4JZKA

Crystal structure of adenylate kinase of e. coli with adp/amp bound
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Adenylate kinase
publication title Crystal structure of E. Coli Adenylate kinase with ADP and AMP bound
rcsb
source organism Escherichia coli o104:h4
total genus 75
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2013-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jzkA00
1II8B 3WP1B 1IN6A 2OSBA 3RC3A 4D4JA 3JZAA 2B7BA 1E96A 3DOFA 4Q1EA 821PA 3EPHA 1U90A 2QQ0A 4JSTA 2J9RA 2BWJA 2DYKA 2OHFA 1IY2A 3MSXA 1T0HB 3LLUA 5G3YA 4S35A 3TAUA 3NDBB 3P26A 1GRNA 4FIDA 4UKDA 3KQUA 5IRCD 4PFSA 1TUIA 5DGXA 4BLTA 1AGPA 3U3JA 5CITA 2J0VA 2PZFA 3RS4A 3IIKA 4ZI3A 2EFEB 3EWAA 1G17A 1E2EA 4Z51A 4ON9A 1TU3A 2B8TA 3Q5DA 4PTLA 2GXAA 2VH5R 4PHTA 3KFVA 1B23P 4B6EA 3I92A 4TYNA 4NCHA 1IN5A 4O25A 4P0TA 1P60A 4G5SA 3QKUA 3AKCA 4QNMA 2G0TA 2PEZA 4TSFA 5HPYB 2PZEA 1E0JA 2O8BA 3K0SA 1EFRA 2CL6X 4QJ3A 1XJQA 1G3RA 4C0JA 5KNCA 4LJ5A 4JLKA 2JJ8A 2PZGA 3LWNA 4RKEA 4GPTA 4EPTA 2GAOA 3RS5A 1DAIA 3U3KA 2J7PA 2DFTA 5C4GB 1R2QA 4MGYR 4XVUA 1LTQA 1R5BA 4G5GA 2QAJA 5LPNA 1SVOA 1G4AE 2IYYA 3K0FA 5HE8A 4I1VA 4WOPA 4FMDB 4GZMA 2W0MA 3FWYA 2V7QD 1M6NA 3RS0A 4ZDIA 4R2IA 5SZHB 1XX6A 1OB5A 4LWZA 4DLZA 4I1UA 4B3GA 5J4VA 2BC9A 1I2MA 3KX2A 5E7MA 1WA5A 3FPAA 1SKYE 4JBYA 4JL6A 4P4UA 4Q18A 3HYTA 3BXZA 1U8YA 1XP8A 2X2FA 3AB3A 2KI5A 4B32A 3EZ2A 4Q4HA 3TSZA 4A2QA 4DLYA 4I1OA 1GOTA 4FMDF 3W90A 1LS1A 2WSSA 1CTQA 3A1UA 2ZQ5A 3QXSA 2QMEA 3P27A 3R8CA 4NHOA 5CM9C 4MYHA 3Q8XB 2CL7X 4NBSA 2VP4A 1J8YF 4ARZA 1DG1G 3I8XA 2ZEJA 3IEVA 3CF0A 1Z47A 2GEDA 4LSGA 5FL7A 2WZQA 1AIPA 4M1MA 2BMFA 3EA5A 3RRNA 4W5HA 3I5YA 4V03A 1OH6A 2AXPA 1NVUQ 2QE7A 3CUEF 4EPYA 1E0AA 1F48A 4FMCB 3X1XA 4TL6A 4QL3A 5JS7A 2O8FB 3TSWA 3TAHA 3VR2A 5CIWA 1E2NA 1Q3TA 3CF2A 1EX7A 3TUJC 4BFXA 4F4CA 4LGMA 1E9DA 2AR7A 4KHZA 1FW6A 2GF9A 1D2MA 1NN3A 2YYZA 2YC2C 1G21E 1QG4A 3C14C 4F92B 1JR3D 5BWMA 2EU8A 2R6DA 1D8TA 1BMFD 1XD9A 1G6HA 4BRUA 3H1TA 3V9PA 5LD2C 2Q0HA 1E69A 1G18A 4FMCF 1DBSA 2H18A 2ZAOA 2A2ZA 3K70C 1Z0DA 5L3RA 1VYTA 4DT1B 5FUWA 4ITRC 4YDSA 1ZNXA 2HT1A 5H70A 1GRQA 2VF8A 3I72A 4DZZA 1TU4A 4Q9KA 1NG9A 2G88A 1ZMXA 4HLDA 4MGZR 4IVRA 1P3JA 3B6EA 4D4MA 4A36A 2G6BA 1E99A 1Z6GA 4LHVA 2E1RA 4P4SB 4D0LB 5KTYA 1Z5ZA 2OAQ1 3PV0A 4PPNA 4IDOA 2RGDA 2I1VB 1IOZA 4MKIA 4HLQB 3BOSA 1ZU5A 4OJKA 4PQFA 5JMTA 3G0HA 4Q21A 2BM1A 2VPPA 4BLQA 3VR6A 2DWPA 1R5NA 2W83A 3GJ7A 3QVVA 1TF7A 2QT1A 4O3MA 3MJHA 1HE8B 3BD9A 1TQ4A 4KYIB 2YVUA 1XTRA 3RS2A 1R0WA 1T0JB 2ZREA 4OBEA 4C0HA 2QY9A 3KTAA 3QKSB 3IHWA 4IOLA 3W3ZB 3KB1A 4ASUA 3IILA 4LHYA 3X2SA 2VA8A 2IS4A 2ZS8A 1XFAA 3FMOB 4RZ3A 1Q57A 2UZ3A 2IXGA 5GVSA 1AS0A 1FPMA 1VG0B 1VCOA 2FPKA 3K09A 1UBCA 2MSDB 1VG8A 4JLVA 1E9CA 3TKLA 3HPQA 2BBSA 3BERA 1RIFA 4DUGD 1KO5A 1NNEA 3KDSE 3RANA 4W5WA 1MABB 5DI3B 1P5ZB 1Z8FA 1GFIA 4HAYA 3FOZA 1XB2A 3BJIC 3ZS9A 4B75A 4TMVA 5AUQA 5TB5A 3SYKA 1RRCA 4B35A 2QBYA 3E70C 4OHXA 4Q4AA 1E9FA 1KO1A 2R44A 5JCPA 2WBLC 4DKXA 1UF9A 1XD8A 2GXQA 3L0PA 4UNPA 4UXHA 1G5RA 4RD1A 4EFMA 1VCNA 3GFOA 1HY3A 3GMTA 4Y0VA 4A2WA 4JS0A 4DCUA 1XCMA 3QG1A 3I61A 1N0UA 1GILA 3SYNA 4QHYA 2J41A 5AUNB 2XXAA 1X3SA 421PA 1E2DA 4IXNA 1KI4A 1CJVC 3GEHA 1QZXA 4X8MA 1Z2AA 4M22A 5FL3A 2ATVA 2ZTSA 4IXMA 5EJEA 3ZZTA 4LI0A 3T1TA 4MRPA 4V0NA 1P6XA 1T91A 1Q1BA 3BBPA 3EA0A 4LYAA 2WJGA 4EJSB 4AKIA 3WRYC 2W6IA 1TQDA 2Q21A 5J4LA 3A37A 1DTSA 1G291 2FJUA 3QENA 4DSTA 4BGDA 4MUAA 1AZSC 3FGNA 2YOGA 3F0TA 4B2IA 1KAOA 4C7OA 4TYYA 3U44A 3GLIB 2Q9CA 1ZCAA 5IT5A 3WHLA 4ZCLA 2WTUA 4M1KA 3M6AA 1GVNB 5EP3A 1R8SA 3KUCA 4G5QA 1KJZA 4URXR 2FZLA 2HT6A 2H57A 1JR3E 2BKEA 3W5JA 4RVCA 1K6MA 3TIFA 1XJ0A 3QVUA 3C8UA 4JBWA 4OQFA 2ZE6A 5EE5B 3IQWA 3VR5A 3RRZA 1CS4C 4BEJA 2AWNA 2ODWA 2WWXA 5AK0A 1FNNA 2FSGA 2ORWA 5HCNA 1UKZA 5HE9A 4C0LA 2ZYVX 1TPZA 2CHQA 1J70A 1F2TB 2NGRA 1I4TD 3ADKA 1OLOA 3HU1A 1VECA 3UANA 4XOIA 3LVQE 4C0QC 3BGWA 4NYIQ 3FMFA 3LLMA 4MQBA 5DYIA 1HT1E 1OKKA 2ZE5A 2FDCA 2IC5A 1TAGA 1S4QA 1WMSA 4RD4A 4UJ3A 4R7ZA 5L3QB 1JAIA 2GEVA 4JSYA 2BV3A 4Q4LA 4B43A 4BE7B 5IHPA 3BB3A 4E09A 3KXLA 2G1JA 3I3SR 2DY1A 1FL9A 5DH9A 2FMXA 3K9NA 3ADDA 3CBQA 5FBRB 1N6KA 3CM0A 1KO7A 4DLVA 3AVYA 2WM9B 2CVFA 1W0KA 5B30A 1EWRA 5D3MB 1HV8A 1G7CA 2WKQA 2JIZA 4P33A 4TTRA 4TLBA 1A1VA 2FE4A 3ZZUA 3SR0A 4NCNA 1NVVQ 1AQUA 5IDVA 1EK0A 3MFYA 1Q1ZA 1NMYA 2K5UA 3C5CA 3QKRA 2HDNB 2ZUCA 1E2FA 2ZPTX 4L9WA 5KHOC 5E4FA 1KI6B 1US8B 4C0KA 1LY1A 4XD7A 3QF4A 5HZHA 1CRQA 4RSGA 2BEJA 4TN1A 2WVJA 2JA1A 3W3AA 4N0EA 1NLFA 2QM7A 2B8WA 5JECA 1G3QA 1G3MA 5TMPA 2QA5A 3HWSA 1NSFA 4BQSA 4M9QA 1X8LA 1ZYUA 1GL9B 1WXQA 2ZJOA 3GQBA 4LBVA 2PJRA 3G5UA 1ODFA 1OV4A 3HU2A 3SEAA 3TW4A 3IKJA 2DWQA 2KB0A 4XH9B 4DDUA 5EE3A 1KI7A 2FSIA 4YQFA 4DLXA 1XEXB 1IXRC 1UDXA 2FGKA 1OB2A 3CIOA 3AEZA 1OHHA 4PSKA 3K0EA 4ERNA 3EG5A 4KYUA 4AK9A 2IX3A 4ESVA 2CE7A 3TNFA 3LNCA 1NY6A 4XVRA 3UPUA 3O8DA 1KNQA 1ZIOA 3PUYA 4AYWA 4Q1AA 1DEKA 5BQ5A 4W9MC 2FU5C 1NBMA 3UMRA 4M1YA 4M1OA 2V6JA 1OFUX 3KZ1E 2WPDA 2XOKD 1DAFA 4MUBA 1G64A 4KODA 2QENA 5KSOA 2FFAA 4IVQA 2HCBA 4M9ZA 4MRSA 1E2MA 4PHGA 1HYQA 3EW9A 4LHZA 1A82A 3AVTA 3TW8B 4QRHA 1T8TA 1XBTA 2DCUA 4HZUA 1UDWA 2EVWX 2NG1A 5JRJA 4IKEA 2ZRDA 2REOA 3NBYC 4M8NE 1ZM4A 3DKPA 1KI1A 3WNDA 4BLSA 2PCLA 3KFXA 3PJRA 1Q20A 4D2IA 1T3HA 2XJ4A 4KFTA 1XZQA 4OQLA 3DEFA 1R0XA 2D2EA 5GADl 5JI3E 1TMKA 4V0MA 5J47A 1SVIA 3BFXA 2ORIA 3V00A 4Q47A 2H92A 3NC0C 1N6RA 1JPNA 1COWA 4JYBA 4NU0A 2QMUA 2XB2A 1TL7C 4OK6A 1KSJA 3KJGA 3RSOA 2IYSA 1S3GA 4CEJB 3B1YA 4EPVA 2EQBA 1ESNA 4LBZA 5E7JA 1XJCA 3KQNA 1LNZA 1TNDA 3RLFA 1C9KA 1ANKA 2RKOA 4E03A 1SULA 3MGCA 3B1VA 5AWFC 3RRYA 4G5RA 1DAHA 4MYCA 4RKFA 4TLDA 3AVVA 3Q85A 5FBLB 4M0LA 3BH7A 1ZNZA 1YR7A 4CEHA 4BPBA 3SQXA 3R7WB 1U99A 3D31A 4PSAA 4EPXA 5KDDA 1QVRA 1Q21A 1OYWA 2BOVA 4DVGA 2ZRPA 3GJ6A 1KDPA 4MH0R 4RD0A 4OI4A 2WKPA 4EQ6B 1IQPA 4FCVA 4PZYA 1E79D 2QSYA 4F91B 2UZIR 2ZR7A 3JVUA 3EZFA 3U3RA 1KJWA 5BN4A 2ZRHA 4TYPA 2GEUA 2O52A 4RCYA 4UNSA 2NPIA 2OT3B 3Q7PA 2W2TA 1F2UB 4BFUA 1N6NA 2GJ8A 2Q3FA 5A4JA 4C30A 2OBNA 3AP3A 2GK6A 1CR4A 1CXZA 1SVMA 4HYYA 2ODNA 3DM9B 2BIFA 2GVDC 3SYLA 2RGNC 3I32A 1S1CA 5FOUA 5B58C 1B0UA 2R8RA 1OSNA 2YOFA 4HB4A 2LCFA 2HXYA 3AV0B 3MWLA 5H8WA 3T61A 2OEPA 1LVGA 1XF9A 2VLIA 2ZJZA 1U0LA 3JZMA 3HR7A 1F5NA 1N0VC 1XTIA 4PC6A 2O8EB 1OFIA 1XTQA 2NZ8A 4CRWB 4PC1A 1E98A 2VP2A 2ZI5A 3MJRA 5L3SB 1EWQA 5LD2B 4BFVA 3AUYA 1E1RA 3CW2A 4DIEA 3NH6A 4MKGA 2ECKA 2ODEA 2REBA 4NE2A 4TL9A 1CU1A 4JT2A 1GUAA 2YC4C 1KY3A 3B13B 3QEOA 4XWOA 2JLQA 4GMXA 1RFLA 1KK0A 1N3BA 3A1SA 4DIDA 3U5ZB 4PPFA 2W6JD 3CRRA 3TGPA 4YMSA 2FEOA 4LJ7A 1UKEA 2OZEA 4YONB 2ZYUX 5JWHA 5JEEA 3VR3A 1LS6A 4I99A 1GWNA 3DZ8A 5TXGA 4C2UA 1XMSA 2A5JA 3QI2A 5KDLA 4B33A 1JI0A 4IRUB 1BYIA 1WDTA 1G8HA 5EUQB 3RVBA 4D80A 4DEYA 1GRRA 1J99A 4WZ6A 1XEWY 4UXIA 2QP4A 2FF7A 2BHRA 2JJ1D 2P2LA 1W36D 3U3OA 2ZSBA 3CR7A 3OHMA 3IGFA 1LW7A 1Q1EA 4C0BA 2QSZA 1Z28A 2MSEB 3AVUA 1M7GA 2OCYC 4WVFA 3EIEA 4QBIA 4IOJA 4KFUA 4U7DA 3RWOA 4GL2A 1RJ9B 2JJ2D 3F8TA 2OFOA 1QHHA 4FN5A 3WMEA 2ZJAA 4OQMA 3AVOA 1XXHB 1A2BA 4C9BA 2GK7A 2NO6A 4BRWA 2CHGA 1DO2A 3M0EA 4URZR 4X8OA 1W36B 4I4LA 4HAZA 5DLQC 1S2MA 1NL3A 4OHZA 5C2JB 1DVRA 1W49A 3B78A 3BAFA 721PA 1CP2A 4TZ0A 2RGGA 1YR6A 3FMPB 4HLCA 2ONKA 3QXXA 4QXAA 4TQ9A 5FPHA 3R7WA 5CLLA 1MO3A 3GJ3A 1P75A 2BJVA 4NYMQ 3LW8A 3C15C 3PUWA 2ZU0C 3UG7A 3QPWA 4MRVA 5AR1A 1WQ1R 1KK2A 1JAHA 4JVMA 1UBFA 2GA8A 4DHEA 4AKGA 1AN0A 2QP3A 4V02A 3NBZC 2WJVA 1DADA 2F6RA 1II0A 4CGZA 1P2UA 1RVDA 1GNPA 3PEUA 3UK6A 2NPFA 3IHLA 2IEZA 2RCNA 4NPHA 1HURA 2O8CA 3GLFB 2V9PA 4TWZA 5F3WB 2J46A 2C9OA 2ZE8A 2HF9A 2ZUBA 5B2ZA 1ZUIA 3CKLA 2JLWA 1KI9A 2R62A 1ZP6A 1PZNA 4EAQA 2VRWA 3GEEA 4DXAA 1F6BA 2XNSA 3H0KA 4A92A 4M4SA 1E3MA 3B82A 4ZDWA 1MO4A 4A6XA 1MRNA 3K53A 4UXJA 2QTFA 4UQOA 1E2HA 3TBKA 5FOWA 3PEWA 2C9CA 4LX0A 2FGJA 5FPYA 2OFWA 2YNMA 3QXHA 2O0HA 2QUZA 4EPWA 1JBKA 1A7JA 2JLYA 4LDJA 1KK1A 5K8IA 2ORVA 3ND9A 1KSHA 5DN6A 4JZKA 1ZD8A 4O2LA 4B3DA 1VPLA 3GLHB 1N5IA 1DO0A 3TE6A 3THXA 4HB2A 4PC7A 5JJKA 3UKDA 1NN5A 3C7KA 3NVAA 2A78A 5D3QA 3TRFA 5GJWC 5EE1A 1SVWA 4HUQB 1BYUA 2R9VA 4GZLA 1SXJD 2DB3A 5JJLA 3EXAA 2ZRNA 5FUXA 2IXEA 4I81A 5EXXA 2AHOA 3RAPR 5BXQC 5DSZA 3LV8A 3ICEA 3Q9LA 1KJYA 3AKEA 2D06A 2Z83A 2ZRAA 2UVQA 1RZ3A 1XZPA 2C78A 4FWIB 3AM1A 1W7AA 1ETUA 3CB4A 4A82A 2RH5A 4L9SA 1RRPA 3TVDA 1Z6YA 4GP7A 4A8JA 1C4OA 2IYZA 5EZ5A 4G3XA 4ACBA 4Q4JB 4B76A 1LB1B 4AKEA 3K0CC 1SXJB 3K9GA 5KSZA 1D5CA 4QHTA 1H8ED 3VU9A 3AF2A 2HEIA 3VTKA 1G8PA 1VIYA 2GWHA 4Z8XA 4QBFA 1DAEA 1ZRHA 3IQXA 3R20A 4MKFA 4DLRA 3B9QA 4TL8A 1HE1C 3SBEA 4ZIRA 4XVQA 2OLKA 1U2RA 4JLBA 2GF0A 4LYHA 2GCOA 5J4HA 2F3RA 1XPUA 2J0UA 4TYQA 3ZGXA 5EE0A 2D3WA 1MH1A 2F55A 1G20E 3EIQA 1BKDR 1IBRA 1X6VA 2E87A 2JATA 3E2IA 1TEXA 3U2QA 1G7RA 2GVZC 3WBKA 4TZ6A 3A58B 2HUPA 3MUFA 1QHYA 4TQAA 3W8RA 1H8HD 4TMTA 5CM8B 3T06B 4QGFA 2A3RA 4H9GA 5FPSA 3O8RA 4B3FX 1N6PA 5FTKA 1X1RA 5K8UA 2OCAA 2R65A 3FHTA 2JDIA 4POAA 1YHNA 5KUTA 4N1AA 4IEIA 3FKQA 4DSNA 3PFIA 2ANBA 3ICQB 3CNLA 3LX5A 3KKOA 4KFSA 3CRMA 3SJZA 5G53C 3AUXA 4FCWA 5J4KA 1CJKC 4MITA 3GLGB 2A5DA 1PUIA 2ZANA 1MOZA 5JWOA 5JSZB 2VO1A 2BCGY 5CLQA 3OIWA 1FMJA 1L2TA 5FTJA 1NN1A 1KNXA 4IDNA 1D9XA 3B60A 2YWFA 3L0IB 2GXSA 1II8A 3KXKA 2XNDA 3U7GA 2CMKA 4JLPA 1Z0KA 1VHTA 4KV9A 4PX9A 2SHKA 3ZQJA 1D6JA 2WJYA 3FYHA 5GJVC 4B2LA 1U9IC 4R9UC 4DCNA 3A1TA 3ADBA 1ZBDA 2QAGB 2HLDA 3X1DA 4Y0AA 2F43B 3ZVMA 4UNRA 3LD9A 3QBTA 5H1YA 1X1SA 4HSEA 521PA 4PO1A 4HAXA 4Q1FA 2ZS9A 4HB3A 4CVNA 1NJGA 2ZRLA 2JCSA 3UMFA 5EE9A 1W5SA 2ZRGA 3DHWC 3QF7A 4EUNA 1ESMA 1W44A 1S3SA 3T34A 2I3BA 2LKDA 4W5JA 2LWIA 5M04A 2B21A 1SXJE 1NF3A 2IUTA 3GEIA 4QM6A 2XSZD 1Z83A 4CEJA 2RGBA 3PITA 3DMDA 3HPRA 4DRZA 3WHKA 1QHGA 2EW1A 4XJXA 5FOVA 4Q02A 1DAGA 3QJYA 4OQXA 1KDOA 1SQ5A 3V4FA 4GMDA 1E0KA 3W6OA 1ZINA 2ZR0A 3AGPA 1D9ZA 2CK3D 2I1QA 2YKGA 1GDDA 2VSFA 4CW7A 5G41A 2A9KA 1NRJB 1Z2CA 3OAAD 5EXPA 2V1UA 5LB2A 4OHYA 3AP1A 3SOPA 4KJZA 4TTQA 3ZIAD 1AKEA 4BZXA 1LF0A 1KO4A 1PLLA 5J40A 1CJMA 1ZM7A 4IW3B 2ZRIA 1O3YA 1OIXA 4HAUA 3FMIA 3WRXC 4IHQA 1W0JD 3FFBA 3R9XA 3VX4A 4JLOA 3DPUA 1JJVA 2J0QA 2IL1A 4JLMA 4ZI2A 2WIAA 4B34A 4QNRA 1QHNA 4AYXA 4Q7JB 5ANRB 2ZI6A 5HR5A 1TQ6A 3EZ7A 2X77A 3PEVA 2IEYA 3K0AB 2OCPA 2JLSA 1OW3B 2WSMA 3CNOA 1WBDA 1NMXA 1BIFA 2XITA 2V54A 4QFMA 4PSVA 1AS2A 1J8MF 4L16A 4TLCA 4Q1BA 1D2EA 2YINC 1CLUA 2V7QA 3HJNA 2P65A 1Z06A 4U5XA 1AKYA 1GG2A 4XTRA 3OESA 1YVDA 2OFXA 2A5GA 2BMJA 5DHFA 4J0QA 2F7SA 2BM0A 5FTMA 4WXRA 5FTLA 2Z0MA 2ZJYA 3HYRA 2QP9X 2C5LA 3SFZA 1DELA 3PVSA 4NCIA 3KKMA 2J1LA 4NMMA 2IA5A 1JECA 3CH4B 1M34E 4OQNA 4TMWA 4B6FA 3ADCA 3EPLA 1Q22A 5LDDC 2O8FA 4M9SA 4IOMA 2QTHA 2KE5A 3TSOA 3FKSD 4RJLA 5KO2A 3VX3A 4NYIR 1Y63A 4KU4A 1JR6A 3FB4A 4KI0A 4HLUA 1XU4A 3DVLA 4A4DA 2GKSA 4OK3A 5CJ2A 1FMLA 3U7FB 4ZDJA 3B1XA 4IDPA 3ZDQA 2FWRA 1WF3A 3CONA 4GSYA 2ZAMA 2QAGA 4URVR 1P2SA 4D26A 1D2NA 1I4LD 2CCJA 2ERYA 4RFVA 4ZCIA 4D81A 5E7IA 4DT1A 1SKQA 2O8DB 3W5IA 4R98A 3K8YA 2FSFA 2O5VA 2FFHA 2OBMA 2OO7A 4PC3A 2HV8A 2X19A 3AVPA 5CB6A 1XD2B 221PA 3KQHA 1NVVR 1OXUA 3IPYA 1SGWA 4P4SA 3ZVLA 4WBSA 4BFYA 3NHAA 1JR3A 2R6AA 2VBCA 1OFTA 1BMFA 3P1JA 4JJKA 3QIAA 1DOAA 1R10A 3PEYA 2D74A 1VG1A 4M53A 4E22A 4PPGA 2VP5A 1Z6XA 2ZRBA 2P67A 2GESA 4CF7A 3AVWA 1IHUA 1P73A 3T5GA 3WP0A 4ZCMA 2PEYA 1OJLA 2XAUA 2PT7A 3U6BA 1XPOA 2CHVA 3QXCA 2IS6A 1A4RA 1N6HA 2D4HA 1ZUNB 2GNOA 3QKSA 4YXWD 3BB4A 3UXMA 4F4IA 3I4LA 5KOYA 3VKWA 3K9HA 3EAQA 2P0EA 4Q7KA 3S1AB 1OYYA 1IN8A 1QG2A 3NG1A 5KYKA 1DE0A 2KBEA 4B71A 1YQTA 4MYUA 3QEJA 1CF4A 1Z07A 2QORA 1G1MA 4LOAA 1M7HA 4AYTA 1Q12A 2WKRA 4BECA 1MABA 4URYR 1WRBA 5DI3A 3I1FA 2PJZA 4WAUA 2Q9BA 4TLEA 1FP6A 3GFTA 5BW8A 2FPMA 4IEEA 4BFZA 4DSUA 4OHVA 3BORA 5C18A 2AFHE 1U0JA 4ACAA 2FH5B 1X86B 3TJZA 1ZNYA 4IOKA 4L5BA 1E6CA 3KJEA 4IFBA 3VMFA 4JBXA 4WZBE 3AVQA 2XEXA 4TT3D 1KSGA 3TR5A 4DUGA 5B64A 2WJHA 3OFND 3PUVA 4YMWA 2N1BA 2B6HA 3OZXA 3K09C 1KTVA 3SBDA 3OEEA 3VKHA 2OUKA 3LBIA 3MWJA 5DE3A 3WYAA 2FNAA 1NSTA 2JEOA 4JLNA 5LBIA 1HTWA 2OE2A 4OL0A 4DB4A 4RZ2A 3NBFA 2P6NA 2FSHA 3AF0A 1XTKA 3T15A 3W9YA 2IUSA 5EUMA 3GLIE 2AN9A 5JCZA 3U3MA 2XZPA 3QXJA 2WICA 4EJSA 3OEHD 1TEVA 1Q0UA 4A2PA 5JS8A 1QDEA 2YJTD 4R2HA 1QRAA 2A5YB 3ZS8A 4NH0A 2JAQA 1RYHA 3DDCA 4LCBA 1FX0B 3NEJA 5EXTA 2AK3A 5EP1A 3RS7A 2HCJB 1R6BX 2GXUA 3NBXX 1P9NA 1HT2E 4LHWA 3GLIA 4AURA 2BMEA 1E2IA 4QHSA 3MWKA 3RYTC 2PCJA 2NO1A 5F9HA 1GSIA 1IY0A 4A1FA 4RD2A 4CEIB 1E1QD 2D2FA 2IYVA 4PAMA 2V1XA 4FD2A 2IHBA 1P62B 2ZIAA 1IN7A 2QGZA 3LY5A 2DWOA 1EFTA 3QKTA 5TVKA 3GP8A 1TQ2A 1VMAA 4WXPA 1XCGB 2KSQA 3THWB 4QC2A 1KSFX 2DR3A 3EARA 3LXRA 3BFKA 3EC1A 4Q1CA 4Q01A 4GOKA 2C99A 1NIJA 2EFDB 4PZZA 2OM2A 3EC2A 4LPSA 1P72A 2AX4A 1CBUA 1F2TA 5FR2A 4HLUC 3VQTA 2GDJA 4KSCA 5JWRA 1MV5A 3L0OA 1CJUC 1GTVA 1CRPA 5KNDA 2QQEA 2ZUDA 4NYJR 4G0NA 2PL3A 2QGNA 5FPTA 4HZIA 5IK2D 5L3QA 3DZDA 2IT1A 3LDAA 3V4RA 4AG5A 2V3CC 2IYXA 4MKHA 4RZUA 3T1VA 2Y8EA 2RB4A 5AJVB 4DB2A 4Q9LA 1YZGA 2BEKA 2N42A 3AKDA 2NO7A 3QBVA 4YMVA 4ZDKA 5G40A 5DI9A 2F9LA 2ZXUA 3AF1A 3TLXA 4X8HA 4A0HA 1JQJC 4CZ2A 1J90A 5CDFE 5D3MA 2REXB 2ZS7A 1HQYE 1N6OA 3CZPA 4LZZA 4Q5IA 3UWKA 4HUTA 3B5JA 1UEIA 3A4NA 1M7BA 1KMHB 2CNWD 4DCSA 2AKAB 4DDVA 3Q7QA 3CPEA 4HDQB 1AQYA 4N3NA 3WY9A 1LV7A 4FMBB 1YU9A 2A7QA 2CE2X 1KI6A 2VYFA 1US8A 1RE0A 4US1R 2CCGA 4YDHB 4EPRA 4RCZA 5HKKD 3KL4A 4L15A 1EXMA 4ESHA 5AJWA 1Z0AA 3A6PC 3T35A 5EXSA 2OILA 3BK7A 5SZJA 2IS1A 1UBGA 3BIFA 3K70D 3C16C 1VYUA 3CX7A 2IHYA 3LW7A 3QY0A 3H84A 5TY0A 2QNRA 1T3LA 1QHXA 3OE7D 4LRWA 1E32A 3SN6A 3SHWA 1UFQA 3THYB 1VTKA 3CO5A 4Q00A 3IUYA 3SS8A 4Z1MD 1XEXA 4IFEA 3KJHA 2GTPA 2IYWA 2ZI3A 1VIAA 1Z0IA 3F3YA 2QPAA 2YV5A 4LHXA 2A5FA 2G0NA 3K70B 5EP4A 2PLFA 4DLTA 4E5UA 2C77A 1XMIA 4B73A 2AK2A 4ZO4A 3RSLA 2IXFA 3GJXC 4B3XA 4MGIR 4KVGA 2DHRA 1QHSA 4S2EA 4TMZA 1JEEA 2F1JA 3H4MA 1XTSA 1LFDB 2BMDA 1GKIA 1ZC3A 2ZI7A 4AIIA 2C98A 3BH0A 3ZYCA 2ZU6A 1KI3A 1EGAA 3RWMB 5FOSA 5JRZA 3JVVA 4HDOB 2OXRA 4FINA 3B8HA 4IDHA 2R6FA 4XWKA 2R6CA 4GBMA 1ONBA 5FBQB 5BN5A 4GFDA 3RDPA 4O2RA 4Q9IA 1CEEA 4Q9JA 1Z08A 4KBFA 1Q3HA 1QVAA 2ZVPX 4TSFD 3ND8A 1JB1A 4F38A 2PX3A 2DFNA 1QF9A 1R0YA 4KFRA 1E9RA 1J2JA 1E9EA 4EJSC 1EFRD 5BYJA 4PPQA 4NYMR 4A9AA 5K8TA 1L8QA 3THOA 4PQYA 3NEYA 3EPKA 2MSCB 1G5TA 4M1WA 2YZ2A 4M21A 1S9HA 2XOKA 1X8KA 2C2HA 4XSHA 2J7PD 2EYQA 1IXSB 4BLPA 2J45A 5AJZA 2JLRA 4A0RA 1E9BA 4JL5A 1M2OB 2HF8A 4CDGA 2GETA 4MYTA 4L8GA 4LV5B 1M1YE 4NTZA 4DDTA 2BVNA 2ZM5A 5TV2A 1ZNWA 3IBYA 3CPJB 4RD6A 2O8BB 5CB8A 3VNUA 3LA6A 5CYOA 3LXXA 4URUR 3ZH9B 1V43A 1P4SA 3NH9A 3BC1A 1IXZA 3MWYW 5BYKA 4KLZA 2EYUA 4Q9HA 3LVRE 3PQCA 3P20A 1DG3A 1U98A 3A8TA 5BN3A 3MMPA 1XWIA 3KUDA 1R0ZA 3K0FB 3CRW1 1YZKA 4KBGA 3QE0A 4NL4H 3SZRA 4EQ6A 1OE0A 2WWYA 1L4UA 3NIBA 3WYFA 2WSSD 4IDQA 4LJ8A 4UNNA 4LJAA 2H8KA 5F2EA 3LBHA 4KCGA 3A1WA 1F2UA 1E4YA 2ZRFA 2ZJ5A 1TF2A 3SE0A 3GCGA 1XPRA 5FL7D 2QMOA 4OI2A 1W2GA 3QQ5A 2RAPA 3D3QA 5FFMA 5CJPA 1R5OA 1BH2A 2G3YA 2AD5A 2QPOA 2QE7D 4FW9A 4Q4HB 4NDZA 4D0GA 4D0NA 2WJJA 2WIBA 4GT1A 2XB4A 5CK5A 1E79A 3LRPA 3SJCA 2FA9A 4LJ4A 4WW0A 2O8EA 1DAKA 3X1YA 5L3SA 2W0SA 4ARZB 2Q9AA 3AGQA 3REGA 2G77B 3PIRA 2GJKA 2YHSA 4URWR 3CF6R 1K5DA 4D25A 3REFA 3AVXA 1YR8A 2BKUA 4M2LA 3VKGA 1XNJA 4DDWA 5JI2E 2AWOA 2O0JA 3EX7C 1AJEA 2J7KA 1VYVA 1GNRA 1JPJA 2D7CA 3KB2A 1OIWA 2WMNB 1GL6A 4AY2A 3B85A 3FVQA 2ZVQX 3HDTA 4PHFA 3T1OA 2E9SA 4KSBA 1A5TA 1EFCA 5K8LA 1XRJA 3EPJA 2ZRKA 4KO8A 1T4GA 3NWJA 4LBWA 4Q1DA 2C9YA 4FXPA 3FE2A 4JLAA 2WMOB 2ZYWX 3EZ6A 2WAYA 4Q48A 1KI2A 1XXHE 3P4YA 4G01B 5FOXA 1FQJA 3PG5A 2Q3MA 2W6JA 1UBEA 3ZLJA 3ONWA 4G1UC 4NZYA 2PLRA 4ASUD 1FTNA 1G6OA 4TYWA 1R8QA 4W7SA 3CZQA 1Z0FA 2GCNA 2XTNA 1ZVQA 1E2JA 4E07A 5JJIA 1RRGA 4C0AC 2QL6A 1RJ9A 4DSOA 2OV2A 1SVSA 3R9IA 4AKHA 4TL7A 5C4MA 2OXCA 1XXHA 4FCTA 3B7GA 1RC8A 3DOEA 3UG6A 3W6PA 2P6RA 3O8BA 4XWAA 3QUSA 5HTKA 4ZKEA 2P5SA 2NQ2C 4PZLA 2J3EA 2JJ1A 4DLUA 3FHCB 4QBGB 2X8AA 3WNCA 3PR1A 3NHBA 3KTAB 5EZ6B 5HCIA 5TDHA 1SVKA 1Z3IX 2F3TA 2CVHA 2JASA 2FV8A 2QROA 5B57C 4KLNA 2JLXA 1AK2A 1IN4A 1W5TA 2QPTA 4M9XA 4B3CA 2JJ2A 3M4YA 2NO0A 1HEIA 1N0WA 2RHMA 4D82A 1G3UA 4QJ5A 1W4CA 3SJBA 5FBWB 3GLFE 1W4RA 4UNQA 3IO5A 2ZRJA 2PX0A 2QTVB 2GBLA 3GFPA 2ZI4A 3IEUA 3R9WA 1G7TA 5DO9A 1YRBA 3TVTA 2ZETA 1MKYA 2VQSA 2W2XA 5JFGA 1UEJA 2OAP1 3N2IA 2QEQA 2QBYB 4Q4AB 3IIMA 3GLFA 3OF5A 1N2CE 2L0XA 4EDHA 3KQKA 1LF5A 1S9DA 2DFKB 2O0KA 2MMGA 3D7MA 3L8YA 4OI0A 2KBFA 3LH5A 4RFSB 3UIEA 4EFNA 3BWDD 3UATA 1FNMA 1N5JA 3X1WA 2W6ID 2ZE7A 2P6UA 2VHCA 4GOJA 3GLHE 4PQRA 4UJ5A 4JLJA 2WOJA 5DIFA 2XXAB 1GAJA 1YZTA 4LYFA 4Z54A 2BDTA 5FUVA 2BBTA 2GJSA 621PA 1EESA 1KHTA 4NKRA 3U7HB 2C8VA 4YC7A 1Z22A 3IPXA 4RY2A 2W58A 1N5KA 2Z5FA 3AF4A 3WBJA 3RC8A 3LAWA 3Q5EA 4JYCA 4LJ9A 4H1UA 3U7EB 2NMVA 3GLHA 3RABA 1T9HA 2GZHA 1RYFA 1G8GA 1AM4D 1HQCA 3B2EA 4HEJA 3CX6A 1KGDA 5L3VA 1N5LA 4AD8A 4B47A 1S0UA 3FHOA 4HUQA 1EX6A 1JNYA 1FQKA 1G19A 3N5CA 4C7OB 3U44B 3AQ4A 1Q1QA 5J4YA 1MT0A 1ZM9A 5FBVB 4PXAA 1T8UA 3TK1A 4WA7A 3ZZ0A 2OG2A 2ZJ2A 4X8LA 4B3BA 4PR0A 1U0HC 5FPKA 1OKKD 3CWZA 1JXOA 4BZQA 1TUEA 4RZXA 3HP1A 1CR1A 2CBZA 4DCVA 2ASEA 1UM8A 1G8FA 1UPTA 3H2YA 3F5FA 1J7KA 4BFTA 4D6PA 2V4ZA 1N6LA 4Q4JA 5JEDA 4QM7A 1SXJA 3L43A 4LYJA 2VHTA 1SVLA 1E9SA 3WNBA 1YZLA 1RW4A 1OH7A 3ZD6A 1OPXA 2LKCA 4DJTA 3ETLA 1IY1A 1CR2A 4GRAA 2BBOA 3TMKA 2HYIC 2WHXA 4DEXA 1W0KD 5DISB 4LBYA 4QKQA 5KSYA 3DL0A 2JIZD 2ZRCA 1XEWX 3PCRB 1ZM2A 2J5XA 1MO6A 2ZI9A 1W2HA 4JVLA 6Q21A 2D7DA 1EFHA 1XMVA 1WB9A 1E2LA 4XD7D 1H8EA 2RGEA 4GI7A 4TMXA 3CX8A 3X1ZA 1ZCBA 5P21A 4A8JC 2WWWA 4BZPA 2FEMA 1JEDA 1T5LA 1G41A 5C46F 1NVXQ 4TQUS 3MLEA 4LK2A 3K9LA 2GRJA 2GZDA 1P7CA 1KAGA 2BJWA 2ZITA 2I4IA 3GLGE 1P61B 2PBRA 2R6GA 2H7VA 1KI8A 5A5GA 3QPVA 4XIGS 3L0SA 1T3SA 2NOAA 3QKRB 1KDRA 2AFIE 4LY6A 1ZJ6A 3OEED 3E5HA 2ZRMA 2DPXA 4R71A 1NI3A 1X8JA 2OLJA 2J87A 3QF4B 3PXGA 1W36C 5EQTA 4D4KA 1UKYA 3MAAC 3BRWD 3H86A 1SZPA 2HJGA 3U60B 4BFWA 3GLGA 1E2QA 1H8HA 1TADA 3LQQA 4LPKA 2FFBA 5DNYB 3GD7A 1TX4B 3HU3A 1IONA 1FUUA 1HUQA 1VCMA 4C2TA 1OHHD 4RFSA 5JSZA 2WAXA 4PAQA 1R7RA 2RGCA 2IYQA 2H1LA 5ELXA 1ELOA 1XCPA 3ECCA 2XTZA 3FTQA 1N25A 1FTSA 2QN6A 2VL7A 5JHGB 1KK3A 1YJ5A 2C04A 3ASZA 3NTUA 1L4YA 5HZKA 3CRQA 2EWWA 2GBLC 1NBMD 4GP6A 3GJ0A 3T1QA 4AC9A 4HDCA 4Q19A 1PJRA 4FI3C 2GZAA 3TUZC 2WPDD 1KDTA 4DC9A 5A0FA 2F43A 4BUJA 4EIWA 5G3ZA 3GPLA 2EWVA 3AKYA 3CLVA 3O8CA 3O47A 1MO5A 1EG7A 1GZSA 2IF0A 3OIUA 3FFAA 1GM5A 3IO3A 1YKSA 4DWJA 4QG7A 3N2EA 2GJAA 3PUZA 5FR1A 4ZPXA 1TTTA 1I2DA 1E94E 3QG5A 4MDFA 1W48A 3I62A 3OIVA 2OESA 2XTMA 3LFUA 4F93B 4I1SA 1AA9A 3VHLB 3PUXA 5GJBA 3IBGA 3U6KA 2VP6A 4Z8YA 1MRSA 2FPLA 2WWGA 5KNBA 4B48A 4QGGA 1PVOA 2VHQA 3B1ZA 1COWD 2NIPA 2IYRA 1O87A 1WP9A 4KAXA 4PO8A 4HZUB 5GVRA 2VP9A 2D62A 2ZROA 4P31A 2CXXA 1PLKA 2ERXA 1VCIA 2PT5A 2HXSA 1NIPA 1AGRA 1ZAKA 3DMNA 4EFLA 1JJ7A 2W00A 2AXNA 1M8PA 2XSZA 2IS2A 1G16A 2H17A 3NXSA 1DAMA 2VF7A 2YOHA 5GJCA 2PMDA 1NLZA 121PA 2JLZA 2NTYC 3UWOA 4K8OA 2RGXA 4A6PA 2IYTA 3RRMA 4LC1A 1VDZA 2TMKA 3SC3A 2CK3A 4HAWA 3W6NA 3A4LA 5TARA 2IBMA 4DLSA 4US2R 3OAAA 4HATA 1OF1A 1ZIPA 2ZYTX 1XMJA 3IIJA 4M1SA 1E2GA 3CWQA 3CNNA 1KZ7B 2RGNA 5F9FA 3SDZA 1SXJC 3K0AA 3P4XA 1XEFA 3TH5A 3ZIAA 3SQWA 5H68A 5AUOB 1VHLA 4ABYA 4CEHB 3EZ9A 1CIPA 4BASA 3SHFA 4EKDA 2XZLA 4ZKDA 3WYGA 2WOOA 1G5PA 1IAQA 4II7A 1OXSC 3MD0A 3EWSA 4MRNA 1W0JA 1QHIA 2RHDA 4OI1A 3WXMA 4FWTA 1TF5A 4JVNA 3QNUA 2QU8A 2P5TB 3RNLA 4DLWA 1ZW6A 3DKVA 1ZUHA 1NG1A 1HA3A 1DS6A 3GJ4A 1G3IA 1JQLB 3FDIA 2F9MA 5CK4A 4B44A 4XSGA 1RPZA 3Q72A 1E1RD 2R2AA 3I5XA 4F4JA 2GILA 1GP2A 1G8YA 1RKBA 1KIMA 4MGKR 4C4PA 3ZVNA 4JL8A 1E9AA 4Q66C 5FUYA 4CIDA 1E2PA 5IF9A 3SU8A 2QM8A 1V5WA 2ZJBA 4BWYA 1GL7A 2X1VA 3WMFA 2AL7A 4DCTA 2XJ9A 2DBYA 3ZQ6A 2ZR9A 2Z43A 4KITB 3U4QB 3PENA 1UAAA 2V8OA 4US0R 1GKYA 2YWGA 1NBME 3KKPA 4P3YA 4MRRA 1U94A 4K46A 5AJXA 4NONA 1Z6AA 4HAVA 3GJ8A 2CL0X 1P9RA 3TR0A 1WBBA 1KO8A 3W8NA 2CLSA 1U81A 2O8DA 3FKSA 3EASA 1HH4A 1PUJA 3TUIC 1W47A 4OKSA 3CR8A 2N46A 2CCKA 2KJQA 4ILEA 5KPDA 4A15A 1GIAA 5L8VA 2XGJA 3MG9A 2CJWB 1XD2A 2ZSAA 3I8SA 3BS4A 4K81B 4BLOA 4BEBA 1KY2A 4CT4B 1C1YA 1YZQA 4JKIA 1W4BA 3T12A 1I4DD 1WE2A 2IYLD 1P2TA 3A36A 2P3SA 1M74A 1UADA 4U00A 1NP6A 3NKVA 1T6NA 3ASYA 2YWEA 1W46A 4JIMA 2CLCX 2G1KA 5E95A 2Z6VA 3ZJYA 4V0ME 2QAGC 1BO6A 2FG5A 2YWHA 2B7CA 4PAOA 5AJYA 1P2VA 1ZU4A 4C3ZA 4P32A 1OH5A 3TQFA 4TTPA 3LX8A 4LV6A 1YE8A 4GOXA 3TQCA 4MA4A 1YRAA 4LJ6A 3S1AA 1U8ZA 1VG9B 1W4AA 4GNKA 4AI6A 3D8BA 5SZKB 5F98A 3NDPA 2GAAA 4JMPA 4QBHA 4QOSA 4XTCS 3VR4A 3L8ZA 3DM5A 3GJ5A 3M1IA 2ONJA 2J0SA 1KMQA 3D6TB 3VNVA 1QHHB 4Q7LA 1XTJA 3EIHA 1SHZA 2H5EA 4QJ4A 5E3HA 3LO5A 2QMHA 4JT4A 4YXWA 5FOTA 4C0SA 3C5HA 2G83A 4IVPA 1S8FA 5CDFA 3SNHA 2KWIA 3K1JA 4JKYA 1R4AA 1AS3A 3UMSA 3RHFA 4PO9A 5DYGA 3Q3JB 1CJTC 1E4VA 2XZOA 5UKDA 3VHXA 4CYMA 2RGAA 3SJAA 2IK8A 1WCV1 2QRZA 1EFUA 2IWRA 4TMKA 1NLYA 5KPJA 2GCPA 1OXXK 2AKYA 1JALA 1QBKC 2V55B 2NO9A 3KJIA 2QZ4A 2FX3A 1VKJA 2FFQA 5SZIA 3VR1A 1L7VC 4LV8B 2BBWA 2B92A 4V0LA 4NYJQ 5KSPA 4H1VA 3LQRA 3T5DA 4V0OA 4U02A 2BCJQ 1KOFA 2ATXA 1A2KC 2IW3A 1G7SA 1H65A 4OJQA 2FOLA 2QI9C 1U8AA 4F7WA 1P9WA 5FH9A 4MDEA 3E1SA 3AP2A 2J59A 2O8CB 4TT3A 4HI0E 3MRSA 3OFNA 4RD3A 3QPUA 5DN6D 1KKMA 3L82B 2Z4SA 4KXFB 1KZGB 1FX0A 1CULC 2X2EA 4WZAE 5JHHB 1PLJA 3WMGA 1YZNA 2VHUA 3KKNA 2NZJA 1G9XA 3U4QA 1DPFA 1S1MA 1K5GA 2EFCB 1OXVA 1Q44A 3VFDA 4YMTA 4AG6A 1IJEA 4AWXA 5C1BA 4CEIA 1W1WA 2UKDA 1ZD9A 3AF3A 1FOEB 1G4UR 2ODBA 2WV9A 5JZVA 3OEHA 3BE4A 4Q03A 1N6IA 2IUUA 1FUKA 2CDNA 1KYIA 2FZ4A 4PC2A 4GDFA 2CLDX 3THWA 3QSYA 4JVSB 2WJIA 1Z6TA 2QT0A 3K0CA 3DO6A 4HB0A 3THXB 2CJWA 1YR9A 2C95A 2HYDA 2VEDA 2Z4RA 1DARA 2VSOA 4M1TA 4B2PA 1PV4A 3HR8A 1UKVY 1GKUB 3NC1C 1GNQA 2HJVA 4DBLC 5FTNA 1Z29A 4JLDA 2IYUA 2PMKA 1II9A 3LBNA 1ZD1A 1OFHA 3J81k 2OCBA 1E1QA 3P32A 1T5IA 3CH5A 2FN4A 3SFVA 2ANCA 4OK5A 2WWHA 2ZSDA 3IDQA 2PH1A 2JLUA 1S96A 4PHHA 3B9PA 1FZQA 3G82C 3ZD7A 2DFLA 2Q3HA 2VTKA 5KDOA 5LB4A 1NMZA 3QOFA 4YLGA 2GHIA 3C4JA 2VIIA 1IM2A 1AZTA 1BS1A 4B74A 2QRNA 1NKSA 2QG6A 1KKLA 3RS3A 1NY5A 4BLRA 4A8JB 4NP6A 4D4LA 1Z0JA 4BFSA 4WIAA 3KXIA 4QGHA 1K8RA 2JGNA 4LC0A 2G9NA 4KVAA 2F1RA 2V6IA 1YZUA 3VU9B 3C41J 2Q6TA 3BB1A 4N0DA 4NCKA 2OBLA 4ZV4A 1ZM3A 3KQLA 3CRVA 5JBQA 5IK2A 3AH8A 8OHMA 5DHAA 2RMKA 4Q7MB 1MR3F 1OXTA 1KMHA 3W34A 5FI1B 2GJ9A 4ZIRB 1BOFA 2EFHB 4JJZA 2GCOB 4LUCA 1JXMA 2VP0A 1FFHA 4OYHA 5KU1A 3OIYA 2J0UB 3MCAA 4G5OA 2XX3A 2H16A 1NVWQ 3KKQA 2JDID 3B1WA 5J5CA 3BH6A 2C03A 2MMCA 3VAAA 2WWIA 3N70A 1NJFA 1F60A 1CR0A 1Y3AA 2F1IA 2IF2A 3U61B 2IWHA 4IJMA 2JLVA 1F3OA 4A0GA 1CKEA 1E2KA 1FP7A 1UJ2A 2CEAA 4L4UA 3SI7A 3R8FA 3A1VA 1GITA 2CNWA 4NCJA 2VHJA 2C96A 1E0SA 5JLJA 3THYA 4P4TA 2F1HA 3L2OB 5CIQA 2AD1A 3I73A 2A30A 1NKTA 5HKKA 1SKYB 1U9IA 2EFGA 5CYPA 2XNDD 4QGAA 1ZC4A 5FI0B 1OT3A 1XDBA 4V0KA 4CT5A 4YMUA 2VSXA 1NN0A 2W2VA 5AUPB 2ZSFA 1Z63A 2WWFA 3A4MA 3OE7A 1OH8A 4TLAA 2HLDD 3CPHA 4OHWA 1RRFA 1SHKA 2ZJ8A 3BFVA 2ZSEA 4O0MA 1OIVA 5EP2A 4PANA 4A0FA 3ZVRA 4Z1MA 1IJFA 4LJYA
chains in the Genus database with same CATH superfamily
1M8JA 3RSCA 3WP1B 1AB5A 3VI3B 5C1OA 3JZAA 4KR7A 2P77A 1LQUA 3I53A 3G1UA 1RBQA 2YZKA 1ZWLA 3OHPA 2YFHA 2BFEA 4Q1EA 5ALPA 821PA 1U90A 3EPHA 1X1TA 2QQ0A 3G2KA 3GDFA 1VB3A 2L19A 4MV5A 5AKJA 3T7IA 2BWJA 1U04A 3PJDA 5KEIA 1IRIA 5KX5F 3FNIA 3RTAA 1V6SA 2H9YA 3TAUA 4PRLA 3WWDA 3P26A 1GRNA 4FIDA 2WRZA 4JI6B 3KQUA 1ZISA 1A7KA 3P2KA 4H59A 2GOYA 3G1TA 1TUIA 1T2DA 4BLTA 4V1CI 3NHLA 1WABA 4F3CA 3KOUA 1XYYA 3UJ7A 4RGVA 1I8TA 2EFEB 4JBNA 4AIRA 1VKNA 2JHFA 2MSNA 1E3IA 3AFHA 2FZ5A 2B82A 2PZLA 4I8DA 2VH5R 1ODKA 4L1KA 5ARBA 4C4RA 4BS9A 3KFVA 1QZTA 1M2OA 4K2HA 2P9GA 4B6EA 5DTIA 2XAAA 2HU7A 2MINB 4AUMA 3NWOA 1H2XA 4TYNA 1ZVKA 4NCHA 4CEJB 4P0TA 1GYPA 4TSFA 4G5SA 5KTOA 2O8BA 2WQ6A 2SKCA 5C7IO 4MWZA 4LMBA 2AI2A 3W77A 2DQKA 1L5KA 1HLFA 3LVBA 1OMOA 4LJ5A 4W8OA 4JLKA 3QXGA 4B3JA 1LU9A 2GAOA 5K8VA 3DHNA 1DAIA 3O1JC 5EHQA 2DFTA 4JIGA 5COBA 1R2QA 4MGYR 2QVBA 4OHFA 1Y5RA 5C4GB 3DWFA 4XVUA 2EZ8A 1HL3A 2M6RA 2R66A 1R5BA 4MW9A 1PD1A 3DOIA 5F4ZA 4G5GA 1C3VA 1EDOA 2QAJA 4JT8A 4ZJZA 5LPNA 5LWQA 1J22A 5B7NA 2I3GA 2PK3A 3HFSA 3K0KA 2XB8A 3LCCA 1FFEA 1VBFA 1W6UA 3CZ4A 4K9KA 4PZ9A 2YRWA 4NHEA 1LD3A 1RU3A 4ZQEA 3WI7A 3CKKA 3U1VA 4ZDIA 2QQGA 3DTTA 5T8KC 3MLAA 4BP3A 4LWZA 1Q0LA 5AI6A 3LE8A 2BC9A 3PDJA 5F1YA 1V41E 5IVDA 3NFYA 4I50A 3Q8WA 2VVTA 5E4JA 2HQSA 3FPAA 1SKYE 4Q18A 2IV2X 3DONA 3WLMA 5BSEA 1QB7A 4DR2B 1Q2XA 5KHAA 4DW8A 3VBCA 5BV7A 1NW5A 1AURA 3GELA 3LLSA 3TSZA 1VL8A 2DOKA 4A2QA 1ATZA 6NULA 2QVZX 3WYDA 1GOTA 3HJRA 3E58A 5TF4A 3W90A 1XHEA 5T64A 3TNYA 3A1UA 3K0HA 4EHLA 5FYDA 1YB4A 5TGTA 1TK3A 1SUCA 2ZEJA 3LM8A 3C8HA 2OORC 4S2UA 5BSTA 3EDQA 3KT6A 3CF0A 1Z47A 2WZQA 3WMWA 4PVDA 1AIPA 4YI5A 3OQNA 2BMFA 2XKAA 3D54D 3TINA 2YHIB 4D6XA 5CB4F 2P91A 2RGWA 1NVUQ 4TRMA 1Z68A 1A69A 1OYOA 1W96A 1YHYA 2A1TR 2GPTA 3HI4A 1Q7EA 3LJKA 1FTGA 4MWBA 2NT4A 4QL3A 4FNAA 4TL6A 3Q9SA 1XF1A 2WU0A 3VR2A 2VHWA 3W06A 2ZKIA 3D64A 5CIWA 3T7KA 1FF9A 1Q3TA 3CUKA 4UOQA 1F20A 1YQUA 4EY4A 4FDLA 1D09A 3TUJC 4C5CA 1EIZA 3UT6A 3B6JA 2J5BA 3N53A 2HA3A 2IXAA 4FOOA 3QVSA 3H0CA 1NN3A 2G4CA 3H9EO 3GVHA 3KOXA 2V45A 5L53A 1J6UA 1G21E 2QTCA 3FZNA 5FWYB 3VSBA 2WY2D 3ZXIA 2BF7A 1GFSA 1OBFO 2HK8A 1KERA 2EU8A 2YYSA 2H06A 3L7AA 3MFQA 4JJEA 4R1MA 1XD9A 1G6HA 1Z3CA 4FT2A 4BRUA 1THZA 3I9NA 3PR2B 4JJ4A 4IH4A 4DCCA 1G18A 3Q12A 1WB6A 1DBSA 1WF6A 3H2BA 2A2ZA 4Y2YA 3OA0A 4D98A 5JUWA 1VYTA 5B2EA 1DWOA 1FJHA 3A0RB 3D4BA 5FUWA 3H9GA 4ITRC 3OQOA 1XZLA 4XLLA 3FI9A 2BTOA 1CV2A 3JU3A 5H70A 4MCJA 4CKXA 2VF8A 3KDAA 1TU4A 8LDHA 1LPPA 1NU8A 3IIIA 3L01A 2CXUA 3ESXA 1Z4MA 4RDXA 3SICE 1J5XA 4HGYA 4D4MA 1PK9A 2ZGVA 3PNMA 2I0FA 3MNFA 1BDIA 1BHSA 2BMVA 4MB0A 5DMHA 4E32A 1UMCA 1SCAA 1IUNA 2W6ZA 4IDOA 3SEFA 1V6CA 1SUDA 4MKIA 1GQRA 4HLQB 2JIPA 3G0HA 2Q4OA 3OIGA 4Q21A 3K5IA 3DZGA 4BLQA 4EA7A 4EVRA 4H6WA 4TTIA 1R5NA 1G9TA 3GJ7A 4TM7A 5AKEA 3ZNNA 1HE8B 1KHHA 3OZIA 1L8AA 5IG2A 2VYVD 4B6OA 4CFZA 2YVUA 1TUBB 4ND4A 2ZREA 1T0JB 1T4CB 2E4ZA 4K6CA 4AJ1A 3U16A 4CI0B 3P9NA 2EDCA 1Q0RA 1ADCA 2QY9A 2XB9A 1PR9A 4UEOA 3TQTA 1NPYA 2VH2A 5E6SA 1GEEA 3UM9A 1H2EA 2G8NA 2E49A 3BA6A 1RAAA 5CT5A 3SS7X 3FMOB 1J0EA 1IOVA 2UZ3A 3M5DA 2HSGA 2WZDA 1EVYA 2IEDA 1FPMA 3BXEA 4H3SA 4NU6A 5JO9A 1E9CA 1STOA 2Y1DA 3P0FA 1IHDA 2R6HA 1B1AA 2I8LA 2O48X 3GJTA 4IDFA 2RHHA 5EZYA 1WXWA 5AHKA 4WNIA 4H7EA 2X14A 3IUMA 3O74A 5JQWA 1LKZA 3BJIC 5FQOA 1C9JA 2H1HA 5HOQA 4B7ZA 1YRYE 2PFGA 5TB5A 1RRCA 4GMFA 1XTPA 2DHEA 2QBYA 5BSHA 3M1AA 3ISVA 5ENDA 1QGUB 5AKGA 4KTTE 2R7NA 4XIFA 4E4TA 3T5PA 2ZQZA 4PRZA 2AF4C 4X3CA 3UT5B 1NJ8A 1E3TA 4AAYA 4CMCA 3BIXA 3L0PA 2I62A 1M2NA 3LPLA 4UXHA 3L7BA 4S1VA 3SWWA 1CDOA 2J0EA 3PE4A 1GCIA 1GILA 4R8SA 2CUZA 4JA0A 1Y1SA 1DMRA 1V7CA 3G59A 3ZHCA 1QK3A 4JJ8A 2AW3A 4U0JA 5GIOE 1PYGA 1OZHA 2PR7A 4RPJA 5FADA 4BMZA 2OHHA 4YRAA 3S2IA 4XX0A 1XQ6A 421PA 4FSHA 5ERGB 2PZ8A 4IXNA 4LSZA 4ZALA 3T99A 4CQMD 1CJVC 1YQ9A 1QZXA 2FETA 5KQPA 2QLMA 1Z2AA 4XGKA 5MFZA 3OTOB 4RY9A 4HNGA 1DDIA 3DBRA 4IXMA 4W6QA 3S2UA 5IYZA 3UMBA 4RULA 2OK8A 3K6SA 5DW3A 1RP1A 2TMYA 5E2IA 3BKXA 3VDRA 1T91A 1AKTA 1THTA 1VMIA 1YJCA 2VTVA 3EA0A 3EGXB 2I33A 1LSSA 3UFXA 2YRFA 1R3UA 4INZA 4R2LA 1XZMA 1DTSA 2FJUA 1M72A 3AR2A 5E1MA 5ILQA 5EPEA 1GPLA 4RKYA 3FGNA 2FP4B 2RK3A 2H2IA 3PFBA 3F0TA 4GE3A 1FRFS 4JOSA 1L4NA 2FPOA 2GPSA 2X0JA 4B2IA 2BFBB 3G6WA 4TYYA 4J0EA 3U44A 2XVMA 4G81A 2W90A 1ZCAA 4UFPA 2XYVA 4XOUA 1PFVA 1OLSA 5IT5A 2WTUA 3V5NA 3PFKA 4IHJB 3RRXA 1QU2A 5DNDA 5J2TB 4GWLA 1R8SA 1VPTA 1YQGA 2YXLA 1GGKA 3KUCA 4ZOLF 3D1LA 1RE1A 3L4JA 1YKGA 2O1EA 2HT6A 3F96A 4N5IX 4OXNA 1VL2A 4RVCA 5DT2A 3STYA 2CXPA 4NDNE 1IZZA 3UICA 3VR5A 2Z2ZA 1R0KA 3H1GA 4YXFA 1P8JA 1V1MB 4IMPA 5BWNA 1FNNA 5HCNA 1Z8DA 3STTA 3UKOA 1H94A 3LZ6A 4K7JA 3KEOA 5E6UA 1WP4A 1K89A 4DREA 3OX3A 4GRIA 2CHQA 1YL7A 3W2GA 4BNKA 4BO5A 4RX1A 3UANA 1OU4A 1KS2A 4X63A 1TJYA 2Z2IA 3BGWA 4UHBA 3ZU6A 3HH8A 1IJBA 1FFXB 3IRUA 4IGAA 4MQBA 5EERA 4PINA 2PQ2A 5JSHA 1OI2A 1U31A 1ODTC 3LLVA 4FYYA 4GXRA 5E3IA 4BQRA 1E1CA 4RD4A 4ZEXA 5DBEX 2PUDA 5L3QB 1PNVA 5BO5A 1USKA 4FYHA 1XAGA 4Q4LA 3WRVA 4BE7B 4RGYA 3FFTA 5A02A 3GFBA 1XEAA 3PCXA 3EFHA 3HY3A 1JA0A 1NX6A 1NQTA 2B5OA 1M2KA 2PXXA 2AN5A 1FL9A 3KUUA 2FMXA 3NTLA 4RVOA 4AS1A 4W82A 4FBMA 1KO7A 1SOVA 1A88A 3OX1A 2ERCA 5B30A 2CVFA 2MIIA 1HV8A 3FPBA 1G7CA 1DIGA 4R31A 1OBHA 4R41A 4TTRA 4X84A 2IZ1A 4TLBA 1IULA 3ZZUA 3RFFA 4NCNA 3SR0A 4X1YB 3WK6A 2WHPB 2EIHA 3HRKA 5IAAA 3QTTA 3MFYA 4U9HS 4NQRA 2HDNB 4RV9A 2E18A 4DBVO 1DT5A 4JWKA 1KI6B 3AB8A 2FWNA 2ZRQA 4C0KA 1LY1A 3QF4A 1JDNA 2OXFA 5JAUA 2IXTA 4P80A 1FFAA 2JA1A 4I4TF 2GHTA 1QG6A 2WD7A 4LISA 4FHZA 4N0EA 4QXRA 1Y89A 2Z3ZA 1N2HA 4MLPA 4XPIB 3AHCA 1G3MA 5JECA 3GT4A 5TMPA 4UEWA 2QA5A 1FRQA 1NSFA 5KQLA 3ETEA 4YAGA 1WW8A 3GYBA 5BV8A 2DBVO 2NZWA 2FQXA 3L7JA 1ODFA 3SEAA 1TGYA 4HDSA 1SUFA 3IKJA 1UPUA 2G1AA 2KB0A 4IG9A 4XH9B 1SQGA 1T5DX 4C5BA 1KI7A 1EK2A 2F64A 3Q8KA 4G85A 4YQFA 3R5JA 5FI5A 5H7XA 4RC9A 1IK6A 5FLYA 4EJMA 1R0LA 1EXNA 2JAPA 1DNPA 1XGKA 2ZYHA 3AU8A 4M1ZA 3PL1A 2Z6QA 1TLTA 2Y93A 1RMYA 2XRYA 3PC3A 4YP1A 1QTQA 4ERNA 4RHUA 2IX3A 3P2MA 4ESVA 1JMYA 1GDHA 4CG2A 4UMDA 3VC1A 5BW5A 2OHJA 4BUCA 3LNCA 1KNQA 2JK1A 4AYWA 2RJNA 4W8GA 1AHPA 1DAPA 1YZFA 2FPGA 3A6GA 3RC9A 4DOMA 3MTJA 2IE0A 3V6MA 2VZ0A 1Y37A 4I36A 3TQIA 4E2YA 5I7VA 1IUKA 4KODA 2K4MA 4IVQA 2HCBA 1HLDA 1UT5A 3QBEA 4PHGA 1T34A 2B69A 3DE5X 3EW9A 3MGKA 4CKCB 4IIGA 1C0LA 2DPMA 3WAGA 2QX4A 3AI2A 3O93A 2WF7A 3GNLA 2BFDA 2NG1A 2GT1A 2X1HA 1A9PA 2E89A 3W7BA 3CZ5A 1IY9A 2IXDA 2ZRDA 4NK4A 3UA4A 4M8NE 3UAVA 3WGNA 1ZM4A 3C0KA 1PR6A 1KI1A 3CNHA 3T1NA 3UEOA 3QEMB 4D97A 2PCLA 1UEXC 3OQIA 3LECA 2BFCB 3KSRA 1NQVA 4NEGA 1T3HA 4OQLA 3JQ8B 2DLDA 1P19A 3ZI4A 1R0XA 2D2EA 2NV6A 1Z88A 2DWCA 3OO1A 1B2LA 1GARA 3ANTA 4UBIA 4HNUA 3WVNA 2ORIA 2VKQA 1VHJA 1TM5E 2OO5C 3DP7A 1LCIA 2JIDA 2WFZA 4L4YA 4MS4B 1V37A 2GPAA 4YS6A 4Y2TA 5FHRA 1AC5A 4EG7A 4O4LF 1N6RA 3C85A 1COWA 2XA9A 4G2TA 4JYBA 3TZQA 3A70A 1VL6A 4DHWA 4F1JA 4UC0A 1CQWA 2VJMA 4JHXA 1A5ZA 3EXFB 4PWYA 2C4MA 1EKXA 5KWSA 3QBDA 3B1YA 3I1JA 4EPVA 1IL0A 2I3DA 3ZI7A 1JMVA 2H59A 5K4AA 4EECA 1UMBA 3UHAA 2ZXFA 3OT1A 1CQIB 2Q3LA 3HYCA 5FRDA 3N7UA 1SULA 2CMHA 5H3HA 4BRZA 4HBGA 3DBLB 4G5RA 2AEEA 2FFJA 3EA4A 3OC6A 5FBLB 1V1RA 1VL0A 5LJLA 1ULHA 4N03A 3PNVA 1K6JA 4BPBA 1M33A 2FX2A 3KXPA 1TAQA 4TS1A 1U99A 4R54A 4MKZA 5TGZA 4WGFA 4PSAA 3PD0A 5BN3B 2QTRA 3AM5A 3OZBA 3M5WA 3QVXA 5KC9A 1ZONA 3R3HA 2ZIXA 3GJ6A 1G59A 4V2UA 1JWBB 4KMSA 4OI4A 4PEVA 5HUHA 1IQPA 4NK5A 2GRUA 4X41A 2E6KA 5E2AA 2QSYA 3RD5A 2UZIR 3EZFA 3A0UA 5EWMB 4J0GA 5DJ5A 3U3RA 5SY9A 2IZZA 2GO1A 2ZKLA 2VJCA 2HA5A 4UNSA 2RFLA 2OT3B 2CNNA 3OEWA 3Q7PA 1F2UB 4BFUA 9ABPA 1N6NA 2NLOA 3ED1A 5A4JA 4FFBA 4OLBA 2I22A 1CXZA 1JH8A 3QUCA 3T9FA 2OECA 2BIFA 1J2UA 5CURA 5TX7A 1Y1LA 4N82A 2SBTA 2QNIA 5FOUA 1P45A 1B0UA 4C6TA 5B58C 2BYTA 4ZVSA 4YDRA 2LCFA 4C01A 2P2CA 2VTBB 3IURA 1AQIA 1Z6QA 3ER8A 5B3JC 4ROTA 1X9GA 1Y1PA 2CWWA 1BHO1 2Q5QA 2ZJZA 5LMUB 3FBWA 3JZMA 3R0VA 3RAJA 1ST3A 3JQ7B 3WGTA 2WSIA 3HR7A 5JS6A 1F5NA 4Q9AA 2O8EB 4ARIA 1OFIA 5EWLA 4EZIA 4PONA 4ZTBA 2VP2A 3MJRA 2UUAB 3PQ2A 5LD2B 1OBOA 2JBAA 3GGOA 3TR6A 5KYGA 3NH6A 5CEFA 1NDHA 3DT6A 4Z4QA 4I55A 4XYGA 2REBA 2QN9A 4MW4A 4Q1VA 3QE4A 1AUVA 5TQJA 1ABFA 3PZRA 3K2BA 3NRBA 3OCCA 4OQPA 3JYPA 3QEOA 3OZCA 4CTKA 2VK2A 2AFVA 3PIIA 3H87A 3F6BX 3B2QA 1KK0A 4DIDA 2YUIA 1B6SA 3IT3A 4DNXA 3IDFA 1OPRA 3KJFA 1WPXA 3AEXA 3CRRA 3FOBA 3STWA 4W5NA 3PS9A 2JL1A 3M4ZA 5REQB 4A73A 2IIVA 2ZYUX 1HQKA 5DTEA 5JWHA 5AW3A 5JEEA 5KJFA 3ZBQA 1NVFA 1SUBA 1XLUA 1MZPA 4CIBA 1AMOA 1FLAA 2C0PA 2A5JA 4B1FA 1IQUA 4ALNA 4IRUB 1BYIA 1EVQA 3PNOA 3RVBA 4F6CA 1Y8QB 6REQA 3RGWS 4C14A 1QFJA 1OVMA 1U2PA 2F1OA 3RJ5A 1DEOA 3UZUA 4EHJA 1J99A 3EIFA 4CMBA 1JR2A 1RAGA 3E2MA 1LPMA 2BHRA 2JJ1D 1YA8A 1Z7GA 4Y7DA 3ST7A 1W36D 4IEFB 4GXNA 3OHMA 3IGFA 1Q1EA 1J5PA 3OZDA 4C0BA 5JNLA 5ALQA 2BONA 2J5QA 1TFRA 3CUSA 3KJQA 3KVNA 4RTMA 4H7KA 5INTA 1FDWA 1IEVA 1QM5A 4WVFA 3OJCA 2RHJA 4DMCA 3WGIA 4U7DA 2PUEA 4QRIA 3E9YA 3MUOA 5KYXA 3D8NA 3MOIA 1PR0A 4YJ3F 4GRDA 3WICA 5JC1A 2ZJAA 3IXLA 1CLEA 1C7IA 2NO6A 1D0VA 4BRWA 1ECFA 3GCXA 4IIYA 3R9KA 1G1AA 4DUPA 3RE1A 3KE8A 4IIVA 4IJUA 4URZR 2AJDA 1XWWA 2X3FA 1M1XB 5DLQC 1YULA 3NHPA 1KYXA 1NL3A 5C2JB 2MYNA 1DVRA 3JQ9C 4L5IA 1I7SB 1H1LA 1P3Y1 4ZVRA 2Q4EA 3F49S 4H7DA 4UULA 1YR6A 4TZ0A 2ONKA 4QXAA 4XQCA 2R3SA 2WA2A 1MO3A 2XMGA 2XWSA 4DV6B 1ADGA 3KD2A 3LW8A 1XVUA 1NJSA 1BS9A 2JGIA 3BX1A 3UG7A 3UHJA 5JH7B 1C9DB 3N28A 1KK2A 1JAHA 2OVFA 5F12A 5EIWA 4XCQA 4DHEA 4DZRA 10MHA 4AKGA 1XL1A 4IWYA 3ZHZA 3G13A 2GGSA 3A3OA 2WJVA 1P4RA 2C5BA 4UUNA 2G63A 1JBEA 4NPCA 4OH1A 2CD9A 1B43A 4MR8B 4AUNA 2NPFA 1WU8A 2IEZA 2J85A 2P30A 2WHYA 2ZWPA 1XG5A 1VLVA 4W5OA 5J23A 3GLFB 3DAGA 2JFBA 1EUZA 3B51X 3P9CA 1N2IA 5DASA 1KE2A 3UO8B 2JLWA 4P5PA 1HRDA 1BXGB 1FDOA 1KI9A 1M75A 1F6DA 1GEGA 1U3DA 2IOFK 4ZZIA 1U5AA 2V98A 4DXAA 3G1WA 4CKWB 5B6JA 4HDKA 3HN2A 3B82A 4Q37A 2FR8C 2IOYA 2I6QA 3AZOA 2A1IA 3N7AA 1JG6A 3KXDA 1IVNA 2CFSA 3PQ3A 1OBCA 2A33A 5F9MA 4Z9XA 3AFGA 1CS0B 1LBSA 3GRCA 3H11B 3LPMA 3N05A 1CQPA 4GYJA 4JX8A 4XJVA 2CUTA 3WBBA 4EPWA 1JBKA 1V8PA 4BVFA 4R2XA 2JLYA 4C78A 5K8IA 3ND9A 4Q34A 1ZD8A 2VZEA 1CUWA 1CSEE 2WK1A 4BMXA 4MVJD 4OHPA 4CUZA 3I6ZA 1N5IA 5CCEA 3B9BA 1DO0A 1JHYA 2OYCA 3T5BA 2FSPA 1SQSA 4HB2A 5JJKA 4GYWA 2BUCA 1NN5A 3HMQA 3LUPA 5CNIA 5GP1A 3TRFA 3EQZA 1I3KA 1SVWA 3IDAA 5EE1A 3T3GA 2VTEA 2DB3A 4KQ2A 1JE0A 3K1AB 2Q0QA 1DEHA 1L8OA 2ZRNA 5HKOA 2IXEA 3GMSA 2HBYA 1L5GB 5CVUA 2ZDQA 3MMZA 5H3CA 2CVOA 1QXSA 2Y6VA 1V3UA 4ZMBA 4CTNA 3H2IA 3VOAA 4PAWA 4B5LA 3ICEA 2MOKA 3AKEA 1DP4A 2ZRAA 3HB9A 4QU8A 2UVQA 4RDCA 2C78A 4FWIB 3K4PA 1W7AA 5I7FA 3HDQA 1ETUA 4L9SA 3KZKA 3OX4A 4M9UA 2XMQA 3HCFA 3KWJA 4A8JA 5EZ5A 2IYZA 4WLOA 5I7AA 1IB6A 3FWZA 4Q4JB 3MXOA 1QX4A 4IO1A 2RGRA 3K0CC 4X94A 2Y1GA 2GSWA 1MUUA 2FZEA 3QOYA 4KE7A 3RVPA 4C4SA 1IE3A 3DL2A 4B40A 4C4ZA 3OCWA 1F3LA 3STXA 3Q7EA 1L6RA 4FLFA 2YCLA 3ROKA 2GWHA 4DV7B 2HN9A 5KYUB 1DAEA 3WA6A 2H51A 2MU1A 1KVQA 3QJGA 3WNVA 1MO2A 1ZRHA 3IQXA 4Z4IA 3NT4A 3B9QA 4UCFA 4NFSA 3SBEA 1GL3A 2OLKA 2BHTA 1XDWA 4JLBA 1AKUA 4HHEA 3ZX5A 3A25A 3ZNOA 4FW8A 2PD4A 1XPUA 1EK6A 2JGMA 4Y9DA 3ZGXA 1KR2A 4OAOA 1ZDMA 2F55A 1H0RA 1UXIA 4X61A 5ALXA 3CEPB 2JATA 3E2IA 1NM5A 1S5PA 3HSSA 3M6IA 4MB6A 3U2QA 5LMZA 2XWJI 1PR2A 2Q4RA 4TZ6A 2WTBA 3OUUA 2HUPA 3ND6A 3ZWWA 1T4DA 2PKQP 2QTNA 1QHYA 4CR6A 3HYNA 4PV7A 1H8HD 2PYDA 4FGUA 2WIGA 3UB3A 4AX4A 1T13A 4K2AA 2A3RA 4HNVA 3AL2A 4C05A 1ZESA 1IAVA 3ZHYA 2C83A 4X9XA 4NZZA 3G0CA 1SOAA 3ZCSA 8MHTA 5FTKA 1KYTA 1XNGA 1X1RA 1ECCA 5C8VA 2JDIA 5GINE 1YHNA 2FUKA 5KUTA 1CUFA 1XQWA 3D1JA 3D5EA 3FKQA 4IEIA 3IHKA 3NI2A 1NF8A 2HWXA 3R3ZA 3JVDA 4F2PA 1MAHA 2FTKE 5KTRA 4G84A 3SR3A 1I36A 2Z8YA 3CYFA 2J4CA 2HXGA 5D01A 4EO9A 5J4KA 1OZFA 1CJKC 3KYCB 1U28C 4WN3A 2VNJA 3PL5A 2ZANA 1PUIA 2E4YA 1IEXA 3IEKA 3BSYA 5JWOA 5DLYA 3QPCA 4IVNA 1WW2A 4LMRA 4QXQA 3OIWA 3OMWA 1BX1A 4GQAA 4O0LA 1NN1A 1KNXA 2Z57A 1JR6A 2LP4Y 2ZUVA 1XZJA 3PXBA 3I76A 4OFXA 1KR5A 1L5QA 1S2OA 1UP7A 3KYBA 3MELA 3SKVA 1MJGA 5U4XA 3TLAA 4PX9A 2PRIA 1I6MA 4Q93A 2YTZA 4MI1A 3JX9A 1R50A 3H8VA 1XZNA 2WU1A 3ELYA 5GJVC 2FW6A 4W63A 1E3JA 4DCNA 3RSHA 2QAGB 2PWBA 2QTBA 3K5HA 3AFNA 3ICWA 4YRQA 5H1YA 3TLZA 4JD5A 5JSUA 2OAGA 3JYOA 1Y3FE 5GONF 1QZUA 2I2FA 5KYTA 3FMGA 4PO1A 1AVTA 2OQ2A 4Q1FA 2WF6A 4CVNA 4EYGA 4PG6A 5ICEA 4ZCQA 3UMFA 4AJ9A 3EH2A 1Q7BA 1W5SA 2HKIA 2ZRGA 3DHWC 3FVRA 4R3WA 4MP6A 4GKKB 1HL7A 2NNLD 3NYRA 1R6XA 3NHWA 5AXBA 2B8JA 2I3BA 3AHFA 1ZY2A 3L7CA 4M8KA 1ENYA 4HX5A 4B6SA 4IIJF 4BGIA 4D46A 1U8UA 4WXMA 5JT1A 1A7UA 3K9CA 2MINA 3K6KA 1NC3A 1K27A 3QU7A 1QRTA 4CEJA 4HBZA 3DMDA 1Q7TA 3P5BA 3PHHA 1NF2A 5IHXA 5IX8A 4DRZA 4GP9A 1QHGA 4IXTA 3GZTB 3WHKA 1MG5A 2B36A 4Q02A 1PJ8A 1NXTA 4I66A 4QU9A 3T94A 3UXYA 3W6OA 1ADFA 1EXDA 1ZINA 1XP5A 2P0YA 2VF5X 3D6VA 1C1DB 2I1QA 1ENZA 4QULA 1GDDA 1XKLA 3E05A 1AT1A 4YVFA 4CW7A 4QVIA 3LFTA 1KBZA 1ZQ1A 2QL5A 1S2DA 2A9KA 3H8JA 3O0TA 4F97A 4BGUA 4ONEA 4EX6A 3NIWA 4JOBA 4A6DA 5K20A 4OHYA 4E70A 1A0OA 3AP1A 1RXVA 2BDUA 1SD5A 4EB6B 2HO4A 2JRCA 1REQB 2EARA 4XQEA 4F06A 1LF0A 1BNCA 3IE0A 3L0DA 2JFNA 2W93A 1PS0A 3H1EA 1ACLA 1ZM7A 2G5GX 3MCWA 4KQ6A 5BNFA 2E0IA 2HA6A 3OX2A 4OA5A 1M67A 2X22A 2XYRA 2FPWA 3KNZA 4HAUA 3FMIA 4XIIA 3L7MA 5EUCA 3T4XA 3VH4A 4ENQA 1OQAA 4KQHA 4MQFB 5DHSA 2WAMA 3DPUA 1I80A 4HMQA 1GPWB 1NYRA 1TJ5A 1T8WA 1JLMA 1E3WB 3SVTA 2NXEA 1N3IA 2XBMA 3SJ7A 1QR2A 1XWFA 5EZQA 1PI3A 5HR5A 5JE8A 4IHAA 3EZ7A 2EW2A 4KPFC 2X77A 1VBMA 3MPOA 4QUJA 3C3MA 2O9JA 3CNOA 2ZIWB 1X42A 2HLNA 1BIFA 4DIKA 5FOQA 1BVHA 4UREA 4TLCA 3V2IA 1BWRA 3R3UA 5FFFA 3VPSA 1Y0BA 4IV5A 2HM7A 3OCXA 3OPVA 3A3NA 3L0ZA 1GG2A 3UQYS 2OFXA 4Y2GA 3S28A 2D2XA 3HP4A 1U7XA 3Q8LA 2PAAA 5IBQA 3URKA 4ZRDA 2VDWB 3D3WB 1GRVA 2BM0A 2P90A 5FTMA 1VLHA 5KNBH 1UOPA 4GBGA 2ZJYA 4BVBA 2H0RA 3DZKA 1N8TA 5FO1A 3D4PA 3EVZA 3NVMB 2QB5A 4FFMA 2YHIA 1DKRA 2J1LA 3S8YA 1QFYA 4MUEA 3SYRA 2FQYA 3EPLA 1C0KA 1Q22A 1RC1A 2CLOB 3Q87B 3V8QA 2TMDA 5EXEA 4DJEC 3A04A 2Q1XA 4MR7B 4QSMA 4DANA 4I1RA 1DHRA 1C3LA 2O2CA 3DULA 4J2OA 3EEBA 4A10A 4PGAA 1Y63A 3HM9A 4AQ7A 1LLUA 2O2GA 4G86A 5JNSA 2WG1A 2RE8A 1FMLA 4G9EA 3KLNA 3RVDA 5IJAA 3ZDQA 5FWYA 1UFKA 2FWRA 2BEVB 4JFAA 3KETA 3ACBA 1YDMA 4JP1A 3FPHA 3Q7IA 4YB8A 1SG0A 3Q9UA 3OPQA 2CCJA 2ERYA 5D5QA 5IDYA 4D8WA 2AEJA 2DKFA 3I2IA 1G5IA 2GTIA 4H7HA 4OJNA 3ZTYA 1A98A 3WLPA 2H08A 1H0SA 2GNPA 3DBIA 3KQTA 3T3NA 1QYIA 5I9IA 4LA4A 4EKYA 4UTOA 5HRUA 4QDKA 1MX9A 2IYAA 1SG9A 2HV8A 3Q10A 1XD2B 221PA 3LHDA 4XW2A 3LT0A 4FS3A 3OD1A 4BFYA 4K6KA 2Q3BA 1EP1B 4Y9UA 3TLYA 2AQ8A 2VBCA 4Q6WA 1DOAA 1G0NA 2FRVA 1Y8RB 3LL4A 1N1MA 4J7UA 1ZA1A 2JLBA 1W581 2XI4A 5E8JA 3ZY2A 4DBZA 2VP5A 3EIUA 9LDBA 2ZRBA 1TTHA 4CF7A 4UBOA 3AVWA 4EI2A 2J9ZB 3GEMA 5A03A 1P73A 4OXKA 1SUAA 4HN4B 1UBJS 4X91A 3WNZA 1L5SA 3ESRA 2PEYA 1OJLA 1KYVA 1SCBA 1TUBA 3A4TA 3R0XA 5THXA 3ZGVA 1T4CA 5IXJA 1A4UA 4UM9D 1U0GA 2GNOA 3BB4A 1BEUB 1GT6A 5AVUA 1BE6A 3DEZA 4NG4A 5AJHA 3MXTA 3MMNA 3ZIUA 4ARUA 3KV3O 3S1AB 1OYYA 1IN8A 3Q1KA 1EVZA 3VAZA 3BBLA 2QIPA 4HFJA 3TRIA 4DV0B 4GWKA 1L5MA 1RBMA 4B71A 5BSWA 4EUSA 2GFQA 3UJ8A 3KR9A 5KKCA 3F3MA 1V8FA 4DWOA 1VLMA 3QEJA 2NVWA 3OY2A 5K3EA 4KO4S 5FO0A 5EMKA 2DQYA 2DVMA 1M7HA 3R5SA 1Q12A 4AYTA 4BECA 2HDWA 2VJQA 3PHIA 4LRSB 4URYR 1EMDA 5EIEA 3VHRA 2PJZA 2AYXA 3GFTA 3S4YA 4IMIB 1N4AA 1DEAA 4RQUA 1Z5WA 2FPMA 3C4QA 3FJ1A 4Q3LA 1D2HA 4U8HA 4L78A 5A3JA 3QP9A 1IU9A 4V0SA 1QGUA 4QDJA 4ACAA 2C59A 3OPNA 1IIRA 1ZNYA 3UT5A 4L08A 1E6CA 1EJ0A 3KJEA 5CLGA 5HWSA 3HCEA 1KZ4A 3T4PA 2VZ8A 2R8BA 3KVOA 3A6DA 2XEXA 2QN3A 3C48A 1RAHA 5B64A 1OV6A 4NV1A 4YMWA 2AC7A 2CUKA 2N1BA 1DJLA 5DX0A 1YUNA 1QO7A 3WDLA 5A4DA 4M49A 4QGSA 3OZXA 2PE5A 1Y4AE 1K7CA 1FSGA 2QZSA 1KTVA 3PHBE 3L07A 3FIUA 3VKHA 3NOOA 3LBIA 5DE3A 4E7OA 1NC1A 2JEOA 2ZYAA 3KCQA 4XE5A 4JLNA 3WYNA 1H9BA 4X1IB 4OL0A 4WASA 3T3IA 3T15A 2FZKA 2RI1A 4MWDA 1PVDA 2IUSA 4BDTA 1ZIDA 3C7AA 4YJ2B 1O94A 4CJXA 4FB5A 4FZ5A 5JBIA 3EGXA 4FUTA 2XCTB 2WICA 4KZKA 3TSAA 1Y9JA 1TEVA 2I7DA 5ECWA 1JQBA 1D6SA 3BGIA 3PFGA 3L4BC 5JS8A 3DO5A 4NH0A 1XQXA 1I9CA 2JAQA 2WYHA 4BNWA 1NOKA 3ET4A 4LCBA 2FP4A 1J4AA 3J80A 1FX0B 3ZLBA 1C0EA 1OFGA 2GN2A 2BP7B 1K86A 1R6BX 2YHBA 2BFBA 3NBXX 1QH9A 3ZW7A 2IITA 4AURA 1ZW1A 1EFPB 1AY0A 4PXYA 5KTNA 4IHJA 3W04A 1N2XA 4MO9A 3MWKA 4RL6A 5J2TA 1QQ7A 3DNFA 1O6CA 4CEIB 1TXGA 2LPMA 1E1QD 2D2FA 3F4LA 2I4LA 2IYVA 2PSHA 1NKVA 4FD2A 3NAQA 4D9HA 4TVKA 1Z2NX 3KC2A 3LYLA 2Q29A 4ND7A 3JW8A 2QGZA 2VT6A 3SJUA 3AIIA 4U7JA 4XIYA 1UKCA 4BBPA 3HXMA 3GP8A 2IY8A 1XCGB 4FZVA 1LK0A 4INJA 5IW8A 1QLWA 3UAWA 1V1MA 3U3XA 2VEOA 1KZ9A 4QC2A 4J9VA 1KSFX 2YJZA 3EARA 3LXRA 5G02A 3ZCTA 3C3XA 2FUEA 3LKBA 4OAPA 4Q1CA 4Q01A 3AEQB 4K9SA 1KPHA 2EFDB 2X13A 2IELA 2FPSA 2I4TA 2IZOA 3P2EA 4ZQHA 1SK8A 1P72A 2AX4A 5J5AA 5C52B 5FR2A 4BCDA 4HLUC 1XA3A 4TXJA 3VQTA 4KSCA 1Y33E 4KQCA 2NZ2A 1NXWA 3L0OA 3Q3GE 1GTVA 1FFXA 3DDUA 3EFBA 2QQEA 5CT6A 3L4EA 2JLAA 2FDRA 1DKMA 1FDIA 2C07A 4DMMA 1IBMB 2PL3A 3MTEA 4LTNA 1YKFA 5FPTA 5IZCA 5IK2D 3HJHA 2DY0A 5L3QA 1U2ZA 3DZDA 3V4RA 1ZLXA 2CC2A 2RJ3A 2WTNA 3Q5GA 1N75A 2C29D 2GVNA 2I4RA 4GZ3A 3T1VA 2Y8EA 3HUUA 2JCVA 3PKZA 4Z0PA 1I32A 3RHZA 2BEKA 3SMQA 1WY7A 2N42A 1RI4A 4M7WA 5LFAA 5G40A 2E3JA 2VAPA 4QQKA 4L5AA 2XOXA 4D43A 3H5IA 3AF1A 5EHNA 4A0HA 5LQSA 4CE6A 2JIBA 1OC2A 1UJ5A 2HD4A 2RBGA 2ZS7A 2G25A 1N6OA 2Z09A 3CZPA 3OETA 4Q5IA 3C3BA 3I9KA 3TLJA 4CM3A 2XKKA 4YNBA 5AOAA 1UEIA 1QGAA 4L6CA 3OWHA 4X1YA 2V5UA 2WHPA 1SUPA 1X7HA 5DLEA 2YWRA 3E1GA 4JEIA 3CPEA 3ROZA 4DLLA 2B6NA 1AQYA 4HDQB 4KN9S 4ZHQF 4NESA 3PPYA 3WY9A 3VC7A 3ZHVA 3TB6A 3HBMA 5JJCA 1KI6A 2VYFA 4MS1B 4YDHB 4L28A 4EPRA 1R9JA 1TB4A 5HKKD 5C8ZA 1U9CA 2FRXA 5BQFA 1VKOA 2ID7A 1QIIA 4B0OA 4X85A 1POWA 1V26A 3CISA 3PKIA 4KR0A 4WL0A 5EXSA 3ZLVA 1UBGA 2AMYA 4XPIA 5E1DA 5AM3A 3C16C 3CX7A 2IHYA 4J1TA 5TY0A 4C0WA 4QOJA 4MHSA 1XCBA 2P3QA 1IBCA 5D3ZA 4FLEA 4KO2S 3ZWQA 5AK5A 4TYMA 2DRIA 1IZ0A 4CLRB 2H6EA 5FB3A 3IUSA 1GV0A 3MJFA 1K97A 4TPKA 1ISJA 3SS8A 1HM5A 1QIMA 3SXPA 2GTPA 1SH7A 1RWPA 3IEXA 3WJAA 1AQNA 2YV5A 3BXGA 3SIXA 5BV0A 3K20A</