBA 3BREA 1Z26A 1GLGA 5TQ0B 4RS3A 1BAPA 2JBAB 1JYEA 3D8UA 3LMKA 3H1FA 3I42A 4YP9A 1NXVA 3L6UA 4MS3A 1APBA 4NCAA 4YWHA 5EWLA 1E6KA 2PUFA 1DJMA 2PAFA 4G0QA 1SXHA 5TQ0A 5B3JC 1DCFA 3RVRA 1XWWA 2JBAA 4EY3A 4RK4A 1EWVA 1U2PA 3GV0A 5TPWB 3CU5A 4RXUA 5KQGA 1CEYA 1AB6A 3RVPA 2VUHB 1Y1LA 1VRVA 3LUAA 3QELA 1TLFA 1J56A 4O1HA 4Z4EA 4F11A 4KMRA 3H5WA 1JLKA 4RK7A 3EQ2A 4WT7A 4KZKA 2WMYA 1QKKA 3HO1A 1GCAA 4N0PA 4W5TA 4MLCA 1TMYA 2LIVA 3N6VA 1L5ZA 5TPWA 3GT7A 3O75A 4Q6BA 4PZ0A 1A2OA 4N03A 5JNTA 3QEMB 3DGFC 3LOPA 2ID7A 2QU7A 1D4ZA 2M98A 4GPAA 4QYMA 4ZPJA 4EVQA 4RXMA 4Z4CA 1WETA 4XLTA 3N53A 3S99A 2IPNA 1JDPA 1M2EA 5JNSA 3IP7A 3CFYA 1YK0A 2IYNA 1ZH4A 3QEMA 4YS6A 5KI6A 3KKEA 1LBIA 3H5OA 3GYBA 5BRJA 4Z0NA 1D5WA 1QQBA 4JB2A 1XHFA 4OBBA 2WB4A 3O2QB 5BRAA 4OLAA 2QSJA 5FBKA 3H5TA 3OMWA 2E4ZA 2ID9A 2L2QA 4G86A 2HPHA 3ILHA 3M9WA 5KC9A 4W5NA 1USGA 2FTKE 4N41A 2FLKA 4MQFB 4JOQA 3F6CA 1QNLA 1DCKA 1I3CA 4KQ9A 2DRIA 1OXKB 4MYRA 1D2AA 2PUEA 3UK0A 4H3KB 3W9SA 3M9XA 4ETIA 4F06A 1T34A 6ABPA 2BGGA 1TJYA 4MQFA 1URPA 1ABEA 4UHJA 2L17A 2CWDA 1NXWA 2QR3A 1U2QA 4IILA 3HV2A 2FKAA 2FMHA 3I45A 4MPTA 1RXEA 2JVKA 1LBHA 5T7BA 4Z4FA 1H9CA 4DQDA 4WXMA 1K66A 5JNWA 5KQLA 1JFVA 5C5EA 2Q5CA 3HUTA 3OLZA 3D02A 3FMVA 1TVMA 1E6MA 3ILYA 3JS5A 4EYOA 4YV7A 2I6FA 2CHEA 3TD9A 4OLBA 2OENG 2R48A 3N0RA 4G0ZA 2WWVD 3OM1A 4LE1A 2E4WA 3NHZA 2RJNA 2MSKA 4F3TA 2M1ZA 1PEYA 1SRRA 1CYEA 4G97A 1DZ3A 3K4HA 3KHTA 2NUBA 3FFWA 3RVJA 3CG4A 3MM4A 3DLHA 3TB6A 4OATA 3JVDA 5I4CA 4RK5A 4EYQA 2MSWA 1ZHHA 3N8IA 1DC7A 3JPYA 4XARA 1NXXA 1CHNA 3IDOA 1Z18A 1D1QA 3RVQA 2W42A 1NXTA 1ZN2A 2R4QA 5CNJA 3OO0A 2QVCA 3KCNA 2RJOA 3OMXA 4W5RA 2JVIA 2PJUA 3FFTA 1EWTA 4RK0A 1Z17A 4RWEA 3CZ5A 4FB4A 3LFTA 5ABPA 5JNVA 3RH0A 1ABFA 1L5YA 4OG2A 3MQ4A 3Q7TA 3QLTA 2PE5A 3EULA 3N0XA 4TN5A 2FEWB 4Z4GA 4HNSA 1MB3A 4NICA 2O20A 4Y9TA 3T95A 1RXIA 3EODA 5FWYB 2YHAA 3CKMA 4XFKA 2FLWA 1U0SY 2V0NA 2FQYA 3QELB 2LBPA 1MB0A 3CNBA 3MF4A 1QO0A 3CS3A 4EVRA 3RVKA 1EWKA 3IP5A 2IPLA 4WUTA 5E3JA 1NY5A 3OO1A 4D74A 3LUGA 1QP4A 1KRWA 5JS1A 2XDYA 3HJFA 3OQOA 4HNRA 4ETMA 3TO5A 3NNSA 4Z9BA 5IUNC 2ZAYA 5FWYA 3DBIA 4GNRA 3IPAA 2A9RA 4G0OA 3UUGA 4O5AA 1JFTA 3E61A 4P1ZA 4G0PA 4EYKA 2IPMA 4G0XA 4ZMRA 5IEBA 3JTEA 2WJAA 4MR7B 2IPAB 1JFSA 4UHKA 3DGEC 4M88A 3O2SB 4KK3A 3I09A 1SXIA 3Q7SA 3N0WA 1PNRA 2H0AA 3IPCA 4TMYA 2AYXA 5JNUA 1QMPA 3RVLA 1Z2DA 2WJWA 1JWLA 4W5OA 2PUGA 3O2JA 3Q7RA 1P8AA 1TM2A 2ZWMA 2H3HA 1DRKA 3SM9A 3NNNA 4MR7A 4NQRA 1MVOA 1ZGZA 5T3YA 1EFAA 1YS6A 3LTEA 1FFSA 2QXYA 1FFGA 1PHRA 4JB0A 4Q6WA 1D1PA 2RGYA 1P6QA 3FGZA 4FE7A 4QICA 4ZJPA 4FE4A 1JX6A 4G0MA 3H1EA 4MAAA 5FBHA 2E4UA 4ML3A 1JL3A 2FMIA 2FVYA 3CRNA 4PEVA 3T8YA 1U04A 4JP1A 2AYZA 5IULC 5FWXB 2A9PA 2IOYA 4ZMSA 1P2FA 4NV3A 3VNAA 3A0UA 1FFWA 3JVIA 2FQWA 5KQMA 1NXOA 4LDAA 4KPYA 3SG0A 3OLVA 4EYGA 1ISSA 2JB9A 4XAQA 3SQNA 4Z9AA 5IX8A 1KGSA 2LUOA 4DADA 4YCSA 5HM6A 2R47A 1DCMA
chains in the Genus database with same CATH superfamily
2JJ8A 4X71A 1RAIA 5IH3A 1ACJA 5CVDA 2HSJA 5FBQB 4CM4B 4HRAA 5I9NA 4JJIA 2C7OA 1Q83A 4YCJA 4CF6A 1FXSA 4KXUA 1G2IA 3DF7A 1X1CA 3R4CA 1N3LA 1QNFA 4I2VA 4DZTA 3D6MA 3RK4A 3UUFA 3KU4A 1ZIOA 1ETHA 5CDSA 2NO4A 2IHZA 3SC6A 3I62A 4B4WA 1JE0A 1AGXA 4F8EA 3QWBA 3O93A 2WYVA 1J8YF 1IUNA 2CZCA 4OQZA 4PV7A 3AVTA 5C9ZA 3GPCA 2MSNA 1J22A 1NNLA 4BO0A 1A76A 1W0JD 2X1LA 2ZJ4A 2QYOA 4XEHA 4MP6A 3D8SA 5LFAA 3G5TA 3WGNA 2J5RA 1JLLA 1Z2AA 5K2OA 1I4LD 1J0BA 1ISFA 4CFZA 5K99A 3MJDA 2ILVA 5DULA 1GADO 2VJMA 5D5HA 5AHKA 3RNOA 4HO1X 2RONA 4DIMA 3IP9A 4EB3A 4JYBA 1J9GA 3A4LA 3MYYA 4WD3A 1C1DB 2UZAA 1EK2A 1D8AA 4ND5A 5EUMA 3WGMA 1MOZA 3WWEA 2J6HA 2VXOA 3K3PA 2QAGA 2FU5C 1MAWA 4X3PA 4HAIA 4Q1BA 3RC8A 1P2SA 4MUGA 4HMPA 2V4MA 4K05A 5GJCA 4P4UA 3LT1A 4Q24A 1ESNA 4Z8XA 1T3SA 2C3PA 4JLPA 4Y6RA 2BMAA 2Q3EA 1ADFA 1KI9A 3ZD7A 3KOZA 4EF6A 4ZVMA 2QRMA 3UMBA 2J3LA 3L0IB 1N5JA 1U9IC 4M83A 4EEZA 3ZHRA 1LLQA 3C97A 2IE0A 1RZRA 5I7VA 4ZI7B 1I3NA 5C8YA 1R9NA 1J8MF 3F3SA 1GUZA 3SQMA 1R6XA 4XJTA 2GXQA 4GIBA 1KBOA 2QPLA 4IOJA 4Q9LA 5CFQA 3PX7A 1NVFA 5CX4A 1NLFA 5KTKA 1DBPA 2ZUDA 1LW7A 1JQBA 3M1YA 4OL0A 4ZODA 4CIDA 4EJ0A 2K7FA 4KE8A 4I1OA 1KPIA 2QJTA 5EMMA 3TLAA 1EFHA 3A9SA 3ORRA 1BEUB 1RYFA 2HDWA 2TS1A 4YUAA 3UMMA 3N05A 2B1QA 3PE4A 1GRRA 1PDOA 4FOTA 2EKQA 4V3BA 3RFUA 2QA5A 4ZHQA 1SQ6A 1Z33A 3KHSA 3WWOA 4Q9HA 4E0BA 4LF9B 1U0EA 4I9HA 2XNCA 1MOPA 2IHVA 3IPRA 4KE7A 5J40A 3KS9A 3GJ5A 1KY4A 5JISA 1W7AA 4GUDA 2XBUA 3TXYA 5EZYA 2C54A 2CMKA 4Q7EA 2XI4A 5L3QB 2OBYA 1PR9A 2IZ7A 3RUIA 3G8YA 1L5QA 1OR8A 1XNJA 3R6GA 3WGHA 1TECE 2XKBA 1ZN9A 3RV4A 2Z56A 2HCJB 4A15A 1XU4A 2BGMA 1VPVA 3JYQA 3M5CA 3G7UA 4WXPA 5AKLA 3TQCA 5A0TA 3HUFA 5LD2B 3GIWA 1SVOA 2JFPA 5ALPA 5INTA 4M8KA 3CUEF 4JJFA 4XIFA 2Q3MA 1OIWA 2RGWA 1KK2A 1P9NA 4P53A 5DM2A 3WGGA 5BQ3A 4OX9Y 4IHJF 4JNKA 4RKYA 1KYTA 4BLPA 1W93A 2OMKA 1K27A 1CY6A 2P2CA 2VWPA 4J0FA 4Q3CA 3ZXXA 2ONJA 4EATA 4Z86A 2C1EA 3BDAA 3R1IA 4FS3A 2KW5A 2OPBA 2IV2X 4Z4HA 3PE3A 1QLHA 1I1NA 2W48A 3PJGA 4D25A 3D7MA 3OZSA 3PR2B 4DLAA 3UICA 2IS4A 4PPNA 3PD1A 3BRQA 4QPJC 4QOEA 1OXBB 1VJ5A 3DBHB 1VYVA 2ZQZA 2UVQA 4HX9A 5E4FA 2I6QA 1P4JA 3F71A 3HUEA 1WWKA 3DZKA 4KWTA 2EOAA 1D2MA 4NFYA 5DBHX 1E3LA 4YR9A 1CVIA 3FOAA 5TARA 1OTXA 1KE1A 1SUCA 1JYFA 3I4CA 1YOBA 2WQ6A 4XQ0A 3MJ4A 2OTCA 2J0UA 1XZIA 3AY3A 5BNIA 2IDMA 4QPNA 2B1IA 4KDRA 3VR6D 5DCWA 4CMIA 1RCTE 3SSAA 3F9CA 2SKCA 1Z63A 1JSZA 3CLSD 2WSSA 2R1TB 2QPOA 2VI5A 2QZSA 2YZKA 4CEHA 1J25A 2BUAA 4HSEA 5JH7B 1AIPA 1FUIA 2AQIA 1K7SN 4EITA 2ZR7A 2VBIA 1PCXA 2CJYA 2ZRQA 4KXFB 4B85A 1KJIA 4WUVA 3ETCA 3IIMA 5BV0A 5IZCA 4J1TA 2RGAA 4MR8B 4B3HA 1GR1A 5D86A 1Y5IA 2W7TA 2WUDA 5K6AA 1H1DA 1E3SA 1S9HA 3PFBA 1OBHA 1P1KA 2CXXA 2X5OA 1ZJWA 2BHRA 2I78A 1PP4A 4FU0A 5K3SA 1NLUA 5ICCA 1Z4OA 2NZYA 3PQDA 2JI4A 2PRIA 3CLSC 4ENQA 1OH5A 2ZUUA 1B8UA 2BEWB 2AC7A 3O8RA 1K9SA 5A4KA 4JT2A 1ORRA 4X5OA 1SQGA 2EX1A 4H4DA 3TD6A 4F3CA 3ZW7A 4YUYA 2J0QA 1XZPA 1RI4A 2NAPA 5FFNA 1EFPB 1X19A 1YZYA 3PQEA 3BHJA 3RGGA 4BVLA 5LZ5A 1I2CA 4AZ3A 4YCDA 1H9AA 2GAJA 4B7XA 5A9TA 4E2ZA 1HDZA 4UM9D 2GN9A 3FZNA 3HRKA 3P8ZA 4L3VA 3ANYB 1H4QA 4AIIA 3H1GA 5JZBA 4HDSA 1JIJA 2QV0A 4HDMA 4FK8A 3P97A 4GUAA 2CLOB 3CE9A 1N0UA 2KPOA 3IIEA 5BT8A 2RGBA 3K20A 2JIOA 2OZPA 2DY1A 5JV5A 1RC8A 3IUQA 4G26A 4GLOA 4MB0A 1E32A 2AQ8A 5DTJA 4KOEC 5AOAA 4B2LA 3AR5A 1FPMA 2ZIEA 5EWJA 3E3AA 1NSYA 3WLPA 3WYBA 4E1BA 1M5UA 2FX3A 3CEAA 1KFCB 1RQNA 1CUIA 2AEMA 4TWBA 4EJ2A 1WY7A 2XYRA 4UVEA 4YP7A 3H99A 2YWDA 4BBJA 5HDQA 3A31A 5B3KA 5JAMA 4D43A 2Z8YM 2HSGA 2MMGA 1YMQA 3REQB 4NZYA 1CQIB 4S05A 5KYYB 3QU7A 1U0RA 5AHWA 4X94A 1KXJA 1R9JA 4DWJA 2W6PA 2I7XA 3IB6A 5SY6A 3ZC3A 5T4EA 3W2GA 3T99A 4LW8A 1NE2A 1T9CA 4KJXA 4PCUA 4RY8A 3MOIA 2X8JB 3L0ZA 4YREA 3NKFA 2J7PD 5CT9A 2O2XA 4Y6SA 4CCYB 3SVLA 5I5GA 3KOYA 4LVCA 1VLJA 5K3DA 4GBED 1OOEA 5JI3E 2P8SA 2QRQA 1RYNA 3VV3A 3S2SA 3ST7A 3IQHX 4GOMD 1L4NA 2JCBA 4Q4AA 4YECA 4BFZA 5G4LA 1Z28A 4ZMBA 5A62A 1NXQA 5JCXA 4KLNA 3ROMA 4RF3A 2E89A 4NNJA 1HQCA 2KYRA 3SOZA 3TIGA 2CUZA 3DPUA 2A1UB 1W6UA 1BRMA 2MSCB 4LJ7A 1L3CA 3BREA 5FV4A 5TQ0B 2XNKA 1D1SA 2JBAB 3CX4A 2H1LA 4FMCF 4L8VA 1E4EA 4M7RA 4U2EA 5EJFA 3T0FA 2WHRA 4BC0A 1N2EA 4F5DA 1IYZA 1V37A 4MV5A 4QGFA 5JBNA 1DPFA 4LZZA 1E0AA 5J4YA 1EJ6A 3T61A 4WCFB 4FB5A 1L4EA 3GRAA 5JASA 2PV7A 3BZUA 1DJMA 3OFJA 4O4JA 3U9TA 1BCSB 1EDDA 5IM5A 2QTMA 3DOIA 3FIJA 1RYDA 3VU1A 4DLRA 3WX0A 2RE8A 1W2HA 3IR5A 3VU9B 2W2MA 4BZPA 5DTQA 4CJXA 2D2XA 4OB7A 4B3CA 4E5UA 2BZ0A 4UPDA 2VUHB 3LUAA 3N0TA 4P2BA 1EKXA 3MYRA 2WZBA 4KACA 4F9FA 3S7ZA 1AK2A 2CXUA 1O3YA 3F74A 4RIIA 4WA7A 3MTIA 3UOWA 3DUFA 3A1VA 3BVPA 3LC0A 4IOLA 4H7EA 5AW8A 5ALTA 1KU0A 2DOKA 4DYVA 5TPWA 3WAJA 5MN5A 3HYNA 2V03A 3P2JA 4QZVA 2BFWA 4YRLA 3W7AA 5KOHB 1GUAA 2HRZA 1O6BA 4LWOA 2FK8A 4R7GA 4ZPJA 3STYA 1NW3A 1GWNA 3YASA 1H0KA 5AR1A 2I3AA 4MVCA 3QRWA 2IH2A 4CZ2A 3IVGA 4R54A 3G3EA 4EG4A 5DHFA 1T15A 5K3FA 4GZ5A 2I22A 1JA0A 2XUDA 4Y1GA 1JG4A 1H1TA 2XDQA 2JF0A 3BIWA 4MPPA 1PQUA 2JFOA 2A9FA 2H5EA 4TM8A 4TVKA 5JI2E 1A72A 1SBTA 4AMGA 4ZCTA 4WOKA 4URWR 2RFLA 3BMOA 3R7AA 4IEIA 2A1TS 1R16A 2Q45A 4LMRA 4X1KB 4E1VA 4LXXA 1ULTA 4O2AA 5BRJA 1P2UA 1D5WA 3IS3A 4D3YA 4JBIA 2MINA 3H2ZA 4AMYA 1O8CA 2QSJA 2ISQA 3DOJA 2K2QB 1TVEA 4KPFC 1AQ6A 1ZW6A 2WF8A 4N4AA 5FADA 3R5FA 4DIOA 2O8CA 5BO5A 3N3AC 4BBAA 1JG3A 1RSZA 1W94A 3PXXA 2HLHA 3DC7A 1II9A 4R68A 2CK3D 5SZIA 4DG9A 3NTOA 2JLYA 3EPKA 3G88A 2QMQA 2B4YA 5JO0A 4MYRA 3C8MA 2MTBA 3F8WA 3TM4A 2CL5A 1LI5A 1SQ0A 3QVMA 1HDRA 2XMRA 4NX2A 3C15C 4O2BA 4YHHB 1POXA 8AT1A 3P9IA 1EYZA 5IAKA 3QE2A 3SC3A 4BZZA 2D3TA 3RBVA 1HC7A 3CEMA 3E3LA 3M7IA 2EFHB 3P0FA 5EY5B 2IUYA 2QM8A 5HUQA 2D5CA 1L8XA 1E20A 3EIOA 5IH7A 3BD8A 1JKFA 4DKJA 2O2YA 3A2MA 3UJAA 1NR7A 3GPIA 2XWJI 5I9BA 2C2HA 2FMUA 1IZ7A 4LKRA 16PKA 2R8YA 4MHSA 4BNXA 3ONNA 3FDIA 2GBIA 2UUOA 2DUNA 4C7JA 2FZVA 4DNQA 9GPBA 4OQMA 3D02A 5KTRA 3H2HA 3H6KA 3JS5A 3VNUA 1QAOA 1MCZA 2RK3A 3O3NB 3EW9A 2FEXA 2FWAA 1UF9A 2BLLA 1O96A 2OZLB 2XITA 4L0CA 3E84A 1JZSA 3HVKA 1SRRA 4YMHA 1XNHA 1W19A 3IMKA 4V0QA 1MZVA 2F3PA 3EIXA 5DNVA 4EPTA 3VO2A 1P0FA 2VXBA 4QREA 6Q21A 2C42A 2WFMA 3UGKA 2MSWA 4HVCA 4IO1A 3LO8A 3OQVA 2XMDA 4I1YA 1VE6A 4PQEA 4R8VA 3B3AA 1TZKA 1RWNA 2WABA 5BW8A 1BX0A 2I2DA 2F43B 5DV9A 4CU2A 4DILA 3PG5A 5K05A 4XVCA 3FRJA 4C4AA 2JGEA 4M0MA 4YMTA 2GN8A 3S4YA 2NW6A 4RUKA 4RK0A 2A9KA 4RWEA 2RC5A 3H8SA 3T7RA 3HHEA 1FBNA 1CZUA 1J2EA 1AT1A 1OZ0A 3KDAA 3DMGA 3PX2A 3IBGA 1V47A 3B6ZA 3HZRA 4OIFA 4PNEA 4G2TA 5B7QA 2PE5A 1Q0TA 3EULA 1CS0B 1NZJA 5HIAA 2D1RA 4IIDA 3WLQA 4YRMA 3FKQA 1Z38A 2GHIA 3T9EA 2ZG6A 4R1PA 3R8XA 3R5HA 2BHSA 3FCUB 2V7TA 5FWYB 1V5GA 2ONZA 2VWHA 4Y9RA 4UQPA 4LSZA 4C0WA 1LQ2A 7MDHA 3KZXA 2WB2A 2GA8A 1WHSB 1Y1TA 2VS1A 2OY0A 3TX2A 3WYEA 4L22A 3ZCVA 4FR0A 1QHIA 3K73O 2R8PA 4MB6A 2BE9A 1PK9A 2HLNA 3CLTD 4O4IA 3PUXA 2PX6A 4C88A 2HDOA 2XDWA 1HF3A 3K8QA 4WBNA 5EHZA 1ZHFA 3A4NA 2ZETA 3EXIB 1XEXB 4A03A 4R0NA 4CG2A 2O59A 4QC2A 1JBKA 3OZWA 4DEVA 3B6KA 2H07A 4J8PA 1WUHS 5D1NA 2VZ0A 4G25A 5SZKB 3W8FA 1O94A 4JI6B 2VNJA 3I9NA 2GCIA 4JEHA 3V1TC 3IMCA 3R0ZA 3ETHA 1VKNA 3NT5A 4MR7B 3HJRA 3DMFA 1T1RA 5AI8A 5DEOA 3U3KA 2XKKA 1Z74A 1KQ3A 4DSZA 3THYB 4F91B 4CW7A 3U4GA 2ZRMA 5LPNA 2H1HA 1IUKA 1GGKA 1TZ2A 3CLTC 3DEAA 3PB3A 4RVGA 2VNAA 4YROA 3WA6A 3CVXA 3EJ6A 1Q14A 3N8HA 2YN4A 3AZPA 4M86A 3URKA 4EHIA 3Q7RA 1TB4A 1M33A 1TXGA 3O8QA 4Q48A 3CKKA 3EC7A 4H3VA 4DRXA 3ND9A 2VP4A 3OZBA 4PXAA 3RIYA 2QXYA 8ADHA 1FFGA 1X80A 3MPUA 1S3SA 1E2DA 4Q6WA 2RGYA 2ZB4A 1CR0A 1CJCA 1KZHA 3HWX1 2H2WA 1L5GB 3W0LB 3P0HA 5AM4A 3D4OA 3DE7X 3WYFA 1AHIA 2JHCA 2N46A 1AN9A 3DKKA 3IDAA 3FPFA 4EMUA 2FMIA 4YAGA 5B2EA 4BXOB 4GMDA 1QHHB 1YS4A 3JQPA 3SQWA 1W36B 3V32A 5CEFA 3ELDA 4IIJF 1KP2A 2VYVA 1U0GA 2WTXA 2XRYA 4IUCS 4P34A 4XEUA 3OEEA 4PTLA 3OLQA 3D3JA 3ACDA 3T52A 1E1KA 4X1YB 1YDHA 1DFIA 3ELUA 3OPMA 2CHUA 4OIMA 4O33A 3RS8A 2W2NA 3UMRA 3VPAA 1FQJA 1KJWA 2O8NA 2ZBGA 1DXQA 2AL7A 5B5SA 1LVGA 4PPGA 3RV3A 3GGOA 4C06A 4RTRA 2PUJA 1XX6A 1K3TA 5BN5A 2CUKA 1IWBB 4JWKA 4QEDA 5E4JA 3AVWA 4CETA 1VMKA 1K7YA 2OWEA 2DHQA 3A6EA 1UFVA 2UVPB 3ZD6A 1OXUA 1UBRS 5AKHA 5A7HA 3OUZA 1DTWA 2ODWA 3AI1A 3HWSA 4HXGA 3RVMA 4LV5B 3SXUA 4A6DA 1BA2A 1NJGA 3KXDA 1H1LA 4HAVA 3EGCA 1U2EA 2QKYA 4OHBA 5FP0A 3WY9A 2NO0A 1L4KA 2BR3A 2V5VA 3AM4A 1P9OA 4J2HA 1C7IA 4RKFA 2JLXA 3E8XA 2GJ8A 3JWHA 1ZO8A 3AEXA 4UVHA 3T9CA 3WOVA 5HIMA 3FUCA 5C1DA 2RG7A 1DFHA 2FA9A 3CH6A 2H3EA 2YS7A 4N9WA 4ZVQA 3EZ7A 2WY2D 3VDXA 4HAXA 4V2UA 4BJHB 3GHYA 2Q2VA 1T1JA 1Z29A 5CLGA 4S35A 5AKXA 1GG2A 3OC0A 5EEGA 1C9JA 4O4HA 3UFXB 1S8AA 1F51E 2PUDA 1A9ZA 5JWOA 1ZBQA 4JJ7A 2IVZA 3H75A 1ZD3A 3DZFA 1P29A 4UMEA 2BYTA 3ZNOA 5CAEA 1TK2A 1R8XA 4HB2A 4GGOA 4OF4A 3MINA 4UVDA 3VR2D 3LBHA 1W8DA 2O8FA 4LRSB 4S2EA 4DDWA 4DV4B 2QJRA 3L6CA 1XU7A 4OQNA 4DIDA 1WZIA 5IJ0B 4HAWA 5JW6A 2WF6A 3TPCA 4BLOA 1J07A 2C2GA 3DDSA 4IDGA 3OMLA 4WNAB 1MT0A 2WUEA 4P4NA 3ZVRA 4UJ5A 4AWAA 3NC1C 2ZBPA 3PSAA 3RKUA 3W5AA 2FCAA 1P3DA 3WIBA 1DJPA 2OBMA 2NYUA 2PQ2A 4WLFA 3AKYA 3SDZA 1GUBA 2VPTA 2VP6A 3D0RA 1A8UA 2OZKA 3C3MA 3DCJA 2I2XB 2XXBA 4L85A 3TLBA 1PFGA 3EARA 3FCEA 4KO4S 1PNTA 4HH4A 3KEMA 5THQA 5IEJA 3VHRA 1U4SA 1OLSB 2A0WA 4M0FA 1QJ4A 1LF5A 1DG1G 3FVVA 1PFUA 3L40A 3C1TA 4MW7A 5JJCA 1M72A 1S2IA 1U3WA 2I6GA 2A94A 4DHEA 4M60A 3MBIA 2X8LA 3P9PA 4XQCA 1JN0A 1XHEA 4RM2A 5FTWA 3UCFA 3WYAA 1Z5WA 1DP4A 4J9VA 4WFKA 4A92A 2J59A 4WKNA 2C2KA 1LNQA 4QULA 1JEYA 5IHXA 3IODA 2BBWA 4BB0A 1CK4A 4P98A 3AIIA 4R6WA 1W4AA 2C4HA 3G2OA 1OBOA 1YB6A 3OQMA 1XA4A 5ALYA 3TBHA 5HQ3A 1NF9A 3C6MA 4RV9A 3EY4A 4CI0B 1TM7E 5DI3A 5BPFA 1O95D 3H5VA 4XFDA 2GILA 5DSTA 5CFMA 4JI8B 3C98A 3P5BA 4OD0A 1KMMA 2XKAA 3U4QA 3MILA 1F4PA 1O8BA 4IKPA 1GAWA 4IIYA 4XDZA 4YCBA 1R0YA 3VZQA 5KOJB 3QJGA 3MVEA 3FPBA 4XQEA 3D31A 1GA4A 1TC1A 3TWOA 3FX2A 2X5JO 3NUQA 2BEVA 2ZB2A 4LK3A 3V8MA 4F9TA 4C7KA 1E64A 1CPYA 5JBQA 1IBLB 2QMHA 3MJRA 1ZUHA 4MLZA 5B2ZA 3UQZA 4F4JA 5M2QA 1DNPA 5ALKA 1CY4A 1NQAO 2QUBA 2EKLA 4MUNA 3VI3B 1EUZA 4EPRA 5ENZA 1O95C 4DCSA 1PV4A 4PSKA 1LSSA 1U1FA 5E6RA 3MQ2A 1LTQA 1RJGA 3DZDA 4I14A 1IXKA 3BGVA 4L78A 2IIVA 1RRVA 1SVNA 2WU1A 3AEZA 1P5RA 4BQIA 3LZ6A 1HLPA 3WWDA 4HX5A 3B3GA 4HOYA 2WHQA 4JELA 1SPBS 2PYDA 5KNDD 2YBDA 4CCSA 3ZCQA 3SBDA 4UTOA 1ODKA 2IOFA 5ED4A 1HQDA 3IYLW 3LL7A 4QUJA 1Z4QA 2XADA 3QPDA 1TM3E 2QG6A 4YMVA 1NBWB 1UC5B 4LYDA 2MHCA 1T13A 2IXEA 3DKIA 1K97A 3EB9A 3LV8A 4R1TA 4EMTA 1B6RA 1JAHA 4XX1A 5FUXA 4L4XA 2YDXA 3L92A 2AN5A 1Z5OA 2NU9A 1VMDA 3MFQA 4IMIB 4MV8A 4MWZA 1Y3HA 5DASA 5AVKA 4FKBA 1KQPA 2BAGA 3HDTA 1R2QA 3F3YA 5FPQA 3K92A 1OF1A 3LRTA 4EHBA 5DRYA 2DBYA 3GLFE 4PYQA 2Q07A 4REQA 1P7YA 4JJKA 1U8AA 3BN3A 4NJMA 1PG0A 3HXTA 4B17A 4U6NA 3JWIA 4EUKA 1IUPA 2WVAA 4NYIR 4AKTA 2Q6LA 3BJMA 4HFJA 1JH9A 3M2PA 4CQJA 1P74A 4MULA 1CEEA 5TPZD 3Q15C 2IWRA 3ZKWA 1X2BA 1OHHD 4ZICA 5IK2A 1AMNA 2HHHB 1ZZEA 3MT8A 4NS4A 3LCCA 2UV8A 3H6HA 2X0DA 3U39A 4E94A 5LZ9A 1QR6A 4OHPA 1RYHA 5LZ7A 2PL3A 3RT9A 3ZWWA 1QCZA 1KBQA 2QORA 5B58T 3BBLA 3RSFA 1IOWA 5THKA 4A0QA 3FWPA 4CQMB 4RTPA 1UOEA 5L3RA 3A1UA 5TQVA 1G9TA 3HJHA 3MGKA 2DEUA 1U4OA 3IAS1 3NG1A 2EGHA 3Q41A 2I1LA 3BH0A 4XYMA 2Y2UA 4MVJH 4TV8F 4RCZA 4DEYA 2R79A 3UT0A 2P9HA 2OGZA 1C8LA 4OMCA 2GZAA 3PHJA 3RVBA 4BNHA 1R3UA 4BTEA 4DCJA 4FQ8A 2IIQA 1NYTA 3NEYA 4ND8B 2OGSA 1DO0A 3EAFA 4Q05A 3FVRA 4ZN6A 3O8BA 4D3SA 1WCIB 4H9GA 2PBRA 3NBFA 1Y5MA 1IG0A 3QGMA 4W6ZA 5JMOA 3I61A 2ZJ3A 3PU6A 4MO9A 3T3OA 3I2GA 2ORED 4PRYA 5H3LA 5J47A 1JHYA 1FP7A 1Q3KA 1XBTA 3JZFA 2Q3FA 1LTHR 5F2OA 4TMTA 1P75A 1G66A 2GFHA 3GRZA 4KAXA 2FFBA 1KTVA 2JGJA 4AYXA 3SK0A 2F1OA 4NYMR 1SBQA 1QMGA 1KI7A 4KQEA 3DS8A 1KQOA 1PGPA 2XW6A 4PGFA 5JPCA 3G5MA 1M34A 3GOQA 2ZS8A 4HXEB 3RYHB 2OO3A 1CIPA 1TU4A 4AUKA 2Q62A 3V8VA 2YWBA 4OGKA 5DNAA 4C01A 3O26A 4CMAA 1XLVA 3ZJ4A 3H2JA 3DDHA 3CQ9A 3D8NA 3FCCA 3GLUA 3LPCA 2X0EA 5I9LA 3BB1A 4KQGA 2B3TA 1Z4PX 3SOPA 3GQBA 3M4NA 2PU7A 4A27A 4JQYA 1G60A 1WMSA 4X84A 1NC1A 2FSSA 3RHZA 1AUXA 3PLNA 1BJRE 3AONB 2Q6IA 5JAZA 2AZTA 4DR7B 1CY8A 3NEPX 1JDBB 4NL4H 4B76A 4ER0A 1N2GA 1KBZA 1Z06A 4GR9A 1NXVA 4UW9A 5EXPA 2AD1A 3P2IA 5FTKA 2G8NA 3OTHA 4RYDA 4KPUB 5C8VA 3CUTA 3TLGB 3NU1A 2I33A 2H57A 1G291 2EDAA 2JI7A 1BEZA 3CRMA 3CF4A 1V8FA 3E1KA 4G0QA 4GZ6A 5M3BA 4EKYA 1VIMA 5KSOA 3D3WB 4DARA 4WY8A 5K8TA 2ATVA 3DXFA 4PFQA 2XNDA 1SVMA 1ZGAA 1ZRMA 5HJEA 1QE3A 3A06A 1YC2A 3BDIA 4RMJA 1G38A 4U2BA 2P2SA 3DCYA 4GGMX 5FA8A 1UP7A 5REQA 2XF2A 3B5JA 3ICCA 1NVKA 1G8GA 1U0LA 2V6GA 3KQTA 1XV5A 4B8WA 5KSZA 2OB2A 5B58C 3RYCA 4ALLA 5FTLA 2YXEA 1WMBA 4JI3B 4E5SA 4G9EA 3H05A 3I3OA 1TU3A 1FNCA 1MA3A 5JNTA 3MCWA 1JHVA 2FQ1A 3GNSA 3WMFA 4RTSA 2WTEA 3S2YA 3DW1X 4UZSA 4ZDWA 1RYZA 4J3NA 1JHDA 1AKTA 2UYOA 4J2TA 2BGTA 3FTEA 1AG9A 4N7RA 3RIXA 4BNVA 5I45A 2L82A 1BQEA 4YH1A 4Q39A 2ORYA 2W2QA 3UJ8A 1IB6A 4E5KA 1RS0A 2LD4A 1R15A 4TTTS 1ZH4A 4OYHA 3WKBA 8ATCA 4KLRA 3INTA 1WL8A 4UCQA 2O8BA 1EUCA 3IKVA 3LDUA 3S81A 4D92A 2QYTA 3BQ9A 3GLHE 1XHFA 2IU3A 2AA3A 1E6CA 4PIVA 1HE1C 1ST3A 5FBKA 5C2JB 4J4BA 3FZQA 3M8KA 3M9WA 1EFVA 1JJ7A 5ALJA 5HM8A 3BXXA 4K6KA 5EKDA 3IXQA 2NSDA 1JBQA 7REQA 3DTTA 1VL5A 4QTYA 4EB6A 4PHHA 1IB0A 5KDLA 9ATCA 4JUIA 4HK4A 1TCCA 3KL2A 2DRIA 5HP4A 2CNOA 2YVQA 1IRXA 2JFHA 3HI4A 2OLJA 5J5VA 2QL7A 3SWWA 4CXMA 4OHWA 1NQXA 1M6YA 3PQCA 4FEYA 1T0IA 2O3SA 3VPHA 2C5GA 2QTNA 1B6TA 2ZUWA 2WHPA 3CVOA 4GPBA 2DBRA 4XLZA 5FOWA 3AVVA 1L5SA 5LBTA 2H0RA 1DAKA 3WRYC 4R01A 1N5MA 1NZDA 2C1XA 2ZBFA 5T8KC 3SQLA 1U1EA 3QFFA 1JP7A 4OI4A 4P4SB 5DGHA 3SIPA 3VC7A 1LBHA 3ZWCA 1OI7A 5BW4A 2I2FA 2I2WA 4ER6A 4AI6A 4Y2UA 2BFBA 4ZOCA 3H8WA 4F6CA 2J0SA 3EOAI 4B8YA 5LP6C 5A2QA 4HNAB 4U6SA 3G7NA 4AX8A 4IX1A 2XPCA 3I9JA 1FYXA 1QCCA 1XDSA 5HKAA 2CCGA 2YVLA 2YRWA 5DHAA 3LQ4A 1L8LA 3HGTA 1RXUA 1S7CA 1UBJS 3EWAA 4D80A 1JPJA 4YJGA 1Z34A 3NXKA 4QRDA 2VNIA 3K4HA 4EFMA 2ZT6A 1U5AA 4JLMA 4R9SA 4PAOA 3NBKA 3NB0A 3QTTA 5IKXA 4FX2A 3LC2O 4J0HA 3QPVA 4EYQA 3N8IA 2X4DA 3NTRA 5DU2A 1WU8A 1PFKA 1YBAA 3MUOA 5LA6B 2CJWA 1W8IA 2R2AA 4MAFA 4FDLA 4MV0A 4ZOLF 1S01A 5J1SB 3NYWA 1J4AA 5KMGA 2X2PA 3PP8A 4QGGA 4BCBA 4C89A 1RQXA 2A57A 2B9VA 4MNTA 4WJZA 4HDNA 4YYZA 4TS1A 3C24A 1PQWA 3IE1A 4IJKA 4LS3A 2OYRA 1U2GA 2ZK7A 4EG3A 1QG0A 1K7CA 4OG2A 4D0NA 1BKYA 3QLTA 4I55B 1XEWY 5LIRA 3DNPA 1RAGA 4A0SA 2ZZMA 1DQYA 3T95A 1KKUA 5EMLA 4G1VA 2X0FA 1RJ9A 2FLWA 4U7FA 1Z8NA 1HEUA 3CNBA 1MO4A 2ATIA 3RVKA 3TH5A 3I83A 3KV1A 3LZCA 4RGYA 3H1PA 3ZZTA 3UV7A 4XQ9A 1P7PA 4ASUD 2IYUA 4KR0A 2GBFA 3KV3O 1I2BA 1BE1A 1K9VF 4KYIB 5FQOA 3D7SA 1GAXA 1RM3A 2I4TA 3WBKA 4BFYA 1NUUA 3DMTA 1XCPA 5LP6B 3EVTA 1UBLS 5CP8A 1O97D 1ZA1A 1XP5A 2CXQA 4GECA 2J5KA 3AHFA 3QWIA 4NEQA 2PRYA 5AXBA 3SZOA 1W88A 5EQJB 4A5OA 4BGIA 4CM9D 5BV1A 3N9IA 3V7NA 4RD2A 4IQFA 5AXAA 4BVAA 2B6HA 1VLMA 2D4AA 4D9MA 3A28A 1K2WA 1LB1B 1Y3BE 3IKJA 5KPJA 1GGNA 3A7DA 2JBHA 1F7UA 4P5PA 3SZRA 1RP1A 1KDPA 4A36A 3DYIA 2ZJBA 4J4HA 4DIKA 2ZRGA 1L7OA 2PUGA 1TM2A 4FE3A 3TAHA 2BBOA 3AW9A 3NNNA 4FYIA 3K0EA 3RCBA 1QF6A 3MLBA 2HUPA 5EJ4A 2AOXA 2PS3A 1O97C 2QN9A 2Y1GA 2X8BA 3NETA 4GPEA 3SJCA 5B1SA 2BCEA 3UAXA 4ZVSA 3E4DA 3FF1A 3TZ6A 4CT5A 4G0MA 2GAIA 5EZQA 4ESHA 1KEWA 2WWTA 1M0TA 3EZ9A 2WW8A 1IHOA 3PENA 1LA2A 2JCXA 4J3JA 2RGNA 4GM4A 1F2VA 3TG2A 1EB9A 4G9GA 1T8WA 1OU0A 3L7YA 1TAQA 1I7DA 1P2BA 3E03A 1C80A 1UBHS 1Q0RA 1Y7HA 1Z5VA 1NDQA 2QLTA 3FBWA 5EHIA 5TEVA 4B3GA 1P2FA 4E5DA 2VJNA 1ZH8A 3BFJA 4M9XA 3F4KA 3QWFA 3U5ZB 1P8JA 1PX2A 2JB9A 3ESXA 1NQWA 1KGSA 3PUYA 2B4TO 1ZUIA 4R1QA 2QSZA 1YKGA 4BO9A 2PUAA 3ZBPA 1Y6RA 3FFAA 4BAUA 1MORA 4ZI3A 1IJFA 1GTSA 6YASA 5LYJB 2Z58A 1OBCA 3GUVA 4MA4A 3FLEA 3OFKA 4ME6A 1O5TA 2O2SA 2YJGA 4WKPA 1JIUA 2OP0A 3B9PA 3CBGA 3H2BA 2JNWA 3TLJA 1G1AA 1E7YA 2FW1A 4TLCA 2I03A 1SN7A 4AF7A 2AFHB 3VKGA 1CZNA 2ZIUB 4B9EA 3EMKA 2GSDA 4XE5A 1MO6A 4OKIA 5KJEA 4E31A 5M7EA 3PHCA 1YS7A 3JZDA 1SCAA 4HQKA 4L28A 4LYFA 4KQ6A 4NULA 1SO8A 4Q82A 1BC5A 1Z2EA 4TMFA 3WGUA 4F9EA 2GT1A 1VMEA 2QDXA 3GVIA 3K1AA 1GTG1 1E98A 2BFEB 4EKEA 1P9RA 4BWFB 4LF7B 3TIVA 4CF7A 3ERCA 1N1DA 3GZ4A 1ZMXA 3G59A 4TUYF 4F5EA 3H9CA 3O47A 3NEAA 3BPSA 3WKCA 3H7AA 4EJSA 2CB0A 1TQ2A 4LQDA 4NBLA 4NENB 4AY5A 4TTJA 3UH1A 2GM5A 5CLIA 4UEWA 1HEYA 1Q50A 1KDOA 4GAEA 4UFOA 2ZFUA 4ALNA 4MQEB 1ZIXA 4F84A 1QF7A 4B3RB 3QMVA 3X1YA 3KYJB 1QH1A 4ZOBA 1Q0UA 2XT6A 3AEYA 3BE5A 3E3NA 4JYCA 5DK4A 4BNYA 4AQYB 4D9JA 4GYWA 1L9KA 2XMQA 5JHGB 3D3KA 4FJ1A 3Q3GE 2FEPA 3WFIA 3E15A 1JJVA 2VSNA 5JAQA 1YMVA 2BM9A 4Q01A 1D2GA 2N1BA 2FXIA 4DA4A 1W76A 3DAGA 3MK31 4PRZA 4CGYA 1UM9A 3LPMA 4RTNA 4YP1A 4W1SA 3KLBA 3KC2A 2RK4A 2QJWA 3RWBA 1FUKA 1JVSA 2OXRA 1ENOA 4QGBA 3B48A 2IU6A 2NUAB 4BO7A 5A5DA 1VCNA 4Y1EA 8LDHA 3I5YA 1B41A 2WT8A 4QLAA 1N5IA 1CQJB 1KDYA 1V4BA 4K9QA 1YR3A 1VCMA 3C6XA 1M2NA 1L7RA 2DLCX 4QBGB 1NV9A 3ESZA 1CQIA 2PSEA 2GZ2A 2Q6KA 5IBPA 3UTCA 4C0BA 3K0HA 1HDYA 3EE6A 3LVQE 4IIEA 1WEKA 2AF3C 2ZU6A 2WNHA 3GEIA 1I10A 2PXXA 3A3KA 5A6SA 4DR1B 3CT6A 3COJA 4E70A 2WFAA 1EGVB 3I8OA 4GI7A 4PX5A 2W2XA 4MUKA 3WB2A 4JZYA 2EX0A 1P1HA 2Z6AA 2WSIA 4LCEA 3DWIA 1S2DA 2XQKA 3SHTA 4MS1A 3CH7A 4XIJA 5B4UA 1UH5A 1HRKA 1OGIA 2K87A 3EUAA 3K9CA 1NVVQ 1QYIA 3F9RA 3OPYI 3GL9A 3PQ5A 4HZGA 2PTGA 4EAAA 2WAAA 2E6KA 1UFRA 2J45A 1XCOA 3ICVA 5FULA 2W4QA 4WECA 1RYYA 5DXJA 1F8UA 1FP1D 3MA0A 3FUVA 3MT7A 5E3IA 2COUA 4LRXA 3CJRA 4EF4A 5G02A 1SQ5A 1Q16A 4J94A 4ACBA 4DV0B 2F8SA 1YQGA 5K6RA 2DFVA 5AKZA 3ZIAA 1GFZA 4JEMA 4ZOQI 1BKSB 5KX5B 1KEEA 1GVHA 4QM6A 4A0FA 2VUIB 3EHEA 5C35A 4BGEA 2DKNA 3EG9B 3F6YA 4EW3A 1QP4A 1RQGA 2WU8A 3PI7A 4LA4A 1ISRA 4QYWA 3U1TA 4OB6A 1NUTA 1IM8A 4L5CA 1T3HA 3AR7A 1ZOLA 4NH0A 5KNLA 3GJ3A 3P5SA 4NEGA 4P7BA 4F12A 1FFDA 2POQX 3LKDA 4LVUA 4P2GA 1IPEA 2RHHA 2D1YA 4GWGA 2QJFA 4OHCA 4BGUA 1P5JA 1PJTA 4TTQA 4R1UA 5UKDA 3TI9A 4FHZA 2P2GA 2Q5LA 3LTNC 2WIGA 4IIVA 2OFFA 1UQRA 1HV8A 1DBIA 3NC0C 4N7BA 5BUQA 2ABWA 2V5AA 4D8VA 1A8HA 1VIVA 1OH6A 1RHMA 2XTJA 4KN8A 2ZWAA 4A9AA 5KWSA 1PR5A 3DL0A 5T3UA 2AFIE 3FTCA 2AR9A 4LMAA 2RIRA 4KR2A 5KOYA 2IS2A 2JJ2A 4UOEA 5KYUB 1T43A 1ESDA 4JYZA 5FH9A 2IEGA 1VM6A 4GXNA 1FVHA 3R44A 4MUMA 5CTAA 2FZWA 3KYIB 1XWFA 3IEIA 4Z7NB 2W5UA 3HB1A 2Z6UA 1TAGA 2AN1A 2JI9A 3SFVA 4EENA 3UXHA 1ZHOA 2C98A 3VJRA 1ZY2A 2YIMA 2AQHA 2PWAA 5JDIA 4UCWA 2FDRA 2YJZA 2PKQP 4GX1A 1GGEA 2AMFA 1BCRA 4QOSA 5DBEX 2ZJ6A 4MGIR 2WSYB 3LBFA 3MTGA 2ZJFA 3WL6A 5ITVA 1PEDA 1CNFA 1PZXA 3AG6A 3KEGA 3UAOA 1AO0A 5JNRA 4LTNA 3BTUA 3O1IC 4QOHA 2FYTA 4UHDA 4BVBA 1EE9A 2KS6A 1ADJA 1NSFA 4IIJB 5B12A 3I04A 4DGSA 4C3OB 4QXRA 2AG6A 4BX2A 1Q0SA 4W82A 1PJSA 1EDBA 1DG9A 3DB2A 4QD3A 4CG1A 3HN6A 1EU1A 2I6UA 1R0WA 2F1KA 2IX9A 3DL2A 3IE0A 5BVGB 3N2GB 2P5UA 1W581 4O0LA 4B2PA 2VPQA 1E3WB 1JLMA 1Z8FA 3C3BA 3ICQB 2REQB 4IICA 1JG6A 2CNWD 3MHPA 4QAQA 1WXWA 4RDCA 1KDZA 2WTNA 4H1UA 2JAQA 2Y4OA 1RZRD 1X86B 3L8GA 5PGMA 4CUZA 2F3SA 2GYVA 1ZMRA 4DV5B 4BTVA 4L57A 2PS0A 3K2IA 4LE0A 2Q8PA 1CUVA 4FLMA 3CZPA 3H9UA 3SJUA 3G17A 1FVOA 2IDJA 2WJZB 3CR3C 1GZ4A 3FFBA 4UOZA 1Y9AA 4CMKA 5JD4A 2FOXA 1E62A 4MW0A 3PEWA 5AVRA 2VSFA 4QRHA 2ATEA 1EVEA 1Z5GA 5D1HA 1VHTA 1XJCA 3MWJA 4EY8A 4DR6B 3JD1A 4OQYA 4Y9DA 3SMQA 1K5GA 1JAXA 2O2GA 3ASVA 3ZGOA 1GRVA 3TNDA 5ESXA 3VO9A 1YMUA 5MDHA 3NAMA 2XUOA 1JW9B 4QYIB 3JWJA 1PDWA 4MWOA 5ALOA 4K26A 2WM9B 4JLNA 1GSIA 1NMSA 3EXHB 2YMLA 1PS0A 3NHWA 4U7GA 2CJXA 4HXYA 2WE8A 3OZGA 1EVYA 4QEZA 3B70A 4YLEA 1YQXA 3BGDA 2RGDA 2Z2YA 4FHCA 4OBWA 3OSZA 5KJ1A 4DG8A 4FYWA 4Z99A 3PNLA 4WINA 1BEEA 1GZHB 1XQ6A 4MUBA 5ALEA 2I66A 2ACWA 2YQ4A 5JD5A 1A2BA 1QGAA 2Q2OA 3SM3A 2QI9F 4F3RA 3D8UA 3LMKA 3ZD8A 3I5XA 1WZEA 4P0PB 3DE4X 1MEJA 5DFAA 4HVLA 4FN5A 1G2QA 1C1YA 2XAUA 3WB9A 1YGYA 4NONA 5A7FA 4WLOA 1QVAA 3EQ8A 4J0EA 1Z6TA 4OH1A 1IE3A 1YDWA 4KDCA 2X4IA 1E2NA 1YB1A 2O1EA 3DR5A 2MR6A 2PL5A 3PTAA 1GQRA 1Z4LA 2AR0A 3I0MA 5JIBA 2VTDA 4JBYA 4ZTBA 3H2SA 2W2TA 3OPYA 4ZRNA 3GJYA 1TLFA 4JR2A 1RWPA 1WNTA 4MV7A 2PH1A 2CE7A 3TRDA 3PIDA 5BWOA 3K70B 1KI3A 1QYXA 2YRXA 4O2LA 4J4TA 3JQ8B 1AXRA 2QVBA 3PNVA 3OE7A 4PNPA 2WSSD 3GT7A 5T4FA 3WP0A 4LYEA 5FUQA 5GONB 2KE5A 4XVQA 3LOPA 3MWGA 2HEGA 2JFXA 1VMAA 3OU7A 5BYKA 1R0CA 2IEZA 2ODQA 5KCMA 1ZM7A 2QB5A 4XLTA 5JVDB 2PZGA 1P4AA 4LFCB 2F9LA 5EMNA 1IVYA 3X2SA 4Y2SA 4KSCA 3EX7C 3OZEA 4FOLA 5JNSA 1XGKA 2BUCA 2NVBA 4MVJI 5LQAA 1X1AA 4N01A 4ZCIA 2PA3A 3Q8WA 4MA0A 1XIVA 3OJ0A 4BRZA 1Q1ZA 4MQMA 5KTYA 2J6BA 4FFBB 3BIOA 9LDBA 4OQEA 3TTWA 1U65A 4Z0NA 3VOAA 4EPXA 1IL0A 3QBEA 1I2DA 3GUHA 4RZHA 1LSUA 2WB4A 1JU4A 2VCHA 1CRWG 1K6EA 3C85A 3E8SA 2BH9A 1FDIA 1SHLA 3EEFA 3FNBA 3K32A 2LGJA 2J9ZB 4QTTB 1CR2A 4ZVTA 3L4JA 2X13A 4GSYA 3D7KA 1CJSA 5IZ4A 4N41A 2NTYC 4YP6A 1V3UA 4J1TC 1Q0QA 2Y9PB 3E1SA 3C7DB 1NX9A 2NP6A 4RVHA 3SP1A 1OZGA 1QRAA 2HK6A 4V0LA 5K6AC 2DB3A 1QS0A 2OO5C 3FPCA 1M3SA 3QXHA 3G5UA 4NIMA 2VH1A 4FGKA 4G41A 2H1OA 1AF7A 5BR7A 1N5DA 3GT4A 1CIJA 3H5RA 3FHLA 4I4TF 3IPLA 2G5CA 3VZCA 5I4KA 4MQFA 3MUEA 2HHCA 4WLUA 1Y9ZA 1R50A 2O7SA 1QRTA 1OAOA 3ZY5A 5K09A 3IQFA 3A11A 3CVJA 2YHSA 4P84A 1TO1E 3EFBA 2YJ6A 1LLUA 1YZUA 2GYWA 3M2TA 4QU9A 3IOBA 4G1BA 2NTEA 2X22A 2ZAGA 3IUSA 2QQEA 4M9RA 3AR9A 1Z5UA 5F35A 4E15A 3KFXA 2RB5A 2MR5A 1NMEA 4X7RA 3VR3A 4OSOA 1RD4A 3Q85A 1Y4ZA 1U9ZA 3OLZA 2QBYB 4UZEA 1ENPA 4YQFA 1TVMA 3AUYA 3KZMA 2VF2A 1FS5A 2I4MA 2LXNA 3R9XB 2V98A 3ANTA 4RQUA 2KM1A 2K4MA 4CHTA 4G0ZA 4WZBE 2P67A 4HEA6 4AJKA 2VHCA 2DE0X 4HQ0A 1MVNA 4N5MA 4LJYA 4JCCA 1A7UA 5I7EA 5G2OA 1V7CA 1PTKA 1G8AA 3CG4A 2O3QA 3L46A 3W8RA 5M04A 2XGMA 1COWA 1ZX1A 5K8JB 2G5GX 3I23A 4NYJQ 2OQ2A 1ORVA 2JGDB 3L1IA 2B0CA 5AKGA 1MT3A 5JCJD 5B3AA 1C4OA 2AHOA 4G5GA 3ZCXA 3RJ9A 1XZ8A 1CY2A 1Z3CA 2O06A 4OJYA 5JCZA 4ODIA 1RMTA 4PVDA 2C3OA 5HZGA 2JAPA 3DLCA 3PLAE 3OIWA 2R6AA 4MZXA 1KO1A 4RJ2A 2Z3WA 5ECDA 3KU1A 3OCCA 2CLLB 1HT1E 1VB5A 1NM5A 3G2IA 3MQ4A 3ZGYA 3KVRA 5C8DA 4ZAGA 4EW2A 3Q3IA 4IIFA 4RE6A 3E7FA 4HNSA 3L3BA 2XXAA 2AQKA 4JKYA 3MWLA 1QH8A 2LKCA 2OVBA 5F9HA 5IS2A 1U0SY 4HWRA 2P35A 5BUZA 4RTLA 4WL0A 4UAUA 1BFDA 1EWKA 2IPLA 3ZK8A 4MUXA 4FYXA 1ZZGA 3H87A 3B1JA 4OU5A 5TX7A 5JJLA 5JS1A 3RIGA 4JUCA 3DAOA 2ETVA 3BF8A 1YT5A 4IINA 1TO6A 1FQKA 3ETJA 5ENDA 1KVUA 1PKEA 2Q27A 3OFND 2O3TA 4IOMA 3KOXA 4LHYA 3NXSA 4OHVA 4FNGA 3EGOA 3UB2A 3U7QB 5ILQA 1UBMS 1SHKA 5IVIA 5J4KA 3K6KA 2ZSJA 2IZ5A 1Q74A 3OIUA 2E21A 4AG6A 2AB0A 3EIEA 5CA0F 4LQCA 2K6GA 1HNNA 1WHTA 4R1OA 1U8YA 4M8IA 1PD1A 5EA2A 5COAA 1OIXA 4KQWA 4DUYB 3A25A 1PYGA 1IAVA 3M34A 4DA6A 3TB4A 1C9DB 1PL7A 4MW1A 2WJWA 5ALRA 3NOOA 4JGIA 4QPPA 3PDJA 2J5BA 3DDWA 3FPKA 1E4YA 3PSHA 2WKQA 1W0KA 3CVWA 1DIHA 1A98A 1SUWA 4BB5A 1MXHA 2VHVA 1HOTA 2PLAA 1DKOA 4XUEA 1P6QA 4EKGA 1T9GS 2P68A 5C5IA 1JPUA 4QDZA 4MYDA 4FE4A 1JX6A 1G9SA 2I67A 2LVBA 3PF9A 1AH2A 1XJ5A 3E3OA 4PLVA 4D0GA 2EGUA 3V5NA 5JQWA 4YQZA 3BXFA 4TSRA 4D45A 3LK7A 4EECA 3S29A 4ZZ0A 1DKPA 2E48A 1YL7A 2BV3A 3DDNA 4A6XA 3AI3A 4M8SA 1RHQA 2VDRB 1H8ED 3PQFA 4GF5A 4PZPA 2F1HA 1XNQB 4FT2A 5C1BA 2HTEA 1FFWA 4KRXA 3JVIA 4RW0A 1VYUA 3ZJVA 2BJVA 1Z2PX 4AZTA 2I34A 1FTYA 4MUAA 4NU6A 1NPYA 1RADA 2EQBA 1VKJA 2Q3CA 4Y2XA 3CEPB 1QYVA 2Y67A 4H31A 4IIBA 2NO1A 4MVJA 2WTAA 4NJOA 2NSHA 3SJBA 3ITDA 4RHYA 3TSOA 2C83A 2YC2C 3OAAD 5FWXA 2ODTX 2CHVA 3K6SA 4G0YA 2WU3A 5IM4F 3VHQA 1ZGGA 1TYDE 1TT5B 1X1SA 4YAEA 3QQPA 1GT6A 4KFRA 2IWHA 4B6FA 1E1QA 1GPMA 4BMVA 3FSEA 3LWNA 4CRWB 2EJBA 1GT91 1WDKA 3DTVD 4PC7A 3OJWA 3R24A 1AXGA 4OFWA 1Y34E 2DFDA 2MT9A 2CUNA 4BC1A 5HKKA 2P2LA 3LT2A 1I6WA 4KTVE 1BROA 4Z1MD 4HC4A 2E85A 1QV6A 5EJ9A 1G41A 4MPDA 1MV5A 1CUYA 1YJAA 1OYYA 1VL0A 2WBLC 3F9IA 1SXJE 3GFQA 4M4SA 4NBRA 4UM9B 2B8JA 3FLBA 5F78A 5HMLA 4XA8A 1IEXA 5CFZA 2R25B 1AKWA 3LCVB 1UPFA 3D4PA 4QO8A 2R8EA 4EABA 3OPXA 5I9SA 5P21A 4DT1B 4F46A 4BRSA 3WGIA 3UXYA 5HCNA 4KSBA 2NWQA 2PPLA 4JUDX 1ICEA 1NPDA 4AZ0A 4ILKA 5FEMA 2NXWA 3C4JA 3IHTA 3I6MA 5DWDA 2ZB7A 4ALIA 3KKLA 3IV9A 1QK5A 2P3OA 4NXNB 5IUJC 3ONWA 4UXJA 1DUSA 5L7TA 3EZXA 3TW8A 4NAHA 4LDRA 1YFKA 1YQDA 1X8LA 4X6LA 2JIDA 1QLWA 2AVDA 3PTLA 1XRJA 3NTLA 3QWAA 3NRBA 5DGIA 1N7JA 2WJPA 2B7CA 4JA0A 4EHNA 2RHLA 2A0XA 1NC3A 3OJLA 3A3YA 3PUHA 2IBTA 4U9UA 4I3FA 5TQ2B 1PHPA 3GJ6A 2XCUA 3SICE 3WMGA 3Q3HA 3O9MA 5AUOB 1KEZA 2ISCA 2YV4A 3A1EA 3OQHA 1DADA 4HGRA 2A2ZA 2FZ4A 4EFDA 5EHXA 2IHKA 3C6QA 2HJHA 3JZAA 1YQQA 3W1VA 1BHSA 3BSSA 2TMGA 3EQ6A 3MAJA 3BMNB 2LCIA 2P62A 1VHQA 4PE5B 4NDAA 2R7AA 3V4LA 4D0LB 2NYRA 4PNZA 1DT5A 1QB8A 4R2HA 1JEQB 1Q19A 4B6OA 2OP1A 2UAGA 2BMVA 2VTBA 4GZ3A 3DEJA 2CLEB 2UYCA 3HNPA 2QVGA 5ALNA 4D6YA 2ZBDA 3IUYA 2ECPA 3QPBA 2V8BA 3F3MA 4TYQA 1UAGA 5E8JA 1EDZA 1P0IA 2PR2A 1QYRA 2GN4A 1IZYA 2AEEA 2PU5A 2IUUA 2EW2A 1O94D 4ZOLB 5EP2A 4E1AA 2VTEA 3HU3A 3ESBA 1CR6A 5DYTA 5F7JA 1J24A 4A2CA 4DJTA 4DSNA 3H5IA 4KQCA 5L6MB 4UHFA 4AKEA 1WDMA 1ULHA 4AAYA 2BFAA 3N2KA 5JYCA 3OLXA 4CGZA 3JYHA 4PLFA 5M34A 4KZPA 3GRVA 4PO9A 13PKA 1MJGM 3IIJA 5JSZB 4I4CA 4ZANA 3ZWNA 5KTPA 4LZLA 4TWJA 4CMEA 2W8BB 3DOFA 2GEBA 1FLAA 3GZNB 4NI5A 4RTJA 3P94A 2EP8A 4D44A 5B36A 4L3OA 4JC8A 4QVIA 3MWDA 1O94C 2JFVA 2J31A 1KJJA 4J03A 4KQKA 4L07A 3ZXUB 3EDOA 4Z6KA 3DE5X 3WHKA 4BWYA 3OUUA 4H17A 4DNXA 1K6IA 3FAZA 4IFTA 1YKFA 2BJHA 4LMBA 1D0SA 1M2OA 3W5DA 2VYVD 3TZLA 3WHPA 2PT6A 2XGSA 5DTRA 3V7UA 2HJVA 3KZ1E 2LZ0A 5DW3A 5F3WB 3OEED 3K09A 3T12A 1E2BA 2JJYA 3ONVA 2HT1A 2DULA 2NADA 1Z12A 2OV8A 2A7QA 5KC8A 3PD0A 3HKDA 1AQNA 1E9EA 5IKOA 2XV1A 4KMOA 4RLFA 5A05A 1I5OA 1E6WA 3QLUA 1ADYA 1I01A 2J5QA 4P22A 1XL1A 3S1AB 3K53A 5AIAA 5D6OA 1RI1A 2FPPA 1B76A 1SXGA 5F77A 1HK7A 2FSHA 2ZBEA 3NCHA 4JBNA 3HJUA 3MJVA 1E0KA 1SULA 2QWXA 4IFEA 4ARBA 4FDMA 2HR1A 2C2OA 3GJ0A 1I14A 5BOVA 4NTZA 2AC2A 4RTQA 3S8EA 1A9RA 1X9HA 2BEUA 4IHJA 4Q1FA 1SOUA 3H6GA 4W5HA 3R6LA 3ZHXA 4MJLA 3QY0A 1VSQA 3PFFA 4C7OB 1Z73A 4QT4A 4O4LF 1NX6A 4P35A 3JQAB 3RANA 1I7QB 5L4NA 3HBMA 3QVUA 5LBUA 2GHTA 3ZJ5A 3TRHA 4EB8A 2GD1O 3FZYA 4WK4B 4LYHA 4NH4A 2YXNA 2FGKA 2XE7A 1H2EA 3RC7A 1XA0A 4LV8B 4EUEA 3UGTA 2JLVA 5KWIA 1QUEA 3CX7A 2C9OA 4RA6B 3WLRA 2GPJA 4KFCA 4J0KA 1KY2A 3D1LA 1D0VA 2GBCA 3IQWA 4C7MA 1FU4A 1A4UA 4YR7A 2FSFA 5KDOA 1YRQA 4M7PA 2O2HA 2O6HA 1C8KA 3PA6A 4PYNA 4RFSA 3ZK7A 1T3TA 2GXSA 1T36A 3FUUA 3RGWS 3BMCA 4B6JA 2B2CA 2O6LA 4WI1A 2CBZA 3JVEA 5TJ9A 2Z5GA 5LB2A 4HDKB 2OEPA 1PWYE 3K1TA 4MRMB 3TL6A 2O1WA 4IYJA 1QO9A 1H6CA 4Y2VA 5TLSA 4LNUB 3NGMA 4FMBB 3ZGVA 3M49A 4CQLB 1RC0A 5CFPA 3AGPA 3MSXA 4FLFA 1QJCA 1VZ2A 4B3BA 4HRYA 4DB4A 3AFNA 2R5FA 4FZJA 4JQSA 4AJJA 4FXPA 3LY7A 2V65A 5LJIA 5MN6A 3LVFO 4LFBB 1J49A 3X1ZA 1HT2E 3JRNA 3HDQA 3LUHA 2QUHA 2O3RA 1WZ2A 2Y92A 1OI2A 1OYVA 4OV6B 3GJ7A 2R00A 1A95A 1YOVB 1LBTA 2ODNA 5HS4A 3G8DA 3ZDAA 4FD2A 2GPWA 1KI8A 3BL6A 4EZEA 1Z4IA 4Y98A 4C4SA 3ABRB 4RLSA 4F93B 3THXA 2X58A 4S2UA 3ZH9B 2HMAA 1TZMA 2AXQA 4RZSA 5H1YA 1RHUA 5I7SA 1GYQA 1E9BA 1B0ZA 1U4NA 2LNDA 2X0JA 5DISB 1K5PA 2F3TA 4ZO9A 2QUJA 4QNNA 4DEXA 2X6QA 4QDOA 1IG3A 4LJSA 3FFXA 3FOEC 3AB7A 4I5IA 1XXHE 3L43A 2OKCA 2A0YA 5J2UA 2IHNA 1R64A 2IYPA 3KRTA 5EWLB 2QD5A 4ETWA 2AKEA 2BFDA 1N6OA 3PL1A 1J1IA 1HYHA 1VKZA 3B20A 5FI3A 1C30A 1K08A 1Q3TA 1XPRA 1B3RA 4EA9A 4ZEXA 4HRVA 4B47A 1MR3F 1I1QB 3LX6A 4NCAA 3A6PC 4LC9A 5CLFA 1HORA 2D6FA 2I7CA 4E5PA 4L6AA 2TMDA 4LJLA 5LOVB 1XRNA 4HDAA 3P2EA 4LCBA 2PQ6A 1RBQA 4RNCA 4TMZA 3ZIUA 3KAJA 3TEMA 4NU0A 2PVPA 4BX0A 1KSFX 2EATA 4IH1A 2VJDA 4EY3A 1HKHA 4QXOA 1HDGO 3PWSA 5K0NA 4R8RA 3BICA 1J5PA 2EFEB 4QGSA 5BMVF 4QFMA 4WERA 1A77A 3AHCA 3IHLA 3B6JA 3B12A 3K0AA 3N2ZB 4K46A 3RC3A 3TYXA 2HIHA 3Q0EA 2FF5A 5JD6A 1HE5A 4Z4EA 4LZNA 1T3ZA 4UCXA 4C87A 2OV6A 3F8SA 1QKKA 2W90A 3AQIA 3MNFA 4N0PA 1R37A 4G56A 1CW2B 4B40A 1JIVA 2IYAA 3DKRA 3QPUA 3F6EX 1QH0A 1YKSA 3P4YA 2CZGA 5EJGA 1RPZA 5KU1A 4AMUA 3IERA 1P2VA 2JZCA 3WQRA 3OHSX 4BQSA 3OJFA 1NE7A 4FMDF 2C8VA 4X54A 4ETMA 4GPAA 1ZCZA 3T06B 4NBWA 4NLLA 4XZ3A 1WETA 3DDUA 4QO7A 3RI3A 2R85A 1RZVA 5DP1A 3ZUPA 1FP4B 1VLVA 2QLNA 4ZPXA 4EEXA 3ZNNA 2X5KO 2GCOA 1T4DA 1JHRA 4BVHA 1J23A 2AOTA 2H7VA 3EGDA 3A4IA 3LPDA 2C9YA 4GSKA 1O89A 2ST1A 3H42B 4QTZA 4QFDA 3GEMA 5CCDA 5FR1A 3W9UA 3K0CA 5GVSA 1YVRA 3F7OA 4E22A 4ZV9A 4BJ3A 4UMFA 4U0JA 2HCBA 3UJDA 1QQBA 1TF5A 2DMRA 2WIAA 2ZVQX 3HJBA 2L0XA 1BU8A 1PJLA 5EJ8A 2HCRA 3W6ZA 3FRIA 5IN4A 5CIWA 2NPIA 5I8PA 2HPHA 4W5NA 3U4AA 2C61A 3ILXA 1G17A 2HQ1A 1NUPA 5L3SB 3EXFB 2BN4A 3IE2A 5E0KB 1N78A 3R7FA 4PC2A 2IYFA 3VZSA 2WTUA 5KZMB 4ZYWA 3LXXA 3GROA 4CLOA 1QRUA 4AG5A 2HA6A 1HG1A 2XCSB 3D64A 3LCRA 1P1RA 1KOGA 2OR3A 2HA7A 2PT7A 2GYUA 4MTCA 3UTDA 4BMNA 3LG2A 4ETIA 3FOFC 4Y67A 3K0SA 3AVPA 1S4QA 2D5BA 1U1GA 4JCOA 4JOCA 3HKCA 4BS9A 1EIWA 3HCFA 4NKRA 5JSQA 4PRKA 3HV2A 3OT4A 3AEQA 2PZFA 5CDUA 2CLDX 1JZQA 2AKAB 3HBFA 4CFSA 4R84A 5JNWA 1UXIA 2YVAA 4LHWA 4CKWB 2CLCX 2Q28A 2QRKA 3CWCA 4EIWA 1ZIPA 5CDFA 5ES4B 4CM3A 1JQEA 2C9DA 1LPSA 2R3SA 3ZBQA 3WFJA 1OTYA 2CYAA 3KT6A 2QZ4A 2HU5A 3CO0S 4AJ1A 4B48A 3QOXA 3W4KA 4JP8A 3VBEA 1QC5A 1E99A 2AG1A 2R68A 2DWCA 3DV0A 3KVVA 3T4PA 4RDXA 2OBBA 4G0UA 2VZEA 5BMOA 1P18A 2JFYA 3AH8A 5DBFA 3QKRA 4LHZA 1YU6A 3GRRA 2FFJA 1XDZA 2ORWA 3I6IA 1QU3A 5I4CA 2WD7A 2ZXUA 2F1RA 2GZ1A 4CKCB 2D5LA 1D03A 4D82A 2HL6A 1NOIA 1KNQA 3WQQA 3Q8MA 3D8RA 2PD4A 4H18A 4PBRA 4C21A 2NX2A 2R4QA 3C3PA 4MW2A 3KCNA 4I66A 4UMDA 1ZL0A 3RAEC 1C7RA 4RVUA 2FRXA 2G71A 3RFXA 3W5VA 1YR8A 2IZ1A 3IT0A 4DBLC 4EI7A 4FGUA 5EJ5A 2C82A 1WB6A 2SICE 3DFUA 1XDUA 1AV7A 1PE0A 1BE0A 3HM2A 4L08A 4QXAA 3OT1A 5TV2A 3LP6A 3BHNA 3A1CA 3WZ2A 1NG9A 2PMFA 5LN1A 3TKLA 2DM6A 3A70A 4JUBA 1EHIA 2NXNA 3NJRA 3LIPA 1XZDA 4FFLA 4U2CA 3MWFA 4NICA 5LIPA 3RTGA 1RXIA 3V4SA 3HY4A 1WUTA 1E1NA 1THTA 5TS2A 5HVNA 5H83A 1WUYA 1W4CA 2JFWA 5DSXA 3KAQA 4XGNA 5ECYA 3RS3A 2XUQA 1D7OA 2D1TA 2XNDD 3LM8A 5HILA 1QO0A 1X13A 1Y8RA 2NO5A 4C7OA 2WV9A 2UDPA 1QE5A 2VJQA 3MWEB 5KSPA 4IDEA 3NOVA 3I28A 4LGCA 3WGJA 4E3ZA 2UXDB 1UZMA 3HR4A 3QENA 4XWWA 1GKYA 1NMXA 3KSDO 4RA9B 2O05A 1Y9DA 2HREA 4GNRA 3IPAA 3PFIA 3UJPA 1C81A 3ZWPA 2C29D 1FBTA 4EYKA 3BK2A 2NG1A 2G9ZA 2J3QA 2VLIA 3WJ7A 4OMFG 5H0IA 1M6EX 1S3IA 3WG9A 3NMUF 1A88A 3SC4A 1PJBA 3IURA 4EL0A 3FYUC 3LH5A 4TMXA 3GN1A 5F12A 1MQAA 1IHYA 5EYPA 1BOFA 3DGEC 3WISA 1NF2A 2ZXFA 3NR2A 1Q12A 3ORSA 4L6CA 1HM5A 2P8JA 4AUNA 2QMUA 4YJ3F 5A6VA 4PLPA 2R1ZA 4TYNA 2BFMA 4UE2A 1Z0DA 1I8TA 1VHDA 2VT2A 3G23A 3R3JA 1OX6A 2OM2A 2PV0A 4FCVA 1I13A 1UBUS 1UPBA 3V7WA 2H3HA 4LJ5A 1KH2A 2JFQA 4LJAA 4U7JA 4C78A 3KSUA 1HTBA 1ZGZA 2RHJA 3W5CA 3N7TA 5JARA 3ZBUA 4JB0A 2XRMA 3AP3A 3FGZA 5SYNA 2G9NA 2WJGA 4PIPA 2C57A 2BY4A 4DCMA 2QRJA 2P4SA 3DTNA 5GADl 4CEIB 1TE2A 4IDAA 1NJ5A 2QTWB 1FC0A 3EG9A 3ZGLA 5A7GA 4AZVA 2BJWA 1J70A 4BIIA 2V9ZA 1WXEA 2XD9A 3FMPB 3B7PA 4V0RA 1TJNA 2AE2A 3ICOA 4OXYA 5BV8A 2YFHA 3TCXB 3TZKA 2VH2A 1GGFA 1E79A 1XVLA 5H70A 2D0PB 3PNPA 3OLVA 1Z0JA 1ISSA 4KPGA 4KFTA 3Q10A 5DLPA 1UDXA 3S68A 1IXRC 221PA 5LZ2A 2YJ3A 1H2FA 1E6EA 2V4ZA 2ZT5A 3BXPA 1VFPA 3Q3JB 3AEKB 1AKYA 4J7UA 4ZRDA 3RYIA 4CR8A 4P36A 2BKAA 3Q7PA 3D3EA 2P9YA 1LDGA 3UFBA 3N2IA 3I37X 4CLXA 2CT8A 3WIEA 3PUWA 3T4UA 4A6PA 3QX8A 1BXGB 1DIGA 5F7OA 1HDXA 3BM5A 5HKBA 1KVTA 5E7MA 4RY2A 1YJXA 1N8KA 2IHJA 2CC2A 4D9IA 2GI4A 3I76A 4YONB 2K5UA 2Y1XA 2V7WA 3DPIA 2YFQA 3FOZA 3U4MA 5I7OA 1Y8QB 4JI5B 1U6KA 4AULA 4AL4A 4GDFA 1F2DA 4ZVRA 1C0KA 3GEHA 1J21A 4K86A 3JARA 4J0IA 1L4YA 1G6HA 4FHEA 1YHNA 3ZCUA 4OUDA 2XB9A 2CV2A 4ZV4A 1BXRB 1J97A 2YRFA 3BXGA 1UBSB 3DZGA 3JATB 3X1MA 1EVZA 1PLLA 3ANLA 4M7OA 1EUDB 1PT6A 1GPBA 2BI7A 3S2FA 2J87A 1LJLA 3QKIA 4TWRA 4R1SA 4JLKA 1W9HA 3DMHA 3QI7A 4B3JA 5TGZA 1X7YA 4DDVA 4YYEA 1XRQA 3NHKA 4YRFA 1SU4A 3QK7A 5ECGC 5KNBH 5EIFA 5I4IA 3RJZA 5CNIA 3CMCO 4RGBA 1MOSA 1VKRA 5CH3A 4M8LA 1CC1S 2WKWA 1OWNA 3O21A 4MQ4A 3L49A 3GBPA 1XQXA 5AKYA 4D9EA 4HTFB 2CDNA 5L7YA 4I1RA 5KVAA 3BX1A 2G04A 2H85A 3SQOA 2V97A 4GNKA 4OB8A 3QJ5A 1DXHA 4IRXA 1EFLA 2BBTA 5KQPA 1EIZA 3OTOB 5KOIA 4A23A 2VSOA 3Q7EA 1XF1A 4Q4JB 2EHDA 3T1TA 1GEEA 1JFLA 3G9ZA 1YS9A 2AJ8A 4XGKA 3OICA 1J06A 4N47A 2XYHA 2R2GA 2H1IA 4WZZA 1KWKA 4H60A 3TFQA 5FUBA 3ACCA 4KQ2A 2ACEA 2I1VB 2GM9A 3I6ZA 4ZO8A 3TR0A 4Z2AA 1RT9A 4YRDA 3RPEA 2W37A 3Q5EA 4ALKA 3KOOA 1U2GC 4R4JA 3KTOA 1NBMA 2WHXA 3L41A 1GA1A 1Y1QA 2XE4A 2A9JA 4N8DA 5IVKA 3EQ7A 3IGFA 3O03A 4S0XA 5KIAA 4GDMA 4AIRA 4K6FA 3CZ9A 2WF9A 4WJKB 3D7RA 2XEDA 1PD0A 1KDRA 1RM0A 2BRUA 3H11B 3VR4D 4A10A 5HYVA 2F62A 4P3XA 3K5PA 1NOJA 1QOZA 4OFXA 4BFLA 3OEYA 3RWMB 1CDDA 2Z2KA 2Y0EA 1N6RA 1HLGA 2OXFA 4H7DA 4E2FA 3UJBA 3EDYA 1FZQA 2GDJA 2VT6A 5CYGA 4MYSA 1DL5A 4MQBA 1JDUA 4U2GA 4MRPA 1FLVA 1J0XO 1H2RS 2WUWE 3PC8C 3J7AC 1TF7A 3F1LA 3O4FA 1NWCA 4GM1A 4KXQA 3FOCA 1BHO1 4OK6A 1ST2A 1DAEA 2PZJA 4UU0A 4ANFA 4JIMA 1B26A 4BJ1A 1XAHA 4NU8X 1ANKA 4NF2A 4A0GA 3AX6A 4HB4A 5DBOA 4MEBA 2I55A 5C3MA 2P9FA 2OV4A 1A5AB 2OD2A 2VC2B 1DB3A 5JALA 4QYTA 2HV8A 3BHMA 4FBGA 4RVFA 4WESA 4O2BF 4Y2RA 4JMPA 5C34B 4TLEA 5C4MA 2FWBA 4RSMA 4PSUA 4Y6QA 3AKDA 1FNNA 2YWXA 3MOSA 1SBNE 3QU9A 3ZV6A 3ZCSA 5LD2C 1XU9A 2A67A 3JD0A 3EJWA 4ZQGA 1VJDA 3SS8A 1U31A 2ZM6B 3ZDZB 1RXYA 2J85A 3DZ8A 5CDHA 5LSAA 1QFMA 2YCLA 4N0EA 3WL8A 1GV1A 1MIOA 1PQ4A 4QGHA 4YHBA 3OFSA 3OCZA 4BFWA 5GIOE 1MJNA 1U8TA 1M1YA 2FUNB 2RGNC 2YV3A 2JGNA 1KAHA 2C99A 4D9CA 1Y3CE 2P2YA 3GVHA 3H65A 3NAZA 4P3PA 3KKKA 4WFIA 5B1IA 3MN1A 5K0FA 2NO6A 3ECCA 3PDHA 3DAPA 4KXYA 2EX4A 3JW8A 1GTL1 1CB7A 4U00A 4LOKA 1DC4A 5CU7A 4ENPA 4UAJA 2A5DA 3WIDA 2DCMA 1VBNA 1CERA 2CNDA 1O0SA 5BV7A 3AJ8A 3QUBA 4BMSA 5LKRA 5EAIA 3LDFA 1RYBA 3EFOB 4DDTA 1CJBA 1KJQA 3RIEA 2XNJA 4BVKA 1A9OA 1L5MA 2DF8A 3DHYA 1QHYA 1YZKA 2JHAA 3I9V1 4JWTA 4LRWA 2F8LA 4NNOA 4AF6A 2J4DA 1JDSA 4BQQA 4DL9A 2ECFA 4F6LA 4FWIB 2Y1WA 3AERA 2Q0SA 2C5AA 3OT5A 3UHFA 3OM0A 4QG3A 3CX6A 5I7RA 3CR7A 3ZLTA 3QP9A 5KNCH 1E8NA 3VAAA 1GL7A 1P4HA 1NYRA 2VKTA 2ZIVB 3EFHA 4MWEA 3C6KA 3P71T 4TV9F 5CX1B 2BBSA 5BYJA 3U3JA 1MXFA 2OFOA 3WO0A 5BR8B 5M5BA 2HYDA 3BK7A 4RHCA 4Y0VA 3LP8A 1EJ2A 2OFPA 2Z2ZA 1JDJA 1X42A 4B7AA 2OB1A 2XMCA 5BSVA 3KOUA 4RBNA 4EJSC 5CDYA 1JIXA 3U44A 2YZ2A 4DNOA 5A5FA 1N8SA 3BFXA 1T0PA 4EVSA 4BKRA 2OO7A 1XYYA 1K7FB 1ZCJA 1E8DA 1SC4A 3CLRD 1AS0A 1AQIA 1E9VA 1D9XA 2JEOA 3CNHA 3MJTA 2R96A 3OKAA 5FWDA 3DO8A 1J42A 3U9SA 1B23P 1EJ0A 3AVQA 3IPYA 5HJ7A 5LWQA 1Z5ZA 4A8JA 3R3WA 2E4XA 4HGPA 1GCGA 5HIKA 4JI2B 2X9NA 3MMZA 4GI2A 2E5FA 1SBHA 2F4NA 1QF9A 3DOOA 3EZ6A 3A58B 1E7SA 5GWXA 4JOSA 2GX6A 1IWOA 3S70A 1FK8A 3UKDA 4HDRA 3BXEA 5GP1A 3M4ZA 3GJSA 2XIJA 3ZHUA 4ZVVA 2QRNA 3B1VA 4TPKA 3CLRC 1C5KA 3AUAA 2QF7A 3L7MA 3KPUA 1SK8A 4L5JA 1YFZA 1B6SA 2FOIA 1ZICA 5AI4A 3CF4G 4AJEA 4ZIRB 1CUEA 1V1RB 3A3NA 4BLUA 2QRHA 3HN7A 2BM8A 4BNWA 2FP4A 3IELA 3MS2A 4RTOA 3U0BA 3E48A 4TV8A 4URUR 4H35A 1HYQA 2XSZA 3F67A 1U2SA 3KB8A 3L6UA 3RRXA 3ZIAD 5EIEA 1PJAA 4AD8A 3PF8A 5T5QA 4HG2A 3QI2A 4TS3A 2V54A 3FPJA 5J4VA 3EXG1 4LGYA 4V03A 1E1CB 1TF2A 2ZSHA 5J63A 1NJ8A 4Q03A 1I33A 3VMFA 1RJWA 3SMVA 1N9ZA 3RRMA 1FVFA 1YIDA 2BOVA 3GJXC 3JQRA 3ET4A 2QD1A 1DAIA 3EGVA 1NONA</