3ZKAA

Crystal structure of pneumococcal surface antigen psaa d280n in the metal-bound, open state
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
278
structure length
278
Chain Sequence
KLKVVATNSIIADITKNIAGDKIDLHSIVPIGQDPHEYEPLPEDVKKTSEADLIFYNGINLETGGNAWFTKLVENAKKTENKDYFAVSDGVDVIYLEGQNEKGKEDPHAWLNLENGIIFAKNIAKQLSAKDPNNKEFYEKNLKEYTDKLDKLDKESKDKFNKIPAEKKLIVTSEGAFKYFSKAYGVPSAYIWEINTEEEGTPEQIKTLVEKLRQTKVPSLFVESSVDDRPMKTVSQDTNIPIYAQIFTNSIAEQGKEGDSYYSMMKYNLDKIAEGLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE ABC TRANSPORTER SUBSTRATE-BINDING LIPOPROTEIN
publication title Imperfect coordination chemistry facilitates metal ion release in the Psa permease.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Metal transport
total genus 101
structure length 278
sequence length 278
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3zkaA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3zkaA01
3AESA 4UDNA 1KAHA 2R7AA 1MIOA 3AEUA 3MFQA 2AFIB 5JG7A 5CR9A 1K75A 3TNYA 1K0FA 2WI8A 3PDIB 2WHYA 3AETB 5M29A 1QH1B 2R79A 4TKUA 3HH8A 1N4AA 2OGWA 4M7OA 2XQVA 2M6KA 4MO9A 1M1YA 4H0FA 5HX7A 2M6LA 2PS0A 2Q8PA 4WESB 2RG7A 5AFSA 2YNMD 2AFIA 3AEKB 3MINB 2OV1A 3ZK7A 3AETA 2MINB 3PSAA 1PQ4A 3MD9A 4B8YA 3HJTA 1N2CB 2YNMC 1M34B 4WN9B 1EFDN 4G09A 2O1EA 4UTPA 4WNAB 5KOJA 3MWGA 4PAGA 5JJ5A 1QGUB 5M34A 2PHZA 4WESA 2OV3A 4HMQA 2OSVA 3TEFA 3AEKA 1TOAA 3LHSA 4WZAB 1N2ZA 3ZK9A 1K2VN 1XVLA 2MINA 3UJPA 5M3BA 1FP4B 1N4DA 1KARA 4NNOA 3EIXA 1M34A 3GI1A 3K1AB 3R5SA 1G20B 3AEQB 4WNAA 2XH8A 5JPDA 3AERB 4LS3A 4OVKA 3LI2A 2XV1A 2XUZA 2XY4A 4MLZA 3PDIA 1QGUA 1QH1A 5FLYA 4CL2A 2AFHB 4BBPA 2PRSA 1G21B 4N01A 5CX1B 3G9QA 1L5HB 3U7QB 4XPIB 1ESZA 1FP4A 5KOHB 3BE5A 4DBLE 2QI9F 1QH8B 3K1AA 4FI3F 4WZBB 5I4KA 1G20A 3AEQA 4ND8B 1PSZA 4FILA 3AERA 2XDQB 3AEUB 4PM4A 3MINA 5KHLB 2PS3A 5BVGB 4HMPA 2AFHA 3HXPA 3MWFA 1N2CA 5GGXA 4OXQA 4OXRA 1G21A 4WN9A 5CX1A 1M1NB 2PS9A 1L5HA 4XPIA 4GICA 1QH8A 2Q8QA 1KAEA 4K3VA 4LJSA 2XDQA 4FNAA 4UTOA 4WZAA 3ZTTA 5BVHB 4UDOA 1H1LB 3BE6A 3CX3A 4TKVB 5BVGA 4G07A 4HN9A 4NNPA 4TKUB 1M1NA 3ZK8A 5M2QA 3AESB 5KOJB 1MIOB 4H59A 5GGYA 5HDQA 3R5TA 4HMOA 4INOA 3TLKA 3ZKAA 4INPA 3PSHA 5BVHA 4IRMA 3NU1A 1H1LA 4MX8A 4MDYA 1M1YB 4FKMA 4TKVA 3U7QA 2X4LA 5B58T 5KOHA 5JOQA 3EIWA 4WZBA 1K7SN 2ETVA 4ND8A
chains in the Genus database with same CATH superfamily
4BP9A 1J0CA 3CSUA 5FV4A 1WCYA 1E7RA 3RRYA 2G4VA 3B3AA 2ZYGA 5DASA 1Q7RA 2FJUA 1NPTO 3FKSA 4OX9B 4Q1EA 5F3DA 2W6QA 1POXA 2ZPUA 2OBYA 3I72A 4N6OA 3ZCXA 3EA0A 3ZY4A 2Q6IA 4EYSA 2P9EA 1AE1A 3HB5X 5JJIA 2R6FA 3TW8A 3DB1A 2PKRA 1XTQA 4CMCA 5DBEX 4B3SB 1OHHA 1MCZA 4G67A 3A4VA 3PNPA 4FJ2A 4RTMA 2FW6A 5AW7A 3U9TA 3SZOA 5EP1A 4N5IX 5EE3A 1BYUA 4GYJA 3MTEA 1FMJA 3M2PA 1E8DA 4NRDA 4DQUA 4OFZA 5EHIA 2XTNA 2SKEA 1KDZA 3EZNA 3HLKA 3IOMA 4Y2VA 4RHYA 3V4FA 5FNVB 1VYHA 1AN9A 4UBJA 1F0NA 2VUUA 2GPAA 4FCWA 4XKJA 1LQTA 1FFWA 1YBFA 1QWOA 3OT1B 2FI1A 2ACWA 2AJCA 3V97A 5BSKA 5H8WA 1MC1A 1CY2A 3DTVD 1AB6A 5BWNA 1UXKA 4O4JB 4ZVMA 5SY9A 3ILSA 1JG6A 4J6EA 4MP3A 1VZ2A 2PXCA 2QLBA 4O25A 2AFHE 4Q4DA 4FCCA 1V16B 2R6HA 4MGEA 3CLRC 4J03A 3ET5A 3P1JA 4V02A 4YY3B 3OQHA 2PCJA 4RK4A 3ABZA 5HVNA 1F8GA 2CMGA 2AJ8A 3DTVA 1S6YA 4I2VA 4PYNA 2RCYA 4IZOA 2GBIA 3PEYA 3I2IA 2CSUA 4QYSA 1IBKB 1P9RA 3I8XA 4Q3DA 3A9SA 3WVNA 1QSGA 2GJ8A 4I81A 3O4IA 4LHYA 5B6JA 1GRVA 1TU4A 2J9GA 2YWJA 3MCTA 4EHKA 4WE3A 1UC9A 1E2QA 1S3IA 1P2UA 4D9FA 2W2OA 3GG2A 4YK7A 1W49A 3OECA 4M1KA 5CNJA 4UQOA 1RZRA 1KEZA 1DX4A 4AROA 4XASA 3ZCUA 4NP6A 2OL4A 5T64A 2B1IA 2ASVA 5LN1A 3RD5A 4CM1A 3SDZA 4X85A 2NYVA 2H2AA 4ZALA 3IBYA 2PX3A 1A88A 2ZB3A 2WM2A 3HJAA 1I7SB 5YASA 4WNIA 2QVGA 3GVXA 5FBKA 2BISA 2X5KO 1F51E 1WMDA 2YWBA 3C6KA 1Z5UA 2B7CA 2OTCA 1ECPA 3A4NA 4TZKA 5K8TA 2HPVA 2Y1GA 4RYDA 4B17A 4P35A 4XYGA 5I47A 3EF1A 1IOVA 4KLNA 3QPCA 1N2BA 4L85A 2ZS9A 3RF6A 5GM2A 1E0JA 4L8YA 1PLKA 3K9LA 1UKCA 1XEWY 4CIVA 3AYZB 3EXAA 4TKUB 2VF5X 1SRRA 3LXUX 4EEXA 1G8GA 2F59A 3TDMA 4WBNA 2BE7A 2JKZA 1XZNA 1XVIA 4G9EA 1NYRA 2WJ3A 3R3JA 1KFBB 3DKIA 1BU5A 4LNAA 5BV1A 3KETA 1SXHA 1JG7A 4KE7A 5JZVA 1F2VA 1QIIA 1ZIDA 1C7IA 1JT9A 1KGDA 1QGZA 3DOUA 3I92A 4F3RA 4KRYA 1YS2X 5I8ZA 5BMVF 5HK9A 3AKZA 1S9DA 4X94A 1EFHA 4FGUA 4LW8A 3C14C 1XJ0A 2AN5A 4FN4A 4GX1A 1BE1A 3RC2A 3OPXA 2YYAA 5DRTA 1MQ8B 1Z2CA 1V3UA 2A5YB 2HBZA 3GFPA 3RV3A 3VPBA 2J59A 2IGTA 2PZLA 2QPOA 3FYUA 2WWFA 4QRDA 4KMRA 4G2TA 4IDCA 4G4SP 2GWRA 3OPYI 1OWOA 3FLBA 4IIEA 5KSWB 1OI2A 2AOUA 3TVDA 1XZJA 1VP3A 2FH5B 4FKZA 4RDCA 4YRMA 5FPKA 1D4FA 4X41A 5KX5A 3VJRA 4D25A 1J2TA 1XAHA 2P8SA 5CBPA 2H2DA 5FWNA 2A1TS 2QTMA 1KDTA 3KJIA 4QPDA 3SIXA 4MS1A 1JVNA 3GH3A 3PD7A 1N6LA 1RI5A 3E3NA 3QITA 5H7XA 5AKYA 1SIUA 2YMPA 4OTZA 3ZXXA 4P81A 4CT0A 5FTMA 1OXBB 3LVRE 3BIXA 2W0SA 1UC8A 2JHPA 2G9QA 2JFPA 3HDQA 3PUHA 5C81A 1TEVA 3TSWA 5AUQA 5JDCC 3FA2A 3HEBA 1VSQA 3A3NA 1NW8A 1CRQA 1Z35A 2BMJA 2RH5A 3H6GA 1H93A 4FDLA 3GLGE 1XF1A 2H2WA 2P79A 4GWGA 2R62A 4NLLA 5CVVA 4YMLA 4WZAB 2MT9A 2O8CB 1DIBA 1MF7A 4E2ZA 1L1QA 3PQ2A 5K3CA 1V25A 5FTLA 1FU7A 4GL2A 1TUIA 2ILTA 1N3BA 1CB7A 1QDEA 2RAFA 1K9SA 4MROA 4BX8A 2PVPA 1WW2A 4WCDA 2G5GX 3CSDA 3LOUA 2L18A 1OAKA 1QVAA 2W8BB 2IZ6A 2O07A 4OMUA 2HAEA 4OQZA 4PPGA 1HDZA 3T9BA 1GLNA 5CEFA 5CVCA 3PUJA 3IGFA 5U9CA 3UKJA 2O0JA 4MW2A 4UNIA 3U7QB 1APBA 5JISA 3BGDA 4K40A 1FJGB 4ZOCA 4RIFA 4QFBA 4QUIA 4E2FA 2XWSA 2AK3A 4BQEA 2PXAA 5EFZA 1WMBA 3VYVA 1DIRA 1TKRA 3HJCA 3DF7A 1NVGA 4S1WA 4CG0A 5C5DA 5J43A 1IZ0A 4D0RA 3CNBA 3DTTA 2ZM5A 1R37A 1V48A 2NTVA 4PU0A 2WTEA 2R8YA 3TIXB 3KPVA 4LE2A 1NYLA 4TT3A 4K88A 4TRNA 1PW5A 2C0QA 1OFGA 4ZRMA 1W0JD 3EUEA 4PG5A 4WSOA 4GXNA 1I6KA 4XYEA 4BUZA 1DFHA 2FK8A 3F46A 4ZO6A 4RJTA 2O3TA 4LQDA 4OJNA 4R8KA 3IAM1 5BRAA 5JQGA 4DR5B 3OLXA 4CF7A 3MWEB 2E37A 4E03A 2AA3A 3HSSA 4QEZA 4BQRA 5E7MA 1RBZA 1HE3A 1MO5A 3C3WA 3L4BA 4MUKA 4MRNA 2BEUB 1NIJA 2Q3JA 3I04A 3MJEA 2WB2A 4XVHA 2V74B 5CTAA 5JAHA 4BQSA 4XWWA 1PCXA 2E5LB 2P40A 3KSBC 2RHRA 1A96A 2YFQA 4GE0A 1SUFA 2GK4A 3WDLA 1X13A 1DBPA 2X1LA 4EW6A 1MW8X 2NAPA 3TQOA 1JMVA 4NC9A 1V9SA 1PZMA 1VSTA 4R81A 1YDHA 3BHJA 4MX8A 2CVFA 1OBCA 3F9RA 3I9V6 2OB2A 4NJEB 5I6DA 2CWWA 1XKTA 2C95A 1PSWA 5B7GA 4GLLA 1G18A 3W2GA 3LL4A 4PZ0A 4I6GA 3EFOA 1FPQA 2N9UA 4LF8B 3KT6A 1P7VA 3MT0A 1LPPA 2ERXA 3LUFA 1QFSA 4J16A 1E9CA 4JIGA 2FKNA 2ZZMA 3HVHA 3F7NA 3BEDA 5D3MA 3DWEX 2QWXA 4YYEA 1QIKA 1H4SA 1E2NA 3H2SA 1WDLA 3OZFA 3QVKA 4OGLA 3FNGA 2PZ8A 2VYVA 1U4OA 3QSGA 1VL2A 5D8DA 5LLTA 1X9IA 4HDKA 4P80A 4IO0A 4OY3A 3TM4A 1XAJA 4NI5A 1YWGO 4A0QA 2PS0A 1CQIB 2PL1A 1NQXA 3CVOA 2I99A 1UKZA 3HZRA 5HRCA 1UQTA 4IHJA 5DU2A 3EMKA 3FPKA 3BMNA 5GONA 3AHFA 3RU7A 1BMDA 3NGMA 5IH7A 2PZFA 4OHCA 2AOVA 5CIWA 3SQXA 2O59A 4WX2B 1NXVA 4N49A 2QXUA 4J2OA 2VPIA 1IJEA 1ZQ9A 3K2QA 4M8IA 3LCUA 2DCUA 2G82A 4YRPA 1G20E 3JQ9C 3HM2A 2Y1DA 4HAWA 1XROA 1WLYA 4YBRA 5HILA 1U9CA 2C04A 2PR7A 2J0UA 2ZJ0A 3CR7A 2G1PA 1DC5A 1XGKA 4WLFA 5LC1A 5IVIA 3KBOA 2WC1A 3OA2A 2R68A 4O0LA 3UJ6A 4MWSA 1WMSA 3SDSA 1ENYA 4B71A 4E4TA 3R3WA 5EIEA 3J7AC 4D4HA 2J0VA 3KR2A 4ZEXA 3VTKA 1DUVG 1M34A 4PLTA 1NASA 2D2EA 3F98A 4KQ2A 4WQMA 1CR1A 4DV7B 1KMCA 3NBMA 4MV0A 4YAKA 1OLUB 2O3JA 3O4RA 1X7ZA 1UZMA 2Q1YA 3GCXA 4K2HA 4XJXA 5IKXA 2QHXA 1UBEA 3N7AA 5EWLA 2QP9X 4V1CA 5KSOA 5BO5A 1D1TA 3NTUA 1VMEA 7REQB 4MDHA 3TVYA 4EG5A 5ICCA 2VH5R 3ILXA 3P2KA 7AT1A 3A06A 3RASA 4RH0A 1XALA 2RARA 2QI9F 1LPOA 3HXOA 3TYXA 4NBSA 1HNWB 1I9CA 3FSEA 1RZUA 1AOXA 4DSUA 4LZWA 1H2HA 1RYBA 4F2DA 3O9ZA 1VBFA 1KFKB 4PYKA 1B6TA 1U9ZA 3FN4A 2H6EA 1FMFA 2YZGA 5JSHA 3I04M 1C8KA 1BXRB 1JWAB 1VFNA 1YQWA 1ZOPA 2R8ZA 4ZVPA 1NW6A 3N28A 4Z3OA 3LLMA 3OE1A 1O9HA 3X2EA 2R60A 4EIWA 2RHGB 4EA8A 2DCMA 2PGXA 4BU0A 1F4LA 3O8RA 1G7SA 1CHDA 1M3SA 1P8AA 3W3AD 4L51A 2JIZA 2ZXEA 4CQLB 1W96A 2NZXA 1LWNA 3RROA 4D3XA 3OIVA 4N76A 1E0AA 3PNOA 4TXLA 1L6IA 4J0QA 3H2BA 2BZSA 1OREA 3K8QA 4H7JA 3QE9Y 4A15A 1D0IA 4BLSA 4CPDA 4F46A 5ENZA 3RUHA 4GM4A 5DBFA 3THSA 3TMKA 4UOQA 3PEEA 3R0JA 4PO8A 3ZOKA 3TQRA 3H99A 3YASA 3L7YA 2QX9A 4PAWA 1JQBA 2DPMA 1RAGA 4YX9A 4FKMA 4OQNA 2YYYA 2XBMA 2BBWA 3UJ9A 5K03A 2GPNA 1K8YB 2Q5EA 2QI9C 2VWPA 3L04A 4HFRA 2E82A 3KXKA 1XZGA 1RM5A 2I66A 2Q2QA 3WLJA 3ZU5A 2GFHA 4B4OA 3HL0A 4UZSA 2ZKIA 1QR6A 1RMQA 3F6SA 4DBLC 3E5NA 5SYAA 3PS9A 3KQWA 1RZ3A 1Z4JA 3V5NA 4FBGA 4KVZA 4GR4A 1CFJA 3FPSA 4RF2A 4E11A 2JFWA 3RVPA 3CSSA 4MV8A 2Z5GA 4ICIA 3KNZA 1XNHA 2ZJ5A 3THWB 1US8A 2BKAA 4MYTA 2O8BB 2PS1A 2OV6A 4OK5A 2HHJA 4U5QA 3DBIA 2N42A 5AXDA 3F2VA 1FLVA 3IMCA 4KCGA 1NOKA 3TN7A 2VPXA 4EG7A 1BDMA 2OBMA 2W4MA 5AFSA 1AS0A 4MI3A 3C6YA 4OUDB 5EJ5A 1U8TA 3GU3A 2AR9A 3DG9A 2QT0A 1N75A 4KWIA 3IDQA 4HGPA 4HYEA 4PIMA 3UK0A 1QRRA 3GRUA 1CP2A 5DWVA 3BORA 1K68A 1USGA 5FOXA 1EFRA 3WQSB 1UKAA 1KI8A 5HTKA 2I29A 1IN8A 3DAPA 5EXSA 3UMVA 3JVDA 1C9NA 2Q99A 3C7KA 4WNAB 4YEDA 5ENVA 4YPOA 3HO1A 3G8CA 4AMVA 1NAIA 2ZE5A 1G42A 3IV9A 4RQTA 5A2QA 1KWGA 3TPFA 4N0PA 3BSYA 4GI1A 1P2SA 3V1LA 3D3WB 1M2FA 5CD1A 1KRWA 2Y6UA 3CONA 4HNSA 5M3BA 4QUJA 1G21E 4XUEA 3UUGA 3WYAA 3QVTA 4NNOA 5FNVA 3OESA 3L06A 3K70D 2X8AA 4YT5A 4MUNA 3WKDA 3IUYA 3OT1A 4JJ4A 4RHXA 3TX2A 4D9GA 3MWDB 1BKYA 1BO6A 2ASEA 2OCYC 2XECA 3PJRA 4O4JA 5ARCA 2QVZX 4HQ6A 5TSDA 1MLDA 1X94A 2LCFA 4C6HA 3PC8A 2ZJZA 1V16A 2K5UA 3ONVA 5JCXA 1IMJA 1E3DA 2JK0A 4LECA 4ZC8A 1E1DA 2QDKA 1CZRA 2TMGA 3PHCA 1Z5WA 2P5SA 4GQBA 2NU9B 4QDKA 3P20A 4V3BA 3JAKB 5EUBA 4JBYA 1Z39A 1NV8A 5CT8A 2VSFA 2CD7A 3BPSA 2A1TR 4ZAYA 4BVGA 3KZXA 2ZPTX 4F5DA 3H0CA 2YIVX 4DFDA 4ZYXA 1Y4UA 2E89A 2CFOA 4PLYA 3C5HA 1OD6A 3GBSA 4ROSA 4GHWA 2YHIA 3BWYA 5HK8A 2EWMA 2ZTSA 3HKBA 3QI2A 4LGCA 4TTIA 1A97A 2FJPA 1UL1X 1Z5NA 3O75A 4JJGA 4KV7A 4LHWA 2EBWA 4ANFA 8ATCA 1QGOA 4YMGA 4KR2A 4JXZA 1OTXA 2ZYTX 3SM9A 4LJSA 2QV7A 1QOPB 4FDVA 3WXMA 5C35A 3WNBA 3FWYA 4D4JA 4O8ZA 2IOFK 2GPYA 2ZCJA 2DTEA 5EZYF 4NAUA 2AX3A 3PT9A 4G07A 2IU3A 2WHXA 4TXNA 4AJLA 3E58A 4CM5A 2AMJA 1OVGA 4MOWA 4DR2B 4LY3A 1VHTA 3IHWA 4W5TA 1YSCA 1Q95A 1JAIA 2JLBA 3EGCA 1QPGA 3IJ5A 1DEOA 1XXHB 3GLRA 1VCOA 1YULA 4GGPA 4L0MA 3O9MA 3CRVA 2IOFA 4YJ2F 5KNLA 5T3YA 1HPLA 1EUDA 1NXQA 1M2NA 1SKAA 2IP2A 1TDJA 2HO5A 1P6UA 2CVZA 2V9PA 2WZDA 2VUTA 2XQKA 4TSRA 4OV6B 4TKUA 2VQFB 1VGVA 2IH2A 5FQOA 3ANXA 1UT6A 1S2DA 4I46A 4P7GA 2VTKA 1PDWA 1T9ZA 2W2LD 3ND7A 4CQMD 4DWVA 4DRXA 1BX3A 1G17A 1NWCA 3RG2A 2V7XA 2DX7A 4QT4A 3G0HA 2VDWA 1DADA 2J85A 1KSHA 3VHLB 1QH1B 5LIPA 1A5ZA 1GUBA 1BRMA 3O8DA 4G5XA 2Q5OA 5AI9A 1XHEA 1K98A 4NCIA 2Q1XA 4Q12A 1O6CA 5B12A 4KQWA 3SQMA 5DHAA 3TSZA 4AF7A 1DINA 5A06A 4JHXA 2Y68A 5FOQA 4UM8B 1U7OA 3V1MA 4O4IF 2VDJA 4PZDA 5FL3A 3STXA 1YS6A 4ZQEA 3F97A 3GMIA 5JRJA 4KN9S 1T34A 2J3LA 4G0OA 3SFVA 1BMQA 8ADHA 4Q37A 1ESEA 4DLZA 2YFKA 4PICA 1VJ0A 1J07A 3AFOA 1XDUA 1BMFA 1JZSA 1O6FA 3DDUA 4GH5A 3VSBA 2JGFA 3A25A 3EBLA 4BEBA 1LS1A 3HXMA 3N74A 3L9WA 1PUIA 4OYLA 5DM1A 1HE5A 4GW3A 1Z18A 1W4AA 3V4VB 2NSHA 2P2CA 3RRZA 4X8OA 4LZNA 3TTVA 5C1BA 3HN2A 2GLXA 3NBYC 3ZLTA 1KKMA 4LF4B 2ZBPA 1F2UB 3CZCA 2GCOB 1H4QA 1BHQ1 1GSAA 4D82A 4CRWB 2GVZC 3LK7A 2JD1A 1PT9A 2ZU6A 4XX1A 2HJGA 3PI6A 5AJYA 1Y82A 4RCVA 3AEQB 3BZUA 3FIUA 2IYAA 1KVRA 2R9VA 3G5UA 3VU3A 1ODFA 3GUCA 3MSCA 2XT0A 3OF3A 4JXJA 1TO2E 1Q22A 2IPLA 3JYHA 1Z26A 2JBHA 2XE6A 3B7GA 5DP1A 4COKA 5IU6A 2O8CA 2WMYA 4INZA 1X8JA 5B1SA 3O7MA 5K0LA 4O5AA 2VYCA 3LC7O 5LMNB 1EB9A 4KO2S 4QE3A 1K6MA 3AR9A 4JX8A 2WV9A 2GEJA 2G83A 1QH8B 4FP9A 5CLIA 1T1RA 1H6BA 1XZCA 2QTAA 2ZSDA 4OMDA 4R41A 4RZUA 5IAGA 4TKLA 4BDTA 3WRWA 5DI9A 1HZZC 3F5FA 4L1KA 2W8BA 4MCIA 3B5EA 2YOHA 3EXIB 2WAAA 4ODIA 1T9KA 3PXGA 1NSTA 3EN0A 4EGJA 4U9UA 3VZSA 4L27A 4GUAA 1P9NA 2FEWB 3ORRA 1SC1A 4DCCA 1PFGA 2ZYUX 3DJFA 1V9LA 4ZVTA 3ESCA 3U7RA 1U0GA 3D1VA 3UJHA 5JNLA 4GMHA 5JSKA 2FE1A 1GILA 1DOAA 3H1FA 2H9IA 3KCNA 4N65A 1Z0DA 3PRKE 1ZIOA 4C21A 3SZLA 2QX6A 3MGKA 1CXZA 4NCAA 1XZHA 4UU8A 3PDUA 4ZQIA 4EMBA 4DLSA 2XCRB 1SKMA 3QX3A 1OXMA 3EUWA 5DHPA 1UBLS 2PSSA 1WRBA 4PC6A 2O2CA 3WIDA 3D8TA 1UMBA 1VJ5A 3A6ZA 1VCIA 1IIBA 2VJQA 1YKGA 3FCUB 3G8YA 3JD3A 4DMRA 1I1HA 1NBME 1Q2XA 3U16A 2XXAB 1Y6GA 1IM2A 1IDN1 5F7XA 3CYFA 2E48A 2FCRA 1A7UA 1RKXA 1IPHA 1PLJA 1RWOA 4I8XA 5J2UB 1D4OA 3TI7A 2ZITA 4D92A 2YJGA 3P2EA 2B4QA 1T24A 3HB9A 1PYGA 4WLVA 4C14A 1NVFA 2OUKA 3K09C 2YINC 2EKBA 4KXWA 4QARA 1EIZA 2GTHA 3T5BA 4FWTA 3CHYA 1NW7A 2DP4E 4CYMA 1W1UA 1KMNA 2O7QA 3H4VA 4YUWA 5CLJA 2BFFB 3UAVA 3E9NA 2YV5A 4EJ2A 3ZLVA 4I08A 5KYYA 2KE5A 4RK7A 3IBCA 5A4MS 5F9FA 4UPEA 1GG5A 3NQ41 1RQNA 1OLXB 1T8YA 5IJXA 5J2UF 3IUMA 3MSXA 4CCYA 3DV9A 4LVUA 5J1SB 3PPIA 1ORHA 2XNJA 2JLWA 4KYVA 5JARA 1LC3A 4EUHA 2OILA 4OXYA 4WW0A 4O0MA 2J4CA 1E5XA 3UKDA 4DBVO 1U2QA 3H6HA 1VKHA 5FBQB 2JA1A 3KELA 4B1FA 2XKAA 2JGDB 3WOVA 4B4DA 3WGUA 1O94A 3VDNB 5KTPA 2YNMD 4IS3A 4UE6A 5TIIA 2NSDA 2WUVA 1F20A 3BHNA 4ASUD 4ZJPA 3W6OA 3FDZB 4BYMA 2ID8A 3GJ3A 5CHEA 1MX3A 1ZZEA 2OPHA 2W2VA 4GZMA 2PRYA 4Q03A 4Z3DA 3GPIA 3IVXA 4CNBA 3ERCA 1JHVA 3S7ZA 3VYUB 4HBZA 4YJ3B 4UTPA 3K9QO 1DKRA 4KPGA 3T3GA 3VR2A 1KMHB 2QB5A 3N7TA 4LYEA 4PBSA 1CQIA 5DFAA 4TV8B 4X62B 2PZEA 2PLWA 3T34A 1UFKA 3DPSA 3LPAA 4YJDA 4X8MA 5CX4A 2O9JA 3ZU4A 2GSWA 1Q44A 4KNWA 3IESA 4KOAA 1XD9A 3G6WA 4JYZA 2CT8A 3COPA 2D1TA 2OO5C 3U6BA 4FGJA 5KTKA 5LQJA 2HQOA 2YHSA 5A6VA 5B64A 2IBSA 2B35A 4EF4A 5KYTA 2OZVA 2G17A 4JNCA 2VSQA 5AK4A 4EECA 3L7AA 2ZCUA 2XIQA 5JJKA 3UW3A 4N0QA 3BJMA 4QU0A 5JFGA 2DWQA 2P4UA 3MMPA 1W4ZA 4A1FA 5BUQA 4TV8F 1GNLA 2Q3MA 2P3QA 2YJ3A 2YWFA 4HDOB 4N01A 5KCZA 2I03A 1VE5A 3COZA 3T9FA 5LOVB 4L08A 1IHXA 4J75A 5KNBD 3KQVA 4I4LA 3CNLA 3D6NB 3QELA 1UFOA 1XAGA 4P58A 2OA0A 3AHEA 4AG6A 2ZJYA 2ZUBA 3CRW1 4XLTA 2JGNA 2XMBA 1N0HA 5KZMB 4G4JA 1Z2EA 2ZR8A 3QIVA 1T2DA 3R9KA 4QUAA 2F1HA 3PLNA 5BPHA 2OHFA 3H0EA 3QJYA 1NNI1 3ZV7A 1VL0A 4G89A 5B4VA 3AY6A 4QSMA 3IH5A 4Z0NA 4ACBA 1CS0A 3ADDA 1ECFA 1Q3KA 2ZUDA 3CCCA 2BFBA 4TTVA 1YXMA 1EVIA 2QLMA 3WIOA 3KE9A 4EO9A 3K5HA 3EVAA 4IDGA 1JEOA 1U0TA 1G6Q1 2DT5A 2QJOA 4Y6SA 5LA6B 1PL7A 2K7ZA 4W5OA 2GD0A 3EDOA 5EEGA 4BE7B 2ZSEA 3KSUA 1TRKA 3WICA 2BUAA 4M6WB 2O1WA 4J0HA 1MU0A 3FCAA 3UJCA 4FHEA 3VMMA 1JQ5A 1J22A 4G36A 3WK6A 1YFZA 5H70A 3ORYA 4EBBA 1UBKS 4FDUA 4YUVA 4Q6WA 4G6ZA 5BW8A 2WTAA 1QRAA 3GRYA 2GBFA 1LJLA 1XCLA 1XNJA 3ROXA 1Z82A 3RT1A 4CQLA 1ORIA 1TIKA 1WIWA 1LW7A 1PX0A 2WILA 2XD9A 3GZTB 3NAGA 3S0JA 3OLWA 2QYOA 3L41A 1T8PA 3C3CA 4QKQA 2DR2A 3V3KA 5ALRA 1E2BA 3VZDA 3QGMA 1EI9A 3LY5A 4MPJA 4OQQA 4J0JA 1ZCJA 1E60A 4L73A 3UK2A 3WDSA 3B7PA 3QXXA 3SNKA 2XOEA 1YC5A 1ZJJA 1PJTA 2B82A 4D46A 1K6JA 5LDDC 4G5HA 2R79A 1KI1A 1M1UA 3GIWA 5A4DA 4TKZA 3UMGA 2OG1A 3K30A 5E6SB 4D5GA 3QFFA 1WSBA 2VK2A 5CLQA 4LKOA 4BMYA 5JZOA 3C5EA 3CFYA 3FNHA 4M8LA 3D4BA 4MWTA 4O2BB 4ESEA 2YW9A 3EZLA 2OFPA 2WD7A 3HY6A 1LDMA 3EVDA 3M1LA 5HJ2A 2H5LA 3THYA 1W25A 1J42A 3H84A 5KREA 1R7RA 2AQIA 2WSYB 2WW8A 2Y4NA 1M33A 3RGWS 2VBGA 3S40A 2V8OA 2YBEA 4EHLA 4N3NA 3HLTA 4JJIA 3IUPA 4A16A 5JZ9A 2XWQA 4Z1OA 2VN8A 1QHFA 4TLLB 1BDHA 3GBVA 2O8BA 3WI7A 4M37A 4YIKA 5EHGA 1ZW1A 3I37X 2F43B 3FOAA 1GKIA 4GBED 5JRZA 3T7TA 2WD8A 1RR6A 4G5SA 1RWMA 4P4SB 4OUDA 4RE5A 2X15A 4Y2RA 4G1BA 3R5KA 1ZPDA 1YRAA 1MB3A 2XR1A 2POQX 1RYYA 3VAZA 3RFFA 3UHAA 3UG6A 1ZUWA 1O3YA 4OQ4A 3KZNA 3ETLA 3PR1A 4WNAA 4OM8A 2OAGA 4LS3A 5JQWA 3MWYW 2OB1A 4YMHA 1U0RA 2DFTA 4ARUA 3BXEA 2JEYA 4EKEA 1E2GA 2VJYA 5JRDS 1B1CA 5GJBA 1SVMA 3GT0A 4OP2A 1WXDA 1Z13A 2DWUA 2B83A 4L28A 3E9ZA 4KQ6A 4B47A 1S5PA 1P0FA 2PKCA 3G6KA 1L9XA 4MNTA 3BD9A 1CEQA 2ZSAA 5F9HA 3W5BA 1OFTA 3NRCA 5A9TA 4RKEA 3FPGA 3IVMA 3FPEA 2BEWA 1GQQA 2IOQA 5LL6P 3AB7A 1Z16A 4YDHB 1MJHA 2P9QA 1S89A 1Z0KA 3TZKA 5LR6A 2HRZA 5IK2A 3MWKA 4QHTA 2BSXA 3SKVA 1JVSA 5D3KA 3QX9A 1FRQA 2X14A 3ESQA 1UBSB 5B4UA 1X9HA 3D6FA 1LTQA 1UFVA 5FFNA 3S2GA 4YJGB 1XI2A 5T4FA 3TQSA 4HS4A 3JAKA 2AEJA 2D2VA 4YUAA 3LO5A 5BWBA 4B3MB 3UMJA 5IW8A 3WIVA 1WMFA 3EA4A 4ENQA 4URVR 4LWOA 2IA5A 2EJCA 2ET6A 4S3MA 1A82A 3N8DA 4F3CA 2PFGA 3GQBB 4D8TA 1C1DB 1J1ZA 3EEYA 1H42A 3ULKA 1XEXB 1XN1A 3UT5B 2N1MA 2B34A 2ODAA 3LCVB 4TYPA 4IIDA 5CPFA 1NVVQ 6NULA 2WDPA 2W7TA 4DCUA 4HY3A 1OAAA 4WADA 1EXDA 4BVFA 3KQNA 2B2XA 2JIPA 4M98A 4WJLA 5A04A 1Z4LA 2V6JA 3K9HA 4K87A 4JKOA 2IT1A 3MXOA 4KXVA 1P1FA 4MR8A 3DAHA 1T5HX 3DTYA 3K92A 4B85A 1H66A 1JR4A 4DPMA 1T10A 1TT7A 3QUBA 3DDHA 3CW9A 4ZMBA 2QD3A 1HNZB 4OLAA 1ZVVA 1HKHA 3R9IA 3RJ5A 1XXHA 4MA4A 4RKRA 1IRXA 4JJ8A 4M7OA 2IYFA 3HWSA 4DW8A 2HK8A 2E4XA 1GNQA 1NR7A 4ZOLF 2Y6VA 5EVCA 3SC4A 1O6ZA 3A70A 5EINA 1OGJA 4US2R 2Q5HA 1CJUC 2VAMA 2ZSFA 3BM5A 5AVXA 4DKXA 1YTUA 4LHSA 1IONA 1BE0A 1RAFA 2WWXA 2ZSJA 3B60A 2C2KA 3IBFA 2ZSIA 1SBTA 3K9BA 1E1KA 3VSDA 2H1HA 4CT4B 1CUYA 2V7QD 1TTTA 5E3HA 3NEJA 2H0QA 3BK2A 4PTZA 4CCWA 4MPDA 4CTJA 1PL8A 1NGSA 2ACEA 2XADA 3WC4A 3PF8A 4KODA 4OI0A 4LRTB 3OPVA 2E49A 5KTTA 3U31A 3LSTA 1HR0B 5JDIA 5JC1A 4IF6A 1KYTA 1QIEA 3ZNPA 2CXXA 1E69A 2DUWA 1WDTA 1NUPA 2YFHA 2AN4A 2Z1MA 2DH5A 2R86A 2WJGA 3AL2A 3BAZA 1G4AE 1YH3A 2JJ2A 1ODTC 2O3SA 5FAXA 2W2PA 1IEXA 1XMSA 3DJYA 4KN5A 3TJRA 3WLLA 1KFJB 3LQKA 1O4VA 1VMKA 3NIDB 3L1JA 3WWOA 4BMOB 5JPDA 3JVUA 2XXBA 4Y2HA 4PLZA 4HVCA 1GGHA 1NP3A 2X9NA 2LCQA 1Y33E 3KTAB 4RK1A 4BASA 1PZEA 2BW0A 5KDOA 4LF5B 1EWTA 5REQB 1N5MA 1SBZA 4M60A 3HCCA 4OHOA 3MC1A 2RONA 4M1EA 2GCOA 3QX8A 2DQZA 3DV2A 3F8WA 1OBVA 1QBGA 1SPXA 3HRIA 1FQJA 4KO8A 3UOWA 3AEQA 4PRLA 2HGSA 3ABSB 1OZAA 3OZXA 3WSVA 5JEDA 2Q4RA 1NBIA 2AI1A 3R6WA 5HFAA 4A5SA 5KVVA 1W36B 4YLYA 3URKA 2V4ZA 2HSZA 3TSYA 2PNFA 5GZ1A 4R3UC 2NX2A 3UYLA 1SU4A 1ZN9A 3PGLA 3DZDA 2OCKA 2JANA 2SNIE 3ZZMA 4PYJA 1Z88A 1OWMA 2FA9A 5A1TA 1SK9A 4XGQA 5BWOA 1EIWA 4L4RA 2J0EA 4JB8A 3DMTC 2Y1XA 1NQOA 1QH8A 5KTMA 1F48A 4CKWB 5JAUA 3NI2A 2OV2A 1FLDA 3PUIA 5KIAA 5FTNA 2HRRA 4DG5A 5JH7B 3FB4A 4QLAA 5C51B 3TAHA 5KJ1A 2JJ1A 1O2DA 3EXIA 5B3AA 5CB4F 1SUSA 5JS2A 2VTBA 3FUXA 5WRFA 1C81A 1M1YE 3ENQA 3BKXA 1F6WA 3E1KA 3IJEB 5KYXB 3IBGA 3GFGA 2XJ4A 2TSYB 3LQ2A 4P7FA 1VPLA 3UUFA 3ETNA 2IYWA 1F2TB 4YV0A 5E1BA 2V7GA 2WDZA 3LHDA 1VLZA 3M8KA 3O92A 1M6YA 4TV9A 2DPXA 5GP1A 3ZZ1A 4Z51A 4LK3A 1G2QA 4ZCRA 5BNTA 1MQ9A 3M1IA 4J90A 3K31A 3DNFA 4KE6A 2H17A 3CRQA 3SKYA 4PCUA 4KFCA 1P91A 2JFBA 4X00A 4MYSA 3V8PA 4JOCA 2XXAA 2DE0X 3E7XA 1PZGA 3KYBA 5KYWA 4HLUA 2FMHA 3P9CA 4HADA 1X86B 4RIEA 1FP6A 3HP1A 1JMYA 1YJ8A 4XGIA 5ANRB 3RSSA 1CNFA 3CF6R 1HZJA 3V34A 3GFTA 4B46A 5LB4A 5LBTA 4BV8A 3N2EA 1JVBA 4EGCB 2P8JA 1U6IA 2CLKB 4M1WA 4JI0B 1Y4ZA 3OIDA 4FHDA 1EHYA 1I5OA 4BB0A 1XVTA 2B78A 2HH9A 2CMDA 3EULA 2QTZA 1BMTA 2IK8A 4KYUA 4PHHA 1FF9A 2OFFA 2FE4A 5DN6D 1V3TA 1L5VA 1ZUNB 2HWKA 4FD3A 2OZPA 3B85A 4HUQB 2XLBA 4AD8A 4TWJA 1YUMA 2X2PA 3R3HA 1U3FA 1OLXA 1LWOA 4QQNA 3UMSA 2I91A 3AUYA 4YRBA 1I4OA 2EW8A 3W5VA 1XL0A 1H65A 3E3MA 2C31A 1NXSA 2RI6A 4WN9B 1WCIA 3AXSA 4I5IA 1W36C 4YI5A 2C0CA 1N2JA 3WKBA 3NVAA 3TH5A 1C4WA 2JH8A 3OJOA 5C1PA 5JZMA 2HKIA 1YRHA 2UXBB 2OGSA 3ORSA 1JYSA 3LA8A 1HSZA 4BCBA 2VNIA 2VHWA 3UHOA 3B3FA 2J3EA 4LYDA 5ICMA 1KJIA 3GVHA 4O3FA 5FADA 2K2WA 3J81k 1P1CA 3F5MA 4QEKA 1T2FA 2TYSB 5JADA 1DG1G 4IOJA 5IULC 3T5DA 4D42A 1DWOA 1XDZA 1Z4IA 2HU5A 3JSAA 3K0KA 5EP4A 5KKAA 3KSRA 4J0CA 4CG2A 5I4BA 3GUHA 2JCXA 3IQGX 3REQB 3A05A 5BUZA 1HDCA 4ZQHA 3KDSE 1AA6A 1ZW6A 3ME5A 3IOCA 3HVJA 4FYYA 4V0SA 4WTOA 4WXYB 2G70A 5DE3A 1BGVA 2C99A 2IX3A 1KK1A 3G0GA 3G2QA 3V00A 3G5AA 3TBFA 1FW8A 1RJEA 2B36A 2PQ0A 3WR5A 4XWOA 3AL0C 1P19A 1UQUA 1FRNA 4K6MA 4A2CA 2IIBA 3ZBUA 3IE0A 1TLFA 4M9SA 5GINE 3WRXC 2JZOA 4ZVQA 4I1YA 4PG7A 3MYRA 4DYVA 2DG2A 3ZH9B 3WFJA 4I55A 4EUFA 3O9VA 1OBHA 2WTBA 4QYMA 5GGXA 1L8LA 3LF1A 2VHZA 1IIRA 3D4LA 4B6OA 1YONA 1E1MA 4KV9A 2QUKA 2A2ZA 5BSHA 5IWAB 3RRMA 3CTMA 4ZANA 2D2FA 4P4TA 4A6EA 4BFTA 3JV7A 3T9EA 4KBFA 1V26A 2F00A 4HWSA 5EKTA 1T13A 3JYLA 4MUMA 4B3RB 4A6XA 3WGQA 2A4KA 4E09A 3LUAA 3LC0A 3OQMA 2MOKA 1H3EA 5CJPA 1AMOA 3Q3CA 1QF6A 4CCSA 2GRJA 1JGTA 4UVDA 4ND3A 3UAZA 4B48A 2D1QA 2D59A 2XVZA 4JROA 3UCXA 3B78A 5ALSA 2FPSA 4P84A 2VNHA 1GZ3A 2FWRA 2EV9A 2Q3DA 1ORTA 4HAOA 3EGWA 3RS4A 4LJ6A 4EY8A 1CNEA 1L3CA 1QC5B 4FMCB 4KLCA 5D1NA 1B8OA 1U9JA 2CHQA 4A8TA 4EJSC 3T4EA 1FE8A 1Q1QA 4M6WA 2AG5A 2XYQA 4WASA 1YR6A 3IODA 1QJ4A 1H4TA 2GDJA 2ETVA 3BH0A 3MAAC 3KP1A 1BHJA 1XKLA 3Q41A 4RHFA 5FPQA 4E15A 1P74A 1YR8A 1JU3A 1U8YA 3Q3JB 5BOSB 1WV0A 4GX5A 2EATA 1JFSA 3DYBA 1MV5A 4BO9A 4HR7A 2Z98A 1TTHA 1IBRA 4MS4B 4PTLA 2IY9A 4P5PA 1II9A 4B6FA 2IHNA 4NPAA 1PR2A 1DWUA 1Y9EA 3QXJA 2O8VA 3TRDA 2HHCA 1P2FA 3RS8A 1Y8AA 1DL5A 3B82A 4DC1A 3TO5A 5ILOA 1ZJYA 3I2GA 3HFGA 2WJAA 4QOGA 1J90A 3GDFA 5EIHA 1TAHA 3PSAA 5AVJA 3RWMB 1MDFA 4QYTA 1AF7A 1IYZA 1RMTA 2J9FB 3OX3A 1ZINA 2VWGA 3RSFA 4ARCA 5E6SA 1W5BA 2IE8A 4D8XA 2CSXA 2Z2KA 3OMLA 1EBFA 5AKKA 1C9JA 4RK0A 4F1WA 1IBCA 1KPIA 1P9LA 4N54A 3NUZA 3Q12A 4HLCA 3DMPA 4O2BA 1EJ0A 4JYBA 2H2HA 2G6BA 3NX4A 4XOIA 5HZHA 2Z4SA 1VBKA 3S27A 1NI4A 4TLAA 1HNXB 2I2AA 2GYWA 3HJGA 5DP2A 1K2VN 3RSHA 4ACAA 1TF5A 1IY0A 2G7ZA 4XIIA 1D8TA 1XQ9A 4D9JA 1C5KA 2XF2A 2WWHA 2ZFUA 4FQ7A 4XD7D 4MARA 1KAQA 4XGKA 3A1NA 2AOXA 5DYTA 5EWMA 1Y1RA 2GZRA 2ZG6A 2IL1A 3AT1A 3R7NA 3GP8A 1GTL1 1QVZA 1D3AA 2F43A 1OLOA 5EQJB 2WE7A 4G4IA 3PWZA 4NG4A 5E6UA 4GBMA 3ZE8A 4YRGA 3S8EA 4P4SA 1DC7A 3I5AA 1MFPA 4LC9A 2XMCA 3OEHD 3DVAB 2QD4A 3D4OA 1RI2A 2WABA 3H3FA 1BHSA 4HNAA 4S0ZA 1BEZA 5CGZA 3P0EA 4P4NA 5EGNA 3RBAA 4DYHA 3D6UA 4JGBA 2WU3A 4M0KA 3MJSA 2NV2B 1TRHA 4C30A 1RWQA 2YWEA 5C7YA 3EUFA 1KQGA 3OEHA 2R66A 2X86A 1Y0BA 1GFSA 1YL5A 3KUXA 4MAAA 1YB4A 1YDEA 2CFCA 1OCEA 2AV6A 2PJUA 4UQPA 8OHMA 4MIKA 4DUZB 4DCVA 2OMEA 2W5UA 4PPQA 3ZWYA 2D13A 3C87A 1OZFA 5EQTA 2REQA 4U0JA 2ZJAA 3FUCA 3H42B 3BD6A 1EFKA 4ZT4A 3W1EA 5DDIP 1A4IA 4O8CA 4EMUA 2XE7A 1GU1A 3H97A 3JWEA 1Z7WA 4GBJA 5U4QA 3VNBA 3WFZA 1LA2A 4C1NA 4D8YA 3AVTA 8LDHA 2WM3A 3K20A 4CMBA 1G0NA 5K20A 1D04A 3WLNA 4HVLA 3H65A 3FY4A 1ZMTA 4EABA 4DHEA 1SOUA 2PSHA 4UNQA 3FRHA 1EDOA 3S70A 2HWUA 1QF7A 4AJKA 5ER6A 3HGTA 1SHUX 4BO1A 2H1CA 5TT1A 4QFMA 2F6RA 3NWOA 4QQ8A 3WJ1A 4INOA 4O4IB 5EPOA 3U62A 1A8PA 3PC2A 4KAXA 2IEIA 2QE7D 3QUCA 5AJWA 2B1GA 4BLQA 4B6JA 5LZ9A 3IKJA 2LP4Y 3A1UA 2DUUA 5AHKA 1JX6A 1YD7A 3F7TA 1VG1A 1R5BA 2CGEA 2C2GA 2VRNA 3GQBA 3Q4GA 1C1DA 2OBXA 3OICA 1YJAA 5D84A 4ENUA 1AY0A 3TOVA 5IJAA 5AM3A 2XDWA 5HJ7A 4LSWA 2Q1TA 5IJ9A 4MVJE 4FS8A 3I52A 2VQSA 4F4HA 2NXJA 3T3DA 3V8RA 5JVDF 4XCQA 2QRGA 3FRJA 3STHA 1CB0A 1TVKA 2C5HA 2C98A 1H2FA 4EA7A 4RPLA 5B57C 1ZD4A 2I78A 3R0ZA 3OTOB 5ALQA 5GJVC 4QO8A 1J70A 2JCYA 2PKXA 2QAIA 1H2WA 3ADBA 3DB2A 3LL7A 4ZD6A 3EVGA 3BBLA 3ZLBA 3IILA 5D2CA 1RP1A 3VPXA 4TS1A 4EPVA 3SHOA 3F6YA 3FCSB 3GXBA 3K6JA 4W9NA 2HHLA 3OUZA 5DLQC 3RFXA 2X6TA 3WP1B 2A9VA 2C8KA 3EZ2A 3PTAA 3E2IA 5KYVA 3Q5DA 1P1KA 2AD1A 4B7XA 2ZKLA 3EF0A 3RFVA 3TLZA 2A7QA 3W7VA 2BCEA 1J56A 4DHWA 3HR8A 4J0FA 1R18A 4DIUA 4BV2A 4DNXA 3SI7A 3TOSA 3OI7A 3H2HA 5ES4B 5FPPA 3ZIDA 5B2EA 1X80B 3BCUA 3AHGA 5LZ4A 3UT6A 1KPHA 4JS0A 1DT5A 3EMBA 4MUJA 1CUAA 1UZUA 3DZHA 1C50A 3DGEC 3MILA 3D6MA 3NEAA 3T3PB 2ZYVX 4M88A 5EMJA 1YZYA 4CKXA 2ZJ1A 2CF6A 3INRA 1W59A 4F96A 4XDGA 2FG6C 4OI2A 1U2ZA 2QSYA 3UENA 4YV1A 3AVVA 2V98A 4JA0A 1ISRA 1PWXA 3PFKA 3O1HB 4PG6A 1G2OA 2QORA 2XAAA 4YALA 2UZ3A 1E9BA 5FTJA 1MO2A 5AJZA 2F9LA 3ZHZA 1FMLA 1ZGHA 3G2HA 1HDIA 2A8YA 3OCVA 4J9UE 4KLZA 1T0UA 1HTBA 1N6IA 4XXHA 4B6SA 1X8XA 2I9KA 2BFCA 2FUCA 4NMHA 3KTAA 2V65A 4I4NA 2CXQA 1JJFA 1W73A 4MLPA 2JAXA 5CIQA 2INGX 1G7RA 3U13A 2QM8A 3B6EA 1PZHA 3W5HA 1H0KA 3PCTA 2FEXA 5CVJA 3WIBA 4FFBB 3WMRA 4H1HA 1EWKA 1OC4A 1WG8A 4Q7QA 1U28A 4ZDJA 2IKQA 1T0JB 1X7WB 5KNBH 4D41A 4H1WA 1GPJA 1TUGA 4HB2A 3SXPA 2WB4A 5AI0A 5K09A 1CFZA 1X1BA 3ZD9A 1RXWA 1PQWA 4OLHA 1KKUA 2W58A 1Z07A 1UR5A 2W6ZA 2HMTA 3FTQA 4O08A 5FF9A 5I7WA 1T9BA 2V1UA 2OHVA 3H13A 1XLTA 4TS3A 1N2SA 1CUXA 1W5FA 1HOTA 3OFVA 5EXXA 3MTAA 1KP3A 3O47A 2W70A 1USUA 4PGAA 1QKKA 2A9KA 3IUBA 4PAOA 4HEA1 3JD4A 1B8PA 3WIEA 1JWLA 5JH7A 3PFNA 1KK0A 2HYDA 3ILYA 5IYZF 3WWDA 3ZR4B 3U3XA 4I4CA 3M6WA 5CJ2A 2REOA 4MWDA 3RS3A 5KYXA 1GPLA 2C7PA 5HBRA 3CIOA 1G3IA 2XUAA 4M4SA 1A2KC 1NVDA 3B1ZA 3CO0S 5A7FA 1XTPA 1T6BY 3NKLA 3O84A 4ZOQI 5EIAA 4H7PA 2LIVA 2FDCA 2Z8XA 3FPAA 2OMKA 3HS3A 4G4GA 5J4YA 1R27A 1Z74A 4K1LA 3IAM6 4ZV4A 2DFLA 1V8OA 1TM5E 3LUBA 3LOQA 1IY1A 1KMMA 2JKYA 4DMLA 1JLHA 3B13B 3Q7IA 2J07A 3ZDAA 1R6DA 1SIBE 3AF1A 2Z2YA 5IM5A 1MGOA 2BI7A 3W1VA 1L7NA 2FSUA 4J91A 4QG3A 4HNTA 3IIIA 5HJ5A 3GNSA 1ND6A 2WHEA 3RK4A 1U8CB 2G77B 5EWJB 1GL9B 2YW2A 4CT5A 5JECA 4D9HA 3ZGOA 1XQYA 3DKKA 3T94A 1U2DC 1GXSB 5B3JA 5EI5A 4F93B 5KOJA 2F55A 2WHPB 2GM4A 1Q1ZA 4MW6A 5KTOA 3B6KA 1V5FA 1ZZGA 2PH5A 2FMFA 1ECBA 1E9DA 2VJCA 3VAAA 1RS0A 1TQ6A 3EGVA 1PS9A 2QAGC 4EJSB 4XIFA 3FCYA 2ZXUA 4IM7A 4E6EA 2FW1A 1FP4B 1VKZA 2QPAA 4X71A 1KTVA 1NN1A 4XYLA 1UKYA 1QH9A 4RVOA 4ZVLA 1ZCBA 1DMSA 4X7PA 2PMCA 1BH2A 1P61B 2NG1A 2IDJA 4EG4A 1H6DA 4D0LB 5KVSA 3ENVA 1RCFA 1X9GA 3L3BA 2ZB2A 4A2WA 1DSSG 2FQXA 1GPMA 3KCQA 1F14A 1NJ8A 2N46A 1KC1A 1L3BA 1TYDE 3WYDA 1V43A 3WNZA 2HA4A 2W2TA 4BYGA 3TF5A 2OT3B 3Q3GE 3T1TA 1O9BA 1QIFA 3NETA 4CHGA 5EPEA 1FDUA 1EVEA 4D0NA 3R6GA 4YMWA 4ALKA 4L5CA 2HSGA 3EHDA 3OE7D 4IKOA 3SS8A 4NXNB 1JW9B 1X39A 4PSDA 4R51A 1CUWA 2HA6A 2GHIA 1VMAA 5IAJA 2MCFA 4AJJA 1UZLA 3GJ5A 2REXB 4QELA 1WY5A 1Q7BA 4IUCS 3QI7A 4MRRA 1P33A 3K2IA 4AJHA 1F3OA 2C2BA 5DPMA 1OYOA 1PZFA 2PT5A 1G66A 3FNBA 4NZ9A 4OG2A 3DM5A 4FFDA 4AZ0B 1GTZA 4ID9A 5E8JA 1W8DA 2YN4A 1WVIA 1I10A 3CINA 5AM0A 4Y6LA 3WADA 3VOSA 4AX4A 2WF7A 1BU8A 2O8NA 1H23A 2Q6LA 3QOFA 4DREA 4GLOA 2A92A 4Z6KA 1U4NA 4NZMA 4B83A 2NU8B 1CX9B 4IH1A 1C1HA 4NOLA 3C1TA 3L8ZA 1CU1A 2AQHA 2CY0A 1V1RB 5CDTA 1ZN7A 5CH5A 4J0EA 2BM0A 3R77A 3PSHA 3BT7A 5KYGA 1Q74A 3OZ7A 1BH6A 3GEDA 1Y1QA 1DUSA 3OZTA 1YZVA 5D6OA 1GKLA 1MAHA 4MEBA 3ZEAA 5K51A 1YR9A 1N92A 3NOXA 3QYFA 1YR1A 1EDEA 4DUPA 1KEKA 1ULBA 3NHMA 4JZYA 1O8BA 3RVSA 4ZEVA 1Q21A 1S8FA 1R8SA 3VR4D 1Z75A 1VOTA 3KV3O 5JC8A 16PKA 4PGMA 3WNQA 4PXYA 4GKKB 2OHHA 4NK4A 3TW4A 2Y0BA 4PGHA 4INJA 4UHCA 3ZCSA 4F45A 3G0BA 1JKIA 3HA2A 1AZLA 1LRJA 1FX1A 3IEMA 2EGGA 3DEAA 3GEMA 3JY6A 2H8GA 2WUEA 1KZGB 3WJ2A 3OM1A 1R4MA 5LXTA 1YB6A 2JATA 2P6RA 4AY6A 3AUKA 4ZAWA 4WD3A 2QVXX 4I1SA 5JEEA 4OHUA 4F04A 5BOSA 3TL2A 3IMKA 4UD2A 1H1TA 1VRCA 1H2XA 3BMOA 3OZWA 1Z45A 3DE4X 4YWHA 4I99A 4YJHB 3KJGA 4AP6A 4W5NA 1GL3A 3QE3A 5AVWA 5GADl 2WWGA 3PBKA 1UEIA 5AK6A 1YOBA 3P5BA 4QU5A 1O0CA 2A88A 3P4YA 3C4VA 3D8UA 1VG9B 1EZ1A 1BQ3A 4TMTA 4WACA 5CURA 3LHSA 3H18A 1FTWA 5CVDA 3A1DA 4IGFA 4S2UA 3CE6A 3SVLA 4DSZA 1X42A 1FS4A 3WGYA 1XNRB 2XIJA 1WBDA 1WTCA 2H06A 1CNMA 2IHZA 1UFQA 3QPBA 3I83A 1YAHA 1D0SA 1NRXA 2ZYDA 4JI2B 1DLIA 3CR8A 3OJWA 5HXAA 1DLJA 1RAEA 3EXG1 5KNCA 4B6EA 5H3HA 4WY5A 5HM8A 1DPFA 2GKGA 3BG5A 4JMLA 3UWMA 1RRGA 2BONA 5GOZA 4EENA 2O4CA 1ODKA 1W75A 1O5TA 2W6NA 4NOMA 3ICQB 3LP5A 1V6AA 5HS6A 2IHJA 4GEGA 3U49A 1CQPA 4D1YA 1I6MA 4J0GA 4JVOA 4QDJA 3TVTA 4EI7A 1TCBA 5JAOA 1CUVA 2H7YA 3BF8A 1E9AA 3NP7A 3WGJA 2GZHA 3RBVA 4QTTB 1V47A 4XUCA 2B94A 5I7FA 2PPLA 5IFKA 2HYIC 4C2TA 1ZGBA 2PX5A 1EBUA 4LJKA 2BGNA 1M7HA 2P5UA 5D3QA 1ZU4A 2W2KB 4OXQA 5FYDA 1U0SY 1IG3A 4RTPA 3PJEA 1M72A 4JI1B 2GPBA 5JT1A 1QTNA 3T5MA 1M66A 1DOZA 4YACA 4PPNA 5IAAA 3AM1A 4HN4B 4OKSA 4L78A 3ZHCA 4JV5B 3RJZA 4FFMA 1E2MA 1GRCA 2LKDA 4P82A 3A9CA 4KSBA 2XB6A 3BYZA 3OBIA 4OH7A 4QG7A 1XNGA 5FA6A 1DX6A 1N25A 4ER6A 1NYQA 1F8XA 1O57A 1SIOA 2DKOA 5D5HA 1V7ZA 3N53A 3RS2A 5A5VA 5AVUA 2P2SA 3I3OA 2IYOA 3NAQA 3BH7A 3FF4A 2ZRFA 4IVRA 5CNIA 1QYRA 1AQ6A 2PXXA 3PXAA 2OEPA 1XQWA 2OO3A 2Z2IA 3V6MA 3WA7A 3AJAA 5MDHA 3JD2A 3QFTA 1Q7TA 4NBTA 2PKYX 2FSVA 4JLJA 5F12A 2Y1WA 1VL8A 4B40A 4EG6A 3HO8A 1DC6A 5A02A 1T4MA 4W7SA 3ANSA 2HB6A 3BN3A 4TZ0A 3KQUA 3VSCA 2H4ZA 3F73A 2CNBA 3DWIA 2AMYA 4DMGA 3R9WA 2C7QA 3ENNA 3CVXA 3F6CA 1MAUA 3KFLA 2JFVA 4S1VA 3KWFA 4ZCIA 3G8DA 4E51A 1KE2A 4BMVA 2XW6A 5CFNA 4NPHA 3QX7A 4MI9A 1RIFA 2KJQA 3NDRA 3QU7A 4DMMA 2VYQA 4HVAA 3B52X 2G9VA 4EBFA 1YU6A 1TF2A 2IY7A 4WFIA 1EPUA 4E33A 1JQJC 1Z8NA 3OHSX 4MWGA 1D8AA 3HRHA 3I23A 2EJWA 4HH1A 4ZXFA 4C4SA 3U60B 1XF9A 3M4XA 4PG8A 1BS1A 4A2QA 1RYHA 5D7BA 1H94A 1PFUA 4JJFA 4LBZA 4FJ0A 4NBRA 1CLUA 2JZNA 1S2GA 4ARAA 3HCBA 1DFIA 1DQNA 1QUFA 4KGDA 4QO7A 1EG7A 2NZYA 2HK6A 2Q3BA 2WM8A 4OOFA 2AYXA 2NUAA 4O2RA 1XPRA 4FHGA 1M6NA 2GJKA 2E0IA 1ISFA 4EEKA 2RK6A 3IO5A 1J23A 3HVIA 2DXIA 5EYPA 5AKLA 1E0KA 1ZDMA 3EGXB 1PIWA 1BQEA 5TF0A 3UANA 3SEFA 4K03A 4PHFA 4DM4A 1E6MA 1K8RA 4U7DA 4KWCA 1A7KA 1B0PA 1NUAA 1A5SB 1VYUA 3CLRD 3FNFA 4M1QA 3Q7EA 5JNWA 1EE2A 5JALA 4ZVRA 2G80A 2QRPA 5TMDA 5AESA 2UKDA 3GAFA 3VAYA 2M1ZA 1WNFA 3AHJA 5DOVA 4IWNA 1XQ6A 1ODSA 2PUWA 2WT9A 4ZK6A 1F7UA 1SRQA 1KDVA 4R6WA 4IICA 4X6UA 3S2ZA 1PQUA 2BY4A 2A5LA 1RRFA 2FX3A 4P6VF 1RHUA 3FHCB 4NCHA 2NZWA 3PR3A 5G0UA 4KB5A 3RTDA 3UICA 4V3CA 1G60A 2WINI 1QRSA 4N7JA 3QLVC 2K6GA 3BKWA 5F5LA 4BWVA 1T9GS 2MWMA 3LTNC 1AGYA 2YUTA 1BW9B 1M5TA 3KOXA 5F2NA 5JSZB 3FLEA 4GDFA 3GJQA 1I13A 2YDYA 1EFPB 4H4CA 1JIXA 1ATIA 4XPIB 1NOIA 5BUCA 1X80A 1UT8A 3GA7A 1Z4OA 2QQFA 1ZRMA 4DTCA 3ROGA 4GI3A 3NIBA 4NE2A 5JTTA 5BOVA 3KEFA 1JHQA 1N0UA 2P2YA 4UNNA 1V39A 1Y4SA 3ZYZA 4Y1RB 1QIMA 1IOWA 1EXNA 1T3HA 3AQIA 1K3FA 5FHQA 3S5JA 3UTDA 4W5JA 1WB4A 4LDNA 5IM4A 1HFKA 3U4HA 1QVWA 3DE7X 4CV0A 1P1HA 1YK0A 2HU8A 3OH8A 2P4QA 5BW5A 4DBZA 2X8WA 2O23A 1DZIA 2JH9A 4CL0A 4RSGA 2D5BA 3FKQA 4J3FA 1BHO1 4UJ3A 2GYVA 2JD0A 2PMFA 3BFVA 2QE6A 4LISA 3OSUA 1D2HA 1IQRA 3RS9A 3ER8A 2H8KA 2QIPA 5A4IS 2Q6VA 4L5YA 3ZNQA 3ZG6A 4BN4A 4F8JA 1JKXA 3AESB 4MQ6A 4MV9A 3FSRA 3CKLA 4F8EA 2QZPA 3TTWA 4CETA 1REQB 3WLRA 3ACDA 2EFYA 4GLFA 5HDQA 3TD9A 4PXAA 2X8JA 4BZXA 4DCNA 4ZAZA 3I09A 4JLBA 1XRLA 2H4XA 5JAQA 2BBTA 2GRAA 3ITKA 4F2GA 3RKUA 2CL7X 2E9SA 1ZD2P 3JRXA 3VVMA 2ZT8A 4BNUA 3NH6A 1N6KA 3RH0A 2LVBA 1C3LA 2NXCA 2BE9A 3FPBA 1VJRA 1H8EA 4NZPA 1P62B 4P2GA 3LDGA 4DB4A 2QMQA 1R9JA 4ZKDA 3I6BA 3OFKA 1AO0A 4C0LA 3VOBA 2YJZA 1L4LA 2DBRA 1CVIA 2JS7A 3AF5A 3WZ2A 4XRRA 2XQVA 4ENVA 3CZAA 2HXGA 1I80A 2VJNA 5DRYA 5LJLA 2RHWA 3L8MA 4Z7JA 1U2GA 3W2EA 1V2GA 1R8JA 1TM2A 3MJFA 4NCKA 2OBBA 2UYGA 3GFFA 4OLJA 1IB6A 2YXNA 1HX7A 2CLFB 3VKFA 2Q5LA 5MGBA 1NZFA 1G1AA 2VF7A 2DVMA 3TTUA 4TM7A 2O5CA 2UZ1B 3BIJA 1KVTA 1PFYA 4HTFB 4TTJA 1RFLA 5E7JA 4UFNA 5TC4A 1HDYA 3ZDXB 4CUZA 1Y7TA 1IXZA 1ZJ4A 3NJ8A 3EXG2 2ZJ3A 2WQ6A 4PAGA 1QHGA 2MHCA 3V46A 3MLAA 4AKSA 4JCOA 4IMPA 4DV5B 3JTMA 4HDMB 1V11A 2HCTA 4R84A 3RVKA 4CM9D 2BTOA 2Q0XA 4L57A 1CT9A 2OAP1 2WF9A 5C32A 3K1TA 3FUUA 4I5FA 4HXFB 4X20B 2C9OA 4YRRA 2AQKA 3WSTA 5EWJA 3UWOA 5BQFA 3L4SO 3GGSA 1BKSB 1SZJG 4GZ3A 1SCIA 1GXSA 2NO6A 4X60A 3FPCA 2H2FA 3Q7SA 4GFDA 5KQSA 1BWSA 2FQQA 4MR7B 4NAVA 2HU2A 4RV4A 2DOKA 1OV4A 1UJ6A 1BFDA 2IVZA 4JYCA 4OCZA 1CCWA 1XUOA 1AF4A 1Y8QB 2Y1KA 3QNUA 4E7OA 2ERYA 4MCJA 4IIUA 3HNRA 5A3JA 3GLUA 3WDKA 3G49A 1E6LA 1BVYF 1FP4A 4W82A 4EGFA 1FCJA 5I7OA 5KYKA 3PIDA 3K4PA 3UOAB 3IALA 4PCVA 5CDGA 4WUVA 3TZHA 4RCZA 1VPTA 2OQ2A 5IMBA 3NNSA 4B7CA 1A2BA 1SG0A 5EJ7A 3WMXA 4BVHA 1N9ZA 2Z30A 3GT3A 1M2EA 2C4VA 5LD2C 4MZDA 4IDQA 3PQEA 2FUG1 3QQ5A 4QX6A 3CPEA 4BVJA 2X0EA 3VPSA 3GRFA 4EO7A 2N1BA 4C89A 3ELBA 4PO3X 2ZWAA 4M99A 3A58B 1QCYA 2IUUA 2H1IA 4Y6RA 1JECA 2O2SA 2Z2XA 4KIUA 3HCDA 4MQFA 4TKMA 2OORA 3SS7X 3ZNNA 1CR4A 1XU7A 2XUOA 2OM2A 3AY0A 4P7JA 3JQ7B 4OFWA 3ASZA 4YP7A 5JV5A 3GRCA 3URMA 1U5CA 3NT5A 4FBLA 1AUXA 1ZFNA 1A0OA 2R5FA 1XWFA 4TPKA 1QR2A 5LQCA 3JARB 1DV2A 2J4DA 4CFZA 1N5LA 1YCGA 5I3ZA 1E61A 2WSSA 3AUFA 3HDHA 5EXDA 2R00C 1GZ5A 4RY9A 4AZ0A 4XUDA 1BWRA 5CA1F 2WUDA 1QM5A 3A27A 1N6HA 3PQ8A 4QBHA 5DBIA 2IEBA 2IKSA 2PD6A 3D4IA 3OZBA 2F3TA 3GLTA 4LMPA 4F4JA 3E22B 2GVNA 1D6SA 1BGXT 4BOYA 4PLGA 2MMGA 3I32A 1N3YA 2V4UA 2PLFA 2DBQA 2YN0A 3LHIA 1VCMA 1V1RA 3PDIB 4Y67A 2XPCA 1B3RA 4R0NA 5DBHX 4QA9A 1AN0A 1J8VA 4MK4A 3WBBA 1VI6A 1HBJA 3TWOA 4UOEA 3TIFA 4L16A 2QL6A 3T0FA 4CV1A 2VHJA 1E1NA 4MTLA 4A8JB 4URXR 3HKCB 1M34E 4QIHA 4KOEC 1MB0A 2VNJA 4PCLA 5E4FA 5FO0A 4R1UA 1SXQA 3TPCA 1TA0A 3IAS1 3HU5A 3GLHB 3P2MA 3AEKB 5SZIA 3I9NA 2I33A 3NBFA 2HMVA 1HA3A 2XB9A 4YGYA 2V4MA 3AUXA 2CMHA 2NTEA 4AJ1A 1ESNA 1KF0A 4U2EA 4HSGA 3GT4A 4QGGA 4DA8A 2GHTA 2A5DA 2PE5A 2WVJA 3N59A 4R5MA 4S12A 2R11A 3HP7A 3BRQA 3L2OB 4MA0A 4R54A 1UF9A 1VB5A 3KSMA 1RKVA 3CUSA 3IIJA 3AKYA 1SB9A 4KAAA 4R1PA 4BXOB 3TLEA 3DZFA 1RSZA 3B6ZA 1NYTA 2VTVA 3V3TA 2UYYA 5T41A 4GPBA 1DB3A 4YJHA 1N6OA 3AHDA 4P86A 2HBQA 5IP5A 1PI3A 2PBFA 4M7WA 3ZQUA 4B4WA 1YRYE 3H2ZA 4ECAA 3ODGA 3IPRA 5ED4A 1D7OA 5FLYA 2HDOA 4YUZA 5AHOA 3QZUA 2ZQZA 3GGCA 4PXSA 3AINA 2CWDA 4PLCA 3IJRA 4JI5B 5CX1B 2VA9A 1GNRA 4OP1A 3ZHSA 4Q1FA 3PR2B 3SKXA 4LHVA 4AL4A 3E0QA 1SG6A 1Q17A 2LZ0A 4I1VA 5TV2A 3QUSA 1L2TA 4IZ6A 4RKFA 5EJIA 2I2FA 4Q3OA 2O7RA 2GZDA 1GWNA 2VAXA 1L7BA 5CM8B 1CVLA 1Y1PA 1VJCA 2DAPA 3IMFA 4WK6A 1HY3A 1DVRA 1ZWLA 4UUOA 2VATA 4FEAA 2X5OA 5ECGC 3L43A 4Y2TA 4FZJA 2Z6UA 4Y18A 3OP1A 1UDRA 3R5FA 3ROQA 4DT1B 1FYVA 3CLUC 4TXHA 4URZR 5E1MA 4F6LA 1O8CA 5FR2A 4A8JC 2HCJB 3P4UA 4NMWA 2FQ1A 1ISPA 2HF8A 3MMZA 3TQHA 2V7VA 4ZHSA 1YA4A 4Y2QA 5ALYA 5EHZA 4EW1A 1UBFA 3Q8MA 3AY3A 1PG5A 3I2HA 3EXHB 1AB5A 3ON5A 4M9QA 4TN1A 2C88A 4QWWA 4NNPA 5I7EA 3E6AA 3AR2A 3DFFA 2W2KA 5E6RB 4FUTA 2CJPA 3IO3A 4I50F 4NFHA 1BX1A 1FXSA 1SIWA 4NTZA 4MHSA 4WRRA 2O06A 1JSXA 1X92A 3IP8A 4MPPA 4RS4A 4U1RA 3ZDFA 1ECLA 4NF2A 2XHEA 1JFFB 3DNPA 4YQYA 2PGDA 1GQOA 3T5PA 2PGIA 2I67A 3WMFA 1XZEA 1EJ6A 4TMWA 4IEEA 1J2YA 3EEIA 1GV1A 1T9GR 5JSQA 4AO8A 2NZUG 4ML3A 4Q7LA 5TPWA 4A0SA 5KOYA 3UGKA 3EIQA 2D0OB 2QQ5A 1HOXA 2Q3CA 2CNNA 2VDVE 1Z0FA 2OENG 3AU9A 3IE2A 1CQJA 2H92A 4XOUA 4ZWNA 2Y05A 2XUJA 1SG9A 1EVKA 1ZKDA 1Y5IA 3AYXB 1ODCA 4LVNA 4HGQA 2GA9A 3UA4A 3GLFA 3H4MA 3QEBZ 3L6BA 5DNDA 1SHKA 1VIMA 3DBRB 3FETA 1PAUA 1VJGA 3PZBA 2XMGA 1QGAA 1IWBB 3CN7A 3FBTA 1IK4A 3ONWA 3CJTA 1U63A 4KRFA 4MWBA 2WYWA 3DOCA 1AQIA 5E1DA 3D8HA 1JHPA 2HL6A 3VH3A 1P39A 1CC1S 2V7WA 5L4NA 1IJBA 1Z3CA 1UBMS 1QG4A 1FDIA 1ZC3A 4I4TA 1KYVA 5FWXA 3CH6A 2QTFA 1W44A 4BO4A 1AKEA 1QHEA 1E7YA 1YFKA 3NWBA 4BLWA 4UKDA 3DFZA 1XQ1A 4KAFA 3K0FB 3BCRA 3ZZTA 1C1XA 4K26A 2RGXA 4YMSA 2BGWA 1HFJA 5CXQA 3GAAA 3K9WA 1HE8B 5F76A 3EE6A 3OOYA 3W06A 3IB3A 4FR0A 1DE0A 1I6LA 1ADBA 1IEVA 1PP4A 1JZTA 3TCNA 3ZHVA 3ZH2A 5GM1A 4ERNA 2QUJA 4HQNA 2ORYA 4U8HA 1RYZA 5EE9A 4L8FA 4Y6PA 3RVMA 4DIEA 3EXHC 4LJ4A 1QHHB 2VQ6A 1TK9A 5ERYA 3JVEA 1AS2A 4A2PA 3ZXYA 1SCJA 1JZQA 3VOAA 3IPYA 4RLFA 2AHOA 4UMDA 4H7HA 1T5IA 5GVRA 5HKOA 2I1WA 1QAOA 3N05A 4JITA 2C4MA 2JIOA 2Q6TA 3MAJA 5D86A 4Z4IA 4XVUA 1SHTX 4HXYA 1G8AA 4RKYA 1PFKA 1NV9A 5EOVA 2RBEA 3IUJA 3K1YA 2PT9A 1C0PA 4QODA 2HJHA 4OM7A 2XUIA 2NYRA 1XT6A 5FH9A 3N5CA 3QU9A 4MV6A 4TRJA 1T9AA 3TQFA 2VRCD 4RY0A 5CIYA 3I1IA 1BW9A 3HVUA 3UF0A 5CFQA 5JSZA 1EFPA 4GPEA 4L75A 1CZHA 4XFKA 4XPIA 1RJFA 1XXLA 5FOUA 2B9EA 3UBMA 1B6GA 1DDOA 3MWJA 3MBOA 5ADWA 4JA2A 5BV7A 1HRKA 4Q9LA 1DRKA 1K63A 1X7YB 3RIMA 2OGTA 1Q7CA 4B79A 4JL6A 2H1SA 1DJNA 1RFGE 3OZSA 3A1SA 4Y1RA 1SM4A 1Z34A 3CTPA 4GMKA 4UNSA 3JQQA 3T4PA 3EFEA 3VR6D 5FLXA 2YWGA 5K1ZA 2UYHA 1SO8A 1GCOA 2QIOA 1PGPA 3GRVA 5E4YA 1AMUA 1COWD 1GVNB 3O8QB 3EDYA 1X2BA 5C7IO 3T9AA 1PEYA 5IVKA 2TMDA 5LPNA 1R9GA 2ZWVA 5H9WA 4EARA 1DAIA 2IY8A 4AC9A 4KWEA 1IC6A 1TTPB 3O2SB 4K9DA 3ST7A 4E5NA 3KDPA 1IRIA 1C7JA 1GUDA 2YV1A 3LKVA 4JKYA 2AZ4A 4URHA 4Q93A 4Q18A 3WP0A 3WZMA 5JHGB 2Z3ZA 1Y34E 2QW8A 4GP6A 1XE3A 3UY4A 3T1VA 3JALA 6GPBA 2C83A 2WJVA 3L05A 1E9RA 3KQHA 1DAEA 3ZTYA 1W2GA 3AESA 3IXLA 2H1WA 2EFEB 2JBAA 2R25B 1REQA 2A57A 3GG9A 3PYMA 3QWBA 4M0LA 1OUMA 4QXRA 4Y2XA 2NQ8A 4L9SA 1XVAA 3PRHA 1X1EA 3PQ4A 1OE0A 1U0HC 1KOLA 1AGXA 1JDPA 2BMWA 3CZMA 3W6PA 5ARBA 2RJNA 1E4EB 1QTIA 4LJ8A 3P2JA 5DGXA 1D1QA 1A9SA 1NHGA 2XSZD 4TZTA 3LSYA 3CUKA 3LT4A 1I36A 1Y89A 3GUUA 4NHEA 1IZ7A 1NQ5A 3MTIA 3LIPA 3V4RA 3LGXA 4DIOA 2WKPA 1FFSA 4MVJP 1G3UA 2HA5A 3T5TA 1L5GB 4EFKA 2IHVA 3LY8A 4TQGA 4OLBA 1WABA 3E5RA 4YRCA 4B8YA 1JHZA 2D0DA 4I7EA 1YDGA 5D5QA 3G0CA 4JI8B 2CJWB 3FTNA 3L5KA 4RK6A 1KH3A 2CBGA 4Y9TA 3I30X 1PK7A 2PTHA 2CK3D 1YZUA 2G9ZA 5EZYA 3QJGA 3A14A 3NP9A 2ZDGA 3DE2X 2VZ9A 4X61A 3HSKA 4RM3A 4QBIA 5CYPA 2FHSA 3H4IA 4ENPA 1JFTA 4K81B 2C61A 4UM7A 1GFIA 1T8SA 3ECCA 4KQKA 3ZK9A 3OKAA 1H9AA 2VQ3A 2DETA 1I4TD 2BEJA 4GR9A 2H5JA 1G4UR 5FUXA 2M32A 2RGGA 3T5GA 1KARA 2BGMA 2UZ1A 1GN9A 3MJDA 1C9KA 4HYTA 4RLSA 1BKDR 4YREA 3E61A 1HO3A 1EEHA 1IQUA 3NIFB 4ZXPA 4YJ2A 3ZLJA 3K4HA 4LNUA 4WNYA 5DN9A 4EB8A 3NBUA 1SJ9A 1CJTC 3SBXA 2DY1A 3MPUA 4PSKA 2WR8A 4WOBA 2QTRA 2FY8A 4UMEA 5LKAA 3TXYA 1DRVA 3RU2A 3EPKA 3IUNA 2Z9CA 3EASA 5DTRA 5FORA 1M83A 5KNCH 4OI1A 3UH0A 3WSWA 4DA9A 2F4VB 1T2UA 2ODBA 4RXTA 2O6HA 4J0DA 3KPWA 4URFA 4HI0E 4BNYA 4CODB 2HJSA 1JPVA 2R47A 3ZNOA 1PL0A 1BCRA 2Q45A 5KVCA 1HE4A 4MR7A 4MVXA 1O1YA 5HIMA 5HUQA 3UAXA 1XSEA 2V59A 3R41A 1V5GA 4ZVOA 3HBMA 3SAJA 5A9SA 3NJRA 1CZNA 2CLOB 4LBYA 1L4MA 3IERA 3QSYA 1P2GA 4XWKA 2ZATA 4MJLA 2EU8A 3L4EA 4TZ6A 1P0CA 2ZRAA 4XQCA 4LXQA 1OFIA 1IQPA 1JHMA 3ZBTA 4B75A 1OC2A 2GCEA 2JFUA 2HEIA 3CUTA 3MJVA 3GGJA 5B36A 1E2JA 5KB3A 1M2JA 4X8LA 3GYBA 1K86A 3ZHBA 4AJPA 1LI4A 1WVGA 3C5VA 3UMYA 3RVJA 2IIQA 4MYDA 3VR1A 3ZE6A 3RVOA 1JLSA 1QYXA 2PBLA 1IQ0A 2V45A 1KHTA 5FNZA 3WGHA 3DL2A 2YHUA 1G8JA 5DSXA 4C4AA 2Q0QA 1V4NA 3T4UA 1E9VA 2ZRJA 5TE9A 1R64A 1X1QA 2I6XA 3IPLA 2RDMA 3H0KA 1CV2A 3JYNA 3VO9A 4BNVA 4CMIB 4D3FA 2HA7A 4WLNA 3RIXA 3R3XA 3MUEA 2AEFA 2PVSA 2Z04A 3UEOA 2XBLA 4M1MA 3TLGB 5HQJA 3ANNA 1N0VC 1TD9A 3EGDB 4JQYA 3TR0A 4DJAA 1D07A 5JCOC 3DZJA 1LRLA 4IIJF 4Q1BA 5FPSA 3NPAA 3VNQA 2VPQA 3WK7A 2PUHA 2ECQA 3PHHA 3GCZA 2BM9A 3JARA 3K0HA 2C9CA 1O7JA 1SXIA 4HQRA 4LMRA 5TB5A 3RS0A 1EK0A 3DLHA 1JQAA 1RBQA 3WB1A 1IAVA 3DULA 1TZBA 2ZDQA 2B8NA 2ZLBA 3DW3X 3PXUA 1L7OA 1WQ4A 4NKRA 2FFAA 5I9NA 3HUDA 5LNK1 2I2WA 2C7GA 2DERA 1EFUA 2HXYA 5AOAA 3TI9A 1T4CA 3L92A 4R16A 2VKTA 3UV3A 3T1YB 1MEEA 4GPTA 2Y2UA 4QQKA 3E22A 5C8YA 1SBNE 1UDAA 2IUYA 3V9AA 2G5CA 4N6GA 4BAGA 1N33B 1A27A 1J8YF 3GZNB 3IEKA 4NZZA 5BR8B 3TRJA 4OSPA 3O0DA 5EPUA 3WWEA 1HK7A 4TTSA 4RQBA 5LDHA 4S2EA 4JENA 4EX6A 1E89A 1IBSA 1VYTA 1UBHS 3OZDA 3CLTD 4G09A 1XTRA 4I1RA 2VSNA 3QU5A 3EGOA 3HKCA 3KPUA 4H0NA 4KIGA 4L6CA 1FYEA 2JGIA 2X0NA 1J6UA 4YP0A 2LWIA 4DSOA 2O8DA 1IE3A 4IV5A 4DPLA 2OCAA 3C3XA 1NMEA 2DQYA 2QXTA 2OV3A 3A10A 4R0VA 3RHZA 3GLHA 1V4VA 3AEKA 3WHLA 1MAVA 2PXHA 2VP3A 1XYVA 5AI4A 4A3SA 2P9BA 3RFTA 4WEQA 2H2GA 4LI3X 4GO1A 4OXIA 5T8KA 3SYNA 1NG9A 2IHUA 3FR8A 4L6IA 1ZVJA 3U3KA 1WZUA 2ZRDA 3GLQA 4C3OB 3NUGA 1W7AA 4MV1A 3SFTA 1Z9BA 5FULA 2P6MA 4QTXA 3O83A 4X7RA 4C2AA 1LSOA 4CL2A 1A8IA 2J3JA 2BTEA 1GJRA 4NZNA 5BN1A 2NXNA 3WQBA 4XIYA 4S05A 3ZIUA 4BXOA 1FQKA 1VKJA 2P2NA 3DUWA 3GJXC 1Y9DA 4J7UA 4AULA 3OJXA 1ZK2A 2GN2A 3QKUA 4CVNA 4UHEA 5CVTA 1Q12A 1VDZA 3K4QA 4L15A 4UE2A 4IGAA 1FTNA 1A4RA 2BM1A 1JG4A 2CNWA 2II6A 4XIGS 4IXNA 2Y2VA 3AUAA 4HCJA 4RANA 3RC7A 4CKZA 1HLPA 3I0ZA 1VPWA 4FMBB 4E94A 4LDAA 1JEEA 1XAIA 1ZIXA 3WGZA 5JLJA 1LBQA 1FYDA 4WOPA 1UM9A 5CX1A 5JXIA 1GTSA 5FL7D 3PGMA 5GV8A 1R4NB 1G8YA 4CLEA 1UWCA 4RGVA 4EKDA 3MGBA 5KTSA 1CZLA 2W4IA 4ZPXA 1SD2A 2QA5A 1B0UA 4Q66C 3G8AA 5KNDD 5AI6A 1I8TA 3PE4A 4JBGA 2BGKA 2QRQA 1W76A 3RVQA 4YXWD 1VB3A 5G3ZA 4KXNA 2MYPA 3VZBA 3DAYA 5IJZA 2QZJA 4ZT3A 1NZJA 4KTVE 3RYFA 3JQBA 4HPJB 4F84A 1O03A 2C3UA 2P5YA 4DT1A 1GDTA 1ZYUA 1KHHA 1JA9A 2C5LA 1UJNA 4L0DA 5BN5B 1Q5PA 3BFJA 3IT0A 3GPLA 1KZ1A 4YXWA 2KYRA 2O3RA 3SXJA 3FUVA 3AVUA 4JQSA 4OK6A 5FR1A 5IKEA 3M2TA 4KVGA 4FFLA 4Y98A 1XZMA 1TFRA 5E6RA 3IQIX 3H04A 2VLIA 4J1SA 4FMDF 3ZGNA 3EIUA 2ZWMA 1CETA 1TMYA 1GEGA 5DLDA 1T8RA 3FI9A 4I66A 2HDNB 5M7EA 1JFFA 1KDRA 1QPBA 1M76A 1E1CB 2AR7A 3H05A 4Y7DA 4DJFC 3QLEA 3AETB 3HWRA 3U39A 1UBTS 3VHRA 2EJUA 2OGWA 3OX4A 2QJTA 3VKHA 3INNA 5MF6A 2PUEA 4PC2A 1U0BB 2G1UA 1EP2B 5FLEX 2YIJA 5T5QA 3UQYS 4AJNA 5K0TA 3GDGA 3PTZA 4N9QA 4D4LA 4LMBA 4W8HA 3NBQA 2R96A 5DISB 5BSEA 2ZYWX 3PX3A 1VLMA 2ZRHA 1TK3A 2NU7B 1AVTA 3H16A 4G84A 3H8JA 2JC3A 4U6QA 5IH3A 1AM4D 2PRJA 3O7WA 1FRZA 1JLLB 2HY7A 2JASA 3Q1KA 1HT2E 1W6UA 1RRPA 1Q0QA 4F60A 1C2YA 1XV5A 2L19A 2WFLB 3GAZA 5AM4A 1DAFA 2VJKA 3DBRA 3ORFA 3M83A 3LWBA 2XDYA 3GEIA 2EW2A 4AMUA 1QV6A 4BMZA 4O4HB 4PLHA 1NC3A 4ETIA 1H22A 2BELA 1OZ0A 4KP7A 3STTA 2NOAA 4FIDA 4DS3A 4QBFA 3JCZA 4JUCA 2J5XA 4M89A 1RCUA 1OI3A 3RVLA 3WFIA 4HH3C 5CLFA 3AGPA 1A1SA 1MVOA 2GESA 1N2XA 2A59A 3VYRB 4DA4A 2XUDA 1KP9A 2LGJA 4R40A 1T2CA 2Z83A 1P4JA 3GK3A 4RETA 3U3OA 4BBZA 4Z4EA 2W6JA 2QZ4A 2XKJE 5E7QA 2AQ8A 3GEPA 3DWGA 2O4UX 3UJAA 1SCBA 3TLMA 3RGGA 4BB9A 3ZV6A 5BQXA 3P0IA 4NSNA 4EY6A 1EE9A 1EK6A 1R15A 2VPYA 3HUTA 4O4HF 2C2ZA 1QFZA 4R9SA 1ZBQA 5DIZA 1XDWA 3HYLA 3WLHA 3E0XA 4FB5A 4J43A 1P2BA 3QUAA 1R0XA 4Y1EA 2D4HA 2HIHA 4H31A 3RHTA 3EISA 3CA8A 4CM8A 2BLNA 4RTKA 5B3LA 1QHHA 2O2YA 1I14A 3H3JA 4RSHA 2XUHA 3DD1A 1IM5A 3I64A 5JPIA 4Y0AA 4RABA 1Z28A 2I54A 5GWXA 5K3OA 1WSWA 2JD2A 4EELA 1VM6A 3D1JA 1CUUA 4XH9B 4NX2A 2NVOA 4K1XA 4M38A 2AE2A 5AKHA 1V7QA 4MUXA 2Q9UA 5ESXA 2E87A 5CYGA 5CGQB 4BZWA 3ADKA 4L7QA 4OHYA 1F2DA 3CURA 2Y4OA 3PDJA 1CJBA 1LLCA 1CW2B 2Y9PB 3I2YX 1SK8A 2JFZA 1I0ZA 3A1CA 2Q4TA 5UKDA 3EWSA 2IYLD 5J5AA 4BNJA 4NJMB 4RPGA 1GNSA 2D8AA 3D6AA 5CH8A 4CN8A 3ELDA 4GMGA 4IH4A 4RU1A 2P3SA 5I7UA 3EC1A 4K86A 4G0ZA 2B8JA 3X1WA 1MHTA 4OYRA 1XXHE 2RE8A 1UPAA 2FPKA 2VKQA 2QN7A 3ZE9A 4DV0B 3UMBA 1Z33A 2WSLA 1MNQA 3STVA 1LCIA 1UXIA 3E1GA 4GPAA 3PC4A 4MB6A 2GKSA 3M34A 4PC7A 3ED1A 4Q21A 4RPKA 2PFKA 3SIRA 2HADA 2AJBA 4DIBA 4G0VA 1Z06A 2B3TA 2QUIA 2P90A 3QWIA 1IZ9A 1RMYA 4KXYA 3L8DA 5KC9A 5K3FA 1O89A 4P3KA 2ZYSA 1IATA 3HDGA 1TAQA 5IXSA 4F38A 1YJ5A 1W85A 5K6RA 3F8SA 4U7PB 3O0TA 4TVBA 1J5EB 1M6HA 2FZEA 3OQPA 5T6MA 3HVRA 1MJFA 3ZVNA 3HTXA 2ZE7A 3FPJA 4TMFA 2RGUA 2WWTA 3AEUA 3I1YA 2NADA 3PXBA 4NH4A 2H07A 4KZPA 4OJKA 1NU8A 1OMOA 3EEBA 4QGHA 3SR4A 2OV4A 1E6EA 2YY6A 4YWJA 4CI9A 3H8VA 4C4OA 3OFSA