2QT0A

Human nicotinamide riboside kinase 1 in complex with nicotinamide riboside and an atp analogue
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
189
structure length
179
Chain Sequence
b'RGSKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nicotinamide riboside kinase 1
publication title Nicotinamide Riboside Kinase Structures Reveal New Pathways to NAD(+).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 55
structure length 179
sequence length 189
ec nomenclature ec 2.7.1.173: Nicotinate riboside kinase.
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qt0A00
3V9PA 4NYIR 3KQHA 3L0OA 4MUAA 3REGA 3TH5A 4EDHA 1YZKA 5KU1A 3CF2A 4RFVA 2GILA 2A5YB 1TAGA 4PHTA 4QKQA 1KSHA 2IXFA 2JLRA 1HQYE 3QQ5A 2JGNA 3RS0A 2C2HA 1XZQA 2QORA 3N70A 4AKIA 3QEJA 4QG7A 1KI7A 1P2UA 4KCGA 4Q7MB 2RGBA 2C99A 1NLFA 3DO6A 3L82B 2VHUA 4D2IA 1Z5ZA 4KHZA 4Q4AB 4LV6A 1ZIPA 1IN8A 4IOLA 1QHGA 1COWA 3CR7A 4JLVA 1P72A 4MGYR 2GZAA 2XXAB 4LPSA 3DDCA 4HUTA 1UEJA 3J81k 4XVRA 3TUJC 4RD4A 4EPVA 3QKRB 1E94E 3WNBA 1PV4A 3K9NA 2G77B 5H68A 3NDBB 2PBRA 4EPRA 1ESMA 1LB1B 1AKYA 1MOZA 1HT2E 1ZM9A 2DFKB 5FTKA 3TK1A 4PAQA 2XXAA 4RKFA 2ZROA 2FMXA 1GL9B 2QE7D 3AF2A 3B7GA 1U0HC 4FMDF 1AGRA 1YR8A 2LWIA 1Q1BA 3BJIC 1BIFA 2QEQA 1G7RA 2JLZA 3QKRA 2GCPA 2PZEA 4TYNA 2JJ2D 3NEJA 2AHOA 3P4XA 1I4LD 2FF7A 1KK2A 2V7QA 2FFAA 4JLAA 1UBCA 5KDDA 4UXJA 4WZ6A 5CM8B 3IQXA 4KFSA 1JNYA 1WA5A 1QVRA 4Z54A 4NMMA 2WAXA 1FUKA 1W0KD 4RCYA 3FYHA 1LVGA 1EG7A 3WBKA 4NBSA 1E2FA 2A5DA 2AWNA 2XX3A 2NMVA 2HCJB 2QM8A 4RD0A 3NWJA 2ZI6A 2IS2A 1KO8A 1XXHA 4P4SB 1KI6A 1M7HA 2JDID 4V0NA 1GL6A 4LRWA 4D26A 3QPVA 4JLKA 1EWRA 4L15A 1SKYB 4GBMA 1G3RA 4U5XA 2CMKA 2GNOA 2VSOA 4JT2A 4KSBA 5IF9A 3F5FA 3NDPA 2MMCA 4OBEA 4P4SA 3OAAD 3ECCA 4IDPA 1MT0A 2FSIA 2QAGA 3B9PA 4G5SA 2V9PA 4K81B 3EZ6A 4DLZA 3BAFA 4MRSA 2CHQA 2JLUA 1KIMA 3EPLA 4EFMA 1P3JA 2OCAA 3PENA 1GITA 4DB2A 4G5QA 5TB5A 4JYCA 1JECA 1TQDA 1CR0A 1E9FA 2V4ZA 3BS4A 4HDCA 5AR1A 5JSZB 2OLKA 2VF8A 3M1IA 4IDNA 5E7MA 1IN5A 3RSLA 1QF9A 2VHCA 3SS8A 3ZIAD 2GDJA 2Z5FA 4ACAA 3K9LA 1EFRD 3NIBA 4R2IA 1WRBA 3WHKA 4E22A 1NRJB 2WVJA 4B2PA 2B8WA 3D8BA 5B58C 3EG5A 1GWNA 4X8OA 5FOTA 5JBQA 4KVAA 5JSZA 4BFUA 3BH0A 3I32A 1Z3IX 5FBLB 3U6KA 2J7PD 1DAEA 2TMKA 5EP2A 4XD7D 1ZAKA 4GMDA 1E9DA 3FMPB 3QBVA 3QIAA 3U5ZB 4DC9A 3DL0A 2IS6A 1G6OA 4D0NA 4MRNA 821PA 4ON9A 4HB2A 2G0NA 3O8BA 4WVFA 1W7AA 2AN9A 1NVUQ 4YQFA 4LPKA 1DAFA 1KSGA 4JS0A 1Z22A 1ZVQA 2J0QA 5EP3A 3H1TA 3BH6A 2DWPA 1IM2A 2OCBA 3FB4A 1MRNA 1Z6XA 1KI8A 1N5JA 4AYTA 5FOVA 3DZDA 4OQLA 4JYBA 4C4PA 2QSYA 4B6FA 2NO6A 4MGZR 1UKZA 3RNLA 1RC8A 2CL6X 4OHXA 3R9WA 1TQ2A 4KITB 2FGJA 4UNPA 4IVPA 3JZMA 1QG2A 2DR3A 2REXB 3EZ2A 4FINA 4K46A 2WTUA 3LDAA 5CLLA 4NCNA 2ZJOA 5B57C 1WCV1 3D31A 3PEVA 4DJTA 4B2IA 2YVUA 2OAQ1 5D3QA 3ZD6A 5G3ZA 3BOSA 2NIPA 4UJ3A 1QRAA 3ZS8A 5ELXA 4DSUA 5G3YA 4DVGA 2V1UA 2F9LA 3NG1A 2CEAA 2BCGY 3T1QA 1CRPA 3HR7A 4IEIA 4I1OA 3KUDA 3KDSE 4HYYA 3CRMA 4I1SA 1GTVA 4QGGA 1EX6A 2VA8A 1XZPA 1YR7A 1DELA 2QQEA 4AG6A 3F0TA 3BBPA 4FI3C 1E9RA 4URXR 4TLBA 5TV2A 2QP9X 4Q1EA 4C9BA 2V55B 4R98A 4ITRC 4TMVA 1ZMXA 3K09A 4WZBE 5DI3B 2W0SA 4M9SA 1D2MA 3PV0A 1NVVQ 1KJZA 1XTSA 2GZDA 4JJKA 2VP2A 2XTZA 1U8ZA 4P31A 4U00A 5KYKA 1EFTA 5BW8A 3MFYA 2IYQA 1TMKA 5DI3A 3W90A 2JAQA 1NP6A 3H86A 1Z6GA 2WMNB 5KDOA 4TYYA 1II9A 3QI2A 3NC0C 4TN1A 4KO8A 4A8JC 8OHMA 2ONJA 3WYAA 2ZE5A 3U3JA 4PPGA 2PMKA 3CPEA 1TQ6A 1SZPA 1XEWX 3B1XA 3RWOA 4QFMA 1PUIA 2V7QD 4O2LA 4L5BA 3CUEF 3CH4B 4I1VA 3BXZA 1G7CA 4HAYA 3LW7A 3FFAA 1YE8A 3ADBA 1AS0A 3TQFA 2C96A 5JI2E 1E9AA 3NBYC 3TVTA 1ZD8A 3ZQJA 1T3LA 5JS8A 2FFBA 3WY9A 4H1UA 1G64A 5K8LA 1ZC3A 5BXQC 1VCMA 3HDTA 2OXCA 1W4BA 1EFCA 3RS2A 1CRQA 4ZI3A 3EWSA 3HU3A 1UAAA 1IAQA 4LC0A 3THXB 3AB3A 2VSXA 4MRVA 1DOAA 2X2FA 3GEEA 1GKUB 5LDDC 4AWXA 3X1DA 2ZE6A 4ZDKA 3LNCA 1S0UA 2BVNA 4TYQA 4V0OA 2GCNA 2NGRA 2D74A 3A1TA 4BFZA 4RY2A 3LAWA 2A9KA 4QBIA 2A3RA 4YXWA 3U44A 3QNUA 2JJ1A 1SXJB 2IW3A 4BWYA 1NLZA 4ZKDA 1G17A 3WBJA 5IRCD 2QPOA 4DLRA 2RGCA 3IHWA 4FWTA 2PEZA 5JJKA 2W6JD 1II0A 3WMFA 2KJQA 4A92A 4Q21A 3DMDA 4US1R 2OE2A 2BBSA 4PO9A 3B85A 4OK5A 3PG5A 2FFQA 3NKVA 1SXJA 3ZQ6A 5JCZA 1LS1A 1DAHA 3DOFA 3T61A 1TX4B 3AVPA 1X8KA 2J5XA 1J99A 3BRWD 3DMNA 3LLMA 4NPHA 4GPTA 4MYHA 4KLNA 3QBTA 4FXPA 3UIEA 2WJHA 1SHZA 4GZLA 4URUR 1XBTA 4OJKA 2CK3A 3B60A 5G40A 2IYTA 1E69A 1NSFA 4IJMA 2Z6VA 1U94A 2DFTA 2ECKA 2GEVA 2H1LA 4ZI2A 4QC2A 3LBHA 4Q4JA 1OV4A 1R0ZA 1ZD1A 2BJWA 3EC1A 3PUZA 3PXGA 5AUQA 2XNSA 4ESHA 2ZRAA 3RHFA 4LBYA 2GF0A 5EE9A 3LXRA 2F6RA 3ND9A 3SJZA 3EZFA 3IQWA 1E1RA 4KFUA 3T1TA 1OH6A 3AVVA 3MWJA 5KNDA 1BH2A 4B75A 1KK3A 3U3RA 2QG6A 4DLXA 4LYJA 4DB4A 2QU8A 4R2HA 2CE2X 2DCUA 3PEYA 1KO4A 1NG1A 2W00A 1OLOA 2JASA 3FMIA 3VR2A 2O0HA 1DS6A 2FV8A 3PUXA 1VMAA 2QSZA 3Q7QA 5CLQA 4AIIA 3GLGB 2JLYA 1E2DA 2GJ8A 4ERNA 2CCGA 1CBUA 3EZ7A 5GJVC 3UANA 2IK8A 3HPQA 4OQNA 2A5FA 1KKLA 4IOJA 4ZKEA 3EX7C 5EE1A 3LX8A 4IKEA 3CX8A 4PAMA 1EXMA 1LFDB 3DHWC 2IYWA 4L9SA 3GLGA 2C9CA 1P6XA 2XB4A 1GG2A 4GSYA 2FA9A 1KI3A 3P26A 4JLBA 4PZYA 3O47A 4QXAA 1JR3A 2FNAA 2BKEA 4HZUB 1U0LA 1E4YA 1R0YA 2EFEB 1P61B 1DVRA 1YZLA 2RGDA 1S4QA 2KBEA 5E7JA 3MWYW 1VDZA 1BS1A 3SYNA 1WP9A 4ZO4A 3EC2A 4Q1AA 1W36B 2ZRDA 3BERA 1SKYE 4B71A 3HYRA 3N5CA 2ZRIA 3KKOA 1PJRA 4A2WA 2WWHA 3VR1A 4C2UA 1AGPA 5B30A 3K70D 2D62A 621PA 1XTJA 2VLIA 2WJGA 1OHHA 4P3YA 3I73A 2GZHA 2ZI3A 5H1YA 4MUBA 1TF7A 4TLCA 2A2ZA 2ZAOA 3GJ4A 2ZRNA 2P3SA 4Y0VA 1NNEA 5TY0A 3QXXA 1VKJA 2VYFA 1X8LA 4QJ3A 1OXUA 2ZJ2A 4PPFA 3EWAA 3ZLJA 2Q6TA 5SZIA 5GVRA 1D2EA 3PEUA 1AZTA 5E3HA 1CULC 3PVSA 3W6OA 4KSCA 2NZ8A 1DPFA 3U60B 2IEYA 4YDSA 4LSGA 5KOYA 2FEMA 4QGFA 1EFUA 3CR8A 1SKQA 2YC2C 1D5CA 2PJZA 1GL7A 1NN0A 4DHEA 4PHGA 4Q02A 4M4SA 4TMZA 1A2BA 1K6MA 2DHRA 2N1BA 2ZE8A 2ZJ5A 2Q0HA 3QUSA 4TMKA 5DYIA 2BOVA 2C9OA 1I2MA 1JBKA 1S9HA 2QT0A 1F2TA 1XCPA 1QVAA 4DUGA 1JQLB 2JJ8A 4NCHA 1E2NA 4HB4A 1IHUA 4TQUS 5FH9A 3EW9A 1H65A 1SVLA 4HLUC 1P5ZB 4Q1CA 1JI0A 5DYGA 3EIHA 4MKIA 4HLDA 1XPOA 1FW6A 1QBKC 3AVTA 2F7SA 4FMCB 4LHXA 3EPJA 2HYIC 1G9XA 1P2TA 1U81A 2X19A 3A8TA 4Q9KA 3BWDD 4YDHB 1LY1A 4OQXA 1M6NA 5FOSA 1XPRA 1DEKA 2ZPTX 3X1WA 3I8XA 3C15C 3T5GA 3LX5A 1QHSA 1OFTA 4PPQA 1LNZA 4YXWD 4TTRA 2JJ1D 5DN6A 3GLFA 1GILA 4NYMQ 2IYXA 3PQCA 4PPNA 5EQTA 4N1AA 1F3OA 3FKQA 4A2QA 4QM7A 1D9XA 1RRGA 221PA 4DCNA 4BFYA 1YRAA 1Z47A 2ZI5A 3M0EA 1VG9B 2WKQA 1VCIA 2JJ2A 2XOKA 1JEEA 1OIXA 1SVWA 4UQOA 1SXJD 2GK7A 2ORWA 1XMIA 3REFA 4Q7KA 2WOJA 3NHBA 1FTSA 1Z2AA 1FMLA 3ASYA 2QGNA 2JLWA 5FOUA 2ZIAA 1JQJC 2GJ9A 3AGPA 1E0KA 4GFDA 1M1YE 1I4TD 3A6PC 4TQ9A 4V0MA 4HUQB 5FL3A 4ABYA 3BK7A 5JJLA 2P5TB 3B2EA 1H8HA 1JB1A 3DM9B 4LZZA 1UDXA 1ZU4A 1BO6A 2QZ4A 2ODNA 4HLQB 1UJ2A 2ZM5A 3I62A 2BMJA 2JDIA 4B3GA 3QXSA 1ODFA 4BECA 5KPDA 2R6AA 2PEYA 4GI7A 2P6RA 1J70A 2CE7A 1TPZA 2QY9A 1A7JA 1U8AA 4B47A 4EJSB 1YHNA 4Q7LA 3T5DA 2OM2A 2O8EA 4UJ5A 4B74A 1NIJA 3ADCA 1T0JB 2Q9BA 3OAAA 1OPXA 4NTZA 2C78A 4M1SA 4EUNA 2JEOA 1XTQA 3LBIA 5AUOB 1MO3A 2PCJA 3K0EA 3QENA 2F1RA 2F43B 4UNRA 3E1SA 4LWZA 4A82A 5LD2C 4A15A 1XEFA 4EJSA 1Q57A 1FPMA 2GHIA 4RJLA 4LYHA 2H5EA 2ZRPA 5CDFA 4ZDIA 3FOZA 3W9YA 3T35A 1Z83A 2PT7A 4C0LA 1SVOA 1XEXB 3CX7A 4AKHA 3WRYC 1Z0FA 3MJHA 5C2JB 2C77A 4POAA 4NZYA 1ZINA 3THWB 3ZIAA 2F43A 2I1QA 4JVLA 5HKKA 2GJAA 4I99A 1JR3D 3OE7A 1G291 3CH5A 4BFSA 4W5HA 1HTWA 3RLFA 3VMFA 1TU4A 1XEXA 4RVCA 3DOEA 3KQKA 3SU8A 5KDLA 2CLCX 1IY2A 1UFQA 3C14C 3SJAA 3THWA 5KNCA 2HCBA 3VR4A 2DB3A 2CNWA 2J7PA 3GCGA 4LHZA 3ZZ0A 1KI2A 3A1WA 2V3CC 4Q48A 2RAPA 3P20A 2EFHB 1TF5A 1E6CA 1ZP6A 3PITA 1ETUA 1OHHD 1OXTA 2Q9CA 1XJ0A 3X2SA 1KY3A 1W36D 4CEHA 3DKVA 1NMYA 1SXJE 1UPTA 2QAGC 4Q1FA 5HE8A 3UG6A 1IQPA 3Q72A 1TADA 2OO7A 4UNSA 2D7CA 5BYJA 4TL7A 4M0LA 1S8FA 4JL6A 4W5JA 3DZ8A 1M7GA 1R7RA 4HB0A 1MABB 1OW3B 5KSYA 1OYWA 1RJ9B 2AWOA 1XWIA 2V6IA 2A7QA 1FQJA 3FKSA 3PCRB 3GJ5A 3JVVA 3LA6A 4RD3A 3TW4A 3AQ4A 5LPNA 3RRZA 2NO9A 1IBRA 4IVQA 1RRCA 3GJ7A 4M1WA 1SVMA 4ACBA 1MABA 1E96A 1RJ9A 2Z43A 2RGXA 5TXGA 1R4AA 4Z8XA 3TAUA 5JECA 1T91A 3P32A 1Q44A 4LY6A 2PLRA 1TTTA 4LBZA 3CRW1 3SZRA 2F55A 1KI9A 2OLJA 2VHQA 3EIEA 3KJHA 3SHFA 4OK6A 5CK5A 3CWZA 5EXXA 3H84A 2YINC 3HU2A 4QHTA 4PSKA 1HH4A 2VP0A 4PHHA 3AVYA 1KK0A 2GA8A 4E09A 2FDCA 5CYPA 1Z8FA 1UKYA 4DUGD 1JJ7A 2R65A 4LJAA 4ZDWA 3B1ZA 2BM1A 2ERXA 4QJ4A 3W3AA 4LV5B 4OKSA 4NONA 4ZDJA 5JEEA 1QHXA 4AI6A 1KJYA 1ZM3A 2YKGA 3TSWA 1UBFA 1NKSA 4A0GA 3ICQB 3CNNA 3C41J 4JLOA 5KUTA 1KDOA 2QQ0A 3GJ3A 2XITA 5EXPA 3QXHA 3GLGE 5GADl 5EUMA 3MLEA 2ZJYA 4NHOA 1KSJA 2VSFA 4KU4A 1DADA 1JR3E 2GVDC 2ZJ8A 1DG1G 3GFPA 1AZSC 4Q4AA 4YMWA 5BN3A 4KXFB 1IOZA 1YVDA 5DN6D 2YHSA 3LD9A 1G3MA 2WJIA 1EWQA 1AN0A 3ND8A 4KYUA 1P9NA 3TIFA 5JLJA 1NN3A 2DY1A 2HLDD 5FL7D 1GM5A 1IONA 1CJTC 3EXAA 4HATA 5FOXA 3IPYA 3K0CC 2XOKD 2GXUA 2JCSA 1Z29A 4MKGA 1ZNYA 2NQ2C 2ZR7A 4PC3A 5FPKA 2VF7A 4TTPA 4RFSB 2IUSA 3BIFA 1L4UA 2PMDA 1W5SA 1DAGA 1SGWA 1VHLA 1KJWA 2BEJA 2BIFA 5CYOA 2OESA 1PLJA 1YU9A 2OILA 3C4JA 4JZKA 4O25A 2QI9C 2GF9A 2H92A 2IYRA 4C0SA 1S1CA 3HYTA 1KMQA 3VQTA 3GPLA 2ZUCA 4JLJA 4OJQA 4B2LA 3EA0A 3QJYA 1G6HA 2BKUA 2ZYUX 4NP6A 1G3IA 1Q1ZA 1PVOA 4FMDB 5FUXA 1H8HD 2QMHA 5SZJA 3K70C 3CIOA 3K09C 1W49A 2QENA 1J90A 2BEKA 1R5NA 4KVGA 5AJZA 4IXMA 2D2EA 3OIWA 4AKEA 3TRFA 2WV9A 1N5LA 3BC1A 1VHTA 2ODBA 4LJ6A 5HTKA 1DAIA 4G0NA 4Q00A 4L4UA 3OFND 5TARA 4G1UC 5AWFC 1KTVA 2J9RA 3Q5DA 3A1SA 3TR0A 1Y3AA 1IJEA 2XEXA 2Y8EA 3H2YA 4QL3A 1LV7A 3AEZA 3U61B 4LHVA 5BYKA 4V0LA 3KQNA 2A5GA 4HAVA 2O0KA 3TJZA 1DG3A 3VNVA 2IS1A 5IT5A 1BYUA 3KKQA 2W6JA 3Q7PA 4Q03A 2H18A 4XWKA 4LBVA 3EPHA 3IDQA 1ZNZA 4HZIA 1Z0AA 3W5JA 3KKNA 5TVKA 4Q5IA 3WP1B 3IO3A 1N6NA 4LJYA 4PANA 1G8FA 1KY2A 2BMFA 1YJ5A 4XOIA 4NU0A 5HKKD 1WBBA 3AVWA 4UKDA 2P6NA 3OE7D 5L3QB 4O3MA 3N2IA 4R71A 2GK6A 2ZAMA 4LV8B 1X86B 3K0SA 2I1VB 5CJ2A 4Q19A 4BLTA 4OI0A 1KSFX 1HT1E 3T1OA 1ZU5A 4G01B 4MYCA 2CNWD 1ZW6A 4BLRA 4D4JA 2D06A 4RZXA 3SOPA 4KODA 3IBYA 4JKYA 5J40A 3GLFE 2W6ID 3L8YA 4P32A 5L3QA 4BUJA 1TUIA 4AY2A 1B0UA 2NPFA 3DPUA 3MG9A 3LQRA 2YZ2A 1GNPA 3RRMA 2R6CA 3AF1A 3PFIA 1KYIA 2CDNA 4OI1A 2RGAA 1N5IA 4TT3A 5CJPA 4B76A 4TMTA 1HURA 1NF3A 5C4GB 4GOXA 4B3CA 3TGPA 1UKEA 1ZM4A 4M21A 1F60A 2NPIA 1VTKA 3C5CA 1XJQA 4PX9A 3WYFA 1FX0B 4URWR 5JWRA 2GETA 5F98A 2I4IA 3CKLA 1OT3A 1EX7A 4US0R 5FOWA 3PUWA 1N6KA 4B44A 2FGKA 1PLLA 1ZIOA 4TLDA 3IKJA 3LVQE 4XSHA 1OE0A 3ZS9A 1W0JA 3CO5A 3FKSD 4NCJA 3RDPA 1IJFA 4DSTA 3IEUA 3KJEA 4V0ME 2QM7A 1FX0A 4KYIB 5CIWA 1NSTA 2HXYA 3RVBA 2G3YA 3TQCA 3HU1A 1AM4D 4PQRA 1RYHA 1OF1A 4MDFA 4HAXA 2KSQA 2MSCB 3UWOA 2R44A 2A30A 2O8CB 3U7EB 1DAKA 3WYGA 3A4LA 3ZZUA 1YZUA 5HCIA 2IEZA 1FNNA 2R8RA 5FR1A 1GUAA 3MGCA 2BV3A 4BZXA 1R5BA 1AQUA 2C98A 4A0FA 4A6PA 3FGNA 2O8CA 2X77A 3M6AA 4ZCMA 4OQMA 1E79D 1UKVY 5L3SB 5DO9A 5K8IA 4J0QA 3U3KA 3B6EA 5FPYA 5CDFE 1RZ3A 3FDIA 1F48A 4JBWA 4LJ5A 3VKGA 4II7A 1M74A 2KBFA 3D3QA 4S35A 3EZ9A 4DLTA 2ATVA 3U7HB 1AJEA 2YYZA 3LW8A 1IN6A 4M1MA 1XD2B 3TSZA 3KQLA 4S2EA 4WAUA 4Q9HA 4LYAA 2OG2A 2ZU0C 2ZRJA 4B32A 2P65A 4NCIA 5JEDA 1NJFA 5CK4A 4DT1B 4XTCS 3UPUA 3FVQA 3GJXC 1XMSA 5JWHA 2VL7A 1OH5A 3EAQA 4HLCA 4W5WA 4A0RA 1F2UB 4P4UA 3THYB 3BFXA 1UM8A 1Q12A 3EARA 4UNNA 2R6DA 1G1MA 2FSFA 4QHSA 4CZ2A 2OSBA 3LXXA 4PC2A 1CF4A 4Q18A 1CXZA 3VKWA 1ZYUA 2ZR9A 1Z07A 4IRUB 1YKSA 2Q3HA 1N3BA 2E1RA 1E0JA 3L2OB 3D7MA 4JLNA 4LJ8A 2ZJAA 2ASEA 1E3MA 3B8HA 1U9IA 1NY6A 2QT1A 2W2VA 3B82A 1CKEA 4B3DA 3AP2A 1G16A 4X8HA 1FMJA 1P9WA 3K1JA 3TMKA 1E2LA 3MWLA 3OIVA 3S1AB 2OBNA 4RD2A 1Z0IA 3AGQA 5J4KA 3W5IA 2ODWA 5EZ5A 3UATA 2AK3A 2O0JA 2ODEA 3WMGA 1N6HA 1W46A 2GJSA 4OHVA 4CDGA 4BFTA 2J3EA 1MV5A 2CBZA 2DPXA 2QMUA 2ZYVX 3VHXA 1YZGA 2PH1A 2P5SA 3CLVA 2JLVA 4Q9LA 2W2TA 4DEYA 2HDNB 3S1AA 4WOPA 5TMPA 3T15A 4TSFA 3CNOA 5AUPB 2OZEA 1IY0A 4UXHA 1WQ1R 3VNUA 1D6JA 3DKPA 3N2EA 2BBWA 3GFTA 1U90A 4FN5A 3THXA 2MSDB 1UEIA 1KDTA 4NKRA 1GKYA 5KHOC 2LKCA 4WBSA 1E2EA 2AR7A 4IOMA 4OL0A 4BZPA 1OXVA 4D0GA 1E0SA 1DARA 1EGAA 2GRJA 3LV8A 2QP4A 2IYLD 3AUYA 2BBTA 2JA1A 2XZPA 4M22A 4BLQA 2FX3A 5B64A 3RANA 3A36A 2CVFA 5FPSA 5DISB 1XJCA 3GLHB 3AUXA 1OSNA 4GZMA 1H8ED 1E4VA 4LJ9A 5JRZA 3VR5A 2R9VA 1R6BX 3D6TB 4QBHA 3TLXA 4DLWA 121PA 1HUQA 2KB0A 2ORVA 1S96A 2GXSA 2J87A 2IBMA 4F38A 2P0EA 4LHYA 1MO6A 4B33A 5L8VA 2NG1A 3A58B 3SYKA 3TUIC 4FCWA 4B34A 4CT5A 3KX2A 5FI0B 1G41A 1W4AA 2WIBA 1T3SA 5D3MB 2OFOA 2CJWB 5JZVA 2F1IA 2IXEA 2OFXA 4EPWA 4RD6A 1US8B 2GKSA 1G5RA 1KGDA 2WZQA 4TT3D 1P62B 5GVSA 1XTKA 3I5XA 1NKTA 3I5YA 5D3MA 2F1HA 1G8PA 1QHYA 2YV5A 2QMOA 3SQWA 2V6JA 4ZV4A 4QOSA 1L7VC 1US8A 3VFDA 2VQSA 4AG5A 2FWRA 1P2SA 4A2PA 3I72A 2WOOA 3WMEA 1K5GA 2J45A 2DFNA 1GRRA 3LWNA 2H17A 1PZNA 1W0JD 4W7SA 4XJXA 3AVXA 3GD7A 2X1VA 4BPBA 2BBOA 2NO1A 3CW2A 3QG1A 1M2OB 3ZVRA 4WA7A 4URVR 4MKHA 1GSIA 2QTFA 3QG5A 1G3UA 5FTJA 4I1UA 1RW4A 2BC9A 1NVVR 4QBGB 1FP7A 1P2VA 2PCLA 3A1VA 3G0HA 1HA3A 2IT1A 3ADKA 3CB4A 2XTNA 2ORIA 4CT4B 2IUTA 2F3RA 3W6PA 1MRSA 1GRQA 4A8JB 2HT1A 1YR6A 1ZUNB 1NVWQ 2YWGA 3K8YA 4I4LA 2G9NA 4C30A 1HY3A 1N6OA 1BMFA 2PZGA 1QHNA 4L9WA 3NEYA 5FBRB 3W3ZB 1XTIA 4NYJQ 4D81A 4KFRA 2FH5B 4QJ5A 4G5OA 4DCSA 4A8JA 4HZUA 3AF4A 1HEIA 3UK6A 4BFVA 3KJIA 1Z6TA 2P6UA 2VP9A 2Q3MA 1TL7C 3FTQA 5KPJA 3GLIB 1ZRHA 3OIYA 4US2R 4XSGA 4HDQB 3UKDA 4GP6A 2VIIA 4KI0A 2RGGA 5UKDA 1JJVA 3SBEA 2B7BA 4C0KA 1DE0A 2NOAA 5K8TA 1E2QA 3RAPR 1Q22A 3TAHA 4EJSC 3SDZA 3GLIA 1W4RA 3RS5A 4MA4A 1YR9A 2QTHA 5KTYA 5G53C 4C0JA 1A5TA 3AF0A 2RGNC 3OF5A 3T1VA 2R6GA 5B2ZA 2I3BA 3RC8A 4DRZA 4BQSA 2QROA 4LDJA 2ZSEA 3AV0B 1NBMA 1Q20A 4M1KA 5DH9A 5IK2A 4V0KA 3SFZA 4D4LA 3BE4A 2IWHA 3KFXA 4DDTA 5J4HA 4IOKA 4G5GA 5FPHA 2GWHA 3MAAC 1MR3F 4Q9JA 1J7KA 1BKDR 1G4UR 2R62A 3ZH9B 2YOGA 2IC5A 1IY1A 3AVQA 1FFHA 3C7KA 3HR8A 1KZGB 4C2TA 1P4SA 2GCOB 2HXSA 4MDEA 2AX4A 4M2LA 1XMJA 1NJGA 4QRHA 3SI7A 1G19A 2EQBA 4LYFA 1W44A 4TSFD 5LB4A 1NLYA 1P60A 3WXMA 4PO1A 1S1MA 1BYIA 2GCOA 4R9UC 3MRSA 1T8TA 4B6EA 2GESA 2HYDA 2WWFA 4JL5A 1KK1A 3BH7A 3TNFA 1G4AE 1EK0A 2C03A 4BGDA 2D2FA 1DO2A 5FUYA 1KDPA 3FHOA 5J47A 2WICA 3CNLA 1E32A 1XMVA 2AKYA 2ZRBA 3SYLA 3U3MA 4C7OB 2CHGA 2HLDA 4GMXA 5FL7A 3T06B 1AS3A 5LB2A 3TW8B 2ZEJA 3CZPA 2OCYC 1T6NA 2CVHA 1MO5A 4TL9A 1T4GA 5JRJA 3A1UA 1T8UA 4DXAA 4C7OA 4CGZA 3K0AB 5F3WB 2AFHE 1G18A 3T12A 4EFLA 3AKEA 3LQQA 1FOEB 1HE1C 1RVDA 3AVOA 5A5GA 1QHIA 3ZZTA 3GP8A 4GL2A 4PQYA 4L16A 2ZI4A 4AK9A 4BEJA 1A1VA 2QA5A 2WM9B 3RRNA 4DLUA 4MRRA 4CEJB 1G8YA 3OHMA 5ANRB 4DSOA 3WHLA 2ZU6A 1GFIA 5AUNB 2IWRA 3WNDA 4KJZA 3R9IA 4BZQA 2LCFA 4FD2A 2FFHA 2ZVPX 3QXCA 3W34A 1GKIA 3GEHA 1WBDA 4M8NE 5AJWA 3MMPA 2EU8A 2O52A 3VR3A 4MGIR 4HUQA 1RFLA 2FPLA 3R8FA 4CEJA 1DAMA 5E7IA 5AK0A 4LK2A 1IN4A 2NO7A 2ZTSA 3OFNA 4IDHA 1OFUX 4NYJR 4TL6A 5HZKA 4CF7A 1W48A 2C8VA 2FPMA 4OI2A 1G8HA 5FBWB 1S2MA 2IYUA 3TR5A 1Y63A 2O8FB 3B1VA 3H4MA 2OXRA 2GXQA 2KE5A 5KSPA 3GJ0A 2OHFA 2UKDA 2OV2A 2WHXA 3E70C 1JPNA 2G0TA 1AKEA 2G88A 1X1SA 4HSEA 1QHHB 4M9ZA 4BFWA 3IEVA 4N0DA 5F9HA 2WIAA 2UZIR 4B3FX 2IYZA 2IUUA 3CF6R 1OH7A 2O8FA 1NN1A 3THOA 5J5CA 2N46A 4TLAA 4YMSA 1M7BA 3L0IB 1DBSA 2CXXA 3E2IA 4GNKA 3QPWA 5EE0A 3CRVA 3TBKA 3W8NA 1BMFD 1QHHA 1HE8B 1VYVA 4TQAA 1U99A 4B35A 3L0SA 1IN7A 1J2JA 1S9DA 4AYXA 5EXSA 4MH0R 3I61A 5LBIA 3KL4A 4PXAA 2F3TA 1J8MF 2W6IA 2EYQA 4DWJA 4F91B 1K5DA 1RRPA 2C95A 2JLQA 4MRPA 2JATA 1LTQA 1VYUA 1N6RA 2WSMA 2OBLA 4GDFA 1S3SA 4EPXA 1WB9A 3IGFA 3TVDA 4BE7B 3DVLA 5IHPA 2B6HA 4TYWA 2RB4A 4U7DA 1KAOA 1E2KA 3I4LA 1NI3A 3PUYA 5FFMA 1JXOA 1OFIA 1XCMA 3KXIA 1KMHB 3UMSA 1NG9A 2PJRA 3KTAB 3C16C 1KKMA 2VHJA 2YNMA 2QL6A 4A4DA 3QF4B 3VX4A 4X8MA 1L8QA 2ZS9A 5CB8A 1R8QA 2GBLA 2HJGA 3UXMA 4OI4A 1WF3A 5C1BA 1KMHA 4FCTA 1T5IA 2Z0MA 3KTAA 3LRPA 1GIAA 2YWEA 4Q7JB 3P27A 4HLUA 2Z4SA 3GJ8A 4U02A 3GFOA 4C0AC 2D7DA 4JMPA 1G7SA 5FUWA 4NCKA 4IDQA 5BN4A 1WE2A 1XP8A 1NBMD 3PUVA 5IK2D 2ZRKA 3MJRA 4GP7A 1HV8A 4D80A 1G20E 1OXSC 1LF5A 1AQYA 1TU3A 2QUZA 1JXMA 4NYMR 5FTMA 1G3QA 2ANBA 3IILA 4WW0A 2EWWA 3UG7A 1L4YA 2AL7A 4DLYA 5DLQC 1G8GA 2Q3FA 3L8ZA 4HAWA 2VH5R 1E79A 3OIUA 1Z0DA 3SJBA 2VHTA 4BLSA 1CJKC 2ZRHA 4TMWA 2G1KA 3A4MA 1GVNB 3FPAA 4PR0A 3CRQA 2ZRMA 2X8AA 4RD1A 4CIDA 2PLFA 4G3XA 3BFKA 4YMVA 1P9RA 1VG8A 2ZXUA 1E1QA 1CIPA 4WXRA 2MMGA 3ZDQA 3IBGA 2CHVA 3MCAA 2AD5A 1AA9A 2C9YA 2WKPA 1R0WA 4DDVA 3PJRA 3TKLA 1E2HA 4LJ7A 3Q85A 2XAUA 5H70A 3UMRA 3ZJYA 1N5KA 1C9KA 3QF7A 1LW7A 4NL4H 5KSZA 4TYPA 2FJUA 1OB5A 2PZFA 1P7CA 1I4DD 4OHYA 4PTLA 2IYYA 2FOLA 4TLEA 5LD2B 2IXGA 1OKKA 2G1JA 1EFHA 5EUQB 3IPXA 3E5HA 5J4LA 1FQKA 4KBFA 2CL0X 3KJGA 1R10A 1V43A 1CR2A 1QG4A 4RFSA 5KSOA 2B8TA 3PEWA 1N6PA 1WDTA 1VPLA 1U8YA 4EKDA 3GLIE 3B9QA 3K0FB 3VAAA 1W4CA 3ONWA 3R20A 1CEEA 2AKAB 1T9HA 4QGHA 3SBDA 3NBZC 3SC3A 4Z1MA 4TL8A 4OHWA 3FE2A 2FE4A 3LH5A 2QPAA 4DLSA 5CM9C 1R0XA 4HAZA 4QHYA 4OHZA 3QKUA 1JPJA 3EA5A 3RS4A 4EIWA 3WNCA 1ZM7A 3RS3A 1XXHB 2G6BA 1KI6B 2OT3B 2ZE7A 3K0FA 2GVZC 3EASA 4KV9A 2R6FA 4ZIRB 1Q0UA 5SZKB 1L2TA 3TUZC 3V4RA 1NBME 2VP6A 3IUYA 4XH9B 4JVSB 3JZAA 1E9CA 2HUPA 3U2QA 4IXNA 1CJUC 1JAHA 2Q9AA 1KNQA 3LY5A 4PHFA 2J0SA 2ZRLA 4A1FA 1KI1A 2REBA 4E5UA 1PUJA 1KO7A 2ZJZA 2VRWA 3C8UA 1D8TA 2W58A 1O87A 2ZITA 1KAGA 2FSGA 4ZIRA 2QAGB 2RHMA 1QDEA 2B7CA 4LX0A 3CONA 1CTQA 3B13B 1U9IC 2ATXA 4C0HA 1UBGA 1D2NA 3I8SA 1ZM2A 1KDRA 2JIZA 3R8CA 2IHBA 4F4JA 1H8EA 3ZVMA 1YZQA 2YC4C 1SHKA 3MUFA 3ADDA 2WAYA 5FBQB 3AF3A 3TE6A 1W47A 5GJCA 1NMZA 4B3BA 1FUUA 3AKCA 5CIQA 1FP6A 3Q3JB 2A78A 3T34A 2X2EA 4NE2A 5TDHA 1SVIA 4DCUA 3SNHA 4HI0E 5CITA 1E99A 1FZQA 4PO8A 2SHKA 1XFAA 4Q1BA 3F8TA 2J41A 1E9SA 1FNMA 3V4FA 3QVUA 1A4RA 5J4VA 3CPHA 1Z28A 2Z83A 1U0JA 4F93B 3KB2A 2WSSA 4Z51A 1CJVC 4N3NA 4XTRA 2QRNA 4LC1A 2F9MA 1N25A 1VCOA 4TTQA 4FCVA 2H16A 4TZ6A 4FMBB 3OEHA 4C3ZA 2XNDD 2DYKA 4BEBA 1ELOA 2WWGA 2ZYTX 1CLUA 1TF2A 4XIGS 1SXJC 1JAIA 3KXKA 3Q8XB 5HPYB 4F92B 1LF0A 5FR2A 3QXJA 5L3VA 3UWKA 1ZNXA 421PA 2EWVA 3Q5EA 2NZJA 5G41A 4Q1DA 2CCJA 1XDBA 3ICEA 4LOAA 1ZC4A 2GEUA 2IS4A 3KZ1E 1VCNA 2XJ4A 3PIRA 2OFWA 3MWKA 2WWWA 4PSVA 4IDOA 4BLOA 4K8OA 2J46A 3I92A 2XSZA 3NC1C 1VIYA 4O2RA 4GOJA 1G21E 1M34E 4NH0A 2J7KA 5FPTA 4IEEA 1E2JA 1E2IA 1RIFA 2J0UB 3U6BA 4AC9A 1F5NA 3CRRA 4IFEA 3K0CA 3VX3A 1VECA 4BASA 2ZETA 4EFNA 4DIDA 4GOKA 4FW9A 4HEJA 2J0UA 3U7GA 1LS6A 1PLKA 4DZZA 4F4IA 1Z6AA 3IIKA 3JVUA 5EXTA 3AKYA 3CWQA 2QMEA 5L3SA 1E1QD 2QTVB 3K70B 5KO2A 1EESA 2LKDA 5JHHB 2DWQA 2EFGA 1R8SA 2IHYA 2MSEB 4KAXA 4R7ZA 1X6VA 2W0MA 3VU9B 1ESNA 1RYFA 3RS7A 2WJJA 3EPKA 4H9GA 3WRXC 3C5HA 3LO5A 3A37A 3X1XA 1KHTA 1XD2A 4E03A 3VTKA 2YOFA 1E9EA 3HPRA 1T3HA 4JLPA 1COWD 4P0TA 1ANKA 2V8OA 3VU9A 4DT1A 2NTYC 5IDVA 1CS4C 2QAJA 2J0VA 2EFCB 2V1XA 3G5UA 1VG0B 4IW3B 1B23P 2JLSA 3OZXA 3SE0A 1F2UA 3THYA 2IA5A 1OKKD 3KQUA 4DSNA 2RMKA 1BOFA 4RZUA 2ZUDA 1UADA 5FTLA 2O8DB 4ASUA 1JALA 5EE3A 2VPPA 1JEDA 3B1WA 4GT1A 3EIQA 3SR0A 3UMFA 3SJCA 2WWIA 2QN6A 4D4KA 5EJEA 3NVAA 1Q3HA 3CBQA 2WMOB 4Z1MD 1OYYA 4DLVA 3AVUA 1W36C 2ZREA 1N0VC 1R5OA 1SULA 2QPTA 4P4TA 1N2CE 4YC7A 5DHAA 4W9MC 1XD9A 3DEFA 5JHGB 2O8DA 4D6PA 2KWIA 3X1ZA 1Z2CA 2IF0A 1Z6YA 2BWJA 4YMUA 3QVVA 4PC1A 1E2GA 4C0BA 4CW7A 5EE5B 3BB3A 4P33A 3F3YA 2AK2A 3B78A 5DIFA 1U98A 2ZS8A 4G5RA 1UBEA 2EFDB 2RCNA 1IXZA 4PC7A 2C04A 2ZRCA 4URZR 1GZSA 3LVRE 5K8UA 1RPZA 2PL3A 2WPDA 4BLPA 4Z8YA 3KFVA 4DCTA 4MYTA 4OK3A 2FG5A 5C46F 3U44B 2BMDA 5EZ6B 1ZD9A 3AP3A 1GAJA 2ZSBA 4Q47A 3OEEA 2ZSAA 1XU4A 1A2KC 4UXIA 5JI3E 2JIZD 2W2XA 1TUEA 2C5LA 2YOHA 4IHQA 3RC3A 1G7TA 1OXXK 2Q21A 4RKEA 3SN6A 4OQFA 2FEOA 1CU1A 3K9HA 2DBYA 3A4NA 4Q01A 5EP4A 2ZANA 2L0XA 4QNRA 5E4FA 4DDUA 2BJVA 1AS2A 3K53A 1Q3TA 2ZRFA 3GLHA 3SQXA 5DHFA 3BGWA 1MKYA 5HR5A 2UVQA 5BWMA 3MSXA 1OB2A 2FZ4A 1XRJA 4C0QC 1Z08A 3GMTA 1YRBA 4EPYA 3NBFA 4HB3A 1VG1A 1F6BA 1XB2A 5EP1A 2GTPA 3P1JA 3L43A 4Q4JB 3QKSB 1Z06A 2FSHA 4ILEA 1NN5A 1U2RA 3HP1A 2CJWA 5P21A 3NH6A 2WSSD 2WJVA 2WKRA 1W2HA 2P2LA 3AH8A 4ESVA 2EYUA 5M04A 3QY0A 2GEDA 3VHLB 2VEDA 2ZVQX 4XVUA 2ZSDA 3L0PA 4Q4HB 4PC6A 2VTKA 3OEHD 5FBVB 5H8WA 3CM0A 3QKSA 3BD9A 3NXSA 4E07A 2B21A 1ZBDA 2YJTD 5AJVB 3ZD7A 3R9XA 4A36A 1N0WA 5JFGA 3B5JA 3I1FA 2PX0A 4L8GA 2IYSA 3HWSA 5DNYB 1O3YA 4A0HA 1GDDA 4Q4HA 2YWFA 1CJMA 2WJYA 3LLUA 3NBXX 5AJXA 1CP2A 1W2GA 3ZGXA 1TNDA 2AD1A 3CF0A 4PFSA 4WXPA 1OH8A 2YWHA 3NH9A 1DTSA 1YZTA 2IF2A 2FN4A 1E0AA 1X3SA 1WMSA 3KB1A 4N0EA 5A0FA 2XSZD 3FWYA 3ZYCA 1GRNA 2HEIA 2ZYWX 4D82A 4JSTA 5GJWC 5F9FA 4LUCA 4PQFA 3CPJB 4AURA 3Q9LA 4KBGA 1XXHE 1T5LA 2OBMA 3RABA 1YQTA 1NIPA 3TSOA 3HJNA 2BMEA 4PSAA 2ZJBA 5JMTA 1QZXA 3KXLA 4LHWA 5KNBA 2BCJQ 4RZ3A 4B73A 1CR4A 2CLDX 1XD8A 4WZAE 5HCNA 4B3XA 4DKXA 2PT5A 1ZUHA 1IXSB 3ZVNA 2FZLA 1V5WA 2EW1A 3SFVA 1NL3A 3O8RA 3ETLA 4DEXA 3U4QB 4MYUA 2ANCA 3BB4A 3AM1A 4YONB 4M1TA 2HF9A 3KKPA 1AIPA 2K5UA 4IFBA 3O8CA 5DE3A 1RKBA 5JS7A 2ZQ5A 3WP0A 2J1LA 1OFHA 4DBLC 3KUCA 3GQBA 3X1YA 3FMOB 1KZ7B 4Q4LA 5L3RA 2AXNA 1J8YF 2CLSA 1TQ4A 3LFUA 5E95A 4CEIB 3U4QA 2QBYB 4YMTA 3AP1A 2GJKA 4M53A 2P67A 4LCBA 4V02A 3P4YA 4WIAA 5HE9A 1C4OA 4LI0A 4ZCIA 2QRZA 4IVRA 2DWOA 4BFXA 4KLZA 4I81A 4CEIA 4ASUD 2FU5C 2QBYA 4TZ0A 4B48A 1II8B 2RKOA 4URYR 3AKDA 1XF9A 1KO1A 2RHDA 4DIEA 2XB2A 1M8PA 4M9XA 4B43A 3U7FB 2ONKA 4FMCF 4MGKR 1KI4A 3PR1A 5HZHA 1NMXA 4Q66C 1F2TB 4XVQA 4UNQA 1IXRC 5DGXA 1II8A 1ONBA 4PAOA 2V54A 4JL8A 4A9AA 4DDWA 2H57A 4JBXA 2GBLC 3W8RA 1SVKA 1W5TA 4HAUA 2OAP1 2ZS7A 2ZI9A 3FMFA 2QGZA 1A82A 1P75A 2GAOA 3RRYA 3O8DA 2XGJA 1TEXA 2WPDD 1R2QA 4GRAA 4AD8A 3RYTC 2ZR0A 1ZCAA 4M1OA 4TMXA 3NHAA 2H7VA 1HQCA 1G5PA 4RZ2A 3GLFB 4JBYA 1E2PA 1KO5A 3I3SR 3OEED 4QM6A 2G83A 1Q1QA 3U3OA 3H0KA 4BRUA 2O5VA 2JLXA 3K9GA 1DO0A 4XWAA 5C18A 1HYQA 3OESA 3SEAA 4NYIQ 3CZQA 5GJBA 4TWZA 1GOTA 4QNMA 5F2EA 3B1YA 3G82C 1N6LA 1WXQA 2QE7A 4EQ6B 721PA 5JJIA 4H1VA 2BHRA 4DCVA 4F7WA 1ZCBA 2VP4A 3K0AA 521PA 1Q21A 2RH5A 1E98A 4EAQA 1XTRA 2ZUBA 4JVNA 2H8KA 2HJVA 4RCZA 4O0MA 1CR1A 2KI5A 4FIDA 1P73A 4MKFA 5SZHB 4EQ6A 1OJLA 3SHWA 1NVXQ 1E9BA 1JR6A 2CK3D 3IIMA 4KFTA 1W0KA 3QEOA 1XCGB 2IX3A 2VP5A 4XWOA 4MITA 5J4YA 1OIVA 1Z0JA 4QBFA 4LJ4A 5FUVA 3VKHA 4V03A 4M1YA 4AKGA 2GXAA 5CB6A 2O8EB 5JCPA 3IIJA 2E87A 4JKIA 2CCKA 1X8JA 1S3GA 4RSGA 1N0UA 5JWOA 1OIWA 1UF9A 4JLDA 4JVMA 2E9SA 2F1JA 1NY5A 6Q21A 1Z63A 1RE0A 1E1RD 2XZLA 4MQBA 1YZNA 5BQ5A 3GEIA 3FHTA 5C4MA 4JT4A 3R7WB 3QSYA 2IL1A 5FI1B 1G5TA 4LBWA 4OYHA 2XTMA 1TEVA 2WWYA 2XJ9A 1I2DA 2FPKA 3FFBA 4Y0AA 4CYMA 1VYTA 3QKTA 1GNQA 2QNRA 1K8RA 4PZZA 4ARZB 2XZOA 2R2AA 4F4CA 4EPTA 3LBNA 3R7WA 3RWMB 3BFVA 3MD0A 2WWXA 3RSOA 2OEPA 1N6IA 4D4MA 3IHLA 1EFRA 1XEWY 1Z0KA 2BDTA 2RGNA 3QOFA 1E2MA 2O8BB 4D0LB 1AK2A 5DSZA 1ZUIA 4ARZA 1GNRA 2OCPA 2VO1A 1T0HB 2REOA 4LGMA 2N42A 1MO4A 1UDWA 2ZI7A 2CL7X 4Q9IA 2W83A 3NTUA 2D4HA 4JIMA 2QP3A 4JLMA 4CEHB 4XD7A 4CVNA 2IYVA 2O8BA 2UZ3A 2Z4RA 4BRWA 2OUKA 3ZVLA 2XNDA 4CRWB 2VBCA 1ZJ6A 2J59A 1KNXA 1X1RA 3GLHE 4PZLA 1GP2A 3IO5A 2ERYA 4NDZA 3BORA 3BB1A 2HV8A 3M4YA 2ZSFA 3QF4A 5AJYA 3V00A 3QE0A 1W1WA 1MH1A 4JSYA 2B92A 4JJZA 3KKMA 1FTNA 1RRFA 2DFLA 5BN5A 1VIAA 4M9QA 1FL9A 2A5JA 1C1YA 3CX6A 2D3WA 2AFIE 3GJ6A 4QGAA 4AYWA 2HF8A 2AXPA 4ZCLA 1KOFA 1SVSA 5DI9A 2NO0A 2HT6A 2RGEA 2WBLC 4HDOB 4FWIB 3ASZA 3QPUA 3DM5A 1D9ZA 1SQ5A 2EVWX 5FTNA 4A6XA 2ZRGA 5A4JA 1XX6A 3FHCB 4X8LA 1ZNWA 3VR6A 3W6NA 1XNJA 2BM0A 2GAAA 4YLGA 2PX3A 4D25A 1Q1EA 4ZPXA 1XPUA
chains in the Genus database with same CATH superfamily
1A0OA 1NUTA 4ZWNA 1EU1A 4UPEA 3BIXA 4EDHA 1CUAA 2Y1EA 5KU1A 2D7JA 1YRYE 5MDHA 4ZQCB 3I6YA 3TNJA 4Z4GA 3SEFA 1U4SA 3ZY5A 5K0CA 4FIZA 1Y8RA 1KQNA 5E6SB 1DEHA 2JK1A 4CLEA 1HQYE 4LYYA 1TZ2A 2FSUA 4KN8A 2GSDA 3ZLUA 1APBA 1QH8A 2HKIA 3N70A 4UQPA 1YV9A 1FFXB 5C1PA 1P2UA 2VT3A 4Q7MB 5BT8A 2C99A 3HZOA 1NLFA 3DO6A 4YALA 3PRYA 4HT3B 2VHUA 3EGCA 3U7QA 1WX1A 3HYNA 3JYQA 1E6UA 4EYOA 1CUXA 5F51A 2WDZA 5E6SA 4DA6A 1J0AA 5JMWA 2VQEB 5ARDA 1TCAA 4JLVA 5BPHA 4CWAA 1KVTA 1D1TA 4LPSA 2ECOA 2H52A 2QRJA 3GH3A 2DHDA 1NX6A 4BMPB 1FFXA 2WIJA 4GX1A 4U0JA 3AFHA 1T2NA 5FYQA 1EGMB 3TCKA 4BWYA 1PV4A 2RK3A 3K9NA 4REQA 4TV8F 5JT1A 5T7BA 1LB1B 2QUKA 3ZBQA 3N28A 5CCXA 1QYRA 2PD4A 2ZROA 2QE7D 1U0HC 3EG9B 1AGRA 1YR8A 2LWIA 3B3GA 1J6UA 4K2AA 4NESA 4S3MA 5DOVA 5CG2A 5F3RA 5EJ7A 5TQ2A 3UICA 4TYNA 2PZEA 3GAFA 3R6DA 4KWHA 2JJ2D 3JXEA 4JUFA 4J2TA 3H0CA 3VDXA 3R0ZA 4Q3LA 3WL3A 5CFOA 1KK2A 2V7QA 4BATA 2QJWA 1XWFA 1UJMA 3R7DA 2IIVA 3KQOA 3EG9A 2IPLA 1I7NA 3IEXA 5EWMB 3CCFA 4UXJA 2YXEA 3HYSA 3AI1A 3I9KA 4ZCSA 3X43A 5JTUA 3JQ7B 4W1PA 4JBLA 5CA1B 4DPMA 3HDVA 4DTCA 2PGIA 1U3DA 2V6GA 3WBBA 3KAQA 3K5IA 3QU7A 3AI2A 1ORTA 1KARA 1PSZA 1LVGA 1O1YA 4K1LA 2ZJ4A 4L6CA 4ZZ2A 1EG7A 2HPVA 5CVEA 1XELA 4JYPA 1E2FA 4NBSA 3D9QX 3C98A 1KDYA 2GM4A 3JPWA 5C8YF 3OE5A 2OXEA 1GUBA 5EWMA 1Y6GA 2NMVA 4KX3A 2ZI6A 4V24A 3E22B 5E9JA 5CA1A 2G07A 1EVJA 1KI6A 1L4BA 1XTTA 3ABZA 3ZI7A 2AI1A 4LRXA 1GL6A 3RSGA 2BCEA 3K9FC 2B35A 2QTGA 3GGGA 3FMGA 2GM5A 2B25A 1EWRA 2GZ2A 4H3HB 4L15A 4MQEB 4YRLA 5FBKA 3NZEA 3SICE 3GNQA 1ESDA 1G3RA 1UBKS 2CMKA 3RHSA 2GNOA 1C7JA 2A6PA 4JT2A 3IUQA 5B4VA 2BFEA 2Y05A 4PXSA 3BMQB 3RRBA 2VATA 1OD6A 1WSAA 3OAAD 4WOBA 2HZ7A 2YBEA 4ML3A 4G5SA 3B9PA 5AJUA 1GCOA 2V9PA 4F2HA 4EY7A 3LY8A 3BAFA 4MQEA 2CHQA 1P33A 1KIMA 1TIPA 3N39C 1T8WA 4RIGA 4Z9FA 1EH5A 5A4DA 3HCWA 1J42A 1QR6A 1PWXA 4EFMA 4F8JA 3IUSA 4RSMA 1HDRA 3V4OA 4P8RA 3CKYA 3GDOA 3BMQA 3BZBA 4EELA 2XMDA 1CR0A 4R2KA 2I4MA 3BS4A 4HDCA 3V6LA 5B1EA 1L7NA 4YRCA 1PWEA 1BCSA 1O94C 3ZIAD 1OI3A 2YXLA 4DJJA 4ACAA 1EFRD 1LV8A 1OI7A 3GLTA 4KP7A 3HGQA 3NIBA 3PFHA 2CVOA 3DZBA 4YHHB 3WHKA 1NRJB 1ZITA 3LHIA 3Q4GA 5CLJA 2B8WA 1NVAA 3O21A 3TW6A 2ZUFA 3TRHA 3DLAA 2VSYA 4KVAA 5CX1A 4BFUA 3B6MA 4P98A 4I50F 5FBLB 4EF4A 2IXTA 3MEQA 2J7PD 4UHJA 1DAEA 3VKFA 1EBUA 1HBJA 1QTIA 2DPLA 3L8HA 3UMJA 4EEKA 4NXNB 3ORRA 5IDWA 1K88A 4ZRNA 5A3VA 2OPBA 2OO5A 3FMPB 3FNRA 3SK0A 3W5AA 1E3SA 1BE1A 1J0BA 3QBVA 5K3DA 3U56A 2H1CA 1EBFA 1U4NA 1CW2B 4BUZA 1JJAA 2QVXX 4J8PA 5EPUA 3EAFA 4WK4B 1EFKA 4GWLA 2BFOA 3CNEA 3JYLA 3ABIA 3FYTA 4L1KA 1A4IA 1LWOA 1NVUQ 5HRCA 2CNOA 1ZICA 2M1ZA 3BICA 1KSGA 3U62A 4AF7A 1Z22A 2GHQA 1Z13A 2NADA 2ES4A 5FHRA 5MF6A 3IKMB 1OWNA 2OORA 3UUWA 3RLIA 3DFUA 2OCBA 3EEIA 1L4GA 3TX6A 3NPAA 1MRNA 4YRGA 4UCWA 3NWPA 2XCRB 4R0VA 2DSTA 5FOVA 2HTEA 2C2ZA 2QD5A 3RFVA 2QSYA 3ETNA 2HA3A 2K87A 4MGZR 3N76A 3P9IA 2ID9A 5JQWA 2CL6X 3G79A 1TQ2A 3NEPX 3N3AC 4KI7A 4N5IX 1PG2A 1J23A 1O9HA 1V4VA 2CEKA 2F48A 1NNSA 4DJAA 4IVPA 5ELMA 1HEUA 4K46A 2HHJA 1XLTC 2I76A 4MARA 4UBJA 3LDAA 4FZ5A 1WCV1 2P62A 3RTGA 3VR6D 3EDOA 5EIOA 2YVUA 2D8MA 3DQPA 4N54A 2X8LA 4UCFA 3U39A 1OYVA 2F3QA 2PXHA 1LPBB 3MOIA 4CKXA 5AJHA 1CCWA 5AI0A 2C07A 5G3YA 3X1MA 4ZD6A 1V39A 4KPGA 3U4AA 4M6WA 5DHTA 3UMBA 3NDJA 2CEAA 2BCGY 3NG1A 1DUIA 3QLUA 4G86A 4QWWA 1E61A 3KUDA 1CB7A 4QUAA 2RHOA 4I1SA 2IIQA 1EX6A 3L0ZA 1BMQA 1BKSB 2FETA 4EW6A 4POOA 1DELA 5HJEA 1SCKA 1H85A 3SKYA 3P2OA 1NPDA 3BBPA 3F0TA 3CZAA 1E9RA 4WECA 3ZU4A 4B8WA 5TV2A 1DIAA 1K7FB 1R4ZA 1Z4LA 4Q1EA 4ITRC 2QUBA 2NQTA 1RHQA 3B9BA 4KIJA 1ZMXA 3K09A 3AL3A 4E14A 1ES9A 3L8GA 1Z34A 4YCNA 1G8JA 2W0SA 1U80A 4M9SA 4F8EA 4YIHA 3V2HA 1M0WA 1WZCA 4RSHA 4OJYA 2PQMA 2VP2A 2NUPA 3S7TA 1UK8A 4U00A 4YMGA 1KP2A 5A1TA 2RJOA 3H6GA 1L7OA 3T0FA 4B31A 2CV0A 3L1UA 1NP6A 2YXNA 5EJFA 5CNJA 4HWOA 3N2KB 3C3MA 4ZOBA 3H5TA 3QI2A 4KX5A 2H4ZA 4KO8A 3W2FA 3RW9A 3NKFA 3WGYA 2PM8A 2AG1A 2PNFA 3AUKA 3DFKA 4M88A 4O02B 4FYIA 2D6FA 2H5IA 2PGOA 5AW8A 1XEWX 4P3NA 4M83A 2RE8A 4XCXA 3PE3A 1JU3A 1HDCA 1BHO1 3HZHA 3LUJA 5F21A 5BWOA 1WDKA 4FEEA 1B8PA 3C4VA 1VL0A 3TQFA 3WKBA 4DIKA 2C96A 2C82A 1UMKA 4Q3NA 4Y2SA 3GDGA 4I3HA 4JDPA 2YZMA 4L02A 2ZCJA 4YH1A 2I22A 2ZAYA 4ND3A 3VHXB 4PAGA 4GE3A 1Y1TA 7MHTA 3IQEA 1MMFB 1XCOA 2ZIZA 4E13A 1VCMA 3E7FA 4HZGA 2H3HA 3HDTA 4RIHA 3WZLA 5KWEA 2RH4A 1EFCA 4QBTA 3BD6A 4EA7A 4ZI3A 3GPBA 3PK0A 5HUJA 3TEFA 3HB5X 1JKFA 1X7YA 1UAAA 2QW0X 3JVDA 4NQRA 5CHEA 8LDHA 3D6HA 2X4DA 3BL8A 3NPMA 1A50B 4TKUB 4XAQA 4DAEA 1GPKA 2AI2A 1GKUB 2ZUSA 3X1DA 5BQFA 4BBPA 4ZTBA 2NTJA 5NLLA 3LNCA 1S0UA 2X76A 3DOHA 4RFLA 4UCQA 2E21A 3TIXB 3VU3A 1MNQA 1XRLA 2MT9A 4FEAA 4V0OA 3VM6A 1TKAA 1RM5A 3Q8WA 4O4JB 3A4TA 1IK4A 3LAWA 5CM2Z 3CUVA 4TRRA 4TKUA 4QBIA 2GGSA 3TTYA 3U44A 2XE7A 1GUDA 1KBQA 2HREA 1Q0PA 1SXJB 2IW3A 3EVZA 2H1SA 3OZRA 4R68A 1G17A 2CGEA 2RHGB 2YJGA 3D6JA 3EODA 3KR1A 4LDRA 3L0BA 1YI8A 3IHWA 4FWTA 2I7DA 5JJKA 1WHTB 1GGKA 3K0BA 4Y6GB 1P1FA 4G07A 2C4MA 4A92A 2ZTHA 1ZJWA 3OICA 4MWBA 1ORDA 2JD2A 2OE2A 3OIDA 2BBSA 4UUNA 4AS1A 3LPAA 4OK5A 2FFQA 3GRKA 1SXJA 5JCZA 1LS1A 1DAHA 3T61A 4AJPA 1IJKA 1TX4B 2QLMA 1JG2A 4QQKA 4EOGA 4IS3A 1OUMA 2NZWA 1KIFA 4YMWA 3TWOA 5G4KB 4DDTA 3A9RA 3PICA 3IBCA 4AM8A 1EXVA 3BT7A 1UWKA 3ROGA 2H8GA 2PMFA 4CHTA 1SHZA 2CK3A 4B3JA 4D8XA 3B60A 3IBSA 3AKZA 1P29A 2OCIA 1NSFA 1SC9A 4IJMA 4BS9A 1G20B 1L5HB 3ELDA 3N2GA 4D9JA 2GEVA 3NMUF 1KDZA 1JS1X 3DYIA 5G4KA 3SS9X 3LLCA 1YUNA 4Q4JA 1ZD1A 3EC1A 3ESBA 3P2JA 4Z9BA 3RIHA 3R3VA 4ESHA 4J3JA 4QDOA 2FWAA 1QMGA 2G1UA 2R48A 3H75A 5C35A 5LQAA 1KR5A 1XYGA 1R8XA 3DB1A 1QGUB 2I6XA 3QNMA 4NK5A 2F6RA 1L5HA 3UF0A 3VGJA 4Q0MA 1OH6A 3AVVA 1UDCA 5KNDA 2LR0A 4UVEA 4X6LA 1FTGA 3GA7A 6REQB 5JNLA 4U1RA 4WXMA 3JAKB 3SQOA 1UWCA 4JVOA 1L6RA 1USVA 4KXQA 1CV2A 4N01A 3RVQA 2Q2OA 2O4CA 1JFRA 1K6EA 3FA2A 4FB5A 1OLOA 3NTRA 2ZB4A 3UJHA 3UXEA 2FV8A 4KAJA 5JNRA 1VMAA 3JWGA 3KBOA 3KQQA 4J7CA 1CY2A 5IJ9A 3HUUA 1EE2A 1UT5A 2JIOA 3EZ7A 5GJVC 1Y8AA 5H9WA 4E1BA 3HPQA 1QX3A 2GO1A 5E2AA 4ZKEA 3G68A 3WR5A 1SXGA 3ZLVA 3ZWKA 3DXYA 1EFVB 5FX2A 1GGFA 4EHLA 3FVTA 2CSUA 4G0ZA 2IYWA 2C9CA 3OPNA 1P6XA 2A9PA 1B42A 3JVEA 3I12A 2FA9A 3FWHA 1ISSA 3O47A 2JAPA 4J0DA 2AFVA 1JR3A 1KYZA 2FNAA 3GLSA 4MYSA 3RO7A 4UUOA 2XUFA 3NX4A 3IMEA 2EFEB 2Y1XA 4Q15A 2EXXA 4LMBA 3PHLA 5E7JA 3DNPA 4N6GA 1PTJC 1ODTC 1JIXA 1WP9A 3AERB 3YASA 1AQIA 4UBLA 1XIVA 2G9RA 5ALDA 3CA8A 1H4QA 1VXRA 4CF5A 3UAVA 1SKYE 2YQ4A 1NUPA 2JGEA 2ZLBA 1WXIA 1WSWA 4KRGA 3O94A 5FNVB 1EVEA 3VR1A 4FYVA 1GUFA 1YMVA 4Y9DA 4C2UA 1YO6A 5B30A 1AQLA 2D5IA 1RS0A 3QEBZ 621PA 1KERA 1NQVA 2VLIA 3GCDA 3R6WA 4D9CA 5K03A 3AERA 4MV0A 4N7MA 2Y1DA 1F8GA 2B4KA 1YL6A 3GUHA 3JQAD 4R8SA 5H1YA 5HW0A 2WZBA 4FNOA 1TF7A 5K0SA 2HWYA 3WJ7A 2B98A 1V4NA 5FHQA 1QYWA 1QLHA 5AVJA 5FNVA 4YV1A 2YY7A 4OLAA 4PSCA 5F23A 2I7XA 3BQNB 4MGEA 5BV1A 2P3SA 3QP9A 2GASA 3OH8A 2DG2A 4FE7A 3MK31 4Y0VA 4K8RB 5TY0A 3DF9A 3OZCA 2IH5A 4WUTA 3GVHA 1RQ2A 2Q6TA 4X6YA 4DABA 4ZMBA 4JB3A 2EKZA 1TJ3A 3GCXA 1D2EA 2VUHB 4Z3DA 5L7WA 1QP8A 1S2NA 2B94A 3G9QA 3PEUA 1SC1A 2Z2JA 5AKIA 2JRCA 3ZR4B 5K0JA 1G8MA 2FAXA 2I4NA 2SCUA 3UT5A 2D0IA 5E3HA 3L0YA 4DCMA 3FCAA 5LYJA 3R24A 3PVSA 5ADUS 5CNIA 5IAOA 2E5LB 5A5EA 4C0XA 2BFWA 2X0IA 4KSCA 4KH1A 2BJHA 2OYCA 4DCGA 2WIDA 1ZSYA 1J06A 3EXG2 2PT6A 5CVDA 1LW6E 5DLEA 1C1HA 1NN0A 3OOYA 3M5WA 2XCUA 3L06A 4HN9A 4MINA 4IUYA 2PHZA 3O3OB 4FHGA 4X20B 2OV4A 2BEUA 2ZUWA 1S3FA 4YGYA 1CZUA 1JBKA 1LBHA 5DYIA 1F2TA 2VJLA 2NAPA 2PKYX 4B4KA 2JJ8A 2HHCA 2P0AA 1HSOA 4YRJA 1E2NA 3LT1A 1O2DA 2JHGA 1P5ZB 1KQFA 3IT3A 5LM3A 3I0ZA 1A8IA 4MKIA 3WVNA 5JS6A 2YIJA 3HA7A 1RQPA 3TTXA 4DNXA 1QBKC 2J4CA 4GPAA 4E5MA 3AVTA 2V7BA 2ECQA 4FMCB 2WY2D 4YP0A 4JN6B 1REQB 1P2TA 1SZJG 3UAZA 3IEPA 3A8TA 3LWZA 3ORQA 3L4SO 1LY1A 2FWNA 4Q9KA 1FDUA 1QQ5A 2HH9A 5HJ5A 5B12A 4JB8A 1DEKA 4NECA 1FS4A 3OIFA 4RTOA 1NR1A 1QHSA 3LX5A 4ZC8A 1LNZA 1E92A 1GSOA 3HGMA 2ZWAA 3B51X 4MDYA 1LI4A 3LUHA 2VAMA 1UXHA 4O5AA 4XUDA 3TO5A 3GLFA 2PUEA 4NYMQ 4ITUA 1K97A 2IYXA 4PPNA 5M3BA 1E7SA 2VJNA 3S5JA 4LFAB 4FJ1A 4KC0A 1IZYA 2MYPA 4DCNA 5IYZB 5LYJB 2AYXA 1OI2A 4S1NA 3DZKA 3M0EA 4AXBA 2IYOA 1OWPA 3IMCA 1VG9B 4CV1A 4ER6A 1JYEA 2VPWA 2YDXA 2XOKA 1JEEA 1OIXA 3C6ZA 2XE4A 1BJKA 3HDQA 4ENTA 3RSHA 3FLMA 4KGDA 1DJOA 2ORWA 3I6BA 5GP1A 4A7PA 4HPJB 4Q7KA 2NM0A 2WOJA 3DV0B 1S89A 1I8TA 5CYFA 5IYZA 2OCLA 4ROSA 1EWYA 2EQAA 2ZIAA 3AILA 1GU7A 4OAPA 1ZHFA 2FW9A 4I08A 5EUBA 1GAEO 3GBSA 4TQ9A 1CUFA 1YQUA 4GEGA 4B6SA 4V0MA 4E70A 4E0BA 3VZQA 1H2ZA 5FL3A 3DV0A 1JG3A 1RXIA 1IY9A 3KJQA 2P5TB 2JZNA 1UBTS 4YO8A 3KQYA 1JB1A 2Q50A 3P9ZA 4E6EA 1J8DA 2QX9A 3DOJA 4H16A 1ZU4A 4RYDA 4DJFC 4C6RA 2HBQA 1W30A 3SZLA 3K2IA 4TMFA 4B3GA 4GXQA 5EQFA 4BECA 3T3NA 1R64A 2R6AA 4KE9A 1NW7A 3RREA 1P0QA 1RAGA 4E5YA 1TPZA 1TU0A 5F12A 1GQQA 1QJCA 4YUXA 2FZKA 5CHYA 4C08A 1YHNA 1EVIA 1XVVA 4Q7LA 4AZ3A 4GP9A 2QQGA 2QF7A 4EARA 1RBMA 1KJIA 2O3TA 2LRHA 1MTZA 4DCJA 3UB2A 2C78A 5CH8A 2XCIA 1J09A 4MWEA 4BUCA 1XTQA 2I8LA 3LBIA 4O59O 2R5NA 1MO3A 1X1EA 3ZWVA 2F43B 1T4MA 3DTYA 2AF3C 1XF1A 3VO2A 5LD2C 1FU7A 1Q57A 1K5PA 2GHIA 1O57A 4L0DA 3JRWA 2H5EA 4LYHA 4XB2A 3D0QA 2COUA 3IVCA 8ADHA 4BFCA 3W9YA 4WGFA 4CLRB 2PT7A 3MOGA 4OFBA 5GIOE 1TUBB 1SVOA 1L7QA 3CX7A 3KWMA 1Z0FA 4J0IA 1NW6A 4AW9A 5C2JB 5E1OA 1Y33E 3GGDA 3IP3A 4F7DA 1NQOA 2A57A 3KZVA 1NXPA 2Q2NA 4A16A 4RTLA 2F43A 2I1QA 4JVLA 3CR3C 3FTNA 4RA6B 4RZIA 3K20A 3FD8A 5JARA 1W34A 3CH5A 3TD6A 4MROA 1UPBA 1E58A 4MULA 4UU1A 1TUBA 1XYYA 2O2JA 1Q7TA 2ORED 2C54A 2VWGA 3DOEA 1R6XA 2ZYRA 5AHOA 3REQA 3WMXA 4ZICA 2ZIWB 3SJAA 3U4IA 3HN2A 3HS3A 1NJ5A 1W19A 2C61A 3DVRX 5B1YA 4RV9A 4ZJZA 2QLJA 4ARIA 3HFRA 2I7CA 5EJ2A 2HRCA 2YQ5A 2PAFA 1KPHA 3EFOA 3EZGA 4J90A 1YS9A 4ND5A 2C2XA 1ZWKA 3F46A 3EBLA 3A1WA 3DO8A 2RAPA 2EFHB 2B1GA 2FPSA 1E6CA 1ZP6A 3A4VA 3L7MA 4MEBA 1ETUA 2FTKE 2JI7A 4Y7DA 3NU1A 1OHHD 2Y9PB 3W0LB 5HPYB 4I4IA 1XJ0A 5C0OE 2QWXA 5EG5A 3BWCA 3PYMA 4XWTA 4ETNA 1XDZA 4KWTA 1SOVA 4QDJA 1EP2B 2QIOA 3M34A 5MFPA 4IIFA 5GM2A 4TRMA 1PK9A 1USIA 2QAGC 5HE8A 3C3YA 3QA3E 2FPRA 3SYRA 1IQPA 1JW9B 1L5SA 5CCEA 4HPWA 2OCGA 1J8FA 2WAMA 1S8FA 3HKDB 4RQAA 3H1PA 3JD0A 1M7GA 2XUHA 1VDMA 1AVTA 3KQVA 4HB0A 3SJ7A 1OYWA 2QV7A 4BP3A 3GP5A 4G56A 3S0JA 3VBEA 2V6IA 1AXEA 2A7QA 1FQJA 5K0NA 5BN4B 1YS7A 2EATA 1UP6A 2GA9A 1OZHA 4O33A 3AQ4A 3TW4A 2QG4A 4G24A 5LPNA 1A88A 4IIUA 2COEA 2IOYA 2VPZA 2C84A 3CKKA 2YV3A 3AUJB 4YBZA 4YRZA 5DP1A 4ACBA 2WNIA 4JX8A 3CIFA 4X1KB 5L4LA 1PFYA 3FCXA 2X0NA 1E5TA 3F9RA 5TXGA 4Z8XA 5JECA 3B6IA 1T91A 3P32A 5KJ6A 1KYYA 2XDQB 1VE3A 2F55A 1SM4A 3D5TA 2OLJA 3EIEA 3KJHA 3KZXA 3NASA 4OK6A 3UJ6A 1P0FA 5DNCA 1G0NA 5AVVA 4YCJA 1V35A 2B34A 3OZFA 1HX7A 1JA1A 3HU2A 5F7OA 4PSKA 4DRXA 2Z5GA 4TWJA 3AVYA 1YRHA 3FUXA 4MX8A 2FSSA 2G4LA 5B6PA 1UKYA 1RLTA 1DJMA 1DWQA 3FDJA 4TXHA 4AI6A 4NONA 2IUFA 1QHXA 1D4OA 1KJYA 4IR7A 1Q84A 5H59A 1A5AB 4QICA 3NUQA 3IUEA 3TSWA 1UBFA 4WFQA 4ETIA 4A0GA 4EG0A 2FPGB 1XROA 3L7KA 3CNNA 1Q7CA 2Q3LA 3O8QB 3C41J 1I2CA 4LC9A 1KDOA 2PDAA 5EXPA 5CPBA 1RWPA 3KEGA 1S8NA 2UZ0A 3CEHA 1UL1X 4BZWA 1A5ZA 4UU7A 3SDSA 3PC8A 3K9QO 3FPLA 5ESXA 3ZU3A 3FOEC 4NZ9A 1S02A 2P4HX 3ANMA 2VSFA 3L40A 4N9QA 3SZMA 2FPGA 3O95A 3N0VA 4X41A 1DADA 1B0PA 5ULLA 1X39A 3L8MA 3O8QA 3VVMA 2BDUA 3C43A 4Q4AA 5F7JA 1QE5A 1YVDA 2HA6A 2XA2A 4H7JA 1G3MA 2YUTA 4BO4A 3QTBA 1FUYB 1XRNA 4DMLA 3ND8A 1L9KA 4GWGA 1P9NA 4MYRA 3TIFA 5CEJA 5H3HA 2DY1A 3QVXA 3TZQA 2HLDD 3ZDCA 5L40A 4E46A 5GINE 1U7UA 3BA6A 4U7HA 4W8GA 3EXAA 2OD2A 1XA3A 4HATA 4L08A 4PIMA 1Z29A 1IG0A 4R8MA 4G8BA 3I6ZA 1ZNYA 1IBCA 1VHQA 2ZR7A 3PS9A 4PC3A 1HLPA 3N74A 2XMPA 4RFSB 2MDTA 5CA1F 2PMDA 2RGRA 5MN6A 2HK7A 2W22A 3LKBA 1MEJA 2YJ3A 2YS6A 4KO3S 4R9SA 3LWBA 5C1OA 1FA9A 1KQPA 2Q3CA 1UC8A 3EEBA 4L75A 2OILA 5ALFA 5FJJA 3C4JA 3CUSA 2VHVA 3I5MA 3S2UA 5LQJA 2ZJ0A 3REOA 4JODA 2OOKA 3ZVKA 4L5AA 4F45A 3QFHA 3H97A 1PJTA 2CVZA 4JLJA 2XNJA 4OJQA 4GS5A 1NNUA 2QL9A 1G6HA 3QJYA 4A10A 1G3IA 2HSGA 3KLNA 1H8HD 3SSMA 3PA6A 1U7HA 3RADC 3CIOA 1JDNA 1A72A 3M70A 3OWXA 2QENA 3MQFA 1J90A 3DMTC 2BTQB 2BEKA 2WTAA 3MJ4A 4MKXA 4NAUA 5KOHB 1NUUA 1PJ8A 2BW0A 3CVWA 2HHAA 4KXNA 3HH8A 3MJCA 3V1YA 5LJLA 5I8PA 4IV5A 1W88B 4JSRA 1ZIDA 2HV9A 4OGFA 4CMBA 5CCBA 5HTKA 2VCEA 1XALA 3JARA 5LZ7A 1DAIA 4GR9A 3UXHA 2R4UA 5TPZA 2Y9MB 3LRTA 1DDOA 4PICA 1TGYA 3HMKA 3Q5DA 1Y3AA 1E7MA 4CIBA 2ZSHA 3H2YA 7GPBA 3IJPA 3ZIUA 2I3AA 1LV7A 3MGKA 4P4LA 1QF7A 1UP7A 2JI9A 4KRFA 4V0LA 3W4JA 3KQNA 1W88A 2OD9A 2A5GA 1X1DA 1DG3A 2IS1A 5IT5A 5ICFA 2FJPA 4RTKA 2QN7A 4XWKA 3EPHA 1VGRA 1O95A 4CTOA 2R87A 3EGOA 3PQ6A 4E3ZA 4HZIA 3EDCA 4YCLA 5JS1A 1ENPA 3W5JA 1HTTA 3TLZA 2D8AA 5EJ8A 1ZESA 3ECSA 4Q5IA 5L6LB 1N6NA 4LJYA 3PNKA 4PANA 1WBBA 4UKDA 1SOMA 3KSMA 3OE7D 5L3QB 1CUZA 4QUHA 4CCYB 5FB3A 1MPXA 4LDZA 3D6VA 2ZAMA 4OX9B 2CW5A 4LV8B 4CETA 1FTYA 2I1VB 3LDFA 4Q19A 5DTIA 2N3ZA 5KNCD 2Z9BA 3QVLA 3LZCA 4I9GA 1NUHA 4D4JA 4BCBA 1BX1A 4IEFB 1HYGA 4WCFB 1GHTA 4JKYA 4KODA 3GFQA 3KT3A 4J75A 4KQHA 5L3QA 3O4HA 2J3IA 1JEJA 4CCYA 5K0TA 2NPFA 3KLBA 4BJ5A 1FDOA 1A2OA 1CJSA 1XVIA 2R6CA 3RRMA 3KJNA 1JQDA 2RGAA 4P35A 5CJPA 4AJ1A 1HG1A 4I4CA 3ZCRA 2V58A 3PQ8A 1UKEA 2X6RA 3EZYA 3FDFA 2VTDA 4WCFA 1QP0A 4WL0A 2NPIA 1A2QA 2VJMA 3C5CA 4PX9A 4S24A 1EZ1A 2YQZA 4URWR 2GETA 3DD5A 1QNLA 1Q1GA 3RFXA 4BRWA 4EY3A 1OT3A 4OO3A 1EX7A 4F6CA 5AQ1A 2IP2A 3PUWA 4AKTA 2BSQA 4QTTB 5IBRA 1GPWB 4TLDA 4HGRA 1W93A 3IKJA 1TZCA 3DWGA 5F7ZA 3IEUA 3KJEA 4LXHA 2QM7A 3K3PA 4KYIB 1DQSA 3W2TA 4HC4A 4J16C 4PNHA 4BNKA 1OAOC 5DBGA 1RMYA 4OGKA 3LY7A 4BBJA 3T7TA 3W1EA 1H5UA 4OHBA 3EN0A 1SUEA 1UXGA 3I9MA 2R44A 5FAKA 1RM4A 1N9GB 2GAIA 1IMJA 3FTDA 2O19A 3FOAA 1UFRA 1YZUA 4NNOA 1TT7A 3KJZA 4GOND 4LWPA 2R8RA 1RJFA 2FP3A 4WUVA 5CURA 4ZVSA 3SC4A 4ND7A 2DLCX 1KAMA 1GDHA 2IXBA 2EZ8A 3AHGA 4BZXA 2Z1MA 5F64A 2D5AA 1AQUA 2C98A 4A6PA 3KKKA 4FYYA 4GZ6A 1S4MA 5ED4A 5AI5A 4CF4A 1HKHA 1J5XA 2R8BA 1N9GA 3M6AA 3NFYA 3Q10A 5THXA 4WKBA 4NE9A 4ID3A 3TLGA 3W3AD 2XUDA 2EJWA 1WPRA 4OXKA 5DO9A 4GF5A 1N5RA 5BO5A 1VPWA 1PFQA 3KPUA 3KSBC 5CDFE 4I5DA 1I51A 5CVCA 4JBWA 4R0MA 3LFTA 3LUBA 3K9BA 5INTA 4II7A 1C7EA 4P6VF 3U16A 4S35A 3EZ9A 1F4PA 2WUVA 1TD9A 1AJEA 4AO7A 2PUTA 4EI2A 4DR2B 2JFYA 3RU2A 5BMOA 3K2EA 3PXAA 4BP8A 3DVAB 3SIWA 3TSZA 2ZZMA 3JWEA 5TS2A 2E0IA 1BKYA 3OD5A 1P7YA 4IO1A 3IVXA 4O3FA 4QUEA 4B32A 2ZRJA 2V8BA 4Z3KA 4NCIA 1NQTA 3JQFC 3LPLA 4KWIA 3V2UA 3ITKA 2ZWPA 3F5SA 2VL7A 4PLZA 3QMMA 2ZUTA 1F2UB 3GJQA 1A1SA 1PJSA 1XAHA 2PSFA 5EFZA 3SIPA 3EARA 4UNNA 3WL4A 4C76A 4CZ2A 1H4TA 1CF4A 4F5ZA 5ITWA 1ZYUA 4RH0A 2Q6OA 1Y4UA 1Z07A 4N4AA 2ZIFA 3ZHOA 1S3IA 2HF2A 1N3BA 1Z17A 1VSTA 3I9FA 2JHCA 2B69A 1FFGA 2ZJAA 2W5UA 2ASEA 3R6TA 4LJ8A 3B8HA 1NURA 1E3MA 3UTCA 3W6ZA 4CG2A 4OM8A 5EWLA 1QM5A 5LBTA 1VIDA 1J0CA 1DX6A 1M1XB 3RVPA 4OYYA 5JNTA 1FMJA 3K1JA 2F4VB 5A03A 2HIGA 2K2WA 1TMGE 1E62A 4R1UA 1Z0IA 3AGQA 1WWKA 4ZAVA 2BI8A 3JQBA 2ODWA 3F6BX 2PRIA 4COOA 3IP5A 4MMZB 1SAYA 2O0JA 3WMGA 1C0IA 1MB2A 1MTOA 2GJSA 4BFTA 1BVYF 4JP8A 3OLCX 3ABSB 1KAEA 1YZGA 2P5SA 1ZUD1 1YJBA 5TMPA 5HP4A 4LX8A 4RAOA 2A9OA 3E2PA 2ENWA 3PJEA 3Q6NA 5BW6B 4OKIA 1D6JA 2IEAA 4FN5A 2XRYA 3GFTA 1X9HA 1UEIA 2FP4B 4NKRA 2GBFA 3FYUA 3OEWA 4JMLA 4OL0A 5DFAA 5B3JC 5F9MA 5GMOA 1IB6A 4BZPA 3U7IA 1OXVA 2JFWA 1G9SA 3VDQA 5CDSA 1EEHA 1ORHA 4HEA1 5BOSB 3LV8A 1A5SB 5HCUA 5J59A 3HXMA 4IIGA 1A3CA 4JBIA 4BMOB 3AUYA 1DRJA 2BZ0A 3WK7A 4BLQA 3ZY2A 4DV1B 2FP4A 3RANA 5GJBA 3HJHA 2RHJA 4JFAA 5DISB 1X92A 3GVPA 1BTOA 1XCJA 1EB8A 4FSHA 1H8ED 3WLSA 6ADHA 2AC2A 5ITSA 5JRZA 3VR5A 1EVYA 3HRHA 3O90A 3QWFA 1UZLA 4OCZA 4DA8A 4OBWA 3GGJA 4KL8S 3TLXA 5AKYA 3F2IA 1S96A 4D8UA 1E8DA 2R66A 2P0EA 2FRDA 4KZPA 2A1UA 2A59A 1MO6A 4LHYA 1NJ1A 5EIBC 4AX8A 2NW6A 3BWXA 4FHDA 5AXAA 4AP5A 1OV6A 3EGWA 4OGGA 1G41A 5ENZA 3IR5A 2Y68A 3G2OA 4MJXA 2HRZA 5ALKA 2F1IA 2OFXA 4RD6A 4HGOA 1US8B 3DT6A 4JXXA 5DNEA 2ZBGA 3IA7A 3NDRA 3A70A 4IH9A 2D0PB 3I5XA 2X22A 2QSJA 1DMSA 2CXQA 3UCXA 2WP0A 3ROEA 3I5YA 1FXWA 2F1HA 3CRZA 2HADA 2X14A 1W8IA 2C7VA 3DMGA 3UV6A 1V2GA 4QOSA 1US8A 4Y9TA 1MC4A 2DPMA 3SLRA 3FNIA 1P2DA 1DKLA 2C3OA 3VFDA 2CD7A 4FYWA 4XX1A 1ABBA 2DUUA 3OY2A 5AW4A 3U9TA 1GRRA 4UFPA 1PZNA 1DAPA 2V5VA 4QA9A 1XO1A 1PT9A 3FAZA 3GD7A 4V2IA 4B4DA 2PA3A 4V1CB 2BBOA 5JAPA 2NO1A 4BPBA 3WGOA 2EHDA 5F1PA 3GEGA 2P4EA 3C4QA 4WA7A 1KE2A 4URVR 2I33A 3ZZ1A 3ZN2A 1WM1A 1C7IA 5CEEA 2HD4A 3U4MA 4A91A 1RW4A 2FVXA 1J0EA 1WKVA 2VPTA 3I6IA 1JPUA 3DFZA 3LUDA 2A58A 5KVAA 3G0HA 4V1CA 3AHIA 3ADKA 2IOFK 1E6EA 2ORIA 1LDYA 4JQSA 2IUTA 4CT4B 2F3RA 1NW4A 1T25A 1OBOA 1MRSA 1Q5PA 1GRQA 3DJYA 4Y6RA 3UMCA 1WVGA 2O2CA 2Q2WA 5HZMA 1F1BA 4PO3X 1L4LA 2I5PO 2G9NA 4CIAA 1HY3A 3LWDA 4L9WA 5K3BA 4JY7A 2IDZA 4J0GA 3EBOA 5FBRB 3R9KA 1VP3A 5HTOA 1XTIA 1AN9A 1C50A 4NYJQ 4OMFG 5FQOA 4FSXA 4KFRA 1MLDA 4ZVVA 1RXWA 2XVXA 3C6KA 1NRXA 4G2TA 3PFGA 2PZ8A 1KOLA 3WGVA 4EVQA 1LQ2A 4BVJA 1CSEE 3DEAA 1KJ9A 3UK6A 4RIIA 2PUCA 2AMVA 3PWKA 2RK6A 1XOIA 1MC5A 3BM5A 3E18A 1SIWA 3E61A 2VP9A 4TKVB 3PKIA 4E31A 1N5OX 2Q3MA 3A27A 4QG3A 1V16A 3HU5A 4LRYA 4PBRA 1UJ5A 2DPYA 3MQ2A 1I30A 3C85A 1U3GA 1ZRHA 5EIFA 1VI5A 2XD4A 4INAA 3RSCA 2VIIA 2GLTA 4WOJA 1PT5A 2XWJI 1ZGCA 5L51A 1FDTA 2D54A 1ZO8A 5LYJF 1ZH6A 5H4GA 2Q4BA 3PX7A 1R6AA 4FOSA 4AICA 4C0KA 4EX6A 4LZLA 5K8TA 4O2BF 4P86A 1E1LA 4TKVA 2ZDGA 2HA7A 2BI4A 3IFSA 4D97A 3D02A 1NA5A 1ZXXA 3HJRA 1XNGA 2WIFA 5F1OA 3FWKA 5DOZA 2IV3A 4BMCA 1LQTA 2EJVA 5COQA 3D3KA 2FPPB 4BBZA 3H5AA 4V0RA 3PRKE 1IHDA 3IL2A 1GQYA 2ENUA 3R44A 3L8FA 3JWPA 4QOFA 3TOCA 3P2IA 3IDAA 2ZAGA 5G53C 1CUCA 3LPNA 3AF0A 2PVSA 2R6GA 2BMAA 1XSEA 3PBKA 4G23A 1KVRA 5CDTA 2I3BA 2OP1A 5EIEA 4M1KA 5DH9A 1NBMA 1E5QA 3R0JA 5FLEX 5IK2A 3ZE2B 3U17A 1C7FA 4IGIA 3FI0A 4C1BA 2IY9A 1DBPA 1I6LA 2QRMA 5FPHA 1TKCA 5BQPA 4DE5A 5AYVA 3MAAC 4COKA 2QPLA 4R40A 2EBUA 1TAQA 1KYQA 2PGLA 1T8SA 1DPGA 4XKJA 4R9VA 3UHPA 3WL7A 1P5HA 3ZE9A 1V5FA 1PEKE 2YOGA 5SYAA 3CBGA 1IY1A 1T0IA 3AVQA 2CT8A 1VM6A 4EJMA 2V0GA 4H1WA 3B1KA 3WGMA 2GCOB 1C7QA 4GE0A 2WNHA 3WLEA 4S0ZA 2AX4A 1LCIA 1TGVA 2CLIB 1W29A 1EA7A 3JAWB 4OLHA 3I04M 1DXHA 1G19A