4JZKA

Crystal structure of adenylate kinase of e. coli with adp/amp bound
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
214
structure length
214
Chain Sequence
b'MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase
publication title Crystal structure of E. Coli Adenylate kinase with ADP and AMP bound
rcsb
source organism Escherichia coli o104:h4
molecule tags Transferase
total genus 75
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2013-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jzkA00
1HA3A 4LYHA 2BEJA 3Q7QA 5CM8B 4W5WA 1R5BA 4RD6A 3PJRA 4RFSA 2C95A 1M34E 5KNCA 2IT1A 3TE6A 2IYQA 2JAQA 2KBFA 2QY9A 1BYUA 1K5GA 2REOA 2XTMA 3GCGA 1YZUA 4QRHA 4B73A 1G8PA 3Q5EA 1Q20A 4TL7A 2ZU6A 2NZ8A 3BD9A 1IHUA 2GCNA 2MMGA 1YE8A 3LX5A 5JRZA 2WM9B 2JLZA 2P3SA 4ZO4A 1KO5A 2H7VA 2WPDD 2ZE6A 3TVDA 5EE5B 3B1YA 5JS8A 4EQ6A 1CBUA 1Z6GA 2VEDA 4HZUB 2ZTSA 5KSOA 2HEIA 1VCOA 3AP2A 3LLUA 1N6IA 3CBQA 2EWWA 1XEFA 1DAKA 3TIFA 4DDUA 5IF9A 2GZHA 4G01B 1NF3A 2IF0A 1GKIA 4KCGA 3MWKA 5KOYA 4RZXA 1KI7A 2J0VA 1NN1A 2REXB 3L0OA 3QJYA 4HZUA 8OHMA 2XITA 1SXJB 1TADA 1VMAA 5CIWA 4EJSC 3K9GA 3ZS8A 1DAGA 2IW3A 4LOAA 3SOPA 3SJZA 2QAGB 2WKQA 3AP3A 4R71A 2QBYA 3MMPA 3DM9B 3O8DA 3B1WA 1KKMA 4HLCA 1HE8B 1YZNA 3W8RA 1LTQA 1CR4A 2EYQA 4L5BA 4GP7A 4HATA 3UK6A 5CB6A 5FBQB 1KJZA 4JVMA 3FVQA 4IEEA 4TTPA 4BFUA 5LD2C 4O2RA 2GXSA 2VP9A 2FPMA 2WIAA 3TUJC 4ERNA 1QHHB 2CCKA 2JLRA 4ARZA 1W0JA 3I32A 5KUTA 2IS1A 4TWZA 1KZ7B 3KKOA 3NBFA 4ZKEA 2FSGA 1BH2A 4QBIA 1WCV1 4C0AC 3ZLJA 3EA0A 4GNKA 1KMQA 1DADA 4BQSA 1SXJD 3U44B 1UEJA 1A5TA 2EWVA 5DNYB 2ASEA 4PXAA 2ZRGA 4KJZA 3RVBA 1VCNA 4AKIA 3LDAA 1U90A 1KI3A 5H70A 2IC5A 4C0LA 2O8BB 4TLDA 3ZYCA 4EPWA 2FNAA 3RS7A 4JSTA 4GOJA 3P4XA 4MRVA 2C98A 1DO2A 1N6PA 3K0SA 1QRAA 1YVDA 4GDFA 2ZM5A 1MABA 3ZDQA 3QI2A 4C3ZA 2IBMA 5E7JA 1FW6A 5LB4A 3V00A 1D9ZA 3KTAB 4DC9A 4QHTA 2UZ3A 2GEUA 4BGDA 3WYFA 4DCUA 3LXRA 3D3QA 5SZHB 4YLGA 1OXUA 3K9LA 2J45A 4CEIA 4XVRA 4A36A 2KBEA 4PC1A 4ZDKA 4XTCS 2R6CA 4YXWD 1XD8A 2QM8A 4K81B 3TQCA 1XX6A 2RGEA 2WWXA 2IYSA 3OE7A 4B3FX 5F9HA 5JI3E 1JR6A 4URWR 2X2FA 4D4MA 1G5RA 1OH8A 3JZMA 4Q9KA 3T06B 3ICQB 2HYIC 1EGAA 2W0MA 4R7ZA 1ZUHA 3SQXA 1FUKA 3Q9LA 3EPJA 1T91A 1UBEA 3MWLA 4DZZA 3TAUA 2N42A 1G3IA 2BBOA 3OE7D 5GJWC 5L3RA 4YQFA 1M7HA 5KHOC 4DJTA 1G41A 3EIQA 4X8LA 4TT3A 4Z54A 2CNWA 1KAGA 3A4MA 4M21A 3UMRA 4PC3A 3U60B 3IKJA 1MO3A 3SJCA 2WWGA 4JLVA 1FMLA 4BFWA 1KTVA 4TMWA 4JLNA 1W4AA 1XTQA 3FTQA 4WZBE 2G9NA 1IJFA 1CJTC 4PC2A 3WNBA 4QM6A 1M2OB 1Q1EA 3VR6A 4F4IA 2J7PA 1FZQA 4AG6A 4Q4HB 5LPNA 1LS6A 1SVOA 1QHSA 1SXJE 2OBNA 3P27A 4JYCA 1XFAA 4LBZA 3SEAA 1RE0A 4P33A 3WMFA 5FPSA 1NMXA 2B8TA 2QSZA 4OHZA 4ESVA 2CK3A 2DY1A 2J0UA 2VF7A 3GP8A 2HYDA 3GEIA 4C30A 3TK1A 4JLJA 5GVRA 1Y3AA 2VHCA 4RZUA 2J7PD 5FPTA 1XP8A 2ZRFA 2NO7A 3R20A 2F7SA 1XDBA 3K9NA 3HDTA 3EXAA 3I3SR 4D4KA 2ECKA 4AWXA 4CYMA 1CKEA 3EZ7A 4RSGA 2VIIA 1GG2A 1T0JB 3M0EA 3GMTA 4B47A 4PAOA 1IXSB 2CK3D 3SYNA 2GJSA 2HF8A 3KQHA 4R98A 4B2LA 2FDCA 1MRSA 2BCGY 5K8UA 3PEWA 3RWMB 1J70A 1G19A 1YHNA 1ESNA 4PPQA 4PO8A 1ZNXA 4QGFA 2V6IA 1NJFA 4TMZA 2OBMA 3VR3A 4LY6A 4C9BA 4MITA 3CRRA 5FI1B 3AVXA 2ZQ5A 4IOJA 4B75A 4C0SA 2PCJA 2ZAOA 2IK8A 1E2QA 2P6UA 2ZI4A 2TMKA 1ZAKA 4F92B 3DVLA 2REBA 3LW8A 2G1KA 3AQ4A 2O8DB 1O3YA 4LPKA 1XTJA 3U3MA 2A30A 2DWPA 4QHYA 1UF9A 1WQ1R 1AJEA 1JR3A 3DKVA 4IVPA 3QG5A 1GNQA 3WRXC 1P72A 4M22A 4ZCLA 3PR1A 2BBSA 1CJUC 3A36A 5CYOA 1HUQA 2VSXA 1PZNA 1IM2A 2ONKA 2PH1A 2YNMA 4OJQA 3EPHA 3AVVA 1XMSA 2IUTA 1G64A 5FTMA 1KK3A 4LHYA 1N6HA 1KI4A 4BEJA 3ZZUA 1E9SA 2G88A 4Q9HA 2O0KA 1JR3D 4I1UA 1JJVA 2ZSDA 4GMDA 1OT3A 2OXCA 1GNRA 1RW4A 1E3MA 4PTLA 2V55B 1S2MA 4NH0A 3PFIA 4I1OA 4AIIA 2JLVA 5IK2A 2YC2C 3HR7A 3I92A 4QGHA 4TTRA 3SS8A 4P4UA 2GRJA 2W2VA 1QBKC 2GBLA 4MKGA 5JEEA 1TU4A 3FHCB 1EFCA 1S0UA 3X1ZA 5F3WB 4BZQA 2AD1A 1N0VC 2BKEA 5JFGA 3RHFA 2IUSA 5KYKA 1LNZA 2ATXA 3QIAA 3GD7A 5IK2D 3ZD7A 3QOFA 1SZPA 1YZLA 2XGJA 1OPXA 1M6NA 3SZRA 4A8JC 4DB2A 4NYJQ 2YKGA 3I5YA 1ZD8A 2XOKA 3K0AA 4LPSA 1IY2A 4V0OA 5EE1A 3EX7C 2DFTA 3E2IA 1E2EA 1KI8A 1E2GA 3CX6A 3TSZA 2WWWA 3AVYA 4A2QA 2FWRA 1QG2A 4UNPA 4P0TA 1E2HA 1E79A 5DI3B 1Q1BA 1ZM4A 4NKRA 1A2KC 3RWOA 3RAPR 5D3MB 3DEFA 3TW8B 2EVWX 5BN5A 1UAAA 4KSBA 1YKSA 3CPJB 3FPAA 2OSBA 2GF9A 5E7MA 4FMDF 3VU9B 1PVOA 3T5GA 2PLFA 3L2OB 2ZJ2A 4BFVA 2QTFA 2H57A 2R6AA 1R7RA 2JLUA 3QXCA 3ZH9B 4PAQA 2VHUA 5JHHB 1E79D 1KSJA 3A8TA 3KFVA 3SFZA 2W6JD 5JLJA 4AKGA 3PQCA 1XCPA 4RY2A 5HE8A 2QN6A 1R0WA 2BJVA 2EFHB 4M53A 2D3WA 4NCNA 3TVTA 3AVWA 2YWEA 2ZVQX 1KO8A 3NIBA 3H84A 2C99A 4ZPXA 1ZNZA 1RJ9A 2Q3FA 1G3QA 1SKQA 4HB0A 4CT5A 1FX0B 4Z8XA 2NZJA 3ZJYA 1NSFA 4G5OA 3SQWA 2QEQA 2JJ1D 2PZGA 2ZSEA 5L3QA 4MKIA 3LW7A 2AFHE 4JBWA 1HV8A 2FSHA 4PQRA 1ZRHA 2G1JA 1CRPA 4BECA 3GQBA 4LJ6A 1L4YA 2B7CA 5CJPA 1G5TA 3OIYA 1RPZA 3U3OA 4OHYA 3SR0A 1AGPA 1NG1A 2QE7A 3BWDD 3CH5A 4KFUA 1D5CA 1ZM7A 4FCTA 2CBZA 1G18A 3A1WA 2C04A 2HJVA 3B5JA 3UG7A 1EFHA 4V0MA 1IXRC 1G8HA 3EZ9A 5FUWA 3THYB 4BPBA 2VH5R 3U7HB 2F9MA 2MSDB 4URUR 4O3MA 1BOFA 3U3JA 1KDOA 1VKJA 1XEXB 4HAWA 3KKMA 2QSYA 1S3GA 1VDZA 2KJQA 4YMWA 1KZGB 2VHQA 3THXB 2VP5A 2OFXA 1UDXA 4P31A 5KDLA 2GAAA 2QE7D 3THYA 3PV0A 2PZEA 5FPKA 3R8FA 1ETUA 1RFLA 4N3NA 3IGFA 1G7RA 4RFVA 2QNRA 4X8HA 1KO4A 2HV8A 1Z63A 2V1XA 3KJGA 3U7FB 1I4LD 1E2KA 2YWHA 3LA6A 2G3YA 4A0GA 1JECA 5DYGA 1SXJC 3THXA 5DISB 4Z1MA 4WOPA 5KPJA 1PUIA 2JEOA 2NO0A 3QBTA 4NHOA 2XJ9A 2GA8A 1IN7A 2QAGC 3K1JA 1O87A 1HT1E 3W34A 4B3DA 2BMDA 3K8YA 2OAP1 2CE7A 1D2MA 4MDEA 4A6XA 1XMJA 1OH5A 4BFZA 2BCJQ 2J46A 4NYIR 1IXZA 3FKQA 3TSWA 3QKUA 5JWOA 1U0JA 1II8A 4Z1MD 4AD8A 1QHGA 3LQRA 1I2MA 4OL0A 3FOZA 3LBNA 1NVUQ 5E3HA 5AUNB 3NC0C 1G6HA 5F9FA 1XPOA 5HKKA 2R2AA 3A4NA 3GJ4A 2BM1A 3Q85A 4JLKA 4FIDA 1NBME 3THOA 1AIPA 3I5XA 2WIBA 3WMGA 1NJGA 5GJBA 3Q3JB 1N6RA 3ONWA 4U00A 3NBZC 1X6VA 2CLSA 4ZI2A 5E95A 1R4AA 3GEEA 2QQ0A 1EFRA 3OFNA 4TTQA 3ZVLA 3DL0A 4JLOA 3FFBA 2LWIA 3CWZA 1E98A 1Q22A 1GRNA 3DDCA 3M1IA 4QBGB 3VKHA 1KDRA 4DDVA 2QU8A 3EW9A 2O8CA 4HLDA 3V4RA 2CJWA 5CLQA 5GJVC 1CR0A 1VHLA 4LHZA 1SKYB 2ZRHA 1IN5A 1EFRD 2CHGA 2FPKA 3UATA 2V54A 2BM0A 4LCBA 1G7CA 1LS1A 4HDCA 1LFDB 1AGRA 2O8EA 4NZYA 4DLXA 2GK7A 1MO4A 1JXMA 2FX3A 2GJKA 4FMCF 4V0NA 1GAJA 1XEWY 4W5JA 1KDPA 2AL7A 2PZFA 4KXFB 4GPTA 1Z3IX 1JALA 4LHWA 4DB4A 1ZC4A 2VQSA 1J99A 4LV8B 2XZOA 2V7QA 2CVFA 1WP9A 2ZI7A 2W6ID 2X2EA 4LZZA 3T1VA 2YOFA 1FFHA 2J3EA 2WZQA 4WXRA 3X1DA 4GOKA 3AB3A 3FGNA 3HP1A 4B74A 3AF1A 2QRZA 1OB5A 3T5DA 4II7A 1U81A 1W0KA 4TYYA 2B8WA 4B3CA 2V7QD 5F2EA 1IY1A 2A7QA 2E87A 2ZYWX 1TQ4A 3BERA 2QG6A 1P4SA 4KSCA 2BEKA 1YRAA 1G16A 3K70B 3FDIA 4DT1B 4OQLA 5B57C 3LD9A 1R5OA 4HLUA 3NEJA 1S4QA 2F1RA 2ODEA 4NYMQ 1SGWA 4KU4A 4XD7A 1KKLA 2OV2A 4Q48A 3CONA 2ZI3A 1HE1C 4D4JA 5FTJA 3W5JA 1DG1G 3ZZTA 1T5LA 2WKRA 3CX8A 2LCFA 5C2JB 3WMEA 3LLMA 2AFIE 1R8QA 2AR7A 2PEZA 2PL3A 2QTHA 2VHJA 5JECA 2VO1A 3RRZA 3C4JA 1R8SA 1YZGA 1ESMA 1XNJA 2A5JA 1FOEB 2FFQA 1NKSA 3H1TA 4Q4AB 4XD7D 1FNNA 3SHFA 3TQFA 3WNCA 3TKLA 1D2NA 3RS3A 2NPFA 2ZUDA 4LBVA 3I61A 1ZCBA 5LBIA 5FPYA 1HY3A 2I3BA 4QHSA 1OKKA 1KK0A 2F43A 1G5PA 1MKYA 3W6NA 3BH7A 2D74A 3QKRB 3IO3A 1KK2A 5CIQA 3OIVA 5JS7A 4QGGA 1TAGA 3IHLA 3T34A 3AEZA 3GPLA 1U0LA 1MRNA 4HUQA 4Q4LA 4DLUA 1P62B 3WP0A 2ZYUX 5FOUA 3U5ZB 3B13B 2QI9C 2OCBA 4HLQB 4JMPA 4M1YA 3UMFA 1JJ7A 2VP2A 3MJHA 4E5UA 4PAMA 1TQDA 4A15A 3SFVA 3BFXA 3LVRE 3I72A 2BJWA 1AS3A 4MRNA 1GL9B 1LY1A 3AVTA 1XCMA 1SVWA 2B92A 2CEAA 3K0EA 4A8JA 1FP7A 1Q1QA 2RHDA 1NVVQ 4KFTA 3OEHA 3KXLA 4IDNA 2D06A 3TRFA 4B3BA 4E07A 4P3YA 5KSZA 1SKYE 4DIDA 1RKBA 1QVAA 3ZZ0A 2HDNB 2Q9CA 4MYCA 1DAIA 3VAAA 2FSFA 4KYUA 3MUFA 2H16A 2QGNA 3HR8A 1UBCA 2ZRAA 4PPFA 4DWJA 5LDDC 2A2ZA 2ERYA 4NE2A 4G5RA 1K5DA 1TU3A 3CF0A 2ONJA 3A58B 2IUUA 5AJZA 1XF9A 3OEHD 4C4PA 2GBLC 3TGPA 2IX3A 2IS2A 4YC7A 2BOVA 3W8NA 1OFHA 2ZITA 4LRWA 5FR1A 2AN9A 2QT1A 4DVGA 2J5XA 1NLYA 1NN3A 4LJYA 3B9QA 3FMFA 1XEWX 3SC3A 5EJEA 1KAOA 2Z6VA 2ANBA 4A92A 4H1UA 5JMTA 1G9XA 2DHRA 1P2TA 4HDQB 3D6TB 4YMTA 4NYIQ 3X1XA 5FOXA 4KBFA 2QZ4A 2WBLC 3B1ZA 4G3XA 3GFPA 4JKYA 1IAQA 4MYUA 5FL7D 3ZGXA 1KJWA 5J40A 3BXZA 4JL8A 4OI2A 1QVRA 2Q9AA 2R6FA 3AVQA 2GVZC 3OESA 2IYZA 1DARA 2NO9A 3LY5A 2BMEA 5C1BA 2XSZA 3SBEA 2CDNA 2VL7A 4XVQA 1U99A 3PCRB 1NN0A 4IJMA 2GNOA 1Z6AA 3ZIAA 3DM5A 1HYQA 5A5GA 1SQ5A 2OILA 4LC1A 3TR0A 3QNUA 2JA1A 4Q7MB 3CRW1 3BFKA 1AK2A 1SVSA 3GJ5A 3CRQA 4A0RA 1GL6A 5EE0A 4PPNA 2XSZD 2OBLA 2Z4RA 4DCSA 4Q7JB 2J7KA 3ZIAD 3PXGA 4ZDIA 4BLRA 3BB1A 3L43A 2DFNA 1KY2A 1XPUA 1T4GA 1E6CA 3GFTA 1XU4A 3NBYC 2P5SA 2YJTD 4C0HA 5DHAA 4C0BA 4QNMA 2DB3A 4DDWA 2UVQA 4C0QC 4LJAA 1HH4A 4IW3B 4CEJB 1NL3A 2IHBA 1E2MA 1KIMA 4NTZA 1SXJA 4HAYA 2EFCB 2IXGA 1RYHA 2ZRJA 3HYRA 3BC1A 4WA7A 1J8YF 2AKYA 1YZKA 2V8OA 4U7DA 1QHYA 2WVJA 2ZR9A 2QAGA 4UJ5A 5EE9A 1W2GA 2ODBA 5J4HA 2ZREA 2FFBA 1EFTA 4M1KA 2IEYA 1BMFA 2ORIA 1KO7A 1NY6A 4NYJR 5JHGB 2J0QA 4Q9LA 4AKEA 1P61B 1KSGA 4XSHA 1F2TB 1XZQA 2W00A 1NN5A 1QHHA 3PEYA 4A6PA 3RNLA 1OXVA 3CF2A 1XPRA 1WB9A 1Q44A 4UJ3A 3I8SA 1T5IA 2YV5A 2D2FA 2QTVB 2PEYA 4XOIA 1TQ6A 2FFAA 2FPLA 3F5FA 3OEEA 4YDHB 1F2TA 1BMFD 1OLOA 3VKWA 3U44A 4P4TA 4YXWA 3R9WA 1T9HA 2E9SA 1G291 2G0TA 2IEZA 4EPXA 2O8BA 3ADDA 4YDSA 1OIVA 3MAAC 4PSKA 5FOTA 2VLIA 4OI1A 3OEED 1E99A 2VP6A 3E1SA 4LV5B 3QSYA 3L0IB 1AA9A 5BQ5A 1T8UA 5BN4A 2ZRCA 3PENA 4HAUA 4BZPA 2X19A 1S9DA 1ZYUA 3KL4A 3KTAA 3REGA 1ZM9A 1C4OA 1PJRA 1T3HA 2R65A 1D9XA 1H8HA 1KNQA 3GLIB 4Q19A 2WJGA 4D26A 1OW3B 5P21A 4XJXA 3MGCA 2JLSA 4QOSA 1TPZA 5CITA 2XX3A 4IXNA 1US8B 4Q4JB 1YZTA 2C03A 1AM4D 4A0FA 3W6PA 3K0FB 2P5TB 4W7SA 3VR5A 1A2BA 1P2UA 2RGXA 2XNDD 4A2WA 3QEJA 2IWRA 2ZUCA 1U8AA 3QG1A 4ITRC 4BLSA 2GXUA 2ODWA 1H8HD 2QT0A 3NH9A 5G3YA 3QENA 2IL1A 1GITA 2IXEA 4MYHA 2K5UA 3CNNA 2IHYA 1RRFA 4Q4JA 1I2DA 4JVSB 2G83A 3F0TA 4K46A 1U9IA 2CHVA 2QPTA 1GUAA 3A37A 3G82C 4EKDA 2XXAB 1DAEA 1VPLA 4H1VA 3FKSD 1JI0A 5AUOB 3AKCA 3NXSA 5JEDA 3WHKA 4F93B 3BH0A 3AGQA 2QORA 2HCJB 3SBDA 2VPPA 3SHWA 2OZEA 3QXSA 3W3AA 3KQLA 4LBWA 1Z0FA 5JWHA 3C15C 1B0UA 4AC9A 2R8RA 2I4IA 2IWHA 1TF2A 4FCVA 1A4RA 4KO8A 4GFDA 4NCJA 5G3ZA 4B6FA 4BRUA 3ZVMA 1X8JA 4QJ4A 4IDPA 4OBEA 3EZFA 2GK6A 4RKEA 2FGKA 1P2VA 4WXPA 1HURA 1Q57A 1W4BA 1WMSA 4M2LA 4CZ2A 721PA 3RSLA 4E22A 2DBYA 3KDSE 2DPXA 4A82A 3MSXA 4EPTA 3KUDA 2KB0A 1E9EA 4Q4HA 1GWNA 4TQAA 4PZYA 4BLTA 4EFMA 2FA9A 1CXZA 1P9RA 1XCGB 1M1YE 2H8KA 3EIEA 4L4UA 1Z2AA 4L9WA 3WY9A 2ZJ5A 4UQOA 1W36B 3AM1A 3EG5A 2IYLD 3CKLA 1JBKA 4EPRA 1GP2A 3GLFB 5JJIA 2W83A 4ZDWA 1VECA 2NQ2C 3KQKA 4M1WA 3BH6A 1OE0A 3AF3A 5D3QA 1BS1A 4MH0R 3CR7A 3GLHB 4Q1FA 4JT4A 4WZAE 5LB2A 5BXQC 5JCPA 1EXMA 2RH5A 4ON9A 4B48A 1TMKA 1ZIPA 4CF7A 3GLFA 1FP6A 2WJVA 3TMKA 2NTYC 2CL6X 1GTVA 2ZIAA 4HAXA 2F3TA 2OM2A 3ECCA 2PX3A 4IXMA 2GJ8A 5KO2A 4HLUC 3PEVA 3ETLA 1Z47A 3QPVA 3U7EB 2JGNA 4M9SA 4HB3A 3B1VA 4URYR 1OXSC 4D82A 4IDOA 3BE4A 5IRCD 1W36D 2WJJA 1VYTA 2YHSA 2Z83A 3UPUA 5DN6A 2OCPA 4JT2A 4D0NA 5TVKA 1NP6A 1G21E 2RGNA 3PUZA 2OUKA 5FBVB 2C5LA 1E9CA 2H18A 2BMFA 1QF9A 4CT4B 2ZI9A 2ZE5A 1OFIA 4AKHA 2O8DA 4DEYA 4TL9A 1YQTA 2VRWA 1CIPA 1COWA 1IN6A 2HLDD 3LWNA 2WWIA 2D7DA 1DAMA 1K8RA 2ZRLA 1B23P 3MCAA 3CB4A 5EE3A 1W44A 5DN6D 4OJKA 2FGJA 3LVQE 3AP1A 3GLIE 3ND9A 4LGMA 1RRPA 1CF4A 2FJUA 5CDFE 1XXHB 4GP6A 1C1YA 3O8CA 2JJ8A 5F98A 4F7WA 1ZD1A 2WWHA 1COWD 1AZTA 2OAQ1 2ZRKA 3ND8A 3U4QB 3PG5A 1KK1A 4BZXA 5GVSA 1M74A 3IPXA 5L8VA 1W1WA 2FF7A 3LX8A 4NDZA 1XXHA 1U98A 2OCAA 1S3SA 1IONA 2QQEA 2A5YB 2BVNA 4N0EA 2FU5C 4PSAA 1ZW6A 1N6KA 3AF0A 5EUMA 3D7MA 1E94E 1X1RA 2BWJA 4RD4A 4Q21A 4ACBA 2GETA 5IDVA 1GNPA 2QPOA 1A82A 2ZJZA 3NHAA 1ZCAA 1IQPA 4NPHA 3TNFA 1II0A 1YZQA 4DUGA 2W2XA 1UFQA 5E4FA 4NYMR 2GEDA 1T3LA 4CVNA 1JEEA 3EZ2A 3V4FA 3IEVA 3VX4A 4IEIA 1NBMA 2C8VA 3QVUA 4QJ3A 2W6JA 4BFTA 1M7GA 3KQNA 1KYIA 2RGCA 4LC0A 4KHZA 2KWIA 4WVFA 4O25A 3VMFA 2ZR7A 4DUGD 2B21A 4GRAA 4A1FA 4DKXA 2JLYA 1S1CA 2QM7A 3NHBA 3JZAA 4D0LB 2GHIA 1T6NA 3BIFA 3IBYA 5DI3A 4A0HA 1NIJA 3I1FA 3IIKA 4OYHA 4M1MA 5D3MA 4LJ8A 4D4LA 2IYUA 3PEUA 4RCYA 2QMOA 3W5IA 1NBMD 3NDPA 1CR2A 1XWIA 2ZS7A 1WBBA 2JJ1A 5GADl 3HU2A 3GLFE 3VU9A 4URZR 4V0KA 3GJ6A 1JQLB 5FOVA 4LSGA 1BO6A 2ZJYA 1DVRA 3KJHA 3GLHE 5JBQA 1A1VA 2GTPA 3H4MA 3QBVA 3B6EA 2PCLA 1G6OA 2AK2A 4HZIA 3ADKA 2F55A 1E69A 1XB2A 2PMDA 2VP4A 2NO1A 5TARA 4WIAA 4EJSB 3EARA 3BK7A 4OHWA 3VFDA 3UXMA 4PQYA 1OXTA 4DCTA 3RSOA 3P26A 2ZROA 3R9IA 1FX0A 2CCJA 3K09A 1G17A 1N5KA 3QKTA 2R62A 3LQQA 3ICEA 1RIFA 1CJVC 3CIOA 4QM7A 4V02A 5LD2B 4G5QA 2OLKA 2O8FB 1G4AE 1NVVR 1JQJC 1E0JA 1XBTA 4B3GA 1E1RA 2B7BA 2F1IA 5FTKA 1OH7A 3A1TA 3SYLA 3F8TA 4BFYA 2YOGA 4C0KA 1GRQA 2QL6A 1DELA 3TAHA 1K6MA 2VBCA 3BFVA 1JEDA 3GFOA 4V0LA 1PLLA 1Z0AA 5FFMA 3ADBA 4KFSA 5FOSA 2HF9A 1L8QA 1CJMA 2ZJAA 4Z51A 1D2EA 1OIXA 3SDZA 1Z6YA 4I99A 1XEXA 4BASA 1NMZA 4N1AA 4XH9B 1E1RD 1QG4A 1FTNA 1P7CA 3OZXA 1Z0KA 1XXHE 4MKFA 2Q9BA 4LV6A 3TUZC 4BWYA 5HCNA 3A1SA 1GIAA 2PBRA 2Q6TA 5H1YA 4URVR 4FI3C 1G20E 4TL6A 1R6BX 3RS0A 2HXYA 2MSCB 4L16A 1X1SA 3WHLA 4ZV4A 5JSZB 3L8YA 4OK5A 1VYUA 2FE4A 2ANCA 3FWYA 4PC7A 3RLFA 2QAJA 4DIEA 2XTNA 3C14C 1TL7C 1T3SA 3IDQA 1RYFA 3DMDA 2ZI5A 3OHMA 4Q7LA 1I4DD 3JVUA 2VSFA 3B9PA 4DLVA 5TV2A 2MMCA 1FL9A 1LF5A 4EPVA 1KI1A 2R6DA 4GL2A 3U3RA 3O47A 1XD2B 2QROA 1ZUIA 4IOMA 1LB1B 3CW2A 3IEUA 4OHVA 2EFGA 3FHOA 4HB4A 3UIEA 4ZIRB 1AKEA 2BIFA 1Q21A 1V5WA 3G5UA 3GJ8A 5KPDA 2P0EA 3FMOB 3NEYA 4JVNA 1W4RA 2ZRNA 1ZJ6A 4QBHA 3UG6A 3UKDA 4B32A 4Q47A 1XRJA 1GVNB 4B33A 3MWYW 5JI2E 3CX7A 4FINA 1W5TA 4U02A 1AQUA 1MR3F 1QZXA 2IS6A 1G8GA 2WWFA 1M8PA 3IPYA 1N2CE 2JLWA 1RZ3A 2GJAA 3EWSA 5DIFA 3NC1C 5BYKA 2NG1A 2W6IA 5AJWA 3T61A 1N6LA 2BBTA 2QENA 3AKDA 3LNCA 4QL3A 4ACAA 3KUCA 2RGBA 4NCHA 4BLPA 2Z0MA 4TMKA 5CK4A 4X8MA 2EQBA 5AK0A 1DS6A 821PA 1BKDR 1GZSA 1YJ5A 1KI2A 1N3BA 4BRWA 2Y8EA 4OI0A 3Q7PA 3QUSA 4FMDB 4LHXA 1TEXA 3C16C 2RGDA 1P6XA 4TYQA 3QKSB 1RC8A 3U6KA 4RD2A 3OAAA 1U9IC 5EXPA 1J90A 2D4HA 1L2TA 2ZS9A 3DZ8A 1UJ2A 3ADCA 1F2UB 4I4LA 1SULA 1TF5A 3LH5A 3KX2A 3RDPA 1T8TA 121PA 3AF2A 3T1OA 2JASA 3KJEA 3RABA 1ZMXA 4P4SB 1ZNYA 5AWFC 5HE9A 3OIUA 3R8CA 2J9RA 3UWKA 3OAAD 1YR8A 2XB2A 1Y63A 3KKQA 1Z8FA 5B2ZA 2X8AA 1UKVY 4ASUA 1DAFA 1N25A 2WJIA 3AKEA 4W9MC 4PANA 4FW9A 4IVRA 1DBSA 2XJ4A 1ZU4A 5KDOA 1HT2E 1FQKA 2DYKA 5JWRA 3CZPA 5FBLB 3RS2A 1CU1A 1KDTA 421PA 2ZUBA 1KNXA 3QF4B 4C2TA 1EK0A 5L3SB 1JPNA 1NLFA 2DWQA 4CGZA 2BHRA 4DT1A 3EIHA 1N0UA 4LJ5A 4GI7A 2ZJOA 4ASUD 1LVGA 3MLEA 1RVDA 2KE5A 4A4DA 4D2IA 5CM9C 1N5JA 1KHTA 3IQXA 3ZS9A 3HYTA 3SJBA 3ZVRA 1ANKA 3R7WB 3IUYA 3FFAA 4LDJA 1N5IA 4TLBA 2RHMA 3K70D 2FEMA 3DOEA 3QY0A 1AKYA 2W2TA 5KDDA 1NMYA 1W36C 3NWJA 1TF7A 4AYXA 1UPTA 1P5ZB 1KI6B 2EFDB 1ELOA 2XAUA 2NO6A 4Q4AA 3NG1A 1Z28A 1UBFA 2P6RA 4X8OA 5TXGA 4R2IA 1AS0A 5EZ5A 3AUYA 3W6OA 5DH9A 2WJYA 5HCIA 4JVLA 2QMEA 5C18A 2ZYTX 3OF5A 4FXPA 4UXIA 2WJHA 1NVWQ 1CEEA 1TQ2A 3QKRA 1R0YA 1X3SA 5FL3A 1RRGA 4I1VA 4FWIB 2AKAB 4Q5IA 1MO6A 3VTKA 3O8RA 3FB4A 4IFEA 3A1UA 5AJVB 2RGNC 3EWAA 2G6BA 2YC4C 3K53A 4PHHA 4UNNA 3VQTA 2YWFA 1U8ZA 3CF6R 4RZ2A 2CL0X 1E1QA 3CR8A 2FN4A 1Z2CA 3CNLA 1CRQA 4HB2A 2ZRDA 4DEXA 2C78A 3F3YA 2PJZA 3RC3A 1X86B 3TR5A 2GKSA 5EP1A 1Q3TA 2ZANA 2ZYVX 2JJ2A 1E9BA 1WE2A 4OKSA 4BLOA 2J1LA 2JDID 1DPFA 1E1QD 1Z08A 2WAYA 3PIRA 4TMTA 4C0JA 5BN3A 4M0LA 4JKIA 3R9XA 1EFUA 1NLZA 1TNDA 3W3ZB 4HDOB 4PO1A 2XZPA 3LBHA 4B3XA 5FL7A 4KITB 4BUJA 2CXXA 3EPKA 3KQUA 2C9OA 4RD1A 2JJ2D 1R5NA 2ZJBA 4E03A 4F4JA 4DDTA 1OXXK 5KNDA 3EZ6A 2CHQA 3SNHA 3ZQ6A 2ATVA 5EUQB 3O8BA 3RC8A 4PHTA 1QHIA 3S1AB 2GZDA 1KO1A 3JVVA 3TJZA 1HQYE 4O2LA 1IOZA 3SU8A 1P2SA 1UEIA 4FMCB 5EP4A 2ZU0C 4DRZA 3HJNA 2ZRBA 2A3RA 2N46A 2GDJA 2WOJA 1UDWA 3THWB 4EFNA 2I1VB 2GILA 1H8EA 1P9WA 4IHQA 4B2IA 4D80A 4AYTA 2GWHA 2V3CC 2OLJA 1EX7A 1UKZA 3DO6A 2XEXA 4L9SA 5DE3A 1GKYA 4MGZR 3C7KA 3N5CA 5KU1A 1E0AA 2CE2X 4Q66C 2ZR0A 4HSEA 4D6PA 1F60A 4RFSB 5EXXA 4QFMA 1TUIA 4JL6A 4CDGA 3CH4B 4C7OB 4I81A 4NONA 4MYTA 2X1VA 2WKPA 3KXKA 3GEHA 1H8ED 2O0HA 1L7VC 1V43A 3BB3A 2NPIA 5SZJA 3BORA 4UXHA 1FPMA 4HYYA 4PQFA 1XTSA 3RYTC 4JS0A 4C7OA 2CMKA 4OHXA 4EQ6B 4BFXA 2FOLA 4WZ6A 2P2LA 3T35A 4TQUS 4DSOA 4RZ3A 4D25A 1XTIA 3EA5A 5B30A 2PMKA 3VKGA 1TX4B 4YMSA 4AK9A 5M04A 1IJEA 2AK3A 2ZRIA 4JBYA 4LYFA 1SVIA 3E5HA 3BGWA 4AURA 1R10A 1A7JA 4TLEA 3LBIA 4LHVA 4EUNA 2VF8A 3LAWA 4PFSA 2QBYB 3QXJA 1FMJA 1UKEA 1WRBA 3K09C 4TMXA 2IYTA 5FI0B 4DLYA 4CEJA 3ZVNA 1D6JA 2EYUA 3WYGA 4ARZB 3BS4A 3QPWA 1TTTA 3K9HA 1VG8A 4P32A 1E9RA 3N70A 3FMPB 4PPGA 3TW4A 1LW7A 1GSIA 3NVAA 1ZUNB 1Z5ZA 1W2HA 3RS5A 4DLRA 2PX0A 2Q3MA 2HUPA 4IOKA 4MA4A 1G7TA 3T1TA 4XIGS 4RVCA 1LF0A 2HT6A 5TB5A 2G77B 2AX4A 2VYFA 4IOLA 4OQMA 1JNYA 4M4SA 4Q01A 4L15A 3HPRA 2WMNB 1W7AA 3LFUA 4EIWA 3BAFA 1OFTA 5DHFA 5C4MA 2QGZA 3U61B 3KXIA 2IYYA 3AVPA 4MRSA 1MABB 2IYXA 4GMXA 2XNSA 2ZE7A 5FBRB 3QPUA 1W0JD 4QJ5A 3KJIA 4K8OA 3IIJA 1Q1ZA 4JLMA 4Q1BA 3Q5DA 4JJKA 2O52A 2XNDA 1U94A 4TLAA 1YU9A 3W9YA 3LO5A 4D81A 2IYWA 1CLUA 2HT1A 4CEIB 1DAHA 1DTSA 1G8YA 3K0CC 2BV3A 3BOSA 4OQFA 2A78A 4LJ7A 2OEPA 1ZIOA 3EPLA 4Q18A 4PO9A 5FUYA 4XWKA 5AR1A 5FTNA 2VTKA 4LUCA 1ZU5A 4ZI3A 1E32A 2P65A 3FKSA 3WXMA 2VSOA 1ZNWA 4NU0A 1BYIA 1XJQA 4PZZA 3VX3A 3GLIA 2NMVA 1W5SA 2HJGA 5L3VA 5CDFA 4NMMA 1F5NA 4HI0E 3L82B 2YZ2A 3BRWD 4OI4A 1US8A 4B34A 1M7BA 5H68A 4AY2A 1OYYA 3K0FA 1N5LA 2Z5FA 3MRSA 4G1UC 2RGAA 1YR9A 5AJXA 3N2IA 3QXHA 2OO7A 1II9A 5KTYA 3SE0A 4TQ9A 2GVDC 5CYPA 3I73A 1J7KA 1KSFX 5J5CA 1W48A 4US0R 3L0SA 3L8ZA 4RD0A 4M1TA 2XXAA 5EXSA 3TLXA 4A2PA 4DSTA 4MGKR 2BDTA 5CJ2A 5FOWA 1GKUB 2GZAA 1KY3A 4Y0AA 4YMVA 4MRPA 4DCNA 4W5HA 4Q1EA 1GFIA 3KKNA 1N0WA 2PT7A 4BE7B 1R0XA 3WBJA 3SI7A 1OIWA 1GOTA 4S2EA 3WP1B 5J4VA 4AYWA 3U7GA 1GL7A 2CLCX 2GAOA 1E2LA 1P9NA 4RJLA 1NNEA 4M9QA 4LBYA 1DOAA 2IF2A 4ZDJA 5JCZA 2WTUA 5HR5A 1KSHA 3UWOA 4G5SA 4NL4H 3NDBB 1HTWA 1E4YA 1QHXA 2J0UB 3HWSA 4G0NA 3RRMA 3VHXA 4TT3D 4MUAA 4PZLA 5DI9A 2CNWD 2FEOA 2OFWA 4CEHB 3CUEF 4F38A 4B43A 2W58A 1U0HC 2JIZA 2JATA 4OQNA 4PC6A 3WNDA 4BFSA 2WWYA 4EDHA 4F4CA 5ELXA 3P1JA 2JCSA 2KI5A 4NCKA 4CEHA 1NSTA 4CW7A 4WW0A 3REFA 4NCIA 1XMIA 5AUPB 1SHZA 3PUVA 4US2R 3GLHA 2NGRA 4BLQA 2H5EA 2QP3A 1OYWA 3CPHA 2JIZD 2GF0A 5SZIA 2C77A 2BMJA 2GJ9A 2IYVA 3J81k 2ZVPX 1WXQA 2ZEJA 5CK5A 2HLDA 3M4YA 3K70C 2DFLA 4XWOA 1CP2A 3AUXA 4JLAA 3T1QA 3AF4A 5AUQA 4IDHA 5FPHA 2WMOB 5A0FA 4LJ9A 4PHGA 5FUVA 4LJ4A 3T12A 4YMUA 4LYAA 1AQYA 1DG3A 2ERXA 2ZS8A 3SN6A 2KSQA 2DCUA 5BWMA 5AJYA 2D2EA 3CPEA 1ODFA 1UKYA 4DXAA 1E9FA 1Z0JA 1FUUA 3GJ7A 5J47A 5B58C 4PSVA 3PUWA 4TMVA 1S1MA 2YWGA 4IFBA 2UZIR 1XJ0A 4KVAA 5IT5A 1PLKA 2NIPA 1R0ZA 5K8TA 2P67A 2WV9A 3PUXA 1VCMA 1NG9A 3A1VA 3NKVA 1U8YA 5DYIA 4EAQA 1X8KA 2O5VA 2SHKA 3NBXX 5FBWB 4FD2A 2V1UA 1DO0A 2FSIA 4HAZA 1ONBA 2ZI6A 3UANA 4ABYA 4XSGA 3KFXA 2DWOA 4ILEA 2GXQA 1QDEA 1BIFA 4XWAA 1LV7A 2CL7X 5KSPA 3ZQJA 3DHWC 4US1R 4H9GA 1G8FA 1G3MA 3U4QA 4UNQA 5B64A 2A9KA 4AI6A 4R2HA 3AVUA 2QP9X 3FE2A 3Q8XB 4B2PA 2JLQA 2X77A 1KOFA 2IYRA 2AWNA 2PJRA 1EX6A 3PITA 1OH6A 3Q72A 4S35A 4Y0VA 5K8LA 3FHTA 2H1LA 2MSEB 2PT5A 221PA 2QMHA 4GOXA 2OCYC 2FFHA 3CWQA 3K0AB 1J2JA 5K8IA 4RD3A 2ZRPA 1ZINA 2D62A 3AGPA 4DCVA 1G1MA 2FMXA 2HXSA 1FNMA 1KI9A 4YONB 5BW8A 3X1YA 5FR2A 1SVMA 2R44A 3G0HA 3B78A 4JJZA 3I4LA 3HU1A 1YR6A 2ZXUA 3IHWA 5EP3A 3AVOA 4QBFA 4DHEA 4IRUB 1Q0UA 3LV8A 2P6NA 5FUXA 4FMBB 3LRPA 1S96A 4GSYA 1VIYA 1R2QA 1XTRA 3FMIA 4QXAA 1CJKC 1MT0A 4LX0A 2A5GA 5KNBA 1AZSC 5C46F 2NOAA 2XOKD 4DLZA 2ZSBA 4Q7KA 4IDQA 3UMSA 2EFEB 621PA 4ZCIA 3KB2A 1WDTA 5DO9A 1H65A 2J0SA 1KJYA 2WAXA 3ASZA 3C5HA 3DPUA 3HPQA 1QHNA 3FYHA 1RJ9B 4DLTA 4A9AA 5TY0A 1JAIA 4EFLA 1JXOA 4HAVA 2RAPA 1JB1A 1W4CA 3U6BA 2FZLA 4FCWA 3MJRA 5L3QB 4M1SA 2FG5A 4EJSA 4GBMA 2ZSAA 3B82A 1W47A 1FQJA 4MGYR 1E2NA 1CS4C 4AG5A 2ZJ8A 2LKDA 2FH5B 1UBGA 2QUZA 3CRVA 3GJ3A 1OB2A 5DGXA 1NY5A 1E0KA 2E1RA 2Q21A 4QG7A 3VR2A 2B6HA 1JR3E 1P75A 4NBSA 2CCGA 2RGGA 1N6NA 1SVLA 1UADA 1VCIA 4TL8A 5HPYB 1S8FA 3B85A 1NKTA 2O8FA 1MO5A 5E7IA 4IVQA 3VR1A 4D0GA 3TBKA 3T15A 2QRNA 4MUBA 3M6AA 5GJCA 4CRWB 3H86A 1E2DA 3CNOA 4B71A 2YINC 1NRJB 1YR7A 3RRNA 4B35A 4QKQA 2W0SA 3H2YA 4L8GA 3BBPA 2C9YA 5G41A 5JRJA 5G53C 2A5DA 1E4VA 4KVGA 2WSMA 1GM5A 3P32A 3H0KA 4LK2A 5HTKA 5J4LA 2V6JA 3U2QA 3V9PA 3PUYA 2J41A 3SYKA 4CIDA 3C5CA 4JLBA 1Z29A 1DE0A 2I1QA 1U2RA 2F3RA 2GCOB 3DMNA 3K0CA 2F1HA 2J59A 1N6OA 1ZM3A 2XZLA 4PR0A 4DLWA 3W90A 3GLGB 2ORVA 3TSOA 2V9PA 1Z6TA 4Q1DA 3GJXC 1II8B 4ZCMA 2QPAA 6Q21A 5JSZA 3PVSA 2GCOA 2ZE8A 4KI0A 3E70C 2AXPA 3GLGA 3X2SA 5H8WA 4Z8YA 1I4TD 3WYAA 2BKUA 2XTZA 4NP6A 4Q9IA 3D8BA 1WF3A 3C41J 5CB8A 4RKFA 3CRMA 1MV5A 2ZRMA 3EASA 1IY0A 1D8TA 1XD2A 2C96A 1AN0A 2Z43A 2R6GA 2ZPTX 2YVUA 3P4YA 4EPYA 4ZIRA 2O0JA 5HZKA 3A6PC 5J4YA 3VNVA 1J8MF 3AV0B 1E96A 3VHLB 2C2HA 3QE0A 1IN4A 2RB4A 1GDDA 2O8CB 4Q9JA 1XJCA 3BJIC 2CJWB 1Z07A 2PLRA 3D31A 4O0MA 4TYNA 5DSZA 4KFRA 5HKKD 1VHTA 1AS2A 3IQWA 1KGDA 5HZHA 4XTRA 4Q1AA 1VG1A 2Z4SA 4V03A 4KODA 3CZQA 2BC9A 2IS4A 5EXTA 4DSUA 2F1JA 1GRRA 2JLXA 2OE2A 1X8LA 1TEVA 1YRBA 2O8EB 1VYVA 1Z0DA 1E2FA 521PA 5EZ6B 1OF1A 4M1OA 3OFND 1Z0IA 2YYZA 3IIMA 2D7CA 3HU3A 1TUEA 4TLCA 1G7SA 1VTKA 2WHXA 1Q3HA 3KZ1E 3C8UA 3ASYA 4GZLA 4OQXA 4KBGA 3EC1A 5UKDA 2ZSFA 3QXXA 4Q03A 1F3OA 4KLZA 1HEIA 4UKDA 5CLLA 1VG0B 1P60A 5J4KA 3QKSA 4TYPA 1OV4A 2LKCA 4UNRA 4FWTA 3B1XA 2IA5A 1PLJA 4B6EA 2ZETA 1MOZA 3B2EA 1F2UA 2VA8A 2G0NA 4GT1A 1Z83A 3CO5A 2GESA 3I62A 1G3RA 4ZKDA 1RRCA 5BYJA 1E9DA 2OT3B 2RCNA 2R9VA 1E9AA 3QF7A 3P20A 4Q1CA 2XB4A 2QP4A 4QC2A 1E0SA 4P4SA 4V0ME 2OESA 2ORWA 3RRYA 4C2UA 2CVHA 4JL5A 4MKHA 1UM8A 3QQ5A 4UNSA 1PUJA 5TDHA 3DZDA 5ANRB 3GJ0A 1IBRA 4RCZA 4DLSA 2HCBA 1C9KA 1ZM2A 4PX9A 5G40A 3EC2A 1WA5A 3RS4A 2OFOA 1P73A 1T0HB 4JIMA 4OK3A 3VR4A 3QF4A 5L3SA 2DFKB 2FZ4A 4M9XA 1VG9B 5JZVA 1W0KD 1L4UA 1Q12A 2OG2A 4PHFA 5SZKB 3OIWA 4TN1A 4BEBA 3IO5A 4G5GA 3NTUA 1XTKA 2WSSA 3TUIC 4B44A 3L0PA 1JAHA 3CLVA 3KKPA 5DLQC 4TYWA 3R7WA 3GLGE 1HQCA 1W49A 4WBSA 5FTLA 4KLNA 1F48A 2F43B 4IKEA 4QNRA 1DEKA 2L0XA 3X1WA 1XZPA 4M8NE 4DSNA 1WBDA 2CLDX 3EAQA 1PV4A 2OHFA 3U3KA 2F6RA 2GCPA 1KI6A 4JBXA 4QGAA 3WRYC 1NI3A 3VNUA 1EWQA 1KMHB 3DKPA 3QEOA 4POAA 1E2JA 1W46A 2DR3A 2AXNA 2WSSD 2BBWA 3MWJA 4HUQB 4HUTA 2EU8A 2N1BA 4DBLC 2ZAMA 5C4GB 4TZ0A 1ZBDA 4MQBA 4F91B 3RANA 2JDIA 4JSYA 1OSNA 1KMHA 1EESA 1Z22A 2FV8A 3B60A 3B8HA 2WICA 5EQTA 1S9HA 2OXRA 1E2PA 1NVXQ 2H17A 4FN5A 2H92A 2RMKA 4ESHA 3IILA 1FTSA 1CTQA 3DOFA 3MD0A 1OKKD 4HEJA 3BB4A 3B7GA 3TH5A 4A8JB 4JLPA 1MH1A 1VIAA 4M9ZA 3ZD6A 4URXR 1XD9A 2AD5A 1SVKA 3I8XA 3SJAA 3LXXA 2V4ZA 3A4LA 1G4UR 1XMVA 1CR1A 1OHHA 1E2IA 2VP0A 4KYIB 3CM0A 4U5XA 2QMUA 5JJKA 4LWZA 1CULC 5IHPA 5JJLA 4MDFA 3QVVA 4JZKA 4GZMA 3AH8A 3KB1A 2VHTA 1NIPA 4LYJA 1EWRA 1Z6XA 4E09A 1G3UA 1GILA 1ZVQA 2WOOA 5TMPA 2GXAA 3NH6A 4UXJA 4N0DA 1OHHD 1P3JA 1F6BA 2Q3HA 4XVUA 4Q02A 3MG9A 4TSFA 1OFUX 2J87A 2AWOA 3WBKA 4Q00A 1ZC3A 2AHOA 3MFYA 4J0QA 4LI0A 2Q0HA 1OJLA 3AKYA 3N2EA 3S1AA 5A4JA 1ZP6A 1Z06A 3IBGA 2F9LA 1EG7A 4OK6A 2GEVA 4B76A 1ZD9A 1IN8A 5KSYA 2ODNA 2RKOA 4JYBA 4R9UC 4KAXA 2C9CA 4TSFD 4MRRA 4WAUA 4MGIR 2YOHA 3THWA 2IXFA 4I1SA 1JPJA 4JLDA 2A5FA 2EW1A 2QA5A 4KV9A 5EP2A 1SHKA 5FH9A 2UKDA 4TZ6A 2WPDA
chains in the Genus database with same CATH superfamily
3H11A 1FE8A 3IAS1 2O9JA 3IVAA 5CM8B 2VUUA 3PJRA 2HDOA 4GLBA 2IODA 1E1DA 1M34E 2GD2A 3KBBA 1V47A 4K1XA 5KNCA 2IYQA 1VA5A 3RADC 4BX9A 1BYUA 2XTMA 4B73A 4DADA 1YZUA 3KT6A 2GYUA 3FZNA 3Q8KA 1KEPA 3OWHA 3ITEA 1T6BY 5AHXA 1WOMA 2NZ8A 5JD5A 5LKAA 2GCNA 2MMGA 2BCEA 4A1OA 1RPTA 4D57A 5JRZA 3OMWA 5CLJA 1ZH2A 3CVYA 1K63A 1WZNA 2ZE6A 1HTBA 1U7TA 2QJFA 1JHZA 3VZCA 5EE5B 1JPVA 3R6DA 2Z8ZA 3F97A 2YFQA 1XVIA 3UA4A 2ZTSA 1ZRMA 4TXJA 4YLEA 2H2HA 4F2HA 1XKTA 5DM1A 2Q3JA 1JA9A 1XN1A 5BV1A 1IVNA 1QS0B 4WK0B 4QDKA 1NF3A 2BFPA 1GKIA 2SNIE 2VH1A 3ECSA 4H27A 1VM6A 2H2IA 2ZB7A 1YQDA 4RQUA 4RZXA 5KOYA 4Z4GA 1NN1A 3ELDA 1R6DA 4RHUA 2JBAA 2QRVB 2V9CA 2XITA 4Y8VA 1LTHR 1TADA 5HF8A 1TLFA 1DQRA 1I30A 3DGFC 3JQQA 3BWVA 3K9GA 4XDZA 4COOA 1U0TA 1ZK4A 3SJZA 5BWBA 4HNQA 5J2UB 2QAGB 4P0PB 4LECA 1QONA 1CQZA 1ULAA 5F5LA 1KKMA 3DE5X 2V9ZA 4JI0B 3ICWA 3SEQA 4L5BA 3ID6C 2NV0A 2VPZA 1O95D 4O2RA 4OY3A 2WIAA 3R3SA 2YBDA 1WIWA 4EKYA 1QHHB 4I3HA 3ZJ4A 5JY1A 3DBRB 4LKOA 2HA0A 1UODA 4JUIA 4DV1B 3KQLA 3ZJUA 1VLVA 3NGLA 4DM3A 2XQGA 1BGXT 3K8OE 3SC2B 2P5UA 4C4XA 2CYCA 3HGQA 4EEKA 1ZN2A 1ZMRA 2FSGA 1BH2A 4OJNA 1PX0A 1WCV1 4C76A 5MN5A 3ZLJA 3WZMA 3IXMA 4TROA 2VQFB 4MUMA 1UEJA 2QZJA 1X70A 2EWVA 4PXAA 4B09A 2DLNA 2IH2A 1K97A 4PYQA 2HZBA 3D7LA 4AKIA 3LDAA 3D8UA 1UBMS 2FZ5A 3GW8A 1ZKDA 5T64A 4C4ZA 4E5SA 1TVCA 3W6ZA 1OZGA 3CURA 1G8MA 2O8BB 1RU3A 2JGIA 3ZYCA 1NJ2A 4WLVA 4GOJA 1SC6A 1ML3A 5AP9A 4MRVA 2D0DA 4H59A 4GLFA 4QODA 5K3FB 5SY9A 2H1HA 5IC4A 1DL5A 1W5AA 2GZ1A 1DBQA 1E62A 4LQLA 1KPHA 4K03A 5DEOA 4GDFA 3UAVA 2R00A 3QI2A 1PS0A 2PZJA 1C9JA 2IBMA 2WWRA 4UDOA 3SSAA 5TF0A 3IAM6 2XCQA 3O26A 5KB3A 3V00A 4P80A 3N2ZB 4AJJA 4DC9A 2EKLA 5K51A 2V6GA 2GEUA 4BGDA 3WYFA 1W6RA 1AX9A 1ZIYA 3D3QA 3LXRA 1TIPA 4YLGA 4KPEC 4YJFB 5BRNA 2Q50A 1U1CA 3A26A 4ZK6A 4CEIA 1Z6PA 2BKVA 5I8WA 4YREA 1CQPA 3QMPA 3RT7A 4YXWD 1PGJA 2FRXA 3W4JA 2REQB 3DE3X 4QO7A 2YXPX 3IOCA 1XX6A 3IMEA 2RGEA 2WWXA 2ZZNA 4B3FX 4WKGA 4RTPA 1LPPA 1I24A 2EFJA 4JFRA 4LZWA 4URWR 2X2FA 4L2IB 4Y9RA 1G5RA 4AN4A 2BHSA 5JD4A 1OH8A 3KZMA 2W11A 1OZFA 3CLHA 3NAMA 1U3TA 2IRWA 3DPSA 4C4TA 1VKRA 2HYIC 4MUIA 4KQFA 1EGAA 1H9BA 1Q2UA 2W0MA 3DZJA 1P2BA 2PMWB 1K6EA 3BSFA 1VL5A 1FUKA 3EPJA 2B4TO 1P2GA 1WY5A 1QX4A 1J9ZA 2WMYA 2N42A 2G67A 1A4IA 4ZEOA 3BXEA 3TAUA 1RMTA 5CD9A 4U2DA 1M10A 1A8IA 1I8TA 2BEUA 5L3RA 5FWAA 1M7HA 4J16A 1MXHA 5KHOC 4MAMA 2VKQA 3FOBA 4PLYA 4KK3A 1Y80A 4Y9UA 5FWYA 2I2CA 4PRKA 4ZVUA 2DHQA 2P4SA 3W2FA 4TRMA 4TT3A 1H0KA 2XGOA 2CXRA 3SF0A 3U1BA 2VZ8A 1J21A 4KQ9A 4ZREA 3UMRA 3ZBPA 3HDHA 1T1RA 1G8JA 1Z34A 2P30A 1J2RA 3EF0A 4IH9A 4M6WA 4U1RA 3HSYA 2H0AA 1KTVA 1TO6A 2WAAA 3HN6A 3NVMB 5KYTA 1X1AA 2G9NA 1IJFA 1QPBA 4WADA 5CCEA 4OVKA 3TNLA 4F4IA 1Y3IA 3WSWA 3OX2A 3QMVA 1CETA 1J42A 1R0RE 3CZ5A 5LUBA 4G1BA 3SZ3A 4AG6A 5EJIA 5SV2A 2Z6UA 3CLRD 4CMJA 5ER6A 3H2JA 2AG6A 1P0IA 1DBIA 2LPMA 2OZLA 3A4YA 3L8DA 1O97D 3P27A 2JKZA 2QN9A 5HBRA 3WDSA 4B4VA 1V1MB 3S2UA 1MX1A 5FPSA 4YJ2A 4LHEA 3N86A 4QAJA 2IV3A 4C03A 4YNBA 1B6GA 4TTIA 1WPRA 3GP8A 3VR6D 4J6EA 4DV7B 3W5CA 1W8DA 4S12A 1ZIDA 2VHCA 3AIIA 1U04A 3C5EA 1H6CA 1X80A 3CMMA 4ARUA 3P96A 1BXKA 2INGX 4NZMA 1XDBA 3GK3A 1NUPA 1Y37A 2PPLA 3HDTA 3K9NA 1GSHA 4D4KA 3BX1A 5JY6A 2ADMA 4BNVA 1CKEA 1BFUA 2FWIA 2Z08A 3EXFB 4BZZA 3O5AA 1XVUA 1P19A 4MDHA 4W9RA 1TKAA 4HK4A 5CBPA 4DV0B 5JT1A 1L4GA 5H81A 2X40A 1P81A 5CT5A 2SKCA 4LG1A 3HVJA 3X1JA 3KQHA 4R98A 4B2LA 5HK9A 3DSRA 4J7AA 4H7FA 3LPDA 4MW5A 3RWMB 3MUOA 4IH4A 3QLEA 3ZHSA 1G19A 1UJMA 1ESNA 3BPSA 1T6ZA 4AT1A 3O2QB 5I4KA 2PUAA 3KHUA 5HQTA 1PT6A 3ZNOA 3VR3A 1ZX1A 5FI1B 5JDCC 3AVXA 2XVXA 2ZQ5A 5DTIA 3AW8A 4BLVA 4C0SA 4O4LB 3EHEA 1E2QA 4KO2S 5I7OA 2ZI4A 4N41A 4CDMA 3FD8A 3PC8A 3LW8A 1KZ6A 1RQPA 2O8DB 1PZFA 2EW8A 3U3MA 4EI8A 2A30A 3A7DA 1PR5A 1Y98A 2QJOA 1MB0A 2RIPA 4NMLA 3URMA 1B8OA 3V6LA 4UMFA 3PD0A 1PT9A 1YUMA 2FWNA 4ZCLA 1NDUA 4I9NA 3S28A 4HQNA 1L5NA 1HNZB 3VO8A 3A36A 5CYOA 2WTNA 4KR6A 1XZBA 3CFYA 4YASA 1IM2A 2PH1A 2YNMA 4W5TA 3KALA 4QYIA 1LK7A 3EPHA 1X9HA 2PX6A 1XMSA 2EG9A 2IUTA 1GPKA 3N8HA 3R4CA 1U2EA 1U80A 1A98A 2W70A 2Y0EA 3EY9A 2UV8A 1RKUA 1YQEA 1E9SA 4J94A 1TUBB 3EDOA 4Q9HA 4Y1RB 3FPKA 4PONA 1TCUA 1JJVA 2HU2A 3HRIA 1X2EA 3FHJA 1GNRA 5LYJF 1VLZA 3QGMA 4NH0A 3IH5A 4I1OA 2QR3A 4RXTA 2DLCX 2HK7A 4P36A 2JLVA 2XDWA 1XC7A 3N8NA 3C3AA 1BEZA 1KEWA 2O2XA 4KL8S 1U2GA 4EFDA 5EJ8A 2GRJA 3EFEA 5ICCA 4WJKB 4RSMA 4BGVA 2ZCJA 3H7IA 3DFIA 5JEEA 4TUYB 1EFCA 2AMLA 2JIRA 4BZQA 4CM1A 1XQXA 2R86A 3AERB 4KBYA 2BKEA 5DRTA 5BV0A 3RHFA 1VQ1A 3HO6A 4QEKA 3HTXA 4FB4A 4MROA 3DBOB 3LT4A 5IK2D 3MUEA 1U2TA 1SZPA 1DXOA 3LT0A 4GDMA 1YZLA 4C14A 5ARBA 5HILA 4K7JA 1DCTA 2XWBF 5HMMA 4RDIA 2I9PA 3VH3A 3O9ZA 4A8JC 4CBVA 2AEEA 3IVXA 3GL9A 5JATA 4DB2A 4R8MA 2KHZA 5C37A 2VHWA 2II6A 4UVDA 5KTSA 5L7TA 2QTZA 4Z9AA 2PYZA 1IY2A 1VBFA 2R6HA 1EVLA 2DFTA 4AZ3A 4DCCA 2X4IA 3D5TA 2O5RA 3UT6A 2PD4A 3FGZA 2OPBA 4UNPA 4U3JB 3DFMA 3TEMA 1YHZA 4GX2A 1E2HA 5E1DA 5C35A 5JC8A 1ZXBA 1Q1BA 3OQNA 1ZM4A 2Q1TA 3HY4A 1DKRA 4K2HA 4NKRA 5ALEA 3RAPR 3RWOA 3WKCA 4TVBA 3A1DA 4WY2A 1E6WA 4HDMB 5BORA 4MS4B 3CPJB 2FRVA 2ZT7A 2A0YA 2OGUA 4ND5A 1DKNA 4TM7A 2QIOA 2C2XA 4CNBA 3VU9B 1PVOA 5CA1A 2J8ZA 1ZSVA 3NEPX 1T1JA 5H3HA 4IAOA 4KQJA 3UGJA 2FPOA 3OZIA 2I66A 3NTVA 4AJLA 1E79D 1ZH0A 3A8TA 5AD1A 4DV5B 5DVZA 5BVHB 2D5IA 2WV7A 3PNVA 4KNYA 4LOKA 2QW8A 1ZUD1 3EEBA 4W1SA 5DK6A 1FIUA 1CW2B 3GUUA 1YBVA 2RGYA 3AR9A 4KV7A 5FAXA 3AEXA 1O6FA 5L51A 3TVTA 1YZFA 5H3CA 3WE7A 4AZVA 2C99A 2QYHA 4ZPXA 5DMXA 4BGUA 1ZNZA 3LHSA 1RJ9A 2R8ZA 2AYYA 1OR8A 1T6XA 1MC5A 3O1IC 1KYXA 4H60A 3C6KA 1FX0B 4Z8XA 3DMYA 2QJTA 1OI4A 5FAKA 4B4KA 1TMYA 2QEQA 2JJ1D 1EHIA 2PZGA 5EWMA 3WBFA 2PUGA 3LW7A 3F90A 4JBWA 3SKVA 2FSHA 2G1JA 3MTAA 3GQBA 3PGKA 2O57A 4DWOA 1L4YA 5DFAA 4EB6A 3AINA 5EIFA 1A88A 2J30A 2LIPA 4ER0A 2AMYA 5B3JC 4D9CA 3HWX1 2DUWA 4Z3KA 4OHYA 1RCTE 3ITDA 4N5LA 1KBZA 2QE7A 5F7XA 5ALOA 3VJMA 5E1BA 1KAMA 1D5CA 1W93A 4A0QA 2CBZA 2Y1EA 3A9RA 2IHJA 2HJVA 4HMPA 4RHTA 3UG7A 5FEUA 1IXRC 3EZ9A 3V8RA 3THYB 4IIXA 3F2IA 1AKNA 1SZCA 3II6X 3U3JA 2QYTA 3SHOA 3S68A 4LYGA 4WK2B 1O95C 3R76A 4IILA 3QYFA 2KJQA 2XNKA 4HCJA 3FPLA 4YH1A 4ROTA 1GPWB 1URPA 4LDNA 2C2BA 4LNAA 3R8FA 4X1YA 2FPSA 1C4XA 1I1QB 1G7RA 1G6Q1 1SVNA 3OIGA 1MJ5A 1G4HA 2AQ8A 1CWUA 1B8PA 1V45E 2HV8A 2V1XA 2R2GA 3KJGA 4ZP1A 3U7FB 1C4KA 3DDOA 3DEIA 1JZTA 3GUCA 2E5LB 4V0RA 2BFCB 4BO6A 4FS3A 3P0IA 2HF7A 3ZN2A 4BQEA 3I37X 2ZM6B 3RFFA 1R6AA 5CH5A 1NBAA 1C9YA 1Q1GA 2XMDA 2GA8A 3RV3A 1IN7A 2QAGC 3FYTA 2Q8QA 3ENVA 1WB4A 1R50A 3K1JA 2BMDA 3QVWA 4PIVA 4XYGA 1NQVA 3ORFA 2OAP1 3WNQA 4BKMA 2P2NA 5HSGA 4A6XA 1XMJA 7MDHA 3IUMA 3STVA 4BQQA 5DBFA 1K7EB 4H6XA 1DGQA 1TECE 3N76A 3QZUA 1BWRA 2WZDA 1WZCA 1FW8A 2ORED 3GELA 3F6CA 3G2IA 1QLJA 3LBNA 5E3HA 2N75A 5I7RA 1DQYA 1ETHA 3RREA 4B7XA 2W42A 4UTOA 2R1TB 3A4NA 1CQWA 3A1CA 2FQQA 4GI5A 4MS1A 5DF1A 5B53A 3D3WA 5JJ5A 1ZR4A 1KL7A 4GH5A 2VT7A 4MTLA 4OKIA 1M6VA 3NPMA 5SY6A 2DBRA 5LQCA 3FGOA 4I4NA 2EJWA 4EL5A 4F5WA 2VNSA 2PV0A 3NBZC 4U00A 1ONNA 3E23A 2KS6A 1POWA 1KERA 2QRLA 3F5SA 3OFNA 2WIGA 2IW1A 3ZVLA 4OP2A 4JLOA 1C3XA 3CWZA 4FDLA 3DDNA 4BX0A 1Q3KA 1CYDA 3HJGA 1EGVB 3I6QA 3WR5A 3VKHA 5THQA 2ZAYA 4G9GA 4B75A 3T94A 1LKZA 2PX8A 2QU8A 3O92A 4DDVA 1CVRA 2EJUA 4HNAB 4DJAA 1ZH6A 3IS3A 2BGNA 1Y3BE 1UEXC 3JYHA 3OWXA 4WPGA 5CLQA 1OXBB 1VHLA 1QKIA 2ETVA 2GVNA 1IN5A 1EFRD 1L1RA 2ZRHA 4W7IA 5GMOA 4QLAA 4N9QA 3H2BA 3M83A 3ENKA 1HEUA 1N36B 5F2KA 1C30A 4HDCA 5HP4A 3VC7A 4WBNA 2EJBA 4X7BA 5I01A 5A7FA 4E1VA 2FVYA 4MWDA 1LJ8A 1PWEA 4DGQA 3T3PB 4J9VA 1MO4A 1JXMA 4FMCF 3AHDA 4R1LA 2YXLA 1GAJA 2FN3A 3EAFA 3ZWNA 4LF7B 4LYDA 1J49A 4DRYA 5JXWA 2AL7A 5BQXA 3K8ZA 1AOXA 4HNSA 1ZC4A 5BR8B 4KIWA 3I5UA 2XZOA 4TPKA 1R6VA 1NW8A 2CVFA 4MKRA 1WP9A 4ENWA 4QFDA 4LZZA 3Q10A 3QPAA 2BFOA 3BXGA 3T1VA 2YOFA 4ODIA 4O4JB 5LZ7A 3RCBA 2WZQA 2JVJA 1K75A 3E18A 3V33A 2PHZA 4GM0A 1FDWA 4X63A 3TQSA 4K9OA 1KFBB 2Y1DA 1VSVA 3CLRC 1ADBA 1EIZA 1BDMA 2BUBA 2OYSA 2D54A 3HP1A 3G0IA 4ATNA 6NULA 5EIEA 1O97C 4TKLA 2NYRA 2AZXA 1OB5A 3T5DA 3QTTA 1U81A 1W0KA 4HS9A 2B8WA 3K8QA 5HWSA 2JVKA 2V7QD 4QUDA 5IWAB 1K06A 1Z5UA 2E87A 2ZYWX 4MLDA 2QD3A 3TQOA 1P4SA 3FFXA 4BQOA 3CLKA 3DNFA 3P9KA 4WLOA 1N1GA 1NXPA 1RJDA 3OQHA 3K70B 3SIWA 1ADJA 5LQSA 4YRPA 3RJ5A 4LSZA 4O2AA 3MMNA 3RU3A 1OZAA 3NEJA 4NYMQ 3WMRA 2AC4A 1KKLA 2OV2A 4UASA 4WCFB 1E6EA 1KEEB 4RAOA 1E64A 2HMWA 3DHYA 3HCEA 3IV6A 4D4JA 2GBCA 5AW5A 2FTKE 1OU4A 4PYOA 3RHZA 1IPHA 4NCXA 3TRKA 5BR1A 5G2OA 3AX6A 3LPCA 4W4TA 1MU0A 3X44A 2DEUA 3LLMA 3WHPA 4MUYA 3U49A 4EG0A 1R88A 3RK1A 1W88A 2PL1A 2VO1A 4WASA 4PG8A 1Z15A 1LI4A 4AJ2A 2P41A 1ORTA 3UGKA 1NKSA 3HRHA 4YUWA 1FNNA 2EGGA 2IPOA 2VDWA 5TRTA 3WNCA 4K87A 2NPFA 1AHPA 3WOVA 4PRYA 5LBIA 2R4UA 1AU9A 5PNTA 5FPYA 4IFTA 4XGNA 2C2WA 1EG2A 2B4QA 3Q41A 4OLHA 3HL0A 3VKVA 1LJLA 1MKYA 3GQVA 4RACA 4LMRA 1Y4SA 3ZDRA 1L7PA 2Z3VA 5CLIA 3QKRB 4JC5A 4ZO9A 3IO3A 4QYSA 5CIQA 3A3KA 3FZEA 4ND1A 1KWKA 3ROGA 5IDXA 4ER3A 3E9EA 4RY0A 1Y8CA 2WTMA 4HV4A 4W9NA 4DV2B 3PC4A 4AL4A 3WP0A 1P62B 3GI1A 2GPJA 1Z39A 3KPWA 3T95A 2YTZA 3TPCA 3UMFA 4JMPA 5TR9A 4ZJYA 1TCBA 3MJHA 2HHCA 2RHRA 1EM8A 2AA3A 3I9V6 3E3MA 3GRVA 3STTA 4BO1A 5IEJA 5KYXB 1RWMA 1CQIA 2X3FA 3TGLA 2BJWA 3VBCA 1M2VA 1H9CA 1ZR2A 5LXTA 1QV7A 3JWJA 5D7BA 1GVHA 3GZ4A 5JAQA 2EP7A 3S1SA 3HUFA 4MEAA 4DC0A 2G04A 2CEAA 3KAPA 3MJTA 1S8OA 1FP7A 2BZGA 5AXBA 4B3BA 4MVWA 3KXLA 3PUHA 2WF8A 1LPMA 3EVDA 2QZSA 3EH1A 2ZJ0A 4MRMA 4CM4A 3CUWA 3P94A 1TJ3A 4L78A 4PY2A 3S55A 3AI3A 3GFSA 4JENA 3G02A 3ZVKA 1WD5A 3QFRA 2UUAB 1DAIA 4B79A 4FEYA 5J2TA 4PPFA 2OXTA 1UOQA 2ERYA 3PJFA 1DCMA 1K5DA 2GAIA 4MUGA 1U6IA 4AMGA 1IB0A 2UZAA 3W8FA 4ZHQF 5M5BA 2GFHA 3OEHD 4YC7A 1F0PA 1NC3A 3QUQA 4JP3A 1O6GA 2QT1A 4DVGA 2J5XA 4OA8A 3D3KA 3KQMA 1Q0SA 1NLYA 3Q7RA 4LJYA 3RODA 1N1MA 4IJWA 5EJEA 1KAOA 2Z6VA 5E9AA 1QXSA 1Q91A 2B61A 3AR6A 1MOSA 2ANBA 3E0XA 3HGTA 4Y2XA 3I9LA 3UV3A 4IHJA 2DHRA 3D6TB 1CNEA 1DMRA 4YMTA 4NYIQ 3X1XA 1JWLA 1E20A 5HIAA 1D4AA 2YWJA 3E5MA 4JUAA 5K0GA 1FDIA 4DLBA 2SBTA 2AB0A 4G3XA 4MPPA 5AXCA 3TMAA 3ZGXA 1KJWA 4F45A 3BXZA 4JL8A 1E2UA 5KKNB 3CVUA 2O19A 1B4DA 2FHPA 3EQ2A 3QPDA 4B3MB 1NU8A 3BYZA 2XZTA 2L17A 3FZQA 1K0UA 1OY1A 4WTOA 4PPYA 3PNOA 1LU9A 4MAAA 3PCRB 1X7ZB 3STHA 3OPYB 1Z6AA 3JVIA 1RMQA 1SQ5A 3SSOA 1O54A 4ZOLA 5JFOA 1L7XA 1WUJS 2E4AA 3EPRA 3MQ4A 2RCYA 3HKCB 1MMFB 4GI2A 3ZTWA 2PTHA 3QLVC 4C08A 3BFKA 1RFGE 5EJ2A 3SQNA 4CWAA 3SLKA 1FC0A 3EQZA 4RL6A 1GL6A 1ZJZA 3IALA 5IKXA 2JGJA 4L72A 2V5UA 5EE0A 1BS2A 4X0EA 3NORA 3U0VA 1QMGA 1BZYA 3BGIA 4G9EA 2PUCA 3ZZNA 3WLTA 1NNI1 2ZBRA 4PYRA 2VPTA 3A14A 3DL7A 3JR7A 4OQZA 1E5QA 2ZWIA 3TPFA 4ZDIA 3T7JA 1ECGA 4BLRA 5HMLA 2A9OA 4XYBA 5NULA 4C07A 1YV9A 4MHOA 4E4RA 4ZCSA 4LWPA 4M0CA 1XU4A 1JDJA 2XUGA 2YJTD 3EVNA 3H18A 3OJWA 3DQZA 5AW1A 3P2OA 2ZYAA 2W6MA 4QNMA 2WFLA 4DDWA 2UVQA 4C0QC 2P0YA 1OGYA 4Y9SA 4G63A 2Z95A 1H69A 1SXJA 1YGYA 2EFCB 1SPXA 5A5FA 1G60A 2C8LA 2ZR9A 4UJ5A 2ODBA 4OAQA 3ZCVA 4MYRA 3UWMA 1MEOA 3UH1A 4YWJA 4TS9A 3LJKA 5CGZA 3OICA 1NR7A 3NASA 1RCFA 4O4HF 4WZAB 4A7PA 4AS1A 2JAPA 1NY6A 4NYJR 5JHGB 1CUAA 4AKEA 2IYFA 1P61B 5AW0A 1NLUA 1F2TB 2IH5A 1B74A 1NN5A 3PEYA 4IIGA 3RNLA 1OXVA 2PZKA 1XNHA 4LNUB 2UXBB 3IUQA 1Z25A 4MIKA 1Q44A 3G2HA 4UJ3A 5AW9A 2HI0A 4F6RA 3BMCA 4TSKA 4E1BA 3VBEA 3TXAA 3F5FA 2CLHB 2G25A 4BV2A 3WLMA 5TGTA 2ZBPA 1BMFD 1J22A 3HDVA 2P4HX 3E3LA 1TC1A 4UM9B 2CWWA 4NMHA 5GTDA 1T9HA 4XVHA 1FFXA 3RGWS 1BD3A 2XVZA 3L7AA 1H4SA 1QGZA 5CAEB 1WV0A 2IUEA 2NXWA 2YYAA 2B2CA 3GFVA 2JFPA 3MLAA 3RSFA 4EW2A 5CVCA 4IO1A 2DPHA 4KREA 4COKA 2J4DA 4Y7DA 5JSUA 4EF5A 4HPWA 1H23A 4LQDA 2JAXA 1BQ3A 4OI1A 1V2HE 3OEED 2E2WA 1F5SA 4LV5B 3OURA 2X6RA 2QVXX 3FNGA 4F06A 2YQ4A 3QVMA 3NTRA 4YRQA 3KTAA 3REGA 1LWNA 3FYCA 4BMSA 4XQGA 1Z4JA 5AVUA 4R84A 4YFVA 1M0TA 4Q1VA 4CR8A 4Q19A 4GPEA 1B73A 4XJXA 4G0QA 1EQAA 4JBHA 1TPZA 4UM9D 3HH8A 1US8B 3UV6A 2OORC 2XXJA 1SUCA 2ZB4A 1T43A 1HRDA 1T24A 3GPBA 3VR5A 4W7SA 2OV6A 4R41A 3HA5A 4HDNB 3VR0A 1G8KA 1CUHA 1U8AA 2Z2KA 4OD0A 1RXYA 1M5RA 3K94A 1SG0A 1PSZA 4ZO7A 5J9FA 5K2MA 1OILA 1CQXA 2IXEA 4MIYA 4D46A 2HU7A 4UE6A 3C1OA 1E8MA 1OLUA 9LDTA 1AK1A 1QH0A 1UINA 2B3TA 3DTTA 3ZE7A 3DDZX 3FPBA 4JB0A 4I1PA 1NBHA 1JS1X 2PVPA 2ZLBA 4JQSA 4WA8A 4EKDA 2PS3A 1UOOA 5JEDA 3PXXA 4O2BA 3PK0A 3EEYA 3OO1A 3AGQA 1DU4A 2QORA 5IAKA 2VPPA 1S2LA 2OZEA 1DLJA 1H5QA 1Q11A 3OPNA 4ENQA 1JXAA 3MTBA 4LRUA 3C15C 1QFMA 4RKWA 4A03A 2Y1GA 4HNUA 5AOAA 2JGDA 2YWCA 4K28A 4FCVA 4KO8A 2DFPA 1CB7A 1YJQA 2DG2A 3CRNA 4UAJA 4CUJA 3TZHA 1RYEA 4XB6B 1MHTA 3GIDA 3QX8A 1WUTA 3A04A 1OFVA 3NJ4A 1WAMA 1WMSA 1P2FA 1Q57A 1UR5A 2BR5A 2LUOA 4HXEB 1WB5A 4FYVA 3RSLA 4CV3A 2GJ4A 4WUVA 1RC0A 2RC5A 4EPTA 1GU7A 1E9EA 4XDGA 4XOUA 3JRWA 4HWGA 4OQPA 1O0CA 1CV2A 1CXZA 2FA9A 1UIMA 1DINA 4P38A 4IMRA 3OLCX 4ZAGA 5JTTA 5CURA 3FAZA 2DGDA 2PWBA 1QPZA 3AM1A 1QFSA 2IYLD 4IUDS 5JNSA 2CVQA 3T3OA 2I55A 3KQKA 2OC9A 5FNVF 1K4YA 1NR1A 3GA7A 3GHYA 2MJLA 3GLHB 2A1UB 2XQKA 2CJFA 4JT4A 4WZAE 5TMDA 3PWTA 1QDUA 5BXQC 4CIWA 4FM9A 1QF6A 3EEIA 4ETIA 3OY7A 5E9QA 5K6RA 4XCQA 3IODA 3JWPA 1EVKA 5IH3A 2XHZA 3V1YA 4CF7A 3GLFA 5JVDA 4Q4CA 1VFNA 1FFAA 4QU0A 2AEMA 2CL6X 3LSTA 1INLA 1NMSA 3TMKA 3VMMA 3C3XA 2IEDA 4D98A 2F3TA 2OM2A 2ZQZA 1P80A 3ECCA 2PKRA 3OHPA 4D9HA 5KO2A 3LY7A 1SEPA 4W8GA 1ODIA 3W9UA 1ODJA 1PIWA 4AO6A 2CJYA 1I3CA 1EVYA 1JRLA 1KVUA 2EIHA 4I9UA 5DNDA 2GUWA 2YHSA 2ZXFA 4I8IA 3H2GA 1IZ8A 3B70A 2Z56A 4UDNA 2RGNA 3OJOA 1QE3A 2CXHA 3IFSA 1E9CA 3GOHA 1VPEA 5A9SA 2VJLA 3HJAA 1UXHA 1ZK3A 2ZE5A 4PZAA 1GG9A 1KEZA 1MW8X 1LLUA 4AKHA 1HQDA 3E2MA 2VRWA 1PX2A 1X1BA 3HY6A 4GKBA 2PSSA 1L8OA 3LWNA 3PJDA 5EUBA 4MW9A 5TNXA 3WLRA 1TW3A 1F9AA 3PNSA 4HDAA 3OUZA 5EE3A 3BMOA 5EGSA 2C4UA 1TM7E 2ZGVA 2WILA 2DPMA 3ENNA 3OX1A 5JG7A 5J23A 5E4YA 3AP1A 4FIZA 2IKQA 4EVIA 4CCSA 4LGMA 4BKPA 1XLTA 5H16A 2HJ9A 1RRPA 2H1RA 4U4AA 2FJUA 5F21A 5CDFE 2PA0A 1XXHB 3NCHA 2CW5A 3T7KA 4YRKA 3E15A 4F7WA 4GKJB 2VHXA 2AKEA 2WWHA 1COWD 3Q40A 1AZTA 2RJ3A 4WY5A 2VTBB 1PZXA 4DSAA 3U4QB 2QUHA 1TVKA 1RLOA 4EBFA 1KK1A 1A3CA 2C42A 5GVSA 4ECEA 3NHWA 1MT3A 3QMWA 4FKZA 3IPXA 3TDNA 1W1WA 4NDZA 2HRRA 2WRZA 4I36A 4ENPA 2OCAA 1S3SA 3TG2A 4A0SA 2A5YB 2BVNA 3UY4A 5BNZA 3PI7A 2QTGA 5KOJB 4PSAA 1FP4B 1PEAA 3ZXUB 1ZW6A 5E6SA 4YY3B 5ILQA 4URHA 1N6KA 3AF0A 1JAXA 5BMVF 3HBJA 2X9VA 3H42B 4Q21A 3D8NA 2GETA 5GM2A 4HNRA 2H4XA 2NUAA 3ZQ4A 3OKCA 3TD2A 3RC2A 2C8KA 3WS7A 1MEJA 3PXUA 1YZQA 4X54A 3DCIA 4G25A 3OM1A 1OWOA 1EQUA 1YQXA 4GNRA 2PQ6A 1T3LA 1VB5A 3A7EA 3ELYA 3KEQA 2X3UA 5AI9A 1FVXA 1NONA 2XUIA 5K03A 4IEIA 4F3RA 3QVUA 4QJ3A 5FHRA 4EJFA 4XIFA 2WNIA 2IXBA 4Z9XA 2FP3A 3FYSA 3TTVA 2HSDA 2RGCA 4LC0A 1PQPA 1UPXA 3DV2A 3GRZA 3JQAB 5E4TA 3F3KA 4X3OA 3OMLA 3JASB 2B21A 4OO3A 1XFDA 1QUEA 4A1FA 2DBQA 2OGTA 4XX0B 2R8EA 5BSTA 2H0QA 3NNNA 3GEBA 1GZ4A 3I1FA 4K9KA 1LX6A 4OB7A 1U4OA 4OYHA 1GZ5A 3TW8A 2IYUA 5LNK6 3PEUA 3U9SA 5DJ5A 1WXDA 1D0SA 1O4VA 4OYYA 5GADl 2ZXEA 1FPQA 1UAGA 4URZR 4V0KA 4BNJA 1JQLB 3HCRA 5FOVA 1LSSA 1CHNA 2NP7A 1S2OA 4HWOA 3GLHE 1Z37A 2IOHA 4DG5A 4GOMD 2VG8A 1SUFA 2DUMA 3BIWA 1SU8A 5EJFA 4BO9A 5B6JA 2AK2A 4C6RA 3K5WA 2P6MA 1JSRA 2Y1OA 4O29A 5I4BA 3SD7A 4KGXA 1MZVA 4PU0A 2VP4A 4DDHA 3R6LA 4IO0A 1MJGA 2QK4A 4O4JF 4RESA 5TARA 4WIAA 2D1QA 3EARA 3BK7A 3FN4A 3VFDA 1Q92A 3PGA1 4L02A 4PQYA 1SELA 1O5IA 2J32A 1T9ZA 3DR5A 4P7JA 3R44A 5K4HA 3ESRA 1EUZA 3T5TA 2ZROA 3R9IA 1IWOA 2QT9A 1I14A 2FR8C 2R62A 3LLSA 3ICEA 1CJVC 1YB7A 3OKFA 5B5SA 3ZY3A 1D1TA 2JBHA 2OLKA 3V1NA 1NGSA 2R8BA 5LQRA 3HSSA 4OPMA 2XXBA 1X7WB 1XBTA 2B7BA 1PL8A 2F1IA 1L4MA 1XU7A 3ZOKA 3SYLA 4IHAA 4C7BA 1H2XA 1PEKE 3R0JA 4C0KA 3A6DA 3IC5A 2QL6A 3OZAA 1PR9A 1DELA 3WKDA 3HCCA 4DEVA 1PR3A 2VBCA 1VSQA 2C8JA 3GFOA 3JZDA 5JDIC 1W85A 2HN9A 2FEXA 1Q7BA 2O2IA 4KFSA 2QGFA 1L8QA 1CJMA 1MG0A 2VUTA 1I1OA 2W2KB 5D3KA 1E63A 5E8RA 3SYTA 2WHQA 5TPZA 3VSAA 4LFBB 1AZWA 1N8SA 1XEXA 4XH9B 1QG4A 1FTNA 2F9FA 3DBVO 1NUTA 1TJNA 2AI3A 1YJCA 5DULA 3VC2A 1XXHE 1FLVA 3M82A 2K7ZA 1HC7A 4HX9A 4XRGA 2C84A 3VH4A 4WFQA 1S2GA 3FOEC 1IQ0A 1FEZA 1TKCA 3GLKA 2QLFA 5KTOA 1OX4B 3T1HB 5KS2A 3JATB 1ARZA 2CC2A 3EZLA 3GFQA 3IOMA 2GN8A 4I50A 1FFBA 2AFIA 3LUJA 4S24A 2G1UA 1BFKA 1EFPA 3DMRA 4AO8A 4ZI7B 1GY8A 2WF5A 1TE2A 1NX6A 1X1SA 3REOA 3RYHA 3IVCA 1OJ7A 3ADOA 3IP8A 5H7XA 2GD0A 2ANCA 2HPAA 3KT3A 4BAGA 3ZDAA 1YOVB 2H9YA 4DIEA 3I4CA 1T4DA 1S7GA 3CS3A 2QRPA 2Z1NA 1T1IA 1T3SA 1RYFA 3AUJB 3DMDA 4XYMA 5BQ3A 4OLBA 1GLGA 5FCDA 3DG9A 3N7AA 2EATA 2VPIA 3B9PA 3EZXA 3S7ZA 5T6BA 1X13A 4W99A 1OLXA 1O1YA 4PS1A 3RYFB 3V2GA 1C80A 1CZNA 2FN9A 4XUGB 2MT9A 5DBIA 4AW9A 4EPVA 1CP3A 2GHTA 2Q45A 2Y67A 2KX7A 5H80A 4Q7QA 4IUYA 5A3JA 3G0OA 3NBUA 3P9ZA 3CW2A 1ZXLA 1CDEA 1QGDA 4ZIRB 1IG3A 2BIFA 1A8QA 3NOOA 4TXNA 4ESEA 1NT4A 1ZS9A 2V98A 5HM6A 3DJFA 3GJ8A 1WB6A 4F9FA 1OI3A 3LKVA 3GGGA 3L7IA 4MICA 3RRFA 4RVHA 2CL5A 4IKPA 1GPNA 3TB6A 4YAOA 4B32A 3K1TA 3JQPA 3FYUA 1HFKA 1A50B 3P2JA 5ESRA 3Q0TA 1U0BB 1UK8A 3MELA 4B33A 2JIDA 4FINA 3B3AA 2Z9CA 4UOQA 4X1IB 1ND6A 2AEFA 4JR1A 1G8GA 3EXHB 2XVMA 4KDCA 4Y2JA 4B40A 2JLWA 1ZA1A 2O1EA 3WGLA 1D1PA 2EARA 1SU7A 4Z4QA 5AJWA 3U13A 3MW8A 1N6LA 2QENA 1SWVA 4AAYA 3ELBA 1C7QA 3MCZA 4NCHA 2OKCA 1AB5A 3H1PA 5GGYA 5TJHA 3USCS 1OREA 2UYOA 4RIEA 2HOQA 4X8MA 5AK0A 2WP8J 2KYRA 1BKDR 1DZ3A 1S3FA 3DVAB 4MLZA 4FE7A 1KI2A 4BRWA 4L8YA 3EWIA 1NUUA 1JF8A 1U0GA 1XK7A 4N0PA 4YR9A 1EIWA 1QYCA 4L08A 1L5ZA 1P6XA 2AI2A 3QKSB 5FWDA 4BNUA 1BOOA 2OHXA 4NF2A 4DF3A 1J90A 2D4HA 3GAFA 3K5IA 3R5SA 4FUQA 3W9SA 4F1WA 4ZAVA 3ZU4A 4OX9Y 4B80A 1TF5A 3R3YA 4RH3A 1XG5A 3KX2A 1X92A 4E5PA 1ZONA 3LL4A 3FWKA 3RBXA 3T1OA 1J56A 1SD2A 3JARB 3BUSA 1S2IA 4KMSA 5KX5B 4FFBA 2G72A 1Y5NA 2FWAA 4P4SB 5HE9A 4EVQA 3CT4A 4KK4A 1U9CA 2WUWE 1YI1A 4A10A 1YR8A 3VGPA 4DA4A 1QAQA 4RA9B 2VDLB 5GONB 1Z8FA 3OT4A 4FYYA 3MOGA 2A0XA 3BL5A 1QVVA 4MKZA 1WCIB 2O05A 1OBVA 3R1IA 1ZU4A 1HT2E 5KYUA 3RUEA 1EUCA 4NE9A 4GLJA 2V4MA 4CCYB 1WHTB 3C43A 3E0QA 1KDTA 3GR6A 5EZQA 2ZUBA 1XZGA 3EGDB 3QF4B 1EK0A 2EZUA 5L3SB 2DWUA 2BHRA 1IOLA 1U3WA 3FGPA 1N0UA 5LN1A 3PRHA 1AXGA 2DKNA 1BEUB 4LJ5A 3ZU2A 3RTAA<