2QT0A

Human nicotinamide riboside kinase 1 in complex with nicotinamide riboside and an atp analogue
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
189
structure length
179
Chain Sequence
RGSKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nicotinamide riboside kinase 1
publication title Nicotinamide Riboside Kinase Structures Reveal New Pathways to NAD(+).
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 179
sequence length 189
ec nomenclature ec 2.7.1.173: Nicotinate riboside kinase.
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qt0A00
3F8TA 4EFLA 4MITA 4V02A 2FA9A 3LWNA 2EWVA 3AP2A 4PAOA 1DAKA 3LAWA 3DHWC 4LJ5A 4LHXA 1W36B 1WRBA 3RC3A 3FFAA 4HUQA 4M9XA 5KOYA 2C5LA 3U3MA 5ELXA 3SHWA 1A5TA 3DPUA 2IK8A 4UNNA 5F2EA 5C18A 2IX3A 1VCOA 5E7JA 1T5IA 3RS2A 4S2EA 3GLHE 3UIEA 4C30A 5DO9A 2VL7A 2GILA 2OCPA 4F7WA 3KQUA 3U61B 2LWIA 2QAGA 2ZI4A 5FI0B 3LY5A 1NVXQ 5AJWA 4DJTA 4EDHA 4ZI2A 1CRQA 1BH2A 1GSIA 2PZGA 1VDZA 3ETLA 3DMNA 4N0EA 5G3ZA 3TAUA 1W48A 2A5YB 2OXCA 3QXSA 4TL6A 2GA8A 3WRXC 3JZMA 3UWOA 5L3QB 4MH0R 1ZNXA 4DIEA 1E2HA 2ZRPA 4P4TA 521PA 5JEDA 2C96A 2QP9X 1K8RA 4EQ6A 5J4YA 1SZPA 4TT3A 3ONWA 2GF0A 1U0HC 3WNDA 5AR1A 3D6TB 1RRFA 2VHUA 5SZIA 2HF9A 1HV8A 4HLQB 1DO2A 1HEIA 1E6CA 2RGDA 1M2OB 4MDEA 3KXKA 1R5NA 3A4MA 2WWYA 1SGWA 3T12A 2IEZA 1U0JA 3CH5A 4D0LB 1Q1BA 4HB0A 2AHOA 721PA 2RGEA 1ZIPA 5AJVB 2WKPA 2HJVA 1Z6YA 2ZXUA 1QHXA 4PX9A 5J4LA 1QHYA 2B8TA 3TBKA 2J0QA 1GUAA 3C4JA 3CNOA 1KI9A 2GKSA 4IVRA 4PZLA 1F2TB 5FOWA 5LBIA 4ESHA 5CB6A 3GLGA 2IS2A 2GJ9A 2RAPA 2OG2A 5LDDC 1TQ4A 3B1VA 2QG6A 4D2IA 3GQBA 2ZRHA 3FTQA 3VKGA 3DZ8A 1YZKA 1G9XA 4U02A 2ZYTX 1Q20A 5L3VA 3PUYA 2GCPA 4QNMA 2FOLA 4MYCA 5FBWB 1CRPA 2RB4A 2OV2A 5CYPA 4XVUA 3EZFA 2WJVA 5CK5A 4BFSA 4Q4HB 5JCZA 1JR6A 1D2MA 3U7FB 1E69A 3GFTA 1DEKA 1OXVA 1NLFA 1G1MA 3BB4A 4KV9A 4QXAA 5FTNA 1WE2A 4Q1AA 4XWKA 4L15A 1CF4A 2ZI7A 1CULC 4BLTA 5BWMA 1GL7A 4A15A 2XNDD 4JLKA 1EFUA 1Q1ZA 4Y0AA 1P9NA 1ZJ6A 3I4LA 1E32A 3WYFA 4OQLA 1OE0A 1JALA 2CLCX 1OV4A 2QT1A 4C0KA 2ZS8A 4LCBA 1ZNWA 2EFDB 1XZQA 4L9WA 4B2IA 3DDCA 1P2UA 2PJZA 3LDAA 4A92A 4IOKA 3DM9B 4ZO4A 4LC0A 4RKFA 4A82A 3KZ1E 5HTKA 2REXB 4X8OA 4LJ9A 2AKYA 3P1JA 3AVYA 3IHWA 2OE2A 3U7GA 1W46A 2H8KA 2CBZA 2IUSA 1BYUA 1GRQA 4NMMA 4O0MA 5KDLA 2V1UA 3ADCA 1SXJE 4HZUA 2JAQA 5IT5A 4O25A 4EUNA 2P2LA 3K0AB 3U3RA 1GOTA 4RFVA 2BBTA 3KTAA 4AG5A 3TIFA 2VSFA 2W2XA 2JLQA 4GRAA 1JR3A 3QKRA 3F3YA 4FCWA 1KSJA 2JLXA 2D3WA 2IS4A 3RRNA 3LXRA 3VR2A 4ARZA 1B0UA 4QJ5A 1E2DA 2X19A 5HR5A 3T15A 2CNWD 2BV3A 1CS4C 2OAQ1 2ZR0A 3EA0A 5DGXA 4DVGA 2RGNC 5JHGB 4O3MA 2CL0X 1R0ZA 1N5IA 1R5BA 3B7GA 4H9GA 4TWZA 2Z83A 4DSTA 1IN8A 3B8HA 3SEAA 3ZZUA 5FFMA 4I1VA 4DDVA 4Q1BA 1EX7A 4YDHB 3B5JA 5FTJA 1IY1A 1DAFA 3UWKA 3FKQA 4POAA 3ZYCA 3REGA 1OHHD 1KSFX 4YMWA 3QG1A 1TNDA 1XEWY 3AVWA 1GITA 4PPNA 2BMJA 2A5DA 2CK3A 1Q0UA 4RZ2A 1Q1QA 2NPFA 2JJ1D 4BZXA 5B2ZA 2IUUA 4FMCB 1M7GA 1SXJB 2KE5A 4D6PA 1UBCA 3BH7A 1DELA 1F60A 1NKSA 3SI7A 1CU1A 1XTKA 3FHCB 4D4MA 4EPWA 2MSEB 4TYYA 1E9FA 1U90A 2F1HA 3VNUA 3IIJA 3BS4A 3K0SA 1H8HA 1KKMA 2ZAMA 3SZRA 4R2HA 3GJ4A 3A36A 3LLMA 1FX0B 3M4YA 2A5GA 1AS0A 1UKVY 3CIOA 3QBVA 4IVPA 3DL0A 1DE0A 2OLJA 2P3SA 4W5JA 3VR3A 3WP1B 2AXNA 2HCJB 1LY1A 4GT1A 5EE1A 4IDQA 2C9YA 4RKEA 2YOGA 3ND8A 3T1VA 2G6BA 1NBMA 1G6HA 4TLBA 4D82A 1T8UA 2IS1A 2EYQA 4B71A 3RANA 1ZNYA 1YRAA 2G88A 4AYTA 2GF9A 4CEHB 4TQ9A 2NO6A 1QHHB 3CRVA 2IBMA 3IQXA 5KUTA 5CIWA 1XTSA 5AUQA 5LB4A 3VR6A 1Z0FA 1U2RA 1R5OA 4NPHA 2FEMA 2WKQA 1FFHA 1OPXA 2JDID 3G0HA 4GP7A 2ZR9A 3EA5A 4P3YA 3QIAA 1W4RA 3EIQA 3QEOA 2DWOA 3A6PC 1GNQA 5IK2D 4V0KA 3C5CA 2YYZA 1J8YF 1Y3AA 2FPKA 1FMLA 3B2EA 4ASUA 1IXSB 2FMXA 1FNMA 1E4YA 1GNRA 1XD8A 2FPMA 2FZ4A 2H92A 3BC1A 4JKYA 2BBSA 2FSFA 4O2LA 4ZKEA 3SOPA 3K70B 3ZJYA 3LRPA 2CCGA 1NSTA 1SQ5A 4B48A 4KJZA 4L16A 1MABB 3VR4A 4C4PA 2E1RA 2F9MA 5FUXA 2FX3A 2I1QA 1OH5A 1IXRC 4I1UA 4WVFA 3LX8A 4GPTA 1JBKA 3NC1C 2O8EA 5DI3B 4OHZA 1UM8A 1R8QA 2AFHE 2C8VA 5BW8A 1XCMA 3KQNA 4UNQA 1II9A 3U6KA 3AUYA 4KLZA 1Z07A 4RD4A 3TUZC 1KI6B 2HT6A 4CZ2A 4P0TA 4DDWA 2LCFA 4JT2A 5EE3A 2R2AA 3B85A 4QKQA 3MUFA 1MKYA 1G8PA 3EPLA 1N6LA 1DAIA 3SBDA 4A9AA 5J5CA 3KXLA 4CYMA 2CHVA 5EP1A 2YINC 4BZQA 4QBHA 1OH7A 2VHTA 1XPRA 5BXQC 1MRNA 1VCNA 4Q01A 3HPRA 3ZH9B 3SFVA 2NO9A 4QHSA 4F91B 1DG3A 4W5HA 1Z5ZA 1G3RA 1Z63A 4XVQA 3T1QA 3I5XA 1E94E 4TMWA 2JASA 5J47A 1S4QA 3RSLA 1XDBA 3TGPA 2AXPA 4AKGA 1US8A 1P61B 2ZROA 3AP1A 3GJ0A 1R10A 2OILA 4L8GA 1DOAA 1NMXA 2OLKA 1FQKA 3EG5A 1XEFA 4OKSA 2PZEA 3W34A 4FMCF 3ICQB 1R6BX 2JCSA 4NYIQ 1VIYA 5FPTA 3FMOB 1W44A 1C4OA 1E98A 4MQBA 2O52A 2ZU6A 4LDJA 5HZHA 1GVNB 2DHRA 2R6AA 3QVUA 2W0MA 4Z1MD 621PA 1U8AA 4EFNA 1LTQA 1I4TD 1I2MA 2J59A 3AV0B 1XTIA 2QQEA 2QMHA 2RCNA 3GEHA 3CNNA 3I72A 2DFKB 2XB2A 2G0NA 3CPEA 3NBYC 1T0HB 1KI3A 4R7ZA 1D2NA 2GESA 2KSQA 1GRNA 1KTVA 3THOA 3ZGXA 4C3ZA 5JZVA 1W7AA 3MWYW 4TLCA 4URYR 2O8CA 2V8OA 1E9RA 3ND9A 2HV8A 1ZYUA 4JKIA 2XNDA 5EP3A 2YHSA 3VTKA 3RS0A 3ZIAD 1IY2A 4HLUA 3WNBA 1E2PA 3MG9A 3P20A 5DN6A 2A5JA 3CRRA 2QEQA 4BGDA 2F43B 4KO8A 4JBXA 2BJWA 2QROA 1G4UR 2Q21A 5AUOB 3WBKA 3AF0A 2OCAA 4NYIR 3LNCA 1EK0A 2ZYWX 1NLYA 2GVZC 4JVNA 2FFQA 2YOFA 4TMTA 2WICA 3QBTA 1TQDA 3IDQA 3BJIC 1J7KA 2CCKA 5FR2A 2O8DA 1N5JA 4RFSB 2G9NA 1II8B 2AD1A 2RKOA 4PO8A 4Q4AA 4TN1A 5G40A 5L3QA 1RPZA 4DT1A 2FGJA 3KKPA 3LO5A 1GKUB 1IHUA 2FSGA 3KB2A 5JS7A 1ZMXA 3HU1A 5SZKB 4LI0A 5L8VA 4BEBA 2GCNA 4MKFA 4Q1FA 3LVRE 4AYXA 3F5FA 1JEDA 1HQYE 1UBEA 4JLNA 2GRJA 1Z22A 2ZUCA 3K09A 3NH6A 1S8FA 4RZXA 1JECA 1E0KA 3LBHA 5GJCA 1YRBA 4RCYA 2XZOA 2JLWA 1OFHA 4DCSA 2Q3HA 2ZRDA 3B78A 5P21A 4JLMA 4F38A 3CX7A 1N6KA 1YZLA 1IAQA 1LB1B 5M04A 1E2EA 2RGCA 2QE7A 1VPLA 1YJ5A 3QXHA 5FOSA 821PA 2ZRKA 5SZJA 5A5GA 4MRRA 3LA6A 3TNFA 2VP6A 1PZNA 2IF0A 3RS4A 2YZ2A 4B3DA 1GG2A 2DY1A 2ZETA 1OHHA 3K09C 3U4QB 1AZSC 3W3AA 2QY9A 2FF7A 1E0JA 1P60A 1P2SA 1ZNZA 5GVSA 2JJ1A 1HY3A 4LBZA 1L8QA 5FPYA 4BFZA 2FV8A 3CF2A 4II7A 2Z4RA 4AC9A 2D2EA 2BCJQ 2A5FA 3P27A 3NDBB 2ZS9A 5DH9A 4A0HA 3W5IA 2FNAA 1ZIOA 4LUCA 4B76A 4WIAA 3U2QA 4B44A 4IJMA 2WJHA 4B3XA 1JNYA 3R9XA 2ASEA 4Q4HA 2ZRLA 1M74A 3RS7A 4TL8A 4TTQA 4AKIA 1WQ1R 5TB5A 4MRPA 2BVNA 4UKDA 1XXHB 3DEFA 3L8ZA 3QI2A 1IOZA 5SZHB 4N0DA 2R9VA 4D4KA 4R71A 3TH5A 4QGGA 1KKLA 2IYYA 1G6OA 4DCNA 2ECKA 5FBLB 2QP3A 3C5HA 1PLKA 3FGNA 4PR0A 2JIZD 4Q7LA 5FBRB 1NN5A 4NTZA 1YU9A 4QFMA 2QBYA 4CF7A 2JLSA 2ANCA 3KUCA 1N0UA 3KUDA 1XU4A 5EE9A 1WB9A 2WZQA 3I8XA 4JL8A 2QP4A 4BPBA 5IRCD 2HJGA 1CJVC 1T8TA 5CJ2A 5FOUA 3RS5A 5BN4A 1AM4D 4HLDA 2PT7A 1R0WA 2A78A 3QKSB 3PIRA 3GD7A 2ZRJA 3GFOA 3AF4A 4W7SA 1ZAKA 3W9YA 2WWWA 4DCVA 2QQ0A 4RD6A 2CMKA 4URZR 2ZPTX 2WTUA 1D9XA 4TTPA 2GHIA 4HDOB 3OIUA 3K9NA 1MV5A 1PUJA 4C7OB 1VG8A 4GOXA 1NIJA 4K81B 4Z51A 3K0FA 3U3OA 1VECA 1ZRHA 2XGJA 2ZSEA 5DI9A 1G8HA 3K1JA 2ZTSA 3QUSA 2ZE8A 1KAOA 4QJ3A 4F4IA 5K8TA 1F48A 2WIBA 1YZQA 3CZQA 1TADA 2R44A 2P67A 4HB3A 4TMXA 2D4HA 4A1FA 1EESA 3L2OB 4F93B 2IHYA 3NC0C 4MRNA 3KKOA 2E87A 4JYBA 1X1SA 4NCKA 1OB5A 5J4HA 1DADA 1Z6TA 5AK0A 1EXMA 2PCLA 3A8TA 2ERYA 1NI3A 3DKPA 1G18A 4CVNA 1R0XA 3IKJA 2ZJAA 1UF9A 5CDFE 4P4SB 2IS6A 4BLPA 1SVKA 4LY6A 4LBVA 4DIDA 1ZD9A 3LBNA 4JL6A 4MRVA 3WXMA 1H65A 2F1IA 4BFTA 1YQTA 2VPPA 3K9HA 3NEYA 3PXGA 2J7PA 2I3BA 1ZU4A 4B6EA 1NIPA 2CK3D 5AUPB 3SJZA 1IN6A 3UXMA 2IEYA 4U7DA 4LK2A 4JYCA 3B9QA 3KQHA 1WBDA 1G5TA 1Z0KA 4QNRA 2UZIR 2R65A 4M9SA 4KFUA 1Z0AA 3THWB 1N6IA 3OIYA 4DCTA 1RYFA 2WMOB 1G3MA 1OFIA 1XD2B 1SVOA 3V4RA 3D8BA 1P62B 3OIWA 1R0YA 2HCBA 4B33A 2C2HA 2GJSA 3QXXA 5JI3E 5DNYB 1U8ZA 3HR7A 2WKRA 2Z4SA 2DFLA 1VHLA 4A0FA 4GI7A 3W6NA 3U44B 3I8SA 4BUJA 1KHTA 2ZI6A 3QKTA 2BMEA 1XTQA 2OHFA 2PZFA 3B60A 4ZPXA 1QVAA 3MLEA 1Q21A 4B6FA 1G41A 4M1YA 3BORA 2VHQA 2EFGA 2IYLD 1TQ2A 1G8GA 2G1JA 2VHJA 3DO6A 4MA4A 4DDTA 4LHWA 4L4UA 4KSCA 3S1AB 1UKYA 1KDTA 3R9IA 1OLOA 2O8FB 1ZUIA 1GL6A 4CDGA 4PHGA 2D06A 1PUIA 2RGXA 1U94A 3VKHA 4B3BA 4PAMA 4RZUA 3FB4A 1CJKC 3OAAD 4I81A 2QZ4A 1QBKC 3ZIAA 4ASUD 2XTNA 4OI0A 5F9HA 1W2GA 1NSFA 4QJ4A 1VYTA 2QM8A 3AVUA 3FKSD 3TVDA 1RC8A 3SYKA 1NRJB 4DKXA 5DSZA 2F3TA 4Q7MB 4R2IA 4X8HA 1EFRA 1OB2A 2OBNA 1E0SA 2QRZA 4LYAA 5JEEA 2PJRA 4MGYR 2ZVQX 1Q1EA 2JLUA 5B64A 1X8LA 1G7TA 1A2KC 1Z47A 1E1RA 4JVMA 2EFHB 3V4FA 1MABA 3W6PA 2VP9A 2AKAB 3DMDA 3GJ7A 2AFIE 2AWOA 4ZDIA 2ZANA 4M1OA 4WZAE 1JEEA 1KI4A 3EZ6A 1Z2AA 1TU4A 3K0EA 4FCTA 1TL7C 3NHAA 4YXWD 3O8RA 5G41A 2QAGC 3GLIA 1VG0B 4V0LA 3IBYA 2A9KA 2KB0A 4URVR 1AA9A 1NLZA 1YE8A 2NO7A 1W4BA 5HCNA 3RC8A 3Q85A 4P31A 2IT1A 1KY2A 3I1FA 1DAGA 1KK2A 2D62A 2DBYA 2QSYA 3MD0A 5JWOA 2F9LA 2FWRA 4OHYA 3T61A 4EPRA 4OJQA 3RVBA 4NHOA 1KNXA 3JVUA 1KYIA 4MKIA 1ONBA 3GLHB 1E9CA 1R7RA 2IYQA 4PHTA 2H1LA 3UG6A 4A4DA 2VBCA 1QF9A 1XMJA 1N5LA 4LPSA 1XTJA 4OBEA 4QG7A 1NG9A 5A4JA 3FWYA 3RHFA 3FVQA 2WWFA 1G8YA 1XJCA 3SQWA 1W4CA 2GVDC 4HAUA 3T5GA 1J8MF 3NBFA 3R8CA 3RRZA 4E09A 4E5UA 2GEUA 4DZZA 5KSYA 2GDJA 5K8LA 3MCAA 4O2RA 4CEJB 1DAHA 1W0JA 2BDTA 1F2UB 2ZRCA 3TKLA 3W3ZB 2FG5A 2Q9BA 1GZSA 2V6IA 3AF3A 3IIMA 4BFYA 3A4NA 2PX3A 2J7KA 4HAXA 2QM7A 2XX3A 4L5BA 4QGFA 3ZVLA 5JMTA 3W8RA 3GLFE 3HYTA 1YZTA 2QT0A 2PLRA 3MWKA 2BEKA 3UG7A 2RH5A 4CRWB 1P2VA 5FUYA 4F4CA 1GILA 2H18A 1Z29A 4BQSA 2AK2A 1Z8FA 4LYHA 4URUR 4P4UA 4ZIRA 1XWIA 4AIIA 1M1YE 4QBGB 1W36D 2A2ZA 1XPOA 4K8OA 2WJIA 5CITA 2WWHA 1T3LA 3WMEA 4TL7A 2JEOA 2NZJA 1S3GA 4Q47A 4TYPA 3KFXA 1OIXA 1Z83A 2JIZA 2G0TA 4ZV4A 1E99A 5BN5A 1AJEA 2V4ZA 5KNBA 2YJTD 1KAGA 1NJFA 3THXB 4JS0A 3MJHA 4KFTA 2F43A 2ZRGA 2V1XA 3UANA 3QKUA 3MFYA 3MSXA 4XIGS 2F1JA 3DOEA 1KDOA 2IXEA 3RABA 1FPMA 4GBMA 1G64A 3TQFA 1DBSA 3A1TA 1JJ7A 3CO5A 3AKYA 3FPAA 4ITRC 3QF4B 2R6FA 5ANRB 5DYIA 1W4AA 1NMZA 4DEXA 2RHDA 3B82A 2P6RA 1LS1A 4RFSA 3QOFA 1II8A 4FMBB 2J41A 4JVSB 4PO1A 1XJ0A 4WZBE 4KHZA 3AM1A 4LJ4A 4JVLA 5JHHB 2J5XA 4M53A 1R2QA 1YZGA 3PITA 4TQUS 1BIFA 4NZYA 5JBQA 3EC2A 1C9KA 1CR4A 2G77B 4N3NA 1NL3A 5J40A 4G0NA 2V54A 1OXXK 5DIFA 3E2IA 3RDPA 1AGRA 1E2JA 4Q00A 1G21E 4Q4LA 2KBFA 5CK4A 1IN7A 1CEEA 4RZ3A 2OSBA 2Z0MA 3A1UA 2QE7D 1QVRA 2O0KA 2VF8A 3BOSA 3NBXX 3OF5A 1E1QD 2ZJOA 3DOFA 4G1UC 4WXRA 5AJZA 5E7IA 2JLRA 3EXAA 3CWZA 4EPVA 3HDTA 4KBFA 4V0NA 4EJSA 3Q72A 1ZM2A 3CF6R 4B74A 1G4AE 1X3SA 4MDFA 5LB2A 3L82B 4V0MA 1CP2A 5JJLA 5L3RA 1NNEA 2WJYA 3EPJA 3U4QA 1M7BA 4LV5B 3BH6A 3U5ZB 4A6PA 1GWNA 2XAUA 5FBVB 3AVXA 3O47A 4GMDA 1KSGA 2N1BA 1WBBA 3HPQA 2MMCA 2C78A 4AK9A 1F6BA 4EJSC 2P6NA 4LPKA 3VU9B 5JJIA 5FOXA 2PEYA 1HTWA 1COWA 1J99A 1QG4A 5JECA 2QU8A 2YWGA 4QHYA 5AJXA 2VP2A 3THYA 4JLPA 1XXHA 3ASZA 4OI4A 1I4DD 1G19A 2H17A 3G82C 3HWSA 4PZYA 3SN6A 3W8NA 5LD2B 2F7SA 1R4AA 3DKVA 3BBPA 1E0AA 4RCZA 1JAHA 3RRYA 3WHKA 2GXUA 2IF2A 3KQKA 1X8JA 4Q9KA 3QSYA 1CR1A 4NBSA 4B2LA 1F5NA 4XWAA 1IY0A 5TY0A 1XMIA 2OM2A 3RS3A 1T91A 2YWEA 1QHGA 2E9SA 5BYKA 2ZRNA 4PC6A 3WYAA 1XEXB 3CB4A 3M6AA 4M1MA 4UNSA 3CONA 3IEUA 4PQRA 1E9SA 1SKQA 1WMSA 2QORA 2CDNA 3BB3A 4PSKA 3NBZC 4BFXA 1Q22A 1Z06A 2VO1A 2Q9CA 3LBIA 1N5KA 2IC5A 2PMDA 2ZUBA 3GJ8A 4LGMA 2KBEA 1H8EA 4ZDWA 2ONJA 5FH9A 2ZJBA 3BFVA 3W90A 2WPDA 3OAAA 3WBJA 8OHMA 2ZYUX 3K8YA 1G3QA 4Q02A 2B8WA 3BK7A 4Q4JB 3EARA 1XCPA 3RNLA 2VA8A 5L3SB 3FKSA 4TSFA 5KDDA 2J9RA 1KI2A 3ZLJA 4Q9HA 4BEJA 4JLOA 1OH6A 1HURA 1VYVA 4IW3B 2GAAA 1KGDA 4DRZA 4DDUA 1KK1A 2NG1A 3N5CA 4HAZA 1CJUC 1FW6A 5FR1A 2LKDA 3CR8A 4ILEA 2XOKD 3PUWA 4CEIA 1MT0A 1WP9A 2ZRMA 1SKYE 4YMSA 5JWRA 2XZPA 4JL5A 1W49A 4QL3A 4JT4A 3IBGA 2WM9B 4BLRA 4KU4A 1GDDA 3TQCA 2QMEA 4YXWA 2ZREA 3GLGE 4ON9A 2WAYA 2CLDX 4XVRA 4GFDA 2J7PD 2W6ID 3B1YA 1DAMA 4UJ5A 2I4IA 1UBFA 3WMGA 1RVDA 1RRPA 1TTTA 4Q9JA 4PQYA 1L7VC 4MYUA 1KDPA 4LRWA 3VR5A 1HQCA 2QRNA 1SXJD 5FUVA 2B6HA 2OESA 4IEEA 2OO7A 3RLFA 1V43A 3Q5DA 4BRWA 2QTFA 4TQAA 2V6JA 4BWYA 4B34A 3UKDA 1XD2A 2ZRFA 2D74A 2OBMA 2H5EA 3LFUA 3OE7D 1SVWA 5GVRA 2HEIA 2BM0A 4RVCA 1AKYA 1TU3A 1KJWA 4HZIA 4PFSA 5TV2A 1HUQA 2MSCB 4YDSA 3U44A 4HUTA 2ODBA 1SKYB 1ZCBA 1MOZA 2FDCA 1D8TA 3H84A 4OQFA 2BBOA 4IDHA 1ZD8A 2OCBA 4IDPA 4GNKA 3RSOA 2CL7X 2ZI3A 5DISB 1FNNA 2OFWA 4J0QA 1JXMA 1Q57A 1SVMA 5CM8B 3R7WA 2VF7A 4AD8A 4CT5A 4ZCMA 4KXFB 1R8SA 4LV6A 1U99A 3QENA 4TLDA 2GAOA 4JLVA 4A8JA 3ZZ0A 1LVGA 4HATA 1QRAA 5IDVA 1ETUA 4ABYA 2DFTA 1ZUHA 3TR0A 1G7SA 4URXR 2ZITA 1GRRA 1M6NA 4A6XA 2NIPA 4BZPA 4TYNA 2Y8EA 3IHLA 2GBLA 3HYRA 1YR8A 1QZXA 1Z0DA 4HAWA 3CPJB 2XXAB 3EWSA 1J90A 4DBLC 1JR3E 4LHVA 1MO4A 2WWGA 3PENA 1V5WA 4BFUA 1DVRA 1OJLA 3LV8A 2IL1A 1GM5A 4US1R 4A8JC 3K70D 1W47A 1EFRD 3NDPA 3EPHA 1ZU5A 1ZM4A 2V3CC 1XNJA 1ZVQA 2Q3MA 1JB1A 3AGQA 3AKCA 3KJEA 4MGKR 2IXGA 3MMPA 4HLCA 4PANA 3IILA 4RJLA 1G291 5EXTA 5J4KA 1W36C 1E1RD 2HT1A 1J2JA 4HLUC 1BOFA 2ZSAA 2GBLC 1KY3A 2ONKA 1LS6A 1EG7A 2OBLA 3A1SA 4DHEA 1JXOA 1MR3F 2OFOA 3GJ5A 1JPJA 1NN3A 2UZ3A 3EC1A 4E03A 4B35A 2FSIA 2QN6A 1ZD1A 1KMQA 2VYFA 5JFGA 1PJRA 2PT5A 1EFCA 5HPYB 2EYUA 2BIFA 4PZZA 1D5CA 3VFDA 1DPFA 4GOJA 4M21A 2C99A 3VAAA 2C9CA 4PAQA 1T3HA 1P73A 3HU2A 3PEYA 1KO4A 4U5XA 2FFHA 2BBWA 1OW3B 2WWIA 3GLHA 4H1UA 4WAUA 3ZVMA 3QKRB 5IF9A 2BHRA 2DYKA 1E1QA 4EKDA 1T0JB 2D7DA 4C2UA 4ARZB 1FZQA 1KIMA 3RWOA 3AVQA 3X1YA 1F2TA 4UXHA 4NKRA 1T6NA 4U00A 2FFAA 2X8AA 2Q9AA 1Z08A 4H1VA 1E2FA 4KLNA 4OI2A 1W0JD 3GEEA 3K9GA 4PHHA 4BFVA 3WMFA 5C4MA 1N6HA 2IYRA 3QEJA 4GOKA 4YC7A 1NBME 4LJ7A 1F2UA 1RFLA 4KYIB 3VHXA 2ZE5A 4P33A 2XTZA 4D4JA 1E2MA 1WDTA 4FN5A 1KI1A 3T35A 4ERNA 4QHTA 2ZE6A 4DLYA 1FUUA 4DC9A 1E2IA 1G3UA 2PBRA 4HEJA 2ZJ8A 4PXAA 2R62A 2FFBA 4NYJQ 3T34A 4Z54A 4IOLA 1E2QA 1XEWX 2JLYA 1IQPA 3AEZA 1YR6A 4WOPA 4DSOA 3CKLA 1N2CE 2FEOA 2YC4C 3KXIA 1I2DA 2CHQA 2VLIA 3PVSA 4OK6A 4JZKA 1X86B 4QC2A 3B1WA 4XSHA 2WOOA 5JSZB 3MGCA 2XSZA 4ACAA 5JI2E 1XCGB 3LLUA 4KVAA 4C0HA 1ESMA 3QY0A 3X1ZA 2R6DA 2GK6A 1N6PA 2XTMA 1I4LD 3KFVA 1F3OA 5FUWA 2F55A 1TEXA 1ODFA 4M1TA 1W5SA 3CF0A 2J46A 1W0KD 4BRUA 1N6RA 2H7VA 3THXA 2NO0A 4LWZA 1UKEA 4QOSA 3VHLB 3I62A 3QE0A 4EPTA 1EFTA 1FTNA 3I92A 4Q5IA 1EWQA 2ZI9A 2EU8A 4BLQA 4B32A 4Q1DA 2ATXA 2V55B 4OL0A 4DLVA 4NDZA 1VHTA 4WW0A 1JAIA 4W5WA 4C0AC 1KO8A 1T4GA 1P9RA 2CHGA 3EASA 2I1VB 3QF4A 4XJXA 4DCUA 2C98A 2K5UA 4XSGA 5FI1B 1XMVA 3MJRA 3IEVA 3K0AA 3MWLA 1RRCA 1AS3A 3DVLA 3OEED 3SU8A 3EPKA 3PEVA 3PCRB 4NYMQ 2DPXA 5KNCA 4PC3A 4LHZA 3FFBA 4KFRA 4C9BA 1P7CA 3R9WA 2FPLA 4D0GA 1HE8B 1OIVA 1ZM9A 1G3IA 4AURA 1E79A 2HUPA 2FU5C 2J3EA 3BE4A 2KJQA 3C16C 3IPXA 3GP8A 2IA5A 3I5YA 1QHIA 1KMHB 2XOKA 3Q7PA 4RSGA 4FXPA 4Y0VA 2IYTA 4WZ6A 3SJAA 1KNQA 3C7KA 4PHFA 4US2R 4TLEA 2QA5A 4NH0A 3L0SA 1A4RA 2EWWA 2C77A 2JGNA 4BFWA 2BOVA 5C4GB 4DSNA 1KJYA 4YMUA 2WSSA 3QPUA 1OXSC 4C0SA 2W6IA 2RGBA 3OESA 4Q48A 4D0NA 2UKDA 5EE5B 3HP1A 4OJKA 3IPYA 3U3JA 5BN3A 1E2GA 3L0IB 1AQYA 2AX4A 4MYTA 3CM0A 2XNSA 5C46F 1SXJA 1GAJA 3FOZA 3PFIA 4TMZA 3AB3A 1IN5A 3VKWA 1TUEA 5TXGA 1P4SA 2NO1A 3GFPA 5FPKA 1Y63A 5D3MB 1YR9A 1Z3IX 2BJVA 1Z0IA 3NG1A 1COWD 3D3QA 3OE7A 1P72A 1DO0A 4G5OA 1FX0A 1A82A 1EWRA 2PX0A 5TMPA 1K5DA 2RHMA 5KSOA 4NE2A 5KHOC 3TW8B 1T5LA 3SS8A 5LPNA 1SXJC 2J87A 4M9ZA 2IYZA 4OQMA 4PSVA 3Q8XB 1SHZA 2PH1A 4G3XA 1OYYA 5KSZA 4DLWA 1KSHA 3TLXA 3SHFA 3MRSA 2YKGA 5CB8A 5FOVA 3CX8A 2QNRA 2ZAOA 3Q9LA 1RYHA 4B2PA 4S35A 1GL9B 4CEHA 1US8B 1U9IA 2ERXA 4JJKA 6Q21A 1QHHA 2L0XA 4LHYA 4Q21A 1L2TA 5E4FA 1OIWA 3ZVRA 3AKEA 121PA 2AL7A 3R20A 4IRUB 1ZW6A 4TMVA 1BO6A 3ZVNA 2JJ8A 1H8ED 3AH8A 3CNLA 2D7CA 4HDQB 1TMKA 2WPDD 3HJNA 1YZUA 4MGIR 4OHVA 3U6BA 3L8YA 4EPXA 3CUEF 4NP6A 5E95A 1VMAA 2YV5A 3CRQA 3CWQA 4Q4JA 2QPTA 1M8PA 4TSFD 2F6RA 4B3CA 4XTRA 1UJ2A 2VQSA 3T1OA 5L3SA 1BKDR 2REBA 1P2TA 2ODEA 1ELOA 2RMKA 3AP3A 4I1OA 2ZS7A 3I61A 3WYGA 1GIAA 2O8CB 4A2PA 4DEYA 1RE0A 1XBTA 4WBSA 3EIHA 5FOTA 4BLSA 2CCJA 2ZVPX 3BGWA 2W0SA 1N6OA 2ZJYA 1CTQA 3OEHD 4E07A 2WWXA 4JLAA 4F92B 1X8KA 4QBIA 2BMDA 3ADBA 1UPTA 3TRFA 5DI3A 2ZJZA 4UJ3A 1YHNA 2REOA 4QGHA 3K70C 4X8MA 1KI6A 2NQ2C 4PPGA 4LJ6A 2XITA 4XTCS 1SVSA 1A7JA 2FN4A 3CPHA 2CL6X 3ZQ6A 4EIWA 3PUXA 2O8DB 2DCUA 1KO1A 1OT3A 1KDRA 4KAXA 4Q4AB 1RZ3A 2GXSA 2IYXA 2EFEB 3TSOA 4KITB 4DLSA 5EXPA 4DT1B 4OK3A 2IHBA 3B13B 2CXXA 4ZI3A 3KKNA 1AK2A 1E9AA 4DLXA 2DB3A 4DUGD 2IWRA 1OYWA 2FE4A 4LJYA 2OEPA 3ZS9A 1KJZA 1Z6AA 2R8RA 2WSMA 3LQRA 2PCJA 4N1AA 3IO5A 2WOJA 4PC7A 2ZJ2A 4AI6A 2DWPA 4KCGA 2CVFA 2FGKA 4A2WA 3TAHA 1UADA 4G01B 1EFHA 3KQLA 3BRWD 2HXYA 3CBQA 1LW7A 3QQ5A 3KJIA 1AZTA 2EW1A 2BCGY 1Q3TA 1G16A 3FHTA 4CT4B 1P75A 2GJKA 5EZ6B 1CIPA 1VTKA 2N42A 1D2EA 4TYQA 5J4VA 1XJQA 1NY6A 4D4LA 1NG1A 1W5TA 1P3JA 3GMTA 1TPZA 1U98A 2J0UB 3PEUA 2P6UA 2B7BA 2BC9A 2NGRA 5DLQC 3WY9A 4EAQA 3JZAA 3KX2A 1L4UA 2FZLA 2QENA 2QPAA 3VMFA 2FJUA 2ZJ5A 2DWQA 5JS8A 3RAPR 5EXXA 1NF3A 5HCIA 3RYTC 2OFXA 2P5SA 3KDSE 5CYOA 1RJ9B 4JSTA 2ZSBA 5EE0A 2VRWA 4WXPA 2PEZA 4OYHA 4R9UC 2A7QA 5TDHA 4M9QA 2X2EA 1Q44A 4JBYA 4Z8YA 4KFSA 1ZM7A 2XXAA 2EFCB 2OT3B 1X6VA 4LYFA 1MO3A 1W0KA 4GSYA 3OIVA 3TSWA 5KSPA 4BASA 3CR7A 5JRJA 3C41J 2BWJA 3REFA 4BLOA 4G5RA 4NCJA 1G5RA 1GFIA 3QJYA 4Q19A 3PUVA 4LYJA 2ATVA 5EZ5A 5JJKA 3H86A 5CLQA 2WHXA 1E4VA 1EGAA 2QBYB 1AN0A 1DG1G 4NCIA 2IXFA 4Q7JB 2V9PA 3B6EA 5FPSA 3M0EA 3GLFB 4AYWA 1GTVA 2YWFA 2QGZA 1J70A 3QG5A 1XTRA 1TF7A 4GP6A 5CIQA 3BB1A 5JCPA 1QHSA 3OEEA 1FP7A 1S1CA 1XD9A 4PPFA 1ZUNB 4XH9B 1A2BA 3IIKA 3PQCA 4US0R 2HYIC 1HH4A 3LQQA 3T06B 5E3HA 2HYDA 3D7MA 3TVTA 1GKIA 1XX6A 1PV4A 1ZC3A 4A36A 5GJWC 4ZCLA 2FH5B 2AD5A 1K6MA 3AVVA 4EPYA 2GNOA 2HF8A 1FMJA 4C2TA 1OFUX 5F9FA 4YONB 1AIPA 3ZDQA 2B21A 2Z6VA 4B3FX 2RGNA 5K8UA 1KOFA 3AF2A 4C0LA 1AGPA 1II0A 2MMGA 3K0FB 2DR3A 3TUIC 1Q12A 4C0JA 4ZDKA 3AVPA 2ZM5A 1EX6A 1KK3A 2BMFA 2NZ8A 5C2JB 2H16A 2PL3A 1FTSA 2HLDD 4JLJA 4NCNA 2HDNB 4QGAA 1W2HA 4F4JA 4A0RA 2O0JA 2WV9A 2WBLC 3QPVA 4FIDA 2ZE7A 3WRYC 3SBEA 1WF3A 3AVOA 3Q3JB 2G3YA 4PSAA 2C03A 3B1ZA 3WNCA 5AWFC 4B3GA 1QHNA 3J81k 1JPNA 2YWHA 4JLDA 5KPJA 1ZP6A 2O0HA 1M7HA 3ZD7A 4M1WA 1QDEA 2CJWB 3OFND 2JJ2D 2XB4A 2GXQA 1JQJC 1S9DA 3KB1A 1GP2A 4DB2A 1TEVA 5HKKD 5IHPA 3EZ2A 2KWIA 1PLJA 5EUMA 3H2YA 5EP4A 5DN6D 1AQUA 2YVUA 1GKYA 2O8BB 5FTMA 1S2MA 5BQ5A 1IXZA 1ESNA 4FWIB 1TF2A 1TQ6A 1E9DA 3EZ7A 3NTUA 4KYUA 1S96A 5E7MA 2XSZD 5A0FA 4M1SA 4M1KA 3U3KA 1OFTA 2VEDA 1AKEA 5JSZA 3VX4A 3E1SA 2W6JD 5FL7D 3SDZA 2TMKA 4QM7A 5B58C 2CE7A 2GCOB 1U8YA 1IM2A 2CE2X 2OAP1 3TK1A 1D9ZA 4UNRA 3CW2A 2YC2C 3NVAA 4LC1A 5DYGA 3LH5A 4TMKA 3LW8A 4UQOA 3U60B 2JLVA 1C1YA 2B92A 2ODWA 5EQTA 1VG1A 4YMVA 4IHQA 2QSZA 4M0LA 4NCHA 5HZKA 2C04A 4OK5A 1U0LA 1KI7A 3KL4A 4IKEA 1DARA 1NKTA 3QKSA 1HT1E 4GZMA 4RD1A 4HDCA 2QMUA 5GJVC 1RKBA 2ORWA 2XZLA 3M1IA 1X1RA 1Z0JA 1XF9A 3A1VA 4JMPA 4V03A 2AN9A 4AKEA 4Q1CA 1OKKA 1T3SA 3P26A 4PC1A 1G17A 1NVWQ 4ZCIA 4IFBA 5JWHA 2IWHA 3GLIE 3O8CA 4C7OA 4FWTA 4FCVA 1YR7A 1ZINA 2QI9C 4JIMA 4TZ0A 1XPUA 2W58A 2ZRIA 1B23P 1NMYA 1G5PA 2G83A 2IW3A 2PMKA 2ZUDA 3HU3A 2VIIA 1BS1A 3CRMA 1ZBDA 2IYWA 4HUQB 4HYYA 1G20E 1E79D 1SULA 1UKZA 4Q03A 4I1SA 4JLBA 1KO5A 3NHBA 3AGPA 3GJ3A 3A37A 5UKDA 2NMVA 3BAFA 3CRW1 3I32A 1KMHA 3JVVA 4XWOA 3OEHA 5D3QA 3X2SA 1QG2A 3U7EB 2QAGB 3BFXA 3T1TA 2VSXA 3BERA 4K46A 3BWDD 4P4SA 4Z8XA 2A3RA 2WSSD 2W2TA 2N46A 3C8UA 2X2FA 2VTKA 4E22A 2O8BA 1ZCAA 3N2IA 4HAVA 4PPQA 4RY2A 1S3SA 3LD9A 5CM9C 5TARA 1UBGA 3NIBA 4MYHA 5G3YA 4B43A 5JLJA 2CVHA 4G5SA 4GMXA 3VNVA 3ZZTA 3PEWA 1VIAA 4EQ6B 3NEJA 5H68A 1E9EA 4NL4H 1CBUA 2GK7A 2WJJA 4DUGA 5KDOA 3GLIB 3THWA 2GJ8A 1W1WA 1L4YA 2F3RA 2MSDB 3IQWA 1ZC4A 5KTYA 1LNZA 1NN1A 3AKDA 5D3MA 4KBGA 3N70A 1XRJA 4KVGA 3MWJA 4MKGA 4FI3C 1BYIA 2DFNA 1FUKA 1UDWA 3LVQE 2WVJA 4D80A 1UFQA 5CJPA 4D26A 3GPLA 5KYKA 2ZYVX 4XD7D 4MKHA 5HE8A 1NP6A 5FBQB 2RGGA 5G53C 1E9BA 5BYJA 2Z43A 4IDOA 3RWMB 5CDFA 3W6OA 2NOAA 4DLTA 3GLGB 4G5GA 2QMOA 4FMDB 3QNUA 3BXZA 3S1AA 4X8LA 4B73A 4M4SA 4DLUA 4P32A 3TSZA 4GZLA 2O8FA 1MO6A 3IGFA 3EAQA 1D6JA 1XP8A 4LOAA 4A0GA 4G5QA 4YLGA 2C9OA 3ECCA 1JI0A 2IYSA 4IXNA 1P6XA 3IUYA 3Q5EA 2Q6TA 1KI8A 1OF1A 2V7QD 1UEJA 1LF0A 3O8DA 3KJGA 5C1BA 1E2KA 3B1XA 3EIEA 4HB4A 2VP5A 4ESVA 4WA7A 2XEXA 1IJEA 1MRSA 2QTHA 1BMFD 1E2LA 3PJRA 1N0WA 4UXJA 5B57C 4MUAA 1LV7A 1NJGA 2XJ9A 2OUKA 1IJFA 1TX4B 1WXQA 3D31A 4LBYA 3VQTA 4ZIRB 4LX0A 4R98A 2CEAA 1OXUA 1G7RA 2EVWX 1JJVA 1ZM3A 5DE3A 4QRHA 1WCV1 3K53A 2JA1A 2W2VA 3P32A 1S0UA 2WJGA 4FD2A 3NWJA 3BFKA 1KZGB 4ACBA 4GL2A 4BE7B 3SC3A 2NPIA 4EFMA 3UMSA 2GEVA 3FMIA 3P4XA 4KSBA 1OXTA 3CLVA 3UPUA 4V0ME 4URWR 4UXIA 3T5DA 3N2EA 2FSHA 3HR8A 2XJ4A 4IOMA 4UNPA 3IO3A 3PG5A 1OH8A 4Q66C 1YZNA 1Z2CA 5H8WA 4I99A 3TE6A 2BEJA 4LJ8A 4MGZR 3PV0A 2HXSA 1NVVQ 2PLFA 4HZUB 4LZZA 3UATA 2ZI5A 2D2FA 3BIFA 3A1WA 3H0KA 3KTAB 2ZEJA 4Q18A 4OHWA 2VP0A 5KNDA 2EQBA 1SHKA 1IBRA 3MAAC 1FP6A 4ZDJA 4TT3D 2JLZA 3SYNA 4PC2A 1VCMA 2J45A 2VP4A 3CZPA 3RRMA 2HLDA 2GWHA 5KPDA 5KO2A 1CXZA 1DTSA 3CX6A 1E96A 1CJTC 1G8FA 2WIAA 1HA3A 4QM6A 3FMFA 1VYUA 1Z28A 1RRGA 1TAGA 1CJMA 1XXHE 3UMRA 4IDNA 3VX3A 1RIFA 2CNWA 4HI0E 4CEJA 3KJHA 2GJAA 2GZDA 4V0OA 2CLSA 1KO7A 1MO5A 2BM1A 2ZU0C 3OFNA 2J0SA 3WP0A 1ANKA 1Z6GA 2R6CA 2X77A 3FDIA 3LW7A 4Q9LA 2JJ2A 1NY5A 4EJSB 1E2NA 4YQFA 3A58B 5HKKA 2IUTA 4RD0A 3CH4B 3ZS8A 2AWNA 2ZRBA 1IONA 2J0UA 1NVVR 5AUNB 2SHKA 4M22A 4M2LA 421PA 5EXSA 3W5JA 4DXAA 2H57A 2VHCA 4TTRA 1CLUA 2GTPA 3EW9A 3KKQA 4DLRA 1U81A 5F3WB 1O3YA 1FQJA 4PTLA 3I3SR 1LF5A 1O87A 3UK6A 4LSGA 1SVIA 5DHFA 3WHLA 5FTKA 1RJ9A 4OHXA 4OI1A 2RGAA 5H1YA 1KK0A 4JJZA 1UDXA 2AR7A 2W6JA 5FL7A 4ZKDA 3H4MA 3L0PA 4PQFA 1G7CA 2QGNA 2NTYC 4HB2A 2OCYC 4FMDF 2GETA 2BKEA 4DLZA 2QPOA 2J0VA 1M34E 1K5GA 3THYB 3AVTA 3VR1A 2YOHA 2P0EA 4IOJA 3FHOA 3E5HA 1E3MA 3QXCA 1SVLA 1KZ7B 4KODA 2AK3A 3LX5A 5EP2A 1Z6XA 3L0OA 4TZ6A 4LJAA 1VCIA 3TW4A 2G1KA 3AUXA 4TL9A 2WMNB 3ZQJA 4B75A 4NYJR 2OZEA 2IYVA 4AKHA 3GLFA 2R6GA 3GCGA 4C0QC 4QBFA 1JQLB 4AWXA 1AS2A 3NXSA 3R8FA 1PVOA 4BECA 3LXXA 4KI0A 4CGZA 5GJBA 4OQNA 1P9WA 2QL6A 1N6NA 3SJBA 5FTLA 2JDIA 2LKCA 3SYLA 2GXAA 5H70A 1XB2A 3GEIA 2IYUA 4NU0A 1WA5A 2VH5R 4HSEA 5IK2A 3OHMA 3H1TA 1YKSA 4JBWA 4W9MC 1T9HA 1HT2E 4JSYA 5DHAA 3GJ6A 1P5ZB 3A4LA 3PR1A 4HAYA 4TLAA 3SJCA 4B47A 1OSNA 2ZSDA 1XZPA 5FPHA 3OZXA 3QF7A 1LFDB 2QAJA 2Z5FA 5KU1A 2ZSFA 1JR3D 1VG9B 3DZDA 1VKJA 3BD9A 3SNHA 4PO9A 2X1VA 3ADDA 2QUZA 221PA 3TR5A 4Q1EA 1YVDA 1FOEB 2BKUA 3C14C 4RD2A 2VSOA 2P5TB 2UVQA 5TVKA 1HYQA 4CEIB 3QVVA 3Q7QA 4IXMA 4AG6A 3EZ9A 2JATA 2P65A 1NN0A 3EX7C 2O8EB 4NYMR 5F98A 3E70C 1N0VC 2CJWA 2OXRA 2Q0HA 2ORIA 2KI5A 3O8BA 3L43A 4Q9IA 2W83A 4MRSA 2GZHA 3X1DA 4FINA 1RW4A 5HE9A 3VU9A 5K8IA 2ZR7A 5JRZA 1Q3HA 2GEDA 3EWAA 2YNMA 5EJEA 3FE2A 4NONA 4OQXA 4M8NE 5CLLA 2Q3FA 2WAXA 4XOIA 1CKEA 1UEIA 4DWJA 4MUBA 2QTVB 3AF1A 3PUZA 2C95A 1DAEA 1XFAA 3K0CA 3G5UA 1PLLA 2ORVA 4C0BA 3AQ4A 3I73A 4IEIA 3ASYA 2B7CA 2F1RA 3SFZA 3V00A 2A30A 4IFEA 2ZQ5A 1DS6A 3TMKA 2GZAA 4XD7A 3F0TA 4DSUA 3P4YA 2O5VA 3B9PA 1HE1C 4CW7A 5B30A 1H8HD 5EUQB 4Q7KA 1S9HA 3GJXC 3TUJC 3NH9A 2GCOA 2ZIAA 3DM5A 2ANBA 4GDFA 1XMSA 4DB4A 4LBWA 3U7HB 3ZD6A 1MH1A 2W00A 4A2QA 3NKVA 3SQXA 1XEXA 3K0CC 2ZRAA 3TJZA 4YMTA 3ADKA 3KKMA 3X1WA 1A1VA 4RD3A 3K9LA 5FL3A 1NBMD 2ODNA 4FW9A 5LD2C 3UMFA 4IVQA 3BH0A 4CIDA 1GNPA 5GADl 3ICEA 4LV8B 1OKKD 1TUIA 2V7QA 3FYHA 2J1LA 3SR0A 3QPWA 4Z1MA 3R7WB 3FMPB 1N25A 1NVUQ 4L9SA 1UAAA 1TF5A 1FL9A 5AJYA 1U9IC 1N3BA 4TYWA 1CR0A 1CR2A 3QXJA 1BMFA 1IN4A 3C15C 1S1MA 3V9PA 3X1XA 4A8JB 4D81A 4AY2A 3SE0A 4D25A 4I4LA
chains in the Genus database with same CATH superfamily
4UAVA 3ZZNA 2ZYSA 4LZNA 3R3UA 3S4YA 3LM8A 4IILA 3LWNA 4ZHQA 1Z2NX 2W6OA 4C0XA 5LXTB 2NUAB 1OLXA 1P0MA 4LHXA 1WRBA 3DJYA 3RC3A 1VGVA 4M9XA 1GLNA 1IHXA 3L8DA 4HWKA 3U3MA 3SHWA 3ONDA 4UNNA 3DDOA 1YDWA 1MAHA 2XVMA 3GNSA 4RQAA 4RNDB 4JUBA 4RLQA 1XU7A 4KR9A 2XCSB 3PDIB 4OKIA 5E7JA 1CUIA 1N3IA 3LYAA 5IPFA 3UV6A 2UUPA 3JVIA 2VL7A 2J33A 3ZG6A 2GILA 3IHTA 3RASA 4BQNA 3V8EA 4F7WA 4Q9NA 3KQUA 2AUMA 2UUCB 2QAGA 2Z1NA 1F9AA 1NVXQ 4RGVA 4K9LA 4ZI2A 1CRQA 1E8MA 3BTUA 4Z0HO 1BH2A 3K92A 3IE2A 5M2QA 3ETLA 5G3ZA 1CY4A 3ITKA 1BQEA 3TAUA 1W48A 2HCRA 2OXCA 3KQOA 4TL6A 2GA8A 3NFYA 4E14A 4MSUA 4BNGA 1PX2A 2ZRPA 3B6MA 2JD0A 2F67A 5HM8A 2VJYA 1M6WA 5A06A 5IX8A 1RAAA 4UE2A 1A72A 6YASA 3BREA 4UTNA 4JHLA 1F8UA 1A9RA 3A2MA 3ZDRA 8ADHA 5EJ4A 5J4YA 3ROXA 1SZPA 3NVMB 4AMYA 3KQYA 4BCCA 4DV7B 4PLFA 2GF0A 1CUYA 1QTIA 2PGXA 3D6TB 2DUWA 4HLQB 1HV8A 3WO0A 2WDPA 3UCXA 2O05A 1NFRA 2VTEA 2VCHA 1O6FA 2VZ9A 3PP8A 3R3JA 5IEBA 2FUEA 2PHZA 3CH5A 3BXEA 3BIJA 4AM8A 1Q1BA 1I5RA 2CZCA 1C0KA 3LX4A 1ZIPA 5AJVB 4D43A 2WKPA 2HJVA 1JZQA 1TUGA 5HQJA 2WAMA 3OA0A 2UZAA 1QIMA 3TBKA 3TEMA 4C7XA 2ZLBA 3AUUA 3F9RA 3T5MA 1X7DA 3QVLA 1KI9A 2GKSA 4WLOA 6NULA 4EYQA 1IVNA 2XQFA 3A3YA 3CX4A 2GJ9A 4AJEA 2RAPA 4K9PA 4EB6A 1P4RA 1VLJA 1WCWA 1X7GA 4KFCA 1NXSA 2DTEA 1TQ4A 3T4XA 1O94D 2QG6A 5TQ0B 4B3SB 2RK6A 4YO8A 2F4NA 1ABEA 1MOPA 1T4BA 1UDCA 4KWHA 4NNOA 5CVDA 4YRIA 5KTRA 4DR4B 1MLDA 4QEKA 3FTCA 3VKGA 1YZKA 3BHJA 1RIIA 3HU5A 4GEKA 1G9XA 4LQ4A 4IG4A 1B2LA 4H1HA 1O58A 1Q20A 4U02A 2G7ZA 3IUJA 3NT4A 4D8UA 2B4TO 2GCPA 1FEZA 3IULA 4WVLA 3K31A 4J0EA 2WNSA 3JD2A 2NVOA 5FA6A 2WD7B 3ZY4A 3U0VA 3VZCA 1POWA 3EZFA 3VYUB 2WJVA 1RXIA 5BUSA 3IMKA 4FEYA 4KUHA 4Q4HB 3H9GA 4BNTA 4MRMA 5ALEA 2XCOA 4KX3A 2CUKA 3GFTA 1DEKA 3BB4A 4F4DA 1KDZA 1AG9A 1YE3A 4ATNA 4XWKA 2C9DA 2WYOA 3CA8A 3H5TA 3ORRA 1U80A 4FLEA 1N2IA 2ZI7A 4ZU1X 3MCWA 4O4LA 5J3JA 4I8XA 4BLTA 2HW8A 1U9JA 4HNGA 4I5EA 3C8DA 4UMFA 1EFUA 1Q1ZA 3H1AA 3KR2A 2P9CA 5I7EA 4DIOA 3I4LA 1UMDA 4OQLA 1OE0A 4H0NA 1LWOA 1O97C 5CVJA 2CLCX 4S3MA 1L5ZA 3M81A 2G7MC 2NXEA 3N8NA 4LCBA 2EFDB 4ARSA 4UAUA 1QIKA 4Q05A 3AX6A 1GCGA 1MU0A 3BWBA 4NZ9A 4B2IA 1AQIA 3MGAA 1S7CA 5BN4B 3MJSA 2ISCA 4IOKA 3DM9B 2RGUA 3UC9A 1MTOA 3ONEA 2P77A 3PXBA 3PLAE 3BGIA 4BNLA 3S2GA 4LJ9A 3ENWA 4ABTA 1J39A 1N2SA 2VJQA 3P1JA 4PQGA 4RIIA 1Y6FA 3AVYA 4IWXA 5KS2A 4FQ7A 5LXTF 1THGA 3AO0B 3HCWA 2HSDA 4O0MA 3CNBA 1HFWA 3ZHZA 1E1DA 2Q2NA 4TKUB 2NO5A 4O8CA 3CVUA 4DQ0A 4V3CA 4C4XA 5IT5A 3C43A 3K0AB 3GFFA 2G25A 1E1NA 2BBTA 1DBRA 2V5AA 3QVKA 1U9YA 2Z9BA 5TRTA 3WYCA 10MHA 3BE8A 2QTMA 4XB6B 3TIFA 4BKOA 1OTHA 3WDMA 2OAEA 1IDOA 2XRYA 1P18A 1V9SA 3PNLA 3CE6A 1JSXA 2X6QA 1DDGA 5AM1A 3A3OA 3VR2A 2IS4A 5EMNA 3UAOA 4FE3A 1E2DA 5I6DA 2X19A 5FNVB 5ALOA 4JODA 2I3AA 2H7XA 2NUBA 1QTRA 3PRYA 4IDAA 4QOEA 3IEPA 1CS4C 1YFLA 4KACA 2RGNC 5JHGB 1ECLA 3VPXA 3ZHQA 4PINA 4RANA 1R9MA 3MWDB 2JCYA 4HNAA 5KQRA 3O4JA 1N5IA 1PDWA 1EQ2A 2DOKA 3B7GA 3MTQA 4RA9B 2Z83A 3T9DA 3V7NA 4NENA 5FFMA 5BXYA 2A5LA 3EY4A 2QXUA 4Q1BA 5H4HA 3B5JA 3A2LA 1JNXX 1DZIA 1MIOB 4G4SO 3FKQA 3UW1A 3DUFA 3REGA 1OHHD 4JI1B 3QG1A 1J0CA 5I7WA 4DGSA 3W3AD 4W63A 4PPNA 2L69A 5BN3B 2JGMA 1LI5A 3URKA 5K0FA 1Q1QA 2NPFA 4V1CI 5AICA 2AG5A 1YACA 1DCTA 1UJMA 1X7XA 3DYIA 3KS9A 5F2KA 3AJEA 1QC5B 1OI7A 4NBTA 4NXMB 1S2LA 2KE5A 1UBCA 4D6PA 1T6BY 4WD3A 3W8FA 4GI5A 1NKSA 2GPWA 5IDQA 3DLPX 4D4MA 1V8FA 1HBJA 2OXEA 3R0JA 3W2HA 2VK4A 3HEBA 3IT3A 3KKLA 4DQDA 1OPRA 3EXHC 4IS2A 4EGAA 3VNUA 1FJXA 1KJQA 1ZOIA 3NIWA 5DBEX 2ZAMA 5JCXA 4NESA 4BTLA 3A0UA 4E1VA 3LLMA 3M4YA 3Q87B 1AS0A 1RABA 4ZRNA 2PU5A 3HKEB 5IKMA 3QBVA 1NW4A 2JHPA 1IEWA 3E61A 1LDMA 3GGOA 6REQA 1CC1S 3ROTA 4Y0NA 2HSWA 3QWIA 5BRJA 4B40A 2VYQA 1PR2A 3IX7A 4L9RA 1UR5A 2G72A 3KEMA 3AR6A 4LRSB 3ZWMA 3ODPA 3GPIA 3LJKA 3MYRA 2W2MA 4FSDA 4RKEA 3RF6A 4Z7JA 3T1VA 2HMUA 4UBOA 4EK9A 1NBMA 2GN0A 1G6HA 1C3EA 1U2PA 1U2ZA 1O4WA 1H2RS 3ZCXA 5K2OA 3PQ4A 4B71A 4BVAA 4OOEA 3BWMA 1XQXA 1ZNYA 1XALA 3VZDA 2E5LB 4JR0A 4QPNA 2GF9A 5G4KA 1DX9A 1I2CA 3RE1A 5K0LA 1THZA 1L1FA 2EX4A 5KUTA 1XTSA 3VR6A 4O63O 2PX6A 1U2RA 2WKQA 4JI2B 3TB6A 2D13A 2PA3A 3A70A 4GP7A 1QFJA 2HZ7A 4TUYB 3QIAA 4UU8A 4KMMA 2NTNA 3VYSB 3BMCB 3A6PC 1GNQA 3ESBA 1Q0SA 2OKCA 3C5CA 2YYZA 2C4UA 3WNZA 5IK2D 1KFCB 2NZ2A 1Y3AA 4RTSA 2FPKA 3C4QA 5JS2A 4OAOA 5FIUA 3ZGOA 4W6QA 1ZGZA 5B58T 1GO2A 4ASUA 5LP6A 4MVJH 4N40A 3D1LA 1LD3A 1JTEA 3SAJA 1UKCA 3H9QA 4WHMA 4OKNA 1XD8A 4G0YA 4MKXA 4PWYA 4I2VA 1UK9A 4L4XA 2REQB 4CV1A 2DUJA 2FSFA 4O2LA 3COYA 1ODCA 4ZRDA 1WUKS 4LK3A 5DSXA 1TAUA 1JH9A 4S1TA 1HR0B 3QLJA 2YJ6A 3CLTC 3BMOA 2CCGA 1GA4A 3UWMA 1NUTA 4B48A 2Z57A 2I2DA 3GDOA 5CJJA 5DLPA 4L16A 3NO4A 2FPIB 2PSFA 2JAXA 1KZYC 2A14A 3SIWA 4GLOA 3HGMA 1HOTA 1AO0A 4LZPA 4C4PA 3OQIA 5LU8A 3KOYA 1IPHA 4RX1A 4GPTA 3NC1C 1EFAA 4ALKA 5DI3B 1NOKA 3JWPA 1UM8A 5A9TA 5BW8A 2DLDA 3PUHA 1XCMA 3U1BA 3KQNA 4AJLA 3DYVA 4EO9A 4JQCA 2VDNB 2VHYA 4QPZA 4W8HA 2B4AA 1XLWA 2CUNA 3QUTA 4J4TA 4OAQA 4CF3A 4DDWA 1QFMA 4YRKA 3UENA 1DINA 3AR7A 3H3FA 3B85A 2Q8NA 1ECFA 1I0ZA 4XPIA 4IH4A 5F5LA 3PQ6A 4X7PA 4QKQA 4L74A 4RC9A 5G1PA 2D5IA 5FNVF 5LZ9A 2YINC 4MIKA 2XQGA 4RIGA 5J2TA 2VHTA 1CFJA 4KQIA 4N0MA 3UV7A 5BXQC 1XPRA 4NCAA 1G9TA 2OZLB 1D0IA 1EDZA 2YWXA 1ODKA 2ZGVA 2ZTMA 3K1AA 4FS3A 4U7JA 3M83A 1TA0A 1JKFA 5AYVA 3O93A 3NNNA 3DEHA 2NO9A 2D1FA 3M4JA 5DHTA 4BMZA 4J16A 4YUXA 2Y99A 3JAKB 1E59A 4LNUA 3KLOA 2RDMA 2W6NA 3T1QA 2FW0A 4BNJA 2JASA 3P0RA 5J47A 3UK0A 4J03A 5T4BA 1K6JA 1ATIA 3WKDA 5JSHA 1P61B 3WR5A 3AP1A 3GJ0A 1R10A 2OILA 3CCCA 1DP4A 3HCAA 2OLKA 2V7VA 1N2EA 1QP8A 2P5YA 2FPXA 2PZEA 5LIRA 3AIMA 3UAGA 3W34A 1ZEMA 4Y2HA 1WY7A 1VIYA 3DMHA 3FPSA 5FPTA 1BOOA 1E98A 4C7KA 4EH1A 4NFYA 4ZXFA 5A1TA 4YJFB 3FCCA 4TWRA 2OD2A 1H5QA 5EL0A 1I7SB 4Z1MD 3QMWA 5K0CA 1I4TD 4GQBA 3T4EA 2Q1UA 2J59A 3OD1A 1XTIA 2D54A 2QQEA 4ID3A 4MLPA 2BPOA 2OQIA 1BDJA 3GEHA 4MZDA 4C7VA 1X13A 4E21A 3AU8A 5CA1F 4MPRA 4KMSA 3CGGA 2G0NA 3NBYC 2AJTA 2E18A 1T0HB 1JSLA 1KI3A 2FZGA 1CHNA 2KSQA 1PI3A 5EMLA 1O03A 3ENVA 4D8XA 1K75A 3UNXA 3MWYW 1T36A 3OPYA 3RTAA 3VVCA 1G6KA 1E9RA 5D6NA 1THMA 2HV8A 2V7XA 4JKIA 4S1PA 4ZVKA 3R7FA 3SK0A 3UCEA 4MQ6A 3RS0A 1C4XA 1IY2A 3C3KA 3ZIAD 1UK7A 2FMFA 3FJ1A 4X64B 5HEKA 3D5EA 2A5JA 3D3EA 4CTNA 4U8GA 4RKRA 5BWCA 4BGDA 5I4IA 2F43B 2I2WA 4KO8A 3OQPA 1C8KA 3E8SA 2P2ZA 2QROA 4ZT2A 4OXQA 4BMXA 5AUOB 2DSTA 1DIAA 3CLHA 1ZIDA 1B8OA 1SOWA 3WL6A 4JKOA 4NYIR 3T7DA 1NLYA 4Y6OA 3ENNA 2FFQA 3BAZA 2PUGA 4IZHA 3BGVA 3QBTA 4Z99A 1TQDA 3ESYA 4TUYF 4AZ3B 1NT2A 1R9JA 3FZNA 1Z74A 4LYGA 1ZJZA 1GN8A 4NU5A 4GKJB 2G9NA 5G40A 1H6CA 2RKOA 5BQXA 5HVNA 3JQAA 5AJUA 3BJMA 4AJHA 4DT1A 4MR8A 1GG5A 2FR8C 3LO5A 4MQLA 4H7EA 3EZNA 3HU1A 5SZKB 4LI0A 4DNXA 2EEZA 4PFJA 4F2GA 5ICSA 4NR0A 2X13A 5HJEA 3L7KA 4GOND 3H2KA 4CCWA 3IALA 1HQYE 3RHTA 1ZZEA 3B2QA 3C1OA 1Z22A 4AROA 1OTXA 3NH6A 5I3CA 1E7YA 4HYTA 5FRDA 4EITA 1D2RA 1TOAA 3UPTA 1EFPA 3SC2B 3L6RA 3VNQA 3AESA 4K9MA 1OFHA 3QELB 1EHCA 4ENWA 4LTDA 2XZOA 2PKQO 5P21A 4BV3A 3Q8WA 3CX7A 5AI9A 1YZLA 3PTLA 2PFKA 4PLYA 1LB1B 1NXVA 4GWLA 4EYGA 1O9BA 1RTKA 3ZE9A 1E2EA 1H9BA 1K6IA 1VE1A 4MQ5A 1FW8A 4L6CA 2APJA 2I8CA 4RZHA 2QE7A 2YCBA 3PC6A 2G4VA 1HORA 1K2VN 4Y2PA 3ZI4A 1MVNA 1QOPB 2YRFA 3ZCQA 5DGDA 5DF1A 1CE8B 2JKVA 2FOXA 3VSDA 1UWCA 2JKYA 3W5HA 4HDRA 3DTVB 4UMVA 2DY1A 2ZETA 3T0IA 3WBFA 1KERA 3DB1A 3GRVA 3K09C 2H1SA 4RQUA 1EWVA 1PZXA 5KYUA 3BRSA 4DAEA 2FF7A 5K03A 1ZNZA 1DQZA 1SBQA 1L8QA 1L1RA 2Q6IA 4IAOA 5FPYA 3MWFA 2WJ3A 4FR0A 4BFZA 3FTNA 2O7SA 4ETWA 2D2EA 1WJGA 3EVZA 3SEQA 2A5FA 5AVKA 5ALKA 3D4OA 2YXNA 3P27A 1XIVA 4QUJA 1J9EA 4UUNA 2CFRA 1I80A 3NDBB 4LUCA 2A7XA 2H2GA 5I47A 1P3DA 3FPFA 3BIWA 4B76A 3AUSA 4TM8A 2LVBA 1HETA 2NZVG 4UHBA 5BQPA 4B3XA 1EDDA 4JBNA 5FORA 1ZD3A 3HUFA 5D51S 2ASEA 2W70A 5HUJA 1YL7A 1PJBA 2OCXA 1N9KA 2D5AA 3UM9A 4ND8A 4TTQA 2Q2WA 3BZBA 5D7BA 3L06A 4U2CA 1UMCA 3DWIA 1XKXA 2XMZA 1RHRA 3DAYA 3P9PA 4IZOA 1EK2A 3LUGA 5TC4A 3ZDXB 4D4KA 2H48A 5A2QA 4YMIA 5LOVF 4J0JA 4WFQA 1W29A 2X5OA 2QP3A 4NI5A 1TZ2A 1U5CA 2PKWA 4QASA 3U7QA 4PR0A 2BKXA 1ORIA 3O4GA 5HDBB 5AMXA 3T8YA 3KUCA 3U17A 4R8MA 1KJ9A 3O3MB 2FP3A 4OMUA 5DW3A 1N2ZA 2WZQA 3E84A 4JL8A 3UHOA 1EX9A 4GYYA 1XLTA 4BPBA 4KQKA 1CJVC 5IFKA 1GNLA 1ADCA 5BURA 1OBFO 1AM4D 1PNQA 1NU8A 1PVDA 4HLDA 4C3UA 4KHPB 4HDMA 4FOTA 1HTTA 4CTKA 5CT8A 1ZAKA 3ZEAA 3I9MA 2BJHA 4CV0A 4G5YA 4N3GA 1GPAA 4RD6A 4MVWA 2BFBA 2YFYA 5DX1A 3FSJX 5TGDA 4URZR 3U26A 2R1UA 4MW9A 2B25A 2WTUA 2VA9A 1PTJC 3OIUA 3S8YA 4BNFA 1MV5A 3SHTA 4C76A 3V1NA 1VG8A 4GOXA 4K81B 4YX9A 1RWKA 3G8BA 1NE2A 5BR8B 3DHVA 1GL3A 1G8HA 3BJZA 2ZTSA 2BI7A 3QUSA 2JGDA 3PWKA 1KAOA 3N86A 1ODLA 3JQDA 2WIBA 4LYEA 1YZQA 1M34B 1TADA 1Q1NA 3VR2D 3THRA 4UVDA 4A1FA 4CT0A 2XDYA 1A1SA 1V4VA 4MRNA 3KKOA 1IYZA 3IQFA 2E87A 1L4KA 4UUAA 5AOBA 2OPHA 1YL6A 5BPFA 1GDTA 1EUYA 2C5EA 3RC7A 3EDYA 1OB5A 2H2AA 5J4HA 2WTAA 1A9PA 5AK0A 2PCLA 4GKAA 4OPMA 3A14A 4F46A 3DKPA 2DVMA 3LBAA 2ZPUA 3ZNQA 3OC0A 1P9OA 2H51A 1IIBA 1LGYA 3MTEA 5CDFE 1PGNA 2R7AA 3OZDA 1BHJA 1SVKA 2Q0SA 2ZYIA 4H6VA 2CJYA 4LY6A 4C01A 4KR6A 3IBCA 3RVOA 3IAM1 1LUAA 1RRVA 3HYSA 3GLQA 4QYXA 3PXGA 3SY8A 4EHLA 1ZU4A 2F64A 2A0YA 3FYSA 1LVHA 1U3TA 1BC5A 4E33A 2ZQZA 3H9CA 4U7DA 1G63A 2Z2IA 3MQFA 5EWLB 2I22A 4KE7A 3W1EA 1WBDA 1G5TA 1Z0KA 3MZ0A 4LWOA 2UZIR 1EXVA 4LF8B 2R65A 1L4LA 3W2GA 1Z0AA 2Y1GA 2BGRA 4E5SA 1CZLA 4ZVMA 2X8WA 1VB3A 3OIYA 3QWBA 1OZAA 2QT9A 1G3MA 1XD2B 3V4RA 3WOHA 3B6JA 4UTRA 3T7IA 4QOHA 5ALXA 1N8NA 1L8AA 1XVAA 3OY2A 3KJFA 4F5DA 3NUZA 1V0JA 1QJCA 3HB4X 3EGWA 3RIHA 1JIQA 1EVLA 1KFKB 3LQ4A 4FXOA 4KO4S 1B42A 4OXXA 5CTJA 5EQFA 2FSPA 1PE0A 1CS0B 5DGTA 4GI7A 4UW9A 3JALA 3NM6B 4DF3A 1PL8A 2Q5IA 3NUQA 3NORA 1KHTA 3O8QB 3HVKA 1YCFA 3EWIA 2MSKA 3T41A 5JADA 1UQRA 2I03A 5BUQA 5SV2A 1G41A 2Z95A 4NIMA 4LGCA 4PF1A 4JI0B 3Q3CA 1WVIA 2P2NA 1RXEA 2WJ4A 2I9KA 3CLSC 4ZVLA 1BMQA 1LI4A 3JTEA 1G8GA 2VHJA 4LFBB 2ODAA 5D00A 1XWFA 3D4PA 1MH9A 1FYDA 5AHKA 4DMGA 3Q6MA 2PSEA 2V58A 2Y93A 4L4UA 4KSCA 1KDTA 3W78A 5CBPA 3KZXA 1Z88A 3SX4A 5IC4A 1I4EB 3EIFA 4TXMA 5DEIA 3ID6C 1Z75A 3QWAA 4GOMD 3RBZA 4EARA 2ID7A 4S0ZA 4A16A 2ZAIA 3WKAA 1MB9A 3O1HB 2R6HA 3C24A 1AB5A 3AM5A 4NJEA 2RGXA 3V97A 2MT9A 2QX4A 3V5NA 1WMAA 1NPTO 1BXZA 4XCQA 1JDBB 5JANA 1JEQA 1WUYA 2OHJA 2YV2A 1V25A 3OAAD 4I81A 2YXEA 4GNRA 1Q92A 4ASUD 2V4UA 2YV3A 4RE5A 1J2EA 5ES3A 1WSDA 5JCOC 2HK7A 2QTCA 3QHPA 1ISMA 1I2AA 2NP6A 1ZN9A 2SCUB 4R41A 2C58A 3IXMA 2GYWA 3MJVA 1TGVA 4KKVA 4KXQA 1NRJB 2IPXA 1CEQA 2Z3VA 3CXUA 2ZUWA 4OREX 5E6RB 1PYDA 3RTCA 1N9GA 4DLPA 1EFRA 2JFGA 2QRZA 2XE8A 4WXYB 5JEEA 3JWHA 2ZVQX 3JQ6A 4NY1A 5CA1A 4ND1A 1OAAA 1X8LA 3QBEA 1LBHA 2UVDA 1DIRA 4AWAA 4Y18A 2ZRQA 2X1MA 3ZV5A 4BDTA 1Z47A 4HH3C 1R88A 4IGFA 3V8RA 3L0DA 4L1KA 3V2HA 3LQFA 3A7DA 1JHZA 2AKAB 2GD1O 2JIPA 2AFIE 3GJ7A 4JJAA 1RU3A 3KG2A 4KC0A 5DHRA 3ZYZA 4CLRB 3OFJA 1TU4A 2GLUA 3ZGZA 4FCTA 4PNPA 2YDXA 1SKUA 2WHPA 1YS6A 3O8RA 5G41A 1UJBA 3WGMA 3GLIA 3ZDFA 4V0LA 4Q3AA 5JDCA 1X1AA 2HKIA 3ZE2B 3PF9A 3W8DA 3RAGA 1SXPA 3HCOA 3JARB 2C7BA 5LSAA 2O0MA 3IP5A 3WL4A 5BOSB 4OLHA 2IT1A 3I5MA 1T8PA 3WL5A 5BVHA 2OHIA 4XFKA 4CIAA 2VJMA 3VR5D 5KYVA 3MD0A 1P5HA 2P7HA 5JWOA 3KOUA 4EMBA 4OHYA 3DH0A 1KNXA 2GFIA 3JVUA 4MKIA 1A7KA 1TVKB 4HQOA 2V5UA 4GSKA 2IYQA 5EHZA 4V0SA 4Q3NA 4HQRA 4XD2A 2VDQB 3CUTA 5EIHA 3DP9A 2H1LA 4WCFA 4A4DA 2VBCA 1QF9A 3LMKA 4QG7A 1OROA 2FJPA 1LJ8A 4MV0A 2IVFA 4TGLA 1KH3A 1NW5A 1S02A 1UDRA 2WWFA 2X5KO 4TOIA 2QZPA 5COBA 2O14A 1KEWA 3OOSA 4HAUA 4N6OA 4OIMA 4WDQA 3T5GA 4ANFA 3OFKA 3ZK8A 1X1EA 4E5UA 2B0JA 3CQ9A 2EKPA 1T1GA 1E7SA 2CVZA 4L4RA 5CDSA 1DAHA 4IQ0A 3FHLA 4BQFA 1QWSA 3TN7A 3DZKA 2ZUTA 3VHXB 2FEPA 3W3ZB 3W8EA 4BFYA 1GZSA 4WZAB 4BL5A 1GPUA 4IHJB 3A4NA 2QM7A 1VKNA 4CKCA 3FUVA 3LHDA 1ZK0A 4QAQA 4UOEA 1MC5A 5EZYF 5BSKA 2BGTA 2QT0A 5BOVA 2PLRA 1SUEA 3MWKA 2BEKA 1THTA 3OJOA 4DPKA 2EX1A 2XZDA 4XX1A 9LDTA 4F5YA 1GAQA 5FUYA 3L6UA 5JNLA 3BSYA 2H18A 5LFAA 4ND3A 1Z29A 3O92A 1YZYA 2RK3A 3G89A 3S99A 1Z8FA 4JI8B 4LYHA 4WH0A 4YAWA 3H8JA 4P4UA 1XWIA 1IVYA 3WLRA 1W36D 3TXAA 1D4ZA 3JQFC 3EQ7A 2WJIA 1GNVA 5LU9A 2WWHA 3AZQA 3QEKA 2R79A 4HLNA 4KR0A 1C3OA 1PFVA 2JEOA 2NZJA 1S3GA 1JJAA 4Q47A 2XA2A 1MQ9A 2G0TA 2KHZA 2GJ4A 2YYAA 4TV9A 5FYDA 3T3MB 5CCDA 2PV0A 1U28C 3HFRA 2EJCA 4UDXX 4WINA 1XQWA 4ZQBA 1NJFA 1UJCA 1ESZA 4M1ZA 4C43A 3MJHA 5AQ1A 2Q4BA 3ZWDA 1U3DA 3I9NA 2ZUFA 1P39A 3B1JA 1J23A 1JFFB 5FBZA 3MSXA 1ABBA 1Y33E 3F4LA 4GR4A 2YH2A 3VKFA 5F3DA 1BQ4A 5ALUA 3W6ZA 1KDOA 1LW6E 3KEGA 3RABA 2XMCA 4GBMA 4HNTA 1PWXA 1TM3E 3U37A 1AGXA 1W94A 2PIDA 1NMQA 3RC1A 3CO5A 1LLQA 1OWPA 1CERA 2VXOA 4WE3A 5TJ9A 3QF4B 5ANRB 3UK7A 4IICA 1NMZA 1QIEA 3OOHA 4DEXA 2RHDA 5IZCA 1QHFA 3HE3A 4BNXA 3QOFA 4PO1A 5MHTA 3OT1A 1HOXA 1BW9A 1JL3A 4L51A 1NVMB 1VLMA 5BQOA 4MGEA 1YAJA 1Z3CA 5JHHB 1NJ5A 2WSYB 3IAUA 5EIXA 1R2QA 4YDQA 4HEHA 4TQUS 1KIFA 4PVDA 2A9RA 1UPBA 1GA6A 1YS1X 5JBQA 2R6R1 3C5WP 4R5HA 1CR4A 2HQ1A 4YAGA 1CZHA 2I4MA 1E3WB 4H7IA 5DIFA 1M1YB 4XFDA 4F8EA 1Z7YA 3RDPA 1PQWA 1UPAA 1PEYA 4LXUA 1E2JA 2PS3A 3BGOS 1W8DA 1YVEI 4Q4LA 4BQRA 1WVMA 5CK4A 3W2TA 4RH3A 3LUJA 3B53X 2HSEA 1IN7A 1CEEA 4Z49A 2E89A 3JASB 3DE5X 1WDWB 3NS7A 3A1UA 3DXXA 2QE7D 4GMFA 4BNKA 3W9YA 1VBMA 4WLEA 5AJZA 5EMJA 4CKBB 4F1KA 9ABPA 3N8KA 4R7TA 4EPVA 4RDIA 2GF2A 5HGJA 1TFUA 1G4AE 4MDFA 2DEUA 3R3VA 1XZAA 4DEVA 3GUCA 5JBNA 1MEEA 4DANA 5LVAA 2BGGA 1C0LA 1XMPA 5ERYA 1Y9AA 3OG9A 3RKSA 3TNYA 3EPJA 3DFMA 4E3WA 3PKZA 5JAPA 1L5VA 4LV5B 2GBIA 1F8GA 1NA5A 4XDYA 3U5ZB 3COVA 2ZJ1A 1ZVMA 4E4RA 1OYVA 1BMDA 1MTZA 3ACDA 4GMDA 2OM6A 4HY3A 4WZBB 1KSGA 4DIMA 3I42A 1WBBA 4EG3A 2MSWA 2MMCA 2C78A 1CV2A 1T8WA 1F6BA 4Y1RB 1EXNA 2BP7B 5HYVA 2ZBUA 1KXJA 4XGIA 2Y0DA 1XLUA 1X1TA 3H1GA 5JJIA 3B3QA 3KZCA 1COWA 1J99A 1Z33A 1QG4A 3N7TA 2JI6A 2ZWAA 3UGQA 1BXRB 1RWBA 3GBSA 1J09A 2AQKA 1O89A 2J6HA 2D0OB 5AJXA 2ID9A 2VP2A 3THYA 4ETNA 1I4DD 4DPMA 3G82C 4Q3DA 5LD2B 2EIXA 4L0QA 4K9RA 3BJRA 1DJNA 3O8LA 4C6HA 1E0AA 4BQQA 2N9UA 3RC2A 2GN1A 3N75A 1F7VA 3WHKA 1P4HA 2BGJA 1DKNA 3MCTA 4ZTZB 1JG4A 1YRQA 3K5WA 1F5NA 1G4HA 1BA2A 3A9VA 1XMIA 4W7HA 3QFHA 4W5TA 5I45A 1QHGA 3V80A 3PQ3A 3FG9A 5KAMA 3M6AA 4M1MA 1VIMA 4UNSA 4E2XA 1EEXB 7GPBA 3PX7A 1U8CB 1WMSA 2CDNA 2QORA 4WOBA 1NNUA 5JZMA 1RBZA 1N5KA 1QZUA 3IUEA 2ZUBA 4HF7A 1MPXA 4LGMA 4KQXA 3I3OA 2V0CA 3PK0A 2KBEA 1H8EA 2OXIA 3UBMA 3ZHCA 4Z1OA 3PFWO 1G2OA 5CVCA 2FAXA 2VZEA 4GRDA 4BYMA 2WPDA 3INRA 5FA8A 3WBJA 1G9SA 1NI4B 4Q3BA 2IEBA 1G3QA 1OJ7A 1VXOA 1H42A 2RC6A 1NLUA 3BK7A 3CJTA 2HO4A 5F1YA 3OTOB 1VSQA 4BNDB 1T1EA 2DTDA 4FS8A 1UZMA 2RBGA 2XOXA 3KALA 3FKSA 1O2DA 4TSFA 2VUIB 4PLCA 3ICOA 5F73A 3ZCVA 3E9ZA 3L1UA 4AO7A 1VSVA 1KI2A 1JHDA 1L7NA 4QTXA 1L7RA 2BF4A 5L7YA 1IG3A 4QUEA 3IVMA 4Q9HA 3DVAB 4BEJA 1OH6A 4W5NA 1HURA 1QPGA 2CNLA 4DRZA 3DZBA 4RVHA 4DDUA 1RLTA 1IY9A 3B3JA 4HPXB 4PIPA 3A05A 1Q77A 5IC5A 1CT9A 1R3UA 3NTQA 1T6ZA 2ZRMA 1SKYE 5HP4A 2XZPA 4ZQHA 1W49A 3PT9A 2ZJFA 3E3NA 3OOYA 1NJ8A 1L5FA 5JXGA 4BLRA 5GIPE 1FP4A 3CNQS 1HF3A 2IUEA 2QTZA 5TGTA 2HF2A 4M7OA 1JWAB 1HDCA 5BR1A 3DMYA 2XKJE 1XAJA 2R7MA 4ON9A 2WAYA 2CLDX 3DO8A 1YE5A 4CIYA 1V5IA 3F90A 1GUFA 2W6ID 3MC1A 1FNDA 1OTYA 2HFKA 4P2GA 4KRXA 4WOCA 3F6SA 1G0OA 3CSDA 5AKZA 3V48A 4EMSA 3AMVA 4ZANA 3DFZA 2B20A 1IBLB 2SKCA 1KZ9A 4PQYA 2JHGA 3FNHA 4ITVA 1JAYA 1KDPA 1LNSA 3QTTA 1DJQA 2HA7A 2HHHB 3BF7A 3PR2B 4U2DA 3VJRA 3R0XA 2QRNA 2NNLD 2VYND 3V6MA 4WKGA 1JYFA 1PSWA 2RKWA 4BTVA 1AA6A 1BCSA 1FPQA 2OESA 3QVMA 4LJRA 2JFYA 1PHPA 3RJMA 3MOGA 4KWCA 1AOXA 2WC1A 2WK1A 4R2JA 2JAWA 5EWJA 1PP4A 2D74A 2OBMA 4KLCA 2ZIUB 1Y1RA 1IL0A 4I9HA 4OHUA 2QXYA 5IXJA 2QSJA 3H05A 1WUTA 2PZAA 3F2VA 3EGXB 4IGIA 2JAHA 2BM0A 2PWZA 4RVCA 3IDSA 1T9GS 4HZIA 3ONFA 3SKVA 1FYXA 3MCUA 3H3XA 3U44A 2CJXA 3FDXA 5TEWA 4HUTA 4PNEA 2VTBB 3IKTA 4MIYA 1H5NA 1FFEA 2OCBA 1BVYF 4RF2A 4ZU3A 4X24A 4IDFA 3RSOA 1CR6A 3GPDG 3G5MA 2GB4A 4EA8A 5DISB 1KU6A 1FNNA 4RJKA 3WLHA 5TJHA 1R9NA 5ILOA 1Q57A 3LDGA 4ZOLA 2VF7A 1E58A 2NXWA 3H1BA 4EECA 2R8OA 1CY7A 5ARDA 4H7DA 5U4XA 4INZA 1R8SA 4MHOA 1ONSA 3OJFA 2VWGA 3DFUA 2GAOA 4TLDA 1MBZA 1M2GA 2D5CA 4DARA 1QRAA 1ZH4A 1EG2A 2V7GA 3UWDA 2DFTA 2QMYA 3P8ZA 5EJGA 1Y0BA 1W35A 2QZZA 2C3YA 1KMIY 4N8SA 1M6NA 5C35A 4A6XA 2QLLA 4BZPA 1PEAA 4B3TB 5ITSA 3I37X 1SURA 5KYXB 2J4FA 3IHLA 1GN9A 3FUUA 1YR8A 3SF0A 1HDXA 1QZXA 4FFDA 3D6VA 4E88A 3H65A 3D3WB 4C7JA 1N2GA 3IDZA 3AY3A 4LXHA 3N0XA 3PENA 2BSQA 1GPJA 3I9LA 1OJLA 4BFUA 4F6CA 1CUXA 4FZVA 2GXAA 1QUFA 4MA0A 1POXA 1EFRD 1HYHA 1YS9A 3CJRA 3NDPA 4PCLA 3EAFA 4NAHA 4ZYTA 1Y42X 4X0EA 4O8ZA 2P0YA 3K7EA 4MGKR 3S29A 5P8WA 2WUWE 1D1PA 3IILA 1YKFA 3ZOKA 4N76A 3SZOA 1Z6QA 1I5OA 2HTFA 4F84A 2V9CA 3K1ZA 4HLUC 4QPJC 1BOFA 3TD9A 3T5AA 2GBLC 1KY3A 3CURA 3NWOA 4MPPA 1U2DC 3QX3A 2I3GA 5EJ7A 4EA6A 1ZRSA 1CYEA 1JXOA 1AD2A 1LDBA 1SELA 1JQ3A 1MC1A 1GZ6A 3LCMA 3WLQA 3NGMA 3E9CA 2V3VA 1D7OA 4ITUA 5E0OA 2HSJA 3TOZA 4CLEA 1FRZA 2AN1A 4AICA 4ME6A 1Z13A 3EFHA 2FSIA 3PC8A 4HQKA 3AIOA 3LPAA 1LLUA 2FWPA 4HMQA 3SS7X 1PJRA 5CXXA 5DB4A 1KZ1A 1RAIA 3F6PA 4WK2B 1HNWB 3M34A 4I55A 1NX6A 2ZYHA 3E3MA 3F3KA 1M2OA 2CB9A 4FFVA 5EIWA 1H1LB 4AP9A 4OM7A 1FYVA 2C99A 2LCQA 3T3IA 2PZLA 3KBOA 3BULA 1LBIA 1DOHA 3I5AA 2BBWA 2IPOA 3GX1A 3RRBA 3ZVMA 1GT6A 2WT4A 2GERA 2YBEA 3QKRB 5JE8A 3DDNA 4MQEA 4QVKA 1Z17A 3LKBA 2ADFA 4E6PA 4Y2JA 1RZUA 4KWEA 1KBZA 2O3UA 4ARZB 1KIMA 1GPDG 2IJGX 4UXHA 3EJWA 3TTWA 4IIJF 1PS9A 3T1YB 3T4PA 1CJCA 2FFAA 2Q9AA 5F9MA 1Z08A 4OI2A 1E2FA 4DM7A 1T35A 3NIGB 4ZD6A 1I0LA 2I3DA 4BY9E 2IYRA 2YMMA 1NBME 1FMCA 1RFLA 2OZVA 4JAVC 2BKAA 1JU4A 2OCIA 1YOVA 4D4JA 1E2MA 2Q4RA 3STUA 4FN5A 1KI1A 3TMAA 2WYUA 2RJOA 1GT91 5EFOA 4CM3A 3IEXA 1Z5PA 3KYCA 4RV5A 4GWKA 4BC1A 4TZKA 1E2IA 4XVHA 3O4IA 1PQ4A 2ZJ8A 2AC7A 2XQKA 2FFBA 4K9SA 2O2GA 1J5XA 4Z54A 1E2QA 1JDSA 2XE7A 3AUAA 5AI8A 5JNVA 1APBA 3AEZA 4K3VA 3PRKE 4M0MA 4OH7A 3PFNA 4MS4A 3VOTA 1IQRA 3RSGA 2P3LA 1SBTA 3KXIA 1M6VB 1FQOA 2CHQA 4OK6A 1EGMB 2JC3A 1Z25A 1FFGA 1X86B 4QC2A 3U5TA 3B1WA 4RIFA 5FOQA 1VSUA 4XSHA 3N0RA 4H4CA 4HQ6A 5TS3A 3MGCA 5B36A 1KVSA 2WNIA 2JGLA 4HQ0A 4QUHA 3WX0A