4JZKA

Crystal structure of adenylate kinase of e. coli with adp/amp bound
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase
publication title Crystal structure of E. Coli Adenylate kinase with ADP and AMP bound
rcsb
source organism Escherichia coli o104:h4
molecule tags Transferase
total genus 75
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2013-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jzkA00
4GI7A 4DKXA 2O8BA 5JLJA 3FVQA 3K70C 2ZQ5A 3ADKA 5H1YA 3QXJA 1EFCA 2J7KA 4Q4LA 4TL8A 3TBKA 4B35A 2BKUA 5C4MA 2ZJZA 1CKEA 1SXJA 5SZIA 1U8ZA 2J3EA 1KKMA 4IRUB 3NDPA 3V00A 1Z28A 1UKEA 2QORA 2WAXA 4DLSA 4MA4A 3WYFA 2ZRDA 1TX4B 2ZI7A 4GT1A 2SHKA 4BEBA 5B30A 5KU1A 3PITA 1NN0A 2QEQA 4BEJA 5DI3B 4S2EA 1G5PA 4H1UA 4C0AC 3C5CA 3Q5EA 4CEJA 5TDHA 1W36C 3EA0A 4DT1A 2H16A 4IW3B 1QHXA 4LWZA 1ZMXA 2QAGC 2B92A 1LS6A 4WA7A 2FG5A 2R62A 4JLNA 5JJKA 4KO8A 2OLKA 3GEHA 3NC1C 1FMJA 5KYKA 2D62A 2CDNA 4LHXA 1G17A 1A1VA 5SZJA 1TQDA 2OCBA 1UDXA 1TADA 4XTCS 3GLFE 4IVRA 5AJWA 2AX4A 2JLVA 3ADBA 3TSOA 4M53A 3NXSA 3ZVRA 1VCMA 3AVOA 1KMQA 1F60A 4E22A 3B5JA 4Q03A 5F3WB 1U0HC 2Q21A 4K81B 4PXAA 1S9DA 4RZUA 5FUVA 1P5ZB 2QPOA 2L0XA 2OT3B 2WSSA 3WP0A 4AIIA 4H9GA 3HYRA 1OB2A 5DHFA 2OBNA 1Z29A 3ICQB 3WMGA 1ZINA 2RGAA 4DLVA 4MRRA 1FX0B 2Z43A 1VIYA 1OPXA 1ZUNB 3L8ZA 4EJSB 1JI0A 2ZRKA 4JSYA 2OUKA 4FD2A 4DDVA 2FGKA 3OEHA 4ZIRB 4WXRA 2RMKA 3TIFA 1XTJA 1DG1G 4ILEA 4EFLA 4Q1AA 4AKEA 1AZSC 4HLDA 4QBFA 4RD2A 2W0MA 1SVKA 1XF9A 3G5UA 3NWJA 2W6ID 2YOFA 2ERYA 3HPRA 3UIEA 1E4VA 5TMPA 3CF6R 2OXRA 5JHGB 4QRHA 1QDEA 2VHCA 4Z54A 2PL3A 2Q3HA 1KSHA 1IN7A 2AFIE 2OFWA 4B32A 5GVRA 2IXEA 4C30A 1KI6B 1FP7A 1X3SA 2HJGA 1G8GA 2V7QA 4XD7A 2YOGA 4LPSA 4A2PA 1VG1A 2EVWX 5DYGA 1VG9B 2F1HA 3C8UA 2F7SA 1ZUHA 1TL7C 2H17A 2Z0MA 4DCNA 4I1VA 4ZIRA 2GWHA 4OKSA 2VEDA 1XMIA 4B74A 3L8YA 1QHYA 3AF1A 4DDTA 1VG0B 2A78A 2WTUA 5L8VA 2NPIA 1CJMA 1E9RA 2AKYA 1XRJA 2BM0A 2VBCA 4LUCA 4RD1A 4ZDIA 1EFUA 5DGXA 2CL6X 2ZU6A 1JEDA 2ODEA 4GP6A 3R9IA 2IK8A 4DSOA 2D2EA 1D6JA 3FHTA 3Q7QA 1YR9A 3IHWA 5EQTA 5P21A 1G6OA 4QGAA 5DIFA 1Z22A 3THXA 3NDBB 4TN1A 1GKIA 2PMKA 1YU9A 2WOOA 1KI6A 1GNRA 4KLNA 3BERA 4MYUA 1JR3D 5HR5A 1W1WA 3KXKA 1KOFA 1JJ7A 3LQRA 3REFA 2ZRBA 3WRYC 4ZPXA 2J0SA 3B60A 3JVVA 3VR5A 1P60A 4FMCF 3QKSA 4JVSB 2I1QA 3P32A 3SDZA 4UNSA 1NBMA 1EG7A 4JLVA 1D2EA 1P2SA 1DADA 4M1SA 4PANA 4Y0AA 3HP1A 3ZZ0A 5DN6D 2P6UA 1AQYA 2XB4A 2UZIR 1G4UR 2ZSDA 3EASA 2IHYA 4E5UA 3AVYA 3GLIE 2C2HA 4OI4A 4RKFA 4URUR 1IONA 2B6HA 4Q7JB 5JJLA 3MCAA 1N0WA 2CBZA 4NL4H 4XWAA 3SNHA 2NO9A 4PO1A 4IOJA 1CR4A 4LYHA 4XIGS 3GPLA 1NG9A 2D7DA 2OXCA 4IEIA 2GESA 2Q9AA 2IF2A 4TTRA 5DE3A 4BLPA 3T1QA 3RS3A 4WOPA 1YZTA 5IT5A 1H8HA 4D4LA 4KJZA 2CK3A 1ZM2A 2EFCB 1OIXA 1R5BA 2GRJA 2OG2A 3R20A 1AN0A 4II7A 4JLMA 5F98A 2VH5R 2J0UB 1J7KA 2A5JA 4TSFA 3AVVA 1ZIOA 1MO3A 2ZRMA 1E0KA 3TW8B 1QVRA 4PPNA 2R6AA 1XMSA 3M0EA 3TUJC 2ONKA 3CPEA 3A4NA 4XWKA 4PQRA 1ZIPA 3CPJB 5J4LA 3L0IB 4LBZA 2G9NA 4TLBA 4DB4A 2JDID 1FQKA 3KQHA 1SQ5A 2FSIA 4B47A 5G53C 1T6NA 4TQ9A 3KKPA 3W8RA 3D3QA 2PJRA 3EIHA 3I61A 1OE0A 1Z63A 2OE2A 4V03A 4IDHA 1M8PA 3REGA 2GEUA 4DVGA 3MWLA 1CS4C 4E07A 4GOJA 5D3QA 1FL9A 5EXPA 5AUQA 4U5XA 5JFGA 2J0UA 1XXHA 1G8YA 1QHSA 2XOKA 3IIMA 4LHYA 4C2TA 3VNVA 2FPKA 2J1LA 2RH5A 2QROA 2TMKA 2IYLD 5CM9C 2WWYA 2IYTA 2A5YB 3P4XA 4MH0R 1AGPA 1VPLA 1UEJA 2PEYA 2PCLA 3SBEA 1IY2A 4JIMA 1RRFA 5IHPA 1X6VA 4TLDA 2BMJA 3D6TB 2IYRA 4LJAA 4XTRA 421PA 5TXGA 1N25A 3U6KA 4FMDF 5HZHA 2FDCA 5FBVB 1K6MA 3OIUA 2ZS8A 3A1TA 4I4LA 5BQ5A 2J46A 2DFLA 3ZGXA 4I99A 3T15A 3QG1A 2E1RA 2CE2X 2JEOA 1G41A 3PEUA 5AWFC 4M9SA 1E2FA 1AK2A 1KO8A 2ZRFA 2KI5A 2UZ3A 4FN5A 2YWGA 1XJ0A 4L9WA 1G19A 3ETLA 3UPUA 3TH5A 1GL7A 1KMHA 2C98A 1UAAA 3P27A 4KV9A 3RC8A 4QM7A 3FGNA 4A8JA 3DZDA 4W9MC 4MGKR 5FOTA 4EPVA 5KSOA 4A8JC 2WM9B 5LDDC 2Z6VA 4GFDA 3KX2A 2GBLC 3BS4A 1ELOA 1YR8A 2CLSA 4E03A 1RC8A 2AK3A 3OFNA 5J40A 5FPKA 1XTKA 4TZ0A 3K9HA 2JJ1D 3DOFA 1OH7A 1E0SA 4W5JA 2NGRA 3GEEA 5KSPA 2KWIA 2XJ4A 3NC0C 1P6XA 1E96A 2BEKA 4NYJQ 1IXRC 3PFIA 1BO6A 1A4RA 4FI3C 3DZ8A 2MSEB 3IILA 2WWFA 1DAMA 3BBPA 4XVRA 3U7FB 1MRSA 2ZJ5A 2ZR0A 3VAAA 4YONB 3KB1A 2FSFA 2GXSA 1R7RA 3PV0A 5E95A 1FTNA 4NCNA 4ZI2A 3IKJA 3I72A 5EP3A 2GETA 3FMIA 2QZ4A 4ASUD 1CR2A 2XTMA 2EQBA 3LLMA 4CT5A 3O8DA 2FFAA 3E5HA 3GP8A 5TB5A 3AF2A 2F43B 4LZZA 1E2EA 2PX3A 3BH7A 4PHGA 3QIAA 2EU8A 5EXSA 4OI0A 5EJEA 5LB2A 2C04A 3H4MA 2NZJA 5EXTA 1SZPA 4OQXA 2ECKA 2FNAA 4DLZA 4MGIR 4Q4AB 4C0BA 1E2DA 3ICEA 3CM0A 3LVQE 4BFXA 2MSCB 1P62B 721PA 1W4AA 2P5SA 1I2MA 1SKQA 2I4IA 2J87A 3KTAB 5FOWA 1EGAA 5A4JA 1E2JA 2C96A 3RS2A 5BYKA 3N2EA 5GADl 2HXYA 2R2AA 5JI3E 2JJ2D 1HQCA 2H18A 1COWA 3GJ0A 4FCWA 3LAWA 4GZLA 1E79D 3QXCA 4LI0A 1SULA 2CXXA 2YC2C 1XPRA 3PUWA 4V0MA 4DSTA 2OAQ1 5C2JB 2NIPA 3IIJA 1RRCA 2H8KA 2DHRA 2WJHA 3K9GA 1AS2A 3NH9A 2EFEB 4TT3D 1RRPA 4MDEA 2IX3A 5HE8A 1KJYA 3U60B 2ZI6A 4D4KA 1YZLA 2GJKA 4LSGA 2V4ZA 4MDFA 4PC3A 3D31A 1L4YA 2DB3A 2CNWA 3ZS9A 4IDPA 2P67A 1Q21A 2WJGA 1NVXQ 1SKYE 3SYNA 2G1JA 5C4GB 4RD0A 1XZQA 1XEFA 2KB0A 2X77A 4DLUA 2OLJA 3AGQA 1W4BA 4H1VA 1IQPA 1U94A 1G7SA 1ZU5A 4L15A 1P2VA 1VCIA 4HEJA 3VU9B 2PZGA 1W2HA 3FKSD 1KK0A 3OE7D 2V3CC 4M8NE 1CJKC 1T0HB 5EE5B 2GCPA 3AH8A 1K8RA 5H68A 3EIEA 3ZZTA 4MKIA 3UG6A 1YR7A 1CJTC 4DLRA 4UXIA 3FWYA 2IWHA 1QVAA 4WIAA 1FTSA 2F9MA 3AVPA 3BC1A 3ZVNA 4B44A 1W47A 3B9PA 3QJYA 5DISB 2BWJA 3DEFA 1TEVA 4MITA 5J4KA 2JLXA 4QM6A 1ZD9A 3AP2A 4P32A 5CIWA 3A1WA 3IQXA 1CR1A 3MGCA 3LFUA 2CLDX 5GJBA 2EFDB 2ATVA 4CEHB 2PT7A 2GEVA 2B21A 3PUZA 3Q5DA 3KQLA 1J99A 1KI8A 1XMVA 5G3ZA 3LRPA 4FXPA 2RKOA 1KY2A 3GMTA 4PHHA 3UWOA 1N6RA 1DBSA 3VU9A 3RABA 1DAEA 4RD3A 1P73A 4CVNA 1D2NA 2JA1A 4LJ9A 1ESMA 4D4MA 1JBKA 4HAWA 3CX6A 1ZYUA 1N0VC 1MO6A 3LXRA 1G7RA 2QA5A 4RCZA 1G18A 2VF8A 2ZI4A 3HYTA 4F7WA 2REBA 4M1OA 5G3YA 4B3CA 2CL0X 4OK5A 4DT1B 1KYIA 4A0HA 2AHOA 4Q7LA 1TQ4A 1XCGB 1NMZA 1TNDA 4JVNA 4NP6A 1PVOA 2F1RA 1E9DA 3PVSA 2CHGA 2FV8A 3I8SA 2VTKA 3RSOA 4CEHA 5C46F 3IBYA 1W48A 4D81A 3GFTA 2D2FA 4DSUA 1NLFA 3QG5A 2PLRA 4EPTA 2IXFA 2IYYA 2QTHA 4A15A 1E32A 5E4FA 4YQFA 5B58C 1YZQA 1MKYA 2J41A 5HCIA 4C9BA 2ZYWX 3T06B 4TMZA 2G3YA 2PH1A 4BFUA 3N5CA 3VX3A 4YMUA 1R8SA 3IUYA 1TQ6A 4V02A 2UKDA 2QM8A 4TYWA 2IYZA 4O2LA 1UADA 1E2GA 2GJ9A 4XWOA 2EFHB 5B57C 4IXMA 5JWHA 3TJZA 5DI9A 3SHFA 5AUNB 5KO2A 1C1YA 3EZ2A 2GA8A 3BB1A 4CT4B 5FTKA 4GMXA 3U3MA 3B85A 1RFLA 2GJAA 3T1VA 2IS2A 2KBEA 4U00A 3EPLA 2GAOA 5HE9A 3WHLA 4RY2A 4YXWD 2F3RA 3I32A 4UXJA 3V4RA 4HLQB 2WOJA 1LFDB 2VHTA 4IVQA 2A9KA 4US0R 4PC6A 4ARZB 3FKQA 3LBIA 3SQWA 2ORVA 4QBHA 2ZJBA 1TUIA 2BMEA 2FFQA 1KJWA 2HCBA 2D06A 3GEIA 4XH9B 3AGPA 1W46A 1NIJA 3ASZA 2ZROA 2QP3A 1F48A 1G16A 4LBWA 3EIQA 2QE7A 2IT1A 1AS3A 3B9QA 5FTMA 1KJZA 1S3GA 4B75A 3MJRA 2VHJA 4WW0A 4BRWA 1NJFA 5DYIA 2AL7A 3D8BA 4MGYR 5J5CA 5EP1A 3MD0A 2ZRLA 1JPJA 1E1QA 3HR8A 3RLFA 3Q85A 1OXUA 4IOLA 4R71A 3EX7C 1N3BA 1N5LA 1GKUB 3HU3A 2CEAA 2OSBA 4OI2A 3SC3A 3TAUA 1GIAA 1UF9A 1W5TA 3WMEA 2PMDA 2CCJA 3DM5A 4ARZA 4BUJA 2WJIA 2ZYTX 1G6HA 3KFVA 3KQKA 1DEKA 1ESNA 2WJYA 5G40A 1P2TA 3TR5A 4S35A 1ZW6A 2WWWA 4L5BA 4NYMR 2ZU0C 5D3MB 1BMFD 1X8KA 1SVSA 3RANA 1Z0FA 2AXPA 5IRCD 5FBRB 3UG7A 2WMNB 3GLHA 3K53A 2RGCA 3PUVA 1GOTA 4OYHA 5EE3A 3FHCB 2CVHA 1OW3B 1I4TD 3KDSE 3MUFA 4TL9A 1RKBA 1JNYA 2V9PA 5EXXA 3K9NA 1OYYA 3JZMA 3ND8A 4F4IA 3I5XA 4XJXA 4HZUB 1DS6A 1KK1A 4PC7A 1RE0A 4DLWA 3SS8A 3T1TA 3A4MA 2CCGA 4QXAA 3LV8A 2XNDA 5JSZB 1HH4A 5LB4A 5HKKA 2FSGA 3WYAA 4ZDJA 3AKDA 4F4JA 4MKFA 3ZIAA 4EKDA 1U99A 1IXSB 2VP4A 3K70B 1ZNXA 1IJFA 2GZDA 2XZPA 2O8BB 2YYZA 4WAUA 1Z0DA 4PSVA 1II0A 3K09A 3PG5A 2DFTA 4QNMA 4RZ3A 3VTKA 1CEEA 4DEXA 1R10A 2X2FA 4F93B 5A0FA 1Q57A 1IBRA 4KYUA 3FE2A 3FPAA 2OHFA 2OEPA 5JMTA 4A6PA 1I2DA 1NNEA 1TMKA 2GAAA 5FI0B 1RYFA 2ZI9A 1S96A 1ANKA 2WKRA 3CBQA 3THYA 4A6XA 3C7KA 5FBWB 5KUTA 3M4YA 4CRWB 1QHHA 1W4CA 1W36B 1U0LA 3SZRA 1EXMA 5JSZA 4R2HA 3BIFA 4FCTA 1Z2AA 4RD4A 4LHWA 1OXXK 2QAGB 4HAXA 2V1XA 4LBVA 4AKHA 2BC9A 2IL1A 3BORA 4PZLA 2HUPA 4MYHA 4NCKA 4A0RA 2IS1A 2XEXA 4GRAA 3X1WA 2GXUA 1XPUA 4R98A 4PC2A 2UVQA 1LNZA 2QT1A 1XEXB 2OBMA 4BLRA 4C0QC 5KDOA 3AKEA 2E9SA 1MT0A 4LBYA 4ON9A 5IF9A 2XTNA 4OL0A 2DBYA 2OILA 1XJQA 1OXVA 4JMPA 4QJ5A 3WNDA 5AJXA 1OV4A 3U3RA 3I73A 1Z0JA 2AKAB 4PO8A 4PZYA 4V0KA 1ZD8A 4GOXA 4TQUS 2BBOA 5E3HA 5JWRA 3IIKA 4AK9A 3AF4A 4ZCLA 2JCSA 2QSYA 3B6EA 2B8TA 4AI6A 2Q6TA 1F5NA 1G1MA 2G88A 2QAGA 3OIVA 1Z83A 1E0AA 1H8EA 3SOPA 4FMBB 4C0LA 3THWA 1FUUA 1WBDA 1XD2B 3ZD6A 4Z8YA 1A82A 4Q48A 4DIEA 2NO0A 3T61A 1CP2A 1AKYA 3BFXA 4N0DA 2EWVA 1OFHA 1JEEA 2VHQA 3RC3A 3PJRA 1FOEB 1OKKA 1XEXA 3ZYCA 3EPKA 4IDOA 4NE2A 1EX7A 4KBGA 4BFYA 1NLYA 1XPOA 2XGJA 4Z8XA 1ZNZA 4Q5IA 3I5YA 5JCZA 2QNRA 4OQFA 4BLOA 5EE1A 5F9FA 2ZXUA 1T8TA 3I62A 2WPDD 4AURA 1AS0A 1ODFA 2VIIA 4YDSA 1V5WA 1ZCBA 2FZ4A 3H2YA 3LW8A 4PHTA 1WMSA 2D4HA 3LBHA 3TE6A 1SVIA 1XD2A 4TSFD 1RJ9B 2FFHA 2P5TB 2GJSA 2CHVA 2FMXA 3WYGA 1G3QA 3R9XA 1G9XA 1DO2A 1Z3IX 4KU4A 2O8DB 4QHTA 5FOVA 1OT3A 2HLDA 3ZH9B 1M74A 5G41A 1SHKA 4CDGA 3PIRA 3V9PA 4B6FA 2D7CA 3LWNA 4BLQA 1N6LA 1SGWA 4M21A 3AEZA 4M0LA 1GL6A 4HLUC 2DY1A 2LKDA 2BBSA 1CLUA 4CYMA 4D0GA 3ECCA 3BWDD 3PR1A 2YJTD 4EPRA 3A37A 2GK6A 3NH6A 4BFZA 3Q8XB 1CIPA 1RJ9A 3W6NA 2ZREA 4EUNA 5B64A 2ZVQX 2J0QA 3CRRA 3THXB 1T0JB 2ZRAA 2R6CA 2JASA 1ZCAA 2O8DA 2HF9A 5TV2A 1HA3A 1P9RA 2BMFA 2XSZA 1T3LA 3BB3A 4Q47A 3RNLA 2I3BA 1Q44A 2IXGA 3IEVA 4B3BA 4U7DA 1U8AA 2ONJA 4KYIB 1OYWA 1DVRA 1ZM7A 2QRZA 1Z6XA 3VX4A 1Z6GA 1ZM3A 4B2LA 3QKSB 3WRXC 4DDWA 4RVCA 4B48A 3SI7A 3QVVA 1AJEA 4D82A 1JPNA 1T5LA 2D3WA 4UQOA 4B3DA 2X8AA 3Q72A 1XNJA 1G8PA 3AVUA 5FPHA 1U9IC 1S0UA 5IDVA 1BKDR 5JS7A 1XTIA 3UMRA 1KK3A 1UKYA 2QQEA 3RWMB 2RHMA 4LJ8A 1ZP6A 2EW1A 3A36A 4QOSA 2AK2A 5HZKA 4NCHA 5L3VA 5BN4A 5CK5A 1E1RA 3T5DA 1ZVQA 5KSYA 4RZ2A 4PC1A 4KSCA 4TMVA 4C4PA 1TAGA 2BKEA 3AVXA 3KKNA 3QY0A 4KFUA 1XTSA 3F8TA 4RCYA 4DUGD 4ZDKA 1GTVA 121PA 1IY0A 1VIAA 2N42A 1CULC 1A2BA 4HUQB 4JT2A 1G5TA 4MUBA 1GM5A 3FTQA 3K0AB 2FF7A 3QBVA 2RGBA 1E2KA 4YDHB 5EP2A 2WHXA 3NBYC 4QL3A 3TLXA 1UBCA 3W90A 1OJLA 1BS1A 1GP2A 4G0NA 3E2IA 4YMTA 2GNOA 2AD5A 1OHHD 4A0GA 1LV7A 3G0HA 3TR0A 4Q9IA 2BCJQ 2IUTA 1TTTA 1Q3TA 1EWRA 4NHOA 2BJWA 1G291 3QKTA 2P2LA 2XNSA 4PQFA 1E9EA 2ZRGA 2ZJAA 4NONA 4GDFA 1P2UA 3KUDA 4HUQA 2IS6A 4DZZA 1XXHB 2ZR7A 3CWZA 1D9ZA 4PTLA 3W3ZB 4DCUA 2DWQA 2WIAA 5L3SB 4BPBA 5DSZA 1NN5A 5HCNA 1U98A 1MO5A 3DPUA 2GILA 4I81A 1LTQA 4MQBA 1E69A 5TVKA 2Z4RA 4F4CA 2E87A 2FZLA 3K0AA 3JZAA 4TMKA 5AUOB 2MMCA 2WICA 1NN3A 4IDNA 3VKGA 1NSFA 2GK7A 2ZYUX 1NN1A 3SJCA 1Q0UA 4JVMA 1NG1A 2W2TA 3O47A 3CF2A 3OESA 4PR0A 4YC7A 1UBFA 3AP1A 1G8FA 4OJQA 1ONBA 1R6BX 2QP4A 2OZEA 5FPTA 2REXB 3BFKA 3SJAA 3OZXA 4LV5B 5KOYA 2DCUA 3DDCA 4BZPA 1IJEA 4GZMA 1EK0A 1WBBA 2PCJA 4DB2A 1R0YA 2YV5A 4A9AA 2RGGA 4OHZA 4DLYA 2O0KA 2VQSA 2P6RA 3L82B 2R8RA 5J47A 5L3SA 5FOUA 1KMHB 2IWRA 3EPJA 1Q1ZA 1F3OA 1MRNA 3OEED 3EARA 2R9VA 4A8JB 3PXGA 5F2EA 1KTVA 2V54A 3PEYA 2VP2A 2BHRA 4HSEA 3X1YA 2RGDA 1N6HA 5H8WA 2ORIA 1VHTA 4DSNA 2VYFA 3UATA 3R8CA 2W6IA 1NIPA 1YHNA 2ZJYA 2ANCA 1MV5A 3LVRE 5FI1B 3TVTA 1G7CA 2IA5A 3VFDA 4CGZA 4J0QA 1TU4A 2GJ8A 3DKVA 1T5IA 2O52A 3QI2A 4CZ2A 4YLGA 1CRQA 2DR3A 5AJZA 4W7SA 3N2IA 2WKPA 4KVAA 1RPZA 3K0CC 2G6BA 4B2PA 4KODA 1VKJA 2AWNA 2DPXA 1WP9A 2ZJ2A 3OAAA 4O25A 1II9A 5BW8A 1X8JA 2GVDC 5GJVC 2GBLA 1YKSA 3QXXA 5AR1A 1W7AA 1P9NA 1S3SA 2YOHA 4IDQA 4RFSB 1EFRD 2OESA 3A8TA 5KNDA 2VLIA 3RRMA 4LDJA 4A92A 4AWXA 3EZFA 1SXJE 3HJNA 4Q1CA 4EFMA 2J59A 1EWQA 1PZNA 3B1WA 3A1VA 2J9RA 2NTYC 4ITRC 5SZHB 2GHIA 1ZJ6A 2Z83A 4DHEA 4PHFA 3SBDA 4O0MA 2V8OA 2FWRA 1KSFX 1SHZA 2YWFA 4E09A 4MKGA 5A5GA 4Q7KA 4BFVA 1W2GA 3RDPA 4B33A 1LS1A 2PZEA 2QPAA 4QHYA 3QE0A 1QF9A 5LBIA 2KSQA 3QEJA 3RRZA 2HDNB 3QOFA 3IHLA 4PFSA 3GJ8A 2B7CA 1M2OB 2QTVB 2AN9A 4JBXA 4DXAA 3KFXA 2A30A 4RFSA 2ZUBA 3CX8A 3TVDA 1SVOA 3AUYA 1N5KA 3BJIC 1JQJC 2C78A 4MUAA 5JJIA 1BIFA 1IM2A 2I1VB 1Z8FA 1U0JA 2ODNA 4UKDA 1J8MF 3HU2A 1Z0AA 3EZ9A 1ZAKA 2Z5FA 1NVVR 3MLEA 4M9QA 4QFMA 4PQYA 5E7MA 2C8VA 2G0TA 3B7GA 4PPGA 4Q21A 4A4DA 5DN6A 1CRPA 2CCKA 3C16C 4BRUA 5FL7D 1QG2A 1AKEA 4LJ6A 2XZLA 3KZ1E 4ABYA 2A5GA 2OV2A 4YMWA 1XTQA 2ZJOA 3CKLA 2W6JD 4QBGB 1OIVA 2DWPA 2P3SA 2H5EA 4AKIA 4I1OA 2QY9A 4X8MA 1YJ5A 4Q1DA 1U81A 2QAJA 1B0UA 1Z5ZA 3FFBA 1TPZA 2IF0A 3SN6A 2OFXA 5JECA 3ZD7A 3GLFB 2ZRIA 3NBXX 1GZSA 1ZM9A 3CWQA 3MJHA 2QG6A 2G0NA 4I1UA 2EFGA 3K0SA 1Z2CA 4TLEA 3ZVMA 3CR8A 4QGHA 1A5TA 3VMFA 4HB4A 3AP3A 4M1MA 3TAHA 3X1ZA 4L8GA 4X8OA 2QI9C 3U7EB 4HAUA 1TF5A 3U7HB 1G3IA 2RGXA 2ZEJA 3MWYW 2HV8A 2H57A 3I3SR 2XJ9A 4HLCA 3ADDA 5ANRB 3AUXA 4QJ3A 1MR3F 2JDIA 4HB2A 4UNNA 1R5NA 3ZJYA 4P31A 4XSGA 2GCOB 3J81k 2JAQA 1DAGA 3W34A 2JLYA 3KJEA 4NH0A 4DDUA 3GLFA 1LW7A 2QSZA 2X1VA 2XITA 1NRJB 5EP4A 3GD7A 4LJYA 3WBKA 4D0NA 1OH6A 1BOFA 1HQYE 2IYWA 2NZ8A 1D2MA 4TL7A 4WVFA 2ZI3A 4DCSA 2FPMA 3QXSA 3DMNA 1NVUQ 4DWJA 1GWNA 3UMSA 2W2VA 4KHZA 5BWMA 1US8A 1B23P 2C99A 2ZSAA 5HPYB 4B76A 4Q9JA 3CNNA 4LYFA 4BASA 2WWXA 2REOA 1W0JD 2LKCA 5JBQA 5KPDA 1Q3HA 2J7PA 3AKCA 1G3RA 3L43A 3I92A 5JWOA 3C14C 1G3UA 2GCOA 1N0UA 4OI1A 3NIBA 5GVSA 3SHWA 5KPJA 4F91B 4G5RA 3O8RA 4GMDA 1IHUA 3GLGB 3AF3A 3QPVA 4D0LB 3AVWA 1AIPA 2PEZA 4YMVA 3SJBA 3VHLB 2NO1A 3GJ7A 5IK2D 2GZHA 1CBUA 3TUIC 1KDOA 4V0LA 1NBME 1NJGA 3BAFA 3WP1B 4LHZA 3ZS8A 3CR7A 1L8QA 1Z6TA 2BJVA 2LCFA 4PSAA 4DJTA 5CIQA 5CLLA 2NMVA 2ZRHA 2IHBA 3DMDA 4G01B 4DRZA 1DARA 3SR0A 1E98A 4NCJA 3EG5A 3U3KA 1VG8A 3AQ4A 5FUXA 4I1SA 3CH4B 4ESVA 4DLTA 4B2IA 3WNCA 1SVMA 5DHAA 2AFHE 3RS7A 3EC2A 1UBEA 2BV3A 1MH1A 1P7CA 3A58B 1WXQA 4OHWA 1NMXA 1Q12A 2NO6A 2JIZA 1LY1A 3GLGA 2FE4A 4KFTA 3ZZUA 1G3MA 1DAKA 2HT1A 2IYUA 4EDHA 1SXJD 4JYCA 4MRSA 4EPWA 4BFSA 2O8CB 5LPNA 3P20A 4RJLA 4A1FA 1AM4D 4N1AA 1UPTA 5EZ6B 4JLAA 4JJKA 3FMFA 1NKTA 2B7BA 3GLIB 1W36D 2GCNA 4P3YA 1N6OA 2GEDA 5LD2C 2FH5B 221PA 1OLOA 4Q1FA 2RHDA 1T8UA 2VP6A 1E2IA 4BLTA 3UANA 4JLBA 3EXAA 1S1CA 4M9ZA 2AWOA 1NF3A 2FA9A 4QG7A 3K8YA 3A1UA 1W0KA 2OO7A 4DBLC 4Q1EA 2P65A 3IBGA 2F6RA 5FR1A 2EYQA 1JR6A 3B1XA 1YVDA 2VF7A 4JLDA 3WY9A 4QHSA 1PLLA 4EIWA 1G7TA 3P1JA 2O8CA 1IAQA 3GLHB 1J90A 1XD9A 4P4UA 4P0TA 4QJ4A 1IOZA 2OM2A 4BZXA 3GLIA 2W00A 1XXHE 2JJ2A 2A3RA 3LX5A 3SFVA 4ESHA 1XEWY 2VRWA 1DELA 1S1MA 4GSYA 3R7WB 3TGPA 4W5HA 1KIMA 3A6PC 3GCGA 5M04A 2WSSD 2QRNA 1F2TB 1KZGB 1GILA 1TEXA 1Y3AA 2IYVA 4N0EA 5CJ2A 3QKRB 1N2CE 4K46A 4WZAE 1T4GA 4B71A 3T34A 4Q9HA 4UXHA 4TT3A 2HLDD 1UBGA 3SYKA 4B34A 3QF7A 3VNUA 1GSIA 4JT4A 1AA9A 2A7QA 4TL6A 4ZCIA 3IO5A 4B73A 2B8WA 3OEHD 2WVJA 2VP5A 4AYWA 3C4JA 3CF0A 3THYB 4DCTA 1VDZA 2ORWA 4A2WA 1YE8A 1QHHB 2D74A 2JLSA 4XVUA 3R7WA 3SQXA 1WB9A 3CX7A 2KE5A 3FKSA 3B8HA 3OE7A 2HT6A 1F2TA 4Q1BA 4URZR 4UNRA 1KSGA 3I1FA 3QKRA 3QPUA 1Z0KA 2R65A 2G77B 1M7HA 1TF7A 2WJJA 3L0SA 4ERNA 3U7GA 3FDIA 5EUMA 4TYPA 1NY5A 2XSZD 2ZANA 1BH2A 2PZFA 4QC2A 3CNLA 2R6GA 1FW6A 2V7QD 1GUAA 4XD7D 1KI9A 3C5HA 4NBSA 4IHQA 1ZNYA 4LHVA 1U90A 1KI3A 4K8OA 5H70A 1G64A 5GJWC 3IPXA 5DNYB 4NPHA 2QGNA 2QUZA 4Q19A 2RB4A 1VCNA 3GJ5A 2G1KA 1GFIA 2RAPA 2ZSFA 1VECA 1A2KC 2YC4C 2GVZC 5CB8A 1UJ2A 2JLUA 4UJ5A 4F92B 2EYUA 3Q7PA 1M7GA 3THWB 1E2HA 3KUCA 1EX6A 3EWAA 4AYTA 4BWYA 2O5VA 3AV0B 3VKWA 4A36A 4TYNA 4ZV4A 5K8UA 3F3YA 3LW7A 4ZI3A 1GKYA 3MSXA 3QKUA 1E3MA 3MWKA 5E7IA 4MYCA 4LRWA 3DL0A 1FPMA 2V6JA 2YHSA 4IXNA 2H1LA 4AG5A 4CF7A 5KNCA 1YZGA 2W2XA 2IYXA 1JB1A 2FSHA 2HXSA 4JLOA 2R44A 3BOSA 3ZDQA 1P61B 4ACAA 2ZSBA 1HEIA 1NL3A 1MO4A 2V55B 1NBMD 1C9KA 821PA 1WA5A 3PEVA 4YMSA 1OFTA 2O0HA 5SZKB 4EPYA 1NVWQ 2N46A 1GRRA 4OHYA 2HEIA 4PSKA 1JECA 4CEIA 4NDZA 4US1R 3CZQA 1SXJC 3RSLA 4JKYA 1V43A 3CO5A 4Q4JB 4MRPA 4MRVA 1FZQA 3H86A 3QVUA 2H7VA 5BN5A 5KDDA 3LD9A 3CLVA 3Q3JB 4PX9A 2ATXA 4V0ME 1K5GA 2P0EA 3F5FA 5C18A 1T9HA 1HUQA 1XP8A 5FFMA 1SVLA 2FJUA 3O8CA 3O8BA 4YXWA 3RRNA 3GJXC 2LWIA 1H8HD 4A2QA 4OJKA 4RFVA 3TRFA 4LJ7A 2CK3D 3TSZA 4PO9A 3CPHA 3H84A 3OF5A 1W44A 1KNXA 5ELXA 2A5FA 1UM8A 1RW4A 3RWOA 4G5OA 2BBTA 3CNOA 4M1WA 3EWSA 4Q4JA 4KITB 4LX0A 1EFHA 4GL2A 3FMPB 4JKIA 5K8LA 5DI3A 3VQTA 2C9OA 2FGJA 3W6PA 5JI2E 5CITA 2AR7A 1KY3A 4XSHA 1MOZA 2YWEA 5KNBA 4HLUA 2BMDA 4O3MA 1TF2A 1SVWA 2XTZA 1OH8A 3V4FA 3MWJA 3KKMA 1UKVY 2ZAMA 4PZZA 4TMXA 1CR0A 1RYHA 1SKYB 1Y63A 2RGNA 3QBTA 1GRNA 1KHTA 3I8XA 4LJ5A 2FFBA 4LGMA 1BMFA 2VP0A 1X1RA 2XOKD 1YZNA 2ZVPX 2GXAA 1FUKA 2RGNC 1D8TA 3IO3A 1JAHA 4R7ZA 1S9HA 1E0JA 4U02A 3X2SA 2IW3A 1HT2E 4IVPA 1QHGA 4Z1MA 1Z6AA 3U44B 4FMDB 4TZ6A 1OB5A 1XCMA 3MAAC 3U4QB 2BBWA 1N6KA 2ZRJA 2IS4A 4G5GA 4V0NA 3A1SA 4NYMQ 4L16A 4Q66C 2O8FB 1XWIA 3D7MA 3ADCA 5FTNA 2NG1A 3H0KA 3X1XA 1XBTA 3U2QA 2QPTA 4ZKDA 4PAQA 3B1VA 3LX8A 4F38A 3TUZC 2JLQA 3GQBA 1DTSA 3S1AB 1ZNWA 1FX0A 4WZ6A 1U9IA 4EJSA 3OAAD 4JVLA 4EJSC 5B2ZA 1KKLA 4NYJR 3R8FA 4UNPA 3KQNA 2F9LA 3NKVA 5CM8B 4US2R 1Q1BA 2C95A 3GLGE 3U44A 1P75A 2YWHA 4URYR 4LPKA 1DE0A 3U4QA 4KAXA 1XEWX 3ND9A 3E70C 3PCRB 1YZKA 3PENA 4FINA 5JRJA 3HDTA 3NHAA 1AGRA 3DM9B 3OFND 1XB2A 4NTZA 2PT5A 2O8FA 5JEDA 4M1KA 1J8YF 1RRGA 1D5CA 1PLJA 1RZ3A 1VMAA 2F1IA 2Y8EA 4FW9A 3UK6A 4C2UA 5JEEA 3TSWA 1Z0IA 1R2QA 3KQUA 4HAYA 3BH6A 3S1AA 2C5LA 3B1ZA 5CDFA 1S4QA 3K1JA 1KO4A 4JS0A 1KSJA 2VSFA 4EPXA 1NP6A 4C0SA 4MRNA 4Y0VA 4BECA 3QXHA 3DKPA 3WBJA 1ZUIA 4FWIB 2VP9A 4NMMA 5FL3A 2FEOA 2Q3MA 2VA8A 3L2OB 3N70A 3SU8A 5JZVA 3AVTA 4R2IA 2WWGA 3GJ6A 5L3RA 2X2EA 1R8QA 2JLRA 4MGZR 5CYPA 3LO5A 3KXLA 3AVQA 2Q9BA 4O2RA 4NZYA 2ZRCA 4HB3A 2AD1A 1DAIA 1CF4A 1G5RA 5FPYA 1HE8B 2GDJA 1O87A 1N5IA 3WMFA 2ZI5A 2XXAB 2ZJ8A 4WZBE 3MRSA 3CZPA 1I4LD 2R6FA 1E2LA 1X86B 1YQTA 3RAPR 2J0VA 5BN3A 3CUEF 3W9YA 1HV8A 4Q7MB 2WV9A 1J2JA 4FCVA 2Q3FA 4G5SA 2Q0HA 3FYHA 3HU1A 5CK4A 1FNNA 1GVNB 1N6NA 3SYLA 621PA 1NSTA 5KTYA 2YKGA 2ZRPA 3CRMA 4OHXA 2JLWA 3SE0A 1M6NA 1OF1A 3CW2A 4TMWA 2ZE6A 4FIDA 2OCYC 2XB2A 3L0PA 4AC9A 2WPDA 1XD8A 5KSZA 1NLZA 4JBYA 4B3FX 1KDTA 1COWD 4RD6A 2WMOB 5CLQA 1GDDA 1O3YA 1ZRHA 1N5JA 3BB4A 3ZVLA 3VR1A 2H92A 1QG4A 3GLHE 3B82A 4LYAA 3QSYA 3SFZA 1CJUC 3GFOA 1DG3A 4TLAA 2XXAA 3KB2A 4P33A 4V0OA 2X19A 3LH5A 4JJZA 4UJ3A 5TY0A 1DPFA 1PV4A 2ZTSA 1JXOA 2Z4SA 3EA5A 4LCBA 4ZKEA 3WHKA 2CNWD 3TKLA 4FWTA 4JL5A 4DCVA 4B43A 4EQ6B 2QT0A 5TARA 1YRAA 2VO1A 3OIYA 2MMGA 4PPQA 1WF3A 4GBMA 2PX0A 4IEEA 3VR2A 1TUEA 5FBQB 4BQSA 2QU8A 5JRZA 1GNPA 4L9SA 4URWR 5JS8A 2ZR9A 2OCAA 4KI0A 2IEZA 2P6NA 2QN6A 1KI4A 4RZXA 3TK1A 1KK2A 3K0CA 2W0SA 2ZITA 1CXZA 4D2IA 2Q9CA 3W5IA 3CB4A 1KGDA 4KBFA 5FOXA 2GTPA 2IYQA 1ZU4A 1Q1QA 4HDCA 4KVGA 2HF8A 1QHIA 2J7PD 4OHVA 3TNFA 1NY6A 1KO1A 3NVAA 4JYBA 4G3XA 1Z07A 4IFBA 4POAA 4UNQA 1AQUA 4LC0A 5FBLB 4DC9A 3R9WA 2BVNA 4EQ6A 5BYJA 3FFAA 4M9XA 4BE7B 4NU0A 3QUSA 2QTFA 2BOVA 3QEOA 2QMOA 5KDLA 1DO0A 1HYQA 1MABB 2FN4A 1DAHA 1KDRA 2FOLA 3KXIA 1WCV1 4C0KA 4URXR 3LBNA 4TYQA 1G4AE 1ETUA 3BK7A 2HYIC 3QNUA 1PUJA 1W4RA 1BYIA 2O8EB 3UXMA 4Q9LA 4EAQA 4LV6A 4B3XA 5HTKA 1IN5A 1AZTA 4ZO4A 2G83A 2WKQA 1JR3A 4R9UC 1UKZA 3BRWD 1KAOA 1Q20A 2GZAA 3C41J 2BEJA 1RVDA 2OAP1 3CRVA 4QNRA 1TQ2A 3FOZA 1RIFA 2KBFA 1IY1A 3LQQA 1L4UA 1IN4A 5C1BA 3NEJA 5EUQB 2AXNA 4B6EA 5J4HA 1MABA 2NO7A 2NQ2C 3BXZA 1BYUA 2JIZD 1ZC4A 4DUGA 2N1BA 1E6CA 3PUXA 1DOAA 2PJZA 4NKRA 3B13B 4QBIA 2BM1A 2O8EA 1XTRA 4URVR 2C03A 3MG9A 1KDPA 2CHQA 3GFPA 3KJHA 1GRQA 1G8HA 3X1DA 3IGFA 2WWHA 2NPFA 1HE1C 2ZM5A 4HAZA 3RS4A 5KHOC 4TWZA 1PJRA 3FB4A 3KL4A 3U6BA 2XZOA 4XVQA 2YNMA 3EZ7A 4IFEA 3EC1A 2ZAOA 4QGFA 4D25A 1HT1E 2BCGY 2V6IA 1OHHA 4OK3A 4JLJA 1S8FA 3VHXA 3AKYA 2OBLA 2QBYB 4XOIA 2JJ8A 2OCPA 3LY5A 4LOAA 4AG6A 1HY3A 2DWOA 1W0KD 3LLUA 2F55A 2FX3A 4RKEA 3GJ3A 4D4JA 4KSBA 2CMKA 3TQCA 5FR2A 3QENA 2ZS7A 2VPPA 2R6DA 1EESA 1LF5A 1S2MA 2QE7D 4JL6A 2A2ZA 3BFVA 1D9XA 3T5GA 5J4YA 1L2TA 5K8TA 3RS0A 1US8B 3THOA 4ZCMA 4Q9KA 2PLFA 1XX6A 5FTLA 1PLKA 2QQ0A 4HDQB 1P4SA 3KJGA 3KKOA 1F2UB 1G20E 4LC1A 1E1QD 4BGDA 4Q02A 1LB1B 2ANBA 4JLPA 4M2LA 2ZS9A 4QGGA 5FOSA 2F43A 5J4VA 3MFYA 1VYVA 2QBYA 2EWWA 2ODWA 1IXZA 3IEUA 1II8B 2ZE8A 1E9AA 2WJVA 4Q4AA 521PA 2DYKA 4L4UA 4Q00A 3AM1A 5EE9A 2DFKB 3DHWC 3KTAA 4PAMA 1DAFA 1GL9B 1Z6YA 3AB3A 3GJ4A 2DFNA 3SJZA 3OEEA 4LY6A 3K0FB 2JGNA 2ZPTX 1P3JA 3A4LA 1Q22A 3CRW1 1XFAA 3RRYA 1F2UA 2F1JA 3H1TA 3K9LA 5CYOA 2CVFA 1IN8A 3CIOA 4KLZA 1H65A 1E9FA 3CH5A 3P26A 1C4OA 1R0ZA 2XNDD 5DH9A 2IEYA 5HKKD 4A0FA 2WSMA 4NYIR 3RS5A 3ZIAD 2GF9A 2YZ2A 5JCPA 3C15C 8OHMA 3HR7A 1II8A 1E99A 3PQCA 1LF0A 1KNQA 1NKSA 4IOKA 2XAUA 1Z06A 1ZC3A 2ZUDA 3TQFA 4AYXA 1KI7A 3QF4B 4Q01A 4M4SA 5UKDA 3SEAA 1F6BA 3EW9A 3UKDA 3BE4A 4OBEA 1KI1A 1OFUX 4G1UC 1VYUA 2C77A 1OFIA 2BDTA 3K0FA 2QGZA 3OHMA 1CTQA 1KAGA 2CLCX 1E94E 4EFNA 1GG2A 1E9SA 4D6PA 3DVLA 1EFRA 1KZ7B 3EPHA 5CDFE 2VHUA 1UEIA 1M1YE 4LV8B 5LD2B 4WBSA 4HI0E 3B1YA 3KKQA 1GNQA 3AF0A 3VKHA 2VSXA 4Q4HB 3G82C 5EZ5A 1GITA 4N3NA 1T3HA 4JL8A 2QP9X 4RSGA 1OH5A 1XJCA 4TTPA 3ASYA 3RYTC 3OIWA 1HTWA 2JJ1A 5DO9A 4C3ZA 3K70D 1TU3A 2ODBA 4GP7A 2ERXA 4M1TA 2HJVA 3LXXA 2ZIAA 3TMKA 3F0TA 2V1UA 2IUUA 3CRQA 5BXQC 1CJVC 1JXMA 1OIWA 3QF4A 4TQAA 5EE0A 3LNCA 3T12A 4D26A 2VL7A 3WXMA 1E2NA 1M7BA 2CJWB 2JATA 3U61B 2ZUCA 5GJCA 4GNKA 4C7OB 4X8HA 1NI3A 4IOMA 4IKEA 4X8LA 3NBFA 3E1SA 3VR6A 4C0JA 3W5JA 3NTUA 5FUWA 3W6OA 3NBZC 3DOEA 5AUPB 1KO7A 3RHFA 2K5UA 1G21E 4ACBA 4Q4HA 1W5SA 4ASUA 3ZLJA 4HB0A 5E7JA 1Q1EA 1FP6A 1FNMA 4HZIA 4W5WA 1J70A 6Q21A 1XZPA 4KCGA 4WXPA 1H8ED 3MMPA 4GOKA 4AKGA 1VCOA 3L0OA 3W3AA 3NHBA 4ZDWA 4CIDA 1XMJA 1LVGA 5FH9A 3JVUA 5FL7A 3IDQA 1VHLA 4A82A 3T35A 3IQWA 1E9CA 1T91A 1N6IA 2WZQA 1FFHA 2GXQA 3B78A 3DO6A 1OKKD 2CJWA 1JAIA 3Q9LA 4TYYA 3ZQJA 2QMHA 2QL6A 3VR3A 3HWSA 4C7OA 3K0EA 1W49A 2W6JA 4QKQA 5AJYA 2A5DA 3NEYA 3U3JA 4NCIA 3T1OA 4DLXA 1NVVQ 4HUTA 3ONWA 3P4YA 1Z47A 1JJVA 1R0XA 4KXFB 3BGWA 5AK0A 3BH0A 4OK6A 5AJVB 2QMEA 1N6PA 5FPSA 4LJ4A 2C9CA 1E2PA 3TW4A 1XU4A 3QPWA 4TMTA 3ZQ6A 1E79A 3FMOB 1X8LA 2WAYA 1E2MA 1U2RA 3BD9A 3UMFA 4TTQA 5CB6A 1CU1A 1T3SA 4LYJA 4P4TA 1QZXA 1R5OA 1Z08A 4AY2A 3LA6A 4OQLA 1E4YA 4HDOB 1UFQA 4IJMA 2W83A 4KFSA 1WRBA 3FHOA 3WNBA 2ZETA 5FTJA 1ZD1A 2F3TA 2IBMA 3M6AA 3U3OA 3UWKA 3CONA 1EFTA 1UDWA 2ZE7A 1XCPA 4HYYA 2GF0A 1JQLB 1K5DA 2ZSEA 3U5ZB 1XDBA 2XX3A 2HYDA 4HATA 4Q18A 2RCNA 2YVUA 5DLQC 2QENA 4M1YA 1M34E 5L3QA 4C0HA 4D80A 2QMUA 3I4LA 4BFWA 2FU5C 5JHHB 1WQ1R 1R4AA 3B2EA 2BIFA 2HCJB 5FUYA 1YR6A 3PEWA 2MSDB 1FMLA 1E9BA 1OSNA 2YINC 1YRBA 4PPFA 4JSTA 1X1SA 2J45A 4OQNA 4KFRA 1WDTA 3VR4A 3EZ6A 1YZUA 2ASEA 1PUIA 4LK2A 1U8YA 1VTKA 4Z1MD 2C9YA 4B3GA 4CW7A 4HAVA 4JLKA 2NOAA 1W0JA 1IN6A 4P4SB 2PBRA 5F9HA 1R0WA 1VYTA 4JZKA 2CL7X 4MYTA 4M22A 4PAOA 2RGEA 1JR3E 4AD8A 1I4DD 1E2QA 5L3QB 5K8IA 1OXTA 2KJQA 3W8NA 2FPLA 3IPYA 4DIDA 4JBWA 2O0JA 3M1IA 1QBKC 4DEYA 1NMYA 5D3MA 2JLZA 1ZBDA 1OXSC 2WIBA 4OQMA 1KI2A 1QHNA 2IYSA 1KO5A 1QRAA 2ZYVX 3EAQA 1SXJB 3PUYA 2WBLC 3K09C 1WE2A 1ZM4A 3NG1A 2FEMA 3HPQA 5IK2A 4CEIB 1HURA 2WWIA 1A7JA 1P72A 1FQJA 1L7VC 2IC5A 2QM7A 2ZE5A 2ZRNA 4NYIQ 2IUSA 3KJIA 3QQ5A 4HZUA 4MKHA 5CJPA 4P4SA 4BZQA 1JALA 2GKSA 2OFOA 4Z51A 2CE7A 4BLSA 2J5XA 2VSOA 3RVBA 1E1RD 4BFTA 4CEJB 4FMCB 4TLCA 1P9WA 3LDAA 4G5QA 2W58A 4GPTA 1GAJA
chains in the Genus database with same CATH superfamily
1C80A 4H4DA 3CUVA 3BMOA 2R8BA 3FCSB 1JZSA 3TSYA 3W0LB 3SX2A 3QVTA 2VA9A 2ZQ5A 1JEYB 3B70A 3R3VA 4WNCA 4FZ5A 4BE4A 1ISGA 2J7KA 4Q4LA 2BFEB 2BKUA 3AIIA 1SXJA 4PLYA 5EWJB 1L4LA 4IRUB 1E89A 2ZWOA 3T3MB 2QORA 1UKEA 4I6EA 2P1RA 2RHJA 3G6WA 1O0BA 3CW8X 2OV8A 4EJ2A 2ZI7A 3Q88A 4AUKA 3C48A 3PT5A 5JZBA 2ACEA 2RCYA 3PITA 1U9JA 1MX1A 4FT4A 1C7FA 4S2EA 3ZE8A 1IZ9A 1G5PA 4C0AC 1X0VA 1MVOA 1E8NA 3D0OA 1X9GA 1DIHA 1WMDA 2H16A 2VNAA 4YFVA 4TKVB 3HA7A 2CJXA 2QAGC 3QVLA 5EMKA 1VRVA 2PSEA 3FZEA 4UBMA 1LS6A 4WA7A 2W48A 1O96A 1O94A 4NBTA 4IYJA 2QX8A 3O8NA 1ZX1A 1O8CA 2XMQA 3KLNA 4G97A 4QOJA 2QTMA 1SUDA 3OZAA 4R41A 2CDNA 4F2GA 1G17A 5J5VA 4BNMA 1X2EA 1F7VA 1XXLA 1UWCA 2OCBA 3ZQUA 1A9XA 2RHGB 3KSAC 1UZLA 1F8FA 1CQPA 1QIFA 3DL4A 4W82A 5B1SA 1JJIA 3JQ9A 4GXNA 2IPLA 3JXEA 3DULA 3NXSA 3ZVRA 4UATA 1MO2A 3TKAA 3M49A 2RI0A 4NFHA 1F60A 4E22A 3B5JA 1HZJA 4NZOA 4Q03A 5F3WB 1U0HC 1ES9A 1TTQB 4GI5A 1QYDA 1RACA 4PXAA 1C3EA 1VE6A 1S9DA 2BR5A 2QVXX 5CFQA 3Q87B 4MQ4A 1P5ZB 3O7WA 4MV9A 4KAAA 2QYSA 4HP8A 3FOFC 1ND6A 3NYRA 4M87A 4YBZA 1TAUA 4OHBA 4AIIA 4P0PB 2FUG6 1DTWB 1I9GA 4M3NA 3L0BA 2XVZA 1UFVA 3PZRA 4OSEA 3DDUA 4ZZ1A 1X7YB 5IF3A 5GGXA 1W93A 1GRCA 4BQNA 4DLVA 3H5WA 2P6RA 3H16A 3PPVA 1FX0B 2HADA 2O2HA 1OPXA 3Q6NA 1EUDB 3B7PA 4PV7A 5A7HA 1JI0A 2V7PA 5TT0A 1FSPA 1K98A 4M1QA 1SIOA 4R1OA 4OYLA 1WD5A 3QUCA 4FD2A 2PMEA 4CM7A 4F4HA 1AZWA 2FGKA 5B1YA 4ZIRB 3Q3VA 2QDXA 1U9ZA 4NZPA 4ILEA 1KEZA 1RCUA 1HDIA 2ZULA 1ONNA 3KFLA 3OWXA 2J9FB 3FUVA 3MEQA 4EHDA 4P5PA 1N8TA 1AUPA 1XQWA 2DTEA 2W0MA 5EKXA 1QS0B 1XF9A 3G5UA 3NWJA 4QXPA 2W6ID 3G49A 2Q1XA 2XMDA 1TZ2A 2VJDA 2YOFA 3UIEA 4BWGA 4HXGA 3AJ8A 3VHQA 3DG9A 1PRYA 1Y9EA 3B3QA 2AN1A 1H2XA 4LZOA 3DFFA 1KEEA 3SZOA 4OGLA 3DE4X 4PX5A 5DEOA 2VHCA 3CG4A 5DLPA 4IIVA 3GCXA 3BMCB 2PX8A 4BN4A 3PQEA 1VJ5A 1LWOA 1FZTA 5GVRA 1P4GA 2CF5A 1WUIS 4R83A 2ZKLA 1KI6B 5DX1A 3TS1A 3P0HA 3GBSA 5P8WA 3C6BA 1BDHA 4PO3X 4CQMD 3TLJA 2V7QA 4DMHA 4W4TA 1YTLA 2XUPA 3C8UA 2F1HA 1CZNA 1VPDA 2C9BA 3AG6A 4GYKA 5ALRA 4DCNA 2D00A 4I1VA 4W5NA 3MILA 4OKSA 5KX5F 4FS3A 1DJPA 1P4HA 1XMIA 3JQAA 4B74A 3EDRA 4PICA 1DRUA 2B61A 1MC1A 5H02A 4AMZA 4TXLA 2WTUA 4Y2PA 2N9UA 2D8MA 1LSSA 1E9RA 1SFRA 1ZOPA 2FW7A 2R11A 1XRJA 1YA4A 5CRIA 3V4LA 2DXIA 2IPNA 1EFUA 5DGXA 2CL6X 1UANA 1JEDA 2ZU6A 5D7NA 4B3TB 2IEBA 1FLDA 5EESA 1VM6A 5LYJF 1QOQB 4FE7A 2D2EA 2BMAA 3RU3A 3RVKA 4H7IA 1YR9A 4MVJD 4S0XA 1ECFA 1G6OA 2Z6UA 3TLYA 4DLNA 4TN1A 3WV4A 2X8JA 1GCIA 1YU9A 1LLQA 1ZEJA 4RO0A 4RBNA 4KLNA 1ISIA 1VLHA 1IDN1 4I5IA 1JR3D 1NYQA 5BN3B 4XX0B 1W1WA 4BUZA 3AZPA 4OPMA 3TNYA 4O4JF 1UPXA 4EGFA 5CJJA 3KEQA 4RF3A 5IJ0A 4B0PA 3TXAA 2C88A 2P5YA 3JVVA 4OD0A 1O7JA 1C9MA 3QA9A 7REQB 2XBMA 5BYAA 1PTKA 2OB2A 3EY9A 3EJWA 1X1AA 4ZANA 3VR5A 4N41A 4WXEA 3DS8A 2A3NA 1O5IA 3P32A 4JXJA 4FE3A 4I4NA 1MJGA 5GMOA 3V3KA 2PX5A 3FLEA 3GEMA 1DJLA 2SKEA 4R2LA 4P1ZA 4MV5A 2VPQA 1D2EA 3A9VA 4GO1A 3OMXA 4Y0AA 4ATNA 1K86A 5IULC 1JDUA 3OJWA 4CWAA 2XB4A 4D9BA 4EI9A 3QLVA 3BGIA 1YBHA 3EASA 3S0JA 3N2GA 5C7LO 1AV6A 3GLIE 2C2HA 2QD4A 3O1HB 4HDKA 1OI7A 4OI4A 1IONA 3PPXA 3Q9UA 5JJLA 3OCYA 5H4HA 1BVRA 2I6SA 2QIOA 3S2FA 4B7AA 3PD1A 5KQSA 3W4KA 3D1VA 1VA5A 3JATB 3OCWA 4IOJA 4OU5A 1E3QA 3L7CA 1BGWA 3ZUGA 1T26A 4FE4A 3ESDA 1IB0A 3GWZA 3G0BA 3DXFA 4GE0A 5C5EA 1KMCA 4XIGS 1H9BA 3R3UA 3D43A 5F3DA 5H59A 1A9ZA 3SZLA 1H3EA 1F8GA 2GESA 4F4DA 2QUBA 4CV2A 2Q07A 1HBJA 4WKBA 1QHEA 5DE3A 1GNLA 1CR6A 3LYHA 1P91A 3COZA 3RS3A 2D13A 1YZTA 2O20A 1WD7A 4KJZA 1HYBA 4JAVC 1C9JA 1MJFA 3TCXB 1R5BA 1NXPA 2GRJA 2OG2A 3T99A 3Q10A 5F98A 1PQPA 2FZCA 1T15A 4B82A 3W5AA 3SEFA 5DLYA 1S2LA 3OQ6A 4TSFA 2D0OB 3G9QA 1MO3A 2ZRMA 4Z4HA 1HFEL 1PT6A 1QVRA 2H7CA 1V8BA 3DTVB 1XMSA 3DPSA 1QWOA 1ZK3A 3CPEA 1T9KA 2XDQB 2VXCA 5B7PA 1HNWB 4PQRA 1ZIPA 5T64A 3CRNA 1NBEA 1SZJG 3G23A 2VT3A 4L2IB 1U2ZA 4LBZA 2G9NA 5TF0A 4X6XA 1FMCA 4DB4A 2JDID 2ZBFA 2Q6IA 2QX6A 4YRFA 3NATA 3TTWA 4JITA 3R7DA 2JBHA 2P11A 4OP3A 1T6NA 4TQ9A 3OPQA 4LW8A 3UUEA 4CU2A 2J3DA 1TCCA 1U8FO 5BT9A 4KGXA 4A8HA 5BSEA 1SOWA 2OE2A 3O3MB 4FS8A 4NI5A 1M8PA 4ZC8A 5KEIA 4RE6A 2E82A 2C3MA 1T1IA 2HN9A 2CD7A 1J9EA 1FL9A 5D3QA 4ZMRA 5JFGA 2J0UA 1NUSA 1N34B 1PQWA 3T3EA 2XOKA 2NO5A 3CLRD 3M1LA 1GR0A 2Q8QA 5JSFA 3BSWA 3BEDA 5HGJA 5CM9C 4LXGA 2A5YB 4WGGA 3JX9A 3H5TA 2EEZA 3ZDRA 4KMRA 2BTOA 4X1IA 2DTXA 4N5MA 5A0TA 1C9EA 3E3OA 4EO9A 3N6RA 4JIMA 4RHEA 3A3KA 4FZJA 1RRFA 1X6VA 3TI9A 2YJGA 4LJAA 1IPHA 3HL0A 3G0IA 1N25A 1HG0A 5ILQA 4BO9A 4C4RA 1VGRA 3KYCA 1K6MA 1OLSA 5FBVB 5K6AA 3ZDDA 2R96A 1URPA 4HYTA 2IXTA 5BQ5A 2J46A 4YAFA 1WABA 4K9RA 5K6AC 1XA4A 4QREA 2JEOA 2BKLA 2UYGA 5G1PA 1GU1A 5CX1B 1QC5A 1SM4A 2WEKA 1P4RA 1YTUA 2J4CA 3NALA 4IIBA 4KREA 2PWBA 3FDZB 4R9NA 4FN5A 3W1WA 2V6FA 3EFOB 4L9WA 4C3UA 3UPUA 3GGSA 2C98A 1GL7A 1RAAA 3HZOA 2CYCA 1SELA 1Q7CA 3P27A 3TH5A 3WGUA 3GVPA 4IDDA 4TV9F 5LM3A 4RTOA 2OP0A 1YS1X 5T7BA 8MHTA 4Y7DA 3TD6A 1D6SA 3THRA 4ZVKA 4D6XA 1GEGA 1J21A 2Q28A 3RWBA 3OLCX 1W87A 5JVDB 1LBHA 1ELOA 4U8HA 1Q0RA 4X61A 4YJ2F 1NW8A 2BEUA 1QP8A 1CC1S 2QRJA 3TPCA 1GAQA 4E03A 1QE0A 2FPIA 1VJ1A 3GZ4A 3O26A 3FIJA 1I24A 5J40A 4JODA 1XTKA 4TZ0A 1A5ZA 1OBVA 1YVPA 3DMHA 3K9HA 1X7ZB 4OHOA 4Y2HA 4NR0A 2NGRA 2XGSA 3A1FA 3GEEA 5KSPA 4MR7A 2XJ4A 3LUDA 3NC0C 5F5LA 1E96A 4N0QA 2FOXA 4DZRA 3L02A 3TDNA 1U7ZA 4F46A 1IUPA 2VRCA 3ZY6A 2ATEA 5GM1A 4X1YA 1PD0A 3U7FB 5NULA 1EBBA 2Q5EA 4I9GA 5TJHA 4BHTA 4BO0A 3ICVA 2CYAA 4TMFA 4TV8A 3C7TA 5IASA 4YONB 4B7ZA 1G63A 2XCOA 3VR6D 1SEVA 3KB1A 2IGBA 1RXEA 1S2NA 2GXSA 5E95A 1R7RA 2LV8A 2PZJA 3QMVA 1FTNA 5AW7A 4PBSA 1ZLXA 3C2QA 4F3NA 3RJ9A 1J0BA 2NM0A 2WF6A 2GETA 5HOQA 2XMBA 4N12A 2XTMA 2QR3A 1DOZA 2MINA 3KLMX 1P2DA 5E4TA 3IVMA 3GP8A 1E2EA 2PX3A 2NQ8A 4CODB 2EU8A 2DULA 4ARAA 5LXTF 5BNIA 3H2BA 2Y6UA 3VVBA 1NF8A 4C7MA 4B6SA 2ECKA 2FNAA 3PXXA 3MF4A 3OKCA 2EP5A 4HVTA 4Q4AB 2AA3A 2WILA 1E2DA 1XC7A 2ZT7A 3LVQE 3RREA 721PA 3EG9A 3ZY2A 3CUWA 3UPDA 2SKDA 4IH4A 1A95A 1I2MA 1W9MA 2I4IA 3KTAB 1AQJA 2ZPUA 1SBTA 2YVAA 5B1DA 5AVTA 1HORA 1OXKB 5THQA 4UCXA 3QYJA 1TJPB 4LRXA 2C96A 4Y2JA 3RS2A 2JFNA 5BYKA 5HXAA 5JYCA 4TMYA 4XR4A 3ENKA 4N6OA 4RDIA 1N3YA 3EF1A 1W5BA 3SIXA 2DG2A 1OOEA 2GD0A 2P4HX 3PDJA 3PQ2A 4WSOA 2JC3A 1KFEB 5MF6A 2A0XA 4PHGA 1P3DA 1OGYA 3CH7A 3ST7A 4BNDA 3J80A 2XIQA 2BT4A 3LY9A 1N77A 2WG1A 3G7NA 2G5CA 3HFJA 3OKFA 4LF9B 2NIPA 2P2YA 1JHQA 1S7CA 2WJHA 5JNUA 2J6CA 3OF3A 3K9GA 1H85A 3NH9A 3U4DA 2AT1A 4TT3D 1KA9H 4Q39A 3EQ2A 3EVAA 1EPUA 4WKPA 4RH1A 4D4KA 1YZLA 2DM6A 1LGYA 2V4ZA 4LSGA 1I10A 1Z5GA 2QRVA 4UCWA 2YJ3A 3OQPA 2NUAB 4WE3A 5ITZB 1R88A 4Y9DA 1Z7EA 1NVXQ 4OXQA 1JWBB 2VKQA 1AXGA 4DA6A 5C4GB 3H2KA 5EJFA 3JYOA 3VDRA 4HDMB 3VYUB 1JKMA 1R64A 2WFAA 3AERA 3AGQA 5EFZA 3PTLA 5C1IA 4L15A 3VU9B 3URKA 4BNUA 2EZ9A 3OD1A 5ARBA 4H08A 1XG5A 3OE7D 1KK0A 3OY2A 3S8MA 4L1KA 4PQEA 1YBFA 1KZ4A 4M8NE 2WPNA 1N2SA 4D9JA 1T0HB 4IMIB 4K86A 3VZRA 5HIAA 3JYQA 3OBIA 1YCFA 3PHHA 5H68A 1MVNA 2VDJA 3EIEA 4NS1A 3DO8A 3UG6A 1W76A 4DLRA 3BRQA 4UXIA 5AM5A 4YP1A 3U19A 1ZHFA 2HSZA 3FWYA 3AL0C 1BE8A 4WIAA 2F9MA 2WFLB 3AVPA 2GQ0A 3GEDA 1W47A 3B9PA 3QJYA 4QVIA 4ZEVA 2I62A 4KUHA 1XMOB 1UFOA 2XT6A 5CIWA 3MGCA 5GJBA 2YXLA 2EFDB 2ATVA 2ZIXA 3KXPA 4Q3KA 4RNDB 4CEHB 2GEVA 3C7DB 3VYTB 4C0XA 1KI8A 2QRLA 3ED5A 1QPGA 3CF4G 2QV7A 5TEVA 2H4ZA 2XUGA 4PRLA 2GR9A 1N6RA 4EATA 2YS6A 4S1TA 4WV3A 4QX6A 3RABA 1DAEA 4QD3A 3D7KA 2C4TA 3ICCA 3MTGA 3P2IA 4QFBA 5C34B 4B40A 4MW2A 4CEJA 2CFCA 1ESMA 1H23A 5KJ1A 2CXHA 1U7WA 2GH1A 4QPCA 1J2YA 3C3YA 4H7KA 3GIWA 4V2IA 4ZAVA 4YCLA 2YN4A 1G7RA 4GECA 1JFTA 5DF1A 2BZGA 1EWYA 3BZUA 5HG0A 1WDKA 4B3CA 4F7WA 2VXBA 4DT1B 1M6VA 1KYIA 5DCLA 4A0HA 1TUBB 1TQ4A 1NMZA 3EOBI 3T94A 1TNDA 1RI1A 4MV0A 4NP6A 4C3VA 1OWLA 1OMOA 4CR6A 4DYHA 4CM6A 1P5HA 2FV8A 3MRVA 5I01A 2VTKA 3VU0A 3PZBA 2PD6A 3IIIA 3IBYA 1W48A 1KZYC 4FVTA 2W2NA 4KQCA 2V9CA 3ABIA 3N7AA 4UVIA 4EPTA 2AKEA 1ZD3A 3GCWA 3I5UA 3KWJA 4AWBA 1VSTA 1Y80A 2J41A 3QELB 1YBVA 3HNRA 2ZYWX 4GMGA 2IU4A 3MCUA 2G3YA 2HWKA 3GJQA 4KN8A 4D1YA 4BKRA 4R3WA 2O5EA 4WHMA 4HGRA 1P0FA 2QM8A 5CAEB 5EIEA 1UBHS 2D5IA 2IYZA 2C9DA 4GPIB 4ADSG 4BO6A 2RK6A 2H00A 1EX9A 4UC0A 2EFHB 4P80A 3TJZA 2G80A 5KYWB 2HO5A 4M8IA 5AUNB 5MGNA 3ZNQA 2GA8A 3BB1A 1GGHA 1TA4A 5HK8A 3L0DA 3FDJA 3U3MA 3B85A 3GBPA 4I6JA 5LQUA 2GAOA 3EISA 4LRUA 1BGVA 3QHPA 1I14A 4MDYA 3TCNA 1DRVA 3U40A 2QLLA 1LFDB 1MB2A 2A9KA 1LPAB 2DH5A 2HU5A 2OZLA 3BWXA 3D3WA 3FKQA 2X2PA 1FLVA 2BSAA 2AZMA 2ORVA 1CUBA 3WL3A 4QBHA 2ZJBA 4DPKA 4NCAA 2FFQA 3KQSA 3ONNA 3BSSA 3G8YA 2K6GA 2OBXA 1ZISA 4YRKA 5KNCH 1EJ0A 1SCNE 1Y1LA 4LBWA 3TPZA 4AXBA 3OZRA 3N6VA 5FIUA 3WDMA 4CPDA 4EYKA 3W04A 3DLAA 4WNAA 1AS3A 1S3GA 4G09A 1YI1A 2O4UX 4MQLA 3T6KA 4B75A 2WD7A 4XQEA 3EZLA 4IXDA 4OMDA 2NUTA 3SR4A 4TZKA 3SE7A 4CMHA 1CUZA 1JL3A 2EWMA 1JPJA 1E1QA 5HGXA 2X4LA 4IOLA 5KNBD 3UJ9A 4G1MB 1GSOA 1N5LA 1JEQA 1U3WA 2ON6A 3ZEIA 3SC3A 1PR2A 2MHCA 1JDBC 3ZNPA 4F11A 4KN9S 2VQ3A 1S4MA 4ARZA 3TM4A 1G6HA 5JSUA 1U0BB 3HLKA 1ESNA 3I2HA 2EC5A 3L1JA 4X54A 5JTTA 1HE3A 1A8SA 1ZW6A 4L7QA 4L5BA 2ZU0C 3SZUA 4EKEA 1JE0A 1RZRA 4RS3A 1SVSA 1O97D 3HCDA 1I2ZA 4CNQA 1VQ1A 1Y33E 4TQGA 4U2DA 2EQAA 2DRIA 1Y8CA 1E7WA 5K0JA 3K53A 1GOTA 3A4IA 4KXNA 1C8VB 3FHCB 2I6QA 4O2AB 5JD3A 1OW3B 3KDSE 4EA6A 2CY0A 2Q5CA 1KPHA 4MV4A 5DK6A 4BNKA 3K9NA 2B1QA 3U4AA 2H9YA 5BVGB 5LMCA 4XJXA 3GN2A 2WD8A 4N49A 3M9XA 4N40A 1YK0A 3NFYA 2COKA 1E3WA 1CK4A 1GGEA 2CZCA 4JX8A 4O1HA 1B6RA 2OV4A 2E5FA 3MTDA 3LV8A 4KSYA 5EZYB 2W22A 3RUPA 3UO8B 2AZ4A 5JSZB 4FNMA 5IVHA 2VK4A 4ZOLA 3G85A 4ZDJA 2PKXA 2C7BA 2RBGA 4MEBA 3ZIAA 4IRXA 1IXSB 1DHRA 1GLNA 1R12A 3G9ZA 2GZDA 1RWNA 2XZPA 3K31A 4H7EA 4BB6A 2O8BB 2QL7A 4MIOA 2G9ZA 1RI5A 2RHLA 4PRYA 1HEUA 4PSVA 1II0A 3RVRA 3IR7A 3LOPA 1SU7A 1PWHA 3H87A 1R6AA 4QNMA 5BR4A 3SZMA 2YTZA 5A0FA 4OBXA 1IBRA 4KYUA 1DHTA 4ND8B 2V6GA 3LDFA 1EAYA 5JMTA 3ZJTA 2P91A 2JFHA 2WTEA 2EZUA 4WLEA 5FI0B 1RYFA 1QIGA 2ZI9A 3F6SA 4RL6A 3RYIA 4D3DA 3R3JA 4UE2A 4P3NA 4CL8A 2O7VA 1XRNA 3THYA 3CBQA 3PX7A 5BOVA 4ZT6A 3PF9A 1QTQA 2GARA 1KVTA 3GNTA 3K2EA 1GD1O 4BCCA 1TDJA 2TMGA 5LKRA 2EX0A 1L5QA 2OHHA 4E32A 3FNGA 4R2HA 4Z4IA 5D5HA 3GUYA 4N8DA 4HAXA 2FX5A 1UPUA 2AG1A 4KQEA 5CDTA 5DTIA 2UUBB 2C3UA 2A8YA 2FRDA 3QOWA 4I66A 3GRKA 2UDPA 4NMXB 4QDTA 1XQ1A 5JSKA 4QDUA 3UT0A 2EZ8A 2G9RA 4BMPB 2XEXA 4GRAA 3ZE0B 2OZKA 5H4GA 2RDMA 5DIZA 4ZVOA 3RUIA 5FOQA 5I4IA 2R86A 1JKJA 1I2BA 2UVQA 2EW2A 1LNZA 1XEXB 2OBMA 3R0JA 5EQJB 3TOVA 4BLRA 4JXZA 3DPIA 1N7IA 1SO8A 1W1UA 3ZGNA 4QJ5A 3RGWS 5AW8A 2W37A 4BVKA 3OM1A 1T5TA 3OM9A 1YFZA 4PO8A 4PZYA 5BNFA 4EELA 4EY5A 5JNVA 2UYCA 1BC5A 1KERA 1I2CA 2BBOA 2ECQA 1SOUA 1XQYA 2PK3A 5COQA 5E3HA 4C78A 4ZCLA 4EG7A 5K0GA 8ADHA 4TTTS 2B8TA 2C3YA 4AJKA 3IALA 1OZGA 2PVPA 4LCJA 3T5CA 1G1MA 3A4TA 2G88A 3OZWA 3PSHA 4D8YA 4RTLA 4OX9Y 1B2LA 1Z83A 4LDAA 1TE2A 1Q83A 4QLAA 1ECPA 4B79A 3THWA 1GPKA 1XD2B 2ZUUA 3OP4A 4Z8YA 3QBJA 1MDBA 2NO0A 4I50A 3ZK7A 2LIPA 3WLTA 2ENWA 3R9XB 1LBEA 2NAPA 3U7JA 4N54A 1JEEA 2VHQA 3NWEA 1FOEB 3AL2A 1PVDA 3M6LA 4K7JA 2I6FA 2L17A 1YWGO 2GBPA 4GVPA 4MA0A 4D8VA 3CX4A 3JYHA 4H6PA 1D09A 4EL0A 2VK1A 1XPOA 1XK7A 1CUHA 4LE2A 3RADC 3P45A 4KDCA 2VTBA 2QNRA 1VLZA 3WSWA 5IW8A 2FEKA 5G0TA 2C8JA 1G8JA 3B7WA 4AURA 3GA0A 4PBRA 3DAHA 5ALZA 3KOUA 1FFXB 1UP7A 2P2CA 4KVFA 2QQ5A 1W85B 2CVPA 2ZIWB 3M7IA 3P9XA 4YDSA 3ROTA 4XCVA 4UOEA 4CI0B 2C1EA 2D4HA 3GWGA 4YQZA 2FG7C 1KOJA 2NU7B 3KR1A 4RVNA 1MRZA 2JHFA 5FV7A 1YQGA 2EBWA 3T8YA 3WQRA 3MJVA 4BV2A 2XDWA 3K92A 4PGFA 4UDYX 5FAKA 2CHVA 1ECLA 4OIMA 3WYGA 3FCXA 1OWMA 1Q0TA 2JFWA 2D59A 1MFPA 3GUZA 4KU4A 4E7PA 1P0PA 1OT3A 5KOJB 4C6TA 4C7KA 5G41A 1SHKA 1Z88A 1VE5A 2BHLA 4KEAA 2D7CA 4KZPA 3LWNA 1N6LA 1MNAA 5K7SA 1B3RA 5F35A 1JT2A 2DVMA 5IBPA 1XL0A 5CB4B 3VPGA 1KFKB 3R3YA 2HA5A 4EA7A 5AM0A 5YASA 3PQ5A 3HO6A 3VDQA 1NF2A 5JNTA 1JEJA 5LFAA 1KVQA 2JH9A 3PR1A 5ENZA 3VJLA 3Q7TA 1SUBA 2CT8A 2G63A 3W6NA 3N8NA 4EENA 1FA9A 4DMCA 4U7HA 4CG3A 1WLSA 5DHUA 3OC0A 1ECJA 3QUBA 2A33A 4M7RA 1GUZA 3BXEA 3OEYA 3R0IA 2O8DA 2HF9A 3X44A 3CC8A 3UQZA 3SHVA 5DRTA 4ND5A 1CNFA 3UMGA 2A92A 2R7NA 3JQPA 4YRNA 3MS2A 3T9EA 1AOXA 2I3BA 3NFRA 4G63A 1DC8A 4R9SA 1R4NA 3IEVA 3U7RA 1TZMA 1CJBA 3WWYA 3L93A 3VSBA 2ONJA 5B55A 5IZCA 3KIPA 4RK4A 3K6KA 2WR8A 3CQ9A 4KQWA 4O08A 3CVUA 1Z6XA 2NU9B 5HZGA 5IZCC 3KQOA 5D87A 2YXPX 5T4EA 3QKSB 4B2LA 1LDGA 1N2BA 4P53A 3KVYA 5IFKA 3C5VA 1ZHOA 4DADA 2X1MA 4OHCA 3E6AA 5LR6A 3KOZA 4MW1A 1W2WB 3IAS6 4RVCA 3NMUF 3DMYA 3QVVA 4AZ3A 2P9QA 4D82A 3TFOA 1SB8A 2CLHB 2QZJA 1M1YB 3MNFA 4QOIA 2BRUC 3AUSA 3C43A 1ZH8A 3AVUA 5FPHA 1SD1A 1MTOA 1BU8A 3D8NA 5IDVA 2OMKA 5JS7A 3UC5A 4PSCA 4LSMA 4B84A 1JLKA 5DXJA 3RWMB 1XZ8A 4DXHA 2IPMA 2D2VA 3LT1A 3OLYA 1UPFA 4IKOA 3HB9A 4LJ8A 3WFJA 5BMOA 5U4XA 2C5BA 4TYMA 3WSTA 2X6TA 5BY2A 3QXGA 3FOAA 3VZBA 2NVBA 2AR9A 1V3QE 4LJLA 3SYRA 1EB8A 3QQPA 5BN4A 1F8XA 5L3VA 4C88A 1KZ6A 1ZVQA 2EFJA 5HMLA 5H3HA 4YQEA 1Q1GA 4CR7A 4MCIA 2X3FA 2JARA 3GFRA 3GCZA 4IGIA 3AHIA 1TAGA 4P34A 4C4PA 1ZNQO 3KKNA 3H4IA 1G5IA 4CE6A 4CF4A 3AVXA 4DUYB 4BP1A 1U2GA 121PA 2N42A 5CCEA 2OP1A 3GCDA 1A2BA 1DTEA 2AXQA 2HTEA 2X4IA 2BR3A 2NPOA 1BXRA 3H1PA 3LC0A 2V4MA 3S44A 2DQZA 3VUEA 1Z5PA 5AFSA 3I9V1 4HWPA 1WTAA 4ALIA 1GM5A 4Z4FA 5I8PA 1JUDA 4CDMA 4ER0A 3QBVA 2W8ZA 1E2KA 2JHCA 4YDHB 5CA0F 1RXCA 1OJLA 4FZVA 1GP2A 4QDKA 3E2IA 1DT3A 3GW8A 3OT1B 1NA5A 3WAJA 1OHHD 1LV7A 1CY2A 3BQNB 3EZGA 3TR0A 3PWSA 3OZFA 2FPSA 1QYVA 1I0ZA 1Q3TA 2GN9A 2WM3A 1G291 5D3KA 3DEYX 2P2LA 4H2DA 1KAHA 4QFCA 1W6UA 1K0FA 1E9EA 4NONA 1P1KA 3M6XA 4HX2A 4TS9A 3KUDA 4HUQA 1YUBA 2FVXA 1WDLA 2ZR7A 3CWZA 2R79A 1NUPA 2QNBA 3AUJB 4ND6A 4PTLA 5AW9A 2FW8A 4YT4A 4BPBA 2CMDA 3WK4A 1NN5A 3OJEA 3EULA 5CB0A 4F4CA 3DPUA 4I81A 1B74A 4MQBA 2XUIA 5TVKA 5JISA 2Z4RA 1P7WA 3O03A 2FZWA 5AUOB 3K4HA 3HI6A 2VH1A 1IUOA 3EAGA 1E64A 1XVVA 4QUEA 3VKGA 2BGJA 1IYZA 3CXUA 5L7WA 3SJCA 1P39A 2ZYUX 1UL1X 2WNHA 3PP8A 4BO1A 4WZAB 4TUYB 3D4BA 3RG8A 2IQIA 3HXMA 1JHVA 4JVMA 1GPLA 4I5GA 3E35A 4R68A 4XQCA 4JA2A 3OJ0A 4FYKA 8ATCA 2IU0A 4PR0A 5JQGB 4YC7A 2AOTA 3JWPA 2P9GA 2VATA 5AK5A 5F51A 2HA7A 1ONBA 2PFSA 5LBUA 3WXBA 4CFYA 4PINA 2REXB 1MQ9A 1R8XA 2EFYA 3BFKA 4WOKA 2CXSA 3G7SA 4FFBB 4HNTA 2DCUA 3R6WA 4G89A 4GZMA 1LBTA 4HXYA 2Z08A 3PEEA 3ABOB 2RGGA 2I8LA 3DZHA 4DLYA 4E5PA 4YUZA 5KU7A 4PFJA 3OEWA 1KYYA 1KMHB 5K0EA 2A67A 2X1HA 4F60A 3EARA 2R9VA 4A8JB 1QV6A 3PXGA 1IJBA 1KTVA 1VRWA 3AQIA 2XAAA 3PEYA 5ADUS 2XIJA 1N6HA 3A32A 4MJ7A 4NQZA 2JFYA 2EP7A 1K5PA 2KX7A 5H8WA 2D2XA 1H05A 4FHCA 3HO8A 3LKZA 3UATA 3WC4A 3D4OA 3LC2O 2Y0BA 4EB3A 1NAIA 3CURA 4TSRA 3H0EA 2WV7A 5JZ9A 1V71A 1PSZA 5FI1B 3G6KA 2IA5A 4CGZA 2Z58A 2UAGA 1TU4A 2GJ8A 3DKVA 4J0QA 1BROA 2NSJA 2QDKA 4QE3A 4ZHQF 1ZN7A 2VT6A 3EMKA 4ARVA 3N2IA 5ED4A 3H8VA 3LPAA 1NX9A 1RPZA 3K0CC 2G6BA 3G2LA 3H1AA 2DPXA 4AMBA 2TYSB 2YMLA 3HDJA 2NVOA 5C1DA 5A03A 5CNKA 1EGQA 1ZD4A 1GNTA 1M34A 1PQ4A 4LNUA 2C2ZA 1A9YA 1YKSA 4F84A 1S3SA 1IATA 3K1TA 4C43A 4MJLA 4RFSB 1CHNA 2OESA 3KKKA 2FVYA 2J3KA 1AQLA 2V6MA 1Y1KE 3DLCA 2OMEA 1LJ8A 3FX2A 3IKLA 3LF1A 4Q1CA 3NEAA 4OXNA 1PZNA 4D3SA 4D92A 2FEWB 4FFSA 4CF6A 5SZHB 3A6ZA 4F7DA 2GHIA 1FCJA 1ZJ6A 2FPPB 4PHFA 5C8VA 1JGTA 4LY3A 2BFDB 2V8OA 3FPBA 3K9QO 2YICA 3LUCA 3COPA 3NXKA 4O0MA 5T8KA 1KSFX 2C00A 2I6UA 3QYAA 4PHCA 4FIZA 4O1IA 4UM8B 4E09A 3KSBC 3ONVA 3E9ZA 3OM0A 2DPGA 4Q7KA 5HX7A 3JD0A 1UPBA 1LS1A 3AR2A 3MAGA 4W99A 2QPAA 3CN7A 5I4CA 2EV9A 3SVZA 2RKWA 2Y1FA 3IUJA 3AL3A 2UYHA 2XQJA 2AN5A 3GJ8A 9ATCA 3FWNA 4MHSA 2QTVB 4JBXA 4KX3A 3KFXA 1DFGA 1USIA 2RHOA 2J07A 1BXGB 2TMYA 2ZUBA 2WZDA 4IH1A 4OUDA 4MW4A 1XZDA 1IH8A 3OT4A 3HFSA 3O92A 5IXYA 1JQJC 4OSOA 4UEKA 1AD2A 1BIFA 1RWVA 2I1VB 2VBIA 1RWWA 2GPTA 1V2GA 1J8MF 2Z30A 3FAZA 3ORSA 3I83A 1XNGA 3ZZ1A 4JVOA 1ZAKA 1PKXA 3ER6A 1NVVR 3MLEA 1IQ0A 4PQYA 3BDIA 3WICA 1FP4A 1TEHA 1UK8A 2VAVA 4PPGA 3IQIX 4UZSA 4Z9XA 5DN6A 4A4DA 1YRWA 2XKBA 2AEFA 2OG1A 3C16C 3IMFA 3FPJA 1KQPA 1LLCA 3OTGA 5F5XA 5FL7D 4MHTA 2YMMA 1PQYA 1M2EA 5LWHA 2PR7A 3IBSA 3VA7A 1VGQA 1KMMA 3FNBA 3JQGB 1W88B 4ABYA 4HAIA 1B4DA 2GB4A 3MWDB 1ESZA 1TW2A 4QJBA 2Q9UA 1Y4UA 2X0FA 4I4IA 1M2OA 4EHNA 2ICAA 1NDQA 4KACA 4AO8A 5U4QA 2Y1XA 2EKZA 3G5MA 4J49A 5JYEA 1AO0A 3GARA 4X8MA 2F3QA 4D3ZA 3RKRA 1CUCA 5D86A 3AG5A 1TPZA 2WVHA 3DNFA 3O3CA 2OFXA 4MIYA 3WGVA 4OGKA 1YBAA 1K7FB 3DE6X 4NICA 1NFQA 3EQ9A 2QQGA 2QG6A 3OM8A 3DEKA 3V3TA 1PEKE 4KQFA 2EGHA 1BQ4A 3ZVMA 3FCOA 5DBEX 1PG2A 5JASA 2HWYA 2I6XA 3L7IA 1YL5A 3AP3A 3P9YA 4M1MA 4ZAXA 3X1ZA 4X8OA 1SPXA 3NBAA 3U7EB 2SCUA 4HAUA 5TGTA 4RK7A 1TOAA 3U7HB 1JAYA 2XDAA 4GX2A 1L4HA 2VF5X 3PJFA 2YJ5A 3DB1A 2RGXA 4PGHA 2BY4A 1OLUB 3K0KA 3LP6A 3PPIA 2H57A 3I3SR 4E4TA 4KN6A 3F98A 3DWFA 4ZOBA 3D3JA 4EB6A 2R00C 3ADDA 4ZWNA 5KC9A 4W5OA 1IXKA 4QJ3A 4X66B 4NFLA 1GZ5A 1NGSA 3IUPA 2W2PA 2PSSA 1LC3A 3D3EA 4ZRNA 1NVBA 2YXDA 2JAQA 1DAGA 3S8EA 4UDNA 2R68A 1JLLB 3SF8B 2C5HA 4HLNA 3TJMA 1HI9A 1JG1A 2X1VA 1U8EA 2HZ7A 3ONDA 5CHEA 4GVXA 3GD7A 3L6OO 4LJYA 2V0GA 3U13A 4L22A 1I3NA 4D0NA 5ICMA 2JGEA 2C5GA 1D2MA 1WPQA 2ID4A 2NZ8A 2XNHA 1GV1A 4PXSA 4TL7A 5CT4A 1HWYA 5DNCA 1SN7A 3QXSA 4WCFA 3L41A 1U6KA 1MP0A 2C99A 4L7VA 1A7KA 1N7GA 2ZTUA 1M5RA 2FJ0A 2MCFA 2PSJA 4OHPA 1F0NA 3CNNA 1SQSA 1W0JD 1L5LA 3BCSA 1R15A 4EG4A 2CFIA 4EZEA 2PVCA 1OLXB 2R8PA 3V34A 1Z2DA 4KIWA 1W25A 1G3RA 4N01A 1QWSA 3AR4A 5HKLA 5EWLB 2C2OA 4E5YA 2JHAA 3EOAI 4MDHA 3NIBA 1NI4B 3HJUA 2VJAA 4XCXA 4JB3A 2JIOA 4F91B 2H0QA 3R0XA 1LSOA 2AOXA 3GAZA 2VHZA 5EJ5A 2DUWA 5BMVB 5LNK1 3O8RA 4Z4QA 3P97A 4IIXA 2EERA 4Z9YA 1R66A 3AF3A 3IKMB 3BHNA 4OM7A 3AVWA 2PEZA 3KKEA 4ME6A 4X95A 1QE5A 3BREA 3HBAA 4WMLA 3MT7A 5AM4A 2OUIA 5EYPA 5AD1A 1L4EA 2PO5A 4DA4A 3JU3A 3D54D 3SZ3A 3WKAA 5HEKA 5T4FA 3W05A 4YRCA 1NBME 3KR0A 1RXYA 4BMVA 2IPAB 2C57A 1Z6TA 3CR7A 2BJVA 5DM0A 5I7AA 1TGVA 3T9FA 5CLLA 2EATA 3C45A 4P2GA 2NMVA 4OL9A 4GKBA 3G5TA 4G01B 3L18A 3SR0A 5ARCA 4NCJA 4TVSA 1ZL2A 1VJGA 4IDEA 2OGSA 1U4NA 5H81A 3AQ4A 5JAMA 2O2SA 3BDVA 1E8DA 3LZCA 4O4LB 4DLTA 4TTSA 2Q6OA 5CXQA 4I5EA 4F2DA 5DHAA 1TU0A 2AFHE 1KRWA 2Z8YA 1P7CA 1JLMA 2VS1A 1RHJA 5H16A 4YRZA 4ZJYA 1WXQA 2JH3A 2JBAA 3A27A 2DWCA 2XZDA