3MSXA

Crystal structure of rhoa.gdp.mgf3 in complex with gap domain of arhgap20
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
177
structure length
177
Chain Sequence
IRKKLVIVGDGACGKTCLLIVNSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of molecular specificity of RhoGAP domains towards small GTPases of RhoA family.
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Transforming protein RhoA
total genus 60
structure length 177
sequence length 177
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3msxA00
1IBRA 3KDSE 3GEHA 1G41A 5LD2C 3BB1A 2GF9A 4NKRA 3X1ZA 4B33A 2QA5A 4BRWA 1I2DA 3DMNA 2YOHA 4PPFA 4XTRA 1N0WA 2DWQA 1UAAA 5KDOA 1PUJA 4Y0VA 2R9VA 2D74A 3K53A 4NDZA 5EE1A 1KI9A 4LY6A 3WP0A 2HV8A 4UJ5A 4TYWA 3REFA 2BBWA 2C2HA 2YJTD 4PC3A 2JLWA 2W6ID 4LZZA 1F2UA 4PC6A 2AWNA 4CVNA 1CJVC 5J4VA 4KHZA 3PEWA 2ZE7A 4LC1A 1IHUA 3K9GA 2IYZA 2MSDB 4GP6A 1UM8A 1ONBA 1JR3D 1D9XA 3K0EA 4K46A 4FXPA 1SVMA 3NXSA 4V02A 4AIIA 3EA0A 4B3XA 4M1TA 4C0BA 2GJ9A 4G3XA 1E99A 4AKEA 2JLZA 3ND8A 3A1VA 1G18A 5CJ2A 2AD5A 2FZLA 3PENA 4PXAA 3P4XA 3ZVNA 3QPUA 1GOTA 2IYSA 1XD9A 3K0FB 5TARA 2O0KA 4CDGA 4AWXA 2F43A 4ILEA 4XWOA 1MABA 1E79D 3BIFA 121PA 1H8HD 1OKKA 3PR1A 3I92A 3L8YA 3C5CA 4PTLA 3P32A 3T1VA 1G6OA 1KI3A 2GJ8A 1KSFX 1KDRA 1PLJA 1G7TA 2A9KA 2OAQ1 4QGHA 4ZI3A 2XXAA 1G7RA 3RANA 1E9CA 3VU9B 4Q5IA 1S96A 1ZC4A 2IYLD 4TYPA 3A1WA 3GJXC 3LNCA 5SZJA 2A7QA 5J4KA 3FGNA 1OIWA 1OJLA 4ZDWA 2N46A 3SI7A 1II8A 3K0AB 1NBME 5FOWA 3OESA 2CHQA 1UF9A 3WMFA 2ZVPX 3HPRA 1AZSC 5IDVA 5IHPA 4AYXA 2BVNA 2O0HA 1VHLA 1XJQA 1BKDR 1R8QA 3CH4B 3QBVA 1S4QA 3THOA 1CEEA 1E0KA 3AKDA 4Q02A 2WTUA 3NBXX 3CF6R 4QHTA 1BS1A 4Q4HB 4JMPA 2J59A 2RHMA 5AUOB 1Q44A 3Q72A 2XEXA 4JT4A 2R2AA 4BUJA 3TR0A 2IYVA 2X77A 3IGFA 4GZMA 4ON9A 3R8FA 2W6JD 2CE2X 2A2ZA 2ZRNA 2XX3A 3QXJA 3LA6A 3RRNA 1XTIA 3MJHA 4W5JA 3WYFA 3FVQA 2NO1A 1Z2CA 2CBZA 2GF0A 2PLRA 3VR2A 1F2TA 3K9NA 2WWIA 2XNSA 2ZU6A 1LS6A 2VHTA 1XTQA 4JS0A 1T3SA 1G21E 3FMPB 2ZS8A 3LLMA 3U7EB 4A2PA 2J45A 5HZHA 1G8YA 2HDNB 3FMIA 3M4YA 3OEHD 3MG9A 3OIYA 3QF4B 4OK5A 3ZS9A 2CCKA 4C0AC 5AJXA 1U0JA 3DVLA 1E9FA 1N5IA 1OXSC 1ZAKA 2DWPA 1P9RA 4DBLC 1W36C 1YZGA 2I4IA 1ZCAA 821PA 1VTKA 4US2R 2Q9BA 1NJFA 3OAAD 2QT0A 3K09A 2ZJ2A 4A6XA 2Z83A 1COWD 4JLMA 2YZ2A 4GOKA 4NZYA 5FUVA 4LOAA 4Q01A 2IEZA 3SS8A 1GUAA 1U2RA 4U7DA 3QY0A 2OV2A 3I72A 1NN5A 1W0JD 1HT1E 2WSMA 4QBHA 5CYPA 3U60B 4L8GA 4R2IA 4IRUB 1T3HA 2H16A 2D2FA 3CBQA 3G82C 4PHFA 3G0HA 2ZRLA 4F4IA 1HUQA 2DHRA 1J99A 2NZ8A 1TAGA 2AN9A 2ZSFA 4TZ6A 2QPAA 2AXNA 4KODA 2HT1A 4GBMA 5KPJA 5GJCA 1SXJE 2ZRIA 1N3BA 1HEIA 4TMTA 1OHHD 4M53A 5FPSA 1JECA 1DG3A 3NC0C 5HKKD 2ZROA 4D25A 4BFVA 1XD2A 1CR4A 1WA5A 1YRBA 4GT1A 3SYKA 4BECA 3AH8A 4C0JA 3PEVA 4G5SA 4TQUS 3VX3A 5LBIA 2FDCA 1NKSA 1OHHA 1P2SA 2BDTA 2H57A 3F8TA 5JWOA 3LD9A 1ZNYA 2OHFA 4MH0R 3SR0A 1KSJA 4BFTA 4OHZA 5JSZA 2FOLA 1L4YA 2CNWD 4CEIA 1KDOA 3AUYA 2DB3A 2CE7A 1TNDA 1PUIA 3Q5EA 4QFMA 1X8JA 3AVXA 4TMVA 4D6PA 4ZPXA 4S2EA 1EX7A 1NN3A 3CUEF 2CK3D 2GBLC 3NDBB 1KY2A 1FNNA 1ZU5A 1N5LA 2GKSA 2VHCA 3T12A 5L8VA 3NTUA 4JLJA 3THYA 2C5LA 4KFUA 1JI0A 5AWFC 3I61A 1DPFA 4FIDA 4UNQA 4OJKA 1SVSA 1E2KA 2CJWB 1U99A 4ZV4A 1EWRA 2BEKA 2QROA 4XWKA 1X3SA 1KMQA 3NDPA 3CIOA 1OF1A 4A2WA 3B85A 3ZZUA 4CEHA 1Q0UA 3RS3A 2FFQA 3QKRB 1Z0JA 3RRYA 2F1IA 2QEQA 4NYMR 4B3FX 4M9ZA 2IWRA 1UKVY 5HCIA 1C9KA 3TVDA 2LWIA 1AKEA 1T8UA 3TRFA 2QQEA 4B75A 4RD1A 1VIYA 1QRAA 2PEZA 2R6AA 3CM0A 3NBYC 1Z2AA 2D4HA 1DO2A 4DT1B 1W44A 1YZQA 2ZS7A 1DEKA 2HEIA 3NEJA 5L3QB 2Q3MA 5E3HA 4DLTA 1E2GA 1OFTA 4TLBA 1FL9A 1Z0IA 2WSSA 4LK2A 4W7SA 3UWOA 5TMPA 1ZM9A 4MRPA 4CEJB 3Q8XB 4N0EA 4DLWA 1OLOA 1UPTA 2OBNA 2P65A 3BGWA 2NG1A 4Q7LA 5H68A 2QRZA 4YQFA 4TLCA 3NHAA 1P62B 3IPXA 5FBVB 1SULA 2ANCA 1VPLA 3KQHA 1GRRA 4RVCA 4OQMA 4TZ0A 2FSGA 2NZJA 3BC1A 3QXHA 1ZUNB 1U8ZA 4EPVA 4C7OA 4LBWA 4L15A 1XPOA 5SZKB 1AS2A 2CLCX 2G3YA 2OM2A 1J7KA 1NMXA 2OESA 3QKSA 5B58C 1QHSA 2YINC 4I1UA 4ACBA 3QNUA 2W83A 1G8PA 4TMWA 4RCZA 3WHLA 2AR7A 5KUTA 3B1VA 2FFHA 3CLVA 3TK1A 4CYMA 2J7PD 4NYJQ 3BORA 3AGQA 1XU4A 3V9PA 1XTKA 4FD2A 4LGMA 4B2PA 1KGDA 4ASUD 2ZVQX 4B74A 3EZFA 4Q18A 1FX0A 4DLRA 2RGAA 2JATA 4RFVA 3B1YA 4TTRA 4O25A 1GTVA 5HE8A 3B1WA 1DOAA 2ZPTX 4WZAE 5L3SA 3L8ZA 3EC2A 4HB2A 5AJWA 1XCMA 2KWIA 1GNPA 5J40A 2FSIA 4KYUA 3SC3A 2GXSA 3AKYA 3CR7A 3ZIAA 3SU8A 3BFKA 2WKRA 4DLVA 1TL7C 1L7VC 4KBGA 5KNCA 4EJSA 1R2QA 3F5FA 2ZJZA 4FWTA 1V5WA 1YR8A 3KJGA 1ESNA 3DL0A 5C4MA 4PPGA 1D9ZA 3GMTA 4LBYA 2AK2A 3RRMA 2PX0A 2NQ2C 2DCUA 5GVSA 1Z3IX 3ZIAD 1E9EA 2B8TA 1RKBA 3FDIA 1CJTC 3LQRA 5KTYA 2CVHA 3L0IB 4DDTA 3N70A 2ZI4A 2OBLA 2PMKA 2O52A 2NPFA 2Q3FA 4FMCB 1JR3A 2B7BA 3V4FA 3GFTA 4AKGA 1E9SA 3WNCA 4PFSA 1JB1A 4M9XA 5JLJA 4ITRC 4RD4A 3OZXA 3RS0A 1IN8A 3A58B 3KKQA 2IX3A 5C2JB 1R7RA 2ZRGA 5K8LA 1E79A 2BMFA 1ZD1A 3LFUA 1H8HA 1RC8A 3HU1A 1UDWA 4HZUA 4EAQA 4QGFA 4IJMA 3UMSA 5JZVA 4B76A 4NP6A 4RZ3A 2QUZA 4JLVA 2FA9A 1NP6A 2GESA 4EIWA 1LTQA 3FHTA 3EG5A 1US8A 3KJEA 3DZ8A 5IF9A 3GP8A 2E87A 1A2BA 5AUNB 1XMJA 4V0KA 2FEOA 4XD7D 5AUQA 3MWJA 2IUTA 2VQSA 3CF2A 1X8LA 2V54A 4E5UA 5FFMA 4D82A 1M7GA 1Q57A 2AHOA 2GZDA 4BEBA 4JZKA 1E0JA 5FOUA 1VCIA 1TU4A 4UNRA 4ARZB 4YMVA 4XD7A 3JZAA 5HE9A 4X8HA 2F3TA 3PG5A 3WXMA 4IVPA 4MYUA 1E2PA 1VYUA 4HB4A 2XSZD 2BC9A 2NO0A 4DLUA 4LV8B 4LJ6A 4POAA 1N6HA 2OILA 1NI3A 1U81A 5FTKA 2QT1A 2IF2A 4LYHA 1BYIA 3SN6A 1E2FA 1N6LA 4DKXA 3X1WA 4EDHA 2RGNC 4BASA 2J87A 5FTMA 4TLAA 1FUKA 1EGAA 4A9AA 4QBGB 4BFXA 4R71A 3KFXA 3LV8A 3QOFA 4Q9KA 3PQCA 2GXQA 3HP1A 4A0HA 3EWSA 2ZUCA 2OCYC 2EU8A 3OEED 1N0VC 2WAYA 3WNBA 1KSGA 3P27A 2HCBA 2IC5A 3BAFA 1KI1A 3LW8A 5BWMA 2BMJA 4CIDA 4IXMA 2GEVA 1S9DA 1BYUA 1XFAA 1NLYA 1VG0B 4FCTA 4PC7A 3W9YA 2XJ4A 5AJZA 3A4LA 1LF5A 1ODFA 4WAUA 1M2OB 1XJCA 3NBFA 1FQKA 2XOKD 3SYLA 5TVKA 2EFDB 2PMDA 2A5GA 1UADA 3HYRA 3TAUA 4FMCF 3AP2A 2SHKA 1W0JA 3LQQA 2F1HA 2F9MA 3P4YA 2HCJB 4DCSA 2VP0A 2V55B 3MWLA 4B6EA 1MABB 3AVPA 1PJRA 4B2LA 2VYFA 4PR0A 5JI3E 3AVVA 4LJ9A 1QHGA 3TW8B 4B6FA 4IOLA 2G83A 1Z0DA 4MA4A 3LY5A 3EPLA 4KV9A 2XTZA 3TJZA 1R0WA 4UQOA 2GK6A 3LVQE 1GWNA 3KKMA 1UEJA 2YVUA 4ZIRB 2ZI3A 1E3MA 1E96A 4PC1A 3L2OB 1X8KA 5BN5A 3IIMA 4H1VA 4IOMA 2K5UA 4MRVA 3IQWA 4UJ3A 3QPWA 1SVLA 3ZS8A 1MRSA 1NVVR 2C96A 2BBOA 1JBKA 4NE2A 1XDBA 1FFHA 4PAOA 4LWZA 1V43A 2PCLA 1YZKA 3B78A 2WM9B 5FL3A 2NGRA 1PV4A 4PZLA 1UJ2A 2VBCA 3FHCB 3AB3A 2A5JA 2LKCA 4JL6A 3T5GA 4JSTA 3QXCA 4Q7JB 4L4UA 1GL6A 1R0ZA 2QTHA 5E7IA 2ZANA 1F48A 4WVFA 5E7MA 1F3OA 2G0NA 5TV2A 2RGDA 4MRSA 5FOXA 1HYQA 1RYFA 2CK3A 4OKSA 1TUEA 2JJ2D 1VHTA 5EP2A 4DRZA 3DOEA 2AXPA 2XAUA 3FTQA 4LV6A 3QBTA 4QHSA 4S35A 4NYIQ 3U6BA 5EE0A 2KJQA 2GA8A 2N42A 4V0ME 1XEXB 4NCIA 1P9WA 4GMXA 1N6KA 2OO7A 1SHKA 4QRHA 4JLAA 2H1LA 5KPDA 4JVSB 4B47A 3VNUA 1ETUA 4BFWA 2B6HA 3BD9A 3B8HA 4KJZA 1OW3B 2WWXA 3UPUA 1HT2E 1E2IA 2P3SA 2RMKA 1HA3A 2JLRA 4PO1A 1DTSA 4PAMA 4RSGA 2GBLA 5CB8A 2CMKA 2QPOA 1MH1A 3QVUA 2OUKA 3PEUA 1UBFA 3RLFA 3U4QB 1PZNA 1QG2A 3CZQA 2OCPA 3U5ZB 1GIAA 4OQLA 1DS6A 3D31A 3U7GA 2D2EA 3K70D 3H0KA 4E22A 2F1JA 3AP1A 4PSAA 1F60A 2QMUA 4KYIB 4OBEA 3G5UA 1CR2A 4I81A 3SJBA 1JEEA 1IAQA 5BN3A 4WIAA 3KQKA 2YYZA 1SKYB 3SEAA 3FKSA 3EZ9A 3B13B 3P26A 2VTKA 5D3QA 4Q9IA 4PO8A 3DZDA 4NYJR 1YHNA 1KK2A 2ZAMA 2I3BA 1CXZA 5EXPA 4KXFB 3C4JA 4TYYA 3LBNA 2REXB 1G5TA 3KX2A 2O8DB 5FTNA 3PIRA 2DWOA 1WCV1 2PEYA 3ZDQA 2VEDA 3RC8A 4LC0A 4R2HA 5FR2A 1MO3A 3TH5A 1KZGB 3H1TA 2F43B 1TPZA 4F4CA 3N2IA 3B7GA 4TMXA 2WOOA 2W0MA 4I1SA 5AK0A 2J46A 5BYKA 2NOAA 2WPDA 5CM9C 5GADl 4C7OB 2REOA 2V6JA 1WP9A 2Q6TA 1FMLA 3K0SA 1J70A 2QORA 5AJVB 1GNRA 2IBMA 2WICA 3I3SR 4UXJA 2KB0A 3D6TB 4M9QA 2QMHA 4KFSA 1JPNA 2PJZA 1LNZA 1Z07A 3D7MA 6Q21A 3SFZA 4IDHA 2GZHA 4EKDA 3SQWA 1JALA 1Q21A 3LWNA 5CB6A 1II8B 3K0AA 1CBUA 2X19A 2IXEA 4RFSA 1VG8A 2PZFA 2GCOA 2ODNA 4DIEA 3THWA 2IYWA 2V4ZA 2B7CA 3CX6A 4TSFD 4JYCA 1ZYUA 2WJYA 4EPXA 1IXZA 2JLUA 1OFHA 1C4OA 4GFDA 2RH5A 2XZPA 1QBKC 4LBZA 1GNQA 1NRJB 4AG6A 1TQDA 4PSKA 4LSGA 2ZRAA 1XP8A 4Q4HA 1E9AA 1RVDA 1KO4A 1VIAA 2P6RA 4I1OA 1ZINA 4YMSA 4HLUA 1L4UA 1RRCA 3PUVA 3UMRA 1WDTA 4HAVA 1XCPA 1DAIA 1ZNXA 3KJIA 4TL7A 3TSWA 2ODEA 3B60A 1PLLA 5DLQC 4NTZA 3CNNA 4WZBE 2IWHA 4MYTA 1ZW6A 3OIUA 2V1UA 4JSYA 4P31A 4PX9A 2GVZC 3Q9LA 2Z0MA 4DT1A 2WKQA 4WXRA 4LHVA 4JVMA 1VMAA 2VO1A 4DUGD 5K8IA 4OI2A 4C0SA 2VLIA 4KITB 1GAJA 2Q3HA 3GLGB 1Q12A 3SBDA 2QBYB 1DELA 1NSTA 1Q20A 4QJ5A 3WMGA 5EUMA 4ZKDA 5FTLA 3OIWA 3T1OA 2GNOA 2HJVA 2OSBA 3I32A 2VL7A 1P2VA 4DUGA 1CJMA 3RS5A 4IKEA 5JWHA 4B3BA 3QG1A 4HATA 1P6XA 3WY9A 2FX3A 3RS2A 1D6JA 1EFRD 5FPTA 1XX6A 4E03A 3GCGA 1LV7A 1KO8A 4Z8YA 2H8KA 5E95A 5EJEA 3QSYA 3GLFE 1Q3HA 2YOFA 4CGZA 5G3YA 2AK3A 2H92A 3I4LA 4AYWA 4URVR 1P2UA 2ZR7A 5EP1A 1OSNA 2L0XA 2QAGA 2FJUA 2C99A 1Q3TA 5L3VA 4EPWA 4GZLA 1GL9B 4DCTA 1GZSA 3VHXA 4DHEA 3A8TA 3FPAA 2IYRA 2VA8A 1MT0A 3OFND 5DN6A 3WBJA 1Z6XA 3KKNA 1T5IA 3T34A 4DJTA 5C46F 1JQLB 3QXXA 2F1RA 721PA 1NF3A 1O87A 3WMEA 2IS2A 3UKDA 4Z8XA 2OFWA 1W4CA 4XJXA 4RD0A 1NKTA 4LYJA 4HUTA 2EFHB 4FMDF 2QAJA 4FW9A 2WJVA 4C0HA 1KZ7B 2A30A 2YHSA 4V0LA 1GKUB 2Q9CA 2ZQ5A 2D06A 2W58A 2BJWA 1GG2A 2VP2A 2ZI6A 4NCNA 5KSZA 1N6IA 1IN6A 5KHOC 1KK1A 3HU2A 3E2IA 5HPYB 5C18A 2DR3A 4JT2A 1SQ5A 1NMZA 2DFNA 5D3MB 1XTSA 4TQ9A 4BQSA 2YKGA 3WYGA 2ZRFA 4JBXA 4YONB 3ZVLA 1AK2A 2I1VB 4XSHA 1D8TA 3DEFA 4U00A 1EESA 5G53C 1A82A 3T06B 4URWR 2W6IA 4A1FA 5CDFE 3ICEA 1VDZA 1EXMA 3DM5A 2WV9A 2WWYA 1GRQA 2CLDX 1LW7A 4HAYA 3T15A 5KU1A 2CXXA 1YZLA 1M1YE 1OXUA 2IXFA 4IOJA 2EW1A 1QDEA 1UDXA 5JJKA 1X1RA 2V9PA 2ZRHA 2WZQA 4NPHA 1WQ1R 4BFZA 4GOJA 4ZDIA 4QOSA 4BRUA 4A0FA 4FWIB 3J81k 2G1KA 2ZSBA 2P2LA 4Q4JA 3TQCA 1D5CA 2ZIAA 2EFCB 4DCUA 4F93B 1K8RA 4LJ8A 1TQ4A 4G0NA 2O8BB 2QPTA 4TLEA 1OKKD 3ZJYA 5LB2A 1KO7A 1N2CE 2RGBA 4PHHA 1KI2A 1E2DA 3Q85A 1T3LA 1M8PA 1BIFA 4L9SA 4A2QA 2V1XA 3IHWA 1TX4B 2C04A 2WHXA 3QE0A 4HLUC 4DCNA 4Z54A 3SJAA 1EFTA 5DI3B 2QENA 4URUR 4ZKEA 2CLSA 2CHVA 1G5RA 3NWJA 4DLZA 1D2MA 4Q19A 2CHGA 2CDNA 1AIPA 1NVVQ 1AKYA 1QF9A 4QC2A 3U61B 4B48A 4E07A 1HURA 3U3MA 3C7KA 2HYDA 1FTNA 2A78A 1E2QA 1Q1QA 3UMFA 4OK3A 1GDDA 3AVQA 1II0A 1IJEA 1N25A 1RJ9A 2PT5A 1W0KA 2FEMA 3DKPA 3HJNA 4PO9A 4XH9B 1XPUA 1E1RA 5B64A 1K5DA 3TUIC 2WBLC 2RCNA 2OCBA 2QY9A 2V7QA 3A1TA 4LJ4A 2QGZA 1JAIA 4KLZA 2EWWA 2YC2C 2O0JA 4XOIA 2BCJQ 1VKJA 1W0KD 3B6EA 1W2HA 1Z22A 1E1RD 4TYNA 4IOKA 1L8QA 1DAFA 1OH7A 4DB2A 1B23P 4A8JC 3HU3A 5DH9A 1VYVA 4QNMA 2VIIA 3GEEA 4CEHB 3Q7PA 2XTMA 1LVGA 3JZMA 4LYFA 5M04A 4RD6A 2QAGC 4OQXA 1CRPA 1CF4A 1A5TA 4PPQA 1KMHB 2F9LA 5AR1A 1H65A 2H7VA 1E69A 2BBSA 4LJ7A 5JS7A 1XF9A 4LX0A 3T1QA 3X1YA 5KSPA 2OEPA 4HUQB 1I4DD 1U98A 5A5GA 3QXSA 4GP7A 4QBFA 2XZLA 5JHHB 1NLZA 3KXKA 3GLHB 4DXAA 3KXLA 1UEIA 5BQ5A 3FKSD 1E0SA 3OIVA 2ONJA 1R0YA 3I8SA 4XSGA 621PA 5KSYA 1ZD9A 4WXPA 2ZM5A 2J0UA 4CEJA 2OBMA 3VMFA 2FFBA 2JJ8A 1YR9A 4J0QA 2J1LA 4A0GA 1JQJC 5CK5A 4DLSA 4FCWA 1XEWY 4MITA 2R65A 3FFBA 5LPNA 2C95A 3CONA 1CRQA 4D4LA 4M22A 2KSQA 4C30A 1XMSA 1HE1C 3ZH9B 3RABA 4R9UC 4ZCIA 4M21A 1JR3E 1SVIA 5DHAA 5CLLA 4UXIA 3TSZA 1KTVA 5HKKA 2OT3B 2C8VA 5ELXA 4DVGA 2NO7A 1C1YA 1S1CA 2JLXA 4LJAA 2BOVA 2GILA 1G16A 5EP3A 3TVTA 2BCGY 4LYAA 4AURA 3K70C 4P4UA 3KUDA 2R8RA 5E7JA 5FL7A 4GL2A 2XJ9A 1KKMA 3AM1A 2ZI5A 4Q1BA 3EPJA 3KB2A 4IXNA 3R8CA 3W6OA 3BB3A 1YVDA 3LDAA 1FX0B 3IDQA 4HSEA 1RYHA 3FYHA 1G8GA 3CX8A 4HDQB 5DYGA 5SZHB 1Z0KA 2GZAA 3VFDA 5EZ5A 1UKEA 4TSFA 4GOXA 2WJJA 5FL7D 2J7KA 1XZPA 5K8UA 3UWKA 2CL6X 3PFIA 4G01B 1YQTA 3ADCA 3QG5A 3H2YA 4PC2A 2HLDD 4YDSA 3ZZTA 1NNEA 4CZ2A 4GDFA 2HYIC 5EXXA 1Q1ZA 3WRYC 1HV8A 2R6CA 3BFXA 2Y8EA 5HR5A 2EFGA 2NMVA 1OV4A 2PZGA 4NBSA 3W90A 2ZR9A 2BV3A 3BB4A 4GPTA 2DY1A 1QG4A 1SHZA 2G9NA 3GLFA 1YZTA 3GJ8A 3C14C 2ZU0C 3U3JA 3U4QA 1IONA 2ONKA 3VQTA 3IILA 2DPXA 4WOPA 2JAQA 2FWRA 3BH0A 1QZXA 1KKLA 5HTKA 221PA 3AF1A 5GJVC 5HCNA 5JEDA 2ZE6A 1KHTA 2QG6A 1Z0FA 1Z83A 2FU5C 1EFCA 2WAXA 3IO5A 5FUWA 3TUJC 4BE7B 5JI2E 5LD2B 2WVJA 1TEVA 4E09A 1ELOA 2ZSAA 4MDFA 1K6MA 4HAXA 1II9A 4DSNA 2X1VA 1OXTA 3EAQA 4PQFA 1SKQA 1ZMXA 2W6JA 3RSLA 1GKIA 5C4GB 3W6PA 2VHJA 2P5TB 1Z63A 2B21A 4F92B 4DC9A 2NTYC 5CJPA 3B82A 5A0FA 3GLGA 3NH9A 3U7FB 4HZUB 4LBVA 1ZUHA 2JLVA 1HE8B 1VCNA 4RZUA 3AEZA 4TTQA 1ZD8A 3EZ7A 3VR3A 1ZNZA 1DO0A 1W5TA 1US8B 1KNXA 3CPJB 1E94E 1P72A 2H18A 4BLSA 4D4JA 2GXAA 2KBEA 5TY0A 3WP1B 1FP7A 3NH6A 2XZOA 2IYXA 2ZYWX 1Q1BA 1E9DA 3B9PA 4D4KA 4OHYA 4OQNA 3SE0A 4MYCA 3OAAA 1ZIOA 1M34E 1A1VA 4H1UA 2VP9A 1SKYE 3ASZA 4DDVA 3GLGE 4LHWA 3K0CC 1G291 1AS0A 1YR7A 1U0HC 1XNJA 4BLPA 4ZIRA 1VG1A 4B34A 4DWJA 5BYJA 2FN4A 5JJLA 2GEUA 1DE0A 1S9HA 3EWAA 2ZJBA 1AQUA 2ZRKA 3CX7A 3FMOB 3WHKA 1E2NA 3C5HA 4LI0A 2IS1A 4QGAA 3CRW1 4URYR 1T0HB 5JHGB 3LXXA 3R7WA 5DHFA 4M1WA 3ZVRA 5EZ6B 1E2EA 5FPKA 1DAMA 3AVUA 4ZCLA 2ORWA 2ZITA 1G4UR 4QG7A 3T1TA 5J4LA 1ZCBA 1IJFA 5CIQA 2DFTA 1KJWA 4LDJA 3ETLA 3KTAA 3I1FA 3LX5A 1P60A 4B32A 4YMUA 2O8CA 3NVAA 2XB2A 4CW7A 1HTWA 1T6NA 3FFAA 5IK2D 1E4YA 3BFVA 4AD8A 4DZZA 1QVAA 4OYHA 3CNOA 1YR6A 5JBQA 1YJ5A 5LB4A 2B8WA 4XTCS 5LDDC 4Q9LA 1N0UA 3TBKA 2Q9AA 2IT1A 1RFLA 4LJYA 5IK2A 1BMFD 4YXWD 3BJIC 4Q4AA 4GMDA 2E1RA 2GCNA 1VECA 3KZ1E 3DPUA 2CL7X 4A82A 4F7WA 4PQYA 4DEYA 4KVGA 4EPTA 4GSYA 1G5PA 2LKDA 1NN0A 3CKLA 2UZ3A 2ZS9A 4HAUA 2XNDD 3W6NA 1WE2A 4QL3A 2RKOA 1YZUA 3OF5A 5CM8B 3W8RA 2QTFA 3Q7QA 1CULC 2EWVA 2HXYA 2F55A 2PCJA 4Q1FA 5P21A 1TUIA 3EW9A 4UNSA 1E2LA 5B30A 1ANKA 2IL1A 3IIKA 1NVUQ 2VSXA 3BH7A 5IRCD 1ZJ6A 2ZREA 1SXJC 3K1JA 5JRZA 1W2GA 3VX4A 2QAGB 2PX3A 4Q66C 2ZJOA 4BWYA 4HLDA 5JS8A 3NEYA 1NBMD 3CO5A 1GVNB 1W1WA 5CK4A 4HDCA 4F91B 4CT5A 3LO5A 1KK0A 1OXVA 2V8OA 2WWWA 5TDHA 2I1QA 1NIPA 4MDEA 1FQJA 1W5SA 1Z8FA 1YE8A 3MGCA 4JLOA 1J8MF 2EYUA 1I4LD 3RAPR 3FMFA 4LPSA 1OH5A 3AKCA 1EK0A 1MO6A 1U9IA 2CCGA 1W4AA 4QM7A 1W46A 2RB4A 1W4RA 1CP2A 1NIJA 4DSUA 4P4TA 1R5OA 2EVWX 5CLQA 5FH9A 4DSTA 1G64A 4G5GA 3GQBA 3H84A 3EPHA 1Z6GA 2OG2A 3AF4A 2ZSEA 4Z1MA 4M2LA 2VF8A 3NHBA 4B3DA 2IYYA 4BLQA 1XWIA 2IS6A 1KK3A 4TYQA 1RE0A 2QM8A 4EQ6A 4DB4A 1JNYA 1GITA 2PBRA 2ZUDA 2D3WA 1VCMA 2BEJA 2A5YB 3SYNA 2QP4A 1U8YA 1VG9B 2O5VA 4US1R 2ZRCA 1RPZA 4C0LA 1SZPA 3S1AA 4TN1A 1G8HA 2VPPA 4I1VA 3CWQA 1COWA 4JLBA 3IHLA 4M1KA 4F38A 2NO6A 2WWGA 2FF7A 1WXQA 4PHTA 1UKYA 3ADKA 1IN4A 2OE2A 4ZDKA 3CWZA 2AD1A 3GJ5A 3NKVA 3ND9A 5F9HA 3SJZA 2YNMA 3A36A 4HLQB 1TADA 3QQ5A 2C98A 1UKZA 1XBTA 2IS4A 4B43A 3ONWA 2KE5A 1IY0A 1IY2A 3A4MA 1KO1A 2RGEA 1T0JB 3IKJA 4MKFA 2UVQA 4Q4JB 4UKDA 5DIFA 1D2EA 1G6HA 3RYTC 5ANRB 2MMGA 2OLJA 4HUQA 2VRWA 2ZYVX 5DI9A 4JLPA 2R6DA 1P75A 4D4MA 3MWYW 5JECA 1NG1A 4H9GA 1OYYA 3GLHA 3O8BA 1RRFA 2VP4A 4W5WA 4PANA 4TWZA 4WW0A 2XITA 1FZQA 1IXSB 5JRJA 1FPMA 2FMXA 1G20E 4QXAA 4KCGA 1ESMA 2O8DA 2QL6A 3THXA 5JJIA 1D2NA 2AFIE 1GKYA 3B5JA 3JVVA 4RD3A 2D7CA 4CF7A 3WNDA 3U3KA 2ZRBA 4IVRA 2EQBA 2CNWA 1R0XA 1JAHA 3W3ZB 1G4AE 3UG7A 1E0AA 4Q9HA 2ODBA 3CH5A 3GFPA 1QHNA 2FG5A 3PV0A 4JYBA 3QPVA 2ORIA 3FHOA 1AN0A 2ZEJA 3KKOA 5FBRB 1NY5A 3GLIE 1JEDA 5J4HA 1RJ9B 3DOFA 3CF0A 4IW3B 3LAWA 3EIEA 3FOZA 3MWKA 4M4SA 5BN4A 4HAZA 4LJ5A 3IUYA 1ZM7A 1JJVA 2AX4A 2BBTA 2GJAA 1JXMA 3M1IA 5EXTA 1U8AA 2FSFA 3K8YA 4CT4B 4QHYA 1FP6A 1G19A 2GXUA 2QE7D 1W36B 2GCOB 2W00A 3THWB 1A4RA 2ZJAA 2V3CC 2HLDA 2X2EA 4ZCMA 3EPKA 4A4DA 4L16A 5G3ZA 1B0UA 2YWGA 5F2EA 4Z51A 4NCKA 5EXSA 1A2KC 2QMOA 1XXHA 3GJ0A 3LRPA 4QNRA 2C78A 2YWEA 3BH6A 4KU4A 3F0TA 4WZ6A 1AJEA 1DBSA 4DDWA 1U94A 1O3YA 3ZQ6A 1SXJA 4D2IA 1S3GA 2DYKA 3RNLA 1W4BA 2F7SA 5K8TA 4DIDA 3KQNA 1KMHA 1UBGA 2WSSD 1CS4C 4NYIR 2JLSA 3VNVA 1AQYA 2NPIA 1P9NA 3SNHA 3SFVA 2RHDA 3W5IA 3U44B 2Z4SA 3DO6A 4JBYA 4TL6A 3SHFA 3VHLB 5KOYA 4JL8A 4NHOA 3PUWA 4LHYA 2ZYTX 3RC3A 2FPMA 3AKEA 4O2LA 3RVBA 1KNQA 1J8YF 3D8BA 3RWOA 4IDNA 1XEWX 1MOZA 4RCYA 2PLFA 2MSCB 2YWHA 5EP4A 4BLTA 2QBYA 1E9RA 1WRBA 2VH5R 1DAEA 3HR7A 4MGYR 3M6AA 4A0RA 1ZNWA 1M7HA 1LFDB 4N0DA 4Q4LA 4XIGS 4X8LA 4ACAA 1AA9A 1U0LA 2IEYA 2O8EB 2ZYUX 4MRRA 1GM5A 4HB3A 4JKYA 4C3ZA 1JR6A 5IT5A 4IDPA 3T35A 2J7PA 4HYYA 3TGPA 3KKPA 2GAOA 2FZ4A 3ADBA 2IHYA 2DFLA 2IYTA 3O8CA 3TE6A 4DDUA 2O8BA 2WJIA 2UKDA 5FBLB 1E98A 3IBYA 4JJKA 3BE4A 2O8FA 2H17A 4PPNA 3IQXA 4JLDA 3K9LA 1XB2A 2QM7A 4FI3C 4B3CA 4EFLA 3CR8A 4AKHA 1N6PA 2W2TA 1WMSA 4NMMA 2XXAB 3PEYA 4KO8A 1G17A 5F98A 4XVUA 3LX8A 2D62A 3EZ2A 4XVQA 3RS4A 2HUPA 3REGA 1T4GA 3A4NA 3IEUA 2ZJ8A 3EC1A 3ZD7A 1GRNA 3W5JA 1WF3A 1Z29A 1W36D 1ZBDA 4RD2A 4O3MA 1KO5A 1K5GA 2QP3A 1Z08A 5G41A 2JIZD 3VKHA 1S2MA 3HDTA 4FMBB 4Q7KA 2C03A 3R9WA 4K81B 1OIVA 3C41J 3R7WB 1R6BX 1N6OA 1P5ZB 3QF7A 4G5OA 2BMEA 2R6GA 1TF2A 3WYAA 5FR1A 4D80A 2GK7A 4U5XA 3TR5A 4QKQA 3GLFB 3X2SA 1PVOA 2FE4A 1I4TD 5HZKA 1QHHB 4FN5A 3AGPA 2ASEA 5D3MA 1S0UA 2WMNB 4B73A 1P61B 1IOZA 2O8CB 4C4PA 3OE7D 3R20A 1G3QA 2GEDA 2GHIA 2YC4C 1E2MA 4KAXA 5FOTA 5KYKA 2BKEA 2A5FA 3AV0B 1ZRHA 2WJHA 2BHRA 2FNAA 4FCVA 2DFKB 1NLFA 4IEEA 1AGRA 1HQYE 4HEJA 2IHBA 4NCJA 3A1SA 1F2UB 2JCSA 2XTNA 3ZYCA 1NG9A 1OFUX 1SGWA 1GL7A 4Q03A 3IBGA 3K0CA 4KBFA 2JJ2A 5F9FA 1NVWQ 3UXMA 1T9HA 1M74A 5JWRA 3QF4A 1XRJA 5J4YA 3EX7C 1CIPA 1ZIPA 4Q4AB 4C0QC 4MKHA 2P6NA 3PXGA 4URXR 3U7HB 2CCJA 4XVRA 3CNLA 3B1XA 4P4SB 3BBPA 3L0SA 3UANA 1KIMA 4P0TA 1LF0A 3A1UA 1YU9A 2J41A 1CTQA 1BO6A 1CLUA 3K0FA 4OK6A 1MR3F 3GEIA 3PUZA 4RKEA 1QHXA 3BRWD 2MSEB 4U02A 4BLRA 4P33A 4Y0AA 4AYTA 3MAAC 3GPLA 2AWOA 2YV5A 3E5HA 3U6KA 5H1YA 5KNBA 2J0UB 4Q1DA 3LH5A 4AC9A 4AY2A 1Y3AA 5DO9A 5FPYA 5J5CA 1NBMA 2C9CA 5DISB 8OHMA 2W0SA 3MCAA 1G7CA 2RAPA 5AUPB 3LW7A 2BIFA 2AKYA 2QNRA 5DI3A 2P6UA 2ZJ5A 2XSZA 2JA1A 5FPHA 5DE3A 3VU9A 3X1XA 4JIMA 2EYQA 3I8XA 1J90A 1KDPA 4G1UC 5GJWC 2Z5FA 3CW2A 2FSHA 3NIBA 2FGJA 2FFAA 4Q1CA 2WKPA 3CPHA 1A7JA 1R10A 3GD7A 4TL8A 3TKLA 3VTKA 4DCVA 4HZIA 3SOPA 5KNDA 2NO9A 2ZI9A 3ADDA 1M7BA 1VCOA 2IYUA 5FUYA 3GJ3A 3ZZ0A 3EXAA 1ZM4A 1DADA 2GDJA 2REBA 2Z4RA 4LUCA 1HQCA 3A6PC 4LV5B 1Z06A 3DDCA 4Q9JA 5JCZA 1Z6AA 3TW4A 4IFEA 1MV5A 1FUUA 2BWJA 2YWFA 2J3EA 4B35A 4A8JA 3K09C 2VP6A 4RJLA 2FPLA 5JSZB 1SVWA 1U9IC 2IF0A 4IFBA 3GJ6A 4JKIA 2XOKA 2WPDD 1OIXA 1HY3A 4K8OA 2AFHE 2QSYA 3IIJA 4KLNA 4OJQA 1KI6B 2KI5A 3BS4A 4M8NE 4WA7A 4G5QA 2GJSA 1OH8A 2FV8A 2R62A 1G3RA 4FINA 5F3WB 4OQFA 1W49A 3VR5A 4EFMA 4QM6A 1CR1A 3GFOA 1OXXK 3IPYA 4TMZA 3BERA 5CYOA 2VSFA 3CRRA 4MQBA 3M0EA 4CRWB 1RW4A 4F4JA 1P4SA 3U3RA 3E70C 3P20A 4II7A 4YLGA 4D0NA 1W7AA 5CIWA 1KSHA 1UBEA 3HWSA 2VP5A 1DAHA 3AVOA 2J0SA 2QSZA 2ZRDA 3EA5A 2P0EA 3LLUA 4MGZR 3AVYA 2G1JA 3L43A 5EUQB 3MJRA 3LXRA 3AF2A 3MLEA 2PL3A 1XPRA 1MKYA 1RRPA 4ESVA 3RSOA 2JDIA 4HLCA 2IYQA 1KDTA 1Z6YA 4JJZA 2IUSA 2ODWA 4JBWA 3EASA 3RS7A 3WRXC 3AUXA 1T91A 5L3QA 2B92A 4P32A 3T5DA 2Q0HA 1GSIA 1FNMA 5L3RA 3GLHE 3CZPA 2J9RA 2ECKA 2C9YA 4FMDB 5EE3A 2GTPA 1OT3A 3C16C 2BM0A 1TU3A 1YRAA 2ZUBA 2JDID 4TL9A 1KI7A 1E9BA 4B3GA 3MSXA 2QQ0A 3Q3JB 4LRWA 2WOJA 4C0KA 3LVRE 2JJ1A 1XD2B 5DSZA 4M1SA 2N1BA 3RWMB 4PHGA 1E2JA 4DLXA 3AF3A 2ERYA 5SZIA 4IHQA 4JLKA 3QKSB 3TLXA 1XCGB 3V00A 4C2TA 4HDOB 4BPBA 2QE7A 2QRNA 1TQ6A 2RGXA 1WBBA 1P3JA 5AJYA 4CEIB 2JJ1D 1ZUIA 1NVXQ 3GLIA 2R6FA 5EE5B 3OHMA 1FW6A 4EQ6B 4NU0A 3KQUA 2JASA 4BFSA 4US0R 2ZETA 1RRGA 1EFRA 2C77A 3KJHA 3PCRB 1DAGA 4V03A 3I5XA 1R5BA 1S1MA 4UXHA 1H8EA 4JVLA 1E6CA 4YMWA 1NJGA 1KJYA 3PVSA 1IN5A 4KI0A 4OHXA 5TB5A 3HR8A 4IDOA 1SXJD 2CJWA 2H5EA 4WBSA 5JEEA 2J5XA 4LCBA 1E2HA 1Q1EA 1QHYA 1RZ3A 2GRJA 4Q47A 2R44A 3TNFA 1KJZA 5KDLA 3SZRA 1H8ED 1X6VA 2WWHA 2Z43A 3OFNA 5DN6D 4ZO4A 3KTAB 2OZEA 2HF8A 2UZIR 3LBIA 4EJSB 1G3UA 1G3MA 1ZC3A 4TT3D 3TQFA 3OEEA 3CRQA 3VR4A 2ZRJA 4KSCA 3CRVA 5FUXA 2Q21A 2BJVA 1F2TB 2OCAA 3ASYA 5CDFA 3W34A 3WBKA 3ZGXA 4A92A 3PUXA 3AVWA 3DHWC 4OHVA 2VHUA 2OFXA 4ESHA 4IDQA 1IXRC 4M1YA 4TT3A 4D0LB 4KFRA 4KVAA 2RGGA 5FBQB 2ATXA 3VKGA 1BH2A 3THXB 3MFYA 2MMCA 4A36A 4D81A 5UKDA 3X1DA 3W3AA 1F6BA 2IK8A 4BLOA 4A15A 4JVNA 3EIHA 4R98A 2G0TA 3BK7A 3BWDD 5KDDA 2O8EA 4MYHA 1R5NA 3QUSA 1ZVQA 1T8TA 1KI8A 2HT6A 2HF9A 1GP2A 2WJGA 1I2MA 2ZRMA 3B9QA 4YC7A 3AVTA 3I5YA 1XTRA 1UFQA 4NH0A 1P7CA 5JCPA 2P67A 3HYTA 4PZZA 4NYMQ 4LHZA 4URZR 3UG6A 2XGJA 3TUZC 4I99A 1OH6A 4BZPA 2VSOA 5H8WA 3FWYA 1NSFA 2PJRA 3ECCA 4OI1A 2ZI7A 3SDZA 3UK6A 1AZTA 5B2ZA 4AG5A 4B2IA 3H4MA 3ZVMA 2LCFA 3QVVA 1OE0A 1LS1A 2JIZA 1N6NA 4BZQA 521PA 1E1QD 3P1JA 4EJSC 4ERNA 3AP3A 1W48A 5E4FA 4L9WA 2OXRA 3O47A 3AQ4A 5FOVA 1QHIA 3BXZA 4IEIA 3SHWA 5B57C 5GJBA 1Q22A 3PJRA 1WBDA 3MUFA 4Q7MB 1TF5A 4OI0A 1CKEA 1E1QA 4OL0A 5DGXA 1Z5ZA 4N1AA 1F5NA 2C9OA 3CPEA 1R8SA 2DBYA 2CEAA 2F3RA 1XMIA 3OE7A 4QBIA 3NBZC 2CL0X 3CRMA 5EQTA 1OPXA 1NMYA 4AKIA 4A6PA 5DNYB 1Y63A 2PZEA 1QHHA 1TEXA 1CR0A 1MO4A 5A4JA 3U44A 3THYB 3MMPA 3L0OA 1G7SA 4AK9A 3AF0A 4Q48A 1XD8A 2TMKA 3R9XA 1E4VA 2QGNA 2G88A 1ZU4A 4EUNA 1G1MA 1LB1B 4M0LA 2RGNA 4Q00A 4DEXA 4V0NA 3VAAA 5JMTA 4NONA 1KOFA 2J0VA 1ZM3A 2JEOA 4HI0E 2KBFA 1U90A 1E32A 2QZ4A 4B71A 2ZSDA 1OB5A 3KFVA 3OEHA 4BFYA 1UBCA 3EIQA 4IVQA 1N5JA 1DARA 2PH1A 3DKVA 3FKQA 2G6BA 4B44A 1EFUA 1XTJA 3GJ4A 4ZDJA 1LY1A 1OB2A 3QI2A 5BXQC 4V0MA 2WWFA 3JVUA 1EFHA 4OHWA 3RRZA 4P4SA 4TLDA 1R4AA 2QTVB 2X8AA 1EX6A 1JXOA 2JLQA 4HB0A 4MKGA 3T61A 3KL4A 2BM1A 1OYWA 2EFEB 1SVOA 1ZP6A 1YZNA 2WMOB 4QJ4A 1TQ2A 3GJ7A 4MUBA 1FOEB 1JPJA 3NC1C 4NL4H 1EWQA 1NL3A 1Z28A 2RGCA 4PZYA 1VYTA 3DMDA 3PITA 4PSVA 3NG1A 3TSOA 2WIBA 5DYIA 1Z6TA 4QGGA 1BOFA 2ATVA 4QJ3A 1T5LA 1KAGA 2J0QA 2FPKA 2V6IA 3MD0A 3ZLJA 4KSBA 3PUYA 3FB4A 1AGPA 5FI0B 2AL7A 4Q1EA 3N5CA 4ARZA 1GFIA 2OXCA 3QKTA 421PA 2X2FA 3TMKA 1PLKA 1S3SA 2W2VA 4XWAA 3QJYA 3CB4A 2JLYA 3D3QA 4Q1AA 1P73A 1N6RA 2HJGA 3L82B 1QVRA 1NN1A 3ICQB 3N2EA 2QMEA 2ZR0A 4ABYA 1S8FA 2QP9X 3U3OA 1G3IA 1L2TA 3K9HA 4LHXA 3ZQJA 1KY3A 1KAOA 1XZQA 4BZXA 1YKSA 3ZD6A 4BGDA 1IN7A 3B2EA 4RKFA 2VF7A 4TTPA 1J2JA 1JJ7A 4A8JB 4UNPA 2A5DA 3S1AB 2ORVA 1G8FA 4OI4A 1SVKA 4PAQA 1N5KA 3V4RA 2IW3A 1NY6A 2JGNA 1TF7A 1Z0AA 3VR6A 1P2TA 4D26A 4MGIR 2ZAOA 1HH4A 1XEFA 2XB4A 4RZXA 1XXHB 3Q5DA 4W5HA 4KFTA 3O8RA 4M1MA 3E1SA 2ZJYA 3RHFA 1GILA 2BMDA 5FBWB 4TMKA 1BMFA 3QKRA 4P3YA 4YXWA 5C1BA 5CITA 2FGKA 3I62A 3H86A 4HAWA 3BOSA 1DVRA 5KO2A 2QN6A 2GVDC 1X86B 1AS3A 4JLNA 4MUAA 3IEVA 2XNDA 4UNNA 4DSOA 3I73A 5FTJA 3QIAA 5J47A 2ANBA 2GAAA 3F3YA 3SQXA 1MO5A 2IUUA 4GRAA 4DLYA 1TMKA 1CU1A 5BW8A 2GETA 1CJKC 4C9BA 2ZXUA 1DAKA 2IA5A 2HXSA 3QKUA 4L5BA 4MGKR 3KXIA 4MKIA 4X8MA 3SBEA 5TXGA 3R9IA 2YOGA 1ZM2A 3VKWA 3UATA 3HPQA 1OFIA 4GI7A 1IQPA 2ZE8A 3RDPA 1KI4A 3K70B 3L0PA 3U2QA 2ZE5A 3O8DA 2ZRPA 4R7ZA 3KUCA 5FI1B 5JFGA 3C8UA 4X8OA 2Z6VA 2IXGA 2V7QD 1AM4D 2OAP1 2P5SA 4PQRA 5G40A 1XJ0A 3TIFA 2BKUA 4D0GA 2OFOA 3DM9B 1DG1G 1XMVA 2O8FB 4MRNA 1W47A 2PT7A 1RIFA 2E9SA 3IO3A 1FTSA 2ZTSA 4M1OA 3VR1A 3QEJA 2D7DA 4NCHA 3A37A 3FE2A 4O0MA 5GVRA 4EPYA 4Z1MD 1CJUC 1M6NA 3B1ZA 1MRNA 4V0OA 3SJCA 2QU8A 5H70A 3W8NA 2F6RA 3MRSA 3KB1A 4Q21A 2GJKA 4G5RA 1XXHE 1EG7A 4JL5A 5EE9A 3GLIB 2AKAB 3QEOA 4RY2A 4TQAA 2FH5B 4BEJA 2GCPA 3EARA 5L3SB 3UIEA 1XEXA 4O2RA 2NIPA 4BFUA 4ASUA 1KI6A 1X1SA 2QI9C 3QENA 4YDHB 4EFNA 5FOSA 4C2UA 4RFSB 4RZ2A 1KYIA 2W2XA 4LPKA 2G77B 5KSOA 1FMJA 3TAHA 1TTTA 1SXJB 2A3RA 3EZ6A 1IY1A 2CVFA 4EPRA 4ZI2A 1G9XA 1IM2A 3LBHA 2VHQA 4YMTA 2GWHA 3KQLA 1Z47A 4W9MC 4AI6A 1WB9A 2WIAA 4N3NA 2ERXA 4I4LA 2OLKA 4M9SA 4GNKA 3C15C
chains in the Genus database with same CATH superfamily
4JUCA 1ONOA 4M0UA 1UXJA 3DAOA 1FLDA 1G41A 2A84A 3OEWA 1KBOA 4RA9A 5C52B 1LBSA 4NKRA 4XDYA 5L4LA 4HYQA 3EMVA 2JBAB 3MZ0A 4CMBA 1PZHA 3HACA 3MXTA 4WFQA 4YXFA 3JVIA 3G8YA 5BY2A 4PPFA 4XTRA 7MDHA 1NNUA 1JE0A 4MIEA 1DRKA 1AC5A 4Y0VA 3WKAA 1H2RS 2D74A 3R1IA 2HA7A 5EE1A 1KI9A 2HPVA 2WP8J 3EW7A 3F2IA 3WP0A 2DKFA 4YB8A 3FFTA 2X5OA 4ZTZB 1FXWA 3W2TA 2PKQP 1SEPA 3VVLA 2QXUA 2UDPA 4G89A 4X45A 3SIXA 4LC1A 5EMNA 2MIIA 1QH8B 2NNWB 1U8EA 3SZUA 1EDEA 4IMIB 4GP6A 1UM8A 1ONBA 2VXYA 5HFJA 1XMQB 5ADUS 4V02A 4Y3UA 4AMUA 3KLNA 4M1TA 1UK7A 5H3CA 4GKAA 5C7OO 3HCRA 3ND8A 1MV8A 3A1VA 4GO1A 5DWQA 1G18A 4YRIA 1EJ2A 2FZLA 4PS0A 5F64A 1U4SA 1FQWA 3QPUA 4QICA 3K0FB 5TARA 1PWXA 3VHRA 2PSDA 4LW8A 4FLMA 4AWXA 2F43A 4ILEA 5LUBA 1BDBA 3PNQA 3BK1A 5KTPA 3H8JA 1OKKA 4H3HB 4NBUA 4O4JA 3S27A 1CY8A 2XD9A 2FZGA 3KYCB 1WCWA 3OTWA 3SQMA 3OU7A 4FDVA 2XUKA 4Q7QA 4FC7A 3WGNA 4MWDA 3FZGA 2GJ8A 2D2VA 4LQ4A 3MGBA 1KDRA 2OAQ1 4ZI3A 2XXAA 1QVZA 4TS9A 5EJ9A 1PNQA 5BSGA 1E9CA 4PGHA 4OD0A 2QZSA 5L6MB 2Z6UA 4B9EA 3RAGA 3A1WA 5SZJA 2VN8A 1M2KA 1OIWA 1P2GA 3G0CA 4G24A 4EKYA 2PZMA 4MHOA 4PXYA 3RVOA 5EZYB 1H23A 3QLJA 1Y1QA 1Z2PX 3OESA 2CHQA 1J21A 5T6BA 5C7IO 1C50A 5DLYA 2X1MA 4F3RA 2PM8A 1NP3A 1W30A 4AB1A 3HYNA 1XIVA 1DINA 4PSUA 1GG8A 1RWWA 2V65A 1MTZA 3ZCSA 1S4QA 2I2DA 2EWMA 3AKDA 3DDNA 2I7DA 1POXA 3NBXX 1MJGM 2B61A 4M6WB 1ZA2A 1YMVA 1QAMA 4JMPA 2J59A 1WVIA 1UANA 4XJVA 1Q44A 2IE8A 1B0ZA 1YRYE 1KDZA 4DADA 1MA3A 4JR2A 4BUJA 2BEVA 4QUAA 5BW4A 1AMOA 3TLAA 4GZMA 3LYUA 3GZ4A 1R4MB 2CE2X 1VE9A 3LA6A 2ZG6A 1XTIA 2DQKA 1JH8A 4Q9AA 3U81A 2NZVG 2KPOA 4J1QA 5ENVA 3JQPA 3O1JC 1EX9A 1Z2CA 2CBZA 2GF0A 3EXHA 3VR2A 3IE0A 5THKA 4N8SA 1IYZA 4MWGA 2VYQA 3S44A 2BFEA 2P2DA 1T3SA 3LLMA 3QVSA 4I4TF 2ZBGA 1JSCA 4L6AA 3IPLA 3PQFA 3C74A 4ZALA 1VLLA 1C7QA 1K4MA 1G8YA 3FMIA 1OWPA 3MCTA 3WYNA 3AI7A 3MG9A 1RDFA 9LDTA 3WGOA 5HRUA 5AJXA 5IKMA 4G5HA 1Z6PA 3DE7X 4D3FA 3DVLA 1E9FA 3DWEX 1U0TA 3GDWA 4NK4A 4DBLC 2ZB7A 3PDHA 1ZCAA 1VSTA 3V97A 1VTKA 2Q9BA 3L1IA 4RZHA 1WS6A 1V9CA 2QT0A 1CIJA 1A9RA 3VH1A 5CLJA 1AUQA 5FWAA 1X7YA 1XZMA 3TM4A 1V0JA 5FUVA 2D54A 1SFRA 2WTXA 2IEZA 4L28A 5DLEA 3NGMA 1U2RA 4KUHA 3QY0A 3KCQA 1W0JD 2O2ZA 1HT1E 2WSMA 1A9ZA 5CYPA 1P74A 2XKJE 4L8GA 4EEKA 2IU6A 4X54A 5BWOA 2PXHA 3K4QA 1GQRA 3PJFA 1H05A 2H16A 3G82C 4PHFA 3EVGA 2YICA 4LXUA 1TAGA 1LRJA 1QYWA 1GA4A 3H5LA 2H5JA 2C5FA 5TGTA 3KBBA 2JLCA 2Z56A 3WK4A 1U3GA 4EUFA 3S8YA 5BN5B 1MW8X 2QVGA 4JNKA 3LP5A 2ZRIA 4TMTA 1FVHA 3FSGD 4J0IA 4ARUA 4HRAA 2VHEA 4BCDA 1JECA 1C3EA 1DG3A 3CZRA 3NC0C 2IEIA 2PD6A 2ZROA 3G2IA 2NYAA 3CNHA 4BFVA 1R00A 4U2KA 4XW2A 2KLBA 2QTZA 4GT1A 4HPXB 5KIAA 4ZN6A 1L1EA 3DMRA 3G7SA 4DCGA 1P5FA 3W8FA 4CL3A 1UKCA 3LGXA 5D85A 5LBIA 3VX3A 1NKSA 2XA1A 5IJXA 3IMCA 4GYWA 3LD9A 1ZNYA 4V38A 4MH0R 3SR0A 1NC3A 2C5HA 1VSBA 4OHZA 1QM5A 4PYOA 3FAKA 2JFZA 4ZQEA 4DNQA 4OREX 1L4YA 2PKQO 3C6BA 3WSVA 1DMRA 2C57A 2Z30A 3EGCA 1PR5A 4AJ4A 1D7OA 3IQIX 4UUBA 2PZJA 4QFMA 2F62A 3OCZA 1T4CB 2KHZA 2QOEA 1LZLA 2FF5A 4O08A 4D6PA 5F2NA 1SD5A 2VA9A 3IDSA 4J75A 3CUEF 1EGHA 2CK3D 2P9GA 3QPDA 2OA0A 1DXQA 1BXRA 1KY2A 5FBKA 2GKSA 1A1VA 4JXZA 2IDZA 3TX6A 2KLHA 4HRYA 1M10A 4S12A 1JI0A 3YASA 2B8EA 1YF3A 5ADHA 4MVJM 1ZRMA 2XGMA 3FDFA 1XQXA 3FOCA 1R8XA 3OOSA 4XGKA 2CJWB 1QZUA 1U99A 3FOWA 1YB2A 4N7JA 2NYVA 5BSRA 4CMEA 4R1UA 4XWKA 8LDHA 3T9FA 2P30A 5EQJB 3Q3IA 5K4GA 4RTKA 3U7IA 4REMA 1OF1A 3AIIA 5K7SA 3B85A 4JC8A 4C05A 1VLZA 1SXIA 4II2A 1QMGA 5CB4B 4JQOA 1R5JA 2QEQA 3MA0A 2ID9A 2WHPA 4D79A 3A11A 2RAUA 3KB6A 3T38A 1T1IA 3UHAA 5HCIA 4WZAB 5HEKA 2X0RA 1AKEA 2H1WA 5TPZD 2IH4A 5H16A 4E4YA 1SU4A 4B75A 5JAMA 2PV0A 2GO7A 2PEZA 4JB3A 4FR2A 3IQZA 3ZTWA 4BMYA 2EL7A 1DO2A 2EBWA 4KGVA 4R8SA 5IG2A 4BKPA 1JBEA 1PEYA 1DEKA 1C29B 1M67A 1WL8A 3HUFA 3LPAA 5FHQA 5IX8A 3ZNOA 3LSYA 5HP4A 4DS3A 1P0PA 4FPXA 1QGED 3RFXA 2O2GA 1ZM9A 1S2IA 3D6JA 4B46A 3TM5A 1P8AA 3K35A 5E9QA 8ATCA 2OBNA 2DZDA 2YH2A 4NIMA 2VUSA 3ROKA 5HFAA 4D8WA 3A25A 5BSHA 1DX4A 4AT1A 3DYVA 1DEAA 2JIMA 2YZGA 2N3ZA 3EMBA 3IPXA 1SULA 2ANCA 1VPLA 2I3GA 1AD2A 4H1TA 1BHSA 4OQMA 3V4LA 4W99A 2ZBRA 5AW5A 2AC4A 1W85B 3CUWA 1VPTA 2BT4A 1Y3DE 2QQFA 4M0EA 4RELA 2HSWA 4O1MA 4KOEC 1W34A 3P9PA 1N7JA 1M8GA 2Y3IA 4L15A 4LBWA 4NY1A 1XPOA 5TS3A 4AMGA 5SY6A 3TZBA 2GT1A 2OP1A 3K4PA 2C8LA 2VZ0A 3OZGA 3SK0A 2HRQA 4ER6A 5BQ3A 1AGYA 2OESA 5DK6A 3RYIA 3NZEA 4YNBA 4I1UA 3R3HA 4CLHA 3PNBA 1AQJA 3SZLA 5LQCA 3QVXA 3AHCA 2C59A 2FFHA 3N8KA 1LX7A 4ZCPA 1AUOA 2VDPB 5K4AA 1RC1A 1C3OB 3AGQA 4D44A 4D42A 1UMBA 2HHHB 1TE2A 1MJHA 4B2PA 2RH8A 2AG5A 1XZGA 2PO5A 5MFZA 3H4VA 1GKLA 4K7JA 4L0CA 4ZANA 3TW6A 2RGAA 2RJOA 3ZGZA 3R7LA 1LRLA 1WCIA 3GO4A 4QUHA 4QYTA 2PZAA 1WUYA 3CN9A 2YW9A 2ZPTX 4WZAE 1W581 5L3SA 3L8ZA 3KRTA 5CVEA 3K7EA 4HB2A 1V7CA 5AJWA 1GNPA 5JD3A 4ZYLA 2FSIA 1O95A 4KYUA 3CR7A 4Y2GA 3VH2A 2OOSA 2BTOA 2XV1A 3BFKA 3SICE 1FDTA 13PKA 1L7VC 5C8YB 1WABA 4NPCA 4EL5A 5KNCA 2NSLA 4X94A 3TLYA 3HMQA 1QZZA 3K5PA 4GF5A 3OJEA 4S1WA 1HLFA 3E05A 2O7QA 3ZKWB 4PPGA 2A9OA 2HMSA 3Q9SA 4MNTA 4LBYA 4CLXA 4LWQA 3U6BA 4BVAA 2FOXA 2BGKA 2NQ2C 4EJ0A 1X13A 2X5JO 1Z3IX 4FNOA 4HTFA 1U3UA 3R8XA 1O96A 3LQRA 3FDIA 3V9AA 1CJTC 5KTYA 2YHAA 3TCXB 3L0IB 2BZ0A 3N70A 3VTFA 4DDTA 1WXFA 3GGCA 1A2QA 4ZOLA 4B3MB 4NS1A 2OBLA 1ADYA 1EE9A 2EJBA 1SC1A 2W2QA 4WCDA 3S1LA 4GBED 1DB3A 3V4FA 4OQPA 3OH8A 4A73A 4PFSA 4TN5A 1GFSA 3B1JA 4RD4A 3RS0A 4YQYA 3UAYA 2B5OA 3W77A 1U2DA 2ZCUA 2Q6LA 2XHEA 3PHIA 4RKWA 3FMVA 3IELA 3KKQA 1BROA 1ISMA 2WU8A 1KTIA 3GJSA 4LCJA 1NC1A 5C2JB 4KN5A 2IX3A 4UDYX 3H75A 4X6UA 2RAFA 3QV1A 5CTJA 2IKQA 1BEEA 2F4NA 2XVMA 4MWOA 3HU1A 3BKXA 1YVRA 5LP6C 4BVGA 4QGFA 3OZ7A 4IJMA 4AF6A 3O93A 2QJTA 4RZ3A 3H3XA 5EJ4A 3NHFA 3L6EA 3GA0A 4JLVA 4CIBA 2R8OA 4OB8A 3O5AA 1MBZA 2JFWA 3EG5A 4CL0A 2GH1A 3NM5A 5ICGA 3DZ8A 3TVYA 1L8LA 1WDKA 1HDIA 2EJVA 5JNSA 3P45A 1H6CA 1SBIA 2P2NA 4B7AA 2HSDA 3VO2A 1ABEA 2QL9A 1XMJA 3M6LA 4E4TA 2VK8A 3C3YA 3KCNA 3MWJA 4UUPA 5IWCA 2VQSA 4XGQA 4BMZA 2ZT8A 3JQFA 2C2MA 2JFQA 4HKTA 1ZZGA 3OTHA 3VC7A 4LNUA 5AM3A 3CJRA 4X00A 1QTQA 2O5EA 2ZPAA 1E0JA 4JZKA 4NRDA 5FOUA 2D1TA 1R8YA 4EB8A 3A28A 4PX5A 3KQQA 2RD2A 4DUZB 2FSVA 4RPCA 2ROQA 3DW1X 2A0WA 1Z68A 2Q0QA 4XD7A 3R23A 1ODTC 3S70A 3N53A 1U1IA 2GPJA 4F21A 1IATA 2A0YA 1PNRA 4D6XA 2VDOB 1GPYA 1ZY2A 2HHLA 4MYUA 1OXBB 4AS3A 2I54A 3QHQA 3RNOA 2BC9A 2XB8A 5J9FA 1W4ZA 5DCLA 1E66A 3HSKA 4HNQA 2YRWA 2O1SA 2VKQA 3HCBA 2D7JA 5LOVF 2IF2A 1BYIA 3SN6A 1N6LA 4DKXA 1B4DA 2PUEA 1P33A 4F5YA 1P7PA 2VDUE 1RP1A 2RGNC 2J87A 2Y1GA 5FTMA 4BFXA 4IDBA 4P35A 1DTWB 5JBIA 1FFEA 3KFXA 2I1LA 1R64A 1Z56C 1DMSA 2QWXA 3LV8A 3QOFA 4QDKA 2DPHA 4Q9KA 4HNTA 1ZFNA 3EWSA 3DGFC 4QYMA 1MC5A 5LZ8A 3OEED 3UK2A 3GFGA 4F4UA 4HLNA 3DBLB 1C0IA 1EX1A 1Y7IA 4DV2B 1CEYA 2PVPA 4GI2A 3WLJA 5JPIA 4CQJA 1YA8A 3EQ8A 3JYNA 4PFKA 1TA0A 2BEWB 2VJPA 2DR0A 4P6VF 1RWXA 2W37A 5BYBA 2HJHA 4IXMA 4PBSA 4V3CA 4CTJA 1KH1A 1V71A 1XUOA 2DSTA 2FWNA 2HH9A 4G8DA 1QH1B 3AXSA 3W9YA 3A4LA 1K92A 2W9XA 2HA3A 1ODFA 4R2KA 2V7TA 1PGQA 3DFUA 1XJCA 3QP9A 4H3SA 4HS4A 4KXXA 4O02B 1K6IA 2XVZA 3C48A 2EFDB 5CUQA 3VKVA 1AY0A 4RTSA 3H97A 1KC3A 4I19A 2JI7A 2B3TA 3N9IA 2F1HA 3STUA 1V6SA 3I30X 3P4YA 2HCJB 5KNCH 4FIZA 3ZJUA 1FJHA 2QD1A 2V55B 3MWLA 1CK4A 5DM2A 3DH0A 3ZWCA 4B6EA 4CF6A 3WRWA 1TAQA 2H4WA 4P4LA 1PJ4A 4QYIB 1QHGA 3TW8B 2GKOA 1THTA 2G83A 3U56A 3JV7A 2QNIA 3D6VA 2EG5A 3EPRA 3TJZA 4M89A 4OHOA 4MWEA 2AQ8A 4Q34A 3WAGA 1CQWA 3F6YA 1SU7A 1GWNA 1XFDA 2QPLA 3KKMA 4ZMBA 1TK2A 2FPGB 1UEJA 1IHPA 1OX4A 2Q2WA 1FX1A 1QLHA 3P0JA 4WCFA 1I3MA 2ZI3A 3L9XA 1ZN8A 1ECFA 3L2OB 3UUGA 1T26A 1X8KA 1H9CA 3JQ9A 2RKBA 3QPWA 1RXEA 4U2CA 1NVVR 2ZIWB 4G4SO 3NHPA 3CE9A 3WC4A 3SSAA 1JBKA 2XCQA 1PZMA 3GRAA 4NE2A 5EJMA 3PXDA 1W25A 3UH0A 2IV3A 4CHGA 4PAGA 3C4QA 3JYPA 3S3TA 4H18A 2YJNA 1ID1A 1XNGA 2IW1A 2TSYB 2JAHA 5JQGF 3JZFA 1MX1A 6REQB 1G8JA 2CXNA 5HGXA 4DV4B 4S05A 3E1KA 4DA8A 1PV4A 1X7DA 2G67A 3AB3A 3FHCB 3TDKA 2MDTA 3V4VB 1Z5OA 3N2KB 4ESEA 3D4LA 4YYZA 4JSTA 4Q7JB 4U7JA 3ESBA 2GBFA 5DNVA 1F3OA 1VKZA 3JU3A 5TV2A 3RS8A 1Y89A 1E1MA 5FXMA 4GR4A 2Q1SA 1A96A 4YRTA 4Y6LA 1RYFA 4BU0A 1TUEA 1F20A 1KIAA 5EP2A 3E0XA 3P9QA 2AXPA 1ZBQA 5LQSA 3T9DA 4S35A 3GUZA 4X65B 5JANA 1ZIXA 2KJQA 3WHPA 3X2FA 3BFJA 3PCTA 4G67A 1XEXB 4RJJA 3BSWA 2ZB3A 3EQ7A 1X7HA 1TVKB 4RTNA 4MS1A 4P93A 1ETUA 5IKOA 2B6HA 1U28C 1G5IA 3L92A 5D1HA 3K3PA 3ZY6A 4R1PA 5ED4A 2C3YA 1RM0A 1E2IA 4DIUA 4CKZA 3P9ZA 1YAHA 3ORSA 1DBWA 2PMCA 1W5EA 3AFNA 3IP9A 4MIOA 5I4IA 1A7AA 1YVPA 2WI8A 3T95A 4TKVA 3R2JA 2PUCA 2KW5A 5DHUA 2EKZA 2QPOA 3HCCA 3AW9A 2XCRB 1XVUA 4P5PA 3NASA 3RUEA 3LU1A 1KFBB 1PZNA 4D57A 3P0EA 1GIAA 3DPSA 4OQLA 4X3CA 1DS6A 3JAKA 3U7GA 3K70D 3CCCA 1G5HA 2PUJA 4KO4S 1EUCA 3PGA1 1T4BA 1UC9A 1PZEA 2GCEA 2Q62A 2QMUA 2B83A 3ESAA 3HJUA 3C1OA 1WB5A 4XDGA 3CSSA 2D5CA 3DPIA 1VRCA 5I9MA 5AHKA 5TJHA 3AZPA 2GGSA 1MA0A 4X92A 1MPXA 2YYZA 3KQKA 1LI5A 1SRQA 2EX4A 3FKSA 1GGJA 3B13B 3P26A 2ISQA 5D3QA 4ZI7B 3DZDA 2DFPA 2OO5C 2WC1A 3A6KA 2PR7A 1PJBA 3HSYA 3B89A 5A2QA 2GQ0A 2WPNA 4QIHA 2NZYA 3H9JA 3PU6A 4IIJA 1J6UA 3ZNNA 4CM1A 3FIJA 4QTZA 3KX2A 1G5TA 2AJ8A 2SKEA 2O8DB 2X14A 4XQ9A 5JDCA 1ZK3A 3DLIA 3LUDA 3HLKA 3Q3EA 5CLGA 3U7RA 4BGVA 3TL6A 4TUYF 4G1MB 3TZQA 1EQ2A 3N2IA 3UQZA 2GBIA 4I1SA 3RYFB 2J46A 4KV7A 4J3JA 1BHJA 2NOAA 5CM9C 4DR2B 2B3DA 1B3BA 2GLTA 1C0KA 3FG9A 4KPFC 5CNMA 4MCAA 1GQSA 1M2HA 1WP9A 3B36A 5HOQA 3BIXA 2B1RA 1OTHA 3HB7A 3E9RA 5CB4F 4HWTA 1IXYA 3M81A 4LE0A 3IAUA 1ESCA 5DK4A 1JAXA 5C8ZA 4YJFA 4M9QA 4Q4DA 4ALMA 4KR0A 2FPWA 2QMHA 1H0KA 1SMKA 5A5FA 3HXPA 3SFZA 1EJ0A 4IDHA 4EKDA 3Q6IA 1PT6A 3AG6A 5LZ5A 3SQWA 1JALA 1Q21A 3A31A 3LWNA 4CMEC 5CB6A 1CBUA 1E1LA 2VOJA 1GTG1 2IXEA 2KMLA 3PWSA 2GCOA 3E5RA 3N2GA 1HE5A 5DNUA 3EGVA 2QTBA 2V4ZA 5I45A 1C9DB 1SIWA 1RZUA 3ZCTA 2CLOB 4D9JA 3ODGA 1FVXA 2HREA 2Y9PB 1C4OA 4NOLA 2HU8A 2VF2A 2VJYA 3MUNA 4LBZA 1SUDA 4AG6A 1TQDA 2NT4A 2PS9A 4JZYA 2ACEA 4LSGA 4J7UA 5A62A 3ETJA 3QE3A 2P6RA 1KFEB 2FN9A 4HLUA 4LHSA 4YMSA 2I4LA 3KZNA 1RRCA 2P8SA 3PUVA 4HAVA 3KJIA 1ZJYA 1SOMA 1V11A 5BYAA 2CN1A 2CVOA 2ODEA 3I42A 3HA5A 4Z4EA 3O9MA 4NTZA 2GD2A 1PL7A 2QX8A 4IP0A 4WZBE 4G97A 2UUOA 3LUBA 3QFRA 1WV1A 2W90A 3LWDA 3PI7A 3G23A 2RI0A 3R5FA 1WEHA 3ZU6A 1ESEA 2H0QA 1P6UA 3EGXB 4DT1A 3WYCA 4OFWA 2FG6C 4CBVA 1EEHA 2RG7A 4G4JA 3QLUA 3O0TA 2PZKA 3ZU5A 4XWWA 2VLIA 5P8WA 1GAJA 1WG8A 3B12A 4JT8A 4N40A 2QBYB 3C8DA 3EVNA 3ZU3A 3LT1A 3ROZA 3SS9X 1GKKA 1Z4NA 4E0BA 2YYYA 3WMGA 1H1LB 1TTHA 1KY4A 2WTMA 3WYDA 2GNOA 4EDFA 1J5PA 3BFPA 2OSBA 3OLQA 2P3QA 4CWAA 4W5RA 1U4OA 4O4JB 4B3BA 4QT4A 1IY8A 1CWUA 1S02A 4HATA 1M2NA 1Z7BA 4QREA 2FX3A 4J3FA 5DBIA 5H0IA 4F2HA 1TCUA 1XX6A 2ZWMA 1LPBB 4KPUB 3VR5H 3GCGA 4RVUA 3PFBA 1LV7A 1KO8A 2GSWA 2H8KA 3INRA 5AI5A 5E95A 3E5MA 4BNTA 2HRDA 3VZDA 1Z37A 2VVTA 4CGZA 3H05A 5IJ9B 5JAIA 3QKWA 4K9PA 1OSNA 2H3EA 1G20A 1TJYA 2C99A 1Q3TA 2FJUA 1RJDA 3B20A 3HDYA 4EPWA 4MWCA 4DCTA 1UQUA 3FUWA 1EQUA 3WKDA 2E5LB 4XVCA 1DRJA 1G8SA 2VA8A 3D0KA 5DN6A 1N3YA 4WLVA 5KC9A 2DECA 1EFKA 1JQLB 1ZONA 3AR7A 4L27A 4DIFA 1NF3A 1S01A 2X13A 3KJQA 3WMEA 4B81A 3BZBA 5CVJA 1U02A 4M6WA 4HL6A 3T3DA 2J9FA 4RTQA 5J2TB 3CC8A 3MM4A 2XVAA 3FTCA 3PTAA 3PQ7A 1CY7A 1MX3A 5K0LA 1AVTA 2EFHB 3K9QO 3N0VA 4FMDF 5K1ZA 1F12A 2WJVA 1EHCA 4C0HA 5CFNA 5MFPA 1EWTA 1LBTA 1XQ6A 1YI0A 2Q9CA 2PLWA 4N6GA 3L8HA 4H7DA 2BJWA 1GG2A 1EINA 4I7EA 4NCNA 1N6IA 5KSZA 4W5TA 2PGAA 1PFKA 1ZIYA 1DQPA 2EBUA 2PUWA 1QYXA 2QRVB 4DUPA 3CCFA 1Z45A 3HK2A 3HU2A 3E2IA 4V24A 1QGUB 1L4KA 4NABA 3EXEB 3RBZA 4BKQA 1NMZA 2DFNA 1RZRD 4BQSA 1JMYA 4IJUA 4ZI7F 1UXGA 2BW0A 3IQFA 2ZRFA 1U5BB 4C4AA 1I3OA 2JFGA 1YKGA 3LUAA 2FW1A 3DB2A 1JJAA 4RY0A 1YMQA 3PQ2A 2C4HA 2DJIA 4Y6OA 2VHWA 3T06B 1GZDA 1U5AA 5GOZA 4BE9A 3LHIA 5EYPB 3T15A 1LW7A 4HAYA 3QPCA 5KU1A 2VS1A 4X3OA 1OXUA 4NNPA 3NNNA 2IXFA 4PV7A 5E0OA 5FQNA 4DIOA 1DXHA 4QEZA 2VQ6A 4BN5A 1UDXA 1X1RA 3D8RA 3PHCA 2PA3A 4NPHA 4GOJA 4BFZA 4QVGA 4CV1A 1DWQA 2HOQA 3EDMA 4BRUA 4UE6A 2PXXA 4NJMB 2G1KA 2ZSBA 4YWHA 1USUA 5DIZA 4EGQA 4PIMA 4HXFB 1LC0A 1JFFA 1TW3A 1EVQA 1XZDA 2ZB8A 3SIRA 4G0NA 5HJ7A 4LWOA 4BNIA 2Y1LA 3CLUD 2CFTA 2AVDA 1K7FB 3E22A 4L0MA 3DBHB 5DEOA 4C1NA 4BQEA 1KKUA 3GOQA 2WILA 4PHHA 4C4RA 2A33A 2L2QA 1BW9B 3HB1A 4LMRA 3T4EA 4YAIA 3W5BA 1PG2A 1KYWA 1QZTA 1PW7A 4R51A 1UBSB 5K0EA 3MTDA 2V1XA 1R4NA 2GHTA 3IHWA 2M98A 3TSCA 2VOEA 1NASA 1U0FA 3QE0A 1QMPA 3B6MA 4MVJA 4DCNA 4Z54A 1EFTA 5DI3B 4IIBA 4ZKEA 3DGEC 3K5WA 1G5RA 4GC9A 5HA5A 1T15A 1R27A 4WKCA 4DLZA 1E6MA 1E9VA 5K0TA 2CDNA 1MG0A 3ZE7A 3EB9A 3FZEA 3O2QB 4QU0A 3UY4A 1X0VA 3Q8WA 1KPHA 1YDFA 2QJRA 3DVRX 1Y33E 1HURA 1U2SA 4O4IF 4OATA 5IXJA 4QOHA 1NULA 2AI2A 3FUXA 4V2IA 4WSOA 1F2DA 3UMFA 4CMJA 4OK3A 2V0NA 4RL4A 3R5HA 4TV9F 1TZKA 4TVKA 3RH0A 3PS9A 4RQUA 1IJEA 3HB9A 3TR6A 3TN7A 1NMEA 1W0KA 3W05A 1ZEMA 2FEMA 3BWEA 4BMXA 4PO9A 5AT1A 5KEIA 1EK5A 4HTAA 3VDQA 3VO9A 1ENPA 5K3CA 4CQNA 3ZBUA 1PNOA 4DYVA 1N2OA 1VRVA 1VZ2A 2RCNA 1T4CA 1PN3A 1XZBA 3OT1B 3PKIA 4IJVA 1YDEA 4LJ4A 2Q1YA 4OGFA 1DC4A 3C3JA 5KTSA 3BMOA 1AU9A 5G0UA 1IM8A 1F0NA 2J4CA 5NLLA 3BGDA 4QJIA 1GPLA 4IIFA 3B6EA 4GS5A 4RK4A 3IUJA 3VNRA 1DKQA 2I34A 4HQOA 3L5OA 4RIEA 2DHDA 1RLIA 3ESZA 4H4DA 4YASA 5F7ZA 5IT0A 1A5SB 4TYNA 5ALNA 3GBVA 1Q1GA 5BUQA 4MKRA 1B23P 1NBAA 3HU3A 4YJHA 5DH9A 1EXNA 1JDTA 1VYVA 3IAFA 2HIHA 4CNQA 4CN8A 3E8MA 3O03A 5C8YA 4ZV9A 4LYFA 4EQZA 4XYLA 1JEQA 4K5QA 4RD6A 4J91A 4DC1A 2CKDA 4DBZA 1EXVA 1ESZA 3OFJA 2OGTA 4BNZA 3HKEA 3ELWA 3L6CA 4MV5A 4WERA 5E7QA 3ZWNA 5JS7A 3INYA 2RBKA 1TRHA 1J5XA 1KXZA 1XF9A 3BTSA 3UBTA 2BELA 4H1WA 3MILA 2Y99A 4LZAA 4QXMA 3QQPA 5JISA 1T8WA 4AMZA 1ZK4A 3GLHB 4GD3Q 5DGHA 3AEXA 3MHPA 4F2PA 3BVPA 3HBAA 3MAGA 4DMCA 4K9RA 1LNQA 4XSGA 4WCFC 4WXPA 4A0SA 2B69A 3ZW8A 2FFBA 2JJ8A 1YR9A 4TPKA 4E7OA 4DQDA 3FFBA 4YJ3F 2C95A 3CONA 1CRQA 1QIIA 1JL3A 4M22A 1UK9A 5HVNA 3QUTA 1ODIA 5FRDA 1A50B 2NUPB 2SNIE 1LSOA 3P2MA 2BGUA 3UOAB 2NU9B 5A0TA 2NVWA 3STYA 1P5JA 3IS3A 4X0EA 4LXQA 4Y2PA 3SJ7A 5B37A 3S40A 4R01A 3TCNA 1KU6A 2C88A 2AS0A 1PTJA 1UJ6A 2PGXA 1S1CA 1Z6ZA 3SXUB 5B1EA 2DUNA 3CX4A 1RKQA 2JLXA 1E3LA 2BCGY 3K70C 1GPDG 3DCIA 3ENVA 4FE3A 4YP1A 3RJ9A 1YOBA 5A5EA 3AFOA 1T8PA 5L6LB 1F8FA 4RMIA 5I7VA 2GM4A 4GL2A 3G02A 1ORIA 2P78A 3O4IA 5DBEX 1JIKA 1PWYE 3GRUA 2Y6UA 5AVYA 4K3VA 4ICIA 3BB3A 3HVHA 4UEQA 3W78A 2X9LA 1SUIA 1ZK0A 1Z4QA 1XZHA 2R8EA 2DTXA 3EZGA 4MV4A 4BJ6A 3C5WP 4MINA 4KQ2A 3T1HB 7YASA 1XN4A 2GZAA 3E23A 5EZ5A 3SEZA 4TSFA 5GONB 3K15A 4BMOB 5FL7D 2B9VA 1NJ2A 3UWKA 2CL6X 2P9QA 4LSZA 2ZAGA 1ZR2A 4YJGB 1U3FA 1P2BA 3A9VA 3A2NA 1CUJA 5JQWA 3NIWA 5DMXA 4DR1B 2HLDD 4YBZA 4YYEA 2QE6A 1NNEA 3ZJ5A 4P4GA 4IJ6A 1YACA 5EPOA 3M2TA 2GFIA 3S2FA 3WOVA 4EWLA 4GDFA 4ARIA 3R5JA 3WRYC 1BN6A 2W93A 4Q12A 1XO1A 2B2XA 4E11A 4YRKA 3ERCA 4HXGA 2Y8EA 2Z9BA 3LCRA 4TXLA 4WNYA 4UTPA 5EUBA 4ALKA 4C7VA 2YJ4A 4EG5A 2ZR9A 1E3DA 5DSXA 2V9CA 3WB1A 3BB4A 4O2BF 4RLSA 5CFZA 4LCEA 3AG5A 2V7WA 3SC4A 5EHNA 1YZTA 3GJ8A 3C3BA 2TECE 1FU8A 5D6NA 3DL7A 1IPFA 1IONA 2QJFA 2ONKA 3L07A 3VNAA 2QQ5A 2DPXA 2FWRA 4B84A 5A02A 5BQFA 3GHYA 3BEOA 3O3NB 2GPAA 3UA4A 4MV6A 3HKCB 1ZLYA 1A9YA 2ZE6A 4TTQA 1DIAA 1KEEB 4KREA 4RGQA 4N5IX 3L9WA 5ICSA 2HRCA 5IJZA 2RH4A 2CLEB 2OK7A 3MBKA 4CCYB 1I3LA 3IQHX 5FUWA 3RCBA 2HXGA 5LD2B 1J56A 1TA9A 4BAGA 3IDZA 1N1MA 1PR6A 4KQ6A 1ELOA 1ZMBA 2BSAA 4YJKA 2WF8A 4E09A 2AE2A 4DG5A 1RWNA 3PT5A 3R6GA 3IEKA 4ZMRA 2X1VA 1OXTA 2QVCA 3FFXA 3LLCA 1ZMXA 3VR3D 3H9BA 3OQNA 1M2OA 1E6EA 3LKDA 1Z63A 3SLRA 5EIEA 4Y2XA 2WAMA 4DC9A 3I01A 2C2BA 3D6HA 1SKUA 3B82A 1UMDA 3LXUX 3NH9A 5CJPA 5A0FA 4WLFA 4DM3A 2WZBA 3PDJA 1FTQA 4DLPA 3U7FB 3OQMA 2Q2OA 3TXAA 5J5AA 5KCZA 1ZUHA 2JLVA 2CXSA 5ABPA 3NRBA 2FMTA 1V5GA 1XZEA 1ZD8A 2W2PA 4KMRA 3N05A 3EZ7A 1BKSB 1ZNZA 2VDRB 4LG1A 5ESDA 1YDHA 3UM9A 3ZWWA 5IVPA 1NP7A 1TYDE 4G23A 2ST1A 4GKVA 4PQEA 3QVOA 4G9GA 3RU2A 1E94E 4D4JA 1BJTA 4BLSA 2XZTA 4JXKA 3DB1A 4L2IA 2R5FA 4UEKA 3WP1B 2IEGA 1A95A 2IYXA 3AKZA 1B15A 4ZJPA 3B9PA 4BX8A 2RJNA 5IFKA 4MYCA 3OAAA 1DFGA 1M34E 5AK3A 2OHOA 3THOA 2IIBA 2YV2A 3ASZA 3GLGE 1YR7A 1AS0A 4BLPA 3E3OA 4F6RB 3CNEA 3DOJA 1V1JA 2P6PA 9MHTA 3GV0A 3KEOA 1TYZA 3U9LA 4EF6A 1LLUA 2EGUA 2JHAA 1DE0A 1S9HA 4UMDA 4DIBA 1QIGA 1F8XA 3V1NA 4WFKA 3P9NA 4U3JA 1E2NA 3SX4A 5AW3A 2IS1A 3LVFO 4URYR 4AMYA 2YY7A 3FUCA 3R7WA 3HXKA 3BM5A 4H4EA 4M1WA 1PYGA 3ZVRA 3SWWA 4OJNA 1WHTB 3CRNA 2HBYA 4YR7A 4QG7A 3QE2A 1F6WA 4TXHA 5EHQA 3DE0X 1IJFA 1AT1A 2VC2B 4Z6KA 1EA5A 1HFJA 3VDXA 4E3WA 3L05A 4XR9A 5DNEA 4O4JF 3KTAA 5CDSA 3I1FA 1TYAE 3P2JA 1VKRA 1U2GC 2XB2A 5E4JA 2PT9A 1X7GA 5HSGA 2YMQA 3QLUC 3TIVA 5IK2D 1ZI6A 2C7PA 1T5TA 2HF7A 2XOEA 2FJ0A 2P1DA 3BFVA 1WSAA 4AD8A 4DZZA 1UBOS 2JAPA 4EJ6A 2BEWA 3HE3A 5JBQA 3I5UA 2P9HA 4XTCS 3NNSA 4HAIA 1V1RA 2AW3A 1OZ0A 2V6BA 4Q9LA 5LDDC 2OKCA 1KU0A 5EJIA 5JDIA 1JG4A 2MYTA 1E7RA 4DLNA 4KN6A 3N28A 5KYYB 3R9XB 1AXGA 2IT1A 3L7DA 3JYLA 1IIBA 3QXGA 3NHZA 4BCCA 4YXWD 4JEIA 1MUUA 4WUVA 3KOXA 1YK0A 3KZ1E 2HD4A 1FYXA 4FSDA 2FPIB 4PQYA 2O23A 4GSYA 3A9CA 1USVA 2AVNA 2LKDA 3E4CA 3ITNA 3OMWA 4K26A 5K3BA 5TC4A 3WQBA 5HX7A 1ZGGA 3IAAA 1OJ7A 1WB6A 2YWDA 4HAUA 2XNDD 4NOMA 2BR5A 2Q5IA 1ZX1A 4QL3A 4Y2YA 1J0XO 1YZUA 3LK7A 5CM8B 1WB4A 4HX5A 4CDRA 3Q7QA 2E37A 5LNK6 2HM7A 4UMEA 4GEGA 3HSSA 3RVMA 1UDCA 4C76A 1IBLB 3CMCO 4Q1FA 4XX0A 3I6ZA 1DV2A 4F2WA 5J43A 3IT1A 1I24A 3COWA 3I1YA 1ANKA 4D8XA 3I6YA 5A1TA 3IOYA 2FPGA 2XMBA 3FCOA 1SXJC 1WXWA 3K1JA 4UTRA 3GXOA 4N4AA 3VX4A 1L6IA 3L4KA 3LP6A 2PX3A 4FYHA 2E5WA 4BWYA 2C2XA 5JS8A 1NBMD 1GVNB 1Z7EA 2RFLA 1TGYA 4NZPA 1BE0A 2I7TA 1CSEE 4CT5A 1P44A 2FVYA 1FQJA 5FNVB 2JC3A 4B7ZA 3N58A 3MGCA 3HBFA 1RPJA 5CX1A 1RPTA 3RAPR 2PIAA 3PC6A 3QUQA 4LPSA 4PG4A 2PS1A 3QU2A 4FU0A 4Y6SA 5IAAA 5LXTB 1OH5A 4L6CA 1MO6A 1U9IA 4FDAA 1W4AA 1YR2A 4MMZB 4X93A 2DHQA 1UBLS 2RB4A 4W8GA 3Q88A 1W4RA 4FFVA 4RWEA 1R5OA 3GZNA 1PJ2A 5CLQA 2CBXA 1G64A 1DX6A 4K28A 3G1UA 2OG2A 1UWKA 3KLPX 1CR6A 1QR6A 2ZSEA 3VI3B 4Z1MA 3NRJA 3N7TA 4LF4B 1NJ1A 5AOVA 2WJPA 1Y1RA 1Y1LA 3HFSA 1XWIA 2IS6A 1C3LA 3DJFA 2CW5A 1ACJA 1NFFA 4FQ5A 4UAUA 1ZOIA 2QM8A 2GPTA 2QLMA 1JNYA 4M0CA 2PBRA 4EQ6A