3MSXA

Crystal structure of rhoa.gdp.mgf3 in complex with gap domain of arhgap20
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
177
structure length
177
Chain Sequence
b'IRKKLVIVGDGACGKTCLLIVNSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming protein RhoA
publication title Mechanism of molecular specificity of RhoGAP domains towards small GTPases of RhoA family.
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 60
structure length 177
sequence length 177
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3msxA00
1KI9A 1J8MF 4LJ6A 4UJ5A 2ORWA 1XD9A 3VR4A 2ZE8A 2IS2A 1E2EA 1KI4A 1US8A 2Q3HA 4YXWD 2NO1A 4IFEA 5FBRB 5KUTA 3CBQA 1LY1A 3AUYA 1YZKA 2DB3A 3RABA 3PENA 4IFBA 3THWA 2E9SA 2PH1A 2PLFA 1IN7A 4MUAA 1YHNA 4PQRA 4PC3A 5E7MA 4BFVA 1E3MA 4L8GA 4M1OA 1L4YA 1L2TA 5FPSA 1CTQA 5JS8A 4Q1CA 2D7CA 1IM2A 4LRWA 2J0SA 4LJ8A 1II9A 5DIFA 3RNLA 2BM1A 3DM9B 1CJMA 1U90A 3MWLA 4D2IA 1DAGA 1DBSA 2CE7A 3B5JA 3GFTA 3UG7A 3LO5A 4BLOA 3N2EA 1S2MA 1MH1A 2FE4A 1W4CA 2FFQA 2GCPA 2ZYVX 4LYFA 4Z1MA 4Q18A 4WBSA 2IEZA 2PL3A 4RD2A 1XPRA 2GTPA 3T1TA 4TL8A 2C04A 1VHTA 1H65A 3IQXA 4YMSA 1GUAA 4OJKA 4PX9A 3FTQA 2VA8A 3C5HA 1G291 4Q03A 4JBYA 1KSFX 4JJZA 3SS8A 3VNUA 2NQ2C 1OT3A 1S3GA 3K0EA 2O8EA 1W0JA 4LWZA 3Q85A 1OXUA 2OCYC 1Z0AA 2VQSA 2Y8EA 4XVUA 4ZO4A 1HV8A 5CB8A 3W6OA 3I5XA 1HUQA 5CM9C 4G5RA 3QKRB 3T35A 1XTJA 3LH5A 4NYJQ 3SJAA 5DHFA 2OT3B 4BWYA 3HYTA 3ZZ0A 4YC7A 3UWOA 2QU8A 4JLKA 3EPHA 4N1AA 4TLAA 1AS0A 2WOOA 5TMPA 3ZH9B 2DWOA 1D9ZA 4AD8A 4O25A 3S1AB 2QORA 3AH8A 2VO1A 3AVPA 1XRJA 4KFSA 4F4JA 4RKFA 5SZJA 1G19A 4Q4AB 3RS7A 1XD8A 2RGXA 3NBZC 1KNQA 2GXQA 5FPTA 3OZXA 3IEVA 3L0SA 4ZPXA 3R20A 4JSTA 1X3SA 2GF0A 2GXSA 1VCIA 2H1LA 4BE7B 1P61B 1XEWX 4CZ2A 2ZS8A 2WJIA 3A36A 4A0GA 4DEXA 5FPKA 1SULA 4PHHA 5F2EA 5FUVA 2I3BA 2BDTA 1E98A 2OUKA 3SDZA 1E94E 3GLFE 5DHAA 5ELXA 3FHOA 5FTJA 2I1QA 1ZINA 1C9KA 5CLQA 3H4MA 3ZZTA 3RLFA 2ZAMA 2NOAA 1T8UA 4TLDA 4ASUD 1IN5A 3EC2A 3IPYA 3W8NA 3LVRE 2IXGA 2O8BB 2FZLA 1XXHB 4D82A 2WWWA 3OIYA 3GPLA 3NHAA 1G5RA 1ZW6A 4QJ5A 4XD7D 4DDUA 2AWNA 1JB1A 2CLCX 4NHOA 4PHGA 1XZQA 2BMFA 4XIGS 4CEHB 1HQCA 4A92A 1N6RA 3OAAD 4LHZA 1E2GA 4AYWA 1G3RA 4PHTA 4DB4A 4RZUA 4DVGA 5DN6D 1G9XA 1TF2A 3KFXA 2V55B 4Q9HA 3TIFA 3I3SR 3W5IA 4JMPA 3QXXA 4Q1EA 4DCTA 3OEEA 4B74A 1IN8A 2R2AA 1Z6YA 2P6UA 3GP8A 5BW8A 1GRQA 1UBCA 4DJTA 3R7WA 1XU4A 4P4SB 1AM4D 1U81A 1V43A 2J0UA 4NYJR 4P3YA 3EZFA 3HPQA 2IYLD 3LY5A 4P4UA 3N2IA 4G3XA 5EP1A 4I1OA 1A1VA 4RVCA 3D31A 1UBFA 3EPLA 2WSSD 3BAFA 4R2HA 3BXZA 3A8TA 1XTQA 1Q57A 3VX4A 4TLBA 4X8LA 1KY2A 4MRVA 2GF9A 4LI0A 3HYRA 3VR6A 1AGPA 2ZYUX 3PQCA 2GEDA 2DHRA 4XOIA 1OF1A 4Q9JA 3KKOA 4Q7LA 2JGNA 3LNCA 1CR0A 3K09C 1W4BA 3QF7A 3H86A 2Q6TA 2G0TA 1FUUA 5CM8B 2FOLA 3KKNA 5EUQB 3QF4A 2ZR0A 1XJQA 4ZCMA 5LPNA 1KY3A 3VHLB 2AL7A 4NPHA 1UKVY 1KKLA 4LDJA 2VRWA 3REFA 2AD5A 1SVOA 4QNRA 2UKDA 3Q7QA 4G5GA 4PFSA 5C46F 2JCSA 2WKPA 3GLGE 4JLDA 3E5HA 1II8B 2ZRCA 1H8HD 2B92A 2ZR9A 4TN1A 2J0QA 2OCAA 4LOAA 4XVQA 2WJHA 4AY2A 2C99A 1DG3A 3VX3A 4IDHA 5JCPA 3BGWA 4IDNA 2QMOA 4YONB 4L15A 5TXGA 1I2MA 5EE3A 1CIPA 5KDOA 3K0CA 1G16A 1E9EA 1OH8A 4PPGA 4Z8YA 1FP6A 2PCJA 1G6OA 3DOEA 3MAAC 5BXQC 3CPEA 4UXHA 1MO4A 3OAAA 1E69A 1CKEA 1OXSC 2ZR7A 2C5LA 5BN3A 3B82A 1GTVA 5G3ZA 5L3QA 4V0ME 1S9DA 4WAUA 4DSNA 4M1MA 4M1YA 2D74A 1HT2E 4AC9A 4C0BA 4EKDA 1U0LA 2QAJA 4QJ3A 4GP7A 5LB2A 3SI7A 1NNEA 2B8TA 3L0IB 5H8WA 1KI6A 2A9KA 2V6JA 3CRMA 2FWRA 1N6KA 4US2R 1E2MA 1XXHE 4A8JC 1KGDA 2WSSA 2ZU0C 3MD0A 2QQ0A 4LC0A 2XZLA 5JFGA 2JASA 1U0JA 1A2KC 4GBMA 2Z83A 4HB0A 3KQNA 5KDLA 1NKTA 1OSNA 3I61A 4M9ZA 2QT0A 4KV9A 4M1KA 1KMHB 5AJVB 4B2LA 3M6AA 4L16A 2BC9A 3TUJC 4RY2A 2IS1A 5FFMA 3NEJA 4IHQA 2ZSFA 1U9IC 4TZ6A 2Z5FA 1ZC3A 2EQBA 1P2UA 2ANCA 1I4LD 3EASA 3SR0A 5EP2A 5CYPA 4HLDA 2WAXA 2BJWA 2JLRA 2JJ1A 3U3OA 2YWFA 5BWMA 2CHGA 4ZI2A 4Q02A 1P9WA 3RRMA 3GLIB 5J4VA 1G1MA 2FDCA 1CJVC 3EXAA 3GJ3A 5KNDA 4DCNA 4WOPA 2NO7A 5IF9A 2C96A 3AVYA 1VYVA 4D4JA 4YLGA 2YWGA 3L2OB 1E2NA 4Q9IA 3U3MA 4QHSA 4LV5B 1E0JA 1ZUIA 3B1ZA 4BQSA 3UIEA 5DYIA 1N5KA 2QPOA 3E1SA 5C1BA 2WIBA 5EXSA 5JLJA 2QE7A 4IEEA 5FPHA 1MO6A 4QHTA 1XMVA 2IYTA 2IYXA 3NBXX 4RFSA 3A1TA 4ZKEA 4B33A 2ODWA 1ESMA 1F2TA 2AX4A 2H16A 5FOTA 4LK2A 1TQ4A 2HLDA 2OO7A 1SXJB 1PJRA 4Q01A 2IX3A 5K8TA 1WBBA 3RS3A 3GLHE 3AVUA 5D3MB 2XB2A 1CR1A 5J40A 1KJYA 2Q9BA 2ZVQX 3KXKA 1VECA 2O8FB 1UDXA 2YWHA 2Z4SA 3SBEA 3CM0A 3KJGA 4G1UC 3CX8A 4QM7A 4DLWA 4TWZA 1RYHA 2NZJA 1VHLA 2FA9A 2VF7A 3IPXA 1P60A 4LJAA 1U99A 4G5OA 1Q1ZA 1KJWA 3LBIA 3TW4A 3FE2A 4AG6A 2HT6A 4BZQA 4B2IA 1T5LA 1W36B 2OE2A 4NCNA 4Q1BA 2X2EA 3U61B 3QKUA 1ZC4A 5CB6A 2ODBA 4Q4JA 3CKLA 3GMTA 2REXB 3B1WA 3THOA 4B3BA 3AF4A 1LVGA 3TW8B 4MQBA 2QRNA 1NY6A 3AKCA 1ZNYA 4EFLA 2ZI9A 1IY1A 5AUPB 1E2HA 2XITA 3BJIC 1E32A 4FI3C 2B8WA 5AJZA 2YOFA 4G0NA 4URUR 1RJ9A 1KDRA 2FEMA 2GCOA 1JR3E 4DC9A 2IS6A 2IF2A 3V4RA 4BEBA 3B1XA 1G8YA 4UQOA 4JKIA 2W2VA 1CBUA 4A2WA 1LV7A 4I99A 2IYVA 1Z0KA 4MITA 2QA5A 4LX0A 3TMKA 5DH9A 2VSXA 5KSPA 4BFUA 3TQFA 2FFHA 3QPUA 1T9HA 4MKHA 4S2EA 4AKGA 2O0JA 5FBLB 4G5SA 4ZDJA 4TT3A 1OXVA 3JVUA 4KFTA 5L3SB 1L7VC 2OXCA 2VEDA 3NDPA 3IIMA 3PUWA 1W4RA 3R8CA 2QUZA 2BKEA 3QBTA 4PANA 1XZPA 2ATVA 4GPTA 3T1VA 5A4JA 3K70D 1DAFA 3W3AA 3C14C 5CDFE 3IUYA 4DDTA 2CK3D 4TYWA 2WBLC 2AHOA 1G5PA 2ZQ5A 4ARZA 3AKDA 4H1UA 2P6NA 4P31A 1W0KD 3AUXA 4O0MA 5TV2A 3ZVRA 1SHZA 5FBQB 5ANRB 1EFCA 4M21A 3W5JA 1FL9A 3ETLA 4OQXA 4XSGA 3BH0A 3QQ5A 3LAWA 1XPUA 2F3RA 1SHKA 5IRCD 2XJ4A 1XBTA 3TAHA 2O8DA 1Q21A 4EPXA 2W83A 1E2JA 1G7TA 1HA3A 1DELA 1R8SA 1DAKA 2FGJA 2AWOA 4CIDA 1E0SA 2WKRA 1ZUNB 4BECA 2WZQA 1ANKA 2OHFA 4I1UA 3AGPA 3PXGA 2F43B 5H68A 2IYZA 4BRUA 4PQFA 5EZ6B 3A6PC 4EJSB 1KSGA 3A37A 2HXYA 3LWNA 1T5IA 2X19A 1QVRA 2ZJAA 4K81B 4XTRA 1E79A 2WTUA 1NBMA 3FWYA 1SXJE 5C4MA 4LCBA 1NVWQ 2H18A 3CONA 4LV8B 1OJLA 5EE9A 1NN5A 3VTKA 2QROA 4DT1B 3ZIAD 2R65A 2ZS7A 1QHHB 1RRGA 3SEAA 1EWRA 1TUIA 2W0MA 1M7HA 3CO5A 3D8BA 1PV4A 1TTTA 3BB3A 2FPLA 2FSHA 4Y0AA 2AN9A 2ZSAA 2UVQA 4YMVA 3AVXA 3VR2A 2EYUA 5KU1A 1TEXA 1PZNA 2F9MA 1SVIA 2HJGA 4G01B 5P21A 4TMTA 5UKDA 5KHOC 2GAAA 4CDGA 3UXMA 1X6VA 1PLKA 1S0UA 3IHWA 5HKKD 3KB1A 1I4TD 5HE9A 2ZRFA 3NWJA 1VCOA 4LBZA 1E1RD 4W5HA 4DUGA 3O8CA 4XH9B 3TH5A 4UJ3A 5FTLA 2B7CA 5GVSA 1Z2CA 1G7RA 4IRUB 4BZXA 121PA 3ZYCA 4QGAA 1GG2A 2F9LA 2DWPA 3CNOA 3OE7A 1Z0JA 5F3WB 4B44A 4DEYA 3I72A 1XCPA 2GKSA 4GOKA 2ZRMA 3E70C 5KYKA 2NIPA 4HLUA 3B8HA 1EESA 5CJPA 1D2MA 1ZM7A 221PA 1IONA 1W5TA 4TSFA 3FGNA 1D2NA 2WWXA 1R5BA 1SXJC 4Q1DA 4Q7KA 3J81k 3SC3A 1IXRC 4E5UA 2A3RA 3BB1A 3THYA 1WB9A 3PJRA 1P3JA 2DFLA 1W5SA 2WMOB 4AWXA 1OH7A 2IYRA 1W0KA 4BLRA 1OFTA 4A36A 4XTCS 2ODNA 2DCUA 1KO7A 2ZI6A 4R2IA 3RS4A 6Q21A 4DDWA 2FJUA 3P4XA 1KHTA 2GETA 4C7OB 1U8AA 1UDWA 4RD1A 4RZ3A 3W9YA 1IBRA 1JXMA 4DIDA 3K0FB 1W36C 3C4JA 1D2EA 1QHIA 1VPLA 1BKDR 1YZGA 1NG9A 1F2UB 1MT0A 4LYJA 1JEDA 4M9QA 4OK3A 2BEKA 1XJCA 3NH9A 5HR5A 3ICQB 1S3SA 2JLWA 5HZKA 1Q3HA 2D3WA 3HJNA 1R0XA 1GKYA 3MWYW 3ZQ6A 3DZDA 2KE5A 1W4AA 3QPVA 5D3QA 3ADCA 4IOJA 3TE6A 5KPJA 4DSUA 5FI1B 1KNXA 1N5LA 2CXXA 4JS0A 5A0FA 4MDFA 2J7PD 2JJ2A 4CEIB 3ZIAA 2G83A 3G5UA 3GCGA 4HAUA 2XNDD 1UKZA 4TYQA 2GEUA 5KNBA 4EPYA 3PG5A 4US0R 4PC1A 2XB4A 3G82C 1WF3A 1XD2A 4ILEA 5FTMA 1KDOA 2F3TA 1UBGA 4Z51A 1Y63A 3A4LA 3PIRA 5EJEA 1G7CA 1Z29A 2FFAA 2L0XA 4JYBA 3TSOA 4MDEA 2QMUA 3PEVA 4JLPA 1XF9A 2LKCA 5CJ2A 2ZSEA 4KXFB 1T3LA 1O87A 3K0AB 2PT7A 2VP4A 2KBFA 1FMLA 4QBFA 4D81A 4XWOA 1KDTA 4KFRA 2X2FA 3WHKA 1E1RA 1YR7A 1YZUA 3BE4A 2D4HA 4IXNA 1DEKA 2N1BA 4OHXA 1BYUA 1X8JA 3GJ7A 4MA4A 1LW7A 3A4NA 4DHEA 1KZ7B 3ZZUA 2GWHA 3SQWA 1Z06A 4PAOA 2CNWA 3HR8A 2H92A 5H70A 2ZRGA 1JAHA 2QP3A 2W6JD 3ZVNA 2ZI4A 4HUQA 2FSFA 1NVUQ 1GL7A 2VP0A 3A1WA 1W48A 1UPTA 1US8B 1GNRA 2GILA 3AF3A 3PUZA 5KTYA 1OHHA 4QFMA 2YINC 3NVAA 1FX0A 4O2RA 4U5XA 1DO2A 1K6MA 1OIXA 1R0WA 1E4VA 1GOTA 5BYJA 3LX8A 3RRNA 1DPFA 1TEVA 3EA0A 3KQKA 4QGHA 2F1IA 2QGZA 1F5NA 1EX6A 4ZI3A 5KPDA 2R6AA 2V6IA 1EFRA 4EUNA 5DE3A 4FW9A 4MRRA 3PUYA 3K70C 1YQTA 2N42A 4FD2A 4QJ4A 2ZRBA 1JR6A 2AXPA 1KO4A 4K46A 3UMFA 4CW7A 3QBVA 4DB2A 1PLLA 3QKSA 1GRNA 1XTSA 1FMJA 2P5TB 1P73A 2YHSA 1DADA 3HU3A 2QRZA 3MRSA 4D0NA 3EA5A 3TR5A 1KSHA 1YR6A 4HDOB 1QVAA 3FMIA 4A1FA 1S1MA 2O0HA 1QG2A 2FZ4A 3A1UA 1DAMA 4MRNA 2D06A 4IXMA 3NKVA 4TYYA 2R9VA 1XEFA 2XAUA 1YR9A 2ZITA 2V54A 4B75A 8OHMA 2ZEJA 4DLSA 1T0HB 3EPJA 1YJ5A 1TUEA 4LYAA 1AS2A 5JRJA 2A5DA 2VPPA 3FFAA 1MRNA 2HF8A 2OFWA 4GSYA 4B76A 1JALA 1Z0FA 4QL3A 2WWIA 3BH7A 4OI4A 3BERA 3GLFA 2LCFA 2NO0A 4I4LA 2GJSA 3K0SA 3QEJA 721PA 1ZM4A 2RGGA 3ZS9A 3F0TA 3QPWA 1N6PA 3I8XA 3K9NA 1BMFD 3LLUA 4A4DA 2MSCB 4KCGA 1P62B 2KBEA 2GBLC 2UZ3A 2IWRA 2QAGC 4WW0A 1N6OA 1Q1BA 3K09A 3I4LA 3ADBA 1XNJA 4Q5IA 2QP4A 4DLXA 5J4HA 1J8YF 3KTAA 2X8AA 2ORVA 1W2HA 4GNKA 4LPKA 5C2JB 1VYUA 1NF3A 2W6JA 1J70A 4UXIA 3W90A 2ZJZA 3VKHA 1F6BA 1FQKA 1DO0A 3AM1A 5HPYB 3GJ0A 4OBEA 3U44B 1P5ZB 2ZJ8A 3X1YA 3ZQJA 3EPKA 1PVOA 2H5EA 3QG5A 3EX7C 2ZE7A 1G8GA 3KQLA 3B6EA 5H1YA 1JJ7A 2PCLA 4PPNA 1M8PA 1COWA 1GL6A 5F98A 3FKQA 5L3RA 2J45A 4HAVA 4C0LA 1LFDB 1E4YA 4PZZA 3WY9A 1M6NA 1D5CA 1XEXA 3SJBA 1NJGA 4JLAA 1E99A 2JLYA 1ZNXA 3LDAA 4TYNA 4F7WA 1C4OA 2J0UB 1QHGA 3MGCA 4JJKA 3GLIA 2DFTA 2REBA 2FG5A 1AS3A 5AK0A 1N6HA 5BN4A 3UANA 4YXWA 2RCNA 3X1ZA 4Z54A 621PA 5BYKA 3RSLA 1LF0A 1U8ZA 2G88A 2OCBA 4JL5A 4Q19A 1R8QA 4Q9KA 4BEJA 1ZVQA 2PMDA 2A5JA 3P4YA 4HAXA 3GLGA 4AKIA 2RGNC 5EP4A 1XTKA 4U00A 1KOFA 2NMVA 4WA7A 5AJWA 3VMFA 4A8JA 5EE0A 1CP2A 1Z0IA 1RZ3A 1XWIA 3HR7A 3LXRA 1OB5A 1TU4A 4KI0A 1G64A 2WJVA 2ZYTX 1B23P 4BLTA 4F91B 2F6RA 2F1RA 2QQEA 4FCWA 5J4YA 2CLDX 1ZNWA 4TQUS 1GIAA 1BMFA 3AVOA 5BQ5A 4M53A 4YMWA 2ZI3A 1W49A 1KKMA 2GJ9A 2EYQA 2OSBA 1WBDA 1P2SA 2NO9A 1XMIA 2XZPA 1L8QA 4W5JA 1U9IA 1U2RA 1Y3AA 4OI2A 4B3XA 3PUXA 2FSIA 3I62A 3CUEF 4TMKA 1SVSA 4JL8A 3IHLA 1OKKD 3VU9A 1E2QA 4V0MA 2V9PA 2W0SA 4B6EA 3PEWA 3A1VA 2HF9A 1IAQA 1RRFA 5FR2A 2F55A 4B3FX 3AKYA 4OQNA 4B3DA 4HDCA 1G6HA 2GJ8A 2PJZA 5FOSA 2OCPA 1FTNA 2AKAB 4C2TA 2ORIA 2J1LA 1QF9A 3NC0C 1KIMA 4UNSA 1UM8A 1IJEA 2O8BA 1AIPA 1EX7A 1XXHA 2CVHA 2OZEA 1HE1C 1FP7A 5JJLA 1HE8B 1UF9A 2GZDA 2CL0X 3KL4A 5GVRA 4CEHA 4OYHA 5L3QB 4NP6A 3RHFA 4WZBE 3RYTC 1G3IA 2BM0A 3KKMA 1D8TA 4LHXA 2F1JA 2WMNB 1R4AA 3U7EB 1T6NA 1WQ1R 3BOSA 2IUTA 2ZJYA 1QHXA 1MKYA 4WVFA 2QENA 4JLMA 3MFYA 1JR3D 1KAGA 1HQYE 3BORA 4ASUA 3RSOA 2ZRKA 3CX6A 1MABA 1YVDA 5HTKA 1EWQA 2DFNA 3CLVA 4IDOA 4XSHA 4GOJA 4XD7A 1CJUC 3T5DA 1W1WA 3SQXA 2NGRA 1E2LA 3B85A 3TVDA 1JECA 3UPUA 4CF7A 1U98A 1E2DA 4DLUA 2XOKD 5DN6A 4Q1FA 3K9GA 2R6FA 2GRJA 1AA9A 2DR3A 4F38A 1CU1A 4C30A 3MCAA 3O47A 1BS1A 5C4GB 2BBOA 5LD2B 3NHBA 4B3GA 1GM5A 1QHYA 2YYZA 4MGKR 5CLLA 3NG1A 3Q5DA 2X77A 2ZJBA 3BFXA 3DOFA 4LC1A 4NCKA 4LSGA 4GL2A 1N0UA 4KSCA 1GITA 2AFIE 2IHBA 3EZ7A 3LBNA 4P0TA 3IIJA 5EXPA 5HE8A 5TVKA 3BFKA 1M74A 4BLPA 3GLHA 2IUUA 5FL7D 1Q20A 1RC8A 2J59A 2VIIA 3FKSD 1NN3A 3GEEA 2C78A 1TPZA 2VSOA 2ODEA 1MOZA 3CZPA 3CWQA 5DO9A 4BLQA 1DTSA 4LYHA 3CW2A 3U2QA 4RFSB 4JLJA 1ETUA 2HYIC 1BIFA 1P9RA 1F2TB 2GZHA 3H1TA 4RD0A 3U7FB 1ESNA 1TQ6A 3L8YA 4BFXA 3NEYA 4DCSA 4CEJA 5J5CA 1SXJD 2WPDD 4UNQA 3SYKA 3RRYA 5DI3A 4BGDA 3ZDQA 3NBFA 2YC2C 1TMKA 3JZAA 1H8HA 2ZRPA 3ZD7A 4TMWA 2VHTA 4PPFA 1ZIPA 1M2OB 4HLQB 1K8RA 2FPKA 4IVQA 3W6NA 4E03A 4DKXA 4M4SA 3OIWA 1JR3A 5HCNA 4PSVA 4KYIB 1E2FA 3IDQA 2A5YB 4Q4JB 3SN6A 1W36D 3GFOA 1WE2A 5DYGA 4Q21A 2R62A 4AK9A 1HURA 2KSQA 3PFIA 1A7JA 4BFTA 4LHWA 2YC4C 3WBKA 2QN6A 2GA8A 4O3MA 4TMXA 5GJVC 4BFWA 3DVLA 1Z47A 1E9AA 5IDVA 1ZYUA 1B0UA 1NI3A 5KNCA 2Q3FA 4LJ4A 1CEEA 4B34A 2RB4A 1AQYA 2J3EA 1HEIA 4L5BA 1RJ9B 3RDPA 2GCOB 1KO8A 2DFKB 2ZRLA 1XEWY 1YZTA 2EFGA 4JSYA 4V0NA 5AWFC 3SZRA 3TBKA 4OHWA 1UJ2A 4HAYA 4MRPA 4OI0A 4LBWA 5CDFA 4V02A 1R0YA 2BV3A 2EFDB 1OYWA 1SGWA 4JVLA 1OW3B 1OIVA 4QG7A 1ZCBA 1X8KA 2EWVA 4DCVA 2V4ZA 2KJQA 2EFCB 3IBYA 3VNVA 1RRCA 1QDEA 3L0OA 2Q21A 1EFTA 3WNBA 3FKSA 4V0KA 2IYYA 1ZAKA 3JVVA 2G9NA 3U6BA 3U60B 4U7DA 5LB4A 4WZ6A 4W9MC 3U7HB 4NZYA 1KO1A 3AF0A 3DHWC 4HZUA 3CF6R 1QBKC 5KOYA 4QGGA 2ONKA 1ZIOA 1G18A 4MGYR 4BRWA 1OFUX 4D25A 2OM2A 1Q1QA 3LLMA 2ZE5A 4A6PA 1WRBA 1F60A 2WVJA 3QIAA 2ZROA 1MRSA 1TL7C 1U0HC 3X2SA 3TR0A 5G53C 4EFNA 4JYCA 2Q0HA 4BPBA 3KXIA 1ZD8A 1SXJA 2IYUA 2ZUDA 2O8DB 1Z2AA 1WP9A 2VP5A 3U3JA 1ZD9A 1G3MA 5IK2D 5J4KA 4PO9A 5D3MA 3R9IA 2W2TA 4M1WA 2QSZA 2WICA 4ZDWA 2QMEA 4JBWA 4AI6A 1Z8FA 2IHYA 4HB3A 2JDID 1P2VA 4A0FA 1AQUA 3FB4A 4DLTA 4ERNA 4KFUA 1VG1A 2R6DA 2F7SA 1KI7A 5KSYA 2WJGA 2QBYB 1CR2A 2PX0A 4H9GA 1XMSA 2H57A 5L3VA 2BIFA 2CCGA 5AJYA 4HUTA 3F3YA 2VP2A 3UG6A 2H7VA 2CCKA 3NIBA 1M1YE 1KTVA 3GLIE 3TJZA 1FZQA 4FMDF 4FMDB 4ZCLA 4MYCA 3Q5EA 4B35A 3CRQA 2XSZD 5FBWB 1UFQA 5LD2C 2CCJA 1PUJA 5DLQC 2IBMA 3RS5A 2A30A 3MSXA 4QNMA 5TARA 1ZU4A 4B2PA 1RVDA 3VR5A 2OAP1 2PZFA 3K9LA 4URYR 3X1DA 4OQMA 2HEIA 1Q44A 3BFVA 4MKFA 2REOA 3B9PA 4D6PA 3RVBA 1HH4A 2IYSA 5DGXA 4DZZA 1Q3TA 2XJ9A 4BFZA 4RD6A 3P27A 4ZIRA 2JLZA 4II7A 2ZRJA 1Z07A 1W47A 1E9SA 3AP1A 3GJ8A 2EU8A 1GFIA 3SU8A 4Y0VA 4XJXA 4Z8XA 4C0KA 3A1SA 1S96A 2GEVA 3B7GA 3BD9A 3AB3A 2P2LA 3KFVA 3KQHA 1VG9B 4KSBA 2CJWA 2BEJA 5JEDA 1OB2A 2G1JA 3SOPA 2JAQA 4FINA 2J87A 3UK6A 3R9XA 2AR7A 5L3SA 3THYB 5FOWA 1E1QD 2BVNA 1GVNB 1IOZA 4B6FA 3SJCA 5KSOA 4KYUA 1MV5A 1ZJ6A 1KDPA 3EC1A 4B3CA 4EQ6A 1E9DA 1TX4B 4L4UA 4ITRC 5CITA 1YRBA 1NMXA 3AVQA 2E1RA 1QHSA 2ZRDA 1Z6TA 4TL6A 2A2ZA 2CBZA 4NCHA 1AZTA 1RPZA 4QRHA 4Q66C 4Q4HA 3U3KA 4A2PA 2IC5A 1AKEA 5JWRA 2PMKA 4IEIA 4HB2A 1HTWA 1IY0A 1KAOA 1TADA 3NBYC 4AYXA 2ZI7A 4HYYA 4LV6A 2XZOA 2ZXUA 4C0AC 1SVMA 3GQBA 1II0A 2ZJ2A 2CK3A 2HXSA 3B60A 1LNZA 1Z63A 3ND8A 3NDBB 1KI1A 1MR3F 2W6ID 5CK4A 1UKEA 2VTKA 3SYNA 2IEYA 1YZNA 1E0KA 1JJVA 3KJIA 4DIEA 5J4LA 1AKYA 2AK2A 4PHFA 3M1IA 4BUJA 3Q9LA 3HP1A 1A4RA 3T1OA 1KK2A 2QGNA 2MMGA 4Q7MB 4QBHA 1XD2B 3TRFA 2WM9B 1SVWA 2QP9X 2FU5C 3P20A 3T61A 2FPMA 5E95A 2GVDC 4DRZA 3AF1A 4OI1A 2RKOA 3QE0A 2D2FA 1EXMA 3WMFA 3CF0A 1A2BA 1U94A 5CIQA 1D9XA 1UEIA 3ZLJA 2BCJQ 4IDPA 5AUNB 5JMTA 2B6HA 2CEAA 3TVTA 2OG2A 2CHQA 2G3YA 1XMJA 2JJ8A 1MO3A 4JVNA 4X8HA 4C0HA 5JSZB 1OH5A 1KZGB 3RC8A 2J0VA 2GDJA 4FN5A 1W44A 4EDHA 4NBSA 1R10A 2V1UA 3MG9A 2QI9C 2PX3A 3X1WA 4AURA 4ZDIA 1GNQA 1RIFA 5TB5A 2ERYA 2GBLA 2R6CA 3LQQA 4GDFA 2QAGA 3D6TB 4F93B 1E1QA 2JLQA 2ONJA 2OBMA 4LJ9A 1X1RA 3WRXC 1FUKA 3RWMB 1FX0B 1GDDA 1HYQA 2FFBA 2HV8A 2QL6A 4JLNA 1F48A 3V9PA 1S8FA 1Z28A 3EIQA 3ADDA 2F1HA 1TF5A 3WHLA 1N2CE 2FH5B 1G3QA 1KJZA 1NMZA 3OIVA 5EXTA 4B32A 5HKKA 5JJKA 1IN6A 1NY5A 3IEUA 3PV0A 4LPSA 2BMJA 4GFDA 4C9BA 2BMDA 1ONBA 3I1FA 4N0DA 3TGPA 2NO6A 1E6CA 2VP9A 4WXRA 4PZLA 3H0KA 2QSYA 4WZAE 1DG1G 4C2UA 3THXB 4TZ0A 1C1YA 3SE0A 1L4UA 1W2GA 4C3ZA 3BBPA 1UKYA 3GD7A 2ERXA 1KK1A 3K8YA 3DMDA 4NTZA 3ND9A 1XDBA 3Q7PA 2QTHA 3AKEA 4W5WA 2AXNA 3RWOA 3U6KA 2BBSA 1NMYA 1OH6A 2YV5A 3EARA 4FMCF 2OESA 4FMCB 5KO2A 3DMNA 2C77A 3FYHA 2CLSA 4PSAA 1KYIA 2RHDA 5TDHA 2W6IA 2IL1A 2PJRA 2ZU6A 1FFHA 3THWB 2FV8A 3F8TA 3HDTA 4PZYA 2C8VA 4XWKA 2GNOA 2ZSBA 4QM6A 1GILA 4TTRA 3WYFA 4CEIA 1Z22A 3QVUA 2OXRA 1K5DA 4TL7A 1FPMA 2C9OA 2C9YA 3GLFB 3F5FA 5K8UA 4EJSC 2Z4RA 4FCVA 1VIAA 4NYMQ 2J7KA 2ZUBA 4H1VA 3W6PA 1GRRA 3ECCA 3LW7A 2JA1A 3LV8A 4CT4B 5A5GA 4K8OA 4D4KA 3CWZA 2PZGA 2RGNA 5CK5A 4PAMA 5AUQA 3CB4A 2XTMA 1JQLB 4OK5A 3X1XA 1KI8A 1T91A 2EFEB 2HDNB 4X8OA 3A58B 2O8EB 5FI0B 5EP3A 1DAEA 1N3BA 3KTAB 5JZVA 2J7PA 4ON9A 3KKQA 1YU9A 4FIDA 4RZ2A 2XNDA 5FTNA 3I92A 4LZZA 1VCMA 1U8YA 2MMCA 2VHJA 3DL0A 5EE5B 3AVVA 4E09A 3NH6A 3B1YA 1O3YA 4URXR 4F4CA 2LWIA 2XTZA 2AD1A 5SZIA 4B47A 2PLRA 3PCRB 3SBDA 1LS1A 3TNFA 2QNRA 3OEHD 3QVVA 1FQJA 4JT4A 2QMHA 2IT1A 3ZD6A 2O8CA 2WJJA 3P26A 4MRSA 5FL3A 1GSIA 4EAQA 2AK3A 2BHRA 4GMXA 4LHYA 5JI3E 1T0JB 4NYIQ 2JLVA 3DEFA 1XCGB 1XPOA 2A5FA 4BFSA 4OHYA 4JT2A 1JPNA 1DAIA 3ZVLA 1G17A 1Z6AA 1XEXB 1N0VC 3PVSA 1NL3A 2AFHE 2R8RA 1CLUA 2CMKA 4HI0E 2XXAA 3KXLA 5DNYB 4M9XA 1G41A 3OEED 3OESA 4AKHA 1XFAA 4KLNA 5E3HA 2ZM5A 4ZCIA 1ZM2A 3VHXA 4A0HA 3U4QA 2VYFA 4PXAA 1M34E 3FMPB 2IXFA 3GJ4A 1JPJA 4JIMA 5G3YA 3B13B 3FHCB 3VKGA 1JNYA 4NCJA 4IKEA 1NN0A 3B1VA 3I8SA 1E9BA 2BJVA 4NYMR 3GLGB 5JWOA 4M1SA 4Q4LA 4NKRA 2C9CA 3FVQA 4HEJA 2NZ8A 1DAHA 4YMUA 2OBNA 3VQTA 3CRRA 2QTVB 1KI2A 3QY0A 1ZUHA 2ZRIA 3CRVA 5DI9A 2WOJA 4A8JB 4Q00A 2ASEA 3OF5A 1G7SA 521PA 1X8LA 5G41A 2OFXA 3VR1A 5EXXA 1CF4A 3CRW1 4IW3B 4US1R 4CGZA 1H8ED 1NLZA 4UXJA 1UEJA 3R7WB 2GZAA 2KWIA 2Q9CA 1OFHA 2VF8A 1IQPA 3C5CA 1TQ2A 3P32A 5JBQA 2V8OA 4A15A 4HSEA 2DPXA 3P1JA 4KAXA 1CULC 2NG1A 3WMEA 1MO5A 3AQ4A 3FHTA 2KI5A 1XTRA 2BBWA 3CX7A 4JVSB 2N46A 3LBHA 3PR1A 4C0QC 1QRAA 3VU9B 4AIIA 2MSEB 1DVRA 4KLZA 5E7JA 2MSDB 5BN5A 1BOFA 3GJXC 3LA6A 2OILA 2DYKA 3QKRA 1AN0A 2O0KA 4NYIR 3OEHA 4PPQA 2PZEA 3DO6A 3QF4B 4JVMA 2GXUA 4HB4A 4LY6A 2OFOA 3FMFA 1G8PA 3CH5A 4DLZA 3U44A 3OFND 3KJEA 3QKTA 1JQJC 3G0HA 2I1VB 2R6GA 5M04A 3S1AA 4RZXA 2IF0A 4AYTA 2RGDA 4MUBA 1RE0A 3WYAA 3QSYA 4Q4AA 2V3CC 4P32A 4OQFA 1JXOA 4RD4A 2WAYA 1DE0A 3JZMA 2WV9A 3GEHA 3H84A 4M2LA 1S4QA 1P72A 2VSFA 4EPWA 1ZM9A 1G21E 4HATA 2YOHA 1BO6A 3LRPA 3QXCA 2YKGA 2A5GA 4MYTA 2GK7A 2BWJA 3SFZA 1IXSB 821PA 2DY1A 2KB0A 5JEEA 4M22A 1MABB 4PC7A 3C8UA 3LD9A 4FXPA 2GCNA 1GNPA 1T3HA 2Q3MA 4PC6A 2VP6A 4ABYA 4Q48A 3EZ2A 4M8NE 5FR1A 3RAPR 1GZSA 2W2XA 3QEOA 3UWKA 2HCBA 4M0LA 1VG8A 1V5WA 3TQCA 2J9RA 3ZS8A 3SFVA 2OLKA 5E7IA 3C41J 2E87A 1XJ0A 4URWR 3PEUA 4I81A 1G20E 1NLFA 2VH5R 3O8DA 4TQAA 3TKLA 4R71A 3VFDA 5FTKA 2GHIA 4KU4A 4E07A 1H8EA 3W34A 1OIWA 1AGRA 3NC1C 4W7SA 1OYYA 4R98A 4FWIB 4TLCA 4NMMA 4KVGA 4DXAA 3DPUA 1J7KA 2JJ1D 2JEOA 2YNMA 5FOUA 1SKQA 2FN4A 2IS4A 1KI6B 3HPRA 3AVTA 1R7RA 4CT5A 1NSTA 3V00A 3VAAA 4P4SA 3CNLA 3PITA 2BCGY 3GLHB 2ATXA 3TUIC 5KSZA 1ZMXA 2AKYA 3KQUA 1LTQA 2FSGA 4FMBB 3C15C 4OKSA 5L8VA 4KITB 4RD3A 2ZYWX 1OFIA 2ZTSA 1NIPA 1Z6GA 1G4AE 2Z6VA 3L8ZA 4GP6A 3UATA 1GL9B 4M1TA 4I1VA 1ZU5A 4OHZA 4GMDA 4M9SA 2ZRHA 3O8RA 2ZAOA 4U02A 1FOEB 4B48A 1ZM3A 2ZRAA 4PTLA 2QE7D 3KDSE 1Q22A 4HAWA 5JS7A 4QBGB 3OFNA 4CEJB 2HLDD 1TQDA 1YE8A 1GKUB 1IY2A 1GP2A 5DI3B 4LJ5A 4ACBA 2J5XA 2UZIR 4QBIA 2GAOA 1CXZA 3BC1A 4Q7JB 1BYIA 4YMTA 4TLEA 5JECA 4JBXA 1M7BA 4BASA 1II8A 2ZPTX 2QEQA 4JLVA 1OKKA 1VG0B 2ECKA 2XX3A 4MYUA 5JHGB 2P65A 4JLOA 1YRAA 3ONWA 1E2IA 1J2JA 1P4SA 2P5SA 1YZLA 1N25A 2CVFA 1HY3A 3N5CA 4DWJA 3AVWA 5GJCA 3SNHA 1CJKC 4EFMA 2DBYA 4TMVA 3MUFA 2IYQA 2OAQ1 2C2HA 3VKWA 1X86B 2FEOA 2I4IA 2RAPA 2IWHA 4A82A 3R8FA 1BH2A 1Q12A 4JL6A 4QGFA 2GXAA 2DWQA 4TL9A 3B78A 3ZGXA 5JHHB 1ZCAA 2YWEA 2J46A 1A5TA 5F9HA 3TLXA 3GJ5A 4HAZA 4R7ZA 4DSOA 3KUCA 1VYTA 5IHPA 2WIAA 5LDDC 3ZVMA 1NSFA 3DKVA 3WNCA 4E22A 4DLVA 3QG1A 5B57C 2D62A 2Z43A 1EG7A 3AEZA 2ZRNA 3TAUA 1CS4C 3WP0A 3DZ8A 4LBVA 3CH4B 3C16C 4XVRA 1Z3IX 1JEEA 3FPAA 4KVAA 4ACAA 5AJXA 3EZ6A 3FMOB 4JLBA 4FWTA 2LKDA 1FNNA 2H17A 2ZREA 3SHWA 3WP1B 4QXAA 3CF2A 3IO5A 3ZJYA 4CVNA 2V7QD 1PUIA 1RYFA 3K1JA 1Z08A 3CPJB 1AJEA 4DBLC 1E2KA 4C0SA 3FOZA 1R5NA 3CIOA 1WMSA 4KJZA 2YJTD 4TT3D 4EPRA 1YR8A 1Z5ZA 1RFLA 3M0EA 3U3RA 2C95A 4HZUB 2GJKA 1HT1E 2XOKA 4LJ7A 1JAIA 4PO1A 1KMHA 2HYDA 1S1CA 3C7KA 1NVVQ 1R5OA 2H8KA 3RS2A 1VDZA 3CR8A 1J90A 3B9QA 5E4FA 2IXEA 1P75A 5SZHB 1LS6A 3Q3JB 1RKBA 2QPTA 2WWHA 4Q47A 2WWYA 1EK0A 1KMQA 4LJYA 4C0JA 1SZPA 3GFPA 3QOFA 5FPYA 4TTPA 1EFHA 1ZNZA 2J41A 2RGCA 1QZXA 3L82B 3L43A 3NXSA 4UNPA 4DCUA 4MKGA 1JI0A 1OPXA 3AP2A 4F4IA 2PT5A 5AR1A 3TSZA 3LFUA 5G40A 1XX6A 1QG4A 3CNNA 4GZLA 3ASZA 4IDQA 2ZIAA 5DISB 5FL7A 2IW3A 4QKQA 3K0CC 2IK8A 5B2ZA 1WDTA 4EPTA 4KBGA 1DS6A 3QNUA 2QG6A 5FUYA 4UNRA 2EVWX 1N5IA 2CL6X 3FFBA 5JI2E 5JJIA 5GJWC 4N3NA 1NP6A 4NH0A 4ARZB 4DSTA 1XTIA 3T12A 2HUPA 4YDSA 1WXQA 1E79D 3BH6A 2RGEA 1NBMD 2HCJB 2G6BA 3IGFA 3D3QA 2ZANA 1XP8A 3CZQA 2WPDA 3KUDA 4LHVA 3REGA 2WWFA 2O5VA 2GESA 3O8BA 3TSWA 1P6XA 4D4LA 2RHMA 2NTYC 4WXPA 5HCIA 3T34A 2O8FA 4IOLA 2K5UA 3Q8XB 2D7DA 1P9NA 1NRJB 5CIWA 1N6NA 3KJHA 2XTNA 2IUSA 2R44A 1OE0A 5FUXA 4ZIRB 4A9AA 3IQWA 1EFUA 4KHZA 1YZQA 1W7AA 1OV4A 2G0NA 4DUGD 4L9SA 2CL7X 2V7QA 2CDNA 1VKJA 5FOVA 2WHXA 2ZE6A 3RC3A 4R9UC 2QM7A 2V1XA 1NVVR 1VIYA 2C98A 3MMPA 2OEPA 3OE7D 1R0ZA 1FW6A 2CJWB 4L9WA 4NONA 1DOAA 1VCNA 3T15A 1CJTC 4HLCA 3T5GA 3BWDD 2PEZA 3LW8A 4TSFD 4BZPA 4D80A 3PUVA 1KK3A 2RGBA 1Z6XA 4GOXA 2W00A 1KK0A 3UMSA 2SHKA 5GJBA 1SKYB 1YKSA 3EWAA 2GJAA 4RCZA 2EW1A 4EQ6B 1E9CA 3EG5A 1CRQA 2FGKA 2FF7A 4QC2A 2WJYA 1RW4A 2JLSA 3CR7A 3K9HA 1WA5A 4D4MA 3M4YA 1T4GA 4EPVA 4MYHA 5EQTA 4PQYA 1UBEA 4HDQB 4Q4HB 1G8HA 3N70A 1AK2A 2XGJA 2P67A 2EWWA 3WMGA 2WWGA 2JLUA 5K8LA 5J47A 1T3SA 2O52A 3IIKA 2JIZD 3IO3A 4AG5A 2FNAA 1T8TA 1JBKA 3K70B 2G77B 2FMXA 4TYPA 1CRPA 5AUOB 2BBTA 4PO8A 1M7GA 2OLJA 3TK1A 2QBYA 1P2TA 3KZ1E 3CPHA 1NLYA 1GWNA 4V0OA 3DKPA 4NCIA 3EIHA 2NPIA 4TMZA 2G1KA 1XB2A 4IOMA 4CYMA 4MGZR 3ICEA 4HZIA 3LXXA 2JJ2D 3UKDA 2QT1A 1G3UA 4RFVA 5JCZA 3IBGA 4JZKA 3SYLA 2QY9A 1IJFA 4NL4H 5IK2A 4IOKA 4LUCA 1CR4A 4DLYA 3BB4A 1W46A 2VHUA 5CYOA 1K5GA 4A0RA 2X1VA 1TAGA 2GVZC 1IXZA 1ZP6A 5KDDA 2JDIA 4LGMA 2VL7A 1OXTA 2OV2A 3HU1A 5EUMA 5GADl 1GKIA 4P33A 4IJMA 4PC2A 4JKYA 3WYGA 2Z0MA 3WXMA 3WBJA 1KSJA 1N0WA 4ZDKA 3H2YA 4D26A 1Q1EA 2F43A 4OJQA 3HU2A 2IA5A 4MGIR 4EJSA 1UAAA 1TNDA 4CRWB 2ZJOA 2HT1A 1LB1B 1VMAA 3QXHA 1NIJA 2PBRA 5FH9A 5EE1A 4GT1A 1NKSA 2XSZA 2CNWD 4J0QA 4POAA 5JRZA 4DT1A 4QOSA 1D6JA 2QAGB 1QHHA 1J99A 2B7BA 421PA 4ZKDA 2IYWA 4WIAA 2D2EA 1E9FA 3SJZA 3WRYC 3QXSA 2ZETA 2C03A 3GEIA 1E0AA 1OHHD 4RCYA 3BRWD 3AF2A 5FOXA 2VBCA 2ZVPX 3LQRA 1ZD1A 4RSGA 1VTKA 3KB2A 1NBME 5EZ5A 1QHNA 2GK6A 3K53A 2Q9AA 4X8MA 4ESHA 5F9FA 5K8IA 2NPFA 4I1SA 3RRZA 3MJRA 2CHVA 2PEYA 1EFRD 2B21A 2BOVA 2YOGA 3QUSA 4B71A 4N0EA 4QHYA 2YZ2A 5B64A 2VHCA 3EIEA 1SVLA 3E2IA 3EWSA 2ZI5A 2W58A 5FBVB 3RS0A 3U5ZB 3AGQA 4B43A 1P7CA 1NG1A 4GRAA 1Q0UA 4HUQB 5FUWA 3LX5A 1FNMA 4D0LB 2FX3A 2JIZA 1N5JA 1IN4A 2P0EA 3B2EA 1E96A 2JLXA 1ZBDA 2ZSDA 3T1QA 4NDZA 4G5QA 2ZJ5A 1Z83A 1KI3A 1DARA 1SKYE 3MWJA 4NU0A 4URVR 3T06B 4TTQA 1Z0DA 4A2QA 3TUZC 3VR3A 3Q72A 2ANBA 5SZKB 1S9HA 1A82A 1WCV1 4EIWA 3A4MA 3EAQA 4Q1AA 4MH0R 4O2LA 5B58C 2HJVA 2XEXA 2XNSA 4ZV4A 3BIFA 1OXXK 3V4FA 3I73A 1ODFA 1X1SA 3EW9A 1UADA 4A6XA 2ZUCA 1F3OA 4V03A 2VLIA 1G4UR 4UKDA 4IVRA 3AP3A 5DSZA 4C4PA 4V0LA 5IT5A 4C7OA 1R2QA 2CE2X 4P4TA 3QKSB 3RANA 1NN1A 3DDCA 3BS4A 3K0FA 4KODA 2QTFA 4YDHB 1TF7A 3PEYA 1F2UA 3FDIA 3I32A 2YVUA 4Z1MD 3DM5A 1SQ5A 4OL0A 4XWAA 4B73A 1XCMA 3HWSA 1G8FA 1RRPA 3QENA 3MLEA 5LBIA 4URZR 1G5TA 2OBLA 2RH5A 1E2PA 1EGAA 4D0GA 1IHUA 3LVQE 4RKEA 4OHVA 2QPAA 1NJFA 4UNNA 2P6RA 5JSZA 3U7GA 1W0JD 2VHQA 1ZRHA 5JWHA 3R9WA 3IILA 4KO8A 2QZ4A 3D7MA 3KX2A 4GZMA 1N6LA 2JATA 5HZHA 4PSKA 3ASYA 1FTSA 3IKJA 3OIUA 3KKPA 1NVXQ 4DDVA 3EZ9A 2QM8A 3W8RA 4AKEA 3AV0B 1I4DD 4NE2A 4PAQA 3I5YA 1SVKA 1N6IA 4OK6A 4KBFA 2O8CB 4TQ9A 4ESVA 2TMKA 4Q9LA 4DLRA 1PLJA 2RGAA 3QI2A 3QXJA 3L0PA 4HLUC 2BMEA 2A7QA 3K0AA 2WSMA 3QJYA 2A78A 3UMRA 2ZS9A 4BFYA 4GI7A 3WNDA 1COWD 2EFHB 3NTUA 5TY0A 4YQFA 1R6BX 4PR0A 1GAJA 1KO5A 2BKUA 3BK7A 3MWKA 4IVPA 4LBYA 4OQLA 1ELOA 1E9RA 3W3ZB 2P3SA 2XXAB 3GJ6A 4S35A 3THXA 1TU3A 3OHMA 1OLOA 2RMKA 4MKIA 5C18A 1I2DA 3ADKA 1LF5A 3SHFA 4BLSA 3U4QB 5B30A 3MJHA 4F92B 1AZSC 2WKQA 4FCTA 4RJLA
chains in the Genus database with same CATH superfamily
4LJ6A 3D4NA 2LBPA 2XGMA 5EY5B 1KI4A 1ZISA 2Q7XA 3CE9A 4IHJF 4EB6B 1K4KA 2CB0A 4IHJB 1HQKA 3CBQA 3THSA 3AEQA 1JL3A 3GL9A 3PI7A 2HEGA 3W2FA 1QP0A 1H1LA 1UBHS 5CHYA 2Z56A 4DJ5X 1IZ9A 2PL1A 4S0ZA 2FPIB 4GQBA 4AWBA 3RBZA 4AN1A 1IN7A 2Q5FA 5LQKA 1IBMB 1YHNA 1GPMA 2CFOA 4BZZA 3PXDA 1JDNA 1O03A 4J3JA 4IR7A 1ICIA 2D7CA 2B78A 2OO3A 4PE5B 3T8YA 1LV8A 1CJMA 5DHPA 3TDNA 3IURA 3B5JA 4E13A 5AIBA 3UG7A 1F17A 2DBRA 2IIVA 4ZO8A 2IBTA 2B30A 2QZSA 4WKCA 2FE4A 2GCPA 3M6WA 3NNDA 1ADJA 2VF2A 3DF9A 3WICA 1X14A 4TL8A 1NLMA 2OHVA 4Y2XA 5BN4B 2Q3CA 4V0SA 5AW0A 3AU9A 4QYTA 5EGNA 3D7RA 4LA4A 2FWIA 4Y2YA 4GX5A 2O06A 5BQOA 1HMYA 4Q03A 3W4KA 1KSFX 4JJZA 4XZ3A 4ZRNA 1XLTC 5K6AC 1E6KA 2O8EA 5AHKA 1W0JA 4RVOA 5H5JA 3ZY4A 3C5VA 3DXYA 3IBTA 1PR0A 4EG7A 1VA4A 3KR0A 4K6KA 2BGJA 2Y8EA 2F4NA 4ZO4A 3IHTA 3LFTA 1JIUA 2EP7A 5CM9C 3FPGA 3QKRB 3WK8A 3T35A 1XTJA 4NYJQ 4CKEA 1OBFO 2F1KA 4I1RA 3BWVA 2EF1A 4BWYA 1RXEA 5K3CA 2H1WA 3F5MA 3ZWOA 3D8HA 1IHDA 3HYTA 4L22A 3ZZ0A 4YC7A 1GPBA 2QU8A 3LX4A 5U1PA 1O6ZA 2HKIA 3DQQA 3V8EA 4PG8A 4K03A 3QGMA 2XA9A 3AI3A 3CEPB 3IEKA 5AM5A 3ZH9B 2EKZA 4AD8A 2Z95A 5FXMA 4YJGB 5EJGA 4BIMA 2AS0A 3KQPA 2VO1A 4PAWA 4M0EA 3Q6NA 1CZKA 1XRJA 3DOHA 3H2BA 3IFSA 5SZJA 4JFRA 3LCUA 3IUSA 1PZFA 1PT5A 2C5GA 3GVHA 3RS7A 4W5OA 1TM5E 3P9SA 5A0TA 3SBXA 3B6JA 1KNQA 3MMXA 1V48A 2JAUA 4PVDA 2JK1A 2XUKA 4MPJA 1ORRA 3IEVA 3L0SA 4H3SA 1X3SA 2AYZA 1WHTA 1T4DA 3A1CA 2H1LA 2PKQP 4OHUA 3FNHA 3JVEA 2ZS8A 4MJ7A 3T9AA 3D5QA 4JUCA 1SULA 2A8YA 4K6CA 2G4CA 1E98A 4GKBA 3UC5A 4BNNA 4DQXA 1O2DA 4MVJP 2CW5A 1G59A 3B2QA 3QE2A 3FHOA 3D3WA 4RZIA 4P80A 4CU2A 2VQDA 3ONDA 2F8SA 2CBXA 1EAYA 1KYZA 3T3MB 4QQNA 4FSDA 4ND2A 1AMUA 3WIUA 1J1UA 2ZAMA 2JGRA 4TLDA 4JB2A 4ASUD 2NTVA 3Q98A 4Q6BA 4CIYA 5T41A 1JG3A 1QC5B 2YWBA 3IPYA 4JYMA 1F1JA 2RHGB 4LI3X 3C7TA 1WXIA 1ZD2P 1XXHB 1U1EA 1RPJA 3C8MA 1SG9A 1JFVA 3BIXA 3GLTA 2CLCX 4B3TB 3ZV3A 1NC1A 1GCIA 1W34A 4B6GA 1XR3A 4CF5A 4LHZA 1V3QE 4AYWA 1E2GA 2WP0A 3IIEA 4MWSA 1WDLA 1G3RA 4Z0NA 4CKBA 3G6KA 4EW2A 5KVCA 4DB4A 4RZUA 3QXGA 4ZA2A 3LCJA 3NM4A 4X54A 2N3ZA 4QBKA 3KFXA 5AKXA 5H4GA 1DX6A 2V55B 5AQ1A 1DWPA 2ZSHA 3I2IA 4BX9A 3TIFA 3S8EA 1Y3BE 1MHTA 1U1IA 1L7OA 1CETA 1R8JA 2R2AA 4K9LA 4X64B 3GT4A 1ODTC 2AZMA 2IUFA 3K2EA 4REOA 4P4SB 1R6DA 4OMFG 2N1MA 4YBZA 4RCVA 1QGZA 3TNDA 3ZJYA 4DJEC 1FTYA 4NYJR 4P3YA 4RK6A 2JVKA 5EP1A 4XDYA 1VBFA 1JEQA 2ZWOA 3BK2A 2Q6LA 3F49S 3AUSA 1S8AA 4DUPA 1QDLB 5BNTA 2P2YA 5C7LO 3AY0A 1DQPA 1Z5GA 3F9RA 4IF6A 1ZI6A 2V7VA 1XTQA 1GSAA 1FNSA 3T3PB 4C03A 2FAXA 1ISPA 3Q2OA 1ABBA 4X8LA 3JQ9A 3NHRA 1I3KA 1C5KA 3HYRA 4Z99A 1RMQA 3OZAA 2AJ8A 3PHGA 3W5DA 2V7EA 2FN7A 4CDNA 2DHRA 4XOIA 5L4SA 1VLZA 3H3FA 1IUNA 4JZYA 5FPPA 1JWBB 1Y1PA 3R3YA 1W4BA 2AW3A 4KOAA 3T54A 3EQZA 3QIVA 1E3LA 3HRHA 2Q6TA 1J00A 3EULA 2HMUA 2ZSJA 3ILHA 1FUUA 5CM8B 3TTXA 3BXEA 4RMGA 4TM8A 5IPFA 3OFJA 3FH0A 4ZCMA 2ZWVA 1BGWA 5AKKA 5LPNA 5AW8A 1KY3A 4NPHA 1UKVY 3O2QB 1KKLA 2UYYA 3M7IA 2I03A 2ORYA 2V45A 5D5QA 1RT9A 5BV2P 3ER8A 3KQTA 4LDJA 5BMOA 1W8IA 3Q9NA 4RHCA 4BMVA 1MGOA 2UKDA 3Q7QA 2QZJA 4PFSA 2ZT6A 2PL9A 4YHBA 2NU8A 3SQMA 4AN4A 2HCRA 1PP4A 1LRJA 1RKQA 5INTA 3GLGE 2PZMA 1IZ0A 1PW7A 2EHJA 2P9EA 1TTPB 3A4TA 3CC8A 4ZPJA 4OBWA 3MGKA 3C97A 3ZY6A 4BO8A 3KK0A 4LWOA 1MCZA 4E94A 1DKOA 1FYWA 4K2AA 1PEDA 1VGQA 1Z68A 3MINB 4XVQA 4DLNA 3F7NA 3W2HA 4DG5A 3M4JA 1DBWA 1PR5A 1VKZA 2EX4A 2I99A 3VX3A 5FWXB 1GZHB 1CUJA 4OH1A 4RIEA 1W25A 3NLLA 3OIDA 4OHPA 1ARZA 3WL7A 3QVKA 2QMOA 2DEUA 2AOTB 2GNPA 3GCDA 3MOSA 3PS9A 3O31A 3N2YA 5LDGA 1ZJWA 1E3WA 2R6JA 2NNLD 1F9EA 1I7PA 2DBZA 3SY8A 4Z8YA 3DVRX 5CA1B 2IV3A 3MAAC 3ORYA 2CJYA 2O2HA 1Z4NA 3CPEA 2I1LA 4P3XA 3WWCA 2FKAA 3OT5A 2C5LA 3NAZA 4LZOA 2QJFA 2OAGA 2OA0A 2Q29A 4TXJA 3FGOA 3W5UA 5L3QA 1U3VA 4ZT2A 4WAUA 2AE1A 4RTKA 4MWCA 4M1YA 4N5IX 4LQLA 1USKA 1ZKDA 1U0LA 3FLBA 1Y3HA 2BHNA 3D7NA 1T2VA 1DC8A 3EEQA 4I5EA 5DMXA 2R5NA 2I22A 3WWEA 1THGA 3DYIA 2ZJ1A 2B8TA 3A0UA 1BRMA 2W4IA 5LA6F 1IXKA 2A9KA 5LA6B 4LRTB 2PS3A 3PRKE 2FWRA 3QKWA 3EUAA 4DWVA 4I2VA 2ZU0C 3MD0A 1Q7BA 1IFXA 4FEAA 4FFLA 4L07A 4HMQA 1PZXA 4LZJA 1GZ6A 2ICAA 1A2KC 4F86A 1W19A 3I61A 4F9FA 4M9ZA 5I45A 2QT0A 3LNTA 3SF0A 2VXCA 4Y2GA 3AJDA 2N0SA 4GL4A 4OFWA 1KEKA 5AJVB 4B2LA 3S8YA 3M6AA 4L16A 2O3UA 2W9XA 4WD3A 3H99A 4QYIA 2YXEA 4B8ZA 2ZSFA 1GN9A 5TEWA 1U9IC 2PPVA 2Z5FA 1K3TA 3LUJA 1JH9A 1QG0A 3LTNC 2WAXA 2JLRA 4LQCA 2WJPA 2WMDA 2CHGA 3GT0A 1ADBA 3ENZA 3JQ9C 2QJTA 2Q5QA 2V59A 4X7PA 5KREA 4PZ9A 5B3AA 1G1MA 3EAGA 4DIBA 1ZOIA 3BULA 3GJ3A 2CNNA 2ZTLA 4WOPA 4DCNA 2O8NA 2NSYA 3SQNA 1PNTA 1UWKA 4I08A 3K9FC 1AKWA 1Y6RA 1OFUA 2J3HA 4CCYA 1GFZA 1L7PA 5ES3A 4JQYA 1HDEA 2NP6A 2WTEA 3E18A 2XUGA 3U3MA 2MSWA 2P62A 2KHZA 4I1IA 3WIEA 4AECA 1PI3A 2R60A 1CEXA 1ZAYA 2CNDA 2WIBA 3N74A 5ENDA 4BC0A 3CUTA 2Y0EA 2HA6A 4IEEA 4PYLA 2W42A 4NG4A 5EIWA 3U4HA 1XQXA 4LF5B 3NBXX 3A1TA 3GUVA 2QR3A 5CLIA 4CKWA 2PUAA 5IT9A 2VQ6A 3SKVA 1TQ4A 2HLDA 1EWTA 5J59A 2HLNA 3UPDA 3FROA 4EZEA 1V96A 5JDIC 5DNCA 4DRYA 3AVUA 2QYHA 5D3MB 2VJMB 1ENOA 4OAPA 5JO9A 3BWBA 1KJYA 1P5JA 5J40A 1CY6A 1WY7A 1LJUA 3KXKA 2X4DA 3Q7RA 4RJJA 2AFRA 3WLEA 1F2DA 1UDXA 2BPOA 2H4JA 2YWHA 3FFXA 3LHKA 2NV2B 3ZHYA 5C5EA 4L51A 2Z6AA 1WUJS 4QM7A 3TDMA 1ZMOA 5H3HA 3CBGA 4PRLA 1ZJ5A 2CVZA 4LJAA 1T9KA 2CXRA 1U99A 3STUA 4AG6A 1FTGA 1KJWA 1P33A 4B2IA 3KSAC 1FRZA 1LPBB 2F17A 5L95A 3R40A 5TNXA 1USWA 3GA5A 4HLNA 2CD7A 1LBTA 1ML4A 1THMA 1KFBB 2Y66A 2B20A 2QTRA 1CDZA 2FRVA 4EEKA 1B6GA 5JAOA 2ODBA 4GE3A 3CKLA 2R85A 2WNSA 2YW9A 4KYTA 5ELMA 3D6FA 5C31A 3WL6A 4GZ3A 5HFJA 2J5KA 3ZU2A 1LVGA 3HB1A 4E88A 1JB9A 2BFAA 1L9KA 1C3XA 3VOAA 1N2HA 3UOAB 5A6VA 1MC8A 3TZEA 1BMDA 3FSJX 2B9VA 2ZI9A 1F14A 3EUEA 1IY1A 4IIEA 4LN1A 5EWJB 3ZUGA 4I4NA 5HS4A 1NQTA 1Y6QA 1SCQA 5AUPB 4FJ0A 3BJIC 4ZDIA 1E32A 3EZLA 4Y6SA 3WWZA 1NW5A 5AJZA 4WY2A 3EFOB 3EWNA 5D6NA 4JI4B 5BRAA 2GCOA 1HXHA 2QI9F 3BEDA 2CXNA 5IW8A 3PUHA 4M0DA 3V4RA 2VJBA 4UQOA 3IMEA 2JCYA 2FFJA 1ZK2A 3KCNA 4Z7OB 1NQOA 4MIEA 5CCBA 2P5YA 4OHOA 2GBFA 4NRDA 2QA5A 3L8FA 4ED9A 2VSXA 5LIRA 4BFUA 3TQFA 2N9UA 2Q3LA 4N3GA 3K35A 4OXYA 2NZXA 5EKDA 3SJ7A 5IUJC 2H4WA 3SHVA 2JANA 3ESCA 1C4WA 4QUHA 4WJLA 3CUVA 4EYEA 3G85A 5K8VA 1AHHA 2I78A 2LV8A 3JVUA 4TROA 1BFKA 1ZA2A 4CDMA 3AB8A 2OXCA 5AW1A 3NDPA 1CUWA 1IRIA 5CURA 2QUZA 5K5EA 2O2DA 1XZPA 3EGVA 3T1VA 3VPDA 3CJQA 5A6SB 1DAFA 5FQNA 4TYWA 3IUYA 1FSZA 1GLGA 2ZPUA 3CQ9A 5CCEA 1LLFA 3B38A 5ESDA 2ZSUA 3RGGA 2FJPA 3GVIA 3OHSX 3RJZA 1SHZA 4XYLA 5ANRB 1EFCA 3EY4A 1QYCA 4BCBA 3CEAA 1N32B 1FDUA 2YWCA 4R8LA 4RMNA 3D7SA 1DSSG 3RSSA 2HRRA 5GIPE 1LJLA 4HPJB 1Q0QA 3ZWBA 2J85A 2O8DA 4E30A 3A6FA 1DZ3A 3BMCA 4Z3KA 1SC9A 2VFAA 2W83A 3ITDA 1DELA 1R8SA 1GG5A 2EDAA 1U0TA 2FGJA 3LHFA 3ROPA 1PNVA 2CMGA 4M7RA 4I19A 2BUBA 3GQBB 2WZQA 2ZYGA 2AG5A 2JIPA 2OHFA 4OMCA 5EIFA 1KEWA 3AGPA 4O2AF 3PXGA 3VYSB 5LQCA 1N2CB 4O2AB 2I4TA 3CH6A 3KAQA 3A37A 3C3XA 4PG5A 3TS1A 4B81A 5JTUA 2X19A 2XKAA 1JQKA 3ICOA 1E79A 4OA5A 1SCUB 1O95D 1SXJE 1ULUA 3FWYA 2IGTA 1HL7A 5C4MA 3CONA 5JCOA 1OJLA 1Q5PA 3TD2A 3CTMA 2QROA 3WGTA 1O08A 2C2ZA 1LWOA 4K26A 2PSEA 1BCSA 2O2IA 1EQ2A 3VDXA 2L82A 2W0MA 2WYHA 1PV4A 3D8BA 1ZY2A 2R4TA 4F9EA 4WBNF 3N87A 4Y0AA 2W6NA 4H18A 4RKYA 2FEAA 2UVQA 4A2CA 3Q8KA 5BT9A 3CURA 1J24A 4W6ZA 2JFQA 3G8AA 4ZO7A 1PUXA 3IC5A 3OEYA 4L4RA 5KBYA 5KMGA 1KVUA 2GARA 2NU9B 1HSOA 2QYOA 5KHOC 4CDGA 3NHJA 1JZTA 3UXMA 3CY6A 2WJAA 2PZ8A 3PC3A 2JAXA 4GM4A 3IHWA 5CH3A 4TTJA 4HN9A 2ZRFA 1D1TA 1QYDA 3NWJA 1ZL0A 4LBZA 1AH2A 3EFHA 4HGZA 4M9RA 4XH9B 1DCKA 1CJCA 1LXCA 3TH5A 5HM6A 5JSUA 4ME6A 4ALNA 1OX4B 4PSDA 4QGAA 2DWPA 1XKQA 3H83A 1Z0JA 4BXOB 2I54A 2ENUA 4IIHA 1XCPA 1YB5A 2GKSA 3SJUA 3WQRA 5KYKA 4QG3A 3AESA 1MOPA 1MTZA 2FWPA 1ZH0A 2J9FB 3K71B 1D2MA 1VHDA 1QGUA 1AKMA 2J3MA 4TSFA 3JQAD 1D2NA 4WZZA 3PFWO 1C0LA 3RNOA 4C5BA 3J81k 3SC3A 1B4DA 3GMIA 2A3RA 3GUUA 4D4GA 1WB9A 1SC3A 3PJRA 1IEQA 5ERXA 1U7WA 2OB2A 2WMOB 3C4QA 3W8FA 4AWXA 5PGMA 2IYRA 1W0KA 2XXAA 1YGYA 4MP6A 2GYWA 3GR6A 4A36A 2DCUA 1KGSA 1KO7A 2YYSA 4DDWA 4QEZA 4JP2A 4C7OB 5JMPA 3TO5A 1U8FO 4QDTA 2B37A 1U3UA 1U8AA 3T7TA 3P0FA 1ZNQO 1IBRA 2I6XA 5K1ZA 3C4JA 1U8UA 3PHLA 1QHIA 1YZGA 3S0JA 1TJ3A 5CT4A 1NG9A 1MT0A 3GA0A 1JEDA 4HZGA 5TPZD 2BEKA 3ZGVA 5CXSA 1RWNA 3K4PA 1HZZA 5AVYA 4GLOA 2YV1A 3L0YA 4BRZA 1YUBA 1KJIA 1Q83A 5AI8A 3ZK8A 3ZJ4A 2WU0A 2ZZKA 1RJEA 4J90A 1BX0A 1HT3A 3C3CA 4FFMA 4OREX 4QUAA 5D3QA 2A0WA 1Z4QA 3SHOA 2Y71A 5ILOA 4DSUA 1TM3E 5FPQA 1YJXA 3HY4A 1FXWA 1T9ZA 3UK0A 3WAGA 3N28A 2J3LA 3OZTA 3S1SA 4Z9AA 5A0FA 1RI5A 4MDFA 3TG8A 4M0CA 4D9EA 3KVYA 4WCFC 1MJ5A 4ALMA 3PXAA 4GWKA 3BJZA 3WKCA 1Q0TA 3GCGA 4BVKA 4TKZA 2XNDD 5IZCC 1WLYA 5CVVA 3RBVA 3WXBA 3CX3A 1Q14A 1M2HA 4JU9A 4US0R 1Z7GA 2XB4A 3WB0A 4ZV9A 1EXVA 4HXYA 3QWIA 1U28C 2JIQA 3FLEA 1BDJA 3WDLA 3WQBA 3L5KA 5BSEA 1FFCA 1Y63A 4HH3C 1U7OA 5ALNA 3A4LA 3KT6A 3PIRA 1ZXBA 3JV7A 4MMYB 2FFAA 2JHAA 2L0XA 5EJEA 4GYJA 4WY8A 2QMUA 1HSZA 2LKCA 2DQSA 3M1LA 1UPCA 2ZSEA 1O87A 2POCA 1C9YA 5IUKC 1FMLA 5K3EA 5LQDA 3VH3A 3HVHA 1QH9A 3MRVA 5SICE 3TTVA 1YS1X 1REQA 2AT1A 1Z2OX 4ZHQA 1YR7A 4GBJA 5ER6A 2D4HA 4MW0A 5AXCA 3F47A 4IXNA 1IXYA 2J6CA 2N1BA 4C2AA 4EKYA 4Z49A 4CMHA 4CTOA 4UM5A 1BYUA 3GJ7A 3GX1A 4MA4A 4LF6B 1LW7A 1ORVA 4P22A 1AG9A 5TGZA 1YZYA 4BNDA 5ER9A 1YRYE 4DHEA 3KVVA 3SQWA 3IPLA 1LQUA 4PNEA 3LUPA 2ZRGA 3U48A 2W6JD 1KERA 3A3OA 3DV0A 4N18A 5FP0A 4HFMA 1NVUQ 2O19A 1GL7A 2P3QA 4RENA 1HNNA 3HUEA 5BSVA 2AYYA 3GG2A 3IPAA 3OF2A 4DR2B 3L6UA 3AF3A 3HH8A 1GGHA 1RMTA 1OHHA 1PCXA 2WW8A 4KX3A 5DX1A 1DO2A 1GQOA 4V0QA 2G76A 3I3OA 4J16C 1CQZA 1E4VA 3A2LA 3P2JA 4MW5A 1GOTA 2XMGA 4LNUB 2YUTA 3LXMA 4GXRA 4OXXA 3RRNA 3EA0A 3KQKA 2RH8A 4INZA 4YV7A 4QGHA 3AR2A 4RPLA 3GRZA 1EFRA 4QRDA 3K70C 5KJCA 4D7AA 1YQTA 4EX7A 5KJ6A 2DRIA 1EIWA 1JR6A 4FNMA 1WNTA 5DGTA 4K46A 5EVCA 1UC9A 3UMFA 4CW7A 3G59A 3QKSA 4DB2A 4RIIA 1O54A 1U1FA 3IE0A 4EW3A 5LXTA 2QRZA 1UC8A 3HU5A 4D0NA 4EI7A 2P9CA 2W8BA 4RSMA 4MV6A 1N1EA 2GI4A 3GFSA 1Y9AA 2GUGA 3FMIA 4PINA 4A1FA 3GOHA 1E7RA 1DAMA 1LDNA 1OI3A 1XF1A 2W2PA 4MWTA 1E6UA 3KJQA 4IXMA 2IHNA 4A8PA 3GLRA 3JD1A 1VKNA 2H00A 2AOVA 3O4IA 2GRUA 2RG7A 4G8CA 4QPJC 3M83A 3EPJA 4E2FA 3H17A 5HQTA 2A5DA 2CVQA 1ESEA 5DM4A 4M1ZA 5KVVA 1MRNA 1SB9A 5EHGA 3ELWA 3K0HA 3L40A 2JLBA 3FI0A 4B76A 2BTQB 5ALJA 5MFPA 4HFJA 3BH7A 3N58A 2I71A 4UUMA 1UKBA 1M1ZA 4FT2A 4U9IS 1Z2PX 2L2QA 1F7UA 2W6ZA 1LCIA 1ZM4A 2RGGA 5DGDA 3F0TA 3QPWA 4DSAA 2BD0A 3I8XA 1BMFD 3I9JA 3LLUA 5E1BA 4A4DA 5HGXA 2YN0A 3W1VA 2W2NA 4KGDA 1H9AA 4NOKA 1DQRA 1JHRA 4DV5B 4MOWA 2UZ3A 1RWBA 2IZ7A 5ALGA 5IAEA 2HOQA 4YRDA 4WW0A 2LW7A 4YGYA 3K09A 3LT2A 5F2OA 3I4LA 3AFIA 3DHEA 3W7BA 4YRZA 3A9RA 4C1NA 5JAMA 2ZIXA 1AHIA 1J2UA 1POWA 4KNWA 5ALEA 4A8TA 3GYBA 2DLCX 2WG2A 2X8AA 1W2HA 2H5JA 4LPKA 1DEAA 1G20B 2FWMX 1NF3A 1T5SA 4IO1A 1DMRA 3UTCA 5KS2A 4UM8B 3K4QA 1Y80A 3ZCQA 2XHZA 4GGMX 3OLQA 3OTQA 4D79A 4BCCA 3RE1A 3Q8LA 3SGLA 4KUEA 3FYCA 5KOHA 1FS5A 2V58A 4K0RA 4XFDA 2FZCA 1S2OA 2BSAA 2IOHA 1H6CA 1SO8A 3BHNA 5FV4A 1PVOA 3E9EA 1I6WA 3EX7C 3UH0A 3HB4X 5BRJA 3AEUA 3IOEA 4D3ZA 4ZICA 5C37A 1SHUX 3DE7X 2HM7A 2PCLA 3A7DA 3TLMA 3LY9A 1COWA 2OB1A 4KMRA 5AKLA 3PNKA 1KYXA 1H4VB 5BNZA 5JZOA 4N6GA 3VPSA 2HV9A 4W1SA 1JZSA 1JYEA 3PA8A 1A8PA 2B69A 1M76A 3OQIA 4LZPA 4IIYA 4E31A 3K6RA 1RWVA 4ZP1A 3ZX5A 3T52A 4F04A 4HDRA 4F7WA 2EP5A 2C1ZA 4JJKA 4QOHA 1EQUA 5EJMA 4PYJA 4EJ0A 2OUIA 2TMYA 3AHHA 3H19A 4JUBA 5IAGA 3FHLA 1U2PA 5KQRA 2CGEA 3A05A 4AS2A 2AFIB 2RCNA 3V34A 1X1CA 3FPCA 4AZSA 1F51E 4MPDA 1SY7A 3RSLA 4MRMB 2EJBA 5AK5A 4MW2A 1FVOA 5EZYA 4F46A 5LDHA 4TKUB 3ZJVA 2X9LA 1Z12A 5AVSA 4ZCQA 4Q9KA 5L3ZA 5BURA 4HAXA 4GOMD 3AILA 3CCBA 1T1JA 2RGNC 5CA0B 1KVSA 1XTKA 1DIBA 3KP1A 4IZHA 2H0AA 5E6SB 1XVUA 1AUQA 2C88A 1CSEE 1CP2A 4B82A 3AWIA 1XWIA 3NT2A 3NRJA 4FP9A 2ETXA 4KI0A 4WOCA 2ZYTX 5LJLA 2C2YA 3P45A 4FCWA 3K0BA 3ZY2A 2C4VA 1A8UA 2CLDX 2YVQA 3L4BC 2R7MA 1PDVA 1NM5A 4TQUS 5BQ5A 4K6GA 4M53A 4YMWA 3GW8A 5DB4A 4P86A 4UQLA 3D5TA 1MJGA 1W49A 3L01A 1KKMA 2EYQA 2DC1A 1XMIA 4QYSA 5I3ZA 4Z3OA 5JS1A 1XVAA 2I2DA 1XZCA 5BPHA 1L5GB 1U2RA 2IDKA 2JHCA 1Y3AA 3OPVA 1C30A 1BMQA 1EIZA 3DB2A 2ZB4A 3P2YA 4OI2A 4B3XA 1MIHA 4L3OA 4KGZA 1C7ZA 1SKUA 2J30A 2WDPA 2HK8A 3H2KA 2FSIA 3PUXA 2WM3A 3PC6A 3I62A 2NM0A 3IHLA 4PLYA 2XWJI 1OKKD 5FB3A 3VU9A 3ZE6A 1Y1SA 4WBXC 1E2QA 1PVVA 2FPUA 5TQ2B 5KTKA 1GAEO 3I6YA 3RK1A 3E9CA 4G5XA 4EJ6A 2CSXA 1VGRA 2F55A 2KS6A 3F78A 1YACA 2QTWB 2GKOA 4RANA 1YXMA 5K0LA 2GJ8A 2XYVA 1B8PA 2IY9A 3ETHA 4GC9A 2XF8A 3NP7A 1JA9A 3RVNA 2HA7A 1MIOA 3SC6A 2P2CA 4C2TA 2J1LA 1QF9A 2QW1A 2YTZA 3NYRA 1V8BA 1RE1A 3ED1A 5DXFA 5A06A 2E4UA 1QZ3A 4HC4A 5MN4A 3C3EA 1J0EA 1VXOA 2OZEA 2P9TA 4RYLA 4ZGWA 5JJLA 2G63A 3Q7IA 3M4ZA 3KL4A 3VDMA 2QK4A 4NS4A 3FNGA 2AJDA 4BQRA 2I7CA 4CEHA 1LZKA 3K5PA 2PH5A 2RHOA 4JEHA 1N3YA 4DJFC 1G3IA 4X66B 1D8TA 1K0UA 2SKDA 1R4AA 1RYNA 1T6NA 4W5QA 4BNKA 1DEHA 1VYHA 2WF6A 2WC1A 3IMFA 3Q8MA 3KJXA 3NBMA 4M6WA 3LIPA 4IDEA 1RHRA 1XZMA 2R2GA 1H2ZA 2EZ8A 3HWX1 4JLMA 4BOYA 1PZMA 4LMBA 1ZOLA 4UBIA 1HQYE 5K20A 4C6RA 1BE8A 1O5TA 3BORA 2NVBA 3IP1A 2NUTA 3BL5A 4WK2B 1V0JA 1D03A 1XTTA 3HLTA 3PRYA 2PUEA 3HBFA 5EEHA 1EE2A 1JNXX 4ZVKA 4H7JA 5HTKA 4EY8A 4NY1A 4PG4A 4A16A 4RVUA 4GOJA 4IRXA 1RI2A 2JI8A 1L5QA 5KVAA 4P7BA 3BQNB 5JY6A 1PN3A 3VC3A 2NXNA 3L7IA 1PR9A 5T4FA 1WULS 1CZUA 2QRVA 4FILA 2LGJA 4FN4A 4MAMA 2IX9A 5DCLA 2GSDA 2A1TR 2BI8A 3GNSA 4CF7A 5I9NA 3OEWA 2OL4A 3LCMA 5F4ZA 2ATCA 4A6EA 3ZWDA 4RA6B 5ITZB 2L17A 2VJAA 4F7DA 2F00A 2J09A 3F8SA 3O47A 2BBOA 4J03A 2AQIA 3NHBA 3GFQA 4FNGA 5LD2B 4KXVA 1ZBQA 1L9XA 4MGKR 3Q5DA 2E82A 4L7VA 4KWIA 4MP8A 4CM5A 1WBJB 4XM2A 5DULA 1SVUA 2D8MA 1PWHA 3G6WA 2P2GA 1J42A 4BBZA 2IHBA 4YCDA 1BE6A 2OK7A 4P0TA 3IIJA 5EXPA 2VHWA 1QTIA 2CLEB 2OV8A 4U5QA 4PGHA 1M74A 5TVKA 1DKPA 3GLHA 3HQ4O 3RRBA 1Q20A 3O3MB 1JHQA 3NIFB 1X9GA 5AKIA 2J59A 1YF3A 2RBEA 3FKSD 3GEEA 4JCOA 4NZ9A 4D45A 3WA7A 5A0VA 4YT5A 2WWRA 2WLTA 1MOZA 1AUXA 4EY5A 1L1EA 3DZBA 3KO8A 4RELA 3VH4A 5AFSA 2ZUEA 3CW2A 3AYZB 3IDAA 1NQXA 1O77A 1RYMA 2CLLB 4EJ2A 4U7PB 5DYNA 1W0CA 3COVA 2RJNA 3AUFA 3EEYA 4U7FA 2BMWA 2GZHA 1OZAA 1VHJA 2JD2A 3B51X 3M70A 1B14A 4GGOA 4KXXA 4N12A 5KHLB 1CV2A 1L8LA 1STOA 2A59A 1JR2A 1E6LA 1SXHA 4BVAA 1FYFA 1NOIA 2JI6A 1Q17A 1C7JA 1G2IA 2NT3A 2QRGA 2WPDD 3Q7TA 2C4KA 2R1TA 3WRVA 1RPAA 2DQ4A 1EJ0A 2X5XA 3FX2A 2FG7C 1TKCA 3AUAA 1EVIA 1NYRA 3OX4A 1H8HA 3ZD7A 4CTNA 2VHTA 1Z3CA 1E9VA 1M2OB 1ZIPA 1R50A 3ANXA 1N7GA 2QG4A 1CQIB 1K8RA 1QO0D 3D8TA 4HLQB 2FPKA 4LYGA 3M1AA 4UUQA 3W6NA 4D8VA 3SXUA 3ZHQA 1TA0A 1E64A 1NI4B 1ZRMA 4DKXA 2HO4A 1JDBB 3S1LA 4YRQA 4CQMB 1M5RA 3QEAZ 3FCSB 1Q84A 1JR3A 3O2SB 4NJEB 5DCYA 3BILA 5HCNA 1CS0B 1P77A 3SN6A 4HD8A 2QIOA 4B9AA 4PXYA 1WM1A 1E6MA 1Z7BA 1Y1QA 2BM9A 1FXUA 2PMFA 3GFOA 5DYGA 3QVMA 2R62A 3FBGA 3VBCA 1IG3A 3HVIA 1SZDA 3PHIA 4HL6A 4KAFA 2YC4C 4LYDA 3T9EA 1NYLA 2QN6A 2GA8A 4BVJA 5U4XA 2P30A 2WG0A 4XYMA 4P0PB 3RPEA 2QM0A 2C4HA 2G80A 3UJAA 3KKEA 3LJKA 1ZYUA 5J2TF 1Q3KA 3VH1A 1INLA 5J2TB 1YGPA 1CEEA 1VXRA 1U1GA 4IPTA 3VJMA 1HEIA 3KJNA 2FZWA 1WXFA 5AI0A 4J91A 1UDRA 1S3IA 4RPCA 5DNWA 2DFKB 1F0NA 3C70A 4MW6A 4C43A 2C3YA 5B2EA 3M49A 4C08A 2ZRLA 1PJ3A 1XEWY 2X3UA 1YZTA 3WLQA 4JQOA 4D9KA 1SG0A 1N3LA 4TWIA 4XJTA 3QLVA 1CUCA 3AJEA 4UCFA 5TE9A 4QPZA 3OKAA 4ZU6X 5CDFA 2EARA 2JI9A 1XXLA 3K9WA 5B3JA 5CPBA 4FOSA 3TQSA 1CE8A 1ND5A 2NNWB 4QG7A 2QL7A 4D98A 1SAYA 2OCIA 3IBYA 1C9NA 3VNVA 2PBLA 3JALA 1RRCA 3Q2KA 4X6XA 1EFTA 3L7LA 4LSMA 1M1NB 4HPWA 3UXYA 3JR7A 1ZAKA 3U6BA 1TW3A 1UJ4A 3AY6A 1B8UA 4WZ6A 1GVHA 2GCGA 3U7HB 1E77A 2VPZA 4JFAA 4U2BA 3AF0A 1QTNA 2BZ0A 2QYTA 1BDMA 2O3QA 1TM1E 4HWRA 2ONKA 1A95A 4QGGA 4EH1A 2YWRA 5K7SA 3W7AA 1UIRA 3SXJA 1IDOA 4A1OA 4F8YA 4D25A 2OM2A 3LLMA 1WXHA 1XTBA 4CI0B 4XRGA 2BGGA 3T9DA 2HHJA 4DMRA 5FEUA 3CLTC 4N54A 2HNBA 1MRSA 4H31A 5JNVA 4HJXA 1QOPB 5G53C 3B52X 1EJBA 3DVQX 4ECEA 1P0PA 3KXIA 1ZD8A 1SU7A 2IYUA 4RWEA 2WIDA 1PG2A 1WP9A 1Z2AA 2HGSA 4LDAA 4OQEA 3PT5A 3U3JA 1VLLA 4BGEA 1XHEA 1XVTA 3P9PA 3PHJA 4RGBA 1SBNE 4MUEA 2ZLBA 3JAWA 1BSVA 3ABSB 5EXDA 5JYBA 2WABA 4K6MA 2PSJA 3WHPA 3OJWA 4BN4A 1R4NA 5A9SB 2W2LD 3WB2A 1ZIDA 4A0FA 3BGVA 4BDSA 2Z5VA 2P90A 1MJGM 2R6DA 4U9UA 4MQFB 1Y5NA 3HG7A 1OOEA 4I8DA 3AEYA 3GRRA 2BGWA 4KREA 1XMSA 1FEZA 2SKCA 2XMBA 5AJYA 4MIKA 5JCJA 3I9MA 2H7VA 2ID9A 2JD1A 2CCKA 4GKAA 4KIFA 4FFDA 3FMVA 1O5OA 4Z3DA 2J9YB 3EEOA 4M9UA 3A9VA 1FZQA 3HVKA 3A6HA 3P19A 3R0JA 2IY7A 2FOXA 4ITUA 3PKJA 3ZIUA 4HK4A 2QUIA 1A5SB 2O5CA 3UOGA 1V26A 3ITEA 3KQMA 4BVGA 5LD2C 3VISA 2CCJA 1XO1A 4ICIA 2OFPA 2OORC 3BFPA 4OGGA 1QK3A 5GM2A 3OBIA 1U3CA 1H2YA 1ODCA 5TARA 4DNFA 1NW8A 1O6CA 1RVDA 2C8KA 4J1TA 2OAP1 3K2BA 4URYR 2HEIA 1UWLA 4TWAA 3SHTA 1Q44A 1PO7A 3AOGA 4MKFA 4N7MA 3TM5A 3BIOA 2XCOA 1WDWB 3IT3A 3P2KA 5DGXA 4W99A 5GV8A 1YTLA 3IQDB 2JLZA 1NNSA 4F11A 1B15A 5EIBD 4MV1A 1YKFA 1SK9A 1XZKA 1GARA 2EU8A 1CERA 1SUAA 2WF7A 5E9JA 3WRXA 2G08A 1SKMA 1TK9A 3M33A 2VI5A 1B1CA 3RSZA 3A1SA 3S2UA 4C0KA 3B7GA 1WU7A 2PIAA 5IN5A 1YBVA 4EP1A 3AB3A 4ZZ2A 3KD2A 1J22A 2GPJA 1CHNA 3QLVC 1PEYA 2CJWA 4RHXA 3GHYA 1L3BA 2CT8A 1OB2A 1DDIA 1DX9A 4FINA 3A4YA 3JWHA 2OQ2A 3RYCB 5FOWA 4TRMA 4Q9AA 4IAOA 4CV1A 1AC5A 3WJ2A 1A9ZA 3NR2A 3G2NA 2X4LA 4KYUA 1M0WA 2BEWB 3VR3D 5GY7A 4UC0A 4DPLA 4ZEMA 5LWHA 1ILWA 2GO1A 4P38A 2UUBB 2G07A 3BHJA 4L4UA 3L4SO 3KETA 2R6ZA 3LLSA 1QHSA 2AN3A 3RJ5A 2QX9A 1H4TA 3BWYA 1O1YA 2QPLA 2X5NA 1RWPA 4YASA 2DUWA 1C3VA 2Q46A 2UUPA 1RLMA 1D8AA 3KLBA 3TTSA 2OCKA 2XGGA 1H3FA 2PMKA 4NU5A 3HBNA 5EPUA 1E20A 1IY0A 1KAOA 3FDZA 3FUTA 4KWCA 4MLZA 4AYXA 4B85A 4HYYA 1NNI1 3BWMA 4XCVA 1W52X 5IMSA 4N3BA 2ZXUA 1TC1A 3I9OA 4UMVA 3W2EA 1LI5A 3GRUA 3JQFA 4XASA 2HXSA 1A9TA 1LI7A 3VV3A 1P8JA 4BV9A 2Z3VA 4I50A 3A6JA 3NDBB 3IVGA 1P2GA 1RQXA 1KI1A 4OHMA 1MR3F 2W6ID 3L1IA 1UKEA 1X7WA 2IEYA 2AG6A 4M8IA 4DIEA 1AKYA 2AK2A 3FYUB 3ZR4B 1Q91A 2V5UA 3IPCA 3D8RA 1BXGA 4U7TB 2WM9B 2FU5C 4DQVA 2ZIGA 3E9MA 3WWPA 1QRRA 1L8AA 2GVDC 3COWA 1P7YA 2YIVX 5KYUA 4DRZA 4EA6A 2D2FA 3JAKB 5DP1A 3UV3A 2VAXA 1QUFA 2WMYA 2CVOA 1QFXA 3PYXA 1L8XA 4IGEA 3WMFA 3FY4A 2YBEA 4IHKA 1A2BA