2QT0A

Human nicotinamide riboside kinase 1 in complex with nicotinamide riboside and an atp analogue
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
189
structure length
179
Chain Sequence
RGSKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nicotinamide Riboside Kinase Structures Reveal New Pathways to NAD(+).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Nicotinamide riboside kinase 1
total genus 55
structure length 179
sequence length 189
ec nomenclature ec 2.7.1.173: Nicotinate riboside kinase.
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qt0A00
4X8HA 3KJIA 4PC3A 2OCAA 5GJWC 3WNBA 3CRVA 1SXJE 1Z63A 4OQLA 3VMFA 2P3SA 2XTMA 3RNLA 3PUWA 3T12A 4NP6A 2G77B 1R0XA 3BB1A 3BOSA 4Q19A 4XIGS 4FCWA 4Q21A 1JR3D 4A36A 1KY3A 1MH1A 4FI3C 3CNOA 5DISB 2GK7A 4QGAA 4N0DA 1FMLA 2PEYA 4IEEA 3AP2A 2FSGA 1U9IA 3N2IA 3NHBA 2VHCA 4D4LA 4OI4A 5IT5A 1OKKD 4B34A 5H70A 4B43A 1IJEA 4HB4A 1G4UR 5FPSA 4G5OA 5CIWA 1COWA 1A7JA 3WXMA 1XCPA 5FTNA 1NSTA 2H18A 1X86B 2R2AA 2WWXA 1EWRA 2OCPA 4DVGA 5E3HA 2O8DA 1YQTA 1AS2A 2PCJA 2ZU6A 3EIQA 5JSZA 2OCYC 3C8UA 3PEYA 1R5NA 3EZ6A 1KMQA 1N0UA 1U0JA 1KJWA 1VYTA 4Q9HA 3ZYCA 3IKJA 2GJ8A 4JL6A 4NYIQ 2JEOA 1H8EA 3UWKA 3U3RA 5FPKA 3DZDA 2BKEA 3R7WB 4O2RA 4JVLA 2PT7A 1MABA 2ZR7A 1NLFA 3TW4A 2O0HA 2ZSAA 2GF0A 3IO3A 2OG2A 5HPYB 4D81A 2JLYA 1D6JA 1GKYA 3B1WA 3QI2A 1D2MA 1GL6A 4Q66C 2J59A 5IF9A 4URUR 4MGZR 1Q22A 1MR3F 4PSKA 5J4YA 5CJPA 4C30A 5JWHA 1XRJA 3EWSA 3T1TA 3GPLA 2ZSFA 3N5CA 4P33A 1SVLA 4AYXA 2RGCA 5JSZB 2B7BA 4PFSA 4CDGA 2ZJBA 4ZDKA 4GBMA 2AFIE 4I99A 2FEOA 3SQWA 1XTKA 4JKYA 4DLSA 4AG6A 2HYDA 3CRQA 1JNYA 1M7HA 2GF9A 1N5IA 1L7VC 1UEIA 1FMJA 1BO6A 2AN9A 4WBSA 3U60B 3GLIE 2GNOA 2J7PD 1CBUA 1AQUA 2F1IA 1SVKA 3OIWA 3QUSA 4Q18A 1G4AE 2PX0A 4MDFA 3I3SR 3SZRA 1EGAA 4HB0A 4AWXA 2PJRA 4PPQA 2CCJA 1U2RA 2JA1A 2HT1A 4JZKA 4Q7LA 3D6TB 4G5QA 2J87A 3LW7A 4LJ5A 5DYIA 2QY9A 2JCSA 1WBDA 1EFRA 3WY9A 5JEEA 3QSYA 4Q4AA 5JI2E 1OE0A 1VHLA 1T8UA 2Q9CA 1E9CA 3GLHE 1US8A 1TADA 3TVTA 3GQBA 1AS3A 2IYTA 3QKSB 4JJZA 3TIFA 3WRYC 1U9IC 3ADDA 1GNPA 3EWAA 1Z0FA 4MYTA 5EE9A 1U0HC 1X3SA 2ZYTX 5CB8A 3SBDA 1MABB 2BKUA 1G21E 1JEDA 5LB2A 3B78A 1U98A 1X8JA 2V6JA 1CU1A 1G18A 2ZUDA 1E0SA 4UNPA 5FBLB 4HAYA 4ZI2A 3PJRA 2R62A 2GJ9A 3FMIA 4B6EA 4PO9A 3QXJA 4B6FA 1XMSA 3M4YA 4XWAA 4PPFA 1UBFA 2FWRA 2H7VA 2WIBA 3LY5A 5ANRB 1N6LA 1ZINA 4O25A 4TL6A 4H1UA 3X1DA 3ZQ6A 3GLIA 4B35A 1OHHA 3WMEA 4AKEA 2BDTA 4Z8YA 3UK6A 1VMAA 1G19A 4E07A 4XVQA 1U99A 2Q0HA 3GJ3A 2AHOA 2QP3A 4OJQA 1KDTA 3J81k 4C4PA 5A5GA 4EPYA 2RGNA 4QJ4A 1II8B 1IN6A 1OW3B 1XB2A 3VR1A 4OJKA 5KDLA 4Q9JA 1BYIA 1L4YA 1WP9A 2ZRJA 1HH4A 1VCOA 5BN4A 2J0SA 1DO2A 1G8FA 2FJUA 2ZS9A 5EE0A 1DAGA 2A5GA 2BEJA 5FBRB 1HYQA 1AGPA 621PA 1A5TA 4U5XA 4DLYA 2YNMA 3I73A 3RC8A 4BLQA 4MGKR 3LW8A 2Q3MA 2CNWA 2R9VA 1R6BX 3F0TA 1IN5A 1IOZA 4NTZA 5FPYA 3AF3A 1QDEA 2DHRA 2OBNA 2WSSD 3KUDA 1OH5A 3GEIA 1E0JA 1FTSA 4HUTA 4I1OA 3O8CA 2A5JA 2ZE6A 3LAWA 1BKDR 2A5YB 1J8YF 1G8HA 2OM2A 4HSEA 4HLDA 1I2DA 1W1WA 4MKGA 4DSUA 2BJWA 2Z5FA 2NGRA 1K8RA 1J70A 4IOJA 1WMSA 1LF5A 2FE4A 4M8NE 3MWYW 4JT2A 1ZIOA 1TTTA 2O8FA 3O8BA 4M22A 5EXXA 1Z47A 1OXTA 4L4UA 3QPWA 2D2EA 4OYHA 5EUMA 1OXSC 2IWHA 2Q3FA 3WYAA 1PUIA 2Z4RA 1NVVQ 4KXFB 3CPEA 1IY2A 2RGBA 3RSOA 4DKXA 1YZTA 2WAYA 1Q1BA 3UATA 2DFKB 4ZDJA 3SJCA 2JIZD 3DMNA 2ANCA 3BFVA 4IVQA 2GRJA 1OFTA 1XCMA 4QJ5A 2P5TB 1YKSA 2B8WA 2IEYA 3U3MA 1W5SA 5C4MA 3BJIC 2O8EA 1QHHB 2NO9A 1II8A 1MRNA 1JQJC 1ZCBA 2HLDA 1ZUHA 1ZD1A 3SJZA 1TUEA 3WHKA 4KVGA 2B7CA 2ZSDA 4BFWA 1TPZA 5JJLA 1E2HA 4MUBA 4TL8A 1A1VA 5FOWA 2RH5A 2D7CA 2HUPA 1WRBA 1W48A 3A4LA 4GRAA 3QF7A 1LFDB 2O0JA 4YQFA 4QNMA 3ZH9B 2V1UA 3QKRA 2IHYA 2IYZA 4Q01A 1T6NA 2C9YA 2YVUA 4RY2A 5K8IA 1GKUB 3H0KA 5HKKD 1CXZA 2PMKA 3B9QA 3GLFE 3R8CA 1SHKA 3Q72A 1HUQA 3E1SA 3QPUA 1WDTA 4I1SA 4JLDA 5TY0A 1W4BA 3P32A 4A2QA 3U7HB 1CR0A 5HR5A 4PTLA 2PJZA 1DO0A 4TTRA 3U6KA 1G16A 1GTVA 5EQTA 1TNDA 5DHFA 4URYR 4IVRA 3CRW1 3K9GA 1BIFA 1LS1A 3I5YA 4WXPA 3LV8A 1YU9A 2BC9A 3KKOA 3QJYA 4C0LA 3ZS8A 3ZD7A 3P26A 3QQ5A 2NG1A 1UJ2A 3IQXA 2EFDB 1HV8A 4F38A 3GLGE 1TAGA 1BMFD 1D8TA 2ERXA 5K8TA 2GWHA 2IS6A 2JLQA 3K09C 2FNAA 4TLCA 4CF7A 4Q48A 5KSZA 1FOEB 3NG1A 2UZ3A 3L2OB 1GWNA 3RAPR 3KZ1E 4HUQA 4RKFA 2CLDX 5KNBA 4QM7A 1E2KA 3B82A 2WSSA 3E2IA 1NKTA 1XEXB 1T9HA 4ON9A 3VX4A 5TMPA 4BLTA 4PHFA 3K0AB 5D3QA 5AJVB 3UWOA 4A0FA 1NBMA 3LBIA 1S1CA 4P4SB 1H65A 5AR1A 521PA 4URVR 4XTCS 2HJGA 1TMKA 3LH5A 2LKDA 3PITA 3U2QA 1N6IA 5JECA 1QHXA 3VR3A 2VHUA 4D25A 3AV0B 4GZMA 2RGNC 4LCBA 3PENA 4C0QC 2R6FA 3U3JA 2BM1A 1RIFA 1IBRA 2QZ4A 1RYHA 2VP4A 1WQ1R 5LB4A 1CEEA 4HUQB 1WE2A 4FWTA 4D4MA 3RABA 5P21A 2NO6A 1J2JA 4HAXA 2GETA 2ZSEA 2ZJAA 1KSHA 3TR5A 2C77A 2ZIAA 2XTNA 5FBVB 4DSOA 4F4IA 2WZQA 4LYFA 1PLKA 2QROA 4MRRA 1ESNA 5D3MB 2ZRCA 1UDXA 3BAFA 3QG5A 2ZAMA 5SZHB 4V0OA 4BWYA 3BD9A 4LUCA 1OXUA 2BCJQ 4PPGA 1V43A 4US2R 2H92A 4NU0A 4F91B 3D31A 3NXSA 4BLRA 3Q7PA 4C9BA 4TZ6A 3IHLA 3TBKA 4XWOA 2BV3A 2NZJA 3BB4A 5KPDA 3L82B 1Z06A 4ZO4A 4B3BA 3BORA 5KSYA 2OESA 2IXFA 1JEEA 1NN5A 4M9QA 2G0NA 3D8BA 1GUAA 3AVWA 1QZXA 4JS0A 4TWZA 2CHVA 3RWMB 4F4CA 1OB2A 1U94A 1Q1ZA 2JLXA 2GVDC 1P75A 1G8YA 3MWKA 1WF3A 1Q12A 4P4TA 4DCUA 1OH7A 2PL3A 1II0A 4MYHA 5EP2A 4M9SA 3AVTA 5FOTA 4LHWA 1CR4A 3X1YA 5HZKA 2OFOA 5EXTA 1KSGA 2QTFA 1W0KD 3CX8A 2FH5B 1EFHA 2QU8A 3A1WA 3Q9LA 3L0PA 1RJ9B 5DH9A 4IXNA 2AKYA 5J47A 1DAEA 5TB5A 4LJ7A 3X1ZA 1SXJC 4G0NA 1E2LA 1GP2A 2IUUA 1AIPA 5HTKA 1XDBA 4TTPA 1MV5A 2HT6A 4IDHA 3TVDA 1QHSA 6Q21A 1AZTA 2RKOA 1KDRA 4K46A 4ZDWA 1UDWA 2V8OA 1XJQA 3FDIA 3PFIA 2F55A 1KTVA 4LV8B 1SVSA 2Q9BA 2H8KA 1E4VA 1G5TA 2QAGA 2MSDB 2V1XA 3IEUA 3IDQA 4RZUA 5KNDA 4D2IA 2EU8A 3L0IB 1FFHA 4BZPA 4PQYA 3REGA 5LDDC 3KTAA 2GAOA 4I4LA 2GDJA 3IQWA 4JLJA 1KZGB 1FX0B 3B8HA 2OBLA 2A3RA 2FFHA 3X1WA 1NJFA 2Q3HA 2P2LA 2WJYA 3GCGA 2E1RA 4V0LA 2N42A 4OHYA 2ZU0C 4OKSA 4US0R 1W0JD 2PZFA 2VHQA 3N2EA 4JLKA 2A7QA 1XPOA 3NIBA 1EFUA 2GK6A 2TMKA 3B6EA 5KDOA 2HYIC 2NIPA 1KDOA 2CCKA 3AGPA 1NVWQ 2IYVA 4LJ6A 3THYA 1XJ0A 1GSIA 4DLRA 4QHTA 3KKNA 2J41A 2PBRA 1IM2A 4IDPA 2ZRIA 1JB1A 4EQ6B 3EZFA 4XD7A 3EPJA 4TZ0A 2WJHA 4PPNA 1FNMA 4OHZA 4QC2A 1NVVR 3QF4B 1A2BA 3W6OA 1OB5A 3G0HA 2XJ9A 3BXZA 2CE2X 3TE6A 4DSNA 3ZIAA 3THOA 4BEJA 4RFVA 3TAHA 3CUEF 4DCNA 4CEJA 2ZE5A 1Z3IX 4ARZA 3KJGA 2PX3A 3LQRA 4CT4B 3IIJA 1K6MA 1JECA 1IN7A 1BH2A 1E2DA 1FP7A 2ZYVX 1QRAA 1Z0DA 1E2MA 3KXKA 2O8BB 4KFRA 4UKDA 3VHLB 1HQYE 2ZR0A 5CIQA 4HAVA 2OSBA 1RE0A 3K9HA 2OXRA 4S2EA 5K8UA 3C15C 3FHOA 1FNNA 2UKDA 4V03A 2DWPA 3T35A 1HURA 2J46A 4A92A 3A4MA 2WBLC 4UNRA 3MWJA 1Z2AA 2W00A 1R8SA 1CULC 2IUSA 2KB0A 1G41A 3TSOA 4HDCA 3VFDA 5IRCD 2IEZA 1Z5ZA 5C2JB 1KDPA 5EZ5A 4V0MA 3Q7QA 2FZLA 1N5JA 5EUQB 4ARZB 1VDZA 1Q21A 4LGMA 5GJVC 3SFZA 2VHJA 3VKHA 4BUJA 2YOGA 1N6OA 2A30A 1YZKA 4CYMA 1PVOA 3L0OA 5DIFA 5J4VA 4A2WA 5IK2A 2IL1A 1XTIA 2JJ8A 4QBFA 1F60A 3K0CA 4LHVA 2ZS7A 4YMSA 1OFHA 5FOSA 1W2HA 4TN1A 2VA8A 1VG8A 2PZEA 4EPTA 4DDWA 3EA0A 4KSCA 3AP1A 4RZ2A 4DLZA 2I1QA 4IEIA 2IK8A 1P61B 2WJJA 3BS4A 2QP9X 3KKMA 3T61A 2YYZA 1O3YA 3F5FA 3GFOA 4OQMA 1P5ZB 4B74A 4UJ5A 3W8RA 4GOKA 1DAFA 1KKMA 1XNJA 2I1VB 3TUZC 3NHAA 4AY2A 4I81A 2YV5A 3W8NA 4BFSA 4W7SA 1XMIA 2V7QD 3K0EA 2ZQ5A 4JKIA 4WAUA 4DWJA 5E7JA 1IAQA 4JLVA 4LPSA 3MFYA 4C0BA 4E22A 1N2CE 5L8VA 4LBZA 4TQAA 3RS2A 4Y0VA 1ZM7A 4QBGB 1QVRA 3H84A 4UNSA 1E9DA 1G6HA 3I62A 1U8YA 2D62A 1ZYUA 4PO8A 2EFCB 3AVQA 3M0EA 4B3GA 4AKHA 1GNQA 3UG6A 3LLMA 2ZI6A 2BMFA 4KV9A 5TDHA 1BS1A 1GITA 2BOVA 4JBYA 2BJVA 4M9ZA 4YMVA 5GVSA 2H57A 4TMZA 1FTNA 3MCAA 4M9XA 3K9LA 4DEXA 2JAQA 4IDQA 4B2IA 4E03A 3IPYA 2BWJA 3TGPA 2WJIA 3BC1A 3NKVA 1SKQA 3HYRA 3FPAA 3K1JA 4C0HA 4DC9A 4AYWA 4QFMA 2ORWA 1NMZA 3PEUA 3WNDA 2ONJA 4Q1BA 5KSPA 3L8YA 5BYJA 4PQRA 3K0FB 1FP6A 1S8FA 1DAIA 1CJKC 4LV5B 2QT0A 4HI0E 3ZVLA 2IYSA 2OLKA 4GT1A 4G1UC 1TUIA 3UMFA 4Z54A 5B30A 1JJVA 2IYWA 2D74A 4URZR 1P9NA 4TLBA 1Z6YA 2CL0X 5J40A 4BFYA 2EYQA 3BH6A 4CGZA 1RRGA 5DI9A 2QMOA 2ZRKA 4A8JC 3PVSA 2QAGC 2GCPA 4NL4H 1T3HA 1YJ5A 3CR7A 4FMBB 1NL3A 2R6DA 5SZIA 5TV2A 3SHFA 3TH5A 3W5IA 1KI2A 5J4HA 2HEIA 5A4JA 1L8QA 4EFMA 5KTYA 2JJ2A 2J45A 4HLQB 3VTKA 4JLPA 4YMTA 1DADA 2VSXA 1E2GA 2CHGA 1KI6A 3KB2A 2VYFA 3BWDD 4CT5A 1DAMA 4LYAA 3SR0A 1AKEA 3CM0A 1E2IA 4ZCIA 3NH6A 3U5ZB 4R7ZA 1YZQA 3LA6A 2IXGA 2J5XA 2OCBA 1N3BA 2QPTA 2YJTD 3BFXA 4HYYA 2C95A 2EFEB 3O8DA 3N70A 2GZDA 3CH5A 4HATA 4PC6A 4TQUS 2J0VA 2PLRA 3C41J 2ZE8A 3GJ5A 1SVWA 3QPVA 4JVSB 1OXXK 3LX8A 5CITA 4GOJA 2O8DB 2QGZA 2ZR9A 1SQ5A 2OUKA 3QXSA 5CYPA 4X8MA 3MUFA 1GDDA 1FZQA 2CK3A 4JT4A 3KQUA 1GNRA 3CONA 1VTKA 2IF0A 2ZUCA 3EIHA 1E99A 4RD2A 4CIDA 4H1VA 2C5LA 5DNYB 4XOIA 3TKLA 2WWGA 4LC0A 3I92A 5KU1A 2ZI4A 1N0VC 1NVUQ 4WXRA 3CPHA 1Z0AA 2AXPA 4AURA 1M7BA 2XGJA 3SNHA 2O8EB 1U8ZA 1KNXA 2D7DA 3REFA 2FEMA 1UBCA 5DGXA 3NEJA 3U44A 2ZUBA 1EESA 4LJ4A 1BOFA 2ZETA 1CS4C 4QJ3A 5A0FA 4OI2A 5SZKB 5AJZA 2IHBA 3K09A 3RHFA 1E1RA 3K0SA 3CX7A 4QGFA 1ETUA 4IRUB 1XEXA 1RRCA 2FGKA 3MGCA 1N6NA 2GESA 5L3RA 5BXQC 1QVAA 2W6IA 4XH9B 5HE8A 3VU9B 1I2MA 4DLTA 3IEVA 2O0KA 4NCKA 1MO3A 3UIEA 5F3WB 1IXRC 2N1BA 3A1SA 4A8JA 2QTVB 1C1YA 4IW3B 4PZLA 1KK1A 1ZD8A 4RD4A 1RRPA 2RHDA 3IHWA 4OK3A 1XEWY 1YZNA 4PHTA 1KO5A 2W2XA 1W47A 3S1AB 2N46A 1XXHE 5EZ6B 1XCGB 4M1WA 2QT1A 3ADCA 2DWQA 1NBME 4CW7A 1E2EA 1UKVY 4OL0A 2R44A 3MLEA 4FMDF 4D0NA 1MOZA 4A82A 2BMJA 4DZZA 1UKEA 5L3QB 5SZJA 4EJSA 3MMPA 5EE1A 1N6KA 1TQ6A 1XD2B 3WRXC 3RYTC 3AVXA 3THXA 3QXCA 2QL6A 2JLSA 1OLOA 3VU9A 1R5BA 4TLEA 1X1SA 4AD8A 4DLVA 2NPIA 1G3IA 3TLXA 3WBKA 1P3JA 3WNCA 3VX3A 4OQFA 2ZJ8A 4NE2A 5KUTA 3QOFA 2YKGA 3UMRA 4CEHB 2WOOA 2YWEA 4Q4HA 1G8PA 1D5CA 4LJYA 3L43A 1LS6A 4QOSA 1Z28A 3OF5A 4PQFA 3T1OA 4DDTA 3QKSA 4KFUA 4AIIA 1U0LA 2XSZD 3QEJA 4RFSA 2ODNA 4RVCA 4KU4A 3SQXA 1J7KA 1FX0A 4AK9A 3RRNA 5M04A 1W0KA 3AGQA 4Q9KA 2VSOA 1VPLA 2B21A 3BIFA 3K70B 1NIJA 2RAPA 2QQ0A 4N1AA 3OIVA 2BVNA 2G6BA 1G7RA 4S35A 3SJBA 1DE0A 5FI0B 2ODBA 3B2EA 1ZMXA 4L9WA 4TT3D 3QKTA 4EPXA 1JAIA 4NKRA 4KVAA 4DCSA 2WV9A 5IDVA 3EASA 4ACBA 2QQEA 5D3MA 4AI6A 2NTYC 2KWIA 2WKRA 4GZLA 4A4DA 1RYFA 5G41A 2X8AA 4HB2A 4IJMA 1RPZA 2JIZA 3V4RA 3AVYA 1W7AA 1M1YE 1XTJA 4M1OA 1FW6A 1CJVC 1NP6A 4BZQA 1KK3A 4PZZA 4BFUA 1YRBA 3A8TA 4PAMA 5EP1A 2XNSA 4DT1B 1KI6B 1OF1A 1EFTA 2DFTA 1T0HB 3I61A 4MITA 3NH9A 4TYPA 3EX7C 4D6PA 4I1VA 3OE7D 2MSEB 2WVJA 3ASZA 1BMFA 4DSTA 1EWQA 2YC2C 4R2HA 5FTLA 1YHNA 1QBKC 1Z0KA 1Y63A 5C1BA 2ZRBA 4IFBA 1D9ZA 4EIWA 4HLUC 4A6XA 2R8RA 4Z8XA 5L3QA 2OO7A 1HY3A 4D82A 1G3QA 2VP6A 2AXNA 4Q7KA 3DO6A 1T3SA 1NKSA 4BRUA 4GDFA 2IWRA 5J5CA 3WMGA 4B48A 3GJ8A 4PO1A 4B76A 4AC9A 1Z0IA 3BFKA 2WTUA 1J8MF 5DN6A 3QXHA 2P6NA 3NBYC 1P9RA 1YR9A 2NO0A 5FTJA 3VQTA 2J0UA 4P0TA 4POAA 4V0ME 3LD9A 2GA8A 1YR7A 1ZRHA 3PUVA 5FR1A 2CNWD 1KO1A 1G5PA 2W0MA 2IX3A 2YZ2A 1SHZA 4JVMA 4Q9IA 3WYFA 2PLFA 1W46A 3OIYA 3AVPA 4NYJQ 3SHWA 3ZZ0A 4DT1A 2CVFA 4R71A 3K70D 1OH6A 1IY1A 1DTSA 1FL9A 1OKKA 2ZYUX 4NMMA 4Q00A 2O8FB 3R8FA 4NHOA 3TRFA 1ZNZA 1XEWX 3LBNA 3MSXA 4MKIA 1XPUA 5JRJA 1V5WA 4LX0A 1W2GA 3ZDQA 1S3SA 2FV8A 1FUKA 4MKFA 4U00A 4ZCLA 2OILA 2VP5A 2GXQA 1TEVA 3FMPB 3HYTA 4KHZA 1ZU4A 4E5UA 2GXSA 3K53A 5DN6D 3W6PA 2MSCB 4W9MC 1JI0A 1AKYA 3ICEA 2WOJA 1KGDA 2BBTA 4FXPA 3W90A 3GJ6A 4B73A 3MJRA 1ZUNB 3OFND 1NVXQ 2CJWA 2PCLA 1IXSB 1F2UB 2JLZA 2V4ZA 4DB4A 2C8VA 1E98A 2I3BA 3KB1A 2XEXA 4JLMA 2ZXUA 4JSTA 1DELA 1ZM4A 4NBSA 2BBOA 4ASUD 3W5JA 2H1LA 3NBFA 3VR5A 2W83A 3KQLA 4YDHB 1Z6AA 2AL7A 8OHMA 2C78A 1MO6A 4CEIA 2JJ2D 1Z83A 2GTPA 2CDNA 2JLVA 1CJTC 1IXZA 4ZKEA 3QY0A 3ECCA 2IC5A 1G20E 3FE2A 4HZUA 1O87A 2UVQA 3U7GA 5CJ2A 2REOA 2XZLA 1TQ4A 2EQBA 4ZV4A 3NBXX 2WIAA 2Q9AA 1X8LA 3U4QB 4TSFA 5L3SA 4OHXA 4P31A 4TMWA 1M34E 3BK7A 1W36C 1VCIA 2C9OA 4BGDA 4EFNA 2JLWA 1X1RA 2DCUA 2R6AA 2F43B 4MGYR 2HLDD 4QBHA 4XWKA 1IQPA 1RC8A 2GJAA 4CEIB 1E9AA 4DUGA 3NDBB 3X1XA 5JHHB 2X2FA 1KI4A 3PUYA 4B47A 1VYUA 3A1VA 2ZRPA 3RRZA 4M21A 1NN1A 4ILEA 5FBWB 4QGGA 1AM4D 4LZZA 1OPXA 3EPHA 3BH7A 2O8BA 4DCTA 2ZRDA 3NC1C 3OEED 4LI0A 3EPKA 1T8TA 1Q1QA 5AUNB 2G3YA 2Q6TA 2ZPTX 4Q03A 5DLQC 3MJHA 1VKJA 4GOXA 4C7OB 3EARA 1FPMA 4C0JA 5L3SB 3HU2A 3QENA 3W3ZB 1KIMA 3KTAB 5KSOA 2REXB 1VECA 3KQKA 3OAAA 3QG1A 1Y3AA 2FSIA 1E9EA 4LHXA 2QM7A 4QL3A 2G1JA 3IO5A 4MUAA 2HDNB 4ESHA 3SJAA 2V7QA 2J0QA 2VO1A 5DHAA 5TARA 3WYGA 1PJRA 4URWR 2IUTA 3RWOA 2IYXA 4XTRA 2FSFA 2FOLA 5IHPA 2IYYA 2KSQA 3AP3A 4C7OA 4UXIA 5KDDA 3HJNA 3I8SA 121PA 4PC2A 2BIFA 4MYUA 3LFUA 2J1LA 5EJEA 4NZYA 2F7SA 1E9BA 2V6IA 3NC0C 4FD2A 4K8OA 5JJKA 1WBBA 3UKDA 2ODWA 2B8TA 1XD9A 4M1TA 2AFHE 4MGIR 4UNNA 3B9PA 3AKYA 3FFAA 3U3KA 1Q44A 4WVFA 1C4OA 3CBQA 3NVAA 3PQCA 1US8B 4RD1A 1S4QA 3LX5A 4N3NA 1U8AA 4O2LA 1K5GA 1SXJB 4GP6A 4CVNA 1KSJA 4PC7A 5TXGA 1HE8B 2CHQA 1L2TA 1YZUA 4BFZA 4L9SA 4BFXA 4HAWA 3KXLA 4WZ6A 2EFHB 4ZDIA 1GM5A 5G53C 2CE7A 3SFVA 3ZVMA 4HZIA 1XX6A 1QHNA 3ADKA 1HQCA 2CCGA 3HR7A 5CK5A 3QVUA 1R10A 4B3DA 1W44A 5BN5A 4XSGA 4JSYA 1E6CA 2B92A 5FOVA 4CZ2A 3GLIB 2HF8A 3E5HA 2ZAOA 5G3ZA 1ZBDA 2W0SA 1HT1E 2P0EA 5FUVA 1P7CA 1OIXA 4JLBA 4PC1A 5E7MA 3W9YA 2GAAA 3B60A 1E32A 2OZEA 1AQYA 1OXVA 3GEHA 5FUYA 4JLOA 2OE2A 4LHYA 4BLSA 2WWWA 2JATA 3H1TA 3E70C 3ZS9A 4BLOA 2ZTSA 2AR7A 4GNKA 1E96A 2GCOB 4KLZA 4Q47A 4IXMA 2GZHA 5J4LA 1ZM2A 2IS2A 3TQFA 2EYUA 1G64A 1MT0A 5B58C 2J9RA 4Y0AA 5C18A 1IY0A 4BRWA 4Q1DA 1XBTA 4HLCA 1KZ7B 2WM9B 5JHGB 1PLJA 5KOYA 3RC3A 3BRWD 3PIRA 3QKUA 4IDOA 4XJXA 5B57C 1P2VA 1KAGA 1YE8A 3R20A 3D3QA 3SYLA 2FDCA 2QNRA 1ZNXA 2IYRA 2ZJZA 3SBEA 3AVVA 1E9RA 4PAOA 3IUYA 2DFLA 3KJHA 2ZRNA 4TLDA 3B5JA 2V54A 1LF0A 4V0KA 5AWFC 2Z43A 3FKQA 1II9A 2RCNA 2YWFA 4KO8A 2YINC 3EW9A 2WMNB 1E69A 3RSLA 3EZ9A 4H9GA 1W4CA 2WPDD 1E1QA 2VP2A 2F1HA 4NCNA 4TMXA 3RS3A 2OLJA 3B1YA 3KKQA 4OK5A 3V4FA 4YLGA 3QBVA 4BECA 4FMCB 1QHYA 4X8LA 3HR8A 2PZGA 1H8ED 2W6ID 3GFPA 4IOKA 4MYCA 3ZVRA 3A1TA 2ZRAA 2ZRGA 1VIAA 1TF5A 4AG5A 4ESVA 1M74A 3D7MA 3Q85A 4JYBA 1F6BA 1WXQA 2VF7A 3AF4A 4BASA 4PHGA 4A0RA 4NDZA 4LJ8A 4UXJA 1JXMA 1VIYA 3K0FA 3AF2A 2QE7A 1G7TA 2FPLA 4IOMA 4C0KA 4DBLC 3TK1A 5JJIA 2BEKA 4HB3A 1Q57A 3EIEA 4B3XA 4EDHA 1CIPA 3M1IA 2Z83A 3CH4B 2F9LA 2ZROA 1W5TA 3OZXA 1M6NA 4ITRC 4MRPA 2P5SA 4HDOB 2REBA 4JL5A 4DDVA 4Z1MD 2YWGA 4G5GA 3PUZA 1GILA 2AD1A 1P60A 2J0UB 2FZ4A 4G5SA 2XOKA 2ZREA 1Z2CA 5JS8A 5GJBA 5CK4A 1PZNA 3THWA 2OXCA 3TJZA 1X8KA 2QPOA 2GXUA 2QBYA 3FHTA 1IHUA 1KO8A 4GPTA 3HU1A 2XB2A 3ZZUA 1SZPA 3FKSA 1G5RA 3U3OA 4D4KA 2W58A 2HCJB 4WW0A 2FN4A 3GFTA 2O52A 3ND9A 4D80A 1I4TD 4KYUA 2GKSA 4MRSA 5CYOA 1VHTA 5AUOB 5EE3A 3T1QA 3DL0A 4LWZA 2XXAB 5E4FA 3CO5A 1XD2A 1LW7A 3ZZTA 2KJQA 4W5HA 2AD5A 4Q4JA 4Z1MA 3C4JA 3LO5A 1AJEA 1S96A 1JPNA 2JGNA 1G3MA 4BLPA 4WA7A 4KYIB 1QF9A 2C96A 3F8TA 2AKAB 4W5WA 5F9FA 1T5LA 2OFXA 3BH0A 2AWNA 2L0XA 2WKPA 5LPNA 3ZIAD 1KI3A 1Z6XA 2FGJA 2QTHA 2QBYB 1UKYA 2VL7A 2GCOA 2ZRFA 2QP4A 4QHSA 5AK0A 3JZMA 2Z6VA 2QE7D 1YR8A 4XD7D 1NBMD 1ELOA 3QIAA 1CLUA 3R9WA 5F9HA 4IDNA 4RZ3A 1DG3A 1KO4A 1NNEA 2DB3A 2RB4A 3LXXA 3NTUA 1K5DA 1NMXA 1XMJA 2GCNA 3SYKA 3GLGA 1QHHA 1NLZA 1VYVA 3T34A 5JZVA 5JEDA 2ZJOA 2A78A 3P20A 2D2FA 4WZAE 3K9NA 1LNZA 4OI1A 2QPAA 5H8WA 2PH1A 3S1AA 4R9UC 1YR6A 5JRZA 2QI9C 4L15A 5EP3A 4ZIRA 4QGHA 421PA 3GP8A 3I72A 1E1QD 1LVGA 3BERA 4RD6A 2NOAA 1PV4A 2QORA 2A5DA 3TAUA 1VG1A 1W4AA 3BGWA 1XXHA 5FL3A 5HCNA 1E0KA 3FMOB 4EJSB 5KNCA 1IJFA 1GFIA 3I8XA 1G291 3SI7A 2MMCA 3X2SA 5HKKA 2YOHA 1XEFA 1DVRA 3UANA 5B2ZA 1NG1A 2J7KA 2Q21A 3GLGB 4RSGA 2YOFA 3C5HA 2ZJ2A 4TQ9A 1P2TA 1XF9A 1QG4A 3C16C 1VG9B 2ODEA 1QG2A 2IYQA 2R6GA 5FOUA 3VR6A 1BYUA 1SVOA 2WJVA 1SVMA 4Q7MB 2OHFA 2JDID 3UMSA 1X6VA 1UF9A 2P6RA 2ZJYA 3QBTA 2JASA 4KFSA 4M1KA 3V9PA 4D0GA 4U7DA 1UAAA 3V00A 2ZI3A 4V02A 1SKYB 3BB3A 1YRAA 1DARA 1G8GA 2D3WA 3VR4A 1OHHD 3HPQA 4F7WA 3GJXC 1P72A 1T4GA 1G7CA 1UBEA 3A58B 4QXAA 2VRWA 2VPPA 4CEHA 3RANA 2CK3D 2BMEA 1N6RA 4DXAA 1G3UA 3OHMA 4M1MA 1GIAA 4II7A 4KJZA 1A82A 1ZNYA 2D4HA 3OE7A 1NG9A 2F43A 4ZIRB 3CF2A 2F1JA 5J4KA 1G1MA 2E87A 4B3CA 2RMKA 2H5EA 2DY1A 4U02A 2DR3A 1Z29A 2OEPA 4B71A 3KQHA 1Q20A 4MA4A 1ZIPA 2FX3A 1RVDA 4GL2A 3ZQJA 1OFIA 4GP7A 3VNVA 3TSWA 1TX4B 4YXWA 1NN0A 4ZPXA 5B64A 4US1R 3ZLJA 3THYB 2XXAA 3QEOA 5BYKA 4BFVA 3DMDA 4GSYA 1KO7A 1NF3A 4A1FA 2QSYA 3AUXA 3CZQA 4Q4JB 4RD3A 821PA 3OESA 2C03A 4IHQA 1JR6A 3NDPA 3C14C 3KFVA 1ZJ6A 5JCZA 1Q3HA 3U7EB 2GVZC 2VH5R 4TMVA 1N5KA 5FTMA 3RRMA 3EG5A 2JDIA 5BWMA 2H16A 3B7GA 5AJYA 4Q9LA 5GJCA 1B23P 2BCGY 4OQNA 721PA 1IN4A 1OIWA 1CJUC 1OYYA 2CLCX 1MKYA 1E9SA 1I4DD 3AKEA 4PSAA 1KJZA 1P6XA 4YMWA 4A6PA 2HF9A 4M0LA 3DPUA 5EE5B 1IN8A 1TQ2A 3RLFA 3A6PC 4ZCMA 1ZCAA 1JR3A 3FHCB 3CPJB 4RJLA 5UKDA 4M4SA 3AF1A 1NY5A 3CWZA 1XTSA 4DHEA 4R2IA 4RCZA 1ZU5A 1E0AA 2ONKA 3LBHA 5FR2A 1DBSA 5G3YA 2CJWB 4UQOA 2IT1A 2O5VA 4HAZA 1DS6A 5FPTA 1VCNA 4FN5A 3BE4A 2QEQA 4B75A 3AVUA 1KSFX 2HV8A 2ZS8A 4OBEA 1CRQA 2DWOA 4FMCF 1E9FA 4M1SA 5FOXA 4LV6A 1RJ9A 3SE0A 2V9PA 4LDJA 2G9NA 5AJXA 2O8CB 5KO2A 5F2EA 1ZC4A 1J90A 2FSHA 2GJKA 1E79D 4QHYA 3L8ZA 4L8GA 3GD7A 2ORIA 3AKDA 3T06B 2AWOA 3SEAA 1S0UA 4KAXA 1R7RA 2RGXA 3SOPA 2XITA 1EFRD 2GBLA 5G40A 4YDSA 4KBFA 4FMDB 4EPVA 2A5FA 2F9MA 2F3TA 3GLHB 2JLUA 4PHHA 4BQSA 2VP0A 2CVHA 1AGRA 1F5NA 3ND8A 2QMHA 4DRZA 1F2TB 2Z4SA 1COWD 2FMXA 2W6JD 5KPJA 1UBGA 3CB4A 1UEJA 3LDAA 1B0UA 4LYHA 4Q1AA 4B2PA 5DE3A 1JXOA 3SDZA 3F3YA 5C4GB 3Q5DA 5FBQB 2O8CA 5CM8B 4UNQA 3AF0A 4W5JA 1JAHA 2J7PA 2GEDA 4FCTA 1F3OA 5LD2B 1S9HA 3EAQA 4LY6A 3RRYA 3Q5EA 1KK2A 4IVPA 1IONA 1ZP6A 2VBCA 1W36D 4QRHA 4QG7A 2OV2A 4YXWD 2NO1A 1JR3E 4IOLA 3ADBA 1U90A 4KITB 4F4JA 4D4JA 3OAAD 3KJEA 4DLWA 2WJGA 4A15A 1EK0A 1OFUX 5JS7A 2VSFA 3P27A 2XAUA 5F98A 3AQ4A 1AZSC 1JPJA 1KYIA 4M2LA 3CLVA 4G3XA 1ZW6A 1NSFA 4EQ6A 1N6HA 2OT3B 3KXIA 3W6NA 5FTKA 1RZ3A 4DB2A 4EUNA 4C0AC 2H17A 4ASUA 3IILA 4IKEA 2XZPA 4UJ3A 3AUYA 1KI8A 1AA9A 2W2VA 2P6UA 2BBWA 3I1FA 5FUXA 4Q4AB 4NH0A 3TR0A 2XNDD 1PLLA 5FPHA 3LLUA 3OFNA 3ONWA 3EZ7A 4NONA 1E94E 3TQCA 2ZM5A 1EX6A 2FG5A 4KODA 1CP2A 1E2PA 4UXHA 5FH9A 3CIOA 3B85A 1CR1A 1G3RA 2ZRLA 4RCYA 4MDEA 3W34A 1T3LA 1NIPA 3DEFA 2G88A 3DOFA 3QE0A 2XJ4A 1ZD9A 4ZI3A 2ZI7A 3PG5A 1ONBA 2G83A 2ASEA 2WSMA 3NWJA 5E95A 2WWHA 3K0CC 1YVDA 1VCMA 1XD8A 2ZI5A 3GJ0A 3A1UA 2OFWA 1N25A 1NLYA 1ZUIA 3SYNA 4JL8A 4Q1CA 4DEYA 4XVRA 1XTRA 5KYKA 1M7GA 1DG1G 4O0MA 1LTQA 2OAP1 2QN6A 2ZRHA 1DOAA 2NPFA 3AKCA 4HAUA 4DLXA 1UM8A 4Q4LA 2VIIA 2A2ZA 4JBWA 1G9XA 1NJGA 3A36A 3I32A 5IK2D 3Q8XB 2QRZA 4JLNA 2QAJA 1KAOA 3O47A 4EPWA 4TL7A 2YC4C 3SN6A 2ATXA 5EXPA 1W0JA 3IIKA 1R0YA 3WP0A 5FI1B 2G1KA 4PX9A 1QHIA 1KMHA 1TU4A 1GOTA 1N5LA 3CX6A 3WP1B 4FWIB 3GJ7A 4DJTA 3CNLA 5DO9A 3G5UA 2VF8A 4F92B 5JMTA 1N0WA 2AK3A 2BHRA 1UADA 1LY1A 2XTZA 1JQLB 4A9AA 2FU5C 3DZ8A 2XZOA 1EFCA 1KI9A 3H86A 1RKBA 1KJYA 3TSZA 3JZAA 4V0NA 1RFLA 2K5UA 1TQDA 5L3VA 1SGWA 2VEDA 1KKLA 2ZJ5A 2NZ8A 3CNNA 3GLFA 1CR2A 1ZC3A 2DPXA 3CKLA 2SHKA 3EC2A 2GXAA 1GAJA 2V55B 3UPUA 4BPBA 2FPMA 5GVRA 1KI1A 4ABYA 4B33A 1CRPA 3CF0A 2QRNA 1Z08A 1KMHB 4NCHA 1TF2A 4NYJR 5H1YA 1JALA 1DAHA 2IF2A 3TUJC 4OHWA 1F2TA 4WZBE 4LBYA 3RDPA 2BMDA 4M1YA 4DCVA 2BBSA 2VQSA 2HCBA 4NCJA 4JLAA 1L4UA 3FWYA 1ZNWA 2OBMA 1OT3A 4TL9A 2QSZA 3AB3A 1XXHB 3T5GA 4Q1FA 1Z8FA 1I4LD 4CEJB 2W6JA 1WA5A 3C7KA 3KL4A 3M6AA 4PR0A 4OI0A 1D9XA 2IYLD 2QGNA 1S2MA 2YHSA 4C0SA 4EAQA 3PCRB 2V3CC 1ODFA 4URXR 2G0TA 3NBZC 2DYKA 1A4RA 2EWWA 2F1RA 2HXSA 1E4YA 3U61B 4YMUA 3W3AA 3AM1A 2CBZA 2LWIA 3Q3JB 2ZANA 3RS0A 2IXEA 4LRWA 3I4LA 4JBXA 1HA3A 2WICA 1E2NA 1WCV1 1WB9A 1T91A 3OEHA 1NRJB 4NYMR 4QBIA 2GEVA 4G5RA 4Q1EA 1M2OB 4TMTA 5LD2C 4TMKA 3IBYA 4FIDA 2C98A 1ESMA 1NMYA 1GRRA 3MRSA 2XOKD 3HWSA 5C46F 4GI7A 4CRWB 3CW2A 4MQBA 1R5OA 3R9XA 1U81A 3SC3A 4MRNA 4Q7JB 3SU8A 3VKGA 1RRFA 3ZJYA 2ZVPX 1SKYE 3JVVA 2BM0A 1LB1B 3LWNA 1SXJA 2YWHA 3R9IA 4QKQA 2IBMA 4J0QA 2CXXA 4JIMA 3GMTA 3B1VA 4A8JB 4TYYA 3KQNA 1W36B 2IW3A 1TF7A 4PANA 4B44A 4OK6A 5DSZA 2A9KA 2KBFA 2RGGA 3CF6R 5FL7A 1S3GA 1ZM3A 4DLUA 3PUXA 1NY6A 1FQJA 2XSZA 4B32A 1UKZA 3U7FB 4LBVA 1P4SA 1MO4A 1OJLA 1GRQA 4LJ9A 2AK2A 1ZVQA 2FFAA 3EC1A 4BE7B 3QKRB 4M53A 4A0HA 5CLQA 2GEUA 2I4IA 1GZSA 3O8RA 1DEKA 1H8HA 2WWIA 3THXB 1T0JB 1CTQA 3U6BA 2F3RA 1GG2A 4DIEA 1E79A 4BEBA 2QMEA 2WMOB 2P67A 3DM5A 3FVQA 4OHVA 3ASYA 2WKQA 3DM9B 3MD0A 4RFSB 2PT5A 4TLAA 1Q3TA 2QA5A 1VG0B 1ANKA 4HEJA 4NPHA 3VNUA 4JVNA 1Z07A 2WPDA 4LPKA 4OQXA 2RHMA 1EXMA 1OIVA 4YONB 3CWQA 4EJSC 3RS5A 3TW8B 4R98A 1W49A 1KI7A 2VLIA 4HDQB 2ERYA 3WMFA 4C2TA 2JJ1D 4P3YA 1CF4A 5K8LA 2WWYA 5H68A 4EPRA 3FYHA 2ANBA 3KX2A 2ZYWX 4ERNA 1R0ZA 2D06A 3DKVA 4LHZA 3VAAA 3DVLA 5BN3A 3AH8A 4F93B 4NYIR 2QM8A 1Q1EA 3K70C 3TNFA 4FCVA 4TYQA 3JVUA 1H8HD 4A2PA 1FQKA 1GVNB 1P9WA 1XU4A 1Z0JA 2IA5A 2WHXA 4L16A 1GL7A 2ZSBA 4Q02A 1HTWA 3DOEA 3UXMA 4KFTA 3T15A 3FMFA 3GLFB 1NN3A 1DAKA 1YZGA 3G82C 4GMDA 3DKPA 4LSGA 4LOAA 3MWLA 3PXGA 3IGFA 4I1UA 5EP4A 1Q0UA 2IYUA 3FFBA 3IIMA 2W2TA 1GRNA 1DPFA 5AUPB 4L5BA 3GJ4A 3L0SA 4AKGA 4IFEA 1ZAKA 5FL7D 1XTQA 3H2YA 5FFMA 4DUGD 1HT2E 5CDFE 2GJSA 2ATVA 2P65A 3ZGXA 2CL6X 5BW8A 4KLNA 5DYGA 4B2LA 3IBGA 1G7SA 3U44B 1CJMA 5HCIA 2WWFA 1HE1C 2LKCA 1SXJD 1SULA 3PR1A 3KKPA 4NCIA 2PEZA 1GL9B 4TSFD 3BBPA 5E7IA 1XP8A 4LK2A 2KE5A 4BFTA 3LNCA 3TMKA 3GLHA 3I5XA 1XFAA 3DHWC 3TUIC 4ACAA 2EVWX 4DIDA 3EPLA 2R6CA 2ZRMA 4JMPA 4XSHA 4Q4HB 4FW9A 5DI3A 1E2QA 2FFBA 1UFQA 4ZKDA 2JJ1A 3QF4A 5CDFA 1S9DA 3C5CA 1LV7A 3RS7A 3RS4A 1G17A 4G01B 2CL7X 2ZE7A 4DDUA 5EXSA 2EFGA 221PA 2HJVA 2GZAA 3EXAA 4MH0R 4KSBA 2KBEA 1R4AA 5HZHA 4WOPA 3OIUA 5BQ5A 3KUCA 2AX4A 3CRMA 2ORVA 2ZI9A 3K8YA 3KFXA 1KK0A 1W4RA 5GADl 3LQQA 3LVQE 4EFLA 5AUQA 2OAQ1 2VHTA 2NMVA 1TL7C 5DI3B 2DFNA 4TYWA 3P4XA 1E1RD 3B13B 3LRPA 1KOFA 4P4SA 1QHGA 2NO7A 3THWB 2Y8EA 1F2UA 1D2NA 1RW4A 2J3EA 3P4YA 3HU3A 3FTQA 4A0GA 4PAQA 2QG6A 5JI3E 1M8PA 4QNRA 1G6OA 2MMGA 1CKEA 1F48A 3MAAC 2F6RA 3B1ZA 1E2JA 1AK2A 3NEYA 4HLUA 1XZQA 2E9SA 5JFGA 1KHTA 3MG9A 2C04A 1T5IA 4RZXA 3DDCA 4N0EA 4C3ZA 4EKDA 1XZPA 3AEZA 4Z51A 4KBGA 4GFDA 5JBQA 1N6PA 3FOZA 4YC7A 3HP1A 2CMKA 3K0AA 5TVKA 4O3MA 5JLJA 3A37A 3U4QA 3T5DA 4HZUB 3ZD6A 1E2FA 3EZ2A 4TTQA 1P73A 4X8OA 3WHLA 2XNDA 3CZPA 4LBWA 2FF7A 5HE9A 4JJKA 1EX7A 3CR8A 1D2EA 2QAGB 3H4MA 3OEHD 3RVBA 3ZVNA 2FPKA 2EWVA 1SVIA 1FUUA 2ECKA 4E09A 4LJAA 1Z6TA 2C2HA 1Z6GA 2ZITA 3AVOA 3B1XA 3QVVA 4D0LB 4RKEA 2C99A 3OEEA 4JYCA 4LC1A 5CLLA 4PXAA 5JWRA 1GKIA 2QMUA 1Z22A 1KNQA 3FB4A 4MKHA 3VR2A 5CB6A 2RGEA 4TYNA 2VP9A 1A2KC 3A4NA 1ZM9A 2NQ2C 3PEVA 4D26A 1MRSA 2DBYA 2XB4A 1OSNA 2X77A 1OV4A 2GHIA 2IS1A 5ELXA 2GBLC 1AN0A 3P1JA 4PZYA 2QUZA 1YZLA 1JJ7A 1R2QA 3PV0A 5AJWA 4Q5IA 4QM6A 4NYMQ 2EW1A 5JCPA 1R8QA 2X2EA 3LXRA 4K81B 3GEEA 2ZVQX 4TT3A 4C2UA 2B6HA 1P2SA 5CM9C 3HDTA 3KDSE 5FUWA 1KY2A 3PEWA 3VHXA 3IPXA 5JWOA 2C9CA 4FINA 3LVRE 2UZIR 2JLRA 4PSVA 1TEXA 2GILA 4RD0A 3ICQB 3EA5A 1TU3A 2PMDA 4P32A 4WIAA 1MO5A 2VTKA 1EG7A 1R0WA 4P4UA 5KHOC 1PUJA 3QNUA 2WAXA 3CRRA 1XPRA 2FFQA 3UG7A 2X1VA 1P2UA 3WBJA 4AYTA 2HXYA 4LYJA 1C9KA 2QENA 3R7WA 2X19A 1JBKA 2Z0MA 2CEAA 2FA9A 2CLSA 2LCFA 2RGDA 4XVUA 3ETLA 1XWIA 1OYWA 1OH8A 3VKWA 2XX3A 2ZEJA 5LBIA 3T1VA 1S1MA 1E3MA 1NI3A 3SS8A 3QXXA 1P62B 1XMVA 1AS0A 4B3FX 1UPTA 4GMXA 2IS4A 3FKSD 3FGNA 2KI5A 1J99A 4BZXA 4AKIA 2R65A 4KI0A 2RGAA 1HEIA 1XJCA 4MRVA 3HPRA 4KCGA
chains in the Genus database with same CATH superfamily
3LXUX 3KJIA 3HNPA 1R0KA 4PC3A 1XWFA 2YN2A 3DBOB 5FWDA 1C2TA 3WNBA 3C5EA 5EIEA 3LGAA 1LU9A 2VG8A 4HC4A 4EY6A 1B6SA 1UM9B 3VMFA 4E2WA 1Z62A 3VBEA 1XLVA 4LF8B 1YDHA 2HOQA 1XRQA 2G77B 3BWCA 1SHUX 3EQ6A 4Q19A 2GGSA 4FCWA 1JBEA 2G5TA 4N54A 2NVOA 4XASA 2YL2A 1MH1A 4FI3C 2G1PA 4N0DA 1FMLA 2G17A 2PEYA 3AP2A 3FBWA 1JQAA 4OHPA 4UARA 3WGZA 1PG2A 1VP9A 4NK5A 3N2IA 1GZ3A 2BL4A 4B34A 5FEUA 2V74B 3DL2A 3E3LA 3P0RA 5K0FA 1IJEA 1S8NA 4R6XA 1LBEA 5HILA 4G5OA 1KH2A 1U3DA 3L07A 1COWA 4P08A 5CIWA 3I6BA 2DT5A 4E5MA 5I7EA 5M7EA 1V7CA 2XCTB 1KBQA 1EU1A 3RASA 5HKAA 4DIFA 1VSVA 3O82A 4EI9A 2HM7A 3K1TA 3KZXA 3OJFA 5CX1A 3VOBA 5JSZA 3PEYA 2VHVA 2UXBB 3PXBA 5ITVA 6LDHA 3K6SB 1N0UA 5IH3A 3FWPA 2VLBA 1FBNA 1C3JA 5JVDF 3EODA 1VYTA 3MXOA 4JL6A 1H8EA 3UWKA 4JBLA 5U1PA 3W4KA 5JAHA 1XK7A 4FJ0A 2XWQA 5JNWA 1A1SA 2EGHA 3CGWA 3LRTA 1Y9AA 4BV3A 1FFBA 1A98A 3LL7A 5DYWA 3AETA 2FP3A 4JVLA 4O2RA 2PT7A 1MABA 3W3AH 4K9NA 4HPJB 5IC6A 1JQDA 4FFMA 1NLFA 2NU6B 3IO3A 5HUQA 3IT0A 1HG1A 4YUXA 4D81A 2JLYA 1D6JA 5C5DA 4O4HA 2FF5A 1R0BA 1GL6A 3FFWA 4RXTA 4URUR 3FTCA 2Q7OE 3LUFA 4DAEA 4EB3A 5IDXA 3T9CA 1MR3F 4KQWA 4CLEA 5J4YA 5D3KA 4C30A 5IT9A 2XUOA 3HB7A 1FJ2A 4WLNA 1XRJA 1L5HA 5BR4A 2DR2A 1HZJA 3F5DA 5ALDA 4H7EA 3C5VA 3QYFA 3LBFA 2YCBA 3LY9A 3N5CA 4NBWA 3O9ZA 4IH9A 5E3IA 1KEKA 3HSSA 5EHGA 1JI3A 3L02A 2FY8A 3TZEA 1E7SA 2X86A 3N0WA 4TKVB 4MS3B 2G9ZA 4U63A 4I99A 1BE1A 3Q41A 4FGKA 2X7JA 4IJKA 2ZYHA 2DKOA 2HYDA 2QTTA 4AG6A 3TOZA 4FDTA 1M7HA 2OFPA 1UC5B 5K9ZA 1F4VA 4D44A 2EAUA 2Y0EA 3T5MA 4OOFA 4C78A 1UEIA 4RFLA 4URFA 2AN9A 4WBSA 3C3CA 3TL2A 1GQ2A 2C7VA 1B42A 2WIDA 2ZJ0A 4F97A 4R1UA 2UV8A 1CBUA 4Q18A 1GUDA 1AKMA 3QUSA 4N3AA 4X1KB 1CF9A 3WNQA 3PFKA 3EVEA 3E3OA 3FNFA 2PX0A 1L7BA 4XWWA 4MDFA 5T4EA 3LUCA 4MKRA 1LFAA 4Y7DA 1EGAA 4G23A 3OX2A 2DJIA 5DBIA 3EC7A 1RDFA 4N47A 4AWXA 5KOHB 1UIRA 3IVMA 4CLHA 4HWSA 2CLEB 1KEUA 3KVNA 2HT1A 4RMIA 1VLQA 4PX3A 3F46A 3OLVA 3T95A 3ERCA 2J87A 2R6ZA 1NE2A 4Q37A 4AVYA 1NU6A 3B5IA 5DYIA 2M6SA 3TOCA 1GFWA 4GMFA 3QSYA 4FYPA 1EM8A 3BX1A 4IUDS 2VK1A 1VHLA 1T8UA 3B1FA 1E9CA 1TADA 1L8XA 4K6MA 5AVZA 4PLFA 1AS3A 4AKTA 2G04A 2IYTA 4C3OB 1GNPA 4PXYA 5EHQA 3UK1A 1P91A 2YHIA 3VXKA 5AFSA 1RI3A 2ZIXB 2ZYTX 3I2KA 1MABB 4MS1A 3RSZA 3W0LB 1FVHA 3V8VA 5LB2A 1I7SB 3UXYA 4AXBA 1POWA 4UNPA 1P29A 1E0SA 4KHPB 3OCVA 2CSUA 3BFJA 2YYSA 4IHJF 1NF8A 5DMXA 2R62A 3DFMA 3S5JA 3PJRA 1L8AA 3I9V6 3R0XA 3IQEA 3SBOA 4MUNA 1ST2A 3L77A 3QXJA 4PO9A 5D1NA 4B6FA 2NYVA 1XMSA 3M4YA 5CT5A 1H2YA 4XWAA 2FWRA 2H7VA 2GPAA 3DD1A 3R0QA 2WIBA 3FNQA 1QFZA 3UPDA 1BDIA 3KM0A 4XFDA 3LY5A 1W8DA 4MVJM 2YZNA 2FEAA 1N2BA 1VKHA 2Q1XA 2Q1WA 3HKEA 4WLEA 5F5LA 1OHHA 3ZZ1A 4LF5B 4D3YA 1TCBA 3ENWA 1VE3A 2IV3A 1VMAA 1HZZC 3QFHA 3N0TA 1SCJA 1U99A 2DX7A 5DSXA 3ZV6A 4F9TA 2AHOA 3N2LA 2CY0A 2OHGA 3ETJA 4RV5A 3QBJA 3SSNA 4C4PA 1GDTA 2BGGA 5AHWA 5A5GA 3ICVA 1DCFA 5ESRA 4YCDA 3VR1A 2J33A 5KDLA 3RTDA 2DMRA 4Q9JA 1BYIA 1RYNA 1WP9A 4IINA 4LJSA 4WNAA 1HH4A 2JIMA 3WWZA 4AM8A 2E3JA 1JB9A 1P5HA 3GJYA 1DO2A 4AMYA 1G8FA 5BN4A 4H59A 5EE0A 1NASA 4N01A 3EVGA 4HGYA 3GFGA 3GN2A 1E6LA 1MOSA 3DUFB 5I3ZA 3FI9A 2W2LA 4IDDA 5D5HA 4U5XA 4DLYA 5DW0A 3D6MA 3RQSA 5L6LB 1OAOC 2R11A 2YNMA 1F9EA 3I73A 3NM6B 1JU9A 4QA9A 1L5GB 3ZI7A 5BRNA 5LQUA 4MGKR 4P83A 7REQA 1TQHA 2D2VA 4OQPA 2R9VA 1HDIA 1IN5A 1K97A 2LR0A 5EWJB 2QRMA 2KLHA 1C1DA 3K5IA 3HA3A 5JYBA 1ZMOA 3S27A 2AVNA 1QDEA 2WSSD 3RVNA 4F4FA 1E0JA 1XSEA 2BKVA 4P35A 3VJRA 3H1BA 1J8YF 3EG9B 3JATB 3HDYA 2LP4Y 3QV1A 1ZXXA 2EKZA 3E0XA 1SEPA 1SKBA 3ILVA 1GEGA 4DSUA 5K45A 1AC5A 1C0IA 1JHQA 1K8RA 4DPKA 4R4JA 5DOVA 1RI2A 2FE4A 4HBZA 4ZO8A 3VR2D 1QRUA 3HLKA 4RDCA 1TTTA 2FW9A 5EXEA 4IYJA 3HJTA 2OBXA 2J4FA 2B1GA 1OXTA 1N7HA 2QUJA 3GP5A 4L4UA 2GHRA 3N1UA 2HTEA 4OF4A 4QASA 2FWMX 1JUDA 4MQFB 5B58T 4DA6A 4KE7A 3WYAA 4J49A 4ARAA 4J94A 4YV1A 1JDVA 5K3FA 2QM3A 4KE9A 3RSOA 3LUGA 4IDFA 3BXHA 1C3OA 4V24A 3H2SA 4Y6PA 2DFKB 2Q45A 4ZDJA 3DMNA 5JIBA 2IHNA 2NACA 2ZCJA 4JEHA 5CD9A 4EG6A 3U3MA 4L02A 2HREA 4ZT2A 4D96A 1YR3A 5KINB 1ZCBA 2CVOA 2NSYA 1JQJC 4LWOA 1ZD1A 1M66A 1TUEA 3A6DA 1MX3A 1SUPA 1TPZA 5DM60 1E1KA 1UFVA 4BFWA 1TEZA 1QS0A 4PU0A 1IHXA 2QKYA 4TL8A 2RH5A 2D7CA 1U7HA 2XWSA 3LMKA 3WB9A 3QOYA 3A4LA 3M4JA 4BO9A 3Q98A 4EHLA 3GMDA 4YQFA 1USUA 3ZH9B 3A1NA 2DUJA 2IHYA 1FW8A 3QKRA 5ICSA 3DWIA 4FNAA 4IIJF 1NMEA 5K8IA 5F1PA 1LSSA 5AOCA 5HKKD 1CXZA 5LU8A 3GLFE 3VH3A 1IG0A 1HUQA 1MN6A 3E1SA 3QPUA 3AUAA 2VSNA 4IWXA 4JLDA 4AJNA 1OX4A 1K8XB 1NV8A 1MX9A 4R7TA 5JAQA 1CR0A 3NHMA 4PTLA 5JUWA 3HUDA 4RVOA 3ACBA 3FPKA 1DO0A 4EYGA 4TTRA 3U6KA 3T9FA 5CMLA 2H1VA 1NOIA 5G4LA 3CRW1 3JQ7A 5IJAA 4AMUA 1LS1A 1GD1O 5EZYA 4CMGA 4EG5A 4ENTA 5KVCA 2JFUA 1P8AA 3QJYA 3ZS8A 1F51E 3KALA 4PIMA 3LQ1A 2NG1A 1UJ2A 3QQ5A 4WFKA 1KQGA 1U31A 3H9JA 1JWLA 3PIDA 2I4RA 3TW8A 1M8FA 3NFRA 1BMFD 3UCXA 4IWYA 4PLVA 1JW9B 5C3MA 1E1CB 2JLQA 3HYLA 2H1WA 4OXQA 2CXHA 2FNAA 3K09C 3AY3A 2A0FA 4UEOA 4CF7A 1QOQB 2G06A 3FDZB 1BXRA 4GMGA 2HIMA 4ND6A 1P39A 1MGOA 2PUCA 1LQTA 4KN8A 3X1KA 4QM7A 2E6KA 3B82A 2VK8A 2WSSA 3OT4A 1XEXB 1T9HA 2AEMA 1B15A 4OCZA 2ENWA 4UBNA 4WASA 5JS6A 4OP3A 4C4RA 2ZIWB 4M6WB 4B83A 3T3OA 3ME5A 1Y1PA 9ATCA 3GUZA 4EW2A 1PGOA 3QIVA 4AT1A 1S1CA 1SZCA 3EVNA 3ASVA 3HZHA 2C54A 1U7TA 3BE8A 2ORED 3LH5A 3D4OA 4CMJA 1JTVA 1NT4A 1QHXA 2VHUA 1GNVA 3LFHA 4JP8A 3QGMA 1XA4A 3LUHA 4X24A 3ELUA 2BM1A 1IBRA 2C2XA 1L7DA 3PUHA 3RD5A 4L3WA 4K9SA 2QYSA 4FWTA 2WHEA 2G0AA 4D4MA 1GYRA 1O57A 3L04A 3LI2A 3WNVA 2XWBF 3CMCO 1J2JA 3MGGA 4PLYA 1Z36A 2ZJAA 1KSHA 3OE4A 2C4HA 4RIHA 4M0PA 4B8WA 1R12A 5B55A 4B3SB 2HC9A 4DSOA 4R0NA 1G63A 5BSKA 1LA2A 5LCXA 1HO3A 4J7XA 5JYEA 1RBYA 2DBZA 1ESNA 3NYQA 4BMNA 4JYZA 2IOHA 4HY3A 1EFLA 3BAFA 3PPWA 3QG5A 3W7VA 5JXIA 5SZHB 1EDBA 4BWYA 2CUNA 4PPGA 2C2MA 2ONCA 1JSZA 1PJAA 4ZJPA 2FUNB 3FVVA 4UTNA 4NU0A 4JIGA 4UEKA 4N0MA 3NXSA 1O58A 2V5VA 1X1BA 3GA5A 5J1SB 3TBKA 2F3UA 2BV3A 3BB4A 1SY7A 5FYDA 3S70A 4TZTA 4ZO4A 4MUEA 4IY1A 3ZWXA 4D98A 1PL6A 2E4AA 2IHJA 4BO6A 2CLKB 3JQCA 5BUZA 5EUBA 1RWQA 1W9HA 2G0NA 3K8QA 4WY2A 2GI4A 3D8BA 2Y2UA 3AVWA 5BN1A 1R15A 3G68A 3R5TA 3RYIA 4WK6A 2CUKA 4RJJA 3NEPX 2W2QA 3RWMB 4JU9A 5I7SA 4KFCA 3MT7A 1CZRA 1NXOA 4MEBA 5E6UB 1OB2A 1LVHA 1H0RA 2HIAA 2V0GA 3KQSA 1XZ8A 4LECA 5B1YA 5AXAA 3DDWA 3MWKA 2V3VA 1SUAA 3RU7A 1RQLA 2J4DA 1II0A 3F6EX 2XV1A 5EP2A 3IAM6 1QQ6A 1Z4KA 4DM3A 1BWRA 2G70A 1QIEA 1K0FA 2QTVA 5ELMA 3AHCA 3OWOA 5GONA 1RADA 3OT5A 5DNWA 3RUPA 5LR6A 4DT1A 3IURA 1FU8A 3IP9A 2YFYA 2WHPA 4ZCPA 1ZQ1A 1ABFA 1I9GA 3HVHA 4JGGA 1E4EB 4ME6A 3IL2A 3H3XA 1QPZA 4IXNA 3RJ5A 3PXXA 4JWTA 2OENG 1DAEA 3X1ZA 2WJ4A 5THKA 1A7KA 1RMTA 3GFVA 3L06A 4G0NA 3WKAA 1OFGA 3RYFB 1AIPA 3IAEA 3MTGA 5EOVA 5HTKA 4M9CA 1ZK1A 1XDBA 5BN3B 3QPDA 4L8FA 3H5TA 5ADUS 3MGAA 4JCCA 1XLWA 4DR1B 3EZNA 4DIBA 3CO0S 3AR8A 1A8PA 4ZDWA 3K2IA 1A50B 5BOSB 4KIUA 5EYPA 3PDIA 3FDIA 3GGOA 4QTZA 3LU1A 4TKUB 4GQIA 2V1XA 4O2BF 1G5TA 2MSDB 3DVAB 3IDQA 2A0UA 3G9ZA 3CHYA 3PF8A 4BIMA 5C8VA 1FFHA 1L7EA 1Q7BA 4U2DA 2QE6A 3MTBA 2W9XA 5IP5A 3REGA 5LDDC 5EJ2A 5DGDA 2IEIA 3NDJA 4IUCS 1KZGB 3VGPA 4ZREA 1FX0B 1P2GA 4GYKA 3H6KA 2E4UA 2A3RA 2FFHA 3SM3A 1A5BB 2D3TA 2P2LA 1PYDA 5LVAA 5I51A 2WJYA 4RF5A 2BHTA 3AF6A 3OFJA 3W6UA 1UAYA 2E1RA 1Z7EA 3EY4A 1FFEA 1SQ6A 1UKBA 1MTZA 2HMTA 3ZK8A 4B4OA 3L1JA 4E5NA 1CQJB 1W0JD 4KXQA 3N2EA 5ERYA 8ABPA 4JLKA 5HFNA 1DFIA 1JS1X 2RHGB 4UDYX 3A9TA 1VRVA 4I50A 5C9ZA 2RG7A 4MWDA 2HBQA 4NFYA 3EY9A 2C4MA 5KDOA 4LRUA 3NVMB 2VAWA 3PE3A 1KRXA 1J0EA 4LJ6A 3WLTA 1QR2A 2DFDA 2Q62A 4CMKA 3EGEA 1PT6A 2PBRA 4NNJA 2ZRIA 1KYYA 1T34A 2H4FA 2QUKA 2WD8A 3H1GA 4XD7A 3S1SA 1BCSB 3EPJA 3NIWA 4LMAA 4W8HA 1A8HA 3H2IA 3HRHA 4FSXA 1P7ZA 4QC2A 4CIVA 2CXTA 3NS7A 3ONVA 1RPJA 1A2BA 3WJ7A 5IJ0B 2XJ9A 3BXZA 1TCAA 1WOYA 3CEMA 1FFCA 4G0VA 2Z6UA 3FZQA 3ZIAA 3PB3A 4BLUA 3ULKA 3DLIA 5B1EA 3KQTA 2EDCA 2R8XA 3UV7A 2ACWA 5A0TA 1ORRA 3GI1A 5CXXA 3NHSA 1DJLA 1Z4QA 2PX3A 3RIEA 4TKVA 2BTQB 2CHFA 3IIJA 4H31A 1NI4A 2O8BB 1QRAA 4BFCA 1E2MA 1K4KA 1ESZA 2COKA 4ZRNA 4KFRA 2ZVJA 4NPCA 5B1IA 5I9IA 4PGFA 3DZGA 4PWZA 2AFIB 4WINA 2OSBA 1OZ0A 2JIBA 2WB4A 3K9HA 4EQZA 4FQ8A 3ZYZA 1U2SA 1USIA 2PJDA 4QULA 3IERA 1PJSA 5K8UA 2QSUA 3ZQUA 2IOFK 4NEGA 1QYVA 4V03A 2DF8A 1KP2A 3AEKB 4I1PA 3NETA 5I7UA 3MQ4A 1YJQA 3H97A 3ILSA 1MNQA 3FOCA 1JLRA 4M49A 3MWJA 4O8CA 1H9CA 4TPKA 2BHNA 1CFJA 3O8QA 4C0WA 3G7SA 4V3CA 3X44A 1Z5ZA 3UA4A 1VXOA 1GN9A 2DR0A 3KHUA 4MVJD 5EZ5A 5IMSA 3ORHA 2AQHA 3KC2A 3G8AA 1VDZA 1VJRA 2BD0A 2HA3A 2HWYA 3EVZA 2I4NA 2YIDA 4ODIA 1S2IA 4R3UC 5GJVC 3SFZA 1UP6A 1UZMA 3KHSA 3OOWA 4QXMA 4XUCA 1F8FA 1FEZA 4J6EA 4ZT6A 1SMKA 3ETHA 4IO1A 4BUJA 3JYOA 2YOGA 1RQGA 3LCCA 4S12A 1UMBA 4EWLA 2A30A 2G9RA 1YZKA 1BXGA 2QU7A 5CNIA 1J06A 3V2IA 5J4VA 2HI0A 4V2UA 4A2WA 4U9HS 2ECPA 5TE9A 4WCFC 4QBFA 4U7HA 4ZMSA 3MRVA 1F60A 1T5BA 4S0XA 1QVWA 2Q27A 5JC1A 2VA8A 2WJPA 4EPTA 1T36A 4KSCA 4RZ2A 3M70A 4DV5B 4B3TB 4MAAA 1U8CB 3Q12A 5B1DA 3T61A 2EFJA 3DBLA 2ST1A 3VZQA 4YHHB 1OC4A 3FG9A 4BLRA 4X6LA 3F5FA 2XMRA 1JSRA 2JBHA 1XNJA 4JVOA 4LFCB 4D57A 3JARB 4KI7A 5EC8A 1L4MA 3TTXA 1LLCA 3WQRA 2PZJA 3CKKA 2BR4A 5LWHA 2V7QD 4W5TA 3C3JA 3MS7A 2ZQ5A 2Z2KA 3DO5A 4BWFB 1JHMA 2J6IA 4JNCA 4ZXPA 3UJDA 5EMJA 4CHTA 4O63O 2VHZA 4RDIA 5L8VA 4E22A 1F0YA 3PLNA 2EC5A 2F8SA 3AIKA 4QODA 1LPBB 1W87A 3CX3A 3MELA 2LNDA 4IGKA 4K6GA 1P2BA 1PDOA 4GKVA 4Y0VA 3RS2A 3L8HA 3ZHZA 4FZ5A 1OXBB 1QQBA 1EGQA 3H84A 1KZ9A 5I9LA 1M1XB 3E22B 1ZLXA 2FEKA 1B73A 1NI5A 4IAOA 3ZUPA 1U0OC 4E70A 5K0ZA 4O4HB 3P2JA 1GLNA 4XIJA 1FYDA 1E8NA 4HXFB 4B3GA 2WAOA 1M8GA 2HU5A 3ESAA 1IATA 4JQZA 5FORA 4Z2YA 4WZAA 2ZI6A 3TGWA 4CTKA 1TO1E 5EWMA 4BO3A 4MNTA 4X54A 1JHYA 4RZSA 1PR9A 1X1TA 3A9SA 4JBYA 1NLUA 2YXLA 3HB1A 3IDSA 4YMVA 2AYZA 3O2JA 5B1SA 5GVSA 4FE3A 4TMZA 1VMKA 2IY7A 3K9LA 2WHQA 2JAQA 4IDQA 3T54A 4BYGA 5K4GA 3IPYA 1COZA 2WJIA 2O2GA 1ZHFA 3FJOA 3HCNA 5U4QA 2ODPA 4IZHA 4TVKA 3H17A 3FPAA 3K1JA 4JXZA 3NHWA 3DV2A 1Q1NA 1Y8RA 2EATA 2OV4A 2CEKA 2R87A 3QA3E 4AYWA 4QFMA 1K3FA 3A0RB 1O6CA 1AQIA 3AOGA 1M2OA 1UBTS 3HJUA 3Q7IA 3EFHA 2XBLA 3NHPA 3NYIA 1FP6A 5FP0A 1TGVA 2QT0A 1UPFA 4HI0E 2DT8A 2GOYA 1TT5B 3AYZB 3UMFA 1JEAA 3UJ3X 4AFNA 3L8MA 4PXSA 4Z54A 2R60A 4YAWA 2Z3WA 4DV6B 2VPXA 2IVZA 1OBOA 4AWAA 1EYZA 4IMRA 4RLFA 2CDAA 5EKXA 3NAGA 4CGZA 5K6TA 4BNXA 4CL0A 3OSZA 1RRGA 3LP5A 5DI9A 2ZJ4A 2XAAA 1SIBE 4HFJA 3J7AC 3TTUA 1QIKA 2QAGC 4FPXA 3U5TA 3GHYA 4J0DA 5KTYA 1KAMA 1Y82A 1WHTB 2J45A 3OQVA 3E48A 3I05A 1DADA 2QLBA 1E2GA 1FQWA 1KI6A 1PS8A 4YAEA 1Y80A 4B2YA 3NVKI 1YS7A 2H29A 2ZDHA 4D4IA 4MCAA 1DAMA 1T35A 4AZ3B 4PN7A 2JFWA 4QYXA 4C22A 4E6PA 1PV1A 3W1WA 1DRUA 2IXGA 1FLAA 2CXQA 1N3BA 1VBFA 2J5XA 2YJTD 4QYTA 1V47A 2EFEB 2PH5A 3O8DA 3ZH2A 3RPEA 4EJ2A 1CHNA 4ROTA 1WP4A 1ZCFA 3ORRA 2IZ7A 2ZE8A 3PQEA 4DWVA 1FFGA 1FNCA 1OXXK 1YOVB 3UFBA 3O8LA 1FFDA 3VVBA 2ZR9A 2OUKA 3OM1A 1NMSA 3QXSA 4G0YA 3VC7A 2X2PA 3MUFA 4RS3A 1MFZA 2CK3A 4BNWA 4C87A 2JCXA 5KTTA 3KQUA 4AJKA 1G20A 4FFVA 2IIBA 2R6JA 1VTKA 2IF0A 2VJKA 1KEPA 4Q3LA 4P9NA 3E0QA 3ROTA 3TQOA 3U4HA 4H1VA 3MTQA 4AICA 3A4VA 4IIVA 1FS5A 1ONSA 3DCIA 4JBGA 4DJEC 5K0BA 4LC0A 4DY4A 1M6HA 2DKNA 2B82A 5KU1A 4EK9A 1N0VC 1ML4A 2E82A 2CB9A 1XG5A 4BV8A 5B12A 1DGQA 2AXPA 5CA0A 1M7BA 4D5EA 2O8EB 1FNBA 3HBMA 3O4GA 2QR5A 5LP1A 1TKCA 3U44A 1PE0A 5TX7A 2WQ6A 3D8NA 2ZUBA 4PM4A 1JAXA 3IUQA 2ZETA 5FLYA 1GGHA 4QJ3A 3ZJUA 1HQDA 5I9BA 3H1FA 5A0FA 3WLSA 2WPNA 4ZV9A 2VQ3A 2DY0A 1ZX1A 3RHFA 3PKJA 1D1PA 1MEJA 4P3OA 5DNCA 5TGZA 4DHWA 3NGMA 1M9NA 5F78A 2QR2A 4BNZA 3JD4A 3QSGA 3CY6A 3A2MA 4FYJA 4JYPA 2OYCA 2XOEA 1R1DA 3FSRA 4FYXA 1RBZA 3H16A 3AJDA 2WC1A 1R5JA 3HUFA 3JQFC 3K35A 3K9WA 4KK3A 4XH9B 1Z5PA 2YQ4A 1DXQA 4CQMD 3LPCA 1VKZA 2P30A 3GAAA 2O0KA 4CR7A 5KMGB 1JKMA 1MO3A 1T3ZA 2IE8A 1IXRC 3UIEA 4BX0A 5FI0B 4PZLA 1ZD8A 4RD4A 1WHTA 3Q1KA 2ZXEA 4WECA 3C3WA 5IASA 1EHIA 4HNGA 4JDUA 3GMIA 1A9ZA 4P53A 1UOOA 3IDOA 1E3DA 3ZHQA 5EZ6B 1RWMA 1XCGB 2QT1A 4M1WA 3NT5A 4YWJA 1B6GA 2FVYA 1OWPA 3TTWA 3MPOA 3KOXA 1ZOOA 2HHLA 4V0RA 3PPYA 1NBME 2NTVA 2X7XA 1E2EA 2PGXA 4BNDB 1XHLA 2AMJA 4U7PB 1PU2A 4TWAA 4KOAA 4V1CA 3PX7A 4A82A 4K7JA 1F6WA 3M82A 1P0IA 1PK8A 3QU2A 3AVXA 2XVMA 1I3LA 3ACDA 2QL6A 1N3IA 5KNBH 3VU9A 1R5BA 4TLEA 4AD8A 2I8CA 5DI3A 3TLXA 2YICA 4CL8A 5JARA 1UANA 4OQFA 4F3TA 3QOFA 4P7JA 1EE2A 3D3NA 3ZQKA 4G09A 2Q4OA 2WOOA 1WCYA 2YWEA 3NCHA 4OHBA 5H3CA 5I8WA 1G8PA 2PBLA 3AR7A 3MCWA 2NZYA 3N59A 4F5EA 4FJ1A 2H52A 3UOAB 2Y1DA 3NIFB 5JOQA 1U0LA 1CCWA 2Z09A 2UVDA 3UYLA 4D43A 4RFSA 3KQYA 5HDQA 1G8KA 1WXXA 1IBLB 4X85A 1RHJA 1TOAA 1BMQA 3BN3A 4IQ4A 2Z1NA 2ZJ1A 4BMYA 5JD4A 3OKAA 3HY4A 4TMFA 1VPLA 1Y3DE 3O75A 4O2BB 4D0RA 3UJPA 3OZGA 4N1AA 2A9QA 2BVNA 2O7RA 3IIEA 3QVJA 3AK4A 3UTDA 1C9NA 1CYDA 1RZUA 3L0CA 2JVJA 4YO7A 4IIXA 4MW6A 3STUA 4EHDA 2NU7B 3WGVA 3ZBTA 4KVAA 4WOKA 1DIAA 5CG1A 1V8PA 5AVQA 2P9QA 3EASA 2F48A 4ZT4A 4XYMA 5IDVA 4AI6A 3ZD9A 4FE7A 1RYFA 2X8AA 4IJMA 2JIZA 1MG0A 4OX9B 1M1YE 4C7KA 2FWIA 4ZT5A 2XQGA 5EGSA 2QVZX 4KXVA 4W4TA 1KK3A 4PZZA 4MW5A 4D9NA 4X3PA 2YFHA 2ZUVA 3V1MA 3LDFA 5KYYB 1KI6B 2ISSD 2DFTA 4CQJA 2JCGA 1YC2A 1RYBA 2W71A 3JSAA 3IUJA 1I1OA 2Z9DA 1I0LA 1HE5A 4MITA 5AXDA 5DPMA 4D6PA 4K6KA 1YD7A 1DL5A 3WGMA 3ASZA 4K3UA 1CUSA 4FOOA 1N2HA 3F7MA 2XRFA 3TSCA 4BHTA 5FTLA 1YHNA 1QG6A 1Z0KA 4WK0B 1C4WA 2JJMA 1CWUA 1M6WA 1C7EA 3MBIA 4IICA 3UMCA 3CVWA 4K1LA 3MQFA 2R8RA 2C83A 5L3QA 4Z6KA 2YMQA 2R4TA 3DT9A 3VJKA 1HY3A 1QMGA 4UFPA 5KX5F 5REQA 2VP6A 4F4DA 3WK5A 3ANNA 1T3SA 5HK8A 4FFOA 1NQUA 1FTYA 1EQAA 1EA7A 1G20B 2CFIA 2H63A 2YR0A 3ANTA 3GJ8A 4I4TB 4PO1A 3WL5A 4TV8A 2FK7A 2P6NA 1XEAA 4DDHA 1DO8A 2NO0A 2V7TA 4YMGA 4XGRA 2CZGA 3SR4A 3VQTA 2FPOA 2J0UA 2J5KA 3KNZA 3Q2IA 4POAA 4ZHQA 4N9WA 3CLSD 2VQ6A 2W7TA 2W90A 4CJXA 2XCOA 3MT8A 1T1GA 3LUJA 4MHTA 3MHPA 2MIIA 1BJKA 1F1JA 2P9ZA 4OJNA 1BMTA 3DMGA 1G5PA 3EF3A 5KYTA 2YZ2A 5DLDA 1JHXA 1DCTA 3OZFA 2ZJ7A 3EYWA 3OIYA 4OLJA 3WYFA 3ZZ0A 4BRSA 1K7XB 3G9QA 5K51A 2CVFA 3AR2A 3LYAA 3NV9A 1NM5A 4W6ZA 6ABPA 2P9HA 1O0BA 1MA0A 4N5LA 4KZKA 3R8FA 1NVDA 2IGTA 3TRFA 1JDBB 3G2NA 3UK7A 1MV8A 5JRJA 1W2GA 1IZZA 1FMCA 4U00A 3DZBA 5BWLA 3VHQA 2QDKA 2IRWA 3HYTA 1ZU4A 4IJQA 2MHCA 1ULUA 1RE1A 3N3BC 5HGXA 1QGDA 1JDBC 1Z35A 1AKYA 3ICEA 3QKWA 2HA0A 3OX3A 4BV9A 2C4UA 1ZUNB 2H3HA 1C7RA 2V4ZA 2PTHA 4Z4HA 4XX0A 4EJ0A 1Y1TA 3M7IA 2P2NA 3STYA 4RQAA 4DQLA 4YP7A 3RTBA 4NBSA 3ROZA 1QS0B 3H6HA 3NBFA 1JJIA 1Y4ZA 3HEMA 3IALA 3VR5A 4BL5A 3R5SA 3ONNA 5GV7A 1Z6AA 3OOJA 1ZPDA 4H7DA 2AL7A 2F3SA 2NT4A 4MB6A 1ZJJA 4QDUA 4IJWA 1WZ2A 1MO6A 1PQUA 1M6YA 2AOTA 4KQGA 1XLTA 3IH5A 3EMVA 1K7EB 4UNIA 2BGNA 2O0MA 4OTZA 3ZLUA 4DW8A 1KFJB 1O87A 2UVQA 1P1JA 3E5RA 3U7GA 3OY2A 2REOA 2SKCA 4QNNA 5H3LA 5BMVA 2FZ5A 3EBOA 2UZ1A 2QL7A 4ZV4A 4GL4A 4W63A 1HZZA 1V9LA 1MP0A 4JB3A 4CM4A 5HQ3B 3U4QB 1IHOA 1HLPA 4JOCA 4OHXA 4TMWA 3RSCA 4DZRA 1UXIA 5BYBA 2PWYA 1EX9A 5CNKA 4QLAA 5HOQA 4ARIA 4MUMA 5A9TA 5KYXA 4YDRA 3O84A 2HU7A 2O9JA 4MV6A 4EFNA 2JLWA 4QQNA 2DCUA 4OQEA 2E21A 3X0DA 4CEIB 1E9AA 1VPDA 2XGOA 3C0KA 3UYKA 3BPSA 3X1XA 4ZYVA 3H2ZA 1FNSA 1VYUA 3R2JA 4KTTE 3X43A 4QUBA 1YC5A 2I6SA 1I2CA 1PGPA 1ZCZA 3V1YA 1NN1A 4LQDA 2W8ZA 3C1UA 3EE6A 3AJ9A 1Z45A 4BKUA 3OQNA 1YL5A 5AKKA 4LZZA 4LZOA 4EHKA 3EPHA 3H4VA 3EB9A 5LJIA 1JQ3A 1XZDA 3BH7A 3M4XA 3WOVA 4ZRMA 2ZRDA 3NC1C 5ALMA 5E4JA 5F2OA 4NCBA 2PUHA 4EL0A 4ER7A 1FDOA 5KX5B 1YQQA 3K6RA 5DCWA 4N8EA 3KR0A 6REQA 5FUQA 1ZMTA 3JQBC 4C6SA 2H3EA 2Z2JA 3BTUA 3D5QA 4LZPA 4C7OB 3KVOA 4M8LA 3HU2A 3QENA 1KS9A 3N87A 4LGCA 1U2TA 3UWMA 3QWHA 1RNLA 1CLEA 1VECA 3L79A 5DK6A 4E88A 2ZZNA 2I9PA 1JIQA 2RE8A 1NXVA 2RI1A 4L9RA 3T52A 4F45A 5IDWA 5KYUB 3JQ8A 4IZOA 1N9ZA 3IO5A 3ZWMA 4ZAZA 5H5JA 4ZHQF 3O5AA 3DXZA 3INGA 3O7MA 4K28A 3WYGA 3CNEA 4ZGWA 3P9IA 1U6IA 3RSQA 2ZWOA 2EP7A 3B9BA 4B9AA 1BE6A 3TWOA 4F2GA 2H65A 2IYXA 2NUPB 4KKXB 1DIGA 4O1MA 1IRIA 3Q6IA 4DNPA 5J2TA 2W5UA 5CVUA 1LLQA 2IYYA 2KSQA 2Z3ZA 1JWBB 3FYDA 3O8NA 3PIIA 1H9BA 2AMLA 1TIKA 2QXUA 1IWPB 2GPJA 5KDDA 4F06A 2QJRA 1JXQA 1EWKA 3U4GA 4PC2A 1ORHA 5ITZA 5JS1A 2JGDA 1F5SA 3LC0A 1U5BB 1IB0A 3MLBA 5ITWA 5EJ6A 3OCZA 2H2WA 3UJ8A 4C1BA 4DQDA 2F7SA 2ZWMA 5EJEA 1LZLA 1CS0B 1A9TA 1SC4A 1WBBA 5T3YA 3I52A 3UKDA 1TQ8A 5B5SA 3DAYA 3RHTA 3KEOA 4EJ6A 5KZMB 1A9XB 4BYMA 3TKYA 4M1TA 1C1DB 2AFHE 4MGIR 4Y30A 4C88A 1C3XA 4H3SA 3K92A 4HLNA 4Z4GA 6PFKA 4LRQA 3CBQA 2JGJA 3NVAA 4PSDA 1MRZA 1M75A 4Y1RB 4FBMA 1EVIA 7GPBA 4O2LA 2ONZA 4MQ4A 4DJJA 3E7XA 1RWNA 1SXJB 4GP6A 3IAHA 1AB5A 5IXYA 3IQIX 5T7BA 1TMOA 5TXGA 3MJTA 2WRZA 3UQYS 2CHQA 1KVRA 3FRIA 3ES9A 3GCZA 1R00A 1YZUA 4L9SA 1PWYE 1DC7A 3AL3A 4JOQA 5G53C 1B1AA 1GM5A 3V4OA 3OQ6A 3ADKA 1HQCA 4XA8A 2CCGA 3RFCA 4YV2A 5CK5A 1I30A 4L57A 3PDCA 3V7NA 3OJXA 1Z7BA 2GN9A 1N7GA 5EMKA 1R10A 5KVSA 3JQGB 3ZCRA 4XYGA 1Z17A 3MW8A 4U39A 1U9JA 5B6IA 3PT9A 2OORA 2Y1FA 1PN3A 3WQSB 3GRAA 2Q3DA 2V6MA 3VPAA 5LZ8A 1J9ZA 2VZ9A 1SIOA 2ZAOA 3ETNA 4PLCA 1EM6A 1HETA 5AOBA 4EFDA 2OWEA 1Z4MA 5DGTA 4ENVA 2P0EA 3Q88A 4L2IB 1EG2A 1PEYA 3LWDA 2GPNA 3AJAA 5FUVA 1FMFA 1VRWA 4LOHA 4BZZA 1I51A 3R7BA 1ZK2A 1BD4A 5BQFA 4CR6A 1BHSA 2GZRA 4PBTA 1N33B 1A8SA 3IAAA 4I50F 4YR7A 1QLWA 2Z1MA 4UE3S 4JLOA 2FN7A 2OE2A 4LXTA 1ISRA 2JATA 4MLZA 3SLRA 4UTOA 3E70C 1KWKA 3NANA 3JRNA 1ZVVA 4GNKA 4L7VA 4S04A 1E96A 1XVLA 3QOWA 2ZUUA 4MQMA 4Q47A 4AAYA 4K6HA 3ZPXA 4QQRA 5ITZB 4QDKA 1IZ9A 3ZHXA 1G64A 5BQPA 5EJ7A 1WXEA 4JUAA 5EFZA 4BPRA 4M76B 1G59A 3HKEB 2NYRA 3Q40A 2R00A 1PJBA 3HLYA 4BRWA 4Q1DA 2Q6KA 2WEKA 1OZFA 3U40A 2CN1A 5HM6A 3QE9Y 1LDMA 1KZ7B 2IKQA 4HNAB 4R1SA 3RBAA 1CD5A 3PZRA 2JAOA 2WM9B 3VRHA 4GI3A 1MGPA 3AJEA 2JIQA 2GZ1A 1EK2A 1SUBA 1TJ5A 2AC7A 3IP7A 2QUIA 4G37A 4YRRA 3S29A 1ZZGA 1Z26A 3SYLA 1P1RA 1YE3A 4GI2A 4Z3KA 3SBEA 5JH7F 1E9RA 1FRZA 3L1KA 4PAOA 1VB5A 1KR2A 2YDYA 2ZRNA 3WL3A 5SYNA 1OVMA 3B5JA 3SP1A 2R3SA 1WXWA 4OFBA 5AWFC 5C53B 2OCLA 2WVHA 1S89A 1KYQA 4AZTA 2YINC 3CG0A 2CFSA 5J63A 5F64A 4TXHA 2FHSA 1GPBA 1Q7EA 2WPDD 1DMSA 2VP2A 1KDYA 3RC1A 4EMSA 3FCYA 4JROA 3KKQA 4F5ZA 5BPHA 4D74A 5FQNA 1AN9A 3GGPA 3Q7RA 5BV2P 4CM3A 2NZWA 3PDUA 3WB2A 3JWPA 1CQIA 1N9KA 1UIMA 4GPAA 4LNUA