3ZKAA

Crystal structure of pneumococcal surface antigen psaa d280n in the metal-bound, open state
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
278
structure length
278
Chain Sequence
KLKVVATNSIIADITKNIAGDKIDLHSIVPIGQDPHEYEPLPEDVKKTSEADLIFYNGINLETGGNAWFTKLVENAKKTENKDYFAVSDGVDVIYLEGQNEKGKEDPHAWLNLENGIIFAKNIAKQLSAKDPNNKEFYEKNLKEYTDKLDKLDKESKDKFNKIPAEKKLIVTSEGAFKYFSKAYGVPSAYIWEINTEEEGTPEQIKTLVEKLRQTKVPSLFVESSVDDRPMKTVSQDTNIPIYAQIFTNSIAEQGKEGDSYYSMMKYNLDKIAEGLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords MANGANESE ABC TRANSPORTER SUBSTRATE-BINDING LIPOPROTEIN
publication title Imperfect coordination chemistry facilitates metal ion release in the Psa permease.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 101
structure length 278
sequence length 278
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3zkaA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3zkaA01
3NU1A 5KOJB 5M34A 5GGXA 4WZAA 3EIWA 5CX1B 4HN9A 5KOHA 1QH8B 2R7AA 2YNMC 4H59A 3AETB 4HMQA 4FKMA 3MINA 5JPDA 4FILA 1M1NB 1M34A 4INOA 4WNAA 4IRMA 4CL2A 4UTPA 4WESB 1H1LB 3PDIA 4K3VA 2PS0A 4WN9B 1PQ4A 5JG7A 3HXPA 4MDYA 2PS3A 5I4KA 5M3BA 3TLKA 2O1EA 1FP4B 1TOAA 2PS9A 1MIOB 4WZBB 4XPIA 3ZK7A 1G21B 1N2ZA 2X4LA 1K2VN 2XDQB 1N4DA 4FNAA 3AESB 4TKUB 4ND8B 4OXQA 5M29A 4B8YA 3AEQB 3R5SA 3AEUA 5FLYA 3AERA 4BBPA 5HX7A 4WZAB 5CR9A 1N2CB 2WI8A 2PHZA 5BVHA 5KOHB 2PRSA 3ZK9A 1KAEA 1PSZA 5JOQA 1QGUA 2OV1A 3U7QA 2AFIA 2XQVA 3MINB 3AEKA 2AFHA 1M1YA 4TKVB 4WNAB 1KAHA 4UTOA 1K75A 3PDIB 4UDNA 5BVGA 4PAGA 5KHLB 2ETVA 4HMPA 2Q8PA 5M2QA 1L5HA 1XVLA 4G09A 1KARA 4H0FA 5CX1A 4MX8A 2MINA 3K1AA 4XPIB 4NNOA 3ZKAA 4NNPA 1QH1B 3ZTTA 5JJ5A 1G20B 3EIXA 2WHYA 4N01A 1ESZA 3AEUB 2OSVA 2OV3A 3MFQA 3AERB 3MWGA 2XUZA 4DBLE 4OXRA 4PM4A 5BVHB 1EFDN 2Q8QA 3LI2A 3LHSA 4MLZA 1M34B 2XDQA 1QGUB 2XV1A 5B58T 3U7QB 2AFIB 4UDOA 3TEFA 3AEKB 2M6LA 2AFHB 1M1YB 3R5TA 5KOJA 4OVKA 3PSHA 3HH8A 3BE5A 3UJPA 5BVGB 1QH8A 2XY4A 1L5HB 1N2CA 3PSAA 4FI3F 3AETA 4LS3A 1N4AA 1M1NA 3CX3A 2MINB 2RG7A 3K1AB 4WESA 1H1LA 4M7OA 4TKVA 2R79A 5AFSA 4LJSA 5GGYA 4WN9A 1K7SN 4GICA 3ZK8A 4HMOA 2M6KA 3MWFA 1FP4A 3HJTA 3MD9A 1MIOA 2OGWA 4INPA 4WZBA 1G21A 3TNYA 3GI1A 4TKUA 3AESA 2YNMD 4ND8A 4MO9A 4G07A 2QI9F 2XH8A 1QH1A 3BE6A 3G9QA 5HDQA 3AEQA 1K0FA 1G20A
chains in the Genus database with same CATH superfamily
3V8NA 2REBA 3KNZA 2PX3A 1P4AA 5E1OA 2FSVC 3VU1A 3EX7C 1E2KA 1RSZA 1T3LA 2OV6A 4FT2A 2X0FA 3TTXA 1OB5A 4M7WA 4TS1A 5GP1A 2QQ5A 4RIIA 3ORQA 3G0HA 2QDKA 3F4KA 5I7SA 2FEPA 3RUAA 4MV4A 4CZ2A 1R74A 2IHUA 2QHXA 4AZ0A 1QYCA 1N5IA 4MIEA 2J3MA 3IBGA 3JYPA 4OREX 4R9NA 2H7VA 3LPAA 1H2YA 2YV4A 2VDKB 1U99A 3ZZUA 3EGIA 2CNBA 3LHDA 1DE0A 4PQEA 5JI3E 1UAAA 3IESA 4RVFA 5EIAA 2AZXA 2WIGA 1A8IA 3FGPA 3FOZA 2ZZMA 3C5CA 4MK4A 3MK31 2P91A 2RKOA 3OPYB 3RVJA 1SXJE 2WTAA 4MI3A 5JSZB 3WGVA 4QPCA 3QJGA 2JHCA 1DT3A 2WYWA 1PW7A 1N2OA 2AVDA 4GT1A 4R84A 5AYVA 4JOSA 1UJCA 1R5NA 3W3AD 4ND5A 4RIEA 3JQGA 1ZHOA 1V7ZA 4I99A 1RJEA 1ZQ1A 3K94A 2IH4A 3JASA 1HE5A 4OKIA 1HXHA 3HI4A 4ABYA 1RABA 5J2UB 4QYIA 5EYPB 1BEEA 1VL0A 5IN4A 2OQRA 2WW8A 1KZ6A 4PV7A 1B00A 4UD2A 2IVZA 3C4QA 1JYFA 1HZZC 4JD5A 5A03A 3ZD9A 2FP4B 4FGJA 4DZZA 3FBWA 5F7ZA 5B2EA 3KAPA 4ENRA 1LW7A 4QL3A 2P8JA 1ZAYA 1X39A 2FPGA 4CW7A 5BSTA 2HZBA 1ATIA 1Q0TA 3M6VA 4C87A 3W6ZA 3L82B 1KA9H 3EFOB 3F7OA 3RGGA 2PH1A 1QHNA 4KUGA 4LDJA 3AF2A 3I5UA 1SCUA 3P94A 3A1EA 2OGZA 3QYFA 4WK0B 2HWWA 4K46A 1LJUA 2V7VA 4XARA 4CG3A 4URVR 4DJEC 2J85A 5K8CA 5AW0A 1XZDA 2HTEA 1SBHA 2Z9BA 3ER6A 4MQUA 4OQQA 4LTDA 5NLLA 4DUGD 3EGDA 3IFSA 1G291 2L69A 5A05A 1N5LA 4OB7A 3RBXA 3Q2KA 1MAVA 3H2BA 3KB8A 3W5UA 1P33A 2ZJBA 3ZZ1A 1E9VA 4PTLA 3D0KA 1DO2A 5T57A 1WF6A 4DA8A 5TRTA 5HWSA 1W1UA 3C8ZA 4RJIA 2C0CA 4Z0NA 1TAHA 3P96A 4HGPA 1QPBA 5AHKA 3T7JA 1IQPA 4PX3A 2G7ZA 1X8LA 3RSHA 4X20B 4S1TA 1RRFA 2ID8A 3IA2A 4WKOA 3O38A 3EOZA 2MSNA 3DXFA 1WCV1 5HXAA 2BC9A 4JXKA 1J4AA 4JLJA 3Q7IA 2R96A 2VXBA 1YVPA 2PXCA 4CM4A 1ZONA 4XSGA 4JZYA 4LYYA 1ZJ6A 2P77A 3H8SA 5AJYA 3KYBA 3EG9B 2I1WA 2W2MA 4BU1A 1Y4AE 4AICA 1JXMA 4TV8A 4EO7A 3R9XA 4QQNA 4EEZA 3UW1A 4ZODA 4RD4A 1YB1A 2ERYA 4TLDA 4GXNA 3AG6A 1AF7A 3R5XA 2O19A 5KYXA 1NX9A 3KVOA 1HDZA 3NYWA 5CDSA 3TFOA 1IBLB 4HWSA 1L5WA 4NZNA 1WKVA 1GL3A 1YONA 1GPLA 1QM5A 2HNBA 2ZXUA 3WOVA 5JTTA 1XNJA 3TR6A 3KJFA 4WN9B 1OYVA 1S2IA 4ZKEA 4TT3A 3VAAA 2QJOA 5BSEA 3SF0A 3EXHC 4GF5A 3OU7A 1RWNA 3HP1A 3MJTA 3OEHD 1NYRA 3DO8A 1Z17A 3B5IA 1Z6TA 3IE2A 4OATA 4IHQA 2AN5A 4QFMA 5A7HA 4DR2B 3QE9Y 2B4RO 5DN6D 5B4TA 3A6FA 4DR7B 1DDIA 3ICCA 4ATNA 1WOYA 1SU7A 1X0VA 3ZD8A 5CYFA 2F1OA 3REGA 3VZQA 3SBOA 1KVUA 1TMGE 4WZAB 1AS3A 1I01A 2QE6A 4MWOA 3AU8A 4TOIA 3KJXA 2GK7A 1V11B 4ASUD 1MB9A 3QG5A 4CMHA 1UM9A 1ZGBA 3PA6A 4JWTA 5TE9A 3AB8A 1PS8A 2ZYHA 1M75A 1TCVA 5GJVC 3TM5A 4CIWA 4UTOA 2VHCA 4LC9A 2BSQA 1XG5A 4Z4CA 4J9UE 4JC5A 5JARA 1Z3IX 2NUAA 5G1NA 2HLDA 2QYSA 3QKIA 4JR1A 5HTKA 3RFTA 3SMQA 3WGGA 4F4IA 2BZSA 2V8OA 3SSNA 3EF3A 5D5HA 3LNCA 1Q1AA 1TZJA 5T67A 1HE3A 3UCFA 3RS2A 3ZHCA 4CFYA 1OJ7A 2R6R1 5J59A 2Z58A 1JZSA 3EEOA 4H4DA 1PDVA 2ZQZA 1II8B 2GKGA 1Y0BA 1YBFA 3FFXA 3DAYA 1JWLA 3PPYA 1RCTE 3AVOA 3JVDA 3ZU5A 4PQGA 1R8JA 3FCCA 3LT0A 4L72A 1FYDA 2P2YA 2P2ZA 1BS1A 1OHHD 1CDDA 3A9SA 3CJQA 2I33A 3WGYA 4IUCS 1T5IA 4QXAA 2OYCA 3OWXA 3FNEA 1VLLA 3GEIA 4GWKA 2FUEA 1AOXA 3DGFC 4RPIA 2PMWB 4XGQA 3H2JA 5KNCH 4YT5A 4XR4A 2MMCA 5I8WA 3RC9A 3CF6R 3SVZA 1GYRA 2ZSAA 4X1YB 2IFTA 4PC3A 2DKNA 2G9RA 2R2AA 1MRSA 2O59A 4YRNA 1YI8A 2IE8A 1DT5A 3ODGA 1C0EA 3ZWCA 4HWPA 3H8JA 1M8PA 4N3BA 4ZDWA 1VJ1A 1CDEA 4FYPA 3CUWA 4IO1A 4J1QA 4EM6A 2JLQA 4EW3A 4MINA 2CNLA 2QN6A 1KK1A 3WSTA 1Z25A 1EVKA 1QG4A 1M0WA 2ODEA 3A6KA 4MI1A 1S5PA 3U9LA 5GTDA 1X77A 1EJ6A 4E0BA 1PK9A 5A3QA 3M6LA 1PL8A 4PHFA 3TKLA 3R6TA 4Z1OA 4P3PA 4EMSA 1QVZA 1HTWA 3UMGA 5LNK1 1ZFNA 4DR3B 1O2DA 2AJTA 2YJ5A 1BD3A 1L5VA 3OWHA 4D2IA 1JIQA 4B6OA 3BH0A 3C3EA 1CHDA 2P67A 4TX1A 1D0SA 4G67A 1UXOA 1A2QA 1J09A 4LVUA 3RK4A 1NU8A 3HA5A 5DPMA 5AI0A 4MNTA 5D01A 5EWMB 1RPZA 3OT5A 1CJCA 5IVPA 2A35A 4JBYA 3FAZA 4UASA 4B1FA 5KCZA 3H11B 4FOTA 4H59A 3O8QB 5HKLA 1H2BA 3N28A 1R0XA 3EASA 4HJXA 2KS6A 4NBTA 1J49A 3O1HB 2P3SA 4X45A 3VPXA 3ROPA 4JUAA 1JG4A 2GZRA 3WZLA 3Q8LA 4LF6B 4TTAA 3AVXA 3CPEA 4K26A 2BFDB 5C8XA 3LBIA 3OFND 2KJQA 3RFUA 5EJEA 2RHMA 2FPWA 3FR8A 1WDTA 3SSOA 2BONA 3KXDA 2QT9A 4N18A 1LBTA 5CLLA 3ETNA 4KI0A 2F43A 1SZDA 3L6UA 4RKWA 1HG1A 5E1MA 1YI1A 4ZHSA 1KPIA 5ARDA 3RWBA 3VNVA 3PLAE 1FMCA 1DXHA 5HR5A 2D1FA 1EFRD 2EF0A 1UWCA 4GYYA 3VFDA 7YASA 1Y34E 4F2GA 4DG5A 3GWGA 4CCYB 2I6FA 1GGEA 5A5FA 3PNSA 4ZJYA 2CNOA 4J0FA 5J23A 2H2FA 1XPUA 3FFAA 1UK8A 2VF7A 2WEKA 4KP7A 3NWBA 1RRPA 1Y8QA 5FTWA 2D2EA 3I92A 3I32A 3IRUA 4WXYB 3RK0A 1XI2A 1YGYA 3KG2A 3QXHA 2C7PA 3AVUA 5U9CA 1TF5A 1F38A 2BFEA 3I1IA 3I6BA 2EARA 3PB3A 3OIYA 3EMVA 1ZRSA 2B2NA 2OTCA 2Q3LA 4DC1A 2VWPA 1KP9A 5DSZA 3HY6A 5HMMA 1QH0A 5JO0A 1IUNA 1GYQA 4YIHA 3OJ0A 4FNOA 1KK2A 3KSMA 5CFQA 4C03A 1W48A 2NZ8A 2JC3A 1VE6A 1GTG1 1X94A 5IBQA 5LDHA 2Z30A 4DE5A 4PG8A 2ZKLA 2BP7B 3Q6MA 4MTLA 3SHVA 1UZUA 2JFGA 4BN5A 4QUEA 4NH0A 2X13A 5K0SA 3UHPA 3LTNC 1P0PA 2GAFA 1TZBA 3AO0B 4M49A 5TQ2B 1YJAA 1CNEA 1E3DA 2C3OA 4I50F 4JAVC 5BOSA 2PT6A 3BB1A 1EINA 6Q21A 1X3SA 3ICEA 1QLJA 3TIVA 3UOAB 3WYGA 2M6LA 4M8IA 3ONNA 1S7GA 1DCKA 2B9EA 4YO7A 4FONA 4F2WA 3IMFA 4AMGA 2A9VA 4BQOA 4FHCA 2NP6A 3FZYA 1QYWA 4G41A 4YUXA 3QQ5A 5IJ9A 2GBLA 3UUGA 4BNUA 1IPFA 3QA9A 1TJYA 1JJBA 1HE8B 1CC1S 1GPDG 5AJHA 5LWQA 4BX3A 1X7WA 1XQ9A 3TSWA 2XTMA 1SPBS 1PEAA 2EC5A 6AT1A 4EKYA 1ZH2A 3R40A 4GSKA 3CG0A 2FEAA 3QMWA 3ZZMA 4UM9B 1AUVA 5A4KA 3EF0A 4RAQA 5AMXA 2V9PA 1Y7PA 2YDXA 3PEVA 2HLDD 2Q9CA 3FUTA 4GBJA 4ND4A 4OFBA 4P9NA 4TV9A 1W88B 4UQPA 2OCKA 1SG9A 2VAVA 3N70A 4J1NA 5SY6A 4WZAE 4ZOQI 5BXQC 3ZWYA 1DC4A 1D2MA 2R8EA 2B7CA 3QKUA 4RABA 3BWCA 5HF5A 4R2JA 2PM8A 1EGQA 3OTHA 3O8OB 1H69A 5H4GA 4MV9A 5BMVF 3CW2A 4OJQA 2CMDA 3LM8A 4NJMA 4BWYA 2BGTA 4E70A 2DF8A 3SDSA 3Q0IA 4ZICA 1TYEB 3ZEAA 1Q0RA 2V7XA 4D4KA 1O57A 1XC7A 2R3SA 3SHWA 1E1QA 1SXJA 1O97D 1PJ2A 2J45A 2WKPA 3JRXA 4IMRA 4IV5A 1KP2A 1M7HA 3QLVA 3AL0C 3T5BA 1G3UA 2B4AA 3W34A 1VPTA 1B73A 2WAOA 3LZCA 3QOFA 3HEMA 3EGOA 4P6VF 1G4HA 2CL0X 1WVGA 1WHSA 5M3BA 3KTDA 1RLJA 1YE5A 5CVCA 5COBA 1QC5B 1XZHA 2BZ1A 3TBKA 3UK0A 3RE1A 1Z63A 1YR7A 4YRBA 4QAJA 1WETA 3FH0A 2Y9MB 2ZJ1A 3A3PA 3ORSA 5AJZA 4AY3A 1AQLA 4M9QA 4V0NA 2AOUB 2F8SA 1PR6A 1X8XA 1E66A 2I76A 2QTZA 2RCNA 2DYKA 2HRZA 2VWQA 3MC1A 4JOCA 4HYTA 3WA6A 1PNTA 3PR1A 4AZSA 4ZYUA 3CQ9A 3U7FB 1P44A 2NU7A 3X43A 3VU9B 2W11A 4JBIA 3GAAA 4IDHA 2L2QA 4HAZA 4ZYTA 3FLAA 4MYSA 2FSFA 2V7QA 3IXQA 4DV0B 1YRHA 7MHTA 4Q4LA 4KMRA 1AV7A 1FUYB 3BIJA 4DSTA 2BFCB 1ZR4A 4HAWA 3DZGA 4KQFA 1SU8A 2VDNB 1V9CA 5L53A 4MAMA 5DBFA 5DO9A 4XDGA 3O93A 3R5JA 3X1JA 1IBKB 3EH1A 1SVWA 3I2YX 2OAGA 4HGQA 2FWAA 2POQX 3L77A 1QYXA 3EG5A 3JQBA 4NEHB 5DLQC 1IOLA 1H9BA 2XW6A 3M6MD 2WG2A 3MS2A 4IM7A 1ULHA 3WMEA 3ZS8A 4QUHA 3FCXA 3O4RA 4L2IB 2BZ0A 3ZDCA 3BK1A 2IEYA 1DI0A 4ARUA 1G2IA 1K1EA 4ZU1X 5KOYA 2A88A 3A6LA 4HEHA 4KRGA 2WHYA 4IWNA 2V6GA 3AR3A 1DKMA 4Q9KA 4DNQA 3BF7A 2ZUUA 4FFOA 1EUQA 1NP6A 3H5RA 1JEYB 1QP0A 5DK4A 2HMVA 4MS4B 4WCFA 1Y9ZA 1MGPA 2XUZA 3JQ9C 1Z12A 3KQSA 1B7GO 3S27A 1XYGA 2J3QA 3FHCB 4NF2A 2Y2VA 1I2CA 2FN8A 1FZQA 3ILXA 3LH5A 3RRYA 4I6GA 4Q3CA 1W36B 2C61A 4BZXA 3INRA 4MZXA 4J3JA 3WB1A 1IULA 2FPRA 4XJTA 3DB1A 1NUSA 1QOZA 2N42A 1Z6QA 3O8BA 3RUEA 4RY8A 4TT8A 5HKOA 1UZNA 2VATA 3NORA 3INTA 1C7RA 1LX6A 3OIFA 1T2CA 4H7HA 1P2UA 3UB3A 4V39A 2QSZA 1MC4A 3QUSA 2QJRA 3JQPA 1IMJA 2ZJ3A 2OXRA 2WFLA 4RSRA 1JVBA 1CUGA 2WG0A 1Z9BA 1WEKA 3KDPA 1UFOA 3QIVA 1JALA 3V8EA 3WYFA 5C51B 4Q4DA 4KDFA 1DJNA 3MIIA 3ES9A 3VKWA 1NAIA 3LCRA 5MN5A 5JNLA 1SD1A 3QVGA 4NZPA 5D8DA 3KV3O 4M1YA 5GOTA 3W8EA 4B3RB 4M36A 3G6KA 1WD7A 4LSMA 5C8VA 3D4IA 4U9IS 5LLTA 2IU4A 1T9HA 4HDNB 4LECA 4WGGA 1JFFB 2CSXA 2Z5GA 1I5RA 2I1VB 4E12A 3OTGA 4RKQA 4I2VA 1QH8B 4Y67A 2FJUA 1FTNA 1OVGA 1UDWA 2ZIEA 5JD6A 2C07A 1K88A 2WSIA 3LK7A 4NC9A 1GILA 1X92A 3OOHA 4Q15A 4DREA 4F3RA 2HCFA 3FTEA 1IN5A 1RBMA 4BOYA 1R6BX 4K9DA 3UB4A 4AF6A 1U8EA 3I9V6 1H4VB 2PJZA 3N8HA 1QB8A 5J1SB 2JLXA 3K71B 4N3AA 4R1TA 3BHJA 1GM5A 3DF7A 3NEJA 1UQRA 2NUTA 1Q0SA 2B1IA 3PQCA 5TT1A 4MVXA 3M2TA 4KXXA 3ANTA 1XE3A 4TSRA 2C77A 2DOKA 5CIQA 4D99A 5I3CA 1E9CA 5JD5A 5KDLA 1C9DB 1QONA 2BEUA 5IJ0A 2X9LA 4LV5B 2N46A 1XCBA 1TM4E 2IJGX 4I3FA 5L6LB 2GAAA 1WV0A 1VIMA 4HQOA 4OFWA 1WHTA 2X5KO 3K05A 4ZHQB 2XB6A 4K87A 1CF9A 2E48A 2QP3A 3C6QA 1W35A 2X8AA 3AT1A 3PNQA 3A2MA 4P4SA 3F90A 3OZBA 1U65A 3FE2A 3WG9A 4CKEB 3HJCA 5KQSA 3D1LA 2HK6A 1KAHA 2ZITA 5BW6B 3GDWA 1BCRB 2BCEA 2IX9A 1MBZA 1WXIA 2TS1A 3L49A 2OHFA 3A58B 5IC5A 1XZKA 1AQJA 1MENA 3D2LA 4G25A 4H1HA 1G6Q1 3UY4A 5C53B 4FFWA 4P4UA 3WZ2A 1J21A 3E8MA 4N0PA 4G85A 5AOCA 2AMVA 2EP5A 3IIJA 4J1TC 3V32A 3R41A 2XD4A 2YIVX 2FLKA 2BBWA 1MXFA 4NU0A 1I4DD 3GARA 5CNMA 5F23A 1X2BA 2YXNA 2GRJA 2Q3EA 2MYNA 1LFDB 4TV8F 4WLOA 1JA0A 2PSEA 1KORA 1U63A 1ENZA 5IHXA 2EFDB 3MWLA 1AUQA 3A1UA 1M5TA 4NJEB 1AXGA 1N9GB 5IYZB 1E3JA 1Z39A 3EVCA 3PE4A 1A5AB 3L93A 3DYBA 2YVQA 3JQ8B 5DMHA 4CIXA 2J6HA 2J0EA 2REQB 3ZVNA 1QVVA 2QG4A 3DFFA 3RFFA 3B1YA 1JAIA 3S40A 2XHEA 2IUFA 3MSCA 3OPYA 4WACA 4E7OA 5JSZA 1WPGA 2XGJA 4FLFA 5CFLA 5J47A 2PUEA 1MEOA 1SUSA 1NVMB 1WCWA 3KYIB 4X3PA 5BVGB 2XITA 1ODSA 1YJCA 2VJOA 2ZYGA 2VQ3A 1LVHA 1P77A 1JJVA 1L7MA 1THZA 2GQ0A 3W3ZB 4GVPA 3DKPA 3L7LA 4O8ZA 3A1FA 2V7QD 3AMVA 1R8XA 2QE7A 4LXYA 1IL0A 4LJSA 5EYPA 2Y93A 4YCDA 5KNDA 3CZ5A 1WUYA 3QU7A 5I01A 4D9HA 2EWVA 2WD9A 2QRVA 2P69A 2PEYA 3HJTA 1EX9A 3MMXA 4PFJA 5LA6B 3QMMA 4B3XA 1XX6A 1EK0A 4R8LA 2GFHA 4CKCB 5KVCA 1KZ9A 3BB4A 1H3NA 2VUSA 1LLDA 3K5IA 4HDRA 3WMGA 4BTVA 3JQFC 4QYXA 3HFSA 2JLZA 2O6LA 3I04M 4Q9IA 3SC3A 1WW2A 2GAJA 4F9TA 2HGSA 3JW8A 4JQYA 4J4BA 4C6RA 4TRJA 1TCCA 2XUGA 1RJWA 3KEFA 4TXJA 1F8UA 3WWDA 3C6MA 3ELUA 5M5BA 4NYMQ 3OKCA 1AA9A 1WXWA 2YMPA 1QIHA 3L8GA 3TBFA 2FK7A 3PHGA 4BJHB 1AGYA 2C2WA 2X4DA 3KZMA 4ER6A 2QD4A 4R7ZA 5JS7A 3FBTA 4U39A 2RGRA 1JDZA 4ND3A 3T3NA 5BSVA 2I62A 3UN1A 1GCGA 1GZVA 2XUPA 4G1EB 4P3OA 2DMRA 1FOEB 1DXYA 5BNWA 1N9KA 2QTGA 3P9SA 2X8JB 3V5NA 1FJ2A 1NHGA 3QV2A 5TMEA 1MC8A 2ZJZA 1NVAA 1OYYA 2VHVA 1VMKA 3L0PA 3ANNA 1WXGA 4B4UA 4D9IA 1E1CB 2ZS8A 3EEYA 4UBMA 1NUPA 3DMGA 5I4IA 4R05A 4LE2A 2D00A 1Q21A 3L6OO 2C57A 3GT7A 5EGSA 5HQJA 1W0KA 5B4UA 2GYWA 2NM0A 2W90A 3QUQA 5L95A 1I1QB 4M7PA 1MEJA 2BH9A 4TL6A 4EPVA 3WICA 2C2XA 3ESXA 3PIIA 4HRAA 3UMJA 4XWKA 1O58A 1MA0A 2IL1A 4GP6A 2YWXA 3TLCA 4OM7A 1J2EA 4CCSA 4EBFA 2FZGA 4GXTA 4ARZA 4N4AA 1Y8CA 1ZISA 4LRXA 4ZT6A 3LE8A 4LRQA 1VG8A 1Z5UA 2VL7A 1FCJA 5CM2Z 1HNWB 2JGFA 4C89A 4NCAA 4J0JA 1TDJA 2GZ1A 2P3QA 2CFOA 1GFZA 1K6XA 1QCZA 2V5AA 4MPPA 1ODJA 3THWA 1PUIA 3WLQA 1LPPA 4YY3B 3P9YA 2DWCA 5SZKB 2DWUA 4XFJA 4NPHA 5K0TA 5LN1A 3IAUA 3ROEA 5ADHA 3KJHA 4W8OA 3HBLA 1T3GA 3C39A 1H2AS 4QPNA 4UDXX 2PZAA 4WTOA 3W7VA 1ZEJA 4JLOA 5A9RA 2B2XA 2XVAA 1IU9A 1GKUB 4K9PA 5FPPA 2BH2A 4K2AA 1GNQA 2CC2A 1IPHA 3GBVA 3P97A 2NO5A 4M0UA 3HK2A 3LW8A 1T3TA 3LUDA 3E0QA 2QR5A 4RUKA 2Q49A 4AKSA 2Z4TA 3HL4A 1RBZA 4BQNA 2I80A 4JKOA 4HN2A 2EEPA 3DEKA 3F6SA 3GFPA 4C1BA 2F8LA 3W8DA 4CVNA 1G18A 1OWMA 1SZJG 3MTBA 3QPWA 4N5MA 5CDFE 2BY4A 1UPUA 4MUBA 2HQRA 2YHIA 4I9NA 3A4MA 3TQHA 3AB3A 5E7QA 3UT5B 5FUMA 2RG7A 2NO1A 3P32A 2HB6A 2O4UX 2ZJ2A 5EMJA 2FN9A 1P2GA 2VPPA 3QYJA 3TVYA 1XIVA 2JJ2A 4MAFA 1BRTA 3SE7A 1GU0A 3R3XA 3UG7A 2W4QA 3RT9A 5HEKA 5AIBA 1W75A 2GYYA 2KQUA 3UHOA 5EKTA 4HGRA 3C3KA 5JSUA 4MQLA 1UADA 3A1DA 1D7OA 1E64A 2PMDA 3QGMA 4ZAFA 5HUHA 5FJIA 3L4EA 2C3YA 1HH4A 2HO5A 4M37A 3E22B 4YAOA 1MN6A 4CFSA 3GJZA 5LOVB 1TNDA 3ELWA 4L5JA 1ODTC 3D2BA 1A4IA 1ARZA 2I3AA 3EDOA 3G2PA 4XWWA 1BNCA 1OFVA 1Q6ZA 2B1QA 2LUOA 4M1TA 4ZT7A 3C70A 4IDBA 4RPGA 3JR7A 1EG7A 3RH0A 3D6HA 3HVJA 3CKYA 4E22A 4EPWA 1UOPA 3KC2A 3LGAA 3TDKA 4G0UA 3MCAA 1NKTA 4NEQA 2EP7A 4QBHA 3UMFA 3BA1A 2KLBA 2YDYA 1Y42X 4WW0A 4EZIA 4FILA 2PPVA 1YR2A 2WU0A 1MRZA 3C1UA 2ZE5A 3KOZA 2A0XA 2FI1A 3B20A 1A4UA 4H1TA 5ITWA 4LEIA 4DDKA 4F6RA 3NHFA 1YZFA 3VZRA 2WQ7A 4X1YA 1R8QA 1TO1E 1ZK4A 3KJIA 10MHA 2O3QA 1SFRA 1MIHA 3BZBA 5K3SA 3AKEA 5KO2A 3I6YA 3PICA 2IZ0A 4BFZA 1I2AA 3RC2A 4NKRA 2RGUA 2G9VA 4DR5B 5E9AA 5CYGA 5ALYA 1RHUA 2ZJOA 1GZ7A 4TYWA 4ND8B 1RPTA 1Q11A 1V3QE 2I3BA 4UCFA 5EPOA 3JD4A 1TM3E 2H00A 1G5RA 2BGJA 2QE7D 3R76A 3ZV3A 3UC9A 1IUOA 1OT5A 1EXNA 3NRCA 1LPMA 2B1GA 4L50A 2IIQA 3RC3A 3TUJC 1Y8RB 2V3CC 5G1PA 1N6NA 2FPKA 1KYZA 1RIFA 4NZ9A 5GAJA 3BRQA 4IS2A 1PWZA 3K0CA 2ZBFA 5EAIA 1PTKA 3ZY3A 4IOKA 3ZCQA 3K6RA 1AS2A 1KMIY 1FTSA 4REQA 2QT0A 4UNPA 1Z56C 2BR5A 4XGRA 2QUJA 1E3QA 4I8XA 1KARA 3F5FA 4BMSA 2Y1WA 2M6SA 1XZ8A 5BRAA 3FA2A 2QIPA 2JATA 2ZRLA 2I22A 2QD2A 3DEYX 2QRUA 4JJGA 4CQMA 1N2IA 4BDSA 4IZ6A 4AG5A 4F2HA 2HJ9A 2X4GA 1N3IA 1DC8A 5ALZA 3WRXC 3ZX5A 2YOHA 5DHUA 1BCSB 4QJ4A 4C7MA 1HETA 3CEMA 4B6SA 2A4MA 1VG1A 3FY4A 1EXWA 1FRQA 2PYZA 3KLNA 5JAPA 4KK4A 2E9SA 1Z0ZA 1NXSA 4I55B 4LWOA 1JW9B 5TS2A 5I7OA 4Q9DA 2ZWPA 3IIEA 2E4YA 1R9MA 1K6MA 4KO4S 4R9SA 4WBNA 1E92A 1QTIA 4Q0MA 1NNLA 3AUSA 3ZGNA 2YY6A 2HHLA 4OQZA 2D1QA 4P82A 4YDQA 1XQVA 2JPDA 3ND9A 5DBIA 5EE1A 5G3ZA 5DF1A 3PS9A 4CDRA 1LS1A 3CWZA 2E21A 1VI2A 3FUUA 3OUZA 3MHPA 1H2HA 4HQ0A 3R3WA 2DULA 2C3UA 3LW7A 5TQJA 3MWYW 4NZOA 2J9XB 1GADO 4LXQA 4QBTA 3LTEA 5FADA 1XPRA 4GGMX 3U62A 3PEUA 3JQCA 4EH1A 1E1NA 4PFSA 2OGWA 1JECA 4QGFA 1JF8A 3BFPA 5EUQB 1EXMA 3CZAA 3DR3A 4B3TB 2QXYA 3BQMB 3NX4A 2NQTA 3TXYA 2HJRA 3OCUA 1RJ9A 2ADFA 3U3KA 3QSGA 2ZSBA 2O1SA 2M98A 3AI1A 3IAM1 4R8SA 4PO9A 1OV4A 4FT4A 2HY7A 5TPWA 4KHPB 3I04A 4WD3A 3HXQA 3HU2A 3EIWA 1YXMA 2V55B 4KQWA 1XQWA 1HFEL 3E5HA 3C3JA 1FNDA 4AJKA 3G7UA 1IC6A 1LSOA 3HCNA 1T9DA 4HPWA 4J90A 2YWGA 4XDZA 5KYGA 4OQXA 4KAFA 4N5NA 2IOHA 4PLYA 3M6UA 1BDHA 1NMYA 1DEOA 1YUBA 2ZKIA 4BKOA 1MUUA 1QYDA 2Z56A 3DZKA 2D7DA 4XWAA 2HCRA 5DYNA 1U5BA 2C7GA 2LIPA 3HCPA 4BC1A 3IVCA 5DHPA 3FI0A 4NBNA 5JAOA 3P2EA 3RDPA 3ROTA 3IELA 1OE0A 1YVEI 4NTZA 1F5SA 3BZWA 6YASA 1LC3A 2N0SA 4KVGA 4M98A 5FEUA 2ZIZA 3PC8A 1H2FA 4FKZA 4J0KA 4LHWA 5A1JA 4C7OA 5KTMA 2PWYA 1VPVA 4QHTA 1AZWA 2IEAA 3ID6C 2RGNC 5IF3A 3RVRA 3G2QA 4IOJA 4YBRA 4JGIA 4DA4A 2PV0A 1L7PA 3K72B 3ETLA 3A1NA 5T3YA 3WQQA 5TX7A 5FBVB 1SXIA 3PQDA 1S1CA 2WJZB 2I91A 3HDGA 5AM4A 5JC1A 3V33A 3OM9A 5F3DA 1JQ3A 4ZVUA 4U6SA 5TEVA 3VKFA 5H8WA 3FTFA 1YO6A 4Z9AA 3ODPA 1JIXA 4HOYA 4NBWA 2WOOA 5DH9A 1OAKA 3L7DA 5TMPA 1Q74A 2AX4A 2RK4A 2FSHA 1IY0A 3T1QA 3T3OA 3R7BA 3RSQA 2QLBA 4CETA 1FFXB 4KAJA 3IQIX 4M0LA 5CB6A 3HABA 3JWHA 4AY5A 4MMXB 3TLZA 4DCUA 4E09A 1RHMA 13PKA 3GRVA 1KR5A 1P7PA 4HPJB 1MX9A 3B12A 5JW6A 4XYLA 3O4JA 2WWIA 4IDNA 2BM0A 1CUXA 5TY0A 1LDGA 3VZCA 4B47A 1JTEA 3KFVA 5K3BA 4W7SA 3K2EA 4B87A 4BLWA 1KEEA 5ECYA 1CLUA 2AOUA 3NKFA 2W2OA 2IYLD 3D7MA 1VKNA 2ZVQX 3IVAA 5K2OA 3WV5A 1L8AA 4BZWA 4C7XA 1GDHA 3I9NA 4NDNE 5C8YB 2Q2NA 2O9JA 3OQJA 4D8YA 3D1VA 4TZ0A 3EVDA 4L8LA 1GTL1 1OX4A 2ZYWX 3NUZA 4C6TA 4LTMA 1MO6A 3DLCA 2Q3JA 4YP0A 4GM1A 3ANMA 5I5GA 1OXKB 2HN9A 3G2MA 1RE1A 1R37A 4UD6A 5ILGA 4BMXA 1JDNA 4B3SB 3WGLA 2CL5A 5LP6C 1CUYA 5C80A 3VO2A 1EDOA 1R0ZA 4JP1A 1Z4NA 3M3HA 4L4SA 5CBKA 3S55A 1R2QA 1NRXA 4RS4A 2XYPA 4WLUA 3TZQA 1KP3A 1ZY2A 1C3JA 3CPJB 3QW2A 4KO3S 4ETNA 4JR0A 2OO3A 2BHRA 1JFRA 2Q5LA 4LOHA 3ZW9A 5K3FA 4TQAA 5DWDA 2VZEA 3C6XA 4RHEA 3DUFA 4LZOA 4OYHA 3L6BA 1K89A 1JHYA 2C8KA 4GOOD 4XX1A 3B1VA 2ZJ6A 1FK8A 2C8JA 2CZGA 3PXDA 1Y9DA 2HWUA 3VYTB 2R1UA 1VMDA 1JSCA 3WLIA 2MYUA 4UDYX 4G0OA 5TPZD 1A9ZA 3RVDA 4CT5A 1KAGA 3K9FC 3E5MA 3VH3A 1BDBA 4ZQFA 2P5UA 1GTJ1 3BHMA 4TMZA 2ZUCA 3QXCA 1M6EX 4IRMA 3TLGA 4YMTA 2WB2A 1BD4A 4LJRA 5BWMA 3Q5EA 3I58A 5K05A 5GJWC 2AE1A 3S8MA 3E9QA 2F67A 3HGTA 3HM9A 3UEOA 1B41A 4D1YA 3JQRA 1MKYA 4ME6A 1E9DA 2J3HA 1DU4A 3KZXA 3KWJA 4MDYA 2B9VA 1YZGA 4OL0A 2FEMA 4RMJA 3ZCSA 1JEAA 3GH1A 1TL7C 2B98A 1MW8X 4JVMA 4D9NA 3TEJA 2VDJA 2DPMA 1B76A 3DTTA 5HGJA 2ANCA 3JZAA 3DE2X 4FNAA 3T9BA 4DYDA 4LFCB 4J4TA 3G2OA 1KQNA 3NAGA 5KNDH 4OQLA 1RM4A 3FUVA 3EAFA 4YUVA 2X8BA 2XWBF 4WK4B 1FMLA 1YDGA 5JXJA 2NTJA 2R65A 3PI7A 3IT0A 3GFFA 3UAGA 4HX5A 5K9ZA 1OF1A 5FFFA 3E5RA 3K09C 4RFLA 3BKXA 1QHGA 2VZLA 3THXB 5J2UF 2XCIA 5F76A 4QECA 5F2EA 1UZAA 4E08A 1GGMA 4L5AA 3R3YA 5FA5A 4AROA 5JNWA 1DIRA 2IOFA 4PC1A 2ESRA 3GD5A 2VO1A 3PRKE 4HDNA 4LZAA 3T1NA 1YS4A 4RZIA 2R6ZA 3HUEA 3A31A 4GOJA 1T1IA 4U8GA 4FYIA 2QROA 2AF4C 3PVZA 1KIFA 4H7IA 4ZCLA 4EQZA 3U7EB 4Z8XA 5KREA 3EULA 3DTNA 3CX6A 1Q0ZA 3PDHA 1MH1A 4H16A 2O8CA 3PFNA 3IV7A 1VI6A 2IPOA 1BVHA 1UC8A 4F60A 4V02A 2DH5A 1ZCAA 3B3GA 1YZHA 2GBIA 5CDFA 4IJ6A 3SZUA 3PYLA 2ZPAA 5CJJA 3TOSA 2VJCA 3I1YA 3ZDAA 5DEOA 3DL2A 3U6BA 1JI0A 1F2DA 1GO2A 4G84A 2WDZA 2R6CA 3C2QA 3PHBE 4KO2S 5J5VA 4AY2A 1EE2A 1Q3TA 1DRVA 4A2PA 1QQAA 2XRYA 3BGDA 1SKBA 2GF0A 4KE8A 4OYLA 4P3NA 5AO9A 3C74A 5REQA 2PU7A 1YZQA 3BTVA 4JMPA 2Z2IA 2PGXA 4CEJA 3BMNA 4KQ9A 4IDGA 4EKDA 4TKLA 2IV7A 4TMFA 1MD9A 3NRJA 1ES9A 1Z6GA 4MHOA 4K9RA 1H6CA 5GIPE 4FCWA 1UMCB 4ZOBA 5D3QA 1XZFA 3W04A 4O4LB 3X2SA 3CR8A 3W5HA 3VOBA 3PUIA 4PYRA 1DQSA 1J22A 3HB7A 3MUFA 2A59A 4NOMA 1HI9A 3HBFA 5HVNA 4ZRDA 2AOXA 2GXAA 4EJ6A 1W93A 3DYVA 5D1NA 4UJ5A 5B3AA 1UPFA 5BN5B 2QN9A 4EX7A 1OFUX 1JP7A 1N8KA 4Z4QA 3CZCA 2NV2B 3FVRA 4LMPA 4WDQA 3TRIA 4XIJA 4HUQB 3U0BA 1K5HA 3ZXXA 3EJ6A 1MJGM 3EGWA 1IEWA 3FMIA 3BE6A 4QSHA 3H4IA 4X0EA 4QXPA 5A04A 1EGHA 4BFSA 1DFGA 2IS6A 4LY3A 3ZTYA 2QZ4A 3RAEC 2GLTA 2XMCA 3ISJA 2H4HA 3UV6A 4RH0A 3HI6A 3OT1A 4DWVA 2V5UA 3FDZA 5GV7A 4Q39A 3TTSA 1N9GA 2G25A 5AI5A 3DFZA 5IYZA 4OK5A 3K70D 4PYMA 1QAOA 4LZPA 2REQA 4NI5A 2AEMA 8OHMA 4RS3A 1CP3A 1S3GA 2RHGB 3OZSA 4K03A 1A7UA 3T4UA 3GUVA 3KQLA 3OECA 1NC1A 1FP4B 1B23P 4FC7A 5E6RA 4H0NA 1JT2A 2NT4A 3EQ9A 3CBGA 3NIBA 1G98A 1KYQA 3MCVA 1YQUA 3KD3A 3PD7A 4JX9A 3FHOA 5IKEA 2Q4BA 3MRTA 4BGIA 2OKCA 3D5QA 3VPAA 1MVOA 2EFGA 5HCNA 1IK6A 4A92A 1XAJA 3FTCA 4X84A 5BSMA 2PNJA 5A6VA 5J2TA 1OAOA 5K3OA 5TVKA 4CKZA 2OD2A 4CKCA 4MQ4A 4P5DA 2VUHB 2C88A 3E3NA 4YHBA 3RIYA 5DK6A 4ZRNA 2MU1A 4IQFA 4QJIA 4JVLA 1COWA 2N75A 4NMMA 4CIYA 4IG9A 1XAGA 5E95A 2PL3A 5CBPB 5JFTA 3CIFA 3S68A 1Z82A 3LBFA 3QPUA 4PAGA 2XXBA 4HXYA 1TEHA 1E7YA 1TQ2A 4PHCA 5AOBA 3RKSA 3ESBA 5DTJA 2HCBA 5DGHA 3AP3A 3KK0A 3T5TA 2UZIR 3F8SA 2NTVA 3AHDA 3D64A 4JFAA 5TQVA 1JBQA 1MOSA 1OY1A 2W2VA 1R66A 3WGMA 1YF3A 1U8UA 2RGCA 4LA4A 4EG7A 4AU1A 1T3HA 5JY1A 1QRDA 4KPFC 4JB0A 1QJCA 4HD8A 3UKDA 3VO9A 2CK3A 2ZYRA 1PEYA 2O2XA 3EQZA 5FUXA 2CZCA 1Z7YA 2TMKA 4KLAA 1I7QB 1AKNA 4TRNA 3D0OA 3PU6A 5AM0A 3KWMA 1TX4B 1YR8A 5CUQA 1LFAA 5LQRA 5ED4A 2X23A 2EW2A 1ACMA 5I51A 3ZLTA 4N5IX 4QBGB 3T3IA 4BATA 4TMWA 3UWKA 3OPYI 1CQZA 2SCUA 3BOSA 2C97A 4BNGA 3DTVA 1Y6GA 3AEXA 1SA0B 2LPMA 2P9HA 5EQFA 1G8HA 1YB2A 1R9JA 1X1CA 2XSZD 2Z57A 1YVDA 1JJIA 3I8SA 3PNYA 4IEIA 4OP1A 5EXPA 2PPLA 4GGPA 1IHDA 1J24A 5FI5A 1M33A 2AXNA 4GFDA 3DZ8A 1SJ9A 3G85A 4HDCA 1DAPA 1L3IA 4ZPXA 1ULBA 4B4WA 2I7CA 4E15A 1EXDA 1EFLA 3OE1A 2FPUA 1KVSA 2B1JA 1FFDA 2BFMA 5DNDA 4CHGA 1IJFA 1BHQ1 3Q15C 4WVFA 4D57A 4LXIA 1GL6A 1QLWA 1UWVA 2BE9A 1QFJA 1USWA 2VSXA 2MT9A 3DKVA 1UBGA 2QOEA 2P9CA 2JVJA 3J81A 1W4RA 4FMCB 3U9TA 1WSAA 4GX2A 3EAGA 3T1HB 3BXHA 1BMFD 2Q4DA 1WF3A 2BMVA 1HO3A 2D2VA 1V7QA 3LIIA 4INPA 4KO8A 2J5QA 3RK1A 4QUJA 1J2UA 2G88A 3ANXA 1CW2B 2RGEA 3B9PA 1QZTA 4JYMA 5KKAA 3R9IA 1HUQA 4KMOA 5E4TA 3TDNA 4E07A 3LUCA 2WNIA 4R5HA 2FX2A 3UATA 1Z4PX 3PXBA 4ZALA 4MGYR 5K09A 2I3DA 2D06A 4Q9NA 2R1TA 3TZ6A 4AIRA 4JBLA 4I3HA 1L4EA 1OMOA 3L5KA 2PGAA 1EFVA 3L46A 1VRVA 1SUDA 3EIOA 3Q3HA 4FK8A 4JN6B 2V65A 3Q7RA 3NTQA 4FKMA 4JVNA 1XPJA 3VOTA 3PNVA 4GOXA 4NATA 5JXWA 3A05A 3FW1A 3BX1A 1H0SA 3VZBA 2WQZA 1ZS9A 4LXHA 4YGXB 5A5GA 1VMEA 1PU2A 3F9CA 1E2PA 1WIWA 2ERXA 1NLZA 4IV8A 1KI8A 3AKCA 4IDCA 3CRRA 1HZJA 4IIBA 4WBNF 2GT1A 3BTSA 1DDOA 4QOJA 1ZUIA 3GJ8A 5LC1A 5DSXA 4ZVKA 1MHTA 2R8RA 2LVBA 2WSLA 3H83A 4RK1A 4WCDA 3IEUA 1LEHA 2VK1A 4ZYVA 4RAOA 2OCGA 4M8KA 3FPHA 3C3BA 1T1GA 1VE7A 4HS4A 1BVYF 4BP9A 1B3RA 2F8MA 5JIBA 1A9TA 1ZGJA 2JGEA 5LXTB 5AI8A 4FGSA 1KDZA 4RH3A 3H6HA 2EGHA 1YASA 5JOQA 3CF4G 5LOVA 2QRGA 4J0HA 4DUYB 3MOSA 3C3XA 4NYMR 3PGA1 4COOA 1X7DA 1XSEA 2W2PA 2H8GA 4UVEA 3E4DA 4RTNA 3B52X 4XQCA 2ETVA 3CEHA 4QFCA 4HATA 4ZYWA 4NV0A 1P1RA 4H0FA 4DWWA 1NV8A 4QDTA 2BHLA 1G3RA 4LXXA 3ZE6A 4M1SA 1MLDA 2CYBA 3TGPA 1G7TA 2AJ8A 2HOQA 3N2GB 1UC9A 1T4CB 4Z7QB 1XO1A 2WJWA 1Y1LA 2VTDA 4F1JA 3QF7A 2XX3A 3C16C 4HEJA 1FJGB 3RS4A 1NL3A 3HRHA 3P9ZA 4O3FA 1Z7BA 4CDGA 2V1UA 4A0HA 3R6DA 1I7LA 3V7UA 2FR1A 3IXLA 2PD3A 1F51E 1L4MA 1Y81A 1Z16A 5EOVA 1YU6A 3G2HA 5DGIA 3KL2A 4RIHA 3K1ZA 4MKFA 2FUG6 4U3JA 3TS1A 2JCGA 5EHXA 3ON5A 4HLUA 3L01A 3CTMA 3QVSA 5DTEA 4RDXA 2UYGA 3GDFA 1FVXA 1E5TA 2Q1YA 1Y8RA 2PTHA 4EHFA 5KWIA 1JYSA 3WLMA 2OT3B 4LDAA 4BWGA 2FQWA 4ZD6A 4D92A 3D8NA 1FX0B 1AQUA 5C37A 3OM8A 3ZV7A 4F2DA 2EBUA 2XUDA 1NG9A 5L3QB 2HKIA 4FNMA 4S1PA 4D3XA 2H16A 1YCHA 1SVUA 4FEYA 5FV7A 5J4KA 5ICGA 5J9FA 3NXKA 1RBQA 1G0NA 3AFMA 4WZBA 1M6VB 2C4MA 4F4DA 4KXVA 3ADDA 4P81A 1UFVA 1WUTA 1KH3A 2OV2A 3W4KA 4MRMB 4LFAB 3GDOA 1PJ8A 5MDHA 1PGJA 1CY0A 3RJ9A 1K86A 2VXOA 3O94A 2X0RA 4YJKA 3AL2A 2RH4A 1MJGA 1ZNYA 1EU1A 2HXSA 1EE9A 2NN3C 3PD0A 1ZVJA 2CK3D 2WWTA 3IGFA 1DG1G 3PWKA 3WHPA 4BNVA 3P0IA 4AKIA 4M1KA 3FNFA 5DCUA 2FG5A 5E6SB 2F4NA 3V7FA 1XQ1A 3SE0A 3W4JA 1R3DA 2ZIUB 2CJXA 4YMIA 4EX6A 3FMPB 1ISRA 1XF1A 4X7BA 2XMQA 1H1DA 3OLWA 2IITA 2BEVB 3JQDA 3CGGA 4S3MA 1HNZB 1KMNA 3RW9A 1J97A 1GQSA 1PS9A 1JL3A 4EEXA 4PNHA 4CLHA 3HN7A 3BA6A 3OOEA 1VGRA 2WWRA 5JD4A 2NVUA 3STTA 5LD2C 1T43A 2PJUA 4YLGA 1CZHA 2MCFA 2FXIA 4UTZA 3VBCA 2OBNA 4TKUB 3GK3A 5BR7A 2G1JA 2NO0A 5JJCA 1XTPA 3UHJA 3H2HA 4JX8A 3TLMA 5BT8A 1KI3A 3O9VA 3KS9A 4JDUA 4Q4HA 2XJ4A 4R40A 5ED0A 1ATZA 1H1TA 3OCZA 4BO9A 5CVTA 3BDIA 1AKEA 2W8ZA 5JAMA 2XUOA 2R5FA 2QN8A 3OURA 4BNYA 3B6IA 4UPVA 2J7KA 3DMHA 4CM9A 5AW3A 1R3UA 2WTNA 1KAEA 4IP0A 4FYVA 4LI0A 2C7RA 2BR4A 5CT9A 2WWFA 5I9SA 2IYWA 2ZM5A 5FR2A 4QQ8A 2C4UA 2DB3A 1KKMA 3FB4A 1SVLA 5G0UA 3A6HA 2GEVA 1CERA 3GGSA 3PYMA 2BI4A 3TLAA 5KX5B 1WV1A 2EATA 1YBMA 1FIUA 2VC2B 3B6EA 1M2HA 5AVOA 4MV3A 3W79A 4IRUB 3WWPA 2G0NA 1E79D 1GPH1 3NR2A 4PQRA 3ZV4A 3HVRA 1BDMA 2NTNA 3DDZX 4KN8A 3T7CA 2IY8A 2YZNA 3RUIA 1GITA 3A7DA 5EPUA 2DHRA 1BMDA 2W2LA 3FFTA 3LP5A 4JSRA 2CNWD 5E9JA 4ZXPA 5BSRA 3RUDA 4DNOA 2LIVA 4UBLA 2XNDD 1CF2O 1STOA 1R18A 5ENDA 1C8KA 5GM2A 3S99A 5BP7A 5AQ1A 2OV3A 3D6VA 4M9RA 5FL7A 2GBLC 2YBEA 2PR2A 2ZZKA 5K20A 4N0QA 3HP7A 4YRJA 2DHEA 2IHTA 1YRWA 3WTBA 4G4SO 2YUTA 1E3IA 1XLVA 5AM2A 3LWNA 2QBYA 3EWSA 3KLBA 1BRMA 2QD3A 3NETA 1BX3A 1T0UA 4CTNA 2D1SA 3DHEA 1BQEA 1BXGB 3EWIA 4AO7A 1RC8A 1IN1A 3R75A 5BQ3A 3L8FA 3G9ZA 3T9EA 1KYTA 2GBCA 3N0VA 1JAZA 4JUDX 4PLCA 1AHHA 2OD7A 3CR7A 1QS0A 1QIFA 1TZ2A 2IYNA 2Q5JA 3UVEA 4KN5A 5MFZA 2ZTLA 4C3VA 2QG9A 2ZVPX 3JXEA 4BQSA 2Y1KA 1A2KC 1RMQA 1OXBB 3EFHA 2B0CA 3M1IA 5D6NA 2GN9A 3PTLA 4G0QA 1JH8A 3RIGA 3O0DA 1X7ZA 4NU8X 2AMYA 4YAIA 2BSAA 1XDWA 1ZI6A 3C8MA 3HBAA 4PVDA 3T8YA 3GLQA 5EJ8A 3H5AA 1Q5PA 4FHZA 4QC2A 4RANA 3FGOA 3IT1A 3RVNA 5JU6A 1SXJC 3LDAA 2ZI4A 4ZTZB 3DV0A 4UMDA 1JLKA 1GRQA 3QLVC 5DWQA 5EJ4A 1KH1A 2SNIE 3IL2A 4K6OA 1X86B 2ZUBA 2YICA 2YWBA 3NP7A 1QX3A 1PSWA 2CFIA 4G4SP 5AK3A 3DT9A 1JJAA 2W70A 4MTCA 2CVHA 3HYNA 4ZI7A 1WMAA 3SYKA 4C0WA 1FNBA 5DNAA 4CCAA 1NLFA 3QV1A 1JGTA 3KD2A 3W1EA 5AW6A 1FYVA 4OPMA 2CB9A 3M2PA 2OZLA 3AW8A 5ES4B 4MUMA 3N8DA 2QW0X 4PZUA 3QBTA 1LDMA 4J43A 4UFNA 3BWBA 2JD1A 1PW5A 1SAYA 3P9XA 3Q5GA 2A9FA 3F78A 1PX2A 4H7EA 3PDIA 4G0VA 2WSSD 2PR7A 3JALB 1RPNA 1WU8A 2WUFA 5BR4A 3DEIA 1WVIA 4HKTA 3MMSA 1T1JA 4V3BA 5JSYA 2ZOSA 3A6GA 2O7SA 3W78A 1M74A 2NQ8A 4U7JA 4R8MA 4L95C 1NONA 3OWOA 2O48X 1LBQA 1GPMA 1NBME 1UBFA 2FAXA 1M8FA 3SBEA 1CUAA 2PA3A 1GCAA 3GW8A 5EHQA 4ZK6A 3R5SA 1SURA 4LWPA 2YWJA 5LMNB 9MHTA 3JQBC 2V7GA 1EWRA 4EL5A 1P9OA 4W5HA 5AKIA 5CR9A 3A25A 4UUNA 2HI0A 4BZPA 5LZ9A 4P0PB 4MOWA 1YDFA 5FWYA 1HA3A 2G72A 4EMUA 3S0JA 5J43A 5HQ3A 2HA3A 4Q02A 4BUZA 3LKVA 5DHAA 4NYJQ 2G0AA 1T9BA 3OIUA 1T0HB 5AJVB 4YMVA 2FEOA 5E9QA 4ACBA 1XD2B 3CNOA 3EY4A 2Q41A 4WCFC 5C1DA 4RHXA 4KPYA 1ND5A 1YS7A 1Z8FA 1VP9A 4XD7A 4HRVA 4ZAXA 2BUAA 2JGNA 3LCJA 5ILQA 4EB6A 4OHXA 5JWRA 2GD2A 2ZSEA 4E13A 5JYBA 2YW2A 3IPRA 4LNUB 1UT8A 3D3QA 3F0TA 1HT2E 3EBPA 1KXJA 3STXA 3EQ2A 1XXHB 4HVTA 1A9PA 1EH5A 1SUIA 3HNOA 2D7JA 2FLWA 2R8PA 3AOEA 1KO4A 3Q9SA 3BPSA 5EL0A 2X2EA 3TE6A 3ZI7A 3GROA 2FDRA 4IGAA 4BGDA 3REQB 1XQ6A 3TQOA 3WXBA 5BWCA 5IYZF 4L0DA 1KZYC 3D8BA 4YCAA 5K3DA 1Z36A 1Z45A 4LJ9A 2H1CA 4AUNA 1P6QA 4PZCA 5B58T 1L4NA 4WINA 1A96A 1N34B 3DBRB 1D2HA 3H0KA 4GPBA 2WV7A 3BL6A 3PVCA 2C98A 1NYLA 1U6KA 2ZAIA 3GNLA 4X95A 4XFKA 3D4NA 4B17A 3PDJA 1TD9A 1OW3B 3AHCA 1RZRA 1P61B 1TVKA 1PDWA 3ZJVA 5EC8A 2OOSA 1T6XA 2PCJA 2BEJA 2E4UA 2KYRA 3ZGOA 3WA7A 4HHEA 2BKLA 4FIZA 2BFOA 3NG1A 4C7KA 3PQ2A 1V6SA 2B8EA 1DIBA 1YQEA 4QXOA 3TTUA 3I0NA 1GXSB 2RHOA 2M6KA 2QTTA 2R6GA 3DE3X 1XDDA 5SICE 2V54A 5FBRB 4BKMA 1NQTA 3RS0A 3AFIA 3NHYA 4UOQA 3Q1LA 2AYXA 5JC8A 3AVTA 5L7YA 2XZDA 1PLJA 3RRJA 1ITZA 3WRVA 5D7BA 4BVKA 3WDSA 3AESA 4RSGA 3T7DA 3TI9A 4CUKA 3F67A 1T25A 4G5FA 2FJPA 4X97A 1CR4A 1PFGA 5FLEX 3SQWA 1UAGA 4C0AC 3FPKA 5FTKA 4AWAA 4L76A 1S4QA 5CRIA 3WBJA 5A02A 1O6BA 3PA8A 5AR1A 3ZY2A 2RMKA 4CM7A 4CQNA 1CQXA 3MTAA 3U39A 3EEIA 4CN8A 2ZBVA 4HN9A 4IMPA 1UL1X 5FL7D 3U44B 2CHGA 2HSEA 3WI7A 4RSMA 1XRNA 5TGZA 4OHWA 1EDEA 1M1NB 4J2HA 3U4IA 1EDZA 1H4QA 2EFHB 3D7NA 3GT3A 2ZT7A 3HCRA 4HPXB 1D09A 4BTLA 3AFGA 4PQFA 2JLYA 3D8SA 5CLQA 1H42A 1DOHA 1TZMA 2WU8A 2XKAA 3DAOA 4G37A 9ATCA 1UK9A 5IVDA 1ECGA 1UMCA 3CT4A 4RV5A 5ELMA 4KCGA 2BLNA 1G21B 1NG1A 2J33A 2JASA 1GUBA 4KJXA 1PRYA 1T2VA 4M2LA 3PC3A 1W73A 3QLUA 4EY3A 4KQCA 3O47A 2XZTA 1WSBA 5J4HA 4UQOA 2AVNA 4DMGA 3AC0A 2H08A 2MYTA 3U81A 3E2MA 3SCZA 3VMFA 1KC3A 1RAFA 5I7WA 1TKCA 1WCXA 5ETJA 4B82A 1EK2A 1A5SB 1OZFA 2CLCX 3ENQA 4OXXA 2PUVA 1J42A 4JLWA 3LX4A 2JG3A 2PRSA 3ZHRA 3GMDA 3JWIA 5L4SA 2RJNA 4G63A 3ZDZB 3L0YA 2EWMA 4AMYA 1BSVA 4B7AA 2ZR9A 3HADA 2J3EA 1MJFA 3AUYA 4HDKB 1ISSA 1XEAA 4EGJA 1LWOA 2IH5A 1VYVA 2BGRA 3HKDA 3OX3A 1HT0A 5T5QA 3KYJB 5TSDA 1J8DA 4V0SA 2ZIXA 3F96A 4WXEA 2OBMA 2K5UA 1G8KA 3R7DA 2PSFA 1IBCA 1YBVA 3T5PA 2P2SA 3NBQA 4ND7A 4WJZA 5U1PA 1EUCA 2AJBA 1SCIA 3PPIA 4FMBB 5G1OA 3DV9A 2YFQA 4LOIA 2GHQA 4B46A 1G1AA 2AR9A 1JR2A 1ZC4A 2D2FA 1NSTA 2Q5HA 3LPDA 3M9XA 2I6UA 4KFSA 1V41E 4LXGA 1P2DA 5IW8A 1I4WA 4BO6A 4QM7A 1LTHR 3L7JA 4BMCA 4BNZA 3E03A 2CLHB 4E5SA 4ABTA 1Y6FA 3HA3A 1QMPA 1QIJA 3W2FA 2DZDA 3KU1A 4HZIA 4TZKA 3U2QA 4QG3A 1VLQA 1G5FA 3TR0A 4OOFA 2OGTA 4OYRA 2OHOA 4QUKA 2XRFA 3TAXA 3WL3A 3EXG2 3H3FA 3SJZA 3T1TA 4H4EA 1V35A 1XZBA 3PRJA 2EF1A 4KN9S 1F8FA 1Q6YA 2RSLA 4WK6A 3U48A 3ZWBA 1PGOA 1PJZA 3OZEA 3CO5A 2D74A 1U7XA 2IGTA 2YVUA 5I9TA 3SBXA 4F21A 5CAEB 3NRBA 1J56A 1H2RS 4JI5B 1BYIA 3VC1A 3MTDA 4XD7D 1R88A 1POWA 3BRSA 4ZVQA 3TQIA 4NYIQ 3WL4A 4B09A 5CA0B 4CIAA 1L7QA 5ARBA 1XRLA 5J58A 5EWLA 4Y18A 2PKXA 1ZM9A 1KL7A 2DX7A 2PL9A 3FYSA 2MR5A 3N8GA 4MUYA 3UJHA 4KTVE 3GWZA 5IJXA 3UAYA 5BXYA 3K2QA 5HIKA 2XDWA 1EZ1A 2JFUA 4C2TA 3K3PA 3NHZA 5BURA 1RWXA 3G5LA 1U2PA 3GCXA 1DLJA 2CLFB 3ENZA 1U3GA 3H9GA 4HADA 5IDWA 1ST3A 1QUEA 1V8DA 3M82A 4HYQA 1Y48E 3CLVA 4YX9A 4Q05A 5C5IA 3P0HA 1XUOA 4U7FA 2J41A 1XXHE 2B82A 2LKCA 4BCDA 4LGYA 5L3VA 4LJ7A 5L3SA 5JHHB 2H92A 3NAQA 1A7KA 1NI4B 2P1ZA 1ADGA 3BIWA 3F6EX 3ZNOA 4DTIA 3MBOA 5JJBA 4V1CA 5AM5A 1W581 1E62A 1CQJA 1YACA 1ULUA 2BI8A 2EKZA 2YV1A 4YP6A 1RZRD 1OCEA 3COWA 1GDTA 1IZ8A 4OOEA 1ID1A 3ND6A 5EXDA 1U0RA 1H4SA 4BQEA 3U3ZA 2KLHA 1E9EA 4UXHA 1QAQA 2B8NA 1VFPA 1HYGA 2Q3FA 3HU3A 3W5BA 3AEQB 3IHKA 3AEUA 4DDMA 1ZVQA 3EEBA 2IOQA 4PZDA 1FP6A 4YV0A 4XDHA 3R4CA 5IJZA 2I4RA 3TOZA 3IKVA 3G89A 1I6KA 3C7AA 1W8IA 2GM9A 2WSMA 3FIJA 3V97A 1JE1A 1N1MA 5BRJA 3KOWA 1SKAA 4F4JA 3A06A 4PINA 3WIUA 3CLTC 1JSRA 2JCYA 3HV0A 1RYYA 4WVLA 3L1JA 4QBIA 2H3EA 5CP8A 3WHLA 3KSAC 2GPNA 1UPXA 1FTYA 4WK2B 5CFRA 2CVFA 3HBJA 1FRZA 2B0JA 3QMVA 4I8IA 3VZPA 2G80A 1P0QA 1VFNA 4HCJA 3GEDA 2GTHA 4QNRA 5HYVA 3ZWKA 2HRBA 3IA7A 1KE2A 2RGDA 4TUYB 1VIDA 2IDZA 5JLJA 2J6CA 1FS6A 5EESA 1AU9A 1VJGA 2JIQA 3E15A 4I55F 1L8LA 3EZNA 3G68A 2NNWB 5A9TA 4EHIA 3ZOZA 4DGSA 3EXHB 4L3WA 4B6QA 3ZKWB 4YRQA 2QKYA 4LGVA 4Z3DA 3GA5A 4UZFA 3EXIB 2X8LA 3MGGA 3OEEA 3QKRB 2XJ9A 1JFLA 2CXRA 3AFHA 2Q3CA 3R8FA 3BF8A 1H2XA 2C92A 4IL5A 4P36A 3B38A 2EJWA 1VQ1A 3KQTA 2WD7A 1C0LA 5E4FA 3OU6A 4B84A 2X15A 4DCSA 5LXTA 1YA6A 4Y9RA 2QXTA 1F6WA 2BTOA 3GD7A 4O5AA 1G41A 3B70A 4ZQIA 2GVNA 2Q29A 1LLUA 2ZB7A 3JZIA 3MJDA 1MEEA 1QGAA 2HR1A 3M1LA 1ZOLA 1G21E 3MLAA 1XNRB 2NZXA 1L7OA 1IN4A 1H2ZA 4QTZA 4BFVA 2ECFA 5A4JA 3OQVA 2Z6QA 3G0GA 3AGQA 4EFDA 4J0GA 3FTDA 1CZNA 4QGGA 1OA0A 4Q6BA 1U31A 3Q98A 1NOJA 3KUKA 1AX9A 1T5OA 2EZ4A 1UBCA 4L85A 4YRIA 4RXTA 3OO1A 3SKYA 4A4DA 1XDZA 4PSDA 3WB2A 3RNOA 5ALSA 5CFNA 1Z0UA 5DP2A 4B7ZA 2WE7A 1Z7GA 1BKYA 4KDCA 4GZ3A 2YIJA 3ABZA 3ILHA 4OUKX 4QGBA 4FCTA 3OJCA 4DLLA 1XHFA 3UTCA 4ZQGA 4EECA 1SB8A 3GLIB 4ZZ2A 1QG0A 1OI2A 2F17A 3QWIA 2J6IA 3NGLA 4BC0A 5JADA 1NI3A 2G5CA 1L3CA 1QANA 4G23A 4OJTA 5DHQA 5BSKA 1BWRA 2IX3A 4GOLD 3SQDA 2BOVA 5KYWB 2NXJA 4YT8A 2ZRHA 3THYA 2F90A 2X1LA 3E3AA 3FKSD 3COYA 1AUPA 2YN4A 3F8TA 1T3SA 4TS4A 1WM1A 5MGBA 4TVSA 3EARA 4Y1RA 1IHYA 3VC2A 2EZUA 4DMRA 3K0CC 2I29A 3K20A 1PN3A 1WB6A 1R8YA 2F9MA 1VLMA 1AJEA 1NIPA 3OBIA 2VPZA 5AK4A 1UJ5A 4UAGA 4A6DA 1N6KA 2MHCA 3D3WB 1AK9A 1ABEA 2G8NA 3JRNA 3NNSA 4BNNA 4EYEA 4EYGA 1U9IA 2QGNA 5BQOA 3RADC 3VKGA 3ILVA 3OTQA 1GNLA 1K9SA 1PBTA 4K6GA 5K4HA 1FF9A 4XWOA 3MQ2A 3OM0A 3C48A 4KITB 1SOVA 3C14C 4F8YA 4B83A 2BV3A 5ARCA 3I4FA 1VBMA 1Y9AA 4IJKA 1OB2A 2XDAA 4P53A 4PIVA 2UXCB 1BHO1 1UMKA 3L3BA 2G36A 4NENB 4A10A 3ER8A 2AD1A 3I2JA 3LX6A 3N5KA 3GA7A 3K1AA 4G2NA 3IUNA 1XA4A 4KQ6A 1Z4QA 5E6SA 1GZSA 5HK8A 1E2JA 4JIGA 5F2KA 3RJMA 3PUVA 4ZI7F 2HD4A 3DCJA 1M5UA 3SHFA 4E14A 7ADHA 3JARB 4RA9B 4OHYA 3H1EA 5JCJA 1JDPA 3PGXA 5A5VA 5ALUA 1JMKC 1BA2A 2VP2A 4LSWA 3TZCA 1U2DA 2HTFA 1Q77A 2VG8A 1HYEA 2DQZA 1NVBA 3CEPB 3LHFA 4LYDA 4X7PA 4DBLE 4DV6B 3JX9A 3ZZ0A 3IAS6 3KQVA 1A9XB 1XVAA 1SD2A 3KOYA 4RWZA 4ZQEA 2CUTA 1RAEA 3LCCA 3L40A 2ZREA 5BRNA 5KWVA 5LQMA 1KJWA 1I7NA 4Y6QA 4DBZA 1FC0A 3HN2A 2FZWA 1SXGA 3TOCA 3TRKA 4FWTA 2A9RA 1HT1E 4LS3A 1AKMA 2ORVA 4FYJA 2OCXA 4FFSA 4IZOA 2V59A 3DLPX 4PHTA 3D3NA 4XUGB 4ZN6A 3CLRC 3ROKA 3SJBA 2BHSA 2NZJA 3OUTA 4JLSA 4IIGA 4IIEA 3A4VA 3FDFA 3OG9A 2IPMA 3HB1A 1NQOA 2X5JO 2FFQA 4IQ0A 4YCMA 1UIMA 5JBNA 4DV1B 2ODWA 3QU5A 1EUDB 4MDFA 1GN8A 4XB6B 3NEAA 2BDEA 5EPEA 4ERNA 1JHAA 1JU3A 1R1DA 3UFXB 4XQ0A 4XVCA 3GGPA 7REQB 4FUTA 5ICMA 2DGDA 2KB0A 3NZEA 2WK1A 3BFVA 3FOBA 3UANA 2ZWOA 3QHPA 4RO0A 1AZLA 5EGNA 2OO7A 5ILOA 4ZO9A 4BMPB 1SKYB 2HDNB 1BZYA 3QLEA 3PC8C 4XTCS 1LPNA 1YA8A 2ZQYA 3GL9A 4OP2A 4XX0B 2FSGA 4MICA 4D46A 5KC8A 2JIPA 3BMQB 1Z4OA 2IDJA 3KLOA 4EFMA 3NONA 3UK1A 4RVOA 2JFNA 1XCPA 4IIHA 4IJWA 1DAEA 3GLUA 1T26A 4PC2A 1V8BA 2HSZA 2WJPA 5TARA 3EDCA 4FE4A 3GRPA 1PJLA 3JD0A 4RYLA 4PBTA 4C0KA 1X8KA 3HEBA 4Q1DA 3FVTA 3DE4X 3S1AB 3UO8B 3AR7A 1G8SA 4UUAA 3VA7A 2J9GA 4YJ2B 5HMLA 1OV6A 2RK3A 1JAHA 5LQKA 3E9CA 3LZ6A 1SCAA 3DW3X 4BRZA 1FFEA 4QTUB 4A03A 3JQAA 3IAFA 4MRPA 2EG5A 3BQ9A 1QGUA 5KU7A 4C0HA 3EIEA 3WWOA 3MINB 1NRJB 4RA6A 3AEZA 3CE9A 1W4BA 2YASA 2CNKA 1QWOA 1QK5A 1ZK2A 4HGNA 2NYAA 2CGEA 5LYJB 2FN7A 1IIRA 1Z07A 4MMYB 4P32A 3RFVA 1R7RA 1Q57A 3T9FA 1Z47A 2YFKA 5AVKA 4F3KA 5T8KA 2QT1A 1NIJA 5CA1A 2IXAA 3QXXA 2N1BA 2VRCD 4JKYA 2K87A 3T5MA 4M9ZA 3MJVA 4IW3B 3VKHA 3U3JA 2B4QA 2GZMA 5DZSA 1K7EB 2RHJA 4N39A 4OK3A 3PPWA 2I6TA 3H0CA 4LMRA 2QV7A 3UQZA 3MYRA 5CK5A 5EIWA 3ISTA 3SXUB 2AW3A 2H2HA 4H31A 1ANKA 3EDMA 4F92B 4FP9A 1WPXA 3E3MA 3NM5A 5B1IA 4QICA 4A15A 1KAOA 1X1EA 1F14A 1SO8A 2GESA 2WF6A 5COQA 3ZDXB 4FEEA 3DEFA 4PYQA 1KI9A 3DDNA 5KTSA 3U4QB 3GLIE 3AH8A 4GZ5A 1PGPA 4R8KA 4RC9A 2GK4A 4Z9XA 4DRZA 4M22A 2JGMA 2Z43A 4GLLA 1H5UA 2H9IA 2ZULA 3T5AA 3CONA 1GJRA 4RZUA 2FX3A 3GFGA 4D8XA 1DPGA 1XBTA 3I30X 3AETA 3IT3A 2O2HA 3L0CA 3Q7PA 2YINC 4GLOA 4HDMB 1U8FO 5BWBA 2W6IA 3WLLA 4FGZA 1NVVQ 4F0JA 4MWZA 1O4VA 3P2KA 1N1EA 1E5LA 1IN8A 1RWMA 2F9FA 3AQ4A 1VL5A 4LK2A 1ZD1A 2C99A 3B5EA 3NGMA 2JAUA 1GGVA 3AVVA 5JYCA 3IOCA 4YREA 1OXMA 1XWFA 2VDWB 4Y9UA 2XMDA 3V2IA 4QU9A 2H3HA 3QXSA 4R4JA 2Y0CA 4JL5A 1EFPA 3RSLA 3TLXA 5I48A 1XK7A 4JB8A 4TSFA 1Y98A 4ZWNA 1E1RD 2JHFA 4WSOA 1N92A 4P3YA 1X74A 2FHPA 4U2CA 3LUGA 4W1QA 4FDTA 5AW9A 2OBFA 4M99A 1IBSA 2PGLA 2PL1A 1IATA 2V7TA 5I9IA 4RTPA 2DWPA 1W36C 1IHUA 2IYRA 2WJ4A 3S2IA 4YXFA 4ZVTA 4W8HA 4HWRA 4MS3B 3OCXA 3REQA 5JCJD 4FSDA 5MFPA 3BICA 2QTRA 2QS9A 1A2OA 1QFZA 2A9OA 2NU8B 3EPHA 4ANFA 1ZMTA 4OXIA 4B4KA 2B4TO 3D3EA 1YIDA 4MR9B 4WESB 3ORRA 3VU8A 3HR8A 4PQYA 2PQ0A 3HMQA 4K3VA 2Y99A 3K2BA 4EO4A 8ADHA 1JUDA 2FTKE 1IXKA 2KI5A 4PAOA 4QREA 2H65A 4KWHA 4AZ3B 4H35A 2E6KA 5FA8A 1RYFA 1QR2A 3WNQA 1I6LA 1ISFA 3ZHOA 3OZIA 2BZGA 2H1FA 3AM3A 1NAHA 1R0WA 3S2YA 1E3EA 1XZJA 3SHQA 3QELA 4FDVA 3ZLBA 3LXRA 2HQSA 1MMFB 3CLSC 3QVXA 3ZHUA 1X42A 3WKBA 3BXXA 3ZC3A 1DJLA 1MXHA 3E9DA 1FYFA 2O0LA 3PRHA 4HGYA 2JAQA 1GEEA 3B60A 4JJ4A 3AM1A 4L3VA 2GDJA 2W2KB 3NC1C 3QX7A 1J8YF 4NV3A 3O73A 3ZHTA 3FSGD 4M55A 2ZJ7A 3H18A 3ZXIA 5LQUA 2C5EA 4RSHA 5F3WB 3II6X 3PX3A 2CXQA 4J7CA 4Q6WA 1VE9A 3E84A 3MTGA 3ZE9A 3H1FA 4NS4A 4DCGA 4KYVA 4CMEA 1DOZA 4UHFA 4EUEA 5DDIP 3AWIA 4PANA 1K97A 3OH8A 1EJ2A 5KAPA 5IMBA 5LNK6 1Y5IA 4X9XA 3V7YA 1S02A 5JYEA 2R7NA 2EV9A 3G9TA 2YXEA 2KX7A 3S3TA 4BV8A 2UUOA 3T3PB 4ER3A 1DXQA 1P2VA 1Z83A 2BR3A 2IYAA 3COSA 3V8MA 5CCDA 4YV1A 1JBKA 4G1MB 4XGNA 2Y68A 3BWMA 1UJBA 2CFRA 3EMBA 4GKJB 2YWRA 3MFQA 1UMDB 1DBWA 1XEXB 3AERB 3QWFA 4GI3A 4LHYA 2FA9A 2QTWB 1W4LA 2DFLA 2XMGA 2Y1DA 1FUEA 2GEKA 3T7RA 2DWQA 4J3NA 1KJYA 4IDQA 1KAQA 4D3SA 1LXCA 2E3JA 3IUMA 3LU1A 4WBSA 1BAPA 1JHRA 2O50A 3M5CA 1EDDA 3L0SA 1SKYE 1U5AA 1W6UA 3FPFA 3F73A 2K2WA 4G6ZA 3IP7A 4EP1A 1Q0HA 5INTA 1UKEA 3OHMA 3DBLA 1Y6ZA 4Q5IA 1CX9B 3KETA 3BFXA 3EB9A 2GN2A 5DGCA 2BKAA 3NUGA 2HU5A 4NYJR 1GZ4A 2JFQA 2R6JA 1FP7A 3JQAD 4IF6A 2AFRA 1XJQA 4PG6A 4Y2YA 5AKHA 4N0DA 2D5BA 5TGDA 1SUPA 2I8LA 2RGWA 4LPKA 4HC4A 3KQNA 1CUHA 1NASA 1MAHA 5EEGA 4HN4B 5SV2A 1M2NA 4UTVA 2EAUA 1ZLYA 4FMCF 4IDPA 4HDKA 1Y1PA 3S6JA 1OLSB 4ZEWA 2ZI7A 4LV8B 5EIBD 5I4CA 1J2RA 4UAJA 4YCCA 1EFCA 1CS4C 5KMGB 2IU3A 1DUVG 3QEMB 2W6OA 4JC0A 2Q1XA 3W06A 1HK7A 1A8HA 1S3SA 2HRQA 1Q20A 3DZJA 1IRXA 3EIHA 3KP1A 4H77A 2XH8A 5FOWA 4BP8A 4IIXA 3UWMA 1G5QA 2PSHA 3AJAA 4E5DA 2DAPA 2H8KA 3G1UA 4PX5A 3E1GA 2BFBA 1XTUA 1GRNA 1FS5A 1HLFA 2AC2A 1D1TA 3DVAA 4MARA 4ZA2A 1ISGA 3N3BC 2OLKA 1YDWA 1KZ1A 1RRKA 4HLQB 1MQSA 2W93A 3NCTA 4M6WA 2R62A 4OL9A 4FBGA 1KU6A 4Y6SA 4F91B 5FIUA 4E2WA 4Q01A 4R0MA 2DUWA 4W4TA 4ZYZA 3L7KA 1IIBA 3EWNA 4IMIB 2ZGVA 4HDAA 2PNFA 1CKEA 3V8QA 1OAOC 1UDBA 3B2EA 3ZHXA 3ZH9B 4EFNA 1XJ5A 4FCCA 1VPLA 2WBLC 3DHVA 4L74A 4N47A 3RRMA 2CMGA 4PCAA 4ZVOA 1N5JA 2FZCA 2Q3DA 3ENWA 4JI4B 4KMMA 1QFMA 5ICCA 3ASVA 1V1MA 2BBOA 4MQEA 4AJ4A 3SC6A 1JA1A 2XE4A 4M0MA 2G5GX 4US2R 4FYHA 4BKPA 1M66A 1Z13A 3X0DA 3MVEA 2TSYB 3EPLA 4B4OA 1FSZA 2F3PA 3PXXA 2ZATA 2HK7A 1ZCJA 1UJ6A 4DC0A 5A0VA 5FI3A 5LXTF 1S89A 3HR7A 4P08A 4Q4AA 5E2BA 4JU9A 4TWJA 5JRJA 5AVJA 4TSFD 2GCEA 5DGTA 4AXXA 1CY2A 4ZAZA 2OY0A 2F64A 2QAGA 3GJQA 5IVHA 1PV2A 3LQQA 1DINA 1V47A 1VKRA 1U7PA 3NOVA 4GVXA 1CJKC 5JAZA 2HRDA 1YC2A 1G16A 1AQ6A 1KETA 2HWYA 1WXEA 4UCQA 4WOCA 5CB4A 1VBKA 4DM7A 3SEAA 1JPJA 1T9GR 3ESDA 4TS9A 2ZDGA 4E2XA 4GSYA 3SDBA 1E0SA 2HSJA 2JI4A 3TOXA 2XXAA 2Z2XA 4XPIB 4XVUA 5BNZA 4EIWA 2I6XA 3AI3A 1QU2A 2V58A 5JZOA 1EZZA 4MUHA 1ZGZA 2UVPA 4W99A 1O0SA 4I1RA 4DCPA 1V3UA 1SWWA 1IEQA 1IFXA 4WKGA 2EZ8A 3GLHB 2I66A 1SRRA 2QU8A 4IQ4A 4RD3A 1EFDN 1SHJA 2IW3A 5HRUA 3N0RA 3OCWA 3D7LA 1D5CA 1KFEB 2DKFA 5CEEA 2CV2A 3GLVA 5IANA 3I8XA 1G17A 1C9KA 4EY7A 5B7PA 6GPBA 4ZC8A 1IJEA 1KVQA 4KXYA 5C31A 3SYTA 4OV6B 1L5HB 1U7OA 4MITA 1A98A 5ALDA 1QFXA 3E27A 3I37X 3IVXA 1WPQA 1H4TA 4KSYA 1N4AA 5ADUS 3BGSA 1WZEA 4F93B 1VE3A 1B26A 1CBUA 2IUTA 3C97A 4EHAA 1NW9B 3OJFA 1EDBA 3H97A 5DW3A 3VGPA 4Q21A 4OHFA 1QBKC 2VNAA 1JQLB 2PVSA 2WVAA 4BMOB 4HQLA 4H6XA 4ZAWA 4C5AA 3X1XA 1SBIA 1ODKA 1VE5A 4K9OA 3JD2A 5IAEA 5TMDA 4XIGS 2QPAA 2ZDHA 4QOHA 5KYUA 1C9MA 3RROA 3MA0A 4MV6A 3SF8A 2NU6B 1PLKA 3OCYA 1Y9EA 1VKJA 3GFRA 3QE4A 4PPQA 5DASA 4D9EA 4ZJPA 3D81A 1US8A 4UEJA 3EC1A 4ZGBA 4GUAA 3OETA 1TM1E 4R2MA 1JU9A 3IQXA 5KJCA 3AINA 2WPDD 2MSDB 2XUIA 4KRYA 5HPYB 1R0KA 1RMTA 1Y37A 3HVUA 4OHOA 3RS7A 2O0HA 1PG0A 4Q4JA 1LNZA 2ZSDA 2VT3A 2GXQA 1TZCA 3DM5A 3PWZA 2CXHA 2GN0A 2ZT8A 3TW6A 1QXSA 1OXVA 5JNUA 3QKRA 3L4KA 1IVYA 1IOVA 3ZWDA 1NXTA 4S2EA 1D9ZA 1CE8A 1C7JA 2ON6A 4NG4A 4V1CI 2RI6A 1K7CA 1MIOB 5IXJA 1C1HA 1SKUA 2P5TB 1L5LA 3AFNA 4BEVA 2PWZA 1BVUA 1YS6A 2P6OA 5B2ZA 4K8OA 5IM5A 5GIOE 1FW8A 4GNRA 1PYGA 2YR0A 3R8CA 3H9QA 4WXPA 4NYIR 5HE8A 5JNVA 3D6JA 5E8JA 1ECCA 3A1WA 3I42A 4RLSA 1K7XB 2XZPA 3ZX4A 1KO8A 1ZRHA 4NR0A 3GEGA 2SKCA 4YMWA 4ND2A 3WBBA 4ESHA 1PR2A 2QPLA 1XU4A 1YB4A 5KAMA 2QY6A 2HBYA 3HHEA 3DULA 4PGMA 4B7CA 4BQFA 4B32A 1G64A 4F6LA 2PX8A 5KZMB 5FD8A 2PWBA 5ER9A 1DXOA 2FSSA 3GJ7A 4G5QA 3VXKA 4EJFA 4EUNA 1F5NA 2O8EB 4GR9A 1AC5A 1VSQA 2PUWA 3RBAA 3GLIA 1B0PA 4B4DA 3DDWA 1XMIA 3MYYA 2IZ7A 4KR7A 2C2MA 1KSGA 5CG2A 4DLWA 2WHQA 4QOSA 1JS1X 4OCZA 1HE4A 1UANA 2V03A 2ZSJA 1SEVA 1YB5A 3HFJA 4HLUC 4IZHA 5CT8A 4HH0A 2WMNB 4HG2A 4N41A 3ELBA 1ELOA 1TYCA 2EIXA 4Q9HA 3WGZA 5CU7A 3MJRA 1SBNE 1X0XA 3WNBA 4NFYA 4W1RA 1TD1A 2QJFA 3JSAA 4G26A 2VJMB 4AS2A 3OFVA 4II2A 3WKCA 1RLUA 3AVPA 2J9RA 3NGXA 4S0XA 5H3HA 4QLOA 3T3EA 4R2KA 1BWSA 3FGZA 2BGIA 3L0ZA 2VCEA 3NBUA 2DR2A 1RC1A 3GMIA 1ECFA 4OSOA 3OLVA 1LQTA 4TL9A 4XI9A 3WLAA 4EZBA 3P9PA 4D82A 3TEMA 4MB6A 5KNLA 2QQEA 2B35A 2XMRA 3PFBA 5GQSA 2G07A 2PZFA 1RI5A 3NNDA 1NR1A 1USVA 3BHIA 3NW9A 4MRNA 1V16B 3MGAA 2VSYA 2X0JA 4U7HA 5GGYA 4BE7B 1AQNA 1BMQA 3WMXA 2QYTA 3VI4B 3VR1A 3FIUA 4L08A 1NRIA 2GCOB 3KEQA 4NENA 5BV0A 2ZBPA 2PYIA 2XUFA 1ULAA 4GRAA 1ZNXA 5G0TA 2P9GA 2D0PB 1OXTA 4FZJA 2J48A 4G1FA 4M21A 2I7VA 4FFLA 3SI7A 4KH0A 4PGHA 4TLMB 1IWOA 4JGBA 4ODIA 1QUFA 3ICWA 3RSGA 2GUWA 1C7QA 1K5GA 1Q17A 3I12A 4C0JA 3V7WA 3WBKA 2GEJA 4TTJA 4R69A 3QLTA 2ORYA 5DI9A 2GCPA 2GN4A 5EMHA 1JDJA 1OAAA 4UU1A 3VSCA 1KYYA 4JLAA 1UMBB 3U3XA 1EM6A 1U3VA 5BWNA 4EEKA 3TECE 4CT4B 3I2GA 3D4OA 5CA1F 3GPDG 4R7GA 1XJCA 3TLJA 3HYCA 3SNHA 1SC3A 4KXUA 1QNLA 1YB7A 1SBCA 3ILSA 1SNYA 4IRXA 1U8CB 3ACCA 5HKKA 3I2FA 5CT5A 1IXZA 5BY2A 2B21A 4FJ0A 2A1TR 3I9LA 3IERA 1MVNA 2H5JA 5TS3A 1N75A 1XAHA 3E81A 1N77A 1YRYE 1JDSA 3LDHA 4XQ9A 3RTBA 3OFSA 1F48A 1GFWA 2QQFA 3UAZA 4BIIA 1E59A 1H0KA 4QRIA 3I0MA 3GLHE 4NESA 3DAFA 3ZWVA 5KJ6A 2JF0A 3BYZA 1WUHS 4GEKA 1L3BA 3UAXA 4H7PA 2C95A 3OZXA 2IHJA 4OH7A 2M1ZA 1H6AA 3KRTA 2VT2A 3Q0EA 5CH3A 3ZWWA 1OZAA 1W4CA 5FOVA 4EHNA 3QTBA 4OIMA 1XTZA 2PMCA 2WAAA 4EYQA 4YPOA 3GLFB 1E1MA 3GEMA 4M1WA 3KHTA 4EB0A 5DBEX 1BJTA 4KX5A 5IUKC 4C0QC 2VJQA 3MCTA 2I8AA 5ALEA 1JWBB 1CT9A 1U1IA 3PT9A 4FEAA 4AW9A 1UKVY 2PLNA 4WFKA 4UREA 2WB4A 1BEUB 1MRNA 2PK3A 4Y6OA 2GH1A 3UAVA 1P31A 2P9ZA 3KZVA 5M2QA 1KOLA 3QFHA 2WE8A 3E7FA 1GSOA 2L82A 3A6JA 1JIIA 1KYIA 3RHZA 3Q8WA 3LHKA 2WF5A 3PHJA 4KWEA 4BO0A 1XN1A 2I99A 1TTQB 2GHRA 4X90A 2PLWA 3S2ZA 5KDOA 3LDUA 3MWDB 1NVTA 4IUBS 5TXGA 1LKZA 2Q50A 3PP8A 3QW4B 1VYTA 3RHTA 1TKBA 2IZ1A 3ND5A 2QX7A 4DXDA 1SU6A 5G40A 3V8PA 5J4VA 5DXAA 4CF7A 2AZTA 3F3SA 2OBLA 3K0FB 2M6RA 2CXTA 1L5RA 2GILA 3A2LA 1KI6A 4MLZA 3AGPA 5B1DA 3VPSA 2AEEA 3ZI4A 5AW7A 4WY2A 3WYEA 4IH4A 1B42A 1E6UA 4IQGA 4QBKA 5FKJA 5F2NA 3NIWA 2E5WA 2I4TA 2OAP1 5GONA 1N7JA 1LNQA 2HV8A 2B92A 3SDZA 4WOKA 3WLPA 3LQKA 4A9AA 3ADBA 4AKTA 4YJF