3ZKAA

Crystal structure of pneumococcal surface antigen psaa d280n in the metal-bound, open state
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
278
structure length
278
Chain Sequence
KLKVVATNSIIADITKNIAGDKIDLHSIVPIGQDPHEYEPLPEDVKKTSEADLIFYNGINLETGGNAWFTKLVENAKKTENKDYFAVSDGVDVIYLEGQNEKGKEDPHAWLNLENGIIFAKNIAKQLSAKDPNNKEFYEKNLKEYTDKLDKLDKESKDKFNKIPAEKKLIVTSEGAFKYFSKAYGVPSAYIWEINTEEEGTPEQIKTLVEKLRQTKVPSLFVESSVDDRPMKTVSQDTNIPIYAQIFTNSIAEQGKEGDSYYSMMKYNLDKIAEGLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Imperfect coordination chemistry facilitates metal ion release in the Psa permease.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Metal transport
molecule keywords MANGANESE ABC TRANSPORTER SUBSTRATE-BINDING LIPOPROTEIN
total genus 101
structure length 278
sequence length 278
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3zkaA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3zkaA01
4XPIB 4HMOA 3HJTA 5BVGB 4HMQA 1FP4B 5KOHA 4OVKA 2RG7A 1N4AA 2XV1A 4LS3A 5JPDA 2Q8QA 4G07A 2AFIA 3MINB 3BE5A 2XH8A 3AESB 4WZBA 3LHSA 2MINB 3MWFA 5M29A 2ETVA 3AERB 5JG7A 2WHYA 3TLKA 4WZAB 4ND8A 1XVLA 2XDQA 3ZK8A 5B58T 4TKVB 2M6LA 5HX7A 1K7SN 4IRMA 3AEUA 3K1AB 1L5HA 2R79A 3PSHA 2YNMD 2AFIB 3MINA 1QH1B 1ESZA 1N2CA 3MFQA 3EIWA 4K3VA 1G20B 5M2QA 3PDIA 3G9QA 4FI3F 4M7OA 1FP4A 3ZKAA 1M34B 2Q8PA 1QH8A 1PSZA 2M6KA 4WNAA 2QI9F 5AFSA 3R5SA 1M1NA 1K75A 4INOA 3ZK7A 1L5HB 4GICA 1MIOA 2PS3A 4LJSA 4MLZA 3TNYA 3AEQB 5BVHA 3ZTTA 3AEUB 5JOQA 2WI8A 4H59A 1PQ4A 3CX3A 4WESA 3U7QA 2XDQB 4FKMA 4WZAA 3AERA 2PS9A 4OXQA 1N2ZA 4OXRA 2MINA 4WZBB 3AEKB 3MD9A 5I4KA 3R5TA 2XUZA 4NNOA 2O1EA 4UDOA 3BE6A 3EIXA 1G20A 5CR9A 3ZK9A 2OSVA 2AFHA 4TKUB 1K2VN 5KOHB 4DBLE 2YNMC 4INPA 2PHZA 1QGUA 3HXPA 2XQVA 4WN9B 1KARA 3AEKA 1TOAA 1QH1A 2OV3A 4FNAA 5CX1B 5KOJB 4B8YA 4HMPA 3AETA 5BVGA 5JJ5A 3K1AA 3PSAA 4G09A 5M34A 3UJPA 1H1LA 3MWGA 3AEQA 5M3BA 1H1LB 2R7AA 5GGYA 1M1YB 4H0FA 5BVHB 1MIOB 4MDYA 4UTOA 4CL2A 1KAHA 3LI2A 1KAEA 3TEFA 4UDNA 3PDIB 2AFHB 4TKUA 1EFDN 4XPIA 1N2CB 1M34A 4N01A 1QGUB 4FILA 2OGWA 1G21B 1K0FA 2PRSA 1M1YA 3NU1A 3GI1A 4TKVA 5KHLB 4MX8A 4BBPA 2X4LA 5HDQA 4NNPA 4PAGA 1N4DA 4ND8B 3HH8A 4UTPA 3AESA 4WESB 1M1NB 3U7QB 5CX1A 4MO9A 4PM4A 4HN9A 5FLYA 1G21A 3AETB 2XY4A 2OV1A 5GGXA 1QH8B 5KOJA 4WN9A 4WNAB 2PS0A
chains in the Genus database with same CATH superfamily
5K8IA 1JG7A 4GXQA 3BGSA 4L72A 4MVJI 1SC6A 3VSCA 1UZLA 1NKTA 1E1MA 2BEUB 4M0EA 5K0NA 4G2TA 3SQXA 2DHEA 3EEFA 2ODBA 4RIFA 1QLJA 4P5DA 1C7EA 1Y6ZA 2IZ7A 2PA3A 2Y93A 4EYQA 1J0XO 4XRRA 4C29A 1V45E 3C24A 3RB8A 2VS1A 2WTAA 5EG5A 3F7OA 4LOLA 4BY9E 1DAHA 5BQXA 2CYBA 1JDBB 4IUYA 4K6GA 3DP7A 3GJTA 4JVNA 1FEZA 2VJDA 5TMBA 3VXKA 4F1WA 1ZRSA 3NWBA 3GPBA 3U3OA 2VAMA 3BZWA 3HCCA 1Q22A 4JYAB 2QTHA 1T24A 5DHTA 2FKNA 2JFWA 4GKKB 1UMCB 1YJQA 3TMYA 2BMVA 4LBZA 1GPH1 3QUTA 1O96A 3RFCA 1KAMA 2IGBA 4PC2A 2FN7A 4I1OA 1QZTA 2QMUA 3W34A 4CV1A 3CCBA 4XJVA 2W4IA 3WK5A 1DBQA 3PPIA 1IULA 1DEXA 2XMGA 3GFTA 5IN5A 2QGFA 2QI9F 4C2UA 4KX3A 4BKPA 1ETUA 3R7DA 3SR3A 1MVOA 4P3XA 3URMA 1XJWA 4KGZA 1N2SA 3UJ7A 4V0LA 3TI9A 5E1MA 2XMDA 3ZGXA 1FDSA 4B0OA 2ZRDA 2QN9A 1WB4A 3UFXB 1OI4A 1V8OA 4HNSA 4N0EA 3ZI0A 2CDAA 2QN2A 3SLGA 4R1NA 1Z8NA 4LXXA 4R2HA 2YOHA 5AM4A 1Q7EA 4WACA 4FDUA 2BM8A 2ZJ0A 3GDHA 4OQXA 3AOGA 1CE8B 3NEYA 1VL6A 4MW1A 4EG3A 1Z13A 4RVGA 3HKDB 4TKUB 1NE2A 4ND5A 4E09A 1VE7A 4CIBA 4DFDA 3K5IA 3KQQA 4LIPD 2G8NA 5JQWA 1SCAA 4OMUA 4X84A 1JZTA 3ZV4A 1WXFA 4EY3A 4FZRA 4EGSA 5H59A 1V26A 5KTMA 1NATA 4QFDA 2I2BA 3AETA 1ZZEA 3A6ZA 4DV7B 3C15C 2QVYX 3BBLA 2V7GA 4G1VA 3D3NA 4ER5A 1ZXXA 4EKIA 1E9AA 1SUSA 2C95A 2G0AA 2JGKA 2QZPA 2UVQA 2UZ1A 3DKVA 1HSOA 3R0XA 3KO8A 1MQAA 2J9GA 3JD4A 4MW6A 4YAJA 4K86A 3LAWA 3I2KA 1S96A 2AQKA 4AMZA 2BEJA 4IMJB 3TL3A 1NJ8A 1XA0A 3L05A 3TEFA 4N76A 1SUPA 4PYMA 1I7DA 5DIFA 2A86A 2P5SA 2GARA 4AYWA 3E22B 4MR8B 5LN1A 2HIGA 3MB5A 3O8DA 3PNQA 4EZEA 4Q00A 3VKVA 3U19A 3M4XA 4PG7A 1XKQA 5B3AA 5DX1A 2W4MA 4OUDA 3ENZA 2QN1A 1YCFA 3ER8A 4CTMA 2HQ1A 1QC5A 2ZATA 4IMPA 3MNFA 2ZSKA 1XRSB 4S1NA 2G04A 4WUTA 3FX2A 1QPBA 3OKPA 2F59A 3AESA 1RJGA 3QFCA 4BLOA 4GOOD 4YUXA 1AUOA 2CNOA 4DCUA 5AW9A 2VIIA 1DV2A 1E2UA 3GJ6A 3WADA 4WL0A 4MRSA 1ZH2A 3LYUA 3H6HA 1NU8A 1JP7A 4WEOA 4E30A 3DGEC 1JMYA 3WDKA 4JVLA 3MC1A 2MIIA 2XRMA 4DMKA 3SY8A 2H00A 2LR0A 4GOLD 2OAGA 3NHMA 3P52A 4GMHA 4YC7A 3LY8A 3R5FA 2HD4A 3OZCA 1G19A 1V9SA 3KTDA 1O1YA 3RVSA 4FU0A 3N2KA 4ZVQA 1UJ6A 5C1IA 4KLZA 1X1EA 2LVBA 4YQYA 4DA0A 1U28C 3G5MA 2IYRA 3DYIA 4FGKA 1A9OA 4FXPA 3CKKA 5A7FA 2FPRA 2QAJA 3AEUA 4DF3A 4F2DA 4CLOB 3B8HA 2ID9A 4RM2A 2YV4A 2YUIA 3W5UA 3QVOA 3FTDA 1KY4A 2WZCA 2GXQA 3QXGA 1Q6YA 1G20B 2HXGA 2VXOA 3AG5A 1KH1A 4HDNB 5B3LA 3K0SA 1YB5A 4PCLA 1MVLA 3DLAA 2ZRKA 1NPYA 2P6MA 4DG9A 4MKHA 3RDPA 4W5RA 4G4SP 4B3HA 4YP6A 3IEVA 2P5YA 5CDFA 2YR0A 1NUUA 4RKYA 1ULHA 2R7LA 4E2YA 3H04A 3ZHOA 2CJPA 5C81A 4KXXA 3LVFO 4EUHA 5DASA 3WBBA 2R7KA 4LY3A 3ZXXA 4DA4A 1N7HA 3LFUA 4DGSA 1Q2XA 2GM9A 1WQ4A 4CKZA 4KYUA 4RQBA 2ZI5A 2I9KA 4UBMA 3GJ0A 3BGWA 4ZAYA 4BNKA 2JFNA 2R60A 4E6PA 5CAEA 5AKKA 1IHYA 2EBUA 3HGMA 1CDDA 3PQEA 1RWNA 4PIPA 3JQAA 5AI0A 3ZGNA 4U9IS 3Q7PA 1EJ0A 5HJ5A 2Q3FA 1MQ9A 2IOYA 2ZPAA 5FHQA 3ZU5A 3MLAA 5AQ1A 4UDYX 5D1HA 2Y2VA 1E2FA 4NH4A 3I5AA 4U0KA 3P94A 2CFTA 4JJIA 4ETWA 4ZK6A 2D7DA 3ISTA 4N65A 1Z3CA 2QRMA 5F35A 3PFIA 4ZXPA 2HTFA 3HMQA 1W5AA 4TTRA 1UXOA 3UG6A 1ZAYA 3ILHA 2WBLC 2JLBA 5DI3A 4PYRA 1C3OA 1ZPDA 3A2NA 4P08A 3RG8A 3TLAA 4JI8B 2E48A 4DWOA 3DVAA 4IZ6A 2PUVA 3WWOA 5C4GB 1LPOA 1PUIA 1BQ4A 3DOOA 1PK7A 2H65A 2LKDA 3I3SR 1APBA 1Q19A 2INGX 2AA3A 2VK1A 5CLIA 1T8PA 2A94A 2YICA 2ZUSA 1RAEA 2HDNB 2POQX 3WAJA 2LP4Y 2PRIA 4FFWA 1NYTA 4OHUA 3DB1A 1VJ5A 3NXSA 5JCPA 2FZKA 1C1HA 2HBQA 1P2SA 3SLKA 3KALA 1FLNA 1PTJC 2PCLA 3PD0A 4YBZA 4IIJB 5EKUA 1F8YA 4G4SO 1Y3FE 2H52A 3TE6A 5JE8A 3H4VA 3VKGA 1WXQA 4BCCA 2B1GA 2J3KA 2AI3A 1QX3A 2HO4A 5CA0B 5B2FA 3PTLA 3LJKA 3KSRA 1JWLA 1HDXA 2FDRA 1PR5A 1ZOOA 2X4DA 1M2JA 1U7HA 1TKBA 1GNTA 4JLWA 3UK7A 1BX3A 3AF5A 4RW0A 1T0JB 1RM4A 1NM5A 4GMFA 3BSSA 4J43A 1XCJA 3J81k 3RO7A 1YI0A 1KVUA 4Y1GA 4G4IA 1BZYA 3PEEA 1DSSG 4XM0A 3Q0IA 3NHSA 5FUQA 2EW8A 2ZJ6A 4IIYA 4L6CA 3I6QA 3SP1A 2ZJ8A 1TK9A 3FCOA 1E3LA 3RKUA 2VP2A 1BXRA 3F98A 5FWNA 1EK1A 4V0QA 4XD2A 5DM60 1FCJA 2D0DA 4HHEA 2AJLI 1X7YA 3UATA 2R9VA 4IHAA 1P0PA 4QL3A 3Q8KA 3VZPA 1KI6B 5C8YF 1KK2A 3HYSA 2XCRB 4P3OA 2B83A 4BO2A 1UJNA 1EG2A 2UUCB 1U1DA 2BF4A 1RZRA 3S28A 4EGAA 2OENG 3A36A 4LWQA 3AKYA 1L5ZA 3UJBA 3PEFA 1F9AA 3VPDA 2XF8A 3FCUB 3RHTA 4BMCA 4TKLA 1PYGA 4YAKA 5BWBA 4EJ2A 2I6SA 4G5QA 5HEKA 1I36A 2J7PD 1EZ1A 2CDRA 2OXEA 3GGDA 4X20B 2A35A 4WY8A 4K7JA 4R1PA 2OZKA 1U7UA 4H7HA 1M0SA 1W1UA 2BWJA 3EIHA 4BO8A 4HB4A 3OZWA 1MXHA 1QZUA 3ZVKA 2JIOA 2AZMA 1KY2A 1KWKA 4BVHA 1I5OA 2HMVA 3BD9A 5E6UB 3NEAA 1XBTA 4ZT2A 3SR4A 2BMDA 4MV6A 4H1WA 4QQRA 2NIPA 5DXFA 4C14A 3ICWA 5CR9A 5FWAA 1T26A 1E3WB 5L3SB 1A88A 1GNSA 2R7MA 2O3TA 1H6CA 1BHQ1 1CQIA 2UVDA 2YVKA 5AK3A 2OB1A 2DR3A 4Y98A 3UT0A 4BATA 4C7VA 1DHTA 1DDOA 1UJCA 4K0RA 5IDYA 2XF2A 3CH4B 3KX2A 3R5KA 4XRGA 3CNQS 3UQYS 1SCDA 1C4XA 1SD5A 1Z75A 2CXXA 3L1HA 4P7BA 1HDYA 2VP5A 3NGXA 1UFQA 5F2NA 2ZWVA 3GA5A 2CGEA 4Q24A 3PU6A 3UFXA 4EP1A 4DR4B 5IH3A 4JK3A 1E4YA 2OLKA 4NU5A 4D6PA 1W2GA 2REOA 4Q4HA 3UJAA 2LBPA 4AW9A 3GAMA 2Q41A 3TFOA 3KB8A 3A9SA 2YTZA 4F12A 1GZ5A 3P2IA 5DWQA 4FPXA 2A0YA 3GLFE 4ALKA 1CS4C 4LK2A 2V0GA 1H2BA 4CIWA 4JMPA 1KYVA 2G17A 2GK3A 2PL3A 3DE3X 4WKPA 3PCXA 3ABQB 4OHZA 1ZI8A 1H5UA 4C6SA 1J09A 2BUCA 2GNOA 3GXBA 2DTEA 4GM0A 1W4RA 2YFYA 1AXRA 2G07A 2VHWA 1LDMA 2C2WA 1WB5A 5J4YA 5LM3A 4LF9B 3O1HB 621PA 4KR2A 2A92A 3WL6A 1EDOA 4A9AA 5A03A 2XMZA 4LFCB 5BV0A 3KAPA 4YCLA 4UHFA 2BR5A 3QPAA 4LQLA 3HH8A 4BJ1A 2Q5HA 4M8NE 1EDDA 3Q85A 5EZYB 1LPSA 4R2LA 1RHUA 5FI1B 5JEEA 1JA1A 3ND6A 3ZTWA 5KYXA 1KNQA 3FNBA 4FOLA 3DYBA 4UU8A 3VYRB 4B8WA 5ESDA 1XHEA 4IFEA 3ELDA 1MNQA 4G23A 4MVJP 1N1DA 2BHRA 1PX0A 1OU4A 2HADA 2HLDA 2NW6A 2PT7A 3HJTA 3AILA 4GECA 4HD8A 4YJ2F 3NAZA 4R1MA 4DZTA 3A58B 3JASB 5EFZA 3MZ0A 4QULA 3NHPA 4ZDIA 3P96A 1XTQA 4KRYA 1YUMA 4Y2GA 1WPRA 3D0QA 2QZ4A 2ALJA 2P3QA 5JMTA 3RPEA 2CVFA 1KVTA 4G8JA 4C78A 4OUKX 3CVXA 3BOSA 4M86A 4UNRA 1REQB 2ZETA 3MJCA 3EOAI 5TT1A 2GETA 3HCAA 3OQVA 3S99A 5BN5A 1DJNA 4LJLA 1U90A 4MRMB 3A27A 1FBNA 2YX1A 1UKVY 4Q9DA 4Z7QB 1IJEA 1XJQA 2DAPA 4UUBA 2QSUA 5LQRA 4PTLA 1PNRA 2P77A 1C7RA 3A8TA 4TT8A 4YDQA 1VLZA 2E6KA 2W8ZA 4PAQA 1KL7A 2QJOA 2PH1A 3BC1A 3A1CA 1VG1A 4H6VA 4JT4A 3B3JA 3I4LA 3TTWA 3HR7A 4GYYA 4J1QA 4UE2A 4ALMA 2HSWA 5JQGF 3REFA 1LSJA 2C9CA 2OR3A 2OBLA 2PH7A 4NCJA 1L5FA 4RPGA 1A7UA 3KV3O 4FMDF 4Z8XA 1RQ2A 1TYDE 4J0JA 2AOWA 3COVA 1I3OA 3O90A 4DZZA 1ZO8A 1HG1A 4U3JA 2CKDA 4UUQA 2Q5QA 4ZI7A 4P93A 1KJNA 2C0CA 3TW4A 3P9QA 1SKYE 5EUMA 4ARCA 2XXAA 5K8UA 1WCIA 1OX4B 1NN1A 4X1KB 1VBNA 4PFSA 1HDGO 5I3CA 4I2VA 2KB0A 3T5DA 4MW4A 4EEXA 4UQPA 2OYCA 1JQJC 1OXUA 5H4HA 4F38A 3G2QA 5HKAA 2NTYC 3D4LA 4E51A 1KYIA 3ITDA 1C30A 3HA3A 1OIXA 2CWDA 1TUBB 1XTBA 3TSYA 5M5BA 3SZ3A 4Q3EA 3B5JA 4CG2A 5LQJA 3RC8A 3FIJA 4N3CA 3E5MA 2Y71A 1NW9B 2XQFA 2ZS9A 3DR5A 2ZJ1A 4R8VA 4CM7A 2GA8A 3OX2A 4LRQA 3O94A 1DUIA 2IXGA 2WF9A 4LPKA 3SU8A 1QNFA 3DKRA 2QLFA 1VRVA 4IFIA 4U6SA 3SZGA 4F60A 1XZNA 4N4AA 3OOSA 3MELA 3AXTA 2EXXA 4A4DA 2QE7D 4Z1MA 4DUGD 3ICQB 4H6WA 3WYDA 3ADOA 3LQFA 4OHVA 3WGLA 4EFKA 3DV0B 4BLTA 3RTAA 1V7PC 1TE2A 1R18A 5T4HA 1XEXA 1NYLA 3JQPA 3NETA 1OGYA 1ZCZA 4Q3LA 5ESWA 1PYDA 5TDHA 3KWLA 4Q4LA 3MQ2A 2BGWA 5MN5A 1UP7A 1CV2A 1XJ5A 4MZDA 4L95C 4QO7A 2WA1A 3VM6A 4AN0A 2CY0A 1D2RA 4ZMBA 1BVHA 2FR8C 5EWLA 4B74A 5HOQA 5LYYA 4ZGBA 4LQDA 5J2UA 4B3XA 2VWQA 1C7JA 3L6EA 4I50B 4U9UA 2VT2A 5AI4A 4YV2A 1TM7E 5I6DA 1MU0A 4MUAA 1AS3A 4ITUA 3K9QO 4OQMA 1ZA2A 1YI8A 4BEWA 3WLRA 4ZI3A 1G6KA 1GGMA 4K40A 3SJUA 4M1KA 3OMWA 1VCMA 1QTRA 1GKYA 5JH7F 1T5OA 1HV8A 1Y1QA 821PA 2OQRA 2BR3A 2QNIA 3KLBA 3ZXUB 3Q5EA 1JS1X 3OE7A 1NBMD 3AW9A 2BISA 4G85A 1SAYA 3L7JA 3RFTA 3RV3A 1E60A 5ADVA 1J8DA 1A9SA 1GARA 1JXOA 1T5HX 3QKIA 5J9FA 2GEVA 3SE7A 1JECA 2ZGVA 2H85A 1ZYUA 2DTDA 2GN4A 2B3TA 2R5WA 4K8OA 3EQ8A 2XECA 3D2LA 3QZUA 3VTAA 3LQ2A 3TRFA 2OHOA 5FRDA 2BDEA 3PDJA 3GNSA 1PZFA 2DBRA 3HXMA 3M5WA 5DRTA 1PGJA 3RRXA 3ZK8A 3ESCA 3QPCA 4RH3A 1J21A 3LCMA 1AGXA 4OHWA 4OFXA 2O2HA 5HZKA 3CRVA 4W82A 2Q0QA 1DI0A 3N2LA 2Q1YA 4MR7B 3IV6A 1HT0A 4J3JA 4D81A 5AD1A 2I6TA 2R25B 2HA7A 4GP7A 2HOQA 2QM8A 4QVIA 3U60B 1PJAA 3QMMA 4D4GA 3C3JA 3ZD8A 4F5ZA 5KNBD 4LPSA 2AOUB 3HKBA 4YHHB 3W5SA 2JJMA 2DFVA 1YFLA 4IDNA 3D4PA 2FQYA 2M6KA 2GZSA 1NVXQ 5D85A 4X66B 3DWGA 3JQFC 3E9ZA 4K9MA 2B36A 4YPVA 1NX9A 2D1SA 2LWIA 1R15A 3A0UA 2C9ZA 1AKVA 2AEEA 4FEAA 1JX6A 3EMVA 4TLBA 3V80A 1E2EA 1ZRHA 1P45A 2XPCA 1N0UA 2D5BA 3E7WA 4AZ3B 2QPAA 3LT4A 6LDHA 1CNEA 4L22A 3L8HA 1KP2A 1OAAA 4IVNA 4OSOA 2PWBA 3T7AA 2BGJA 4P31A 4IM7A 1Z2AA 3C6YA 4GVXA 1QHGA 4DC1A 4DT1B 3NBUA 1P1FA 3TTXA 3G9XA 3QPWA 1D0SA 1E5VA 4HEHA 2YNMC 5IXYA 1G8YA 3EZFA 4MRRA 1D2MA 3QF4B 3BTUA 5B1IA 5CCDA 1OB5A 1UJ2A 3AEKA 1TPZA 5DNUA 1S9HA 1UMBA 1XWFA 3CYFA 5CVDA 4BFCA 3GLRA 1UWVA 1ZL0A 4NU6A 1D6MA 3DHNA 4O4IA 1O94A 1QO9A 3H4MA 2QROA 4UUMA 1LWOA 4PU0A 3IMFA 5GONA 3WL3A 1NDHA 5DM4A 2DXIA 2JGDB 3C2QA 3H1BA 4BKMA 3BEOA 2LZ0A 2EU8A 1UDRA 1A8PA 4AZ0B 1N92A 1XUOA 4EUEA 3L8DA 3FJOA 1AN9A 4L0DA 1T9GS 4RL6A 5T3UA 4MP8A 3CVYA 1W93A 1ONPA 3ENNA 3I8XA 4BNDB 5A02A 1WE2A 4QUHA 1KZHA 1KOGA 4DIEA 4JSYA 4ZAFA 4HDNA 1VL5A 3CUWA 2WJAA 1J07A 2VFAA 2G9QA 1XRNA 3E03A 3TOVA 5IWAB 1FQOA 4TXJA 5AUOB 4D92A 3FDIA 3O75A 2NO0A 2WWYA 3TZHA 5A5FA 3L6DA 1T5TA 3ZU2A 4CU5A 1RSZA 1GGHA 2XVYA 4I9FA 5LLSA 2IBTA 3QELB 1L4MA 1N4DA 3IJRA 1WABA 4EG7A 3BD7A 3DUWA 2VK4A 5LWQA 2BGNA 5IABA 3PQ7A 1W85A 1YGYA 3A06A 3GLIA 4Z9FA 1K98A 1CU1A 1F0PA 3WFZA 1YU6A 3HWWA 4I50F 1U2QA 3GLUA 4J0QA 4ZOAA 3BD6A 3FUXA 3NYQA 4V0MA 2MYTA 2XRFA 1VGQA 1QYWA 3DA8A 5HFNA 4D0GA 1U3DA 1DMSA 1PT8A 1OAOC 1QUFA 2PKXA 3HNPA 5T8KC 2Q8QA 1YACA 3QEMB 5DOVA 4ZVRA 2ZIAA 3TQTA 3DO5A 2O5VA 4KN5A 3W6UA 4UATA 3BXEA 1Z6XA 2E7ZA 1Y3IA 2F43B 2PZJA 5JXJA 3HK2A 3L7AA 5THXA 4C1BA 2DHRA 2DKFA 1XE3A 1YJ5A 1FQJA 3AF4A 3T3NA 1WDLA 2QW0X 3CX7A 4I9HA 5HZHA 1Y1SA 2XMRA 1VSTA 1EVLA 1FLVA 1LSSA 4IUDS 4CM8B 4MS3B 2E6UX 1ULTA 3VVBA 4X54A 1BROA 1RKVA 3G2PA 3GW8A 2QRVA 2ZUFA 1ECGA 1H8EA 2ZRCA 2OV4A 3MWYW 5KTSA 4C0JA 1XKTA 3HBMA 5LQDA 2H1HA 4E1BA 1NQTA 2OD7A 1TZKA 5K3DA 1S01A 3T95A 4RS3A 2YCBA 1A9PA 2CLEB 3UO8B 4KRXA 1L7AA 3PNMA 4HQNA 4L7QA 1SRRA 1JLLA 2W22A 6NULA 4B81A 2PS1A 3CXRA 2YZNA 1ZKMA 4KZKA 1WL8A 3LCRA 1S8OA 5D51S 1DHRA 4F2WA 3WAGA 5FF9A 4LMRA 1EUCA 4HPJB 2IW1A 4HSGA 4O08A 1QJ4A 3ASZA 2IUYA 1JLLB 1UXIA 2R8XA 3C7DB 2IF2A 2P2NA 1DZIA 2WK1A 2X15A 1DT5A 5DGXA 4I6GA 4MGEA 3HG7A 3QBTA 3R5TA 1F2VA 1PT7A 1XO1A 1Z5PA 2PLWA 2ZROA 3SXJA 2ZR8A 2HRQA 3MMNA 4IF4A 3FOEC 5JNUA 3SIPA 5JWOA 5LNK1 2XNCA 3ZE6A 4W9NC 3RS7A 1GEGA 1Y5LA 4J07A 3WOHA 1C2YA 1OFUA 1Q7GA 3PC7A 2BPOA 2AGVA 3FI0A 3K6SB 2JBWA 3KDSE 3D6FA 3EX7C 3HVIA 4ZQFA 2XADA 3MWGA 1CUWA 4PSVA 1C3VA 3T94A 3ZQJA 5AW2A 4X3CA 2DQZA 5AKEA 4D9EA 1H4VB 2E4YA 4HGRA 3PFKA 4O4HB 5BWNA 4GSLA 1L5YA 1QHNA 2C5LA 2WWFA 3K6SA 3F5QA 2WDZA 4I9UA 1CZHA 1I6LA 2Y1EA 1DCKA 5AXCA 4FEYA 1IN8A 4RADA 3S2YA 10MHA 5EMMA 2J07A 4Q16A 5IKPA 2HUPA 5T7BA 3DMTA 1G17A 3CR3C 4EUKA 1GSIA 1RACA 4EFDA 3EVGA 1STOA 1R5BA 1SOWA 3CIFA 5FNVA 3CC8A 3F5MA 3YASA 3THOA 4P0QB 4RSMA 3LT2A 1Z2CA 1XG5A 1CEQA 4P0PB 4NH0A 1CSEE 1JR2A 1U9IC 2XR1A 3VR4D 5FTMA 1GOTA 3AEZA 4WT7A 1K2WA 1M2VB 2WY2D 4BMSA 3DOCA 2GJAA 3EZGA 4KQJA 3S8YA 2JLZA 1SG6A 3M9WA 1ENZA 1JHVA 2AYZA 3FSRA 4RY2A 5C51B 3KCQA 3BF7A 5IT5A 3OVMA 1PL8A 1XI2A 2Q3HA 1J2JA 3FMIA 1UPUA 4UU7A 1ECJA 5ITZB 1VLQA 3DULA 4LISA 5IVDA 2BW0A 2A59A 3GDWA 4YB8A 1OW3B 3GF4A 1LUAA 3IURA 3A6GA 3D6VA 2NACA 1HI9A 4V1CA 1PQPA 3KTOA 3F8TA 5EJGA 3ILSA 3DE2X 4O1IA 2ZRAA 2P4EA 2YASA 2VOEA 4UQLA 4YRBA 5LU8A 4BWGA 1U3FA 3Q6NA 4QQNA 3P2EA 1N34B 2H1FA 4BO9A 1J2EA 2ZRNA 3ZVNA 2X8JA 4B71A 4GOKA 1M1YE 3GCXA 3C48A 4MWGA 1T29A 4HRYA 3NT4A 4TKVB 1YS9A 3O47A 4JUFA 4LJAA 1K8RA 2AJTA 4ZP1A 4BGVA 4R1TA 1XWIA 1A77A 2WAAA 3ET4A 1QFZA 4FOTA 3IMGA 3A9CA 2HK9A 4HNTA 5L3QA 1WXHA 2HU2A 1K0UA 3D7MA 4GF5A 4PC3A 1U28A 4KAJA 3JX9A 5CGZA 3NHKA 1THGA 5HF9A 1MOPA 3I9JA 3F47A 4EHHA 5FBVB 2OV6A 3PC4A 5CX4A 1XNHA 1QU3A 1DIOB 2TECE 3U9SA 4YI3A 5L3QB 4N8SA 1UPXA 3C1TA 4GMKA 4D3XA 4ERNA 2O8DB 4R8KA 2Q3DA 4MLZA 3GQVA 3UJ3X 3D4NA 3K0KA 2PX8A 4LNUB 1AZLA 1EFRD 1R9MA 1J20A 2XTJA 1Z4JA 2B7CA 1QGDA 1CZNA 1C14A 3OCXA 3T3IA 3H4IA 2Q46A 3VH1A 2VYQA 4TWZA 5CVUA 4EB0A 3LFHA 1G42A 2DWCA 1C7ZA 5DHFA 4DZRA 3WLSA 4QDKA 1ZCFA 1X80A 7YASA 2JATA 2O3JA 1U6IA 2FMKA 2PMKA 2HCRA 3IR5A 2WF6A 2UYGA 5FAXA 1F8UA 3D8TA 1Q50A 2F9FA 4JJKA 2QRQA 4US0R 4KB5A 5IAGA 1UMCA 5K0SA 2O8CA 3T3PB 2CL7X 1SA0B 4FNGA 1YTUA 1OLXA 1Q0LA 5EP3A 5DN9A 3USCS 2JG3A 3LBHA 4IGKA 4OHMA 2HLHA 5B1HA 4RGYA 1DKNA 3IUMA 4W5OA 2ZSDA 4MVJG 4HRVA 4QRIA 1ORTA 3TJRA 2VHVA 4MQLA 4MVJE 2Z6UA 2VJLA 4NYMR 2GILA 3B1JA 8LDHA 5B57C 4MW0A 4WQMA 4G5RA 3I9NA 2P2DA 1C7FA 1S5PA 1U8XX 2OOKA 2WTNA 4OB7A 4Y2TA 5C34B 1ZFNA 1L7OA 4DV2B 1WX1A 4D9NA 2HK7A 1XAHA 4AT1A 1E2QA 4N8EA 1E58A 2D8AA 1HY3A 4R1LA 3ETHA 4HVAA 2ODAA 4J6EA 4ABYA 2IP4A 4HL6A 3KXKA 2P40A 1N5MA 1BU8A 3T9AA 3E5RA 2EG5A 3DTNA 1VHLA 2WQ7A 2R85A 3KNZA 1G7RA 4JVSB 5IJ0A 5EQFA 3JVIA 3NORA 5B6JA 3VPGA 1NOKA 4WA7A 5EPEA 3L06A 3H1PA 3P20A 3ZI7A 1D0IA 3EW9A 1PFQA 4B35A 2EFEB 3E8SA 3I30X 2HMSA 4GQAA 1QFJA 2J41A 2Z04A 3LBNA 2XZPA 2GEUA 1CHNA 2E21A 3HDJA 1N6KA 3MWDA 1JHUA 5CA0F 5JMOA 3V1NA 3ISVA 5BPHA 3LF2A 3C14C 3F9CA 1E1RA 1CFJA 2VP0A 5CJPA 3B5EA 2OORC 4ZYVA 2ECQA 4GU5A 3DBRA 4YQFA 1CY8A 3QA3E 2O1XA 4UNQA 3SHVA 5BMOA 2HGZA 3NTRA 2Y1KA 4NE2A 3MJ4A 1QE0A 2DC1A 3I32A 4IIXA 1YS4A 1HE5A 2WJ6A 4F71A 1V5IA 4HWRA 3L0YA 3BHIA 3VH2A 4BV2A 4ESOA 7MDHA 5LQNA 5CFPA 1IJBA 4A92A 2I67A 3O92A 3SJZA 4J7CA 1M6NA 1BEEA 4OKIA 4CVNA 3ZD6A 2JAOA 3LKVA 3VOAA 3WNQA 3I9OA 3RYCA 4PEVA 4WXYB 4CN9A 3U5ZB 1FFGA 3AY6A 4ASUD 1OV4A 2GM5A 5IEJA 2QWXA 3ZDRA 3T7TA 2YNMD 1PCXA 3IB3A 2GHTA 4N12A 1YZFA 2EG9A 4ZICA 4CM6A 4YT8A 4LX8A 2R2GA 1V8DA 2HMTA 1KZ9A 4D25A 4IDHA 2YFQA 3BQ9A 1GPLA 1L1RA 1R9GA 3VAYA 1TTHA 4MWZA 4O4HA 4CM1A 4E5VA 1W88B 2IKQA 6YASA 2O4CA 3OSUA 2NQ8A 3JQAD 2ZSIA 4LE0A 5G0WA 2X86A 3H18A 5CU7A 3IDSA 1QGZA 4GLBA 3UM9A 5JIBA 4G4GA 4HRAA 1X8LA 4IQ8A 4UHJA 3IGFA 5EMJA 3VOTA 5JW6A 2IPXA 2XHZA 4BGDA 1FRVA 2GKSA 2C1XA 4P6VF 4EB6B 1PFWA 3TW8B 1G59A 4GX1A 3V1UA 4PYJA 2O1EA 2J3EA 4NESA 3VU0A 4GBMA 3I61A 4WNIA 3A7EA 1WUTA 1ISMA 4PNHA 5BSUA 1NY5A 4DA7A 2QNBA 2C03A 3BX1A 5J1TB 4EJMA 4NXNB 5GIPE 1Z6ZA 4KBYA 4JJ6A 1GL3A 2I80A 4PINA 3BH7A 3HB5X 3WHLA 1CUAA 5CDYA 1U8CB 4WJLA 3CGGA 4BKUA 2JVKA 2AEMA 3JW8A 1ND6A 3M0EA 1BH2A 4RWZA 4P8RA 3CX6A 3FPHA 4LFAB 4ZVKA 1M7BA 1ZY2A 1Y34E 2GPTA 3VU8A 2JHPA 3OURA 1TMKA 5FWXA 1KIMA 1CD5A 4FE3A 3DS8A 4MUHA 2UUPA 3W4JA 4AN4A 2I7XA 3H4TA 4CFZA 1E8NA 1JSLA 4IV5A 3MAGA 4AMVA 4AXBA 2D2XA 4DYDA 5AW3A 3VSAA 3PITA 4HNVA 2PRJA 3L92A 4L4RA 2J3HA 2ZB8A 3G6KA 2FI1A 3UT5B 1RZVA 3WIVA 3FGPA 1S7GA 5IP5A 1KC3A 4BN5A 1RWKA 2IEBA 2PRSA 2FY8A 3KTAB 1JT2A 4H7DA 3V34A 3IQEA 4EQ6A 1OTHA 3VR4H 4TKVA 2CHGA 5H4GA 2QQEA 1BJRE 3IDQA 4HDCA 2QLNA 1NDQA 1CIVA 2WIFA 1WY7A 4KSBA 1ZIPA 1MO3A 1S0UA 1PT6A 1U7DA 2C4NA 4Y1FA 5DTEA 4MEJA 4CV2A 3PXUA 2BY4A 4O63O 2P8SA 4BE7B 1Z0AA 2JZCA 4PC1A 4PZLA 2AXQA 4RENA 5J5AA 3DDNA 1A9QA 1Z7YA 4NU0A 5LQKA 4BQQA 3NIDB 5AVQA 1FNBA 3ADKA 2F2TA 1TYCA 1RJEA 4R0NA 3N2ZB 5ESRA 2UZ3A 2PUBA 1C9YA 1V16A 1Z8HA 3G59A 3WLEA 5KOIA 5BSTA 5KO2A 3KSZO 2I4IA 3EIQA 3V48A 4OU4A 1D4FA 2IZ6A 1YR7A 4ZYYA 3WYGA 4C08A 4KH1A 1I4LD 3P71T 3DLBA 1UBMS 3CSDA 2L69A 3TZ6A 1Y37A 1UZMA 2AUTA 1AZTA 1M2WA 2LV8A 3OZDA 3O1LA 2LKCA 4XEUA 5FPTA 3S29A 4R01A 1DJQA 1PZMA 3GUHA 5IM4F 1LU9A 4QQFA 3TF5A 1CR2A 4O4JB 3C87A 3NAMA 4MW9A 1BVYF 4WY2A 3U1TA 4J9UE 2XNJA 3UUEA 4J3NA 1ILEA 2NZ8A 1SA0A 2JAUA 4Q9LA 3FROA 1UEJA 1GPDG 3GJ8A 4ZMSA 5IVHA 5FL7A 2Z5LA 3RSZA 1T3SA 4ICIA 2Z6VA 2X77A 1Q83A 5M2QA 4FOPA 4QWMA 1DAFA 2WPDA 3WLQA 4F9TA 2IYPA 3TJMA 3CISA 3OMLA 3WTBA 5FV4A 3CZ4A 1OH5A 4KAAA 2W7TA 1IN4A 2GJSA 2GVNA 5IAKA 4NMHA 2WP8J 2JLQA 3TQFA 1JPJA 2GD6A 3UWSA 1YL6A 1DC5A 3ZK7A 4YJHB 3I72A 5HNKA 2P4QA 2RHLA 5JOQA 1K8QA 2VLBA 1GFWA 3IAEA 4MGYR 4PQGA 4QJIA 2W8BB 2O0LA 3V55A 4AWBA 2LIPA 4I50A 1N6IA 4CL3A 4ALJA 1XLTC 2D4HA 2JCSA 2GF9A 2NV6A 3IQIX 3RODA 4WFIA 1YQWA 3INRA 3IOCA 1T35A 1N2XA 1JJFA 4M3NA 4BX0A 1BX0A 4U1RA 4RMIA 5D5HA 1EESA 3OPYA 2O8NA 4RPHA 5DBGA 4B9AA 3NTVA 4MUGA 5KNLA 1DIAA 7MHTA 3P4XA 3QOWA 1ZW1A 2MSEB 5GIOE 1DRVA 3R74A 4LVNA 4G67A 3E6AA 5J2TA 4G1MB 2A4KA 1C0IA 1HLFA 2ZUVA 5HXAA 1SIBE 2IEYA 4I55A 3KLNA 3PWZA 1VKNA 3GJRA 3OCVA 4PBTA 4ZV7A 4D42A 3EDOA 4H9GA 4P32A 4AG6A 3A6FA 2QW1A 1SC4A 2OHIA 3N39C 1KERA 2NVUA 2Z5GA 2GCEA 1BA3A 3NPMA 2JAWA 3FUCA 4YLYA 5B7QA 4Q0MA 2QU7A 1Q95A 1ATIA 3ZE2B 5FBKA 4BNMA 4OAOA 1RXVA 2XYPA 2GTPA 3FBWA 1L5GB 1GPBA 2PY6A 2V58A 3EAFA 3USZA 4ZFNA 5KIAA 2X2FA 1CUDA 4C04A 2QRVB 5BNWA 3PIRA 4JDUA 3P8ZA 3LM8A 5LUBA 5DLQC 4G1BA 5JYEA 3COJA 2ZE5A 5FXMA 5K7SA 1GAXA 1AMOA 2P6UA 2P9ZA 1MG5A 3EXFA 4JLNA 4XZ3A 1SCBA 4FFVA 1XB2A 2CNBA 3IP3A 4JEIA 4QYSA 1RFLA 3LQ1A 3OD1A 5TLSA 2JEOA 3UMFA 4EVQA 5AR1A 2C2KA 2R4TA 3KOUA 4XIFA 5ES3A 1PGOA 1CRQA 3CUVA 1GRRA 4L50A 3DJFA 2WKWA 3A4NA 2DFPA 1F06A 3MMPA 3ZWBA 3K6JA 4NFYA 3JQ7B 1MV5A 4MB2A 2Q6LA 3OJ0A 1ML3A 4XM1A 1J9EA 1PJRA 2ZQZA 3IAFA 1IYZA 1HNZB 1JDPA 3PGJA 3R3XA 4MGIR 1Y1RA 3T5PA 1ULBA 2AC7A 2HSJA 4LSGA 3A4LA 4CKBB 4ZTZB 2J0EA 5JRJA 3OZUA 4M38A 1E1CB 1IJKA 3ZZNA 3FSEA 2OGZA 4ZOCA 3FPSA 3U3MA 4IHJF 1RKXA 1MD9A 4N40A 4MV9A 2P1RA 4D8XA 2GQ0A 5JAUA 1WMAA 1NIPA 3H99A 3I2FA 1UINA 2PSEA 4TLLB 2Q6KA 3VR5H 2Q6OA 4GAEA 1LPAB 1QSGA 2XVXA 2F8MA 1ZD8A 1W5BA 2G9VA 3FNHA 1AO3A 4P3KA 3SMQA 3VZQA 4C20A 3MPUA 1NBOA 4DXHA 4PIMA 3IKJA 3I5XA 5JNRA 2J6CA 4JLKA 3AJDA 5C4IA 5DNEA 1JEJA 2PCJA 4MI9A 2QTVA 5F33A 3U17A 3KR1A 1PG0A 3Q7RA 4BCBA 1PX2A 2BR4A 3TM4A 4HI0E 3KRTA 4EHKA 4RHYA 3FHOA 2EF1A 2X3YA 3RUPA 4RA6B 4IV0A 1MKYA 3F2VA 1KI7A 1CVIA 3OZXA 3QKSA 2PUEA 1N2ZA 3VR5A 3D6HA 3OZRA 3K15A 4G5OA 2XBUA 3ANMA 3FTPA 2NUAB 1N5RA 1IOVA 1RXEA 3IBGA 3U80A 3Q9UA 1T91A 5ABPA 2Y1DA 4TM7A 4FC7A 2BHLA 5BRJA 4HC4A 2C04A 3AIOA 4V2IA 3IP9A 1SHLA 3C45A 5D3QA 2G9UA 3UK6A 1JSZA 1PKXA 2CLOB 1SC9A 3TXXA 4WCVA 3GARA 3DFMA 3OF2A 2F55A 4JQYA 4JROA 3JCZA 1GGEA 4BO4A 2ABWA 3PPWA 4PZCA 2PMDA 3SJAA 1V6CA 3KKQA 1P60A 3TI7A 1C8KA 1NUPA 1Q84A 3GJYA 2CXPA 1QFYA 3B3FA 3EIEA 2ES4A 2E2WA 1E62A 1T4GA 2F43A 3AI1A 4Q3AA 3VVLA 3WSWA 2I2CA 2NGRA 3UG7A 4EUNA 2HREA 1E7RA 5K4GA 1VFNA 2AXNA 3EN0A 1XD2B 1HTBA 4FLMA 2H8KA 3E48A 2ZBRA 3A9WA 3QM1A 4ER0A 4ID3A 3CN7A 4TWJA 3DP9A 3HDTA 4MKXA 2AFHB 1HE8B 4DABA 4GPZA 3RS4A 2AFIE 4DSOA 4F8YA 4OJTA 5DYGA 4HB3A 2FPOA 4W7HA 4L8WB 3BMNA 1PIWA 3K9HA 1U7TA 5DK4A 2DT8A 1PGQA 3P32A 4HO1X 5DYIA 2AN3A 3GJ4A 3NG1A 4I3FA 3RUEA 3FLBA 1M1YA 5GZ1A 4JWKA 3DT8A 1HYBA 1SVKA 2NX2A 1XNQB 5ICEA 4NE9A 3FYDA 3OZSA 1A72A 2BEWA 1N9ZA 1YS2X 3SR0A 2WYUA 3NGMA 1QTQA 1UAGA 1A8HA 2IIVA 1XZ8A 2JASA 3JTMA 4CE6A 1ZSVA 2VQ3A 2A57A 3H87A 5FA6A 4XE5A 3U3DA 4CF7A 4WUVA 1GLNA 3EE6A 4GEGA 3SFVA 5CTJA 5FTJA 3IXQA 5JBQA 5GWXA 1GYPA 3WDSA 3IE2A 2ATVA 3WL4A 3OQIA 5HSGA 2GN2A 3GPIA 1Y5IA 2BBOA 2BHNA 2YMMA 3AFGA 4H6XA 5DE3A 3P5BA 5EIXA 1Q17A 1XRQA 4MW2A 2P78A 1MT0A 3MN1A 4GMDA 2FMHA 5KAPA 3WQBA 4R9SA 2A9FA 4G01B 2FXIA 3AEXA 3EPLA 1YVEI 2XIJA 1KJZA 4OLHA 1EUYA 3IEPA 4ZREA 3L1KA 4KXQA 4EO4A 5THKA 1KR2A 5IKMA 4G0UA 4DJFC 4PXYA 1U0HC 3F3MA 3Q3JB 2GK6A 4OQDA 3EFOB 2H1VA 4PX2A 3HYNA 3EBLA 4YRPA 2AR9A 3UPUA 5KQGA 3QYAA 3DZCA 4DLYA 1HRKA 1ZOLA 4R81A 2AEJA 5MGNA 4RYDA 4NECA 1WCXA 2PN1A 1FP6A 2UUAB 2RH9B 2AX4A 3UMRA 3GQBA 2V3WA 5A6SB 1C3XA 3DAGA 2EKPA 3VGPA 3V1LA 1U2PA 1VBMA 3LPCA 3M6MD 3QKTA 4EW2A 1YC2A 3AUJB 2I1QA 5EE5B 1ZI6A 3EW7A 1MJ5A 4YRFA 4CCWA 4EH1A 1CBUA 1QX4A 1RJWA 1YVUA 2QP3A 1WWKA 2X0NA 3A6DA 4OV6B 2X2EA 1EQ2A 1FLAA 2C58A 3HU5A 4TRNA 2YJTD 1WEKA 3VZCA 2YBEA 3UIEA 1N1GA 5TPZA 2VYVD 3OQNA 3U49A 5EHZA 4OAPA 1EK2A 2H54A 1WU8A 1TJ3A 1Y48E 1X92A 3IERA 1R3DA 5HBRA 3T5CA 3WBJA 1XV5A 4DGQA 1N5LA 4DMFA 2O2CA 3F5SA 2WC1A 2X1LA 1JU9A 1SIWA 2NXJA 1QOQB 4GWGA 1PD0A 3EVNA 4PCUA 3ZNOA 3CFYA 1PVOA 2WZDA 1KHHA 4C7MA 3AZQA 4IPTA 4B83A 1ULAA 3B1YA 5IUJC 4TVSA 4MCAA 1G8GA 4P2BA 4PO1A 3BZUA 4QJ4A 3LZDA 3DDSA 4FCCA 5AKHA 2R47A 1S8FA 4IQGA 1W0KA 2QZZA 4JBXA 3SFZA 4XGQA 2Z1DA 1JSXA 3BN3A 1YRBA 2XA9A 3QVXA 3OQOA 3H6KA 2VHUA 3X3HA 4JU9A 1AZSC 3IHKA 4EBBA 1GGVA 4EGQA 5KDOA 5KKAA 1FTWA 4LXHA 4F4JA 2TS1A 3CW9A 3UJHA 1E1LA 1PGPA 1JG4A 5BWLA 5I7UA 3KKOA 1YZUA 1N33B 2GBPA 4GYJA 1V8ZA 3LFTA 4H0FA 4N18A 3ANLA 4RFLA 3EXAA 4MUIA 5G3ZA 1SXIA 2X7XA 3Q8WA 2AQHA 2GJ8A 2JCVA 2YVQA 3LI2A 1N6NA 2VRBA 4QUAA 3ESDA 3ZQ4A 2FP4B 2IS4A 5DN6A 3VOBA 3DBLA 4ZV9A 3DH0A 1B74A 2CUTA 1K5DA 3D8HA 3LY9A 2X6TA 4MCHA 2RI1A 3HLYA 4IKPA 4Z6KA 1C9EA 1DV1A 1UQUA 1HLDA 2VPXA 3HACA 3M83A 3TH5A 5K2OA 1KMIY 3A4IA 3KYDB 4FOOA 4DE5A 5LUAA 3ACDA 1T2VA 4M1WA 3KYCB 1RT9A 3DJYA 1GZ7A 4D4MA 2YZGA 1NNUA 2ETXA 3H17A 4RHUA 4DIKA 3TNFA 4ND3A 4BXOB 5G0TA 2RI6A 2J59A 1DL5A 3KKPA 3P4YA 5EYPB 4HAIA 3AJRA 4UTNA 1RKBA 2UZIR 2ZZMA 4BP3A 3HB4X 1QO0D 1L3CA 1YOVB 1YR3A 1F2DA 4KN9S 2B99A 3AM1A 1BTOA 4P34A 3H97A 4YO8A 4L5IA 2HY7A 4IGEA 3QX3A 3NTOA 3NHJA 4XW2A 5DSZA 1TZJA 4RKQA 1ZU5A 2Q4BA 5DYYA 4CIDA 3K35A 4QNNA 1NJSA 3GFBA 4H77A 2WRZA 4JI5B 3NMUF 3ETGA 4C0XA 3CT6A 5A1TA 4HV4A 3O83A 4O2BF 4XLTA 1T1IA 4PHCA 2BMFA 1T2NA 2FPIA 5CA0A 3WFIA 4DG8A 5CVTA 1P4AA 2OORA 1J33A 3D0RA 2PTGA 1MZPA 3T0GA 5IBPA 1KE1A 3FRIA 4BNJA 4ER7A 2OFWA 3OZVA 1RYMA 3T06B 1U8ZA 1NLMA 2QMYA 5IKOA 3RRJA 1MA3A 3B1KA 3TB4A 4MWSA 1ZUNA 3KB6A 5AI9A 5BO5A 2AG1A 3B38A 3PA8A 4QXOA 4RKFA 5L7WA 3SCZA 1P6UA 4TYPA 4DLBA 4HLDA 4M37A 1VYHA 3OAAD 1RLMA 2ACVA 4KC0A 4IZIA 1UF9A 1P1KA 4FI3F 3NHLA 5ADWA 3CT4A 3ESZA 4RVNA 1NXWA 3KD3A 2HDHA 4BJHB 2FQQA 1WSAA 4W8OA 3DVSX 5B2EA 2CNWA 2ZJYA 2VK2A 3NP9A 4QO8A 2Q45A 3PC8A 2W2LD 1RI1A 4NCBA 3BXZA 4EX6A 4L0MA 2PS3A 3VYWA 2OEPA 1FDOA 2Z4SA 3SSOA 1GFIA 2AS0A 4F5DA 1EGMB 4TZ6A 1SHJA 3GEEA 5G4LA 1C3OB 3H83A 2DERA 1SN7A 2GCOB 1NULA 1ECCA 1HETA 2YWRA 3AONB 1ISIA 1N5OX 3MGCA 3N5CA 3PUJA 3AERA 4Y1RB 3QA9A 4ZKEA 3WNBA 4B33A 5JZSA 1Y7IA 4QC2A 2Z2YA 2B35A 5GAJA 3BE4A 1JIKA 1K4KA 1X1RA 1RIFA 1N0VC 1M2KA 1ELOA 4ZGWA 2VSFA 4H4EA 5HCIA 4E2ZA 3P0JA 4P22A 1NMQA 5LJLA 2PHZA 3QITA 4P7FA 3R7WB 4KLRA 1G8SA 1ZMRA 3LOUA 2QRGA 4TGLA 4A8JB 2Y9MB 3LG2A 1J8VA 1MPTA 3COYA 4QDTA 4Y9DA 3HZRA 2GCGA 1SZDA 1MGOA 5EJ6A 2JARA 3LL7A 2NTEA 4W6QA 5ANRB 2W48A 3B2QA 3JATA 3NYWA 4E3ZA 5ELLA 1ZJYA 5AK5A 5EGSA 4YCAA 2AMFA 2ZKIA 5AP9A 4BMVA 1P72A 1E59A 1QQ6A 1O97C 3OQBA 3CH6A 5AESA 4IYJA 5FJIA 4EPTA 1UC9A 1FC0A 3UAZA 4IKOA 1P3JA 4JLSA 5IXSA 1A0OA 1EFDN 4P53A 3VUEA 1PN3A 1P0CA 4ND6A 1NBEA 4AVYA 1MB0A 4EDFA 1H22A 1MTOA 5ELMA 2P3SA 3TVDA 1P1IA 4RIIA 1M6EX 1TMYA 3WS7A 1L4EA 2YWGA 1M1ZA 2AJCA 5BVGB 4XASA 5FEUA 4G1EB 2C5FA 1I4DD 1PTKA 3RLFA 4AKTA 3I6MA 5KQLA 2EKDA 2ACKA 3ZJVA 4O59O 4DTCA 3CUKA 1W59A 1Y33E 1MEOA 4KQHA 4GW3A 5HRUA 5KVQA 1TGYA 3ELUA 2EX1A 2QVCA 3T7SA 4DNQA 2H3HA 2ZVQX 1TNDA 4RL4A 3ZH2A 4C0SA 2GERA 1H4QA 2UXCB 1NT2A 4DJDC 2H4YA 1I2BA 3LWDA 4HDOB 1VLJA 3BPSA 4DA9A 1IY8A 3TLZA 1ZUIA 2HWUA 1DRJA 3BG5A 4C2AA 4FDMA 5E8JA 4B76A 1GTJ1 5LZ8A 5B7NA 5DM70 3EZ9A 4UMDA 1JIUA 2O06A 3GRUA 5FPQA 2GEJA 3ANSA 1CNFA 2EOAA 3N8IA 4EL0A 2W6ID 4IJWA 3ON5A 1R5JA 4INZA 2HCBA 2DYKA 3PVSA 4O2RA 2GFIA 1Y1LA 5I9SA 4CNQA 1UFVA 4KLAA 1E64A 1EZZA 1P44A 5AVZA 2O0JA 2HC9A 3O9ZA 5LNK6 3MYYA 4WCFB 3VZBA 1DCFA 2ZJFA 4IGAA 3QBEA 5TVGA 2AG5A 2P6OA 3AKCA 1U4NA 3ABZA 1T0UA 4M22A 4MMYB 3VJKA 3HADA 4MQUA 3H9QA 4Y2HA 2R1TA 1M6YA 1W30A 3MSXA 4M49A 3ZKAA 4R1UA 5M04A 2DETA 1K88A 1KYTA 3DPUA 3D7SA 5C3UA 1XDDA 4QPDA 2ORWA 4PAMA 4OA8A 1K9VF 1EWKA 3TPZA 3WYEA 4RYLA 3AHDA 4M8IA 1SU8A 3IAUA 2RGNA 4PR0A 1Q1QA 2BTQA 1PL0A 1SCKA 1R6TA 2IP2A 4ZVOA 2QP4A 4RH0A 4QJ3A 3ZDXB 1VE1A 1EX1A 2R1VA 4UCFA 2V7WA 1L3IA 3GYGA 4G0ZA 1I5RA 1A8UA 2BRUA 1SBHA 1XIVA 3A4MA 3DXZA 3PUYA 3VO9A 3W5AA 5FUYA 3TAUA 4ARZB 4RAQA 3SDSA 1JE0A 1I94B 1YMVA 3DWEX 1LV8A 3MHTA 2K4MA 1J0BA 2G9NA 1I5EA 4E46A 1XDZA 5EIBC 5CH3A 1JDJA 1EVZA 2WFAA 5E4YA 1S89A 3GDGA 3BJRA 4I81A 3BS4A 3R3JA 2QR5A 4WXRA 1DG3A 2YJ6A 1O58A 4PSCA 2OZEA 1DUVG 3Q3CA 3W8DA 1CJUC 5F5NA 1Y8ZA 1LKZA 5PGMA 1R50A 2YW2A 3NJRA 2C8LA 1W96A 3ODPA 5FPPA 5T41A 1HKHA 3RYTC 4FDTA 1JQ3A 2WJYA 1KH2A 2ZCVA 3DKIA 3LA8A 3KZOA 3SGLA 2VP6A 1M3SA 4F46A 3QLVA 3EDMA 3X1KA 4I36A 1FX1A 3PB3A 3V7WA 1VP3A 4K81B 2V8BA 2AF4C 1KY3A 4KQFA 1GRNA 3EA5A 5EIOA 1TCUA 1N2CB 3EZ7A 4TTSA 4D5GA 4O25A 5SZJA 4J7XA 3VO2A 1SHZA 2ZRHA 2QTTA 5F76A 1F2TA 1QKIA 5CFNA 3ZVRA 2VUIB 2ZI3A 3J7AC 2CJFA 3DZ8A 4DSNA 3PP8A 5IARA 1O0SA 3JWPA 1DRKA 2KYRA 2O2XA 3EGIA 3GROA 1GCIA 2DZDA 1REQA 3CF0A 3NT2A 3OZBA 2R00A 3C3AA 2PV0A 2JJ1A 5C5EA 4XKJA 4EA9A 5SV2A 2ZT8A 2ZLBA 4DCSA 2FUEA 4MLDA 1C1DA 2ACWA 5GPBA 1SMKA 4BZZA 2E5LB 5EP1A 1NNLA 1IAVA 1VG8A 1JVNA 3VKHA 3LX5A 4ZQIA 5ILGA 2FF7A 3PDWA 3MW8A 3JYQA 3U7EB 2DFDA 1EP2B 1KO4A 2Q1XA 3U56A 1VQ1A 1XZEA 1ZD2P 4O29A 5I7WA 2YXNA 3I9V1 2AZ4A 2RGNC 1I01A 3EWIA 4D5EA 5JPDA 1SXJC 2XITA 1DAEA 3B60A 3SHTA 1RC1A 1PJZA 3B82A 1C9KA 5FPKA 4AY4A 3NHBA 1QONA 5B1YA 4JYZA 1I4EB 2ZYSA 4AF8A 1DAGA 2BTOA 3E7FA 5D6OA 4U8HA 5GJVC 4ZD6A 3HCRA 3WO0A 5JDIA 1N8SA 4N5MA 2NVUB 1BA2A 3U7HB 4J0GA 2LUOA 4KDCA 4YECA 5TJ9A 3TLEA 3KSUA 2EARA 4JL6A 3VHXB 4XWOA 3BMOB 4MA5A 4TYNA 4C0BA 2JDID 4NCHA 1ZITA 5CUQA 1HH4A 3TLXA 2NAPA 2VP4A 3BMQB 3F6EX 3P9IA 4K3VA 2FMTA 1VLLA 2P91A 3AT1A 2YY7A 2B5OA 3E27A 2QVGA 1CCWA 1UBLS 1WMFA 2QTBA 4LYDA 2CT8A 1MRNA 1Z5ZA 1CUCA 1MTZA 4IOKA 3M8KA 5CYGA 1Q21A 4JLMA 3CLSD 4H35A 3GZJA 4HH3C 4GFDA 3EHEA 5JH7A 1MJNA 1BDBA 2EJCA 1URPA 1WKVA 2AJ8A 3RI3A 2B2XA 2G9RA 2Y0BA 2YWXA 2ZB3A 4GICA 4MS3A 3RKRA 3O8OB 4ON9A 2WVGA 3EZLA 1HPLA 3QX9A 3X1DA 4IXNA 3C3WA 2RHBA 3RYCB 2M2IA 2NO5A 5HQ3B 5DWVA 5JH7B 3E70C 2WFZA 2B1IA 1ORVA 3PQFA 1MBZA 1QK4A 3ZZTA 2NU8B 4DXDA 3RREA 2LRHA 4GOMD 3L41A 1GUZA 4NNOA 4EELA 1GA6A 2O3RA 5EPOA 3E9NA 1Z88A 4BN4A 1HT3A 4JT2A 1XEWX 3H7IA 3SYKA 1C8LA 4MR8A 4FW9A 5TPZD 1MZVA 2OKCA 2YZ7A 3MTQA 1W76A 4A15A 3RK4A 5KX5F 2DFLA 4UVEA 3WB9A 4M0FA 3ZV6A 1A8QA 1YFZA 3CO5A 1C4WA 1XTZA 2DWOA 2IYVA 1RU3A 1FE8A 3KT6A 4H31A 5F52A 2FMXA 3GGCA 4TV8A 2GB4A 5K2MA 1B3RA 1FSGA 3GAFA 5TQJA 2CUKA 1P1CA 4ARVA 1H2FA 3PJDA 5HFJA 3WB0A 1IZ7A 5BSMA 3OOWA 5HJEA 4DLVA 5G1NA 1P7ZA 3OHSX 4OL9A 1YNSA 1Z4IA 2F17A 5J40A 2X19A 1UMBB 2HJGA 4AJEA 4PLZA 4Y6PA 1G6Q1 1T6BY 2YINC 3RVMA 5JZOA 3FGOA 2HX1A 4EHLA 2YXPX 3AF6A 2ONJA 2D6FA 1CUYA 5J4VA 2X3FA 5T8KA 2EBHX 2XB4A 2Q1TA 3OTIA 1JVBA 4FILA 1XU9A 5EMHA 4G8DA 1AV7A 3GI1A 3LUFA 2H4FA 3K1TA 4HDMB 1CHDA 2B34A 3OIGA 2XUDA 1SVWA 2QRPA 2WZBA 1DXOA 3VAAA 3L7IA 5BSHA 2DEUA 2OM6A 3R09A 1MENA 5IT4A 1P19A 4UCQA 4DR7B 3FR8A 3C7CB 4GC9A 1G21A 2IS2A 3AETB 2FUNB 2VR1A 1SVNA 3EG9B 5C8XA 1IVNA 1E3WA 3QXXA 2XZTA 3FUWA 3AUAA 4FE7A 1TZMA 4WX2B 4UEKA 5HKLA 2RGYA 4GT1A 1RABA 4YVFA 4N0QA 3JQEA 2ZRFA 2L2QA 1DTWB 1ZQ9A 1A4XA 3HFGA 4AF6A 1JIQA 4B46A 5D84A 1ZCAA 5A9SB 2HDWA 4YO7A 1KP9A 4O2AA 1BCSB 5AVSA 4GKVA 4Y18A 3BDVA 1HG0A 4W5QA 4Q93A 1E99A 1QLHA 1OJLA 5BP7A 3H1EA 5FQNA 1ZIDA 5DNVA 5EERA 3HR4A 3KFXA 2IX9A 1F60A 1WS6A 4RABA 3W8RA 3SVZA 4G1FA 1YJAA 2JGMA 1N6RA 1U0OC 2I1VB 3UANA 3H2KA 4PSAA 3I45A 4L2IA 2PZBA 2ORIA 2ZBVA 2V7QD 3C7KA 2F67A 2CD7A 2IPNA 2ZTVA 3WGMA 1ZK2A 3NCTA 3LLVA 1RPNA 3AKEA 3KELA 3TLBA 3WI7A 3I2JA 5FI3A 1UXKA 2O0HA 3SC4A 2RGBA 2II6A 4K9NA 3DONA 3CY6A 2F1IA 4LSWA 5YASA 2B4TO 1Y3DE 4BVFA 4WBNB 4BNWA 1KMHA 1M0EA 5AJWA 4F06A 1DPFA 3E7DA 3GYBA 2O57A 5AVJA 1LDEA 1ZOSA 4FGSA 2CD9A 1YZVA 3FR7A 3RYHA 4DLZA 1JBQA 1I80A 2C7VA 1CZOA 1U1EA 3DMPA 3UOGA 5JDCA 1T10A 4A8JC 2OCDA 1DQPA 3A0RB 3KZMA 3Q1LA 1JKIA 4XYGA 7ADHA 4ZCQA 1YB6A 2WWHA 4DBVO 5FD8A 4HZGA 4RD1A 1JNXX 2HPAA 2C31A 3PICA 3ETCA 3WBFA 4C88A 4YUZA 4QICA 4NICA 1E1YA 1W6RA 4PLVA 3D5QA 2ZQYA 4AKSA 4DCVA 3DBRB 3LP5A 2J3QA 4DIUA 5CFRA 4C87A 1SXQA 4CW7A 4GI1A 3O1IC 2JA1A 2VA8A 1MO5A 5LZ4A 4HADA 3KPUA 1RLTA 4DLNA 3M9XA 2FRDC 1XMPA 3DL2A 3EDQA 3K1AA 5ALFA 3T1NA 3I73A 2CBXA 2VT6A 3FG9A 3JYPA 1F8FA 2XVAA 4M0KA 1QXSA 5AYVA 5I8WA 4AX8A 2C8KA 5C37A 3V8EA 4BMYA 3I42A 4Q7LA 3UWOA 1VL1A 3BGOS 3LYHA 4MRPA 1TU4A 2GF0A 3AMVA 4PQRA 2G5PA 3GC6A 3KJFA 3QWIA 1X1TA 3TMKA 2CFOA 3AR8A 4DLUA 3DHYA 4NFHA 2YH2A 4R84A 2FOIA 3FHJA 1L2TA 3R6WA 4TS1A 4J0KA 2BFOA 3LCVB 4IIUA 4I6EA 1MFPA 3I76A 1IOLA 2DWQA 4L85A 3IAXA 6REQA 2XODA 3RRBA 2QRJA 4JITA 1ENYA 3GFPA 2R8YA 4NZYA 1B73A 4OSEA 1YVRA 2GZ2A 3T7JA 1NZFA 2JIZA 1P0IA 5KTKA 2CF6A 4MVJM 1V5EA 4KTVE 4LEIA 1JTFA 3CX8A 1SVIA 3W5HA 1ST3A 4ZI7B 4FFNA 4PYIA 2QD5A 4OQNA 3HLTA 3T7KA 4E3WA 2D5CA 5CDUA 2PRYA 3AXSA 1PGNA 3AR4A 3HSYA 5H83A 3UJCA 4BGEA 2FWJA 3OMXA 2XQKA 3PENA 3DTVB 5AKGA 1SUEA 2B2NA 3OOHA 3QBJA 4Q9HA 1NXOA 4PXAA 1BWPA 1SZCA 3KU1A 3UT6A 4JAVC 4BX9A 4CPDA 4D4IA 1PV4A 4TPKA 2PYDA 2NU6A 3GHHA 1TJ4A 4UASA 1X14A 4YV0A 1TUBA 3UH0A 2J4FA 4YS6A 5JD4A 2I7TA 3HFJA 3ILXA 4DVJA 4NONA 5PNTA 1DO0A 3TDKA 4EYEA 1S2GA 5EIHA 4DMGA 4BTLA 2BZGA 2C0PA 2GVDC 4CDGA 2PX0A 3IYLW 2QTFA 4KU4A 5A3VA 4Z0PA 3RAJA 3D3WA 1KOLA 1EK6A 3EZYA 3QVKA 1UOOA 2Z9DA 3D1LA 3N8HA 4KFTA 4MPDA 3R9KA 2GXAA 4R54A 4DJ5X 1L5OA 1YHYA 2BHSA 4QUKA 5K3EA 1PT5A 3VH3A 5BWOA 3E9EA 3AUSA 3GMIA 3V4ZA 4FSDA 5KWIA 1C1XA 4UEQA 4D9GA 2CLCX 3Q3EA 4M1SA 1ZH6A 3SS8A 4AIRA 3KHUA 2VUUA 4X6LA 4R3NA 3FVTA 4H0CA 1NYQA 3VZDA 4EEZA 5BW5A 2CNLA 2FA9A 2IHJA 1V9LA 4CKCB 4N0DA 1M5TA 4ANFA 1NBMA 4QXPA 3ROGA 4LDRA 521PA 2C61A 4LGVA 2ADMA 3Q88A 2KBFA 3UV7A 5J4KA 4B9EA 1TZCA 3G0DA 4K6MA 4JBGA 3F3KA 3P0FA 1T5LA 2PYIA 1E1CA 3ODGA 5FOVA 1D03A 2IA5A 3C6XA 3OQJA 4N3AA 4RK7A 2JLXA 4OXRA 3KB1A 1PJ3A 2MINA 3AJ9A 2FG7C 2R6CA 4LN1A 4E6EA 3CN9A 4P4TA 1ZD9A 2BZSA 1QMGA 1XAJA 1E2NA 4RIHA 2HSDA 2PFGA 1U8EA 3N59A 4CDMA 2BKLA 4GWKA 4IJUA 3O4IA 1Y98A 2ZYUX 3C97A 3BXPA 1BIFA 5CFZA 4UUAA 1U2TA 2V03A 3PNYA 2Z1MA 3MHPA 3IT1A 5K6AC 1GPYA 3C39A 2O8EA 3N58A 5CX1B 4ZGGA 3IQFA 3SMVA 2ROQA 3OIFA 1MB2A 2GKOA 4NSNA 4I1RA 1OMOA 2N9UA 3G2KA 2PQ6A 2FWRA 2I66A 3R7NA 3DAHA 3K5HA 5IC4A 4RJJA 3T52A 2H51A 2OBYA 5KX5A 1Q5PA 1I7NA 3OJWA 3K1ZA 4RFSA 5CB8A 3JWJA 1CUXA 2BBTA 1BMQA 4ZVVA 1ANKA 2E9SA 2FW8A 2WQZA 5TY0A 4FXOA 5F3WB 4AL4A 3EMKA 1TIPA 2LTAA 1U63A 3NUQA 2YV2A 5KX5B 3B89A 1FYDA 4OXKA 3X1ZA 2QHXA 2G6TA 3V1KA 1T4DA 2IKSA 3QKRA 4YX9A 3RLIA 5EE9A 2CLKB 4ACBA 3IP1A 3OIYA 4MI1A 1PUJA 4X9XA 4UU0A 3VZRA 5I7SA 5LC1A 4AZSA 2R84A 1E2PA 1WNTA 2LXNA 3M6UA 3HJCA 1U80A 3RRMA 3SS7X 4QD3A 5KC8A 3E3OA 1GDTA 2BTQB 2WWRA 3IIJA 3QX8A 1RI2A 4DDVA 2J3LA 5JWHA 3ZIUA 4RZUA 1YULA 1OSNA 4WERA 1GU1A 3CF2A 2OPHA 4DLRA 1M2OB 1DBPA 5J3JA 4QXQA 5I9IA 3C16C 1H05A 1JG1A 4TS9A 1J8YF 4ESEA 1OWNA 2ZJBA 1YVPA 3N0XA 1UK9A 4OK5A 4LZOA 1LPNA 4PO9A 5COQA 3G85A 4B5KA 1S6YA 2WJPA 3FJYA 2QRLA 2FRVA 221PA 4GL4A 1H6AA 2FG6C 1TJYA 3ZCQA 1U11A 4TXLA 2WD7B 3PWTA 4A5OA 3F46A 3L0SA 2O2GA 3CEMA 4RZIA 5E9AA 4FLFA 3G1UA 1IATA 3KVVA 4IIEA 4Q03A 4U7FA 4BLRA 2ASEA 4G0NA 4ZT4A 2JAHA 4ENRA 4KAFA 2PQ0A 2FFJA 3I8OA 5SZHB 3I0NA 4LRTB 2M6LA 5HX7A 1E0JA 3GNLA 3BWEA 5FT9A 5H0IA 3GU3A 3UAVA 2JFGA 3U9LA 4CLXA 4E5UA 2RIPA 2WM3A 3FGZA 3FW1A 3ZX4A 4ZHQF 4IJ5A 2V96A 1QO7A 3QJYA 4EYGA 4GP9A 5K0BA 1E6KA 2HRZA 3GCWA 3B12A 3E18A 3LZCA 4ALNA 4PSDA 6GPBA 3D6NB 4YJDA 2JBAB 3N74A 3ZGOA 4JT9A 4EYKA 2ECFA 2NUAA 3VUFA 1GTRA 1KDTA 1ITZA 2SKEA 4H2DA 1VPVA 2JFZA 3JY6A 3LWBA 4D9FA 1FUEA 2AMJA 4NY1A 3UAGA 2I8CA 2Y2UA 5K6RA 3PWKA 3ZBQA 1I33A 1GA4A 1N7IA 1NM5C 1SIOA 1P7CA 4M54A 4RHCA 1NW4A 3VBCA 3WMRA 1E3MA 4EO9A 4YJGA 3K0FB 3H8SA 2PL1A 3ASUA 1L4HA 3ONWA 4JS0A 1JEEA 3EIOA 3G0HA 3L4SO 3ZV5A 3M6WA 3K31A 4M7PA 3H5OA 3WGJA 3U7FB 1FXWF 3KUUA 4CHTA 2NO7A 2XOEA 4DR3B 1ISGA 2JIQA 3RNLA 5L7TA 1PDVA 3MWJA 4HWSA 4KMMA 3ZLTA 4F5WA 2QDKA 4J7UA 4M0PA 5A6SA 4ZAVA 5FX2A 3INTA 3IHTA 3OZAA 4D3SA 2UKDA 2BZ1A 2QUBA 4A73A 3KWFA 5IF9A 2C3UA 4FGJA 3IHLA 2BGGA 4XWYA 3MERA 1V47A 4F86A 4YMTA 3CQ9A 2Q4OA 2EHJA 1RYYA 3QEJA 1T0PA 4MA0A 4EB6A 1HURA 3HPQA 2Q5JA 2H92A 4YT5A 2A9PA 1YA8A 4DJEC 4X7MA 5BUZA 1XRRA 2H59A 2VRCA 2ZS7A 2SHKA 5I7AA 2HQOA 3MWDB 4R9RA 4ZKDA 3F6RA 3PRYA 3CB2A 1YQXA 4BMPB 3Q40A 4F6RA 4FJ1A 2QTCA 3AY7A 3OFND 4EG4A 1UJMA 2KJQA 4OATA 1CK4A 2G1AA 1IXRC 3SX2A 3ZCPA 1Z62A 3RYFA 5LYJB 1T4CB 1Q14A 2YDXA 1RKUA 2NUTA 4BYGA 3LVQE 3HUDA 4R2MA 2A1TR 3KE9A 5I9MA 1IN6A 3F49S 3IOMA 3NX4A 4NBLA 2DPHA 1T9GR 4LXIA 4O1MA 2IQ5A 2QVBA 5A4FS 3J80A 5B37A 1W87A 2YBDA 3LKDA 2NUTB 2GK7A 4AJLA 1M6VB 1RJDA 5LKRA 4AJ1A 2MOKA 4PXSA 5DXJA 4CI0B 3AVXA 3IBFA 4AJ2A 1KZYC 3HY3A 3FNQA 3H2YA 3L1JA 5H02A 1H9AA 1C1XB 1LPMA 4JA2A 1ZHFA 4V0NA 4ZIRB 2D0OB 2H0AA 2R62A 4Q05A 4LMPA 1BSVA 4D45A 1JEAA 1EUCB 2IYYA 3KL2A 2CLMB 2QI9C 1R4AA 2GJ4A 1WXXA 4JGIA 4KGDA 1SU7A 4LK3A 5HF8A 4Y2PA 4AS1A 1Q1GA 2IIQA 3IMEA 5EJEA 1H1TA 4XI9A 5LP6C 2P2SA 1JIJA 5LIPA 1Z38A 3PT9A 4DLKA 4WNAB 2J9XB 1UUFA 2CV1A 4L6AA 4F4HA 2X23A 1CY4A 4IFTA 4MMZB 5E7MA 4PHHA 4TUYA 1VE6A 5JAZA 5B5SA 4KWCA 4A8PA 3AJEA 1Z0ZA 2C5HA 3PJRA 2ZM6B 2XQGA 1E9DA 1EGVB 2QD1A 5TPWA 1BVRA 2VAPA 5FA8A 1X15A 2C2GA 5K3FA 2MINB 1SCQA 3WMEA 1BN7A 1RWBA 2OZLA 4XARA 1RYFA 4M0CA 3UGQA 1Z35A 4RD2A 2W83A 1AV6A 4QDUA 2FZVA 1MPXA 2EX0A 4P5EA 5ARDA 2HDOA 1SG0A 5J2UB 5K3FB 2O0KA 4J3FA 1I3LA 1M73E 3BJZA 3NYIA 4NI5A 4JYPA 1QGAA 2RGAA 2H4ZA 5FFMA 1XQ1A 2LIVA 5JS6A 2O2ZA 5F64A 1P7PA 2FFAA 2WKRA 1MJGM 5BT9A 1PV1A 3F5DA 1SD1A 4DR6B 2R68A 1G7CA 2Q9BA 2PUTA 3LPLA 1Y6QA 1G5QA 2QIPA 3OOJA 3P0IA 1DEKA 4O8ZA 2W37A 2Q5FA 5T4BA 4CCYB 3GNTA 9ABPA 5JEDA 2Y1LA 1ZU4A 4D9BA 2VTDA 3CMMA 1A82A 1GTL1 1GTZA 3EEIA 3UHFA 1CIPA 3C3BA 4LHXA 3UW3A 4TL6A 2HM7A 5C8VA 1WP4A 2V54A 3EVDA 1IQPA 3OX1A 2ZJOA 4BTEA 3IUJA 4ZAZA 1JLHA 1Y7TA 4GPBA 3W5DA 3HUEA 3HXKA 1US8B 3STHA 4B7AA 4KO2S 5JI3E 1B6RA 16PKA 3LOPA 1U04A 3K9FC 1PW7A 1GG2A 2QY9A 3QE9Y 5I7EA 2NO9A 3UK1A 4EI7A 4JUIA 4RULA 3ZCVA 4NK5A 1RC8A 2QT1A 1TOAA 3QSGA 2QR3A 4FHEA 3PNBA 5H9VA 4EABA 1UFKA 4IKEA 1E2LA 2HO5A 4HXEB 4S3MA 1BXZA 4CV3A 3PSAA 2IUUA 1WSDA 1Z0FA 3HYTA 4I55F 4PY2A 3AEYA 4KPEC 1DKRA 4U9HS 2FW6A 3AHJA 2XUHA 3JVEA 2HK8A 4I4TB 4YIKA 5JFGA 1QOZA 1S9DA 5TMEA 4RTSA 2XWSA 3AB3A 2WB2A 1SGWA 4GSYA 2ON6A 5A05A 2Q0XA 1OIVA 5CT8A 3WK4A 4BFYA 1SXJE 5K8JB 1NVVQ 3A3PA 1R0ZA 3WKEA 1GZ6A 3O2JA 2R8ZA 3BMQA 5D3ZA 1BMDA 1Z7GA 4FHGA 4TS3A 1GNQA 5KNDD 1BFKA 3DOIA 4AWAA 4X24A 1KVQA 1YOVA 3ZW8A 3N8KA 3FCEA 3CNBA 1DFHA 3OM0A 4BVBA 2D1QA 1XD2A 1ODIA 3LPNA 5IFLA 1J1ZA 3A1NA 4R2JA 3ZWKA 2HLNA 2WAYA 4RSHA 5I51A 1AA6A 3JYNA 1LZLA 1O5OA 5H7XA 4B8YA 1IEVA 5D01A 1C29B 1SQFA 4M1OA 5EXSA 2ZB7A 3WAKA 3W0LB 3JALB 3BDIA 1ADBA 3ECCA 3GNQA 3QW4B 4KO3S 4UUOA 5HJ2A 3U40A 3DOUA 4C4OA 2O8CB 2A67A 2G7MC 4XOUA 4V39A 4BWFB 3B48A 2UYYA 2C9BA 3FLAA 4GMXA 3D7NA 5EJ8A 3TW0A 3TNJA 3GAAA 2ISQA 3LW8A 1T0IA 2IGTA 1X77A 5BNFA 1XEXB 2WT9A 4L08A 4CZ2A 1P73A 4YAEA 3ZWCA 4FX5A 4J1NA 3OQHA 4BFXA 1GN9A 2IPMA 1T5SA 3BWMA 4PNEA 4INJA 2OQIA 4RQAA 2P9BA 5JSKA 1ZN9A 1PWYE 2WU4A 3CU5A 2VNIA 3PJFA 4IDBA 4R1QA 2ZRMA 3DVRX 1OXSC 1JR3E 3IH5A 2DMRA 2O2SA 1X7DA 3DDOA 3E61A 3IQDB 2A5DA 4S1VA 3M7IA 2XWJI 3N6XA 3HU2A 3IJPA 1L5NA 3MBIA 2V74B 4P7GA 5TV2A 4KEAA 1ECBA 2PUCA 3CZMA 3KAQA 4PSUA 1AM4D 3HYCA 5JPCA 1Z29A 1U1CA 1SHKA 2FWNA 4O2BB 4P0TA 4ZEVA 4PN7A 2WU1A 2VATA 2RG1A 2XMBA 5AXBA 2XYHA 2LPMA 3R5SA 1KFEB 3INGA 5DNDA 4P7KA 3GJZA 3WKCA 3RYFB 3R6DA 1A7AA 3EJ6A 5HKKD 1YZNA 1Y81A 5KVAA 1NNEA 2PZAA 4NBVA 3F1KA 4FK8A 3OA2A 2V1XA 4R71A 4WZ6A 1ZISA 3O2QB 1P1RA 5EP4A 5KVCA 5L3SA 5H5JA 2A3RA 3EZ2A 3OX4A 1HRDA 3BH6A 3JD2A 4FX2A 5FFFA 1QAMA 3B78A 1ESMA 1HZZA 5DPMA 2P5UA 5E7QA 2VZEA 3LT5A 2ZIWB 2FE4A 3FB4A 4TQGA 3GP5A 4BNDA 3ZHYA 1KZGB 4FZJA 1C4OA 2FQWA 4INPA 4YJ3A 1VE9A 4MINA 3ZJ5A 4ZPJA 4V1CI 1G4HA 1NUQA 5HS4A 3K1YA 1Y8QB 3N86A 2G1KA 1FVFA 1TM2A 3U4DA 4JHXA 4HBGA 4F3CA 4FNAA 3Q7SA 5C2JB 2YIDA 3IV9A 4UM5A 3EWSA 3PS9A 4CEJA 4UAVA 1EPUA 1WUHS 1CY2A 2VG8A 4G3XA 3WYNA 1HTTA 4BMDA 4C7BA 2WWIA 4KUHA 2ZJ3A 3SKVA 3AFMA 3UICA 1YR9A 5BN4B 2OWEA 4COKA 4IJ6A 2C0QA 1E2KA 3W5CA 4KMOA 3QIVA 4TRMA 3UPTA 1IZ0A 1VMKA 4YBRA 1Q0HA 2PLNA 1LEHA 1HTWA 2HHJA 2YS7A 3DBHA 5FOTA 1ZMBA 4AF7A 3WGZA 4ZT6A 4FCWA 3GL9A 1KJWA 2ZDHA 4YUVA 3REOA 1XZBA 4DMCA 3ADBA 4LG1A 2D3WA 2J48A 1QHHA 1NLZA 2NU7B 3QJGA 1CJVC 4Z3KA 1E98A 2XNHA 2PQ2A 2P9HA 2KWIA 5IZCC 4ZRNA 5IF3A 4A0HA 4MEBA 3G82C 1CJMA 2Y1GA 3HCBA 3NKLA 4F2HA 4ZANA 4RTRA 4UTPA 3PRKE 1M1NB 4ES6A 3K30A 4TZKA 1NAHA 2PLRA 1AGPA 3HXOA 1IUOA 2LW7A 3F4KA 1M1UA 1RRFA 1Z25A 3SNHA 4XVHA 2I1WA 2WVJA 1Y6GA 1A04A 4P4NA 4RVCA 1U3UA 2VLIA 3ZWYA 5IDXA 4DSAA 1NSFA 3EK2A 1V1RA 3HCFA 1FP4B 4HUTA 5LD2B 1ZK3A 4AUMA 1Q77A 6ABPA 1YE8A 1G5FA 4J0HA 1PNTA 3DVAB 2W0MA 3NFYA 4ZOEA 1G60A 3A7DA 3E1SA 3FM9A 5K51A 2P9JA 5EJ2A 2P2LA 3LQQA 3EFBA 4RA6A 2CW5A 2VJYA 3QFRA 4GR5A 3T54A 3WGVA 1R8JA 2FZLA 1Z2DA 1ZGCA 4JX9A 1VLHA 3JQ6A 5HZGA 2FW9A 1GV0A 4RA9A 3OWXA 3ZU4A 2X3UA 3V4FA 4NYIQ 4BQSA 1CUZA 2IVZA 5A62A 4LX0A 4OQLA 3KHTA 4OI2A 5J23A 1GZ3A 1OXVA 1RLUA 1XTUA 4G0XA 1DO2A 5HIKA 1YNOA 4YYEA 2FU5C 2ENWA 3NBMA 3WIEA 4Q9JA 3A1WA 3I1FA 3KWMA 3VHRA 5KKCA 2QVZX 2FN8A 3ZE9A 2RH8A 2AFVA 1LI7A 2ADFA 3WWEA 4INOA 3LDFA 5JAOA 3SC3A 2G88A 2QOEA 3C6MA 1JA9A 5BSGA 4KZPA 2P1DA 4OLAA 3G8BA 4RDXA 2O3QA 2R6R1 3DAPA 1RPJA 3R4VA 4D41A 4YMGA 4JJFA 3T7EA 3FDZA 4OXQA 4XR9A 1GTMA 2BCJQ 3UMVA 4ZCLA 5K0TA 1J24A 1A2BA 5DV9A 3ZIAA 3DHEA 4KNWA 1OBCA 5CYFA 4ILEA 3N3BC 1Q7CA 1Q0SA 1CQJA 3ES9A 1J1UA 4XYEA 4ZEMA 2C2BA 1NF3A 3GLHB 4WLNA 1PAUA 2W2KA 3A3OA 2GNAA 3EGEA 5AW6A 1VJRA 2YRWA 1U1IA 3R8XA 1Y8AA 2O1WA 4CLRB 4OFWA 2RHGB 3PDUA 1Y9AA 2Q3LA 1NWCA 4LA4A 1OWMA 4RACA 2JFBA 3FDJA 2BP7B 3K72B 4JZYA 5U1PA 3S2SA 3SJ7A 2ZWIA 4MUXA 1CQJB 4NBTA 5LQAA 1ZQ1A 2BFCB 3THXA 1TT7A 3F2IA 4ZU3A 4DA6A 2OHHA 1VSVA 2Y27A 4D3DA 1RMTA 3F8SA 2Q9UA 3O8OA 1J42A 3TCXB 2NWQA 2F3PA 3WBKA 3W78A 5M3BA 3DMYA 1X3LA 1OC2A 3U16A 2C9OA 1PZHA 1XXHB 2BFCA 2GI4A 3H75A 4D98A 2VDOB 4BO1A 3THXB 1X87A 2W6MA 3MJSA 4K2HA 4KDEA 1QP8A 2OTCA 4XDGA 5A0FA 1XPJA 4FQ5A 4HFMA 2QMOA 1KO8A 4A8JA 1Z82A 2HTEA 3E1KA 2XIQA 5EXDA 4WI1A 5JMPA 4DNPA 1OYVA 1F0KA 4JP2A 4LZNA 2ZFUA 3PXEA 1T6NA 3A11A 4KQEA 5DX0A 4IV8A 2ZPUA 2ZSFA 1FZQA 1GXSB 4C43A 1QP7A 5AKZA 5E6UA 5BV2P 4ZVUA 3UJ8A 3BFXA 3BK2A 2O6LA 2GRUA 4TVBA 1S4QA 3BZBA 2ZSAA 4G0OA 1H0HA 2Z57A 1YDMA 2J6BA 4C6TA 3SE0A 4P82A 4WESB 3U3JA 4PCAA 5AK4A 4AZTA 5ICFA 2ECKA 3GA0A 2BKVA 4PS1A 2IUEA 1ZW6A 1LTHR 1FVOA 2VTVA 3PEUA 4QHYA 4QIHA 3F6YA 2GNPA 3RF6A 1JHYA 1TZ2A 1SWVA 3D7KA 3GLGE 4FFBA 4R2WA 4Z49A 1EWTA 2BFMA 1FFWA 1KVSA 3KC2A 4F4DA 1O97D 1YBAA 1SHUX 1PR4A 3CEHA 3DEAA 3PIDA 3PQDA 1JXAA 3QFFA 4ARZA 4RMJA 2CC2A 2E4UA 4FYWA 5EN4A 5G1OA 4AROA 2F1JA 1Z56C 2B4RO 1DB3A 4ARUA 2OC9A 3PD7A 1X7YB 4PFQA 1U3VA 4WOCA 5IUNC 5K05A 3DZBA 4EOGA 5DP1A 1PR1A 4PX5A 2OK7A 4HLUA 3ESAA 2NSYA 3B9BA 1BS9A 1NN3A 1F0YA 3EQ9A 3QIAA 2QSYA 3D6AA 4HEJA 1SBIA 1R0KA 4J1TC 1V5WA 1W0KD 3L1IA 4GI5A 5LA6A 3EIWA 1C9DB 2CMKA 1WBBA 3HO1A 3U4MA 1XEWY 2ODPA 2PKYX 1MHPA 1VTKA 2MSLA 2QPTA 4H08A 4L3OA 2A0WA 3U4IA 3WSVA 1WXDA 2BL4A 2C4UA 3DF9A 4LQCA 4MUNA 4YRAA 1W35A 2P2CA 1KYXA 3AHIA 1NC3A 4HDSB 3GP3A 3NVKI 1O08A 3OIUA 3F4BA 1AY0A 4WE3A 5CPBA 2EFCB 4Q7JB 2ZUDA 5K0GA 4J4TA 4X00A 1TTTA 4NENB 4TLAA 1O4VA 3JAKA 1L5WA 5ENZA 1MABB 1Y1PA 4HUQB 5FNVF 3T5MA 5JNLA 3ED1A 2DBZA 5KNDH 2O9JA 4KO1S 4CKWA 4AY6A 4K9DA 3N1UA 4DR5B 4FI3C 2PSJA 3CJQA 3MG9A 3ZV3A 4LI3X 1YRYE 2ZTHA 3L5OA 4B6JA 3I2GA 2AIRA 3O8LA 4IJVA 2EZUA 3AB7A 4JB8A 4L2IB 2Q27A 1XZPA 2BSXA 3AWIA 3A9VA 3PD1A 3TSCA 4EDHA 5BW4A 4L6IA 1E1NA 3N8DA 2PSDA 4QFMA 1B6GA 1JNYA 4JWTA 2YRXA 4RK1A 3I92A