3MSXA

Crystal structure of rhoa.gdp.mgf3 in complex with gap domain of arhgap20
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
177
structure length
177
Chain Sequence
IRKKLVIVGDGACGKTCLLIVNSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming protein RhoA
publication title Mechanism of molecular specificity of RhoGAP domains towards small GTPases of RhoA family.
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 60
structure length 177
sequence length 177
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3msxA00
2N1BA 4JLNA 1Q0UA 1KO4A 4EIWA 1I2DA 2B92A 1Z6YA 4BFWA 5FPTA 2IS6A 2WM9B 1TQ4A 2WPDA 1W4BA 5G53C 1NG1A 3ZZ0A 3ZQ6A 1N0WA 1W4RA 4MRRA 4CEHA 3AF3A 1SULA 2V3CC 2ZPTX 2IL1A 1DAEA 4A8JB 1F60A 1VIAA 1G7SA 4LJ4A 3EIQA 4RD0A 3GD7A 1E1RA 2BMJA 4HB3A 4L15A 3LX8A 4AIIA 1E1QA 1IHUA 2ONKA 2DY1A 5FR2A 4Q7MB 2YOGA 4MRSA 4DLRA 3LA6A 1D9ZA 1P9WA 3EZ2A 3T5DA 3FFAA 2ZRBA 1L4YA 4QJ5A 2WKRA 5JJLA 1M1YE 4TL6A 2W0SA 4QBGB 4MH0R 1WRBA 1W1WA 4XVQA 2RCNA 2IYZA 1HQCA 4Q00A 4QL3A 1NLYA 1PVOA 2BMDA 4Q4JB 1BMFD 3C4JA 1QHIA 2PZGA 4MGKR 4XH9B 4XWAA 4AKEA 1S4QA 3AVXA 5G41A 1ZNWA 1IN4A 2ZYTX 3CH4B 5H1YA 1Q1EA 2ZRPA 1W36D 2QBYA 2WWIA 5TARA 1XEWX 5J47A 3LH5A 4JZKA 4FIDA 3A1TA 5GJCA 1IN8A 2NOAA 2ZJ5A 3NBXX 1KO1A 5FR1A 3TSZA 4OI0A 4IJMA 4HAZA 3E2IA 3PUZA 4CEJB 3QEJA 3K09C 3DM5A 3ADBA 1W0KD 2YWFA 3ZD7A 1W44A 1NVWQ 4DUGA 2ZREA 2XJ9A 2VRWA 4I99A 4D80A 1AZSC 3CW2A 3FHTA 1G1MA 3NC1C 5FTJA 1QHGA 3LRPA 3MFYA 1G8PA 1Q12A 5FOSA 3ZYCA 4EKDA 1RYHA 1FQJA 4NHOA 2QMEA 4US0R 4GOXA 5F9HA 1QG2A 2WBLC 4RD2A 1XB2A 5J4KA 1XTJA 1AN0A 1M34E 3M6AA 2LWIA 5SZHB 1XCPA 2FSGA 3LX5A 3FHCB 3WY9A 1PZNA 3WYFA 4YMSA 2WSSA 4B44A 3K8YA 3LO5A 4PQYA 1M74A 2R62A 4FW9A 1IN5A 3CZQA 3KQUA 1UKYA 4E07A 3WXMA 2QTHA 2ERYA 4MDFA 1CJVC 2I4IA 2A5GA 1KDPA 1ZM4A 3TUZC 4UNNA 3Q9LA 3AGPA 1JECA 1BH2A 4TQUS 5EE5B 2GTPA 3KTAB 4IXMA 3OEHA 1OXUA 3KKPA 5AUNB 5J4VA 3U3JA 2DPXA 2O8CB 1G18A 3WHKA 3AM1A 4XIGS 3E1SA 1HH4A 4URZR 4M1TA 1TF5A 4C0AC 4IVRA 3K53A 5GJVC 3BERA 2VHJA 4Q4JA 1W0JA 1D2MA 2FEMA 1E2JA 4MYCA 1KNXA 1U99A 5A4JA 1AQUA 2JAQA 2GXSA 4D4KA 2WSMA 1IQPA 1WMSA 4HYYA 3RRZA 3GLIB 3FDIA 1GRRA 3QE0A 5J4LA 2EFDB 1SXJD 4FCWA 1OHHA 1T5LA 2OLJA 1JBKA 3Q7QA 5C1BA 1F48A 2UZ3A 2ZE8A 4M1SA 5DHAA 4FMDF 3BRWD 4L8GA 1S3GA 3I72A 2F1HA 3BE4A 4BEJA 2J9RA 3I5YA 1N5LA 2ZSFA 4NYIR 2YHSA 2ZRNA 2GESA 1XF9A 2H92A 1GG2A 1E2HA 2P67A 3OAAA 4AD8A 5JLJA 4F4IA 3LV8A 3LBNA 2ZRHA 3I62A 2WPDD 3AB3A 2CCKA 2QGNA 4IDOA 3R9WA 5CDFA 3OF5A 5JS7A 3ND8A 2H8KA 4JBYA 4BFSA 2XEXA 1CULC 4NZYA 1T3HA 1UBCA 3U7GA 3BC1A 2QPOA 2C8VA 2QPTA 3T12A 3X1XA 1OH7A 4WZBE 1XEFA 5K8UA 2CHGA 5HE9A 3D3QA 2PBRA 1L8QA 2YZ2A 4NL4H 3EZ7A 4OK3A 3UG7A 2R8RA 1OIWA 2DHRA 2FMXA 3C7KA 1YRBA 1P2TA 4DJTA 3GJ3A 3TAHA 1N6NA 4HLDA 2OAP1 3KTAA 4BZXA 1BYIA 3IO3A 4EPTA 2ATXA 3FMPB 4CIDA 3CLVA 5E7MA 5CB8A 3AUXA 4O2LA 3ICQB 4LV6A 1XZQA 1ZVQA 3LBIA 4IOKA 2O8CA 2XTZA 1MR3F 1MO3A 4PQRA 3VNUA 1XMSA 2DFNA 3TQFA 5EUMA 1TUEA 1AKYA 2XTMA 1G5RA 3D31A 2BM1A 1G19A 4KYIB 2NG1A 4BLRA 4LJ7A 4WW0A 4EQ6B 1ESMA 4UQOA 1E2NA 2KI5A 1DS6A 4XWKA 1Y3AA 3GLIA 3EA0A 2J41A 3CM0A 4PZYA 5IK2A 3B13B 1OH5A 1NIPA 4PPFA 3PEYA 1EESA 1W46A 3THXB 1RJ9B 3RC8A 1XXHE 2Z4RA 421PA 2BCJQ 1SKYE 2Q21A 2WJVA 4IEIA 4A2QA 1T3LA 3A36A 1MO5A 3TVDA 1RFLA 1Z5ZA 1YZKA 1ZC4A 3V00A 1U0HC 4QFMA 1CXZA 2BBOA 3CX8A 5CM8B 5BYKA 3K0SA 4TMWA 4R7ZA 3KKMA 2ZR9A 4Q48A 3HPQA 5SZJA 1NKTA 1VYTA 2IYVA 4V0LA 1CJTC 4W5HA 2QM8A 4TMTA 1PV4A 4I1VA 2IXEA 4RVCA 2J5XA 3IILA 2C77A 2V54A 2ZRGA 2GXAA 4ABYA 3QUSA 4D6PA 2AFHE 1YQTA 5JHHB 1XPRA 1US8B 2C5LA 3IIJA 4RCYA 2GKSA 2ZI6A 4F7WA 2D7DA 3GLFB 1GUAA 1PLJA 1SKQA 4C0HA 1LFDB 3A4NA 4A8JC 2IYXA 4GI7A 4TT3D 1JJ7A 1KJWA 4GFDA 1QHSA 2A5JA 2XXAB 1OFIA 2FWRA 4BLTA 2RMKA 4ZDJA 5KOYA 3PV0A 2W83A 3BIFA 3CB4A 3PUWA 3MG9A 1T0HB 1QBKC 1QG4A 1ZP6A 3D7MA 1U98A 3K9GA 3L8YA 1S9HA 4I81A 3ZZTA 3U6BA 5LDDC 1Z07A 5FFMA 3IQXA 1ZU4A 2GEVA 1XWIA 3ADKA 5BQ5A 2ODWA 621PA 3NBZC 2BJWA 4B2LA 2ZSDA 5JEEA 4DLWA 3B9QA 5DNYB 1U81A 4W5WA 1RE0A 1Z47A 3K0EA 5JBQA 1YR6A 4HB0A 3AGQA 3QXCA 1OXTA 4OJKA 1E96A 1MO4A 3J81k 1VG8A 4UNSA 2P65A 4LV5B 4EPWA 3L0PA 1J90A 1G3QA 4RSGA 3W6PA 2BC9A 3KXIA 1U94A 5J4YA 2OXRA 1K6MA 5CB6A 1GL9B 2ZRFA 3THXA 3MCAA 1RJ9A 4JSTA 1UAAA 2VF7A 1EK0A 1MO6A 3LDAA 4U5XA 4POAA 2WHXA 1ZD8A 3EPHA 3IBYA 5J5CA 2VEDA 3OE7D 4Q47A 4Y0AA 4A2WA 2WJIA 3NC0C 4URXR 5J4HA 5AJYA 4GMDA 1KZ7B 4MRNA 3EG5A 3BS4A 3X1DA 2BBTA 4LK2A 4OK5A 1LS6A 2QGZA 4TL9A 4B3DA 5GADl 3NEYA 3KQNA 4UNQA 4RFSB 5F9FA 1IONA 1XEXB 3THOA 3VR1A 4D81A 2B8WA 2AD5A 1FX0B 1V43A 3FPAA 1CKEA 2Q3FA 5EZ5A 3AP3A 4KO8A 1NJGA 1E9BA 1ZNZA 2A78A 2IHYA 1R0XA 1XDBA 1CP2A 2GK7A 1VHLA 1US8A 3SFZA 1KYIA 4BASA 3K0CA 3R9XA 4N0EA 2QP9X 4Q66C 1FQKA 4US2R 1MKYA 2EFCB 2XXAA 2ORIA 3RRYA 5TVKA 2BWJA 4AI6A 4KBGA 2CE7A 3U5ZB 3F5FA 1ZM7A 1NVUQ 3BK7A 2VQSA 1VPLA 3OIUA 4DLYA 3PG5A 3WBJA 2W2VA 3GLHE 2WKPA 5KPDA 1A82A 2QSZA 1M8PA 4NYIQ 4TLAA 3UANA 4DCUA 5IK2D 4OHZA 5A0FA 4GZMA 2PH1A 3QI2A 4FD2A 4NU0A 3IEUA 3CPJB 4KITB 3CUEF 1WXQA 3TBKA 1VTKA 4D0LB 4JLMA 3BORA 1KI2A 4BLOA 3CNNA 3U60B 1T91A 5BN4A 4ZCIA 1E79A 3B1ZA 4JLJA 1MOZA 3EAQA 3L43A 2WWGA 1R0WA 1ZIPA 3CRQA 1JPNA 1OYYA 3BAFA 4PFSA 4EUNA 2PMDA 1JNYA 3AP1A 1C9KA 2IF0A 1Q1ZA 4LSGA 1W48A 4PO9A 1P62B 4NYJR 3S1AB 3U7FB 4TQAA 3RS3A 2HT1A 1DAIA 3QENA 5UKDA 1T5IA 2G83A 4LJAA 3W5IA 4D2IA 4ZPXA 4NE2A 1VKJA 1UJ2A 1ZBDA 1P61B 4M0LA 1IAQA 1JPJA 1P75A 1XTKA 4OBEA 4RFSA 2BCGY 1GL6A 3AEZA 1XEXA 2HV8A 1FW6A 1FX0A 4KSCA 2IA5A 1E9RA 5JMTA 3HP1A 2VF8A 2ZJ8A 2FZLA 1G3MA 2GHIA 3I1FA 4ZDIA 4LJ8A 1WBDA 2A5DA 2HF8A 1II8B 3ND9A 3T35A 4NCHA 3HR7A 4A0HA 1M6NA 1E0SA 1TUIA 2F6RA 2RH5A 1XJ0A 2XNDD 1NLZA 5F2EA 2O8FB 3DHWC 4LBWA 3QEOA 3KFXA 2J45A 4BEBA 1K8RA 2P6NA 2VP9A 4URVR 1XBTA 1F2UB 4GPTA 3EX7C 4A6PA 2JASA 2P5SA 4M9ZA 2YYZA 2JGNA 4Q02A 1MABB 5FUWA 2BDTA 4D4MA 4D4LA 4X8LA 3LLUA 2JLVA 3BD9A 2RGAA 5F3WB 1R10A 3WRYC 4BRUA 1NMZA 2GCPA 2P0EA 2ZI9A 1HY3A 2MSEB 5FOXA 1ONBA 4HAUA 2QL6A 3GJ4A 4M1YA 2OCYC 3WNDA 4NCIA 2WJHA 2HT6A 4IDQA 1LY1A 3P4XA 1V5WA 2ZIAA 1GL7A 2DWQA 4RZ3A 1IXZA 2CL7X 1N6PA 1IOZA 1T6NA 2IUUA 3LFUA 1U8AA 3A1SA 4LHXA 5HPYB 2QROA 2XGJA 1Z6TA 5TXGA 4R71A 2ZI4A 2FOLA 1OH6A 1WB9A 1CTQA 1FFHA 1EGAA 2ZS8A 3EWAA 4ZO4A 3UIEA 4DVGA 2F1IA 2ZRLA 1YR8A 5G3ZA 3IIMA 5FBVB 1AKEA 1HT2E 3NH6A 1XXHB 2GK6A 1KI6A 4G3XA 1J7KA 1SKYB 1I2MA 4Q18A 4CEHB 3GCGA 1G8HA 2DR3A 4FXPA 4MQBA 4MYUA 1W5SA 2VL7A 4WAUA 3S1AA 4LYFA 2HYIC 2VHCA 2X2FA 1HE8B 5TB5A 2GZAA 1TEVA 4R2HA 4L5BA 1QHNA 3GPLA 2QG6A 1YHNA 3VU9B 4CT5A 2IX3A 5L8VA 4X8OA 1CBUA 5CYPA 3BJIC 1JI0A 2R6AA 4QM6A 2VIIA 2ZYWX 5DE3A 4F38A 2QAGB 3K1JA 4TLDA 1ZCAA 3EIHA 4IDHA 4LJ5A 4D26A 1RRGA 1AM4D 1G6HA 1CRQA 4IVQA 3DM9B 3OEEA 4HDOB 1EX7A 3CRRA 1CJUC 4Z51A 2REBA 2ZSBA 2FH5B 2N46A 1PLLA 2QENA 1DEKA 1ZYUA 2GJAA 3FHOA 3RANA 2J3EA 2FF7A 1F2UA 1PUJA 4NKRA 2KB0A 1W7AA 4Q9JA 1FUKA 4US1R 1KNQA 1JR3E 3PEVA 1G8FA 1S1MA 1MABA 1Q3TA 3AKEA 3C5HA 3OIWA 3ETLA 1G3IA 3KJEA 5EQTA 3ZIAD 3RRNA 3T1OA 3D6TB 4UXIA 1J70A 1UKZA 3M4YA 2AR7A 1COWA 1LTQA 2ZU0C 4MUAA 4N0DA 2GNOA 3U2QA 2JLSA 5TV2A 3C15C 1VHTA 2Q3HA 3FMIA 4DLUA 3TRFA 3VKGA 4XTRA 2BHRA 2RAPA 3KXLA 3N2IA 3OFNA 2J7PD 1N6KA 4F4CA 4BLSA 4WZ6A 3QKTA 2OCAA 2NO1A 4DKXA 2R44A 2ZU6A 2FV8A 1KSGA 1FP6A 4AKIA 2ODEA 2KE5A 2ZUBA 3K9HA 4JL6A 3EW9A 3KDSE 4LYAA 121PA 3VFDA 3EIEA 2LKCA 2YC4C 1E2EA 2ZM5A 1OKKD 1HV8A 1D2EA 1W2HA 3H84A 1S1CA 1RPZA 2W00A 4Q1AA 4CW7A 1XXHA 1N25A 4BE7B 2ZE5A 2NO6A 5EXSA 1EXMA 1GAJA 1Q22A 1VYVA 2W6ID 2ZAMA 3OZXA 5LBIA 4A82A 5KYKA 4D25A 3B8HA 5H8WA 3EPKA 1QDEA 4FWTA 1RRPA 2XTNA 8OHMA 5KSOA 4W5JA 4DZZA 5HCIA 2Z43A 1NN0A 2QPAA 3G5UA 2Z0MA 5KUTA 2C96A 2VA8A 2ZJBA 4IKEA 1WQ1R 2H7VA 2EYQA 4KFUA 1P2SA 1NSFA 1XTQA 2YWHA 2ZJOA 1I4TD 1R5BA 5B57C 3NVAA 2GZHA 2VTKA 1EFCA 1WE2A 1Z6XA 2WKQA 1DAKA 1WCV1 3SOPA 2D4HA 4OJQA 3TSOA 3G0HA 3I8XA 2VLIA 2V8OA 2K5UA 1KMHA 3P20A 2FFBA 3CWZA 1YZUA 4OHYA 4Q7KA 1AA9A 2ANBA 1NG9A 4Q7JB 3E5HA 3SYNA 1OJLA 3VR3A 5CIQA 2BEJA 2Z6VA 3DO6A 1NNEA 1Z28A 1KY2A 1P72A 5JZVA 1LV7A 4KU4A 4NYJQ 3A1WA 4UNRA 1L2TA 3GLHB 2SHKA 5B58C 3KQHA 1AGRA 1DAMA 2HF9A 2GF9A 4URUR 2NMVA 2F1JA 2EFHB 2IYRA 5AUQA 2J59A 2IC5A 2REXB 2ASEA 4AYXA 5IT5A 1G8YA 5B30A 3L0OA 1Q44A 4QBFA 5FOWA 4GT1A 5EP3A 3GLFE 2IW3A 2OCPA 4NMMA 2BBWA 1ANKA 1OLOA 2CE2X 3PCRB 4HAXA 4KFTA 4PPNA 2EYUA 4A0RA 2JJ1D 4C7OB 4NONA 1E2MA 2FGJA 3DOEA 5H68A 1OB5A 1TAGA 4G5SA 4M21A 4FMDB 4A4DA 4GDFA 2A9KA 4P4TA 1DAFA 1S9DA 2XITA 2WOOA 5C18A 4JL8A 2CVHA 3RAPR 3W34A 4LJ9A 3TH5A 4HLCA 4OI2A 2OAQ1 5HR5A 5C4MA 1VECA 2V4ZA 1Q20A 3NHBA 5FBWB 2IS2A 3KQKA 4X8HA 1RZ3A 4IOLA 3FGNA 3LD9A 3SN6A 3THWB 1G3RA 2WWWA 3AVOA 4TWZA 3L2OB 3LW8A 1KTVA 3CF2A 3K70C 1YZTA 3DEFA 5G3YA 4XOIA 1UKVY 1TF7A 1G64A 3MJHA 4PAQA 3OEED 1G9XA 4Q1DA 3Q7PA 1WF3A 4PQFA 3FVQA 1G16A 4RJLA 1ELOA 4ZDWA 1JQJC 4ARZB 5FBQB 3I5XA 2AHOA 3WNBA 3VKWA 3TW4A 3TK1A 3U6KA 4NDZA 3BFVA 3T5GA 2HXSA 4NBSA 4JKYA 4XD7A 3KX2A 4HZUB 4EDHA 4C2UA 2ZTSA 1IM2A 4O2RA 3QOFA 1KI3A 1XFAA 4KV9A 4GSYA 4QJ3A 5JCZA 1RW4A 5JSZB 1P6XA 4ON9A 3BOSA 1P4SA 3GJ8A 3LW7A 3V9PA 3CRMA 4W9MC 2W2TA 2QORA 4AWXA 3I61A 1LS1A 2XZOA 1TX4B 2WIAA 2YINC 2PMKA 3GLHA 3W8NA 5KNDA 2EQBA 1W36C 1EWRA 2VSOA 2V7QA 1KIMA 4HUTA 1UEJA 3DMNA 3BB3A 2HDNB 5EXTA 3RWMB 4JLDA 2PX3A 4IVPA 2D62A 2BEKA 2VP2A 5FI1B 2KBFA 5JFGA 4C7OA 2GETA 2BM0A 2BVNA 5EP1A 2NQ2C 1GITA 4A8JA 3QG1A 1FNNA 3A4LA 1N6OA 1S3SA 4KHZA 3QXSA 2WWYA 3DL0A 3TAUA 1XPUA 5D3MB 5JWHA 3RS2A 1GNQA 2DCUA 2OO7A 4G0NA 5FBLB 2E87A 4DC9A 4RD6A 2GJSA 2PLRA 4TMVA 4XJXA 1SGWA 4YDHB 2NPIA 3IO5A 1NN3A 3FMFA 3L8ZA 3QKUA 1OXSC 3RS7A 1D6JA 5FL7A 1G5PA 4C3ZA 2WWHA 1EFRD 1R8SA 3THWA 3IHLA 3B1WA 4JJZA 4BFTA 1KSFX 2G0TA 1X8KA 2EWVA 3MGCA 4TLBA 2W6JA 4PC2A 3FOZA 3X1ZA 2QAGC 3PUYA 1VIYA 2OCBA 3GEEA 4GOKA 4ARZA 5CITA 3DZ8A 3H86A 1KMQA 4Q9KA 2F9MA 3W90A 2LKDA 1NBMD 4TYPA 4XTCS 2X77A 4DEYA 3BWDD 4C0SA 1U2RA 2D2FA 3AF1A 3L0SA 3NXSA 4HAYA 3WRXC 4HZUA 2F43B 4WA7A 5L3SB 2DFLA 3BB4A 3TQCA 4CEJA 2CEAA 2CMKA 5CK5A 1T0JB 4M1OA 1H65A 2Y8EA 1NF3A 1II9A 1A4RA 1XMVA 4LPSA 3T1TA 2W2XA 2RGDA 2QZ4A 3ZVNA 3SJZA 2V1UA 1OSNA 1UF9A 5CIWA 2J7KA 3EC1A 4EFLA 1NJFA 1OF1A 4A2PA 4U00A 3MD0A 4Z1MA 2AXNA 2GZDA 4K8OA 4EFMA 3HYTA 3VX4A 1ZNXA 1U8YA 1E1RD 1GM5A 1KY3A 1E1QD 1NVVR 1D2NA 3H2YA 1SXJC 1ZD1A 3MMPA 4ACBA 3GEIA 4TZ6A 2WOJA 4Q5IA 1B0UA 3MWLA 3AF4A 2O8DB 2FFQA 2IYYA 1R7RA 3SZRA 1R4AA 4MGZR 2ZRAA 2QMUA 2A2ZA 1G7TA 2V6IA 5AJWA 5KDLA 2YV5A 3A37A 1CU1A 5DO9A 3TSWA 2MMGA 1MH1A 2OESA 2ERXA 2AKAB 2GRJA 2D74A 2DFTA 4Q7LA 3IPXA 4ASUA 4M1KA 4PO1A 2RGXA 2Z5FA 4DHEA 2ZANA 4G5RA 4A0GA 3OIYA 2G0NA 3EXAA 4LBZA 3HU3A 3CNOA 4QOSA 1IN6A 4QGFA 1C4OA 1GVNB 4GOJA 4HSEA 1N6LA 4KI0A 1SHZA 2YOFA 1TQ2A 4H1VA 2CLSA 2XAUA 3DDCA 1E3MA 3RYTC 2AFIE 5KU1A 1N6RA 3QPUA 2ZYUX 1VDZA 4Z54A 4XD7D 2O5VA 2RHMA 2VP6A 1QHHB 1KI7A 2JEOA 5M04A 5GJBA 1E2FA 4OHWA 4DT1B 4PXAA 2QY9A 3FMOB 1E2PA 4C9BA 3NIBA 1TQDA 4DUGD 2PZEA 1JEEA 4JIMA 2JDIA 3PIRA 4QBIA 4L16A 4DSTA 2CJWB 3BFKA 4URWR 3VR4A 4IW3B 5E3HA 5L3QB 1O3YA 1WDTA 3LQQA 1UBFA 4JLAA 4N3NA 5B2ZA 2DYKA 5IF9A 2IS1A 4ZI2A 2XOKA 1ZUHA 2F43A 1TEXA 3NDPA 2QI9C 3I4LA 4ZKEA 1SHKA 2FN4A 2ZUCA 3AVWA 4BUJA 4UKDA 1FMLA 2A3RA 1UDXA 2V7QD 3QBVA 4BZQA 4OI4A 1KO5A 3EARA 2WSSD 1GIAA 1H8HA 5EP2A 1JR3A 3SBDA 2VSFA 3K0FB 1IJEA 1HYQA 1C1YA 1KGDA 2YVUA 2P6UA 2CL6X 4P0TA 4TTQA 5HKKA 5IRCD 4RZ2A 5KDOA 2V9PA 4Y0VA 1OXXK 1N2CE 3ZQJA 1E9DA 4MYTA 4TYNA 5E7JA 1N0UA 2YWGA 3WMFA 4WVFA 2TMKA 3OEHD 4NCNA 3R7WB 2N42A 3QF7A 2GCNA 1ESNA 5L3RA 3ZDQA 5C4GB 1MRSA 1XZPA 3EA5A 1XTRA 4ZCLA 2IUSA 2CLCX 2GA8A 3QKRB 2Q0HA 5K8LA 1W0JD 4ZKDA 1KO8A 3JVVA 4Q9LA 4GMXA 2CDNA 4WIAA 2OFOA 4Q1FA 4E03A 1E9FA 1NL3A 1JXMA 2ZI7A 3DMDA 4QBHA 3W6OA 3U44B 1Z0FA 4Z8XA 1OHHD 2KWIA 2G88A 3HPRA 1II0A 3DVLA 1SXJE 3ZH9B 2F1RA 1E9AA 1AS2A 1G291 3RWOA 4RKFA 1GNPA 1IN7A 1JEDA 1JXOA 1VCIA 4P32A 2J0UB 4PPQA 1QHHA 5C2JB 4QRHA 4F93B 3U3MA 4EQ6A 4A92A 1EFHA 4DT1A 1Q1BA 2WAYA 3IEVA 3Q85A 2V6JA 4LHZA 4DCSA 3GJ0A 4QGAA 3HJNA 3N2EA 4UXHA 2ZITA 4DDUA 2BMFA 3SI7A 4HATA 4EFNA 3OAAD 3EASA 1G4UR 2MSCB 4S2EA 4DLXA 1CEEA 3HYRA 1NSTA 4BQSA 2P6RA 3CF6R 2QN6A 4OQFA 2BJVA 5L3QA 4O3MA 2LCFA 1ZUIA 3JVUA 4R98A 4DSOA 5LB2A 1VMAA 2E9SA 4WBSA 1KSJA 4KSBA 2QA5A 4HB2A 1F3OA 3SHWA 2GXQA 3FKSA 3AH8A 2BBSA 2ZEJA 1IBRA 4YONB 2IWRA 2IS4A 3AP2A 3DZDA 1BS1A 3PEUA 4LCBA 1OIVA 1CJKC 3SS8A 3EC2A 2OT3B 3K0FA 4JLPA 5LD2C 2CVFA 2XSZA 4YMWA 1BO6A 3U3KA 4LRWA 1X86B 1XD9A 3B7GA 1IXRC 4FMBB 3HDTA 5EXPA 2ZXUA 3GLFA 3R7WA 1IY1A 3THYB 3GFOA 1CJMA 3KB2A 1FNMA 4B2IA 1WA5A 1P9RA 2FEOA 4EPYA 4P31A 3UMRA 4JVLA 2UKDA 2WIBA 2ODBA 2YC2C 1YZQA 1D8TA 3U3RA 2B7BA 3QKRA 221PA 1SVMA 4K81B 1K5DA 2ZRCA 3A8TA 2G6BA 3VMFA 1U90A 3PR1A 3T1VA 3KJIA 1E2LA 4DRZA 1Q3HA 2J87A 4J0QA 3RLFA 1OW3B 4OKSA 3K0AB 3GLGE 3TR0A 2X19A 3U44A 1EFUA 4LI0A 3A1VA 2JDID 3GJ5A 1PLKA 4OK6A 2RHDA 1LF0A 5C46F 2YOHA 1ZM3A 3IHWA 1E0AA 1NMXA 2XOKD 3CF0A 1R5OA 4QM7A 3KKNA 1E2DA 4M2LA 2AK2A 1G3UA 1KKLA 1NVVQ 2IXGA 1H8EA 2QQEA 3ZS9A 5DHFA 1KK3A 1YZLA 3O8RA 1GTVA 1KI4A 5FTKA 1HT1E 4YXWA 4PAOA 3QF4B 3SU8A 2ZR0A 4JMPA 3KKOA 1TADA 5DSZA 3W3ZB 1E9CA 2QE7A 2R6GA 3C5CA 4Q4AB 3IDQA 2D2EA 4NH0A 1AS0A 2CCGA 3K70B 2JA1A 1JALA 1KDOA 3UKDA 2A5YB 1UEIA 3A1UA 2YWEA 3SC3A 1LNZA 3PQCA 4Z8YA 1Z2AA 4PTLA 3QJYA 1IY0A 4M8NE 3TJZA 4WXRA 1R0YA 3PUXA 1ZUNB 1P73A 3AV0B 3U7EB 1DG3A 1OH8A 3THYA 5LB4A 2E1RA 3W5JA 3U4QB 3W3AA 5CLLA 2R65A 3ECCA 1YRAA 2CBZA 4IFEA 5KO2A 3AF0A 4ZCMA 2GJKA 4W7SA 1Z6AA 4M22A 4M9XA 3RRMA 2J0SA 3MWJA 3O8BA 5SZKB 5LPNA 4ERNA 4BPBA 3QY0A 2ECKA 1N5JA 1M7BA 2BKEA 2OV2A 4GNKA 3W9YA 1SVSA 4DSNA 1FTNA 5ANRB 2NIPA 1W36B 2GVDC 5FUXA 5JWRA 4NPHA 2NO9A 4PHFA 2PZFA 1LB1B 4YMUA 1Y63A 5KSPA 2DB3A 1U0JA 1XCGB 4UJ3A 1CF4A 2ZE7A 1E9SA 4JT2A 3RABA 2BMEA 3FKSD 3HR8A 5JI2E 4QJ4A 1XEWY 3C8UA 1XPOA 1OB2A 2J0VA 3AKDA 5FL3A 3SNHA 4A36A 2FPLA 1E2IA 4NTZA 3BXZA 4DCTA 3KKQA 4TLEA 4HDQB 1UM8A 1Z0AA 3AVTA 2QMHA 2B21A 1IJFA 2ZSAA 1NN1A 3QF4A 3NBFA 5JEDA 1VYUA 3MUFA 6Q21A 5TY0A 2C99A 4FI3C 4BLPA 2X2EA 4GP6A 3B2EA 4JJKA 2IYTA 5EUQB 2ZYVX 5FUYA 3V4FA 1XMIA 2BV3A 4Q4AA 2AN9A 1Z2CA 4B75A 1GKYA 1KO7A 1NY6A 5JJKA 1Z22A 4DLTA 1A2BA 3KB1A 1Q57A 4FCTA 3GEHA 4LJ6A 5DYIA 4GP7A 3CR7A 4P4SB 4AC9A 2I3BA 3F8TA 1II8A 4B3FX 2KBEA 5FBRB 4KAXA 1OFTA 2ZI5A 2GBLC 4RCZA 4ILEA 2O8FA 4IEEA 1OT3A 1A2KC 2FSIA 2WMNB 1IY2A 3Q8XB 2AD1A 1Q21A 4KLNA 3RS4A 4HUQB 3U4QA 3K09A 3KFVA 1XCMA 5EE3A 1ZM2A 2G1JA 2NO7A 1KJYA 4AYWA 4I1OA 4HZIA 3FFBA 2FNAA 1UADA 2C9OA 2ORWA 1DELA 3BB1A 5DN6A 2J46A 3VHLB 3R8FA 2GCOB 1BMFA 1W47A 5J40A 2VHTA 3N70A 1RKBA 3FB4A 1VG0B 1YZNA 1E79D 1T8UA 3ASYA 2QT0A 2R6FA 1UPTA 2CK3A 4TYWA 1SXJB 4BFVA 1ZC3A 3PENA 1I4DD 4A0FA 1O87A 3B60A 3UK6A 3WYGA 4EPRA 3QXXA 4CYMA 1JJVA 1E4VA 5E95A 2F9LA 3AVUA 1NI3A 2HCJB 4L4UA 1UKEA 3B85A 2QE7D 1T9HA 2DBYA 1QHXA 2GAAA 4GL2A 4ACAA 2PL3A 1OV4A 2C2HA 2OZEA 1WBBA 5KHOC 4M1MA 3H1TA 1HTWA 4ESHA 5HZHA 3GJ6A 4TYQA 1XX6A 4BRWA 3ZVLA 3MRSA 2H18A 3B1XA 4H9GA 5FUVA 4YDSA 4IXNA 4OQXA 4HDCA 1LVGA 2PJZA 2ZJZA 3B1VA 1KOFA 3VU9A 4D4JA 1R0ZA 2AK3A 2FG5A 4OYHA 2QAGA 2FFAA 1XTSA 4HAVA 4LZZA 4RFVA 4TMZA 3UPUA 3QPWA 5DIFA 4L9WA 4V0ME 3B78A 4C0LA 3H4MA 4AK9A 2FZ4A 4IRUB 2QMOA 2L0XA 3AVQA 5JECA 2PT7A 4Q9IA 5JRZA 4MRPA 4BFXA 3QNUA 1ZM9A 2FJUA 4HUQA 4LDJA 4H1UA 4B6EA 2Q9CA 2WAXA 1OXVA 1ZNYA 2XJ4A 1ZRHA 2PEYA 4ITRC 1Z8FA 4R2IA 4B76A 1E94E 4A15A 3MJRA 5JS8A 2O8BB 1HQYE 3SFVA 4EJSB 4BFYA 1Z29A 3WBKA 4S35A 3GLGB 2WMOB 3CRVA 1AZTA 4AG6A 2VHQA 4KCGA 5IDVA 1GKIA 1RC8A 4AURA 1ZJ6A 1ZCBA 2KSQA 1YU9A 3N5CA 1A5TA 2AX4A 2X1VA 4E09A 1SXJA 4E22A 2O0JA 2RKOA 3RNLA 2B8TA 2C03A 2HXYA 2PX0A 2ZRIA 2WVJA 4JBWA 2JLZA 2XX3A 2GDJA 4C0QC 2ZS9A 3SDZA 3AVVA 3TIFA 2W0MA 2FU5C 4QG7A 4BECA 4FCVA 2ZE6A 5E7IA 1PJRA 4B47A 1P9NA 2OBNA 4QHYA 4RZUA 2HJGA 3H0KA 3K9LA 4MDEA 4YQFA 2C04A 1NN5A 3KL4A 3A58B 3K70D 1R6BX 2CLDX 3AVPA 4M9QA 4A6XA 4CRWB 4IHQA 4U7DA 3CNLA 2IXFA 3GFPA 2QAJA 3VTKA 1YJ5A 5BW8A 4JVNA 4LYJA 3RSLA 4PX9A 3ZJYA 1SVIA 1TU3A 1DAGA 1DAHA 1JR6A 5L3VA 4NYMR 3ZD6A 1G4AE 4L9SA 2AWOA 5KNCA 2JLWA 3W6NA 1U9IC 4IOMA 4F4JA 1TTTA 2C78A 4FMCF 521PA 3QPVA 5B64A 5KSYA 1W5TA 4CF7A 1W4CA 2D7CA 5EP4A 4QC2A 3BBPA 1G5TA 2RGGA 5DN6D 3VX3A 5FTMA 2DWPA 2OG2A 2EU8A 3SJBA 2JATA 3LBHA 1G7CA 4JT4A 1GFIA 1WP9A 3P32A 1XJCA 2OXCA 2G3YA 4QGGA 1COWD 4MYHA 3QIAA 2QNRA 5DI9A 1G41A 4AG5A 1UBGA 2CK3D 4V0OA 4CDGA 1Z0DA 3EZFA 2HJVA 3KQLA 2QP3A 3LQRA 3OFND 4Q01A 1JB1A 4Q1EA 2NGRA 4JLKA 4DCNA 2O8BA 1VCNA 4QGHA 2OILA 2HUPA 4EJSA 2O52A 3UG6A 1IXSB 2EFGA 3GLGA 5LD2B 2FE4A 1N6IA 1DE0A 2YNMA 3WYAA 4FINA 1YZGA 2CHQA 3M0EA 4MITA 2QM7A 2IYQA 1R2QA 1OPXA 1QHYA 4KVGA 721PA 4PZLA 4OI1A 1VG9B 4E5UA 5EJEA 1DPFA 1W4AA 4B3CA 5FI0B 4PSVA 2ZAOA 1NKSA 2OE2A 5KSZA 3WP1B 2IYLD 4DCVA 1TL7C 2O8EA 3P4YA 1T3SA 3AUYA 3T34A 4PZZA 3JZAA 1XMJA 4LX0A 3GJXC 1NMYA 1L7VC 4RD4A 4CT4B 3FE2A 4CEIB 2OLKA 1TMKA 2GJ9A 4LGMA 1X8JA 2JIZA 4NCKA 1SVKA 2WWXA 2B6HA 4XSGA 2ZVPX 1TF2A 2R2AA 4HEJA 2QT1A 2JJ8A 1KAOA 2VSXA 2G77B 1J99A 1E32A 4TT3A 3DOFA 3SQXA 1G7RA 4KODA 2GAOA 5JJIA 3NKVA 3BGWA 4XSHA 3B5JA 2HLDA 1EX6A 5FOUA 3ZLJA 3CR8A 2MSDB 3ZVRA 4B74A 4F92B 2V55B 3ONWA 4DXAA 2AKYA 1CS4C 2EVWX 1GZSA 3NEJA 4TYYA 4PC7A 5AK0A 2IT1A 1GOTA 2GILA 3CX6A 3K9NA 3TVTA 2WJGA 3UWOA 3C16C 3QSYA 3T61A 1OIXA 5JSZA 3I73A 4DLZA 1XD2B 1GSIA 2IYWA 2CHVA 4OHXA 4C2TA 2CNWA 1LF5A 1JQLB 4A1FA 1BOFA 4PANA 3NWJA 1VCOA 4DEXA 4NP6A 3IUYA 3CPEA 5CK4A 1X1RA 4B34A 2R6DA 4CVNA 3MWYW 3QXJA 5FOVA 4HLUC 4DDTA 2IYSA 2Z83A 4MKHA 3DPUA 2GEDA 2Q9AA 2UVQA 4IDPA 2ZETA 5GJWC 1ZMXA 3CWQA 2RGNC 5FPHA 2EW1A 4LPKA 1B23P 2RB4A 4PC1A 4Q9HA 1J8YF 1E9EA 2KJQA 2GJ8A 2WWFA 3OE7A 2Q6TA 2ZRDA 4LOAA 2ZRJA 4CZ2A 5BWMA 4KXFB 4AY2A 2ODNA 4KBFA 5D3MA 5JCPA 1FL9A 1TU4A 4FWIB 1AS3A 1S2MA 3UATA 3KUCA 2VO1A 1HUQA 3EZ6A 5AJVB 3U7HB 1DBSA 4O25A 1JAHA 1P60A 1GP2A 2R9VA 2ZJ2A 4JVSB 3TR5A 4G5OA 4CEIA 1GRQA 2QTFA 4U02A 5H70A 3O47A 2DWOA 2WJJA 1XP8A 2ZS7A 1DARA 4C0KA 1T8TA 4DB4A 3MLEA 1FOEB 1GRNA 2FX3A 1KI8A 3VAAA 4PO8A 1E0KA 3B6EA 4TTRA 5HTKA 2V1XA 2D3WA 2FSFA 4ZDKA 1Z0KA 3KXKA 1S0UA 4IFBA 1FUUA 3LXRA 1E99A 5DYGA 4TMXA 2C9YA 3Q5DA 4LBYA 4Q19A 2IEZA 3RHFA 2QEQA 2PEZA 1DTSA 2H16A 3D8BA 4II7A 3VNVA 3P27A 2G1KA 2ZROA 4KFRA 4XVUA 5L3SA 3P26A 4PR0A 1AIPA 3M1IA 4AKHA 4EPXA 2NZ8A 2VYFA 4DSUA 5SZIA 2HYDA 1NLFA 4DLVA 5FTNA 2C9CA 2GEUA 1XD2A 2RGCA 4O0MA 4LHWA 4Q4LA 4RD3A 1N0VC 1SVOA 2BKUA 3ADCA 4KLZA 1DG1G 3GFTA 5EXXA 4YMVA 1XJQA 4HB4A 1KI1A 5JWOA 1FPMA 1EG7A 1QRAA 1F5NA 2PLFA 3F3YA 4NYMQ 1E2QA 1KDRA 4CGZA 3B1YA 4PPGA 3KJGA 2O8DA 5DI3B 1E98A 2WV9A 3WMGA 2OBMA 5DLQC 3HU1A 4C0BA 4DB2A 3WP0A 4BFZA 3R8CA 2A30A 4LYHA 3RDPA 5FL7D 4JYCA 1TNDA 4TSFA 1KAGA 1QVRA 2QUZA 5AJXA 1X6VA 5CLQA 2JIZD 4JKIA 3TMKA 3W8RA 1HURA 4JVMA 2W6JD 2WZQA 1KSHA 2IEYA 3CH5A 1XD8A 3NDBB 3BH7A 4G1UC 2ZJYA 4WZAE 3SJCA 2AL7A 5D3QA 3B9PA 4B6FA 2X8AA 4LWZA 2J1LA 3AKCA 1CR4A 4JLVA 1P2UA 3NHAA 2J0QA 3A4MA 1BIFA 5KPJA 3EPJA 2HLDD 3NG1A 2QSYA 1HA3A 1NBME 2H1LA 1P2VA 5KNBA 4B32A 4C0JA 1X3SA 4QXAA 3TKLA 3AKYA 5EE9A 3A6PC 2ORVA 2QRNA 2ANCA 2XNDA 3C41J 4ESVA 2CJWA 3UXMA 3T1QA 2ZI3A 3NH9A 3GMTA 4V0NA 1RIFA 821PA 4V0MA 1GILA 1XU4A 1L4UA 1YR9A 2P5TB 2XB2A 2CNWD 3CBQA 4YC7A 4Z1MD 1CRPA 3UMFA 4V03A 2QP4A 5AR1A 3SBEA 4B2PA 3HU2A 5AJZA 5AUOB 1GDDA 2QRZA 1X8LA 1QZXA 4DBLC 1NVXQ 2VH5R 4JL5A 4B35A 4UXJA 3CIOA 1E6CA 3TUJC 2JJ2A 4BZPA 1YR7A 4B33A 2CL0X 3BH6A 1EFTA 2GVZC 3IQWA 3GP8A 2IWHA 3O8DA 1G20E 2C95A 1U0LA 3LY5A 2P3SA 4BLQA 1G6OA 4GZLA 5K8IA 4N1AA 3SEAA 5TDHA 4OL0A 4Q1CA 4ASUD 3SE0A 3ZZUA 1P3JA 1N6HA 2EWWA 5JHGB 4TZ0A 5DI3A 4BGDA 4RKEA 2GBLA 4TLCA 2F7SA 5P21A 4A9AA 2C98A 2A5FA 1KK1A 1W49A 3MAAC 3CPHA 4LHVA 4NCJA 1CIPA 2IUTA 3PFIA 4WOPA 2W58A 4RY2A 4JYBA 4HAWA 4DWJA 3UMSA 5F98A 3NTUA 5DH9A 1A7JA 1D5CA 2VBCA 1DOAA 1KJZA 4PC6A 2OFXA 2OM2A 1F6BA 2JLUA 1NY5A 2JLQA 1Z63A 3ASZA 3FYHA 5JRJA 1P7CA 3X2SA 1VG1A 2WJYA 2ZRKA 4D0NA 4DIDA 1UDWA 1SZPA 2FPKA 1Z3IX 2J0UA 2VHUA 1E69A 3BH0A 3LVRE 4LY6A 3SR0A 3TLXA 4ZI3A 3Q3JB 4UJ5A 2ZVQX 3R9IA 5EE1A 3SYKA 5FH9A 4HI0E 5CYOA 3X1WA 2XZLA 2ZSEA 1KDTA 2WICA 4QKQA 4B48A 2AXPA 4PC3A 4TL7A 2HCBA 2OBLA 1A1VA 1H8HD 1QVAA 2QU8A 4MRVA 3I92A 1JR3D 3QXHA 2ZRMA 1FTSA 1FZQA 1F2TB 5FTLA 5HKKD 1ZINA 5BYJA 4EJSC 3SQWA 5KTYA 4I1UA 1GWNA 3ZS8A 4GBMA 1AGPA 4AKGA 3ZIAA 2JLRA 4XVRA 1QF9A 1N5KA 3SJAA 1BYUA 3IGFA 1ODFA 4LC1A 3PUVA 2IF2A 5ELXA 1M7GA 4QHTA 3I32A 3Q5EA 3TE6A 3LXXA 4B3XA 2WTUA 3IKJA 1KI6B 1BKDR 3E70C 2O8EB 4DDWA 4Q4HB 2J7PA 5AUPB 3B82A 3T06B 5KDDA 4TSFD 3P1JA 2XZPA 3FTQA 2OUKA 4K46A 3Q72A 1NP6A 3REGA 4DDVA 3RS0A 2OFWA 3CKLA 4OQLA 4P4UA 4V02A 1Z0JA 1OKKA 5BN3A 4TL8A 2RGBA 1G21E 1SQ5A 3KUDA 4BWYA 3IPYA 4Q21A 5DISB 4P3YA 3VR2A 4DIEA 1CLUA 1LW7A 1UFQA 5FPKA 2W6IA 4ZIRB 3CX7A 4IOJA 3KJHA 5EZ6B 1XRJA 2ONJA 1AK2A 1DADA 3QQ5A 5GVSA 1X1SA 3X1YA 4JS0A 2ZQ5A 1G8GA 1S8FA 2DFKB 2FSHA 1M7HA 2F55A 4Q03A 1N5IA 2PCJA 2ZUDA 3K0AA 5BXQC 3AF2A 3RC3A 2ZJAA 1PUIA 1XTIA 4P33A 1R8QA 5DGXA 5CJ2A 1RRFA 2PT5A 2FA9A 3L0IB 4X8MA 1KI9A 1E2KA 3QVVA 2RGEA 3TUIC 3LWNA 3U3OA 5CDFE 4MGYR 3QBTA 2F3RA 1ZW6A 1OFUX 2OEPA 4QHSA 5G40A 4C30A 4XWOA 2ZR7A 4MKFA 2JJ2D 3VR5A 1E2GA 1XNJA 1RYFA 2Q3MA 4I4LA 4Q1BA 1F2TA 4MUBA 1KKMA 1YVDA 4YMTA 1ZIOA 2XNSA 3PVSA 1RRCA 2XSZD 4M1WA 1G17A 3QKSB 1GNRA 1KK2A 2IYUA 3WNCA 1ZAKA 1HEIA 1NIJA 1S96A 3GJ7A 5HZKA 2QTVB 2H17A 2YJTD 3WHLA 2O0KA 5A5GA 3JZMA 3TGPA 2IK8A 2P2LA 5AWFC 3UWKA 4RZXA 4Q4HA 2JJ1A 1U9IA 1KZGB 3L82B 1OFHA 3OHMA 2HEIA 4G5QA 5FPSA 1YKSA 1CR2A 1DO2A 4GRAA 4KFSA 4WXPA 2BIFA 3F0TA 4EAQA 1E0JA 4M9SA 5JI3E 4UNPA 1U8ZA 4JSYA 3OIVA 3SYLA 3EPLA 1N3BA 1T4GA 3OESA 4KVAA 1Z08A 2VPPA 5CJPA 4PHGA 2FGKA 3QG5A 5TMPA 3GLIE 1DVRA 1TQ6A 3ZVMA 2R6CA 2VP0A 3T15A 2Z4SA 4ZIRA 3PJRA 3RVBA 2BOVA 4LHYA 2F3TA 1OYWA 3TW8B 3K0CC 2XB4A 1CR1A 4MA4A 4D0GA 2FFHA 1D9XA 2GF0A 2I1QA 5FOTA 3WMEA 3EWSA 4LUCA 1MT0A 4OHVA 5GVRA 3MSXA 2Q9BA 1H8ED 2H57A 1KMHB 3EZ9A 2JLXA 1J8MF 3ICEA 1SVWA 2REOA 1OE0A 4G5GA 4PSAA 3AQ4A 4FMCB 2G9NA 3FKQA 4YXWD 1ZD9A 4LBVA 3I3SR 4JBXA 4QNMA 2VP4A 4JLBA 1KHTA 4YLGA 2D06A 2H5EA 1TPZA 3LNCA 5IHPA 3RS5A 3QVUA 2GXUA 3KZ1E 2PCLA 2NO0A 4KJZA 5FPYA 3RSOA 4EPVA 1W0KA 1Z83A 3G82C 4OQNA 3FWYA 4TTPA 4B73A 1ETUA 4BFUA 1NRJB 1MV5A 2IHBA 4G01B 4MKGA 2PJRA 2O0HA 3ADDA 2YKGA 3REFA 1SVLA 4R9UC 3IBGA 3GQBA 5CM9C 1E4YA 4M4SA 2UZIR 2JCSA 4MGIR 1J2JA 3BFXA 1VCMA 1AJEA 4DLSA 3QKSA 4OQMA 1Q1QA 1FMJA 4B3BA 3NBYC 2I1VB 4M53A 3DKPA 3LAWA 2B7CA 2CXXA 2OSBA 4RD1A 4ZV4A 4B43A 3LLMA 4PHHA 4FN5A 3VR6A 1Z0IA 4F91B 3DKVA 4AYTA 2EFEB 4P4SA 4HLQB 2GWHA 2QQ0A 3AVYA 4B3GA 1M2OB 1YE8A 1DO0A 2CCJA 2FPMA 3CONA 1AQYA 3PITA 1Z06A 3C14C 5E4FA 2QBYB 1Z6GA 4TQ9A 1RVDA 4V0KA 2VP5A 3ZGXA 1I4LD 1ZU5A 1EFRA 5EE0A 3PEWA 4LJYA 4URYR 4B71A 2GCOA 4PHTA 1P5ZB 4PSKA 2NZJA 2OHFA 5BN5A 3CO5A 2ATVA 2JLYA 1EWQA 1R5NA 2NPFA 3O8CA 2IBMA 2A7QA 5HE8A 3VHXA 4JLOA 4C4PA 3PXGA 5K8TA 2FDCA 3CRW1 4D82A 1FP7A 2MMCA 2NTYC 3I8SA 3U61B 3SHFA 1W2GA 1HE1C 1CR0A 4KYUA 4TMKA 4HLUA 1NBMA 4I1SA 1UBEA 1KK0A 4IDNA 2AWNA 4LC0A 5HCNA 4LV8B 3MWKA 3IIKA 3LVQE 4MKIA 3V4RA 3HWSA 4PAMA 3VKHA 4TN1A 1JAIA 2RGNA 4QNRA 3TNFA 3VQTA 3R20A 1K5GA 3CZPA 1MRNA 1GKUB
chains in the Genus database with same CATH superfamily
1R0CA 2N1BA 1Y6ZA 4YYZA 4JLNA 1PNRA 1RLOA 4Y7DA 4F9GA 1VMIA 2IS6A 2P90A 2ZIXB 1QK4A 1Y1SA 5DX1A 1W4BA 5G53C 3ACBA 3ZZ0A 1WW2A 2QRVB 4TKZA 5AVOA 3W9UA 4MRRA 2PZBA 2V3CC 4GKKB 1ZXBA 3FETA 3HB1A 1QXSA 1ZWKA 1XZMA 3LXUX 3GD7A 3VYTB 2BMJA 2EKBA 1KOLA 4KPEC 1E1QA 2AC2A 4O59O 2ACWA 2IDZA 3H9QA 1Y8ZA 3CT6A 4KR3A 2QMZA 3Q7EA 4ZARA 5FBZA 3SHVA 5U4XA 3T5DA 1U2TA 3G68A 3FFAA 1ZH0A 5JJCA 1JJBA 4JD5A 2W11A 4DAOA 3MRTA 5AI8A 1BQ4A 1CSEE 3DHEA 4XVQA 5HGJA 5JIBA 1BHJA 1QYRA 3VDRA 4K9SA 3DT6A 3MXOA 2AXEA 2H11A 3AWDA 3C4JA 1M2OA 1G21B 4MGKR 1K9VF 3ZGYA 4NR0A 3WLLA 4PCAA 3AVXA 2PUCA 1H2AS 2ZYTX 3FTNA 4KQXA 3A4YA 1BQ3A 3K9FC 3CH4B 1XQWA 5H1YA 3G7UA 1C3XA 4I14A 2R8BA 1Q1EA 2ZRPA 3H5LA 1FYFA 4F56A 1HL3A 4L2IA 3F5MA 1A9QA 4GG1A 4F8YA 1WW3A 3AF5A 3QWHA 1VLJA 4QXRA 1EMDA 3RVKA 4QLAA 2ZJ5A 3D4NA 3OWHA 4IG9A 1KO1A 3BDVA 4DAEA 3EXHA 2JCGA 3D3JA 2MR6A 1JHQA 1RQXA 4RE6A 5D84A 5FJJA 4BL5A 1EFPA 3K09C 5GGXA 3S2EA 4ZRNA 4B7CA 1BWRA 1E7MA 4FFMA 4Z7OB 2ZT6A 5CB4A 4PG7A 1NVWQ 3V2HA 4A16A 5ARBA 3V8NA 2TMGA 4YGXB 4JI5B 5IVDA 4EHLA 3O91A 5IAJA 4MV0A 4IDBA 3WWDA 5J43A 2ZK7A 1AZSC 3UH1A 2TS1A 3NC1C 2PGOA 3OTGA 3QLUC 1QHGA 3MFYA 3ZYCA 1G8PA 3TZ6A 4US0R 3CG0A 5CJJA 1QV7A 5H82A 1XB2A 1L5YA 3V7WA 5J4KA 1XTJA 5JDCA 2W70A 4ND5A 1DIGA 2YASA 3R5TA 3BA6A 1GDHA 1M2NA 1T1JA 3FLMA 3LX5A 5H7XA 2IHVA 5BVHA 3FXAA 4B44A 3K8YA 3LO5A 2V6GA 1MEEA 3CN9A 4PQYA 3ZXIA 5BQFA 1M74A 1D1SA 2R62A 4HJRA 2INGX 4R6WA 1IN5A 2XMRA 4V24A 3U4AA 1HLDA 4E07A 4BP9A 2QTHA 2XRFA 4AUMA 2ERYA 1J5XA 3UZUA 4F0JA 4F5ZA 2IU6A 2A5GA 3NGLA 1LX7A 1VLMA 2CNOA 2HHAA 2OY0A 2VHEA 4PRZA 3H13A 4UNNA 5A3VA 4TQUS 3SSNA 4JI8B 4YJGA 1K7FB 2B4KA 3HL4A 3KTAB 4GU5A 4IXMA 4BVBA 2OZLA 3C8MA 5NULA 5IH7A 1IHOA 5HM8A 4IIXA 4UVIA 1YNOA 1L5VA 4UBIA 2O8CB 1G18A 3E5NA 3GX1A 4C4RA 3AM1A 1JHDA 1HH4A 1MP0A 1T0IA 3ZWVA 5IWCA 5DCYA 5KS2A 4IVRA 5H3LA 4EYKA 3ZGNA 3BERA 2VHJA 5A5VA 1OBHA 1YASA 2FEMA 1XN4A 2JGIA 3BWMA 4MYCA 1Q84A 1O97D 3C48A 2RHGB 1D2GA 4F4UA 5L40A 5KX5F 3P9SA 2XAAA 3NTQA 1IQPA 4R6XA 4AJKA 1YCHA 2BFEB 4YGYA 3GLIB 3FDIA 2YDYA 1J42A 1NVTA 2PJUA 3BRCA 1D6MA 3PGA1 4FCWA 1OHHA 1JLMA 2OLJA 4DWVA 2DF8A 3OJFA 3QBJA 1LCIA 1YQWA 4QTYA 1GT91 2ZE8A 4HGOA 1EVYA 3AJ9A 5GMOA 4Y6RA 1UBUS 5I7EA 5L7YA 5AMXA 1S3GA 2AFVA 4GR5A 2NSJA 5IJZA 4BEJA 3I5YA 1N5LA 4ZQHA 4L4SA 4BQNA 3QVGA 1LX6A 2OV1A 4JA2A 1B23P 2GESA 3BXXA 3PXBA 2XRZA 4QYMA 1F2VA 3NHFA 3Q7TA 2P67A 7AT1A 4OGGA 1RAEA 2J5KA 2QOEA 2O1WA 2P3LA 2NXNA 2WPDD 3AB3A 4PYLA 3OF5A 3C3YA 4XARA 5JS7A 2H8KA 5K01A 5BR7A 1TM4E 1CULC 1GA1A 1ZXLA 2B5WA 1ZMTA 2XEXA 3EDMA 4OQEA 3D3NA 3NDRA 5DM1A 5EAIA 2W2LA 3KR2A 3BC1A 2QPOA 3ZX4A 2DU8A 4WZBE 3PF8A 2CHGA 1J9GA 5HE9A 2CXTA 2QIOA 1ODSA 4ZCQA 1KVTA 5L9AA 4MX8A 2BFCA 3OJCA 5I4BA 4AUNA 5JNWA 5ALGA 1DMSA 4IY1A 2XHZA 2I6QA 4EELA 4OK3A 5B3AA 2R8RA 3RS8A 2X2PA 4RJIA 4P3XA 5KCMA 2DHRA 3S5JA 1EA7A 2ZJFA 3WLNA 2OFFA 2FQYA 3F2IA 3W2GA 1DX4A 1P81A 2OHHA 3FPGA 4DJTA 4C7XA 1Y8RB 4GKAA 3OQHA 3C6ZA 3VJRA 4GMKA 1SUEA 2QN9A 4Z6KA 5AW6A 1TT7A 2ATXA 3FMPB 5CB8A 4YEDA 4O2LA 3UMYA 5J23A 1E66A 1HE5A 3LBIA 3COSA 5JMPA 1MO3A 1SO8A 1EZ4A 2I2BA 3TQFA 4G37A 5EUMA 3WYNA 2XTMA 4MXDA 1MEOA 2MYUA 1RMQA 3D31A 3EOZA 4OL9A 3LG2A 4QU9A 4KYIB 4X44A 2Y1KA 5I9IA 2J8ZA 3LQ1A 2LIVA 5IK2A 3B13B 4PPFA 1S02A 3PNPA 2ZSJA 4HTFA 4IZOA 4R01A 1H2RS 1W46A 1X1DA 2ZIVB 3Q9UA 3NHMA 5IMSA 4F8EA 3RC8A 1XXHE 1CIJA 1B76A 2Z4RA 3F3KA 3Q11A 1PK7A 3A2NA 3D5TA 3HUTA 3WL6A 2PD4A 2G1PA 2C5FA 3FCAA 4IEIA 6AT1A 3KTOA 3VU8A 1Z5ZA 3D3EA 3FTCA 1YZKA 2CZQA 3NORA 2PTHA 1YJQA 3OY7A 4MP3A 1Z9BA 4QFMA 3ZH2A 1DFHA 2C2YA 1SQ0A 4EUEA 2IP2A 3M83A 2RCYA 4TMWA 2ADFA 2POQX 4Q48A 3WJ2A 2R8ZA 3LHIA 3R3UA 2C59A 2K4MA 2F00A 4PINA 1T8WA 2I6FA 4WOKA 3TTSA 2NLOA 4ZVOA 4TMTA 4EMSA 4LQ4A 1V6CA 2GZ3A 4J91A 1PV4A 2G70A 4QDTA 4MW1A 4OP1A 1VKOA 2Z98A 3SYRA 5JHHB 4D97A 4RIEA 4UVGA 4Q9NA 1MJFA 4XUGB 1XPRA 2D7DA 1XIVA 4CKXA 4O2BF 4PLZA 3FHJA 3T7SA 3GLFB 4MP8A 1PLJA 4JYMA 4Q0MA 1Q7GA 3DR3A 1LFDB 3GA7A 2XT0A 4RPHA 3JQBA 3THRA 2IYAA 4CJXA 4ZI7B 3G88A 4MV3A 1X7HA 1F6WA 1HBJA 4GNRA 1WQ4A 4KGVA 3DOHA 1FLAA 2RMKA 1LBQA 3G7SA 2QG9A 3A2LA 1ZJ5A 1EUCA 2C5BA 3D7NA 5AVWA 3WK7A 1NWHA 3ZZTA 1ISHA 3DHYA 1V4BA 1U0EA 4XI9A 3SKVA 3U6BA 3U9SA 3IVAA 1LBSA 1OA1A 5TEVA 1Z07A 4R16A 5AOBA 2O2IA 1RHMA 2GEVA 3IQXA 3OQ6A 1AQNA 3IB6A 1F14A 2MCFA 5CYFA 1CVRA 1TZ2A 1VHDA 4B2LA 1B41A 4W1RA 5CBPA 3B9QA 4ZWNA 1JDUA 1QG6A 5A6VA 4X85A 2C2OA 1HNNA 1X1QA 4KN5A 3OIGA 1CQIA 5JBQA 1YR6A 3N2YA 1BN6A 1WSWA 4J2OA 5FBHA 2AMVA 1JDTA 3U81A 2RJOA 3W8FA 5EMMA 3J81k 1UCFA 2BUAA 3URKA 1ZN7A 1J90A 3KEFA 4XEUA 3QE3A 3WC4A 5DYTA 4G65A 1JJAA 2BC9A 4MJLA 1FVOA 4MA5A 1ZIYA 2LVBA 2QRKA 3PUIA 2ZRFA 1ULTA 1MC1A 3MCAA 1EH5A 4FYHA 1L9XA 5LYJA 4E3WA 5JNRA 1IQ0A 1X1BA 4B6OA 3H11A 1CDZA 2WHXA 1XN1A 1KYVA 1Q0HA 4ZO7A 5T8KC 3WIOA 3IBYA 3ESYA 1MFZA 4BE4A 2GLXA 3I9JA 3JYOA 4URXR 3MGAA 4UHCA 3P2EA 3TTVA 1HYBA 2J4FA 3GN2A 1FS4A 3MN1A 4Z4HA 4AJ1A 2DT5A 3AHJA 3A3YA 1QPBA 2C00A 3UWSA 3X1DA 3EWNA 4Q15A 2BBTA 1K5PA 4MO9A 1NXOA 4R2MA 3TZKA 2X0NA 1SBTA 4KQCA 4LOLA 5F9FA 1B3BA 2QZPA 5AW1A 1XEXB 3THOA 3MS4A 4QTZA 1QP0A 1FX0B 2G9RA 1AY0A 1TJ5A 4YFVA 3DQQA 1Q91A 3VU1A 1ZI6A 4FE4A 1URPA 4KO8A 1P2DA 4MPPA 1KGSA 1E9BA 2ZTVA 4JLUA 1TIKA 1XDBA 4N12A 1N92A 4KGXA 3QA9A 4I6GA 2Q8PA 1US8A 2HIHA 2YJ5A 3L93A 4ZC1A 4GW3A 4WESA 1U6IA 2FRXA 4AXXA 1ECJA 4DJFC 4ZAXA 4N40A 4N0EA 1W85A 1PDWA 2OGWA 4WKOA 4Y30A 5BORA 3GJZA 3HCOA 4LSMA 5BSUA 3CNBA 3E9RA 3H9GA 4US2R 3NWBA 2WHYA 3OCWA 5E1MA 1NUPA 1P7PA 2XXAA 2O2GA 1MEJA 3HA5A 4RFLA 4OSEA 5ALYA 3RRYA 4EHHA 3H42B 5JVDF 1G5QA 2CE7A 3A26A 4UOQA 3LLSA 4NJEA 2AF3C 1A50B 1NVUQ 3AT1A 3BK7A 2VQSA 1VPLA 4ER0A 4HMOA 4EHFA 3Q3CA 3PG5A 4O1IA 2W2VA 3WLFA 3MHTA 4GXQA 4EUFA 3HRKA 2UZ1A 2HPHA 5DGCA 1VKNA 2QXTA 3VTZA 4C4XA 4YUZA 5CEFA 5C8VA 3NJ8A 5JZ9A 5IXYA 4TLAA 3UANA 4F84A 4OHZA 3KT8A 4PXSA 1E77A 4FD2A 5JALA 3IEUA 1SUBA 1M2HA 1P77A 4KITB 1A4XA 3CUEF 3BE8A 4XW2A 1CY2A 4REQB 4ZAGA 2EW8A 1XTBA 3Q3VA 3PDHA 2EBFX 2P9YA 1Z8NA 4JLMA 4D0LB 5H9WA 5KWEA 5JYEA 3MLBA 1E79A 2Q1SA 1U0RA 3B1ZA 1N0HA 4HNVA 4AJJA 1R74A 2GPYA 3AY7A 1R0WA 4PFSA 1MF7A 1OYYA 1VL8A 2CNDA 1POWA 3BAFA 3CRQA 2FHSA 3ED1A 3NIGB 3NRJA 3OZDA 3AP1A 4N3BA 4HNUA 1QB8A 2CF6A 3CUKA 4XQ9A 4JJ8A 2O3SA 4KL8S 3TSAA 1P62B 2G4VA 3S1AB 4BJ3A 4TQAA 1U3GA 4YJ3A 1G59A 3KLMX 1PAUA 1T2VA 5UKDA 3VDQA 4DFDA 5HQTA 3NBQA 2IQIA 1DINA 4X94A 4BGUA 3LPMA 1XT6A 1VKJA 3TIVA 1YCDA 4BKUA 1U2DA 2OP0A 1XTKA 1DV2A 1P75A 1WKCA 3C4VA 2WFAA 4RFSA 3TLZA 4CTOA 1GL6A 1IN1A 2HV8A 3IOCA 5BV0A 1FW6A 1ZN9A 3B70A 3T1YB 1TM2A 4G56A 3EJ6A 4UZSA 1B3RA 3ZKWB 5LMZA 3UJHA 1JHRA 4G84A 2FZLA 2BGLA 3UY4A 1WBDA 2IXDA 4DV5B 2BPOA 5I7RA 4P3PA 3KPVA 5KYKA 3J81A 3LTNC 3T7TA 4MVJG 1O6ZA 1K6JA 4OY3A 4ZVUA 1TJ3A 1KL7A 1TD9A 3A9WA 2AEFA 3EPRA 3HEAA 3JZDA 3O03A 2GARA 2HBRA 4PFKA 5D3KA 5EKSA 2JAWA 4LBWA 4LOKA 4MCJA 4REMA 3TRHA 3VZQA 4W9NC 3FPBA 2ROQA 2VP9A 4JQOA 1XBTA 4XLLA 4URVR 4LTMA 1A8UA 3B1KA 4M9ZA 4EGJA 1TK2A 1WWKA 4GEGA 1FJXA 1N7IA 1T9BA 2YYZA 3GRCA 2JLCA 5DWDA 4D4MA 2BDTA 4CTKA 2EERA 1TZKA 1KR5A 3BQMB 4D4LA 4ZK2A 2JLVA 1VHJA 2R68A 1PWYE 3ZWYA 1BVYF 1A9SA 2OP1A 3E9CA 1HY3A 1GVHA 1NOJA 3EPPA 3H7IA 1LPPA 3HFSA 2H65A 1CUYA 2R48A 2IE0A 1ST2A 3SZOA 3WWOA 3OFKA 2HT6A 4U7GA 1C7QA 1LY1A 1GL7A 4RZ3A 3DF7A 3U4CA 1M1NA 4U7JA 1U28C 1PFWA 1NRXA 2XYRA 4RUKA 3M6FA 3UEOA 2CL7X 2FMTA 4YV0A 4QYIA 3PE3A 4XUDA 2IUUA 3ONVA 4AIRA 4EMBA 1HDXA 3AI1A 2XGJA 3GROA 4CKEA 1T4BA 4OQQA 3E3NA 3DFKA 5EEHA 2HA6A 2VQ3A 2ZS8A 1EGAA 3AU8A 2AN1A 3B3AA 2NTJA 4QO7A 5DMHA 3REQA 3UIEA 4DVGA 2ZRLA 3EEQA 4D46A 1NVDA 2H06A 4UTVA 1C30B 5JXHA 3IIMA 5F1OA 5FBVB 1AKEA 3NH6A 4QPZA 4MS4A 5IUKC 2G40A 2XMQA 4P53A 4YRZA 1T9GS 3D2LA 1QH8A 4MMXB 1ZN2A 4MQMA 1W1IA 2DR3A 1O4VA 2JA2A 3V1YA 1NHGA 4H2DA 4R1OA 4RXUA 4BMSA 2GCIA 4LYFA 5IVIA 3UJ7A 1IEWA 1DNPA 1I0ZA 4YXFA 5KYWA 4WOBA 1HE8B 1LQ2A 2GZAA 3BK1A 2H1CA 1C8LA 2ZBEA 2WG0A 5D3ZA 5JSUA 3W2HA 1T1EA 3TOSA 2IVZA 3HEBA 3HLTA 4RESA 2ECPA 4X8OA 3VU9B 4CT5A 4DQXA 5J2TB 2R7LA 4PAWA 4QM6A 1OAOC 4MQLA 2VIIA 3H16A 3O7WA 5CVVA 2ZYWX 5AVYA 5EIWA 1P0PA 4L7QA 5DASA 3UFBA 2GUWA 3R8XA 2V5AA 4II3A 4CM4A 4S12A 4IUCS 3OPQA 4X5OA 4ZMSA 4D4IA 1LSJA 1AHNA 4ZVKA 2GFIA 1L7MA 3D8NA 3NVDA 3FF1A 4I9FA 4HY3A 4ZGWA 3OEEA 4CQNA 5TQ2B 2I4TA 1QQBA 4MLCA 1TW2A 5D87A 3JQPA 3DEIA 4KTTE 4R8VA 4BWGA 5I3ZA 2O7SA 5T4EA 1GUDA 1PUJA 1T3ZA 3LL4A 1W7AA 2R85A 4WV3A 5DGIA 1JR3E 3PEVA 1G8FA 1S1MA 5BRAA 2RKBA 3IYLW 4DMUB 1V71A 3FDZB 1TUGA 5EQTA 5I9LA 2HREA 1PO7A 3GUVA 4KX3A 3KOXA 1M0TA 1M2KA 1TCAA 2XNCA 1UKZA 3A70A 4UXIA 1XCJA 4E1BA 3JAKA 2O20A 5K6TA 3U2QA 5K20A 1RXYA 2ZKLA 3KLNA 5BV1A 4MVJA 1O6CA 1XZIA 1ESCA 2P8JA 3VO1A 1NM5A 3F78A 1Y5MA 4L0MA 1RWBA 2CD9A 2XD4A 3C3XA 2J7PD 3PHCA 4MR8A 3WTBA 4BLSA 4J1TA 5K3FA 4GKBA 4WZ6A 2VNJA 1YI0A 2WV7A 2CZGA 2DECA 4X64B 2NO1A 2QYOA 3ZXXA 2ZAYA 4MPDA 4MP6A 3GLTA 1KSGA 3JQ9A 4IJUA 4EF5A 4ARIA 3K9HA 3N3BC 1X7YA 3DVQX 3EW9A 4JL6A 1Q50A 1Y1QA 4Q34A 4ROTA 2YC4C 1E2EA 1G2PA 2PQ0A 2WT4A 5DBGA 3RUAA 4EEKA 4YAUA 1YI8A 1S1CA 3OZUA 3PQFA 4YTEA 3V8QA 4EABA 1RPZA 2HIGA 1OBCA 1JFSA 1CR6A 4XASA 5C51B 3DMYA 3ZXUB 3BGIA 4CEHA 4A82A 4P5PA 3L6CA 4D25A 1PBTA 3B8HA 2A84A 2ZYAA 4P58A 4Y9DA 4UTRA 1KFKB 3IQFA 5FA6A 1NF9A 3LUBA 1KHHA 3EPKA 4HLNA 4MLPA 1PCXA 5B6IA 3T0GA 4FWTA 3HFJA 1R27A 1Q11A 5EVCA 2ARKA 1GRCA 4D74A 4LI3X 2VTBB 1HDYA 3ZDEA 5MF6A 2AOWA 5KUTA 2C96A 4DM4A 1PYGA 1TKCA 4RPLA 4JOCA 2ZDGA 3DZHA 3T7EA 3EYWA 1NFQA 2EYQA 1XTQA 1LQUA 2HQRA 5B57C 1C8VB 1KYQA 1NI5A 5K3EA 3NMUF 1PZHA 3UGKA 3SOPA 4L8FA 1U3UA 1VHWA 1U7WA 2D4HA 1DGQA 1UBNA 2NN3C 3WXBA 4BMCA 1XTTA 2O1SA 2K5UA 5BOVA 5TLSA 3ILVA 4NZZA 1GTJ1 2BFMA 4MEBA 1SA0B 3FYCA 4AKSA 1AA9A 4HQRA 3TQTA 3DH0A 5B1IA 2A57A 3E5HA 3IVMA 3T7AA 1PL8A 5CFQA 4RLFA 2PANA 4WECA 2XLCA 1KY2A 1P72A 5D2CA 5BSKA 4KU4A 4NYJQ 2VZLA 3OTWA 1L2TA 1V39A 3GLHB 4UNRA 4RF4A 1L5MA 2GCEA 1M2GA 3B6IA 3TLEA 2EFHB 2HWYA 4G07A 3A9VA 4X45A 3RCBA 2REXB 3WO0A 3ZBPA 3TLMA 5IT5A 1WZ2A 1Q44A 4QBFA 5F5LA 1Z0SA 1MZVA 2FJ0A 2BBWA 1RBYA 1VGQA 2CE2X 4QXMA 4KFTA 2TECE 4DA6A 1PK9A 2AOUA 2EYUA 2VDJA 1C4KA 5I5GA 4LGCA 1M3SA 3OHSX 4C7OB 2JFXA 2FGJA 4I66A 5E2IA 3RVMA 3SC6A 4GHWA 3VRHA 3TE7A 2A88A 4A4DA 2EWMA 3CSDA 3B6KA 4JU8A 1NU6A 3EEIA 3IQHX 3KEMA 4LXUA 1XELA 4XYLA 2VQEB 2A9KA 2GKGA 4EI2A 3IVRA 2WOOA 5JQGB 4AO7A 5C18A 2CVHA 2PLNA 3KE9A 2VATA 3PK0A 1GA4A 2FB9A 2UXCB 1PDVA 3I4CA 3AF6A 5HR5A 4CTJA 2D7JA 4PG4A 2V4ZA 4GYWA 2JAUA 3EB9A 3NHBA 3NYIA 4BX8A 3FGZA 2LXNA 2VCHA 4X8HA 3IAXA 1BU8A 1CUJA 1Y1RA 2JL1A 3LD9A 3SN6A 3NOVA 3SYTA 1IBKB 3KYJB 3AHCA 5C31A 3GGCA 3LW8A 5G3YA 3R6LA 1ZLYA 1YULA 2V7WA 3GGGA 1E8DA 2M32A 4E21A 1N2GA 1G64A 4PLYA 3KZOA 4ZEWA 3VFDA 4CNQA 1IMJA 3K9BA 3OCCA 2CUNA 1G16A 1B0AA 3A6DA 4IG4A 1JQJC 1RWVA 4IJKA 2BHNA 4L4ZA 3P9NA 1UDCA 4V2IA 2C3OA 2D2VA 4YP0A 2P91A 2FW1A 4I2NA 3EVBA 3WLRA 1E63A 3FPJA 2B4TO 1FFDA 3NBUA 2BP7A 3P5SA 1F51E 1S8NA 2VPIA 4PBSA 5I7OA 1SC6A 4D43A 5HS4A 4OYLA 1PN3A 4BX3A 3GUCA 5LU8A 3UMMA 3COJA 4O2RA 5TX7A 2I3AA 3JD1A 4KOEC 2QN2A 4BUCA 1NUSA 2YBDA 2O2HA 2IBTA 3JQ8B 4NIMA 5CG1A 2Y76A 2BKLA 4NF2A 3VISA 3BOSA 3FUCA 2FPGA 3HSKA 4PGHA 4GZ5A 3V9PA 4YRBA 4N3GA 1FRZA 3LKBA 3Q0TA 3ELYA 2XZOA 3QVTA 4GGOA 1TX4B 3I6MA 3JQEA 3CLUD 4IZ6A 3JQRA 1A8PA 2Y71A 4XX0B 3W8NA 4G24A 4JUFA 2XUGA 4BAZA 4RF2A 1TZJA 1CF9A 1P4GA 3W5DA 1QK5A 4D0SA 5ECYA 2EP8A 4HUTA 1UEJA 1OYOA 2P8SA 3V48A 3BB3A 4JEUA 4DPKA 5EXTA 3RWMB 3HXMA 1RQ7A 2F2TA 3R0XA 1T9DA 3HB7A 2PX3A 3C5VA 3PFCA 1FE8A 2VP2A 2KBFA 3AU9A 4YWHA 3ZD8A 3WK5A 2NZUG 2R2GA 5LQCA 3TEMA 3ZHYA 1Y7TA 3EHDA 5EP1A 1NC3A 1LH0A 1EEHA 2AT1A 2NQ2C 2NUAA 5EY5B 3GZ4A 4NJMA 1VLVA 1N6OA 1QIDA 1RT9A 1T26A 2J4DA 2JH3A 3EDRA 3JZFA 2QUJA 3QXSA 4CLEA 4KR6A 3DL0A 3LUAA 1XPUA 4WLVA 1GNQA 1ECBA 2OZVA 1L8AA 4LJRA 1M6VB 1VFNA 5E8JA 1SIBE 3WKCA 3N0RA 1OD6A 3PQ8A 3UH0A 4AMGA 2NZ2A 1FYXA 4DC9A 2NPIA 3IO5A 1JZSA 1NN3A 3FMFA 3L8ZA 1OXSC 1J2RA 1D6JA 2X0IA 4C3ZA 4KR7A 4RQUA 1ZGCA 2QM0A 3R4CA 4HXGA 5L53A 3T9DA 4EEXA 1BKYA 4JJZA 4OIMA 4EHJA 4ALMA 1KSFX 3K20A 3GUZA 3KJNA 3MGCA 1FCJA 2Y6UA 3F7MA 3A3NA 1QNLA 3BD8A 2IV7A 2HI0A 4HVCA 1SXPA 3C3JA 3K1YA 4QARA 4H7JA 4RELA 1E4EB 2OMEA 1N33B 1XJWA 3UMRA 2CVOA 5B1YA 1ZOSA 1A9RA 4RK6A 1X9HA 1KMQA 1BD4A 2YJZA 5DP2A 4D3FA 2AUMA 2F9MA 1OGJA 1QANA 2QRGA 3I6QA 1J2UA 4XTCS 4DEYA 1QV6A 2JRLA 2D2FA 3AF1A 4ZQIA 5AIBA 5K4GA 3GCWA 2P9FA 4HZUA 5GAJA 2A92A 3VI4B 3WRXC 1SXIA 1VE6A 1X3LA 4TXNA 3IDZA 3EGXB 2CEAA 2P1RA 2YH2A 3KAQA 4M1OA 3RHSA 3TQCA 2M1ZA 3RTAA 1L4LA 1XMVA 4RDIA 1UT8A 3GDGA 4BO9A 4QPPA 3KSAC 3ZVNA 1QRUA 5DM4A 3SJZA 3MWEB 1OSNA 1UF9A 2WD8A 2ZULA 3WKAA 3INRA 4WK0B 4EFLA 4WFIA 4M88A 3DS8A 4XE5A 5FO0A 1YJCA 3IBSA 3T0FA 3R44A 4ZAYA 2XDAA 3HYTA 2FAXA 2HL6A 2X23A 2ZR8A 4G97A 3VX4A 1U8YA 4I9UA 1PE0A 2C4NA 4NAVA 1EJ2A 1Y6RA 1FYVA 3H87A 4FR0A 4YQYA 5EJ2A 5AW5A 4BNZA 3CVUA 4RJTA 3D0QA 1F4VA 4ENPA 1JG6A 1EUQA 1P7YA 2QE6A 2WIKA 3DP9A 1E62A 1P91A 4JROA 3ABRB 3T3NA 3ABZA 1PQ4A 2HRDA 2FFQA 1R7RA 3SZRA 4MGZR 4PNPA 4IDDA 1PEAA 2Z2ZA 1KIFA 2A2ZA 4IXTA 3R7SA 1BEUB 5K8CA 3N7AA 1CU1A 1PD0A 2VQFB 5DO9A 3TSWA 2MMGA 1MH1A 1EK1A 2ERXA 2FXVA 1X39A 2AKAB 2GRJA 4MUFA 3UJBA 2I1WA 2V6FA 3I2GA 4B3MB 4F2GA 4GR9A 4A1OA 2ZANA 1DI0A 2HMAA 3K4PA 1M2JA 3LPDA 4FT2A 1Q0SA 4Z0PA 1GVNB 4GOJA 4GM0A 1N6LA 2FW6A 3WLAA 4F2WA 5TPWA 3O8CA 4XUEA 5BN1A 3MTBA 1KJIA 3BAZA 3DDCA 4H1VA 1IWBB 5KU1A 2AFIE 4R1NA 3ICPA 4IXDA 2HDHA 3R77A 3I30X 3LA8A 2E4ZA 4DCOA 2WU4A 3KELA 3V1LA 1N34B 3D64A 5M04A 1D03A 4I55B 4OHWA 3F2VA 3T1HB 2A0YA 2OHXA 3FMOB 4NENB 4P35A 5D86A 2HSZA 1E2PA 1W88A 4M36A 5JO0A 1V26A 3R1IA 1HETA 4DUGD 5KTTA 1U8TA 2JFNA 3PCXA 1L6IA 3KZCA 3PIRA 4QBIA 3CT4A 1DWUA 4DSTA 5I7WA 4URWR 2HZ7A 4LJLA 4NZ9A 4R84A 1XWWA 1YRWA 2BMAA 2EJCA 2ILTA 4IGKA 4J2HA 4N3NA 3SXUB 3VOAA 4ZI2A 1RPNA 4RDXA 5IYZB 1W76A 1ZOOA 1GA6A 4H6WA 1WMBA 1RTKA 2VK4A 3L9XA 5DP1A 1S2LA 3RHZA 2ZUCA 5D6OA 3AVWA 1Z7GA 1GGHA 3O6VA 4I8IA 4KE9A 4BUJA 4K6FA 3L1KA 5K3AA 2UUAB 1E1CA 3IUNA 3OQ1A 1KO5A 3EARA 2Q29A 5JZBA 4GXTA 3GV0A 3SBDA 3L7YA 4U6SA 1C1DB 3ELDA 3HG7A 2C7PA 1TYCA 2VPTA 3HUDA 4MUXA 2PRIA 2P6OA 3LDHA 3PC6A 4EK9A 1N2CE 4QAJA 3KKEA 1KORA 4MYTA 5LP6A 3W5SA 2YJ3A 4RS4A 4DY6A 5IPFA 3CLKA 3KOMA 3PQ6A 4AWBA 3SVLA 4NCNA 2VJPA 1HOXA 1Y0BA 2N42A 2VBGA 3DZGA 2GCNA 3PDCA 4P2BA 1QF6A 1QIKA 3GJRA 5I8PA 1F0KA 1CLEA 4KKVA 4CKWB 1MRSA 2PBZA 4KIUA 5AQ1A 5EJ6A 3G9QA 4MR7A 1XTRA 3HP4A 3SEFA 4EVQA 2IUSA 3UTDA 2CLCX 3H1AA 1Y8RA 3HDJA 2Q0HA 4ZKDA 3H6GA 3I6IA 1DO8A 1U4NA 3C7DB 4RPCA 2R66A 4W1SA 1D07A 2CDNA 5FQNA 3ROQA 7MDHA 9ATCA 2IKSA 2IU3A 2JBWA 2DHDA 4Q1FA 1IBCA 4ZVSA 1XEAA 5TS3A 1BWQA 1JXMA 2ZI7A 4PSUA 4QBHA 2OA0A 3TLJA 3W6OA 3ZHZA 3IP9A 4RC9A 2G88A 3HZHA 4D9FA 1EVIA 1PT9A 2R7KA 4YBZA 3DVLA 3N74A 4AXBA 3TG8A 2I7VA 3V5NA 2F1RA 4N9WA 1AS2A 1Z4KA 4CF6A 5LUBA 3RWBA 4GXRA 4OO3A 2X8BA 3W1VA 1YQGA 2QRPA 3VC7A 1JXOA 4F93B 1ENPA 1U0OC 1AV7A 2DX7A 1K98A 2IQ5A 3ITEA 3U3MA 1RMTA 3EY4A 3SMVA 4BBZA 4FFBB 3VO8A 4QUGA 5BNIA 2WAYA 2P9CA 4NCXA 3TOXA 1Z2NX 1ZD4A 2Q4BA 2Q5FA 3WK6A 5BUZA 1M73E 4EFNA 3OAAD 4GYJA 3EASA 1N2ZA 2MSCB 4IHJB 5E9AA 2ZUEA 1CEEA 2EJWA 4OQFA 4D4HA 5GVSA 1WXDA 5L3QA 3C6XA 2A0XA 3JVUA 3X1KA 4TXLA 4J0IA 2SICE 5LB2A 5JANA 3VVLA 1XZCA 3RBVA 2Z8XA 3DG9A 3JW8A 2G17A 4M89A 2O8VA 2YCBA 2ZEJA 4CKZA 4P7GA 1YNSA 3SIXA 1IBRA 4YONB 4M9RA 5EINA 2RHOA 4YRPA 5FX2A 3LUCA 1SU6A 3BJEA 1BS1A 3D4BA 1OIVA 1X9GA 1CJKC 1IAVA 4J03A 2QYSA 3EC2A 3WGVA 2CLIB 4KWEA 4QVGA 4LJKA 3F6BX 4YMWA 4UBJA 3CX4A 3I9FA 4P54A 1KP9A 1X86B 1MDBA 4RPKA 1XD9A 1HDRA 3B7GA 3TLGB 4EUSA 1JWBB 1OI2A 4KGDA 4CCSA 4G2TA 3GLFA 3Q8KA 1IY1A 3QTBA 4F5EA 3THYB 1K63A 1NQUA 3PX2A 2CSXA 2Q4TA 3PGXA 3ORFA 4I5EA 4NZNA 1KQNA 1CJBA 1DOHA 5KC8A 4ZI7A 5AKXA 1U9JA 2J32A 4P31A 1AKWA 2Q5IA 5DBIA 1TTPB 2ODBA 2YC2C 1RI2A 2QD1A 4C6RA 3U3RA 3VPXA 2FZKA 2YFQA 3WHIA 3TZQA 3IMFA 1FTYA 221PA 2VA9A 1SVMA 4K81B 2JFOA 5GV7A 2QN7A 4CTMA 1ZPDA 3T1VA 4ATNA 1QO0A 4F71A 2HH9A 3D81A 3OX1A 1R6DA 4EG3A 4J0QA 4HQLA 1PS0A 3ICOA 1LD3A 5GZ6A 3RLFA 4CMEC 2EX0A 4OVKA 3ZW7A 3ES9A 3TR0A 4GMFA 5FAXA 5KVCA 1YF3A 3EMBA 3K1ZA 1EFUA 3ABIA 3HC7A 4BPRA 1IQRA 4YDRA 3A9UA 1U9ZA 3GJ5A 3QBDA 4QRDA 4OK6A 4K9KA 1D0SA 4TTJA 3SKXA 4TSRA 4YJ2F 4BN0A 1LZLA 1ZM3A 3IHWA 1PL7A 1NMXA 1YK0A 2QNIA 1V37A 3S2FA 3KKNA 2RBEA 1F4LA 4HPJB 1CDEA 3DCYA 4M99A 2BISA 1K97A 4BIMA 1NVVQ 1RWOA 1UEXC 1RYMA 2QQEA 3GA0A 4ZVNA 3OZTA 5HIAA 2CV1A 1QNFA 1ISMA 3PWSA 1XMOB 3PTLA 4Y2JA 1KK3A 1YZLA 5LC1A 2PUGA 2DFPA 2GX6A 2YMLA 3FFTA 5CLIA 1N9GB 1TYBE 3DFFA 5B53A 5JPIA 1DRVA 4OJNA 1YT5A 3OQOA 3NP9A 1C3EA 1SUIA 3D6AA 2R7MA 3T4EA 5JAUA 3LBAA 5IAOA 3GZTB 2F1KA 2QE7A 1SURA 2R6GA 1EWYA 2BGKA 4ITUA 2D2EA 5JTTA 5IKEA 4YT4A 3QWFA 3PFHA 3PE6A 2DY0A 4MW0A 5EUCA 2A59A 1WXXA 4ZOBA 4FFWA 2BFDB 3TF5A 3HYNA 5D7NA 1H2XA 2DPLA 4IIVA 3UKDA 3RV3A 2AH5A 3AIIA 5HIKA 5KNDH 1PX0A 2K2WA 4CQMB 2IVFA 4IGIA 2AZDA 3MJFA 3EGVA 4HWOA 4MPJA 1J20A 4DADA 3RFUA 2OORA 4EHIA 2DPYA 3AV0B 4E12A 5A3QA 3U7EB 1PSZA 1V1JA 1CQJB 2EKPA 1ZDMA 2WVHA 2C9ZA 2Z3ZA 3LOPA 3LZCA 4MV7A 1K08A 2C5HA 2TYSB 5MHTA 3U4QB 3W3AA 4DZRA 1V2GA 3ECCA 4YCCA 1YRAA 2FUNB 4WUVA 1C3VA 5JTUA 2FP4B 6ADHA 4I1IA 1UIRA 5CTJA 4NOMA 2Q6VA 2ZJ7A 1JKMA 3LHKA 5AK6A 4PCUA 1Z6AA 5H0IA 3RRMA 4AUEA 2YN4A 3S2YA 2J0SA 3MWJA 3AIKA 5SZKB 3PHLA 3QY0A 2ECKA 4ZN6A 1XV5A 1N5JA 2BKEA 4K2HA 2O54A 3WNZA 2VHVA 2E82A 3WG9A 3BDIA 2OCKA 4DSNA 1FTNA 5ANRB 2NIPA 3D4LA 1MB4A 2GVDC 4GLBA 4TT8A 5JWRA 2O2CA 2WYUA 4LXTA 4PHFA 3FR8A 2ZYRA 1PF7E 4HD8A 3EFOB 5JISA 5EIFA 4BMNA 3ETJA 3G0OA 4RYDA 4K26A 1DQSA 2Z1NA 2PZMA 2JLAA 1ISFA 1IBMB 3BZWA 4AJEA 2AUNA 1ZJWA 3HL0A 3ZHCA 1EBBA 2PQMA 1FDTA 1QVVA 3HR8A 4TWRA 5IUJC 3JY6A 4X6XA 1YB1A 3LFHA 4MMZB 3ND6A 3SVTA 2EW2A 4NTZA 3DWEX 3WQSB 4MLZA 4YRJA 4HDQB 2RAVA 1IJFA 1UC8A 1X74A 1Y9EA 4XIIA 5JEDA 3K35A 3E5MA 2P35A 1LSUA 3V97A 3HA2A 3UGJA 3BMQA 1WZIA 3PJGA 5T4HA 4WZZA 3DLTA 1U9YA 3BTVA 3GNLA 4Q4AA 3QFFA 3TRDA 1RJGA 1VMKA 1MB0A 1SBNE 2AVDA 1QTIA 3N1UA 4RL4A 1NY6A 5KQSA 1Z22A 3C87A 4IIDA 1FU4A 1XRPA 4IFTA 2A33A 4MOWA 4XWYA 2ZIWB 5HRAA 3RAEC