2QT0A

Human nicotinamide riboside kinase 1 in complex with nicotinamide riboside and an atp analogue
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
189
structure length
179
Chain Sequence
RGSKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nicotinamide riboside kinase 1
publication title Nicotinamide Riboside Kinase Structures Reveal New Pathways to NAD(+).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 55
structure length 179
sequence length 189
ec nomenclature ec 2.7.1.173: Nicotinate riboside kinase.
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qt0A00
3GLIA 3AVPA 1KK0A 5DHAA 5EE3A 1EK0A 1JB1A 3TH5A 3PJRA 4CEHA 2XNDD 2ORIA 3RNLA 3CWZA 5B57C 2GZAA 1QG2A 1ZC4A 1NKTA 2C9YA 2Z43A 5FUXA 2FWRA 3CX7A 4PC1A 3U7HB 4TQAA 2QA5A 3RRMA 1U8AA 4FIDA 2IW3A 3VR6A 3W9YA 3PG5A 4KODA 4Q4AB 1XNJA 4D4JA 1M34E 5CJPA 1P73A 1XP8A 1IXRC 2PMKA 2VA8A 4MDFA 2F6RA 5EUQB 2IF2A 2QM8A 5EXPA 1P2TA 2JATA 2P2LA 4HAUA 1Z6GA 4RKEA 3QNUA 5FTKA 2XSZA 1EWRA 2GEVA 3KUCA 3MWKA 5HCNA 3LW8A 1P9WA 2IYSA 4D80A 2ODBA 3HPRA 3WMGA 1EGAA 1TPZA 3CZQA 4IEIA 1IOZA 1W2HA 2F3TA 3GQBA 2C77A 4AIIA 1T0JB 1A7JA 3LW7A 4YMTA 1RRPA 1RRFA 3AKYA 3RS7A 2F55A 5CIWA 1N5KA 2DWOA 2GJSA 4JL5A 5FTMA 1OFHA 3MMPA 4OKSA 3CX6A 2ANCA 4KI0A 3VX3A 1KAOA 1NY5A 3CPJB 4DRZA 5H8WA 1XTJA 2ERXA 2ZI9A 1Z83A 3KXLA 4DLSA 1YZGA 1P75A 4B33A 2BIFA 1QF9A 4ZCLA 2PT7A 2VHCA 2IUTA 1UM8A 3LLUA 4M8NE 2HYIC 3CIOA 1ZM2A 2BEKA 1NBME 4GOKA 5FOWA 4DDVA 4LJ9A 1WBDA 2CBZA 1HE1C 4A92A 1X8KA 4EFMA 5GVSA 1AKYA 2G0TA 2XEXA 1E2IA 2NG1A 1DOAA 4A2PA 4OHZA 2G0NA 2I4IA 2VBCA 5HPYB 1XTIA 4PHTA 2YOHA 3U7FB 2IK8A 2ZUBA 4RCYA 1W4BA 1W46A 2NPFA 1OYYA 4FWTA 2Q3FA 5BW8A 1MV5A 2R2AA 1CXZA 1OT3A 3QXJA 2QP9X 2GF0A 3QKRA 4BZXA 3AH8A 3KKOA 4HAVA 2OBLA 2IYRA 2Y8EA 4LHXA 4TMVA 1ZUIA 2BMDA 4PO8A 4NONA 3B82A 2RGAA 2YNMA 4OHXA 2OLJA 4CEIB 3AVOA 3I5YA 2ZR0A 4AKIA 3DVLA 1AQUA 1CKEA 1XJCA 4IDHA 1HURA 1XPOA 3ZD7A 4DT1B 4DUGA 4EQ6A 4UNPA 5CYPA 4A6XA 5L8VA 1N0UA 5JECA 1E2NA 1VG1A 4IHQA 4WVFA 4AK9A 3FPAA 2CVFA 1N0VC 4YLGA 3IHLA 2O8DA 2O0HA 4PHHA 5FL7A 2QN6A 2EVWX 4TL7A 3CUEF 1R5BA 2CK3A 2PLRA 2WJYA 2CJWB 4X8LA 4YQFA 4LYFA 2IF0A 4HB2A 1G5PA 3NKVA 1SHKA 2F43A 2PJZA 4M1YA 5J4LA 3RANA 4TLEA 4PPNA 4B3DA 2QTFA 3UMRA 3QOFA 1GAJA 1W49A 2R6CA 4PX9A 5C1BA 4M9ZA 1US8B 1G8GA 2F7SA 2WJIA 4A1FA 1HT2E 1P9RA 2BJWA 4FW9A 3VU9A 2XZOA 4XWKA 3KTAB 2WWIA 2H17A 3QXSA 3TUJC 1Z63A 2Z4SA 4KHZA 1U81A 1E98A 1IN8A 3W6PA 3U61B 1J99A 2GEUA 2FFAA 4JT4A 4NHOA 4LSGA 4RJLA 1EWQA 2J0VA 2QT1A 3A58B 5JI2E 1DEKA 3HWSA 2F1HA 4V0ME 2FEOA 1DAKA 3W6OA 3T15A 3QPWA 2OILA 3EZ9A 4DLWA 2XZPA 4ZDWA 2BOVA 2JLYA 4V03A 2PCJA 1Q22A 4AYXA 5KYKA 5EJEA 2VO1A 1OXSC 1ZRHA 1UDXA 4F91B 3MD0A 3BFXA 4RSGA 4PQRA 3KKNA 2B92A 1DAGA 3K0SA 2B8WA 4P0TA 4EFNA 2ZREA 2OUKA 2ZS7A 5C46F 2GXSA 2QE7D 1YZTA 2W0SA 3AB3A 3NEJA 4R9UC 4US1R 1S9DA 3OIVA 3TNFA 5TV2A 2IYWA 2VQSA 1U0HC 4OJQA 3WNDA 2R6AA 1LFDB 4NYMQ 1PLLA 4LPSA 1G1MA 4XWAA 1EX6A 1XMSA 4QGAA 2A7QA 3OEEA 2BMFA 2IXEA 2A2ZA 2PZFA 3IDQA 3KXKA 4MDEA 1E1QA 1XPUA 1PVOA 3H1TA 2Q3MA 4Y0VA 5FR1A 4OK3A 4V0LA 3JZAA 1V5WA 4BGDA 4GDFA 5JCPA 3L8YA 4FCWA 2REBA 2A5YB 1MO6A 5FBVB 3B1VA 2IUUA 3CWQA 1UAAA 2OEPA 2OXCA 2WPDD 3P26A 3QUSA 5D3MB 4BFXA 2FPKA 4PAOA 1P62B 2CNWA 3FTQA 2E9SA 2Z0MA 2QTHA 1L7VC 2ZJYA 1JECA 4BFTA 4TL6A 1TTTA 1JAIA 1G17A 5E4FA 3A1TA 3H2YA 4A9AA 4GT1A 4UNSA 1LTQA 2W2VA 5G53C 1XFAA 4ZO4A 1GILA 2QAGC 3BERA 1KJYA 3VR4A 3CPHA 3T12A 2CHGA 3DPUA 4OI0A 4TZ6A 4R2IA 4ARZB 4ASUA 3PEYA 5EP4A 4NTZA 1F48A 5FTLA 3ASYA 3MUFA 1UJ2A 4PHGA 3W3ZB 1G41A 1SULA 3TK1A 2HYDA 2PZEA 1W36D 2GK6A 1KI7A 2VLIA 4DCVA 3KB1A 3RSOA 3GLFB 3ZGXA 2OO7A 2YHSA 2XAUA 1TF2A 4XJXA 2XX3A 1G64A 1ZCBA 1COWA 2AX4A 1Z47A 2ATVA 4F92B 1J2JA 3ZD6A 1G3IA 3N5CA 2JDID 2NOAA 2GILA 2HUPA 4Q4LA 1E9RA 1M7BA 4YMWA 1W4CA 1JI0A 3BFVA 4M1KA 5DI3B 1XWIA 5DO9A 1FTNA 4Q02A 4KSBA 1YQTA 2HJGA 2QAJA 4CGZA 3PUXA 2BKEA 3U7EB 1NLFA 3IUYA 2XXAB 4KYIB 2FPLA 4KJZA 4MQBA 2PL3A 3QEOA 1R6BX 1ZBDA 3MCAA 2YJTD 1R4AA 1KI4A 2ZRMA 4IVRA 1LNZA 4XVQA 3T61A 2DWPA 3WHLA 4TYPA 3VAAA 4C3ZA 5AUOB 1EESA 2Q21A 3OE7D 1GKIA 2G3YA 2OLKA 2MSDB 4TMXA 2CCGA 4JLKA 4JL6A 5AJVB 5FBWB 2A5DA 5JEEA 1WF3A 5FOUA 2ZU6A 1IY2A 2PEYA 1BKDR 1II0A 1JNYA 2ZSEA 4UXIA 5FH9A 1CRPA 3TLXA 5EZ6B 1AJEA 3R8FA 2HF8A 1EFUA 2YC2C 2CHQA 3FMIA 4C0KA 1U0JA 5B64A 4TMZA 1XRJA 1SXJC 2G6BA 2HEIA 3W6NA 3RC8A 1G3MA 2AK2A 3NEYA 4LJ4A 2QMEA 4TYQA 4ZIRB 5G40A 3LBHA 2YWGA 2ANBA 2WJHA 2ZI7A 3UATA 2D2EA 3DHWC 3G82C 4PPQA 1QHHB 3K1JA 1D9XA 2Q9CA 4TT3D 3RWMB 3BH7A 3WY9A 1PJRA 3AF1A 2O8FA 2OCAA 1K8RA 3UANA 1II9A 5A4JA 4QFMA 1IBRA 2H16A 2WMNB 1RRGA 4M53A 5FL3A 2ZJ2A 4X8HA 3FHTA 2O52A 4MYTA 3QF4B 1C9KA 3IQXA 1Z0AA 3K09A 3FWYA 3K0FB 2AL7A 5CK4A 3C14C 4G1UC 3NBZC 4A4DA 2GCOB 1DAFA 1NBMA 4BEBA 4IOLA 4WXPA 4HAWA 3B1XA 4URWR 4E07A 1TU3A 4P33A 1GWNA 1XXHA 2ZVPX 5IT5A 2C03A 1ZC3A 5AWFC 3GLIE 2H1LA 3SYLA 2ZE7A 5DISB 4JS0A 3RRYA 1WB9A 2ZRFA 2C9OA 4B2IA 4PSVA 3SC3A 2QSYA 4CEJB 3IIMA 1GG2A 4WIAA 1E2JA 3KKPA 5EP2A 5L3QB 5FBRB 4XH9B 2BEJA 2QL6A 1X8JA 4O2LA 1KSJA 2ZRAA 1E2DA 3BC1A 3QJYA 4HSEA 2HV8A 2C2HA 3REGA 2ZSBA 4DEYA 2BDTA 3VR1A 3C5HA 4DXAA 4QGFA 1QHYA 4YDSA 2EWWA 1J7KA 1YR9A 1HV8A 1SKYB 1EG7A 2GHIA 3CNNA 4XD7D 1A82A 4Q1FA 2FNAA 3GJ5A 4MKHA 1U9IC 2GNOA 2GVZC 4QHYA 1OH5A 1YE8A 2D74A 5C4GB 4AURA 4Q21A 3GCGA 1UPTA 1KKMA 1YKSA 3FYHA 2V55B 2XTNA 2PX0A 1XJ0A 2JJ1D 1Z0FA 2V1XA 3M0EA 4GZMA 2RGCA 1W44A 1DADA 1TEVA 4NL4H 2EYUA 5DYGA 2G1JA 4QBFA 4Z8XA 1NVXQ 2RGNC 2A5GA 2QPTA 4D2IA 3FKQA 3T1OA 5HCIA 4BFVA 4MRPA 1J90A 2JIZA 2QQEA 2Q6TA 2VF8A 3KQLA 3W8RA 3EXAA 1KO4A 4NYIR 2BJVA 4KVAA 4Q1BA 1I2MA 2H5EA 3THXA 4C9BA 4URXR 1L4UA 1G19A 1RJ9B 3DO6A 3I1FA 3FE2A 3LQRA 4PANA 2V3CC 2OCPA 3M6AA 4FCVA 3THYA 1II8B 2YINC 1Y3AA 4YMUA 2C78A 3GMTA 1UKZA 4NYJR 3NBXX 1JALA 5FOSA 5B58C 3ZJYA 4XTCS 1CTQA 1DAHA 1W4AA 4JSTA 2BM1A 2ZRIA 1D6JA 1WQ1R 1Z6TA 2QAGA 2CHVA 4E03A 4KLNA 1QZXA 4LHYA 2OBMA 1E0JA 1P3JA 2R44A 2WM9B 4B73A 2N1BA 4OHVA 1VYTA 3K9GA 4NBSA 4DLXA 3AVUA 3S1AA 1VKJA 3EG5A 2QP3A 3FGNA 3NBFA 3THWB 2B7BA 4HLDA 3VHLB 3QEJA 4AI6A 4D4LA 1BMFD 2RAPA 3L8ZA 2Q0HA 3CNLA 1GIAA 2J46A 4IOJA 2A30A 3T5GA 1XPRA 1S1CA 4D82A 1QHSA 1ZM3A 2VHJA 2BMEA 2ZANA 2CDNA 4D4KA 2YKGA 2ZIAA 1M8PA 2W58A 4A0HA 1XX6A 4YC7A 5EXSA 4JBXA 4BFWA 1Q12A 2HLDA 5CB6A 3CZPA 1VCIA 3E2IA 721PA 5J5CA 4HDOB 1E6CA 2AFIE 2H18A 5HKKD 2ZM5A 3LQQA 2JLRA 1VG8A 3F5FA 1VTKA 1GOTA 4I1UA 4URYR 3FHOA 2J41A 4Z1MA 1D2MA 2QEQA 2IYVA 2ECKA 2P3SA 4II7A 3B13B 5G41A 3TR5A 2AN9A 1CEEA 3LRPA 4BZQA 1JQJC 3Q85A 4DKXA 4O25A 4PZYA 3ZVLA 3SEAA 5K8IA 3SQXA 3E1SA 1KI8A 1T0HB 4EKDA 3IIJA 3MGCA 2ORVA 4LBYA 4DC9A 1YR6A 2PCLA 4Q18A 2WOOA 2JLUA 2W6ID 1C1YA 2ZETA 1Q0UA 1T3HA 1S3GA 4GRAA 4DDTA 1UADA 1CJTC 4ZKDA 3RWOA 2QRZA 4D81A 4L9SA 1UBFA 1SXJA 4I1VA 1FZQA 2ZYWX 1KI6B 2ZRPA 3V4FA 2ZU0C 2P5TB 2FA9A 3PVSA 1N6IA 1Z06A 3IEVA 3R7WB 4FI3C 1OIVA 5AUQA 4GP7A 2VP4A 2WKRA 2O8CA 4FWIB 3OFNA 3AKEA 1XCPA 4PSAA 5KHOC 1FL9A 1Z0JA 1VYUA 5EZ5A 2EQBA 1ZVQA 3SU8A 2GJ9A 3WYGA 4L8GA 1NLYA 4QGHA 3OIWA 2IYTA 1J70A 1TUEA 5FUVA 1KI1A 3KJGA 4C0BA 5CIQA 2OFOA 4G0NA 5LB2A 1F5NA 4BPBA 3P32A 2AKAB 1MKYA 2IHBA 4G01B 3RDPA 1G20E 2PLFA 5GJBA 1Q57A 1IQPA 1E0SA 1VG0B 2J5XA 4BZPA 3EPJA 1JBKA 3CONA 2WKQA 5JSZB 1OFIA 3DZ8A 2DR3A 1NMZA 3A1SA 4NCNA 2XSZD 2ZR7A 3Q72A 4QBGB 5AJYA 2Z4RA 1FQKA 3CRVA 3Q7QA 1PUIA 1ZM4A 3DMNA 4RD4A 3U6BA 1FNNA 3QI2A 2RKOA 4OQFA 5AJWA 4D0LB 4ZI3A 3O8RA 1GL9B 3LNCA 3QXHA 2IBMA 2HDNB 2MMGA 2ZI4A 5TVKA 1XTRA 1Q21A 4LCBA 4RCZA 1W36B 3I4LA 2VTKA 4HLQB 4PPGA 3FMPB 1N2CE 4JKYA 4DIEA 2ZRBA 3HR7A 1R10A 3MWJA 3TUZC 4OBEA 3O8DA 4Q48A 3AVQA 1P7CA 3SR0A 3UKDA 1OFUX 2HCJB 5ELXA 1G3RA 2XOKA 3CX8A 4C7OB 2DHRA 4UXJA 2BV3A 4I4LA 4LC0A 1E2PA 2CLCX 3LX8A 4AG6A 2RGXA 3I61A 2YZ2A 3TSZA 5IRCD 2J1LA 2VPPA 1GVNB 4DB4A 3QG5A 3X1YA 1W0KA 3I73A 1XF9A 3K0CC 4C0AC 4C0JA 4PSKA 4R71A 2G83A 1F6BA 4DSOA 2QP4A 1EFRA 2H8KA 2X77A 2BCJQ 3K8YA 4KYUA 3QKSA 3Q7PA 2F3RA 3PEUA 2Q3HA 4KLZA 1HQYE 4FMDB 2FGKA 5J40A 5EQTA 2V9PA 5BN4A 4O2RA 2QENA 4QNRA 3WMEA 5SZIA 4URZR 4FMDF 2H57A 4M21A 4PFSA 1E9FA 2ZYVX 1W1WA 1AS0A 1T3LA 3UMSA 3SJBA 4LJ8A 2P6NA 5DN6A 3CO5A 4PC6A 4RFSB 3TGPA 4QGGA 1MOZA 2WIAA 4G3XA 1ZNXA 5B2ZA 5KO2A 2KE5A 1KSGA 3OEHA 1KDOA 1IN7A 3FOZA 3C8UA 3TMKA 1Q20A 3BBPA 1G6OA 1YZKA 3CF6R 3N2IA 4XSHA 3F0TA 1AGRA 2CK3D 4G5OA 3I5XA 1G8HA 4JVSB 4OJKA 2BBOA 3LBNA 5JRZA 2PBRA 3V00A 1G7TA 1KK2A 5FBLB 5J4YA 2JLWA 4WZ6A 2VHTA 2QQ0A 2JLZA 4TL9A 1BYUA 1UKYA 4KAXA 2ZJBA 3OIYA 3ADDA 3KZ1E 3U60B 3BH0A 4MA4A 3KQHA 2VF7A 2W00A 2IS6A 2ZRHA 3GFOA 5K8LA 5IK2A 2VH5R 4BLTA 2A5JA 1MRNA 3CH4B 4WW0A 3GPLA 1U90A 3K70D 5DH9A 5BYJA 1T6NA 4AG5A 4FMCB 1P9NA 4M1SA 1P61B 1D2NA 3J81k 4K8OA 4FMCF 3CRRA 4HZIA 3QSYA 1U8ZA 2B8TA 2D2FA 2X19A 3QPUA 4IW3B 3SE0A 4DDWA 4RD6A 3EPLA 3LAWA 3T35A 3RS2A 4P32A 1AIPA 2AXNA 5SZKB 3SOPA 4A15A 1KZ7B 4XTRA 4KO8A 1ETUA 1YRAA 2GCPA 2V8OA 4Q4JA 4A2QA 3IPYA 2RCNA 4HB0A 4ERNA 1YZNA 3IILA 2IEYA 3WHKA 1AK2A 2DCUA 4H9GA 3L43A 2R65A 1NNEA 3GLGB 1ANKA 4DLYA 1LF5A 1E32A 1G9XA 3EPKA 1NSFA 4JLBA 1YU9A 1XXHE 1EFCA 5E7JA 4MKGA 2ZS8A 2OCYC 3HU1A 4EPYA 5J47A 1E94E 3OEED 2YVUA 4Y0AA 3ONWA 3MLEA 1E1QD 2MMCA 4KFUA 1L8QA 3K0AA 1M2OB 3BB4A 3CR8A 1S9HA 2CEAA 4JLJA 1E9AA 2WKPA 3X1WA 1SVWA 5JHGB 2REOA 3AF0A 5HE9A 4LYAA 2JLXA 4U7DA 2KB0A 2G1KA 4I1OA 4IFEA 5H70A 1XCGB 1W0JA 3T5DA 4MGKR 2RHMA 5IF9A 2J87A 5J4HA 3H4MA 5FI1B 3OAAA 1CJMA 1ZW6A 2IWRA 3C7KA 4DWJA 4FCTA 3SS8A 4JVNA 3FB4A 4A8JC 2P5SA 2FEMA 1MO5A 1WE2A 3EZ6A 3NXSA 1DTSA 4EJSB 1N6OA 1Z28A 5KDLA 3W3AA 3AVWA 1SKQA 1GL7A 5HR5A 1JEEA 3PFIA 3CRW1 2HXYA 3NH6A 4WXRA 4ASUD 1G16A 3DZDA 4LHWA 5CM9C 4NCKA 2OE2A 1WXQA 4DLZA 1I4TD 3ZZTA 1RPZA 4HLCA 2VSFA 2I3BA 2C99A 4DCSA 2O8BB 1WCV1 4HB3A 1ZM9A 2PT5A 3GFTA 8OHMA 5KNDA 2VP0A 5LD2B 3ADCA 1Z0IA 1GFIA 3FHCB 4PHFA 1COWD 4PO1A 5L3SB 2QG6A 4HDCA 4BFZA 3HU3A 5E7IA 4LBZA 4Q4HB 4F93B 1SVSA 4Q9LA 1MRSA 2XNDA 3ND9A 1Z2CA 3DDCA 1T8UA 2JCSA 3REFA 3U6KA 2OHFA 5GADl 1PLKA 2C5LA 2GBLA 1CRQA 2RB4A 2AXPA 3Q5EA 4Q19A 4EPXA 5EE1A 5FTJA 2X1VA 3QVUA 2CCJA 4TLAA 4MYUA 3WYAA 4CDGA 3C15C 2JLVA 1W7AA 2PZGA 1CULC 1HE8B 2QBYB 2H7VA 3U7GA 2XGJA 1KMHA 3ZVMA 2CMKA 1G7RA 3IBYA 5FPKA 5FI0B 2WIBA 3CM0A 4GI7A 2J0SA 1XEFA 4Q1EA 1KHTA 1VG9B 2J0UB 5F9FA 5F98A 1EXMA 2WVJA 3U4QA 3SFVA 1DO0A 5LB4A 3KKMA 1TX4B 2D4HA 2EFDB 5E3HA 4Q9IA 3RS5A 1W36C 2YWFA 1XMVA 3T34A 1XEXB 2OFXA 1OJLA 4LBVA 4QJ3A 3EA5A 3AUYA 4BLQA 5LDDC 2FN4A 3GLIB 3RSLA 4FINA 4Q7MB 5UKDA 4Q9JA 221PA 4BASA 5DIFA 4CW7A 4US2R 4BUJA 4E09A 2YWHA 1R7RA 1UBCA 3SBDA 1CP2A 1PV4A 4BEJA 1KTVA 1SVKA 4M9QA 1QVRA 1LVGA 1OIWA 2UVQA 1U8YA 5AJXA 2J0QA 2GWHA 1BOFA 3OZXA 4TQUS 4ACAA 3EX7C 3EASA 3JVVA 3W90A 4I1SA 3THOA 2XB4A 4W5HA 1UKVY 2TMKA 3RLFA 4M9SA 2XB2A 3BIFA 4HATA 3L0PA 1XD2A 3PQCA 1FP6A 1P4SA 2F9MA 4MRVA 3JVUA 2GJAA 2GJKA 2FFQA 3AEZA 1NBMD 3L2OB 3FKSA 4OQMA 5AJZA 4ZV4A 3B9QA 1SXJE 3HPQA 4LHVA 2IYLD 3U5ZB 2O0JA 4ABYA 2GXQA 2FH5B 4NYJQ 1RKBA 1KI2A 1QVAA 1X3SA 4HUTA 1GTVA 3B1ZA 1YJ5A 1E2QA 1U0LA 2ZAMA 2WTUA 4Z8YA 4CEHB 4U02A 5FUWA 2HT6A 4B6EA 1ZINA 4J0QA 3U3OA 1IY1A 3MRSA 5EE0A 2PEZA 3AQ4A 3D7MA 4ZDJA 1IXSB 4WBSA 2PH1A 4QRHA 4Q03A 3GJ8A 1KGDA 5KSOA 2P67A 3NBYC 4M9XA 1P5ZB 3KX2A 3LX5A 2ZVQX 3AVYA 1BH2A 2GESA 2D62A 2QROA 3DKPA 4LV8B 2ZI3A 4LPKA 4YMSA 1RFLA 2GAAA 3KFXA 1OHHA 2XITA 1D2EA 3WNCA 2WOJA 5ANRB 1Z6YA 3EZ2A 3PCRB 3CBQA 4ZKEA 1E4YA 1KNXA 2MSCB 4QL3A 4GBMA 1R5NA 1CBUA 4CRWB 4NCJA 3BXZA 2QPAA 3NHAA 4TMTA 3QKRB 4R98A 1P2SA 2GRJA 4DLUA 2WBLC 1OE0A 4JIMA 1Z8FA 4BE7B 2VHUA 2XJ9A 2P65A 1CF4A 3VHXA 2NGRA 4JBWA 1X1RA 2GEDA 2P6RA 1B0UA 4OQLA 2ZSFA 3GEEA 4B35A 1TF5A 1CR4A 1UBGA 4EQ6B 3HJNA 4RKFA 1N6NA 3UK6A 4F4IA 2R8RA 4A8JA 4FXPA 1J8YF 1K6MA 4B34A 2O8DB 2OBNA 1H8HA 2ZI6A 3KB2A 4DJTA 1OH6A 2RGDA 4TL8A 4HUQA 4MYCA 1A4RA 3NG1A 1OKKA 2F43B 4W5WA 421PA 2R9VA 2ZE6A 2IT1A 3H84A 1BO6A 4JL8A 1KK3A 2K5UA 4QOSA 4N1AA 4I81A 1ONBA 2QRNA 4UXHA 1Z3IX 1KKLA 1VCNA 2ZITA 3SFZA 4GOJA 4TQ9A 5FOXA 4OI4A 3UG6A 4URVR 4LK2A 1BYIA 3SYKA 3A6PC 2IS1A 3I92A 2QORA 3OESA 3VU9B 5E7MA 1KDRA 2GXAA 2W2XA 4HAXA 1W48A 2DY1A 4N3NA 1Q44A 1G21E 1NI3A 2BM0A 4B76A 4UJ5A 1J8MF 3K70B 2HLDD 3LO5A 4KVGA 2W0MA 1N6LA 1NJFA 4B3FX 4GMXA 3GJ3A 2GF9A 2WPDA 4M4SA 3O8CA 1FX0A 5JS7A 2AD1A 3NC0C 2WSSA 1E9SA 4A6PA 4Z1MD 3VQTA 4IOMA 3MJHA 2MSEB 2GJ8A 2BBTA 1NMXA 1ZMXA 3MWYW 4PR0A 4BQSA 2NO7A 2ZRGA 2GDJA 4P4SA 4TSFA 3BK7A 1XTSA 3LXXA 3ZIAA 2E87A 1FW6A 4KBFA 1OIXA 3RC3A 4B74A 1F2UA 1P2UA 1BIFA 1U98A 4EJSC 3K0EA 4EPVA 2ZPTX 1U99A 4B71A 2JASA 3OF5A 3FMOB 3MG9A 3TW4A 4LZZA 4XIGS 4N0EA 3VFDA 1B23P 1VHLA 2ZSAA 4URUR 3Q8XB 1R8QA 3QBVA 5LBIA 1F2TA 3W5JA 5C4MA 3QKTA 4Q9KA 2Q9BA 1E0AA 5DI9A 4H1VA 2OAP1 3WBKA 1T3SA 4YXWA 4AKEA 1DARA 2FFBA 2ZRLA 4Q7KA 5LD2C 4EIWA 2FSIA 2CLDX 1W5TA 2C96A 4LWZA 4B3XA 4EAQA 3AVXA 3OHMA 4F7WA 1XD8A 1Q3HA 1P60A 1KI3A 3UPUA 2EFEB 4HLUC 1ZD1A 3WMFA 5BN3A 4BLSA 1W47A 1MABA 3RHFA 2OZEA 4ZDIA 1TUIA 1IJEA 1GKYA 1H8EA 2CL6X 4YONB 3E70C 3R9XA 4RVCA 1IONA 4NP6A 2DFNA 1S4QA 3B1YA 2QT0A 4HZUA 1KDTA 3ICEA 2R6FA 4TYNA 1F3OA 1AA9A 1E2MA 3F3YA 1A2BA 3TJZA 3BRWD 4KFTA 4XVUA 1YZUA 3B60A 1N3BA 3K9LA 5KSYA 1XBTA 3OE7A 2O8EA 1R0ZA 2X2EA 1K5GA 5JHHB 1CJUC 4L5BA 4B43A 3GJXC 1SHZA 4PZLA 1NVUQ 2ONJA 5KTYA 3GLFE 2QUZA 1T8TA 3FFBA 3QKUA 4AKHA 3CRQA 4P3YA 4Q9HA 2ZR9A 2AHOA 2EFGA 2JLQA 1G4AE 1W2GA 2FGJA 1ZU4A 3KQNA 5M04A 2ATXA 1U94A 4EPRA 5JJLA 3SJZA 1SVOA 2IXGA 1XZPA 3G5UA 1RE0A 1JPNA 2ZXUA 3ZVRA 2VL7A 4BRWA 2ZJ8A 2H92A 3AP2A 4ON9A 4IDOA 3ZQJA 5KNBA 5FTNA 3GJ0A 4TMWA 2ZRKA 3N70A 1Q1BA 4QC2A 3UWOA 1XTQA 4MKFA 4CF7A 4TYWA 2N42A 2RHDA 3ADBA 3NTUA 2XOKD 1G8PA 2Z6VA 2FE4A 5CJ2A 3FDIA 2JEOA 2ZE5A 3EIHA 1ZUHA 4IEEA 5TDHA 1G18A 4B3BA 2WWHA 1NL3A 2O5VA 1FMLA 3FMFA 1WDTA 3RRNA 4AYWA 3I72A 3EWSA 1UKEA 5F3WB 1XB2A 1W0KD 1E3MA 3R20A 1E0KA 1TADA 4OYHA 5J4VA 4Q4AA 4KCGA 3KJHA 3TSWA 2DYKA 4B48A 4KFSA 3RS3A 1KO5A 2VP5A 1NN3A 5TARA 3ECCA 3LVRE 1UBEA 1NIJA 2FPMA 3QXCA 1ZU5A 4CT4B 3SYNA 2VHQA 5K8UA 4HB4A 2J7PA 3PEVA 4Q1AA 2XTMA 4LGMA 4UNQA 4FD2A 5SZJA 1Z2AA 5AUPB 2YOGA 1GITA 2G88A 2JGNA 1KSHA 3CKLA 3IBGA 1S1MA 4PZZA 4PXAA 5SZHB 4DDUA 4QKQA 4AY2A 3PR1A 5IHPA 2F1RA 5DN6D 1OSNA 4DIDA 1JAHA 1JJVA 4QG7A 5CYOA 2IYYA 5B30A 2ODNA 3RS0A 1A2KC 3OEHD 4DSUA 1OV4A 3HU2A 1YZQA 1JXMA 2PX3A 3A4NA 1P2VA 3LD9A 1LF0A 3MSXA 5LPNA 1LB1B 5HE8A 3BAFA 4PQYA 1OXUA 2O8FB 1KIMA 1IHUA 2X8AA 3A4MA 4Q66C 4G5RA 4TZ0A 1NSTA 3B85A 5KPDA 4PC2A 1GM5A 1Z0KA 2NO1A 6Q21A 3VKHA 3SN6A 2OXRA 1FUKA 2RGEA 2W83A 1ZD8A 1KYIA 3VMFA 3B2EA 4M1TA 3BOSA 4M1WA 4BRUA 3U44A 5IK2D 1W4RA 1IJFA 1P6XA 4CIDA 4PAQA 4IDQA 4PO9A 5JJIA 2FU5C 4S35A 1ZNYA 1XXHB 4IXMA 2QSZA 3CB4A 4ZDKA 5FUYA 4ESVA 1G3QA 3P4YA 4RFVA 1I4LD 3EW9A 5EXXA 4MGZR 2VYFA 5F9HA 1YVDA 5FR2A 1CS4C 2JJ2A 5CDFE 1LY1A 4P31A 5JWRA 2FJUA 2DFTA 1E1RA 2NO0A 4TTQA 5GJVC 4CEIA 3T1TA 5EXTA 2GXUA 1R8SA 4QJ5A 4DT1A 4DHEA 5BYKA 4M0LA 4QJ4A 4NE2A 4JLVA 2KWIA 4LI0A 3CH5A 4ACBA 1NLZA 2GETA 2A78A 4PTLA 5G3YA 2QY9A 4W7SA 1QHXA 3PXGA 1E2EA 1UDWA 2BKUA 3ZYCA 1FNMA 2I1QA 1HA3A 1OXVA 1U9IA 4PAMA 3SJCA 2WAXA 2CJWA 4MGIR 1GNPA 1NVVR 4O3MA 3TAHA 1N6HA 3BORA 5FBQB 4X8OA 3SNHA 1PZNA 3WRXC 3PIRA 2IA5A 4OI2A 4JT2A 1VCMA 4I99A 2QMUA 1NVWQ 4IKEA 3N2EA 3GJ7A 4PC3A 1US8A 1XU4A 4TLCA 5JMTA 3GP8A 4BFUA 1LV7A 3RVBA 2V1UA 1OLOA 1GP2A 1GUAA 3EIEA 2RGNA 3KTAA 3NH9A 4IRUB 4JLMA 4BFSA 1WBBA 4MUBA 1JQLB 1QHIA 3IO5A 3FFAA 3SDZA 1YR7A 1T5IA 3K70C 1FMJA 2CLSA 3THXB 1OXTA 1G5RA 3EPHA 2KSQA 4ITRC 1X8LA 1NRJB 2NTYC 2VIIA 4HLUA 1VECA 1S3SA 4DSNA 3R9WA 1SZPA 5HKKA 4B44A 2UZIR 3THYB 3W34A 4JJZA 4JLNA 2RGGA 1AGPA 1ZUNB 3OAAD 3B8HA 4NCIA 4R7ZA 4G5SA 4OI1A 1IN4A 4LY6A 4OQXA 4DUGD 5A5GA 2QAGB 3SZRA 4DBLC 3AGPA 2BMJA 5KOYA 1KOFA 3WRYC 3ZZ0A 5FL7D 4LJ6A 2L0XA 3NIBA 1XMJA 5JJKA 4RD0A 3S1AB 1VIAA 2YV5A 1KJWA 2G77B 4OHWA 3X2SA 3ETLA 1LW7A 2W6IA 2AD5A 1VDZA 2WAYA 4L9WA 5H1YA 4OL0A 4LRWA 1SGWA 2ODWA 4LBWA 4C4PA 4L15A 2W6JA 1L2TA 4NCHA 4L4UA 1N0WA 3VR2A 4OHYA 3O47A 1U2RA 4L16A 4BFYA 1Z5ZA 2OG2A 3QF7A 3IO3A 5C2JB 1R0YA 3ZLJA 5CLLA 3U3RA 4UKDA 4Q00A 4DVGA 2C8VA 3Q9LA 1JR3A 5JWHA 1VMAA 1SVIA 4AYTA 5D3MA 3X1ZA 1ZCAA 1IN6A 3HYRA 1CLUA 2Z5FA 4EDHA 3A1WA 4QHTA 3AV0B 2IUSA 1CIPA 3GLHE 1HEIA 1KJZA 3P20A 2BBWA 2PJRA 1E9DA 3AGQA 1HY3A 4A82A 2CVHA 1SVLA 2YYZA 1E79A 1XTKA 2HCBA 5FFMA 3SHFA 1ZIPA 4FMBB 4QHSA 5D3QA 1RC8A 5TY0A 1F60A 1RW4A 1T91A 2V7QA 3BB3A 4OK6A 2IYUA 2V54A 4D25A 121PA 3H86A 4AC9A 1KY3A 4ARZA 1QBKC 2OFWA 3KFVA 4HI0E 5DHFA 5BWMA 4Q01A 5KSPA 3D31A 3TQFA 2CL0X 3CNOA 3AP1A 1GNQA 1G7CA 1SXJB 1XD9A 4XWOA 2WHXA 4JYBA 4S2EA 3GLFA 3IGFA 2ZJOA 4KBGA 1E99A 4O0MA 2VP9A 3PENA 2NO9A 4RD2A 1EX7A 5KPJA 2O8CB 1KNQA 2AK3A 2N46A 2IYZA 1S0UA 2P0EA 3IKJA 4W9MC 2QZ4A 5CLQA 5DI3A 1S8FA 2AKYA 2CNWD 3O8BA 4A0RA 4ZCMA 3BS4A 4GMDA 1G7SA 3V9PA 5BQ5A 4DLVA 1M6NA 4R2HA 2CE2X 1Z08A 2XXAA 3DEFA 5FOTA 3U44B 3CR7A 4CVNA 1DS6A 2CL7X 2UKDA 4QBIA 5L3VA 2NZJA 5DNYB 2QPOA 3FKSD 3K9NA 3EZFA 1KO7A 5FOVA 3ZS9A 1IAQA 4JJKA 1OH7A 3DL0A 4P4UA 2QI9C 1I4DD 1AKEA 4C2UA 1GSIA 2ZRDA 3AP3A 1GNRA 2FV8A 2IL1A 3QVVA 1NIPA 1IY0A 2C98A 4IOKA 1NKSA 3EIQA 3MAAC 3TVDA 3TIFA 3ZH9B 2GVDC 4D4MA 4MRNA 1NN0A 4NH0A 1G5TA 4NMMA 4BLPA 1ODFA 2QMOA 3B1WA 1OPXA 3ZS8A 5C18A 4M1MA 3DKVA 4M2LA 2E1RA 1KDPA 5KNCA 1OYWA 4ZIRA 3WXMA 5JCZA 1TQDA 1E2LA 4RD1A 3V4RA 1ZYUA 1Q1ZA 4RZXA 4C2TA 3M4YA 1JPJA 3CRMA 2EW1A 1NMYA 1QHHA 1E9EA 4NU0A 4NZYA 4MYHA 4AD8A 4DCTA 2D3WA 2SHKA 5JZVA 3WP1B 1GZSA 5JBQA 1DPFA 1OFTA 1OHHD 2WWGA 1OXXK 2XZLA 3TSOA 3KJIA 3B5JA 3K0CA 2WWXA 3NVAA 3RRZA 1MO3A 4DSTA 3BJIC 3QF4A 1TU4A 2ZRNA 3K09C 1WRBA 3QKSB 1X6VA 1C4OA 1DG3A 3ZZUA 3IPXA 3K0FA 3AVVA 3QBTA 3GEIA 2ODEA 2QGNA 4C30A 5HTKA 2CE7A 2GCOA 4F38A 3ICQB 2ONKA 2JLSA 1FP7A 2G9NA 2KJQA 2J59A 3TW8B 4V02A 1MT0A 1R0WA 1CU1A 1TMKA 2ZROA 3HDTA 1GRRA 4CEJA 2I1VB 1VPLA 1ESMA 1R2QA 3CLVA 2FFHA 1ZNWA 5L3QA 1FUUA 1VIYA 4N0DA 5TMPA 4YDHB 4GZLA 4MUAA 1ESNA 1SQ5A 4OQNA 1H8HD 1Z0DA 2UZ3A 4Q7JB 4C0HA 5CDFA 4E22A 4D0NA 1TF7A 3X1XA 1OF1A 2F1IA 2RGBA 3MFYA 5FPTA 1X86B 1OKKD 2VEDA 3P27A 4A0GA 5JLJA 2CXXA 5EP1A 3SI7A 2AWOA 4B2LA 2QGZA 2FDCA 2ZQ5A 1T9HA 3L0SA 1NJGA 1S2MA 3AVTA 1RIFA 2GAOA 1HUQA 3I32A 4IXNA 3Q5DA 5GVRA 4JMPA 3B78A 1HQCA 3MWLA 3PUYA 621PA 1XMIA 2JAQA 2LCFA 2C9CA 4NYIQ 1CJVC 4EFLA 5J4KA 1HT1E 4BECA 1JR6A 4JLOA 5GJWC 4HYYA 3AM1A 2ZEJA 2FG5A 4D6PA 1D8TA 4JBYA 2OCBA 2QTVB 3BD9A 3UMFA 4GSYA 1RYHA 4EPWA 3SBEA 1EFHA 2BWJA 5KSZA 3KKQA 2O0KA 1BS1A 2EWVA 1W5SA 4AKGA 1RJ9A 1DE0A 3U3MA 3EZ7A 2D7CA 2NQ2C 2WSSD 4RZ2A 3BB1A 1DELA 4JLPA 3RAPR 1II8A 5EE9A 3ADKA 4GOXA 1E2KA 1NN5A 2IWHA 4B47A 3GLGE 4EPTA 5KDDA 2WZQA 2ORWA 4TSFD 2ZUDA 5DGXA 3U3JA 4ESHA 4B75A 3ZIAD 2V4ZA 3QIAA 4JLAA 2FOLA 4F4JA 2HXSA 2ZI5A 4Q4JB 4QM7A 821PA 3DM5A 3OIUA 1XJQA 2WJGA 4DCUA 2EFHB 2V6JA 1H65A 4MITA 3BWDD 4UNRA 4TWZA 2R62A 2NIPA 2J9RA 4HDQB 4LJ5A 2IYQA 4K81B 3B6EA 1R5OA 4U5XA 2KI5A 1AQYA 1WA5A 4WA7A 3THWA 1ZM7A 3GJ6A 1G6HA 5HZKA 3I8SA 1DAIA 3H0KA 3QENA 1KZGB 2C95A 5P21A 1DAEA 3WYFA 1GL6A 4LJ7A 3TVTA 4YXWD 5DSZA 2WWFA 4NDZA 3K0AB 1D5CA 3D8BA 4GFDA 2WICA 1LS6A 3QE0A 3A8TA 4KV9A 1E4VA 3TUIC 3U2QA 2QNRA 3LV8A 4CYMA 2QMHA 2IC5A 2JIZD 4LYHA 3EC2A 2V6IA 2ZAOA 1G291 2P6UA 1O3YA 1H8ED 2B6HA 5KDOA 3JZMA 2AFHE 1N5IA 2FZLA 2YC4C 3D6TB 5CITA 2DFKB 2IS2A 2F9LA 5H68A 3GFPA 4RZUA 3VX4A 3WNBA 3VNVA 2WJJA 2NMVA 3K9HA 3QPVA 3P4XA 4CT5A 2PMDA 1M7HA 1N5LA 1GDDA 1KSFX 2ZYUX 3WP0A 3UG7A 3UIEA 4MGYR 4PPFA 5JS8A 1Z29A 4F4CA 2BVNA 1UEJA 4PC7A 3TRFA 4C0QC 2ERYA 1XEWY 4MH0R 3GLHA 1G8FA 1M7GA 2QE7A 1NN1A 3VKGA 2OT3B 4NPHA 3IQWA 2DB3A 1FPMA 5FPHA 1QHNA 5DE3A 2DBYA 3HP1A 1DVRA 3T06B 4IFBA 2HF9A 1KI6A 1TEXA 2FX3A 1E9CA 4D0GA 1CJKC 3AF3A 1ZAKA 2HT1A 3R7WA 4B3GA 4PQFA 1O87A 3RABA 3AKDA 1JJ7A 1X1SA 1Z07A 2ZRJA 2FF7A 4WZAE 1E9BA 1KO1A 1TQ2A 4KFRA 2EFCB 1OB5A 2A9KA 1E2FA 1G3UA 4LX0A 3HR8A 1OW3B 1HYQA 2VRWA 2WWYA 1YRBA 2OAQ1 3KQKA 2VSXA 2J7KA 5FPYA 3TE6A 1KMHB 3VNUA 4KXFB 2LKDA 4W5JA 3F8TA 5JFGA 2FSFA 1A5TA 5DLQC 5JSZA 2J7PD 4D26A 2NPIA 2VP6A 2GZHA 4E5UA 4UNNA 3IEUA 2WJVA 1YR8A 1E2HA 1CR0A 3U4QB 4JYCA 4KU4A 4Q47A 2ZS9A 1Q1EA 4Q1DA 1RZ3A 5F2EA 4B3CA 1WMSA 1N6KA 1AM4D 1FTSA 4DLTA 1ZIOA 4P4TA 2BBSA 2Z83A 1E96A 1JR3E 3DM9B 1XDBA 1SXJD 2ZE8A 3PUVA 2GA8A 1M74A 4WAUA 3NC1C 3EARA 4TMKA 3LY5A 4Q5IA 4V0NA 2KBEA 4WOPA 3VKWA 1G4UR 2ZJ5A 2A3RA 4LUCA 3W5IA 1GRQA 1XEWX 4NYMR 3C5CA 3TR0A 2D7DA 1NVVQ 3M1IA 3OFND 2JDIA 1ZNZA 3ASZA 2IEZA 4C7OA 3BGWA 1XZQA 1S96A 2IX3A 5AUNB 3KDSE 4A36A 4JVLA 2ZSDA 2FSHA 3E5HA 1FQJA 2ZRCA 1IXZA 4RY2A 4K46A 3I3SR 3CF2A 2HJVA 4GPTA 1XD2B 4TN1A 2GCNA 3L0IB 4DLRA 3L0OA 5JI3E 4V0OA 4XOIA 2YWEA 4BWYA 4LDJA 1RYFA 3BFKA 4XSGA 3QQ5A 1Z6XA 2LKCA 1N5JA 1KO8A 2KBFA 2XJ4A 4TTRA 1L4YA 5L3RA 3WBJA 4RD3A 3I62A 2RMKA 3CPEA 4KITB 1A1VA 2JJ2D 4G5GA 4DEXA 4XVRA 3C41J 2XNSA 4BLRA 4QNMA 1E1RD 4M22A 1NY6A 3A4LA 2ZYTX 3LWNA 2WSMA 4QBHA 4B2PA 1KAGA 4RFSA 1PUJA 3B9PA 2IS4A 1D9ZA 3TKLA 3X1DA 1T4GA 2B7CA 1N6PA 1RRCA 1KI9A 4V0MA 1M1YE 4H1UA 3VTKA 3KUDA 1VCOA 1ELOA 4V0KA 4DZZA 2QU8A 2WWWA 1AZSC 4B32A 4LV6A 5E95A 4LV5B 4TT3A 5BN5A 1UEIA 1Z6AA 5EE5B 1G8YA 5CK5A 4TYYA 3B7GA 4KSCA 1EFTA 1QDEA 1DBSA 3FVQA 3QXXA 3LLMA 3C16C 3KL4A 3LVQE 3IIKA 1EFRD 1NF3A 4LYJA 4DCNA 5KU1A 4IDNA 1AN0A 5CM8B 3VR3A 1ZP6A 4LHZA 4G5QA 3AUXA 2AWNA 2NZ8A 5AR1A 3W8NA 5DYIA 3GEHA 2NO6A 1FFHA 2IHYA 2OESA 5BXQC 3EC1A 4M1OA 3NWJA 2Q9AA 4JSYA 4NKRA 1Z22A 4JVMA 1KY2A 1GRNA 3BE4A 2FSGA 4ILEA 3UXMA 1JXOA 2DPXA 4JZKA 4Z54A 1N25A 3U3KA 4A8JB 3UWKA 2IYXA 3PV0A 4LJYA 1T5LA 3TBKA 1DG1G 3SHWA 4QM6A 2GK7A 4IJMA 4JLDA 2CCKA 1AZTA 4IDPA 2RH5A 5JEDA 1OH8A 2BC9A 5HZHA 4HUQB 4XD7A 3AF4A 4Q1CA 1E69A 1HH4A 1AS2A 3A1VA 3GLHB 3EWAA 5AK0A 3ZVNA 2F1JA 3NDBB 2DFLA 4ZCIA 5JRJA 3GLGA 2WV9A 4WZBE 2EU8A 1VHTA 1DO2A 2X2FA 4BLOA 4RZ3A 5EP3A 3EA0A 3KJEA 3QG1A 4ZPXA 2W6JD 3KQUA 5GJCA 4GNKA 2ZJAA 2JJ1A 1IM2A 3G0HA 2GZDA 3EAQA 3GJ4A 3HYTA 3Q3JB 2WMOB 2FMXA 3PEWA 1UF9A 4CZ2A 4HAZA 3NDPA 3ND8A 4MRRA 4DB2A 4EUNA 2IXFA 1TQ6A 1I2DA 2AR7A 2GTPA 521PA 3VR5A 3PUWA 1JR3D 5FPSA 4AWXA 1MR3F 2C04A 4IVQA 2JJ8A 3LH5A 4GP6A 1VYVA 1FX0B 1FOEB 4OK5A 1AS3A 5TXGA 4TTPA 1TNDA 1SKYE 2OM2A 2OSBA 3R9IA 5A0FA 1TL7C 3NHBA 3P1JA 4P4SB 3RS4A 3AF2A 1MH1A 1QG4A 1E79D 5KUTA 3AKCA 3KXIA 4FN5A 5EUMA 4UJ3A 1DAMA 1F2UB 2A5FA 4JKIA 2OV2A 3A37A 1V43A 1K5DA 4MRSA 3PUZA 4EJSA 1QRAA 2QM7A 2R6GA 2V7QD 4UQOA 4B6FA 2R6DA 1NP6A 3LA6A 2J3EA 3DMDA 3T1VA 4ZI2A 2REXB 4C0LA 4Q7LA 2BHRA 5TB5A 1TAGA 1E2GA 3PITA 4U00A 2BCGY 4A2WA 3D3QA 1MO4A 3A1UA 3I8XA 3TAUA 1R0XA 4Z51A 1CR1A 3BH6A 1F2TB 3R8CA 2ZJZA 1NG9A 1YZLA 4HEJA 1SVMA 3CF0A 2O8BA 1PLJA 1BMFA 3ZQ6A 1UFQA 4IVPA 4TLDA 3TQCA 3L82B 3C4JA 3SJAA 1Q3TA 3IHWA 3LDAA 5L3SA 3K53A 2D06A 3GD7A 5CB8A 1HTWA 1CR2A 4Q4HA 4LJAA 1QHGA 3CW2A 1YHNA 2GKSA 3LFUA 1KK1A 4HAYA 2VSOA 1GKUB 1MABB 1Y63A 1W0JD 2ZTSA 1ZJ6A 3QY0A 2GBLC 1N6RA 4LOAA 2W2TA 4YMVA 3RYTC 2JA1A 4US0R 3DOFA 4HZUB 3T1QA 4LC1A 3ZDQA 3LXRA 1TQ4A 1Q1QA 4TLBA 3SQWA 2QBYA 1XCMA 2DWQA 3LBIA 2O8EB 1OB2A 5G3ZA 2YOFA 1ZD9A 2ZUCA 2B21A 3DOEA 2FZ4A 4A0FA 5IDVA 1P72A 4GL2A 2XTZA 4X8MA 1WP9A 3MJRA 4QXAA 2J0UA 1KMQA 2LWIA 1RVDA 4C0SA 4MKIA 4POAA 2J45A 2VP2A 1NG1A 1IN5A 1XEXA 5JWOA 5K8TA 2EYQA 1LS1A 2ASEA 1JEDA 3A36A
chains in the Genus database with same CATH superfamily
1B42A 3WLEA 1DINA 4P35A 3RC7A 3EGWA 4GNRA 1Q74A 5L53A 3PQ6A 5HKAA 1L4MA 2EOAA 3HDGA 1DG9A 4ODIA 4M0PA 1L7BA 4XWWA 5EI5A 3SIXA 3KZMA 1N2HA 3WGVA 1PT9A 1KY5A 4BC1A 1N8NA 3D3KA 5JYEA 3C3BA 2C4TA 3BDVA 3KQSA 1QG2A 2C9YA 5B57C 1JGTA 2DAPA 2C3OA 1P1HA 3ONDA 2FWRA 4FYVA 1F9AA 4C14A 1NOJA 1W88A 4C7XA 1U8AA 4FIDA 2IW3A 1QZUA 1X1TA 1J4AA 3DUWA 1WUJS 3QYAA 1PWEA 2IZ5A 4KODA 1XNJA 3H8VA 1KZ1A 3GN2A 4YGXB 3ZBTA 2HL6A 3QM1A 4N5NA 5CJPA 1XP8A 4ZVMA 2VA8A 2HJSA 5IVKA 1A9YA 2F6RA 1DPGA 3NQ41 4G0XA 1A95A 4WCVA 4YJ2F 5EUQB 1K7SN 2HMTA 5L45A 1RMTA 2P2LA 1E6WA 1P18A 5JJ5A 1N3LA 2FW1A 5DULA 5KJEA 3TL2A 3KUCA 1EWRA 2BDEA 2CLMB 4AJNA 1SNYA 3A6DA 1U5AA 3LT5A 1EE1A 4GI3A 4ERXA 1IVSA 5CB0A 3E3OA 4FJ2A 3HPRA 5F1PA 3KYDA 1XMOB 3LBAA 3V34A 3VH3A 1DBPA 2E2WA 1TPZA 3L6CA 2VWQA 1IOZA 1ZLYA 1KYVA 1O6GA 4AUMA 4FHEA 1A7JA 4GR9A 2PM8A 3LW7A 4P7GA 1RRFA 1DV2A 5GV7A 2M6KA 1RWWA 3D8SA 4YO8A 4N0QA 4PX3A 3PC2A 1XLUA 2XVXA 3MMPA 4HNSA 4OKSA 4HFRA 5FTMA 3VU8A 3E5NA 4B17A 4DXDA 1OUMA 5IVDA 3C6XA 4X3OA 1KFBB 3CPJB 2A6PA 2J6IA 4R81A 4YHBA 3PGJA 1U2QA 4DRZA 1SXPA 4DLSA 3TPFA 5ALOA 1YZGA 2BEVA 3W4IA 3RD5A 2VK1A 3RGGA 4B33A 3KYBA 3L04A 3EXEA 4ZCLA 3HVUA 4NVRA 2AMLA 2VHCA 2IUTA 1XJWA 2P1RA 1OXBB 4M8NE 4DJDC 2FPWA 4BBJA 2B3TA 5HEKA 1N2EA 2C5EA 2O2YA 4DDVA 4YP7A 4LJ9A 4N7BA 2CBZA 5TT0A 1HE1C 2ZBUA 4REQA 1WBDA 1P0FA 1X8KA 2PWAA 4H4EA 4QODA 4WKOA 5EOVA 4AP9A 1EK6A 1N5DA 4L08A 3UMYA 3UEOA 4IDBA 1TKAA 1M1YA 4A2PA 3IUQA 4OYRA 4EMTA 1ZS9A 1ONSA 3WYEA 1UFRA 5ICGA 5F5XA 5LU8A 4OPMA 1FS6A 2EHJA 4MP3A 2H11A 2SICE 3B36A 2VXBA 3G1TA 4O8ZA 2YWJA 1HYHA 2OXFA 5DMXA 1OYYA 4FWTA 4JYPA 5LWQA 2Q3FA 2YN4A 1MV5A 2C4UA 2ZWAA 1CXZA 1OT3A 4ZOCA 2GF0A 4HGOA 2R79A 2O3RA 3KKOA 4OHUA 1W59A 5IBQA 4QWWA 1ZUIA 3ESYA 4OU5A 4RQUA 4G1EB 4NONA 1NFFA 3KJFA 1D4FA 1V47A 4OHXA 4JXZA 3S81A 2OLJA 3WLFA 3AVOA 5HJ5A 3DDOA 4ZOAA 3IAUA 4YJ3A 5EEGA 1XJCA 3PFKA 5I7SA 3H2HA 4DUGA 3R6TA 2ZP1A 2XNCA 2HFKA 3GLUA 1Q2XA 4PLTA 3F9RA 1UEXC 1Q6ZA 3QHPA 4NZNA 4AK9A 1YDEA 2CVFA 3DE5X 1IWBB 1TUGA 3ZV5A 4ZRDA 2Y0BA 5C1IA 1NV8A 2O8DA 3WBFA 3LL4A 4PHHA 5EJFA 3EQ9A 2EVWX 4ICIA 4KNYA 1QB7A 4HMQA 4J07A 1YF3A 4ZEVA 5JUWA 1R5BA 1U1CA 3DGEC 1L3IA 2J07A 4ND4A 4YQFA 2YQ4A 4X8LA 1V5IA 1B0AA 3ZTWA 3QHAA 4F4HA 1G5PA 1N3IA 2F43A 1JHMA 5JZSA 3SF8A 4TLEA 1I3MA 2MINB 4JVOA 1MENA 2ZQYA 5IF3A 3QOFA 3R09A 5NLLA 1W49A 3L6RA 5C1BA 1BRMA 3F71A 4QUJA 2R8OA 1ODJA 3FLBA 3SVLA 4XWKA 2XZOA 1XZMA 1JLSA 2HJWA 3GDFA 1X80A 3UKJA 4AF6A 2H07A 3QFHA 4KHZA 1Z63A 4K8RB 3U61B 2W8BA 3W1WA 3AHEA 4KUEA 3ROFA 1K66A 5FLEX 4RJLA 2H51A 1WV1A 2X8JB 1GCGA 2X9QA 3K20A 4BO6A 2C7PA 3DGFC 1AMUA 1JYEA 3BN3A 3HWSA 3TMAA 3RYIB 2FEOA 3LQRA 3UMGA 3W6OA 3QPWA 4KQCA 2QZSA 1BGWA 5B3JC 2GAJA 2ATCA 1Y6RA 2PCJA 1SHLA 3WTCA 3R7FA 4EP1A 1B7GO 1RS0A 1YB6A 2ZIXA 3ORYA 2CHFA 1FQOA 1PJ3A 3CUKA 4WZAB 3UJAA 3VOAA 2PUEA 2W6NA 2BGKA 4C6SA 3B9RA 1H85A 3D3EA 3MD0A 5FLXA 1ODIA 2FPIA 3K0SA 1T1RA 2WF6A 4P0TA 3AO0B 2BFPA 2ZREA 5KMGA 3GVPA 4IICA 2QF7A 1VLMA 3EXHA 3IEIA 1R0KA 5LXTF 3RFUA 4US1R 3E5MA 4ZVPA 3U4MA 1S9DA 4TT8A 2FZ5A 3FPHA 1U0HC 3H2GA 4X6YA 5J1TB 3WNDA 3RBAA 4XWAA 4WLNA 4A91A 1EX6A 1XMSA 3PFBA 1MNQA 4ZGBA 3S0JA 4L22A 4YMIA 2OBXA 3BF8A 3JQAA 3OEEA 5AQ1A 1XQYA 2PZFA 2A2ZA 2FHPA 2WG1A 4MW4A 2G82A 2JZOA 4PLYA 3V7WA 1QDLB 3PEFA 4Y6PA 4BGDA 2WWTA 1ACJA 1BJKA 4UARA 1PNOA 1SVNA 3D81A 3HLYA 3O2NA 1MO6A 1N57A 1N5MA 2NQ8A 4IIGA 4AX8A 4D7AA 3CWQA 1QRUA 2OEPA 4CKCB 4G24A 2B3DA 1SUEA 1R4ZA 1V8FA 1B0PA 4PAOA 3OQIA 3IEMA 1P62B 3TOCA 4BJ3A 1V1JA 2EZ4A 3FNQA 3MVEA 4CG1A 5CIYA 1UBOS 2Z0MA 2QTHA 1T1IA 3GWGA 3T6KA 3BD8A 3GUCA 1E0DA 3TLGB 1JAIA 5KJ6A 5C52B 2IE0A 1JA9A 5DBFA 1DJQA 3MRVA 3RJ5A 3VOBA 4ALIA 4GT1A 4V1CI 2O7QA 3HY6A 4F86A 3DV2A 3OM1A 2WFLA 2ZUUA 3BERA 3F6CA 3KP1A 4MWSA 3GJTA 5KCZA 3OTQA 4AF7A 3IOBA 3DPUA 2P0YA 3DAGA 3H65A 1WU7A 5EESA 3IODA 3I6ZA 1Y9AA 5TT1A 5I4CA 1COZA 4ASUA 3ZXUB 1Y3DE 3PEYA 1LDNA 2O2DA 4JJFA 5EIWA 3ASYA 3MUFA 4PHGA 5ISMA 1JEQA 3Q12A 4JQZA 1XQ1A 3FDXA 4KQ1A 4EX7A 3CLKA 3U13A 4EW3A 1JIKA 3L0DA 5G1NA 5JYDA 4DQLA 1W36D 1LJ8A 2VLIA 2X0IA 3KLBA 4MHSA 5HK9A 4UOEA 1QYWA 4DCVA 1UUFA 1OJ7A 1FP4A 4NCAA 1CCWA 1W35A 1FU7A 5CA1F 1MJFA 1UCFA 2YHSA 2XAUA 2UXDB 3ZJTA 3RS8A 3P52A 5JO0A 2PT6A 3RJ9A 2LVBA 2L19A 3HVIA 2ATVA 3CPSA 4KQGA 4UBLA 1ZL2A 3F7TA 4E12A 2WUGA 3U09A 5LNK6 2JDID 4Q4LA 1OAOA 1E9RA 1H3NA 1MEJA 2PH5A 3FZGA 4J91A 4LIPD 1GA1A 4DA8A 1W6UA 1DXHA 1W4CA 1SIWA 1PR9A 4KC0A 2HQBA 4R5HA 5JAIA 3NYIA 4ECAA 7REQA 5JNLA 4BXOA 3UV6A 4MV9A 1V5EA 5A5EA 1LRJA 2HJGA 1ZIYA 2ODTX 2CNNA 2BSAA 1NQOA 4Y1GA 3U7EB 4E5VA 2XXAB 2XYPA 3IUYA 4EJ0A 4KJZA 4MQBA 4JBGA 1R6BX 1QGUA 3ICVA 1YU6A 2YJTD 4YJKA 1LGYA 2ROQA 4JA2A 3TB4A 5DLDA 2IVZA 2WAMA 3CLHA 4IVRA 5DTEA 3WHLA 4IZIA 4TYPA 2X4LA 3FOWA 3VU3A 2Q21A 3OE7D 4XZ3A 5TQ0B 3RSFA 1R0CA 4AROA 1T1JA 1ZJWA 2PK3A 4JLKA 3NNSA 5FUQA 3CG0A 1V48A 3RVQA 5IFKA 2D5AA 1ZGCA 3H5WA 1IY2A 3E84A 2YHUA 4JI8B 1BKDR 1XXLA 1JNYA 2ZSEA 3N0TA 1CRPA 1Q0LA 1UXJA 4N12A 4ZRMA 4REMA 5AXBA 2WYIA 4L02A 5EZ6B 5GZ6A 4X97A 2HF8A 1U1EA 3V80A 3BHMA 3VTFA 4D9MA 4C0KA 5EWMB 4K2HA 4X24A 5DASA 2XRZA 1BDJA 2ZIWB 3L7IA 3WGUA 1N8TA 4YJ3F 3RVJA 4ZT5A 4AJPA 5K0ZA 2FW0A 2I7VA 5IWAB 1FFDA 5E9WA 3ZV6A 4LJ4A 2YY6A 5LMUB 2QMEA 2A33A 4WOCA 4B8YA 2VXYA 3JQGB 2YWGA 4V39A 1RM5A 1S8NA 4FHGA 4WTOA 2ZM6B 4QXMA 3I2FA 3G82C 3H8SA 3BL8A 2QRLA 4PAWA 3EMKA 2RJNA 1QHHB 4BP1A 4JWTA 4BAZA 4HQNA 4BO9A 1ZR4A 1D9XA 2H2HA 1HDXA 2FR8C 5P8WA 1EDDA 3N7TA 4P4LA 5T4FA 3UANA 1ECGA 3WL5A 2G5CA 4N01A 1IBRA 2RH8A 1RRGA 5U4XA 2QUIA 5FL3A 2JFQA 4MZDA 4JBLA 2VCYA 4K87A 1S2DA 3GMSA 3K0HA 1PR3A 2PT9A 3QF4B 3G0DA 2AZ4A 3DCNA 4K9NA 2QD5A 3S8YA 3DAFA 3FWYA 4HNTA 4G1UC 3T7EA 3NBZC 4A4DA 4OOEA 2YMMA 5F76A 1NBMA 1CEQA 1HM5A 2Y1KA 4KXVA 4YIHA 3SOZA 5T4EA 4P33A 1WBJB 4MA5A 4FDVA 4KQHA 4Y9RA 2QGFA 2ZVPX 1W87A 3MWFA 1R12A 3SLKA 4J4TA 1NMSA 2H1LA 3SYLA 3P2KA 2CKDA 1ECFA 2Q5JA 4RELA 3VC3A 2JCGA 4IZOA 4B2IA 4B83A 3CTPA 3CKKA 2AC2A 3SC3A 2QSYA 1WHTB 3NNNA 3PGLA 2WR8A 3DE2X 2V3WA 4WRRA 2AKEA 1E2JA 5DBGA 4XA8A 3QVSA 3OX1A 4C4YA 1WETA 5E6SB 3X3HA 3GPIA 5L3QB 4PICA 2SECE 2QL6A 3REGA 3LUDA 2ZRAA 3BC1A 4RXMA 2HV8A 1UWLA 2ZSBA 3FPGA 2P7IA 2BDTA 4DXAA 1JIIA 3I9V1 1M1ZA 4LJSA 4MINA 1R9JA 2OV8A 3ANYB 2CEKA 4HRVA 4G1VA 4XYBA 4CQLB 3KETA 1J7KA 2ONCA 1M0SA 4EHLA 5CEJA 1EG7A 2GHIA 5JT1A 1N2XA 2H63A 3DPSA 5JSZA 4Q1FA 3W2HA 1Q7CA 2P3LA 4BV8A 1N36B 1U9IC 4PZEA 2GNOA 5IKMA 4E3WA 1YE8A 5H7XA 5C4GB 3I58A 3BWEA 1RHKA 2O1WA 4Q21A 4HFNA 3DLPX 4ZPJA 2XTNA 5GONB 2V1XA 1MZVA 2VNAA 3OZVA 4N8EA 2G1AA 1MIHA 1R18A 2V6GA 1TEVA 3VOSA 3DMRA 1T29A 3K05A 4MQMA 2G1JA 4GVPA 5DYGA 3BAZA 5IAKA 4EA6A 3OCYA 4DPKA 1YFKA 2G9ZA 3KVVA 5AIAA 4ALMA 3T1OA 1E2UA 2IY9A 4HT3B 3H4VA 3KQLA 2I6QA 1H2FA 5BNWA 1GGJA 4Q1BA 2XRMA 4OFWA 5BT8A 4OXRA 4B8WA 1C4KA 1JDUA 1G19A 1DCKA 1P8AA 1PCXA 1WEHA 2P9TA 2Q2OA 3BICA 2D00A 2WSYB 3DO6A 1W76A 3FE2A 3M6AA 4QLOA 3W5SA 4RTNA 5JXIA 1V3TA 1L4HA 3THYA 3Q7TA 4BGVA 3LUBA 3OOEA 4H18A 4M6WB 1ZUNA 2C78A 3DVAA 3SKVA 4KPYA 3IR6A 4WWHA 5AM2A 1YJAA 4XTCS 3TWOA 1DAHA 3KXPA 1RAHA 3K6KA 3S2ZA 1QO0A 1Z6TA 2CNLA 5ILOA 1FYEA 3BYZA 4ZRNA 2DZDA 4NI5A 5ALJA 3JAMA 3NBMA 3TCKA 4LHYA 4DPMA 2OBMA 1P3JA 1NSYA 4H77A 4PG6A 4B73A 4NBSA 1X2EA 4X6UA 1W75A 5BV8A 1VBMA 1BVUA 2ODQA 5JH7F 4QU5A 2WG0A 2X7XA 3P9RA 3S3TA 2CHUA 3C3EA 2ID9A 3CLRC 1KBZA 2XXBA 1VI5A 4HLDA 3VHLB 2B1RA 3QEJA 2PO7A 1BMFD 1FXUA 4DG9A 3L8ZA 1JTFA 2PGJA 4PG7A 1FNSA 3BL5A 1BWPA 4IOJA 1E9VA 4WDRA 2O4CA 1FLDA 2NSLA 2JFUA 4E5DA 2NQTA 3KSAC 1A96A 1S7GA 1JFRA 1N7HA 1MAUA 3FFTA 1GN8A 2CDNA 4U9HS 2D2XA 2QTMA 3C3CA 4P34A 5CHYA 1L1FA 1XX6A 3IXQA 4YRCA 1YBFA 3JWPA 4QUKA 4BAUA 1SG0A 3M4NA 2HGZA 1WPQA 1Y8QA 2VNJA 2NO4A 1VCIA 3KQOA 4NAVA 1PEYA 1ORIA 3GRCA 3S2YA 5BQFA 2NWQA 4AZ3B 3RC2A 1XVTA 3TRDA 4KE7A 1VG8A 4I6GA 4QDXA 5LQKA 1CUIA 1JSZA 3FCSB 4UBNA 5IULC 4C4ZA 4Z1MA 3ELWA 3DZIA 2WZBA 4Z4FA 4TXLA 1ZCZA 3T3IA 3ORFA 3DBIA 3NAGA 1G38A 1HKUA 4LVCA 1DX9A 2AN9A 3C97A 4G4GA 3LRPA 4CFZA 3B53X 4XD2A 1HFKA 1C8VB 5GIPE 4PLCA 4XIIA 1MGOA 3ZVLA 1RYBA 4MB6A 4R0VA 3E1SA 5KYYA 1VBFA 1OVMA 2DUMA 2OB2A 4Q6WA 3OJLA 3MGCA 4KQMA 1M34B 3GT7A 5EIHA 1W85B 4Q18A 3VJMA 3ZYZA 4DMGA 2W6ID 4FGSA 1C1YA 2ZETA 1T3HA 1UADA 3RNOA 3V9AA 3RWOA 2JAHA 2A57A 3H2BA 4I1VA 2O50A 4L72A 2ZYWX 1KI6B 2ZRPA 4YAJA 4PCVA 3HRKA 2DF8A 3PVSA 3AU8A 5DBIA 1F6DA 1N6IA 1Z06A 4LVOA 1STOA 5KWEA 3RUEA 3ROTA 3WQBA 5AUQA 5JW6A 1YE5A 5LZ5A 5JCJD 3AFHA 3GX1A 2FAXA 3S2FA 1RP7A 3OFNA 4QO7A 1X7XB 1HOXA 1F8GA 1J5XA 4P4NA 3AI1A 1J2TA 2C7GA 1Z0JA 2DPGA 4MR9A 5EZ5A 2FWIA 5I9TA 4DBLE 4FGJA 1BW9A 3KDAA 4PLGA 2BE7A 3SU8A 2XYGA 3K6JA 4K1XA 2IYTA 3HWRA 4CCSA 3KJGA 1YE3A 5CIQA 2OFOA 1EK5A 5EC8A 4JUCA 5LB2A 1F5NA 3BM5A 4WACA 4K6CA 4II3A 5A1JA 2G17A 4K28A 3AUSA 1GXSB 4KN5A 3RDPA 2D5BA 3LYUA 2E5WA 3BJEA 1VG0B 4NECA 4LK3A 4TTAA 3VDNB 3EPJA 1JBKA 3CONA 1BQ4A 4DUZB 2PGIA 3GNTA 2HREA 3MRXA 1KDYA 1OFIA 5AJYA 4JAVC 3WL4A 2P75A 4J0EA 2XSZD 1IK6A 2Q2VA 2Z4RA 1K7EB 1U7OA 3Q7QA 3NORA 3QEMA 3DMNA 4NAUA 3U6BA 5AJWA 4LF8B 2C0CA 3CGGA 4LRXA 5I01A 3QXHA 1GLNA 4MP8A 2IBMA 1P31A 3RM3A 3C7AA 2HDNB 4ZCTA 1C9NA 1Q21A 3LKDA 2J3IA 3ANSA 1YS9A 2ZB3A 4C2AA 3FYUB 3G3EA 4IF4A 2O5RA 1MOPA 1ZJYA 4MCHA 1QKIA 2XOXA 4RVGA 3JY6A 2H00A 2CF5A 5ALIA 2CN1A 3FNFA 2NU8A 4F7DA 3MWJA 2DHQA 3QEKA 1RFGE 4PONA 1CK4A 2GLXA 4XLLA 4Q48A 5ERXA 5TEVA 5F23A 2PKYX 1YASA 4OHBA 5C0OE 5ITZA 1PTJA 1YK1A 3UKDA 5HX7A 2BTEA 3LYHA 1YOBA 1J42A 5DHRA 2DC1A 3N07A 2C4HA 2XOKA 4I3FA 2XVMA 4B81A 4FPXA 4CM8B 4YWHA 1E2PA 2CLCX 4GE3A 3GZTB 1U7XA 4OF4A 4PBSA 5JJBA 2OD2A 2YZ2A 2SKCA 3TSZA 5IRCD 4IGAA 5EWLB 3LX4A 4ZVVA 3FOBA 4KR3A 2P2NA 1TLTA 1EHIA 2X0KA 2IUFA 3AV3A 3QG5A 3K6SA 4JYZA 1W0KA 1T4DA 2BSQA 1LVUA 1WY7A 3K0CC 2ZGVA 5I9BA 4R71A 4DM3A 3EEFA 1WW2A 3OOSA 4AG3A 2QP4A 1JLRA 2JGDA 1WM1A 3K8YA 3FUXA 3QKSA 4KYUA 3PEUA 1BKYA 5LC1A 3O7MA 3D0OA 1HQYE 2ERCA 1HKHA 3KAKA 1AXRA 2EEZA 2FB9A 2FGKA 1GDTA 4IUCS 3U37A 4ZVKA 4O2RA 2QENA 3GNLA 3TEFA 2FZEA 3NBQA 4URZR 3RAFC 1GPMA 3AU9A 1IBKB 2H57A 4M21A 2J9GA 4BPRA 1OD6A 1E9FA 1RR6A 1K63A 1XQ9A 2W2KA 1HZJA 1W1WA 2ZYVX 3OF3A 4W1SA 4Y2GA 3EQ2A 4Q3NA 4EF4A 3O8QA 1ND5A 2R1UA 3DFIA 5EUCA 3SJBA 4TXNA 2A7XA 2X4IA 4HC4A 3CO5A 2HD4A 2JAPA 2ZUFA 3EH1A 3HL0A 2NO5A 5KNBH 1WZ2A 2WFMA 3OY2A 4G3XA 1ZNXA 4E94A 1KSGA 4L5IA 3UW1A 1P6UA 2I99A 1IN7A 3VVLA 4AN0A 2QRKA 4P54A 4FFPA 3GCDA 2Q46A 5K0LA 4ZHQB 1YZKA 4XSHA 4IIDA 3F97A 3F0TA 3QWFA 1PS8A 2EQAA 3MTBA 1PT5A 1WIWA 3I5XA 3RSGA 3WC4A 1FYWA 2WUVA 4CBVA 5L7TA 5CD9A 2OHOA 4KXQA 5BSHA 5JRZA 1SBNE 2CJFA 4L5CA 2HHJA 1B8NA 2UYGA 1CR6A 2NTNA 3MHTA 5KYGA 2DX7A 1GZ3A 2FQ1A 1NU6A 3U60B 4BNDB 1GAWA 3GROA 3HS3A 6ABPA 4EF6A 2W00A 3HJCA 1PJZA 5AM3A 2IS6A 5ADVA 4B6SA 1U5BA 3H9JA 4RA6A 1JZTA 1NVMB 4BUCA 1SC1A 4WW0A 2BHTA 5KC8A 1Y1SA 2V03A 5DH9A 5K6AA 1T0BA 1U2TA 4QGSA 3K92A 3NT4A 4QAJA 2AJDA 2ISSD 4DV4B 1X7WA 2JEYA 3QSYA 1JL3A 2K87A 4ZYLA 4YDQA 2H4JA 2XUIA 3IQGX 3LAWA 4KMOA 4LE0A 3OUTA 1CUHA 3N8IA 1TXGA 4P32A 3IP5A 4X93A 4B46A 4ZK2A 3JQPA 3HKCB 2ZYGA 1L4NA 1VSBA 5IAOA 2GCPA 4IBOA 2WFAA 2R1VA 1G2QA 4ERNA 1CUVA 3KXDA 3C8DA 3NDRA 1BU5A 1CY4A 2QNIA 3AJ9A 2WQ7A 1QUEA 5DM2A 1AK2A 4X1YA 4G9EA 4ZEWA 2DBQA 2G0AA 3CBGA 3GLGB 1EVYA 1RXYA 5LLTA 1LF5A 2YW2A 3FYTA 2HB6A 5EQJB 1B8UA 3WRVA 5B6PA 5K6RA 3S1SA 5THKA 1VPWA 2HSWA 5KBYA 1NP7A 4CM4B 2H1HA 4F46A 3JQBA 4L6CA 4ETIA 3HU1A 4R6XA 5HDBB 1YI8A 4EPYA 5J47A 2X2PA 3ZXYA 2F3SA 4LZJA 3CH7A 2NLOA 1WVMA 1BAPA 1E1QD 3ZDEA 1Z62A 5KHOC 4KFUA 1L8QA 1M2KA 3K0AA 2JFYA 3I1IA 2CEAA 1AX9A 2HWWA 2VOJA 3N87A 5ULLA 3X1WA 4G6ZA 5HE9A 4RLQA 2JAWA 4LYAA 5FORA 1OGYA 3HCOA 1GUZA 1KYQA 2B8EA 5DX0A 1VP9A 3WKDA 3BXXA 5H70A 4A73A 1XCGB 5BVGA 1GZDA 2BE9A 1ISRA 5KINB 1BGVA 2DUUA 3UFXB 1P5FA 2VA9A 1M8GA 4CM7A 1HC7A 5FI1B 4PZAA 1ZW6A 1LNQA 3OQJA 4XQEA 3WOVA 2DBVO 2JFHA 4FCTA 3WJ1A 1UZMA 3SS8A 3SF0A 2XDQA 2CT8A 1QP4A 2MSNA 3N05A 2CXOA 1MO5A 4EKEA 1SUWA 3JRXA 5DDIP 3NXSA 3ESDA 1SK9A 1U2PA 2IPXA 1Z35A 2CB0A 4KE8A 4LA4A 5HKBA 2PSSA 3W5DA 3AVWA 4BNTA 1GL7A 2V7UA 1O4WA 3D5TA 5A62A 1YS1X 4WXRA 3AG5A 3DZDA 3FJYA 3LC2O 4LG1A 4NCKA 1E1CA 1F06A 1EFPB 5CT5A 2DETA 1ISIA 1TJPB 4PGFA 4YI3A 4E33A 1BEEA 1I4TD 3WWZA 4HLCA 1RPZA 1MPXA 3GEGA 4J3FA 4IHJA 3Q9UA 5E6RB 1UH5A 5J9FA 3NT2A 2DCMA 1JB9A 1A7AA 2I4NA 3OHSX 3PXAA 4NS1A 4OLJA 1ZM9A 2Q8PA 1YJXA 3GFTA 2X0EA 8OHMA 3G68A 1U7ZA 4FNAA 1QMPA 1B73A 2VDRB 2VP0A 4XWYA 1SBYA 4HWOA 1GRVA 1GFIA 2BEUA 1RKXA 4ZAVA 3AI3A 4L8VA 1COWD 4FSHA 2QG6A 3HU3A 1ZXXA 4XOUA 3TW0A 1DNPA 1EVIA 1RLTA 1ZA1A 1NBOA 1O94D 4H15A 4LS3A 5BSEA 1SVSA 5LZ2A 5AYVA 2WP8J 3ND9A 5KEIA 1NJSA 1T8UA 2JCSA 3N58A 4CJXA 5IP5A 1E18A 3U6KA 5GM1A 3H9CA 5GADl 3BZBA 5EIBC 1KVRA 4Q19A 4EPXA 4DQKA 2GMWA 5FTJA 3D6UA 3QVUA 1HDEA 2CCJA 4UOZA 3NASA 3UA4A 4PBRA 3G49A 2RI0A 2JLVA 2YTZA 1W7AA 1U11A 2YIJA 5KTKA 1KMIY 1HE8B 1DAPA 4PEVA 2J4DA 1U0FA 1ZGZA 2N47A 3L7NA 3GMIA 3MRTA 3RFTA 4LXUA 2W93A 2IXAA 2CMKA 2P9QA 3FJOA 2V5AA 3IBYA 4CDRA 3ED5A 1QCCA 3VDMA 2ZZNA 5H9WA 2WIBA 3FAZA 2CDAA 1XEFA 3LRTA 4BVLA 3A1DA 1SM4A 3E4DA 1Q2UA 1ZVVA 1VG9B 3EMDA 5JVDF 1YWGO 2AQHA 3TKAA 1CVIA 3UOAB 5F9FA 1Y7LA 3C5VA 4KXYA 1DO0A 5TGZA 5LB4A 1JDNA 4WXYB 3CLSC 4B7UA 2G08A 3MXTA 1IBMB 4QZVA 3CNEA 3RIYA 3H5LA 4B3RB 1N9GA 1UJ6A 3RS5A 4S1TA 4H7FA 5BV2P 2OFXA 2IVFA 2PGDA 1NVAA 1OJLA 4CG2A 4F8EA 1L5LA 1EXWA 2VJBA 4BLQA 2DTXA 2FN4A 2CYAA 5FA6A 1JEOA 3DJFA 5MN5A 1SHTX 2I4OA 1ETHA 4G4SP 4Q9JA 4C0XA 3HBNA 5DIFA 2IOFK 4GLLA 1P0MA 4BUJA 5F4BA 2BP7A 1GUDA 4OH1A 4ETWA 4F6LA 4C07A 1PV4A 2XCLA 1VFPA 4L0QA 3TZKA 3Q6NA 1ZONA 4UFOA 4CL0A 1BGXT 2UVQA 1FVHA 5JATA 3BMNA 4Y2PA 2PMCA 4AJIA 2GWHA 3OZXA 2OV1A 1Z56C 3EX7C 3K1AB 3CR3C 3JVVA 5KQSA 2XB4A 5JS6A 5EKSA 1P7YA 2Q9UA 3RLFA 4M9SA 1K7FB 1XFDA 3NMUF 2H3HA 1XD2A 1OV6A 2F9MA 5JBNA 4UBKA 3ER8A 1XYGA 2EJBA 3FKSA 4HGPA 1RVV1 1M2FA 5ECGC 2X5OA 1C50A 3AHGA 4K2AA 1LNSA 1AY0A 1GGHA 1KQNA 4KXNA 3MCVA 1QVAA 2BRUA 2X7JA 3I1JA 4M99A 1V3VA 3D1VA 4MOWA 2JIQA 3TFQA 5LYJF 2AXQA 2O1EA 4X3PA 4MV8A 1DP4A 3A0RB 4ZXPA 2RGYA 1FY2A 5FUWA 2YMLA 4Y67A 1JFTA 4J0QA 5EE0A 3LIPA 2DWUA 3LJKA 4ZDJA 2BM8A 2Z6QA 1A8SA 1LI4A 2JRCA 4M8LA 4BE4A 4TKUB 5FIUA 1UIRA 1AQNA 3GJ8A 5E9AA 1EAMA 1SCBA 2P67A 3NBYC 4C87A 2NYUA 4MLPA 3AVYA 3OX3A 2MYUA 1JFFA 2HHAA 4FGWA 4TSKA 1QLHA 2ZI3A 1SXGA 4Q3CA 1TIBA 3DKRA 1Q7GA 3AFNA 4TV9B 3VNBA 3KFXA 3WNCA 2QY6A 2WOJA 3KKKA 1HRKA 4P5EA 1V8OA 1JTEA 4MMZB 4ZTUB 3PCRB 5BMVB 1YB1A 1EVQA 4ZQIA 1JDBB 3PFCA 3G9UA 2MSCB 5AVQA 4K0RA 4UNIA 4P7JA 3VXKA 2HSEA 2TMDA 3UAOA 1VCHA 5ALYA 4CWAA 3GGJA 4YCBA 3DTTA 5EZYB 4PFJA 1YVUA 3BXZA 1ONNA 1L5ZA 1JQBA 3NHAA 4LF5B 1XDZA 4R98A 1S5PA 2PVCA 1OE0A 3ZDRA 4ZJYA 2Z9CA 1U7WA 1WVIA 2QZJA 1U1IA 2XCIA 3L7OA 2EL7A 4LMPA 1E3SA 1V95A 1Z8DA 3VHXA 4S1WA 4UEWA 2YFQA 2GEDA 4P53A 5EGNA 5TPZA 3T3NA 1RE1A 2E4AA 5HKOA 1RBYA 1CR4A 1D4AA 4DV7B 2DQKA 3HJNA 4F4IA 1N6NA 4UW9A 4YUZA 3IUMA 3ENNA 1J8YF 3RIEA 4YMGA 4W5NA 4OFZA 4YRIA 1RHMA 1V1RA 3AUJB 4ZOLF 3PXXA 1KU6A 2W71A 1N1EA 4AP5A 1ZN7A 1H8HA 3KB2A 4L76A 3V2UA 4PYOA 4DJTA 1VHDA 3I28A 2GBGA 4HMOA 3C6ZA 1MA3A 1IL0A 4WNAB 1A4RA 4IWXA 3H2IA 4W5WA 2IXBA 2ZE6A 3H84A 4E31A 3ZKWB 4MV5A 3IE0A 4I81A 1E7MA 1CY7A 4IHJF 4UC0A 3G0BA 3K16A 4GOJA 4XQCA 5FOXA 3D8UA 4OBXA 2NUAA 1ESCA 5DOZA 3UC9A 5ALPA 1INLA 1P1CA 1NT4A 2EZ9A 4DMMA 3SSOA 1KDRA 4Z7JA 4HAXA 2O2ZA 3G8CA 4RPKA 4NK4A 1GARA 3V4VB 3ZWBA 2UYYA 4F6RB 2QG4A 4UJ5A 1J8MF 4KPEC 2W0MA 6CHYA 3A6GA 4Q34A 1T1EA 4X85A 5FV7A 3VGJA 2W2MA 4JT9A 2GF9A 3DXYA 3ETHA 3KOZA 4G9GA 2PVSA 1E77A 1Y6FA 5IABA 1ECBA 1KEKA 2JI6A 2SKEA 2PJDA 5CVUA 4A6PA 2QJRA 2BBTA 1NMXA 1ZMXA 1CUCA 2Q6IA 4PR0A 4TVBA 4BQSA 2ZRGA 4MJXA 4XR9A 3IPLA 2B0CA 2IKQA 3BJRA 3CVUA 1K3UB 4G8CA 4TSFA 1UAAA 1XTSA 3W5AA 4O4LF 1G9TA 3I64A 3PWZA 3HDJA 1OIXA 4B74A 4B3MB 1AUPA 1U98A 1YMUA 1ENZA 1J0AA 3WDMA 1V3QE 3LSTA 3B3AA 4O2BB 2JASA 3HJRA 3OF5A 1D04A 3AJEA 3FMOB 2P91A 4LZZA 3IEXA 5AIBA 1O1YA 2JHAA 3CY6A 1VM6A 4BX3A 1G20B 1G8KA 5EMJA 3TNYA 1QQ7A 4X90A 3WWPA 1DOHA 2I67A 3D4PA 1REQB 2ZSAA 3D8RA 3MILA 1JFVA 1R8QA 4IWNA 3TRJA 2BGJA 2V7VA 4IJWA 4U9UA 5LBIA 1BXZA 1JBEA 1QZTA 4MAAA 1AD2A 2OAP1 3D64A 4AICA 3VYSB 4YXWA 4DQDA 1IUPA 4M8IA 1HWYA 1KYYA 4LDRA 5COQA 2HA7A 2IE8A 4RY9A 4U2BA 2IPLA 3W5CA 1T8YA 1Y8AA 1L0BA 2IPNA 3IMFA 3PRKE 4L8YA 4B3XA 1MB3A 3AVXA 1SCQA 1W2WB 3AEQA 1XD8A 3KVNA 4JHXA 3HM9A 1NG9A 2NV0A 1R9MA 2WIKA 2EFEB 3WMFA 4Y2RA 3USCS 4AECA 4BLSA 1MABA 1R0BA 1UDRA 3DONA 4BP3A 1G59A 3KLOA 4MMXB 1NC3A 2NU6B 1GKYA 4CL8A 5CFNA 4RPJA 2JBHA 3BULA 4RMHA 5ADWA 3HO1A 2ARKA 4NP6A 3ZU3A 4Z7QB 1S4QA 3ZJ4A 3RF7A 1F3OA 1AA9A 1E2MA 3F3YA 4FIZA 2FQWA 2WHPA 4XVUA 5G02A 1YZUA 4PSCA 1N3BA 1U0NA 1ORWA 1NLUA 1I3KA 3DQZA 1QH1A 3K9LA 3AJRA 5KSYA 1J25A 4GZ6A 4ISCA 3ROQA 5JHHB 3GJXC 1SHZA 1RACA 2GYVA 8MHTA 1NVUQ 1PF7E 1T8TA 2A0YA 1POXA 2QM0A 2EFGA 1XELA 3HC7A 1W2GA 2FGJA 4G23A 1ZU4A 4JKOA 4LECA 5EA2A 5A7FA 2QRMA 4OHMA 3OT1A 4IJVA 1RI5A 1N0IA 2G9RA 5F1YA 4HRAA 5B7PA 4UTXA 1PHRA 4DEVA 1M1NA 3IP7A 1VZ2A 7MDHA 3TE7A 2VL7A 2ZJ8A 5ES3A 5DT2A 5ESWA 3TN7A 1J00A 2ZJ6A 1UT8A 3DAYA 1JHYA 1D7AA 1RT9A 3N8NA 5A6VA 2AH5A 3P5SA 4Z0TA 3UWOA 5FAXA 1XTQA 1ZWKA 3ITDA 4CF7A 4TYWA 1J5PA 5K01A 2N42A 1YFLA 4QPPA 2AQKA 2PKRA 1G8PA 2Z6VA 4KUGA 2FE4A 2LGJA 2JANA 5KOIA 2ZE5A 3EIHA 1S01A 3OTHA 4IY1A 5DJ5A 3LPCA 4CM8A 5D7NA 1NL3A 1WCIB 2O5VA 3IXLA 3PQFA 3GCXA 4XRGA 2QVZX 3WKAA 1THZA 2XYVA 1UKEA 3ZW8A 4OJYA 3G2HA 5TJHA 3FI0A 1EP9A 1KFJB 2Y67A 1C4WA 1E0KA 3IQDB 2AMVA 4RMIA 4OYHA 5ALDA 1EVKA 1P2GA 3DDUA 1SCNE 2HRRA 1VPEA 3KJHA 4KCGA 4P5DA 4Q4AA 2Y3IA 2DYKA 4D6XA 4KFSA 1UBJS 3J7TA 1ZK0A 2WYVA 3AESB 2JARA 2BFEB 1LPAB 1CX9B 3AT1A 4CT4B 1Y8ZA 3DL7A 3EGXB 5K8UA 1PGJA 1R0LA 2F67A 5K3AA 1ZRMA 1XHLA 2XTMA 3SKXA 4WNYA 2AI1A 4LGMA 2YOGA 4YUVA 3UWMA 2JGNA 1NI4A 2XMCA 4IL5A 4QASA 5CCDA 4PZZA 4PXAA 4QPCA 3D4NA 3JARB 2G9UA 1RQPA 3M3HA 4KSYA 3IELA 5DN6D 4PRKA 1N2SA 3BKWA 3PQ8A 2CVPA 3DDHA 4DIDA 3TF5A 4U7PB 3ZE8A 4I2NA 5CYOA 2IYYA 1KRWA 1T8PA 5ILQA 2XLCA 1A2KC 4N8SA 3A25A 2JFVA 3IEKA 5U4QA 2UXCB 1YZQA 1JXMA 1W1UA 2H4WA 1GO2A 3A4NA