3ZKAA

Crystal structure of pneumococcal surface antigen psaa d280n in the metal-bound, open state
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
278
structure length
278
Chain Sequence
KLKVVATNSIIADITKNIAGDKIDLHSIVPIGQDPHEYEPLPEDVKKTSEADLIFYNGINLETGGNAWFTKLVENAKKTENKDYFAVSDGVDVIYLEGQNEKGKEDPHAWLNLENGIIFAKNIAKQLSAKDPNNKEFYEKNLKEYTDKLDKLDKESKDKFNKIPAEKKLIVTSEGAFKYFSKAYGVPSAYIWEINTEEEGTPEQIKTLVEKLRQTKVPSLFVESSVDDRPMKTVSQDTNIPIYAQIFTNSIAEQGKEGDSYYSMMKYNLDKIAEGLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE ABC TRANSPORTER SUBSTRATE-BINDING LIPOPROTEIN
publication title Imperfect coordination chemistry facilitates metal ion release in the Psa permease.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Metal transport
total genus 101
structure length 278
sequence length 278
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3zkaA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3zkaA01
5KOJA 1N4AA 1M1YA 3NU1A 3R5SA 3ZK8A 2MINA 4FI3F 2PRSA 4FNAA 4OVKA 1PQ4A 5BVGB 5CR9A 1FP4A 5M3BA 4ND8A 4FILA 3ZKAA 1KAEA 3PSAA 4G07A 3AERA 4GICA 3LHSA 5GGYA 4PAGA 5CX1B 2Q8PA 3AEKA 3AETA 1K75A 2OV1A 2XH8A 4OXQA 4TKUA 1MIOB 5CX1A 5JG7A 3TEFA 1ESZA 4MO9A 2Q8QA 2OSVA 1MIOA 2RG7A 4NNPA 2OGWA 4H0FA 4WZBA 1QGUB 2YNMC 1G21A 5KOJB 1K7SN 1G20A 5AFSA 1QH8B 1N2ZA 1M1YB 3G9QA 2MINB 4UDOA 1K0FA 2PS3A 5BVHB 2M6KA 1EFDN 4FKMA 1QH8A 2XUZA 4G09A 1FP4B 3AEQB 4B8YA 5I4KA 5M29A 5BVHA 4ND8B 5JPDA 5KOHA 2WHYA 4CL2A 3AERB 3AEQA 4MLZA 4XPIA 4WZAA 2PS9A 3MFQA 1N4DA 4MDYA 5FLYA 3AEKB 3AETB 4TKUB 2PS0A 1QH1A 3HJTA 4PM4A 2XV1A 4BBPA 1M34B 4WZBB 4HN9A 2XY4A 4UTPA 4WESB 1G21B 1M34A 3HH8A 1G20B 1XVLA 3MWFA 4WESA 2R79A 3AEUA 4M7OA 4UDNA 1M1NA 4INOA 3AESA 4HMQA 3UJPA 2ETVA 3BE5A 2YNMD 1KAHA 2XDQA 4HMPA 4N01A 3TLKA 2AFIA 5KOHB 4XPIB 4WZAB 1PSZA 5JOQA 4DBLE 3ZK7A 1QH1B 1L5HA 4TKVA 4WN9A 4HMOA 1N2CA 2O1EA 2OV3A 1H1LA 1K2VN 3MINA 4NNOA 3CX3A 5B58T 1KARA 2QI9F 3PSHA 4K3VA 2X4LA 3AEUB 3TNYA 1M1NB 3LI2A 3AESB 4WNAA 3ZK9A 3PDIA 3MWGA 3U7QB 5M2QA 5JJ5A 2XDQB 3ZTTA 2AFIB 5GGXA 5KHLB 3U7QA 4INPA 4UTOA 5BVGA 2PHZA 4LS3A 1L5HB 5HDQA 4TKVB 4WN9B 2M6LA 1N2CB 3BE6A 5HX7A 1H1LB 5M34A 3MINB 4MX8A 3K1AB 3GI1A 3EIXA 2R7AA 2WI8A 4LJSA 4H59A 2AFHB 2XQVA 3R5TA 4OXRA 3K1AA 3EIWA 1TOAA 2AFHA 4WNAB 1QGUA 3PDIB 4IRMA 3MD9A 3HXPA
chains in the Genus database with same CATH superfamily
4GBGA 1XTSA 2WU3A 4PE5B 1RZVA 3QMVA 2VZ0A 4WIAA 3KLBA 4WERA 2J31A 3N39C 3FY4A 4QPPA 4HPJB 5HS4A 2HQBA 3FWZA 3FYHA 5DWVA 2SKDA 4GL4A 3VR3A 4RVOA 2MCFA 4LV8B 1VBNA 4NJMA 1NQTA 4QTYA 1E2FA 1NXXA 3RRMA 5EYPA 1OILA 4B6FA 5HUHA 1E5VA 1W36C 2POQX 3WK8A 4MVWA 3AETA 2I4NA 3I53A 3MMZA 4M21A 3Q15C 4KPEC 1VMIA 4N6NA 3MBOA 3PDUA 2Q21A 4MZDA 3BIOA 4FDVA 1FYWA 1NW3A 5FPSA 1RC1A 4PFJA 5ERYA 4V03A 3T6KA 4HDOB 1RWVA 1H9CA 1HQYE 1KA9H 3N58A 3WB2A 4GIBA 2ZJBA 3ELUA 2QZ4A 3MRXA 2R8OA 3OPXA 2A4MA 2Z04A 2YQ4A 3L9XA 4JBWA 3RYTC 1NX6A 3QMMA 4WFKA 3W6OA 2ZRBA 3PZRA 4LIPD 5AW6A 3PJRA 2HB6A 3OWHA 2YWDA 1XQWA 3RYIB 2AG0A 1CNFA 2QTZA 3NAZA 4LRYA 3KXDA 3NDJA 1UXOA 4RACA 3EXHB 2QN9A 1S2DA 2X14A 1QQAA 2IEBA 4QX6A 1QIEA 1T36B 1BOOA 2PWPA 4WXRA 5HCIA 3IPXA 2JC3A 2P4SA 3Q7RA 1OGYA 3MYRA 1H3FA 3FOWA 4JB3A 5FLEX 3TZLA 2B69A 3D8UA 3LL7A 4AF7A 3RVJA 4MR8B 1U9CA 2NGRA 2E89A 4BFTA 4ZT4A 3G2QA 2Z08A 2NP7A 1O87A 3EOBI 4URFA 4WESA 2C96A 2KJQA 1YBVA 5H4HA 1XLVA 2WQ6A 1F5SA 4KPUB 2CLOB 3AVQA 1J8FA 2XNCA 3G02A 4B7UA 2DR2A 4L51A 2P11A 1DPFA 3NJRA 3MCTA 4HZIA 4D8YA 1T5IA 2XF8A 3KKQA 4QPCA 3EZXA 4P0QB 5FDFA 4UHDA 1PEDA 1G66A 1Q3KA 1HI9A 2BGGA 1VSBA 3HCCA 2ECQA 3LBIA 4L73A 5EIWA 3PXUA 3L07A 2ZJOA 3D3NA 4HUQA 4J1QA 4X20B 4DDMA 1F2VA 4J2OA 4LJAA 4QGGA 1WB4A 1ETHA 1PZGA 2HK9A 4ISBA 2E9SA 5FHQA 3UH1A 1XTIA 3UMSA 4F71A 3ROZA 3JQEA 1G6Q1 1O94C 3GT3A 1WOYA 4PG7A 4DRYA 2PFSA 1E1LA 1LSJA 1TC2A 1DT3A 3U56A 1CUEA 1DQNA 2PUHA 2WIAA 1JALA 4NVRA 3GAAA 5KNLA 3CV3A 2L18A 4UUNA 4YWJA 5E6UB 1VI5A 1NJ5A 1UPCA 4M8NE 1UP4A 4MV4A 1N2XA 1M0SA 2Q1SA 1Z2CA 3H9GA 4I6JA 4EW3A 1VHLA 1VKJA 4XYMA 3OLQA 3PQ7A 2G9UA 2R2GA 2WT9A 1CSEE 1AXGA 1PWYE 4QOFA 3RSGA 1ABFA 1PJLA 2WF7A 3PC2A 4XJSA 4HCJA 3V4FA 1ZIYA 3HR8A 3RBVA 5D01A 2WC1A 3DXZA 4MX8A 1R7RA 5CNMA 4AYTA 2AHOA 3KV3O 1XNGA 4DCSA 2ZOSA 4Q66C 3R4VA 3MJ4A 2Q3JA 4IS2A 3OPYA 1CHNA 4PCVA 4I8XA 2X6QA 1JQAA 3LUCA 4IHKA 5JSFA 5E2BA 2EJCA 1I3NA 2O23A 4YP0A 3EVTA 4NBWA 3FNRA 1RE1A 2JEOA 5ALFA 4DXDA 1IATA 3URMA 1UUFA 3UY4A 1OXMA 1RPTA 4DLAA 3O3OB 4PBSA 1T29A 2PGJA 1ZM2A 2B6NA 1YZTA 3DZBA 5I7FA 5LQJA 4R69A 3TSOA 3TDMA 4KQHA 4EGSA 3AR5A 4JJ7A 3WRYA 5JWHA 2CZQA 1QS0A 3AIKA 4KU4A 2IUUA 3A14A 1KAMA 3STTA 5IT0A 2CUTA 3NANA 3Q8MA 5DSZA 3MAGA 4DIEA 3K0SA 1GKYA 4H6WA 4G0XA 3IPYA 4YONB 1VYUA 4QXPA 4WNIA 2R6GA 1K7SN 3NC0C 5I7EA 3PGMA 5HMLA 3OZ7A 2GI4A 3BXZA 3K0HA 5JSZB 4EHNA 4UEQA 4DCVA 3GLSA 3KD2A 3N07A 2YV1A 4PLPA 5C8VA 2GBIA 3GD5A 2MMGA 2XMCA 4K86A 1S8FA 4LXGA 4RHCA 1BJTA 5TIIA 3ROEA 1V37A 4PSKA 3Q6IA 3JALB 2VDLB 2CLEB 3LT0A 4W9NA 4EB0A 3ID6C 4YY3B 4MKGA 2X77A 1OWPA 2J7KA 1GP2A 3IKVA 4D6YA 1Z2PX 1QF7A 2DPGA 1YR3A 4N40A 4CF3A 1NATA 2ZBRA 5FFFA 1QV9A 4B33A 2BH2A 4WESB 4FYIA 3LECA 2ZQ5A 3IV9A 1G98A 3WLOA 4DTIA 4EBFA 5BSKA 1EWYA 3KFXA 4KLNA 3L4JA 4KLRA 1I6MA 2FMXA 2C4TA 3HGQA 3WLKX 3EGOA 5L8VA 1XTTA 2VBCA 1E32A 3ITDA 1F8FA 2WHPB 2V65A 3HDHA 4MTLA 4HWOA 2YWJA 4F92B 1M5UA 4MV1A 3BBPA 1A88A 3DMNA 5TGDA 4O3FA 4AJJA 4K6MA 3UUGA 2WNSA 3GOQA 3H1FA 3GMTA 5KNBD 4XR4A 4AJ9A 4PCUA 4QASA 4HUQB 3RFXA 2QM0A 1GZHB 1V4BA 4JIMA 4PQRA 4MHTA 4BKOA 3P9XA 2W6JD 3VBEA 3L0PA 3T3HA 5JAPA 1UWVA 1W87A 2FHPA 4IJKA 3IP3A 3SXPA 1ZW1A 4IDHA 3FAZA 3OPQA 1WZNA 4DE5A 4UEKA 5E0KB 1DGQA 2YWXA 3UHAA 3VR5H 5B37A 2A92A 2QMYA 4MP8A 2HSDA 3R3HA 8ADHA 4ZT3A 1ZL0A 1OW3B 1P17A 3WSTA 1O6BA 5AOBA 5JE8A 3UWPA 4RX1A 2CJWA 5IUNC 3DFIA 1U2QA 5LJIA 1DXQA 1TCBA 4RKEA 2VK2A 3AJ9A 1RLUA 1EP1B 4JSYA 1UQRA 3FNGA 2Y66A 4PVCA 1MO2A 5EIXA 2EFGA 3JWEA 1JEOA 4XQCA 1PNQA 3SS8A 3T5CA 1TIKA 1GDHA 3D4IA 4WGGA 2G25A 2C3OA 3WB1A 3ZVMA 5A4IS 3UV3A 4ZAZA 5K8UA 1X19A 4IF4A 1IPHA 3OPYB 2X1LA 3QFSA 1S7GA 2V58A 4MUMA 5KC9A 1HY3A 1LPPA 4R54A 7ADHA 1JQLB 3Q1KA 3QFHA 4EL0A 2L2QA 4KV9A 1ZEJA 4LSZA 4U3JA 1OV6A 2MINA 2C0QA 2PH1A 3TSZA 2QIPA 3B7GA 2QD2A 1JLHA 3K0AB 1UZLA 3QM1A 2DJIA 4WACA 4YQZA 5M7EA 5LQNA 3PHLA 5LMZA 3GRAA 1CE8A 5M3BA 4KMSA 4AIRA 3MRVA 4JP8A 4GLOA 3E6AA 4W6QA 3PENA 2W6JA 4PZ9A 2XODA 1XROA 5TJ9A 2XUAA 4KC0A 3FF1A 1VZ3A 4ZCLA 2C4UA 5FD8A 5H9VA 2BFEB 3ROPA 5BXQC 1HE3A 1EX7A 5DBGA 1L5RA 3RW9A 2QMZA 1QU3A 3ND5A 5AW8A 1RYHA 2ZS8A 3GRKA 2I6XA 3GLTA 3LNCA 3QEKA 4ILEA 1HE8B 1F9EA 3CR7A 2OLKA 1KS2A 4WZBA 3PQFA 5K0NA 4S1VA 4FFRA 1SBCA 4JP5A 1NRJB 3PU6A 3KT8A 4CLOB 1DBVO 4UPDA 2W00A 3PFHA 2H2FA 2HRRA 2I2DA 2HMAA 4GM1A 2X8LA 4N6OA 5I3ZA 1XPUA 4HJRA 2ZU0C 3MBIA 4DLLA 1T1RA 1QYVA 3G2LA 2TMYA 1I3OA 4KN8A 1NTOA 2Z5LA 2R66A 2KMLA 4YA6A 3K0KA 1VRVA 1XDZA 2EKLA 2GD0A 3N7TA 4TN5A 1HL3A 1FC0A 1Q21A 3TVYA 1RKUA 3X3HA 4EJFA 4S0ZA 5KSZA 4F2DA 4AWXA 4MVJE 3MRTA 2ZI4A 3ZKWA 4EG8A 2C3YA 4LCBA 1J22A 1LLFA 1UMCB 3OU6A 4IMPA 1DV2A 5I8WA 4A1OA 4EZBA 3RSCA 5BURA 3L49A 4V1CB 1SQGA 4Q12A 2ACEA 2JCGA 4GC9A 3B6IA 2X8JA 3HXOA 1RKQA 2FP4A 2OR3A 1R8QA 3IO5A 3DV0A 1WNFA 4GR9A 5AVXA 5B6IA 4D6XA 2GJ9A 4BMVA 2PMFA 3PQ5A 1KMQA 3SQDA 5L9AA 1V3QE 2JGDA 1RP7A 1W6UA 4X92A 3BAZA 1UL1X 2D0OB 2NO1A 2H6EA 3SYLA 4DPLA 3RAFC 3EIUA 4PSAA 1MUUA 3S0JA 1SR8A 1UBSB 3DSRA 3FOBA 3QOYA 2QW8A 4G85A 3CIFA 3R09A 3GMDA 3IPAA 3BXOA 4R9VA 4NDZA 1T4BA 3E05A 2OKCA 4KXYA 1P0IA 2H0RA 2RC6A 3N2ZB 3DKIA 1QGDA 4OHRA 5IUKC 1KZHA 4D0NA 3JYPA 1ULZA 2ZLBA 1WF6A 2DFPA 1KNQA 2QLMA 1M1UA 1Y6JA 3FAKA 3NALA 3UYKA 1Z6GA 2CGEA 2XHEA 2V7XA 2WY2D 1DBRA 1KJQA 2EWVA 4FMPA 1LTHR 2ZJ6A 2CEAA 5DI3A 1ODJA 10MHA 2BAGA 2RJ3A 3RROA 2DPXA 4LBYA 3KALA 2LZ0A 4FEAA 4KO4S 2E2WA 3GRUA 1WVGA 2HU7A 2XVZA 5CEFA 3ZWDA 3E9YA 1R8JA 3WC4A 2UZ4A 3ND6A 2GVNA 4MGIR 4FQ7A 4MS3A 1MOPA 3NOOA 1EE2A 2PLAA 1N9GA 2RGAA 3MXOA 3K8ZA 5IP5A 4C1BA 1ZH0A 3O5AA 1K6MA 1RZ3A 1TGVA 1M2EA 4S2UA 5BXYA 4X6LA 2A6PA 3E84A 2VPYA 3Q85A 5AJTA 5AM1A 3ZYZA 1GAQA 5D6OA 2V7GA 2GPYA 3QI2A 5DGXA 5CITA 3GAMA 3A9WA 3GVXA 2Q45A 3ISTA 4U00A 2YFKA 2BGIA 1IVYA 1RHRA 1X1AA 1DAGA 3C6BA 1W30A 1XLWA 2QTMA 4JC4A 3RE1A 3PCXA 2GN0A 2WAYA 3BVPA 4JKOA 5SZKB 4YAUA 1NZJA 4I5IA 3RKUA 1L7AA 4MLDA 1YKGA 1CR1A 2A5DA 1RAGA 2AN9A 3RQIA 1SU4A 4U2KA 1Y82A 2VSFA 3TD9A 2GK7A 1KH3A 2BSQA 3K15A 4DADA 1C30A 5B4VA 4ENVA 1QYDA 4LNHA 3FHTA 3T7IA 3LT5A 3Q4GA 4IV8A 1LW7A 3UK7A 1P19A 3OZUA 3SLGA 1ESZA 4HS9A 4RABA 1JU3A 4ZVNA 1XPRA 1C9NA 2GGSA 3I0MA 5A9SA 1SUWA 2C0PA 3QXGA 2XDAA 3UC5A 2HCBA 3VZCA 4MKIA 1U0FA 3VH2A 1NXOA 2YYSA 3NWOA 4FD2A 5FNVF 2EHDA 2IBTA 4QAJA 3HEMA 2E1PA 3K5IA 4XE5A 1M2KA 4IG9A 4B1FA 5JBQA 4A2QA 2ZJFA 3ITEA 1PJBA 3FMVA 3ZW8A 1QLJA 2PN1A 5B4UA 2AW3A 2CDAA 1PR1A 2UVDA 2IH2A 4YP1A 8ATCA 3QMWA 4A03A 2WKWA 3IXMA 5HA5A 3OQOA 1CJSA 3C85A 3QWAA 5GIOE 5EGSA 3CWCA 1GVHA 3D9QX 4ID9A 2QQ5A 1E96A 4Q9DA 3ET4A 4OFWA 3U9LA 4F4CA 3HNRA 3ZWAA 5AUOB 1OH5A 3O84A 3DV0B 4BKQA 4I50A 3AHCA 1T3SA 3DMDA 1R6DA 4I08A 4URUR 1JDVA 5ITVA 3K3PA 2PMWB 2MYTA 1YOVA 1ZIOA 3D59A 3HYLA 3QIVA 4HPWA 4KH1A 4W5WA 5KOHB 1GKKA 2J0UA 3AJ8A 3DFMA 2WJAA 1KMNA 3EGCA 4OK3A 2EKZA 1G5IA 4M36A 2OYRA 4L22A 2K5UA 1AKWA 4ZCQA 3TMAA 3CZQA 4F5EA 2PZLA 4MMYB 4BS9A 4TKVA 4WN9A 4A91A 2W2QA 2W90A 1PJZA 2P7HA 5J4LA 3QY0A 2H3HA 1ODSA 3N53A 4LFCB 1D03A 1X1SA 3KTAB 4CG3A 4RIHA 1R0RE 3KQYA 5DI3B 3ER9A 5THQA 3R2JA 3AFGA 2WWHA 1I0IA 4GRDA 2AZ4A 3R40A 4G81A 1GKLA 1DKUA 3LLVA 1QG6A 2D2FA 2HCTA 1CHDA 4H7EA 5JPIA 4IIFA 3NZEA 4NZOA 3ZY5A 4JUCA 4ABYA 1M72A 5BQ3A 3L7DA 3AVUA 1GCOA 4OBXA 1VE7A 3CT6A 3LVQE 4QYSA 4GMDA 4EPYA 1IN4A 5CXXA 4OFXA 3I4FA 4NEQA 4CTMA 1X8LA 5I5EA 1NJGA 2C7PA 3VNVA 2I1WA 2Z4SA 3N8IA 1P5RA 1C3EA 1H1DA 1S6YA 2IUSA 2P2NA 3HNOA 2VPIA 2BHRA 4G1CA 1IIBA 4L8LA 4O8CA 4GPBA 1OX5A 1USWA 1P7CA 3MMSA 4ERXA 4IUBS 2JA1A 1QPBA 1WV1A 4F4IA 5EOVA 4BL5A 2NPIA 1V47A 1Y81A 1T3TA 3QTLA 4OJMX 3AKZA 2PX2A 4G6ZA 4D2IA 3OM0A 2ST1A 2ZKIA 4LOKA 4LYDA 2ERYA 2VDKB 4PNZA 1L5GB 4UAUA 1C8KA 1O95C 1VCNA 5DM1A 3X1WA 1NLUA 4WE3A 5DU2A 3ZOKA 3H87A 4EFMA 3VNUA 3T1OA 4LV6A 5CPFA 1IM8A 3FMFA 2W6NA 3EWSA 2E4UA 1RLJA 2B0JA 1ZG3A 1T6XA 1NGSA 3NDPA 4DY4A 4JY7A 3CX4A 1YGYA 4P3PA 4UNPA 5JSYA 2FMKA 3IE2A 1SBNE 2R3SA 4WY8A 4KXMA 4IQGA 2O3JA 1IHPA 3J80A 4H9GA 3C3CA 1ML4A 3UPUA 3IS3A 1YC5A 1NXWA 1CUSA 4ARCA 1MH1A 2W2MA 4A7PA 4AKTA 2C07A 3HFJA 1CZKA 5DLPA 5KOJB 1BN6A 4DR2B 2O06A 4M0MA 3JAMA 3CH7A 3FTFA 1AHHA 4TXMA 1P4HA 1JBEA 2QVCA 1JDTA 1G2OA 1VG0B 4Y9SA 3SOPA 2Q07A 3ED1A 4JXKA 3QBDA 1RCTE 3GNLA 4POAA 4RJ2A 3ZDFA 1SCKA 1ENYA 4AZVA 3QFFA 2Q8NA 4W9NC 3EAQA 5DPMA 5IMSA 1HNWB 2GCGA 5KJCA 4MVYA 2L0XA 4M9SA 3ZVKA 1W4RA 1H0RA 1M6YA 1SG0A 2IP2A 4FE4A 4RFVA 3REQA 1VLZA 5HWSA 2QL6A 1IZZA 1WSAA 1NAIA 4U2CA 1MX5A 1SNYA 2ZETA 3PUHA 1XQ1A 3SEQA 3KS9A 1FFCA 4KQMA 3ZX4A 5KVCA 3SOZA 2HDOA 4F97A 2WSIA 4OL9A 4Q48A 1YZLA 1YOVB 3LOUA 4ED9A 4F3CA 2J09A 1FNDA 2J0UB 1HEUA 1LF0A 4NARA 1Z0IA 3KE8A 4NESA 4Q3OA 2HIAA 1X8XA 4QBKA 5EMJA 1RP1A 5P8WA 4D0RA 4I5DA 1YVDA 4ABTA 4J1TC 2ZR9A 1KR2A 3NBFA 1UPXA 1WXEA 2R96A 3AF3A 3P0EA 4ZVVA 4TYYA 1DEHA 3GLQA 4OJYA 2QPAA 3SC4A 3SJUA 4AUMA 1ZZGA 3U7HB 4Y1FA 1CS0A 4BHTA 4HZUB 1JWAB 2EYUA 5KYVA 3AZOA 4HUJA 2JBAB 1MEOA 4Q9KA 1I24A 1FFGA 2WJIA 1DKPA 2R9VA 4Q4JA 5AVWA 1R6BX 2BBWA 2BMEA 4ZEXA 4UM9D 1ZL2A 5JD4A 1U0HC 5LQKA 4WLOA 4ZRNA 1AZSC 1MVLA 3TM5A 2JEZA 4X24A 5H83A 3TR0A 4G8DA 2Q7DA 1BRMA 1JJIA 2DX7A 3IBCA 1R1DA 5KJEA 2C2XA 2NACA 3DV2A 3GPDG 3JVVA 1BOFA 4HQFA 3HBLA 3O1LA 4KGVA 3OURA 3E1GA 4CCYA 2G63A 5AW1A 1UJCA 3FLEA 3HM2A 4NG4A 3H13A 4JJIA 1TJNA 3JQ9A 1N2CB 3ZE0B 4Q4LA 4XA8A 3HUDA 2JIOA 4LDNA 2QN3A 5FBZA 4XWOA 3C1OA 2ZWIA 2IUFA 4BC1A 5JW6A 1AUQA 3AOEC 1QKKA 5DIZA 4OLFA 2QAGA 1PZNA 3KTFA 3L0IB 3RBAA 2FHSA 4AROA 3NV7A 3WLEA 1S2IA 3FPKA 1GZ6A 4MULA 4G25A 4E1AA 5IANA 5KYYB 4D25A 3UUFA 1GLNA 4I4CA 4TYMA 4B6QA 3ZE7A 2W42A 4M1TA 1JSCA 3FPFA 2RBGA 5T8KA 1L7DA 3FBGA 4DC1A 4Y3UA 3ESXA 1O4VA 1DIGA 4KR3A 2QMQA 5BW4A 5CVEA 2F64A 5KNDH 1T1JA 3KOZA 4OJQA 4P84A 4U0KA 3M5CA 3G2HA 4KTTE 2AFVA 1DAPA 2B36A 3K72B 4JIGA 4XSHA 1D09A 3M6VA 1ICIA 1PGPA 2HLPA 2ZUWA 1YK0A 1PT9A 2Y1EA 3N2GA 4GVLA 4HQ6A 1SOWA 1L4KA 3W1WA 2O8FA 3B7WA 5JS6A 4N48A 1KYTA 2IVFA 4UXJA 5FJJA 5GZ6A 1V9SA 5KDOA 4PC1A 2PUCA 5J4HA 2E0IA 1AA6A 4BX2A 3WMRA 5EJ8A 2H7YA 1JXQA 3RARA 3U4GA 4DCNA 2I6UA 4ROSA 4QKQA 4B8YA 3VR4D 5BNWA 4F4HA 1OBFO 3B1VA 2BEJA 3FMIA 1BMFD 3EY9A 3PI6A 3QVJA 1RC8A 3WJ7A 1EVEA 1WE2A 1ZDMA 1QIJA 2VDJA 1KXZA 1U8ZA 1XV5A 5C5EA 1N7GA 4EFDA 2IZ7A 3O9MA 1EX6A 3HK2A 2XMBA 2P9JA 3WK5A 1TLLA 2GZRA 3HG7A 4RW0A 3SZUA 2K7FA 2GH1A 3GJ0A 1GCUA 2YN4A 1Z37A 1DEOA 3OZRA 4RKRA 4JYPA 2A5LA 2BEWB 4UE2A 4ESVA 2IHBA 3LPCA 4MS4A 1XU9A 3RC9A 4F9EA 3PL1A 2IWHA 4FFSA 2LDBA 3F46A 4N8SA 5HIJA 3BD7A 3OFJA 4KWEA 4I19A 2CEKA 2VDVE 3INTA 3ZZ0A 4AKEA 1KYVA 5U9CA 3K73O 1FA9A 3BMCA 3G8BA 4JCOA 1OLXB 1OE0A 1I5EA 1RT9A 3KKMA 4OJTA 2ZZMA 3DDUA 4JELA 2C2MA 1AQ6A 3MOIA 1R0XA 4D8XA 4L57A 4X8MA 3A32A 3AMVA 3BSFA 5ALOA 3PF8A 4GG1A 4R5MA 2HK6A 3I32A 4N3GA 4UU1A 4B2LA 4EGAA 1KZYC 2BGJA 2KWIA 4K9MA 4AX4A 4BZXA 3WNQA 2YZNA 3PRYA 5D1HA 4CHGA 2C5LA 4KYIB 3Q7TA 4CGYA 3K53A 5AVYA 4L8YA 1X80A 4MQ5A 5H59A 3VR4A 4E07A 1MW9X 2QHXA 1XPJA 4X7MA 1BMFA 3MUFA 1CULC 2BW0A 4LCJA 3WKDA 3PC6A 1P80A 2P1RA 3NC4A 4K9RA 1MD9A 4LG1A 1QC5A 3FMGA 1G3UA 4UTOA 1N5OX 2QRHA 3Q8XB 3UB2A 4UNRA 2HY7A 1I3LA 2NP6A 1M76A 2BGNA 5TGZA 4OBWA 4TWZA 3C2QA 4DCPA 4OH7A 1QXSA 1YMVA 2BJWA 1OZAA 4BBPA 2YJGA 2AFRA 4RORA 1G8JA 1W4LA 3F3SA 3P45A 3E3MA 4C7MA 5ISMA 4NQZA 1A7UA 1G0OA 3VGJA 5JIBA 3O8RA 2ZTSA 3PX2A 4NDNE 3WR5A 4TMZA 2QAGB 4HY3A 1GZUA 4MEJA 2QDXA 3AW8A 3NOVA 3CUWA 1BXKA 1NYLA 4YV1A 3EA5A 4IIXA 2P2YA 5IC6A 1MIHA 3ZIAD 1BE8A 2ASEA 1H94A 3A1VA 3P96A 3AB7A 1IQ0A 2CXPA 2AD5A 3QNUA 1A9XA 1JDBB 1PS8A 3DCJA 4MR9A 1U8AA 5JS7A 4U6QA 1ULSA 3WKAA 3AVPA 4LC9A 3X1XA 1SIWA 3AX6A 4YAOA 1FVOA 3UEOA 4Q00A 1ODKA 3SHTA 1WSWA 3COZA 1VE6A 3N2GB 1BDMA 2PH5A 3IKJA 4I4TB 2V7TA 3ASZA 4KK3A 4MIEA 4HFJA 3K0EA 3PT9A 5LR6A 3KJHA 4YDQA 3IE1A 2JLAA 1WMSA 4MGHA 2NVOA 2UYHA 5AFSA 1IG3A 3MS2A 2BFCA 2Y68A 1GM5A 4LJ9A 1UT8A 1W1WA 5IPFA 5ADUS 4RHUA 2PV0A 1TRHA 4Q4HB 4E5UA 4EM6A 3H2SA 1EZ4A 1YCFA 4BATA 2YRXA 1D6SA 2G0NA 3BYZA 3NWBA 4GU5A 1S8NA 4XGQA 4XQ9A 3KL4A 3IIIA 5EL0A 4BZQA 2WTUA 2CHUA 1BW9A 2NSHA 5EHIA 3DGEC 2AG6A 2VHJA 2AX3A 3MK31 5TGTA 3LF2A 4G86A 3HKCB 4Q7MB 4B44A 2VUIB 1E18A 1SCDA 4H4CA 4RVUA 1LK7A 1XMIA 3D3QA 4CQLA 1L4UA 4E14A 2NVBA 4NXMB 1OUMA 4MS4B 5I7UA 2XY4A 2VF2A 3DVAB 5ITSA 1Z8DA 1Y3CE 1KBQA 3BJMA 2YW9A 4KO1S 2ZJ3A 3E2PA 4LYJA 2CFOA 5TQVA 3LOQA 5AHRA 3V2HA 4PYNA 3DNMA 4Z4CA 2MSNA 2WLSA 1YA6A 4IOMA 1OWMA 3KUXA 3PXGA 1X38A 4ZYTA 3L05A 4FZRA 2G04A 2WIBA 2IEIA 3DC7A 4X7PA 1DOZA 4L3VA 3V55A 2REOA 3PJFA 4R51A 3NFYA 3GT0A 1ABBA 1DWUA 1J06A 1H2FA 4Q37A 1ZO8A 4DUPA 4XQEA 1JHQA 4OKSA 3LHIA 4WY5A 2XRYA 1ZNZA 5ALUA 5DE3A 1YI8A 4F7WA 4UAGA 1M2JA 3F5FA 2RHJA 3BZWA 4UVIA 4DS3A 2WJ4A 5CB4B 1YA8A 5G0UA 1ZMOA 2Z6UA 2VNKA 2CK3A 3QPDA 3I1FA 4ALNA 5B12A 3W2GA 1HG1A 1P18A 1RJDA 2YY6A 2DXIA 1AV6A 4BLPA 5L6MB 1NU8A 1XZJA 1QC5B 4KSCA 2CHGA 4AD8A 3CLSC 1BHQ1 1C4OA 2C5GA 4AN1A 2P30A 2JFQA 2VBGA 4MPTA 3TNDA 1LB1B 3VMMA 4R1UA 5FB3A 4V0RA 4ZKEA 4DN6A 3RK0A 3KB8A 5IC5A 2EDCA 3GRYA 3RADC 2VYQA 2QTFA 3UMMA 5KWEA 5BT9A 3EBLA 3HXKA 1CY7A 1R8SA 4EX7A 4N1AA 2WWVD 1Y7LA 5A1TA 4RV9A 1M5RA 2BV3A 5F73A 4BV8A 4C1NA 4C3UA 1X7YB 2XQVA 3D5EA 3S28A 1BRTA 4RO0A 2N47A 2I6TA 2HTEA 2ODAA 4L85A 4OXRA 2G9NA 5IWCA 1BS9A 2BFPA 4V38A 4X1IB 3JQ8A 3KPYA 3VI4B 1VGRA 4RCYA 4TXNA 3BH6A 2WNIA 3P2YA 5MN5A 5FOWA 3VFDA 2D2IA 2LPMA 3D8NA 3KJZA 1VHTA 3PC8A 3E03A 3LCUA 4WW0A 5FFNA 1TJ4A 2B35A 1DARA 1N8NA 3QVSA 4KV7A 4AM8A 4E1VA 1LU9A 2VHTA 4LSWA 4MIKA 4TTJA 1MO6A 1FQJA 2X0IA 2IBSA 3MT9A 1OJLA 3DHVA 1W25A 4YDHB 4DXHA 2IXDA 2WEKA 2OCYC 1Z2OX 3FIJA 1U1IA 1IDN1 2DHRA 3KAQA 5DK6A 4N7MA 3RIMA 1H8ED 3QXSA 3D8BA 2WR8A 2RHGB 1FW6A 3DUFB 1TADA 3G0CA 3H42B 1KY2A 4FYHA 6GPBA 1TA4A 3OQJA 3USES 1NHGA 4DM3A 3LP6A 5H70A 1JV2B 2I9KA 4JLAA 3ZVNA 3VUEA 1G291 1ZP6A 1U3CA 2AR0A 1N9KA 2IW1A 3H7AA 2BGKA 4RADA 5GV7A 2EATA 1J20A 1B0ZA 3ZV4A 4M55A 5MGNA 1NW6A 1SZCA 2Y0DA 3BFXA 2PUBA 4DIFA 3IAEA 4YCSA 3QIAA 2FQWA 3BHJA 3WFIA 4EO4A 3ETLA 1WP9A 1MX1A 4NEHB 3T8YA 2CDBA 3L92A 3SYMA 1FP1D 3UFBA 3A9UA 2G6BA 4HOYA 2WRZA 3CLUC 1GNLA 4BU0A 1Z68A 4Z4EA 3R0XA 5SYAA 1TQ4A 4DLBA 2PGOA 4KXQA 4YT4A 2WJVA 3P2JA 4H4DA 5K3FA 2IYNA 2ZW9A 1DOHA 1PWXA 4CLRB 1QQBA 3K9FC 5G0VA 4MW4A 3RNOA 1WDKA 4GMFA 3ZUPA 1TT7A 2HWXA 1VHWA 2J6HA 3ZEAA 4DDUA 2VXYA 4X6XA 5BOVA 4S1NA 1M2VA 1U7OA 1T2VA 4GOKA 5CDTA 3DMFA 1DTSA 3QA3E 1A9OA 2DBVO 4HAYA 3QVLA 2O6HA 5EXEA 1F4PA 1UK6A 3SYRA 2FSSA 1ZQ9A 1PV4A 2IFTA 1YRHA 5G4KB 1JT9A 3P0HA 1AUVA 5J59A 4GW3A 3TOCA 1LLCA 3DDCA 5EXTA 4R83A 3UV7A 4BLOA 4ZO4A 2G0AA 1LS1A 3Q5DA 4WH0A 1SZJG 2Y1WA 1X94A 1YMQA 1TEVA 4HR7A 2X76A 2XCUA 4EUNA 3AU8A 1ZH2A 3TAXA 3AJEA 4EVRA 2OB1A 4Z6KA 1H4SA 4LGYA 4BNMA 3VZBA 1M33A 1L4EA 3TZKA 1P2BA 4TXJA 1GPKA 4C9BA 4NBLA 1N33B 2XYPA 1GEGA 2ICAA 4OG2A 4YCCA 2C78A 4BNFA 2FSVA 4HNVA 3UMYA 2VPWA 5ALLA 2H8KA 3ZLUA 1CDZA 2Z2XA 3HY6A 4RS4A 5ELMA 4HATA 5HILA 1AMUA 3HXLA 5JV5A 5DLEA 2BUBA 5CB8A 1PZHA 4LMAA 3EUWA 1A0OA 1CS4C 2B5WA 2G9ZA 3NRJA 1UH5A 2R00A 1NJSA 1W0JA 2R60A 1B1CA 5EXXA 2QAGC 1XDGA 4KQKA 1IMJA 2UUAB 3IKMB 3IUQA 3BS4A 2VJKA 3O2SB 4TMWA 5LDDC 1TYZA 2O7VA 9LDBA 3QVXA 5GZ1A 4HWTA 2P9EA 4OAOA 3STVA 2HU5A 4JT4A 3SICE 3VOAA 1OY1A 4EI9A 5T8KC 3JQ7A 4C3OB 1EBFA 3BICA 3A25A 1JDBC 3X0DA 3SX2A 1WPGA 2VCHA 1HTBA 1NXVA 5A71A 3TUJC 4CV1A 5LZ9A 1NVFA 1DX4A 4C6TB 5KNCD 3DAOA 2IQIA 3KSDO 2VJCA 3QE0A 4IHJA 3QNMA 1SAYA 1USVA 2X7JA 2VNIA 3M9LA 4WK4B 1ZK4A 2WPDA 4N12A 3BK1A 1B73A 1P45A 3QX7A 4PGAA 4RTMA 3K1ZA 1AM4D 2AOUB 2Q3MA 4RK1A 2J7PD 3KD3A 3OT1A 1Z0ZA 3OZWA 5HW0A 5BN3A 3S7ZA 1B8PA 3CVYA 4RHYA 1SUAA 1QHEA 1B2LA 2BM0A 1XWFA 4YMGA 2DH6A 3VU0A 4KQ1A 3GZ4A 4IWYA 4GYWA 2BMJA 4YJGB 3F6SA 4WADA 3A4VA 1JTFA 1C0KA 1VXOA 3DLCA 4IEIA 1ZWLA 3FHOA 4IMIB 4FUQA 4W8GA 3BT7A 1FQWA 5JR3A 3DHEA 2A33A 5FPPA 4E4TA 1NA5A 4MDEA 4GLJA 2QN1A 3QRWA 1V7PC 3W04A 1P5HA 3BK7A 3QUQA 5JXGA 1GPH1 4PFSA 1KBOA 2FEOA 1NWCA 1JTEA 1OWLA 1UZAA 5DRTA 2I66A 4F9FA 4E0BA 2WJ3A 3AI3A 1L2TA 3KUUA 4LQDA 3G5LA 1YZQA 2ZQYA 4E1BA 5JAIA 1CY1A 1FYFA 4PHHA 1R9JA 3IELA 1FFAA 1NVEA 1RKXA 3A31A 3MCZA 4GPIB 1OT3A 1QIGA 1UBFA 2JASA 4LY6A 2BKUA 2O8DB 1R0YA 1TTQB 1LSOA 1KEKA 1ZBDA 1GQFA 3NB0A 5SV2A 1RM4A 4YQFA 1YDFA 3EVCA 2XOXA 3NIFB 4N39A 4Y9UA 4F04A 1SVOA 1G2PA 1TQ2A 1MZVA 1I36A 1NLYA 1USIA 3HA7A 2HK8A 5JFOA 2FEMA 1ZONA 4R9RA 2J7PA 5C34B 1YZKA 5DM60 3D3WB 3UMBA 3NRBA 4GZMA 3CYFA 1YAJA 2N1MA 3J7AC 3R9XA 1P44A 2HJWA 1HQCA 4QLOA 1LUAA 1W29A 3BDIA 4MIYA 1I30A 4EFKA 1JAZA 1AA9A 4UFPA 1F2TB 3KPVA 2ZAYA 3UVEA 4GLFA 4IF6A 4US0R 1J2RA 1CQZA 4Z8XA 1L8QA 1MMFB 4GBED 9GPBA 1L4MA 3T7CA 2Y27A 2B8NA 4INPA 2J9YB 3AIMA 3OLYA 3FOFC 1GQSA 2OD9A 4Y2QA 3VNQA 5D3MB 2IXAA 1R0WA 4XVCA 1Y34E 4I50F 4NX2A 4QWMA 3I2HA 4M0PA 5EHZA 5F1YA 2X5NA 4WVFA 5GMOA 1UWKA 5EMNA 4EG5A 1NG1A 3JW8A 6YASA 2CE7A 1NYTA 2XA1A 1H3NA 3TTXA 4NF2A 3H1PA 3NKFA 4IUDS 4MV7A 4J16C 4C6SA 5I9LA 1E1NA 5F52A 5EE1A 1ZXXA 4UD2A 2IUEA 1QIFA 5E9AA 4BFCA 2X2PA 3K05A 2C4KA 2YOGA 3F6RA 3NHWA 4QO8A 3WL5A 1FLNA 1Y42X 3HKBA 3GGOA 4QYMA 3B6MA 4JA0A 2ZRKA 4Z2AA 2TSYB 3I3SR 1QORA 4IL5A 3W8NA 2BYTA 5CVTA 1CUUA 1EE9A 2B2CA 1AQUA 1DUSA 1HDYA 3JQ7B 1K97A 4U0JA 4XX1A 5ECDA 4FMBB 3CRQA 3NHBA 3KYBA 3TFWA 1Q7CA 4AO8A 4EB6A 5CDGA 1C4KA 3BSYA 5CVDA 4XB2A 5DW3A 4BV9A 3W9SA 2Y1FA 1KVQA 4MPPA 4GZLA 4JJKA 1X0VA 3MILA 4G41A 2PSDA 5KI6A 2AX4A 4EY7A 4BWYA 5AIAA 2FR8A 1K7YA 2OGWA 1Y7TA 1MX9A 2NPOA 1Y63A 3EQZA 4KO8A 4FFBA 4OQYA 4QXAA 3C1UA 5F3DA 5BN3B 1LCIA 3SKVA 1TK9A 4LHEA 4BLUA 4Z9YA 1I3MA 3U1VA 4D9KA 3TLZA 2VHWA 4TS9A 4KXVA 2GJSA 2AOXA 2XOEA 3N1UA 5E4TA 2FPOA 2YZMA 3D3KA 4XLTA 3H2BA 1YQEA 1Z88A 4RY2A 3BUSA 16PKA 2HRBA 3SVTA 4X3OA 4ZT6A 4Z3KA 3FZGA 3QUTA 4D9BA 1GITA 4EENA 2RCNA 2Z1DA 2XCLA 1KOGA 1XNQB 1NBMD 1Z9BA 1B16A 4J0CA 3FZYA 4FXPA 1CFJA 4QM6A 5JVDB 5JCZA 1YR6A 2BD0A 1KY3A 2BM1A 4NABA 5D3QA 3MJHA 2NU6B 3TOZA 2GQ0A 4AS2A 2D1YA 1QZTA 2J9XB 3KYDA 3L6UA 1PZEA 3C14C 3LXRA 4RL4A 3V8MA 1B2RA 1NXPA 3QBTA 1BN7A 1J33A 4ZOAA 5J4YA 2C9BA 1NF3A 3V8RA 3N0VA 4DR4B 4NCKA 2B4QA 4NYIR 1RJ9A 5I7AA 3H04A 1V4NA 2XDQA 3UGKA 1E5LA 3H9CA 4DT1B 1TE2A 3HBFA 5JYCA 4LF6B 5BYJA 1EINA 3PXCX 2ODQA 4IXDA 2HF2A 3JQRA 5D5HA 5IX8A 3R6DA 1BHO1 5A3VA 3R77A 3MD0A 2HHAA 2ZIVB 2WAXA 1CVRA 1KI3A 4FFWA 1DC6A 2VJQA 3JZDA 2UYYA 2HHLA 4RLHA 4S1OA 1NKTA 2JD0A 4D4IA 3R9XB 2MTBA 2EERA 2QL7A 1JHXA 1VL5A 2HDHA 1DRVA 3EXEA 1NJ2A 3IH5A 3PNQA 1CJVC 3U4QB 1U2RA 3AM5A 1N92A 1K7FB 1U4NA 2FYTA 4M46A 4F86A 1XAHA 2UYGA 4B3XA 3ZK9A 1JSXA 1QZXA 5CM8B 2XTJA 1J49A 2B1QA 3N2KA 2EU8A 2VSOA 2VHZA 2SCUB 3IUEA 1C0EA 2XECA 4JR0A 4C78A 3R3JA 3C4QA 1NBMA 4OD0A 5AI9A 4N9QA 5EWJA 4HWKA 3PZBA 3DOEA 2HPHA 5B7GA 2VDQB 5JY1A 1UJNA 1GU1A 5AK6A 1RAFA 3AH8A 3DVQX 3INRA 4A9AA 1CU1A 2PKEA 1S3IA 2LVBA 2NQTA 3IB3A 2E37A 2FEPA 4EB3A 3OH8A 3BC1A 2VWGA 3QV1A 1FMTA 2AWOA 2FPGA 1ORVA 4L72A 1THGA 2D0PB 1FXSA 2VPPA 4JL5A 1ADFA 2C0CA 4UAVA 3G6KA 1L8OA 3GFSA 1RJFA 2QE6A 3H6GA 3N2NA 5EWLB 2VH1A 2XF2A 3V1MA 4E5KA 2HOQA 3ZDZB 2E4XA 1IJFA 1ISHA 1NJ6A 1QSGA 1PJ4A 1WZEA 2BLNA 3SYNA 3DT9A 3RIGA 4BV2A 1FDSA 3KNZA 4L0DA 3IQIX 1ML3A 2QZPA 3PC8C 3ZCQA 4EB6B 1RLMA 2HBRA 1HG0A 1PLLA 1XRSB 2YXPX 4GX0A 1B6GA 1KSGA 1TF7A 1LH0A 1ZKMA 2VUSA 1TRKA 1P4AA 1SVSA 1MC5A 5ALPA 3ZE9A 4ENUA 3K6SA 4JI7B 1D04A 1CEQA 1XA0A 3FYSA 3QOFA 4HLCA 4PAGA 1INLA 4LZLA 4UUMA 2MSDB 1UJMA 3IA7A 4EO9A 2ZE7A 3ZHSA 1VJTA 1MG0A 1B23P 3IP1A 5A3RA 3QWFA 2PL3A 3B1ZA 3LT2A 3QWIA 4RK7A 5K5EA 4YGYA 3CR8A 4H2DA 3CUYA 4D9IA 5IM4A 2FTKE 2PBZA 3NWJA 2RJNA 1G20A 5BYKA 1EM8A 1G42A 3N7AA 1QO9A 3JX9A 4EIWA 5ABPA 1VRWA 2BR3A 4BQOA 1V5FA 3A3PA 4GDMA 4XIYA 4EEXA 2WNHA 2C8JA 1US8A 2R8PA 2QM3A 4H35A 2P69A 3A3NA 4JWTA 1XRJA 1D6JA 1YZYA 3MJTA 4OKNA 1VCOA 4S0XA 1SQ6A 2DQKA 3PC7A 4J2TA 4QUKA 5FPTA 1GTL1 1TU0A 3PKIA 1WUIS 3ISVA 5LUBA 1NFRA 1Y0BA 5HZMA 3HABA 3KYDB 2XDWA 2C95A 4XI9A 4FFOA 4Z4GA 1U3DA 5K0EA 2Q7XA 1YA4A 2ZK7A 3B7PA 3TSWA 1CUHA 2P5UA 1FOEB 1RJ9B 2GK3A 3ZU6A 5FTMA 2ZSFA 3BB1A 5KTTA 4L08A 3CWZA 3UOWA 2H1RA 3U31A 4DMHA 1D6MA 2UZ3A 3KJXA 2C7OA 2Q9UA 2HWWA 3FCCA 3H5IA 4KW7A 3ETDA 2C2KA 2OOSA 2MYPA 2RAUA 4FM9A 5K0GA 5EP3A 1S96A 1XKXA 2P62A 4JEUA 3IHKA 4ER6A 3CNEA 4RH0A 1DZIA 3VU9B 1C8LA 3D1JA 3QVVA 3RU3A 1RKVA 1X3SA 4FS8A 4YJKA 3DS8A 3HLKA 3SQLA 2C7GA 1MT3A 2NV0A 3I6IA 2AXEA 4R1MA 3ML1A 4IDFA 4CM5A 2XHZA 1GXSA 1OZGA 1YBMA 3CB4A 4GPD1 2BBOA 4ZVPA 3F90A 3KAKA 2IOHA 2ERXA 3O1JC 4KAAA 3GW8A 3LQKA 3FBTA 4L8GA 4PPGA 4H16A 1JQBA 4MI3A 4YR7A 3PQ6A 1ADCA 5AVJA 1BVHA 1A50B 2LE0A 4ISCA 1YVPA 5CLFA 2QE7D 1ZJWA 1BX3A 1FUEA 3EGXB 2FSVC 4L9RA 4HGNA 1QX3A 3KHUA 5KU7A 2J48A 3BQMB 2AFIE 1IEQA 4DMMA 3SR4A 2C2GA 1GTRA 1E6CA 1B6SA 5IM5A 1C41A 3Q98A 1W9HA 2BSXA 3QEOA 5FBVB 1NNEA 2BMFA 5JI2E 3S2ZA 2O2HA 4FFVA 1BEEA 3EPPA 3HJRA 3OBBA 2NMVA 2EF0A 4FONA 3UB3A 3IT3A 1M2NA 1IHDA 1P33A 2JGNA 1XNJA 3E9NA 4KTVE 3SIPA 4CM4A 2XD9A 3OJCA 3UGQA 4C0JA 1KVRA 3DP9A 4V0NA 4Q9IA 2I29A 3DLPX 2QYOA 3G0OA 1TTTA 3AT1A 3U81A 4MICA 5K20A 5C1DA 1C29B 1E0AA 3BWDD 1W5BA 1Q74A 5CIYA 2QLTA 3JYNA 4ZFNA 4QVIA 4PTYA 3O4IA 2AI1A 1CZUA 4D8TA 4YRIA 2I91A 2HADA 1AMNA 3FROA 3ASYA 4B84A 4RIIA 2NNWB 3BA1A 3DBLA 3HJBA 3L06A 3G13A 4PQEA 5HFJA 3MGCA 1FS6A 4BMOB 1V8PA 1V8DA 1VG1A 3TDKA 1IBLB 2BR4A 2ZSAA 2VRBA 4UAJA 1RYFA 4Q39A 4J0GA 4O4IB 4EBBA 2HDWA 1O5TA 1HM5A 3E48A 3Q1LA 2PGAA 4IMJB 3JWPA 4RTLA 3AYXB 3DAGA 4FKMA 3DO5A 4M1EA 1FYVA 1W4AA 2PX6A 3CZ4A 2BC9A 1A8HA 1LK5A 2H48A 1W85B 2QJFA 3PCTA 3QW2A 4G4SP 1MNAA 3NC1C 2XB9A 3TW6A 3AY6A 3OCZA 5KVAA 3IUSA 1GGNA 2ZB8A 3VR1A 4DYVA 4M0LA 1IMOA 2R87A 1WNTA 2FFQA 2GPAA 1GN9A 4PG4A 1KAOA 4UU7A 5B1DA 2KI5A 2X9VA 4JOQA 3PUZA 2ZUDA 1SGWA 4PX2A 2XYQA 2JW5A 1XTZA 2HWUA 3FMOB 1TD9A 4NNJA 5J3JA 1MENA 1DSSG 2NVWA 4XYBA 3H3XA 4RY8A 1PG2A 1S3SA 1B6RA 4B45A 3GBVA 4O2BA 4WLEA 2KW5A 1WLYA 5HF8A 2RK6A 1EFPB 5CIQA 3MS7A 4PO9A 1H42A 4IIYA 1NRWA 1IDOA 3G17A 4RWEA 4F4UA 1RAIA 4IVQA 3M0EA 4NCNA 1YVEI 1VPWA 2Z5GA 3DZ8A 2F00A 4I66A 2OV3A 3P9CA 3RUEA 2OXEA 1I2AA 1PTJA 3C41J 3IDAA 4WDRA 4A0FA 1GT91 1DNPA 1XDDA 1PG5A 4YBZA 5BNIA 2M1XA 1DFHA 3K2QA 1KQPA 4C6RA 3OTGA 4KDCA 2CUNA 3O8OA 5T4BA 4EUEA 4UOEA 1FUYB 3NJ4A 4PY2A 4AZTA 5CBPB 2IX9A 3OKFA 3IT2A 4K6FA 3FHJA 2NNLD 2PZFA 1EGHA 1X74A 1ZY2A 5AVQA 3TB4A 4JBYA 3NNDA 2CVPA 4M1OA 1JIUA 1F7VA 4M7RA 5KVSA 2ZYDA 1TKCA 2F90A 4A6DA 3I9V1 4LC1A 4DCCA 3S2YA 2VNHA 3TWOA 4NPAA 2FSIA 3WMXA 4D4MA 5EINA 5K05A 3OZBA 3LZCA 2JHGA 5F3WB 4CM4B 2W6QA 2Q9AA 4XOUA 1OFHA 2NZUG 4QBGB 3DHYA 4GHWA 1VI2A 4P3XA 3USZA 2JGLA 1QVZA 1M66A 2EGHA 4PBRA 5A6SB 1OLOA 3L6CA 4YJ2B 3BD9A 4JXZA 2J9ZB 2D4AA 3ECSA 1TF5A 3AG5A 3GFQA 4YO7A 1G60A 2VSYA 4M1SA 4MUJA 5I4KA 2FH5B 4UATA 2QRUA 2BWJA 3DTNA 4KXWA 1TYEB 4PYOA 5ALEA 2FWIA 3UAXA 4DQLA 5BRJA 3KBOA 1J1IA 1B8NA 2JJ2D 2UZIR 4GICA 4ENWA 3NOQA 3GZNA 4MGKR 1Z6XA 4PCLA 4LYEA 3JWHA 4OXQA 1G7SA 3QU9A 3UMRA 3EZ2A 1GNVA 4YRSA 1UAGA 1OBVA 2FR8C 2WJYA 3QITA 2ZRNA 3HE3A 4RD1A 4XEHA 3T54A 1OFVA 3GGCA 2FKAA 3DYVA 1Y3HA 3II6X 1B0UA 4IQ8A 1KK2A 3R8CA 3WGMA 1IXZA 2XVYA 3CH6A 3N8DA 4Q3DA 1JSRA 1QCYA 5JEDA 2ODPA 4Y2PA 2ZDGA 1IOVA 1Q6ZA 3HCAA 4JI5B 3BBLA 1XU7A 1UWCA 4GNKA 5EZSA 4M1YA 3W5VA 4AQDA 3CMCO 2I62A 3AINA 1SC9A 1IUNA 4JBGA 1R6TA 2HDNB 4G4IA 4JFAA 2WE7A 4L5CA 5K3CA 4IGFA 3V8VA 5CFQA 3A2LA 4NYMQ 2ZVQX 3QF4A 4ZHSA 1KDPA 5CJPA 3B36A 3T9CA 2HIMA 4R8KA 2QLNA 4RV5A 2NO0A 2P3LA 4TWIA 5H3HA 1FUKA 2D8AA 2E82A 4DDVA 4REOA 1KIMA 4M86A 3VVMA 4YJFB 2OHVA 4TLAA 3L8GA 1XNRB 2VT6A 1PFVA 3V1YA 4OATA 4DGQA 1R0ZA 1XVUA 4KQCA 3HKDB 3AKEA 2J3MA 3RS2A 2JIBA 3N28A 4XUEA 4EG4A 4K6KA 5CHYA 1AGRA 3WDLA 4D4GA 3BSSA 1C7JA 2G1PA 5KINB 4DV3B 5IWAB 3OKPA 1WXQA 2EJWA 2JJ2A 4JI1B 1ONOA 1ODTC 1CK4A 4Q7EA 4WZAB 3VU1A 2OP0A 1EVIA 3B1YA 3B5JA 3D31A 3GEMA 4LZNA 4DCUA 1BAPA 4J4HA 1VP3A 1XAGA 2J67A 4GXRA 1U8EA 1EZ1A 1QH1B 3DEJA 1NM5A 1FDRA 1SCQA 3L0SA 4QTXA 3N8GA 3ZBPA 4CJXA 4E2FA 4ZCTA 3A6PC 2ODNA 2OVBA 3QKSB 2PQ6A 3IDZA 4ZAYA 4C20A 3T9AA 1QAMA 2IIBA 2Z3VA 4B81A 3B53X 4NOKA 4DPMA 1YF3A 1ZUHA 2QNRA 2FEXA 1Z0UA 2ZRMA 1GSAA 3BL6A 4UQPA 4JI2B 2CN1A 4ND6A 1OH8A 4YRJA 4AZWA 3BDVA 4B3FX 2BMVA 1Q0SA 1Z13A 1QO7A 1NKVA 3Q2KA 4PLCA 2PU5A 4EDFA 4BXOB 2ZKLA 2NG1A 2H11A 1HSZA 3OP4A 5DI9A 1IZ8A 3FMPB 5F4BA 3MWEB 4KPFC 3RHFA 5FX2A 4CM6A 1N6KA 2AH5A 2KB0A 5E3JA 4G0QA 1IXKA 1Q5PA 2XRZA 3DB1A 1GZ7A 3N87A 2GTHA 3KJIA 1XKQA 4WLVA 3ANLA 4QDXA 2H00A 4BNDA 2IWRA 2M32A 2R751 3BXEA 2WBLC 1ZM3A 4TSFD 5CBPA 1ZHFA 1PBNA 3E70C 4ZP1A 4FI3C 5KTSA 3DLHA 3OZSA 4K9PA 3T1QA 4AJ1A 4OHFA 1EJ0A 5CGQB 4D3FA 4RESA 3WK4A 4JDUA 1LI5A 1YH3A 2GBFA 3NLLA 2XBMA 1ACLA 4TQAA 2PO7A 3VV3A 4F2GA 5BQFA 4KKVA 5F5LA 4R0MA 5HJ5A 3MD9A 3BQNB 4P83A 1DO8A 1Y9ZA 2JAHA 1UMBB 1Q0ZA 3NU1A 2UUOA 2XZPA 1DV1A 5CURA 1C50A 1LA2A 3EIOA 5K45A 1YU6A 1RQRA 4P5DA 1F2DA 3PC4A 4NDAA 5IDYA 1E4EB 1JIVA 4ND8A 4UHHA 3S1AB 3BHIA 1FFHA 4P81A 2FPLA 2H1SA 5IVHA 3HZRA 3K0BA 4O1HA 5JCOA 1UZNA 3HXMA 5EFOA 3WXMA 2HC9A 2OK8A 4TKUA 5CNJA 3BEOA 3LQFA 2C58A 2GN1A 5HZHA 5HSGA 5KJ1A 2VPZA 1RDFA 3IP6A 4YALA 3T4UA 1YC2A 4HXFB 4WKGA 5DX1A 1GTVA 3EDQA 1Y3IA 4UHFA 4E2WA 4PN7A 4MSUA 1I7SB 3JXEA 4D5GA 1OD6A 2VTEA 3UN1A 4DQKA 1P0PA 3PA6A 1Y1LA 4TTPA 4RM3A 5LJLA 1VLVA 2XNHA 1DCFA 1UIRA 4GQIA 3L7YA 4Y9RA 2WZCA 1JEQB 1MB4A 1ZN9A 2TMDA 3LDHA 3PFIA 2N0SA 5LQDA 1ILEA 1ZH6A 2CFSA 3OCYA 5J2TA 3GVCA 3QF4B 3QXCA 4G1VA 4TSFA 3N70A 3HP1A 4FWIB 1E2NA 2OM2A 1RCFA 2FWJA 4RNCA 4ZQIA 2CCJA 4LHSA 3IO3A 4YDSA 2AE1A 4UVHA 3M4YA 4YB8A 2VS1A 3SZLA 4X64B 1FL9A 1ZGCA 3DOCA 3ITNA 4J9UE 4JJZA 2FZ5A 4ARVA 1XI2A 1GRQA 5F1PA 2M1ZA 5IH3A 1XA4A 4QG3A 3HJHA 5IAJA 1P72A 4GX1A 1BYIA 4BNVA 2Q5OA 1JIKA 3JQGA 4WSOA 1VJCA 1H2WA 4NR0A 1FS5A 4P86A 1X3LA 1NT4A 3R24A 4C7XA 4US1R 5JNUA 1GPBA 2E6UX 2H29A 3R0ZA 1X87A 2EBWA 5HDBB 3FRIA 3SCZA 2ACWA 3EFOA 1DIOB 4A1FA 2NOAA 1SOAA 2QZJA 4NATA 4RVGA 1WJGA 3BWMA 3LA8A 1U7TA 4EJ2A 5K01A 4IHJF 4RDHA 1IOLA 2VIIA 2OCLA 1K7EB 2JI4A 4C7KA 1PO7A 5EIBD 1DJPA 1VC2A 3SXUA 1OXUA 4PAQA 3PEEA 3S5JA 2FWRA 2OAQ1 2RD2A 4PC2A 1ESNA 2BFBA 2DUNA 3BREA 3Q87B 4HQNA 4YV0A 1YFZA 5G40A 1ZAKA 3RR2A 3WJAA 3QX9A 4ZO7A 2MYNA 2XYHA 4BMNA 5ALMA 2IPLA 4KVAA 3W5IA 3UJCA 4LWZA 4MYHA 4X66B 2OZPA 1Y37A 4JT9A 2OSBA 3K9BA 1RM5A 4NJEA 4LF8B 2RGXA 4DVGA 4Y7CA 3I4LA 5GM2A 1CUWA 2B4RO 2PLRA 3OWXA 4U4AA 3D81A 1AJEA 2TYSB 3NTXA 3A6FA 2HUPA 3ND9A 3NIDB 5K03A 1PX0A 121PA 1Z0AA 1XZQA 2GCNA 4Q1DA 4DL9A 2BFMA 2C9OA 1TYAE 4WNCA 2B4YA 1C3OA 3F9IA 2YJ5A 1T8WA 3F5SA 1F1JA 2E4ZA 2ZUVA 4XFJA 5P21A 4U7TB 4AWAA 2IXGA 1KTVA 3RVQA 3OCWA 2NUAB 1TAUA 1UANA 3IEKA 1AQLA 2I2XB 4I81A 2XX3A 5DNVA 3G3EA 1Z7YA 3LFUA 4TLDA 1C7EA 2B20A 4C4OA 5AVZA 2Q6LA 1JT2A 1T3LA 1ISMA 4ON9A 4XWTA 4YAWA 3EA4A 1RADA 3H6KA 1BEZA 4TSKA 4FGKA 3BJRA 5FT9A 2ARKA 2BGMA 3R41A 4OJNA 4FCWA 2ZRHA 1Y80A 2J33A 4JH0A 2AGVA 1PX2A 4XXHA 1I51A 4KWCA 4BC0A 3ZGOA 3I1IA 5BVGB 1J6UA 4QYIA 4M98A 3TQSA 1CCWA 2H1HA 1CP2A 2IF2A 1I32A 1PK8A 2XR1A 2OMKA 3GGGA 3ONVA 4KSYA 2P4UA 3W1EA 4MUBA 3AUJB 3UCEA 1XEFA 2PG3A 1I7QB 1VG8A 2SKCA 2QN8A 4C22A 5GAJA 1QVAA 3F5QA 2Z30A 3R75A 3AL0C 4JLKA 4IICA 2WMOB 3PUYA 4A8PA 4CG0A 1JR3E 3P9QA 3NPAA 1TJ3A 2WKQA 2WWWA 3MIIA 2VDOB 4H77A 2LNDA 3HDJA 4YN3A 5EXSA 4EFLA 2CUZA 1N2BA 2PAAA 4ITUA 2WDZA 4IZIA 4OHKA 1Z8NA 5ESRA 4DFDA 4DG9A 4F3NA 1QCCA 2ZFUA 3T3DA 1XZBA 4RFSB 3ETGA 1D0VA 4TX1A 1SXJA 3L6OO 4DREA 2O8EA 1GNSA 2R5WA 3MOGA 5C8YB 5F9MA 1N7JA 2ZYAA 3H5NA 2PT9A 3ZWPA 1B4DA 1TM3E 3EZLA 3PUIA 2WHYA 4L8VA 2AI3A 4Y1RA 2CV2A 3PQ3A 2R86A 3AFHA 4TVSA 1UJ2A 3WNZA 3CZAA 4NBUA 3UC9A 1NE2A 2CZGA 4IXWA 2JGKA 1B7GO 2ISCA 2XQGA 3K9HA 3PA8A 5ARCA 3R7WA 4EDHA 5L3SB 5LQCA 1KVSA 1CJUC 2J1LA 3LZ6A 3PWTA 1FK8A 3A7DA 3VC7A 4WK0B 4BRZA 3LUGA 1XIVA 5JZVA 3G7SA 3H1GA 5JXHA 2M2IA 1SHLA 1I2BA 2A8YA 3EZNA 3IJEB 4NV0A 5I9TA 5A4FS 3JZIA 3V34A 4BLRA 4OP1A 2ZUUA 3I83A 3RJ9A 1ZU5A 2UZ1A 1KP3A 5CAEB 3EXIB 1JEAA 3CNOA 1SZPA 4MRMA 1ZJYA 2ZJ2A 2BFBB 3D4BA 3HMQA 3ROFA 2BEVA 1TM2A 3OCUA 2GM4A 1JFFB 4KE9A 2DUWA 3MTJA 1TTHA 3DWIA 5H1YA 2V6MA 3CA8A 3A4TA 3KJFA 3GIWA 3KFLA 4TYPA 4YASA 5AJZA 3VYUB 4CEJA 4D9EA 5GV8A 4M60A 1H1LA 2GYVA 4Y2UA 1E62A 5SYMA 1T1SA 1AKQA 4ZEOA 4XYGA 2I3ZA 5ALDA 3BTUA 5H4GA 1VBKA 3IMKA 1E3TA 1VP9A 3ZH9B 5K7SA 5L3QB 3P2KA 1IPEA 1XZ8A 2WWGA 4OP2A 2FFAA 3FB4A 3ZJYA 4GI7A 4EA9A 2O05A 2ALJA 2HMTA 3KLPX 3V33A 1IN1A 1DINA 1J9ZA 1P1FA 2IYRA 2ZIZA 3PXEA 4WCDA 1A2KC 3H7IA 1YFLA 2L69A 1GQYA 2H63A 2R68A 1QJ4A 1MU0A 3JQDA 1PKXA 4I36A 4TT8A 3WLQA 2PYZA 2BJHA 2EZ8A 3GLRA 3GXOA 2VPQA 4O3MA 4ZALA 2AWNA 1TO1E 4E5NA 5FTLA 5FAKA 4CEIB 2A4KA 4IYJA 1G16A 4BGUA 9ATCA 5AYVA 1PG0A 1RQGA 3AM3A 3VSDA 3RFUA 3MQ2A 4U5QA 3BL5A 1H65A 2FK7A 3AF5A 3H1BA 2FQ1A 5JQGB 2YH2A 2NUBA 4B3DA 4BKUA 2V55B 4EF6A 3IA2A 5EJEA 2QUHA 3R5SA 4QYIB 1A4IA 4LRXA 4P9NA 2EV9A 2XJ4A 1KGDA 2FX5A 4P7BA 3WLPA 4CM8B 2OFPA 4CQNA 2ZM5A 4R01A 1RI1A 2P2GA 1A1SA 4G0NA 3KQVA 1ZNWA 3MUNA 2GHIA 1QGOA 3GCDA 1P2SA 4B40A 2RI1A 1CY8A 3FKSD 1EXWA 2LCFA 2GBPA 1JKFA 3HYTA 2QTBA 3TGLA 4ZICA 1GQOA 4G56A 2CHFA 1Q7BA 1EFVA 4KO2S 1NVMB 3Q8KA 1GTJ1 4M3NA 2Z98A 2XOKA 3WDKA 3LHFA 3D02A 3K8YA 2IGBA 4IZ6A 1NVGA 1SXJB 4XLLA 1OROA 4H0CA 5TPWA 3ONWA 4JFRA 3PPVA 1YTUA 5BMVA 4WMLA 1XMXA 1D2NA 3FNFA 5AI8A 2WVGA 3P8ZA 4JWKA 1XHFA 2GWRA 2YZ2A 2H2GA 1EFRD 1MOZA 1ECCA 1F8GA 2EJBA 2ATVA 2LGJA 3EK2A 2EIXA 1GQQA 2ZPTX 3IEPA 1YQDA 1G18A 2DWQA 2O3UA 4YJHA 1SXQA 3R7WB 3C8MA 1D2RA 1NT2A 5I7VA 1YS9A 5LU9A 3W2HA 1M6NA 1A2QA 3UBMA 5JYEA 3AR6A 4MRNA 1D5CA 1X42A 2WU0A 4PM4A 4XSGA 4YUYA 4B0OA 1D1SA 3R8XA 1N75A 1ZA1A 3L1UA 4P7GA 1PLJA 1LQUA 3DFZA 1RHUA 3WLHA 3V7UA 4BN0A 4E2ZA 3T7SA 2P3QA 4LDJA 4EGCB 1FY2A 5JRJA 2N42A 4J76A 3JRWA 3WQRA 3DA8A 3DXYA 3A1EA 4HEA6 5K51A 3T61A 2X22A 5KX5A 4RK6A 1YFKA 4KR6A 2YWBA 3FW1A 2G80A 3U7IA 4X44A 3FKSA 4UZFA 5KQLA 3THYB 1TF2A 2PGLA 1RYNA 1NLFA 2Z4TA 3K4HA 5FORA 4F93B 4LF9B 1C1HA 2XKBA 1KMMA 3P9YA 1O96A 4J03A 3SQNA 3IT1A 5IM4F 4LDQA 5F1OA 3X2EA 1ZM4A 5K0TA 1U65A 2PUDA 3A70A 2ZVJA 3I1YA 1QYIA 4DCMA 5B57C 3KZCA 2OHOA 1JHVA 2C4WA 2DYKA 4HT3B 2DOKA 2CNOA 5BR7A 2R4UA 2WICA 5LB2A 3ZGLA 1S4MA 5K6RA 3MCWA 1Z4KA 3RC3A 1GRVA 2G4VA 3GLVA 2ES4A 3FNEA 1XXHA 4P31A 2XB6A 3COPA 2PUFA 4DXAA 1NE7A 3TNYA 3IIEA 3IOYA 2R85A 5FOQA 4FEYA 4ZWNA 3IEMA 3WFJA 1Z74A 1UBEA 2D06A 1NIPA 2BUAA 5TQ0B 4B3GA 4LOJA 2ZATA 4TPKA 5EJ2A 2JCVA 1GWNA 4AKSA 5ADWA 4IJWA 3ZIUA 4L5BA 3ZLJA 3RVLA 3S6JA 5EUQB 2RHOA 4PQFA 4TTQA 5E1BA 3VR0A 5AH0A 3ORFA 1X7ZA 4RKFA 3NHRA 2AOTA 1NXQA 1QANA 3AUYA 5JO0A 3OCJA 6AT1A 1NJFA 3WDMA 3GH3A 4HAUA 1PWEA 3R3UA 2ZE6A 2H65A 5B2ZA 4A15A 2WKPA 1RI4A 5BOSB 1IUKA 1DC3A 2H2AA 4D26A 1T8TA 5I4IA 1F3LA 1QUEA 2OFWA 5K3EA 3I3OA 4LF4B 4RVHA 2A7QA 4C0BA 4ZC8A 4J9VA 1TM1E 3INNA 2ZIGA 3CNQS 4R2KA 3MHPA 3EIFA 2BFFB 5E7MA 2VK4A 1TVCA 3EPJA 1DRJA 3DZIA 4ZAGA 2AF4C 3D7MA 1R4MA 1JIJA 1VZ2A 2QZZA 5FJIA 4CKBA 1QTIA 5IT9A 1JFSA 3MJDA 5BN1A 4NKRA 4Y67A 3JARA 5CM9C 1WVMA 2V98A 1I7LA 2VNAA 4IDEA 4R3WA 3ZXYA 4BE9A 5KZMB 1ZM7A 3IQWA 1A8UA 2G6TA 4LFAB 3LC0A 3TNLA 3ORRA 1PNTA 3O31A 3DGFC 4LI3X 3TL3A 4UM7A 1HT2E 1V1RB 2W2OA 3QUAA 4X61A 4UTRA 4N8DA 1O08A 3KSUA 3IAAA 5BWCA 4ZPXA 1U28C 2D5CA 2I5PO 3E7PA 5K6AA 1XHLA 3TLYA 5L95A 2M6KA 2JH9A 2WILA 2X15A 2C5EA 4G4SO 2FUCA 1Q6YA 1GU0A 4NZZA 4YJHB 4QOHA 3SJZA 5DN6D 2FG5A 3IB6A 2GPTA 4ALKA 4B4UA 4ZU1X 1GYQA 4D5EA 3NGXA 2FPXA 3TPCA 2WT4A 5FWXB 3KOMA 3SKYA 3UWOA 3WL3A 1RBMA 2VHUA 4HSGA 5KX5B 1K66A 1UDCA 3T0GA 4CMKA 2OBNA 2X5JO 4H7JA 3HHEA 5G02A 2BHTA 1NQOA 3GVHA 3GLGB 4ES6A 5I4BA 1VFNA 2C5SA 4F1WA 1NVDA 3DTTA 4XD7D 1XRMA 2IRWA 3WX0A 2ZREA 1J7KA 4G84A 2NUTA 2IHJA 4ZI5A 2HPZA 2XQIA 2YN2A 4BNYA 3CONA 1YJBA 2ONZA 1DBPA 2WSLA 2YC2C 2PZAA 2ZYHA 2D2VA 1Z35A 3PE6A 4MV5A 4XIIA 5F78A 1D8TA 1IC6A 1DDGA 3E27A 5DEIA 2ZWMA 3QLVA 2H5JA 4FMCF 5IFKA 2P2SA 3B51X 2YVQA 3MSXA 1TVMA 3X43A 1GRCA 4G97A 4ZOLA 2RKBA 3HS3A 3GUVA 1QP4A 1T91A 1OH7A 2N46A 4IDPA 3IAHA 3O95A 3LQQA 1E0KA 4CKXA 1XXHB 1KS9A 2GERA 3RUPA 5YASA 2HUNA 2AC4A 5AHXA 3VSEA 2VYCA 4QT4A 4ZAWA 1L4LA 3TE7A 1H0HA 1OLSB 5TJHA 4IKOA 2CLMB 1ESCA 1L7XA 3ZTTA 3RKRA 3DMTA 3W3AH 3AI2A 4M53A 3OZTA 2VYFA 3L1KA 2FPIA 1W35A 2V97A 3OEHD 3ZGVA 3PICA 4FLEA 3D6HA 5ALKA 1PGNA 3CW2A 3ES9A 4JUDX 3ZU3A 5BN5A 3ZDDA 3G7UA 2PRJA 4XM0A 3VPFA 1H4VB 1LX7A 2AOTB 2ON6A 3IOBA 4OMFG 4PZEA 3LIIA 4XD7A 1DX9A 4EWLA 5B3KA 4K8RB 4P8RA 1JNYA 1XL1A 2ODBA 2YY7A 3SJBA 4D3XA 4IDDA 4NU5A 1Z4OA 4O2BF 4OBBA 5SY4A 2B94A 3EBOA 3VH1A 1G9TA 3L7IA 4U8GA 2UXCB 4HRYA 2ENUA 2GN4A 5LYYA 3WKEA 1O03A 1Z22A 3E9EA 4OQXA 1ECLA 3NTVA 5F64A 4BRUA 3H8JA 2XE8A 2VOEA 3AHDA 3DG9A 3MBKA 3LC2O 4HDKB 2P40A 5CVUA 1XCBA 1OFUA 4ZRDA 1V7ZA 1U7HA 4NL4H 4WNYA 4A82A 2A0FA 4Z1OA 3MNFA 1A8SA 1T0JB 1S8AA 2OO7A 2VBFA 4ARZA 4UNIA 1WL8A 3RO7A 4CBVA 4PZPA 2W37A 3TLAA 4BLSA 3I09A 1GLVA 4Z3DA 3EZYA 4CU5A 3JARB 4CODB 1CR2A 2HU8A 4B75A 3E5RA 2QRNA 2Y1XA 2ZR0A 3H1TA 5REQB 1ZVVA 2PD6A 2GXQA 2CNNA 3GLIA 1MB3A 1PHPA 1KPGA 1OXVA 2JA2A 3A28A 3BKWA 1Z63A 4ZO9A 4OI0A 2QTGA 5AT1A 5HFAA 3N2YA 5AI6A 3AUUA 4G0WA 5ILOA 1E3IA 1UBHS 3H2HA 5C3MA 3G0DA 5BSRA 2QPLA 5FA5A 4Q4DA 2ZZNA 1XCOA 4TMKA 4PXAA 4YNBA 3GBPA 3JZFA 3ZS9A 2I7VA 3DZHA 1TKRA 3JD0A 4TRJA 2XKJE 2YDYA 1SPBS 1QO0A 3FCXA 1RXSA 1A9SA 3P2IA 4IGIA 1L0BA 2HV9A 4KUEA 4LBVA 2P4QA 1SXJC 4ZEVA 4QXOA 1SA0A 3CLTC 3OTQA 2HYDA 3T7RA 4HGRA 3DNFA 3K70B 5FI3A 4NIMA 2QR3A 3AEQA 1QHGA 4AJNA 3B1XA 3WZMA 1PE0A 4FHDA 4KOAA 2J0QA 3SG0A 5FR1A 1KI7A 1O9HA 2PPVA 1PYGA 2Q29A 4C07A 4IIBA 3SHVA 3COJA 4F38A 4DV5B 1E9SA 2Q50A 2LKDA 3QHAA 4FZJA 1SIBE 2AEJA 4D02A 4GYYA 1YZUA 5WRFA 1NBHA 2W48A 2EBFX 3IDQA 1JLMA 4ND3A 1E6KA 4M76B 2QM7A 2O3TA 2VYVA 2XVAA 4L9WA 2EOAA 2HPVA 2Q6VA 3CPJB 4KRXA 3GG9A 4WZBE 4X94A 5J2UB 3ZCRA 2WLTA 4I5FA 4ZYLA 1YONA 5JANA 1VIMA 5FLKA 5H7XA 3ROMA 3WRXC 2QUAA 4LZZA 4H4EA 4WX2B 3DTVB 4WRRA 4YRCA 4PN3A 1H9AA 3GNQA 1U9IC 2PY6A 4MQUA 5DM2A 4J29A 3ZK7A 5AJUA 1EP3B 1VKNA 4GI1A 3K1TA 3H5RA 2E49A 4BNLA 5FIUA 3PYMA 4D99A 1YCHA 1WMAA 1TGYA 2JFGA 3LPMA 1EFCA 2XYVA 4MDFA 2O8CA 3TFOA 4YCAA 2P6RA 1FE8A 2MYUA 2NZVG 4ZCMA 2WZBA 1ZRHA 1D07A 1LI7A 1OLUA 4KZKA 3EVAA 2RGDA 2VL7A 2XB2A 2VUUA 2REXB 4WBXC 1JBQA 5LKRA 3DVRX 4Y2GA 3C3WA 1K9SA 3RVRA 5DXFA 1KI8A 1BA3A 3R7DA 1QGED 3CB2A 4D9MA 4KK4A 1XD2A 3L8CA 2RDMA 2O0LA 4OM8A 1UR5A 1YL5A 3FZQA 4PGGA 3AUKA 4C30A 5L53A 2O5RA 2PX4A 3FM9A 2IPMA 1Y6RA 1HBJA 4BFWA 2I2AA 5JRDS 2JKVA 3PGVA 3F97A 4MA4A 3S1SA 3P2MA 4BVBA 1YR7A 2OOKA 1RWKA 2J30A 1CUYA 1HLGA 4INAA 4DLPA 8OHMA 4MWOA 4EJSB 3LKVA 4ARZB 4CM7A 3RSHA 2FSPA 1ZJ5A 1YHYA 4EVQA 4QXMA 1NSTA 4ACAA 3WNVA 1GL6A 3MQ4A 1I94B 3SC6A 4FHFA 1N1MA 1UXGA 1LDEA 1S5PA 2FA9A 4BTVA 1J0AA 1QX4A 1YJ8A 2ATXA 2KHZA 3EQ6A 1N36B 5HQTA 2YHSA 1PDOA 2VDWA 2W6PA 2OV2A 3V46A 5DGTA 4PPNA 2CLLB 3FFBA 1PR9A 1SA0B 1CQWA 2PT6A 4HLUA 5B3JA 4ZI7A 3E53A 4PYRA 3C3EA 1FTGA 2O2XA 1H3EA 3P52A 4RIFA 3AEQB 5DHRA 1THMA 2EF1A 2XAAA 3OJFA 4HFNA 5HPYB 4TUYB 5HKOA 2Z6QA 2ZYRA 2A35A 3DEZA 4G5RA 4KX3A 4Z7NB 3EW7A 1G5HA 1MJFA 4FBLA 1DHTA 2GKSA 4G63A 4P4UA 5IUJC 1ZH4A 3AF4A 2WVJA 4JQYA 1ZOOA 4ETMA 4MGZR 4D9HA 1P4JA 4F2HA 3DO6A 4TS3A 1XFDA 2ZULA 3QPCA 3GDGA 2JGFA 4WXPA 4BCDA 4X90A 3V4ZA 4RPJA 4BE7B 4FYVA 4JYAB 2G1UA 3H1AA 1ZH8A 1LPBB 1X1DA 4DQVA 3Q10A 4GXTA 3UAYA 4O1IA 2DH5A 1T6ZA 2QR2A 2QT1A 1U2GA 4ND7A 4QSMA 1P7YA 3KVYA 1RM0A 1N3LA 3OQHA 4AJ2A 1Y8AA 1ZRNA 2X58A 4MEBA 5ADHA 4YPFA 3G88A 1YXMA 1AX9A 5DTQA 5EEHA 5JI3E 1E3WA 1KYXA 5ED4A 4BQPA 4IHAA 1W4ZA 5EE0A 1AOXA 2ZT5A 5FBLB 4LWOA 4M0CA 2Z09A 5AW0A 1UFQA 1Z0JA 4YYEA 3I8XA 4BVJA 2P0AA 4K81B 2WTNA 5J2TF 4NNOA 3PXXA 4ICIA 4N5HX 2X3YA 3ZWOA 3F47A 3JSXA 2PBRA 3VDRA 3ORSA 3DFFA 4MV8A 1U2SA 3OFNA 2X4LA 4QYWA 4DILA 3MT8A 4OPMA 4DABA 2YMLA 4V02A 3HU3A 4OOEA 4RDXA 5CVVA 3PNYA 1QB7A 1IN5A 3AR9A 1SPXA 3M6LA 2BP7B 2Q4TA 1DBWA 1L3CA 1AO3A 4C04A 1OA1A 4CM3A 1DEXA 3QG5A 1QBGA 1SQFA 1XF9A 4YROA 4CRWB 1DRUA 2G9RA 3SNHA 4U7FA 5K8LA 1KK0A 1AUOA 3OA0A 3RIHA 1Z6TA 2YHIA 4AMGA 3WG9A 1AKMA 3U37A 3JATA 3EG9B 2QF7A 3LCJA 1V96A 4I1RA 4RSRA 1GPWB 5AM0A 3O73A 2B4KA 2PEYA 1E6MA 3C8ZA 4R68A 2PSEA 3VSBA 4DJJA 1LNZA 2FUNB 2RHWA 3GCWA 2ZT6A 3E5NA 3WOHA 2H7XA 4HYQA 2VWHA 2JI8A 3IQHX 1C7ZA 1EBBA 2XTMA 3SSNA 4A0SA 4LHZA 1K06A 2Y67A 1NW5A 3MTGA 4ZANA 3KEFA 1UKCA 3RLIA 2YFYA 2F3UA 3WY9A 3WISA 4P7FA 1U0OC 4I14A 1E2QA 2OXTA 1M6WA 1QE0A 3Q8WA 1CERA 1AZTA 2ZZKA 2YOHA 3EQ8A 1V1MB 4H60A 1SU6A 4CT4B 1LY1A 3F0TA 4ZT5A 3U80A 5KYTA 2RE8A 1PCXA 1MO5A 3HJAA 4XTCS 2QXUA 4NBNA 2MHCA 2Q8QA 3MVEA 1GUZA 4NNPA 4ADSG 2B1JA 1NPYA 1IAQA 2QYSA 3BWBA 3S2SA 4CYMA 1PQUA 2B7CA 4J0DA 4MRAA 5C81A 3FFXA 1JKMA 3OMWA 5IH7A 3UT5A 3A26A 2R6DA 2DGDA 3KPUA 4FGJA 2MOKA 1E2DA 1TB4A 2Y4NA 3LDAA 4HWGA 4GSKA 2UV8A 4ZVSA 3KEQA 1UFVA 3WYGA 5BSFA 2VCYA 3RRZA 5I4CA 1BE0A 2AYZA 3I6ZA 1HLDA 3L41A 3RCBA 1KU6A 1IN6A 3RSFA 3W77A 2I4TA 3WV5A 4BMPB 2WU8A 4DIOA 2WAAA 1KI9A 4BTLA 1E7RA 3GVIA 3K70C 4HB0A 1J00A 1QLWA 1F7UA 1JHUA 1KYQA 1QGAA 3KWJA 4H27A 3R5FA 5AI5A 3V42A 4A5OA 1OI3A 1YQ9A 2FEAA 5A02A 4KVZA 3CUEF 2Q6OA 1KPHA 4EH1A 4XVUA 1KU0A 3GAZA 4MCJA 1F0PA 3RFCA 1U3GA 1V71A 4F4FA 3ZY2A 4DJDC 1F2UB 3SQXA 1DJOA 5C8DA 1QRSA 5FUQA 4I99A 2B5OA 2FUKA 5B7QA 4EKYA 1OT5A 3SLRA 3UZUA 5CXQA 4YRBA 2YNMD 4N01A 5JJIA 5ALNA 1MFPA 2ID7A 3ANMA 1QP7A 3QVGA 3TD6A 3QLVC 3AUXA 1K7XB 2YCLA 2VJMB 3Q3EA 1X9GA 4KMMA 1NRXA 1E2HA 5IVDA 2F7SA 3R20A 1Y8CA 2EBHX 5DHTA 3WMWA 4MINA 4Q47A 1TEXA 3G0BA 4FDTA 4QFDA 4QHSA 4Q03A 1C0IA 1KMIY 2GK4A 2GARA 2CBGA 4QXRA 2FOLA 1PFWA 1P0QA 1X6VA 1NULA 2PTHA 2W4MA 4J43A 5F7JA 1IU9A 2IXBA 1VDMA 1T34A 1XHEA 3OE5A 3O8NA 4G0YA 1U3WA 3PKJA 5LWHA 3S99A 3X2SA 3PDIA 2PZJA 1TZCA 1L5KA 1DS6A 3HKEA 1KYYA 3RUHA 1ULHA 5EXDA 3CFYA 3T1VA 4DKXA 2RCYA 1A9TA 1GGHA 1MGOA 4K03A 5I5GA 4R8SA 4TWBA 1I5RA 1NY6A 2FQYA 4YPVA 1ZSYA 3OEED 1NMSA 1EVJA 2H31A 2W7TA 3P9NA 1FYEA 4A16A 2XE7A 4Y2SA 3L1VA 3G1UA 3JD4A 2GBLA 3JATB 1XEAA 5JATA 3EUAA 4FYKA 1BXGA 4K6GA 5DHUA 3VZPA 2ATEA 4PX5A 5CP8A 3DBHA 1J5PA 2XZLA 4H08A 3ZY3A 3A6KA 2W43A 4R05A 3VJLA 1YFJA 3DQZA 3HCEA 4A92A 4BDSA 4Y0AA 1JKJB 5CFOA 1A8IA 3OZVA 3CNLA 4G89A 3CKLA 4NMLA 4ZQBA 1QFZA 5E7QA 3T9DA 3WLRA 5CBKA 6ABPA 4IIJA 4DJ5X 1TUBA 4UNQA 1G9SA 1RYMA 3TO5A 1CQIB 2XRFA 2OBFA 2P77A 5K3BA 3U39A 3ZQ4A 3FCUB 1WCXA 1QH0A 3HRIA 3GARA 4Y6LA 4DG8A 1MB9A 4II3A 4CN9A 4ESOA 2XWJI 5JROA 1G63A 5HBRA 3GLFA 2A67A 3F7MA 5B55A 3LTNC 1IOZA 1PR5A 3P0IA 4JLBA 4LE0A 1R9NA 2P9HA 2XH8A 3NHSA 1FLVA 1YULA 2OHJA 3OZXA 5KHAA 4E4RA 1Z0SA 2IHTA 5ESXA 5EFZA 3RYCA 1QCDA 1XG5A 4LVOA 2FUEA 1AKVA 1NVVR 2WJJA 3ECAA 3MYYA 5CX4A 1I1HA 3UT5B 3VI3B 1GY8A 4PPFA 1E77A 3WNCA 2V6FA 5B7PA 1EX9A 4XWGA 1LPAB 1DADA 1GDDA 1BFUA 3LU1A 4RLFA 1RQ2A 4L2IA 5A05A 3TIGA 5BR4A 4GSLA 3OEEA 1JMYA 3WGKA 1N6LA 4MQLA 5KYUB 5K09A 5U4XA 4YLYA 2QU8A 1HTWA 5C35A 4P3KA 3MCUA 4MVJH 2I6GA 4RSHA 5JDCA 1EPUA 1O6GA 4XPIA 1ISIA 2GFIA 2YYAA 3A1WA 1FX1A 2GVZC 1YBAA 1COWD 3COSA 4WAUA 2R6ZA 1B42A 2OXRA 2VH2A 3D0KA 2Q5FA 5EZYB 4ZVTA 3IDSA 5FOXA 3B82A 1CJTC 4C89A 4ENTA 3TZBA 2G0TA 4XDGA 3ESZA 3I9FA 4YUVA 4RD6A 4EG3A 5KQMA 3S1LA 1PVOA 3VR6H 4J3JA 3DBRB 2C42A 1M34A 4PWYA 1Q0LA 4JQSA 2LCQA 3ENWA 4KNVA 3TLBA 2CVFA 5ALZA 3A2MA 2R79A 3UMFA 4DRXA 3S2GA 4I55B 5KCMA 1OYWA 2EJVA 4KXUA 3PRKE 5EJ5A 1NMEA 3GFVA 4Z53A 3IV6A 1M75A 1Z2DA 1GEEA 4RPLA 1VJGA 4GX5A 1PJCA 1ZICA 3NBQA 1OHHA 2OCBA 3EB9A 4MJLA 1E3EA 1TZBA 2I6SA 3HUEA 1WCYA 1QHXA 2E7ZA 2Q1UA 1DQRA 4PCAA 3FSEA 4XSVA 4ZU3A 4CKEA 1P9OA 5BMVF 3ASUA 1U0TA 1WULS 7MHTA 1T9HA