3MSXA

Crystal structure of rhoa.gdp.mgf3 in complex with gap domain of arhgap20
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
177
structure length
177
Chain Sequence
IRKKLVIVGDGACGKTCLLIVNSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of molecular specificity of RhoGAP domains towards small GTPases of RhoA family.
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Transforming protein RhoA
total genus 60
structure length 177
sequence length 177
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3msxA00
3SFZA 4TTPA 1B0UA 4ZI3A 4AURA 3IIJA 4E03A 4PPNA 4EPYA 3TH5A 3DPUA 3KQUA 3CX6A 4A1FA 4I1SA 5DSZA 3U5ZB 1OW3B 3QXHA 3AEZA 3QQ5A 5K8UA 2G83A 1KDPA 5EE0A 2Z83A 5JZVA 5JWHA 2WMOB 3LAWA 3U3MA 1QG4A 3LLMA 2A5FA 2RGXA 2QEQA 2OBLA 1TUEA 5EP1A 1DO0A 4Q1AA 4B6EA 1S3SA 4IW3B 4XSGA 1UADA 4IJMA 2F9LA 4TMKA 3UG7A 4EPTA 4TMWA 4UXHA 5G53C 2RGGA 3I4LA 4TN1A 5JMTA 2WBLC 4JLBA 1WBBA 2G77B 2C98A 1W0JD 4ON9A 2CHQA 4POAA 4B3BA 3EXAA 4XVUA 1ZM2A 1W48A 2EQBA 2NG1A 4JYBA 4GZLA 1U8YA 3NXSA 1RJ9A 3AVWA 3PCRB 3V4FA 1J8MF 3MGCA 4TSFD 2ZJBA 3QVVA 4IFBA 3AVOA 2NO7A 4DUGD 1TU4A 4KSCA 1NMZA 4Q01A 2O8FA 5GJBA 2QE7A 3FPAA 5G3YA 3GEHA 1I4DD 2IYZA 4Q1CA 3VNUA 1R0ZA 2CEAA 5BQ5A 3NTUA 4MRPA 4EJSB 1BKDR 3VKHA 5JLJA 3CH5A 1T8UA 5SZIA 1KSGA 1PV4A 4RFSA 2ORIA 3B60A 4ZCLA 4BZQA 1FP6A 3D8BA 3SYKA 1Q21A 5GJCA 1XTRA 3CWZA 3IHLA 1XWIA 5FTLA 2CK3D 1MOZA 3IO3A 3BB4A 1BIFA 1SULA 1U8AA 5K8LA 4ZCIA 4QC2A 2KBFA 1XD2A 1UBGA 2D62A 1GRQA 2NZ8A 4BFYA 4DLRA 5FFMA 4CEIA 4KSBA 2NTYC 1VHTA 3MMPA 1MRSA 4Q7LA 1LTQA 3RSOA 4HLQB 1GKIA 3EIEA 3THWA 1XPRA 3I73A 3M6AA 4URYR 3CIOA 3IIMA 3GLFE 4TYNA 4TYPA 5E7MA 5DYIA 3C5CA 1G7TA 2ZRNA 2IYUA 1X1SA 4JLNA 2O5VA 5CJPA 3K0AA 4YONB 1XTKA 1OXTA 3ZIAA 2Z5FA 1ZNWA 2DFKB 3ZZUA 221PA 2ZR7A 4HLDA 3TR5A 1XEWY 4QBFA 1G64A 3NHAA 4GP7A 2Y8EA 2F3TA 2QM7A 1J70A 1S9HA 3CRRA 4D0GA 3DVLA 1GFIA 4EPWA 2ZJZA 3VR3A 3JZMA 4KVGA 1KI7A 2BKUA 1SXJB 1SVWA 4C7OB 1VCMA 3HP1A 4DB2A 1Z6YA 3LX8A 4YDHB 1II8B 2QMHA 2QN6A 4RCYA 2ZRDA 4DC9A 1FNNA 2C5LA 3KFVA 1W4RA 1XF9A 4LBWA 4XVQA 3IIKA 4GDFA 3CNOA 2QE7D 4QM7A 1U9IC 2BEJA 1KK1A 2HF9A 2ZQ5A 1A7JA 2RGBA 4LHVA 5FBVB 3U44A 3R9IA 4CYMA 1UBCA 5AWFC 2H1LA 5DYGA 3W3AA 4BUJA 3R7WB 1VG8A 4AY2A 2GAOA 1Z2AA 3UATA 2G9NA 4PR0A 3KB1A 3GCGA 3P26A 3AF2A 2BMFA 2WVJA 1H8HA 2NO0A 3AVVA 3UWKA 1U0JA 1R0XA 1Q0UA 4NCKA 2OV2A 1D6JA 2ZU6A 5AUOB 1KMHB 1TU3A 3F0TA 2JCSA 3EZ9A 1J90A 2BCJQ 3P4YA 2W6JA 1T0JB 5CB8A 2IXGA 1N0WA 1G5RA 2EYUA 4M8NE 5CK4A 1EG7A 3PR1A 3NKVA 1X8JA 2WM9B 2IBMA 4Q4HA 3T34A 1ZYUA 4NHOA 3QXXA 1KMQA 4IKEA 1H8ED 1BMFD 2CNWD 1M7HA 1NN1A 4S2EA 2MSEB 1OB5A 2N1BA 2OAP1 4TYQA 4RFVA 5JJKA 2ERYA 1AS3A 2F43B 1W5SA 2CL7X 3W5JA 3ZVMA 2DFLA 2QBYB 4NKRA 1MR3F 1VHLA 2C04A 3CRMA 2QP9X 4M1MA 4R9UC 5KDOA 4FWTA 4JZKA 4XWOA 2ZS7A 1I2DA 2Z6VA 2O8BB 2JEOA 1ZCBA 2Z4SA 1X6VA 3CZQA 4DEYA 3QNUA 3IEVA 1QHHA 1IN4A 2ZETA 2ZREA 2FGJA 4U5XA 3NEYA 4LWZA 4BZXA 4LX0A 1D2NA 2ODWA 4ARZB 1ZNYA 2X2EA 1L4UA 3HDTA 4RZXA 5SZHB 4BFXA 4ZIRB 5KYKA 4ZDIA 3DZ8A 3A1SA 2FNAA 2A3RA 2GZAA 3CR8A 2CL6X 4LJ8A 4HDOB 3NDBB 1LV7A 3K53A 2DWOA 4UQOA 4F4IA 1XEFA 5CLLA 1KTVA 4Y0AA 3T1OA 4BFWA 2BBWA 4MGIR 3FHCB 3HJNA 4MGZR 1NIJA 4MA4A 3U4QA 4JKIA 4TT3A 1W2HA 5KUTA 3A8TA 1E1RA 4K46A 1US8A 1N6HA 3NDPA 4NE2A 2J9RA 1S4QA 4H9GA 3U3KA 1F2UB 1JR3E 2OM2A 3C4JA 1Q57A 3HPRA 4PO8A 2XTNA 1WRBA 4PHTA 3OIVA 1Z83A 1CIPA 1YJ5A 1U2RA 4DSTA 2V54A 3UK6A 4P4SA 2ZSAA 3AF0A 3A6PC 1IY0A 2VL7A 1SGWA 4US2R 3LWNA 1F2TA 4DBLC 4CEJA 2HXYA 1DTSA 3BORA 4JT2A 5LB4A 1E2LA 4TSFA 5B57C 2ZUCA 4ILEA 2FGKA 2C99A 4KFTA 3SYLA 1YHNA 3DOFA 2OFWA 4UNSA 3RWMB 4C0KA 1KO5A 1U9IA 4ERNA 3AKDA 1E2QA 1JXOA 4CEHA 1II9A 1OXVA 5SZKB 2CMKA 3VU9B 5L3QA 3NBZC 2IEZA 4XOIA 1XPUA 3T1QA 1CRQA 3GJ8A 4Q7KA 2QENA 5C46F 1P9WA 1VMAA 4V0KA 5DIFA 3PIRA 1GWNA 3K0CC 3LXXA 4RD3A 2OCPA 1GL7A 1CR4A 1NNEA 3TIFA 1HURA 2ZRLA 3GLFB 1ESMA 2VA8A 2ZR9A 1W7AA 1XEXB 1N6PA 3GFOA 5FTMA 2BEKA 2QMUA 5EQTA 2QMEA 2GCNA 1T4GA 2D2FA 4M53A 1OV4A 1DPFA 3U3JA 4XWKA 1KNQA 3LBNA 1E79A 1COWD 3PUVA 3PUWA 1XBTA 4Q21A 2REXB 2CE7A 3X1DA 3EASA 1WF3A 5BN5A 4W5WA 1ZUIA 2YC4C 1NSTA 1N6NA 3Q85A 1DAMA 5EXTA 4MRRA 4D4KA 3EPLA 1PVOA 3U3OA 3QKSB 3E1SA 4KXFB 4OHZA 1XTIA 1E0AA 1T3LA 3SNHA 4BRWA 5A4JA 4M1YA 3VX3A 3IKJA 1IXSB 4JKYA 4W5JA 1G1MA 3AP1A 2PT7A 4NCNA 1PJRA 4PZYA 1LFDB 1UDWA 4ZPXA 4EKDA 2WSSA 4TTRA 2ZM5A 1JEDA 4TTQA 1XEXA 3ECCA 4P31A 3U7HB 2EWVA 2HDNB 1AZSC 1NVVR 3P1JA 2ZAOA 3HR8A 2L0XA 4B43A 2ONJA 1A2KC 3H84A 2PMKA 2WSMA 2I3BA 3LXRA 4M1OA 4AIIA 1ZMXA 2ZE5A 4G5QA 3TLXA 1YKSA 4KHZA 4V03A 4GOKA 1Z0FA 1NG9A 5EXSA 2JLSA 2Z43A 5CK5A 3RWOA 3C14C 5L3SA 2VP9A 2PX0A 3K8YA 3GJ6A 2PEYA 2D2EA 4GMXA 5TY0A 1YRBA 2F3RA 3OIWA 4A2QA 4NH0A 3QENA 2JJ1D 2QI9C 1DELA 1NG1A 2OHFA 2GJ8A 4D80A 4ZCMA 2VHQA 2ANBA 2WJYA 2ZRFA 1UFQA 1Z6XA 1OHHD 1DAHA 1G20E 5BN4A 4C0JA 1NRJB 1PUJA 1J7KA 2ZI3A 1S0UA 2GCOA 2R62A 3AVQA 1RRPA 2R8RA 5KO2A 2Z0MA 4MUBA 4TYYA 2PX3A 3NIBA 4M1WA 4M4SA 1FUUA 4RD0A 4BLPA 4CVNA 4ZI2A 1RPZA 2F6RA 1ZD9A 1KI9A 1UF9A 1CP2A 4TL6A 4KITB 4TZ0A 1ZM7A 5HR5A 3I61A 1DG3A 2ORWA 4WOPA 2HT6A 3SE0A 3TAHA 3TUIC 2RHMA 2V7QA 5JEDA 2WAYA 3Q72A 4A0HA 1U81A 1FMLA 1VDZA 1G8FA 1YR8A 3CPJB 3I1FA 1ZM9A 2XGJA 3NEJA 2XJ9A 3TQFA 3OEHA 4C2TA 4B3GA 2HF8A 1Z0JA 1KJYA 5DI3A 1IJEA 4WXPA 4LRWA 4CT5A 1CTQA 1J8YF 1UKEA 5EZ6B 3BOSA 1OFIA 3K0CA 1Q12A 2CLDX 2NO6A 2BJVA 4FMBB 4Q5IA 1P9NA 2ZRAA 3BB3A 2XB2A 4LJ9A 1GILA 2PZEA 2Q3FA 3HU1A 5JEEA 4QG7A 1FMJA 1G3IA 1W36C 2WKRA 1OSNA 5FPYA 1E2GA 4BE7B 4XWAA 3W6OA 1P61B 2R6FA 4B3XA 1E9FA 1T5LA 3K0FA 3Q8XB 3CW2A 4BQSA 1NKSA 2IF2A 4HAZA 2ZXUA 1HUQA 1ZW6A 3MWKA 4BLRA 3UPUA 4R7ZA 1ELOA 2HUPA 2I1VB 2KWIA 2PMDA 4LCBA 2FZLA 4TT3D 3TRFA 4D81A 4BECA 3U6BA 3EWAA 1VTKA 2VSFA 4HZUB 2XNSA 4FMDF 3S1AB 1SXJC 3R8FA 1MV5A 1RVDA 3RRZA 2ZRHA 4RVCA 4DSNA 3REFA 3I62A 3AGQA 2CE2X 3SS8A 3BAFA 5AJVB 2ZYWX 4N3NA 3TKLA 5JWRA 4NCIA 1XXHE 2ZS8A 3CLVA 3MAAC 2OCYC 1AK2A 4M1TA 3U2QA 4WZBE 2JJ2A 4NL4H 2GXSA 3DL0A 1KK0A 3IPYA 2X8AA 2FE4A 4EQ6A 2OBNA 1JPJA 2V7QD 3MWLA 4G3XA 4GOJA 4MYTA 3I5YA 4DLYA 3OE7D 2ZSFA 3HWSA 3WBKA 1HV8A 2B8WA 3TSWA 4D26A 1FFHA 4KFSA 1VCNA 2JAQA 5TV2A 4LJ4A 4YXWA 3TAUA 2VH5R 3CZPA 1BO6A 1NY5A 1U99A 3O8CA 3KZ1E 2P5TB 3DOEA 2ZI7A 3T06B 1G291 2QROA 2W00A 4L9SA 4S35A 2Q3HA 3CUEF 1OHHA 2G88A 1QZXA 5AJZA 3VQTA 4YXWD 4PC1A 1KI6A 1LW7A 2V55B 2QT1A 4GBMA 2O8DB 4A8JC 3H1TA 3IDQA 3ONWA 3KKQA 2VP0A 2DWPA 4Q4LA 4Q4AB 3BH6A 1JXMA 4NYIQ 1SVMA 1IONA 1ZIPA 2GF9A 3U7FB 3KJHA 1EFRA 5HTKA 621PA 1LF5A 4QM6A 1AQUA 3SR0A 5AUPB 1DAIA 4OI1A 4G01B 1P2UA 1ONBA 1KAGA 1QVAA 1DAEA 2O8EA 1SVKA 1K8RA 1S2MA 3KX2A 4NYMQ 3D7MA 3HR7A 4URWR 4JVLA 3LD9A 4ZDWA 4E22A 1E2DA 1ZU5A 2FJUA 4DLVA 4IVPA 2EVWX 1RRGA 2IWRA 2BBTA 2QGNA 1XP8A 1XTJA 3FOZA 3EIQA 4RD4A 3S1AA 4JLVA 4N1AA 3N2EA 1E2EA 2ZU0C 1E0KA 3AVUA 5JRJA 4URZR 2CDNA 5AUQA 3GEIA 4B44A 3K9NA 3ZVRA 4Z8XA 3RVBA 3GPLA 3B85A 2EFEB 4JVNA 1K6MA 1FTNA 1QVRA 3F3YA 5H68A 4CEJB 3EAQA 2ZS9A 2GTPA 2MMCA 4FWIB 4B48A 4A36A 2R65A 3MJRA 1XXHB 2FFAA 4DCUA 4XIGS 1P60A 1CS4C 2ANCA 4OK6A 3AF1A 2BMEA 1G3QA 4WVFA 4OHYA 5AJWA 1DAKA 1A1VA 2D74A 4X8OA 2GJSA 521PA 1RZ3A 1NBMA 3ADDA 5AR1A 4DLZA 3WP0A 1E9BA 5D3MB 1US8B 1Z5ZA 4IDNA 2F1RA 4C9BA 1V5WA 5FUWA 1R5NA 2ZYVX 4YDSA 2AXNA 3Q3JB 1E2IA 1Q3TA 4D25A 3HU2A 4L16A 3QUSA 4LPSA 1OIWA 5FUVA 2CHVA 3GLGE 1HT1E 3PVSA 4TQUS 1P2TA 4AI6A 1IY1A 1LB1B 2DYKA 4F4JA 2ZE6A 1AKYA 4OI2A 3RYTC 1N6IA 3WBJA 3NBYC 3TK1A 5B30A 1IN6A 2JLUA 1KYIA 2H18A 1E0SA 2X19A 2GJAA 2ZE7A 2FG5A 1GDDA 1DG1G 4LY6A 2R44A 4WXRA 4MYCA 3VKWA 4LI0A 4DDTA 3QF4A 1M7BA 5H70A 3KXLA 3ADKA 4LSGA 4L8GA 3RS4A 2IUUA 2WJIA 1GITA 3IGFA 3AV0B 4HUTA 1KDRA 1YQTA 3GLHE 4GZMA 4TQ9A 4M21A 1SVIA 1AIPA 2WAXA 5CITA 1G17A 1Z8FA 3PUYA 5JCZA 1ANKA 4LUCA 1CJKC 4DDWA 4I81A 1L7VC 3ZZ0A 3ETLA 4IXNA 4IDPA 1WBDA 2NO9A 1E3MA 1UKYA 4RY2A 3SFVA 5IK2A 3FGNA 2ZYUX 1G8HA 2XNDD 3O8RA 1H8EA 3IHWA 5HKKA 4ESVA 3VR4A 2V9PA 4HLUA 2CCGA 2QSZA 5A0FA 1TTTA 4TL8A 1QDEA 3OHMA 1VCIA 2QNRA 4QBHA 1T91A 1WA5A 2ZSBA 4KYIB 1KDTA 4CT4B 2Q21A 4MQBA 4C0AC 3IBYA 3FHOA 1HEIA 1QHGA 3QY0A 2GZDA 4HLCA 5BXQC 1N3BA 3GJ3A 1NMXA 2OFXA 4HZUA 4Q4AA 4RZ3A 4A15A 2HXSA 2BCGY 3T1TA 1KSFX 2OO7A 1DBSA 4Z1MA 4DSOA 3THYA 1MT0A 4MITA 3K70D 2J7PA 1J99A 2HCJB 5FL3A 5DLQC 2IYRA 4JSYA 2XEXA 1NVXQ 1YR6A 2CJWA 4CZ2A 2J0UB 5CIWA 4XD7A 3QXCA 4D4MA 1HY3A 3ZVNA 2IF0A 4BGDA 5K8IA 4UNPA 2VHCA 4C4PA 2C78A 5IHPA 1KK2A 1U0LA 1G7SA 2JLRA 1M74A 2O0KA 4URUR 4ZO4A 1M2OB 2YJTD 4WZ6A 2DHRA 2BIFA 4PAMA 4XD7D 1ZU4A 4CW7A 2XSZA 4FD2A 4HAXA 1EXMA 4RJLA 1NI3A 1YZKA 4DLXA 4O25A 4B76A 4E09A 4OJKA 3K9HA 3G82C 3SOPA 4DVGA 2IX3A 4MYHA 4II7A 3B13B 2EYQA 5DI3B 1Z07A 1GNRA 4AD8A 4O2RA 2AR7A 4UNQA 1XX6A 3W34A 4ACBA 3PUXA 2BDTA 3PEUA 4IDQA 4V0LA 2WTUA 1W46A 4DZZA 1FL9A 4OQFA 1ETUA 2FA9A 2V8OA 4QGGA 5M04A 3PENA 2FFHA 3BH7A 3QBTA 4AC9A 5KSYA 4CEHB 3ADCA 4EPRA 1P7CA 5TDHA 5G3ZA 4NP6A 3KJGA 4I99A 2J0SA 1H8HD 3QIAA 2XAUA 2ASEA 1E0JA 3D6TB 2QTVB 4YC7A 4PHHA 2OCBA 1LS6A 3NVAA 3B9PA 4BLOA 1SKYE 3HPQA 4OKSA 3A4LA 4TQAA 3JZAA 3C15C 1Q1BA 4NCHA 4LBVA 1DEKA 5LB2A 2VHUA 1EFRD 3V00A 4OQNA 4KU4A 5J4KA 3P32A 1CXZA 3PEWA 3GJ0A 2FF7A 2HT1A 2JGNA 2GEUA 1YR7A 1Y63A 1X3SA 1ZJ6A 1IAQA 1ESNA 3QXSA 4GFDA 2N46A 2C77A 1QG2A 2GF0A 3K0EA 1F3OA 2C9CA 4DJTA 3LQRA 1M1YE 1HQCA 3EW9A 3SEAA 2QPOA 5HKKD 4ITRC 3A4NA 1I2MA 1IN5A 4QJ5A 3O8BA 4Q02A 2ZJYA 5EP3A 5FOVA 3LA6A 1XCPA 1T0HB 4HYYA 3ND8A 1W49A 4QOSA 1W5TA 1WB9A 5BYJA 3GJXC 3SJZA 3W5IA 5LPNA 3WHLA 2OESA 1XCGB 2YINC 4OBEA 2O8DA 3K70C 4EFMA 1FUKA 2ATVA 1TMKA 2ZR0A 3FB4A 3IPXA 4R2IA 5EE3A 1BH2A 2KBEA 2ZSEA 4V0ME 4URXR 4JL5A 1E9RA 1E99A 3KDSE 4QGHA 4IFEA 2JDID 1NVUQ 4TLDA 1S9DA 3Q5EA 3HU3A 4EPXA 3TW4A 4TLBA 4HDCA 4Q48A 1TF5A 3CWQA 3B1YA 1SVLA 1Z08A 1XFAA 2JIZA 4TWZA 3K1JA 1BOFA 1F6BA 4A0FA 4OHVA 2OLKA 1W44A 2PCJA 2JASA 1MKYA 2XTMA 3ZYCA 4CIDA 2BC9A 5FUXA 2VP4A 4BEBA 4B71A 3I3SR 3T12A 1XJCA 2OBMA 2I1QA 5CIQA 3DMNA 3Q7PA 2LKDA 3EA0A 3UWOA 2QSYA 2IS4A 2R2AA 3EIHA 4KV9A 1EWRA 3ZDQA 1P2VA 1RKBA 2JJ1A 4W7SA 1Z0KA 3KXIA 3MFYA 1TQ4A 4LJ5A 1GKYA 1G18A 4BFTA 1Y3AA 2KJQA 1G3MA 4MDFA 3SJCA 3A4MA 4X8LA 1O87A 1QHYA 4L15A 3UMFA 2QMOA 4PSKA 2IHBA 3AKEA 5CLQA 1KI3A 1BMFA 2CNWA 5ANRB 5J5CA 2I4IA 2VSXA 1U90A 3A1WA 4D6PA 4BPBA 1ZNXA 1W47A 3AUYA 2NPIA 3BXZA 5D3MA 3TVTA 4GMDA 2O8CA 4LV6A 3EZ2A 4G5RA 4RSGA 4DHEA 3PUZA 4KBFA 4IDOA 2QP3A 5C2JB 3GD7A 4WAUA 5UKDA 5FPSA 2C95A 3WHKA 1S1CA 4N0EA 2IL1A 4UNNA 1W36B 4OQMA 1F2TB 2REBA 2W6ID 4NONA 3B5JA 3AQ4A 4LYJA 3TGPA 1NVVQ 1D5CA 421PA 2DFTA 1EESA 5FOSA 1GAJA 3KQHA 4NMMA 4Q9LA 4B75A 2ZJOA 3DKPA 2BBSA 4DB4A 2OXCA 4FMCB 2O8FB 1VG1A 5JHGB 5L3VA 4NYMR 2ZRJA 3QEOA 3TR0A 4MRSA 3VR2A 5FI1B 2G0TA 1EX7A 1KZGB 1TL7C 2A78A 4TL9A 1IQPA 1Q3HA 1ZD8A 4TL7A 4XTCS 2WWIA 3U4QB 2JLWA 4PHFA 3SHWA 2EFHB 1XMJA 2QA5A 2FPMA 3W9YA 1Q1EA 3BB1A 1AS2A 3PV0A 1EFTA 1P4SA 1Q20A 2Q6TA 1T6NA 3TJZA 4B34A 3WRXC 3OEED 5KOYA 2ZJ8A 4OI4A 1VIAA 3SDZA 2JLVA 2GCPA 4LBZA 3CRW1 4DXAA 3A36A 1ZUHA 5FTJA 1RRCA 1NY6A 3TBKA 5FBWB 1N6KA 4Q19A 4QXAA 4EAQA 2EFDB 1OKKD 2CVHA 4LOAA 3Q5DA 4M9SA 1E2HA 3QKUA 2J7PD 3LQQA 4Q47A 5TARA 2VF8A 3FMPB 1NP6A 3H0KA 1ZP6A 4F93B 1AA9A 3H2YA 4HSEA 4KLNA 3W3ZB 2BMJA 2OSBA 1NVWQ 1DVRA 1QHHB 2WV9A 3B1VA 2ZI6A 2RH5A 5DHFA 3OEHD 1PLKA 2G1KA 5GJWC 3GJ5A 1KI8A 2GCOB 2W2VA 2Q9CA 4EIWA 1OH7A 1RFLA 4LJ7A 2J0UA 1FP7A 3QSYA 4AKGA 3GMTA 3W8RA 4LC1A 1PLJA 2F43A 4B74A 2BOVA 2GJ9A 5JS8A 1C9KA 3ZS9A 3U6KA 1UEIA 3LX5A 3L8YA 4PC7A 4LK2A 1NJFA 2H92A 2YYZA 4NYJQ 5HE8A 3KTAB 4D0LB 3THYB 1G3UA 3QF7A 1J2JA 3L0OA 5KDLA 1GL9B 4PHGA 2PH1A 1II0A 3B6EA 5E7JA 2QTHA 5KSZA 2BM0A 2ONKA 2YNMA 4RD2A 1JI0A 4OK3A 2BWJA 4BFVA 2VSOA 2WSSD 3A37A 1CU1A 1CULC 3E5HA 2Q9AA 2FSIA 3AUXA 2HV8A 2VTKA 5EP4A 4G5SA 1SQ5A 2P2LA 1TQDA 2R9VA 2P0EA 2QAGC 1TUIA 4JL8A 2O8EB 2VEDA 4TLEA 1KY2A 2HYDA 2P3SA 3C7KA 1RRFA 2ZROA 3CNNA 4A92A 2FZ4A 5C4GB 3CF0A 4H1UA 1GSIA 2VHTA 2CXXA 1VCOA 3QVUA 1W36D 5FOUA 1JR3A 3ND9A 3CB4A 4PPFA 3KXKA 1OFUX 4ZIRA 1QHNA 2ZRCA 1N5LA 1I4TD 4IOLA 3OAAA 1KI2A 2AWNA 3K70B 3BGWA 4M2LA 4YMVA 1XTQA 4QHTA 3CRVA 4JBWA 4QBIA 3QPWA 4C30A 3U44B 1XD9A 3CO5A 1AJEA 2YHSA 2XJ4A 2YKGA 4BRUA 3X2SA 4B3CA 3EPJA 4ACAA 4GP6A 1LNZA 4HI0E 4XJXA 4D4JA 4DDVA 2IYSA 3EG5A 3QF4B 1A82A 1UDXA 2CJWB 2WWXA 5DISB 3W8NA 4C7OA 2F9MA 1TPZA 1KDOA 4LYHA 3DZDA 3GFPA 5KSPA 1U94A 4TMVA 3WYFA 3ZD7A 4QJ4A 2GXUA 3SQWA 3K9GA 5JSZB 1W4CA 2A7QA 3QG1A 4G5GA 4RD6A 4ABYA 5GVSA 5JI2E 2ERXA 1N5IA 1YZLA 4A2PA 1VECA 4PPGA 3LNCA 4B32A 1E4VA 5CM8B 1XZQA 3THWB 3EC1A 1RIFA 1T3SA 2YOGA 1V43A 3LW8A 3BE4A 1SXJE 2UVQA 4M0LA 2D7CA 4PC6A 2E87A 1DAGA 2GWHA 1GUAA 1W0KA 2ZAMA 5CJ2A 4DLSA 2EFCB 1CLUA 1G3RA 1NBMD 4KFRA 3CPEA 3WYAA 1P62B 3LBHA 4JJKA 4NU0A 2GKSA 2QL6A 5JBQA 5TXGA 2GNOA 4I4LA 1HQYE 5L8VA 2YWHA 4D82A 2W58A 1D2MA 2F7SA 3KTAA 4AK9A 5LD2B 2RGCA 2RKOA 4KAXA 1F5NA 3UKDA 2CCJA 1JNYA 1KY3A 2ZIAA 1G8GA 2RAPA 3AP3A 3LFUA 1AGPA 5J47A 3K0FB 3KQLA 1OLOA 1ZRHA 4Q9HA 2ZRBA 4V0OA 1FX0B 1EFHA 2XZPA 3TE6A 4LHXA 5CDFA 3X1ZA 5F3WB 2J1LA 4PQFA 1F2UA 1HYQA 1NLFA 2FPLA 4YMWA 1U98A 3FFBA 1MO3A 1O3YA 5LD2C 3RAPR 4V02A 4IXMA 5B58C 4Q1DA 2W0SA 1NN3A 2OLJA 2JA1A 3BWDD 2C96A 8OHMA 4PC3A 2ZJAA 4M9ZA 2PCLA 5DI9A 4LV8B 3NC1C 5EUMA 2GETA 4WW0A 2NOAA 2PL3A 2AD5A 3B2EA 4NCJA 3LBIA 2IYVA 3OF5A 1OPXA 3L43A 4FXPA 4IRUB 1G5PA 3MUFA 3AKYA 3FWYA 2B7CA 3UXMA 4C0BA 4YMTA 4W9MC 2HYIC 2VQSA 1L4YA 3GEEA 3SJAA 2Q0HA 3QJYA 1OYYA 4Q00A 1XD2B 2X1VA 1GRRA 1KI6B 3MCAA 5FPKA 4EFLA 2QY9A 2XB4A 4ZV4A 5KU1A 2CLCX 3BK7A 2H16A 4JLDA 3RS2A 2CHGA 2YWFA 1AQYA 4FINA 5EUQB 1QRAA 2K5UA 3VR6A 3AVPA 3CH4B 3UG6A 1R5OA 2IHYA 5IRCD 4Z51A 1VYTA 1OE0A 2QBYA 1ZAKA 1D8TA 3EZ6A 2OT3B 4DIDA 5P21A 1IY2A 5KTYA 1XXHA 3KUDA 2DFNA 3RNLA 1E69A 4JSTA 3EX7C 4FMDB 1Q44A 4B47A 5E3HA 1MO6A 2PJRA 3BFVA 3DM9B 3WNDA 2JLQA 3U7EB 2IUSA 3V4RA 1ZM4A 2GILA 1Z0DA 4EQ6B 3SQXA 5EJEA 1NSFA 3D31A 4OYHA 2AK2A 4LJYA 4ASUD 1TAGA 4AYXA 1SKYB 2EW1A 3T5DA 4RZUA 1IHUA 1KOFA 1KMHA 1Z6TA 4UXJA 1W2GA 2A5GA 4MKGA 2IXFA 1GG2A 1XJQA 2WWFA 4WIAA 4PO1A 5KSOA 3THOA 1YZUA 2ZANA 1YVDA 5G40A 5D3QA 1D9ZA 1ZINA 1LS1A 4MH0R 4F7WA 3CRQA 5EXXA 1AM4D 2P6UA 1JJ7A 4NTZA 2V6IA 1S8FA 4E07A 2AN9A 2WZQA 4TLAA 1N0UA 2AKYA 1TF7A 3C16C 2GBLC 2DPXA 5FOXA 5CB6A 5B64A 3QKSA 3RRNA 1ZNZA 2HLDD 3IILA 3L0IB 2OCAA 3M4YA 2QU8A 4Q03A 4MUAA 3LVQE 1G4UR 5FTNA 2IUTA 4C0QC 2IS2A 4W5HA 2REOA 1OKKA 3BC1A 2JIZD 1JALA 3OFNA 2AWOA 4F38A 1VG0B 3P20A 1FOEB 3NC0C 2HLDA 3CBQA 5FR2A 4QJ3A 1N6RA 4E5UA 1OH8A 2IK8A 1PZNA 5HCNA 1CF4A 1GNQA 2ZJ5A 3PITA 3GLFA 2D3WA 2ZI5A 2CBZA 2GRJA 1FTSA 2MSCB 1SZPA 3O8DA 3WNCA 5JI3E 1E9AA 3WY9A 2IYQA 3EARA 4HUQB 4LHZA 4R2HA 3OAAD 3I92A 821PA 3ZQ6A 5GADl 4A4DA 4KFUA 3LV8A 2AD1A 5JWOA 4M9XA 2P6RA 4FN5A 5AJYA 2V3CC 5JJLA 4H1VA 1NL3A 4HAVA 3VU9A 1Q22A 1E2KA 2DB3A 3AVYA 2ZRPA 4OI0A 2XZOA 5HZHA 4YQFA 2P6NA 1YZGA 1NJGA 4PZLA 5FR1A 5BW8A 5JCPA 2WWYA 3IO5A 721PA 1E1QD 2E1RA 4JL6A 2KI5A 4XTRA 2DY1A 5DNYB 5KHOC 2FOLA 1G7RA 2A2ZA 1Z29A 5EE9A 2LWIA 4GRAA 4O3MA 1QHIA 1DS6A 5F98A 4M1KA 4KJZA 2ZVQX 1JB1A 2UKDA 1N25A 3FE2A 4BLSA 4TLCA 3M0EA 2UZ3A 2AFIE 4TZ6A 2J5XA 3UIEA 1NLZA 4G5OA 2JLXA 3MWYW 2V6JA 3HYTA 1RYHA 1WQ1R 4C0SA 1E1QA 1PUIA 1RJ9B 1UEJA 1W0KD 1MH1A 2FV8A 2LKCA 2XNDA 3PQCA 1HE1C 2W83A 5JJIA 4DIEA 4OJQA 2J45A 3SN6A 4I1UA 2QAGA 4IVQA 2ZRKA 2XSZD 3UMRA 1NN0A 2G0NA 1E2PA 2QQ0A 3AB3A 3WYGA 3I5XA 3FVQA 4URVR 2ATXA 2WJHA 2ZRGA 5TB5A 3KQKA 3DMDA 1QF9A 4NYJR 2ZPTX 4QNRA 2PEZA 1NLYA 1KJZA 1JEEA 2QP4A 3GP8A 1CJVC 4D0NA 4DT1B 2RGEA 4MRVA 4P3YA 3ZLJA 4HB2A 3CR7A 1T5IA 3W6NA 3GLGB 1Z06A 1S96A 5FL7A 5C18A 1EX6A 3GLIA 4JMPA 1E2MA 3GFTA 1IOZA 2XOKD 1D2EA 1E2NA 1OIVA 2VHJA 1GNPA 4Q1EA 4DCVA 3PEYA 1WE2A 3SBEA 4LGMA 2HJVA 3PXGA 2NMVA 2VF7A 4AKHA 2XTZA 5HE9A 2A5DA 2VP2A 3OFND 5BYKA 1R8SA 1EGAA 4YMSA 2FEMA 2QORA 3QBVA 3T5GA 3GLGA 4C2UA 2XZLA 3VNVA 5DN6A 2QZ4A 4GI7A 4PSVA 3KJIA 2J0QA 4LZZA 5J4YA 5IF9A 3T61A 4FCWA 4FCTA 1IXZA 3AF4A 5KNBA 3ICEA 5CYOA 4Q1FA 2W2XA 3B8HA 4KODA 3R8CA 4OHXA 1AN0A 2WIBA 3CM0A 2A9KA 3BFXA 2ZUBA 3B7GA 4KLZA 5CDFE 5JS7A 3UMSA 4RKEA 1OH5A 3JVVA 1NKTA 3L2OB 1IXRC 4CGZA 1YRAA 1JR3D 3OIYA 4EPVA 1P3JA 2VYFA 4LYAA 3R7WA 4AG6A 2F1JA 3G5UA 2OEPA 3A1VA 3DM5A 4KI0A 3WP1B 4DCTA 4DKXA 2H5EA 1IM2A 4NYIR 4MKFA 2ZEJA 4U00A 2DCUA 2B21A 1YE8A 3CONA 4GNKA 5C4MA 5FOWA 1KO7A 1II8A 2O0HA 4Z8YA 3BH0A 3NH6A 1TX4B 2KE5A 3X1XA 2P5SA 2BJWA 2ODBA 3FMIA 3LDAA 2HEIA 3ICQB 1ODFA 1ZBDA 3W6PA 1UM8A 2WJVA 3KFXA 5HZKA 2DR3A 4IDHA 1XZPA 1P6XA 2FX3A 5FH9A 4HDQB 4BEJA 2YWEA 2IA5A 2FU5C 4KCGA 2BMDA 2C9OA 4IEIA 5J4HA 4BZPA 4KVAA 3IQXA 4BLQA 2WMNB 3FFAA 1QHSA 4DCSA 3HYRA 1OFTA 1C1YA 4C3ZA 1KKLA 1XCMA 2CLSA 3VTKA 2CCKA 5EXPA 2FFBA 2HJGA 2IEYA 3KJEA 4IEEA 3TUZC 4LHWA 3U60B 2X77A 3FDIA 3BFKA 3MJHA 3KKPA 2RGNC 4PQYA 3FKSA 2Q3MA 1KAOA 4UXIA 4YMUA 3R20A 4UKDA 6Q21A 1P75A 2E9SA 2FSFA 5L3QB 1KNXA 4K8OA 3IBGA 1RC8A 1JAHA 2WWWA 3FKSD 1G6HA 1W1WA 4M9QA 2GEDA 3REGA 2QRZA 2IS6A 3L8ZA 4JIMA 4WA7A 1UAAA 2J7KA 2FSGA 2PLRA 4B3FX 1COWA 5KDDA 5DGXA 5G41A 3MG9A 1Z2CA 3O47A 4BFUA 4PQRA 4AG5A 4N0DA 3QI2A 2ZI9A 2J59A 5CM9C 3BS4A 3M1IA 3X1YA 4CF7A 1XMVA 3PJRA 3KL4A 1M7GA 4X8HA 2ODNA 2FWRA 4RD1A 3VR1A 2GXAA 1U8ZA 5IT5A 4XVRA 4QFMA 2CK3A 1JQLB 2WKPA 1WMSA 4PANA 2B8TA 4QHSA 1N2CE 3TQCA 5KPJA 3KKMA 1ZCAA 3FTQA 4LYFA 5H8WA 1B23P 1F48A 2QUZA 5FUYA 2QPAA 1DADA 4D2IA 5DH9A 4Q7MB 1P2SA 1YZQA 2NQ2C 2C2HA 2C8VA 3RC3A 2FDCA 1XNJA 4HAUA 1WCV1 1EK0A 4DUGA 1E9EA 1E4YA 2AHOA 4ZKDA 4M22A 3FHTA 4DDUA 2WOOA 1N6LA 5TVKA 3RRYA 3MD0A 4NDZA 2VIIA 1R0WA 3C41J 3RDPA 1FPMA 3AGPA 3ZIAD 1ZVQA 3ZVLA 4PAQA 4CDGA 1VIYA 1A4RA 2JLZA 5FTKA 4LC0A 4R98A 2QTFA 2YV5A 4AYTA 1MRNA 4B6FA 1KHTA 2D4HA 2O0JA 2JJ8A 1OF1A 2WIAA 2ZJ2A 4P4TA 5F9HA 1CR0A 2FH5B 3BBPA 2VP6A 2WKQA 3AKCA 2HCBA 4Q4JA 2QAJA 1XDBA 3MRSA 4NBSA 3ZZTA 3NBXX 1G9XA 1ZC4A 3R9WA 1NIPA 1W4AA 3FMOB 4TMTA 2GHIA 2VPPA 4JLAA 5C1BA 3BRWD 4TYWA 5J4LA 4NZYA 4ASUA 5EE5B 4Q4HB 4IVRA 4PPQA 1TF2A 3QG5A 1SXJD 1N6OA 1HT2E 3K09C 1KSJA 3N2IA 1UJ2A 1DARA 2JDIA 2OG2A 4EFNA 5GVRA 3TUJC 2FN4A 1GKUB 1KO8A 2QAGB 4B73A 1X86B 2ZRMA 5AUNB 2XX3A 2XXAB 4A82A 4V0MA 3AVTA 5FBRB 4Q9IA 3NWJA 3KB2A 4A0RA 4LDJA 1JECA 4HB0A 3A1TA 3VHXA 5IDVA 1UKZA 3EZ7A 5JFGA 2RB4A 1G8PA 3I8SA 1WXQA 4JLOA 1GZSA 2WWHA 3DEFA 3FKQA 2VBCA 1ZUNB 3RRMA 4UJ5A 2EFGA 3SZRA 3CNLA 1C4OA 1G7CA 2O52A 2W0MA 3EA5A 3LRPA 1FQJA 4G1UC 4OK5A 4Q9JA 4EJSA 2WPDD 3ZJYA 2XITA 3OIUA 1KJWA 1W0JA 1Z0IA 3DHWC 1FX0A 1DAFA 2GZHA 4LPKA 5EP2A 4JS0A 1LF0A 4RZ2A 5FL7D 3LW7A 4ZDJA 4IHQA 3RABA 4B35A 1E94E 1IN8A 3W90A 1GP2A 2P65A 3THXB 1TEXA 2G3YA 4PFSA 5L3RA 3K0AB 4P0TA 4P4UA 5FPTA 4DSUA 3TSOA 3GLIE 1N5JA 1VYVA 4Q1BA 3F8TA 2ODEA 2GESA 4JT4A 4IOMA 3CPHA 2WJGA 1RYFA 1SHKA 2YZ2A 2GJKA 1XMIA 4OQLA 3DO6A 1Z0AA 4ZDKA 4F92B 1E9SA 2A5JA 4QBGB 3C8UA 4A6PA 1XTSA 4HUQA 1HE8B 4HB4A 1UBFA 4LV5B 2PZGA 2QGZA 1CEEA 3RANA 1SVOA 3VMFA 2VRWA 2QM8A 1BYUA 2NO1A 1P9RA 3B1WA 2O8BA 1XB2A 2H8KA 3TNFA 1M34E 3SJBA 1MABB 4DWJA 4EUNA 1T8TA 2RGAA 4LBYA 1S3GA 2UZIR 4HAYA 1AZTA 1JJVA 4XH9B 3EWSA 2AX4A 2CL0X 4PC2A 1WDTA 1ZM3A 4FIDA 4BASA 3A1UA 1YR9A 3K0SA 4KBGA 2G6BA 1OXXK 3L0PA 3U61B 1G4AE 1IN7A 4R71A 4DLUA 3RS7A 1LVGA 2ORVA 1EWQA 1KI4A 1G16A 2JATA 1YU9A 3SHFA 3RC8A 2F1IA 2ZITA 1E79D 4Q9KA 4O0MA 2IWHA 2W6JD 1VPLA 4D4LA 1IBRA 5L3SB 2FMXA 2PBRA 4XSHA 2B7BA 4Q66C 3WRYC 1HA3A 4TMXA 1QHXA 5B2ZA 3VFDA 3QEJA 4QRHA 4RCZA 3U3RA 3K09A 2DWQA 4FMCF 2RCNA 1AGRA 1M6NA 5AK0A 5KPDA 1T3HA 3Q7QA 4BWYA 1R2QA 3P4XA 4B3DA 3B9QA 3MWJA 1N5KA 3NHBA 1OB2A 4OQXA 3VAAA 1BYIA 1G5TA 4M1SA 1D9XA 3SI7A 3H4MA 1Q1QA 3B1XA 3T15A 4MGKR 5GJVC 4GPTA 5A5GA 3LO5A 4L4UA 5H1YA 4B2IA 1CKEA 2C9YA 1R10A 1IJFA 5AJXA 1NMYA 3ZD6A 1TEVA 1GTVA 3WMEA 3AVXA 1OIXA 3IUYA 4OL0A 1GVNB 3K9LA 5DHAA 2PLFA 5E7IA 5HPYB 1KK3A 1NBME 2A30A 1KI1A 3SBDA 2JLYA 2PJZA 2NGRA 2QQEA 1SXJA 1OH6A 2LCFA 2DBYA 4EJSC 2YC2C 1FQKA 4A8JB 4JBXA 1JQJC 4L5BA 5EZ5A 3GLIB 1OJLA 3D3QA 1JR6A 5DO9A 3U7GA 2YWGA 1X8LA 3GJ4A 4PXAA 1CJUC 1K5DA 5LBIA 1OXUA 2MSDB 3LY5A 4UNRA 5DN6D 2IS1A 1R0YA 2GAAA 2ZVPX 5E95A 2WJJA 4LHYA 3WMGA 2IC5A 4P32A 3ZQJA 4BFZA 4MRNA 1ZIOA 4QHYA 1NF3A 2J46A 4K81B 2OUKA 2PZFA 1R7RA 1G8YA 1XEWX 3IQWA 1R8QA 3DDCA 3AF3A 3FYHA 2IT1A 3KKNA 2ZI4A 4B2PA 1T9HA 4CEIB 2EU8A 2W2TA 2YOHA 2IYLD 2RGNA 3RS3A 3LH5A 2V4ZA 2B92A 1CR1A 3IEUA 5KNDA 2F1HA 3RS0A 121PA 2ZSDA 1P5ZB 5F9FA 1TQ6A 4A9AA 1UKVY 2IW3A 3EPKA 1R6BX 1GM5A 1G6OA 3L82B 1GRNA 3B78A 3T1VA 2BV3A 3BJIC 3N5CA 1E6CA 3NH9A 2OXRA 2WICA 3QOFA 2V1XA 4O2LA 4P4SB 2OAQ1 4FCVA 3C5HA 4JLPA 1CRPA 1DO2A 2NIPA 1KKMA 2BBOA 1ZD1A 2GK6A 2VO1A 1SVSA 3WMFA 1Z6AA 4F4CA 1OYWA 2WOJA 2R6DA 4JBYA 3TW8B 3AP2A 3OE7A 4WBSA 3PG5A 4Z1MD 3ASZA 5JHHB 4ESHA 1P72A 4CRWB 2R6AA 2GBLA 4L9WA 1KSHA 4JYCA 3J81k 1SHZA 2EWWA 2PT5A 1FZQA 4C0HA 4MGYR 3LVRE 4DRZA 3AM1A 2C03A 3BD9A 4FW9A 2IYXA 4B33A 2FSHA 2IYYA 1Z28A 2R6CA 2O8CB 1Z6GA 2ZRIA 4MDEA 4PSAA 3NBFA 1XRJA 1CJTC 4PZZA 3RSLA 3I8XA 3P27A 4QKQA 2G1JA 4B2LA 3MSXA 1NN5A 1G19A 1L8QA 5FBQB 1Z3IX 2J3EA 4PX9A 1YZTA 2ZTSA 1E2FA 2GA8A 4ARZA 4QGFA 3QPUA 4QGAA 2W6IA 2AXPA 2OILA 4GL2A 4A0GA 3R9XA 2BKEA 2QRNA 3ZGXA 2GXQA 1Z22A 3GQBA 4PO9A 4QL3A 3T35A 4C0LA 1XU4A 2NZJA 4U7DA 1EFCA 2WHXA 5JSZA 2QPTA 3TVDA 2KB0A 3RS5A 4UJ3A 4GSYA 1VG9B 5EE1A 1DE0A 1E2JA 3VR5A 4JJZA 3VX4A 3WXMA 1FW6A 4AWXA 5FOTA 3GJ7A 4US1R 4GOXA 2GEVA 3QXJA 1MO4A 3I32A 1TNDA 4HB3A 3QPVA 3ZH9B 1E98A 4JVMA 3VKGA 1E32A 1VYUA 1JAIA 3QE0A 3JVUA 2OFOA 2OE2A 1Z63A 1XD8A 2B6HA 2H57A 5FPHA 2QG6A 2FEOA 1G41A 4Q18A 1CJMA 4BLTA 2Q9BA 1XMSA 3TSZA 1HH4A 4F91B 2H17A 3BERA 2J41A 3EZFA 2VP5A 3OZXA 5DE3A 5LDDC 4Q7JB 1FNMA 4IOJA 5JRZA 4Z54A 3CKLA 4P33A 4PTLA 5ELXA 3AH8A 2A5YB 1EFUA 2YOFA 1XPOA 3WNBA 4YLGA 2BHRA 4V0NA 4DEXA 3LLUA 4ZKEA 2RGDA 1CBUA 1Z47A 5J40A 4LJ6A 2X2FA 2FPKA 4I1VA 2NPFA 3ADBA 1KZ7B 3F5FA 1A2BA 2ZYTX 3QKRA 2D7DA 5BN3A 3SYNA 1JPNA 2CVFA 4RKFA 5JECA 4WZAE 5KNCA 4FI3C 1N0VC 1Q1ZA 1KO1A 1W4BA 2KSQA 1E1RD 1CR2A 2MMGA 4EDHA 3KKOA 1MO5A 3ASYA 2AFHE 4OHWA 3CF2A 3RLFA 3H86A 4MKHA 2IYWA 4GT1A 4US0R 1DOAA 3SU8A 2RHDA 1LY1A 1BS1A 1TQ2A 4JVSB 5FBLB 5IK2D 1AS0A 1S1MA 4DLWA 4HLUC 2AL7A 3CX7A 2N42A 2BVNA 1MABA 4HZIA 2FFQA 1YZNA 4DT1A 1RW4A 2ZE8A 1KGDA 2XOKA 3GLHA 1TADA 3A58B 3KQNA 5K8TA 2ECKA 1E9DA 1P73A 3QKTA 4JLJA 4MKIA 2JJ2D 5TMPA 4DLTA 4IOKA 1X8KA 4NPHA 4A2WA 4G0NA 3FMFA 3VHLB 3E2IA 1HTWA 4JLMA 3BIFA 3CX8A 1E96A 1RE0A 3DKVA 2OZEA 3I72A 3GLHB 3THXA 1E9CA 4JLKA 3PEVA 1PLLA 3TMKA 2R6GA 1VKJA 4AKIA 3PFIA 1L2TA 3Q9LA 2YVUA 5BWMA 3B1ZA 1UPTA 3N70A 4RFSB 4AKEA 1GIAA 4HEJA 2GVZC 4A8JA 3OEEA 4TMZA 2H7VA 2SHKA 3B82A 1K5GA 4U02A 4Q4JB 1JBKA 4LJAA 1U0HC 3EC2A 4J0QA 2J0VA 1XJ0A 4HATA 1G21E 1WP9A 1OXSC 1QBKC 2D06A 1KO4A 1X1RA 2AK3A 1GOTA 4BFSA 3OESA 2AKAB 3MLEA 3SC3A 1OT3A 1R4AA 2V1UA 2Z4RA 3UANA 4KO8A 1SKQA 2IXEA 1AKEA 5FI0B 4HAWA 2RMKA 2QT0A 1OFHA 5F2EA 3QKRB 3EPHA 4X8MA 5HCIA 1M8PA 5CYPA 1A5TA 4DCNA 2XXAA 3ZS8A 2F55A 5E4FA 1UBEA 2GK7A 4MYUA 3E70C 5J4VA 1KIMA 1H65A 3KUCA 3L0SA 2BM1A 2P67A 1F60A 4I1OA 1GL6A 2J87A 3X1WA 2WPDA 2GDJA 3NG1A 5SZJA 4Y0VA 3RHFA 4A6XA 4AYWA 4PAOA 3CF6R 2ZUDA 4QNMA 3V9PA 1R5BA 2WWGA 2VLIA 2TMKA 2GVDC 4KYUA 2IYTA 1I4LD 3G0HA 1ZC3A
chains in the Genus database with same CATH superfamily
4L0MA 3SFZA 4TTPA 3RIGA 4HJRA 1ZN8A 4IIUA 4J3NA 4JUIA 1NW8A 3W77A 1ILEA 3FY4A 2ZPUA 4FFVA 1M9NA 5AYVA 3AHEA 2Q5IA 4I1SA 5B1IA 5DSZA 4MUIA 1OW3B 5ICCA 4M7PA 2I2AA 3AEZA 2EARA 2PRYA 3TR6A 1RCUA 5K8UA 4MV0A 1P4HA 4ZQEA 4UTRA 4BNYA 1KJJA 1U2EA 1SNYA 1E3JA 1YOVB 4XDHA 5DWDA 3FWPA 4ZQBA 3U3MA 3MN1A 2Z58A 1GAEO 1H5QA 5TRTA 2RGXA 3VYUB 3E1KA 4IMRA 5CHYA 1KQNA 4QUHA 6PFKA 3VM6A 4XSGA 4AS3A 3I6IA 4IJMA 5I3CA 2Q2NA 3O8NA 4TMKA 3DTYA 1DZIA 3ROMA 3H1EA 1JHUA 2BDUA 2MWMA 2JLCA 5FKJA 5FADA 3PNOA 3FVTA 4TN1A 3RC9A 1Q7BA 1ZOOA 2OYSA 3CUUA 3E3LA 3NKFA 2WBLC 1DT5A 4JN6B 5LUBA 1OYVA 2G77B 1YQQA 3OPYI 1QGUA 3UC9A 4FZRA 4BNWA 3O8OA 1BRMA 4QRDA 4HWTA 3ZZMA 5BSMA 4B3BA 4AUNA 1E5DA 3FCYA 5EQJB 5ALVA 1R0CA 3O75A 4NENB 3T5MA 1XZ8A 4AZ0B 2NG1A 1CRLA 3ONEA 1OR8A 1NR5A 4JYBA 3GRFA 5AP9A 2A9PA 3U3ZA 3HZZA 2FK8A 1QNLA 2ZJBA 1BXRA 2I3GA 3S68A 4EUSA 5AHXA 1WS6A 3IP7A 1SKAA 3AVOA 2YZNA 4KSCA 4WESA 4Q7QA 4H16A 5JAHA 3FGZA 3FPAA 3HCNA 1U28A 3ZZNA 1K9VF 2VXBA 2XRMA 3HA5A 2O19A 2XYVA 1I4DD 4MROA 2IIBA 2IYZA 3ZWCA 3U4CA 8MHTA 4O8ZA 3G2KA 1R0ZA 1M1UA 3CZCA 3FLMA 1NX9A 3GWZA 5DB4A 4MRPA 1B6SA 2FPGA 3SX2A 4CV3A 1NQTA 4EJSB 4CIWA 2PM8A 3OG9A 1A9QA 4EUHA 4MQFA 1V5GA 3AR6A 5SZIA 2YXBA 4KRFA 4DM4A 3HL4A 2QMZA 5AM0A 3KYDB 2MJLA 1V2HE 2ORIA 4ZCLA 2ZUEA 1Z17A 2QMQA 1Q21A 2W6MA 4B45A 1J22A 3CWZA 3G2IA 1G5QA 1XWIA 4N8SA 4O1HA 1R18A 1SCAA 1WUHS 2FP3A 4OFBA 3DXYA 3WSTA 3BB4A 4I3FA 5BVHB 2O14A 3C85A 2FUG1 3R3XA 1RPJA 2D5BA 4FC6A 1GRQA 1V3UA 2IU4A 2WJWA 3QNWA 4ZMRA 4CEIA 1Y5RA 2PKEA 3M49A 1ZLXA 2AC4A 2NTYC 5MN4A 4H7EA 3NR2A 3CHYA 4EI8A 4CTOA 3BXEA 5TMEA 3F9RA 1X92A 1GKIA 3ES9A 1EFDN 2GEBA 4EKEA 2FW8A 2VJBA 2WFLB 3M6AA 4KGDA 3CIOA 1NMSA 3IIMA 4C89A 1XVAA 2VFAA 1MZPA 4TYNA 4N0PA 5EKXA 3C5CA 3G2MA 1YIOA 4JLNA 3HB9A 5CJPA 5FYDA 4WNAA 1OXTA 1ZQ1A 2WQZA 2BEUA 4NATA 5KKAA 5J2UF 2EKQA 5CTJA 4PTYA 5DCYA 2VAWA 3B70A 5DGHA 5A3VA 5MDHA 1EXVA 3ZWNA 1M5RA 4OMFG 1S9HA 1V96A 4HFNA 1U2GC 3CRRA 1LPOA 2QX6A 1GFIA 5DASA 3D6UA 3U13A 2ZJZA 2C7RA 4AJ2A 1R4MB 2F3QA 4BNJA 4WCFB 2PFSA 4X61A 5ETJA 2VT3A 1VCMA 1R64A 2JIOA 2PKQO 3PWTA 1EXDA 3HCEA 4DB2A 2QIOA 3D4OA 2XMBA 3I34X 3C87A 4FUQA 5D87A 4S05A 4ZICA 4DC9A 2MYNA 1MJGM 2HQRA 1FNNA 3KFVA 4LBWA 1W4RA 2PVCA 4ARUA 4GDFA 3I9KA 3RTAA 4KPEC 4LXGA 2QE7D 3EGIA 1U9IC 2YW9A 2BEJA 3BXXA 5FV7A 1PV1A 2C2KA 3O4GA 4BVFA 1W6UA 4CYMA 4JJ8A 5AQEA 4F5DA 4G1VA 4F45A 3W78A 5FLXA 3V7YA 5B53A 1G5FA 1KP9A 1TJYA 3R7WB 2JZOA 4P22A 4AM8A 1IY8A 2G9NA 1A7UA 3KB1A 3IERA 3OY2A 1PEAA 4RSMA 4IS2A 3TPFA 3RS9A 3KOXA 1XCJA 1NE2A 2BMFA 2OHHA 3ABZA 3BE6A 4E31A 2NO0A 4RXTA 1LVHA 3CYFA 3RRXA 3N8DA 4U1RA 5HGJA 1R0XA 1SRQA 1YQWA 2OV2A 2VJMB 4K9MA 4G1EB 1D6JA 4L6IA 2ZU6A 1KMHB 3K6KA 2JCSA 1NBWB 2HF2A 4IZ6A 4F9EA 1V8PA 4Y2TA 4YUXA 4U7FA 4HEA6 2VBGA 5CB8A 3KZCA 1G5RA 2QX8A 2Q62A 3NKVA 2DFVA 2H1CA 1LD3A 1BHO1 4JGGA 1GT6A 4DV4B 2ZSHA 4I6GA 4B3HA 1P5HA 1FFDA 1BMFD 2E48A 1M7HA 2MSEB 3A4IA 2C2XA 1OB5A 1N0HA 4O02B 1IULA 1U3TA 2HSZA 2OGTA 4L51A 1FCJA 4MP8A 1W5SA 3G8BA 1DC7A 1RKVA 1Y5LA 4UCQA 2CJYA 2PL1A 4RX1A 1MR3F 1SN7A 2P4EA 1RHJA 1LBEA 5E1MA 2QP9X 1PGOA 3EVZA 4M1MA 1YXMA 3KNZA 4R9UC 4CKEA 3PIDA 2DKFA 5A4AA 4UHHA 4X97A 4AX8A 3N1UA 2O8BB 4M49A 1X6VA 3R44A 1BVRA 1G2PA 4WOBA 3H1PA 2ZETA 1TJPB 2ZREA 1UKAA 5I7HA 1NXOA 1O7JA 3TSCA 1I14A 1KJ8A 3HTXA 5LQRA 3ITKA 1EBFA 3LC0A 3RUCA 2HK7A 4MS1B 1L4UA 4BFXA 2H08A 2V7PA 3MILA 2YMLA 5KYKA 5H9WA 3DZ8A 1FMCA 3NAZA 2A3RA 4UCFA 5JZ9A 3CR8A 4CMBA 4KG7A 1BDJA 4MYRA 4RF5A 1W75A 4DR4B 2NYVA 4GDMA 3TOVA 5JMWA 4WACA 5KTSA 1VJDA 1A4XA 3H5NA 1LV7A 4D9NA 2X4LA 1QYIA 1VLQA 1JA0A 1K7CA 1C4WA 2WTBA 1NVKA 3OCCA 2ECQA 2CMGA 3U7QB 2GCIA 2FZ5A 5EKSA 4MGIR 3HJNA 1YB6A 5D1NA 4GHWA 2X9NA 3GB9A 4JKIA 3CZMA 4BNXA 1US8A 3R7LA 5K8JB 1B6TA 1VB5A 4MNTA 2ZIXB 4GP9A 4NE2A 4H9GA 5ENZA 2OM2A 2PUBA 2P2GA 4LXYA 3HPRA 1VKOA 2XTNA 1ZSNA 4IDEA 2YHIB 3GG9A 4WOCA 5U1PA 1R0RE 1P5FA 3S7ZA 2VNSA 3OIVA 1CIPA 1QKJA 3VV3A 4YQYA 4Y1EA 1SGWA 2DGDA 4US2R 1LZKA 4C06A 3EMDA 3LWNA 1F2TA 4DBLC 3NTOA 3FPHA 3LVFO 2IOFK 4L2IA 2WIGA 1DTSA 3N6VA 2I2CA 3LQ2A 5LB4A 1E2LA 4DMMA 1IAVA 2E4VA 5B57C 1M8KA 2ZUCA 3FNRA 3S2ZA 3SYLA 3V8MA 4C0KA 2PL5A 3DOUA 5KWEA 1CQPA 2IU3A 4CQLA 4MYSA 3FOFC 2PBLA 3AKDA 1E2QA 3ZXIA 3WMWA 3ESAA 1JLMA 5FPQA 1HNXB 1RI2A 3PFCA 2CMKA 4ZAGA 3DOCA 1FUIA 3PHBE 3NBZC 4GUAA 1XPUA 2DLDA 2XQVA 3P2YA 5FV4A 1MGOA 3ZBTA 1G42A 2DF8A 3R7SA 3UV3A 1D0SA 1GWNA 3PIRA 1K4MA 5BMVB 4RD3A 1Q0HA 2OHJA 3RK1A 2IYPA 1FJGB 4RVDA 1GL7A 1MORA 3GARA 5EMKA 2PMBA 4D79A 3P2KA 1ESMA 2VA8A 2X4DA 2ZR9A 3CEPB 4LMPA 1W7AA 3FAKA 1XDDA 1XEXB 2YN0A 4DNOA 1IZ7A 2GARA 4M36A 1PNOA 5IKPA 1CY8A 2FKAA 4ZHSA 2M9MA 1OV4A 2XF2A 1XQYA 4EVIA 4YFYA 1M1NA 1X13A 1I2ZA 5LOVA 4KNYA 3PUVA 3PUWA 1HZZA 3HACA 3ZE2B 4C6HA 5BNTA 5K7SA 4K88A 1T2EA 4K9NA 3R0VA 3H5IA 3OWXA 4DGQA 4N6GA 5KNCH 2WP0A 1JU9A 1V9LA 1OREA 3KBBA 1U2DC 4LTMA 1NSTA 4KXVA 1X42A 3FJYA 3Q85A 3KXPA 4MRRA 4D4KA 3EPLA 1ODJA 1NASA 3QKSB 1CHNA 3E1SA 3G88A 3K9FC 4YRFA 1T3LA 4BRWA 2PX4A 4M1YA 1Y7TA 3VX3A 1WQ3A 4GPD1 1IXSB 2QG9A 4JKYA 4W5JA 1G1MA 4MPJA 1A9XA 3AKZA 1LC3A 3ESCA 4RV4A 2VLBA 1YKGA 3F9CA 1LK5A 4NCNA 4U2CA 3C70A 1PJRA 2B2NA 3NNDA 4J0IA 5K51A 4MUXA 3OO0A 1ZK2A 3NOQA 1JEDA 1S2NA 3UW1A 3RUAA 3SG0A 4TTQA 4CF5A 4U6QA 1N3YA 1XEXA 4P31A 2XI4A 2HDNB 5DX0A 1FMFA 1L5QA 2BAGA 2R751 3IAXA 4HEA1 4R2JA 3WMXA 4MVJF 2QDKA 3HR8A 1NM5C 3KHSA 3I37X 4WINA 2M98A 4QVIA 3EK2A 2PMKA 5JIBA 1YU6A 1KF0A 4DNXA 4Y2PA 3CLTD 2ORYA 5CCDA 2XKKA 2I3BA 2JIPA 2J08A 3KYIB 4M1OA 5BSTA 1ZMXA 2ZE5A 4FDVA 5AM5A 1GZUA 2CNLA 4V03A 4Z6KA 3Q8MA 2JLSA 5HS4A 1EK2A 3BE5A 1JDVA 2R84A 3FOWA 5CK5A 3RBVA 1HDYA 2D2VA 3RWOA 1JQ5A 3SBXA 1U1IA 2EEPA 5AW3A 5CCEA 1PK8A 3BSWA 3K8YA 4A0SA 1WOMA 5AMXA 2D2EA 2QQGA 3DLAA 1TCBA 2BMWA 4JHXA 4EB0A 1YRBA 4JB3A 5HQ3B 4UREA 1XUOA 2WRZA 2XKAA 3QENA 5D1HA 1O5TA 7MDHA 1ZL0A 2QI9C 3D54D 5TPZD 1M67A 2VHQA 4FCCA 4KQ6A 4M0PA 1JZQA 2VUSA 3C8ZA 3PXCX 5DP1A 2ANBA 1SUDA 1JDSA 3HKDA 1U1FA 3ZV4A 2ILVA 2PLAA 2ZRFA 1U1GA 3JD0A 5B6PA 4EY5A 3ZI0A 5CCBA 4XVCA 1ZH0A 4PZ9A 3CSDA 1G20E 2PKQP 5BN4A 4ZJUA 4LZJA 1QOQB 2GCOA 3TD9A 1MO2A 3S5UA 4CFSA 3L8CA 1LPPA 2Z0MA 3TDNA 4EGAA 3W7BA 3BHJA 1R8XA 1GUYA 2KS6A 1OWOA 2LE0A 2X8WA 3OLQA 4M4SA 4M1WA 4ITUA 2H06A 4CVNA 4ZI2A 1ZD9A 4CLDA 1M3SA 2QHXA 1ZNQO 1JU3A 4LTNA 3RYHA 3WGVA 4ER6A 3I61A 1DG3A 2JI6A 4K87A 4EG5A 4WFKA 2DKOA 3KP1A 5H5JA 2V7QA 5A3SA 5EAIA 2GM9A 4FU0A 2PWYA 2CZCA 1ZM9A 4CF6A 4UHDA 4EI2A 3LDUA 1NV8A 4I4NA 1TD1A 5DI3A 4BN4A 3LP8A 4H7DA 2DMRA 4EA6A 1GNTA 2EERA 4O4IF 1IJEA 3F8SA 3MIIA 5KQMA 1J0AA 2EBFX 1CS0A 1CTQA 1UKEA 3BQNB 3BOSA 3MTGA 4L9AA 1Q12A 2ZCJA 3P96A 3CE6A 5D3ZA 1BW9B 1P9NA 1H4TA 4Q5IA 1AN9A 1CQXA 1E3TA 1S2GA 3BB3A 2XB2A 4W5OA 2FR1A 4LJ9A 2PZEA 1XJ5A 2FWAA 2Q3FA 3D3KA 1Q16A 1KMNA 4KQJA 5A05A 4YX9A 1N77A 5J58A 2PGNA 3I1YA 1G3IA 2JI4A 3NHRA 1YVUA 4ZEMA 2DWCA 1EEXB 3DLPX 5ESRA 1MFPA 3RYIB 1E2GA 2AI1A 2PX8A 1U2GA 5BYAA 2R11A 5CH5A 3W6OA 4B3XA 1I36A 5JCXA 1A5ZA 3P9XA 1WMEA 5JMPA 4BQSA 1VE6A 1L4BA 3P9YA 3A6LA 2ZXUA 1U3FA 2J9FB 3ADOA 3MWKA 4XX1A 4G37A 1HKHA 1HLDA 5IFKA 3ZWXA 4LDQA 1ELOA 2RI0A 1XVUA 3HU5A 1MJGA 3DP7A 3SK0A 4DDKA 1PL7A 3ZJVA 5MN5A 3ZWDA 1SXJC 2Q4TA 4EHAA 4NXNB 1QDLB 2NXWA 5GV8A 4YJFA 1XZIA 2AG6A 1K8YB 3IQHX 1KDYA 3RRZA 2C3OA 2OVBA 2ZRHA 2Q1WA 4FD3A 3WK7A 4XUGB 1YMVA 2XCTB 1YFZA 1PFQA 1W1UA 2HB6A 4N3NA 3LI2A 5LP6C 4OX9B 5GIOE 4JCCA 1JH8A 5E6SA 3VR6H 5CBPA 1YIDA 5CT6A 2FB9A 1QG6A 2FXIA 2OCYC 1PEKE 1OLXA 3DV9A 4X41A 3K30A 1L0BA 1U9JA 2GZ1A 1U7UA 2XT6A 4YUWA 2ZG6A 5AI6A 2JJ2A 4KPYA 3DL0A 4OIMA 1WY5A 3A6KA 4R1LA 3D6HA 1UOPA 1ZHOA 1H2AS 3AINA 2PYIA 1QU2A 4J4TA 3I5YA 3OE7D 2YYYA 4KNWA 4L02A 5DM60 4D26A 2DERA 2PKYX 5JZMA 3KUUA 1R6DA 1E8DA 2JAQA 5CA0A 4GM1A 4LJ4A 4LXUA 3CZPA 1CHDA 1ZHFA 1QE0A 2J3IA 2XQIA 5ADUS 3QE9Y 5EPUA 1RVV1 1KIAA 1PZHA 2P75A 3DOEA 4J76A 3ZXSA 2Q4EA 1YHYA 5B7PA 2H63A 1G291 1IHYA 4L9SA 1AE1A 1ENPA 2Y1KA 2Q3HA 4KP7A 3WSWA 3W1EA 3DLTA 3QHAA 3OZSA 3D0RA 2Z8XA 3SZ3A 1QZXA 5AJZA 5AJHA 3T3MB 1KYQA 3ZXUB 1KI6A 4UMVA 1LW7A 4GBMA 3GRKA 3CUYA 4O8CA 4OH7A 4PW0A 4XQCA 3RQIA 4A8JC 4D9KA 4K86A 2LD4A 3DE7X 4S2UA 2ORED 5KCMA 1GU0A 5FB3A 1IHOA 3T9EA 4Q4LA 1L1FA 1YI8A 4NYIQ 1Z4KA 3B9RA 3VZQA 4DQVA 4EMTA 3T9BA 4QM6A 2R79A 1EVEA 2FPSA 2PNFA 1EA7A 4EUKA 5AUPB 5G02A 1DAIA 1P4RA 1QH0A 4H1TA 1P2UA 3S6JA 5A4IS 1KAGA 1Z56C 4FHGA 3WAJA 2VJDA 3GFGA 1SVKA 4LYYA 1K8RA 3KX2A 2VDMB 4PLCA 1KWGA 4JVLA 4E22A 4ZDWA 5MFZA 4Y6SA 3VVLA 1E2DA 3D6MA 4PWZA 1ZN2A 4DLVA 2NSYA 3F6PA 3ZD9A 4D44A 1M72A 1EMDA 1PR0A 2YIJA 2PG3A 3BMQA 1XP8A 1H69A 2FUG6 3KKKA 2O59A 3RSQA 4CM9D 1U9CA 3F2IA 2WM3A 1APBA 1KQGA 2YWCA 1T36A 5CB4F 4ZODA 1MG5A 2IPLA 2EBUA 5ALKA 1DFGA 3NDBB 2FHPA 3K9NA 5A7FA 5EG5A 3RAEC 3HQ4O 1K6MA 4Y9RA 3F3YA 1SQSA 4GOMD 2UXBB 1SUEA 1Y42X 3U4AA 4QXOA 4QE3A 5L7TA 4B48A 4ZYWA 2XADA 3MK31 1PJTA 1PL6A 5JZSA 3JQAD 5DRYA 4K0RA 4MUJA 2AR9A 2C57A 2FFAA 3A27A 2VXYA 5I9MA 1UM9B 1CS4C 4B7CA 2Y9MB 1NULA 2BMEA 3V1MA 1I3LA 2Y1CA 1UFKA 1YK1A 3ICCA 3KSUA 4X8OA 2YVKA 1W19A 2NNLD 2AFRA 3LPAA 521PA 4UHJA 4Q12A 4AY6A 2WIDA 5EPEA 4I36A 5EWMA 1Z5ZA 2YX1A 3F1KA 4IDNA 2F1RA 3DEKA 1F8XA 3K2EA 3KG2A 4UBOA 5D5HA 5DMXA 5IM5A 4C9BA 4CM6A 4I4CA 1R5NA 5KWIA 4LF4B 2ZYVX 1UANA 4RZHA 4YDSA 3SEQA 2PD3A 3N28A 1E2IA 2H2IA 1I9GA 1Q3TA 1KP2A 3QUSA 2NXNA 4LYDA 5ADHA 5FUVA 4A73A 4DANA 5DBOA 5LN1A 3L1JA 4E4YA 5KX5A 2IYEA 2OCDA 5T8KC 3LHSA 4YRQA 3S27A 1P2TA 1J97A 2QUIA 2QVZX 5K0BA 2YQ4A 1LB1B 3H5OA 4HAIA 1A9SA 1H85A 2D59A 1AQ6A 1AKYA 3AUUA 3FF4A 3MVEA 1N6IA 1PR6A 3QK7A 4NZPA 3KSZO 3MJSA 5ICFA 3RYTC 2CKMA 4A3SA 2DUMA 4EF5A 3UJ3X 2PJUA 2ZUWA 1LI4A 3N75A 4TLLB 2JLUA 4GE3A 3QW2A 3QMPA 4GNRA 1ISHA 2FG5A 4JBHA 2YW2A 3A2NA 1AUQA 1HOXA 2WZBA 3M5CA 4G4JA 5LBTA 2XUPA 1BDHA 2W4QA 5I9SA 1NAIA 2IHZA 3GIWA 1FSPA 1K6IA 3SEFA 3C3XA 4JBIA 3EOAI 3QF4A 2FW1A 3ZDAA 3KXLA 4K6FA 4LSGA 4JI8B 1ADYA 1ZIDA 2H1HA 3FPSA 4AZVA 2VSQA 3WKDA 4G0UA 1CY7A 3OZCA 4QUIA 4RK7A 4E2YA 1N34B 1SVIA 5BSFA 5JAOA 8LDHA 4YAKA 2FLKA 3A1EA 4DABA 1OZGA 2YNMC 3OLCX 3A3NA 3PUYA 1Z8FA 4XWWA 3EGEA 3TLZA 4LUCA 4ENRA 3ETLA 2QTAA 1Z15A 4B7AA 2OHXA 1Z9BA 4ZALA 2NO9A 4KQ1A 5ALQA 4ZVNA 4NOLA 5IAAA 3OZAA 3UBTA 1HE4A 4R2MA 3FGNA 3V3TA 4PZ0A 2WTAA 1OWLA 5C8ZA 2R1TA 5JSHA 1H8EA 4BMSA 3ISJA 3FCXA 1A9RA 2C7QA 2VDNB 3IVCA 2FPWA 1BX1A 4GI3A 4XR4A 3HKBB 5HKKA 1LPMA 3FPBA 3IP5A 3PFKA 3VR4A 5A0FA 4ENUA 1JZTA 1RM3A 3KT3A 4ABTA 2NVWA 3L8HA 1QDEA 2B61A 3FUUA 5DXJA 3M1LA 1E61A 3PTLA 4LZPA 4RPLA 3BXGA 4QBHA 3CNQS 1TGYA 3F3KA 1WA5A 2I7CA 2ZSBA 4KO4S 4AZSA 4CT4B 4C0AC 3IBYA 3AZQA 2BE7A 2RGWA 1BVUA 1WXXA 2FOXA 2NU6A 4JOSA 3SNKA 4RTLA 3FNEA 1QGOA 3GJ3A 2OFXA 1G8JA 4FGUA 4KQ9A 5JCOC 2J6IA 3ORFA 1DBSA 4N7MA 4Z1MA 3UT0A 4BMPB 4PYNA 5FWNA 2D1RA 4MITA 3GVIA 3MCUA 3G2PA 3RADC 3ORSA 3B3JA 4N6NA 3ZU5A 1L8AA 5LLTA 1PHRA 2JD0A 3OJEA 2EF0A 1WNFA 5EHGA 4IIEA 4BE9A 1FJ2A 3DB1A 2QLFA 3NAQA 4UVGA 4D4MA 3NAMA 4MKZA 3OIDA 3P97A 4BGDA 1KYTA 3GZTB 5AW5A 2C42A 1Z8DA 2C78A 1TC1A 2BGGA 1HLFA 1G7SA 2IYOA 1TCCA 2WU3A 5DHSA 4J75A 1M2OB 5DF1A 3NW9A 2DXIA 1DEXA 2AJCA 1YB4A 2RSLA 2XSZA 5BSEA 1MJHA 4RJLA 3JXEA 5ED0A 3RUPA 4O25A 3IP9A 1DBWA 2CXRA 3K9HA 2FZCA 3G82C 4F60A 4XUCA 4EW1A 3QTLA 1Z5NA 1NW5A 2EC5A 4IJKA 1JSCA 4KQCA 1FFWA 2EYQA 3Q2OA 5B55A 2GZRA 4KQ2A 3ZWMA 4UNQA 1XX6A 2HHCA 1J2UA 2YJGA 1T0IA 3M5DA 3OKFA 4ID3A 4JY7A 2XXBA 4DIMA 2BDTA 2YMMA 4S0XA 4KO2S 3RGGA 1F9EA 3O4RA 4IDQA 4UBKA 4ZJYA 4CKWA 2WTUA 2H2DA 3VDQA 1ETUA 2YYAA 3G0DA 2AMYA 4EBFA 3F7MA 4CEHB 1T5OA 2DOKA 2Z8YM 2ISCA 4LG1A 3A31A 1JWLA 2BRUC 3AJRA 1AZWA 2VWGA 1CVIA 3UGQA 1V7CA 4IYRA 4OMCA 2HA6A 3G0BA 4DLNA 1DFHA 4N03A 3NHSA 4I08A 3DOOA 1ISGA 1QP8A 2QTVB 3F1LA 1J25A 1CWUA 2H4JA 2NT4A 2Z9BA 3ZCTA 6CHYA 1H0SA 5HRCA 5BVGB 3IJRA 1VJ5A 1LS6A 5IVPA 3SF0A 3JYHA 1OLUB 3EGDB 4GVLA 4B6GA 4YMLA 1SBQA 4L1KA 1SD2A 4QOIA 5KHAA 3MWEB 2QUAA 5DNCA 1GFZA 2II6A 4RYDA 3B2QA 1F8GA 3V00A 5EKTA 3EF3A 2HN9A 3EXIB 3G02A 5J4KA 5IKOA 2ODPA 5EI5A 5ALUA 1BHQ1 2QUHA 1SWWA 3C8HA 2QVGA 4BFLA 1RP1A 1ESNA 1BXRB 4KQWA 2I1LA 5FTWA 4I6EA 1HT3A 2GF0A 3OF3A 4BJHB 3K0EA 1F3OA 1ADJA 2UYGA 1VDMA 2V7BA 4FKMA 4J7CA 4BAZA 2H65A 3IALA 1HQCA 2QPOA 3GZNA 3BSSA 1T5SA 5HZMA 4D46A 5IJWA 4IDCA 4K28A 4OSEA 4PLVA 3EH1A 5FOVA 5CEEA 3GEMA 1XCPA 2GQ0A 4WLFA 4DMHA 2R4UA 1T6BY 1W5TA 4M87A 2VAVA 4IICA 3GJXC 2J9GA 3JR7A 4FBMA 4GL4A 3W5IA 2IHVA 5LMNB 1GQOA 2NZXA 3WHLA 3NVDA 4FFNA 4MRAA 4TLMB 1XCGB 1UJBA 2YINC 2O8DA 3OC6A 1U0GA 1TMKA 3IPXA 3FB4A 2UUOA 4JODA 3CW9A 1BH2A 1W581 4R2IA 4C1NA 4D8YA 2ZSEA 2Y1OA 2C3YA 1E99A 1DX6A 1UWKA 3A7EA 5EJIA 2JDID 1RWXA 2WK1A 1NGSA 4KB5A 5AHRA 4F0JA 4EPXA 3TW4A 4BGUA 2FLVA 3NBAA 3PGA1 4RQBA 5C5DA 4RQTA 5BN5B 3AJEA 3B1YA 3VC7A 4Z7JA 1SOUA 2HFJA 4TWZA 3PHHA 4HMOA 1QQTA 1UK9A 2GBGA 5AM4A 1UOEA 3VUFA 5LMCA 2HLNA 4OLBA 1X7ZB 2GFIA 2CXUA 2PCJA 2NVOA 1VA5A 1MKYA 3MS2A 1MIOA 5DEIA 2GEKA 1IN1A 2BC9A 3MNFA 2VP4A 4DDMA 3HS3A 2V7EA 3T12A 1MC5A 1FXWF 2QZZA 3M6IA 1T5BA 3AY3A 3E7PA 3Q7PA 5CW1A 4R8VA 4LZWA 5EZQA 1A1SA 1ZW1A 3RIYA 3UYLA 3ZDQA 5CBPB 2JJ1A 4W7SA 1Z0KA 3KXIA 2O3RA 2G40A 4H17A 1GKYA 1G18A 4BQOA 4WN9B 1Q2XA 2WYWA 2NVBA 5IANA 1PR5A 2KJQA 1RKXA 2GO1A 4KVZA 2SCUA 1T0BA 3SJCA 1ZCZA 1O87A 4JH0A 4LTDA 4YRAA 1BSVA 3HHEA 3KZNA 3P2EA 3INGA 4L15A 4PSKA 2IHBA 3EDQA 4W4TA 3UMFA 3PZRA 5AW1A 2H3HA 4D6PA 2JAHA 3A1WA 5F35A 4ZC8A 2H59A 2NO4A 4KKXB 3I9V1 5D00A 2YFKA 1ZNXA 4KPFC 4B79A 2AEMA 2CNBA 4EQ6A 3PD0A 1U11A 1TJ5A 4X1OA 4AZ3A 2F8SA 1C9DB 2PZ8A 2O8CA 1WZEA 2PGAA 3EZ2A 1Q91A 1DV1A 4G5RA 2L2QA 4HMQA 2L18A 4LV6A 3BRQA 4XB2A 4DHEA 1T5HX 2Y6VA 1CIJA 2ZLBA 5UKDA 2RHTA 5FWXB 4CXMA 4NR0A 1Y80A 2C82A 2IL1A 4N0EA 4Q3KA 4TVKA 4UNNA 1F2TB 4HYTA 5AK3A 3DLHA 4PX3A 3B5JA 4UUNA 3HO6A 4NK5A 2MOKA 1PI3A 2RG7A 3O38A 4LYJA 4MSUA 5F2OA 3TGPA 2DFTA 1JAYA 2R60A 1DP4A 2ZYGA 3AZOA 4UOZA 1PW7A 2ZJOA 1M34A 3NUQA 5IMSA 1NT4A 1LFAA 3I6MA 4MWBA 3KAJA 2O8FB 3BE8A 1GQYA 3L7NA 5JQGF 2PSDA 4NYMR 2ZRJA 1U0SY 1VKHA 3QEOA 4RK4A 4YJ3A 1C4KA 3KLPX 1KZGB 1TL7C 2A78A 4PQEA 1IQPA 4XTCS 2JLWA 4C5CA 1YTLA 2EFHB 3IXMA 3W9YA 4C7MA 3ABRB 3KPUA 4OMUA 4K9KA 4UARA 3RPEA 3TO5A 1Q20A 5AKHA 3SQMA 3O1HB 3P2JA 1E6UA 4JA0A 4I1YA 3WRXC 1HQKA 2EKPA 2OGSA 4KAJA 3N2GB 2WU0A 4JX8A 4L9RA 1B8UA 1DJLA 2HA7A 2OMKA 3KAKA 3SDZA 2JLVA 2DQSA 4GVXA 5FTJA 3OFVA 3BMCB 4EI9A 2QRQA 2P2NA 3V48A 4Q19A 4Y6PA 4QXAA 3CKYA 1OKKD 3RFXA 2IPXA 1ZMOA 1E0DA 3I0ZA 4DMKA 4AVYA 5KX5B 3FNIA 1J1UA 4MTLA 1AUVA 4NXMB 1A98A 3J80A 1IK6A 4DM7A 5IZCA 1SXHA 3MWFA 3PUJA 2PRKA 4REOA 4ZTBA 4F93B 1M1ZA 3W3ZB 4X3CA 4PGHA 1QANA 5ECDA 4ENWA 5DHFA 3ZE8A 3OEHD 4JUDX 2BMVA 3QUBA 3GJ5A 4B0OA 4KFCA 2Q9CA 4DA0A 3QY9A 3WLAA 4AJLA 1OH7A 4N7BA 1C81A 1EVYA 1U7OA 2J0UA 3KT6A 4IKOA 3RARA 3GMTA 1GD1O 1VLZA 4LC1A 5JQGA 1BGVA 2C97A 2CD9A 4GZLA 2VJKA 3AR7A 5JS8A 4L8VA 1UEIA 3UWSA 4LK2A 1NJFA 1R1DA 1RAFA 5HE8A 4OGWA 3KTAB 4D0LB 2RG1A 5IUJC 3P9ZA 3N5KA 2QUBA 3QF7A 3GLTA 2DT5A 1GL9B 4KYTA 5E7JA 1CY4A 2C5SA 2RAFA 5CTAA 3V80A 5K9ZA 1XDWA 1ZD5A 2YNMA 3ETJA 5KSZA 3WO0A 1EAYA 1X9GA 3WOVA 1OBHA 4IS3A 2VSOA 4MZXA 3NU1A 4LFAB 4HS9A 1ARZA 4MI1A 1DB3A 1WB4A 1CU1A 4I14A 4IQ0A 5AVXA 5DTRA 1SD1A 1X1EA 3FOBA 2VTKA 5EP4A 3VZDA 4ALIA 2BHNA 3KE8A 3HVKA 3E5NA 3VNAA 2ID9A 4IWXA 2ZROA 4BB0A 4A92A 4B3SB 2VHTA 4CDMA 3WJAA 3S2EA 1OGIA 1LWNA 4WA8A 2X0DA 4ZIRA 4GZ3A 2DETA 2FWMX 1RAEA 1P1CA 2MTBA 5IX8A 4M2LA 1UEXC 2J3KA 1Z18A 4YMVA 4LKRA 5H4GA 5HXAA 3V8QA 1T2VA 3JQ6A 5E6UA 3HM9A 4RF4A 4JBWA 1T4CB 4LYGA 4C30A 5CG1A 1XD9A 4NJOA 1TD9A 3CTPA 1XQVA 5KCZA 3UJAA 2ZRQA 4CR7A 4S0ZA 4Q4DA 1UDRA 3QTBA 5EWLA 3L46A 5K3EA 1KYVA 3FI0A 1FDSA 4F2DA 3LWBA 5BRNA 3N7AA 2ZBUA 4BRUA 4KN6A 3DE3X 1JDJA 4B3CA 5DNUA 3RVKA 2CJFA 5LQNA 1LNZA 1PD0A 3KEFA 4MWSA 4TS4A 4DDVA 3K9WA 1ZFNA 4WOKA 4AN0A 4MHOA 2WWXA 5DISB 1EFVB 4D98A 1QIFA 4RY8A 3JAMA 4YCAA 5KJCA 2JPDA 3ZI7A 1GU1A 3N8NA 3WX0A 2JGDA 1PAUA 2VI5A 3DZDA 1U7HA 5G4KA 4MR9B 2CXNA 2TRSB 3KAPA 2ZWOA 2C92A 3WYFA 1EDDA 3ZYZA 4C21A 3DBRA 3SQWA 3BF8A 4GO1A 4AJPA 4BE4A 3CVWA 5GVSA 1E7QA 4N0QA 2R8XA 4A2PA 2JGMA 3GNTA 1M1XB 4OAQA 4PPGA 4ZMSA 1E4VA 2DFDA 2B4QA 1RIFA 2X76A 3F5DA 3RLIA 3STTA 5IBRA 1I7DA 3ZHBA 2DUJA 1P91A 1F2VA 4TVOA 3A9VA 4JU8A 4X1YA 5TQ0A 4E5NA 2P8SA 4M0LA 3TLMA 2GVNA 2YIDA 3OT1B 5HCUA 2DTDA 2E87A 2XNJA 4EL5A 4ZYTA 5I8ZA 4GEKA 3T5BA 2IYFA 4DTIA 4DLSA 4ZEXA 4Z3KA 5C32A 1HKUA 1CLUA 3VAZA 2Q6LA 1G3RA 2WU4A 4OTZA 3HJHA 1P62B 3LBHA 2Z6UA 5JBQA 2CXOA 3L0YA 5IAJA 4AIRA 4I4LA 4RNDB 3KCNA 4TM8A 5F76A 5HJ7A 2M1ZA 4D82A 5K4AA 1D2MA 3LZCA 3CF4G 4RUKA 2HR1A 4QX6A 3OU7A 2RGCA 3GX1A 3RSHA 2ET6A 4KAXA 1KY3A 1NUTA 2XUQA 1L9KA 1XVTA 1G8GA 2IKQA 1AGPA 3AI1A 4W1PA 5J47A 1K6JA 2NM0A 4QQ8A 4BNKA 2EJWA 4CM5A 1ICEA 2VPWA 4OREX 4HVLA 3TE6A 2XZPA 1EWTA 2NNWB 3EEIA 3OO1A 5CDFA 2PXXA 2Q2WA 1F2UA 3MXOA 4X6UA 1NW4A 3ZJ5A 3CJRA 2BKLA 1CETA 2RAUA 3A3OA 1GY8A 5BOSB 3KSAC 1QONA 2PZJA 5DOVA 1MO3A 3IURA 3KEGA 4YEDA 2I1WA 2HGZA 3T54A 3I05A 3RAPR 1C3JA 3UXEA 3PQFA 4XUDA 4Q1DA 3S70A 3KSMA 4RIIA 3BWDD 3DEAA 1YS6A 3P9CA 2B5VA 4M7WA 8OHMA 1RHKA 2V5UA 1YF3A 2BYTA 2DSNA 4W5TA 2ZJAA 4L5CA 1GXSB 4M9ZA 5CVUA 1E59A 3UTDA 4FYMA 1AT1A 1QZUA 2WD9A 3MINA 3NC1C 1W93A 1RJEA 4A2CA 3C1UA 1R4ZA 1FSZA 2NOAA 2PL3A 3D6NB 5JYDA 5D7BA 3L43A 4K40A 5KYYA 1XF1A 3HDYA 4D8WA 3GDFA 2BP7B 3UXMA 5L9AA 3RYCA 2VQSA 3UVEA 1L4YA 2ZR8A 3GEEA 2QTLA 3ILXA 5HHTA 2JFNA 5J3JA 1XD2B 1M2OA 5FPKA 2Q4BA 3K6JA 2MYUA 1S2LA 1N32B 1JDTA 4XD2A 2O2ZA 1PYGA 5EWMB 2C29D 3C6BA 4BBZA 2GN2A 3RS2A 5JS2A 3GHYA 1XU7A 3D5EA 4CMGA 4WLEA 2EZTA 1A9ZA 3CH4B 2C5FA 4AP5A 1XAGA 2FYTA 2F1OA 1GQFA 2GAIA 1Q83A 3UK1A 1DKRA 5LA6A 3PQ3A 1D8TA 3HN6A 2C9MA 4DIDA 1NVDA 3ONNA 2W98A 3KUDA 2OVFA 3CG0A 1FDTA 1KEKA 1A2OA 3Q15C 3D4LA 1N5MA 1TCVA 4V0QA 2PUVA 2X7HA 1MEJA 3BFVA 3EFOB 3V4RA 3EXHB 1XMPA 2GILA 1XKXA 4EQ6B 2Y2VA 3OSUA 2APJA 2DUWA 3AIOA 3EXHC 5CT5A 2NXCA 2AK2A 3SDBA 4QJIA 4QOHA 3UC5A 5JD4A 1K7SN 4E3ZA 4QZVA 3ASVA 4RLHA 2EW1A 4ZAVA 4ZTZB 1IHUA 1KBZA 1Y0BA 2WW8A 3EOZA 5EJ2A 1XZGA 1C9YA 5EEGA 1Z6TA 5IWCA 2HIAA 5G1OA 2JI8A 4NNOA 4AMGA 2QRUA 5HWSA 3CEMA 3GDGA 5KAMA 3ZI4A 2I6UA 1FDUA