4JZKA

Crystal structure of adenylate kinase of e. coli with adp/amp bound
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase
publication title Crystal structure of E. Coli Adenylate kinase with ADP and AMP bound
rcsb
source organism Escherichia coli o104:h4
molecule tags Transferase
total genus 75
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2013-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jzkA00
1CTQA 2ZJBA 4FN5A 4KV9A 3TQFA 3H1TA 4JZKA 4N1AA 4Y0VA 5JEDA 1E0AA 1V5WA 3K9GA 1XF9A 1U8ZA 3OAAA 4B6FA 1XXHE 3LW8A 2DCUA 4V0LA 3I62A 4XTCS 2LWIA 5D3MB 4G0NA 2O8BA 4NYIQ 1OIVA 4WW0A 5DLQC 1JXOA 2A7QA 2D2EA 2WWWA 5FOUA 2PMKA 1P75A 2OT3B 1QVAA 3TSZA 1XRJA 4DC9A 1YZNA 3B1ZA 2QM8A 3WHKA 3NG1A 2VRWA 1VIYA 2VQSA 3HP1A 2MSCB 4L9SA 721PA 3ZIAA 5LPNA 3GP8A 2FEOA 3SBEA 2C95A 2IF0A 2V3CC 2ZRJA 3U6KA 2WAYA 5J47A 4DVGA 4V03A 4UNNA 3ZS8A 4NYMR 5DYGA 1YJ5A 2GEDA 3OFNA 2IUTA 4P32A 1ZBDA 2QT0A 4M1WA 5KO2A 2QY9A 2CDNA 3VNVA 4Q4LA 2CEAA 4HB4A 1YZQA 3K70D 1US8B 2AWNA 1Z07A 1YHNA 2HCJB 2ZR0A 4JLKA 1D2EA 4YMWA 1KO4A 1NY5A 1TUEA 3DO6A 1ESMA 2ASEA 5FI0B 3FVQA 3K1JA 3PUYA 3X1YA 1OXSC 5M04A 4G5QA 1P9RA 3SOPA 4MUAA 3SYKA 5HCNA 2VHJA 2FZ4A 4BQSA 1SHKA 3IUYA 1G8GA 1Z0AA 3IBYA 3N70A 4HAWA 4Q66C 3C8UA 1ZU4A 3CZPA 5HTKA 4N0EA 1QHIA 3BXZA 4RD3A 3FYHA 2VHQA 1SVKA 1U9IC 1YRBA 3A8TA 1COWA 1RKBA 2G0TA 4LBWA 2DWPA 4LHYA 1W36B 1VTKA 3GLIA 2DFLA 2ORVA 3CF0A 2O8BB 2VIIA 3AB3A 1KGDA 3NVAA 2R44A 1W0JD 2WJJA 2X8AA 3U61B 2FN4A 2P3SA 4Q5IA 3BJIC 3TE6A 1WF3A 2FDCA 3FFAA 3TRFA 5TDHA 1OF1A 3RANA 3C7KA 2J3EA 8OHMA 4KFSA 5KDLA 1CR1A 2QMHA 3TNFA 2UKDA 5IRCD 3IBGA 5FOTA 4UQOA 1VPLA 2GILA 3DKVA 3FMOB 4Q19A 1SZPA 4ZDIA 4RD4A 2IEZA 1R8QA 2REXB 2PLRA 1JR6A 4DXAA 3T06B 2OCYC 2QQEA 1NJFA 5L8VA 2WOOA 4URXR 1FFHA 5BN3A 5K8UA 1Z5ZA 4HDOB 1KSJA 1NN3A 2GCNA 4M2LA 4Q1FA 1FQKA 1XX6A 3MAAC 1X1RA 3LH5A 5HCIA 3GMTA 2AN9A 1ZM7A 4GT1A 1IY2A 2ZJ2A 3DMDA 2F9MA 2WMOB 1F2UA 2AR7A 5EZ5A 2RHDA 4OI4A 1IJFA 5EE3A 3R8FA 3CX7A 1UKEA 4KYIB 1GITA 5GJVC 1WBDA 1ZUHA 3Q5EA 3W6NA 4WZBE 3GJ8A 3IQWA 4LSGA 5EP3A 4QFMA 1H8ED 3AQ4A 2D7CA 4L16A 3SQWA 2A30A 2H18A 2IF2A 2J9RA 2XJ9A 1XD2A 3KKOA 4HLDA 4A0GA 5L3VA 3OE7A 3KQNA 4M9QA 4US1R 2GNOA 5AUNB 3X1DA 1TQ2A 1KI7A 1VYVA 2C9CA 1EFRD 1Z6AA 2H1LA 4ZCIA 3GLIB 4IDPA 4XWAA 3QXSA 3QJYA 3NC1C 4JL6A 1AS3A 5LD2B 2O8FA 3FGNA 3Q3JB 2OG2A 2YNMA 3LV8A 4B2IA 4PANA 3AGQA 1EX6A 4QOSA 1SHZA 4B44A 1KI2A 1ODFA 3K53A 4PQFA 4AG6A 4LHZA 4HB3A 4JLVA 3K70C 1QVRA 5JLJA 3TGPA 2ZJZA 3FHCB 1TL7C 3I61A 2IWRA 1DG3A 4MDEA 1CS4C 2SHKA 3LRPA 4MRVA 4M0LA 1AS2A 2GZAA 1CR4A 1WDTA 3EPKA 2ZR7A 4MDFA 3RVBA 4HI0E 2YINC 2Q3MA 4HLUC 3ONWA 2QTHA 3ECCA 2CCGA 3SHWA 2J5XA 4Q7JB 3SN6A 5JI3E 4P33A 3IPYA 2GVDC 1EX7A 2C04A 4XJXA 4QM7A 4ZO4A 4DLZA 4WA7A 2QI9C 2ZM5A 1U9IA 1NMZA 1YZTA 2YHSA 4FWIB 2BVNA 1GWNA 1E96A 1F2UB 2WSMA 4YDSA 1ZAKA 3BGWA 2CK3D 3IIJA 1XMVA 1DAEA 2ZU6A 2Q0HA 2VP5A 1JQJC 1IBRA 1P7CA 2HV8A 2IYVA 2RGAA 2ZRLA 2AD5A 2ZE6A 5AUOB 2CVFA 2WKPA 1FTNA 1Q22A 1KJWA 4WZAE 3RS5A 4ZI3A 3AP2A 4FWTA 5CK4A 1ZCBA 4ZCLA 1EG7A 1QHHB 1XD2B 3P27A 5TVKA 3QSYA 2Z83A 1I4TD 2KJQA 5IHPA 3VNUA 2CL7X 1UADA 1G8HA 1OKKD 4URUR 2GF9A 2WIBA 1EFTA 1G7SA 1VHTA 3FMIA 3BS4A 1G8PA 4A15A 1WA5A 4LJ9A 1VIAA 4JJZA 4TLCA 1NNEA 2O8FB 3RS0A 1K5DA 4JYBA 4AURA 3THXA 4JVNA 1G6OA 4OKSA 1ZD1A 4JL5A 2OXRA 1LFDB 3GJ4A 2BC9A 4ZIRA 2WTUA 3B1XA 1ZYUA 1E69A 3KTAA 4URWR 4D0GA 3BRWD 3AVYA 1U90A 2NQ2C 3DVLA 3CX6A 4LDJA 5FPSA 2X19A 3VKGA 4Q9KA 2GBLC 2G88A 2QZ4A 3OESA 2R6CA 1ZP6A 2C9OA 3DOEA 4LBVA 4BLTA 1SQ5A 4YDHB 4BUJA 4QJ3A 4DLTA 4HAUA 2OBLA 2WJVA 3PFIA 2C78A 1DEKA 2H8KA 3EW9A 1BIFA 5JJLA 3LXRA 4CZ2A 1SKYE 2VF7A 4K81B 3TW4A 3MD0A 3L82B 2KBEA 3HPQA 4NZYA 2VP0A 4AG5A 1NI3A 4O2RA 2PZEA 4M21A 5CITA 5CJ2A 1X86B 1NRJB 3AVVA 4US2R 3ASYA 3GEEA 5LB2A 1KO1A 4RFVA 5EP4A 2W00A 3Q85A 1TX4B 2FOLA 3U6BA 4ESVA 2WWFA 3AVUA 4CEIA 2Z6VA 2ZSDA 4LY6A 4PC3A 4PPQA 3K9LA 4BLRA 2OO7A 4JLJA 5JRJA 2W58A 1NIJA 1B0UA 3EZ6A 5H1YA 5HE8A 2GEUA 5J4KA 1N0WA 1GILA 2VEDA 4BFZA 3FOZA 2ZI3A 4PQYA 2DFKB 2P0EA 3CRRA 3IKJA 1PJRA 1QHYA 1T3LA 2YWHA 4PR0A 4AYXA 5A4JA 4LX0A 5GVSA 4Q1DA 4RZXA 3E70C 2OEPA 2KWIA 3THXB 2FV8A 3OIWA 3W8RA 2FPLA 2RB4A 5EUMA 1XDBA 2XB2A 2XNDD 1FNMA 5KYKA 4ZIRB 5KUTA 1WP9A 5AJYA 3KTAB 4HLUA 1ZD8A 1DELA 2OESA 4KJZA 5CLQA 2IS1A 5JWRA 2ZE8A 3L0SA 3BWDD 4B47A 1XZPA 1M2OB 1YE8A 4HEJA 5FPYA 3U4QA 3I73A 1KMHA 3K0CC 1KDPA 4XD7D 1E2LA 1Z63A 1QBKC 2E87A 2G6BA 5B2ZA 5JCPA 3MWJA 1SVOA 1HE8B 1UF9A 4OHYA 1JECA 1C4OA 2AFIE 3LXXA 1W0JA 4N3NA 1P6XA 4LJAA 4UJ3A 1LNZA 3U3JA 3ZVRA 2OUKA 2IT1A 1P2SA 1F5NA 2Q9AA 1NLZA 4ZPXA 5L3SA 1Z29A 2ZRPA 4CEIB 3CRW1 3SJCA 2V6JA 1NL3A 3K09C 3WYFA 4EQ6A 1G21E 1FNNA 2CHQA 5FH9A 4DSUA 1U81A 1HT1E 1AS0A 4CF7A 3SJAA 1XP8A 4DJTA 1IONA 1S8FA 4QBFA 1W2GA 2Q3HA 2QP9X 4U5XA 1CEEA 3NBZC 3W90A 1W4BA 4FMCB 4NCNA 3K70B 3LBNA 4NYIR 4LYHA 2LKCA 1ZNXA 4KODA 3B60A 4HAVA 3T35A 1X1SA 3VKWA 3CPEA 2GBLA 3P4XA 4F91B 1K6MA 1KSFX 4GPTA 3KQLA 1NVUQ 5SZKB 2QMOA 3GLFE 2BHRA 4JBXA 1ZM3A 1EK0A 3B1YA 1IN8A 2H5EA 4JSTA 4GMDA 4YONB 2B8TA 2ZRKA 2FFQA 3HU3A 4FINA 4R98A 1G8YA 4WBSA 1E2FA 4NONA 4TYNA 2PX0A 1H8EA 1MT0A 2Q3FA 3AP1A 1FZQA 5FUWA 4C0AC 3U4QB 1KMHB 2ORWA 3GJ5A 4CVNA 1T0HB 3B85A 3PENA 1KYIA 3PJRA 1UPTA 1VYUA 1J8YF 4UKDA 1P3JA 4B2PA 1V43A 3TW8B 3PUXA 2W83A 4IKEA 3AVXA 1EFRA 2ZYUX 4RKEA 1OYWA 2UZIR 4DB2A 3QPVA 1S3GA 3B9QA 1OHHD 1W48A 5SZIA 1QHGA 4TMTA 1N6NA 1RIFA 4DHEA 4TLEA 2YYZA 521PA 5L3SB 2R6FA 4O2LA 2ODBA 3R8CA 3U2QA 4EQ6B 4OYHA 1JQLB 1Q1QA 1Y3AA 4BLQA 2QUZA 2O0KA 2GJKA 4ACBA 4P3YA 4OK6A 2ZREA 1MKYA 4BLSA 3HJNA 4E09A 4D6PA 1E2QA 2OXCA 4B73A 3DMNA 4TLBA 3AGPA 5JECA 3PQCA 4Q1BA 1MO6A 4W9MC 1OFTA 2IXFA 2CK3A 4JKYA 2WKQA 2NO7A 1GRQA 2MSDB 4EPXA 1HUQA 1E2NA 1XEWX 2J46A 4M1TA 1W49A 3V4FA 5FI1B 1G5TA 2ZS9A 1AKYA 4DLYA 2MMGA 2F55A 1T91A 2V8OA 3Q8XB 1FP6A 2OE2A 1T0JB 3M1IA 2ZR9A 3NXSA 1T3SA 4MYTA 1AN0A 5EXSA 1NVWQ 2R8RA 1OKKA 2H57A 1JEEA 3CF2A 5LB4A 4JLMA 1W44A 5JCZA 3FB4A 5K8TA 1XNJA 2XNSA 3VR6A 1T5IA 2ZSFA 1G5PA 2EFGA 3BAFA 2HYDA 4MH0R 3QKUA 1AQUA 1KK2A 1TQ6A 2WIAA 1N5JA 2AFHE 4DSOA 2ANBA 2PJZA 2EYQA 5JZVA 2YZ2A 1O87A 2QAGA 2YOFA 4IFBA 4UXIA 1PLJA 2P2LA 3WYGA 1S96A 2P5TB 1NLFA 1NN5A 4FMDB 4JLBA 1FW6A 4FMCF 5JS7A 2A78A 3C14C 1KIMA 1T9HA 3CKLA 3N2EA 1ZINA 3KB1A 3ZVLA 1N5KA 2DPXA 3AF1A 2J7PD 2VHUA 4P4UA 3TBKA 3WMFA 4PAQA 1FOEB 3K0EA 1LTQA 5HKKD 3OIYA 1HEIA 4XWOA 2HCBA 2CCJA 2BCJQ 2VTKA 2WJYA 4EFMA 4HYYA 1D6JA 1QDEA 3PXGA 3RAPR 3PR1A 1KKMA 4DLSA 1E6CA 1N6LA 5FPTA 2YWFA 2J87A 1QF9A 4FCWA 5D3QA 2AKAB 2QP3A 5EUQB 3SDZA 4BWYA 1NKSA 3QKRA 5JFGA 1T3HA 1G9XA 3T61A 2GJSA 1R8SA 2V4ZA 4OI0A 5FL7D 4G5SA 1YU9A 4RD2A 2ZAMA 3KKQA 2ODNA 2WKRA 4KO8A 3UG7A 3VX3A 3WBKA 1GL9B 5IK2D 1M7HA 3W34A 4AY2A 2IYRA 4PPGA 5EE5B 4IEIA 3AF0A 3SQXA 2OLKA 4RD0A 5CB8A 2QAJA 1N6OA 3IIKA 2FSGA 1N6IA 2IWHA 1BO6A 2GWHA 1XTSA 3EA0A 4JKIA 4OQNA 1H8HD 3CH4B 2WM9B 2GXQA 3REGA 3RHFA 1KK0A 5F2EA 2ZVQX 1NY6A 1P9NA 2YWGA 1KI6A 4LZZA 1Z6GA 4LJYA 4M22A 4NCIA 3BERA 4GSYA 2QAGB 2XNDA 3C15C 4JLAA 4UNQA 4LCBA 2WHXA 1OB2A 2PL3A 3WBJA 1DVRA 3DL0A 3U7GA 2O52A 4F4JA 1KI9A 2JLUA 4IJMA 5AUPB 1G8FA 1Z22A 1JNYA 3GPLA 4JL8A 2R9VA 3KUCA 4NE2A 3OIUA 3B5JA 4UNPA 4XD7A 5A0FA 3ZQ6A 4URVR 1LF0A 5HPYB 2V9PA 4YQFA 2ORIA 5JBQA 1OIXA 2BBWA 3A4LA 4AKIA 5KSPA 4AKEA 4WXRA 5AJZA 1OFHA 2OILA 5CK5A 3IPXA 2WJHA 5DH9A 1J8MF 4QJ5A 1ZNWA 2XOKA 4ZI2A 2BMDA 3QKRB 2CVHA 4D4LA 1BMFD 4TQ9A 3K9NA 2IYQA 2HLDD 1N6RA 1ANKA 1FUKA 1YVDA 1G3UA 1HTWA 3RYTC 3B2EA 2CLCX 4OQXA 2JATA 4B32A 4DLUA 2QL6A 4PAOA 1ZU5A 2VA8A 2RGGA 4GZLA 2YVUA 4TMXA 4NKRA 1C1YA 5BW8A 3I8XA 2YWEA 3SC3A 4MYHA 2G1KA 3A1SA 2GETA 3U3MA 2OAQ1 1Q12A 4LRWA 4DLWA 1U0HC 4FMDF 2VP2A 4JLDA 1KI6B 5UKDA 5F98A 1MO3A 5GJBA 2C9YA 1MOZA 2WWYA 3JVUA 4LJ6A 5LBIA 3VR4A 1CLUA 1UBFA 4NCJA 2BOVA 3EX7C 4C2TA 5C2JB 2YOGA 1QZXA 4TZ0A 4DSNA 3A36A 1E99A 4JS0A 3ZQJA 4BRUA 4JLOA 5BWMA 1GOTA 2JLYA 1SVWA 1DARA 4QNRA 3AP3A 4B71A 2BCGY 5B58C 3C5HA 4TLDA 2JDIA 3KZ1E 2ZS7A 2ZANA 2QE7D 2ZQ5A 5AJWA 2DFNA 5FUVA 3P4YA 2GJ8A 4DCVA 4JSYA 1FUUA 2I1VB 3DKPA 5K8LA 5DNYB 3AF2A 1U0JA 1S2MA 1BKDR 5FBVB 3I5XA 4XIGS 4WIAA 1KZ7B 3JZMA 5TARA 4L8GA 1L4YA 3GQBA 1Z0DA 2ZI5A 1OFIA 3UMRA 1O3YA 3BFVA 3TR0A 2ZPTX 3R7WA 3W3AA 2R6DA 3NC0C 4D0LB 4A82A 1N25A 3NKVA 4DIEA 2GVZC 4GFDA 4IHQA 2AK2A 5TXGA 4A9AA 1G7CA 3BB3A 4BFTA 4TT3D 2FH5B 3QVUA 5DHFA 1X8JA 3NDPA 1N3BA 1X8KA 4CYMA 3BFXA 1F2TA 4K8OA 4TYPA 3TH5A 1AZSC 1SXJD 2IX3A 4A36A 1ZRHA 3QF4A 4AWXA 4QGGA 5B57C 2QPAA 4TZ6A 4FIDA 3SEAA 1P2VA 3MWYW 3RSOA 4RJLA 4EAQA 5AR1A 1N2CE 2VSXA 1DAFA 1W7AA 1PLLA 4V0MA 3TIFA 1A5TA 4Q1AA 2GZDA 2A3RA 3SFZA 2HUPA 4FI3C 4O25A 2V1XA 3U44A 4E07A 3OEHD 4BFUA 1II9A 4BLOA 2FFHA 3A58B 3W8NA 1AA9A 2HEIA 2XSZD 2ERYA 1XEXA 1PUIA 2ZUBA 2O8DA 3BB1A 4LUCA 3GLHE 2JJ2D 3MJHA 5FPKA 2D06A 4JBYA 4B3GA 1GNRA 4V02A 1D5CA 1U2RA 2ZI9A 3X1WA 3LVRE 1UEIA 2XX3A 4U7DA 3B6EA 1XXHA 2IL1A 4M1SA 4A6XA 2BM0A 4IOJA 4KU4A 2VYFA 4NHOA 4BFVA 4OI2A 3W3ZB 5FL3A 2V55B 1E79D 1QHNA 1LY1A 3BFKA 1G3IA 2JA1A 3R7WB 3LQRA 4AD8A 3IO5A 1II0A 3J81k 1AJEA 5DHAA 2VHTA 4DDVA 3WNDA 3SHFA 1KJZA 3PUWA 4ZKDA 3P26A 1RE0A 1E0JA 1HV8A 1F2TB 4CIDA 2WWGA 4C0JA 4PZZA 1I2MA 1LW7A 3QF4B 4TQAA 4Q47A 1JXMA 1PLKA 4KFRA 2TMKA 3RWMB 2J0QA 4JT4A 2N42A 1GNPA 4GP7A 3T1QA 3EAQA 5HKKA 5H68A 1TU3A 3TUZC 4MKIA 1ZCAA 3O8DA 1UDWA 2R65A 1LS1A 4B75A 5J5CA 3ADCA 3TQCA 1W1WA 2NO1A 2OSBA 3CO5A 1GIAA 1CJTC 3RSLA 3U44B 1RRCA 1YRAA 4S2EA 4OJQA 2NZJA 1W0KD 1XEXB 5FL7A 3SU8A 2O8DB 2HF8A 2A9KA 2H16A 2LCFA 3GJ6A 1OJLA 3VMFA 3EWAA 4W5JA 5IK2A 4D25A 4QM6A 4Z8XA 4LI0A 2RAPA 1Z0JA 2Z43A 4A4DA 1XXHB 2E9SA 3SZRA 2QG6A 1OXVA 3AVTA 3BIFA 3TVDA 2OLJA 1Q1BA 2GK6A 2CLDX 3QVVA 1J99A 1HYQA 5DIFA 2E1RA 1H8HA 2ZYVX 3L2OB 3L0OA 4MKGA 1G4AE 1CBUA 2GJAA 4DEXA 2OZEA 4B34A 4CRWB 5A5GA 2GDJA 1F48A 4XVRA 1GVNB 1SXJC 2H92A 2YV5A 3LW7A 1CP2A 2VO1A 3EZFA 3KXLA 4NTZA 1VCNA 1IQPA 2IYYA 3L8ZA 4G3XA 4G1UC 1G64A 1KI4A 3WP1B 1L7VC 2JCSA 4ZDWA 2C77A 3ZD6A 4KHZA 4B3BA 3SJBA 4HZUA 4CGZA 3ZVNA 2IK8A 4URZR 1XJQA 2RGCA 2ZRNA 1ZM4A 2O0JA 3I8SA 1G4UR 2W2VA 1E2KA 4RCYA 4RSGA 5C4GB 3RC3A 3PEVA 4TL9A 3VKHA 4A6PA 3QI2A 1GDDA 3K8YA 3RRYA 1IJEA 3ZZUA 2WSSD 1E98A 1T5LA 3QUSA 5FBQB 4IOMA 1W4AA 4AYWA 6Q21A 1RVDA 4GP6A 1BMFA 4J0QA 3WRYC 4B33A 2RGBA 1CKEA 2VF8A 4CT5A 1AIPA 1RJ9A 4RKFA 5DN6D 1OPXA 2FFAA 1XWIA 2GRJA 1IOZA 2XEXA 1Z06A 4C30A 2FSIA 3QNUA 1A2KC 3LD9A 3CBQA 4KXFB 4QXAA 1K8RA 1WRBA 1K5GA 1NIPA 1SXJE 3QXHA 4RD6A 4H9GA 3T34A 3NIBA 2N1BA 1UKYA 2C96A 4JJKA 3KXKA 2W6JD 2IYUA 2GAAA 3S1AA 2V7QA 4M9XA 4DCNA 4YMUA 4TTRA 4KVAA 1P73A 2W2XA 4R7ZA 5TV2A 3PITA 4EPVA 3CLVA 1TQ4A 5EXTA 1XMJA 4C0QC 2Q9BA 2IUSA 4EJSC 4B76A 5JHGB 4IVRA 4RCZA 5JMTA 4HDCA 4DCSA 3BK7A 1W2HA 2DWQA 1ELOA 3NEJA 1E9AA 1RC8A 3AVOA 4G5GA 1ZC4A 5CYOA 1KI3A 1ZJ6A 4DCTA 4HZUB 3W6PA 2QE7A 5JHHB 2JLRA 1S1CA 1YR9A 3WYAA 1RFLA 3E2IA 1KO7A 2OM2A 2O5VA 3BC1A 1WQ1R 2AXNA 3LWNA 3SYLA 1J90A 3VTKA 1ZIOA 2QSZA 2BKEA 3GFTA 3U3RA 2RGEA 5J4VA 4HLCA 3ASZA 1GG2A 1R0ZA 3HU2A 2D2FA 4Q9IA 2ZAOA 4P0TA 4JYCA 3CR7A 2B7BA 1PUJA 3O8RA 2IS2A 2GESA 5EE1A 2V1UA 1VMAA 1F60A 3B1VA 1T4GA 1RJ9B 1F6BA 1W4RA 4NMMA 2D7DA 4OHZA 2D74A 2PCLA 5EP1A 3U3KA 2BJVA 4TT3A 1ZC3A 1QG4A 2GXSA 1KKLA 3RC8A 4LV8B 1E2MA 4M1KA 3VR5A 3PCRB 3ICQB 1TNDA 4R2HA 4KAXA 1Z6TA 1CULC 1SXJA 2JLSA 4ITRC 1KNXA 2CE7A 1TAGA 3U7HB 4LJ5A 1TMKA 2J7KA 3BB4A 3EA5A 3RS2A 2BWJA 5F9FA 4GOXA 3UATA 421PA 1JI0A 4B2LA 3T5GA 1P2TA 2QMEA 4L4UA 3UIEA 1E2PA 4Z51A 1E1QD 1FPMA 3ETLA 1CF4A 2CNWD 3NH9A 3QG1A 1XTJA 4BECA 2OCPA 4NPHA 1G6HA 2F1JA 1Y63A 2QROA 4B6EA 1CRQA 3OEHA 4P4TA 3AKEA 2B6HA 2HXSA 2P6UA 2WWIA 1WXQA 1OH5A 2HJGA 4ARZA 4Q4HA 4Q7LA 5JWHA 2JJ2A 3V9PA 1R7RA 5E7MA 1P4SA 2QTFA 5TY0A 3LLUA 3X2SA 4BFXA 1N5IA 2JEOA 3EG5A 2B8WA 5G3YA 3UWOA 1OIWA 3RDPA 1R0YA 2B92A 2ODEA 2ZEJA 3DZ8A 5FOXA 3LBIA 1E79A 4MA4A 4RFSA 1M34E 3QE0A 4GI7A 3R9IA 3TVTA 1U99A 3WMGA 4D81A 1XCGB 3O8CA 2PZFA 4NCHA 1JAIA 5CIQA 4FCTA 2G77B 3CZQA 4EPTA 4Q1CA 3KJEA 1FQJA 4IDOA 4DSTA 4DCUA 3DDCA 1MABA 2IXGA 1S0UA 1T6NA 1SXJB 3P20A 3UWKA 3QG5A 4F7WA 3BH6A 2FA9A 1HURA 4EJSA 1XU4A 4Q9LA 1FX0A 3SBDA 2I4IA 3QBTA 5CDFE 4KITB 3QPWA 4LJ7A 2EQBA 4AKGA 5KSYA 1OH6A 1XEFA 2AWOA 1HH4A 1YZGA 1ONBA 2GEVA 4M4SA 4TL7A 1G17A 4V0OA 1NSFA 4WOPA 4DBLC 3EWSA 5GJCA 3THOA 2O8EA 2FPKA 3IQXA 2J0SA 1WB9A 3AV0B 4LPKA 1W0KA 4YMTA 1RPZA 4ARZB 4DLVA 3H86A 1MO4A 4Q4HB 2QGZA 4Q21A 2FE4A 4CDGA 3GFPA 4ACAA 4AIIA 4Q4JA 4O0MA 4Q7MB 1RYHA 4G5RA 3B13B 1S9HA 3IEVA 1NN1A 4FW9A 2ZSBA 3MWKA 2C5LA 4LOAA 1SKYB 1E2DA 2ZE5A 2RGXA 4AK9A 3LY5A 4XTRA 5CM8B 4EPRA 2ZS8A 4Z1MD 1ESNA 1VCIA 1XCMA 4RFSB 5AJXA 1DOAA 1KOFA 3MMPA 4D0NA 4EFLA 2UZ3A 1IY1A 4MRRA 1ZNZA 5FFMA 2ZUDA 3ZGXA 4PC7A 3U7EB 3O8BA 2DYKA 2FGJA 3QEOA 2XZPA 1M7BA 1MABB 3V4RA 1CU1A 3M4YA 5H8WA 3ZJYA 2ZSAA 2CBZA 3KFXA 3RWOA 3NBYC 4EJSB 2ZYWX 1CJUC 1DPFA 2GHIA 1R2QA 1R0WA 1YR6A 2REOA 3RRZA 1FX0B 1VCOA 4LV6A 3B7GA 3AVPA 4IOLA 5E95A 3VR3A 5K8IA 5CDFA 2WJIA 3MCAA 4MGZR 1ETUA 5JRZA 3LDAA 2BMFA 4BZPA 4MKFA 3ZIAD 1S9DA 3ZZTA 1IXZA 4PZYA 4V0KA 3K0CA 2WSSA 5KNCA 3W9YA 3GLFA 2O8EB 1DAHA 3OFND 1M8PA 2XTNA 3A4NA 3B78A 3QKTA 1KNQA 2YOHA 3CRMA 1E94E 3QXJA 5AUQA 5FTKA 1J70A 1OXTA 1E9FA 1NBME 3DM5A 4G01B 4PFSA 1EWQA 2FWRA 5DN6A 2YC4C 4Q4JB 5KTYA 1OH8A 3MUFA 4MKHA 1HE1C 5BQ5A 2IUUA 1OV4A 1G291 1AKEA 2ZRGA 1OYYA 2ZITA 4MGYR 4YXWD 1DE0A 5FBRB 3CB4A 1XMSA 3K09A 3IGFA 4OK5A 2PT5A 1Q1EA 3DEFA 1I2DA 2CJWA 4RY2A 4BFSA 4OQFA 3CH5A 1U0LA 2W6JA 2QA5A 1KSGA 3NTUA 1B23P 2IYLD 2JAQA 3KJGA 4PSAA 4TWZA 2HDNB 3W6OA 4I99A 2A5GA 2QSYA 4RVCA 4E03A 4BEBA 5G40A 1II8A 4A8JC 5CLLA 3Q9LA 4OBEA 3CONA 1Z28A 4UJ5A 4M9SA 3OHMA 1E0KA 2XZOA 1GKIA 4GNKA 3I5YA 1Q0UA 1IN7A 3WP0A 4H1UA 1XPUA 1KJYA 4C9BA 2KB0A 3EIHA 3SR0A 1E32A 4AC9A 4B35A 3CR8A 4QJ4A 2CL0X 1DAKA 4X8MA 2GCOA 2P6NA 4KLNA 5HZKA 3DM9B 5P21A 2AX4A 2NMVA 5DGXA 2QORA 3LX8A 5TB5A 3H0KA 3LO5A 4QHYA 4D80A 4DUGD 1SKQA 1GUAA 3GLFB 2FNAA 2FMXA 2V54A 1M7GA 4BEJA 4X8LA 3SJZA 2J59A 3K0AA 1IN5A 3THWA 4DEYA 2QRZA 2B21A 5C18A 1KO5A 3GJXC 4PSVA 1JBKA 3JZAA 4DLRA 1E2HA 2RKOA 5FOWA 4JVSB 1YZLA 1OLOA 1EXMA 4C4PA 2Z4SA 3KB2A 4QGHA 4DLXA 1F3OA 3QXCA 1RRGA 2WICA 1G20E 2BMJA 2CJWB 2IBMA 2ONKA 4LYFA 1QHXA 1KHTA 4TYYA 3D7MA 5EE9A 4IVPA 2PX3A 2L0XA 1E1QA 3T1VA 3LX5A 1NKTA 5IF9A 4Q01A 5B64A 3I72A 2J1LA 1G7RA 1II8B 1E9CA 5IT5A 2Q21A 4ZCMA 2OBMA 3NEYA 3REFA 4HSEA 1CR2A 4OQMA 3RRNA 1OXXK 1GRNA 4AI6A 1DO2A 1GZSA 1P60A 1Z08A 4RZ3A 2ZETA 1GKYA 3QENA 4MYCA 3EASA 4W5WA 3R9WA 3L0IB 2GCOB 3AUYA 4F4IA 2GK7A 1VHLA 3SS8A 4C3ZA 2BEJA 3GFOA 4L9WA 5KU1A 1HQYE 3U7FB 3L43A 4Q02A 2YJTD 3UMFA 1GKUB 4HZIA 4C2UA 2O8CA 1Z2CA 2NPIA 2PCJA 5EQTA 2ZXUA 3GLGE 5SZHB 4LYJA 3ZVMA 1Z2AA 3K0AB 2NO9A 4HLQB 3THWB 1IN4A 2OCBA 2BIFA 2CCKA 4C7OA 1LB1B 1EGAA 1LS6A 4ASUD 4LC1A 4D2IA 1LF5A 1CR0A 1S1MA 3I4LA 1JB1A 3ZYCA 4M9ZA 2ZI6A 3QF7A 4KSBA 3N5CA 1TUIA 3A4MA 4JLPA 5AWFC 2W0MA 4A8JA 4QL3A 5AK0A 3DOFA 2ZSEA 4TTPA 4C0SA 2Z0MA 1ZM2A 1TTTA 4A2PA 1BYUA 4TMWA 3TMKA 2BV3A 3P1JA 4TL6A 4A0FA 3ND8A 1Q21A 4HAXA 2GJ9A 1E2JA 2ZIAA 1SVIA 4KI0A 4LPSA 2GAOA 3FMFA 4FXPA 3FFBA 1D8TA 4P4SA 4MQBA 5HR5A 1CJKC 2GXUA 4MITA 5LDDC 3WMEA 1XTRA 1GTVA 4DKXA 3BH0A 3D3QA 1LV7A 1E9DA 1L8QA 1GL6A 2ZJOA 4PC6A 4US0R 1RYFA 4Q03A 3W5IA 1A2BA 1UM8A 2WPDD 1G16A 4QNMA 3OEED 5FUYA 3TJZA 1BOFA 4K46A 4B3FX 5KNBA 4EFNA 1AM4D 4D4JA 2O8CB 5BN5A 2VHCA 1OHHA 4Z1MA 1FL9A 1ZUNB 3THYA 2NPFA 2IYWA 3KKNA 3OZXA 3GLGA 1M74A 4QGAA 2EU8A 5IDVA 4C0LA 4C7OB 2Y8EA 4QHSA 1KI8A 2PEZA 4YC7A 5HE9A 1DAIA 1JAHA 2CHGA 5KSOA 2A2ZA 3BORA 3KFVA 1E4VA 2WWXA 2EFCB 4RZ2A 3GLIE 4F93B 5AJVB 3HWSA 4LYAA 4DWJA 1N6KA 4A8JB 2DFTA 3UANA 5KDOA 4RD1A 1R5BA 3RABA 2KBFA 2ZUCA 3PIRA 2EWVA 3GJ3A 3EC2A 2QT1A 3OF5A 2ZJ8A 2CXXA 1CJMA 1HT2E 4PX9A 4I1SA 2R62A 1Q57A 3AM1A 4P4SB 1UBGA 2F7SA 3KX2A 1HY3A 4ZDJA 1E1RD 121PA 3X1ZA 3W5JA 1I4LD 2A5JA 4CEHA 1P61B 5FR1A 5FTJA 2K5UA 1W5TA 1A7JA 2ZJYA 2F9LA 4HB2A 4PSKA 5JS8A 3UXMA 4CW7A 4YXWA 4LWZA 4XVUA 1KDTA 1VG9B 2KE5A 1XBTA 1UAAA 1JEDA 2OFOA 1PVOA 3HYRA 1Q1ZA 1Z0FA 2XB4A 3CPHA 3T1OA 4JIMA 3KL4A 2CL6X 3EZ7A 3THYB 3P32A 5KSZA 4IEEA 2P67A 5DI9A 3GLGB 2IW3A 2PZGA 2QMUA 1JPNA 2ZYTX 2IHBA 3DZDA 3ZH9B 4U02A 3LFUA 3BE4A 4JMPA 3SNHA 2DR3A 3VAAA 3A1VA 1FMLA 3AUXA 4GRAA 4BASA 1BS1A 1JALA 1UKZA 3MRSA 4BRWA 4Q4AA 1Q3HA 5DYIA 5CYPA 4L5BA 2G1JA 3VQTA 1NMYA 2J7PA 2BEKA 3KJHA 4X8OA 4H1VA 1E2GA 1R5OA 2JLQA 4M1OA 1ZIPA 2WBLC 1HQCA 1YR7A 5KHOC 1DAMA 3GEHA 2J45A 2GXAA 1VG1A 2XITA 1Z3IX 1ZVQA 4JT2A 3CIOA 2REBA 3VHXA 1E2EA 2VP9A 4DUGA 4Q7KA 2DB3A 4M1MA 1RRFA 4FCVA 1KY3A 4PAMA 1EFUA 3C4JA 1AGRA 3A1UA 1TU4A 4B48A 3FTQA 1G41A 1BYIA 4NYJQ 1A1VA 3U60B 1R5NA 4CEHB 3GLHA 4LHVA 2FEMA 3R9XA 1S4QA 4YMSA 4Q9HA 2FGKA 4XVQA 3LQQA 2BBOA 3WXMA 2HF9A 4WZ6A 2EFHB 5EP2A 4DDTA 3PUZA 4L15A 3QKSA 3KDSE 4LBYA 4AYTA 2ATVA 3PUVA 4I1OA 1H65A 4FMBB 4BPBA 1OE0A 1AK2A 4TLAA 4A1FA 1N6PA 2XJ4A 3CWQA 5L3QA 3CNNA 1E4YA 3EPHA 3D6TB 1G19A 3FKSD 2JLZA 4EIWA 2G83A 4YMVA 5EXPA 1MRNA 2QTVB 2ZU0C 3AVQA 1IXSB 1QHHA 2IXEA 4Q4AB 4OI1A 5FOSA 4TMVA 3RLFA 2PLFA 4NCKA 2V6IA 5FBWB 3UMSA 4BE7B 1G3QA 2CLSA 5TMPA 4ILEA 2XZLA 4PXAA 221PA 4CT4B 3QOFA 2ECKA 2JJ1D 2OAP1 3LVQE 4LJ4A 3IHLA 2W6ID 1SGWA 3EIEA 2X77A 2I1QA 1R4AA 2RCNA 4MRPA 3RNLA 1YKSA 5JWOA 3AKDA 3B1WA 4DRZA 3KKMA 2CMKA 1GM5A 5FTMA 3HU1A 4MRNA 3ZS9A 4QBHA 4A0RA 4FD2A 3TAHA 2GKSA 4ZDKA 1P2UA 1AZTA 2Z4RA 1MV5A 2ZVPX 5HZHA 5J4LA 2IYSA 4HB0A 2W2TA 1P9WA 5B30A 1E2IA 1CXZA 3BH7A 1DO0A 4TSFD 2HLDA 1W46A 2OHFA 1E9BA 2DWOA 2IYTA 2IYZA 4ASUA 4TMZA 3GLHB 3PEUA 4Z8YA 3F3YA 2J41A 4GMXA 4TTQA 4M53A 4LJ8A 3E5HA 3VFDA 3BD9A 5G3ZA 4D4KA 2R2AA 1RZ3A 5DI3A 5FR2A 3QKSB 4ESHA 1DS6A 2VH5R 4PZLA 4NP6A 3G5UA 2ZJ5A 1S3SA 4ZV4A 5EXXA 3EXAA 2WJGA 4C0KA 3Q7PA 2A5DA 4PPNA 4Q00A 1GAJA 4XSGA 3SFVA 3VX4A 2ZRBA 3CNOA 5L3QB 2BJWA 3F0TA 1UFQA 4GOKA 2FFBA 3CM0A 1OH7A 3ADKA 1NVVQ 2EYUA 3JVVA 3T12A 3RRMA 3VR1A 3VR2A 4DDUA 4QKQA 2ATXA 3GJ0A 3MLEA 3MG9A 4BLPA 3KQUA 1WBBA 4D26A 4TYWA 3WNCA 4LV5B 3SYNA 3X1XA 1XTIA 5E7IA 4NU0A 5BYKA 4JLNA 2NO6A 2C03A 3Q7QA 1KZGB 2YKGA 4IVQA 4KCGA 1WMSA 2F43A 3CX8A 1UDXA 3FHTA 1WE2A 1Z47A 1XTKA 5J40A 2WPDA 1KDRA 1XD8A 3PVSA 3O47A 4IRUB 2XGJA 3OEEA 4NDZA 2IHYA 1N5LA 2P65A 2JIZD 4JVLA 1EFHA 2FSHA 2PEYA 3QQ5A 3KQKA 1G7TA 3NHAA 3MSXA 3FE2A 2RGDA 3G0HA 2BBSA 4GL2A 3ZDQA 2WV9A 1IY0A 1CIPA 1D2MA 1YQTA 3LLMA 4RZUA 5CJPA 3TKLA 1DTSA 4DZZA 1Z6YA 3TUIC 1I4DD 2KI5A 4LGMA 4JVMA 5FOVA 1R0XA 1ZD9A 2UVQA 1NLYA 2FJUA 1NBMD 1AGPA 2VP4A 3NH6A 4LK2A 1MO5A 1X8LA 4TN1A 1IN6A 2J0UA 3Q5DA 3FPAA 1ZW6A 2H17A 1Z83A 1U94A 5C1BA 5BXQC 1VECA 1VDZA 2GCPA 1PV4A 3VU9A 1DADA 2ZRHA 5DI3B 4PC2A 2QP4A 4KLZA 2JLWA 4IDNA 1G5RA 2IC5A 3C41J 3B8HA 1MRSA 3S1AB 3AVWA 5SZJA 1IHUA 1OFUX 2WVJA 1KDOA 1NVXQ 3A1TA 1NMXA 2AK3A 2PT7A 3KXIA 1UBCA 4PO8A 4QRHA 3Q72A 4A0HA 1ZUIA 3I92A 1E9EA 3FHOA 4MRSA 3TSOA 4MGKR 4IXMA 1TF2A 1GRRA 1QG2A 4N0DA 4UXHA 2B7CA 5FTNA 3HR7A 3UK6A 5E3HA 4BGDA 3C5CA 3BBPA 4F4CA 2D3WA 1E1RA 2XSZA 2MMCA 3WY9A 3K9HA 4DIDA 3I3SR 2MSEB 5J4HA 3CNLA 2GZHA 2F43B 2IA5A 3TAUA 2ANCA 1KSHA 2VLIA 5JI2E 1NP6A 3R20A 3QPUA 1XEWY 4D4MA 2ZJAA 2NTYC 1SULA 3M6AA 4O3MA 821PA 4IDQA 3TLXA 1Z0IA 4A2QA 2WOJA 5ANRB 4TYQA 2X2FA 4YLGA 3U3OA 3WRXC 2HJVA 3ZZ0A 4ABYA 1TQDA 2BMEA 3I32A 4URYR 3B82A 4OL0A 3KKPA 3CUEF 3CWZA 4R9UC 1DAGA 2CE2X 3GJ7A 4NYMQ 1XTQA 2J0UB 2Z5FA 2ODWA 4OJKA 4C0BA 1NG9A 5JSZA 2IS6A 1KAGA 1QRAA 2J0VA 3FWYA 3HR8A 5FBLB 2NO0A 2HT6A 4UXJA 1JR3D 3IEUA 3VU9B 5J4YA 2FSFA 1U8YA 2NZ8A 1VKJA 3F5FA 4PHGA 2EW1A 3IILA 2P5SA 2XOKD 3NWJA 2ONJA 1SVSA 3AH8A 4M1YA 4F92B 1VCMA 1SVMA 3HDTA 2FPMA 5BYJA 1G1MA 2R6AA 3I1FA 2O0HA 4M8NE 2NGRA 1EWRA 4C0HA 1SVLA 5DE3A 3AKCA 1ZM9A 2XTZA 5L3RA 4LBZA 3F8TA 1HA3A 2AD1A 3TUJC 4V0NA 4E22A 1U98A 2VSFA 4GDFA 2QAGC 4MGIR 2I3BA 1XMIA 3A37A 2N46A 2G9NA 4A92A 1YZKA 5ELXA 3FKQA 4MUBA 1MR3F 4PPFA 3G82C 5C46F 3A6PC 5GJWC 1NF3A 5JJIA 3T5DA 2FX3A 2PH1A 3NDBB 3LNCA 2IYXA 2F1IA 1RW4A 1KTVA 621PA 2HYIC 1TF7A 4Q48A 5KDDA 1JJ7A 2A5YB 5E4FA 3L0PA 2JDID 4Q1EA 1YR8A 2GA8A 2JJ8A 3FKSA 2G3YA 2PMDA 1IM2A 2D62A 3QIAA 4PO9A 5DO9A 4DT1A 1NN0A 4PHFA 1D9XA 1KAOA 2FG5A 2QGNA 4I81A 2DY1A 3OAAD 5CM9C 2BKUA 2DBYA 3L8YA 4EPWA 5JSZB 2VPPA 5EZ6B 4GBMA 4PC1A 1W36D 2ERXA 2KSQA 4D82A 1U8AA 3MJRA 2DHRA 1A82A 2JJ1A 4HAZA 4R71A 2ZRMA 5KNDA 2W6IA 4KVGA 4S35A 4BFWA 4XWKA 3HYTA 2YC2C 1E3MA 4QBIA 2ZI4A 4QGFA 1Z8FA 1QHSA 2NOAA 2WAXA 2QENA 1FTSA 5FPHA 3T15A 2JASA 4CEJA 1Q44A 5BN4A 4Q18A 1M1YE 1Q3TA 2BBTA 2A5FA 1LVGA 4GOJA 4PHTA 2RGNC 3MGCA 3TSWA 2BM1A 2ZRCA 3CRQA 1OB5A 3KJIA 1DBSA 1NJGA 4HUQA 4OK3A 4TSFA 2PJRA 1J7KA 4EKDA 2ZRFA 3H2YA 2PBRA 4DDWA 5CIWA 1X6VA 2HT1A 3EZ2A 3CF6R 1UKVY 2JGNA 2RMKA 3NBFA 5FTLA 4HUTA 2ZRIA 1GFIA 3AEZA 2C8VA 3U5ZB 4HDQB 3SE0A 1TEXA 2HXYA 2FZLA 1E0SA 1W4CA 4I1UA 2RH5A 3RS3A 2NG1A 1L2TA 3TK1A 1KMQA 1KK3A 1YZUA 4XOIA 3ND9A 1N0VC 3NHBA 4NL4H 5EE0A 2AL7A 3E1SA 1NG1A 1CJVC 4DT1B 2X2EA 2QQ0A 3RS7A 2EVWX 4NYJR 3FMPB 2R6GA 2EFDB 2C99A 4KFTA 4KSCA 2XAUA 4XH9B 1W47A 1DG1G 1COWD 3C16C 3N2IA 3AF4A 1KO8A 4KBFA 5FUXA 1BH2A 3NBXX 4PHHA 1W5SA 1KY2A 1D2NA 3M0EA 2ZI7A 1UEJA 3IIMA 3V00A 5H70A 1Z0KA 3CPJB 1EESA 5CB6A 4B74A 4JBWA 4IOKA 2FF7A 1T8UA 4II7A 1XPRA 3GEIA 3BOSA 1CRPA 4OHXA 4TL8A 3EIQA 2VP6A 4LHWA 2ZE7A 4UNRA 4QC2A 3VHLB 1GNQA 1XZQA 1TPZA 3QBVA 3QY0A 5C4MA 2JIZA 1WCV1 4CEJB 2OV2A 2F1RA 2EWWA 3LAWA 1OW3B 4IFEA 2AXPA 2GTPA 2H7VA 1T8TA 4HUQB 1P72A 3PV0A 1TEVA 3ICEA 1P5ZB 4BZXA 4XSHA 2QM7A 4OHVA 1C9KA 5F3WB 1NBMA 1Q20A 5E7JA 2X1VA 3D31A 4ERNA 3DPUA 4B43A 1TF5A 3AKYA 3QEJA 3EZ9A 1JJVA 2AHOA 3FDIA 3GD7A 3MFYA 4QG7A 1JR3E 4B3DA 2FU5C 4B3CA 5EJEA 4EPYA 4LC0A 1AQYA 2GF0A 2OBNA 3SI7A 2QEQA 1E9RA 2WWHA 2WZQA 3OIVA 4F38A 3IDQA 3IO3A 4W5HA 2ZRDA 3K0FA 4I4LA 4IDHA 4UNSA 5DSZA 3ZLJA 5G53C 1W36C 3MWLA 5KPDA 1D9ZA 1L4UA 2QNRA 3B9PA 3CW2A 1A4RA 2NIPA 4Y0AA 1J2JA 2CNWA 3A1WA 1XD9A 2EFEB 1GL7A 3OE7D 3H4MA 4OQLA 3IHWA 4POAA 2XTMA 2QRNA 3KUDA 1P62B 1M6NA 1G3MA 3PEYA 2IS4A 2CHVA 4TQUS 2XXAA 2QU8A 5G41A 1ZNYA 4EUNA 1IXRC 1OSNA 4NH0A 2RGNA 2AKYA 4I1VA 4R2IA 1GP2A 4HAYA 1XB2A 4KYUA 1EFCA 2VBCA 1GSIA 4LHXA 1XJ0A 1UBEA 2OCAA 1KK1A 1PZNA 5JEEA 1E9SA 1JPJA 1XCPA 2OFXA 4A2WA 1NVVR 5KOYA 2BDTA 4IXNA 3HPRA 1Z6XA 3UG6A 4PTLA 5DISB 4B3XA 4W7SA 4AKHA 4WAUA 2F3RA 1XJCA 1N0UA 3GCGA 1FMJA 4BZQA 1XPOA 2QBYA 4Q9JA 1IAQA 3ADBA 1RRPA 2C98A 1G18A 3RS4A 3EARA 3UPUA 3LBHA 4IW3B 4ZKEA 4WXPA 4WVFA 3DHWC 4QBGB 4PO1A 1OT3A 4GZMA 5GADl 1JR3A 1KI1A 4KBGA 3PEWA 4OHWA 5D3MA 3D8BA 4U00A 1VG0B 1OXUA 1NSTA 3K0SA 1FP7A 1TADA 2OFWA 1UJ2A 3K0FB 1G3RA 4TMKA 5F9HA 3PG5A 1ZMXA 3H84A 4HATA 3T1TA 4PQRA 3KQHA 4P31A 3AF3A 1MH1A 3WHLA 1VYTA 1VG8A 3QXXA 5LD2C 2LKDA 4X8HA 1R6BX 3EC1A 4E5UA 2D4HA 2QPOA 2QPTA 2VL7A 2W0SA 5GVRA 3EPLA 2F3TA 5KPJA 3ADDA 3WNBA 1X3SA 2Q9CA 2JLXA 3ZD7A 4KFUA 2XXAB 4BFYA 1US8A 2V7QD 2ZTSA 4Z54A 2F6RA 2P6RA 3UKDA 2F1HA 2ZROA 1N6HA 4V0ME 2C2HA 2G0NA 4QHTA 2JLVA 4MYUA 3EPJA 2Q6TA 4NBSA 2IEYA 4ON9A 1R10A 3TR5A 4EDHA 4DB4A 1XFAA 2VSOA 3CRVA 4G5OA 2WMNB 2ZRAA 3LA6A 5JJKA 2QN6A 2RHMA 2QBYB
chains in the Genus database with same CATH superfamily
1CHNA 4FN5A 4KV9A 4BXOA 3QOWA 2ACWA 2AVDA 2WT8A 3ZGOA 3FPBA 3ES9A 1TM4E 4WLOA 4CGYA 1Y1PA 3TTVA 2GPWA 5BPFA 1GU1A 1GZ5A 1YQEA 3JYNA 4YP1A 3I62A 3B53X 5FB3A 4PG7A 4XTCS 2LWIA 2D2VA 5D3MB 1REQB 3MGKA 4G0NA 4H4CA 1KKUA 4CQJA 5DNAA 1NOJA 4B3BA 2D2EA 4BNWA 2PMKA 3ZKWA 4OQPA 1OROA 3RC7A 1OWMA 4HH1A 1T9BA 1YZNA 3AR9A 3B1ZA 1PSDA 5E2AA 1P5HA 3BHIA 2C00A 5AJHA 2YUIA 4HAOA 5FPPA 1P80A 5AI5A 2CD9A 5IXJA 5B4UA 1EVZA 1O6ZA 2FKAA 3K6SB 4KGVA 2H2GA 4UNNA 4EGFA 4NYMR 1CNFA 1HNNA 2PRJA 4TRRA 1KQGA 2GEDA 5EWMB 5CNJA 2YNMC 5TPWB 4D97A 2QT0A 4HMPA 3GXOA 2QVGA 3EISA 4JJAA 4Z3DA 4C2AA 1F7UA 3VNVA 1NBHA 2IIBA 2FSVC 5C0OE 2O0MA 8ADHA 3D02A 2YVLA 1TUEA 1NY5A 3O3MB 2V5UA 2PMBA 3OI7A 2IZ7A 2DAPA 2FHPA 4MRMB 4EM6A 1PX0A 1TT7A 1TOAA 4N3AA 4AZ3B 5DEIA 4MUAA 4M60A 5DNEA 4XWWA 1LSUA 4CIXA 3VDQA 5BV7A 4LYEA 2FZ4A 2GVNA 5FADA 4GC5A 4QULA 2IOQA 3RFCA 1NQVA 4UFPA 4IHAA 4LTNA 3A05A 3HB0A 1B6TA 2BLLA 4AT1A 3LP8A 2HWKA 3AC0A 3O8QA 3GPCA 3BXZA 2XMDA 5HKOA 3ZIUA 1EFPB 5LMNB 2KX7A 4PPYA 4INPA 4RK1A 2X4DA 3A8TA 2HMUA 4LWQA 1COWA 4KIGA 4GKVA 4EY3A 4LQCA 5FJIA 5AI0A 4UBJA 1RI5A 2QLLA 1J42A 1JHZA 1QO0A 1VTKA 3B9RA 4R51A 4AJJA 2DFLA 2ORVA 4MQEB 2FPGA 3PLAE 3A70A 2O8BB 3A9SA 1GZ4A 1YS9A 3AR6A 2R44A 5C3MA 2X8AA 3M5CA 1N7IA 2FN4A 5E0KB 3TXYA 3UOAB 3U61B 1UZLA 2ZUSA 4KWEA 2GDZA 5DK6A 3ZBPA 2OCXA 2R97A 3FFAA 3MM4A 1Q0HA 3UPTA 2ZJFA 1OF1A 4AWBA 1NUTA 2OQVA 5T4FA 4CF3A 3W7BA 1PS9A 4PFQA 1KOLA 3UK7A 4P3NA 1SQ6A 4DJ5X 5JNRA 2QMHA 4OATA 3TNFA 2ZYHA 3IBGA 5IJXA 4AMBA 3Q8MA 1FFGA 5CH5A 2Z1NA 4ZYVA 1YRLA 1Z4NA 2O20A 1X1TA 3FMOB 3W4IA 3SNKA 5LU8A 4I9UA 1V5IA 2R1VB 3T06B 1PFQA 4YLYA 2ZWVA 3FNEA 1YMUA 2PLWA 2WOOA 4M76B 5B3KA 5K8UA 1KSJA 2EJCA 3PYMA 4M2LA 3VYRB 2VYVA 1FQKA 3WE7A 1XTZA 1UJCA 5THKA 4KH1A 4WBNF 4PG8A 4Z2YA 1ZM7A 3I39X 4GT1A 3KUKA 3DMDA 3SDSA 1LZKA 2AR7A 3C6BA 3DS8A 2RHDA 1Q7CA 2VNIA 5KWSA 2A4MA 3D6FA 4CTNA 3RD5A 1Y1KE 4JJ6A 2IZOA 1OU4A 4K8RB 5EZYB 3KVRA 3WV5A 1IQUA 3W6NA 1N75A 1J0CA 2H3EA 2VK4A 3IYLW 4G0QA 4X94A 4RIGA 4L16A 3T5AA 1GGKA 2J9RA 3FSGA 1EDZA 3KKOA 1QYWA 4HLDA 4W8OA 5HA5A 4A0GA 5L3VA 1SXPA 1YJXA 1YDEA 4YJGA 5A6SB 3WMWA 2QHXA 1DX4A 2H1LA 1EFRD 3GLIB 4K6KA 3DF9A 4R01A 1TD1A 3FYDA 3QXSA 2OV1A 3IQGX 3PL5A 3NC1C 4P2BA 4ESEA 5A6VA 1Z74A 4AQYB 5LD2B 2R6HA 1NYRA 4G09A 4XXHA 1OYOA 1N1EA 2YNMA 3BQNB 4B2IA 1BQ4A 3NRBA 3LHIA 5KQGA 2C8KA 4ZCTA 3G9QA 3P2MA 2NZ2A 2GLUA 2BELA 1HL7A 2O3JA 3WGGA 2UXDB 4XR9A 2BZ0A 4Y2XA 3OF2A 3KU4A 3TGPA 4OCZA 2ZJZA 4HJRA 2BFFA 4FE4A 1UBLS 1N1MA 1CS4C 2SHKA 3L4BC 4GH5A 4MRVA 3SMQA 4OD0A 3GBPA 2P40A 1SK8A 1WOYA 1WDTA 4DCOA 4GU5A 1VHJA 2ZR7A 4MKXA 4O2BA 2E21A 2Q3MA 4DM3A 4B82A 4MQ4A 4IWNA 4DAEA 1RWBA 1XWFA 3ONWA 1MDFA 3HCNA 1SXHA 2J5XA 3MTGA 4ZAFA 1D1PA 1U9JA 1V9CA 4S1TA 3WFIA 4BQFA 3ANXA 1GPAA 5K01A 2QRHA 1YCDA 4FYXA 3PKIA 3LUHA 1BMDA 2WSYB 1YZTA 4YRCA 3D6VA 4YDSA 3BGWA 1Y6QA 4MR8A 1X7YB 1XMVA 3M6MD 4PS0A 4TT8A 2AJ8A 1A8SA 2NADA 2BGTA 1IBRA 3IOYA 4FFDA 2ZE6A 1U2QA 2HL6A 3KV3O 3UJ6A 4CMEC 5AUOB 4WZAE 1RQNA 3CFYA 3OUTA 2QDXA 2VHXA 4P3OA 1PO7A 3GUYA 3PSHA 4FFSA 5FCDA 1CUUA 5C3UA 5AFSA 1WZ2A 2X4GA 2P6MA 4Q37A 2Z83A 4NJMA 3ZCQA 1MB9A 2KJQA 1GTSA 1I5EA 1X7DA 2A1UB 2CL7X 1IPFA 3PJDA 5ES4B 3HGQA 4GMKA 2WIBA 4A15A 2RHTA 1VHTA 1G8PA 4BV2A 3ZIDA 1XI2A 4JJZA 4F96A 2H1RA 3KVYA 4AN1A 5A3SA 1K5DA 4JYBA 4PVCA 3C5EA 3BMNA 2B2CA 4FNMA 1NNUA 3N86A 3CYFA 1Y1LA 2X3UA 4X7MA 3ZI4A 5LQRA 2AN5A 2BC9A 5I4BA 4IQ4A 4REMA 3TINA 1MJNA 2R84A 1M2EA 3B1XA 1H22A 5LQKA 1E69A 2QN8A 4L0DA 4URWR 3BRWD 1GZ6A 1RFGE 1U90A 1GGVA 3CX6A 4YR9A 2CNBA 4HTAA 4J6EA 4E3ZA 1A9XB 1C7FA 1WXEA 2OZVA 3BDVA 3LJKA 1Z5PA 2QVLA 4JIGA 3BGVA 2R6CA 4BUJA 4BLTA 1TVCA 3AHIA 3L5OA 5DLEA 4DLTA 3CUWA 1XP5A 3OO0A 3MJSA 1EE9A 2B5OA 3WG9A 2VTBA 1NUUA 3BZUA 4JY7A 2H8KA 5CXSA 4KQCA 1SKYE 2VF7A 4OMUA 1QP7A 4BNTA 4U9UA 4I36A 4B1FA 4ZVLA 3MD0A 5GOTA 3BREA 2KBEA 4PGHA 2VT7A 4NZYA 1NI3A 1Y8RB 4EY4A 5LVAA 5CJ2A 1X86B 2QTCA 2PWAA 3AI1A 2NNWB 3H05A 3E18A 1U2PA 4RFVA 4NBWA 1QMPA 3DAHA 4J94A 5LB2A 1JVBA 1JHOA 1MVLA 1SKAA 2OCDA 3LQ4A 3NAGA 3NUQA 3Q85A 4KE9A 4MVJF 3WLEA 4NS1A 5I9SA 4TV9B 5B1EA 2OD9A 1AURA 1DC5A 2Z09A 3RIHA 2WJZB 4BLRA 1NHGA 1X2BA 2HJ9A 3NNDA 4I4TA 2AI3A 4JLJA 4MARA 3ACDA 1IEXA 4MV3A 4UBMA 1B0UA 5HE8A 1M2FA 1QAOA 1XKLA 2GEUA 2X8JB 2XE7A 4L76A 3K6KA 1QG0A 3PHGA 3RF6A 5JUWA 4BFZA 1GHTA 1DKMA 3KYJB 4S3MA 2HIAA 3FPFA 5KCMA 4E21A 1PJ4A 3RS8A 5JNSA 1QHYA 2YWHA 2ZTMA 4TQGA 3G1TA 3A4YA 3M5DA 4LX0A 4YECA 3Q7EA 5GVSA 3RVPA 4Q1DA 4RZXA 4MB0A 2OR3A 5HHTA 4HFNA 2O5RA 1P0IA 2FV8A 4G85A 3RLIA 4CUZA 2MSNA 1FB5A 3L4BA 5AVQA 3NYIA 2RB4A 3ZDXB 3O3OB 2XB2A 3BIOA 4F5EA 3T9EA 5B1YA 5KYKA 4ZIRB 1UT6A 5HUJA 1HLFA 3KTAB 1S3IA 4B7UA 4LNHA 4KJZA 4RADA 1LPBB 2H54A 3IAFA 1YQDA 2NO4A 4HQOA 5JWRA 3L0SA 5E6RB 3BWDD 2PGIA 4B47A 4WY8A 1M2OB 3FNHA 5JQGA 2FDXA 2R11A 1IK4A 3U4QA 1JA0A 3I73A 4UOQA 3UUGA 1H4SA 3KXDA 1WL8A 4LKRA 5EVJA 1KDPA 5HS6A 3AHDA 1WMBA 2GEJA 1QBKC 2B1GA 1M2JA 1YRYE 3SPXA 4BNNA 1ORDA 1KEEB 1CD5A 4JHLA 1WU7A 4YN3A 1JECA 2YJZA 3R1IA 4CG1A 1CVLA 2AR9A 5JD4A 2B4KA 1Q0QA 2YWJA 1P4HA 3M83A 3A2NA 1HE5A 4LZLA 1P2SA 1X3LA 4BWGA 3A7DA 1UDCA 1HEUA 4ZPXA 1PNQA 4M37A 4CEIB 3HCAA 2ERCA 3CRW1 2SCUB 2H52A 2V6JA 1GXSB 1VSQA 1JQ5A 3NVDA 4HEA6 1G21E 4ND8A 2YXEA 3WSVA 4DMGA 4MCIA 5F9MA 4ZYTA 1WAMA 1JLMA 1HM5A 4DJTA 3NIFB 5TR9A 1ZD2P 4JDUA 3ZDBA 4N39A 3C3MA 2W2MA 1IDOA 3E2PA 1S8FA 1W2GA 2Q3HA 4NVRA 1CEEA 2E4ZA 2ZYAA 2ZBUA 4NCNA 1QS0B 1YCHA 3ORFA 4Q3LA 1WBJB 4FVTA 4KODA 1PYDA 1MIOB 2CD7A 1NXQA 1X8XA 3LDFA 5SICE 3DMTC 4DMHA 3CPEA 5E1BA 3BMXA 4AO7A 1J8FA 1K6MA 4UZSA 1L7OA 4GPTA 3DBHB 5KQMA 1BEZA 3VR4D 3WLSA 2GPTA 5SZKB 1R0CA 1ZJJA 3GVHA 1S02A 5BRAA 2BHRA 3GLFE 1XAIA 2FPSA 2OK8A 2W48A 3WDMA 3ZTWA 1JDTA 1V11A 2M98A 2H5EA 1ZO8A 2WAMA 3ANMA 3DMYA 1P0CA 1CHDA 2B8TA 4G23A 3GDHA 4R98A 1P81A 4WBSA 4BMCA 4ZYXA 1EPUA 5IKEA 1DUSA 1J1ZA 3TG2A 3AU9A 1L4KA 1E2FA 2O54A 3DTNA 1H8EA 5FUWA 2W6NA 1BD3A 2A4KA 3ENKA 1FXWF 1V9LA 4UHHA 2QRPA 3NKFA 3OCZA 1A2QA 1VYUA 2M6SA 2R3SA 4UKDA 4DOMA 5HIKA 1W9HA 4LY0A 4UATA 5ESDA 4B2PA 5LYYA 1M73E 4IKEA 3DR5A 4TS1A 4L4SA 3UENA 1QYCA 4ALLA 1OYWA 2ICAA 2PU5A 4QYMA 4TV9F 5L4NA 4LDQA 1OHHD 1YUBA 3TO5A 2VRNA 1IEWA 2AFIA 1RWQA 2BFWA 2BFNA 3GNLA 4CM9A 4HFRA 1VPTA 3FZEA 2I9PA 3L1VA 2VS1A 1GZUA 4JWKA 4O2LA 4K9RA 3R8CA 3BXFA 1TLFA 3T1NA 4QA9A 1ZW1A 4ZJYA 5AW3A 3S99A 1PYGA 2EV9A 2W2KA 3L8MA 4EI2A 1WCIB 4F60A 1RI4A 3PE3A 4QODA 3I37X 2RH4A 4BLQA 5LA6A 2C2YA 3AW8A 1Z15A 3G0CA 2BFDB 4U7GA 4R40A 1L1FA 4ACBA 3IAHA 1FP2A 4BNFA 4DBLE 5BYBA 5JXIA 1O96B 1Z9BA 2W6CX 5K0LA 3IQDB 1R9MA 1ZDMA 4PX2A 5AVOA 4UPDA 3FX2A 2OXCA 3U56A 1OX4B 2DM6A 3WNZA 2HSZA 1GQYA 4MLPA 2DZDA 3ZWPA 2GM9A 3FWPA 3O74A 4OSEA 1U3GA 5JECA 5K0CA 4HEA1 3DLCA 3ESQA 4J75A 2OZKA 2G8NA 1LUAA 4R2JA 5EPOA 3LZDA 2H63A 5DEOA 1TFUA 4NZ9A 3W2GA 2FN9A 3SE7A 3EAGA 2FAXA 2IP2A 3A11A 4ND7A 2CK3A 4JKYA 1PFWA 4UUAA 3I2HA 1VKOA 4UAVA 4UUPA 1XEWX 2DTEA 2J46A 1W49A 3LVBA 4M1TA 4N40A 2PO7A 4ECEA 1M2NA 1ONSA 1Q19A 5B37A 1P1FA 4I1PA 2OHJA 1M6YA 4N3GA 1NDQA 4K9NA 3AY7A 3K05A 3FW1A 5C9ZA 2OE2A 1D6NA 3M1IA 3NXSA 1T3SA 3DFFA 4L8WB 4MYTA 1NDUA 3F3MA 4JI6B 5EXSA 3IQIX 1NVWQ 2WQZA 4PRYA 4RKRA 1FFEA 4U1RA 1YO6A 1OKKA 2ETVA 3JQGB 1GDHA 1PJ2A 3JALA 1FTWA 4N82A 5HF6A 3JRWA 1L5FA 6ABPA 2VSYA 1ZH2A 5F51A 1E3LA 1AB6A 3UWPA 4DNQA 3EIOA 4MH0R 4YCMA 3QKUA 2XUPA 4QEDA 2AOWA 1I1HA 1UMCB 4QVKA 2WIAA 1N5JA 2VTDA 5JZ9A 2ANBA 1L3IA 4IFBA 4WESB 3LQ2A 4MO2A 4UREA 4DIBA 1KMCA 1T4CB 2C9DA 2FQ1A 4JNKA 4PW0A 4COOA 1IHDA 3EODA 4UC0A 2P5TB 1I9CA 4UBKA 1OI4A 4IIFA 2VHZA 1O0CA 3UKJA 3ZTTA 3C14C 3PX3A 1M1YA 2RC5A 3IUSA 3UAOA 3ZVLA 3GDWA 2DPXA 2J7PD 4P4UA 1PZHA 3EN0A 3A9WA 3V80A 3KAKA 3OHPA 1WZNA 4PAWA 1VMDA 1CNMA 4M3NA 4O4LA 4GC9A 4QPNA 1P9LA 1P29A 2CCJA 3L7CA 1PV2A 1EUCB 4OXQA 1CY6A 2VA9A 4Q1VA 4YNBA 3DQPA 1WCWA 5AW5A 3PXGA 2JIDA 4GNRA 4EBFA 4G5XA 1SEPA 1ZR2A 3AWDA 1L5LA 1XR3A 2AZMA 5FPTA 3GK3A 2QI9F 2YWFA 4YHHB 1QF9A 2IYPA 2B37A 2QP3A 3SDZA 4QRDA 3DZHA 2PN1A 2K6GA 3JS5A 4QRIA 5IKMA 3BWMA 3G2KA 1AOXA 1Y89A 2AX3A 3EH2A 1QCZA 1UPFA 3NTQA 4DPKA 1NURA 5IBCA 5JE8A 2QD4A 2ZPUA 4ZO7A 4NZNA 2WB4A 2WKRA 4KO8A 2R5NA 3VX3A 5JTTA 1G9SA 2J9YB 3TTWA 4B9AA 1QANA 2NPOA 4NMWA 4L7VA 3M1YA 4IEIA 4MR7B 5EE5B 3SQXA 1T43A 2MT9A 2ZBEA 4AP9A 1KOJA 4IDEA 2H9AA 3VUEA 4F46A 2B4AA 3TQHA 2B78A 4ZQBA 3OECA 1BO6A 2GD2A 2GWHA 3EXIB 3H2KA 3ZLVA 1H4TA 2C7RA 4EHIA 2QD2A 5PGMA 2LIPA 3IVMA 2IYEA 5T6BA 4WT7A 1YTLA 3CH4B 2WM9B 5DNDA 5J2UB 1NBOA 3RHFA 1KK0A 1SCKA 3HL4A 4M22A 2W37A 5F2KA 4NCIA 1Z6GA 4E88A 2DBQA 2H06A 4DEVA 2CEKA 3BERA 4DR4B 2AVNA 2XNDA 2Z2XA 3C15C 4UNQA 4ZTZB 1YE5A 3HWWA 1CDEA 4ZOCA 5A4MS 3KZKA 1YH3A 2JFBA 2X40A 2P9YA 3ASUA 5ITVA 3U7GA 5HQTA 2VAXA 4J91A 2O52A 1EP1B 4F4JA 1S3FA 2IITA 2PSHA 1NUAA 5B1HA 4YPOA 2H59A 2HBZA 3I1YA 1W59A 1G8FA 2I1LA 3D3KA 4WJZA 2FWNA 5IJAA 4BP9A 1DIOB 4I66A 1QRDA 1XVTA 4ZREA 3LK7A 4WUVA 1LF0A 1UQTA 4YQFA 1OZFA 1EI9A 1OIXA 2EX1A 2C3OA 2FPPB 4DCPA 2OV8A 4F85A 2EBFX 3DHEA 5AJZA 2OILA 2WJHA 1TRKA 1THTA 2BCEA 3CXUA 1GQSA 2EC5A 2XUGA 2CVHA 3HNRA 1BMFD 4AMZA 1K2VN 3SFTA 4R1OA 4BVEA 1RXUA 3EUWA 4ADSG 4X62B 1NNI1 1U5BA 2GUGA 2ZIGA 3GIWA 3AHGA 2R8XA 1U2GA 3S28A 3B2EA 1N1GA 3HZOA 4IX9A 3QX3A 1GPKA 2OAEA 4MS4A 3SYTA 1IG3A 2CYBA 3LUCA 2R8EA 1IXYA 2ZUEA 2QL6A 2FW9A 3ZHXA 4GZLA 2RGGA 2G5PA 2ACKA 4GS5A 4BB9A 5BQFA 2Q5IA 3HBFA 4J3FA 2G1KA 4MYHA 2GETA 2G7MC 4B7CA 1SZJG 1E5DA 3JWPA 3KEFA 3W0LB 4P5PA 4RPHA 1VRCA 3GMDA 4Z9BA 4BGIA 1F8FA 4JB0A 1KI6B 2IE0A 2BEVB 1XK6A 4QO8A 3L1UA 4XEUA 2GLTA 3GCXA 2WWYA 1HORA 1CLUA 2W22A 4O8CA 3EX7C 4C2TA 1BS2A 2G28A 2R7AA 4JC5A 3QELB 4XRRA 4DSNA 2PWZA 1KIFA 3JQ7B 1YVRA 3ZQJA 2BGRA 1SN7A 5BWMA 1JIKA 4QNRA 4AULA 3CVUA 3AP3A 3RUHA 5B58C 4TLDA 4HWGA 3S40A 1RPJA 4M87A 3BSWA 1E3TA 1P0MA 3JSAA 2Y3IA 2ZANA 2GH1A 2QL7A 2DUUA 4OHFA 2R85A 3DMRA 1TU0A 4E51A 2DFNA 1ZD3A 5FUVA 5JPDA 1RI3A 1VE6A 4Y9SA 5ADVA 1SCBA 1AKQA 1TTHA 2VT6A 3JVEA 4Y7CA 5AKIA 5TGZA 4DY6A 5EJ4A 1AV7A 4XE5A 5CVEA 5D51S 3HJAA 3AF2A 4OQZA 5K8LA 3DFUA 2BEUB 1IVYA 2QZZA 4HOYA 4XIGS 5CU7A 2I1WA 2PA0A 5TARA 2Q6VA 2LD4A 2NM0A 2XBLA 4LW8A 5F1KA 4Z0TA 4EZEA 5LIPA 4WN9A 1CRLA 1OD6A 2AQ8A 2IEGA 2UZ1B 3L7NA 4MUHA 1O3YA 1HFWA 3BFVA 3TR0A 3U39A 1B8VA 3FDZA 1WZEA 4BMVA 1QLJA 2F8LA 1F0KA 4GFDA 4DIEA 5MN4A 5C7YA 2D0PB 2R4TA 1Z4KA 5HKAA 4HTFB 4MVXA 4AL4A 1RT9A 4W99A 4JBNA 4DRYA 5DHFA 3R0XA 2G06A 4NZOA 4CYMA 3OCXA 3WIOA 1JKJA 4WCFB 2Y77A 1ESDA 1W75A 3GG2A 5J2UF 3TGLA 3E81A 4NG4A 4LE0A 3EMDA 1WX1A 3L7IA 4QOEA 1N77A 1QO9A 4QGGA 3OJOA 1BHO1 2CFIA 4RLHA 5ALIA 4F6RA 4ZV9A 1PJQA 5J63A 3WL4A 5JMPA 5KINB 5IVKA 5JQGB 1RAEA 2Z6AA 4EGQA 3CINA 3E4CA 4NIMA 3RSCA 3ZD8A 4EI9A 1M5UA 1KFBB 4EL0A 5AR1A 4KXLA 3AHCA 3FRHA 3D6MA 3Q41A 5ER9A 4Q1AA 2JLBA 4HNRA 3CXRA 4AMVA 3VR4H 2O4UX 3KQQA 4ROSA 1YOVB 2BFMA 3L7JA 3RYFB 4E07A 1II9A 2UYOA 4BLOA 2FFHA 1AA9A 2HEIA 2BZSA 1LRKA 1X0VA 2ERYA 3QW4B 1GADO 2W43A 3CSUA 1F2DA 1NUPA 5EA2A 2FVXA 3MJHA 2IW1A 1FLNA 4JBYA 4Q3CA 1UANA 4V02A 2CFOA 5I7UA 1WG8A 1Q0SA 4RLFA 2OXEA 3DV9A 4GKKB 2HCTA 1UEIA 2R1TA 2V6MA 2XX3A 1XXHA 2YN0A 3SOZA 3KQWA 2EW2A 3QW2A 1RWXA 2QSUA 2VJOA 2ORYA 2BM0A 2P9GA 3DFKA 4KPYA 1Z6QA 2VYFA 2E2WA 2DRIA 2MOKA 4JEIA 5ICSA 2PQMA 5KCZA 5FL3A 3GUCA 1R0BA 3QE3A 1QB8A 3BTVA 2JA1A 2CUNA 4EG0A 3RYIA 5HJ7A 1TIKA 5MN5A 2NVBA 3NATA 1AJEA 1PR9A 2OTCA 4PNPA 4MQUA 1V8OA 2H8GA 1GO2A 2R8OA 2X3YA 3T3DA 2AJDA 3GOHA 2FUG6 4DDVA 3WNDA 2VZEA 2PKQP 2B0JA 1KJZA 4ZKDA 3NRJA 1RE0A 1UK8A 3MJ4A 3MJTA 4CIDA 1F2TB 2IJGX 5IUKC 4RJTA 4GPEA 4PZZA 3GFVA 2V0CA 3QF4B 4TQAA 3W6ZA 2VPWA 4MW0A 1JXMA 4KFRA 4XGRA 3RWMB 1E8MA 1KA9H 4JT4A 1GNPA 4M38A 4AS1A 2XCQA 1M1ZA 4OB8A 5H68A 1TU3A 3MYRA 3CMMA 3GT3A 2YWRA 3OZ7A 1FLDA 1X92A 1ZCAA 5EIBD 1UDWA 3OZAA 1KTIA 4MW1A 2BGIA 2I66A 3ISJA 3TQCA 4M1EA 2DTXA 1W1WA 4WLEA 4V1CB 1LNQA 1GIAA 4H7PA 1DOHA 1MB3A 4HR7A 3RSFA 1C2YA 3VTZA 1EWVA 2NV0A 3LT0A 4NRDA 1AY0A 4OY3A 3U44B 2ZATA 2HHCA 3EEIA 2VP3A 3WLNA 1MW8X 1MFZA 3OO1A 2XEDA 4OJQA 1G63A 1EX1A 3RVNA 3RAEC 1PDOA 4ZA2A 4RORA 1XEXB 3N2NA 3TQRA 3AF5A 2A9KA 3GN1A 1E20A 2LCFA 1OASA 1B74A 2C4UA 1ZFNA 3F46A 4DXHA 4MS3A 5F7JA 3SR4A 1EXDA 1QHFA 3F7MA 2EZ4A 3JASA 3R3SA 4JYZA 1MQ8B 4LI0A 1Z0JA 3SZRA 3C6ZA 2QG6A 1OXVA 1TYAE 2HIHA 3TVDA 5KYXB 3JYLA 4L08A 5B6PA 2CLDX 1AXEA 3BHJA 1HYQA 3PEYA 5AVSA 2JHFA 1E4EA 3DE0X 3QU9A 2X76A 1JW9B 3OU7A 4MKGA 2NZWA 4RZQA 3V7UA 4HXGA 2GJAA 3GW8A 4IX1A 4NBTA 3H6KA 4FHCA 3LE8A 4Q9DA 3GA5A 1FBTA 2C97A 2P9BA 5C31A 2IXBA 1J9ZA 1GVNB 1SXJC 2YV5A 4GVXA 4KIFA 5G1NA 3L6DA 2ZDGA 5IEBA 4UULA 5LFAA 3AINA 1MGOA 3DD5A 1NTRA 3CS3A 1IQPA 1IUOA 1QIEA 2IYYA 3BK2A 4MPTA 4XDHA 2XD4A 1UK9A 4CKEB 1LBQA 2BL4A 5CIYA 2F62A 5F4ZA 2C4NA 5E6UB 4UE2A 5B12A 2FW6A 2BP7A 4Z3OA 4NZZA 2X4LA 4CFYA 2O0JA 2JS7A 2C92A 3I8SA 1NPYA 1E2KA 1ID1A 3MXOA 3QA9A 4WASA 5KWEA 4M54A 3ZU3A 2IH5A 1E3IA 4NFYA 3QI2A 3K8YA 4L6AA 1P8AA 2FUG1 4LISA 4BFCA 5HUHA 2Z2JA 1GJRA 1XQXA 3NJRA 3JAKB 4DJFC 3NFYA 3WRYC 1TZMA 3KKEA 2GZ1A 4CT5A 4LZWA 3IOBA 3CF4G 4YJ3B 4D3XA 4ZTUB 2D00A 3PGXA 2WYOA 2YQZA 4CV0A 1ACLA 1OPXA 2FFAA 2XEXA 3C6QA 3DBLB 3KL2A 3K3PA 5HF5A 3ZLUA 5F76A 3AUFA 1A2KC 3EY4A 3LD9A 2P62A 2WSBA 3CBQA 1YUMA 1AGYA 2DPHA 4HFJA 3RQSA 1K5GA 1GNTA 4C0XA 4XIIA 1NIPA 1I9GA 2PUFA 4H9GA 5IJ0A 2JRLA 3QWAA 3AJRA 3FLAA 3URMA 1W1IA 3KC2A 3WL8A 4BVLA 4JJKA 3KXKA 1M10A 5LL6P 1O1YA 3DJYA 5KVQA 1OBCA 3OLWA 3IBCA 3S1AA 5EKUA 3U7RA 5AKZA 3UMMA 3HMQA 1X9GA 2FW8A 3BL5A 4MZXA 1KEUA 4ZWNA 4I6GA 3HP4A 1BCRA 1D4AA 1EKXA 2EW8A 3PCXA 4BNXA 2GK3A 5EXTA 1A4UA 1TW3A 1PZMA 1H2FA 2Q9BA 2R6ZA 3GA7A 4GE0A 1CYEA 1IBKB 3AW9A 5JHGB 2VYQA 2XE6A 4XLTA 3TX2A 5JMTA 1EQ2A 1L7DA 1HYBA 2PIAA 4HDCA 1I4WA 1HKUA 1W2HA 1PFVA 1J0BA 2XYQA 3AUSA 3PL1A 4HY3A 4NWIA 5HMMA 1EFVB 5JBIA 4DCTA 2ENUA 1T1EA 3WDSA 1YF3A 4AIRA 2FJPA 2J9ZB 5JHHB 2ATIA 1TA4A 3R77A 4A8PA 3SKYA 4LNAA 5BWNA 1SXGA 4Y9TA 2F2TA 3R5HA 4I0WB 3G7NA 1YIOA 3E5RA 1BHSA 3IP7A 4HJXA 1RHMA 3OZBA 2JFQA 3H16A 3EDOA 2HZBA 2V59A 4FLMA 4BO1A 1OX5A 1WZIA 1V4BA 3A1NA 3D0KA 1MAAA 3QM1A 4Q9IA 2NV2B 3IH5A 4JYCA 5K0EA 1ABEA 3BMOA 3GRAA 5EIOA 1PUJA 5LP6A 3O8RA 1KYXA 4TYMA 1A9RA 5EE1A 3AEQB 4W82A 7MDHA 2V96A 4GGOA 4KN8A 4UM7A 3VHQA 1JG2A 2IYAA 5CA1B 1WJGA 1DTEA 2Q0QA 2P8JA 1ISIA 5EP1A 1WUTA 3LL7A 3OU6A 4TPKA 1SELA 2BJVA 4TT3A 5MDHA 2GXSA 4ARVA 5C8VA 5CDGA 3PCRB 3UMBA 1NSYA 4KNYA 1L4GA 1TNDA 4R2HA 2X2OA 1LI5A 2K2QB 1Z6TA 2O06A 1SXJA 2JLSA 3UXYA 4ITRC 4YRZA 3MN1A 3L6OO 1YMQA 3CLTC 4PX5A 4UEWA 4MLDA 1VJTA 4UDXX 4Y2SA 1TMKA 3RS2A 4CU2A 2CV1A 3U4AA 4FTWA 3N0VA 3Q3GE 4AU1A 1JI0A 4CCYB 4EYSA 3LUGA 2QT9A 3T5GA 8ATCA 3UGJA 1Y1RA 1HOTA 4JKOA 3TGWA 4Z2AA 4L4UA 2PQ6A 1UJ5A 2F48A 4R81A 3L01A 1YI1A 3HDYA 4OHKA 1M54A 1WIWA 3RHSA 1N5MA 1OZAA 2PRYA 4BECA 2KYRA 2OCPA 5FA6A 3H1GA 3GRUA 4AAYA 4HS4A 4QATA 1CRQA 4LSZA 3PICA 2CLMB 2B6HA 3VBCA 4ENRA 3H8WA 1DEHA 1R18A 2P6UA 4Q12A 4D9BA 4BEWA 1OH5A 1NQXA 4Q7LA 4I55A 4Z6KA 4RXMA 3GJQA 1XLUA 3LOPA 4C22A 4L7QA 4DQUA 3GO4A 4HFMA 3SBXA 3WRYA 3FMVA 4Z1OA 1J2RA 4I5EA 5HDQA 1NKVA 2JEOA 5C32A 1EEHA 5CD9A 1C0IA 1PHRA 3UWOA 4G1CA 4CLRA 1ZOIA 2JW5A 3ZWAA 4J0JA 4KWIA 4OA5A 3ZNPA 5FOXA 2RKWA 1JKFA 4A16A 4KAAA 4LRXA 3MGGA 1M34E 2P3OA 4ZHQB 1NYTA 3QE0A 2QUIA 4KQ2A 2G5TA 5DBIA 5A5VA 1ZOOA 5JIBA 1U1EA 1JAIA 1VJ5A 1BZYA 4X1KB 1BEEA 4BNJA 1T15A 3FNRA 3BVPA 1H5UA 3JARA 4WZAB 3V48A 5IG2A 5AKYA 4IDOA 1XO1A 4CKCA 2ALJA 3DKRA 3OJ0A 2Y9PB 3ZWYA 4XQEA 2D4AA 3GYBA 4G4SP 4YACA 4DCUA 1HSOA 2IPXA 3N2YA 2J6BA 3P20A 4IG9A 1SG9A 4EJFA 5F1OA 4F7WA 1YZ3A 4EBBA 4UZEA 1NUHA 4NK4A 1P4RA 1XU4A 1FX0A 1BG6A 4I2VA 4LOHA 2G1AA 4ZRDA 5CDFE 4CWAA 2HKIA 5C1IA 2PZMA 1SU6A 1ZJYA 3DHNA 4HH0A 3EPPA 2I3AA 1UJBA 3MJDA 3HCPA 3L6EA 3OQJA 4BJ1A 4DSZA 4DMMA 4G36A 1HH4A 1OH6A 4INZA 3GVCA 4L0MA 4GYYA 4JYAB 4GOLD 5IKXA 2JK1A 4CG0A 3EWSA 5GJCA 4XRGA 2O8EA 1OVMA 4IGAA 2FPKA 2JLAA 3CZ4A 1R16A 5CG2A 1T2VA 2C3MA 1GPLA 1I1NA 1PL0A 2CKMA 2ZKIA 3JATB 3O7MA 4YMTA 4QO7A 4ZEVA 1TYEB 1GN8A 2ZBPA 4QGSA 1RPZA 2BR4A 2EBUA 4Q4HB 2QGZA 4Q21A 2LV8A 4PR3A 1DLIA 3GFPA 4H17A 3KSUA 1IM8A 1JHUA 2P4EA 1T36A 3BIWA 4Q7MB 3ZWKA 3ZGZA 1IUKA 3GBSA 3C0KA 1PT9A 4TUYF 5ALZA 2YS6A 3IEVA 2IHJA 1DKPA 2ZSBA 1LTHR 3UNXA 3L92A 4LOAA 1SKYB 1LQ2A 2J6HA 2ONCA 2ZE5A 2RGXA 4R3UC 4OUDA 3OCYA 4HQKA 3NPMA 2E6KA 1JPUA 5BT9A 1TVKA 1LBIA 3K0KA 4EPRA 3C8DA 4Q7QA 3RRJA 5CA1F 3G0IA 4U5QA 4OSPA 2FHSA 3TIVA 1ZHHA 4GBJA 1JT2A 1RWNA 3ESCA 3TW0A 2AGVA 2CXQA 2GEBA 3ZGVA 4OLHA 5BMVA 1T8YA 3FVVA 5CT9A 4AX4A 1U0RA 5GWXA 1USVA 4BQPA 1PF7E 2ZUDA 3C85A 2JGFA 1FFXB 4FDTA 4E5YA 4KHPB 1P39A 2DYKA 2W4QA 4X1IB 1M7BA 3V4RA 5C8XA 2HNBA 4YUYA 4PG5A 5ITZB 5H8WA 3ZJYA 3JWJA 2ZSAA 2CBZA 3ZJVA 4JAVC 4FDAA 3SJUA 2Z98A 2ZJ7A 1D0VA 3AEXA 4BO6A 1Q7BA 1Q7RA 3RRZA 5LDHA 1I2BA 3EUAA 4IOLA 1X15A 2V6BA 3EY9A 1GGEA 4NNPA 2XT0A 1ARZA 1DP4A 5CVTA 3BD8A 1C29B 3ITNA 1KL7A 3H17A 1ZPDA 4QAJA 5K8IA 2JNWA 4MKFA 3G0OA 3ZIAD 3WBBA 1K86A 4CIWA 1IBSA 1DJPA 3ZZTA 5KNCA 1JDVA 2WSSA 3PGJA 3CVWA 3W9YA 1T5SA 2H00A 3N8IA 1YI0A 1ZY2A 1VA4A 2X5OA 3BCUA 4M88A 4B40A 4EH1A 3OFND 2FLKA 5TX7A 2F4VB 4D3SA 3CRMA 5FTKA 3VSAA 1B6SA 3HRIA 4OH1A 1J70A 1OXTA 3IIEA 3FRIA 4PFSA 4B31A 3NHZA 4RA9B 3OG9A 2GPBA 2H1FA 2E55A 4Q4JB 4X95A 5P8WA 3RFVA 4DTIA 5KTYA 5A0TA 1PGOA 2APJA 3MUFA 4MKHA 4J7XA 4RVHA 1EVYA 4UDNA 3R7DA 1AKEA 5HW0A 3WZMA 3R2JA 3AV3A 3LPCA 4I2NA 3AIOA 4QUBA 1QH1B 2R8YA 3ZX5A 2PUBA 1DEOA 2H6EA 3CB4A 4WGFA 4YHBA 3VNRA 1U28A 2GFIA 4KQJA 1H2EA 3ZZ1A 4B7XA 1Q1EA 3WQSB 3GL9A 4FFNA 3DUWA 4RY2A 4BFSA 1RZRD 1M2VB 2CLEB 1K97A 3NM6B 3G8AA 4RF3A 4PM4A 2IU6A 1RHJA 3NTUA 1KSGA 2PTGA 3IL2A 5JV5A 2BFCB 2VXCA 3Q9SA 2FN8A 4DV2B 3DT9A 4F2GA 3T5PA 4DQXA 2HDNB 2PL9A 2PS9A 3W6OA 2A5GA 2X0KA 4RVCA 2RJOA 1II8A 2BI8A 1XKXA 3VH1A 1J9EA 4WBNA 1VDMA 1DIHA 4NK5A 1RYYA 3PQ8A 2K2WA 2DBZA 1LQTA 3HY4A 3A0RB 1X9HA 4MQ6A 3U80A 4JQZA 3T6KA 3MCZA 3G7SA 4KMRA 3H75A 4H1UA 3GQVA 1G6Q1 1LI7A 1K68A 1R8XA 3RV3A 5TEWA 2YJ6A 1EBFA 1F3LA 1JQEA 3GU3A 3SR0A 3UB2A 4C1BA 4ND4A 1DAKA 4X8MA 5E9WA 3J80A 4ER6A 4IQ0A 4M99A 2X0IA 3W2IA 3NDRA 4CQMB 5TS2A 2WUDA 1GKKA 3BA6A 3DFMA 5HZKA 3OZVA 3CUYA