3ZKAA

Crystal structure of pneumococcal surface antigen psaa d280n in the metal-bound, open state
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
278
structure length
278
Chain Sequence
KLKVVATNSIIADITKNIAGDKIDLHSIVPIGQDPHEYEPLPEDVKKTSEADLIFYNGINLETGGNAWFTKLVENAKKTENKDYFAVSDGVDVIYLEGQNEKGKEDPHAWLNLENGIIFAKNIAKQLSAKDPNNKEFYEKNLKEYTDKLDKLDKESKDKFNKIPAEKKLIVTSEGAFKYFSKAYGVPSAYIWEINTEEEGTPEQIKTLVEKLRQTKVPSLFVESSVDDRPMKTVSQDTNIPIYAQIFTNSIAEQGKEGDSYYSMMKYNLDKIAEGLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Imperfect coordination chemistry facilitates metal ion release in the Psa permease.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Metal transport
molecule keywords MANGANESE ABC TRANSPORTER SUBSTRATE-BINDING LIPOPROTEIN
total genus 101
structure length 278
sequence length 278
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3zkaA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3zkaA01
3AEKA 4WN9B 1KAEA 4PAGA 1XVLA 4LS3A 1K0FA 4NNOA 4WN9A 2ETVA 1M34A 3BE6A 1L5HA 2XDQA 3PSAA 1FP4A 2XUZA 4XPIB 3EIXA 3PSHA 5JOQA 2WI8A 4FILA 4TKVB 4IRMA 5BVHB 4WZAB 5BVHA 1G21B 3AEQB 3AEUB 1N2ZA 2MINB 1KARA 2XQVA 2XY4A 1N4AA 3AESB 5AFSA 1PSZA 3MINA 1M1NB 1QH8A 1L5HB 1M34B 3HXPA 2M6KA 4XPIA 3EIWA 2XDQB 3AEKB 2PS0A 4WZBB 4WZBA 2Q8PA 3PDIA 4WNAB 2PRSA 3MWGA 2YNMD 3ZKAA 4FNAA 4UTPA 1G20B 3AERB 5KOJB 1M1NA 1QH8B 2Q8QA 2XV1A 5CX1B 4MDYA 1QGUB 2AFHB 4BBPA 2R79A 4HMOA 2MINA 3NU1A 4M7OA 2XH8A 2PS9A 5KOHB 5KOHA 1QH1A 1N2CA 4K3VA 3AEQA 1G21A 3K1AA 5FLYA 3ZK9A 1K7SN 4UTOA 2R7AA 4TKVA 2AFIA 5BVGA 4UDNA 2YNMC 3AERA 1G20A 3CX3A 5M3BA 2O1EA 3LI2A 4G07A 2PHZA 3TEFA 4INOA 1KAHA 1MIOA 5I4KA 3AETA 1MIOB 4MX8A 2AFIB 3HH8A 5M34A 3G9QA 3MFQA 4WESA 2X4LA 4OXQA 3MINB 3K1AB 4CL2A 5JG7A 4N01A 4ND8A 5JPDA 3R5TA 4UDOA 4MO9A 3ZK7A 1K2VN 1N4DA 4WESB 3ZK8A 1N2CB 3UJPA 1H1LA 4TKUA 5B58T 1ESZA 4MLZA 3TNYA 3TLKA 2OSVA 2QI9F 1EFDN 1K75A 1PQ4A 2M6LA 1M1YB 3GI1A 4H0FA 4WNAA 5HDQA 5KOJA 3R5SA 4PM4A 5M2QA 4DBLE 5KHLB 5GGXA 4B8YA 4INPA 2OV1A 3MD9A 5BVGB 5M29A 2OGWA 3U7QB 1M1YA 1H1LB 2WHYA 5GGYA 1QH1B 2OV3A 3AEUA 5CR9A 3LHSA 3AESA 3MWFA 4TKUB 1TOAA 4FKMA 4HMPA 4NNPA 5JJ5A 5HX7A 4HN9A 3ZTTA 4ND8B 4H59A 4OVKA 4WZAA 4HMQA 4OXRA 3U7QA 2RG7A 2PS3A 4G09A 1QGUA 2AFHA 1FP4B 3BE5A 3PDIB 4GICA 5CX1A 3HJTA 4FI3F 4LJSA 3AETB
chains in the Genus database with same CATH superfamily
2OT3B 1G5QA 3LVRE 1SG0A 1TLFA 4UUAA 4G0VA 3L6EA 2E89A 2C5BA 3OOWA 2WTUA 1QG4A 4YUYA 4LZLA 4G26A 2FSVA 4J1SA 4GZ3A 4UM9D 2LIPA 1Y4SA 4RORA 1J2UA 1EGQA 1NPTO 4M2LA 4UU1A 5AJHA 2XE8A 3USES 3ICCA 3S2GA 2YXNA 1NR7A 2B4AA 4NQZA 3PDCA 5D1HA 3PNVA 2IYQA 3ILSA 4R51A 1M34E 1SCNE 3ZWAA 5DNEA 5IKMA 3GLGB 3AUJB 1ONPA 2CJPA 3QH4A 3A4NA 4NOLA 1OWPA 1GYQA 3Q98A 1OTXA 1YR2A 5LKAA 1GU1A 1OC4A 1SVLA 1EK5A 3UJCA 3MT7A 3P0JA 1M1NB 4RJ2A 5F64A 1FX1A 3CXUA 4W7SA 1Q7TA 4DFDA 1O6GA 3Q2IA 4Y98A 4CMBA 3T3NA 1Y34E 4EELA 4OHYA 1N7IA 1LSOA 2V03A 2JLYA 3HCDA 2C5SA 1MJNA 1D2AA 4XA8A 1RJEA 4KPGA 4NY1A 2DH5A 4QYXA 2Y1CA 5A3QA 1P7VA 1YJBA 3D02A 3WYBA 4TWBA 4AICA 3OZCA 1G5RA 3HFGA 4JT8A 3TIGA 3VKHA 3HUUA 3VSAA 5I7WA 2I29A 4F60A 1P9WA 2OILA 3VPHA 2I2CA 2R25B 1PE0A 4FTWA 3WIDA 1U1FA 4DJDC 2OM2A 5AP9A 4YVFA 3W4IA 4UBOA 4JFAA 2QLJA 3QJGA 5FPYA 2YFQA 2WU0A 1LVGA 2XRMA 4EPYA 2H63A 5T8KA 1DXOA 5D6NA 4BJ5A 5CGQB 1IJEA 1ZGGA 4IRUB 1PR1A 3RADC 4OKNA 1GV1A 1U1CA 2YQ5A 3H42B 4B3HA 2A5DA 4A0SA 2XUDA 4NE9A 4UUBA 2FWPA 1OTHA 3MT0A 2M2IA 1JKXA 4RH1A 2KB0A 2G9RA 4AP6A 1SELA 5DN6D 3DPSA 4XGKA 4V2UA 2AC2A 2F00A 1GO2A 1EZ1A 1QIMA 2RHRA 1JWBB 3MCTA 1QR2A 1Q17A 2A9FA 2H92A 2P11A 1UBGA 2XQFA 1J20A 1P0IA 3GBPA 4W1SA 5B1YA 4QBKA 2QD1A 4QBFA 3CRRA 1MA0A 4NIMA 3RAPR 3VJKA 5D00A 3DLTA 4NU0A 4XTRA 3K09C 4RQTA 1K3FA 5ALWA 1NNEA 2YOHA 2HMVA 2H2IA 3P9RA 1U98A 1U8ZA 3THXA 4YRIA 4UC0A 5H3HA 4HQRA 1NKTA 2BF4A 3FWKA 4AO6A 1WE2A 1GLVA 1NZDA 2NACA 4N0EA 3I5XA 5MN5A 4LOJA 1BDBA 2NAFA 4E21A 4P81A 4NXMB 1CBUA 4WW0A 4BEWA 2GQ0A 1ZN7A 4YP6A 5K45A 1L7EA 4FE4A 1JB9A 4X61A 4DZTA 5C32A 2GZ1A 3SFTA 2EZUA 4LEIA 3O75A 3DS8A 1UKEA 1LJ8A 2FP4B 4MVJF 2HT6A 3KLMX 2OG2A 4ZCTA 2C2ZA 1EMDA 1JSRA 5L3QB 5AJUA 1E69A 3U60B 3SX0A 2R00A 1QK3A 4G5XA 4MA0A 5A62A 3FHTA 1JIUA 2B8WA 1GNTA 5ERXA 721PA 4HT3B 4TVKA 1N7HA 3K6RA 1RZRA 4MRMA 3NOOA 2OYRA 1XTJA 3W5UA 3GDFA 1GTRA 3K9QO 5EP4A 5EZ5A 2ECFA 2HWXA 1ZCAA 3EXAA 5B2ZA 5SY9A 4O3FA 5ALYA 1RQNA 1WZEA 1CEQA 3S8EA 1JR3E 1O5OA 2CDNA 5KNBD 1W0JA 3D31A 1T2CA 3BN3A 1PUXA 4J7AA 1AKRA 2C29D 3JU3A 3OM9A 4A8PA 4BJ6A 5SZKB 5H9VA 4BQOA 2GLXA 2GK6A 3E15A 3L4JA 3BCSA 2WM3A 1U7HA 1YDFA 3Q3CA 4IWXA 3WHLA 2HSWA 4P5EA 5D7NA 4D56A 3PQ3A 4NULA 4AY2A 4M0EA 2Y1DA 4YROA 3WFIA 2P6UA 1Z2CA 1ZH8A 1Q77A 3ZDYB 2GCOB 5EHZA 1D09A 4NAUA 3STHA 3UT5A 2PRZA 3WO0A 2J9YB 2PFKA 3MPUA 4ZIRA 3DBOB 3AR9A 3ZCXA 2CXUA 2JJQA 4NCJA 2V97A 3HWRA 3MK31 1QIFA 2H2WA 4YC7A 4NCHA 2EGGA 2V5VA 3WNZA 3ZU6A 4C0XA 4BZZA 1T36B 4QDUA 2WPNA 1JEDA 3O8QB 4UNSA 3CH7A 1UZUA 4XASA 3C48A 3V8EA 4M1KA 2CBXA 3IQZA 4KNWA 3UFBA 5CD1A 4MV3A 1YIOA 4ZCPA 4PSUA 4U0KA 5BSUA 2D59A 1R16A 2WAYA 4IVNA 3BZBA 4GE0A 3OJ0A 3SFVA 4F38A 2NO0A 4UDNA 1O6FA 3O94A 1P19A 1V3QE 3NTXA 5AW0A 3MERA 1XGKA 1ISSA 3BCUA 2C00A 1M66A 2VHUA 4WUTA 2GM5A 3B5IA 4D6PA 3N6XA 1B2RA 1KEWA 4OYYA 2B83A 2PNFA 1XZHA 3RWMB 1E5QA 3ZE0B 1HPLA 4EMSA 1GKKA 2OV6A 4MSUA 9ABPA 4MYTA 4UAGA 3KXPA 1Z8FA 1OF1A 3N6VA 4P9NA 3GIWA 3G2LA 4BFVA 2P90A 3A1NA 3DB1A 2PUBA 1QCZA 1SR8A 2Y76A 1LJLA 2QUAA 3ZOZA 1IQ0A 1N78A 3T52A 2HIAA 4ZOAA 3T5GA 1YCHA 2IYTA 2DWUA 3H4IA 3U3JA 1XVAA 2DR3A 4GLJA 3UKOA 3V9PA 3I9OA 2VTBB 4YRAA 4EHLA 4ASUA 2ATCA 2BZ0A 4TLCA 1M1YB 3DYVA 1LWNA 1RI4A 3B36A 3TAUA 1VE3A 2CZQA 1JAXA 1E1RA 1QXSA 1MQ9A 2BUCA 1REQB 1NWCA 3UMVA 1VCMA 1XDSA 3KXDA 1DUIA 2WV7A 3KJFA 4D6XA 3ORRA 4OF4A 2CJWB 4MRSA 3SE7A 3H1PA 4DCUA 2QDKA 4KNYA 1F5NA 1ZD3A 5JI3E 1MCZA 4EB6B 2EBFX 3EXHA 4HS4A 1O03A 2VWQA 3WMWA 2FZVA 1R0WA 5FA5A 2V5AA 4EM6A 4YHHB 2ZRBA 4N12A 2YS7A 5CDUA 1BH6A 1Q7GA 3LS2A 4MV0A 3SYMA 3WKDA 3HXMA 1YA6A 1CRPA 4WY5A 3SF8A 3D6HA 4YRNA 1HL3A 2IRWA 4GPBA 5DCYA 2B6HA 3NT2A 5AUOB 4ZAFA 4KH1A 1SVNA 4RLHA 2JI6A 1JQ5A 5DNAA 5FKJA 5T8KC 3ACCA 2LCIA 3Q1KA 4JR2A 4TWIA 1I6LA 4Q9LA 2Q5IA 1YTUA 4WIAA 3W2IA 3NB0A 1OAKA 1V6AA 1YR3A 2I78A 3A6FA 3GUCA 3KNZA 5ALKA 4D7AA 3B9RA 2IPOA 1M7HA 3TPFA 4F5YA 1DJMA 2ZYSA 3KT6A 1JNYA 3C4QA 3U56A 3VH2A 3I1FA 4HGOA 1JG4A 4F3CA 1M83A 1USVA 4JWTA 5GV8A 4LWOA 4Q7EA 5DTEA 2CXOA 4CM3A 4EQZA 1W36C 2EBUA 1IK4A 2DUUA 1Z0AA 2BHLA 1NZJA 3BXOA 4L9SA 5B4TA 1OC2A 1PGPA 2EF0A 4K9PA 5HF8A 1GV0A 2OKGA 3F67A 3MAJA 4EO4A 4C07A 1C9JA 5TT1A 3VZPA 4L4SA 4RV5A 5C1DA 5LR6A 2QKYA 2XUKA 2E9SA 4TTAA 1TA4A 5AW1A 4MS1B 2H7YA 3EYAA 2I6FA 1NW9B 1PF7E 2AN1A 1XWWA 4RWEA 4CKXA 2G83A 1RWOA 2NTYC 2H1WA 5GJBA 2IZ6A 1UP4A 2RK6A 1T3HA 4CZ2A 5P21A 4EF6A 2X0IA 2HA0A 3CNQS 2G7MC 1SXJA 4DC9A 1E61A 1KI2A 3H9UA 2JJ2A 2VNIA 4Q6WA 1QYIA 5FO1A 4DNXA 3EEOA 3KQKA 4DMLA 4LXHA 5IH3A 5DFAA 2RHJA 3LXMA 3EVGA 1L4YA 1GR0A 1YVUA 4CHTA 2OL4A 4RTLA 3FNRA 3L4BC 1LNSA 3ZCUA 3ZBUA 4KMRA 3TCNA 5EIBC 2Z6AA 4G5RA 5KNLA 2F9FA 1G8PA 3LNCA 1OUMA 2JHGA 1XUOA 2VH5R 3LLUA 2FRDC 5ER9A 2NSJA 1U2DC 3LK7A 4R7GA 4YDSA 2ZSDA 2O2GA 3NBKA 3BAZA 2C20A 5BSGA 2VOJA 2PT5A 4B75A 3THRA 5F77A 2O07A 3PD7A 4Z7QB 5CNMA 3UXEA 1UJNA 3ZHRA 5ICCA 1SOVA 4QUIA 3KFXA 4UHHA 4KQ9A 3C4VA 1BE1A 3GK3A 3EARA 4QVIA 3U3KA 2IY9A 2UVDA 2VQFB 1E3TA 4H08A 4WESB 5E6RB 4J1QA 3AXTA 1MH1A 3GYBA 1UKVY 1GFZA 1QWOA 2IT1A 1UKCA 2VYVA 3IV7A 4FUQA 4R83A 5EWJA 4DUGD 2QMOA 4QE3A 3K9LA 1X15A 3I6MA 1E9EA 4HZUA 4HWSA 5JPCA 1CNFA 2KI5A 3ZBQA 4OHKA 4ITUA 4JR1A 3FCCA 4ITRC 3LWNA 2BLLA 2K5UA 1QVRA 1K6EA 3OLCX 1Y8ZA 3BWEA 1RAGA 1Z6PA 2EQAA 4IPTA 1VYVA 3T7EA 4MV9A 3HXLA 1NJ1A 1VMIA 3PGA1 4QYTA 3R8XA 4IYJA 2B8JA 3GPLA 3C70A 1V3VA 2LZ0A 3M2PA 1WKVA 3Q11A 4F2WA 3OF5A 4MPDA 1KQFA 1K5PA 2PKCA 1RXIA 1Z5GA 1LI7A 2V6FA 4K26A 4BNHA 2ZSIA 4COOA 5BSKA 4DV2B 1FFXA 5K6RA 1QLJA 4C4SA 5KU7A 2J0VA 3KQQA 2I54A 1V8BA 5K0CA 3EF3A 4QBTA 4ZYUA 2QL7A 3BTSA 1SEVA 1BKYA 3LT2A 3HNOA 3PSHA 4UU7A 1CEXA 1FSFA 3FSEA 3OIFA 4CCYB 3FTFA 1EWQA 4UBJA 4WN9A 4AMUA 2L19A 2HL6A 2XBLA 3IEPA 3M1AA 4PU0A 2BFOA 4PGMA 1ADJA 2VRCA 2A3RA 1VKZA 3NKVA 1S4MA 2WV9A 4LNHA 3OP1A 4EUEA 2C1XA 4ARCA 3PA8A 2OYSA 5CLIA 3TTVA 3WVNA 3CTMA 1ZIYA 2YWXA 3OFSA 4JJ4A 2I7DA 4LHYA 5DVZA 1TEVA 1PV2A 4HJXA 5HPYB 3NHYA 1BHJA 1QHYA 4FM9A 2XT9A 2J87A 3AC0A 3QUCA 2ZTMA 3U16A 2HY7A 4LY0A 2P2YA 3OQIA 1PWEA 2AWNA 1AD2A 1YB2A 2YXPX 3GNQA 2IZ0A 3AUSA 3L40A 4G0OA 4CUZA 4DCGA 3AM3A 1QTQA 4JMPA 4NPCA 1F0NA 1X9IA 1DIRA 4KQCA 1Q0TA 2FPPB 4CDGA 1WF6A 4FFBB 1TVKB 1M2KA 3INYA 1Y1RA 1OV6A 3O4FA 4L78A 4DABA 3SQMA 3NUQA 3GVHA 4YJDA 4AWXA 3W1WA 2BFCB 5KYYB 5LZ2A 2O8CA 5ENZA 4KFTA 3SICE 8OHMA 1FRQA 1C3XA 3ZH2A 1JKFA 1F2DA 1T6ZA 4HNSA 5AHOA 1XCMA 4IIEA 1ZL0A 2YWEA 1W29A 5GJWC 1P45A 1KDZA 1UMDA 2FB9A 2FW0A 4FCCA 1FFBA 4L3OA 1FE8A 4EY4A 1G4UR 5EUQB 5KYXA 4HNVA 2CFRA 2JKYA 2GUWA 3OJEA 4FE3A 2GKOA 5HF6A 5IN5A 3STUA 5CIQA 4KUEA 3TNJA 1E9AA 1R66A 4KL8S 3RODA 4Q24A 3SYLA 3LX4A 4RPHA 2R6GA 3R74A 5CDFA 2JCXA 2ZSFA 3ZD8A 4C7OB 3WYGA 4MQEB 4DWVA 1XVIA 3PUJA 3TGWA 3OPNA 4K9NA 3EMDA 1R4AA 3DBHB 3GC6A 1VKNA 4HEQA 2O14A 2OD2A 4L8WB 2WEKA 3NKLA 2XCRB 4MW6A 3SEQA 2VHWA 2HK9A 3CRNA 1AQJA 5BV7A 1DUVG 3AFNA 1FVOA 3ESCA 3TQQA 1CQPA 1JEOA 2C4HA 3VPFA 4ZCMA 4G24A 5K0TA 1SC6A 5EKDA 4P5DA 2XNKA 2YXLA 1T1GA 5EKSA 4ED9A 3HB4X 2IDJA 2V7QD 4J0HA 2QGZA 3RIEA 5FLXA 2QTAA 1OI3A 3KL4A 4BO2A 2HA2A 1SD2A 2WF9A 4YTEA 1K97A 2DTDA 3V00A 3FMOB 5DTQA 3T9FA 3NX4A 3H2JA 2OFOA 1E7SA 3FFTA 3O2SB 3PEUA 3H8VA 2OMEA 2QLBA 2PGLA 3ZGLA 3Q10A 4BZXA 4ZCQA 1SCBA 4DCTA 2BTEA 4LQDA 2YV5A 1DJQA 3QBDA 1G38A 3MWEA 1L3IA 5L3QA 4DRYA 2HCJB 4RVNA 2FW7A 2RC5A 1NBOA 2XVZA 2VDUE 4Z1MA 3WLKX 5JD6A 4KVZA 4RV9A 2ZWVA 4CQLB 3PRHA 4KW7A 2AEFA 3D5QA 3FKQA 2YJ3A 4CPDA 3C1TA 1NR5A 5EVCA 1IXYA 5FPTA 4DQ0A 5AKLA 4Q16A 2ODTX 4ATNA 3F5MA 4OKSA 4B3CA 1X80A 3GMTA 2AQKA 2G09A 1TF2A 4HQFA 2CK3D 4JT9A 2C2HA 1V9SA 2I3BA 2QB5A 2ZBFA 4KDFA 2WJZB 4NKRA 2HDOA 5CHYA 4F72A 3CE6A 4MZDA 1BKDR 5GINE 7ABPA 2AXEA 2EJTA 5AW2A 3GCXA 3KEGA 3Q7PA 4ZVUA 4JUIA 2C9OA 4RQBA 5ERYA 3VOAA 4IRMA 3GVCA 3H3XA 3I6BA 4CQMA 5JZMA 1E7YA 2XA9A 3H9QA 1N1DA 2PYDA 4A1FA 5TC4A 5B2EA 1UWCA 2VP6A 3DMTA 4I1SA 1QGYA 1RDFA 3NH9A 3GW8A 1DIHA 2A84A 4G4SP 4CVNA 4DARA 3T99A 1CQWA 1GAQA 4Q4DA 2OCIA 3AR4A 2QUBA 4H6XA 1K06A 1MABA 1UEIA 3K8ZA 1RCTE 1XDDA 1DAKA 1QKKA 1RJDA 1KHHA 1H2HA 2G04A 3QBTA 3A4LA 5FTLA 5L4NA 5EXDA 1DGQA 1BWSA 2QEQA 1NQAO 4PHFA 2CT8A 1Z83A 3VR5D 2VJMA 1EUYA 5J23A 4YJ3B 1FC0A 2RMKA 3I34X 3NVDA 3QELA 1X80B 4NP6A 4RCVA 5HBRA 1L7BA 1W5TA 4TLEA 3IQIX 2Q8QA 1EXDA 4E5SA 2Z2JA 3B53X 3RU2A 1YI1A 4RFLA 2JBHA 4MKXA 3CUEF 5K4AA 3FCYA 2VQ6A 4CQLA 4JP1A 2H3HA 4URUR 3I83A 3LJKA 3E9RA 3LDAA 3D4LA 3MAGA 3NM5A 4L02A 3V32A 4B4UA 4AKIA 4M83A 3AOEA 2GTPA 1MC8A 4YV2A 3ZOKA 3LY9A 2O1SA 5B6JA 5A1JA 4B71A 4AWBA 1IY1A 1CZRA 4EJSB 4OXNA 1P3DA 3MWJA 5AUNB 3DKIA 3WR5A 3QF7A 4AS3A 1FL9A 4LSZA 3RASA 2ACKA 4I1UA 4I3GA 4AMVA 3S0JA 4IQ0A 5D3QA 3Q12A 4XJSA 3VGPA 4OJMX 1ZI6A 1VE6A 2V8BA 3DAFA 2Z2KA 4UM9B 3UG6A 5A0TA 4F7DA 3SYRA 2Q27A 3DE0X 3HHEA 2K7ZA 5K3AA 2X86A 3L0YA 4YMTA 1Q14A 1YE5A 4FWIB 1L5RA 1X6VA 1BN7A 3MYRA 1J8QA 3QIAA 4FHGA 4X20A 3ZCPA 5IEJA 1BQEA 3GIDA 4L73A 3T4UA 1JDPA 4D9KA 2UZIR 2FVXA 1C7FA 2ZE6A 3DMNA 3L7AA 3PXAA 4F3RA 1QX4A 4J91A 3WJ2A 4C4OA 1QB7A 2IEBA 4YJ3A 2YBEA 3VDXA 4H3HB 3A2LA 2J09A 3CX6A 3JQFC 5DBFA 2C0PA 5ESRA 1WCWA 2QRVB 4R5HA 5EJFA 5EWMA 5H82A 1IHYA 4QTUB 5EZYA 3RJ5A 4Z4HA 2ORED 4UREA 4LGCA 2ZTSA 1EP2B 3NOXA 1OLUA 1ZC4A 3DW1X 4LX0A 4MQFB 4ZT4A 1JA0A 2QTWB 3WHKA 3KB6A 2M1ZA 3IR6A 1ZAKA 3ST7A 3ZWYA 1G5TA 3KLBA 5J2UB 2FEMA 3NCTA 2GESA 3QVMA 4N8SA 3EPPA 1XEFA 5ALUA 4BFLA 5BT8A 2DB3A 4S1PA 1RBZA 4I5IA 4YAKA 1IN6A 1KQOA 1T5HX 1RPJA 1WUJS 3QVLA 4IBOA 1IHPA 4XUEA 3B1JA 2MYNA 2ZM5A 3NHRA 3DCJA 1FX0B 4KIFA 4B45A 3UCFA 1XZCA 5T4HA 4WCVA 4EKGA 3T5PA 3W9BA 3UHOA 2BELA 2PMBA 2V4MA 4CUJA 3S2IA 1RRGA 2BFFA 3SZUA 1L5WA 4R41A 1SKUA 4E5KA 1R6BX 4TTVA 1JU4A 2CW5A 3V7YA 1Y33E 4G56A 4IV8A 3N39C 1H85A 4I1RA 3IP3A 5K03A 3ENKA 4NU6A 1N1EA 3O38A 4PTLA 4US2R 3DZHA 3BBPA 3HHPA 3QF4A 3HFSA 4RZQA 1G8AA 1YOVA 3IIEA 3EDCA 3LV8A 3OIWA 3UT6A 3ILXA 4EWLA 1IVYA 2R11A 1SXJD 3F4BA 3FB1A 1NJ8A 4GVLA 3SQXA 4GZLA 1PJLA 1UEJA 2C97A 2FK7A 2ZRQA 1Z5VA 3B1ZA 2PX0A 3PB3A 3PQ8A 3FW1A 4FQ5A 4ZPXA 3MFYA 4ZALA 1X7XA 5CJJA 4FBMA 6AT1A 4RDHA 3LRXA 1ARZA 3BGSA 3DDNA 3NAZA 2WB2A 1M1NA 2I65A 5JXWA 3F2VA 4V1CI 3JW8A 3O47A 1GZ7A 2XH8A 3LOPA 2X0FA 4Z2AA 1TADA 2OVFA 2QTGA 2YR0A 2VKQA 2ZREA 1MPTA 3LYLA 3PUKA 3L7KA 1LK5A 3ZW9A 1R10A 1BMQA 1NW8A 3GMSA 2UZ1B 4V0ME 2GH1A 4WH0A 1DSSG 5KAPA 5LBTA 4HTFB 1K7SN 1W5SA 3TTSA 3UF0A 1ID8A 4H77A 3OE1A 4QBGB 3ME5A 4F3TA 3CXRA 4I0WB 2O2SA 3ZWQA 3A6LA 1VGRA 4MKIA 4W8OA 4FCTA 2O1EA 2V55B 3C14C 3ND9A 2ZDHA 1E4OA 2OY0A 3LSYA 5HRCA 1Y4UA 3ED1A 1XXHB 3BRQA 2Q5CA 3BZWA 3G8YA 4YMGA 3THXB 3OCZA 4J0JA 1SHUX 3GEDA 4G2NA 1Q95A 4K9MA 3CKYA 3ZJ5A 5G4KA 4PYNA 5G3YA 3OO1A 3PU6A 2AVDA 4HEA6 4R1MA 1P4SA 4MO9A 1K2VN 1LX7A 2IHTA 1YVRA 3HVJA 2YRWA 3FZQA 2IF2A 5BSRA 3PYLA 3T7SA 1X87A 2IQ5A 1RWKA 1KFBB 2WFZA 1Q7RA 3M3PA 3QVUA 4YUVA 5B4VA 3RYIA 4EB0A 4YH1A 2GO7A 3LC1O 1ODLA 3FZNA 1F6WA 1ZJZA 2GF0A 4UZEA 1Z08A 3PNKA 4AYXA 5M2QA 4H7FA 4RKWA 3ZWBA 2QR3A 3AJRA 2J5KA 5C8ZA 1U2GC 3I8XA 2HT1A 2OV1A 1UBLS 3U62A 3TR0A 3FCEA 4DC0A 5EIFA 5BVGB 3F78A 1QHIA 1QPBA 1ZEMA 3KXKA 1GZ4A 2I9PA 4ZVTA 3JYQA 5B1DA 1BJKA 1Q3KA 1R8XA 2ZI5A 2NZWA 5L40A 4WFIA 5JAIA 1FTNA 3W2EA 3MQ2A 1WVGA 3I28A 3AR6A 5LZ9A 1B0ZA 2OCAA 3W1EA 4PQEA 3F7NA 4BGUA 1SCJA 2JLSA 1Y6QA 3IHWA 1IBMB 5CYPA 3OPYB 3FUTA 2BDTA 1DEHA 5BPHA 2BONA 3JD2A 4W9NA 5F5NA 4D96A 1FDUA 3I92A 4D45A 1M2VA 4PAGA 2R6HA 4NI5A 5BO5A 2FZLA 4PG6A 4Y2RA 4GYYA 4C3OB 2VSYA 5M5BA 2D7DA 2WNSA 2WTAA 1XALA 2RH8A 3L8EA 1AOXA 4G5GA 5AI0A 1DADA 4Z51A 4K9QA 4TYNA 4AJ4A 3C8ZA 5DT2A 3T5DA 1QR6A 4LXQA 4OREX 2QD2A 2VHTA 4ZYVA 1GZ3A 2ZIXA 1HLPA 2NYUA 2VJCA 5HW0A 3FVTA 2GS9A 2ZWAA 3S2UA 3O8QA 4B09A 5C5IA 1YT5A 3AIIA 2V7UA 3EUAA 2FW6A 3PNBA 4KHZA 4ACAA 2WHPB 5CFNA 3RNOA 3W7BA 3U39A 1J06A 1CNMA 1QSGA 2CJYA 2REBA 4J1NA 4PFSA 3SEAA 4PWZA 4ZKDA 4HB0A 3PK0A 4XCQA 1EVIA 1U7XA 1YAHA 4IOMA 1P3JA 3TBFA 1THGA 1A8HA 4LC0A 1P4JA 2OHIA 2Y68A 3MWGA 4AG6A 1RP1A 2PLRA 3K72B 4OQEA 5NLLA 3DBLB 2NUAB 1E3DA 3R9KA 4DTCA 3I6IA 4J7CA 4EQ6B 4HJRA 1EKXA 2HEGA 4H6PA 4U39A 1ZK0A 4FOTA 2VA8A 4LUCA 4WUVA 1YJAA 4F12A 3OCYA 1RR6A 4UTXA 3NAMA 5IF3A 1N1GA 3VVCA 4XYLA 4G01B 2YNMA 2QQ5A 1BWRA 3MJTA 4YN3A 3K8YA 1TQ4A 4KI0A 2HPVA 1G6Q1 4UEJA 5HKLA 1OFUA 1U3TA 2WSIA 1D2EA 4Z0PA 1UZLA 2CLCX 1O94D 1IB0A 3DOUA 1LTHR 3B2QA 2CJWA 5EKTA 1SA0B 1I6WA 4EGAA 1Z25A 1AC5A 1FTWA 2YHBA 1NM5C 1G6HA 4NJEB 5JMPA 4X5OA 4L6AA 4DV3B 1OIWA 2FE1A 2RB5A 3HH8A 1VMKA 3KKNA 4UHKA 3I5YA 4R1TA 1A1VA 3KOUA 5F3WB 2QV0A 5B7PA 1MX1A 3K1AB 3PLNA 2GPYA 5BSTA 2I66A 1KE1A 1CDDA 1RYBA 1L5OA 5K3DA 3FHJA 3KQLA 1VL1A 1Z5ZA 1EX7A 3LWDA 3QU2A 3SLRA 4IZOA 4I1PA 2CFTA 2WD9A 4E32A 1P6XA 1TTHA 1Y7TA 1YDWA 1YK0A 2HA4A 3CLHA 3QFSA 4GYJA 4HLUA 2QLTA 2BKLA 1KJWA 1A8IA 4YGYA 4JVMA 4RESA 3UPTA 2BI7A 4P3KA 5SV2A 1KNQA 2B1QA 5H7XA 2RH5A 1IN8A 3P0IA 2GNOA 4BUCA 5KKNB 3ZVMA 4WT7A 4KFRA 5LXTF 1FQOA 4DBLE 4FDLA 4YCDA 4S3MA 1CX9B 2F8LA 4B0PA 4D0SA 2EFCB 4MKFA 2JCSA 1B16A 4GPIB 2FN7A 3WK5A 5CYOA 3DMRA 3R0XA 1Y6FA 2V0NA 1PBNA 4M9RA 4ZO6A 1QH1B 1ZXLA 2CK3A 2ZKIA 5AVTA 2W0SA 3LX8A 3SF0A 3IDOA 2EBWA 2JFQA 4LYYA 1C7ZA 2E1RA 4PLCA 4UBIA 4GG1A 5CD9A 2IS6A 1B8VA 1S2MA 1U3CA 2CD9A 4M98A 5CT9A 1TTTA 3DD1A 2XVXA 1S0UA 3DHEA 1FP7A 2R8BA 4G8DA 3OZIA 3PZRA 4X7PA 5IF9A 3BE5A 3QYAA 3QVGA 4R6WA 4OK3A 3DR5A 2CFSA 2CWWA 1UC9A 1J2EA 2E85A 4YS6A 5KVAA 2IS1A 5K3FB 5IKPA 2ZPTX 2DMRA 1N0WA 1EGMB 4L50A 2BEVB 3SSNA 1SUPA 1YMVA 1ULUA 3LWZA 3OPQA 4WWHA 3QM1A 3RK4A 1FMFA 3GRPA 5AKXA 2KLHA 2FW9A 4D4HA 5LBUA 2A1TR 3PITA 3Q3HA 5E6SA 1GDTA 1I7PA 1VOTA 2PKXA 2O2DA 4GX5A 1Z33A 3BVPA 1MO6A 1S8AA 2H16A 4AUKA 2NAPA 4TLAA 4Z4IA 3PJFA 3W8FA 4ETNA 2HHAA 2Z5VA 2XQVA 4MKRA 8GPBA 3AESB 4HGYA 3O03A 2FPUA 2RGDA 1U3UA 1P2DA 2DGDA 4NDNE 4WCFB 3T9BA 3VH4A 5JZSA 1L5HB 3S2FA 4WK4B 1CZNA 4ZOEA 4MWBA 2QVXX 3PFFA 4RHFA 4ZYTA 3ZZ0A 1T0BA 4IZIA 4KDRA 3OZBA 2IU6A 2YV4A 2DAPA 4L74A 4PO3X 4B3IA 5BY2A 5F98A 1V16B 4G86A 1GGJA 2OUIA 3KQYA 3GUYA 4R2JA 5K8TA 4O4HA 2ZSUA 3K1YA 1VB3A 4FEGA 2I9KA 5B7QA 5AXDA 1U2GA 3ANLA 2B99A 3CGWA 1SXPA 1Q1ZA 1H4VB 1TI7A 4ZANA 4FWBA 5EPOA 1XZQA 2OECA 5FQOA 3ZZ1A 5ITZA 5L7TA 1DKNA 1VSBA 3EQ6A 2C3UA 4H3VA 4U2KA 4ZI2A 1ZXBA 3G2IA 2IPAB 4I50F 4UASA 3DMYA 3M1LA 1P2FA 5K01A 1CUHA 2YJ4A 2O50A 3AF1A 1I0IA 2G9QA 4N76A 3NT5A 2GEVA 5BMOA 3PQEA 4C6HA 2NZXA 3W4KA 2AE1A 4FXPA 1F1JA 4C29A 1FW6A 1I36A 1HV8A 3MC1A 1C0KA 2WWIA 5HOQA 1F8GA 3ID6C 4HXEB 2FRXA 1VJCA 2BISA 3M0EA 4OHVA 1EA5A 1G9SA 1CG6A 1KJJA 3LT1A 1YRHA 3O31A 3VKVA 1PFKA 1Y9EA 2KYRA 1HFKA 4G97A 4HFNA 4PCUA 2P1DA 5BSHA 4MR9B 3FUXA 4E09A 4JGBA 1V96A 3DHYA 5JPDA 2ERXA 2O8DA 3G8AA 3EF0A 3IJEB 2A35A 3BG5A 3W2TA 4MI9A 5BV2P 3IXQA 4NOMA 1QU3A 1K27A 5TDHA 1N6OA 4XSHA 3Q3VA 3RARA 3ZGVA 1C9YA 2QD4A 2WKRA 3BIWA 1PJTA 1XD2B 2ECKA 2INGX 3GPIA 4XB1A 3AW9A 3ZGXA 4ALIA 5E6UA 4D1YA 3NMUF 1E6KA 4TL6A 1V7ZA 1Z3IX 4ANFA 5CCBA 5IFLA 3DOJA 2XQJA 4F96A 1T2EA 2AFIE 3LQ1A 2VWPA 3K9FC 5FJJA 1E18A 4GOOD 1RYHA 1XFAA 4PZLA 1C8KA 2Q5LA 2NU9B 2RH9B 4OOEA 3REQA 1XBTA 1GQQA 3DEYX 4B3FX 1WXWA 4RX1A 2XCIA 3N58A 4DMGA 5MFPA 1MRNA 4FOPA 1SPBS 1AK2A 1CRQA 2PT7A 4KDCA 2CDAA 1UFKA 2Q2QA 4NNJA 4L4ZA 1SPXA 4YCMA 2ZRLA 2FDCA 1A88A 4O5AA 3NHZA 5F7XA 3EXFB 3T1QA 3VR5A 2G8LA 3O21A 4CU5A 4C1NA 4MAMA 5HGJA 2D1RA 1O6CA 4QU8A 3DD5A 1FP4B 2WJYA 3LPAA 4MQEA 4NBNA 5EE9A 3E9EA 2JLBA 1RMTA 1FNNA 4MRNA 4KN6A 3UCXA 4XE5A 3A9WA 2VJKA 3HE3A 4RK6A 5ECYA 2PZJA 1HUQA 1WMAA 1YSCA 2LIVA 3SWWA 2HA6A 2ZRDA 3EIXA 4E2XA 2C5HA 2Y0DA 4EZIA 1VFPA 4P4UA 4BVFA 1EEXB 3BF7A 2P3SA 4L3VA 4MGZR 1A76A 2JASA 3V7NA 1O9HA 2GO1A 1C0PA 1HQDA 4DXAA 3OWHA 2H1LA 3K70D 3HLKA 3CLUD 3NRJA 4GOLD 1T0UA 5GV7A 2Q0HA 1N0IA 4YRLA 5TVKA 3RNLA 4F4UA 5JS6A 5EIXA 2Q50A 4DA6A 3ZLJA 2WT9A 1Q7CA 1YC5A 2NV0A 4Q01A 3R7WB 3S29A 2WZBA 4KN9S 2Z2XA 3IVGA 1B8PA 1P2TA 1DVRA 1A3CA 1TUIA 2QRZA 4FYMA 1KDPA 4E2FA 4Z1MD 5IJZA 4UARA 2BSXA 4X94A 3X1DA 2EWWA 5H80A 3EWIA 1PDWA 1W0KD 2D5LA 2IZ1A 3DAOA 3WISA 4D4KA 3CRW1 3W8RA 3MGKA 4MDFA 3U4DA 4I19A 5U1PA 3ROPA 2D2VA 3FPBA 2QLMA 2R1VA 4NFYA 1XRPA 4MW0A 5KJEA 2L0XA 3ESQA 5TB5A 4LTNA 3K4PA 4OEHA 5JPIA 3VPAA 3L1HA 1Z7WA 3EXG2 3L8CA 4Q9DA 1NXQA 5BVGA 5IUJC 2HQBA 3VYUB 1NRXA 5TT0A 4OSOA 1HXHA 3GN1A 3M4NA 4YACA 3SZRA 1XYYA 1KAHA 1NVGA 1VXOA 3NBXX 2E4ZA 1Z4QA 3AILA 3IT0A 4IX1A 4M9ZA 5KQGA 1T25A 5JBNA 2QT0A 1XA3A 3H6GA 1Z4OA 1Z6XA 1NP7A 1KVRA 2EEPA 2J3DA 4FYWA 4KSCA 3P9QA 3OMXA 1C0IA 1KBZA 5K0SA 4NH0A 2XKJE 1JJVA 1GPMA 2QIPA 1EB8A 1Y3DE 4GH5A 3TE6A 5DGCA 2A3NA 1NW6A 5EP3A 3TSWA 1LS6A 4ER7A 3LAWA 1VMDA 3RSFA 2YIMA 1BNCA 5FNVB 3TZ6A 4YIHA 2I7XA 3V8RA 4C20A 3I2IA 2GF2A 2VDWA 3IAM1 3HJRA 1JR3A 3F9CA 4JLBA 4RPCA 4DIMA 4J0EA 3RE1A 3G88A 2IE8A 1RFGE 4LDRA 3SEZA 4F8YA 1KJ8A 2QYSA 4JGIA 4E11A 3H1TA 2WB4A 4O4LB 5C53B 5K51A 3QY9A 2OK8A 2VDWB 4BNTA 2IOYA 3G89A 4FC6A 3C74A 4IQGA 3VYVA 1T9DA 3IVMA 4LRQA 4MVJG 3O1HB 2QAIA 3D81A 1KJIA 2YCBA 1ANKA 3C3BA 1NVVQ 1C7QA 2QN9A 3HR7A 1JFVA 2CVHA 3GJZA 2ZIUB 3TW4A 1GNLA 3B6EA 1KI9A 1W4RA 3M6MD 4P92A 4UHJA 3KHSA 2V45A 2TMGA 3QBEA 4QGBA 1H0SA 3C45A 3RLFA 4Z99A 1HQYE 3F2IA 3PJGA 5HX7A 5HIKA 2BUAA 1IG3A 1GPKA 3X1KA 4GBJA 1L1FA 1I3CA 1A4XA 4PGAA 2F1RA 2WWFA 2A1TS 4RMJA 2P3LA 4WVFA 3W6ZA 1DTWB 1NVFA 5FL7A 3EN0A 1MO4A 2YY5A 3N2IA 1RHJA 2Q1WA 2WYHA 4CT5A 3GAFA 2DWOA 3K1JA 2YXBA 5CU7A 3ER9A 5ELLA 5G0SA 3EZYA 2XWQA 1W581 1FYFA 4QFBA 1AIPA 3UB3A 2EZ4A 3B7WA 1WB5A 3E0QA 2B9EA 2QTCA 3AEUB 4QGAA 2X0DA 1ZISA 4AXXA 5K6AC 3OQMA 1SC9A 5CT4A 3DNMA 4IDNA 1E8NA 1VI6A 4U3JA 3O74A 4Y2QA 3RRBA 3T7IA 4ESHA 5FWYA 4HHEA 1K8ZB 1AMNA 3GEPA 4ND5A 4MK4A 4RD0A 4FI3C 3U0VA 3ZQKA 5IU6A 2ZUVA 3RVOA 1EJ0A 1K8YB 1N5RA 2GCNA 3AV0B 3S55A 1UT6A 4F0JA 1HOXA 2NVOA 3W79A 1VKHA 1O95C 1SVIA 4I1OA 5FP0A 1U2SA 4M0PA 4DPMA 2UVPB 2EFJA 1J4AA 5HK8A 1PG0A 1EG2A 1E1CA 3TQHA 3ZIDA 1PCXA 3THWA 2FPIA 4Y9DA 2PGDA 3VOTA 2ROQA 2ZDQA 3OLYA 2ZLBA 4QDKA 1IXZA 2AI3A 3FUCA 2ZE5A 4KZPA 1Z0UA 2VUHB 1MFPA 4ZC8A 3HBAA 3SSOA 4F4FA 3EXIA 1FSZA 1SBQA 3QUQA 4RF3A 3A6PC 4OBWA 3KSZO 3LI2A 4CIWA 2GWHA 4IIJB 3OETA 3GNSA 1O4VA 3A1FA 4DLTA 1ZJWA 4YJHA 4ZCRA 1HNNA 1CRLA 3VR0A 3HCFA 3L8FA 2MSNA 1AKTA 1T3LA 2HLHA 3KLNA 3QNUA 2VCYA 2JGIA 2Y3IA 5I7OA 1BS9A 1E94E 2I34A 2WT8A 1AHHA 4D6YA 3E1GA 3KD3A 4WA8A 2G28A 1XTZA 2K6GA 3IRVA 4BO7A 2NU6B 1AV6A 2QZ9A 2YZMA 3RV3A 2PYZA 2WJ6A 5GM2A 2ZYTX 1E62A 2HGZA 2OSBA 4U9UA 3QPCA 1P74A 3UG7A 2JFZA 2OOKA 1B7GO 3O3CA 1EWRA 5JH7A 2CDRA 2QNRA 3M8KA 2D00A 4ZQCB 2BY4A 2DTXA 4B33A 4CM8B 1A71A 5DPMA 1I30A 1SBCA 2WAMA 2XYHA 1J7KA 2E7ZA 3A27A 4IDBA 5GGXA 5LA6F 3SVZA 5SZJA 3MUFA 4E15A 1XD2A 4E5YA 4N5NA 4AZ0B 1F4PA 1NY5A 2BFDB 3U7QB 4KX3A 5E1DA 1LLCA 1ZMXA 1WMBA 1SIOA 2B5WA 2Z2IA 3HPQA 3VZDA 1R0YA 2C2WA 2JGDB 2VNHA 1VKJA 4KWTA 4EVRA 1G42A 5CCDA 4WA7A 2XYVA 3DFFA 3G2KA 4C21A 3CRQA 4BO1A 3WNCA 5U4XA 4TWAA 2D2FA 2IU0A 1DDOA 3R7BA 3X1WA 5IG2A 3DUWA 3ZCQA 2ZVPX 5AK3A 3NPMA 3IAFA 5H02A 4D8YA 5I9NA 4LMBA 3U9LA 5KB3A 4P3PA 2YBDA 1HA3A 3FDZB 4AKGA 4LXYA 1C9EA 2Z3VA 3DO6A 1DAPA 2DLDA 4HWPA 2C4WA 5I01A 2BFPA 4HH3C 1CY8A 2O7RA 4YRGA 4FINA 4IVRA 3D6TB 1VG8A 3FG9A 5TX7A 1DCFA 3S5JA 3T9DA 4AJEA 3JYOA 3MQ4A 5J2UF 1FA9A 4R0VA 1K8XB 3B1VA 3AVQA 4GMGA 4URXR 2EW8A 2J46A 5BSMA 4YRZA 1TEHA 1R0ZA 4CM9D 4LY9A 2AX4A 4U6SA 1DAOA 1UXKA 2GAFA 4UHDA 3B89A 2JJ8A 3ENZA 4KR2A 2WJWA 3H2YA 2FDXA 1JS1X 3LY8A 2VF8A 3G2JA 1ODKA 1VJRA 1YB7A 3L05A 3S40A 5TEVA 1MJGM 3LHDA 2REQB 3ZU3A 1FJGB 2Q5EA 3W5CA 1HDRA 1IAVA 3DEHA 3PGXA 2FSUA 3DNPA 3ZX4A 2R8RA 3N2LA 4PX9A 4X1IA 4LI0A 1DG3A 1QDLB 2XE7A 3HSSA 3KKMA 1DTEA 4ESEA 2HB6A 2IEYA 2J9FB 2MSEB 3NWJA 4PLTA 3TZQA 4PANA 5IASA 1QOQB 2ZFUA 2QZPA 4ZI7B 3KDAA 3N7AA 2WMOB 4X1IB 4NBTA 5AI9A 2V4UA 3QMPA 4ARSA 1X0XA 4J1TC 4WY2A 3WMFA 3HJHA 2Q1TA 1YU6A 1XNJA 2ECOA 4JKYA 1THZA 4F4HA 5KSYA 4HH1A 1ULSA 2QN6A 5DHPA 5G2OA 4U02A 3WX0A 4CLRB 3SKXA 3AYZB 1WDLA 2RARA 5CNJA 4RM2A 3VAZA 5E6SB 1FNMA 5MHTA 4KLZA 2HBYA 4J0QA 2PD4A 3QU4A 4B6JA 2Q3MA 1HFJA 2BIFA 4IO1A 4ERNA 1I7DA 4FEYA 1LTQA 4WNIA 4JI6B 2W58A 4RDCA 3WGIA 2VT2A 2ZXEA 2PUAA 1A69A 3SDSA 2I99A 4II2A 3ZV6A 3FCAA 3I0NA 4ALLA 2XYGA 4D81A 1LF5A 3RIXA 2Y05A 3U3ZA 3TLMA 4FYXA 5SYMA 4WBNB 1S2DA 4X3OA 2BR5A 2D0IA 4Q4LA 3RS9A 4NCBA 1QO9A 4IJQA 1WQ1R 5FTJA 1RXVA 4CKEA 4HFMA 1EQAA 3SQOA 2JRLA 4F4JA 2QLFA 4Y2UA 5JD4A 4BMZA 8MHTA 4X45A 2MDTA 3GA5A 1K9SA 3KTFA 4LX8A 4O6VA 3TNYA 1GILA 3MA0A 3LCRA 4EY3A 3ABQB 1EFDN 3A1VA 1ZNQO 2G9VA 2PCJA 4AO7A 3CO5A 1X0VA 2EGUA 3RHZA 2D2IA 5D5HA 2DVMA 4EF5A 2B5OA 3LFTA 3FR8A 2VDQB 3DYIA 2PT9A 1E66A 4C7OA 2WJIA 1IHUA 2ODBA 5FL3A 4XVCA 1DHRA 1R5NA 3ONNA 1E98A 1YCFA 1YS7A 2C3YA 2IGBA 4NFLA 4C0SA 5D1NA 1Z22A 2CL5A 4NZOA 2ZR8A 4ZVSA 1MTZA 3AHDA 5HWSA 3U6KA 3B70A 3B6KA 1ZOPA 4DOMA 1C4WA 3P2EA 3P0HA 2ODPA 1ODIA 1ODCA 3ND8A 4ESOA 5TE9A 4DZRA 5ALHA 4X66B 1Y0BA 1RYMA 3DKPA 4WJKB 1VRVA 5B4UA 1OH7A 3C6QA 2TSYB 5C80A 4YLYA 2NO1A 4OQZA 1SNYA 5CLFA 4PTZA 3X43A 2W83A 1KYQA 2JIOA 3W3ZB 4K81B 5CW1A 3V1UA 1NUHA 3ETGA 4FEEA 1P4AA 2IQIA 3RQIA 2OQRA 2WBLC 3ENWA 1EE2A 1YKGA 3EJ6A 2JFOA 3VPDA 2HK8A 1RWQA 1EXWA 1FS4A 1IOWA 3PENA 2BD0A 5KSZA 2YZ2A 4EI2A 5BN3B 1OX4B 3GELA 2FW8A 1RJWA 5CVVA 5FI1B 2Z9CA 1CY1A 3LUGA 2GLTA 5E7JA 3T35A 1K6JA 2YWFA 1P7WA 3A0UA 2Z4SA 3WC4A 3UMYA 1G21B 4OV6B 4YAWA 2G9UA 1X7DA 2POQX 2NUTA 4RULA 1KYWA 1D6MA 3JZDA 4OSEA 2D4AA 4R01A 1Y81A 4AMGA 3KYJB 2B3DA 1E1CB 3L43A 3IT3A 5KNDA 1HDZA 1B6GA 3AZQA 2NUAA 3DBLA 3PFGA 3WA7A 4BP8A 4LJ8A 4MB6A 2OFXA 1OGJA 1II9A 4PR3A 3GLHB 1Z37A 2H06A 5DM70 1QQ6A 3BMQA 4BLOA 5IVKA 2HO5A 5KYGA 3FLAA 2NZYA 2M6SA 3RM3A 1KQNA 2J0UA 3VPXA 2F3UA 2WHPA 4UMVA 2CKMA 1N3IA 3KWJA 3M6WA 2AFHB 1XC7A 1PLLA 1USUA 2AN5A 3HJAA 3P4XA 4KRGA 5HUJA 3EFBA 2E87A 1PGJA 1G4HA 1N6HA 3OJLA 4YAIA 1OXVA 5JAOA 3PKJA 3V48A 4F1WA 1H8ED 3K7EA 1AHNA 4FX2A 3EEBA 2YASA 5CB8A 3KT8A 5IVHA 5BQFA 5C8YB 4LC9A 3KQUA 3ZCVA 2XYQA 2D1SA 2GVZC 4Z8XA 1WJGA 1TRHA 1ZITA 1B6TA 5LP6F 3EIFA 5JCJD 3O9VA 4HLCA 3HU3A 1W2WB 3IAAA 1I24A 1V5GA 1N9GB 5A4AA 3F1KA 4HQ6A 3L8HA 4RU1A 5DXFA 2LBPA 3ORYA 4U3JB 3PDUA 1U80A 4ZGWA 2FZ5A 4ABTA 3QYFA 3LGAA 2PU7A 4H16A 1ZW1A 2BEUB 3M81A 4WXEA 5KNDD 1H2YA 2AUNA 3NV7A 1DT3A 3B52X 3IDQA 4AMZA 2XTAA 3MTQA 4F5EA 5KDOA 3P19A 1TVMA 4UDOA 2QE7D 1AQYA 4KAXA 4MVJI 1ST3A 5HM8A 1RHUA 3EMVA 1C7EA 3EZXA 1CJMA 3CJRA 3IB3A 5EJ5A 3CN7A 4AROA 4MJXA 4DRXB 4CDNA 4V0OA 3A3YA 1SU8A 3K70B 1PFWA 2B82A 4OYRA 2ZUDA 4HLNA 4TLMB 1LEHA 1Z8NA 4RPLA 4ZVOA 3ZI4A 2JLVA 1V0JA 3G85A 3WWYA 1TE2A 4BRWA 5KNCH 4DKJA 3MW8A 3JVIA 4NF2A 2H6EA 4GYKA 4KRXA 4HN2A 3MSXA 2HH9A 2XWPA 5KTNA 1J70A 1VHQA 4MUFA 4FZ3A 3CBQA 1CIPA 1AZTA 2I6GA 4HSGA 1WCXA 3V4VB 2ZBVA 3UA3A 3I61A 4EA8A 3P4UA 3AUAA 2WVGA 1JE0A 4FBLA 3IHLA 5J2UA 3IKLA 2EVWX 1PUJA 2UZAA 2X6TA 3OOJA 3P4YA 2DJ5A 3WGOA 7MHTA 4NCKA 3VAAA 2OO3A 2Q45A 2OXRA 3ZJUA 3ZY3A 3L0CA 1T6NA 2QL6A 4EHFA 2G1JA 4ZVQA 1V1MB 1EWYA 3LF2A 5IM4A 4DLAA 2JLRA 3FOCA 1M1UA 3ELBA 3NT4A 1XLVA 3DPUA 1R9MA 1VG0B 2KS6A 4QWWA 2VPPA 3QKSB 4HN4B 4JZKA 3ZXYA 4AB1A 1IBCA 3DC7A 1MT3A 3NI2A 2HQ1A 2HQOA 3JQ9A 4X1KB 1OLSB 2ET6A 2XF8A 4KIGA 5B6PA 1DARA 5AIAA 2PNJA 3QWHA 1SXHA 3AUXA 1W96A 3WB9A 4RTNA 2LGJA 1BAPA 4HYTA 1RKUA 4EFKA 1N2SA 5D8DA 2DOKA 3OLQA 1SGWA 1KARA 1WSWA 2DPXA 3DDZX 3GMDA 3M34A 4Y0NA 1UINA 4JUFA 1QH8A 2PJUA 5BNFA 5ILOA 2B1RA 3X1MA 1QUFA 2CNBA 3I23A 3KD2A 3CURA 5J4VA 1GD1O 1KI6B 4R3NA 5E2AA 3DP7A 4ESVA 1ZUNA 4RE6A 2QX7A 2XJ9A 1K7YA 2GN8A 1OT3A 1QOZA 2O5RA 2DEUA 1XMPA 4OJKA 3HRKA 3PRYA 3TBHA 4V0KA 3S5UA 3RYFB 1QJCA 1R9JA 4JK3A 2R48A 3ENNA 2J31A 3AP2A 2Q99A 3PLRA 4US0R 4WSOA 3VOSA 4A03A 1KR5A 1QS0A 1Q12A 2KPOA 1QGAA 2MMCA 4YGXB 4XW2A 5JXJA 2FG6C 2Z8ZA 4AVYA 1QFYA 2VP9A 3GVPA 4YAUA 5LL6P 2P6OA 4C9BA 4I99A 4IS2A 3UWOA 1ZHFA 4L57A 2ZW9A 3JYPA 3QHAA 4IJ5A 4OLFA 4EPVA 2QP3A 1RWVA 2EBHX 2J1LA 5IVDA 4IDFA 4W5NA 3P32A 1YS1X 2AFIB 2PA3A 3D8BA 4IDOA 3PPIA 1XVUA 2YWRA 3JRNA 1P8AA 3I9JA 1GLNA 2XMQA 3SQDA 4Y0VA 3AR2A 4R84A 1ZKDA 5JS7A 2QVGA 1W4ZA 3IO5A 3LBAA 3P71T 4BFZA 2FWMX 4PY2A 3GFPA 3LECA 1DMRA 2YJ6A 2RGGA 3RS8A 5JRJA 3IX7A 5IT5A 1FP2A 3G9TA 5JJCA 5FNZA 2DCUA 3DUFA 1WM1A 2OBLA 2FF5A 2XUPA 3KLPX 4H0FA 5C4GB 4NVRA 3CCCA 4KWCA 5LMCA 4JN6B 3HBLA 1XZAA 4YAOA 1IY8A 4J8PA 4D79A 1N2IA 1FDTA 4HGRA 3TG8A 2VYVD 4EO7A 1KVSA 4QYMA 3FWZA 3WZLA 2WHXA 1O58A 2C8LA 4DSAA 1BJRE 2REOA 3NIGB 4ID9A 1HDOA 3V8QA 4OB8A 4H1WA 1N77A 2IYEA 4QUBA 4BX9A 2CUKA 1UFRA 2YQ4A 5B37A 4YUZA 1VM6A 3DEJA 4V2IA 3MGGA 1X7XB 2H1VA 2Q7XA 2FN8A 3GRAA 1MB9A 1I0LA 3KT3A 1N6RA 3U3RA 4C4ZA 1POWA 3GQVA 1FFGA 2ORYA 1ZLXA 1CY7A 1DOZA 1FOEB 4UAUA 4CV1A 4YUAA 5JY6A 1E9SA 5AKYA 3QZUA 4LVCA 3ZNOA 4OFZA 4HP8A 3MOSA 1BIFA 1GTZA 1XEXB 2EFGA 1WAMA 2JKZA 3MF4A 4XARA 5YASA 3HWWA 4N0QA 5FXMA 1LBIA 5KYWB 3W34A 4DMUB 1XMIA 1ISFA 3B7GA 3RH0A 2YFYA 2EL7A 4ICIA 3WRYC 2O0KA 4ZK6A 3AH8A 2AA3A 3QHPA 3PQ2A 3HMQA 1EZZA 1AUPA 2VAPA 3QRWA 5AXAA 1N2OA 1DBRA 1EP9A 4R3WA 4GGPA 3U80A 3KELA 4J3JA 2P1ZA 3W8DA 2RAPA 2HRBA 1SO8A 1A2QA 1IXRC 1W9HA 4FZVA 1H2FA 1E2MA 3DDCA 1GGKA 2CLOB 2FQWA 4BLVA 2EDAA 1K7XB 5KTOA 1WW2A 1MHTA 5JJKA 2RGNC 1A27A 4RHXA 1QRUA 1MABB 2Z56A 1D5CA 3CMCO 3QKUA 1JBEA 1G20B 2BUBA 2WYUA 3NHWA 4XFJA 1VA4A 2JFFA 1FBNA 2ZWMA 4U7PB 3SYTA 2WHRA 2AYZA 2PUTA 3GRVA 5TGDA 3DSRA 2NU8A 1D1TA 4RL4A 1USWA 3H4VA 3KFVA 1UPBA 4KE8A 1A9OA 3L04A 2EP8A 5FRDA 3ONWA 2W6PA 5JU6A 4GECA 4QBIA 2P1RA 3TSCA 4F1JA 5L3VA 2WUVA 3BMCB 5E7QA 1I01A 4DR4B 3Q3IA 1KMQA 1XX6A 2DT5A 3QVOA 2FP4A 2ATEA 2VQEB 4WGFA 3JATA 3QKTA 3K70C 1MBZA 1H6DA 1FUKA 1MKYA 3COPA 1W85B 4ON9A 5EMKA 1ZMBA 2KBFA 4ETWA 1KEKA 2FPPA 3RSHA 1JH8A 1LRKA 2FPKA 4GPAA 4MV1A 4YJ2B 1WQ4A 2IW1A 5AK4A 4C3UA 1TUEA 1KAQA 2OQIA 2BVNA 3H9CA 3JAWA 5A7GA 4DCNA 4EG8A 4EZBA 3AXSA 2ZDGA 4RW0A 1L5FA 2QNIA 2QRJA 3B60A 1VBMA 3GPDG 3KQSA 2AFRA 2IPLA 2W2MA 3HYSA 3DAGA 3DQZA 4IJWA 2G5TA 4QPZA 5GONA 1CJSA 5K0GA 5KYNA 1GZUA 2WD7B 5TQ2A 5IHPA 3LCVB 4EJ0A 3MZ0A 2WJPA 1KY5A 3K15A 4IH4A 5DGXA 4HG2A 1XQXA 3FWHA 3KXIA 4GMXA 4DQUA 4CL8A 3ANSA 4HYEA 2WKWA 2JBWA 1T0HB 2CHGA 1E6EA 2ODQA 3H83A 3TLJA 3T0GA 3ONVA 4DMCA 5CLGA 3GLIB 1CS0B 1LZLA 1VP3A 2GD0A 4G9BA 2OQVA 1IPHA 2J59A 2PTGA 3L1JA 1OFIA 1GHTA 3FYTA 5IM4F 3WB0A 4RIFA 2XDAA 3LUDA 5CVUA 5IDYA 3W6OA 3CLTC 1QE0A 3D8RA 3MHPA 3IR5A 5TPZD 5EEHA 2IH2A 5ICGA 4YR7A 3CPHA 1LPBB 3DFKA 4Q9IA 1GITA 1YB6A 3B2EA 2OLKA 1C9KA 5LM3A 4CI9A 1U3DA 4XD2A 3KVYA 5DOVA 4FB5A 1H8HD 3O8OA 3S28A 3OAAA 1QFXA 4Q34A 2VPZA 3AKYA 1AS0A 2V7BA 1G2IA 4JJZA 4L1KA 4ZJPA 2B4KA 1N34B 1JQ3A 1GADO 3JVVA 5KHOC 1YR1A 3FPGA 1VJDA 2Y2VA 1N25A 3OT5A 4PICA 3H65A 2ZUFA 5TPWB 1TYBE 2E2WA 4H7IA 2TYSB 4ZZ2A 1E0DA 1Z28A 2P69A 3EA0A 2P9QA 3H2HA 3IGFA 1HL7A 4FMDF 5T57A 4HRXA 4C04A 3RFUA 2JAHA 2HI0A 2OGTA 2XD4A 3R4CA 2C9BA 4CQMB 1Y7PA 1T13A 4HRYA 3X1YA 5FULA 2ZJBA 3ECCA 4BGEA 3R1IA 4ENTA 4F8JA 4K1XA 5IWAB 1ZNXA 3EQ8A 2ERCA 3GLHE 1DB3A 4CG1A 3VO2A 4YEDA 2HSEA 2HFKA 4OIFA 5DWVA 1W2GA 5L45A 4P2BA 5HMLA 1D2GA 1N6IA 2EHDA 4ZZ1A 1DO8A 1ATZA 3MJRA 5ERGB 5K0LA 3U4HA 4CQNA 2VFAA 2UZ0A 3HBMA 3BSYA 4BP1A 3QE3A 3MB8A 4N6GA 3CCFA 1WMSA 1GAWA 3GA0A 2IHUA 4LVOA 1HE4A 2O9JA 2GEKA 3B20A 3EGXB 1W4LA 1II8A 2PN1A 3GFQA 4RHEA 1OWNA 5CXXA 1IN7A 1OB5A 1GNPA 3U4IA 1LLQA 3R77A 1I51A 1L7PA 4PXYA 4MYCA 1P77A 3BEOA 3G2MA 2LE0A 3ONEA 1F14A 1ZZEA 4MW7A 5H16A 4FWTA 2WZQA 1UQUA 4B2IA 4XQ9A 4ND4A 3A4MA 4HQOA 2Z3WA 2OR3A 4UW9A 5KTKA 3DWEX 3ZKWB 2BMAA 3D1LA 1GGHA 3RW9A 3TGPA 4A0FA 3IE1A 4RMHA 2IEGA 2A7XA 1XB2A 3JWJA 4LJKA 4M46A 1FLAA 5CP8A 3WLQA 5BR1A 1G2QA 3A37A 2VAXA 4RY8A 3R0QA 3HCWA 1NAIA 4LF5B 4REMA 3DMDA 2BKVA 4ENSA 5JXGA 3NVMB 1JLKA 1ACJA 1H9CA 2WW8A 1JWLA 5L6MB 1F4LA 4X54A 4DANA 4OQDA 3EPJA 1AMUA 3UENA 2MYUA 3VX4A 3OY7A 5T64A 4URYR 4QG3A 3SVTA 1JEQA 1K88A 4XEHA 3VNBA 1MG5A 4NCAA 2BMJA 5TRTA 2X0NA 1DIAA 4RK1A 4JEHA 1ZUWA 2VDPB 4LAFA 4CKCA 4GRAA 3EG5A 5JNUA 2IP4A 3BTOA 3GY0A 1OXXK 2QW8A 4WFJA 4X00A 3RUEA 2H1OA 3H17A 4OUDB 4Q4HA 4WINA 2XZTA 4KV9A 3T7TA 3NATA 3L4SO 2VJOA 6LDHA 4J90A 3WL3A 1R6UA 3VHXA 3V33A 3DVAA 1JSLA 4BNIA 2I6XA 1V5IA 3FVQA 3MN1A 1RRCA 2WTNA 3MGBA 1SVOA 3LKDA 5EJGA 1XZEA 4LNUA 4RKRA 4HGPA 3ZE9A 1US8B 3KL2A 4NBLA 3NUGA 4UNPA 3UOAB 1RAHA 3I45A 4TTTS 5DJ5A 4G5OA 4X8LA 4B4VA 4O2AF 5F2NA 2JB9A 1U0FA 4CKBA 1G8SA 2CUNA 4LKRA 2PJDA 3B1KA 4IG4A 1VIVA 4RKQA 5LYJA 3IURA 4RPIA 2AW5A 2ZSHA 2RE8A 1DAFA 3CQ9A 4LJSA 3L93A 1E9BA 3G17A 3I53A 3VHXB 1PDVA 2ZXFA 2L69A 3E4CA 1G3MA 2CV0A 3K92A 1QG2A 2IOFA 2W93A 3TW8A 1Q19A 4OA5A 4Q66C 5CW2A 1WXQA 1DJPA 3A9TA 3WMXA 1MP0A 1LTKA 5IBPA 1WMDA 5LC1A 4Q4CA 5C9ZA 4J0IA 3VC1A 3LGXA 3BD7A 2XHZA 3QLVA 1G19A 5GZ6A 1VJ5A 3DE6X 5JD3A 4UEOA 4Y2GA 4YUWA 1Z0KA 1WD5A 4O63O 2XVYA 4XWOA 3PI6A 1Y63A 4CXMA 2PKQP 4GUDA 4TWJA 4HDQB 2CVPA 3W5JA 3D8UA 2CB9A 4FYYA 1XCBA 4W5WA 1VCIA 3WIOA 4J4TA 1VG9B 5JAZA 3P0FA 1AK9A 1T4BA 1XN1A 2PGNA 3EF1A 4MI6A 1QK5A 1J0DA 1SCUB 2EAUA 3AVVA 2JAOA 3PGMA 1W87A 4P4LA 5F2KA 4DEYA 4G63A 3VYRB 4BVJA 2NU7B 3IBGA 1X9GA 5EWLA 1EFLA 3RIYA 2OCYC 3IMKA 4EYOA 4NBUA 1A82A 2YOGA 3IE0A 1M2OB 4FMBB 3HKCB 1WCIA 2O59A 2B78A 4RUKA 4BX3A 1VJTA 2CHVA 1SB8A 3GLTA 4GSYA 4KKVA 1NXPA 4WKGA 5IJ0B 1CUVA 2JI9A 2X7JA 2J6CA 1WXIA 2QPOA 2POCA 3L92A 2EF1A 2DHEA 3AU9A 3V34A 4XVQA 2F1KA 3FDJA 5DM1A 3WKAA 4PYRA 2HF2A 1HTWA 4DLVA 1EFKA 1OV4A 1SXIA 3D7SA 1DELA 2XKAA 3A1WA 3DTNA 4HXGA 4HWGA 2WF8A 3ZHOA 2NQTA 4ONEA 2YZ7A 5ENVA 3ZYZA 3URMA 4JHLA 5CA1F 1NDQA 3C16C 2GKGA 2J4FA 3MFQA 4UXJA 4D3FA 1PP4A 4EAAA 1PJQA 4F4DA 1A5SB 4MXDA 3ZJ4A 4Z4GA 1WXDA 2CWDA 5FBQB 1Z56C 4EFLA 2VZ8A 4NC9A 2W00A 4M1TA 2CUTA 4LHSA 2JBAA 1L5SA 5KQPA 2ZJ5A 4M0DA 2HBRA 4OMUA 1ZICA 1KDYA 4J16C 1UXGA 1V25A 3QOYA 5AWFC 1XKQA 3ROEA 3WV5A 3H5NA 1M72A 1SCAA 1Y3BE 5G0WA 2WLSA 4ZQGA 4LQ4A 1P72A 2ZJFA 4D80A 3A04A 2NUPA 1UZNA 2QMZA 4JNCA 2C88A 4D02A 2GJ8A 3AEZA 2DWCA 3AG5A 2OAQ1 1PFYA 2NQ2C 4PM4A 2XMZA 3JVUA 1SVMA 2C04A 2ACVA 1DCMA 3ASZA 2IIPA 3JYHA 3KYIB 3BIOA 5AJVB 5B3AA 5JASA 1TYDE 5CDYA 2B2CA 4UVDA 2C94A 1PZGA 1YBHA 5F73A 1HT3A 3IEUA 2IYUA 3WHIA 1RMQA 4J07A 1ECGA 2DR0A 1FW8A 1RXUA 3L1KA 1UMBB 1XDGA 4YV7A 2ECQA 3E5MA 1KU6A 4TSFA 3S6JA 1JFSA 3IA7A 1SK8A 1QH9A 5F3DA 1Z63A 3O26A 2AMLA 4PQGA 4Q9NA 2WA2A 3WLLA 5JJ5A 2VJQA 3MJFA 3J7TA 1A8SA 1M33A 2VT3A 3AUUA 4H59A 4UNNA 3F7OA 2OUKA 1UMCA 3OZTA 4N03A 4YCSA 2PQ6A 3SIXA 3C3MA 2DPYA 3Q40A 1UPXA 5CJ2A 2JLCA 3ODPA 4RA6B 1FFSA 2YRFA 2IYFA 1DC7A 3OE7A 3P8ZA 1NXSA 3HCBA 2RGEA 1ZCBA 2XXBA 2PIDA 3ND5A 2VP5A 2P4HX 1FZQA 1LBQA 4DMHA 4O8ZA 3EDYA 1PQYA 1F2VA 4DNFA 1L5ZA 3KWMA 2A5JA 4YMSA 3ZCRA 4BBZA 3JX9A 2VSFA 3BA6A 4MUIA 2FPSA 3PHHA 3BKXA 3SJCA 3I4FA 4YASA 3HJNA 1ZH2A 5LZ5A 3Q2KA 5JYCA 2GVNA 4KXFB 3ZS9A 3DL4A 2AG1A 3MWLA 3OLZA 4MV5A 5JFTA 3FWNA 5F33A 1U04A 2JIBA 4Y2SA 4CTMA 4B3BA 5TXGA 4O1MA 4X1YB 2O8VA 5KNBH 3IOCA 2QPAA 3AF4A 3WLMA 3ABZA 4DNOA 3CTPA 4DR7B 3WLJA 5L53A 1E0JA 4GPEA 4HEHA 4C3ZA 3RVLA 3DT8A 1DBPA 5T4EA 5JWOA 2VDOB 3BDVA 4BUJA 2Z9DA 3F6PA 1JVNA 3B6MA 2HJGA 5CB4A 1BFKA 4AJIA 4AWAA 1VA5A 1XJ0A 3FLBA 4NYMR 2MSLA 5AOVA 1SWVA 5E0OA 4EVQA 5FFMA 1NMQA 2P6NA 1KH3A 4XFKA 2IV2X 3W9SA 4ALKA 4CBVA 1QQTA 2E21A 2GCGA 2Z04A 1XAHA 2P2GA 1QHXA 3AERA 3HA5A 3UK7A 3VHRA 2ZZMA 3PPVA 5TGZA 1ZOIA 4MYUA 1NQTA 3OLXA 3R3HA 3ZGOA 1KI4A 2ZYWX 3GLFE 3OQOA 2QVZX 4DRZA 3HYTA 3ZWVA 5FUQA 1XEWY 5KYWA 3WWDA 3B6ZA 3QUAA 1EFVB 3FMFA 1WTAA 4OI2A 3KT0A 3GGOA 2CXSA 3BILA 3FZYA 1WVMA 4H1VA 1XJWA 5EIEA 2ZCUA 4OTZA 4BFSA 5EJ4A 3CVXA 4BB9A 1HYGA 3HGQA 4FS3A 1L0BA 3QLVC 2WP0A 3LTEA 3R3VA 4E3WA 2CV1A 3R0ZA 4TYMA 4R9UC 2DTEA 4X90A 1RE1A 4M37A 4URHA 1KH1A 4NONA 2V7WA 4WTOA 1YCGA 5LB2A 1N5MA 2QS9A 3IIKA 3VTAA 2ZIWB 3MWEB 4DA9A 1J2TA 1K75A 2FTKE 2IP1A 2QMEA 2YYSA 3ZBPA 5J40A 1ABFA 4I55F 4O2AA 1I94B 1QIKA 2OV2A 3GRCA 3O3OB 4P7JA 1E2HA 5EFOA 4DDHA 2F90A 3CNOA 3NIDB 4FYKA 2RKBA 1B76A 4UVGA 3GD7A 1XEWX 5LYJF 1LU9A 3KSMA 1J56A 4FGSA 5IABA 4TS3A 3ZEIA 4CM8A 7AT1A 2F1OA 5FOXA 3IQDB 1E9CA 4KE7A 5JALA 4TRRA 3JD1A 3IVRA 3CEAA 1O0SA 1J5XA 1V9LA 4GSKA 2DECA 1DKQA 4AMYA 1DFHA 1E7QA 2CNWD 2WOOA 1P2BA 1ZMOA 3JQ7A 3K0KA 4PO8A 3SN6A 1KFKB 3OJWA 4TZ0A 1VZ2A 3OSZA 1ZR2A 1TU0A 1X7WB 1ZJ5A 2B37A 2Z30A 3DEAA 3NIBA 3A31A 4ZVMA 1VLJA 2FSVC 2Z4RA 1NU8A 1SC4A 4JBYA 4NE2A 3V8NA 5AIBA 4IW3B 1SKMA 4J2OA 1M54A 4U9HS 1F1BA 2O3QA 4N48A 1TQDA 4UEKA 3TH5A 3T34A 3QJ5A 5PNTA 2H18A 1MU0A 2EG5A 1V4NA 3JQAB 5IHXA 2DBRA 1QF7A 2J4CA 4GEKA 2GPSA 2QV7A 4HYYA 4UZFA 2Y9MB 3TX2A 3ZNQA 4HL6A 4XPIB 1JIVA 2Y9PB 3P20A 3GG9A 5AJZA 4GX2A 1DAIA 4J0DA 4DT1B 2RHGB 3BK1A 1Y5LA 3GDHA 3ICEA 4TKVB 2NU6A 3P2IA 1KQ3A 4RF4A 3HLTA 3A9VA 4ZJZA 3T5AA 4OXIA 5K4HA 1U5BA 1FVXA 2L18A 3EH2A 2CLKB 4KDEA 5THXA 4N5LA 3ZWMA 4BJ3A 3HO1A 4CJXA 4EY6A 1TK9A 4OHWA 3SS9X 3OFNA 4XYGA 4KXVA 5TNXA 2FPOA 3K2IA 3JZAA 3LFHA 4QAQA 3TIVA 3B8EA 4DMMA 4ZAYA 5IJ0A 5HRUA 4YCBA 1SEPA 3U7RA 2PZ8A 2GERA 3SMQA 1J2RA 2GAAA 1X8JA 1EXMA 4LG1A 1V8ZA 5DU2A 4I55B 3VPGA 4E88A 1H2EA 2W37A 5C0OE 4DUZB 1YMUA 5LU8A 1RBQA 4N0MA 3FMVA 4MLCA 2WK1A 5DP1A 2JCBA 5ALZA 4Z0TA 5BXYA 3HA3A 3VC2A 3UHAA 5GY7A 1A9XB 1Y89A 5CA1A 3G0DA 1X1AA 2YWDA 4BEJA 4WNYA 4CDRA 5KU1A 3BWCA 2OPBA 1ESMA 3C4JA 4RTKA 3PV0A 5TMEA 1I13A 1DZIA 3NBMA 3TM4A 1GCIA 2H0QA 3CKLA 4ENWA 1J0EA 4PRZA 5JRDS 5LQRA 3FPJA 2JGJA 4YFYA 2D1TA 1UCFA 2CLMB 1C0EA 1QK4A 4BB0A 1Q6YA 2WYOA 4A2QA 1JQEA 1A7KA 4X6XA 3W7VA 2I4MA 3H5OA 2OHOA 2OORA 1B0PA 4GQAA 2N1MA 5H5JA 1XDWA 3RSCA 5FORA 2VZEA 5GM1A 3FYCA 1E9RA 1IUNA 3MILA 2A9JA 4MPJA 3MJCA 3S2YA 4MMXB 4MW1A 1ZVJA 2X2PA 2VSXA 4B4KA 3S44A 1KYIA 3CJTA 4FR0A 1RXCA 2F62A 1E3QA 3BRWD 2NYVA 1CW2B 3W3AA 1MJFA 3PE3A 1LDEA 3RUPA 3Q5DA 1DLJA 1T1RA 3TTYA 4B6EA 4E03A 1FIUA 1VC2A 4QRHA 4JLUA 3SLKA 1OILA 1WHTB 2XUGA 4B1FA 4D4JA 3HSKA 3GGGA 1TCUA 4H7JA 4KXQA 2ZI9A 5EQDA 3UJPA 5BMVA 3CF4A 5KTPA 1H1LA 3GJ7A 3TVYA 3IOBA 4M1MA 3I62A 221PA 4JVOA 4FT2A 1G6KA 2F9MA 1DBVO 1H1TA 1RADA 4CCYA 1L5QA 4KXXA 1NI3A 1Z2DA 1CB0A 1AN9A 2AZTA 3N59A 4H3KB 5HE9A 5TMDA 1DAGA 4EUSA 2QQ0A 3G23A 3QUBA 1MNQA 2HWWA 3B78A 3WMGA 4NDZA 2NSHA 5I4IA 5C7IO 4KFUA 2COEA 2W4QA 3R5JA 3ZUGA 2VPYA 3W9UA 1JA1A 3GX1A 3KOOA 2HMUA 3P5BA 3R75A 2CFCA 3EBPA 4TYPA 2Q49A 2OV3A 4F9GA 2IIVA 3PT9A 1D2NA 3U44B 1W19A 1US8A 4PG7A 2FPLA 2DJIA 5DBEX 2ZUEA 3CE9A 2EJVA 5CVDA 3EIQA 4RIHA 1TVEA 1CJUC 1DC3A 2VN8A 3NC1C 4IZHA 2QDXA 5L3RA 2IS2A 2UUPA 5DHSA 3TEMA 2P40A 3I09A 3LBHA 2HC9A 2GILA 4MQ6A 2PMKA 5FUMA 7REQA 3VBCA 3K9GA 1FRFS 2F48A 5D5QA 5DWDA 1BW9B 3WGHA 3ZR4B 1ISGA 1M6HA 2EL9A 4JITA 2AMJA 3LUFA 4W5TA 5COBA 4GBED 1PJSA 2QJOA 3AR7A 2XDQA 5IZCC 2FE4A 4ZOLB 1V47A 2EOAA 1LGYA 3AIMA 3CR8A 3TKAA 4B6FA 4BZQA 2O2XA 4DPLA 4R2HA 5DM4A 1JR6A 2DY1A 1ZA2A 4HNHA 5EE3A 2FPRA 4ARZA 1YZNA 2FQQA 1KZ9A 3ZDXB 5DKFA 1TEZA 5BNIA 1WNFA 3L8MA 3D4PA 4OU5A 2AOUA 4AP9A 2QJFA 2RHBA 1D8TA 3INNA 1TMGE 4HGNA 1E2GA 2AB0A 4M1ZA 2QNBA 4NBWA 4FSXA 3L46A 4GD3Q 4CLOB 1DKUA 3Q3EA 3IUEA 3EOAI 2WFAA 4IEFB 4C03A 2DF8A 5AKGA 4RFSB 4IGIA 2VJBA 4EJFA 4PZ0A 1OGYA 2Y67A 4Z4QA 1NQOA 4KOAA 5LQJA 3UJ3X 2R8YA 2JGAA 1EFPB 1R9NA 3JQEA 2I1WA 3W5BA 3DOOA 4RFSA 2XA2A 3Q8XB 3E2MA 3PUHA 4MUJA 1ZDMA 4PYQA 2K2WA 3PIDA 3RHSA 3QLUC 4PGGA 1ZM4A 3E7PA 2GHTA 4D3YA 3K8OE 5JDCC 4CMEA 2I8LA 1J2YA 4K86A 3Q9UA 4DJFC 2D6FA 3HS3A 4JVLA 2DFLA 16PKA 1Z0ZA 2WWGA 3EQZA 4NXNB 4A91A 2FQYA 3R6DA 2BMDA 4H1HA 4J0FA 4QOSA 4XCVA 1NPDA 3E4DA 5KWJA 4ZMRA 5CYGA 1GFIA 1BQ4A 2I2WA 4IGAA 5THQA 3QPUA 3OQJA 1DCTA 3EPRA 4FNGA 3ROMA 4PCVA 3IP1A 1I7SB 2X9LA 3L82B 2QLNA 5JZ9A 4FFVA 3JXEA 3ROGA 2I55A 1ZJJA 3ZVLA 3ABOB 4XUDA 4X8HA 4OOFA 5JVDF 2EJWA 1Z0FA 3IR7A 3ZK8A 1Z82A 1OZ0A 1TYZA 4Y2VA 4CQJA 4GM4A 3ZHXA 4I1VA 2EKZA 2I2XB 1I7LA 1H3NA 1O9BA 4ZJYA 2BSAA 1R18A 2B92A 4AZWA 2BDEA 2QOEA 1NBIA 1QRRA 1E4EA 2AQHA 3K09A 2FK8A 4BN4A 2OBFA 3VTZA 1GG2A 3EEQA 1NZFA 1LK7A 3E2PA 4MRPA 4BX0A 4JB0A 3I76A 2OZLB 1JLMA 5FJIA 5FAXA 3WK7A 4C0AC 3H04A 2AD1A 1LY1A 2EFDB 2YKGA 3TUZC 1YO6A 4FFWA 1P9LA 1C81A 2Y0CA 3IQXA 1UODA 2XE6A 1Y6JA 5EP2A 1E58A 5IAGA 1JMVA 2CNOA 3M4JA 4HGZA 4CKYA 1EFAA 2O05A 3PX3A 1X7GA 4HDKA 2A1UB 3WRXC 5J4KA 4JQYA 4X7RA 2E4YA 4H60A 4HMPA 2B1IA 4OBBA 2JANA 2IW3A 1T0JB 4O33A 2PV7A 1ODTC 2XTMA 1IHDA 1OI7A 2X3UA 1W5AA 3ABIA 3OHPA 4GSLA 4GYWA 4WZAA 3V1YA 1QZXA 4QT4A 3HU5A 1Z68A 2C58A 4MWDA 3TMKA 1LDBA 3N74A 3H8JA 3GHYA 5K3BA 1UK8A 3TIFA 1QE3A 2FMFA 4JYAB 2M98A 2H2FA 3USZA 1L4GA 1IBRA 3CY6A 4KXNA 2Q4RA 3B1XA 1UADA 2GBFA 5ESDA 1L7RA 2YW9A 2XMGA 3IOYA 1S7GA 1A8QA 1FF9A 1J9GA 1PHPA 1R2QA 1GL6A 1T8PA 2JIDA 4I6GA 4M7RA 4MYSA 4WOPA 3WRWA 1NN1A 9GPBA 2I4TA 2QG6A 3JQ8A 4G5YA 3ACBA 4MPRA 3TZHA 1ZJYA 1G291 1E3WA 1GQSA 1K4KA 2P2DA 2ZJ0A 3OTIA 3JRWA 3FRHA 1YOBA 1T4CB 1C8BA 3SJZA 5ES4B 1YH3A 3BXXA 3PHJA 4LPKA 1IHXA 1JKJB 1TTQB 4L5YA 4YB8A 2OYCA 2GM3A 4PFJA 4MKZA 3T95A 4KYVA 1KA9H 5FPKA 3VDQA 3ZKAA 3UATA 1G8HA 4RF5A 5EOVA 1XELA 3VU8A 5CX1B 1UDCA 4ZODA 4L4RA 3BL6A 4NYIR 3RSGA 1RD4A 1TEXA 4BGIA 1UBFA 2G7ZA 4D3SA 4BP3A 4WCFA 1HDYA 3EW7A 1XKLA 3FOWA 4J03A 4C89A 4DILA 4RLFA 1SB9A 4NFHA 2P9BA 3TQFA 4C6SA 5JUWA 3FCXA 3FXAA 2V9CA 3NP7A 3ORSA 3ND7A 2JDIA 4JLOA 3IAUA 1O6ZA 2XRZA 121PA 1BH2A 1TKCA 1FBTA 2ID4A 3LYAA 4UTOA 1I9GA 1V16A 1WW8A 3DG9A 5EJ2A 1ML3A 1DJNA 3FJYA 1R8QA 1XCJA 4P32A 4B76A 1VBFA 1G8KA 1D8AA 4MEAA 5EMMA 5ADHA 3Q87B 3TI9A 5A2GA 1L4EA 4D57A 5A5DA 4YT2A 1EUQA 1Q92A 3PUYA 1ONNA 3EA5A 2BMEA 1WBBA 4LF8B 4U6NA 4A0RA 4INAA 4JJ7A 5T3UA 4QEZA 2IITA 1A4IA 1HR0B 1QCDA 2BTQB 3G7UA 4MULA 2G5PA 4MVJM 1SG9A 3OIUA 1A95A 4PLFA 5BYAA 3IMGA 1QC5B 4RVCA 2XZDA 3GDGA 2NVUB 4KAFA 3R4VA 4TYWA 3WLFA 4QBHA 1DRJA 2O3TA 2EX0A 3Q7TA 1J8MF 2GEJA 1G20E 4JROA 4PPNA 4FYIA 1NUQA 4JLJA 4X44A 8ADHA 1JG6A 3CUSA 2QTFA 1EM6A 2AC4A 4YJ2F 2JZOA 3OA2A 4N0PA 3AEYA 1LSUA 4MQLA 2PTHA 1RRPA 4RACA 1UK7A 3TMYA 2SICE 1Z3CA 3LUJA 2X3YA 2NU7A 2ZU6A 2NO6A 1NVEA 1H42A 2Y99A 3C3XA 3OJFA 4UVIA 3U09A 3AONB 2QTNA 4INPA 5DM2A 4XWKA 5A4FS 3GZTB 2QAGA 3KP1A 4MWZA 5JCJA 2GCEA 4BLQA 3CT4A 3I01A 4EYGA 3I39X 2M1XA 2Z83A 3IHTA 4PYJA 1IH8A 4YV0A 2DPMA 3SQWA 2HRDA 1ZL2A 3BQ9A 2RJOA 3CX8A 3DDSA 3D7MA 3HDJA 5DMHA 4TTIA 2H3EA 5TVGA 1M0SA 2GN9A 4E2YA 1NVUQ 2KWIA 2VUSA 1G3IA 3FN4A 4UQLA 1V1RB 3QPVA 3QLUA 3EXHC 5BSEA 1JI0A 2R751 1WUYA 2AUTA 2BFBB 4JR0A 3U7QA 4MX8A 1KL7A 2GYVA 3F90A 3VR4A 1TRKA 3H1EA 2WKPA 4UNQA 2RGBA 4QXQA 1QLHA 3N2GA 4QHTA 2J5XA 2JHFA 2REXB 1KP9A 2ORVA 1CR4A 4OQQA 4EBBA 2QM0A 1CQZA 3L3BA 3D3WA 1PFGA 4I6EA 5K2OA 4EDFA 1E79A 3KEMA 3LVBA 2O6HA 5KINB 1BYIA 3IPLA 4Z9YA 3E82A 4D9FA 3EZ2A 5K8UA 1NKSA 4JXXA 3F3YA 3SU8A 4G2TA 3JSXA 1KBQA 4MUKA 4LYDA 1G3UA 3AJEA 1P44A 1LJUA 5B53A 5B1EA 1TK2A 3AVUA 1H1DA 1FUIA 2L2QA 1D2CA 1L4LA 2QN8A 3GGSA 1P7ZA 4S2UA 4ZDIA 2ZRNA 4X41A 3DDOA 2FMKA 3RT1A 2VWHA 5D7BA 4AC9A 2PS0A 2JHAA 4JLDA 4IM7A 3WDSA 5ABPA 3BJEA 3IPYA 4ZDJA 4QOJA 5AQ1A 2C31A 4MAFA 1BMFD 1K68A 4U4AA 3T0FA 3ZHSA 1M1ZA 1QP4A 1VL5A 2PX6A 1MQSA 1CUUA 2OBXA 3B3JA 4AO8A 1VGVA 4FBGA 2ZSJA 4PNZA 1A8UA 3TX6A 1O97D 1NMEA 2IC5A 5H3CA 3RTBA 2V7XA 1Y5IA 4RYLA 4MJ3A 4DLYA 4WACA 4OLAA 4QFDA 3TBKA 3LBFA 1PWYE 4IGFA 5JI2E 1CDEA 1U8EA 4LDAA 4ZZ0A 1ULZA 1WCIB 5IDVA 4MIYA 3JQPA 4N3NA 4LQLA 4FGUA 1F6BA 3E6AA 1C9DB 2FUEA 4PZCA 5FO0A 3P9IA 2XR1A 3FBTA 5F5LA 2C4TA 1UANA 3TLAA 4CT4B 1Z34A 4W1PA 1BN6A 4BNDA 3UWDA 4BKOA 1RZRD 4I50B 2GI4A 3IP6A 4LHZA 1Z4PX 2R6CA 4LHWA 3WYNA 5JSZA 5K0JA 4EUNA 4OLJA 1ZVVA 1K4MA 3CLSC 3MINB 2KJQA 5BV8A 5FPSA 3K0BA 1NVBA 1SVSA 3U0BA 4OXYA 2H54A 1E7RA 4C05A 1UM9A 5DEOA 3O3NB 4KXYA 1FTSA 1XTVA