2QT0A

Human nicotinamide riboside kinase 1 in complex with nicotinamide riboside and an atp analogue
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
189
structure length
179
Chain Sequence
RGSKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nicotinamide Riboside Kinase Structures Reveal New Pathways to NAD(+).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Nicotinamide riboside kinase 1
total genus 55
structure length 179
sequence length 189
ec nomenclature ec 2.7.1.173: Nicotinate riboside kinase.
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qt0A00
1COWA 3RRNA 1E9BA 4KYIB 2Z6VA 3AVYA 3B13B 1WXQA 4FXPA 1E98A 2ZI4A 1TEVA 3LW7A 1K8RA 5IDVA 2QG6A 3W3AA 5JWOA 4HLQB 1ZMXA 3I1FA 1R8QA 1XEXA 2WJIA 3SU8A 4FMDF 1W49A 2XNSA 4EIWA 4Q1DA 4XH9B 3SQXA 2XX3A 4PC6A 4P0TA 3I62A 2GJSA 4UXJA 1I4TD 2QGZA 1DAMA 3TR5A 5LBIA 1I2DA 4QGAA 4B73A 1E2IA 1U2RA 4JLBA 3ZLJA 5KDDA 4C0KA 3SC3A 1KMHB 2FZLA 3A1VA 3G82C 5JWHA 4DSNA 1DVRA 3RS3A 2NOAA 3GEEA 1GNRA 3ZGXA 1T3SA 2ZYTX 3CWZA 3QVVA 1X1SA 4TMWA 3FGNA 3TKLA 1YR8A 3FTQA 5B57C 1P72A 3E2IA 1KMHA 2Y8EA 1W36C 4JZKA 4DJTA 3LQQA 1YZLA 1NLFA 1Q44A 2GZDA 5H1YA 3PUXA 3CRMA 3DL0A 2GA8A 2O8CB 3N70A 2GKSA 1W2GA 1NY6A 1W46A 4EPXA 4AKGA 2VYFA 2HF8A 3X1WA 4ZI2A 4UNRA 1KSHA 3HU2A 2IX3A 4BGDA 3QY0A 3CPHA 2FF7A 3QKRA 1Z63A 4GPTA 1S3SA 4FW9A 1JAIA 2RHMA 4HZIA 1WMSA 2G1JA 2VP9A 4IVPA 2VPPA 5C4GB 3T1OA 4DLWA 3GLFA 4DWJA 4XIGS 1NJGA 2B92A 1W4AA 2RGEA 4XWKA 4DLUA 4ZDWA 1NY5A 5B2ZA 4ZDIA 3BB4A 2AD1A 5DI9A 1RYFA 4RZXA 3UG6A 2GDJA 1Q3TA 4URVR 2HUPA 2GCNA 3BJIC 3BE4A 4P33A 4CIDA 3H86A 4EFLA 1SVIA 3ZZTA 3DMDA 1UDWA 2RMKA 2ZRNA 4Q21A 1KY3A 1SKQA 2XB2A 5CYPA 3KQLA 3GJ5A 5LB4A 1E2PA 3QEJA 2Z0MA 4NYJR 4QBIA 4LJAA 3ZS9A 3T61A 2OE2A 1G5RA 2J59A 1DE0A 1RJ9A 4C0AC 1FQJA 4AKIA 3RLFA 2XXAB 1DAHA 1E79A 2IWHA 2WMOB 3IBGA 1E2FA 2IYLD 3B82A 4I4LA 3A1WA 1B0UA 4P31A 5H68A 2TMKA 2Z4RA 1LF0A 2V7QD 4IVRA 3U7EB 3W6NA 4YMTA 1AKYA 3KJHA 5SZIA 5IRCD 1NIPA 3NHAA 1N6IA 1JJVA 4B75A 2ZRLA 5FR2A 4IDHA 2BJWA 1UADA 4N0DA 3FPAA 2CLDX 4US1R 3CR7A 3EPLA 1XCPA 3SJAA 1CF4A 4BRUA 2OLJA 4JKIA 1AQUA 3TJZA 5DIFA 4W5HA 3UATA 2C2HA 2H92A 2GF9A 1TAGA 3FFAA 1EX6A 3QXCA 2ZRBA 3WYFA 1LNZA 3RABA 1QVAA 2VIIA 4RFSB 4D4JA 4PZYA 2R6DA 4ZKDA 4PAQA 4DT1A 4OHWA 2OCBA 2WWXA 3QVUA 3TGPA 5JI3E 3OEED 1W0KA 1MO6A 5KNDA 3Q7PA 1TMKA 5KPDA 3BIFA 4D0NA 4DDUA 3QBVA 3ZD6A 3K53A 4CF7A 3IHWA 1GL7A 1XP8A 4TL6A 1E2MA 1NVWQ 4QHTA 3VX3A 1LS6A 4DB4A 3EG5A 2PX3A 2V54A 2ZYVX 2JJ8A 3WHLA 4DC9A 3GLIE 3OF5A 3PUVA 4PSAA 4DCUA 4M1TA 1DG3A 3X1XA 2CL7X 2F3RA 3MWLA 4KXFB 1N3BA 1P2UA 2W6IA 4Q7MB 1U9IA 4G01B 2H17A 4OI1A 3MD0A 3QF4A 2ZJAA 1KO5A 4L9WA 1KI8A 2ZS9A 5C18A 3KZ1E 2IYRA 3AP3A 4A1FA 2MMCA 1NI3A 2FPMA 4IEEA 1BH2A 1FX0B 3GLGB 4DCVA 2OCPA 4EPYA 4EPTA 1W2HA 1OV4A 4C7OA 4TMKA 1T5IA 2XEXA 5AR1A 4QKQA 2P3SA 2JJ2D 4NH0A 1P60A 2HJGA 2IXFA 4WXPA 5DO9A 4Q4AB 1UBEA 1G5PA 1GSIA 2IYSA 4JT2A 4O2LA 4G5OA 3QQ5A 1XTSA 3WMGA 5KYKA 1NN5A 3AM1A 1DAGA 1SXJE 4NL4H 3W34A 3RRMA 4TTQA 4IKEA 2YHSA 2ASEA 2C9YA 4KODA 1SVSA 3FMFA 2GHIA 4AKHA 4Q7JB 2C8VA 4G0NA 1KI9A 2NO0A 3TSZA 2LCFA 1W0KD 2IUTA 4ZIRB 4WZ6A 4LPKA 5CJ2A 1MO4A 2HXYA 3FVQA 4FI3C 3EW9A 2NMVA 4PPGA 5E3HA 2EWVA 5EP4A 5AUOB 4TQAA 1LV7A 2QMUA 2VF8A 4IHQA 4QGGA 2PLRA 4K46A 1AM4D 2I3BA 4Q18A 1N2CE 4JLAA 2PJZA 2GJAA 1UBFA 3AV0B 1Z6TA 4BZPA 1CR1A 4A0GA 1ZNZA 1P61B 3EIHA 2IA5A 1XWIA 2GJ9A 2W6JD 1AS2A 1OE0A 2YOFA 2ZJOA 2X19A 3EAQA 4MUAA 3B1ZA 2IS6A 3DEFA 3ZIAA 3ZD7A 2RH5A 4YMVA 3KQNA 2ZE6A 3K0EA 5FTJA 2NO7A 4GRAA 1R7RA 2DWOA 2IF2A 3CBQA 4M1OA 1HYQA 4V0ME 2J0QA 2IHYA 3CRVA 3K9GA 3ADDA 2WJHA 1U90A 2ZJZA 4V0MA 3UG7A 4U02A 1JALA 1OH5A 4ZCMA 3WNCA 2ZANA 2B6HA 5M04A 4JLDA 1NNEA 1YZQA 5FTKA 4ASUD 5KOYA 1F2TB 3IO5A 3H4MA 3L2OB 2R6AA 3D8BA 3BH0A 3LQRA 4GT1A 4HDQB 1G6OA 4TYWA 4LV5B 4JS0A 2J0UA 2QE7A 1Z29A 1KDTA 2QP9X 2WHXA 1ELOA 1KDOA 1ZUNB 2H57A 5KUTA 2RCNA 1QRAA 2RGGA 2O5VA 2XTMA 4A8JB 3CZPA 3U3JA 4DEXA 1V43A 5J4KA 4C2UA 1B23P 4CEJA 1Q22A 1ZAKA 2YINC 3BXZA 3Q7QA 2NTYC 4F4JA 5FBVB 1D2NA 1IXZA 1FOEB 3TAUA 2QGNA 4DEYA 2ZJYA 1G9XA 2RHDA 3TUIC 1PLKA 4MKIA 4DCTA 1E2EA 4CEHA 1W36D 3IHLA 5F9FA 3L0PA 4RCZA 2WKRA 3HPQA 2BBTA 4URZR 2J46A 5BW8A 3B9QA 4BEJA 1OH8A 3VU9A 3UMFA 3FMOB 3UPUA 4IOMA 1XEXB 4D81A 3LW8A 1XTKA 4DUGA 3AUYA 4LYJA 3VMFA 4KJZA 2EFGA 1G7SA 1ZM3A 3U6KA 1C9KA 821PA 2GVDC 3LDAA 4MGYR 1VECA 5JHGB 2GJKA 2RGAA 2WWGA 3C5HA 3KJIA 3NDPA 4WBSA 4G5RA 3R9WA 1MABB 1G5TA 2A5FA 2VO1A 4M4SA 1KSGA 2VSXA 3K70D 2R6FA 1ZM4A 1N6KA 3MWJA 2IK8A 2BMEA 4F38A 3B2EA 2VQSA 2PZFA 5TY0A 3CO5A 3VU9B 2ZJBA 5IT5A 3OE7D 5UKDA 1E4YA 2QAGC 1NLZA 4JIMA 1M34E 4IDNA 1UEIA 3VAAA 1IQPA 4EJSB 1P2TA 1R5NA 2PEZA 3A4NA 3RS0A 1DAIA 3KXIA 3EC1A 4MYHA 1ZM7A 2AKAB 3IILA 4HZUB 2J87A 1G21E 2YKGA 3EX7C 4BUJA 1WE2A 3ZVNA 1GG2A 4JLVA 2NO1A 2HYDA 3AVOA 5EXSA 3FYHA 4HEJA 1II0A 2NQ2C 2MSDB 2R65A 2XTZA 1NRJB 3B1WA 4TQ9A 2GF0A 1KI2A 2ODWA 2D06A 4S2EA 2YZ2A 2GWHA 1QHXA 3SS8A 5CB6A 3KUDA 3KKMA 1OFTA 2FA9A 4UNNA 3P32A 1XCGB 5BN5A 5EJEA 2BV3A 3QXHA 5FBWB 1C4OA 2JDIA 2ZRDA 2ZTSA 4RD2A 5G3YA 5C1BA 4DVGA 4R7ZA 1RIFA 3SBEA 1F6BA 2X2EA 1R6BX 1YQTA 1VCNA 1E69A 2GILA 4D82A 1Z6XA 4US0R 3CUEF 2PEYA 2DYKA 2F1RA 3QENA 3ZVMA 1T8UA 1OJLA 2KBFA 1A2BA 1NN3A 3B78A 3NEYA 4TMTA 1JR3A 2AXNA 1UPTA 4UXIA 3RWOA 1TQDA 4ZDJA 2DFNA 1IN8A 2YWEA 4KFTA 2QQ0A 4LYAA 4AG5A 3PV0A 2ZYUX 3KKQA 2A3RA 4FMCB 1R5BA 1YE8A 5CIWA 2C03A 4G5QA 4QNMA 3ICEA 1G19A 3GD7A 3D31A 4H1VA 4OI2A 4YONB 3O8CA 4M8NE 2HYIC 1P62B 2QN6A 1R8SA 2VP0A 2VHJA 2JLZA 2DPXA 4O25A 1E3MA 3HP1A 1JAHA 5C2JB 2A9KA 2GXAA 1E2NA 3AGQA 2ZU0C 2V1UA 3VR2A 2QM7A 1I4LD 1N5IA 5FR1A 1KMQA 3OESA 3K0FB 4Q1FA 1AGPA 3OEHA 2F1JA 4FMCF 1RRGA 1R5OA 1XF9A 1DAEA 5JECA 4V02A 1E2DA 5J40A 2DBYA 3PEUA 2OM2A 2J1LA 4OBEA 3DDCA 5ELXA 2XZPA 5JEEA 3OIVA 1XX6A 1F5NA 3ADBA 4IOKA 2J45A 4LHWA 3QI2A 1S3GA 2GEUA 3RC3A 4B3DA 3VR3A 1Z0IA 2MSEB 1TX4B 1FP6A 2W83A 3GJ3A 1N6OA 5EE0A 1EG7A 3LVQE 5EQTA 2PCJA 4D2IA 8OHMA 1T5LA 1UBGA 3CPEA 3NDBB 1NBMA 4AY2A 1RW4A 4Y0VA 1P3JA 2QEQA 4RD4A 4RFSA 5IK2A 4OHZA 4C0QC 4BECA 4HB4A 1UF9A 2ZSEA 5DYIA 4JBYA 4OQLA 1II8A 4V0OA 5BN4A 3THOA 4TSFD 1DELA 1TQ4A 1OXXK 5DYGA 4A0HA 5FOVA 1VYTA 3A1TA 1TQ6A 1P2VA 3EC2A 3Q8XB 3VHXA 4TZ0A 3R8CA 2NO6A 1KI6A 1RPZA 2ZRMA 4MKGA 3B1YA 1S8FA 2G1KA 3ZH9B 3BBPA 3LLUA 3GLIB 5HTKA 1OFUX 1G8GA 1BIFA 2ZVPX 4FWIB 2A7QA 5BQ5A 2KBEA 2B7CA 2ZI9A 1UKZA 2VH5R 3B9PA 4RZ2A 5G3ZA 2QY9A 3R9IA 4MUBA 1R2QA 4OK6A 3AVQA 4Z8XA 3IDQA 2GXUA 1VG9B 4LBYA 1E96A 4D4KA 2WJGA 3W5JA 1KDRA 2ZSBA 3T34A 2O8FB 3GLHA 4NYIR 4PSVA 3F5FA 4DHEA 1H8EA 2OFOA 1GZSA 1QHYA 1M6NA 5HE9A 3MAAC 1GWNA 3TNFA 1ZUIA 3JVUA 5FOXA 5DH9A 3CW2A 3DZ8A 1X8KA 1ZU4A 2ZRIA 1CS4C 4BEBA 1QHNA 4MRRA 4GL2A 1T3LA 1DTSA 4TYQA 3HU1A 1JR3E 3GLHB 5IK2D 3PUWA 2F7SA 2EFCB 4GSYA 4HLDA 1G8HA 3DOEA 2RGXA 1TEXA 2R2AA 2V4ZA 2FPKA 4PHFA 3GJ7A 2AXPA 5DI3B 1XTIA 4NCJA 2BOVA 1E1RA 2EFEB 1S4QA 4ZIRA 4NE2A 2GK6A 1NG1A 1SVKA 4LSGA 4LK2A 4QG7A 2JASA 4QGFA 1NMYA 4E22A 4PZLA 4RKEA 1G3UA 4GOJA 4FMBB 3CF0A 2E87A 3PIRA 4M9XA 4A6PA 3PEWA 1AKEA 4B2PA 3QEOA 3GJ8A 4QHYA 1NVUQ 4ESHA 2FSFA 1GILA 1DS6A 2JJ2A 3QG5A 2ZJ5A 3GEHA 4L4UA 4M22A 2ORWA 4CVNA 2CEAA 2G0NA 1PJRA 1COWD 4I1UA 3F3YA 5L3QB 1AS3A 2OXRA 4CGZA 3IEVA 3TUJC 1GUAA 1YR7A 1KK3A 4DLTA 2OBNA 1U99A 2EVWX 1FFHA 3CM0A 1N6RA 1E32A 2VHUA 2ZRFA 3D6TB 3T5DA 1PLLA 1XCMA 2FSIA 1OXSC 2WJVA 3AKYA 2NG1A 5DISB 1U98A 2ZRGA 4B47A 2H16A 2IT1A 4QBGB 4A15A 4B44A 2ZRJA 2ZRAA 2XAUA 5JWRA 3U60B 1Q3HA 4O2RA 4TQUS 1TF2A 1ZYUA 3LV8A 1CR0A 1XU4A 4XD7D 4QM6A 2P5SA 1KJYA 5K8LA 4RY2A 3CX7A 3KKPA 5FOTA 2WWFA 2JJ1A 2IYWA 4QBFA 5DN6A 5C4MA 1AQYA 3F8TA 4XD7A 1S0UA 3OE7A 3RS4A 3SQWA 4A82A 2D7DA 5JLJA 3EARA 4TL9A 1CRQA 1CRPA 5E7MA 3CNLA 1DG1G 4RVCA 5TDHA 3TK1A 2RGNC 3KTAB 3T5GA 5A5GA 4FCTA 2FFBA 5JSZB 2WBLC 3SBDA 4TMVA 4WVFA 2AK2A 4BZQA 4NMMA 3QSYA 3K1JA 3W8NA 3RSLA 2IEZA 4M1KA 3E5HA 1E0SA 4Q7LA 4B2LA 1RVDA 5CYOA 1KDPA 1W5SA 2OFWA 1Q1EA 5HCNA 1GVNB 2GRJA 3PUZA 1KAGA 3LX8A 3U3MA 3THWB 4ZKEA 4LYHA 1KOFA 5A0FA 3GLGA 1M1YE 1YRAA 3UANA 3LX5A 3A37A 1ZCAA 4JJZA 2KE5A 3UMSA 4ZV4A 2EQBA 1ZBDA 4JMPA 4F4CA 4IRUB 2KB0A 1LY1A 2GCOA 3C14C 4IXNA 2OCAA 2WV9A 3CIOA 5FPHA 3RVBA 2D74A 4F92B 4B3FX 1XPUA 1RKBA 5KU1A 3IIMA 5JI2E 4B34A 1SXJA 3S1AB 421PA 2QORA 3RNLA 3HDTA 1KZGB 1CIPA 5HE8A 5FTNA 3FKSD 4D4MA 2Q9AA 1P7CA 2DWQA 1W1WA 1ZD9A 5EE9A 1IN4A 1GM5A 2DFKB 2HEIA 4PANA 1X86B 4BFYA 3C8UA 5DN6D 1G41A 4NCKA 4DSUA 4UNPA 3O8DA 2BJVA 4BWYA 3QXJA 2VP6A 4TL8A 4Q9KA 3Q3JB 4QGHA 4OQXA 3IIKA 3LAWA 3KDSE 2R8RA 4IFEA 1NN1A 4K81B 3A4MA 2ERXA 3TSOA 1FMLA 2J3EA 3H2YA 4R2IA 2QAGB 4GOKA 4Q9JA 3WRYC 4Q03A 1YZNA 2ZUBA 5EUQB 2A5DA 5J47A 3QXSA 4Q7KA 1QZXA 1WA5A 2QU8A 4QXAA 4F4IA 2EYQA 1CJTC 5JEDA 3WP1B 4QJ5A 1R0ZA 3TSWA 3QIAA 2F3TA 2IF0A 2YV5A 1OIVA 1KKMA 4WA7A 3EA0A 1XZQA 4TT3D 3NHBA 1NP6A 1JPJA 1EWRA 2QROA 1Z07A 1VPLA 3H1TA 3R7WB 3K0SA 4KLNA 1H8HD 2GVZC 2DB3A 4X8MA 2CK3D 1F2UB 3GFOA 4TWZA 2WOJA 3RS5A 2WJYA 4FN5A 4JLNA 4TSFA 3WNDA 3V4RA 4A36A 3KFXA 1TU4A 3CPJB 3VTKA 1JECA 1AN0A 5KSPA 2PX0A 4OK5A 3O47A 1P73A 4PAOA 3QKRB 1DO2A 3UK6A 4C3ZA 1FUUA 2IYQA 3R7WA 2OO7A 5JJIA 4NYMQ 2P67A 2YOHA 3NBYC 2QPTA 2XJ9A 3MG9A 3GLFB 3DM9B 4DLVA 1FX0A 4GP6A 2CHVA 3PEYA 1IAQA 3DM5A 1K5GA 3EPHA 4FIDA 3CB4A 4LHVA 4CEIB 1Z06A 2WKPA 5FL3A 3PJRA 3TE6A 4MRPA 2GNOA 5HZHA 3QKUA 2QL6A 3SE0A 2QT1A 4QM7A 1A7JA 2CE2X 4MKHA 2IYVA 3JVVA 2ZUDA 3P1JA 4A0RA 4AI6A 4PQFA 3AF4A 1R0WA 2OXCA 3OAAD 4EDHA 5KHOC 3LBNA 1KO7A 1N0WA 2CHQA 1G17A 1X6VA 2IHBA 4UJ5A 1XB2A 2VEDA 3RSOA 2WIAA 5DSZA 1HQCA 3OEHD 2D4HA 4HI0E 1N6PA 2PT7A 2O8DA 1YZUA 3JZAA 2QUZA 2VA8A 1ANKA 1OFHA 4D26A 1UAAA 1ZNXA 5ANRB 4QOSA 3Q5DA 2ORVA 2XSZA 2C78A 4BFWA 4P3YA 1IJFA 2CE7A 1XFAA 5JZVA 1BS1A 1KHTA 2BM1A 4CT5A 2CDNA 4YC7A 3AVUA 2REBA 1CP2A 2EW1A 5JFGA 1ZVQA 3CR8A 2PMKA 5K8UA 3N5CA 1A2KC 2JJ1D 1QF9A 2D2FA 4Q4HA 3IQXA 2CJWB 4QFMA 1NBMD 1IY2A 4LV8B 3TBKA 4EUNA 1OKKD 5FPSA 2FEMA 1GKIA 1J90A 1HA3A 3T1QA 3FFBA 3I5XA 2N1BA 2QTVB 4LYFA 3LLMA 4OI0A 2GTPA 2VP2A 3FE2A 2GZHA 5L3QA 1DEKA 1NJFA 1US8B 2QI9C 1OH6A 1KNXA 4MRVA 2FDCA 1Z08A 2FH5B 3AKCA 3K0CC 2CVHA 3ZZ0A 2ONKA 3GPLA 4B48A 3KJEA 3CX8A 5DLQC 4PTLA 2NZ8A 5KTYA 4MDEA 1NVVR 1XPOA 4C0SA 3P20A 4B71A 4LI0A 4E09A 2IXEA 3GLHE 4HAVA 1DAFA 3THYA 1E79D 2O8FA 1T6NA 4HB0A 1AIPA 4O0MA 4B32A 1UKEA 2FU5C 1T8TA 3K0CA 1JJ7A 1E0JA 2O0KA 5CK5A 2ZE5A 1MRNA 3EZ7A 3PFIA 4YLGA 1R0YA 1YKSA 4NONA 4C0BA 2QBYB 4V0KA 2BKEA 1N5LA 2MMGA 2UVQA 4QJ4A 2N46A 4DLRA 2ZUCA 4EFNA 2BMDA 2CLSA 1J7KA 2ZROA 3VKWA 4US2R 2ZJ8A 1AA9A 1OXVA 4HAYA 4UQOA 1L7VC 4EFMA 2PJRA 2CCJA 1YVDA 3REFA 5D3MB 4BLQA 4MQBA 1E9AA 3LXRA 2VSOA 1DPFA 1QG4A 4LBWA 4NDZA 3UWKA 5F3WB 2RGDA 2PBRA 3SHFA 1S9DA 3TMKA 1OXTA 3BORA 4TYPA 1Q21A 1XMJA 1XEFA 4L15A 4NU0A 1Q57A 3LNCA 1TUIA 1GFIA 4G5SA 1GTVA 1KTVA 1W0JA 4M1SA 4TT3A 3I8SA 1Z22A 3KB1A 4YDHB 3TW4A 2WOOA 2CCGA 4BFUA 1MABA 4H1UA 4EQ6A 4DSOA 2C9CA 2JDID 4DLXA 4DUGD 3ASYA 4A0FA 2HLDA 4LWZA 5TV2A 2UKDA 1DBSA 4JSYA 4P4TA 5FBLB 1E9CA 3DO6A 2IS2A 4XVQA 3V4FA 4G1UC 1HH4A 3K0AA 3U6BA 4RD0A 521PA 1GDDA 1HURA 3SYKA 4HAXA 3GJ6A 3X1ZA 4C0HA 1D8TA 4R71A 4NYIQ 2JLUA 3LA6A 5BYKA 1Z47A 4QBHA 2CCKA 2DFTA 2WKQA 1II8B 1SQ5A 4CRWB 4AIIA 1E99A 2QENA 2WJJA 4OQFA 3TRFA 3BK7A 2Q9BA 2ZSAA 3FKSA 3VR4A 2QP3A 4TZ6A 4Z1MA 3TQCA 4A9AA 1KSFX 4JLMA 2BDTA 1NF3A 4CZ2A 3HPRA 4NBSA 2X8AA 3AF0A 4K8OA 3WRXC 5JMTA 1JPNA 2QAGA 3TVTA 4HUTA 2K5UA 4NZYA 3GLIA 2A5YB 1P2SA 2LWIA 1D2EA 1SKYE 4TMXA 5JRJA 4PO8A 4BFTA 3VR5A 3U4QB 4OJKA 1G16A 3TR0A 3R9XA 2PCLA 1G8PA 4JVSB 2BM0A 4ZO4A 5FUVA 3FDIA 1ZD1A 5G53C 4ON9A 1Q1ZA 1M8PA 3BB1A 5TVKA 1KI7A 4EKDA 4MYUA 2EFDB 2RB4A 3AF3A 4V0LA 4Z54A 3DPUA 1RC8A 4R98A 1HQYE 4R2HA 1SULA 5KDLA 3CX6A 4Q01A 1G8FA 4N0EA 2J9RA 1HT1E 4HB3A 5TB5A 3CLVA 1OXUA 4KHZA 1OYWA 4TL7A 4RZUA 1KK2A 5J4VA 3KB2A 2GCOB 4D4LA 4X8OA 1FW6A 2O8EB 3W8RA 2FV8A 3MFYA 4DRZA 3QG1A 1ESMA 3U5ZB 3SEAA 3WBJA 1BKDR 4P32A 3HJNA 3KL4A 4P4SB 4Q9LA 2VP4A 1OHHA 2J41A 4FD2A 4GZMA 4KYUA 4PHGA 2R6CA 2XTNA 4BFXA 2PZGA 4F7WA 3KQUA 1TADA 2JLXA 1JR6A 4HDCA 3ADKA 5B58C 5DE3A 3DVLA 3QJYA 4NHOA 4OQNA 2QTHA 2C04A 2ZR9A 3FHTA 2VSFA 2IXGA 2ZRCA 3TW8B 4LX0A 5JS7A 3IUYA 4DIDA 3E70C 2I1QA 3MMPA 1J99A 3RS7A 4P4SA 3LH5A 4ABYA 5L3RA 4C9BA 2SHKA 2YC4C 4TYYA 4IXMA 4XTRA 4URYR 1G20E 3BOSA 4KFRA 3UXMA 4PPFA 1OYYA 2BMFA 3NTUA 1GKUB 2FJUA 4M21A 3FHCB 2IS4A 3OIYA 1LF5A 4CYMA 2ZYWX 1TF5A 3QKTA 1X3SA 5AJYA 3KUCA 2Q0HA 1D9ZA 3BC1A 4BLPA 1SVMA 3NWJA 2MSCB 2O8BA 1ZM2A 1FP7A 4BE7B 1W0JD 4NCNA 4M9ZA 1CR2A 3T06B 5KSZA 2JEOA 1M7BA 2C99A 3K09A 3FMIA 5FH9A 1OIWA 1YU9A 1RFLA 3EZ6A 3PG5A 2BCJQ 3WY9A 1MR3F 1F2UA 1Z83A 2JIZD 2W6ID 4NYJQ 4ZCLA 1ZM9A 4RJLA 3RANA 2RAPA 1W7AA 1A1VA 3IPXA 1Z0FA 3EZFA 3FMPB 5FPYA 2QA5A 1DAKA 1XJQA 5EZ6B 2OSBA 3EA5A 2QMHA 2V1XA 4H9GA 3PQCA 5FOUA 3G5UA 4MDFA 2X1VA 4DDVA 2OAQ1 1NKSA 3KTAA 3ASZA 5JJKA 3ICQB 4MYCA 1RE0A 1G7TA 1KI4A 1SKYB 2QZ4A 3AVPA 4TLEA 5CJPA 1CEEA 3MWYW 1VG0B 4BLOA 121PA 2JLQA 1FTNA 1IM2A 4B76A 3UMRA 2IYYA 5GJVC 3RYTC 3BFVA 4KI0A 2ZQ5A 2NPFA 1UEJA 4Q1EA 1SHZA 2W6JA 1EWQA 2JLWA 1ZD8A 2BBWA 4JBWA 4OKSA 1NG9A 4YXWD 1CXZA 1KZ7B 1QHSA 2IUSA 3C5CA 5FUWA 2JLVA 3I32A 3MJHA 1AK2A 3NG1A 2CNWD 4BASA 2YWFA 5AJZA 1FL9A 4LDJA 1WRBA 2B21A 5AUPB 4I1SA 4HLUC 4WZBE 1EFRA 1J8YF 1GITA 1C1YA 3S1AA 5DI3A 1W47A 4PR0A 3KFVA 2YWGA 4HATA 3SFZA 1KI3A 5F9HA 2H5EA 2G6BA 1JXMA 4LOAA 2ZE7A 3QKSB 5JS8A 4JLKA 1G64A 1BO6A 3MWKA 2XITA 3CRRA 2FE4A 4JBXA 3L82B 4FMDB 3DOFA 3CF2A 1XD8A 1VIAA 1G4AE 2O52A 5TMPA 1WBDA 1JEEA 5K8IA 5AUQA 221PA 3W90A 1U8AA 1IBRA 4RCYA 2E1RA 4O3MA 3ZIAD 4ZPXA 5SZKB 4FCWA 4C0JA 2P0EA 3VR6A 1UBCA 2WSMA 3LRPA 4RFVA 5FOSA 2FGJA 3QF7A 2A2ZA 1U81A 4W7SA 3WMEA 1SGWA 4RZ3A 3RC8A 1JI0A 2ZS7A 2V8OA 5L3VA 3F0TA 3T15A 1IOZA 1FMJA 3ZYCA 5DGXA 3VX4A 2VHCA 1L4YA 1SVLA 2WWIA 3FWYA 2ZRHA 2ORIA 3Q72A 1MV5A 2W2VA 1PLJA 1KI6B 3C15C 2JLRA 4KITB 2E9SA 2NGRA 2WAXA 4CW7A 3A1SA 3EPJA 2WWYA 3SFVA 2A5JA 2OBLA 2AFIE 1FTSA 4PZZA 4GMXA 4DLYA 4Q48A 2BKUA 2HT6A 4XVRA 1Q20A 4Q1BA 2XZOA 1DARA 3PEVA 1GRQA 2P5TB 3NC1C 2WWWA 1E9SA 3CKLA 4AD8A 4AYTA 2EYUA 1BMFD 1VDZA 1U0LA 4JSTA 4XTCS 1XTJA 2WVJA 1VCOA 2BC9A 4B35A 4KLZA 1VG8A 3MLEA 3CRW1 4M1YA 5GVRA 3K9NA 3NBFA 1CU1A 3TVDA 3THWA 3C16C 3EASA 4NTZA 2UZIR 3K0FA 2CVFA 1AS0A 2GAAA 1XTRA 1VYVA 3C41J 4PQRA 2CL0X 5EXXA 4YQFA 3CNNA 1CJMA 4EPVA 5D3MA 2HF9A 5FUYA 2C77A 2YC2C 2WZQA 3ZJYA 1Z28A 5KNCA 2KJQA 3IO3A 2H1LA 1X8LA 1Z0JA 2AFHE 3X1DA 3I61A 2AK3A 2ZEJA 3A8TA 1KGDA 3RAPR 3QPVA 4URUR 1NL3A 4A4DA 1V5WA 1GAJA 4XWOA 1F60A 3BS4A 2ANBA 3MJRA 2FSHA 5GJWC 3P4YA 2QT0A 2X2FA 1IONA 1UKYA 4AK9A 1OPXA 4UNSA 1EFCA 2QQEA 1ZC3A 2IYZA 3NBXX 1XD9A 1LB1B 2Z4SA 5P21A 3BH7A 1A4RA 1G8YA 3D3QA 1LFDB 4GNKA 4AURA 2ODEA 1Z0KA 3LD9A 2AWNA 5J4YA 5IHPA 2N42A 3CH5A 3SZRA 5LDDC 2KWIA 3TLXA 1CLUA 1ZP6A 3RHFA 1II9A 1XXHE 2I4IA 1RYHA 1W4RA 2P65A 1JNYA 2Q3MA 4PAMA 5BYJA 5KDOA 2ZJ2A 1VTKA 2J0VA 2FSGA 3KKNA 1CBUA 1ZU5A 1ZNYA 2Q3FA 3RRYA 2BHRA 2WIBA 4R9UC 4WIAA 3ADCA 4IJMA 3N2IA 2O0JA 2OESA 3NBZC 2LKCA 1NLYA 1E2JA 4C2TA 4Z8YA 1AZTA 1G1MA 3AQ4A 1F2TA 4KFSA 4M9SA 3EIQA 1SVWA 1S1MA 4Q9HA 4DZZA 3TAHA 2AX4A 4PXAA 4B6FA 3ZS8A 4LJ5A 1E9FA 2NZJA 1QBKC 1XD2B 2FEOA 2XB4A 3K8YA 1XEWY 4A8JC 2J0SA 1EXMA 1VYUA 3QXXA 3R20A 1AJEA 3GMTA 3VNUA 1FNMA 4Q19A 3I73A 4DDWA 1US8A 3HU3A 5E7JA 1JR3D 4CDGA 1M2OB 4ZI3A 2HT1A 4M9QA 2ZXUA 3U3KA 4Q66C 3WXMA 5L3SB 4A2PA 1GL6A 4PX9A 2ZR7A 2OFXA 3OZXA 1KJWA 4HAZA 621PA 4MRSA 5GJCA 2CBZA 5HCIA 4OJQA 5TARA 3THYB 1VCIA 1ZRHA 2FNAA 4YMWA 1KYIA 1GRRA 1K6MA 4KVAA 3A58B 4DXAA 4ZDKA 2C5LA 2OCYC 2VHQA 2BBSA 3HR7A 3M1IA 4BPBA 4HUQA 4KBFA 4AG6A 5L3SA 1FZQA 1BMFA 4MYTA 1Y63A 4NCHA 4CEIA 2JCSA 5A4JA 2CL6X 4OQMA 3C4JA 1P4SA 3IQWA 1T3HA 5CB8A 2B8TA 3QE0A 2DY1A 1W48A 1YJ5A 2VF7A 1G3MA 2JA1A 4Q00A 4UKDA 4A92A 1KY2A 5HKKD 1GIAA 2OZEA 4LC1A 4HLCA 4UNQA 2ZRPA 4A8JA 1H65A 4ILEA 5BN3A 3ZQJA 3FOZA 4URXR 1DO0A 3THXB 1UM8A 2CLCX 2CXXA 3UKDA 1IY0A 5AJVB 3M6AA 2ATXA 3EWAA 3LO5A 4OYHA 3PENA 3W3ZB 1VG1A 1TNDA 2ANCA 3I3SR 1S9HA 2F43B 4OK3A 2I1VB 3L0SA 4MGKR 4NYMR 3L8YA 4IDOA 1UDXA 4RD1A 3U44B 4Q47A 2G77B 1JEDA 5E4FA 2NPIA 1IJEA 2JAQA 3WBKA 2UZ3A 4L16A 3DZDA 4JL8A 2H7VA 3OFNA 4MITA 3MSXA 4I99A 3NEJA 5FI0B 3BWDD 3FB4A 3KQKA 2XJ4A 3WP0A 4LY6A 4GZLA 5B30A 1T4GA 2XXAA 3EWSA 3DKPA 1XXHB 1R10A 1D5CA 5FUXA 3AVTA 1ZW6A 2QSYA 2DHRA 2IS1A 3V9PA 1R4AA 3I8XA 5JCZA 2BVNA 1E1RD 2YWHA 4KSCA 3U7FB 5SZJA 3E1SA 3QPUA 2D3WA 1KJZA 4IEIA 4B74A 3SR0A 4EJSA 1XPRA 2JGNA 1KK1A 1P6XA 2JATA 2XOKD 2GEVA 2GCPA 3NVAA 2VP5A 1Z2AA 1G4UR 3B6EA 3WNBA 1W36B 1U0HC 1XXHA 3ND8A 1ZIOA 3BAFA 5JHHB 3SNHA 4QC2A 4I1VA 4N3NA 4I81A 1CTQA 1K5DA 2XOKA 4P4UA 4B3GA 5CM9C 3U4QA 1TF7A 2CK3A 1W5TA 1WB9A 3TUZC 4G3XA 4LJ7A 1TPZA 4DSTA 5D3QA 3B1VA 1H8ED 4X8LA 1CJVC 5CLQA 2YNMA 5J4HA 3Q9LA 4TLAA 3GEIA 3UIEA 2HJVA 4NPHA 5KPJA 4A6XA 3K70B 5KSOA 4EPWA 5EP1A 4Q4LA 1HE8B 2GBLC 1E94E 5CDFE 3O8RA 1X1RA 2L0XA 2HCJB 3TIFA 4JJKA 2HV8A 2ZPTX 5DHAA 4Z51A 1ONBA 2VRWA 3LBIA 4YXWA 1IXRC 2Q21A 1E2HA 3T1VA 1A5TA 4CT4B 3C7KA 4C4PA 5K8TA 1W4CA 3QF4B 4TMZA 2GXSA 2IYTA 2GBLA 2GETA 2P2LA 3NH6A 4JVMA 1JQJC 4RSGA 1TTTA 2W0MA 1NSTA 3LXXA 1LS1A 4RD3A 5FFMA 2QMEA 1PVOA 4LJYA 4KAXA 3K70C 1WQ1R 1E9DA 3A1UA 1KK0A 4Y0AA 2G88A 2ZITA 2XSZD 2FGKA 3QKSA 3QOFA 1E2GA 2XGJA 1NMXA 4Z1MD 2HDNB 4A2WA 2RGCA 1G7RA 4URWR 3EPKA 2QMOA 3RDPA 2EFHB 4Q4AA 4Q02A 2IYXA 4YMSA 1WCV1 2NIPA 2OG2A 5FOWA 3RRZA 4JKYA 4TN1A 3TQFA 4AKEA 2QPOA 3U7GA 3B5JA 3RS2A 4ARZB 1L2TA 2JIZA 2O8DB 2J7KA 2NO9A 2HXSA 5GADl 1CJKC 1G291 3Q85A 2GZAA 1S1CA 5B64A 4W9MC 3CONA 4TTRA 4LGMA 3K0AB 4LV6A 1IN6A 4IW3B 4EPRA 4LUCA 1VHLA 2P6NA 5H70A 1EFHA 3L0OA 4MKFA 1G18A 1JQLB 4XSGA 3CNOA 1S96A 2ZETA 3OIUA 1SXJD 3VKGA 1GL9B 4JL6A 3D7MA 1MT0A 4KCGA 4RD6A 4MH0R 5KSYA 1MH1A 2O8BB 4QNRA 5FL7A 2WSSD 4JLPA 1KSJA 3VQTA 2BEKA 3SDZA 2CJWA 2FX3A 4DCNA 2R62A 2ZI5A 2WICA 3PVSA 1KO1A 4BLSA 2F55A 1VKJA 2O0HA 1E2LA 1U8YA 1Z0AA 2ZREA 3LFUA 3GJXC 5EE5B 5J4LA 1KI1A 1T91A 1OHHD 1XMSA 1Z0DA 4N1AA 3K9HA 1E2KA 3RWMB 3L43A 2A78A 1HT2E 2BIFA 4E5UA 2GAOA 1G3RA 5JBQA 1FNNA 3IIJA 3GCGA 2GEDA 1J2JA 1KKLA 2HCBA 3SYLA 1QHIA 2VBCA 5E7IA 3PCRB 4B6EA 2BCGY 3U3RA 4LCBA 1P75A 2IWRA 1UFQA 2YYZA 3G0HA 2VL7A 1QHHA 1GRNA 3OEEA 1L8QA 5EP2A 1IN5A 2QBYA 3Q5EA 1P5ZB 2OUKA 3AH8A 4M53A 3OAAA 1E0KA 1XNJA 2AR7A 4LHXA 2KI5A 4YMUA 4LPSA 1RRCA 5CIQA 2ZAMA 1PUJA 1I2MA 3PR1A 4HDOB 1NSFA 3DMNA 2Z5FA 3IBYA 4C0LA 3I5YA 5AK0A 5EZ5A 3FKQA 2REOA 5TXGA 2ZVQX 3R8FA 2RKOA 3FHOA 3REGA 1QHHB 1GOTA 3WHKA 1NBME 1WF3A 4ERNA 4D25A 4YDSA 2DFLA 1NVVQ 4HUQB 2QE7D 4CEJB 1N5JA 2IC5A 3B60A 5CITA 5EXPA 1XTQA 3KKOA 5CDFA 721PA 1EFTA 4LJ8A 1MO3A 1TUEA 2FPLA 4Q4HB 5KO2A 4BFZA 1AGRA 4C30A 4PSKA 4LHYA 4DDTA 2G0TA 1IHUA 5F98A 1MKYA 3M4YA 3MUFA 4TLCA 4AWXA 1G3QA 3W9YA 4QJ3A 1OIXA 2DR3A 3PXGA 1OF1A 1XDBA 1Z6AA 3THXA 1LVGA 2PH1A 3ZVLA 1LTQA 2G83A 4DBLC 1OB2A 1RRPA 4KFUA 2JLYA 4JYBA 4FWTA 3GQBA 2FWRA 3SJBA 3IPYA 4QRHA 2G9NA 3AP2A 4ZCIA 1GNQA 1KAOA 1VMAA 3IEUA 3U44A 4II7A 1NN0A 4OHVA 3B7GA 4WW0A 5AJXA 1Q1QA 1ZJ6A 1U94A 2ZSDA 1E0AA 2CNWA 1RZ3A 1TQ2A 2OEPA 2O8CA 3BB3A 5EXTA 1M7HA 4WOPA 3AP1A 2FN4A 3B85A 1IN7A 1T0JB 2AKYA 1IXSB 2ONJA 5GVSA 1FPMA 3SN6A 4ACAA 2ZS8A 3KX2A 5G40A 5FPKA 4GDFA 3VHLB 2IYUA 4Q1AA 4AYXA 4BRWA 3PUYA 4JYCA 1NIJA 1VHTA 2OT3B 3EZ9A 3KXKA 4ITRC 3GLFE 2WAYA 1XBTA 3BRWD 5CLLA 4FINA 2PT5A 3SYNA 1Q1BA 2EWWA 1N0VC 2J7PD 4Q5IA 1E9RA 1WP9A 2ZM5A 1EFUA 1XJ0A 4M2LA 5FI1B 3I4LA 3O8BA 4B3BA 2A30A 3ECCA 3A6PC 4AYWA 3QNUA 4KO8A 2QM8A 2ATVA 3JZMA 3PITA 4EQ6B 5GJBA 2ODBA 1CJUC 3CZQA 1DADA 3ZDQA 3VKHA 2ZR0A 4IOLA 5F2EA 2Q9CA 1BYUA 3VFDA 3LBHA 5LD2B 2W2XA 4BFSA 4PO9A 3NKVA 4HYYA 1KIMA 1OSNA 4M1MA 1XZPA 5LB2A 2RGBA 5E95A 1L4UA 4F93B 1QG2A 1HTWA 2HLDD 2B8WA 3A4LA 1BYIA 1W44A 1U9IC 2H8KA 4XOIA 4WZAE 3OFND 4PC2A 1W4BA 4S35A 1Z8FA 2WPDA 4ACBA 1PV4A 4E07A 1YR9A 3CH4B 3GFTA 4U7DA 3P4XA 1XJCA 2ZIAA 2C98A 4D0GA 3ONWA 1RRFA 2W58A 2WMNB 2GESA 4G5GA 3SOPA 4DB2A 5LD2C 4WXRA 1YZTA 3J81k 2D2EA 2QRZA 2AL7A 1Z5ZA 4TLBA 3KJGA 1J8MF 5FTLA 3N2EA 1Y3AA 3KQHA 3SJCA 1UKVY 1YHNA 5EP3A 4E03A 2VHTA 1EX7A 1YR6A 4EJSC 3GLGE 1UJ2A 5BWMA 2R44A 3LWNA 4JT4A 2D7CA 2RGNA 1T9HA 4LZZA 4MRNA 3WYGA 2ZI3A 3EXAA 2C95A 1HEIA 1OW3B 4LRWA 2Z43A 3I92A 1N6LA 3U7HB 1XRJA 5EUMA 4GOXA 2YOGA 2WWHA 5J5CA 4Q4JA 2V3CC 4HB2A 3AEZA 2FFAA 4KVGA 4PFSA 3AVVA 1T0HB 2ZU6A 1CULC 3WYAA 3BH6A 4LBVA 4HAUA 5HR5A 4LJ4A 4GP7A 2BBOA 4B43A 4D6PA 2ECKA 1QDEA 1CR4A 4LJ6A 1ZCBA 4JL5A 3A36A 4M0LA 2J0UB 1N0UA 2QP4A 2ZI7A 2FZ4A 2WPDD 2VTKA 3QBTA 4OI4A 3VR1A 1JB1A 4MA4A 4TTPA 1Z6YA 2ZI6A 2WSSA 1Q12A 2V7QA 3AKDA 2IUUA 1F48A 4IOJA 2AD5A 4Q1CA 3B8HA 2B7BA 2BEJA 2V6JA 2QTFA 1OLOA 1N25A 1O3YA 4C7OB 4PHHA 1GNPA 3QPWA 1DOAA 4L9SA 2OILA 2IBMA 3OHMA 2IL1A 2XNDA 4GBMA 1E1QA 1ODFA 3AVWA 3HWSA 2F1HA 5DHFA 3CRQA 4UXHA 4B3XA 1KO8A 4LC0A 4F91B 4DLSA 5KNBA 1YRBA 5LPNA 1WBBA 2GJ8A 2QRNA 2ZAOA 4ASUA 2AN9A 2YVUA 1QVRA 3OIWA 2IW3A 2BMJA 1SVOA 2C96A 1HY3A 2V55B 1GP2A 4PPNA 1RJ9B 1Z6GA 4ESVA 1E6CA 1OFIA 5HPYB 2R9VA 2F43A 5FBQB 5EE3A 1X8JA 2J7PA 3W6OA 3AUXA 2KSQA 1LW7A 4HAWA 4JVNA 2H18A 4BLRA 4XVUA 1U8ZA 1D9XA 1MOZA 1Z2CA 5C46F 1J70A 4U00A 4NCIA 4DLZA 5H8WA 1M7GA 3MCAA 1CKEA 4LBZA 5FTMA 5CK4A 1SZPA 1PZNA 3DKVA 1NMZA 2OLKA 4DKXA 4W5WA 3ETLA 1YZKA 3VNVA 2D62A 1TU3A 2IEYA 3EIEA 4PO1A 2GXQA 3W6PA 1N6NA 2OAP1 6Q21A 1Z3IX 3T35A 3BD9A 4DT1B 3AGPA 4L8GA 3EZ2A 1ZNWA 4DIEA 3L8ZA 1XD2A 2Q6TA 1MO5A 3NH9A 1A82A 1EGAA 1PUIA 1XMIA 2FG5A 3I72A 1ZINA 3BFKA 4KV9A 4Q9IA 4X8HA 4B33A 2FFHA 3K09C 3P27A 4A2QA 2PMDA 2PL3A 1OT3A 3M0EA 3MGCA 4BLTA 1ETUA 4PPQA 1F3OA 2CHGA 2F1IA 2WTUA 2XZLA 3U2QA 2ERYA 2FMXA 4JLOA 1G7CA 5CM8B 2XNDD 3X1YA 4LJ9A 3B1XA 3GJ0A 3X2SA 4XJXA 2FOLA 4BZXA 1EK0A 1E9EA 1FUKA 2BWJA 4OL0A 1QHGA 2OV2A 3H84A 5DNYB 1VIYA 3U61B 3LVRE 1P9NA 1S2MA 2W00A 3L0IB 1YZGA 2P6RA 2PLFA 1AZSC 4POAA 4BFVA 1OH7A 1FQKA 4CEHB 3W5IA 4XSHA 3AF1A 4GMDA 3HR8A 1ESNA 3ZQ6A 3ZZUA 2Q3HA 4U5XA 3T1TA 1HV8A 2F6RA 1OKKA 2YJTD 4HLUA 4JVLA 3WMFA 5JJLA 1IY1A 2LKDA 3HYTA 1JXOA 3BGWA 1MRSA 3KXLA 3TH5A 4B3CA 5HKKA 4J0QA 1ZIPA 1I4DD 1D2MA 1M74A 5G41A 4PC3A 3SHWA 5JCPA 1HUQA 3AF2A 3MRSA 2AHOA 4D0LB 2CMKA 4D80A 5EE1A 2F9LA 5BXQC 2W0SA 4NKRA 2C9OA 1XEWX 4ARZA 1E1QD 1OB5A 1SXJB 2QPAA 5FBRB 3CF6R 4DCSA 4PC1A 1R0XA 4TLDA 3UWOA 3NIBA 3P26A 4WAUA 4PQYA 4UJ3A 1E2QA 5FL7D 1N6HA 2F9MA 4W5JA 4HZUA 1N5KA 3AB3A 2ZRKA 4FCVA 4IDPA 3GJ4A 5SZHB 1EFRD 5L8VA 2QSZA 1XMVA 2REXB 3SJZA 1NKTA 4PHTA 5AUNB 3ZVRA 4MGZR 1BOFA 2G3YA 2QNRA 5AWFC 1WDTA 1ZUHA 3CWQA 4PC7A 5JRZA 4RKFA 4M1WA 4IVQA 1U0JA 2OBMA 5FPTA 3NXSA 2ODNA 1SXJC 4V03A 2FFQA 3H0KA 4XWAA 5AJWA 3SI7A 3U3OA 3V00A 4LHZA 4OHYA 2V6IA 2V9PA 4AC9A 5IF9A 1SHKA 2ZE8A 4L5BA 2DWPA 1GKYA 1Q0UA 4GI7A 5HZKA 3DHWC 1E4VA 4QHSA 2Z83A 4IDQA 4KU4A 2AWOA 5JSZA 3QUSA 1JBKA 1D6JA 2O8EA 3IGFA 2VLIA 3HYRA 4TYNA 2J5XA 3K9LA 2OHFA 3BFXA 1P9WA 1ZC4A 3AKEA 4QL3A 4KSBA 4Q4JB 1G3IA 3GFPA 4HSEA 1KO4A 3T12A 4JLJA 4OHXA 4V0NA 4B2IA 2A5GA 2R6GA 3BERA 3IKJA 4GFDA 4BQSA 4EAQA 1HE1C 2EU8A 3GP8A 2WM9B 4IFBA 3AVXA 1VCMA 4I1OA 2W2TA 2GK7A 2PZEA 1NVXQ 1H8HA 4NP6A 1G6HA 1P9RA 4MGIR 3LY5A 1KNQA 2DCUA 2P6UA 4KBGA 2X77A 1TL7C 2JLSA 1O87A 3NC0C 2ZSFA 3ND9A 2QAJA 1EESA
chains in the Genus database with same CATH superfamily
2DUJA 5JOQA 3V8PA 4FXPA 5JAIA 1ST3A 4NAVA 3A1EA 5IDVA 1WMBA 3A2LA 3EXHB 3P9RA 5JWOA 3I1FA 1UZMA 1V4BA 1XEXA 2WJIA 3EZXA 4FKBA 2EZTA 4QXRA 1B3BA 1V8ZA 3JYOA 4XH9B 1Z36A 4C6HA 3SQXA 1JXAA 1VJ1A 3KHUA 3KQYA 1U0OC 4RV4A 2AH5A 1JSCA 4QFBA 4EMTA 3I62A 3DOUA 1GUYA 1SRQA 2QGZA 2X22A 4MXDA 1W85A 3OP4A 4Z99A 2IODA 1B6RA 4L02A 3TR5A 2PMFA 3W8DA 1F17A 2QL9A 2Q3CA 4N6NA 4R1LA 1JI3A 2NUAB 4D45A 5JDIA 3GUYA 2Z2IA 5EWJB 2E4VA 5KDDA 4K2AA 3SC3A 4C0KA 1EA7A 1KMHB 1YE3A 2FZLA 4S1TA 4PEVA 4MEJA 4C6TA 5JWHA 3F8WA 3X2FA 1FLDA 2NOAA 3GEEA 3CKMA 3KL2A 1HDEA 1VPDA 1ULAA 3WTBA 3ZGXA 1QFSA 2JFFA 2V4MA 1T3SA 1ZKDA 4G86A 4DMMA 4ZYYA 3ZV7A 2P9JA 1HTBA 2YQ4A 2OORA 5AKYA 4R8KA 3ZU6A 2QTBA 5C52B 3HABA 3PDHA 2DQZA 3PKJA 3TZQA 4QOHA 3FGNA 3HDVA 1KOLA 3UC5A 3O38A 4LY3A 2XDWA 1USKA 5JLAA 3DMYA 2JBWA 2YH2A 2AOWA 1JHYA 3G1UA 3K6RA 4DJTA 4YP5A 5EZYA 1N1EA 1RQLA 5H1YA 3UHPA 2Q6KA 1E3JA 2WT8A 3JQBC 1YFLA 1UZAA 3CRMA 4QDOA 4PGAA 2VF4X 4BQEA 2M6SA 4N5HX 4W1QA 4F86A 1JDZA 2O8CB 3N70A 4R1SA 3FOBA 5CHEA 4O4LF 4PBTA 4CMEA 3X1WA 3T5PA 3QJ5A 3NPAA 4UNRA 2OPBA 3MINB 3U4IA 3QELB 3OKFA 1FSGA 2PUHA 4OLBA 2QRQA 4HEQA 2AEFA 3G6KA 4GIBA 5TQJA 3ZGZA 3T1HB 1EYZA 5F1OA 5AVWA 1C2TA 4UAGA 4QUKA 2VDRB 1WMSA 1CS0A 2VP9A 2VPPA 3IEPA 5C4GB 3RYHA 3AHIA 2O3RA 3WGQA 5CFPA 4BXOA 4KXXA 1M2EA 1PF7E 3NHYA 3VISA 2B92A 3CH6A 1W4AA 2PK3A 4RANA 3FBWA 3UB3A 4DV2B 2HO5A 4RACA 4UHBA 1B14A 1N7HA 3MINA 1G9TA 3QELA 2FSSA 4BCDA 5K6AA 1ND6A 2HKIA 2CLEB 4ZOEA 1SC4A 1XKXA 2QR2A 3E48A 3QVKA 4HFMA 4PLCA 3RTDA 1TKBA 4WLOA 2I29A 2GDJA 4EVIA 4RTPA 4CV2A 2IBSA 1I0LA 5GPBA 3KDAA 3BJIC 4P33A 3H86A 3LLVA 4EFLA 2GKOA 3MERA 2H5JA 3NTOA 3Q7IA 4LXHA 2RMKA 4Q21A 1L7XA 2AOXA 2IYOA 1NW4A 3KD2A 5C53B 2Z8YA 1L8XA 2XB2A 1RI2A 5LB4A 4NAHA 3RT9A 4DJEC 1E2PA 1Q5PA 1SU4A 2Y6UA 1R18A 1W5BA 2Z0MA 4NYJR 4IDGA 4DJAA 4QBIA 2NU7A 1G5RA 1PJBA 4C0AC 4EJ0A 1R88A 4MO9A 4RWZA 1E79A 5CA0F 1KP2A 1ES9A 2WMOB 2HDWA 3KYIB 2OHJA 3U62A 3ZV4A 3BF7A 3HCRA 2NZ2A 3EVAA 1B0UA 4P31A 2J6HA 4C76A 3JYLA 2TMKA 4NAUA 2Z4RA 4O08A 4QE3A 1IPEA 3KJHA 3OZBA 5F35A 2ZYHA 4B4UA 1NF8A 1N6IA 1BD3A 2BR3A 4OLHA 1WLSA 3HCOA 4C20A 3O0DA 1OZGA 1X7WA 4FC7A 1ZO8A 3A25A 3FPAA 1Y3FE 3RYIB 1NBWB 3ZHBA 1OV6A 3CR7A 1NE2A 3B70A 5F1YA 5FRDA 4B0PA 3EPLA 3HDHA 4OLAA 4LJSA 2J9FA 2FEKA 2I2CA 4BRUA 1K2WA 1ORWA 2E4XA 2OUIA 4UZFA 3SZUA 4ARAA 1GNVA 1TO2E 4J2TA 4UASA 2C2HA 1XP5A 4KNVA 7ABPA 1MQAA 1EX6A 3UPDA 3INRA 2WIKA 3DNMA 1LNZA 2R5NA 4Q0MA 4OJNA 1QVAA 2VIIA 4RFSB 3RABA 3K20A 5M2QA 4ZKDA 1WQ3A 3OBBA 4RK4A 3HV0A 4DT1A 1S2NA 3NGXA 2G17A 3QVUA 1NW7A 2HDHA 4K03A 2I22A 3JQDA 4HBGA 3TGPA 2H2WA 3GP5A 1W0KA 4IJQA 5KNDA 1M1NB 3WGGA 5LUBA 1LC3A 5E0OA 1JE1A 4D0NA 4DMGA 4BQRA 1JZSA 4OGLA 1ZBQA 5A5FA 1ZGGA 2SICE 1PFQA 1GL7A 3K53A 1XP8A 1NZJA 1H5NA 1E2MA 3PDJA 1UJBA 3H9QA 4DYDA 3O8OA 3VX3A 5B1EA 3RD5A 5SY6A 2PX3A 2ZYVX 3CMCO 5ERYA 5MGNA 3GLIE 1B8NA 1H85A 3MTIA 3DS8A 2CL7X 4JZYA 3VNAA 2I33A 1KS2A 4QT0A 4TV8A 1E1MA 2PSSA 1XVUA 3MWLA 4EABA 1N3BA 1NGSA 2WZDA 2Z2JA 3K0KA 1ECBA 1Z2PX 1EHIA 4G01B 4I9GA 4OI1A 1Q50A 4WCDA 4AN0A 3MD0A 4EUEA 2C4UA 4V1CB 1A96A 3IV6A 3VBCA 2Z2XA 3KZ1E 1J25A 2CXRA 2ID9A 3KR1A 1PJCA 4EKNB 3DAYA 3L04A 1ODCA 3AP3A 1QTNA 3DE0X 4QBKA 1DXQA 2Y0DA 1NI3A 4RVUA 3BZWA 3WZLA 4A1FA 5CDTA 4Z53A 2GS9A 1BH2A 2JH9A 4XASA 3S4YA 2CNKA 1X80B 4QICA 1KJIA 4QYSA 3DBHB 2IZZA 3DVAA 4RGQA 2G9UA 1T5IA 2XEXA 3R7BA 3HC7A 2P3SA 5CG2A 4NH0A 1P60A 3T52A 2IKQA 1Z82A 3EHEA 1AT1A 5DO9A 4J4HA 1Z35A 1G5PA 3MT7A 2XADA 4JT2A 3UAWA 3ZBQA 1WXIA 4BNMA 2PMBA 1RCUA 4D0SA 2Z8XA 3FNEA 4EECA 2EARA 5FWDA 1P33A 3O92A 1SXJE 4R8MA 2BGJA 4NL4H 3RRMA 2B35A 2NVOA 3W34A 1TFRA 3HNOA 2HPHA 3KD3A 4B46A 2YTZA 4M1QA 1EGMB 5LQKA 3OCWA 3A6JA 1R4MB 4QPJC 4TVKA 2GHIA 4AKHA 1BXRB 4L5CA 3R6TA 4Q7JB 5HIIA 3DZJA 4ZV7A 4EQZA 4YUYA 3OQ1A 5CT6A 1IPHA 3I34X 1XMQB 3UUFA 1EWVA 4OFBA 3CNHA 3G9UA 4OSPA 4QSMA 4M7RA 4P98A 4D9FA 1LTHR 1JU9A 3RUHA 2YRXA 3HUTA 2PMCA 4FI3C 3W4JA 2J9GA 3WA6A 3ZZ1A 5IJ9B 5IAAA 1KWKA 1OREA 4RX1A 3KR2A 2EBWA 3OM9A 1I7PA 3L7NA 5DK6A 4BQFA 5CG1A 3ANMA 3H4TA 3HGTA 4NNJA 1HG0A 4QGGA 1Z39A 3CUTA 3I30X 3WKCA 2I4NA 1V48A 2J85A 4FP9A 1V7PC 1GPLA 2CXHA 1N2CE 4JLAA 2JNWA 1E89A 4JYZA 3QWHA 4ETMA 1H6DA 4A0GA 1Z62A 1MX1A 3DAHA 3T3OA 4YCLA 3IB3A 1XWIA 4V2UA 1OE0A 1A27A 2X19A 4ZT5A 4NCXA 3ZD7A 2RH5A 4YMVA 1A97A 3VH2A 5CCEA 1L1QA 1C30A 2SCUB 2NO7A 2A9FA 2GA9A 3D2LA 4OXKA 4XUCA 2UVDA 1I14A 2VJAA 5F4ZA 1U3CA 4N8EA 3L7JA 5KYUA 5LP6B 3K9GA 1U0TA 3EVCA 2FHSA 3UG7A 2VQFB 3GF4A 4MUGA 1B8VA 3W7VA 1RMYA 1NHWA 4NIMA 4G0PA 2EW8A 5F7OA 2ZANA 3ZKWB 2ZXEA 2JGAA 3PNYA 4YJFB 2P27A 3MELA 4WLNA 1YZQA 1YWGO 5BSEA 1WMEA 5FTKA 3NX4A 4WKNA 2APJA 1ZRMA 1DSSG 3ZY5A 5KYWA 4KZPA 4I9HA 1ODSA 3H4MA 1T4CB 4QDJA 5DYNA 2Q3DA 1NXQA 4TMFA 2UUAB 4OCZA 1G6OA 3E9MA 3S7TA 1L8OA 5D2CA 4X41A 4F5EA 5TJ9A 2DTDA 4JVOA 4BNIA 1KDTA 4IKPA 1KF0A 2YHIA 2OHOA 1MPXA 2WHXA 1KDOA 2BGGA 3BXXA 4TVBA 5KUTA 2RCNA 3I42A 1C8KA 1QRAA 2RGGA 4E6PA 2OCIA 1CEQA 1B15A 1QOPB 2WHQA 2WHPB 4A8JB 2HK6A 5G4KB 4EG6A 4C7XA 2C9ZA 2PGOA 4C2UA 1O7JA 1B23P 1E7RA 4CEJA 3DBLB 4ND7A 4E5MA 3DT9A 1U1GA 3BXZA 3MLBA 4EGQA 4F04A 3TAUA 2CUNA 2ZJYA 5DM60 1W8DA 1PLKA 2I4RA 4UD2A 4OX9B 1GLVA 1I6MA 4KIJA 3PRJA 3FCSB 3SQOA 4RCZA 4YRAA 3HPQA 2BBTA 4UDXX 1CW2B 3GUVA 3ZWNA 4BO9A 2O2IA 1IM5A 3IBCA 1PEYA 1U5BA 4XX1A 2C7VA 4EMSA 4H1WA 5H9WA 3J81A 2WUVA 3LW8A 4ALKA 3ZU3A 4D81A 3N3AC 3G68A 3VOTA 2QRPA 5JFTA 2W2QA 3W5HA 3BIWA 4FB5A 3BTUA 4DCPA 3VSAA 4UBKA 3AWIA 1QQ6A 1YCGA 2BONA 2RGAA 3NDPA 4ZCQA 4YQZA 4YCCA 2IIBA 1MABB 1G5TA 2VAMA 1ZHFA 3C7CB 4WERA 2R6FA 1N6KA 4RAQA 4OYLA 2BMEA 3IR7A 3AT1A 1A9QA 1ZMBA 2ZJBA 2PBZA 1XRSB 1P6UA 2E37A 2DJ5A 3H5WA 4NZZA 2H07A 1PSDA 4C43A 3H13A 1D4ZA 2R7MA 1M34E 4P81A 2X0DA 1T1RA 1IQPA 5JSHA 2PEZA 4HQNA 2PANA 4I2VA 4QXOA 1Q0HA 1JFFA 1CZLA 2PXHA 3KFLA 4IF6A 4K9NA 4Y2XA 3K94A 4E13A 2YKGA 2H7XA 2J87A 4C6RA 3EIUA 4MVJP 3DE4X 4WLFA 1Z5VA 3KQLA 2H9AA 3DLAA 2LIVA 3DONA 1DTWB 4JLVA 4G9EA 2P4SA 2HYDA 1C0EA 1D7OA 3ED1A 2JKYA 3FYHA 5ALNA 3MWGA 2WSLA 5JDIC 4UOEA 1LJ8A 5L45A 5EMNA 1NRJB 3B1WA 5LZ7A 1JWBB 1D6NA 1KP3A 2J5RA 4DQUA 2Q0XA 2ODWA 2DH5A 3UM9A 3QEKA 3GG2A 3T7DA 1WABA 1Q2UA 2PM8A 1V2GA 2QZZA 3KKMA 4YUXA 1SZCA 4MUHA 2XB8A 3R1IA 4CQJA 3BGVA 2ZTSA 2JDIA 2ZRDA 3CZ9A 3V1KA 4L5YA 4UPEA 4KH0A 3ILYA 3O7MA 1FSFA 3SBEA 2DBVO 2X2EA 4MI3A 4MNTA 5I7SA 1E69A 1EFKA 1RKXA 1ENYA 1Z6XA 4DRXA 2XA9A 4X60A 2QRHA 1ZOPA 1XTPA 2DYKA 1WEHA 2FPXA 4YRKA 2ZDQA 1Z33A 2OHXA 4QOJA 5AVXA 4GS5A 4TMTA 3VTAA 4JITA 1KPHA 4B6SA 3RW9A 5J58A 4ZDJA 2DFNA 5K2MA 1IN8A 1M2NA 3Q12A 1QP7A 1A04A 4LYAA 2P9EA 3DUFB 2Q2NA 3TW6A 3AEQA 3TZLA 3OIDA 5MN5A 1VB3A 3OI7A 1SUSA 1D04A 2ECOA 3TZEA 3VHQA 1XJ5A 4HBZA 4MA5A 4RM2A 1E3TA 1QU2A 1ZLXA 3RTBA 4BUCA 5ICGA 2V9ZA 1SXGA 3GIDA 1G19A 5DYTA 4H1VA 2Y0CA 4JJGA 2HMVA 3EXEA 1Y1TA 5C5DA 4K6KA 4YMIA 4X1YB 4IICA 4XLZA 1N75A 2YJZA 1P62B 4GR9A 3IMFA 1A8PA 1D8AA 3WYCA 1G63A 4BGEA 1M1XB 2JLZA 4F12A 4O25A 4G25A 1ZJYA 4TUYB 4ZMBA 3U16A 3P9XA 5HKLA 3ML1A 3OVMA 4FXOA 1MF7A 3D0OA 3AOEC 1JTFA 1U3TA 2GXAA 1NHGA 2H4JA 3BXEA 3CA8A 4PRKA 2V1UA 4N76A 1BU5A 4YQEA 3ZHCA 1JTVA 1OQAA 3HEAA 4HGYA 4M55A 2VZ9A 3NM6B 3R3UA 1N5IA 4FE4A 2B9VA 3QEBZ 1Y4UA 2B36A 3Q9UA 1DTEA 3JQGB 2R4QA 2UUBB 4Q1FA 4X64B 3UJDA 3P0RA 4DA6A 2V7XA 4GPZA 3KETA 1M75A 3AETB 1DIBA 3GDGA 3FSRA 1L5FA 2D5CA 4MV9A 4V02A 4AJ9A 4BGIA 4J0HA 2QR3A 2DBYA 3F67A 1FMCA 1EVLA 4WHMA 5KYYA 3AF6A 1KR5A 3DDCA 4R9SA 3X1KA 5ELXA 3LFTA 1XX6A 3OIVA 1JAZA 4J16A 2GMWA 4IOKA 2FW9A 5CXUA 4LHWA 2PSJA 1H22A 4EA7A 3U81A 1KJ8A 3UCXA 3VR3A 3STHA 2CB9A 1TX4B 4G24A 2W83A 3DSRA 3GJ3A 4H1HA 4NR0A 3UOAB 9ATCA 1FS5A 1CUAA 3HFGA 3L7KA 1N6OA 5EE0A 5CYFA 5EINA 2PCJA 1JHDA 2HHHB 1T5LA 3NNNA 4ARCA 3ZCXA 3WQRA 3M3HA 1E59A 6REQA 1RW4A 2G36A 1Z18A 4I6EA 1P3JA 3A9SA 2OGUA 3NV9A 3RLIA 3SM3A 4EY6A 3MVEA 1TCBA 1U3FA 2VS1A 4PO3X 4UE2A 1T2CA 2COUA 4HB4A 4KOAA 4BECA 1WZ2A 5BN4A 2YFYA 3DMHA 2ZSJA 2G08A 1T15A 3STTA 5FWAA 1IEVA 4BZZA 4WASA 1EQ2A 4CFSA 3ONDA 3PQ7A 2O2XA 4MJ3A 5FOVA 3KZCA 3HS3A 2BL4A 2ILTA 2XVYA 3Q8XB 3EC2A 4YAWA 5CURA 4TZ0A 3OY2A 5AICA 2JIBA 5DP2A 1VLQA 2QUAA 5LBTA 3AJAA 3MT8A 1CF2O 1JHRA 1VHJA 5LWHA 3B1YA 1S8FA 2P79A 3UY4A 4DCMA 3FF4A 2WUDA 5HTKA 5TGTA 1OFUX 4BC1A 2AEJA 2VYND 1BIFA 2ZVPX 3B7WA 2PWBA 4B8WA 2KBEA 3BCRA 1K5HA 1Y6QA 2BUAA 1UKZA 2QLJA 2QXTA 5TMBA 3K0BA 4Q9AA 3NWEA 1EI9A 3FG9A 1MLDA 1YDWA 3R9IA 1M6HA 3KV3O 3PSHA 5DNWA 3FUVA 3UXYA 4Z8XA 1EFDN 3FYTA 3LOQA 5LL6P 2VKQA 2GXUA 4LBYA 5JZSA 2AVDA 3T4XA 3W5JA 2UUCB 3PJDA 1F06A 2I2XB 4XXHA 3ILXA 3ZWXA 1KTIA 3M6FA 4OM7A 1V5EA 3KZKA 1PZEA 1SUEA 4YECA 1K9SA 1VP9A 2ZIXA 2VYQA 4Z49A 1Z5UA 2OFOA 3VDXA 1X92A 4WI1A 3TOVA 4LJLA 3TSCA 1GJRA 1CWUA 1MB4A 3MCTA 5K0ZA 1AQLA 5I7FA 1M6NA 3MMXA 1RMTA 5IJXA 4HDKB 2VTBA 1ZONA 3RJMA 3TD6A 4N39A 5L9AA 1H9CA 3CW2A 5CW2A 1MDFA 1QFJA 4MWEA 1XZMA 1T3LA 2FP4A 4EHFA 4TYQA 4YV2A 5LOVB 5GV7A 3A04A 2CSXA 2O7VA 2Y05A 5A9TA 1JU4A 2XUHA 3P2OA 4X6LA 3MQ2A 2D8MA 3GJ7A 2AXPA 4FHFA 5DI3B 4ARUA 1S3IA 4F6LA 1P19A 2F67A 4WN9B 2DH6A 1XTIA 3TRKA 2Z9DA 1I7NA 3HRKA 3DEIA 4ZIRA 4DQDA 4M86A 2J08A 1NG1A 4B4KA 3U9SA 1P2GA 5LMUB 1GTMA 2I2BA 3WBBA 2AS0A 1G3UA 2D7JA 3OQMA 2FQWA 3W8FA 1BS2A 3LL4A 4FMBB 4WLUA 3F6YA 3LECA 1QONA 1N77A 1FNBA 4X1IA 3QEOA 4B2PA 1OLXB 1Z5NA 4HJXA 4DABA 1YS2X 2YV4A 5TMEA 3BA6A 1ITZA 5LIRA 2DERA 1DS6A 2JJ2A 2JVIA 3QG5A 3HK2A 5FO0A 1L4HA 1XAJA 4M22A 4JX8A 1LC0A 3C6BA 2FETA 1PFKA 1T1GA 1COWD 4UEOA 3F3YA 3OCVA 4BX3A 1AS3A 3G5AA 1QH1B 3F47A 3IEVA 3TUJC 1CUZA 1YR7A 2Y9MB 4DLTA 1QQ5A 4NJEB 2OBNA 1U99A 1J33A 4DCJA 4MVJD 4L0DA 1FFHA 1M1YB 4IGAA 1N6RA 1MRZA 3D6TB 2ZDHA 3L06A 4P08A 2L19A 1RR6A 4IDBA 2ZRGA 3IPRA 4RHEA 4MRMA 4QBGB 4F71A 2AFHA 4A15A 3KSZO 1NTOA 2ZRAA 2WP8J 1XZFA 4TQUS 4WZBB 1C41A 4BC0A 1VI6A 2DKOA 3D4OA 5FIUA 5EZYB 1ST2A 1BE0A 9LDBA 4QM6A 4OJTA 1DX4A 1F0NA 1P0CA 3MPOA 1WB5A 4RY2A 3KKPA 2B82A 4UUQA 3JWEA 5FOTA 5C1DA 2J3JA 2JJ1A 4MICA 1KYXA 1N2SA 3Q8MA 4BWGA 1G8KA 5DN6A 1AQYA 1PFYA 1X7DA 1XZNA 3OLWA 1S0UA 3OE7A 4HRXA 2DQSA 3VR4H 3EGOA 3F7OA 4HVLA 4A82A 3SQWA 1YOBA 1TUBA 4TL9A 4DV5B 5H83A 3DDWA 3WISA 1YC2A 1CRPA 1XNQB 3CNLA 4RVCA 2RGNC 3E03A 4FCTA 4W5QA 2FFBA 8ABPA 5JSZB 3RUEA 3EXFA 2PWYA 2WBLC 4TMVA 2AK2A 1YRQA 3W8NA 3ZEAA 3IP7A 4JGBA 3RSLA 4LF4B 3AK4A 4B2LA 1X7YB 2VK2A 4Q7LA 4R8LA 1RVDA 1IUNA 1KDPA 4U9HS 3VO2A 4JOQA 1Q1EA 5HCNA 2AEMA 3PUZA 2C7QA 1UDAA 3THWB 3IQZA 4LYHA 1SQSA 3GLGA 2FZVA 3KS9A 2PUBA 5BVGB 4UU1A 1YB6A 4CF6A 1U1CA 3OQIA 2IIQA 1VKHA 2XA2A 3N0WA 4JJZA 5KJ1A 2KE5A 1LPNA 1DJQA 1S2GA 3UMSA 3SY8A 2IZ0A 2O2DA 4ZV4A 1AKMA 5F7XA 2AQIA 3GFVA 2KB0A 1LY1A 4M0CA 5WRFA 1KU0A 2G5CA 2NQ8A 3OT1B 3RVNA 2OQVA 3MUNA 5DCLA 4F4FA 4ED9A 2MINA 4L75A 3GI1A 4B3FX 4F92B 1RKBA 5IVKA 3K05A 5F77A 2ODTX 3EDMA 1RP7A 1T0BA 3A1DA 5EJ6A 5JI2E 4J3FA 4XD2A 2IXDA 1P45A 4WY2A 4EITA 5IDQA 1F4LA 4PBRA 421PA 1DXHA 2OG1A 5I4BA 4GE0A 3DMGA 5ADHA 4ECEA 1I4EB 1RPTA 1KZGB 4MWCA 1SUDA 4X5OA 3GK3A 4BDSA 3KWMA 1DT3A 2Q9AA 3IVXA 3QW4B 2OPHA 3C6ZA 3S0JA 3GFGA 3TD2A 1RWWA 1GZVA 2DFKB 1GM5A 3LUBA 4FC6A 1JJAA 3RRXA 4X71A 4D9HA 3AHJA 4UHHA 3DP9A 3QXJA 3TLZA 4CM4A 2A1IA 3LY8A 6YASA 5GGXA 3OD5A 4TL8A 2ACKA 4IHAA 3SBOA 4N7MA 5IEJA 1EVEA 1DOHA 5CR9A 4BB0A 1C3VA 1PI3A 2ERXA 2BW0A 3JYQA 4UBMA 4X7BA 2O2SA 2FVXA 3H2YA 3KYJB 5C8YA 3EF1A 4ER0A 3QFRA 4O0LA 1NDQA 5AOVA 5J47A 5HRUA 5JBNA 2QVGA 4Q7KA 1WA5A 4OYRA 5EXDA 3WJ1A 1CJTC 2I6XA 3L4SO 2NZVG 4L6IA 3ABSB 4XQ0A 3RM3A 3IELA 3U4GA 2NYAA 3TSWA 3E9RA 1VP3A 2E4YA 3D0KA 3P0EA 3AYXB 3TEFA 2EW2A 2E5FA 2WA2A 3U19A 2NU8B 3IKTA 3SIPA 3B12A 3GUCA 4KVZA 1JPJA 1EWRA 2QROA 3K0SA 1VPLA 5BR7A 4KLNA 3CLKA 2GVZC 4G4GA 1GCGA 1NNLA 2CXSA 1DEHA 1JLSA 4X8MA 3W9UA 3ZI4A 2F3PA 4D4GA 1PCXA 1DMSA 4GOOD 3RS5A 1TZCA 1O89A 3CEAA 1W4ZA 1Q77A 3O3MB 4X65B 1NQVA 1LNSA 3DT6A 2MIIA 3HB0A 4B7UA 1CYEA 1DO8A 3EFHA 3P5BA 5LDHA 3R8XA 3DJYA 3OPXA 3A7EA 4D79A 3T3PB 4EI8A 3QKRB 2WM2A 4GOLD 2A0WA 3S2EA 4AM8A 5HQ3B 5I7HA 1E1CA 2O9JA 2ZJ0A 3OP1A 2OHVA 4M7PA 3E22B 3NBYC 2SNIE 4MWZA 2XJ9A 2YIVX 1KRHA 3GLFB 1BX1A 1NQUA 2IPXA 2GM5A 1R6VA 4R69A 5JMWA 2M2IA 3FN4A 4IMPA 4JUIA 1A5BB 5IAKA 2QYHA 4Y0NA 4C4ZA 1RABA 3C7DB 2A0XA 1KEUA 1DFHA 1UJ5A 4FIDA 3AFNA 4UE6A 4LHVA 4CEIB 1Z06A 3O1LA 1KH2A 1SHUX 1QJCA 2AW3A 2G5GX 2UVPB 4AMUA 2YXLA 1THZA 2VJYA 2Q1SA 4MRPA 3ICWA 4IX1A 1Y7HA 4XIIA 2XNJA 1DBIA 4LHEA 1YACA 4R1OA 3MNFA 1E6LA 5T57A 1A7JA 4YRJA 4DEVA 3ZOKA 4LAFA 5K6RA 4MKHA 4RH1A 1U7ZA 3JVVA 2R47A 5FHQA 3N7AA 3EC7A 4AI6A 5AKIA 2PZAA 1O4WA 2D3TA 4JQYA 3RFVA 3DUWA 5A05A 5J1TB 5BWCA 2BYTA 1R0WA 2VZ8A 4U3JA 1DQPA 4FX2A 3UWDA 1KKUA 3B52X 2HWYA 4QWWA 5JPIA 3G3EA 3RAGA 2WT4A 1LVHA 4IIYA 2X0IA 1YXMA 4J16C 4PONA 4B9EA 1JTEA 2FPRA 4UJ5A 4LF8B 5DSZA 4D9GA 1HQCA 3S2SA 3UJPA 3OEHD 4UUMA 2D4HA 2X6QA 4JBGA 4LEIA 3RK4A 4HI0E 2XI4A 3T7RA 2PT7A 4RH3A 3KE8A 3I6IA 3RK0A 3UFXA 4CN8A 1ANKA 3OT4A 5J5AA 1AO0A 4FFSA 4AN4A 1BJRE 4RV5A 1ZNXA 2QJWA 3UW3A 3PE3A 5ANRB 4Q5IA 2ORVA 3DVQX 3ETNA 1QIEA 4CCYB 3KQTA 4RPKA 2CE7A 2FRDA 1BS1A 1V8OA 2GGSA 3MUOA 3VC1A 4X1OA 3TTSA 4XDZA 4YC7A 1FJGB 1WVGA 2REBA 3INTA 2WF6A 2JIRA 3MS2A 2PMKA 3RFXA 1PFUA 2I62A 2RE8A 3N5KA 1T9ZA 2DPMA 4R1NA 4CUZA 1LGYA 3II6X 4K9MA 2A1UA 4Y2QA 1ISFA 3SR4A 4KQIA 5C8ZA 2PRZA 7ADHA 4EZIA 2G82A 4UM8B 2BFEA 2QN9A 3JAKA 2W6QA 3CS3A 5LZ9A 3BD7A 1SPBS 5CH8A 1GADO 1J90A 1HA3A 5E1DA 5HS6A 3T1QA 1ISHA 1NBIA 3F96A 3LA8A 1U1FA 3L8FA 4KZKA 4YALA 1L5LA 2EIXA 3KSRA 1TM7E 1GRVA 4R7TA 3DFUA 2QI9C 4MRVA 1DI0A 2YS6A 1VSUA 5EJ5A 4IMRA 4KLCA 3O91A 2Z98A 3B2QA 2FH5B 4E2WA 1IG3A 1CZNA 3ZWDA 5IUNC 2ONKA 4B48A 1LDNA 1XLUA 2WJAA 1U0GA 5H16A 1U3VA 3LUAA 4PTLA 5DLQC 1NVVR 1RI3A 1XPOA 3P20A 4MUYA 4E09A 3ZE9A 3EW7A 4G85A 4ZFNA 1DAFA 3THYA 1QBGA 3R0VA 3D8UA 3RVKA 4EA9A 4Y1FA 3K15A 3M34A 2D5AA 5CRIA 4BFZA 1WKVA 3LKVA 1JJ7A 5B4UA 2O0KA 1MJGA 4GC9A 4PGGA 2XR1A 4AY4A 3U37A 2XLCA 4EGCB 2V6BA 1MRNA 3ZGYA 1YKSA 4Y8VA 4C4XA 2NTJA 3D6AA 2EF0A 4FONA 2UVQA 4QJ4A 4XGNA 1A1SA 4YFYA 3TDNA 3W4KA 1N9ZA 3DFIA 4B7AA 1I3MA 1VZ2A 3SC2B 3DD1A 4LJKA 2V6GA 1O03A 1MO2A 1TO1E 2BSAA 2BAGA 2II6A 5EPOA 4CIYA 4DANA 4US2R 1WB4A 3ZBPA 1RM3A 4F9TA 4UQOA 2G6TA 2PJRA 2CCJA 2FAXA 1YVUA 3N2GA 4UHEA 4BVEA 3M9WA 2WFLA 2NZUG 3DV9A 3ZXIA 5HK9A 5TIIA 4OV6B 2CHEA 4NDZA 1LX6A 3E53A 1PK9A 3DO8A 4MWGA 1KR2A 2R8EA 3GROA 3WV5A 5F3WB 2WG1A 4DA0A 4WOCA 4LQ4A 3RKUA 1Y5IA 4NU0A 1Q57A 2RIPA 1EH5A 1GFIA 1KTVA 5FOQA 2P68A 4TN5A 5KOHA 1O6CA 1QWOA 4IJUA 4P7BA 5KQPA 4BFUA 3CJTA 1UEXC 4TKLA 5DYWA 5C8DA 1KMIY 2XDQB 2D6FA 1B00A 2JDID 2IUEA 1RYNA 2O7NA 4A0FA 1WIWA 5FJJA 2VYVA 3CR3C 4LWZA 5AHOA 5TV2A 3T3EA 4CMAA 5BOSB 1J07A 2L82A 2UKDA 4LIPD 3Q41A 1J2EA 4I5IA 3TLKA 4QRDA 2YJ6A 3G0DA 3FCYA 5DGDA 4CMBA 1TT7A 2RGRA 3PDIB 1B6TA 3I83A 4RD0A 4I9FA 3HJHA 3EUWA 3X1ZA 2C8LA 3I64A 4LXIA 4ZVUA 3RVJA 4D9EA 1TCUA 3C43A 3WLTA 4R71A 3AM3A 4RBNA 4CV3A 3KDPA 4TRRA 1WF6A 2BR4A 2I34A 1UBJS 4J9UE 1D1QA 5IH7A 2CCKA 2FK7A 2DFTA 5LP6C 4F3CA 4YJ2F 3DOHA 1P0MA 4U7PB 5BY2A 2ZM6B 3VR4A 3BK7A 2OXIA 2ZSAA 3COSA 3ME5A 4FDAA 4RVDA 3L4BC 4TV8F 4AY2A 4XWYA 4Z1MA 4GGPA 1EP2B 5H3CA 1FTQA 2AQHA 3X0DA 4CZ2A 5AW1A 3F6PA 4DFDA 2SCUA 3HPRA 4NBSA 3U39A 3MOIA 4FUQA 2W2NA 4D1YA 3VOBA 2PAAA 1R6TA 1PVDA 1YJCA 2Y76A 5TPWB 2PV0A 4JJFA 4MQEB 4FOOA 3PGJA 4KVFA 2EDAA 4YJ3A 3I05A 3K1ZA 1E5XA 3JW8A 4PO8A 4C0XA 4V0QA 5B58T 3U4QB 1BXKA 1G16A 3TR0A 3EH2A 3CVXA 2E0IA 3I9OA 5K3EA 4G1EB 5ISMA 4TS9A 2XZDA 1ZD1A 5G53C 4ON9A 1Q1ZA 1ENPA 3DKIA 4OMDA 1QQ7A 2DM6A 2TMDA 4MYUA 3PYXA 3RGGA 2UXBB 1HTTA 1PDOA 2CC2A 3NHWA 3ENNA 4UAJA 2F4NA 2FJPA 4ZJZA 3D43A 3FCXA 3FGOA 1WXDA 1RWOA 4TM7A 4YLYA 1Y8QA 4DA7A 2YYYA 3F46A 1YB5A 4MCHA 3WIBA 1TQHA 1X94A 1U8FO 1K4MA 5J4VA 5BW5A 3KB2A 4L76A 4Q1VA 5EIBC 4D4LA 5HIMA 4G5XA 1RWNA 3MFYA 3W8RA 2IZ5A 1UOOA 1F1BA 1ESMA 1P1FA 1CUBA 1QH0A 5DLDA 3UMGA 4P32A 3HUUA 1B73A 3PGMA 5IC5A 3VYRB 3P0FA 4ER7A 4ZOQI 1MG0A 1GNSA 4I5GA 2YHBA 1H2WA 5MFPA 4JUCA 4P93A 3ET4A 4FD2A 1PR9A 3PFGA 1ULTA 3RBZA 4OD0A 3ZX5A 3BWEA 4ZK6A 1PEDA 4F4HA 1UDBA 3PWTA 1WVIA 5LOVA 1JR6A 1TADA 3D3WA 4JBHA 5EMJA 5E1OA 1Z17A 2HRZA 3JALA 3KKEA 3N3BC 4OQNA 4D3DA 1FLNA 4WOKA 1QZUA 2VSFA 1HFKA 3AFMA 1N2CA 3L7OA 5ENDA 3VQTA 4PBSA 3ZK7A 2WUFA 4K40A 3VPBA 4DIDA 2P5UA 3E84A 2JANA 4ABYA 5KJFA 2P1RA 5L3RA 4R0MA 3RREA 2SHKA 1LSJA 2RG7A 2YC4C 4PCAA 1X9HA 1C0IA 4L28A 3ZIDA 2FPPB 5FLEX 2BF7A 4CL0A 3PX7A 2GEBA 3KLPX 4URYR 1GN9A 4C0WA 3QE9Y 2Y1FA 3GGPA 1UFVA 3W6UA 2YZ7A 4GQBA 1U7XA 4PHCA 5AIBA 1DL5A 1C3LA 1N5DA 3C3CA 4HMOA 5DTQA 2IS4A 2EP5A 3L1HA 5JH7A 1FS4A 3C98A 4TWBA 3QKTA 5BPHA 1JPUA 1QV6A 2NZYA 3KUCA 4UULA 5AJYA 4OA8A 1JV2B 1SVMA 2MSCB 2B25A 5JSQA 4ZT2A 2DECA 4N0MA 2JRCA 5TQ0B 5L7TA 2JEOA 4XUDA 4OTZA 1QRSA 1Q0RA 4Y2YA 2C99A 5HQTA 3K09A 2NACA 3FMIA 4GX0A 5FH9A 3O8QA 3PG5A 1UK6A 1YA4A 3KQVA 5A5DA 1ZI8A 1F2UA 4LDZA 5JECA 1N92A 3AZOA 1PWHA 2JIZD 1GNTA 4NYJQ 1G2PA 1ZM9A 2FPOA 4RJLA 1M2WA 1JIQA 2HMSA 3DTVA 1E3SA 4HYEA 5AVZA 1JKMA 4R1TA 2H0RA 1QE0A 3DFZA 5EZ6B 1CY4A 1ZZEA 4CMJA 1I3KA 5FOUA 3W04A 3G5UA 4MDFA 3ESQA 3EG9A 4DDVA 2OAQ1 1NKSA 1G9SA 3DXZA 1I6KA 4FJ0A 3REOA 3IVGA 3KK0A 1KI4A 3I9KA 1SKYB 4ZRDA 3ASVA 4YI3A 5E38A 3QKIA 1JXQA 1VBNA 2HC9A 3W1WA 3THRA 1KOGA 4ZD6A 3RYTC 3G23A 1NU8A 1C3OA 1ORDA 3JD1A 3PFNA 3DB2A 2CUTA 1RFGE 3TBFA 1JDVA 2H1VA 2G4CA 5AM1A 1PGNA 1U7WA 2AV6A 2NWQA 2EKBA 1J0DA 4NDAA 4B6QA 4ZCRA 5KOJA 1L7MA 1YF3A 4YO8A 4YIHA 4YXWD 1BWSA 1OWLA 2AUNA 2UYQA 1FFGA 2EXXA 4G0VA 3C5CA 1A4IA 5FUWA 3I32A 3MJHA 2BRUC 1BW9B 2ZBQA 3NG1A 3I0NA 4MVJA 5AJZA 5G1NA 3JQ9C 5CDYA 1C3OB 3H2JA 4IIVA 5DX0A 1VA4A 1WRBA 2B21A 5AUPB 4I55F 1V6AA 3UOWA 4RPJA 1EFRA 1W88B 3I9NA 4YR9A 1N34B 3MXOA 4Y3UA 1Z4KA 3S1AA 2ZVJA 4BDTA 2IE8A 1P8JA 1C81A 1O97C 2BGLA 1Q14A 1VJDA 3LF2A 1FTWA 4HATA 2M32A 4RQAA 5F9HA 2IXAA 3GVCA 4JLKA 1NWHA 4YAFA 1U7TA 3FCOA 3LC1O 3O1JC 3K8ZA 1FLAA 3OMXA 4OXXA 1THTA 1YMVA 4DY4A 4U7TB 2HQSA 4JBXA 1JLLB 1POXA 1TD9A 3PDUA 4G8JA 3RSCA 3HCFA 3EMDA 3W4IA 3CRNA 1BA2A 2VCYA 4XYGA 1XD8A 3IRUA 3MJDA 5K2OA 2EG9A 3WC4A 3AR4A 1T0PA 1TGYA 4MV4A 4LDQA 1LDBA 4RIHA 1UPFA 4ZPXA