3MSXA

Crystal structure of rhoa.gdp.mgf3 in complex with gap domain of arhgap20
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
177
structure length
177
Chain Sequence
IRKKLVIVGDGACGKTCLLIVNSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of molecular specificity of RhoGAP domains towards small GTPases of RhoA family.
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Transforming protein RhoA
total genus 60
structure length 177
sequence length 177
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3msxA00
1T8TA 2IEYA 3B78A 4R2IA 4TLBA 1TQ2A 1AS2A 3QKUA 4I4LA 5J40A 1D2NA 3LBIA 2IF0A 2ZEJA 4NMMA 2ODBA 3DO6A 3TUIC 4ZIRB 1D5CA 1DAMA 4AWXA 5DE3A 2WIBA 3SJCA 2IS6A 1GITA 4Q01A 4LPSA 3LQQA 1E2NA 3NEJA 2KBFA 3AB3A 2QE7A 4PXAA 2HXSA 5C4MA 1C4OA 4JS0A 3T61A 3U2QA 2ZRCA 2HJGA 3ZDQA 2JLSA 4HAYA 3ZD6A 5IT5A 4R7ZA 3PFIA 2VP9A 2NMVA 1YHNA 5JSZB 3KKMA 3QF7A 3K9NA 5FPHA 5FOXA 2PCLA 2HF9A 4NCKA 3RNLA 5CJ2A 4D0GA 1J7KA 1NBMA 1G291 3FMPB 1XMVA 5JJKA 5JWOA 2ZREA 4HAVA 4YMTA 4U00A 3QKTA 2D2EA 3IBGA 3GQBA 3U7FB 2WWWA 2H17A 1SVMA 3BB1A 2EYQA 5KOYA 1G16A 2W6ID 3NHBA 2CCJA 1VDZA 2UZ3A 1C9KA 2IT1A 2ZE5A 4Y0VA 3U4QB 4YMUA 3ZQJA 1FQJA 2PT7A 1G18A 5EUMA 2BBWA 3KXIA 4M9XA 2N42A 1E2PA 1F2TA 4BFUA 1XJCA 2QSZA 5BWMA 2GESA 3LQRA 2CHQA 3M4YA 2NTYC 3QSYA 5FPTA 5TB5A 4QG7A 4TL7A 3O8RA 4DLTA 4KHZA 4OI0A 2P6RA 5HKKA 4RFSB 1NJFA 4BLQA 2WVJA 1E1QA 1LVGA 1TMKA 2R2AA 4AG6A 4DLUA 1Z0IA 4V02A 3TH5A 3DM5A 3B7GA 4YMSA 3CM0A 3OIUA 4YLGA 1IJEA 4FCVA 1EGAA 5DIFA 2IHBA 2YINC 1W36B 2KE5A 4BZQA 3CWQA 3ECCA 2H18A 2WWGA 1CJVC 3BFVA 1GKYA 2QMHA 3KFVA 4URXR 1Z83A 3K09A 1U8AA 1AA9A 1G8PA 1DARA 2ORWA 3U3JA 2JJ1A 2JEOA 3WNCA 1E2QA 3PUYA 1KI6A 2D2FA 2VP5A 1H8ED 1EFHA 3SQXA 5C4GB 3FGNA 2G1KA 2GF0A 3X2SA 2XSZD 2YWGA 3TIFA 2GBLA 4B33A 3CLVA 2IEZA 2IHYA 1E0JA 4UJ5A 4PZYA 3H1TA 3Q5DA 3SU8A 1G7TA 1J90A 4M9ZA 3BB4A 1DEKA 1UDXA 4QFMA 2ZROA 1A2KC 1JJVA 1AGRA 2A2ZA 1XXHE 2YJTD 2BCJQ 3AF3A 4EFLA 2Z5FA 2VQSA 2FGJA 1VPLA 1FTNA 3Q85A 4HZUA 4I1UA 2GA8A 1H8EA 1ZMXA 1GAJA 4LJ4A 1KSGA 5FTNA 2YYZA 1NVVQ 2J9RA 621PA 2OCAA 5FL7A 1XEXB 4EPXA 1CJTC 3C8UA 4O3MA 2R6CA 4O0MA 4P33A 4B48A 1Z3IX 4IXNA 2AWNA 2W6IA 3SZRA 2CEAA 4Q7LA 2JJ8A 2PT5A 4C0AC 2FZLA 1OF1A 2WKRA 4D4JA 3HU1A 1CTQA 1OW3B 2HUPA 1UKZA 2W6JD 1EFCA 1F6BA 2C96A 2VTKA 1NBMD 3B1WA 4L4UA 4NCJA 4LJ5A 5JEEA 1W1WA 4TZ0A 2ZI7A 2HJVA 4DLWA 2X19A 4LCBA 4XWAA 1FOEB 3ADCA 1FTSA 4QJ3A 3P20A 1TF7A 4G0NA 4NYMQ 5FUWA 1FL9A 1T3LA 1T5LA 1TF2A 2AFHE 1BYUA 3TAUA 2HT6A 2R6AA 3K0CA 1L4YA 4II7A 4DC9A 2W0MA 1AZSC 3FMIA 1TQDA 3AVXA 3R7WA 1FW6A 4JBXA 1W47A 2W2XA 3UMFA 4BFWA 1N3BA 1KSJA 3EXAA 1N6OA 3QENA 5H70A 3P1JA 2P5TB 4JVSB 1I2MA 4L8GA 5K8IA 1E1QD 4BEBA 1TX4B 2WPDD 3EW9A 1W4CA 2EWVA 3K1JA 1CRQA 2G88A 3LLUA 2BOVA 3I61A 5F9FA 5EJEA 3V4RA 5B57C 1VKJA 3VNUA 3AV0B 1NJGA 3GD7A 5DYIA 5TXGA 4BEJA 1ZAKA 2GCOA 2ODNA 2QSYA 4ZCLA 1Z2AA 2ZE8A 1CBUA 2Q3HA 4PQRA 4LYFA 1GP2A 1IHUA 2JDID 2LKDA 1XD9A 4DB2A 2OAP1 4BZXA 3Q7PA 5FUVA 1Z6AA 1MO6A 2N1BA 3MWKA 4URYR 5EP4A 5D3QA 1UM8A 1WCV1 1ZM7A 3AVUA 1GZSA 1TPZA 1RE0A 2GXAA 3AVYA 1P5ZB 4HAWA 4Q02A 5ELXA 3LLMA 1OHHA 3AVTA 1XJ0A 3CUEF 2EYUA 1JR3A 4JLBA 5JI3E 1OH8A 1GVNB 5CYPA 2AK3A 4BLTA 3DHWC 4JKIA 2GEDA 4GMXA 3REGA 3KUDA 2FPMA 1KAOA 1KZ7B 4CW7A 5JJLA 2OBLA 4MYUA 2ZJ8A 3UG6A 1S9DA 1NY5A 5IDVA 4XWKA 1VG8A 2BM1A 2XTNA 1CRPA 1E9CA 3W6PA 4DCVA 1NP6A 1W4RA 3B60A 5AR1A 4KXFB 5TMPA 3S1AB 4BECA 1YZUA 3PENA 4US2R 2ZU0C 2RGXA 4IRUB 1KDTA 2IUTA 3R9IA 3QXHA 3QF4B 1K8RA 2OCYC 4BLSA 1XTQA 3ZGXA 3RAPR 4DEXA 3ZZTA 1E2FA 3CZPA 3THYA 4JL5A 4QJ5A 2G0NA 2ANBA 4B34A 4R2HA 1YJ5A 1M74A 1IN5A 1KO5A 1SXJB 1U0JA 2CHVA 2HV8A 3KKPA 5AK0A 1W46A 2O5VA 2ZI9A 4JL6A 3WP1B 3B1XA 2ZU6A 4OHYA 5E3HA 2CBZA 3DKPA 2Z4SA 4IJMA 3T34A 4A0RA 2FGKA 2QP3A 3IIMA 2O8DA 3AUXA 3KX2A 2ZJYA 1E1RA 1QRAA 3C5CA 4H9GA 2XNSA 2ZANA 1DOAA 3WYFA 1G7SA 4NTZA 2XJ9A 3K70B 4B32A 5FBVB 3TGPA 1DAIA 2J1LA 3GP8A 2J0QA 4N1AA 5L8VA 1N6NA 1OXVA 2XTZA 5AJYA 3KUCA 2QAGB 4S2EA 2RMKA 3D8BA 2GF9A 2ZJ5A 3NBFA 2YWHA 4DZZA 2Z83A 3M6AA 2HF8A 1L2TA 3NBXX 4PO1A 4Q1BA 3R7WB 1N6RA 2IYUA 4KFRA 3AKDA 1X1RA 3MJHA 2FSHA 1E94E 2ZRJA 2NZ8A 4TYQA 4FMBB 3W3ZB 5AUPB 1YKSA 5KSZA 2ZQ5A 1HQYE 5E95A 4LUCA 2JLZA 2ZRAA 3CW2A 5LD2C 1X8LA 4TQ9A 4B76A 3AH8A 1YR9A 1YR6A 4WAUA 1PJRA 4TL8A 3B8HA 5HZHA 4AI6A 4B3BA 3HJNA 2GBLC 3R9XA 3VHLB 4Q5IA 2W2VA 3EASA 1KDRA 4XD7A 4B47A 3AVPA 1XB2A 1G8HA 5JS7A 1FUKA 4HB2A 2B8TA 3MWLA 4DLXA 4NBSA 1E79A 4G5GA 1GWNA 4Q7MB 2JLQA 3KB1A 5KSPA 2BEJA 1HYQA 4OL0A 3LBNA 1R0XA 1T8UA 1IJFA 1Q21A 3KXKA 4K46A 1II9A 2QROA 2VA8A 3TKLA 1QHIA 3A1TA 3HYTA 2WJIA 1P61B 1ESNA 2EFCB 2FPLA 3CF0A 1JBKA 2QUZA 4V0NA 4DSTA 2JLUA 3GJ8A 4LGMA 2C04A 5IK2D 2EFGA 1OXXK 4ERNA 3CRVA 3EZFA 1YE8A 4Q7KA 2OCPA 3D7MA 3TQFA 3RYTC 3WP0A 2DFLA 1S4QA 3HR8A 4M9QA 2CLCX 3U3RA 1LS1A 3L8ZA 5GJWC 1G8FA 3QPUA 2XNDA 3TUJC 4TL9A 1DS6A 1L7VC 3LO5A 1OH7A 1G1MA 1S3SA 4POAA 4XSGA 1VG1A 4TMWA 4NDZA 3L0OA 4EIWA 2YC4C 2IWRA 4QBFA 1NI3A 2R44A 2O8EB 1A5TA 2LKCA 1Z0FA 2OE2A 4IOJA 4Q00A 1UPTA 3DKVA 3B6EA 3CH5A 5UKDA 4BLPA 2GCOB 2WAXA 3EZ7A 1OV4A 3CR7A 3WMFA 2Q6TA 2GHIA 2QAGC 4WIAA 5CJPA 5KDLA 4MGIR 4A15A 2BV3A 1W48A 6Q21A 4TYPA 1QHGA 1SULA 2NGRA 2C8VA 1QHHA 2AK2A 2QRZA 1XZPA 1ZNWA 1RZ3A 1KDPA 2KWIA 4LYJA 4DUGD 4B3GA 4KFTA 4D81A 1ZVQA 4HAUA 3EX7C 2J59A 1EFRA 3QEOA 1W44A 2VHCA 1Z5ZA 2IYYA 2WKPA 4PAMA 4US0R 1ZIOA 2X8AA 3KXLA 2Q3MA 4QJ4A 5DN6D 5D3MA 3EC2A 4CEIA 2VP2A 1ZD1A 3EPKA 1XDBA 4IHQA 4JLKA 3RDPA 3U5ZB 3ZLJA 4A6XA 2WBLC 3IDQA 4YDSA 2ATXA 3A1SA 4Q48A 4OQNA 2WJVA 4Q9KA 3MFYA 4JSTA 1U2RA 2GEVA 4E03A 3VMFA 2WWXA 3K0CC 5IHPA 4QHYA 1CS4C 1KKLA 1JR3E 1O3YA 3QBTA 5LB2A 2JCSA 4FMDB 2DWOA 3GLGE 1BH2A 1E2MA 1TADA 4HUQB 4HDOB 1E96A 2EWWA 1XRJA 1WE2A 2WSMA 2IXEA 3T1QA 1J8MF 2N46A 4ASUA 2A5YB 1OXSC 3AF2A 1XEXA 4F4IA 5FOVA 4KLZA 1W4AA 4ZIRA 3NH6A 4ZI3A 5KNDA 1VG9B 1U8ZA 1DO2A 2OZEA 3A6PC 1DE0A 2C03A 3HYRA 5J5CA 1G3MA 2VHTA 1VYUA 1AQYA 4D25A 2EW1A 2CLDX 2ZITA 3W3AA 4M1OA 3RS3A 4Z51A 1IY2A 4NU0A 1RPZA 5J4VA 1BS1A 4XVQA 1W0KD 2RGAA 1Q1EA 1NN5A 4GMDA 1A4RA 1EFUA 2NPIA 1KI3A 1S1CA 1FMJA 1G9XA 2C78A 1G19A 3LD9A 4ITRC 4B3FX 2GJ9A 4TLDA 1CR4A 5G3ZA 1ZP6A 1OYYA 2AHOA 2IXFA 3L43A 4B3XA 1QVRA 2FMXA 4B2IA 3KJHA 2EFDB 3EIQA 3LWNA 3IHWA 2VH5R 1JXOA 1XBTA 3U3MA 2JLYA 4PSAA 1DADA 4RD6A 1NL3A 1CR1A 2ZE7A 2FA9A 1AM4D 4DSOA 1WXQA 1JB1A 3A1UA 3NC1C 1UBEA 3KJIA 2A3RA 1N6HA 1OT3A 3BORA 3SJAA 3VR6A 4CGZA 1ANKA 3D6TB 3OIWA 1RFLA 4ARZA 4E07A 5DGXA 1IY0A 4ESVA 4JIMA 5DI3A 3ZVLA 2FPKA 2D7CA 3HR7A 4ZDKA 2CNWD 4HATA 4JMPA 4TMTA 3HPRA 1QG4A 3BGWA 4HB3A 4BFVA 4NL4H 4NPHA 4F4JA 3W6NA 3W5JA 1A7JA 2XZPA 2ZVQX 2F1HA 4O25A 2B7CA 3AF4A 4A8JC 3HP1A 4RFSA 3BFXA 5KYKA 1Z0AA 2ZUBA 3Q3JB 3GEIA 4MGKR 4RD4A 2PJRA 1Q3TA 2MSDB 4OHWA 1ZM3A 2XB2A 1TF5A 4LBYA 5EXTA 1W0JA 2A5FA 3OESA 4Q1AA 4GZMA 2GK6A 4LBZA 3WHLA 4QL3A 2NOAA 5JEDA 2WWIA 4JJZA 3SJZA 4HB0A 4V0OA 2RGCA 2XOKA 1KAGA 2XB4A 2QAGA 3I8SA 3U4QA 1XPOA 4DBLC 1A2BA 4JT4A 2OFXA 3TMKA 2JAQA 4D0NA 2REXB 5C18A 3ADBA 4KAXA 1VG0B 3U60B 1GILA 2RGGA 4NYJQ 2XNDD 1X6VA 2ZAOA 4RZUA 1X8JA 3TR5A 2TMKA 4FWTA 3W34A 3B9QA 4YXWD 2QI9C 3EPHA 1ZCAA 1IY1A 1FX0B 3L0SA 1C1YA 3IIKA 4C0LA 1XEWX 3TJZA 1ZU4A 1Q22A 3TK1A 1KOFA 2ZSBA 4GDFA 1M6NA 2EFHB 1WQ1R 1FZQA 2J7PD 2MMCA 2FX3A 3ZIAD 1ZM2A 5EXSA 1Q1ZA 5KSOA 4PFSA 2F6RA 3TUZC 3U6KA 4C30A 2W83A 5BN3A 4YMWA 3KTAA 3GFOA 3A36A 2WM9B 1E4VA 2XX3A 3MCAA 3TBKA 1HT1E 3EZ6A 3RLFA 5CDFE 3D3QA 1DPFA 4HYYA 2J87A 4ZDIA 1E79D 2A5DA 2CCGA 1MR3F 4EJSC 5BYJA 1OKKD 2F9MA 2GJSA 1YZNA 1KNXA 2JDIA 2HCBA 1OFUX 5DSZA 4DUGA 2J7PA 3D31A 4CDGA 4KSCA 5HZKA 1M2OB 2ZRHA 1M1YE 4NONA 4QOSA 4WVFA 3H2YA 2IYRA 3X1XA 3ADKA 1GRRA 4DDVA 3TW8B 5DHAA 2QY9A 5HTKA 1P2SA 3IEUA 5G41A 4E09A 3H4MA 1NIJA 2GK7A 4QBHA 5FPSA 4G3XA 1KK3A 4X8HA 2BJVA 5TARA 2RGDA 2QTFA 1D8TA 4UNSA 3CIOA 4Q9HA 3VTKA 1PUJA 5DI3B 2V9PA 3W8RA 4DWJA 2XXAB 3CR8A 3L2OB 4ARZB 3QXJA 4QBIA 3A37A 1FP6A 4XVRA 1OB5A 3BS4A 4KYUA 2KSQA 3WMGA 1Z0DA 2WZQA 2FEMA 2ZRNA 2CLSA 4D0LB 5AJXA 3CB4A 3LH5A 4GOXA 4MYTA 4F92B 2I1VB 3CRW1 2ONJA 4ACBA 3CNLA 2VP4A 2CJWA 1M34E 4EQ6B 1E69A 2JA1A 2C95A 1ETUA 2F43A 4P32A 4Q9JA 1EX6A 3ZS9A 1NMZA 5FI0B 4JBWA 4IDHA 4UKDA 5JWRA 1AK2A 1NVVR 4JL8A 1CJMA 4HDCA 4RZ3A 3QUSA 4AYXA 721PA 1Q57A 2CK3D 3BH0A 2FSFA 2G0TA 1XTJA 3ZVNA 1P60A 4PPFA 4ZKDA 1AS3A 2CJWB 5EE5B 1KK2A 4KVAA 5CM9C 1F3OA 1YZQA 2QG6A 4C4PA 2XGJA 1KY3A 1E99A 3GMTA 1YZKA 2EQBA 4FW9A 4DVGA 4MYHA 1JI0A 1WDTA 1M8PA 1COWA 4PC7A 4B73A 4TQAA 1E2KA 4YC7A 1AKYA 1T3HA 3C14C 1W36C 3OIVA 3SBEA 1S8FA 3AVVA 1CKEA 1RJ9B 1SZPA 3GJ7A 4LJ7A 2GTPA 1GFIA 1CEEA 4NHOA 5LBIA 1HURA 2WOJA 1NBME 2A9KA 3F3YA 1WBBA 1IAQA 1KI7A 2ZI6A 4RKFA 2GZDA 2CVFA 3EZ2A 2DY1A 4GP6A 3A4MA 4OI1A 5KDOA 3O8CA 1Z28A 1ZBDA 2J3EA 4MDEA 3BWDD 1IXZA 1RYHA 2GVZC 1E9RA 4DDTA 3TE6A 1J99A 3BC1A 1G5TA 3NXSA 1OH6A 4LJ8A 3AM1A 2LWIA 4ILEA 4LRWA 3PV0A 2YOGA 2ZRMA 3GCGA 3K0AA 3QKSA 4Q66C 1S3GA 2EVWX 1K6MA 3GLHE 1UBFA 3A1VA 3F5FA 4KVGA 4CEIB 2IA5A 2VPPA 1G6OA 3CX7A 5D3MB 1PLKA 4P3YA 1MRNA 2G6BA 3AVOA 4XWOA 3FWYA 1CR0A 4DJTA 4BWYA 4PC3A 2UVQA 1DBSA 3SN6A 1NLZA 1A82A 4Q1CA 2H7VA 5HKKD 3QNUA 3PJRA 2GZHA 2OXRA 5SZJA 5FOSA 1XEFA 3WNDA 4TYWA 3SOPA 3BXZA 1YU9A 1I4TD 1KYIA 4DT1A 4GOJA 5CLQA 3IQWA 5TV2A 4NZYA 3CX8A 2JIZA 2ZRDA 2ZJAA 5SZHB 3K0EA 3LNCA 2BMFA 1FX0A 4QXAA 4D4LA 3QXXA 4TLAA 1AGPA 2Q9BA 4TLCA 1R8QA 2ZYWX 3NDBB 3RS2A 3KFXA 2FSIA 2FOLA 3Q7QA 4WZBE 3GEEA 2HYIC 1NRJB 1II0A 5J4LA 5TVKA 1E6CA 4RD2A 5LB4A 3QE0A 1ZUHA 5K8TA 5FL3A 4Q9LA 5SZIA 1X86B 3FPAA 3HPQA 1KI6B 3KQNA 2R62A 2YVUA 3FVQA 2D3WA 3WHKA 4Q7JB 2BIFA 3U44A 4L16A 2C77A 3VQTA 1OPXA 3GLIB 4PPGA 3BOSA 3LVQE 4FIDA 5HE9A 1Z47A 3I72A 4KBFA 1R8SA 2ZYUX 4NH0A 3K70C 5H1YA 4LK2A 2X1VA 2KB0A 3EWSA 3CRQA 1E2LA 1XP8A 4P4TA 3GEHA 4NCIA 3T1TA 1XF9A 1WBDA 4DCNA 1E9BA 2V1XA 5HR5A 1V43A 4GI7A 5DH9A 3JVVA 1OSNA 3I73A 2W2TA 3WNBA 4TZ6A 2IC5A 2ZTSA 2QRNA 3HU2A 2R6FA 3HWSA 2QP9X 3PVSA 2WJJA 4RD3A 1P9NA 3CRRA 4ZCMA 2QTHA 2IYVA 1MOZA 4X8OA 4PQYA 1COWD 4PHHA 5CK4A 5C2JB 2IYZA 3GLGB 3THXB 4LHVA 5G3YA 4M4SA 1N6KA 4KV9A 4WW0A 4D4MA 2XOKD 4RD0A 3IEVA 3UG7A 3HDTA 1R2QA 4I1VA 3CBQA 3SJBA 1KNQA 3FKSA 1G3RA 1GOTA 2QNRA 3B1YA 4A9AA 5GJBA 3CF2A 4JLPA 5KHOC 1E0SA 2ZAMA 4B43A 4OYHA 3MD0A 1T4GA 5JZVA 2CMKA 2WOOA 121PA 1N5JA 3GFPA 2WMNB 2DYKA 2R6DA 2DWQA 1IN8A 2F3TA 3ZYCA 1GRNA 2ZRGA 1ZUIA 3M0EA 4PC6A 3KJEA 3RSOA 4QGFA 1KO4A 1Z08A 1BMFD 2F55A 1QDEA 4EFNA 5AUNB 5BW8A 3R20A 1GNRA 1GIAA 3AP1A 3RS7A 4EUNA 2J0VA 4LV8B 1ONBA 1LTQA 5DO9A 2A7QA 4HDQB 2IYXA 2QBYB 1R4AA 1SKYB 2G83A 4B3DA 2REOA 5FTMA 4LOAA 2DB3A 2RKOA 4MH0R 1E4YA 5DI9A 2GEUA 4AG5A 2J0SA 3MMPA 1A1VA 1BYIA 4ZCIA 4DB4A 4ZPXA 2BBSA 1EK0A 4KJZA 4LJ9A 4B6FA 2AKYA 1N6IA 2REBA 3RS5A 1XEWY 1LB1B 2ZRIA 3VU9A 1R5OA 2OBMA 4TTPA 3KZ1E 2XEXA 2BC9A 1E32A 3NTUA 2OILA 3OEEA 3T1VA 1Z6YA 2NO9A 4Q4LA 3W90A 2VO1A 3ZZ0A 3NEYA 3OFNA 3K09C 3PEVA 3CWZA 1IXSB 2Q9AA 2B21A 2NQ2C 4IEEA 2YNMA 4AYWA 4DCUA 4TT3A 5JRJA 5FPKA 3BIFA 2QMEA 4GP7A 3RC8A 1SXJA 5L3QA 1JPJA 2PJZA 3RVBA 4HUTA 1P7CA 2ZRLA 5FOWA 5BN4A 2F7SA 5FBLB 1JJ7A 2ZUCA 2FZ4A 2IXGA 1CLUA 4XH9B 4Q1FA 3NG1A 3SQWA 4LC1A 3RHFA 4GL2A 2BM0A 5KSYA 1D2MA 2GJ8A 421PA 3ZIAA 1R7RA 4C0BA 1XFAA 2CE7A 2PZGA 3EPJA 3G0HA 1E0AA 3TW4A 3P4XA 2GETA 4TQUS 4US1R 1ESMA 2OBNA 4BGDA 3QVVA 1XZQA 5GJCA 3K0AB 4A0GA 4MA4A 3OFND 2QT0A 2JLVA 3GJ6A 3MWYW 5KU1A 1R0WA 2ZR9A 4BLOA 4HAZA 2QZ4A 2GXQA 3BAFA 4DSNA 1XCMA 2I4IA 2QPTA 3K9HA 3C16C 4AY2A 2ZSAA 3ONWA 4NCHA 5CM8B 1IQPA 4Q4AA 1Y63A 5CYOA 3A4LA 1O87A 2OESA 3RRZA 4BLRA 2WSSD 1G17A 1E9DA 4DLRA 2O8EA 4IVPA 3VX4A 1NSFA 1RJ9A 5BYKA 4B71A 4ZDWA 4TN1A 5LD2B 3BFKA 2RH5A 4C0HA 3ZJYA 1OFIA 3TAHA 2J46A 3CPHA 3IPXA 1HUQA 3KQLA 4M1SA 3FFAA 4M53A 1XXHB 1U98A 3FFBA 2QMUA 3ND9A 3WXMA 4K8OA 2E9SA 5CLLA 4Q4AB 4XJXA 4A2WA 2CE2X 3V4FA 2R65A 4LV5B 3QG1A 1MO4A 1R5NA 4OK3A 4EJSB 2OSBA 3RRMA 1XTKA 4R9UC 5J4KA 2OFOA 4LX0A 1JAHA 1FQKA 1HE1C 1DAEA 4C7OB 5F98A 1P6XA 1BIFA 1I4LD 1OLOA 1VHLA 2F1RA 2ZS8A 4V0MA 4W9MC 4YQFA 1CF4A 3I5YA 3NH9A 3P26A 3QVUA 4QNMA 4EQ6A 2ANCA 4G5QA 3UMRA 3IBYA 3WBJA 4A6PA 2D62A 1LW7A 1W5SA 3H86A 5HPYB 5JHGB 2O0KA 5J4YA 2V6IA 1UFQA 1Z06A 5KUTA 2CK3A 2AD5A 1SKQA 1JAIA 3CONA 2BDTA 4EFMA 4DLYA 1P9RA 4TTQA 2IL1A 2Z6VA 1D2EA 1HEIA 5E7MA 2G9NA 1GKUB 1SHKA 1GSIA 2V6JA 3H0KA 3B5JA 4RZXA 1KO1A 1HTWA 4DCTA 3T5GA 4JLVA 1F5NA 1NVWQ 4MUBA 4B2PA 2HCJB 3AF0A 3CH4B 5FI1B 4ZDJA 5FR1A 1J2JA 4KFUA 2OV2A 1KJYA 1QZXA 3B13B 3L0PA 1OFTA 4JLDA 4PAOA 5EZ5A 5GVSA 3CNNA 2P67A 2QA5A 4IOKA 1P9WA 1KTVA 1XTRA 1XWIA 3LRPA 4F91B 2QBYA 4KCGA 2AWOA 2VF8A 2VYFA 2C98A 4G5SA 2O8CA 1TNDA 2V7QA 4TYNA 1HY3A 4M1YA 3B85A 1DG3A 4E22A 4Q4HB 4HZUB 4AURA 2BCGY 1QBKC 2NG1A 1J8YF 1GG2A 2OLKA 4RZ2A 2PX3A 2X2FA 5KPDA 2BBTA 4J0QA 1XX6A 4TSFA 2FG5A 4OQLA 1NN3A 5P21A 3QG5A 4R98A 4OHXA 4CEHB 3PUWA 2IUSA 4WZ6A 1Z22A 4G5RA 2HDNB 4DDWA 2PBRA 4I1SA 1CP2A 4DLZA 3DOFA 3VKHA 2OAQ1 1AJEA 1FMLA 2IW3A 3E70C 1Q20A 1W4BA 3G82C 4UXIA 2PX0A 2C5LA 4FI3C 3UMSA 1HE8B 5AJZA 3AUYA 5IRCD 4PTLA 2V7QD 3OF5A 1OJLA 2V54A 1QVAA 3ASYA 1Z0KA 2VL7A 1XTSA 5B64A 1TL7C 2A78A 3G5UA 2QM7A 3PITA 3O47A 4JLOA 1MO3A 1Z0JA 1UKVY 2H1LA 2WJHA 1UF9A 2OXCA 4CEJA 3EA5A 1NMYA 1E9FA 2AXPA 3F0TA 3DL0A 3RRNA 4XTRA 2ZR7A 2WWYA 3UWOA 1ZCBA 1FP7A 3SYLA 4UNNA 2C9CA 4FMCB 5EQTA 1PUIA 3SYNA 2O0HA 1ZM4A 2OM2A 4XSHA 2PMKA 3SFZA 4DHEA 3MJRA 2O8BB 4IFEA 2IYSA 3PXGA 3I92A 4MRSA 3K0FB 1G3QA 2HEIA 2YZ2A 1TU3A 3MLEA 4BQSA 1N6LA 5DLQC 3U6BA 2ZM5A 1CIPA 1VCNA 4URUR 3QXSA 1YZTA 3SHWA 1G4AE 2VHQA 1NSTA 2ZRBA 4Z1MA 3UKDA 3CKLA 3HU3A 2QMOA 2VBCA 3FHOA 4KO8A 1TTTA 2KJQA 4C9BA 5ANRB 4Z54A 4P0TA 3JVUA 3I1FA 1IN6A 1F2TB 4FCTA 4MITA 3C5HA 2V8OA 1IN7A 5FL7D 4HLQB 1I4DD 4JSYA 4L9WA 1M7HA 2V55B 4OBEA 5HCNA 4BFSA 1U99A 1II8A 1IM2A 1G7RA 2FFAA 4RJLA 1K5GA 1MH1A 4HZIA 1CULC 2YWEA 2IS4A 1ZD8A 3R9WA 1RW4A 3WYAA 1XNJA 4HLDA 1E2JA 1GNQA 4O2LA 2IWHA 4NYJR 3LX5A 3MRSA 4WXPA 1YVDA 4A1FA 1RRGA 4TYYA 4LYHA 4E5UA 5AUOB 4RVCA 1RRPA 4XIGS 2RGNC 2FEOA 1EFTA 5FUXA 2OHFA 2SHKA 3QQ5A 4EPWA 1KJWA 3TQCA 1MKYA 1ZRHA 4HLCA 2DBYA 3QKRB 1KKMA 2ASEA 4TMZA 1RRCA 5FR2A 4LY6A 4C2UA 3Q8XB 3OEHD 1ZINA 4KU4A 1ZC4A 1N25A 1U90A 2ERYA 1VECA 3K9GA 1RKBA 3E5HA 3NBYC 4TMKA 4C0JA 4C0KA 3F8TA 4DRZA 1NY6A 3TSZA 1Z07A 2K5UA 3DMNA 4QGAA 4V0KA 2JGNA 1D9ZA 4ZI2A 2IYWA 3K70D 1NIPA 3OAAD 4N3NA 1M7GA 5KTYA 5EXPA 1AIPA 1CU1A 3ICQB 2P6UA 2C99A 3N2IA 4N0DA 1SGWA 3SS8A 3BK7A 2D7DA 2C9OA 3BJIC 1X1SA 2X2EA 1HQCA 4ESHA 1GL6A 1KI4A 1LY1A 2XAUA 3BB3A 4QC2A 2GJAA 3U7GA 1UJ2A 1OFHA 1RIFA 1YRAA 3N70A 4JYCA 1XPRA 4LJYA 3AVQA 1HV8A 1XD2B 1Q44A 4RCZA 4OQXA 2G1JA 3NHAA 3SR0A 1IBRA 1XTIA 3RWMB 2ZJ2A 1ZNYA 1G64A 1E2EA 3KKOA 2FWRA 3GPLA 1EWQA 4OKSA 1XCPA 1R0ZA 2WSSA 3UPUA 2V4ZA 4X8MA 3KQHA 3C7KA 4PR0A 4JT2A 1MRSA 1S96A 4IDOA 1ZNXA 2FU5C 1ZD9A 3AGQA 3RSLA 3VKWA 1WA5A 4R71A 1OH5A 1UBGA 4ABYA 1E2HA 2VHJA 3L0IB 4QKQA 5JWHA 3GLGA 2J45A 1MT0A 1OXUA 4PZLA 2FFQA 2LCFA 4LV6A 3SYKA 2FN4A 1SKYE 4A0HA 5BXQC 3PEYA 4F38A 3NIBA 1E9EA 1VYTA 3IILA 4DXAA 5JRZA 2FE4A 521PA 1GTVA 2A5JA 1Z6XA 1E98A 3H84A 5CIQA 3UANA 3FMOB 1AS0A 4OK6A 2YC2C 4CT5A 2AR7A 2ZI5A 3AP2A 3EARA 3TNFA 2X77A 3CF6R 1XJQA 3ICEA 1G5PA 4PO9A 4WBSA 5A4JA 4JKYA 1KI1A 1EESA 1S0UA 1W0JD 2RCNA 3QPWA 1B0UA 3U7EB 2QPOA 2YHSA 1XD8A 4D4KA 1AQUA 1SXJC 3MGCA 3C15C 4HI0E 2P0EA 1RVDA 4PO8A 1R6BX 4EKDA 3MG9A 2OCBA 4OHVA 2AX4A 3TLXA 5K8LA 1T0JB 1II8B 3SFVA 1Z63A 3EAQA 3FOZA 5KNBA 4DEYA 8OHMA 5JJIA 4PQFA 4OK5A 2BMJA 3OEHA 5H8WA 3VHXA 4MKFA 1H8HD 3IO3A 2J7KA 4B3CA 3ZD7A 2HXYA 3OAAA 4BFZA 1JR6A 2O8FA 3BRWD 2ZE6A 3DPUA 1T5IA 3BD9A 4NP6A 2PLRA 5EUQB 3IUYA 4YONB 5FTKA 4YDHB 4GFDA 4Y0AA 5DN6A 4PC1A 3K0FA 3ZH9B 2D4HA 1UEJA 4A8JB 5J4HA 5CIWA 2F1JA 3ZQ6A 1D9XA 2QP4A 1E2DA 4M9SA 1GL9B 1L8QA 2P6NA 2QAJA 1OHHD 3DDCA 4WOPA 4ZO4A 2WWHA 4MDFA 4AK9A 2Y8EA 2O52A 4W5HA 2ZS7A 4JLNA 1QHXA 1G3UA 2P3SA 3EZ9A 4B35A 1OXTA 1GL7A 3RABA 4P31A 4CEJB 3GFTA 1L4UA 1W5TA 1NKSA 2DPXA 2FJUA 3LA6A 2PH1A 3GLFE 3PR1A 5EZ6B 4M1KA 3FMFA 4NYMR 1TAGA 4KBGA 2AL7A 3FTQA 4UNPA 1ODFA 3QKSB 4C2TA 5EXXA 2V3CC 2I1QA 3MAAC 5LPNA 4RCYA 4PC2A 4GRAA 4LPKA 5KPJA 4DCSA 1SXJD 2GNOA 2PZEA 5TY0A 3MSXA 1XMIA 1D6JA 4CEHA 4HLUA 5A5GA 4IDQA 2W00A 1YZGA 3C4JA 4PX9A 2DHRA 2AFIE 4LBWA 3VNVA 2H57A 5EE3A 1Z6TA 3DZ8A 3SC3A 2OEPA 2B92A 3DEFA 4Q19A 5L3SB 4Q4HA 3O8DA 3U61B 3B2EA 2IS1A 1P75A 4XVUA 1RC8A 3CPEA 3B9PA 2QL6A 4MQBA 3TVDA 5HCIA 2P65A 1EFRD 2NO0A 3JZAA 3P27A 4LWZA 5EP3A 2ONKA 4B6EA 1XPUA 4PAQA 3C41J 4BZPA 2ZJBA 4I1OA 2OLJA 3ETLA 3NWJA 1T91A 5FBWB 1DVRA 2QQEA 3N2EA 3U3KA 4GNKA 1E1RD 3AVWA 4Q18A 2XTMA 4NYIQ 5DYGA 2BKUA 2UZIR 4LZZA 1P4SA 1NNEA 3TR0A 1NN1A 1ZYUA 5JS8A 2W6JA 2GVDC 1MV5A 1S1MA 3REFA 3UATA 1EWRA 1LS6A 4IVQA 4MRPA 4DIEA 3QIAA 1XU4A 3L82B 2GDJA 4UXHA 3THWA 1JECA 2ZRPA 2JJ1D 4FWIB 3T5DA 1T9HA 3PG5A 2B7BA 2B8WA 2RGNA 2ZS9A 4Q1DA 2JASA 1PZNA 2ORIA 1TU4A 2C9YA 2ODEA 2F1IA 3GJ4A 3THYB 1TEVA 3PUVA 3KKQA 3GJ0A 3ZVMA 1N6PA 2ZSDA 4A82A 1JALA 1Q3HA 1QF9A 1F2UB 4D26A 3EIHA 3B82A 2VSOA 4PPNA 1KZGB 4L5BA 2Z0MA 1AN0A 3K0SA 4V0ME 3THWB 4CYMA 2XZLA 1BKDR 4UNRA 3RRYA 2AD1A 1E2GA 2ZRFA 1KO7A 1NLYA 4JLJA 4FCWA 5J47A 2JLRA 2BKEA 3TSWA 5B30A 5DISB 3IO5A 4XD7D 4ZKEA 4M1MA 5FH9A 2RHDA 2VRWA 4D80A 1SVSA 4MYCA 3T35A 4V0LA 1PLJA 5AWFC 4CRWB 1VCMA 4BPBA 3CPJB 1J70A 1XXHA 4KSBA 4V03A 1FNNA 1KO8A 4QRHA 4QHSA 3RANA 1JNYA 3VX3A 4EPTA 5JFGA 3U7HB 2QPAA 1GRQA 3ZS8A 1OE0A 3WMEA 4ACAA 4F7WA 2ZXUA 3AGPA 4LJ6A 4GSYA 5KDDA 1SVWA 3P4YA 3K53A 1AKEA 1G3IA 1P3JA 2NIPA 3B1ZA 4RY2A 5JHHB 3VKGA 4KYIB 3Q72A 3GLFB 4HUQA 2MSEB 1VCOA 2IUUA 2CDNA 3EA0A 4MKIA 4TMVA 5FOUA 3TRFA 2W0SA 4CF7A 2GAOA 5GADl 5DHFA 3I5XA 3DM9B 1DAKA 4G5OA 4Z8YA 2GXUA 1N0VC 2CVHA 1KIMA 2Q21A 4IEIA 2WJYA 3NKVA 2GXSA 5H68A 3EPLA 1H8HA 1PV4A 1PLLA 4XOIA 4W5JA 1G8YA 2HYDA 2KBEA 4DKXA 4Q1EA 4QNRA 4URVR 4Z8XA 3UWKA 3IKJA 1PVOA 1G6HA 4CIDA 1FFHA 4ON9A 4FMCF 1Q12A 5E7IA 1T0HB 3SBDA 1E2IA 4L15A 3WBKA 1UBCA 2WWFA 1HH4A 4NE2A 4CZ2A 4LHWA 3ADDA 4JVMA 3BERA 4W7SA 2JJ2D 1M7BA 4AIIA 2OUKA 1E9AA 2KI5A 4A2QA 2WPDA 4LHYA 4P4SB 3PEWA 4QGHA 4GBMA 4BFTA 1N0WA 1OYWA 2CL7X 5EP2A 3KDSE 5JBQA 1ZC3A 1OIWA 5F3WB 3B1VA 2VEDA 4MRVA 2ZI4A 1R10A 1QHNA 2XJ4A 5CB8A 5AUQA 1LV7A 2GRJA 3FHCB 3NDPA 4OI2A 2YKGA 1G5RA 1XMSA 2ZJOA 2ZR0A 4HAXA 5E4FA 2EFEB 3N5CA 1P73A 4TLEA 3SHFA 1NG1A 2H16A 1TUIA 4F93B 5L3RA 3L8YA 1B23P 5SZKB 1W36D 5G40A 3CRMA 3CX6A 1HT2E 2CNWA 4B2LA 2HLDD 4PPQA 2G3YA 1SVLA 4C0QC 5LDDC 5JMTA 4UXJA 1UDWA 5AJWA 4TT3D 1G20E 3AKYA 3GJ5A 4GT1A 4DIDA 5EE0A 2E87A 1DAGA 4LI0A 1NLFA 2QM8A 1OKKA 4IKEA 2GCPA 2IYQA 1Q0UA 2ODWA 2ZYVX 5B58C 1LF5A 2J0UA 4FINA 3BH7A 1OIVA 4FMDF 4JYBA 3OHMA 5GVRA 1JQLB 4LHXA 4MGZR 2JLXA 1FPMA 4DSUA 4FD2A 3LVRE 3KKNA 4IVRA 4GZLA 2H92A 3PEUA 2VLIA 1R5BA 3O8BA 4EJSA 2L0XA 5L3VA 4D2IA 4LSGA 4AKGA 4LC0A 4A92A 2VSFA 3X1YA 4AKHA 1X8KA 4M1TA 1KK1A 2WIAA 1P2TA 3V9PA 2Q3FA 4OQMA 3ZZUA 3X1DA 3AQ4A 5FOTA 2FH5B 2IBMA 4FN5A 3A1WA 4Q03A 4OI4A 1N5KA 2J0UB 2Q9CA 3K9LA 4F4CA 4M2LA 5M04A 2VF7A 5A0FA 5DNYB 4QGGA 3FB4A 3DVLA 1Z6GA 3OE7D 1KI2A 3SNHA 1FNMA 3AF1A 4D82A 4HLUC 1KMHA 2NZJA 1DTSA 1VTKA 4NYIR 1YR7A 5BQ5A 4Q4JA 3THXA 1WRBA 4G1UC 1U9IA 2ZSEA 3LY5A 5TDHA 4UJ3A 1ELOA 221PA 1E9SA 1QHSA 2AKAB 2JJ2A 3LAWA 2W58A 3CNOA 3MUFA 3RC3A 1KI9A 3VR2A 1F48A 4EDHA 1JXMA 2FFBA 2MSCB 4Q47A 2DFTA 4QBGB 5JECA 1DELA 1KJZA 1N5IA 1CJKC 4YXWA 4BFXA 1N2CE 2GZAA 2FF7A 1VHTA 1XD2A 2OT3B 2QGNA 1Q1BA 4OQFA 4BASA 5F9HA 3OE7A 2ORVA 5JCPA 1V5WA 4X8LA 1GNPA 3R8CA 4JLAA 1E3MA 1US8A 5FBQB 2AN9A 2PEZA 2R8RA 2RGBA 3X1ZA 3IQXA 4K81B 2IYTA 3BE4A 4P4SA 3NBZC 3GLIA 4A0FA 1OB2A 2A30A 2J5XA 1XMJA 5L3QB 1H65A 3PUZA 2D06A 2IYLD 3KQKA 1QG2A 3ND8A 2YV5A 1W2HA 1G41A 1X3SA 1QHHB 1I2DA 2P5SA 4S35A 1MABA 2QEQA 2O0JA 1BO6A 1DAFA 1TQ4A 1YR8A 1ZU5A 3QKRA 3QXCA 4M8NE 3EC1A 2ECKA 5AJVB 3VU9B 1TUEA 5GJVC 2DFKB 3I4LA 1YRBA 3TSOA 5JSZA 3DOEA 4KITB 3I62A 4WA7A 1CXZA 2NO1A 3EIEA 3IIJA 1MABB 2HLDA 3AP3A 2Z43A 3BH6A 4KI0A 2YOFA 1ZW6A 2FV8A 4XTCS 5FFMA 1UKYA 3W6OA 1GKIA 3WY9A 2BJWA 2XITA 4DT1B 1P72A 1ZUNB 4LYAA 3CO5A 2WICA 2ZI3A 1KSHA 2I3BA 2NO6A 4MRRA 3WRYC 1T6NA 2WMOB 1GDDA 4C0SA 4LHZA 1WB9A 3KL4A 2WKQA 4HB4A 3OIYA 3TVTA 3QF4A 2QE7D 3WYGA 4OJQA 1P62B 1US8B 5E7JA 3FE2A 1P2UA 3T12A 1WF3A 3VR4A 2G77B 5CK5A 2FSGA 4JZKA 2IX3A 1CJUC 2ERXA 4BRWA 4QM6A 4CT4B 5CB6A 3OZXA 1KI8A 4L9SA 1JEDA 5G53C 4M21A 1SVIA 2ZJZA 1AZTA 1NKTA 2BMEA 4CVNA 4IFBA 4RSGA 2QQ0A 2O8BA 2BBOA 2F9LA 4RKEA 1KDOA 1IXRC 2Z4RA 3V00A 4C3ZA 3EWAA 2YOHA 3QY0A 3UIEA 1OIXA 3IGFA 3RS4A 2BVNA 2XSZA 2JIZD 4Q4JB 4B44A 3FDIA 2H5EA 1ZJ6A 3AEZA 4GOKA 4HSEA 2IF2A 1F2UA 3KB2A 1DO0A 3W8NA 1KMHB 3A4NA 4MRNA 2OFWA 821PA 2PCJA 4GPTA 2FFHA 2XZOA 1G4UR 2QN6A 2VHUA 4FXPA 3LW8A 4JVLA 4N0EA 1BMFA 4QHTA 2GAAA 3T1OA 3VR5A 2GWHA 4AKEA 1SXJE 1DG1G 1S9HA 2E1RA 1KMQA 4AD8A 1RYFA 4BUJA 4EAQA 1LF0A 2ZUDA 2WTUA 3QEJA 3DMDA 2ZYTX 2P2LA 4PANA 5IF9A 3QI2A 1DAHA 4JJKA 1G7CA 2PMDA 1EXMA 4M22A 1W0KA 4LBVA 2F43B 4KFSA 4WXRA 3THOA 2WJGA 5EP1A 3LV8A 2JLWA 4EPYA 2PLFA 3QJYA 5JCZA 2UKDA 2O8CB 1VIAA 4UQOA 1SVKA 3UXMA 3U44B 4DDUA 1MO5A 2J41A 1LNZA 3AKEA 4JVNA 1NF3A 1KY2A 2RGEA 1W7AA 4NCNA 4UNQA 4DLVA 3I8XA 4U7DA 1TEXA 2NPFA 1HA3A 1GUAA 1UKEA 5L3SA 2V1UA 5C46F 4TTRA 4TMXA 4HEJA 4YMVA 2GILA 5C1BA 3MWJA 2QGZA 3Q9LA 2WHXA 3FKQA 4BRUA 2CXXA 3KQUA 2GKSA 2O8DB 2DR3A 4DLSA 1JQJC 3GJXC 1LFDB 4M1WA 3LW7A 1SVOA 3A58B 4P4UA 1WMSA 3W9YA 1FUUA 1KK0A 3EG5A 2ZETA 3CZQA 3SEAA 1WP9A 1JPNA 2ZSFA 3W5IA 4D6PA 5FUYA 4AYTA 5CDFA 4IXMA 1VYVA 3JZMA 4TSFD 4MKHA 4ASUD 4BE7B 2CCKA 2CHGA 2IS2A 2H8KA 3M1IA 4AKIA 1S2MA 3LXXA 3P32A 1BOFA 1G8GA 2D74A 4O2RA 1NG9A 1Y3AA 2ZPTX 3GLHA 3LX8A 4M0LA 1NVUQ 2DFNA 4JBYA 5FTLA 2CL0X 2RAPA 3I3SR 4EPRA 4G01B 1N5LA 5F2EA 3GLHB 3PIRA 2QORA 3S1AA 2QU8A 2R9VA 3KTAB 4KODA 3J81k 3K8YA 5FPYA 3SE0A 4B74A 4IDPA 2OO7A 4IW3B 3WRXC 4PHTA 3FHTA 2GCNA 3DZDA 3KJGA 3LFUA 5K8UA 4C7OA 2BHRA 4PZZA 4I99A 4PHFA 4W5WA 5KNCA 4A8JA 5CITA 1IN4A 1U94A 3FYHA 4IDNA 2IK8A 4B75A 5B2ZA 2VIIA 1XCGB 4WZAE 1U0HC 4NKRA 2ZVPX 2RB4A 4MKGA 1U81A 1JR3D 2Q0HA 3GLFA 2O8FB 4I81A 4URZR 3FKSD 3BBPA 4A2PA 3VR3A 1U0LA 4TL6A 4EPVA 1VIYA 4IOLA 1ZNZA 3QOFA 5JI2E 2BEKA 4RD1A 2QTVB 1TQ6A 1NN0A 2AXNA 4H1UA 1K5DA 2GJKA 2VP6A 4PSKA 1GM5A 2OG2A 4PHGA 4Z1MD 3NVAA 3RWOA 3QPVA 3A8TA 2HT1A 1E0KA 2BMDA 1VMAA 2QENA 4U5XA 1G21E 2ATVA 4URWR 1N0UA 4Q9IA 2C2HA 3I32A 1NMXA 3SI7A 2PEYA 1KGDA 2CL6X 3LBHA 4MGYR 3LDAA 3NC0C 4U02A 3GLIE 1EG7A 1SQ5A 3PCRB 3R8FA 1QHYA 2DCUA 4PSVA 3ZVRA 3T15A 2QT1A 3U3OA 1U8YA 4OJKA 4KLNA 4A4DA 1ZIPA 1JEEA 1Z29A 1YZLA 4LDJA 2PL3A 5FBRB 4LJAA 2YWFA 1NVXQ 1Z8FA 1F60A 1ZM9A 2WV9A 3QBVA 1IONA 1UADA 2B6HA 1EX7A 1W49A 3IPYA 3ASZA 1W2GA 4RFVA 5KO2A 1IOZA 2NO7A 1KSFX 1KHTA 5HE8A 4A36A 1U9IC 1UAAA 5FTJA 1YQTA 3T06B 3VAAA 3OEED 3GJ3A 1SHZA 3Q5EA 4Q21A 2FDCA 2R6GA 3RS0A 4ZV4A 1R0YA 2XXAA 4MUAA 3E2IA 5JLJA 2ZRKA 3LXRA 2DWPA 2VSXA 3UK6A 3SDZA 2A5GA 1VCIA 4BFYA 2RHMA 3PUXA 2EU8A 2PZFA 5IK2A 1UEIA 3IHLA 2VP0A 1CR2A 4H1VA 1P2VA 1Q1QA 2WAYA 3E1SA 4JLMA 4TWZA 3VR1A 3PQCA 1RRFA 4IOMA 4OHZA 2ZIAA 2JATA 1Z2CA 4QM7A 3VFDA 2BWJA 3AKCA 5EE9A 3X1WA 2F3RA 1T3SA 2MMGA 4AC9A 5EE1A 5BN5A 2FNAA
chains in the Genus database with same CATH superfamily
2W6ZA 2P2NA 2WTMA 3WLFA 4DC1A 3K8ZA 2GM4A 5E1OA 1EI9A 2J6HA 1XVIA 1O5TA 4LVCA 3WL8A 1VP9A 2IF0A 2OCDA 2ZEJA 4JFAA 1EE1A 5BT9A 3TUIC 1SCJA 4JASB 4XJVA 4Q01A 3BHNA 2XCLA 4LPSA 3I1JA 1E2NA 1XE3A 3NEJA 3AB3A 3MMXA 5K51A 4YP5A 4R83A 3MT9A 4X00A 5DSTA 2HXSA 5ILQA 1NZJA 5ICEA 5KC8A 3T61A 1VHJA 4O1IA 3WIEA 2OCGA 1N57A 3DT9A 4Y9RA 5SYMA 3ZD6A 2C7VA 3ZQUA 2P9EA 5IT5A 2W5UA 4I14A 4R7ZA 1QP0A 1RACA 2VP9A 2ACWA 4D0SA 4F3YA 3RWBA 3KKMA 3QF7A 4MLCA 5FOXA 4PWZA 2HF9A 1Z6QA 3ITDA 4I5IA 4BNJA 4GECA 4P3PA 2B0CA 4OYRA 1J7KA 4PU0A 3D81A 1QCZA 4EUSA 1RADA 4X7RA 2ZREA 4HAVA 3BE6A 4YMTA 3ROKA 3JAWA 3U7FB 2AMFA 4YEDA 3PJEA 2H17A 4UHFA 1T2CA 2EYQA 3PFGA 3RK4A 4IV0A 4OB8A 2PLNA 3PFNA 5I8ZA 3RHSA 1VDZA 2W7TA 1ZRSA 4PGMA 2A58A 4Z5XA 3G13A 4CMIB 4PZCA 4P3KA 4EX7A 3I5MA 2AYXA 3DC7A 3A2NA 5EUMA 1ZI6A 3SE7A 2ERCA 2C3UA 4FEAA 2F8LA 5U9CA 1DUVG 4BFUA 4D92A 4DDMA 5LMUB 2QSZA 2ARKA 1XI2A 2ZSIA 4O2AF 4I1RA 3M4YA 4TS1A 1IK4A 5TB5A 2X6QA 1XDSA 4ODIA 5CH3A 5LNK6 2UZAA 2ZIVB 2P6RA 1KZYC 3MM4A 5CW1A 5B5SA 1Q1NA 3GQVA 5DLYA 1VL6A 4MVJG 4DAEA 3IAXA 5B1DA 2NZWA 2O4CA 3HKEB 1JYFA 3KV1A 1OWLA 3K72B 3PRJA 2R2AA 2RHRA 3QVSA 4V02A 1OR8A 1C7FA 3CM0A 1ZHOA 4MXDA 3UGTA 1YWGO 3C6KA 2X41A 3MAGA 2RONA 3AFMA 4EHBA 3IJRA 2DXIA 2JVJA 2VJNA 2I4MA 3ZHQA 4ZJUA 2HMSA 1M54A 2PUGA 1PHRA 3HXKA 4B2YA 1PZMA 2OAGA 4LGCA 2WWGA 3USCS 1U8XX 1ZDMA 1CJVC 3ZV6A 4URXR 4M0DA 3RUHA 1ABBA 4BE9A 2XBLA 3DAGA 1U8AA 4YIKA 5BNFA 4EOGA 4ENUA 4YRIA 2ORWA 1MG5A 4MGEA 3U3JA 1P1RA 3WNCA 5EEGA 2CMHA 4NU5A 4Q3CA 1WWKA 5HW0A 1EFHA 2A0XA 4WKBA 3SQXA 4O08A 1XC7A 2HWWA 3DB2A 3ROGA 1Q92A 4M0MA 1GZHB 4YRJA 4E51A 2AC2A 2R0QC 2IEZA 5I9MA 2RGWA 2WA1A 5D5PA 4HPXB 2NT3A 3W5BA 4J7CA 3UHAA 3PB3A 5AVYA 1FXUA 2XNJA 4HMOA 4WESB 1A50B 5AOVA 3RFUA 1K7XB 4TV9B 1AGRA 3UJHA 2X58A 2PVPA 4L73A 4LW8A 1MDFA 1D07A 1QH1B 3DSRA 4KC0A 2BCJQ 2OFPA 1CZOA 1VYHA 2AR9A 3AFIA 4E3WA 5BSVA 1K7SN 1YONA 4QFBA 2IH5A 1E2UA 4HZUA 2GA8A 1ZMXA 4EK9A 5DM70 2HRQA 2XMZA 4LJ4A 4BIIA 4KPUA 3C97A 3ZHYA 3ZHUA 1F2VA 3FJ1A 5AM4A 3SEZA 4O3MA 2R6CA 3EEIA 4O0MA 4KIFA 1C4KA 2XDQB 4IXNA 1Y1SA 3RK0A 2CEAA 2UXCB 3LHKA 2JJ8A 4KN8A 3GRZA 5TGDA 4H1HA 3AHCA 3HU1A 1Y7HA 4QO8A 3WG9A 1OW3B 4A0QA 4A5OA 1CIVA 4P7FA 4XCVA 4ECAA 2W6JD 3KAQA 1NBMD 1KRXA 5JEEA 1W1WA 3HNPA 3KQTA 2ZI7A 1A1SA 2BFFA 3K30A 4IFTA 3RKSA 4KUEA 5LNK1 1JB9A 1ACJA 2XY4A 4RL6A 5TF0A 2PT6A 4XWAA 5I9IA 1MB0A 2PVSA 3KR2A 4GOLD 2IZ6A 4F04A 1F8GA 5EPEA 1NWCA 1FTSA 3P20A 5K3SA 1TF7A 3TFWA 3I01A 3EDQA 3U39A 1FL9A 1T3LA 3Q3VA 4JY7A 4B6SA 2HT6A 1YRHA 3IAS1 1O95A 1PNOA 1H85A 2PA0A 2HWUA 4EA9A 5BUQA 3AONB 2HMWA 3UVEA 2YRFA 4YAGA 3VR4D 4NOKA 5CDSA 5AOBA 4XWWA 3AVXA 2PDAA 3UQYS 1W47A 1XKQA 2W2XA 4ZVMA 3AIKA 1F12A 4KX3A 4ROTA 1N3BA 3ONFA 3QVJA 4YNBA 2X0RA 4EGAA 1VGQA 2NUAA 3P1JA 2DPHA 3TXXA 4D97A 4DE5A 3UJ8A 1Q7GA 3F5QA 4F46A 2H11A 3HXQA 1YL7A 1J1ZA 2VJOA 4L8GA 4N8DA 5FX2A 4P0QB 3UOWA 1O8CA 1TX4B 2DJIA 3D54D 1CVIA 4MVCA 1W4CA 3BWXA 2QTWB 2QTCA 3IAFA 2EWVA 1M2KA 3K1JA 1VJCA 2X0IA 2H9AA 1O54A 5CA0A 4JUIA 4YDQA 4N7RA 2W2LA 5LA6F 2PBLA 1Y89A 1RYZA 3QU4A 3OTQA 4BEJA 3H1PA 3HV2A 2GCOA 3MBIA 4ESOA 1Z2AA 4INPA 3VZRA 3O31A 2FEAA 3H19A 3BWEA 3LLSA 4LYFA 1IDN1 4EWLA 5DMXA 1VSVA 1L3BA 3HJAA 1KERA 4EG3A 1BU5A 5JTTA 5GZ3A 2LKDA 4UBKA 3FUVA 3JATA 5KYWB 2IDKA 3NFRA 1MO6A 4URYR 2OD2A 5EP4A 2H1FA 1UM8A 3I0MA 2HL6A 2Q0XA 1F5SA 2VT6A 1J00A 3GUVA 4EO7A 2KS6A 2QTVA 4HAWA 3GX1A 3TI7A 5J2TA 4NBLA 3CUEF 4J0EA 1JR3A 4JLBA 5KQMA 1OH8A 1JVNA 5LLSA 4QDOA 4UC0A 2XNKA 4H6PA 5FNVA 4GOMD 3M5WA 2X13A 4NMXB 1VJRA 4IH9A 4IZ6A 1UBKS 2GEDA 4RENA 1QC5A 2FZWA 2XUQA 3KSMA 1QOQB 4YRFA 2O06A 3ESAA 4WK6A 3L4JA 1S2LA 1O96A 2I4NA 3IOYA 4ARSA 1PR3A 4MYUA 3TW8A 4LDNA 1NY5A 2W6OA 5IDVA 4TKUB 1JA0A 4JJGA 3VBCA 3G88A 5C5EA 3GGGA 1J0BA 1XZFA 2QUHA 2XTNA 3QA9A 4JWKA 1A9RA 2C5BA 4MS3A 2Q27A 1CRPA 2CVQA 3B60A 5AR1A 4KXFB 2RK6A 3JYLA 4IP0A 4GH5A 4M0UA 1H9BA 4MMZB 4QPPA 3SQOA 3KNZA 4L57A 1I3NA 1DQRA 4WWHA 3UAGA 4YJ3A 2DFVA 3TM4A 3Q7TA 4HGQA 4ROSA 5FNVB 4F2GA 1C81A 1BEEA 3GT4A 1A8QA 5FDFA 4AS3A 4CMCA 3RAPR 4DEXA 2G70A 3GFVA 4M6WA 2PUAA 1O7JA 1E1CB 1TCUA 2E5WA 4D1YA 10MHA 2ANBA 3OI7A 4B34A 1D5WA 3BIJA 1RLUA 5JH7A 1KO5A 1OASA 5LQMA 1NW3A 4J1TA 2RC6A 4HLNA 2Y68A 1MHPA 3M1YA 4GI5A 1XTZA 2XGOA 2ZI9A 4JL6A 2YL2A 3VISA 1WKVA 4Z2AA 1DV2A 4CPDA 5EZYB 3LUJA 1KOLA 2FUG6 3FOCA 4ZD6A 4BRZA 4OMFG 2IBSA 3PQ4A 4EHKA 4GMHA 3DPIA 3QV2A 4HPWA 4I3FA 3RARA 3HBAA 1NVDA 4GGMX 1UMDA 5I48A 1Q6ZA 1C3OA 4WJZA 5T8KC 1Z13A 4LEIA 5ESDA 2JIRA 3GMIA 3IIMA 3VNBA 1LK7A 1P6UA 1VZ2A 2HPHA 4E5YA 1NVTA 2GEFA 3ZJUA 5KWJA 2XNSA 1KDZA 2ZANA 4AJ9A 2C5GA 3QEBZ 1V4BA 1TM1E 3D4IA 4L4ZA 4B32A 3TGPA 3L7NA 3SHVA 5GM1A 3SY8A 2W2KA 3T3OA 1FRZA 2ZUUA 3OU2A 3ET5A 2PGLA 2XTZA 2FRDA 4F96A 1RQLA 1PIWA 3ZE6A 1A7UA 4Y7CA 1ZNQO 3GDGA 3UY4A 2ZJ5A 1Z26A 3NBFA 3RKUA 4HQKA 3OKAA 3O1JC 3U3DA 4KJXA 4OGFA 3H3FA 3TNYA 4QECA 1LDYA 2Z83A 3SZOA 3KT8A 2ZYGA 3R7WB 4CL2A 3ZY3A 4UW9A 3K05A 3TZ6A 1N6RA 4J3NA 2IYUA 2DVMA 1X2EA 1ZRNA 3G5LA 3KG2A 3MJHA 2ZRJA 3WIUA 2D59A 2J9YB 2PQMA 4E5SA 1QHFA 4K9LA 3OE1A 3G7SA 5FI3A 1VMKA 4LDZA 3CMCO 4OJYA 3HN2A 4E5KA 3KT3A 2ZQ5A 3GFBA 5FV4A 4TV9F 4GE0A 4XR4A 1V7QA 2ZRAA 1GA4A 5LSAA 4TQ9A 1AH2A 1BEZA 3AH8A 4IDAA 5JXWA 4WAUA 4TQGA 1EA5A 4DV0B 2BMVA 2Y0CA 3I42A 4B3BA 4BKPA 3V6MA 1X7ZA 3R9XA 3G7UA 4Q5IA 1JE1A 4FDAA 4WNYA 3L7MA 1KDRA 4XD7A 4B47A 5JH7B 4CKXA 4EHNA 1CIJA 3QITA 1FUKA 3FLMA 4HB2A 3PYMA 5AI8A 1GQSA 3EEYA 4DLXA 1JSRA 1E79A 1JIUA 2GRUA 2PANA 1PK9A 4Q7MB 5IAGA 3ER9A 4C89A 4D6XA 3ZGNA 3KB1A 5KSPA 2AFIA 3WWYA 4IUBS 4OL0A 2C0QA 3CSSA 4B5KA 5BV0A 1BG6A 3G7NA 2EX0A 1IJFA 2HIMA 2VUHB 4NU8X 1KAHA 7REQA 2EDAA 2W37A 3GDHA 3TKLA 3HKCB 3HYTA 2C2XA 1ESNA 3V9AA 1IOWA 2HQRA 2W2QA 4ER0A 5LBTA 2QUZA 5A4DA 4DSTA 3N3AC 4DA6A 5EIFA 5B55A 5K1ZA 1RXIA 1UKBA 2R1VA 3HSSA 3FNBA 5EIWA 3ONNA 2XUPA 2PR2A 3U7QA 1E3LA 3CYFA 5K0LA 1OXXK 2DT8A 3BRQA 3SGLA 4HRVA 5K7SA 1T35A 4I4CA 1SBHA 3D7MA 4Q7KA 1NT2A 4U7HA 3G0GA 2DFLA 3RYTC 2XVAA 2V7BA 3HR8A 3U3RA 3WP0A 1ARZA 4O4IB 4WDQA 5G4LA 5CP8A 4D5EA 1A4XA 1N5DA 2NYRA 3O4JA 4OHOA 1Y3DE 2G09A 2B25A 4FFDA 2AQKA 5LQNA 4E5DA 1JPUA 5K4GA 2ODTX 2QS9A 2R5NA 3L0OA 4PBTA 1CRLA 4RK4A 5ALLA 4PZEA 1AC5A 3HDYA 4QBFA 3UV7A 2X6RA 1F17A 2LKCA 3I6QA 3OZEA 4N03A 4PLHA 1IN1A 4IOJA 4Q00A 5JS6A 5F1KA 3VI3B 3CEAA 4EA7A 4L1KA 3CCFA 1NQAO 2DBVO 2X6TA 3MJTA 3H5TA 1EVIA 4XUGB 3CR7A 2VH1A 3I52A 2Q6TA 1NAIA 1VSQA 2PTGA 5KSWB 3AZQA 3KQSA 3VBEA 1GL3A 3FSGD 3ZTTA 1B7GO 4MGIR 4A15A 4DLPA 1SZDA 2BV3A 2YNMD 2D0DA 4Y7DA 5LMCA 1PRYA 2IHJA 1OREA 4UEQA 1G8AA 3SM3A 4B3JA 1RMYA 4CUZA 4KPYA 2AK2A 3O03A 1VFPA 2AN4A 2I34A 2QRZA 1E1KA 3K5HA 4MDYA 4QUKA 1ZNWA 4EJ0A 1KDPA 2FW7A 2J48A 2FDRA 3I34X 1ZGJA 1W1IA 1TLTA 1XCOA 1MQ9A 1SBZA 4KFTA 3SCZA 3DMPA 4E4YA 3NWOA 2C8LA 5B4UA 3EX7C 1QMPA 3CURA 1EFRA 1XDWA 2VHCA 4E1AA 2DH6A 3FPBA 5BPFA 1Z5ZA 2WKPA 4YRMA 4B7ZA 1I33A 1ZIOA 1U0SY 2X8AA 1J22A 3KXLA 3L1KA 1W5FA 5D3MA 5I4BA 3H1BA 3UA4A 1SUBA 3EPKA 1XDBA 3ZHXA 4IHQA 1INLA 4JLKA 2ATEA 1PFQA 1U3CA 2PA3A 5JD6A 2F4VB 1H93A 2ZDQA 3IDQA 2C29D 4ZAFA 3S40A 3ZG6A 3RTGA 2OPBA 1RXEA 4OQNA 4IIGA 3WIOA 3KCNA 3NM4A 3W04A 4JSTA 3ESZA 4OA8A 5LWHA 3H8JA 2WWXA 2WKSA 3HVRA 3UMYA 3TZBA 1A5AB 1L7BA 4AKHA 1CS4C 3Q0TA 1H6DA 3IUJA 5LB2A 4G85A 2XCUA 1LWOA 2HO5A 2PGXA 4MTLA 1BH2A 1E2MA 1E62A 2F3UA 3F3SA 4E7PA 5HM6A 2QLNA 1JHUA 5EIEA 5JMOA 1E96A 1K4KA 2X76A 2ZPUA 3F7NA 3T9FA 1AV6A 1Y7IA 5BSMA 3G02A 2AOVA 3T1QA 1ISJA 1J8MF 2N46A 4LC9A 3OQIA 4U3JA 3BF7A 1OXSC 4ASUA 4F4IA 2QDKA 5MF6A 1G9TA 4KLZA 1TT7A 4XLTA 4ZIRA 3D7SA 3MELA 2XMSA 1VG9B 4KO2S 4MR8A 4MI1A 5LXTF 1U8ZA 4R2MA 3HGTA 1Z73A 2C03A 5L6MB 3IAEA 5I9BA 4MVYA 3I53A 1AQYA 1T8PA 4D25A 1F0PA 3ONDA 1P4RA 3W3AA 4RA9A 1P5JA 1U3TA 1W4ZA 2CYCA 3DPSA 3RS3A 3RSQA 2PKCA 1G5IA 1N8NA 3RFFA 1BS1A 1QH1A 3EGXB 5DNCA 8ATCA 4EHFA 3IELA 2XIJA 4QXQA 5GZ6A 4YX9A 1WSDA 2IPMA 4GMDA 3ZTWA 2DRIA 4UAVA 2XQVA 3IP5A 3RVDA 4BMSA 1S1CA 5T67A 1FMJA 2D5LA 4AMUA 1Y8QB 7MHTA 1N32B 2GJ9A 3INYA 1DEXA 1SPXA 2SICE 4HDNB 3S70A 4N3CA 4CIVA 4BQEA 3WL7A 4V1CI 3OG9A 1Z2EA 3AL2A 5P8WA 4WGGA 5A4AA 1EVKA 1XKTA 3FZQA 2EFDB 3LWNA 5BSGA 4XGNA 1JXOA 4RPHA 1ATIA 2D1TA 4ZAZA 3U3MA 3W1EA 1YZHA 2IEBA 1DADA 4UVEA 4RD6A 3LGAA 3JD3A 3NC1C 1JB1A 3A1UA 4RY9A 1FDSA 4R01A 5BORA 3KJIA 4DLLA 3KQVA 1N6HA 4L07A 4MRAA 1OT3A 5JPIA 3VR6A 5HDBB 2XHZA 1ESZA 1IBKB 2HI0A 4ZVKA 3G0BA 3OIWA 1E4EA 1ZJ5A 4N7JA 5AVUA 4E07A 4MUIA 2FWAA 3F49S 4FZJA 1VHWA 9ATCA 2C3PA 1Q0RA 4H0NA 3KQQA 1NBEA 3V7YA 3HCPA 3IOMA 5FXMA 1JQ3A 1M5TA 4JMPA 2A1IA 2G4CA 3G49A 3UK7A 4BPRA 2AJDA 3CVJA 1LBHA 3H75A 1WZNA 3NJRA 1XRNA 4LA4A 4Y6QA 5IC4A 2XZPA 2ZVQX 4O25A 3AF4A 3M81A 4P80A 3WLLA 3BFXA 4X91A 4KQEA 4G81A 2PJRA 3AUKA 2MSDB 4FYHA 1U3UA 4OHWA 3T7SA 1IQ0A 2XB2A 4OY3A 1DBQA 5JCJA 3TQTA 2FMTA 5E1DA 1XL0A 1W0JA 1T5OA 1YV9A 3HCBA 3H4VA 3DZFA 3PDCA 4BGVA 3PD1A 5HKBA 5JEDA 3ZU6A 2EP7A 2WWIA 4B6PA 1UZLA 4JJZA 2XGSA 2RGCA 1MX1A 3MWDA 5JJCA 1PT8A 1KAGA 2XB4A 3DOHA 4IDGA 4UCWA 2QIPA 1N2IA 1NU6A 3FWHA 3CLSC 3EYAA 3NOVA 2DWUA 2JAQA 1P74A 2JHFA 2REXB 2VJKA 2HLNA 4KAXA 4A8PA 5BN3B 1YD7A 3LQ2A 3L9XA 4Y30A 3FBWA 2XNDD 2BUAA 3D6JA 2GJ4A 4NBUA 2ZAOA 4X20A 5CT9A 4A2CA 1X8JA 1XQVA 2TMKA 3IMFA 3OM1A 4MUGA 4ALNA 2I3ZA 1L7NA 2SKCA 4INOA 3NLLA 5AKIA 1J0DA 5EHZA 3DMTA 2QI9C 3EPHA 1QKIA 3RYHA 1IC6A 1SG9A 4O4HA 1OZ0A 1QHEA 4C0LA 1QVWA 2BF4A 1RAGA 1XEWX 2PMBA 4KGXA 3TJZA 3C45A 4F4HA 1DKLA 1Q22A 3R6GA 2J7PD 3SSOA 1FZQA 1QO7A 3ER8A 4CLOA 3GN2A 1U3VA 1XWFA 4YPVA 5KSOA 3TUZC 2C9BA 1PFYA 4BZZA 2W83A 1VDMA 4Y1EA 3AR8A 8GPBA 4K9MA 1EX1A 2IYNA 4BV8A 4AULA 1KVQA 3FSJX 2JAOA 3WGTA 2II6A 3K5PA 3MCAA 3TBKA 1HT1E 1FJHA 4KGVA 4H7JA 3ZE2B 1FLVA 3K4PA 1VIDA 1PNVA 1Z56C 4RUKA 2CCGA 5JAQA 3GXOA 1B76A 1ZOOA 5A02A 1FF9A 5BYJA 2ENUA 1Z36A 5LL6P 2FFJA 4CQLB 3DR3A 4CKCA 3H4IA 2ALJA 2QX4A 4J9UE 3STVA 2CXPA 2J7PA 3QVOA 1LDNA 1TUBB 3P8ZA 4X1KA 5HZKA 3WLIA 1M2OB 4M7PA 1RQGA 4UBLA 4L9RA 3UMGA 3ADKA 1WMAA 5DHAA 3HJFA 2XUIA 4N40A 5C9ZA 3IVRA 1O96B 3QE3A 1QOPB 4MB6A 5CNIA 3EXEA 1I30A 3OZFA 4YRLA 5G41A 2VXBA 3I09A 4E09A 1V4NA 3PQ6A 4YLEA 1TYBE 2N3ZA 1OI2A 3L7YA 5CGQB 1D8TA 4Q9HA 3URMA 3M4XA 3QOXA 4DWJA 3I9JA 4WOKA 4TS3A 3A1DA 5COBA 3ICVA 3L2OB 4QBIA 1YQXA 1FP6A 1IE3A 3A37A 4OA5A 3WMGA 3EYWA 5E9AA 4FC7A 3TB4A 1CT9A 2HFJA 1Z0DA 2BFPA 3E9DA 3EJWA 3F9CA 1MB3A 3O38A 2VQFB 2R96A 4AP9A 1XLVA 1I6KA 3VPHA 4D0LB 1I7SB 5AJXA 3CB4A 3LH5A 3PUIA 1B0AA 1NA5A 2Z1DA 4L6CA 4MYTA 3NRBA 1H22A 5BVHB 1LCIA 1KJ9A 4HQNA 1A9YA 2CJWA 1EVLA 5EJ8A 2WKWA 4DYVA 4CGYA 1ETUA 5CXUA 1L5KA 1EX6A 3ZS9A 4ZGBA 1NMZA 1UMCA 3SLGA 4QPNA 5JQGF 5EGNA 4UKDA 2VS1A 4P0PB 2VDQB 2AJTA 1VXOA 3QUSA 3CFYA 4OVKA 3SK0A 721PA 4E2YA 1PR2A 1FJ2A 1SA0A 2ZIUB 3LUBA 4O8CA 2G0TA 3OQ6A 4BNFA 5IVKA 3FTNA 1U0FA 1Y98A 3B3JA 1A9ZA 1GN8A 1XZKA 2LD4A 3IT1A 1Y9DA 1T0PA 1EHCA 2Q1TA 1NP3A 4FJ0A 2VDKB 4TWRA 2NQTA 4ZVQA 5I7SA 5K0BA 4KVAA 2QG6A 4B0OA 1EINA 1KY3A 2OBBA 2HSDA 1TJ4A 3VR5H 2B4RO 4MJLA 3PT5A 1N0IA 3QFTA 1UUFA 1M8PA 3PL1A 4IIJB 3NAGA 4B73A 1R12A 1RFGE 1YCFA 3JPYA 1W36C 5CA1A 4BRWA 2CFTA 1RJ9B 3GJ7A 3IMGA 1EKXA 1MA0A 3LK6A 3LQFA 4EGFA 2OP1A 2VEOA 3EFOB 3Q9UA 5E3IA 4RHXA 3DLIA 3FAKA 2J07A 3L0BA 4QVKA 1HURA 1PQUA 5KEIA 1A9XA 1RC0A 3LY7A 3P4UA 3VYUB 3ABRB 1MGOA 3MT0A 3A1FA 2GMWA 2ZI6A 3M2PA 4IKOA 3UJ3X 2CVFA 2RGRA 3ZY6A 1B8PA 2YJ5A 3ZI7A 1S8OA 3SJ7A 3Q4GA 1Z62A 4OH1A 1P80A 4LMAA 4YJKA 2DY1A 4GP6A 1SOMA 1Z28A 1Z74A 2I7TA 2J3EA 1L8OA 2Q5FA 2XYQA 1IXZA 2EKZA 2BJHA 4IINA 3RCBA 4DDTA 2JKZA 5EYPA 4QPDA 3BTVA 4NZNA 1G5TA 2XLCA 1V16B 3NXSA 4LJ8A 3SQLA 3TZCA 4ILEA 3PV0A 1FBNA 2O2XA 2YOGA 2ZRMA 3M89A 4TSKA 4OSOA 1K6MA 2DTXA 3A1VA 4YAOA 4Q34A 4CEIB 3CX7A 3NTXA 3UV6A 3U09A 2M1ZA 1VL1A 5JFTA 3K6SA 2XDQA 3D7KA 2V58A 3IXLA 3QLTA 4EZBA 5JYCA 1YA6A 4R3UC 2FEWB 5MGBA 3TTXA 2HSEA 4YCMA 2X14A 2P1DA 2RI1A 3FYUC 3JQRA 4MVJM 4PC3A 3SN6A 1Q3KA 3R4CA 3E61A 4J0KA 2RDMA 4PXSA 1HYHA 3EVBA 3LFHA 1D2RA 1MAVA 1XEFA 4M9UA 2OHXA 2R7NA 1JP7A 3BXZA 1R6DA 3KVRA 5K3BA 3U48A 2FPIB 4MO2A 5K0CA 4BEVA 4MI6A 2R87A 3AEUA 4QASA 2AYZA 3TQRA 1EXDA 1XA4A 2GM9A 3FWNA 3R3SA 1E5VA 2JIZA 4IHKA 4CT0A 2ZRDA 2ZJAA 1WEKA 3K0EA 3KQYA 1BE8A 2VQ6A 3PHIA 2PPVA 3R2JA 4J1QA 1KIFA 3GAAA 4PQEA 1DI0A 1FX0A 4QXAA 1A72A 1PT5A 4Y2SA 4WFKA 1C1DA 1RKVA 3OJXA 4UUBA 3KFXA 1L7AA 4HV4A 4S04A 1ZH0A 1BQ3A 2RD2A 4WZBE 4WXMA 3GEEA 3WA6A 4JOQA 5J4LA 1ZY2A 3IH5A 5TVKA 2OHVA 3HM9A 4KHPB 1TLFA 3QE0A 4X7BA 5K8TA 3FGPA 2FXIA 2VPQA 2CNBA 5AIAA 5FL3A 3HPQA 1C14A 4QQFA 5AXAA 2R62A 4YUZA 5HFNA 5IC6A 4AXXA 3I1YA 3NUZA 3MWDB 3WHKA 1DRWA 1RM3A 2XNCA 1GCOA 1O4WA 2BIFA 2O8VA 1QIMA 2YY7A 2HU5A 2Z5GA 4BXOA 1UXIA 3VQTA 3MCZA 5EPOA 3KUKA 1QLHA 2Y1XA 5JVDA 4QFDA 4DR5B 3E7PA 1R8SA 3IBTA 2HDWA 4KBFA 1ONNA 2GPBA 4QUJA 1V37A 1FYEA 1F1JA 1K1EA 2KB0A 2X1VA 1ZGCA 3C4VA 3CRQA 2SECE 2A33A 3Q3HA 5DPMA 3GEHA 4KQFA 1YFLA 1XF9A 3EGIA 1LDGA 3QXGA 3LUGA 1V43A 2NSYA 3G79A 5HCUA 3CE9A 3THSA 4A73A 5IDXA 5KWSA 2QR3A 2W2TA 4TZ6A 1ZSVA 1Q16A 3HU2A 1N2OA 3LHDA 2B5VA 1J23A 3QFHA 3OQBA 2QQ5A 1P9NA 2QX6A 5FUQA 1EZZA 1NYQA 3S8MA 3TCXB 3KVYA 1GTL1 1X7GA 2IYVA 2RGUA 3H9JA 4X8OA 4PN7A 1COWD 2IYZA 4EZEA 1L1RA 2AQIA 3C1OA 4LHVA 3CVVA 3RTCA 2H63A 1GJRA 2EXXA 5H4HA 1T2NA 3A6ZA 3EWNA 2BHNA 2QRUA 2CZQA 2Q5JA 3GN1A 4MI9A 5AQEA 4X24A 3IEVA 2FY8A 4CMKA 2H00A 1H6AA 2QN8A 4D9HA 4I1VA 4GGOA 4X61A 3CBQA 3PXEA 1KNQA 3N2ZB 4MIOA 4URHA 2P3QA 3TLEA 5B1SA 5KOHA 3FOEC 1TVEA 5GJBA 2H31A 3I9LA 5F73A 1WEHA 3AINA 4OYHA 3ZXXA 1Z0UA 3QBEA 3UWPA 2ZULA 4B43A 4ENPA 3ACCA 5B12A 1A8PA 1V95A 1JTEA 5JZVA 1QYWA 1N5JA 4Z7JA 1SBCA 3NHPA 1ZI8A 4GDMA 3AXSA 2FPPB 2Q3JA 5ICSA 1NVBA 4F5ZA 2R6DA 3GI1A 3IP6A 2DWQA 3ZYCA 1GRNA 3MJFA 1ML4A 3G68A 3NMUF 1Y5RA 1ZUIA 3M0EA 5CFOA 4FDTA 1VIMA 3KJEA 4PC6A 2XDAA 2CJXA 5J2UA 4QGFA 3C43A 5TX7A 1X7HA 3D64A 3U1BA 5AUNB 3MQFA 2F90A 3IE1A 4B79A 2ZTHA 4OQEA 1GIAA 2VNKA 5BNWA 4RYLA 4LV8B 1ONBA 1AKMA 5DO9A 3SQNA 2X9LA 4EVRA 1QFJA 3IUMA 4OKNA 4N8SA 2MWMA 4D5GA 2I5PO 1D04A 1R4AA 1SKYB 3AT1A 1JMVA 2DB3A 1SUWA 1E4YA 3QRWA 2GEUA 5DI9A 1DTWA 1BYIA 1HM5A 4DB4A 2YN0A 6ABPA 2DTEA 1E7SA 1EDOA 1GA1A 4A27A 1BC5A 1NI5A 4KRYA 1W73A 4R4JA 3WJ7A 1J1UA 4AXBA 2AKYA 5B3JC 1N6IA 4J2HA 4U7TB 4ZQFA 1XEWY 2Q3LA 3H5VA 2C94A 3OMLA 4L0MA 1VLHA 3L6RA 1QDUA 5DGHA 1RWNA 5LJLA 1B6GA 3WBBA 2OZKA 3KZ1E 2BC9A 1MGPA 4QYXA 5DV9A 3T1VA 1WD7A 4V39A 3RSGA 1VA4A 4MOWA 2QTRA 3TXAA 3W90A 1YB1A 1PQYA 3NEYA 2Z5VA 3CWZA 2Q4DA 3D0RA 3VO8A 1IXSB 1G63A 1W9MA 2Q1UA 3PLNA 3MWEA 2YNMA 2QX8A 5DTEA 4TT3A 2SCUB 1L7RA 2QMEA 3VTAA 1E1LA 1KQOA 2ZB3A 3V4OA 4MQFB 2JARA 3IUPA 3RVBA 4DBLE 5BN4A 2K7ZA 1SCIA 4IPTA 4BNDA 5FBLB 2R7MA 2I6UA 3TFQA 1DMSA 4BGUA 3LCMA 1OC4A 4PONA 4XH9B 5I9SA 7ADHA 4GL2A 3SXJA 3ABOB 3IFSA 4PGGA 3ZIAA 3TIXB 4BRSA 1XFAA 2PZGA 4P9NA 2CXQA 1BFKA 4IRXA 2X0DA 2IBTA 3P4XA 3WMWA 4QQ8A 1YBHA 2HQ1A 2WHPB 2XADA 4US1R 3TDKA 4UOZA 4JX9A 4WJLA 1E60A 3DDSA 3K0AB 1C7QA 1WCYA 4Q3DA 1GZ4A 3Q12A 3V55A 4POOA 5ICFA 1WG8A 2QSUA 2QT0A 2JLVA 2I7XA 3GJ6A 3LPCA 4EEKA 1R0WA 2O3JA 3L18A 4C5AA 4HAZA 2C2MA 1OZGA 3IPCA 1HNZB 2DUNA 4NZMA 3EDMA 5FD8A 2B8NA 2ILVA 2I4IA 1ZD4A 3K9HA 4F8EA 3C16C 2EBUA 7MDHA 4J90A 4NCHA 5CM8B 4K9DA 3COPA 3LC7O 5FUBA 2GBCA 2OESA 3C8ZA 3OTWA 1YE3A 4FFRA 1YQDA 4WEOA 2R7KA 1FSPA 1T9DA 2F8TA 4GMKA 3H9CA 3OX3A 3D6AA 4NS1A 1UQUA 5BW4A 4B71A 1NVGA 1DX6A 3O8QA 3LG2A 2HCFA 3JQ9C 2Y99A 4U1RA 3LKBA 3Q3GE 1O89A 2J46A 4ZO6A 3CG0A 2HNAA 4HVAA 4R2KA 2YV2A 3L8EA 3DCJA 4BCDA 1B15A 3TD2A 4PSCA 2QUAA 3HXTA 4M53A 3TCKA 4QOEA 4FHEA 3FFBA 2VNHA 3ND9A 1H2ZA 1WY5A 1EVJA 3LUKA 4FNMA 1ECLA 4OGGA 2XQGA 3ELDA 4DNPA 2VHWA 2R1VB 3H9EO 1E6WA 1LV8A 1RI3A 1G60A 2H51A 2QVBA 2R65A 3A05A 5JC8A 2R79A 3W3AD 4ARVA 3GELA 2OSBA 5KKAA 4EJSB 1XTKA 1M33A 4R9UC 2OFOA 1G2IA 4QDZA 4XEHA 1S89A 4V0MA 2FWIA 2AEJA 2QZJA 1ADCA 1GYQA 1LZKA 1N2CB 3NIDB 4DTIA 4DQ0A 3P9PA 4RLFA 3QOYA 3P26A 1I3OA 1CW2B 4FTWA 5SY4A 3BILA 4EQ6A 1J5XA 1JHRA 1QXSA 2GK3A 3F1LA 4GQAA 2QYHA 3WBJA 5F7XA 1TZMA 3E9ZA 1B8NA 1TVKB 5LIPA 1IY9A 3C85A 5FLKA 2IUFA 1C41A 2WU0A 4R0MA 5A1TA 5GIPE 1V0JA 1N2HA 2WP0A 1TKCA 3JAKA 2M1XA 5FUMA 2CK3A 2L18A 1N3IA 2IX9A 3B6KA 1JDNA 1YE5A 2AN3A 1SKQA 1K5HA 3RVQA 4EYKA 4J0HA 3CONA 9LDTA 4L51A 5AO9A 3ST7A 5JW6A 3W8DA 3S1SA 2XWPA 4N48A 4MWCA 5KYYA 3FWZA 5CFRA 1I7DA 5AW2A 3QEAZ 1DIAA 2IL1A 3N59A 3UYLA 2VK1A 5LCXA 4Z6KA 2Q45A 2G9NA 1CG6A 1GKUB 3PQDA 3VU8A 2J3HA 1GSIA 3AF6A 1XLUA 1LUAA 2V6JA 1CQPA 5CNKA 2MT9A 3O2NA 4DCTA 3T5GA 4D9NA 1Z6PA 4JB8A 3ZV5A 1F5NA 1XQ1A 3DVSX 4PFQA 2H59A 3IT3A 2R66A 5G02A 1FMCA 4B2PA 2G5CA 4F8JA 3CH4B 4RJTA 4ZDJA 3KSAC 5FR1A 2JLBA 3ZQ4A 3OCUA 4BMZA 4UTNA 3HO1A 2G25A 2OV2A 3NP7A 3BGDA 3QMPA 1OFTA 2AG8A 4JLDA 5B6IA 5CVTA 3LK7A 4DIFA 4DOMA 5EZ5A 3K8OE 4F3KA 2W2NA 4DA4A 3HUTA 1JEJA 1SM4A 4OAPA 1BAPA 2RIPA 1TI7A 4IOKA 1P9WA 2JFPA 2WSBA 4ZU1X 3LRPA 1F9AA 1QFSA 4KCGA 2H52A 2QN9A 4IL5A 3LL7A 4G25A 2C98A 4OQQA 1L3CA 4CMJA 4EB6A 2ST1A 4HFMA 2XYGA 4M55A 1DG3A 5D84A 1HR0B 1C8LA 1R15A 4AX4A 4E22A 4RIFA 2B2XA 2VT3A 3R0QA 1TIPA 3P5SA 4CCAA 1T36B 4C78A 1ODSA 3OQNA 4RZ2A 3A6LA 1EWKA 2X2FA 3NGLA 5KPDA 4J0QA 3BVPA 1LPBB 3MHPA 5CD1A 1L5NA 4OQLA 1NN3A 4Y2VA 1ZOIA 4DR4B 4OHXA 2J08A 5AW5A 3PUWA 4R1LA 4JN6B 1JJBA 3BWYA 3ITEA 3G0IA 1AKVA 2PBRA 3EXFA 4I1SA 2P7HA 1A71A 4G26A 3KYCA 4NCXA 3VKHA 2OAQ1 1AJEA 1JFSA 2A14A 4MCIA 3IODA 1W4BA 3CNHA 2RI6A 2Q7OE 2W48A 2A5LA 3DZIA 2FZEA 4NAVA 4UM9D 1HE8B 3HHEA 2CDRA 5H80A 5M29A 5IRCD 4KLCA 5FWAA 2K6GA 2V54A 2AT1A 1N1MA 3ASYA 3EDYA 1Z0KA 2VL7A 1XTSA 2VTEA 2XECA 3LY8A 4MS4A 4RVOA 3W8FA 3U4MA 1TYCA 2IGTA 2OCLA 3LLCA 4F84A 1GXSA 1Z0JA 1UKVY 2WJHA 1U2PA 1BJRE 1L3IA 3HWRA 4MI3A 3EA5A 3DF7A 1WD5A 4R69A 5JAOA 3ZCUA 4RU1A 3ZGZA 1O58A 3CT6A 1HMYA 3HDHA 3ILXA 3DE1X 3UHFA 3DL0A 4BTEA 2ZR7A 3UWOA 4TM8A 4Q4DA 1FP7A 3AWDA 4G1VA 3I04A 4BVGA 3EH2A 3GRPA 1R50A 3FHLA 5EQTA 2ZGVA 3WS7A 4YCLA 4DYHA 3UUGA 3SFZA 1G20A 4X45A 3PXGA 1D09A 4ALJA 3KHTA 3JCZA 5L95A 1VBFA 3D4BA 3PWTA 3PVZA 2J3QA 2YZ2A 4HDAA 4C7JA 1TU3A 3BG5A 2XE4A 2QAIA 2IXDA 3QLJA 3BWBA 1G2PA 1CIPA 5HXAA 1V8FA 2ZM5A 3DZJA 1YZTA 3SIXA 1CUGA