3REFA

Crystal structure of ehrho1 bound to gdp and magnesium
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
173
structure length
173
Chain Sequence
b'GKIENGKKALKIVVVGDGAVGKTCLLLAFSKGEIPTAYVPTVFENFSHVMKYKNEEFILHLWDTAGQEEYDRLRPLSYADSDVVLLCFAVNNRTSFDNISTKWEPEIKHYIDTAKTVLVGLKVDLRKDGSDDVTKQEGDDLCQKLGCVAYIEASSVAKIGLNEVFEKSVDCIF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho-like small GTPase
publication title Unique structural and nucleotide exchange features of the Rho1 GTPase of Entamoeba histolytica.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Signaling protein
total genus 55
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3refA00
4JS0A 1QF9A 2L0XA 4JBYA 4GMXA 5EE3A 4QKQA 1P2SA 4TMXA 1IN4A 2BOVA 3WXMA 3KKQA 3SN6A 1R5OA 3B9QA 3K70C 4ZCMA 4FWIB 1M7HA 2VYFA 4Q4HB 1BOFA 2JLQA 2QENA 4IDQA 3LWNA 3MWKA 1AK2A 1R5BA 5B2ZA 4MA4A 5FPYA 4C0LA 4XWAA 1OFUX 1DG3A 1KI4A 2HLDA 4KI0A 1OB5A 3HR8A 121PA 1CBUA 4CEJB 1YR6A 3A1TA 3WNDA 5LD2B 2QEQA 1N6NA 1KDRA 3UWKA 1YKSA 3VHLB 1NSTA 4D6PA 5JRJA 2P2LA 3RS7A 1Z0KA 3MWYW 4M1YA 4OQXA 3T61A 2OCAA 4JLDA 5FFMA 1TQ2A 2PCJA 4MGYR 1LF5A 5DH9A 5AJVB 2GBLC 5FL3A 1GOTA 2GESA 1XPOA 2WSSA 2YVUA 2QMEA 4FD2A 5HCNA 1GKIA 1RPZA 4M1TA 1N6HA 1XZPA 1COWD 1JEDA 2FE4A 2EWWA 3KJIA 1X8JA 4E03A 4RFVA 1G18A 5G3YA 1ELOA 4W9MC 5G53C 2QBYA 1TUEA 2MSEB 3LLUA 5CIQA 2ASEA 4LJ5A 4OQNA 4RZ3A 3TRFA 2ZYUX 4L16A 3B2EA 3LBNA 1A1VA 3TUJC 1GWNA 1ZM9A 2PZEA 1SVMA 5FUYA 1VG1A 5SZIA 1G9XA 4HDOB 4CW7A 1E9RA 4MKHA 2A30A 3GMTA 2WWXA 3U6BA 1U8YA 2JEOA 2VP9A 3P20A 3TR5A 3L8ZA 4U00A 2JIZA 4PSVA 3FYHA 2VP6A 3EPLA 1XD9A 1HQYE 3E1SA 2IYUA 1P2VA 3FPAA 4Q19A 4A6XA 1Q22A 2ZTSA 2ZJ5A 1XTJA 2QRZA 3D8BA 2EW1A 1TF5A 4RFSB 5DHFA 4BFTA 2BMJA 3AF3A 1F2UB 1KSHA 1TU4A 3H0KA 3FHCB 1E0JA 2PJRA 3L82B 1LY1A 1OHHD 3F8TA 1ZNZA 4KLNA 4ZO4A 2CCJA 4GZMA 1W7AA 2ZI9A 3VR4A 1BIFA 2X2FA 1VPLA 2VSFA 3T1OA 1W4BA 5CB8A 2EVWX 4Q7KA 5AJXA 4PAOA 1KMQA 2GBLA 4PTLA 5FTJA 2WBLC 1EG7A 4M9XA 4FCVA 2HXYA 5DLQC 1A5TA 2ORWA 2ZR7A 4RD1A 2J3EA 5DI9A 4DEYA 4EIWA 2QPOA 2HLDD 2QPTA 2O0JA 2RCNA 2W6IA 4AKIA 3HYRA 2H5EA 3Q9LA 4CIDA 1ZCAA 3SR0A 1Y63A 2B7BA 2GCOA 2WOJA 1XMSA 1E2QA 4S35A 2RGCA 2D7CA 5EE5B 4FCWA 2JLVA 2QMHA 1Z06A 2GCNA 4TLAA 4G5OA 1HYQA 2XGJA 4TSFA 1ZUIA 4CRWB 1G4UR 1I4DD 2WSSD 2OESA 2I3BA 2BBTA 1L4UA 1SKYB 1ZVQA 4DB4A 1N0WA 3AF2A 2QTFA 1AN0A 1UKZA 4TN1A 4YONB 1M8PA 4TMVA 1FMJA 3AP1A 4US1R 4KFTA 2J7KA 2QZ4A 5JCPA 4PPGA 1E9BA 1XDBA 3GFPA 2IHYA 2WMOB 2ZR9A 2NO1A 2YWGA 1TAGA 1VG9B 5IF9A 4XTRA 2QORA 1LV7A 3KFXA 3LXXA 2GXSA 4UXJA 1Q1QA 5FH9A 1NNEA 5TVKA 1OFIA 1U99A 4ABYA 2YOFA 1D9XA 1N3BA 5A0FA 1NBME 4ERNA 2JIZD 3A6PC 3VAAA 5KDDA 1EX7A 2CHVA 2D2EA 5KU1A 3K70D 5EE0A 4BZPA 2PCLA 1ZP6A 3IIKA 1JXOA 3GJXC 4QGAA 5J5CA 2PEZA 3P1JA 5DIFA 3CRRA 2FSIA 4LPSA 1NBMA 4IVPA 1MABA 3EZ7A 2FFAA 1FX0A 1KY3A 4M9QA 5DSZA 2C9YA 3K0AA 1AIPA 4DLYA 2HT6A 1GL6A 4Q47A 3F3YA 3V00A 4GBMA 3X1YA 4PC3A 4BEBA 4V0ME 4KSBA 4A2WA 1JQLB 4P31A 1E1RA 2DR3A 1R4AA 4MYUA 3P26A 1DTSA 2YYZA 3SBEA 2CHGA 1M1YE 1DPFA 2W6ID 4A15A 5HE9A 1ZM2A 2WJYA 3CBQA 4JVMA 2ZE8A 4TL7A 1E9SA 1SULA 4V0MA 1XTIA 2G77B 3P4YA 3QEJA 3W8RA 2FDCA 5CIWA 3QSYA 4BFUA 4I81A 4AC9A 4V0KA 4KU4A 2NZ8A 4P32A 3N70A 1VYVA 4TSFD 3QUSA 4IDNA 3GLIB 1WQ1R 3A1UA 3BH7A 1UM8A 4NU0A 2A5YB 2IYRA 1E2PA 1N5JA 1HE1C 3SZRA 4GOJA 5D3MB 3R7WA 4OI0A 4DIDA 4EJSB 4AKGA 1T4GA 4KITB 1XEWY 2FZ4A 4DLXA 5BN3A 1GG2A 3FOZA 5JS8A 3THYB 4HUTA 1I2MA 2OLKA 1E32A 3GEEA 3TGPA 4HZUA 4RZ2A 3IEVA 2ZANA 1E2LA 4RD4A 2B6HA 4AKEA 5HZHA 2BEKA 5FI1B 1NN1A 1KHTA 3VR3A 4PZLA 2PMDA 3FKQA 2GZHA 3NEJA 2KI5A 2Q3FA 3FHTA 2GF9A 3LBHA 1NKSA 3W8NA 1NMZA 1VG8A 2GNOA 4CGZA 1KIMA 3LRPA 3CIOA 4D0LB 4DEXA 3PV0A 2PT5A 3H4MA 4HAZA 1NBMD 3R8CA 4B3DA 2ZM5A 2QAJA 4N0DA 2C03A 3QNUA 5TB5A 3UG7A 4OHXA 1LFDB 3CF0A 3NG1A 5LDDC 2G3YA 2OFOA 3CR7A 3I4LA 4UNNA 2GRJA 4F7WA 1A7JA 2FPKA 5EP2A 1T3SA 4D81A 1XCPA 4QRHA 1IJEA 4UNSA 4D0GA 4GDFA 1J8MF 1SVLA 4TQAA 4NZYA 3GLHB 3E2IA 3Q7PA 5DI3B 1E1RD 1AS2A 1QVAA 4Q66C 1W47A 4Q1CA 4O2LA 4MKIA 2WOOA 1II8A 4IFEA 2BBOA 3GLFB 3I62A 4I1UA 4RCZA 1ZINA 2ZRDA 1G7CA 3AQ4A 2QBYB 4CF7A 4OK3A 3CNNA 3B9PA 3JZMA 5FR2A 3MD0A 4ACAA 4HB0A 3CW2A 3U3OA 4ZCIA 4BASA 2GJ9A 3IIJA 1FMLA 2ODEA 1Q3HA 1R8SA 3OEEA 5HR5A 1NP6A 3SYKA 4QNRA 3RC8A 3P4XA 2NPFA 1P6XA 1RYFA 2ZRIA 3NHAA 2JJ1A 1UF9A 2F1JA 1SQ5A 2QU8A 5ELXA 3K70B 4Q48A 3SFVA 4B32A 1MT0A 2ZRKA 4IFBA 4A92A 1RIFA 4CYMA 1A2BA 3DOEA 3BXZA 1DE0A 2ODWA 1HT2E 3D6TB 4KFRA 1IHUA 5KHOC 5F3WB 2K5UA 2JA1A 2ZJ8A 4HDQB 3SYLA 5KDLA 4ILEA 5FBLB 1NY6A 4LYAA 4C3ZA 4KJZA 4TLCA 3GLGB 1NL3A 1GILA 3U7FB 5H8WA 4F4CA 1EGAA 3R9XA 2HDNB 3KX2A 3UMSA 2AFHE 5C18A 4EPYA 2ZRNA 5EXPA 1RJ9A 3EX7C 2O52A 4HLQB 4F93B 2IS1A 2C5LA 4L5BA 2F1RA 1Z0IA 2ZYWX 2E9SA 2IW3A 4FN5A 1X8KA 1CS4C 2V6JA 1ZIOA 2WM9B 3LX8A 3NBZC 5C4MA 2B21A 4OHYA 4Z8YA 4ZIRA 2CBZA 5B58C 2GCOB 5D3QA 4HAXA 2FSHA 1RKBA 2XEXA 1N25A 3BFVA 2GK7A 1T3LA 2O8DA 2J5XA 3QXHA 3SU8A 4DZZA 4GPTA 2O8FA 2A5DA 2ODBA 4YMSA 2LCFA 1U0HC 2JLZA 2VHTA 1DAIA 2I1QA 4HEJA 3OZXA 3QXJA 2DY1A 4EQ6B 3NDPA 1D5CA 3LDAA 3W3AA 3Q5DA 4LJYA 3LQQA 4IXMA 4UXHA 1KZGB 3OF5A 4B44A 2NMVA 2NGRA 4ZKDA 1CJVC 3BORA 4H1UA 4UNQA 2D62A 1G41A 2ZJOA 5H1YA 5JRZA 1XD2A 3OEED 5FUXA 3OAAA 3DEFA 1T8UA 3IEUA 2OM2A 3U5ZB 4DDUA 5B57C 2ODNA 3KTAB 2JJ1D 2ECKA 4D4MA 4NYMR 2J41A 4Q21A 2WWFA 3FMIA 3O8DA 4B47A 4PHFA 3LVRE 3FTQA 1ZMXA 2DFKB 3A1WA 1VCNA 3L0SA 1E1QA 2AWOA 3ZGXA 5JS7A 3A4LA 1MO3A 1S1CA 4QJ4A 3LD9A 1NMYA 2J0SA 4MRPA 3IBYA 3RANA 2ZUDA 3ZYCA 4AG6A 3GP8A 5TDHA 2QTVB 4UNRA 3EIQA 2P65A 2WKRA 3VNVA 2WPDA 5FPSA 2JJ2D 4MGIR 1CULC 3EA5A 2HYIC 1XFAA 2RHDA 3R9IA 2GHIA 3C5CA 1GDDA 2DFNA 4Y0AA 2IEYA 1CIPA 4D25A 3PUYA 1UDWA 4XSHA 2XOKA 2IYXA 2KB0A 3A36A 4ZV4A 4QM7A 3K8YA 2QGNA 3QPWA 1R7RA 3UMFA 3ZVRA 1TTTA 1NF3A 2GXQA 2D74A 1SHKA 4MKGA 3QXXA 3B85A 4BRWA 2N46A 1R6BX 2FWRA 2QP4A 2V54A 4TMZA 2JDID 3AF0A 3QVUA 3KQLA 2VF8A 3M1IA 4IXNA 1HA3A 3MSXA 3WBKA 1Z0AA 1HV8A 2CLCX 2WV9A 4OBEA 3RC3A 1OFTA 1P9RA 4PPQA 4HB2A 2IYTA 4JIMA 4KVGA 4LDJA 4C9BA 1YR8A 4GL2A 1W2GA 4P3YA 2QG6A 4JL6A 4ZPXA 5ANRB 1TX4B 4XD7D 1C9KA 4JLNA 3NBFA 3PITA 4LK2A 5AUPB 4P4UA 1QRAA 2RGBA 3TSWA 221PA 2BIFA 5FUWA 5H68A 1NLYA 2HT1A 1TADA 1DVRA 2QI9C 4M1KA 4J0QA 3AVVA 3C41J 3DMDA 2VO1A 2W6JA 3KFVA 1W5SA 1LS1A 4QNMA 2XB2A 2J0UB 5J4KA 1E2IA 2FNAA 3OAAD 4M8NE 3H1TA 1QHYA 2WKPA 4NTZA 4R7ZA 3IHWA 3IO3A 3Q72A 2F7SA 1F6BA 4LJ6A 2RH5A 3I8SA 1LB1B 2IWHA 3QF4A 4KBGA 3AVPA 5KSPA 3QI2A 3GPLA 4NYIR 3SFZA 1E1QD 2JCSA 1UBFA 4MRRA 1ZCBA 1G7RA 3IQWA 1DO2A 4NYJQ 4F91B 1OYWA 5CJ2A 1KNXA 4M2LA 5KDOA 1CR1A 2WZQA 4PSAA 2R6CA 4KYUA 2WPDD 5DYGA 3EPJA 2AWNA 1NJFA 3ASYA 3NBYC 2F1IA 4PHGA 3D31A 4NCHA 4OK5A 5JEEA 1WMSA 4A0FA 1U9IC 2V1XA 3RS4A 3B82A 5GJCA 5HTKA 3QKUA 4G1UC 3M6AA 2ZAOA 5GVSA 1ZRHA 2GEUA 2B7CA 4I1SA 1GITA 2CLDX 3N2EA 4OL0A 5KSZA 1S9HA 1MV5A 2OUKA 2O8CB 1IY2A 1T0HB 3W34A 4W5WA 2VP4A 2NO6A 2VP2A 2Z6VA 3H2YA 1FUKA 1XCMA 2CJWA 4JLMA 4M9ZA 2GAOA 5J4YA 2VP5A 1G8PA 3UK6A 1NIPA 621PA 2QA5A 4F4JA 4NYMQ 4C30A 4G5GA 1P9NA 4TQ9A 3TJZA 1W1WA 2CNWA 2J87A 5JSZB 1RVDA 2ZRGA 3BIFA 2GXUA 4WAUA 1QZXA 3KQNA 5FPKA 1ZUNB 4H9GA 3DKPA 5J40A 3SOPA 1G8YA 1IONA 4W5HA 5B30A 3U6KA 1GNQA 3HU3A 5L3SB 3GJ7A 1NVUQ 3TKLA 2DWQA 2ZYVX 3CWQA 4M0LA 1GUAA 1CRQA 4D4LA 3I3SR 5FI0B 3U4QB 4MITA 1YRAA 2ZU6A 4LGMA 5TARA 1W4CA 4OHZA 4MKFA 2G9NA 1TL7C 2Q9AA 5AJWA 4AD8A 2PLFA 4D0NA 5BWMA 4DB2A 3TH5A 3K1JA 3K9HA 3KL4A 3OHMA 1GRQA 1VCIA 1G8HA 4TMTA 4C0HA 1E0SA 4K8OA 1U81A 1XTRA 5LBIA 5JJKA 4LUCA 1FZQA 3DZ8A 2O8EA 1KY2A 1NN0A 2ZPTX 2OG2A 1QHGA 3SS8A 3PVSA 5DN6A 3ZS8A 2V55B 1SXJD 3KB1A 4HI0E 5DE3A 1RFLA 1RYHA 3NXSA 5EZ6B 3ZVLA 3RS3A 3TBKA 1PV4A 3QF7A 5LB4A 5L3QB 1VCOA 1DARA 3L0IB 1KDPA 4MDEA 4JJKA 3PR1A 2D4HA 5HZKA 1XF9A 2IC5A 3M0EA 4AG5A 1CU1A 2H7VA 3ZS9A 4QBFA 1N5IA 1OXXK 3V9PA 4Q1FA 2HV8A 1CR4A 1HEIA 3V4RA 2FGJA 4WOPA 4CEHA 2YOGA 3TUZC 1UDXA 2VHQA 4JT2A 4KBFA 3FFAA 3CKLA 3PCRB 3R8FA 2FU5C 1FTSA 2ZE5A 1DO0A 5JHGB 2PH1A 2ZRBA 1E3MA 2R6GA 5KNBA 4M4SA 2DFTA 5EE9A 2ONJA 3RS5A 4FMDF 4JLPA 3ZVNA 2F43A 2ZRPA 4A0GA 5FTNA 3G82C 3Q5EA 4MYHA 1IM2A 1Z47A 1PLLA 1XD2B 2CNWD 3AKDA 3QBTA 4HUQA 3X1WA 4RSGA 4AYXA 3MWLA 4NYIQ 5EP4A 2OAQ1 3T12A 1YZTA 1S3SA 3QVVA 3QY0A 4URVR 2BCJQ 3AVQA 1AM4D 1TQ6A 4FI3C 3KKOA 5JLJA 2WWYA 4TLDA 4URYR 4XVUA 5CDFE 2ZSEA 4BWYA 5AUOB 3FMOB 1LS6A 4DC9A 2WWIA 3C4JA 4JBWA 4Q4AA 3VX4A 2ERYA 4HYYA 5E7MA 5JHHB 3I92A 1YR9A 3LFUA 3B1VA 2WWGA 5BN4A 3DDCA 1ZM4A 4YQFA 1AKYA 1E9FA 5DHAA 2QAGB 4PZZA 4B43A 4LYHA 4DDTA 3E5HA 2WJHA 5CDFA 2W2VA 1YHNA 2FPMA 2WTUA 3B1YA 1ZNYA 2CLSA 1FPMA 2OBMA 1S3GA 4DUGA 2ZU0C 4A8JC 2ZI6A 2TMKA 4M21A 2W0SA 2JLXA 1YZGA 3KUCA 4X8OA 5E3HA 1KO7A 1CTQA 1QHHB 4XIGS 3T1QA 1I4LD 5EQTA 1RRPA 3WNCA 4DLSA 4URUR 2ZI4A 4Q4JA 2Q0HA 2BKUA 1W36C 1OIVA 1AGPA 4TL8A 5KO2A 2V3CC 4Q1DA 3WMGA 2KBFA 2ZJAA 1Z28A 2YINC 3IGFA 3P27A 4B48A 2QGZA 3GEHA 5B64A 1EWQA 2OLJA 2PX3A 1H8HA 3IDQA 2XXAB 4O0MA 2ZIAA 3EC2A 3K0FB 2WJIA 3SBDA 4EPXA 1G3IA 1RRGA 4R71A 2DCUA 2X19A 1LVGA 1BMFD 2VPPA 2OZEA 1L2TA 1IAQA 3AGQA 4JSYA 4RVCA 2FFQA 2XJ4A 5SZHB 2GVDC 3PXGA 2ZSAA 4HATA 2BM0A 4IVRA 4NE2A 4LPKA 4E09A 5KSYA 2IYWA 4Q1BA 4HSEA 4QOSA 4US0R 2GEDA 1OKKA 2RMKA 1MOZA 3PUZA 2F3RA 3TQFA 1KO1A 3AF1A 3U7HB 1OXTA 4WIAA 4BZQA 1E0KA 1XJQA 4P33A 2ZRFA 3FB4A 4URZR 3WBJA 2AD5A 4A8JA 3O47A 1R0WA 3REGA 4RD6A 1NIJA 3KKPA 2V7QA 3RDPA 1HH4A 2IYZA 2KBEA 4DT1B 1XMIA 4FMCB 421PA 1KI6A 4DLTA 3VU9B 3LO5A 2XZPA 2XB4A 3CPHA 1G20E 4CEIA 4PC6A 5BXQC 2C8VA 3WNBA 5JI3E 1OF1A 1SXJB 3PENA 1AQYA 1WE2A 1FP6A 3U44A 1OH7A 1TF7A 4JL8A 3F0TA 1SVSA 3FHOA 4MDFA 4QGHA 5IT5A 1ESNA 1ETUA 5EUMA 1E9DA 1S9DA 4DUGD 2YKGA 3EG5A 2Z43A 1D8TA 1T91A 3GJ6A 4ZCLA 5IHPA 3JVUA 3GCGA 4PQYA 3VFDA 5L3VA 4GT1A 4W5JA 2GK6A 1U94A 3OE7A 3W6OA 2AD1A 4DSOA 2J59A 5G40A 2G88A 4C0KA 4AI6A 4BLOA 3I5YA 1GL7A 3R9WA 3DZDA 2F3TA 2OBLA 3LQRA 2Z5FA 5GVRA 2I4IA 1L4YA 1H8HD 3VR5A 3KB2A 2B8WA 4IOJA 4B71A 3MJRA 2VA8A 1L8QA 1BH2A 2ZSDA 3KQHA 3W6NA 1CR0A 1HTWA 2P3SA 4ON9A 4D4KA 2DWOA 5EE1A 1HT1E 1Z0FA 4B34A 4BFVA 4C0SA 2XZOA 3UPUA 4LJ8A 2RGNC 4LCBA 2IS2A 1S4QA 1CEEA 1N0UA 5FOWA 2BCGY 4TL6A 1LTQA 4MUAA 4N1AA 1M7GA 1G6OA 2R6AA 3I61A 1E2NA 1EFTA 2A78A 3QKSA 2QSYA 1OKKD 2XNSA 1KKMA 1QDEA 2R62A 4B73A 1W0JA 4L15A 2GJSA 1TNDA 2P5TB 3T35A 4ACBA 1PLKA 3ICEA 4LV6A 2JJ8A 2F6RA 4X8LA 4LC0A 2QNRA 4JVNA 2BJWA 3AF4A 2WVJA 3FE2A 1OV4A 1AGRA 5CYOA 2OXCA 2RGAA 2V7QD 4MRVA 1VTKA 4B3GA 1E2FA 1XMVA 1O87A 1XB2A 4WZAE 1W36D 1E4YA 2BV3A 2UKDA 5JJIA 5KPJA 3PIRA 3S1AA 1RC8A 3QEOA 4YXWA 2ZUBA 2QPAA 2OFXA 4OQLA 1G291 1OPXA 1NN5A 1BYUA 3W90A 2JLSA 3RS0A 4NP6A 4KVAA 3H86A 4U5XA 2O0KA 1K8RA 3FMFA 4QXAA 5EP1A 4GP6A 4B3XA 4FW9A 3OEHA 4BFYA 3BFKA 4QHSA 1GRRA 4WW0A 3W5JA 1DAEA 3KJHA 3MMPA 4R2HA 2BVNA 4ARZB 2RGNA 1KMHB 2EU8A 2EYQA 3TSOA 2VBCA 3MG9A 3OE7D 4S2EA 4DWJA 1XBTA 1KSJA 2WJVA 3C8UA 3CLVA 5EJEA 5FBVB 1WP9A 3UIEA 1ZW6A 2ERXA 3K0SA 1JPJA 2OSBA 1G6HA 1OLOA 4PANA 1J2JA 1CJTC 4IRUB 2ZROA 2EFDB 3WYAA 4X8MA 4MGZR 1D2NA 4IOMA 1N6OA 3THWA 1PVOA 1S8FA 2IA5A 4LY6A 2ZXUA 3QE0A 5K8LA 2D2FA 1E79A 3C16C 3QKRA 3SC3A 4DJTA 1MRSA 4I99A 2CL7X 3EZ9A 3THXA 3PJRA 1YR7A 1PUIA 2FZLA 2F43B 2IUTA 3CRVA 2FA9A 3L8YA 2VF7A 4F38A 5SZKB 1B23P 3KZ1E 4KXFB 2MMCA 4E22A 4TYWA 1NVWQ 4YMUA 4GFDA 2EFGA 3IQXA 2FEOA 3SJZA 3B5JA 1EFCA 2W58A 3NWJA 3AVXA 4JL5A 4Q9LA 1W0JD 4BLPA 4PAMA 4IVQA 5KNCA 4EPWA 3HPRA 3CH5A 1JPNA 3SHFA 5E7IA 3IKJA 1W46A 3HP1A 4C7OA 1DAHA 3EPKA 3OFNA 4EUNA 3TQCA 2VHJA 2GJKA 1NMXA 3AVTA 3G5UA 1NRJB 4TL9A 2VSOA 3DOFA 2W0MA 2FFHA 4IDPA 4XSGA 2WWHA 3CX6A 2GETA 3NKVA 4B2IA 3V4FA 3CONA 2G6BA 3IHLA 4YXWD 5A4JA 1JI0A 1PLJA 1K6MA 4OJQA 1N2CE 1KAOA 1GKYA 1WBBA 4KAXA 5E4FA 1UADA 4ZDKA 5HPYB 4QFMA 1E2EA 2RGDA 1OXVA 3NC0C 5DNYB 2QRNA 3OEHD 4EFLA 2QL6A 1GTVA 1HE8B 1OYYA 2WJJA 1RE0A 2OE2A 2DPXA 3CZQA 3T34A 3EIHA 2X2EA 2P5SA 1Q1BA 4PC1A 2EQBA 2Z4SA 4URWR 1KK0A 3B8HA 3ZJYA 3BFXA 1XWIA 3D7MA 1G7TA 2H17A 3KUDA 821PA 4A82A 1BYIA 1VYUA 2AXPA 2N1BA 1H8EA 3TR0A 3KXIA 5A5GA 2IHBA 3UATA 3QXCA 1ZC3A 2ZRAA 4E5UA 4TZ0A 1Y3AA 4OKSA 4GRAA 4EKDA 4CVNA 2FH5B 4L9WA 3PQCA 3AP3A 3KDSE 3GD7A 1NI3A 2H8KA 3BBPA 4C2TA 3CPJB 4AWXA 2REBA 3C14C 4A8JB 2JLYA 2QQ0A 1IXSB 3ASZA 1TQ4A 4JJZA 1LW7A 1IQPA 4NYJR 2YWFA 1T5IA 1DEKA 5C46F 1XJCA 1XXHA 3QXSA 2OCBA 3K53A 1P62B 1QG4A 4TMKA 2NTYC 2QP9X 1FUUA 3I72A 2FN4A 3R20A 2XNDA 5EZ5A 2BDTA 4CEIB 3K0EA 2PX0A 4JYBA 4Q7LA 1KTVA 3U44B 1MO6A 3RRYA 2REOA 4LJAA 2A5FA 1D9ZA 2O8BA 4Q1EA 4Q7JB 1CF4A 4MUBA 3SJCA 1JR6A 1XNJA 2HCJB 1BO6A 3RRZA 1X1RA 5BW8A 3CRW1 5FOXA 4BFXA 4HAUA 3A58B 1D2MA 5KPDA 3UG6A 1WB9A 3VQTA 2AX4A 3LBIA 1KO8A 1SZPA 2NO9A 1JALA 5IDVA 1N6RA 2HJGA 1H65A 1R10A 1T6NA 3IPXA 1UJ2A 1CJKC 3PEWA 3B13B 2HF8A 5M04A 3WHLA 2OFWA 4A2PA 1WXQA 1Z22A 1IXRC 1EX6A 5CK4A 3G0HA 1OXSC 2ZREA 1Z3IX 2PZGA 4YMVA 1TEVA 4PPFA 2V8OA 2IBMA 4JT4A 1P9WA 3LH5A 3WMFA 2GJ8A 3PEUA 4MH0R 2GKSA 4LV5B 4DLRA 1MABB 2JAQA 1FX0B 3SDZA 3UKDA 1WBDA 4PC7A 1H8ED 4A4DA 4FWTA 1G7SA 4L9SA 3DO6A 4DIEA 3K0AB 3N2IA 2CDNA 4RD2A 3QKSB 1GKUB 2ZS7A 1P61B 3CB4A 1VKJA 2H57A 1KYIA 3GFTA 4B74A 4DVGA 2W2XA 4CEJA 3ZZ0A 4PFSA 2FG5A 4LBYA 4DCTA 5G41A 4B33A 1XP8A 3PEVA 4MGKR 2AN9A 3ICQB 3MUFA 3T1TA 2FF7A 3LW7A 4PAQA 1RZ3A 1G5TA 4AYWA 3RWOA 5FOUA 1DADA 4D2IA 3RNLA 4DDVA 3AKEA 1ZM7A 3EZ6A 4D4JA 2KWIA 2XNDD 2BWJA 4QJ3A 4BRUA 4LBZA 2MSDB 1IY1A 5CYPA 1IN6A 3SNHA 2WWWA 4JKYA 2BBWA 1FW6A 3Q85A 3R7WB 1R0XA 4YC7A 1VHTA 4WBSA 3CX8A 4Q03A 1Z63A 4IDOA 1KJZA 2DFLA 3ADCA 1G16A 2CVHA 1OFHA 1N6LA 3EIEA 2FGKA 3TMKA 1XEXA 2VQSA 4BGDA 4HZUB 4Q9KA 1NJGA 2V4ZA 3TVDA 2JLWA 3BERA 3MWJA 1U98A 3DVLA 3VX3A 2BHRA 3WRYC 5FTLA 2FSFA 4Z8XA 1F2UA 3TAHA 1C1YA 2GTPA 3FKSA 3OESA 3RRNA 2IS4A 4DLVA 3PUWA 1R0ZA 1Q12A 2FX3A 3THWB 4BLRA 1GAJA 5J47A 4GZLA 3CZPA 4CDGA 5KUTA 4UQOA 4M1OA 5FL7A 1UFQA 3U7GA 1U8AA 2GJAA 4HZIA 3SI7A 2AHOA 3QG1A 1ZBDA 4V0NA 5IK2A 1N6IA 4OQMA 3TW8B 2F9LA 3U3MA 2ZE7A 4JLVA 3CR8A 1R5NA 2H16A 2QM8A 1S0UA 1WA5A 5HKKA 1P5ZB 1Q44A 1WRBA 4LC1A 1A2KC 3DMNA 2AKYA 4KFUA 1SHZA 3VNUA 2QQEA 3BS4A 3TSZA 3T15A 3ZVMA 1FP7A 1AZTA 1IXZA 4Q9IA 3W9YA 4QM6A 2W2TA 4R98A 4XVQA 3TK1A 2JLRA 1SKYE 3B1ZA 2FOLA 2LKCA 1U2RA 2YJTD 2XOKD 1P7CA 1VCMA 3SJBA 8OHMA 4A1FA 1EFHA 3W3ZB 1T0JB 2IYQA 2X8AA 2F9MA 4PSKA 3T5GA 3CO5A 3L0OA 4AY2A 1II8B 2JGNA 4ESVA 3SQXA 1GP2A 1DELA 1HUQA 4HAWA 4PPNA 1MR3F 4DLUA 1Z2AA 2ZETA 3IIMA 1XMJA 2QSZA 1KSFX 4OJKA 4US2R 3B7GA 2BKEA 2ZJZA 1MH1A 1XTSA 3K0CC 1YJ5A 4DSNA 3AP2A 3NH9A 2XZLA 2OO7A 4B2PA 4OI4A 4BUJA 3CUEF 3C15C 4B2LA 1KJYA 4DCNA 2VEDA 3WY9A 4RKFA 4WVFA 4BFWA 2CCKA 2OCYC 4K81B 4DCSA 3AVUA 2P6UA 4IDHA 2A9KA 3NTUA 1OJLA 2CE7A 2QTHA 3BOSA 1KDOA 3OIWA 4NCNA 1GRNA 1JBKA 3ECCA 4DDWA 2H1LA 3A1VA 3ONWA 5EP3A 1ESMA 3QG5A 5KOYA 2RGEA 2W6JD 1T3HA 3IO5A 4LYFA 4TLEA 4TTRA 2YC2C 3EZ2A 1R2QA 2XSZA 4QBHA 5KNDA 4Z1MA 3FKSD 4PHTA 2O0HA 3RS2A 4Y0VA 5FL7D 1EXMA 1Z83A 4QBIA 4JLJA 1RRFA 5IK2D 4AURA 2RGXA 1U90A 1RJ9B 4RCYA 4PHHA 3MLEA 1G5PA 2IS6A 4C0JA 4B35A 1CP2A 5GJVC 4AKHA 4NCIA 1HQCA 1N6KA 5HKKD 3CRMA 4FXPA 5BYKA 1V43A 2QM7A 4JLOA 4A0HA 1SVWA 3K0CA 1N6PA 1ZD8A 1YZQA 2NZJA 3B60A 4O25A 1YVDA 4LJ4A 4PO8A 3SHWA 2PLRA 4ZIRB 1OIWA 2GILA 3CM0A 1IN5A 4TT3A 1E6CA 3BRWD 2C9CA 4Q7MB 3BH6A 1OH5A 2B92A 1QHXA 4TYNA 2QT1A 2O8DB 1F3OA 1JB1A 2R44A 4QGGA 1JJ7A 4EPVA 1Z6GA 4QG7A 4V0LA 1ZJ6A 2O8FB 4N0EA 2QMUA 1E9AA 1OH6A 1W44A 2OXRA 4Q9JA 1XEFA 2ANCA 5CITA 1AQUA 2C95A 5D3MA 5IRCD 1A4RA 1ZC4A 4ASUA 3SQWA 5AUNB 4JVSB 1PZNA 2Q3HA 2XTNA 1G1MA 4IW3B 2C9OA 2I1VB 2GEVA 3THYA 2IXFA 3WYGA 4YDHB 1ZAKA 4CT4B 4JSTA 1TQDA 3QOFA 2EFHB 4B76A 2UZ3A 5FOVA 2R9VA 1KK1A 3K9LA 4D82A 3AKCA 5JCZA 1KOFA 4PO9A 2IK8A 3NDBB 1Q1EA 1TPZA 2ZS8A 5JWHA 2ZI5A 3CF6R 1KGDA 4LOAA 3DPUA 4RZXA 2YWHA 5L3RA 1XU4A 2ZAMA 1NLFA 2BC9A 2XTZA 4LI0A 4KFSA 2XSZD 2WIAA 4Z1MD 1E2GA 4EFNA 4YMTA 1Z07A 3GJ0A 4Q01A 4NDZA 1KK3A 2OILA 2A3RA 2P0EA 1X3SA 3GLHE 1P60A 2IF0A 3F5FA 4I4LA 5AWFC 1QBKC 1ONBA 4JMPA 2CXXA 3NVAA 5LPNA 1EK0A 1U0JA 4V03A 4XWOA 1XX6A 4DRZA 3LW8A 2AXNA 4LHZA 1FNNA 5BYJA 3JVVA 2QUZA 5J4HA 2G1JA 3GLFE 4LV8B 2YV5A 3JZAA 2GF0A 1P4SA 5DN6D 2IF2A 1EESA 3CH4B 5F2EA 4G0NA 2VL7A 3GLHA 3PUVA 1Z6TA 2HXSA 5DI3A 2J7PA 4JYCA 4LYJA 2NQ2C 3AV0B 4DSTA 2ZEJA 1E0AA 1S2MA 1ZD1A 3KXKA 5J4LA 3I5XA 4L8GA 3GLFA 3IUYA 4DBLC 4V0OA 3U60B 4TT3D 2QN6A 1U0LA 1N5KA 2A5GA 3K09C 4V02A 1Q57A 2ZJ2A 4R9UC 4ZKEA 4B3FX 4KV9A 2HUPA 1RW4A 4FINA 2C04A 3NHBA 4LJ7A 4M9SA 4M53A 2DBYA 4IHQA 4POAA 4C0QC 2PJZA 1OH8A 3B6EA 5FPHA 2WSMA 3U3JA 1GNPA 3U2QA 4A6PA 2F55A 4ASUD 3I1FA 1QHIA 2WAXA 4GI7A 4B6FA 1D2EA 2G83A 3SEAA 1X8LA 1JXMA 1XEXB 3GLGE 4EDHA 1ZNWA 3KQKA 3LX5A 5FBRB 1OXUA 2NG1A 1E2MA 5E95A 2V6IA 5FPTA 2IUUA 3B1XA 3EZFA 3VR2A 2DWPA 3BD9A 4FCTA 1G19A 5HE8A 3AH8A 1KI1A 4CT5A 3LXRA 2O5VA 3QF4B 1NN3A 1II9A 1KI8A 1E94E 1YZNA 3GLGA 1TUIA 1Z8FA 1RRCA 1UEJA 4PX9A 5FTMA 3AVWA 3LVQE 4QHYA 3CPEA 4BFSA 3KJGA 3K09A 4YLGA 2NO0A 2R65A 2A7QA 2FFBA 3A4NA 2AK2A 1ZD9A 4OK6A 5DYIA 4OI1A 3NC1C 1KO5A 2SHKA 3BH0A 3L2OB 3ZZUA 3QENA 1R0YA 2YWEA 3B78A 4K46A 4C0AC 3BE4A 3QQ5A 4DXAA 2IXGA 5L8VA 3EAQA 3FWYA 1P75A 1X1SA 3VMFA 4GOXA 4GNKA 1Q3TA 1J70A 3PG5A 4OYHA 1QHNA 2J7PD 2YHSA 1MRNA 1QG2A 1UKYA 3DHWC 4I1VA 3WMEA 4Z51A 5JFGA 2QROA 5C1BA 2NO7A 1NG9A 1EFUA 4TYYA 1JAIA 3TAUA 2CJWB 1WCV1 1UBEA 4EFMA 4EAQA 5FTKA 4EQ6A 3W5IA 3HJNA 3RLFA 3GEIA 5CM8B 3HU1A 3BK7A 2BMFA 1SVOA 1OB2A 1P3JA 1XEWX 3UWOA 5AK0A 2BMEA 2REXB 5FOTA 2HF9A 4BLQA 1E4VA 3VTKA 5JJLA 2VSXA 3FFBA 3DL0A 3QPUA 2J0QA 5JECA 2VHUA 2FMXA 3KTAA 4UKDA 2ATVA 1KDTA 3H84A 3THOA 1Z0DA 1ZUHA 6Q21A 1E96A 2RAPA 4LBWA 3ADBA 3AUXA 1GIAA 1VG0B 2ZE6A 4R2IA 4TMWA 1VIYA 5KSOA 3GQBA 3IILA 1ZU5A 4GOKA 2HYDA 1KI7A 2GAAA 2ATXA 4U02A 1SVKA 2FPLA 1G3MA 4XJXA 4WZBE 3RSLA 1G17A 3EC1A 2Q9CA 5K8IA 2XITA 5AJZA 2O8EB 3TLXA 1F48A 4TTPA 4WXPA 2QE7A 4WA7A 1YU9A 1IY0A 2Q6TA 3EW9A 3ZQ6A 4F92B 4IOLA 3U3KA 3U61B 4C4PA 2PZFA 2P6RA 2JASA 5GADl 1WDTA 2QT0A 3MRSA 2V1UA 4FMDB 2ZRMA 5P21A 2ZR0A 5CB6A 5FUVA 1E2KA 3FMPB 4XOIA 2HCBA 4DCUA 3M4YA 4A0RA 3TW4A 1FQKA 2GA8A 5TXGA 3WP1B 1CRPA 2WAYA 4II7A 2C2HA 4TWZA 4D26A 2YC4C 2ZSBA 1Q0UA 4LWZA 4CEHB 5CJPA 1VHLA 3CF2A 3Q3JB 4BLSA 2NIPA 3ZIAA 2GXAA 5JZVA 1XJ0A 3WYFA 2VHCA 3PUXA 5TY0A 4NH0A 4QGFA 2D06A 2HJVA 2ZJYA 3C5HA 4EPTA 2CHQA 1G5RA 1J90A 2GZDA 4DCVA 2E87A 1UBCA 4URXR 1A82A 5H70A 1IBRA 3ZDQA 1MKYA 3MFYA 2CEAA 3KKMA 1Z2CA 4HUQB 3KXLA 2OEPA 4NL4H 4RKEA 1C4OA 3WHKA 5JMTA 2J0UA 4NPHA 5DISB 5GJBA 1I4TD 2DHRA 2LWIA 1G8FA 3C7KA 1K5GA 2EYUA 5CLQA 3AB3A 2C77A 3CWZA 3X1ZA 2YNMA 2WKQA 1R8QA 1M7BA 2ONKA 4Q4AB 4Q4LA 4BEJA 1FQJA 2ORIA 2V9PA 1XPUA 3RHFA 4XWKA 2RHMA 4HAYA 1P2UA 3RSOA 1SKQA 3RABA 1DBSA 1JAHA 3O8CA 2P67A 3SYNA 4H1VA 4NCKA 2C78A 2IYVA 4G01B 1OT3A 3BGWA 3LAWA 3QKTA 1SVIA 5F98A 3ADKA 1J99A 2HEIA 3FGNA 1CR2A 1YRBA 4Q1AA 4JBXA 4TQUS 2YZ2A 2QE7D 4D80A 1G64A 4JKIA 1CKEA 4Q4JB 1G3UA 2Z83A 3AUYA 2ZRJA 5C4GB 4CZ2A 2RGGA 1F2TA 4IEIA 5BQ5A 1KJWA 2IL1A 4LBVA 4L4UA 1HY3A 3AKYA 3SE0A 2O8CA 1NVXQ 4I1OA 1JEEA 3MGCA 3BB1A 1G21E 4HB3A 3HPQA 4OHWA 1X86B 4RY2A 2AK3A 1J7KA 2QMOA 4TYPA 3U3RA 2VIIA 3QJYA 2W00A 1XTKA 1W4AA 5EXSA 1FL9A 1PUJA 3ZQJA 1YZUA 4ZDWA 3TUIC 2GCPA 1AJEA 2J45A 5DGXA 3HWSA 3ZLJA 4P4SA 1N0VC 3ZIAD 4AIIA 3UMRA 2FJUA 5JSZA 4KO8A 2EWVA 2C98A 2R8RA 2XJ9A 2Q9BA 3O8RA 5BN5A 1F60A 4U7DA 3EWAA 3A37A 1PJRA 4HLUC 4RD0A 3X1XA 1ZNXA 3UXMA 4PQRA 1E79D 1KI9A 1S1MA 1XXHE 1JR3E 1KNQA 1N5LA 2G1KA 3LV8A 2RB4A 5L3SA 2BEJA 4OI2A 4N3NA 3I32A 2OHFA 1KAGA 1MO5A 1NSFA 3IBGA 4DSUA 5K8TA 1XTQA 1US8A 4W7SA 4BE7B 1GL9B 1EFRA 4BECA 3U4QA 2PL3A 2JJ2A 2PT7A 2R6DA 1BS1A 2KJQA 1JR3A 2UZIR 2X1VA 3BWDD 3CRQA 1KI6B 2GVZC 1L7VC 4ZI3A 1W36B 2Q3MA 1YZKA 1XD8A 5J4VA 1Z6YA 2E1RA 2R6FA 1NG1A 4B75A 3AM1A 4GMDA 4JZKA 5G3ZA 3A8TA 1KKLA 3OFND 3AGPA 2N42A 3BAFA 3OIUA 4M1WA 5LD2C 1E98A 4XVRA 1GM5A 3BJIC 4EPRA 3EWSA 5L3QA 4GSYA 4IEEA 3W6PA 4PQFA 1VECA 1T8TA 1FNMA 1GVNB 1G8GA 2JDIA 1E2HA 2QAGC 3RWMB 3RAPR 4KLZA 3QPVA 4B3BA 1W2HA 3ND9A 4IOKA 3A1SA 4NBSA 2IWRA 4HLUA 3QBVA 2XTMA 5JWOA 2AR7A 2ZUCA 4QJ5A 3WRXC 4A2QA 1MO4A 4NKRA 4WXRA 1U8ZA 2QY9A 3B1WA 3ZD6A 4A36A 3P32A 4XD7A 2ZYTX 3T5DA 4F4IA 2WICA 4Q02A 1J8YF 4KHZA 1F5NA 1FOEB 4KODA 4TTQA 1DG1G 3OIVA 1AS3A 5TV2A 4M1MA 4P0TA 5C2JB 1M74A 3ADDA 4JLBA 1EWRA 3LNCA 1XPRA 1Q21A 4Q4HA 1TEXA 3UANA 1E99A 1CJMA 1X6VA 4MQBA 3L43A 3LLMA 5TMPA 2J46A 1TMKA 3NIBA 4ZI2A 4MYTA 4TZ6A 1KSGA 1JJVA 4MRNA 2ZJBA 5DO9A 1XRJA 3NH6A 3KQUA 3T1VA 3Q8XB 4XH9B 3CX7A 1YE8A 1OW3B 3EXAA 2J0VA 4PO1A 3RYTC 1W4RA 3Q7QA 5JEDA 1ZM3A 1KO4A 3J81k 2IXEA 4B6EA 2W83A 3K9GA 3RVBA 1EFRD 2ZITA 1E9CA 4XTCS 4G5QA 3LA6A 5CK5A 3WP0A 2QAGA 4UNPA 2A5JA 2G0NA 4BQSA 1JR3D 3X2SA 5FR1A 4NHOA 5AJYA 2ZVPX 4BPBA 1VDZA 3DM9B 4LHWA 3S1AB 4BFZA 2ZRHA 4YMWA 4IJMA 4ZDIA 4WZ6A 2ZI7A 2ZS9A 5AR1A 1QHHA 5KTYA 2ZVQX 1B0UA 1KI2A 2F1HA 4O3MA 2FEMA 4LX0A 1ZIPA 1T5LA 3CNOA 3L0PA 3O8BA 2D7DA 3DM5A 4UJ3A 4Q9HA 4DLZA 4QHTA 5HCIA 4UJ5A 1SXJC 1UEIA 4PC2A 2IYLD 2XXAA 1K5DA 2QP3A 1JQJC 4RJLA 3K0FA 1UBGA 1NVVR 1YZLA 2CL0X 4RD3A 1DAGA 4C2UA 4RFSA 3ZZTA 4NMMA 3VKWA 1G4AE 1Z6AA 4PXAA 4G3XA 2ORVA 3AVOA 4P4TA 4IKEA 1NKTA 1UKEA 2R2AA 2IT1A 2WHXA 5JBQA 3VR1A 1M2OB 2G0TA 2LKDA 2OAP1 4LHYA 3E70C 3VKHA 3GJ8A 2ZRCA 2KE5A 3EASA 1KK2A 2AKAB 3TIFA 3VR6A 3QKRB 1Z0JA 5FBQB 1UAAA 2ANBA 3THXB 5EXXA 1IN7A 5CLLA 4BZXA 4C0BA 2VH5R 1KI3A 1ZYUA 4PR0A 2IUSA 2P6NA 2IYSA 3SJAA 1AZSC 1CXZA 1LF0A 4M1SA 1JNYA 2GDJA 3ND8A 2CCGA 3TVTA 4QC2A 5UKDA 5FOSA 1V5WA 2AL7A 1GZSA 5JI2E 3AVYA 1NLZA 1VYTA 1ZU4A 1SXJE 1P72A 3REFA 2CE2X 3ZD7A 4HLDA 4NONA 2IEZA 1DAKA 5K8UA 3BC1A 4DT1A 2WJGA 2NPIA 4JLKA 1P2TA 1ANKA 5JWRA 1W0KA 3VU9A 3NBXX 5AUQA 1XCGB 2AFIE 1D6JA 2OV2A 4ESHA 2Z0MA 2H18A 4DHEA 1UPTA 4LHXA 2EFEB 3HDTA 2PBRA 3T06B 1GFIA 1IOZA 5E7JA 1SXJA 4YDSA 4C7OB 1KZ7B 4FMBB 1LNZA 2CK3A 1W5TA 4HLCA 2C96A 4OQFA 1TU3A 1IJFA 3GJ5A 2UVQA 1M34E 1DAFA 2BBSA 2PEYA 1E2DA 4GP7A 4O2RA 4MRSA 3EPHA 1CJUC 3ZH9B 4NCJA 1Z6XA 2ZSFA 2BJVA 4FMCF 3X1DA 2Z4RA 1NY5A 3N5CA 2ZRLA 2DB3A 1AA9A 4B3CA 2OCPA 2OBNA 2VP0A 4OHVA 3PEYA 4QL3A 4DKXA 1F2TB 4LHVA 2NOAA 2J9RA 1P73A 2CL6X 1W49A 2FSGA 2GWHA 1OE0A 1O3YA 4MYCA 1DAMA 3GJ4A 4Q00A 3NEYA 2Q21A 1AKEA 4Z54A 5EXTA 5GJWC 4HB4A 2MSCB 4KCGA 4G5SA 4AK9A 3VKGA 1OIXA 5F9FA 1GNRA 4P4SB 3K9NA 4EJSC 2ZQ5A 2VRWA 1ODFA 1Q20A 4QBGB 4X8HA 3GFOA 4JVLA 2OT3B 3HU2A 521PA 3D3QA 4LZZA 1T9HA 2H92A 1G3QA 3EA0A 2A2ZA 5CM9C 2FV8A 3MCAA 3A4MA 3AEZA 5F9HA 1OSNA 3QIAA 3TNFA 2VLIA 2CMKA 2PMKA 2BM1A 1E2JA 4Q5IA 1US8B 2RKOA 4LRWA 4LJ9A 3BB3A 1U9IA 1S96A 3VHXA 1XXHB 2C99A 3GLIE 3U7EB 4LSGA 1COWA 3FDIA 3FVQA 4HAVA 2VTKA 3KKNA 4KYIB 1DS6A 3I8XA 2DYKA 1W0KD 2XAUA 3BB4A 3CNLA 2YOHA 4UXIA 3ETLA 3IPYA 3GJ3A 1Z29A 5EUQB 1TF2A 1JECA 3KJEA 4RZUA 1DOAA 2BMDA 3MJHA 2O8BB 1IN8A 1CLUA 3DKVA 3RRMA 1Q1ZA 3MAAC 3HR7A 3GLIA 4HDCA 1Z5ZA 2CK3D 1QVRA 2GZAA 2IYYA 1NVVQ 2JATA 2XX3A 5FBWB 4TLBA 2B8TA 4PZYA 1G3RA 5KYKA 2EFCB 1VIAA 2X77A 1AS0A 2KSQA 4KSCA 2ZI3A 4JLAA 2D3WA 1E69A 4M22A 4Q18A 4EJSA 2WMNB 4A9AA 1Z08A 4DLWA 2MMGA 3LY5A 1SGWA 1VMAA 1WF3A 1UKVY 4ITRC 5SZJA 721PA 4ARZA 1FTNA 1KMHA 4G5RA 1QHSA 1YQTA 3PFIA 1GSIA 1XZQA 4ZDJA 4AYTA 3TE6A 1BMFA 3I73A 4TYQA 2IX3A 1M6NA 2JLUA 4E07A 1HURA 2CVFA 1I2DA 1OHHA 1W48A 3OIYA 3EARA 2J1LA 2WIBA 1FFHA 1II0A 3HYTA 1E9EA 4BLTA 1BKDR 5LB2A 2Y8EA 4FIDA
chains in the Genus database with same CATH superfamily
1EWKA 1RWPA 4JS0A 1QF9A 1Z35A 1YL7A 4OQDA 4UHBA 4NG5A 1EDZA 2ISQA 1QIHA 4QKQA 3LECA 5EHGA 4BY9E 1Z25A 1ZA2A 2RAFA 3AJAA 3PE3A 4HFJA 1R5OA 5K45A 4YH1A 4R1UA 2VYFA 3R0ZA 1AU9A 3FLMA 4LGVA 4Q4HB 4B6PA 1BOFA 4MDHA 1NU8A 1QR2A 4IDQA 3LWNA 2DX7A 4HRXA 3RHZA 3V2GA 2BUBA 4MA4A 3RYIB 5JMWA 4B6OA 3E22B 4OH7A 3SF0A 1WCYA 2PD4A 3HR8A 1SC6A 1TJYA 1YR6A 3WNDA 2WINI 1E3WB 2R0QC 5I9SA 1OX5A 1LRJA 4BYMA 1Z0KA 3JSXA 4FGSA 1ZVMA 3OTHA 1FNBA 3N2KB 1E5XA 4LCEA 4PVDA 1DJNA 3MWYW 4RC9A 4M1YA 1BWSA 3K96A 5FFMA 3K9QO 4MLPA 1TQ2A 3RIHA 3TQOA 1LF5A 5DH9A 2GBLC 4I5IA 3ZDEA 3KZXA 4MVJH 4ETMA 1QP0A 1RRMA 2WSSA 2YVUA 4OYYA 5HCNA 5A9RA 1RPZA 4M1TA 1WHSA 1CP3A 1IZYA 2XZDA 4Y2SA 4U6SA 3GCZA 5G3YA 3SEAA 3CVVA 1QR6A 1T2VA 1GCUA 3CWCA 3HDYA 3IE0A 4RVDA 4EYKA 3UGKA 3INYA 2IUYA 5HK9A 1SCKA 1X14A 4DYHA 4O8CA 4QQFA 1EFPA 3AF5A 3DEJA 3B2EA 3IRUA 1XU9A 3LBNA 4RTQA 1XCLA 3SJ7A 2ZSIA 1L4MA 1SVMA 3CUVA 4Q0MA 5SZIA 2FRDA 1KS9A 4ZPJA 3EVGA 2O1XA 1E6MA 1GU1A 2RAVA 3GMTA 2WWXA 3CEMA 3M6FA 1CNMA 1E89A 1RABA 4L75A 5T8KA 2VP9A 4LNUA 4EUEA 5A7FA 1W76A 3U6BA 4C21A 1I3KA 5I01A 2C5EA 3ZE9A 1V16A 3G8CA 1ADYA 3H2IA 2QRPA 1N7HA 1J2YA 3E1SA 3FCUB 1P2VA 3HCEA 2J3JA 2W48A 3D4NA 1E4EB 2X8JB 3EXHC 3L6RA 4Q19A 4A6XA 4C3VA 4YRDA 4YQEA 3R3VA 2IY8A 2EW1A 2Q2VA 2XMBA 2PSHA 1AV6A 2E21A 4CQLB 4DA9A 2EZ4A 3EGXA 3H0KA 1XRLA 4QOHA 3V1TC 3DV0B 4UM8B 3F8TA 1GAXA 1ZNZA 4YIKA 5AXCA 2WIDA 1D7AA 2W2LD 4IMPA 3F7NA 4QYMA 3M4NA 1OR8A 4GZMA 2ZI9A 4ZO4A 1BIFA 1K6XA 1MG0A 1JEQA 3ZXIA 3LCVB 1W4BA 2FSSA 3SS9X 5IJ9B 5JBNA 4OOEA 2A35A 3WIEA 4IIBA 1JJFA 3MBOA 3PGXA 2DQSA 4TTVA 2A0YA 1XZKA 4H6XA 4OIFA 4ZZ3A 3FLAA 1CQWA 2P2GA 4RXUA 1KJJA 3RV3A 4TKLA 1PNVA 2QM0A 3O93A 3QEAZ 2G9UA 3D0KA 3EWIA 3IUMA 3O82A 1QP4A 4LXGA 2QYSA 3F78A 2VZ0A 3O92A 1YS2X 2VNJA 3HG7A 4I0WB 3JQRA 4R9VA 3G5TA 5AVKA 1X2BA 3WSVA 1KQ3A 2A9QA 4D8UA 5BN1A 3MINA 1U3GA 2JIRA 4PG6A 1Y63A 4G23A 4OEHA 3S28A 1XMSA 1E2QA 2MDTA 3QFSA 2G5GX 4G0UA 3D3WB 1KEPA 1QFYA 3MWEA 4FCWA 4HQOA 4WDQA 4XIYA 2GPJA 2VZEA 4CU5A 4EG1A 2JLVA 2NSYA 1JHPA 1Z06A 4Z49A 1SOAA 4P0QB 4RQTA 2QRVB 3LXMA 1ECBA 4DL9A 3FOEC 2HOQA 4BL5A 3ADOA 1ZUIA 3WLFA 3EFHA 2CKDA 3H3JA 1THGA 1TYZA 2F59A 3EPPA 3BTUA 5EHNA 5TC4A 2JFNA 1L4UA 1SKYB 1ZVQA 2Q3BA 2A33A 5AIBA 1OY1A 3AF2A 4RMGA 1AN0A 1FS5A 3VC1A 5LQRA 1YR3A 1M8PA 3D7RA 2XQFA 3AILA 1HOXA 2YH2A 3H5TA 1C9EA 3GFPA 2AOTB 4PXYA 1U8EA 5HJ5A 3IODA 1TAGA 4I4TB 1LH0A 2IZ5A 4PLTA 5IKXA 5DTJA 2BH2A 4G89A 4XTRA 2QORA 3KFXA 1FFWA 2GXSA 2XPCA 1LLQA 2GFHA 3LXXA 3NAZA 2W2PA 4KDFA 5EWJB 3NFYA 1ZJ4A 1NNEA 3HVIA 3V1MA 5EZYA 4W8GA 1A8HA 3S99A 1ND6A 2CHVA 3RARA 1B8NA 2D2EA 1UK8A 5KU1A 3K70D 5EE0A 4BZPA 4A5OA 3UAZA 5KIAA 1VSVA 3GJXC 4LDQA 1WMAA 1H4VB 4PYNA 4X63A 1IYZA 5A1JA 4GYWA 2NV2B 3P1JA 4F3NA 2EJCA 3K20A 3G2NA 4ODIA 4RHYA 2HRZA 2ZW9A 3VR2D 2GUWA 4HDAA 1KZ9A 1P17A 1AB6A 1RXCA 1SB9A 1SPXA 2Z9CA 3DYIA 1JWAB 1GZ5A 3QVKA 4LZAA 4F97A 1BEZA 1ZRMA 2FDXA 2XMCA 3ENKA 4HPXB 2VPXA 4ED9A 4J2HA 1FIUA 4A6EA 2IBTA 3LRTA 4EB6B 5KHLB 2XIJA 3CLUC 1IM8A 4JYPA 2OCIA 3KWFA 5EZYF 3U4GA 1K92A 2GB4A 4DLYA 2BCEA 1NJSA 4JU8A 4WT7A 1RPJA 1TLLA 5A4MS 5CFZA 1A8SA 1JAZA 3C5VA 1BDJA 3EVNA 4PEVA 3RTGA 5ISMA 2HDHA 5BSGA 2J31A 3TYXA 1DJOA 4MYUA 3P26A 4NQRA 1DQZA 1FYXA 4UPVA 3AHHA 4P80A 5LVAA 4NBUA 1E1MA 1P0IA 4OA8A 3WLPA 1M1YE 2VF5X 1ZM2A 1SXPA 1VE6A 2XRFA 5T7BA 1SULA 1U2SA 2FFJA 3P4YA 3RBAA 2P77A 3FWHA 3QEJA 4D9GA 4BQEA 5INTA 3O8QB 4I1PA 2HR1A 2XCIA 1SBYA 2FDCA 2HV9A 3QSYA 4KU4A 3C5WP 2WHEA 2IUEA 4EYGA 5A6SA 5HK8A 3GLIB 2WTNA 1WQ1R 3CHYA 3A1UA 3BH7A 3HA2A 5AM1A 5ICCA 1R9NA 2LV8A 5ALQA 1FE8A 3USCS 5BV1A 2QJTA 5CFLA 4OI0A 1L7EA 3EXIB 4X1OA 2R8YA 4KE8A 4RU1A 4CIYA 1TA4A 3V34A 1RIIA 5DDIP 1ZZEA 3AR9A 2CVPA 3SQMA 5JS8A 2XYGA 5IVDA 4JBNA 1AKTA 2OLKA 2ZYRA 5ALKA 1O4VA 3GEEA 1Q5PA 1ZX1A 2I4LA 4RZ2A 4QELA 5ALXA 3IEVA 1V9SA 4BNWA 4KQ2A 2B6HA 5TT0A 2R47A 2RKBA 3VZDA 3G7NA 1T2CA 1NN1A 3WLRA 4QYIB 3VR3A 3IP3A 3PDWA 1A9TA 4C4SA 1ZQ9A 2FTKE 1H6CA 3FHTA 5G0WA 3HADA 3AUUA 3W8NA 3OE1A 4CT0A 3FSRA 1IIRA 1UT8A 5IWCA 1XIVA 3YASA 1QC5B 2GNOA 3T9EA 2HNBA 3LRPA 4CGZA 5IP5A 3TW8A 4D0LB 4DEXA 4X45A 3NNNA 1VRWA 2VK8A 5F51A 3NHPA 3PV0A 1RQLA 1P0PA 1V9LA 2FHSA 3H4MA 4G4SP 3I01A 1M0WA 3CLKA 1LZKA 3R8CA 3WRVA 3W78A 3NUZA 1YR1A 1ZCFA 4GRDA 1J1UA 3JR7A 1BU5A 2C03A 3C3YA 4R9RA 4QQRA 1Z34A 5ALSA 4OHXA 5TB5A 4Y1RA 4XAQA 2XQIA 2XUHA 3CF0A 3KBOA 3NV9A 5EIBC 2OFOA 5LDDC 3CR7A 4LDNA 2O7VA 3JS5A 3WS7A 1OZFA 1A7JA 2FPKA 3UM9A 4F7WA 2C8KA 2HHCA 2V45A 2WA1A 1E3IA 4UNSA 5I7VA 5SY9A 2AG1A 1LVUA 1GRCA 4IGFA 3ROMA 5CB0A 1C50A 3BAZA 5B37A 1VQ1A 1B8VA 3KLBA 3TBHA 3Q7PA 3FRJA 3SE7A 4RPKA 4KR9A 5DM4A 3PLRA 1K86A 1L5GB 4Q1CA 3ZI4A 2EJVA 3S4YA 2TYSB 4TOIA 4UVDA 1II8A 5BSRA 2HRCA 1PK8A 3GLFB 3OHSX 3U62A 2HEGA 1U5BA 4I1UA 1UBJS 4RCZA 1ZINA 1CW2B 2RDMA 3A7EA 4YHHB 5A4AA 4CF7A 2EX0A 1I3MA 2MT9A 4TN5A 4GECA 1P1KA 3KJFA 5FR2A 3T1NA 4BFCA 2YHUA 1EFPB 2BZGA 1QFZA 3OJLA 1T4BA 2JFQA 2Z1MA 4G56A 3U3OA 4ZCIA 1CQZA 3DW1X 2B4QA 3I04A 4OHOA 3TRKA 4F56A 4ZZIA 2XI4A 4G4IA 4RMNA 5LMCA 4U2EA 5HR5A 2JD2A 3M3PA 4ZQHA 2OVFA 3F6CA 2Y1XA 1IDOA 1AVTA 4QTTB 1TZJA 1LSOA 1WVMA 3WMRA 3PX7A 1HE4A 3HCOA 4AZ0A 4YV0A 1WMDA 5HFNA 1IG3A 1ODLA 3LI2A 2FPPA 5HMMA 3INTA 4KZPA 1RXWA 3JARB 1HT2E 3TIIA 3EGXB 4IG4A 4Y1EA 1OYOA 1P5FA 4E7OA 2JA1A 4HDQB 3PEEA 1K0UA 1YKGA 1QXSA 4MQ4A 1W73A 4JUIA 5M3BA 4ZP1A 4LYAA 4C3ZA 3E5NA 4XYGA 1JEQB 1PAUA 1NR1A 3P9NA 4JZYA 3KUXA 3UC9A 5JS1A 1EGAA 2VBIA 3R9XA 1XQYA 1VSTA 2H2WA 2YJ4A 1AK1A 4DPKA 3ORQA 1LC0A 2ZRNA 2GHRA 5GZ6A 1OOEA 1IATA 4B4VA 1PE0A 1DB3A 2JIPA 8ATCA 1FYWA 2O59A 4B3JA 1IL0A 4ENQA 2JK0A 2WUVA 3VSEA 2C5LA 2IS1A 3NAMA 5J2UF 4H17A 1Z0IA 3E0XA 4J6FA 2E9SA 1IG0A 1OC4A 3NFRA 4OF4A 2V6JA 5FLKA 3P52A 3HWRA 2CBZA 5B58C 2XUFA 2Y1FA 4FGJA 5HGJA 3U80A 1JG6A 5D3QA 2B37A 4HAXA 2OPHA 1BWRA 3MWEB 2ZAIA 4FJ2A 3U7JA 4BJ6A 2XEXA 3C7TA 4NU8X 4CV2A 5AW4A 1M6WA 4RIIA 2GK7A 5DLPA 2OYCA 4M49A 3SU8A 4DZZA 4MUYA 1QRSA 2PS1A 4A5SA 2O8FA 1M0SA 1XTVA 2BN4A 3E9MA 3HZHA 5FP0A 5T67A 3AHDA 3RSZA 1QE5A 3B6KA 4J0GA 1ZWKA 3GEPA 4N54A 3O75A 2JLZA 1P4JA 1KPGA 2I1QA 2WP0A 3LUFA 1SVNA 4HEJA 2JFVA 4M0CA 2QSUA 1FTYA 1H2ZA 1LDNA 2GPYA 1KFEB 4IXMA 4UXHA 1KZGB 1B8PA 1B0PA 2ATIA 1EUDA 3W05A 3Q8KA 4ZKDA 3ETCA 2LW7A 1CJVC 1SPBS 4H1UA 1WEKA 4UNQA 3V1UA 1FA9A 1Y5IA 1IZ9A 3IKLA 3FPCA 5JRZA 2GK3A 3F67A 1A96A 5IARA 3JWGA 4FHZA 1QG0A 3IEUA 4PF1A 1FBNA 2YQ5A 2CMFA 2PPLA 3R09A 3SX2A 4UNIA 3KTAB 1EP1B 1EVZA 4WZZA 4NYMR 2C94A 2WWFA 3EFOA 4OQZA 1N9ZA 1N75A 1AQ6A 2XVZA 4O59O 2VTDA 4PPQA 1QNLA 1Y98A 1ZMXA 5HUJA 2I7XA 1SHJA 2XODA 1Y3IA 1PW5A 2Z57A 4BO4A 4D8TA 2Q99A 5EJ7A 1ZICA 2HWYA 1VKHA 4JUCA 4QJ4A 3L0ZA 4M37A 4FJ1A 1ORIA 3MCZA 3GP8A 1X77A 2ZUDA 3ZYCA 1BW9A 3QOWA 3QVOA 4Y6OA 2QTVB 5TDHA 5KBYA 3HKDA 4ZQIA 2P65A 2WKRA 3M2TA 2WPDA 5FPSA 4MGIR 3WGOA 1FMFA 3E61A 3PKJA 1CULC 1T35A 2PJDA 2CBGA 4DWVA 4EY3A 4WOBA 3OZWA 1ZMOA 4HH0A 4MVJG 2PZLA 2A6PA 1TK9A 1XFAA 1XUOA 3URMA 2Z5GA 1XKTA 3C5CA 3NHFA 1VJ1A 5J5AA 5ELXA 2WU4A 2H0RA 1V96A 2VAPA 5I9MA 2NW6A 2ZBDA 4NCXA 2G4CA 4D25A 2BELA 3GELA 4LRSB 4XSHA 4J49A 5DCWA 1EA7A 1NAIA 4OYRA 3F73A 2W6QA 3M4XA 5IASA 1P2GA 4YRIA 4ND8A 1CD5A 3QPWA 3GLRA 3P97A 3DE6X 3ZVRA 2NYUA 3BUSA 3OT4A 1PVDA 4JUBA 3C39A 2PZ8A 2D74A 1OX4A 4RY9A 1IZ0A 3IQEA 3B85A 3KBBA 2JFGA 3H75A 2FWRA 3MMZA 3ZTTA 9LDBA 2IYEA 4N5DA 2JDID 5K0CA 1Y4SA 5K0TA 3KQLA 4BNVA 4EB0A 3DMTA 3P9IA 3I9OA 4F6CA 4IXNA 1X19A 2IXAA 3CISA 1Y6GA 1QQAA 3QPAA 3TJRA 2QPLA 1YRWA 3VU1A 3LVBA 1Q0RA 1Z0AA 3K72B 3QVLA 1HV8A 3U7QA 4BNMA 4OBEA 5A6SB 4R9SA 4RPJA 4B46A 2HXGA 3G02A 2IYTA 3HP7A 3NONA 3QTLA 3IEKA 2I7CA 1JDTA 3DE1X 3LUCA 3OF2A 4GBED 3ASUA 3E15A 7ADHA 4R9NA 3ROEA 3VVMA 5M34A 1W2GA 4BJ1A 3PU6A 4JL6A 4V24A 3U4MA 2YXDA 3HTXA 1C9KA 1XZJA 2L69A 3CTPA 3LUJA 4LK2A 4LSMA 1QRAA 1G38A 4OGFA 1OXKB 4ZHQB 1MV8A 4AU1A 1NA5A 4J0QA 4W1RA 5EQJB 1JDVA 1SURA 4QQ8A 2WQZA 4YQYA 3ZW8A 3K1AB 1A9QA 3IYLW 4QUHA 2XHZA 1BCSA 2Q5QA 3MT9A 4HF7A 2FNAA 4HXYA 4M8NE 5DWQA 3A4TA 5SY4A 3T5CA 1BGVA 2WKPA 4NPAA 4X60A 1JFVA 1DGQA 1WUTA 3WISA 3EZXA 1MZPA 5LZ2A 3VKVA 2F7SA 4BO2A 4KE9A 5MFPA 4LJ6A 3I8SA 4OL9A 4JWTA 4ALNA 4KBGA 3HXTA 3F8SA 4NYIR 2ON6A 1E1QD 4K05A 1EK2A 1X7ZA 5BSTA 1ZCBA 3KU1A 4IIVA 1JSCA 1BHQ1 2UZ4A 4WKOA 1RYEA 5I8ZA 4W9NC 5BORA 5IVPA 2QTZA 5KOJB 3WG9A 5LP6F 5CJ2A 4M2LA 1P4HA 1CR1A 1MORA 3IL2A 3ZWBA 3LKZA 3SGLA 3AFHA 5DYGA 4R6XA 1WW8A 3RYFA 3QMPA 3ZWXA 1LSJA 3DTNA 1JDBB 1T4CA 3BXFA 4PHGA 4NCHA 4DZTA 3J80A 2YCLA 3QOYA 4IIHA 5T4EA 4B82A 5KVCA 2YFKA 1M9NA 2WFZA 4G1UC 4WGGA 5ER6A 3A3PA 3ZKWA 2C9DA 3HRHA 3IVRA 3V2IA 1WULS 1VKRA 2ZAOA 2OZPA 3DLTA 4GQIA 1DC3A 2PRIA 4QXOA 3HFJA 4EGSA 4S1TA 4EBFA 1GITA 3C6ZA 4KVZA 1JBQA 4OL0A 1ARZA 4MJ7A 3I9LA 4KWCA 1AZWA 5DGIA 3IB6A 1U5BB 3VTZA 4HNRA 3NNDA 1G60A 2C92A 1JYFA 4FYYA 2YIJA 3WA6A 5MGNA 2WD8A 4EW3A 1XCMA 2CJWA 3N1UA 3ZHXA 2GAFA 1TJ3A 4M9ZA 1MBZA 2DUWA 4FHFA 4WCFA 4YLYA 3FOCA 3HDHA 1G8PA 5LDHA 4D3XA 2QMYA 3OCYA 3UK6A 4BRSA 5B7PA 1IM5A 3UW3A 4G5GA 5I8WA 4I2NA 4TQ9A 4IBOA 1W35A 3KAQA 4OREX 1MVNA 4IL5A 2ZRGA 4NATA 2O1SA 2GXUA 1CUXA 4WAUA 4J7AA 1Z7GA 1ZUNB 2WIGA 4H9GA 2X7XA 3WBBA 4ZO8A 2RHBA 3OZIA 1DMRA 1N4DA 2X5OA 4TMFA 2I8CA 3SOPA 1GNQA 1TO1E 3HJAA 1NW7A 2GI4A 1V3VA 3HB9A 1Q91A 2FPPB 3GJ7A 2GLTA 3GRAA 5ADUS 4JELA 4HNQA 5KQLA 3KKEA 3BD6A 4PVCA 2BGUA 3IEXA 4HGOA 4NLLA 3V97A 1GUAA 4TTTS 4D4LA 3B5IA 4J75A 4IIUA 2PFGA 3QVMA 2D0DA 3NRJA 4OQ4A 4LGMA 3BIJA 3C3WA 1W4CA 1I8TA 1Y6QA 2KM1A 3DHVA 4GLFA 5AJWA 5BWMA 3EPJA 4DB2A 1RLJA 3TH5A 4H0FA 3K9HA 1N1EA 4MUHA 2WUWE 4KHPB 5GMOA 2YRXA 3PJFA 2NUTA 3E9CA 4O2AA 5AM2A 5DM70 1HEYA 4ZAYA 3O03A 1S2LA 3CXUA 1XTRA 3QUTA 4YAOA 5AP9A 3KOWA 4LUCA 3NUGA 1XMQB 2PT6A 2JGIA 5AMXA 2UUOA 1FVFA 2OG2A 3BMQB 4M8IA 4MVJF 1ZH2A 3A25A 1F0PA 4HI0E 2FZCA 3DTTA 4G81A 5DE3A 1JQBA 1RFLA 1RYHA 2F9FA 2XMQA 4HN4B 4LXXA 3TBKA 4Q3BA 5HSGA 1JG1A 2PXXA 1J2RA 1I7LA 4K3VA 1YQ9A 3NM4A 5CTAA 1DARA 1RS0A 2FUKA 5IPFA 4MDEA 3PR1A 2D4HA 3CC8A 3LPLA 1R6UA 1XF9A 1SM4A 3A6GA 3CNQS 3G88A 3GFSA 4KUGA 3ESBA 1U7OA 4AG5A 1P80A 4F04A 3JQCA 2PWAA 2NVWA 3FCOA 4PFKA 4BKPA 3K5HA 4FZJA 3IAUA 1FDRA 3JQ7A 4XDYA 5DHQA 5B4TA 4IQGA 2JW5A 1HEIA 1XGKA 2EWMA 3NHZA 2CT8A 3P0HA 2FGJA 4NJMA 3DVAA 3JRWA 3TUZC 1PWYE 1UDXA 5C81A 3ZLVA 3H05A 2VHQA 1FF9A 1EFLA 4JT2A 4MQEA 4X20A 3R8FA 1F2VA 2DRIA 2FU5C 3ISVA 3PXUA 1DO0A 3MJDA 4ER0A 1Q95A 4AICA 3U1TA 1PJZA 3I53A 4PZDA 2I3AA 1KR5A 3I8OA 4MCJA 5EE9A 4QGSA 5E1BA 2WF9A 3KLPX 5IZ4A 2ZRPA 4NOJA 5IKEA 2SCUB 1E7MA 5CVTA 4P92A 4MQUA 1IM2A 1W87A 1XVVA 3AKDA 4I1YA 1KFCB 2PH3A 5EP4A 1FFDA 2OAQ1 1L5WA 2CB0A 2WNSA 3DMHA 3EMVA 3QVVA 4MVCA 4ZEXA 3RF7A 2PXCA 1Z15A 3AVQA 4JT9A 1SY7A 1TQ6A 2ZWPA 1XDZA 3CFYA 4EUHA 3EFOB 3O4HA 2WWYA 4TLDA 3AFOA 3PIIA 3OLYA 3U7IA 3BE8A 4AJIA 5I9LA 1KP3A 4DC9A 3C4JA 1U3FA 3D64A 4Q4AA 1P7ZA 2EP5A 5ECDA 4G41A 2ERYA 1VE9A 4UARA 3RVOA 1UOEA 2FZKA 5DBEX 5JROA 2H51A 4BKRA 2PUBA 4ZODA 2V0GA 2PWBA 5KVAA 2HADA 4M9UA 1E9FA 2BRUC 1QNFA 3UHOA 4RVOA 1LLCA 5CDGA 1V8ZA 5CU7A 3KWLA 4CG1A 1X1DA 3B1YA 1XRPA 2QUJA 1HORA 3HJTA 2M9MA 2V5AA 3H1BA 4MYDA 2XKBA 5BT9A 1GTMA 3AXTA 2LPMA 5HUQA 3V4VB 1GFSA 1WPXA 3VNQA 5KNDH 1YZGA 2OFPA 3A3KA 1FQOA 1CTQA 1KO7A 1QHHB 3U6KA 1Y9JA 4MNTA 4DLSA 4URUR 1RM4A 2JHFA 4ND8B 3L7KA 1OIVA 5DK4A 5DKFA 5KO2A 1OX4B 3WMGA 2KBFA 2ZJAA 3BBLA 4Y8VA 3P27A 5EQDA 5TPZD 1G5FA 4CQMA 1EWQA 3NJ4A 5CCDA 2OLJA 2C9BA 3KSAC 1H85A 4HVTA 1PT6A 2OUIA 5CVCA 5F2OA 5FLXA 3IQHX 2N0SA 4IH1A 5AKXA 4L4XA 2P41A 5J5VA 4HGYA 3AUAA 4PZ9A 3IHTA 3U7QB 4KPYA 4KIWA 4KE6A 1ES9A 1X7YB 1JSLA 3JW8A 3P9RA 4B1FA 4ENPA 1VC2A 2R48A 1J8VA 3LX4A 3GR6A 1GPDG 1IAQA 2YXEA 4KGZA 4JSYA 4C88A 2ZCJA 1A4UA 1PGPA 3ACCA 3R0JA 3PXGA 1VLJA 3IXMA 2EEPA 2ZBEA 1E6WA 1H69A 1TD1A 3HNOA 4YMLA 1ZGAA 4HGPA 4YUWA 3GZNB 2REQB 4Q1BA 4MV6A 5KNBD 5JU6A 3EODA 1T13A 3SXJA 1CRLA 2M6RA 3NPMA 2BH9A 1W1IA 3BYZA 4XDGA 3HUFA 4LTNA 3WJAA 3MTJA 4MKXA 4ZT6A 3TQFA 3U7HB 1OXTA 3H9EO 3JTEA 3KVRA 3VMMA 1BCSB 4M0UA 2PMBA 3B70A 3NT4A 1NVFA 4KO4S 3SJUA 4A8JA 3ZHTA 3O47A 3F6PA 3GW8A 4RD6A 1VI6A 4P81A 1JT2A 1P6UA 2WB2A 2TMGA 5AVOA 4DT1B 4WKPA 3FD8A 3L0BA 4FMCB 3UYKA 4V1CA 1KI6A 3DC2A 1XVTA 3HA3A 3BN3A 2XZPA 3F90A 4NNJA 2XB4A 3E84A 3LUPA 1PJTA 1L4HA 5JASA 5G1PA 2FEPA 4N5HX 4BIMA 2VTEA 1JL3A 4L74A 3PENA 1AQYA 1PW7A 1I7NA 1KVQA 3G8YA 4K1XA 3WE7A 4W5QA 5K4HA 3FI9A 3JYLA 1JVNA 1UXOA 3T0FA 3RYFB 1O0CA 2FVXA 5IAEA 1JHRA 1JLKA 1T4CB 3B3JA 4MDFA 3I9V6 1T1RA 3I2HA 1CY4A 1E9DA 1LC3A 2GBPA 3FYTA 3EG5A 3OH8A 3QQPA 2P5YA 1IHXA 1QVVA 2OORA 4P3NA 4ZCLA 5BR4A 1G20A 2J6CA 3ZKWB 2CHEA 2ZB2A 2JEYA 3GJSA 4P3XA 1WW3A 4IEFB 1X0VA 3LYLA 1U94A 3L46A 2AD1A 2EF1A 3D2BA 1XKQA 4HDNA 2Z30A 3F74A 5LN1A 1VJ5A 1J0DA 2I76A 4BYGA 3I5YA 3LM8A 4AI6A 2D0PB 3RU7A 1M34B 2F3TA 3LQRA 5K3FB 3UHFA 3PSAA 4S0XA 3DBLB 1GA1A 1CE8A 4JB3A 3W1WA 1XQWA 1TCAA 5D86A 2J32A 1H3FA 5ARBA 5KOIA 2I4NA 5DXJA 3KB2A 3NT2A 4RLSA 2FEXA 4Y1FA 3WAKA 1M8JA 2AVDA 2B8WA 1E18A 2NO4A 4D0SA 5JS6A 3VJMA 4KPGA 4FP9A 1BH2A 3KQHA 4ON9A 1ZH0A 2DWOA 1HT1E 4B34A 4BFVA 3Q7IA 2IRWA 3S2IA 5AW3A 4LJ8A 2BL4A 1RAIA 2RGNC 4LCBA 2ASVA 5CHEA 4NCBA 1V8BA 1UZUA 3M6MD 3H7AA 3MYRA 3VC7A 4AXBA 1CEEA 3PDUA 3OZFA 2R5FA 4TL6A 2JAXA 2OECA 3ZE2B 1LTQA 4MUAA 4NZNA 4YRBA 1M7GA 1A1SA 3H4IA 3I61A 1EFTA 1YMVA 4RA6A 2B4RO 4UUBA 1V1JA 3HXLA 5B12A 2QX6A 1YD7A 1KKMA 2HPVA 3TD2A 5KC8A 4L15A 3T35A 4ZAGA 4LV6A 2JJ8A 4ZAWA 1HDXA 1HTBA 2F6RA 4BTLA 3EQ2A 4I1IA 2BR3A 1EAMA 1RWVA 4ENSA 2GAIA 2E4AA 1AKWA 1XN1A 2HCFA 1JILA 2WVJA 3GFFA 1NNSA 3ORFA 2V7QD 3ZD9A 4MRVA 3U3DA 1AT1A 2XQVA 4IINA 4C4RA 2OGSA 5CG1A 2OBXA 1XMVA 2XA1A 2NUTB 2XAAA 3BXPA 4O2AB 1E5LA 5A2GA 5B3LA 2CKMA 3IUSA 2CUKA 2OVBA 3EDQA 4XWYA 3ETDA 2BV3A 4MUFA 3GV0A 2UKDA 5HUHA 2ZXEA 3QHAA 3BWYA 3PIRA 4LGCA 4IJ6A 4TV8B 5AOBA 4CNQA 1XNQB 3D5TA 4PU0A 2PV0A 3T3IA 3C3CA 2QPAA 4ZC8A 3VNBA 4D3DA 3OFSA 1Y82A 3DT6A 4RLHA 3LWDA 5JADA 4KVAA 5ALVA 2O0KA 1GDHA 4LYGA 4I1RA 2YWDA 1XMOB 4QXAA 5EP1A 5DM0A 2VSQA 4QPJC 5IDYA 4B3XA 5DWDA 4C2AA 3DTVD 3OEHA 4XARA 4EKIA 2WKSA 4A0QA 3UGJA 4RVGA 1JHOA 3UJ8A 1R88A 5HOEA 4RTRA 2WM3A 2EBFX 4D6XA 5CB4B 3MMPA 4R2HA 1PL7A 5I7OA 5H83A 1O5OA 1ODSA 3O4IA 3RE1A 1K5HA 4C5AA 1EDDA 3CLVA 2WJVA 3L8GA 4Y7DA 4MW9A 3GYGA 4FX2A 2P9FA 4JV5B 4E2XA 4NNOA 5IM5A 4UBJA 4PANA 3EVTA 3PIDA 4IDEA 4IRUB 1CYDA 2ZROA 2XWSA 4KXWA 4P5DA 4MQEB 3UWDA 2E1PA 2CF5A 2HAEA 3WLOA 1IQ0A 1D2NA 4ZVLA 3KETA 1PVOA 2LBPA 1FFXB 3VR5D 2JRLA 1SA0B 1SD2A 3UAYA 2SKEA 4XLTA 1JHMA 3TBFA 4J2OA 3THXA 1PUIA 1X1CA 3MQ2A 4RH1A 3I0NA 5C5IA 5L9AA 3COZA 1J00A 3GOQA 3T9DA 5SZKB 2WTMA 3KZ1E 3MSCA 1NF9A 4B6RA 5KOHA 1JEAA 4BMOB 1CQXA 1QFMA 4IMIB 4E22A 3BPSA 1NVWQ 2BP7B 4MZXA 4Y98A 4TYWA 3AZPA 3L1HA 3K6RA 4FEAA 4KEAA 5G4KA 2AJCA 3R4VA 4K2HA 4BATA 4ES6A 5EZQA 4JL5A 4Q9LA 4G09A 1VL1A 1MA0A 1VE7A 1L5OA 1ZK2A 1RP1A 2O4UX 5EAIA 1NURA 5EUBA 1QZTA 1V1RB 5ALUA 1NXSA 5KYVA 1HRDA 1SIUA 2ZJ4A 3L41A 3S3TA 2X1MA 3HKEA 1I2ZA 1TM3E 2OYSA 3PQ8A 3HP1A 4QVGA 3OFNA 2PVPA 2AG8A 3X43A 1U65A 2OZVA 1M10A 1UMBB 2V7PA 2WTAA 4TUYB 2GJKA 1ISMA 1NMXA 3ESXA 3F4BA 1NRJB 3G5UA 2PMEA 2VSOA 3DOFA 3S81A 1T9GS 2CDRA 3K8QA 4MR9A 2BUCA 2W0MA 3N6VA 2RB5A 3BK1A 4NPCA 1U2GC 1TGYA 1XHEA 2GETA 3NKVA 3V4FA 1H5UA 3IHLA 5K0NA 4EG4A 1D2RA 2AJLI 4PNZA 1N2CE 4AZ3A 4FYKA 2J6BA 3N8HA 4X7PA 3U3ZA 2GLUA 1CZHA 1XZAA 2PX4A 1E5VA 4ZDKA 4ND4A 3GJYA 5HPYB 3BD7A 2Z1DA 1E2EA 2XCRB 4EFLA 1OBFO 2ODQA 2VJKA 3CUSA 2XWQA 4UREA 3C6MA 1OYYA 3AFGA 4BZZA 3GPIA 2IODA 5F3RA 3SWWA 3CZQA 5K1ZA 3ELYA 1CY1A 3EIHA 3ZCRA 2VEOA 1QH9A 2IU4A 1KXJA 1R4MA 1XWIA 2M6SA 2Y93A 4A91A 3FBGA 1OU4A 1QMGA 1DT3A 4PZUA 5BRJA 4B3SB 2X5NA 2FY8A 3KXIA 2FN9A 2X6RA 1GPUA 1V48A 2FR8A 3BDAA 3RSCA 3G8DA 2Q4EA 4BNLA 5AKHA 1QG6A 1R3UA 2CXHA 4ID9A 4IHJA 5JARA 4XLLA 4TZ0A 3F6YA 3ZOKA 4CVNA 2G9VA 3L4EA 3IV9A 4RJKA 4E31A 3AP3A 1JKIA 3KDSE 5DSXA 4GKBA 6ABPA 1HXHA 4ME6A 3G17A 2L2QA 1IEVA 4C2TA 3WIDA 2CV2A 2Q46A 5BSMA 4GEGA 4A8JB 3ASZA 4PG4A 4C2BA 1C30A 4B85A 3HVUA 1TQ4A 4D3FA 3MILA 3ZHVA 4HJXA 2ZZNA 3I5UA 4V0QA 2PM8A 3ESDA 2NYVA 3II6X 3MMSA 3JQ9A 5B3JA 3WL5A 4TM8A 1EZ4A 3ANXA 2OCBA 3OJXA 1ECJA 4IV0A 4OAPA 4LWOA 2FZVA 5F77A 4EY4A 5J1SB 1YCDA 3B1JA 3FRIA 3TB4A 3GO4A 3O1HB 4GPAA 1QIIA 1QYDA 3I72A 2FN4A 3I2YX 1DDOA 3R20A 3MA0A 4F5ZA 3PWZA 4IHJF 4JYBA 1U6IA 1DWOA 3LHKA 4BHTA 3V1YA 2Q1SA 1Y80A 4ZOQI 4KLRA 3SSAA 5FWYA 2EKZA 1D9ZA 1FRNA 4HYEA 4MIYA 1E3LA 4Q7JB 3SJCA 3TIGA 3NUQA 1XNJA 4ZXPA 1X1RA 5KAPA 3SZ3A 3FZGA 3NU1A 5FOXA 4A3SA 3TEJA 4ZU6X 3A58B 5KPDA 4RKYA 1FXWA 1AGNA 1WB9A 1BFKA 4XLZA 2ENUA 1U2ZA 3S2GA 1CUWA 3HDGA 3A6LA 3T9AA 2NO9A 4UCWA 1EWVA 5KMGB 1FVXA 1OXBB 3UCFA 5TQJA 1R10A 5BWLA 1JFFA 2E4VA 4ZALA 4QYWA 5FD8A 5LNK1 1NXVA 2KLBA 5G1OA 3QBEA 2HIHA 5AI8A 3G0DA 3JZFA 4YJ3A 4A8HA 2XCUA 4PSCA 3WHLA 4ZQGA 1CE8B 3WK8A 4EL5A 4MPTA 4YUAA 3QWBA 1Z22A 4PLZA 4MB2A 1IXRC 4B6SA 4FILA 3DMFA 5CK4A 1J39A 4OSOA 3RHTA 1Z3IX 2CNOA 3BHJA 1TEVA 2O8NA 4QEDA 2V8OA 1QQ5A 2QVYX 3G2IA 1VL8A 3EY9A 3LH5A 4JT4A 2YFYA 3BXOA 4BAGA 2R1UA 3H4TA 1MABB 3IEPA 2AZDA 3K5PA 2JAQA 5HYVA 3K9FC 3I64A 4OM8A 4RV4A 2BD0A 2FUCA 2MSKA 4E33A 1Q19A 1H8ED 2C4TA 3QFHA 5LBUA 1WMEA 3DO6A 4E11A 4EYEA 2C58A 3N2IA 4YT5A 3IIEA 4YJ3F 5CM2Z 5ILOA 1I36A 4WESA 4RD2A 2EP7A 4JJIA 3S8YA 1ID1A 5FAKA 1ZSNA 1OI2A 1QX3A 5A3RA 4B3TB 2W2XA 3P4UA 1Z4IA 4GOMD 2BFEB 5CEJA 3SSOA 4OIMA 4EUSA 1NUQA 4PFSA 2FG5A 2TSYB 4LBYA 3AO0B 2Z5LA 3CX4A 3NXKA 3RC1A 4D9JA 1EZZA 2NM0A 1BN6A 4Z0PA 4DCTA 2C3OA 4MGKR 5CT8A 1Y7PA 1QK3A 3SY8A 5BR1A 1MB2A 2IE8A 1L5SA 4PAQA 1RZ3A 1YONA 3HB5X 2VNKA 4AYWA 4PS0A 1B0ZA 3N8KA 4BVAA 4DCJA 3C6YA 1QWSA 1SUCA 1QRUA 4NCAA 1I7PA 2YUIA 3N3BC 3LTNC 1W93A 1J6UA 3EFBA 3WMWA 3RG2A 4F9EA 1NP3A 1V39A 1EDOA 4QJ3A 1UZLA 5BQ3A 4LBZA 1WCIB 3IX7A 3NHKA 4S0ZA 5ALZA 3UAOA 5JNWA 1M1YB 4ER7A 1IN6A 2UYYA 3SNHA 2VYQA 1AXRA 1LBHA 3FUVA 4D4IA 2DTDA 4N48A 4AKSA 5HM8A 1ECLA 1R0XA 2RHCA 3CH7A 1VHTA 3EXFB 3HDQA 3QYPA 4Q03A 4D3ZA 2W6ZA 5JNVA 3F6BX 4BQNA 2DFLA 3ADCA 3FVWA 2C5HA 1OFHA 1AF4A 4RY8A 1AKRA 3JQ8A 3OLCX 1CFZA 4HZUB 1WZCA 4Q9KA 2V4ZA 3TVDA 4L8FA 3BERA 4EHAA