3REFA

Crystal structure of ehrho1 bound to gdp and magnesium
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
173
structure length
173
Chain Sequence
GKIENGKKALKIVVVGDGAVGKTCLLLAFSKGEIPTAYVPTVFENFSHVMKYKNEEFILHLWDTAGQEEYDRLRPLSYADSDVVLLCFAVNNRTSFDNISTKWEPEIKHYIDTAKTVLVGLKVDLRKDGSDDVTKQEGDDLCQKLGCVAYIEASSVAKIGLNEVFEKSVDCIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho-like small GTPase
publication title Unique structural and nucleotide exchange features of the Rho1 GTPase of Entamoeba histolytica.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Signaling protein
total genus 55
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3refA00
4ARZA 1G7CA 2BV3A 3FPAA 1VG0B 3EZ9A 5AR1A 3RAPR 5KNBA 4RZXA 5J4HA 4HAUA 5JHHB 1O87A 1SVMA 1IXRC 5TXGA 2JJ8A 3U4QB 2A5DA 2O0HA 3IEUA 1YR9A 2WVJA 1U90A 3LBNA 4B47A 2XB2A 2GESA 1HT2E 3IQWA 1IN7A 5BXQC 2ZETA 4URXR 4U5XA 2AFIE 2ZYVX 3IHLA 4Q4JA 1L8QA 1UBFA 3ECCA 4EPYA 2IYVA 1SVKA 1BMFD 1M6NA 5EE1A 3ZS9A 3U3KA 1FP6A 1SXJB 4Q00A 1OYWA 2WSSA 2G1KA 1W44A 4Q9JA 4IVQA 1NF3A 1WBBA 2R6FA 1G3IA 3BH6A 4AYXA 4D81A 4LJAA 1T5IA 3GJ3A 4JZKA 1XTJA 1YU9A 1W5SA 2D2FA 1KO8A 2HF8A 4XVQA 5EP4A 3V9PA 1UFQA 2FG5A 3LVRE 4JL5A 3CF6R 3SYLA 4G5OA 1N2CE 2IWHA 1BO6A 2GF9A 3GJ8A 1U8AA 1F6BA 4DVGA 3QXJA 2YC2C 4LPKA 2MMGA 1E2JA 2OCYC 2QAGC 5UKDA 4IVRA 1Z0FA 4QRHA 4B3DA 5TY0A 3QENA 4TYQA 3ZS8A 5JEDA 3GEIA 3WBJA 3T06B 1S1CA 4V02A 1W36B 1YHNA 1R5BA 1W4BA 3GD7A 1EX6A 2IA5A 2JGNA 3EXAA 1CR2A 1QHHA 1ZIOA 4PAMA 4ZDKA 3NC1C 2QMUA 3MMPA 3PUWA 2FV8A 4NPHA 4LSGA 5AJVB 5AJXA 3TVTA 3X1YA 3IHWA 3QG5A 4DCSA 2FGKA 1MO6A 3EARA 2ZE6A 2OE2A 3VFDA 1G1MA 4F93B 5L3SB 2PCJA 3AEZA 3OFNA 4MUAA 3VHXA 5JECA 2JLRA 2VP0A 2Z4RA 3CRQA 3GLIA 3TUZC 3TGPA 3H84A 1P7CA 2H17A 4LYAA 4PFSA 4AD8A 1OB2A 3KQKA 1S96A 3F5FA 1J99A 5KDLA 3WMGA 3AH8A 1QDEA 1GNPA 5B2ZA 5FFMA 5FH9A 2XJ4A 1C1YA 4E03A 3O8CA 1U8ZA 1XCPA 2BCJQ 4RD0A 5KOYA 2YOHA 4WBSA 2F43A 1E79A 3MG9A 4PAQA 5BQ5A 1DAHA 2ZSDA 2HF9A 2YYZA 3QF4A 4Q02A 5KNDA 5CB8A 3AVVA 3I4LA 1AJEA 2BBOA 4PHFA 4O25A 1NP6A 2OUKA 2V8OA 3ZIAA 5DYIA 2H57A 2RB4A 5L3VA 1F2TA 2GKSA 3NBYC 4TTQA 1ZM3A 2CNWA 1G5PA 4G5RA 3RS7A 3TSZA 1UAAA 2GXSA 3VR3A 3NIBA 3X1DA 4QM6A 5L3RA 1TPZA 2D7CA 2PZFA 1OSNA 3SJAA 4R71A 5CLLA 1HURA 3KXKA 1GTVA 1E2PA 1VDZA 1L4UA 4KXFB 4ZDWA 4B3GA 2H92A 3NC0C 1SVWA 4A0HA 1M8PA 4CEJB 5IRCD 3IO5A 2O8FB 4LI0A 4YMTA 1FP7A 1N5KA 1Z06A 3C4JA 4JBYA 2Z43A 2P6NA 2MSCB 4MRPA 4AURA 1TAGA 1XRJA 4NONA 1YE8A 1AS3A 2KBEA 5CYOA 2B21A 1T8TA 1UDXA 2VF8A 4GOJA 2QUZA 1OKKA 1TQ4A 3KJIA 3BFVA 2PEYA 3AGQA 5CK5A 3AVOA 1GM5A 8OHMA 1VG1A 1XTSA 2CNWD 2FEOA 2ZROA 1NLYA 3BIFA 3ZQ6A 2GEUA 4MQBA 2IUSA 2P0EA 4IOLA 1EFUA 5AUNB 4Z1MD 1XPRA 3EX7C 2RMKA 1DPFA 4V0MA 2F1HA 2VP5A 1XMJA 3SE0A 5EXPA 3T61A 4DXAA 1TEVA 3CW2A 1RIFA 3RSLA 3SYKA 1MRSA 1YR7A 4EJSB 2NIPA 4AK9A 5HKKA 1JQJC 1ZUNB 2R44A 4TN1A 1UBCA 4JL8A 4OI4A 1LTQA 2E1RA 3CNOA 1VECA 5H68A 2J1LA 1R0YA 2NO7A 1JB1A 1KI8A 2FZLA 2PZGA 4OHVA 4Q1CA 4X8HA 2CL6X 4KCGA 4NMMA 4Q4HA 3EPHA 2JLXA 2PLRA 4PQYA 1P72A 4DEXA 2RGCA 1YR8A 4PO8A 1RW4A 5EE0A 4LZZA 2VHCA 2ZRNA 5FTLA 3R9XA 3OESA 2XXAA 1XF9A 4ZCLA 3S1AA 3P32A 3ADCA 1Z47A 4LC0A 1OFTA 3B1XA 1J8YF 2WV9A 4IVPA 1D2NA 1YZGA 4JS0A 3TSWA 3L8YA 3IO3A 3TJZA 2GDJA 1J70A 4R9UC 1SULA 1NY6A 4A1FA 4HAVA 3DKVA 5K8LA 4HUTA 4Q01A 1A82A 1OXUA 1JXOA 2C5LA 2HLDD 2VQSA 4HB3A 1GAJA 2ZUCA 3V4FA 3W34A 2V54A 3RC8A 4RCZA 1TUIA 1BYUA 1XZQA 2BKUA 2OFWA 3CF2A 1W1WA 4CZ2A 1G7SA 1WDTA 2REOA 2H16A 1XEWY 3IPYA 2XXAB 1B0UA 3F8TA 4QOSA 1SHKA 3HR8A 4QC2A 3BWDD 2OILA 4BPBA 4B44A 1P73A 1VIAA 1QBKC 2YOFA 3NHBA 1X8JA 2IT1A 2V55B 4TQUS 1GNRA 1ZINA 2TMKA 4DLVA 4CEHA 3TQFA 2GTPA 4Q1FA 5TDHA 1XEXA 1H65A 5GJWC 1N6OA 1AK2A 2BJWA 2XSZA 4B2PA 4KI0A 1KI7A 5A4JA 4OK6A 4M9XA 1BS1A 3QVUA 3KUDA 4A8JB 3P20A 4AYWA 4C0SA 1XPOA 1WRBA 2D06A 5AJZA 1T91A 5FUXA 2QAJA 2ZSFA 4YXWD 4LJ5A 4LYJA 2Q9CA 4ZDIA 4PTLA 2G9NA 2QPTA 4RZ2A 1E0JA 1K5DA 3GLHE 1TNDA 3C16C 1D6JA 2FFBA 2X2FA 5CJPA 3SEAA 1M34E 1RJ9B 2VPPA 2YJTD 4R98A 5JJIA 3LLMA 2FDCA 4NU0A 1G8HA 2XX3A 4JLPA 4EFLA 4H9GA 1R2QA 1NN5A 2DWQA 4RD3A 2ATVA 2FSHA 4GP7A 4P4SB 2X19A 2NGRA 2G77B 5JI2E 2ZI3A 1PLJA 5H1YA 3GEEA 2ODNA 2YKGA 4MKGA 1II8B 2J59A 5EUMA 4CF7A 4AI6A 1JR3D 1MT0A 2V1UA 4CW7A 2EVWX 2F7SA 1FZQA 4A6XA 2O8EB 4KSBA 4RZ3A 3AVWA 4JVMA 2GBLC 5DO9A 5G41A 4DJTA 2RGNC 3LO5A 3NEJA 3U44B 3JVVA 2V7QA 4NCHA 5CIQA 3QKTA 4PC2A 1Z07A 2C96A 2CL0X 4FIDA 3IPXA 1KDRA 4G01B 5FBWB 2GA8A 4A0RA 4MYHA 3VNUA 2NTYC 1A4RA 1TU4A 2IEZA 4URZR 5KSZA 3CX6A 521PA 2J7PD 3EW9A 4TLDA 3HWSA 4UKDA 1D2MA 3O8DA 1I2MA 4W9MC 2ZAMA 5D3MA 3K0CA 4ZCIA 5AJYA 3FKQA 2AWOA 4M8NE 5C4MA 3H1TA 5FOTA 1WB9A 1YVDA 2ZJ2A 1XEFA 3BH0A 2OESA 4PR0A 3LX8A 2ZR0A 1VPLA 1U9IA 1T0HB 1E4YA 3LWNA 4HLQB 4AG6A 1GL7A 1P6XA 2QSZA 2LWIA 3DM9B 3KJEA 1M7BA 1A2BA 2VBCA 2HT6A 1L2TA 1ESMA 4LPSA 5JLJA 2J0UA 3TK1A 1N25A 1OW3B 1CULC 4GRAA 2V7QD 2JIZA 1S2MA 1OFUX 3MWKA 4BFVA 1EFRD 3QPWA 1DO2A 2GWHA 1G3QA 5FL7A 3AVQA 2XNDD 3DPUA 4Z8XA 2IX3A 1QHSA 1BOFA 1XJQA 4CIDA 2CLSA 2QE7D 5C4GB 1NN1A 2F3TA 2UZ3A 2QEQA 3MGCA 2QTHA 4US2R 4MGZR 4PC3A 2ZE7A 1KI6A 1Q3TA 3VAAA 2ZS7A 3NEYA 4QBIA 4QL3A 2WJVA 3PUYA 4URWR 4ZI3A 4A2QA 2D4HA 1Q21A 2HT1A 2IF0A 4R2HA 4B43A 3NBFA 2FF7A 2ZS8A 4M21A 4KJZA 4GL2A 3OIVA 3GJ7A 2BBWA 4TLCA 3T5DA 3W6NA 3NG1A 1KGDA 4PPFA 1KHTA 4D4LA 4ITRC 2NO6A 2BIFA 2IXFA 4L4UA 3MRSA 3MCAA 1NSFA 3V4RA 2QQ0A 4MGIR 3DO6A 2JIZD 2YC4C 2J0VA 2BMDA 3W5IA 2ORIA 2E87A 2QL6A 3D8BA 1VCNA 1IQPA 2ZI4A 4GBMA 4F7WA 5J4YA 4AC9A 1DAMA 3BB1A 2AR7A 1KK1A 1AS0A 4D25A 3PEUA 3VR5A 1TTTA 4Q7KA 4J0QA 2EFEB 4BQSA 2BWJA 5AJWA 4H1VA 4FINA 1UADA 3Q7PA 1NMYA 4NCNA 3QNUA 3FMFA 4KLZA 1JAIA 3C5HA 1D8TA 2QAGA 3NWJA 4RKFA 4BEBA 2OBLA 3A1VA 3C7KA 3SFVA 1ZMXA 2F6RA 2XZLA 4HZUB 2RGXA 3FKSD 5DISB 1JEDA 2R6CA 2PBRA 4OQMA 4PQFA 1E9FA 2B92A 4M4SA 1I4TD 3B1ZA 4EPRA 4EPTA 3FB4A 2FMXA 1NKSA 1FQKA 1KO7A 3P27A 1XMVA 4Q47A 1XWIA 1Z2CA 2PMKA 4KFTA 1JNYA 1LV7A 2C95A 4X8OA 4JJKA 4UXHA 2ZSEA 2JLUA 3NTUA 2EQBA 2OT3B 3RABA 1OH6A 4DLXA 1AZSC 1PLKA 1E0SA 5C18A 1NKTA 1QG2A 3K1JA 5FOUA 4ARZB 1OV4A 4CVNA 1G18A 1DBSA 3NDPA 1NSTA 1KSFX 1U99A 3GJXC 4JVLA 2XJ9A 3RC3A 1T8UA 4PPNA 3PEWA 1KNXA 5D3QA 1NBME 2AXPA 1OYYA 2QM8A 4MRVA 2WKPA 3PQCA 1PUJA 4LCBA 5EJEA 2QN6A 1TU3A 1EX7A 3SBEA 4C7OB 1II8A 1MO5A 1QF9A 3CRRA 3AVYA 1KMQA 3WY9A 3SS8A 1KSHA 3M6AA 2B7CA 1CJKC 2ZE8A 4K8OA 1Q1EA 5M04A 3BS4A 3T12A 5G53C 2OFXA 2WOOA 3VHLB 3KTAA 1W5TA 5C46F 4UNRA 1SKYE 4DKXA 1GRQA 3DMDA 3ND9A 2ZI6A 3SQWA 2KJQA 4MH0R 4Q4AA 2ZRBA 2WIAA 1NMZA 3AM1A 1DELA 5HZKA 1AA9A 3RVBA 4EQ6A 1T6NA 2H18A 1CXZA 3EASA 2RHDA 4OJKA 1X8LA 3GLGA 2ZREA 5SZHB 1R8QA 2HJVA 1B23P 1F48A 2RH5A 1Z08A 1N6KA 5DN6A 3A4MA 3SDZA 4D6PA 2P2LA 2DFNA 1Q44A 5L3QB 1EFCA 1BKDR 821PA 4GMXA 2MSDB 1NIPA 2ZPTX 1UBEA 4YDHB 4HB4A 5CDFE 3HU3A 3SFZA 2RGGA 4FWIB 3UWKA 2BMFA 1G8PA 2C98A 3IQXA 1QZXA 5B64A 4BLRA 1W4CA 1W4AA 2JJ2A 4B3XA 4BLSA 4C9BA 3R8FA 4WZBE 2ORWA 4XVUA 5AK0A 3T1QA 4TZ6A 1QHHB 4EAQA 1RRPA 2ZVPX 4MYTA 3U3RA 2GXQA 4MRRA 2O8BB 4ABYA 3ZVNA 3B85A 2P65A 4Q1EA 2AD5A 1XNJA 5TVKA 4S2EA 4TYPA 1I4LD 3I8SA 4DLYA 3PUVA 2PX0A 1R8SA 3HU2A 2NPFA 1WCV1 1FOEB 2GILA 2FX3A 2EFGA 5FTMA 3GLIE 2GXAA 3UK6A 1LNZA 1AKYA 3BB4A 3BXZA 2ECKA 1T0JB 2HUPA 4O3MA 1M1YE 5DHFA 3L8ZA 4MKHA 2OO7A 1W0KA 4MKIA 2JLYA 1J2JA 2J0SA 1OPXA 1S3SA 4OJQA 4HDQB 4LHZA 1JJ7A 2F43B 2YINC 4ZPXA 2OAQ1 1GZSA 1NMXA 1KI9A 1CU1A 1NI3A 3L82B 1E0AA 4XD7A 3THXA 2DPXA 3ICQB 1ZM4A 3D3QA 1XXHA 4AG5A 4N0EA 1F2TB 3WYAA 4JT4A 3QG1A 2C8VA 1GIAA 1XB2A 4C0HA 2QP9X 1LB1B 2FH5B 1VCOA 4IDPA 2N1BA 2IUUA 3UG6A 1ZM2A 3WRYC 5IK2A 5JJLA 2VO1A 3B9PA 1E0KA 1Z0KA 3ZD7A 4EIWA 1OE0A 4WOPA 1EESA 2DWPA 2ZTSA 3RS3A 1Q12A 3REGA 3GJ0A 2D74A 4TLBA 1F2UA 5LB4A 1TUEA 1GP2A 3W3AA 4Q5IA 4DDUA 3ZVMA 3E2IA 4RFSA 1NRJB 3BK7A 2FFQA 3VR4A 1ZJ6A 2IS1A 2VF7A 5E7IA 4N0DA 4ZI2A 2UZIR 1G9XA 1Z6GA 5EP2A 1IJFA 1BMFA 1Y3AA 2GJ8A 2JJ1A 5FPTA 1RC8A 1L7VC 2HYIC 2ZXUA 3GP8A 4MDFA 4YMSA 1DS6A 5JHGB 2QZ4A 3Q3JB 3DL0A 1GFIA 5EP3A 3SHWA 1U2RA 5IK2D 3BC1A 3LBIA 3ZZ0A 1U0LA 2OCPA 3AKDA 2J9RA 3PJRA 2IS6A 3QKUA 3QI2A 3VR6A 5LD2B 1S4QA 3C14C 2DY1A 4NCKA 5FI1B 1GRNA 3THOA 4PZZA 1D5CA 3U2QA 4POAA 5DIFA 1XMSA 5P21A 2OCBA 1E2KA 3THWA 5AUQA 1MKYA 2ONKA 1VYVA 1IN8A 2VSXA 3A58B 3GLFA 2NG1A 2W58A 3P1JA 1EFTA 4C7OA 1E9EA 3BH7A 3PFIA 4BGDA 3B13B 4DSUA 4OBEA 2V4ZA 4LV6A 4QM7A 3KQHA 4Q4HB 2O8DA 2FOLA 1D9ZA 4JVSB 4OQLA 3QIAA 3W6PA 2JJ1D 2KB0A 2ZI5A 1S1MA 3VTKA 1COWD 1ELOA 1N5LA 1SXJE 2ANCA 3CF0A 5KSOA 1G6HA 4PANA 2REXB 3KJHA 3ND8A 1YZTA 3U7GA 2GJAA 3S1AB 2GJ9A 2KBFA 3VQTA 5EZ5A 3LD9A 2ZM5A 3FHCB 3NKVA 2XTZA 2A5FA 2PMDA 2CE2X 1BYIA 1E69A 5JMTA 5F98A 1P2SA 4H1UA 3TSOA 2ZRPA 3MWYW 2GBLA 1XJCA 1Z6AA 3DOFA 3U6BA 5J47A 4TL8A 1E9AA 3R7WA 2RGNA 4DC9A 2VHUA 1OFHA 2ZJAA 3QY0A 4XSHA 5L3QA 5HE8A 3DZDA 3RNLA 3A1SA 4URUR 1JJVA 4V0OA 3CB4A 4LHXA 2CHQA 1II0A 1G6OA 4IDOA 1X86B 1XPUA 2JEOA 3KZ1E 4HLDA 1KAGA 4GZLA 4Q9IA 2ZRAA 2HJGA 5J40A 1E99A 1U0JA 4B34A 3QVVA 1FQJA 1DTSA 4CEHB 4JLOA 4RFVA 3J81k 2O8BA 1R5NA 3LDAA 1XEXB 4D4KA 2VSFA 4GPTA 3UG7A 1LS1A 5TARA 4GDFA 5DHAA 2GJSA 2RGAA 3KJGA 4FMCF 3WRXC 1CR4A 4RY2A 3U5ZB 3RSOA 4I1SA 3TAHA 2CHGA 2KI5A 4BFSA 2ERXA 3M4YA 5EE9A 3WP0A 5KSYA 3EC1A 1E2QA 4L9WA 3LVQE 2B7BA 4CEIA 1P9RA 2WWWA 3I5YA 4ZCMA 5BN3A 2ZJOA 1T5LA 2GEDA 1P2TA 5JCZA 1QHGA 4OQXA 1ZP6A 5LPNA 5GVSA 121PA 2OEPA 3QPUA 3SNHA 3TQCA 2FEMA 4Y0VA 1DAFA 3E1SA 2IS4A 5KDOA 3ADKA 2WMOB 2UVQA 1QHYA 1V5WA 3EIQA 3DM5A 3A1WA 1F5NA 1MRNA 1H8ED 2AK3A 1G8YA 3BRWD 2AX4A 5BYJA 3TMKA 3E70C 3NH9A 3Q5EA 3FMPB 5KPDA 2HEIA 1WXQA 4FN5A 2PT5A 4JLMA 3NH6A 1LFDB 2H8KA 1HTWA 2C78A 3L0SA 4R2IA 3RWMB 1SZPA 3RYTC 3PCRB 2P6UA 3AP1A 1YQTA 3IILA 2QRZA 4Z1MA 4M1MA 1TX4B 3H2YA 3I3SR 1VCIA 4GSYA 2J5XA 2WJJA 1EWQA 5F2EA 1HA3A 4JLVA 2ZANA 4K81B 5EXTA 4XWKA 4LHVA 4DUGD 1U0HC 1IN5A 4MYCA 3U3OA 4UJ3A 4IDNA 4BZQA 2WSMA 3P4YA 3T1TA 1UBGA 4DDTA 3HYTA 3BGWA 3CIOA 2WMNB 4Q21A 4RZUA 1KK0A 1US8A 4C2TA 5D3MB 2R2AA 3OEED 5KPJA 3D6TB 2Z6VA 3L0IB 1FNMA 1UKEA 5DGXA 3GJ4A 1XTKA 2MSEB 4QFMA 4BECA 3K09A 4HATA 3I32A 4BZPA 4B76A 2GZAA 3FHTA 1SGWA 5A0FA 4B2IA 1G291 4TTPA 2WWFA 3PITA 1XU4A 4E09A 1KI2A 4QBFA 3KFVA 4LV8B 5EP1A 3WXMA 1XD8A 2IXEA 4JVNA 1E3MA 2J0UB 1NNEA 1N0VC 5J5CA 4F4JA 3ETLA 5IDVA 3UXMA 1R0ZA 2C9CA 4YMWA 1G21E 2HLDA 4PHHA 2J45A 4LBWA 1CIPA 5DI3B 3MJHA 2G6BA 2D7DA 4L16A 5BN4A 1RYFA 3EPKA 2VH5R 1DO0A 4Z8YA 4A0GA 2WKQA 1UDWA 1E1QA 2CDNA 1M74A 3ZZUA 1NLFA 3K9LA 1IONA 1KI6B 2Q6TA 3L2OB 3RWOA 1E2FA 3N2IA 1XTQA 4LGMA 4TQ9A 4B75A 1G4AE 1KI4A 2ZRLA 4DT1A 5JJKA 2B6HA 2E9SA 5GADl 1UKYA 2VRWA 2YOGA 2J3EA 1LF0A 3NBZC 5E7JA 4KFSA 2PT7A 4DLSA 3F3YA 4RD4A 4TYYA 1H8HA 1VHLA 5DI9A 4QJ5A 4CT4B 4IFBA 4YXWA 1Q20A 4IW3B 1QVAA 3W8RA 4FD2A 4DSOA 1ZCAA 2IYXA 3NHAA 4ZKDA 3HP1A 2Q9AA 1M7HA 2WOJA 1KYIA 1GUAA 2PX3A 3MLEA 2DB3A 2WPDD 4B2LA 3AKCA 4JYCA 1OH5A 2RAPA 1OIVA 4JL6A 3CX7A 1NG9A 4OQNA 5JS8A 1E1QD 2WJHA 5FPYA 4CGZA 1W2GA 1N6NA 2N46A 1ZBDA 2PEZA 4DLUA 3RS2A 3DOEA 4Z51A 4IDQA 4JLNA 2QAGB 4C4PA 2D3WA 1Z8FA 4NKRA 3ZGXA 4PXAA 4TT3D 2X2EA 2DR3A 1JR3A 2YWFA 4XIGS 4IXMA 3KKQA 2QORA 1MH1A 1XTIA 3CR8A 5HR5A 3EC2A 3SHFA 1ZCBA 4Q7JB 2IS2A 2O8CA 4FCWA 1OLOA 4A4DA 1H8HD 4NDZA 1R7RA 1KDPA 2R6DA 1P61B 2AKAB 3AVXA 3E5HA 4BUJA 1JXMA 3I73A 4A2WA 1LW7A 5CIWA 3LRPA 2WWHA 3OF5A 3B1YA 1K6MA 4JLJA 4FMDF 2A9KA 3LW7A 1OIXA 3GQBA 1SXJD 4G3XA 4Y0AA 2EYQA 2IYUA 2KWIA 2R6GA 1YRAA 2J7PA 4NYIR 3OIYA 3Q8XB 4D0GA 3IEVA 3B60A 4V0LA 2EU8A 3LQRA 3VR1A 2L0XA 2D62A 2C2HA 4IRUB 3M1IA 2QM7A 4NP6A 5EQTA 3IBYA 4MDEA 2ZYTX 2XITA 4DCNA 3RS4A 3I92A 1Z6TA 1NVVQ 1ONBA 4U00A 4F4IA 4RJLA 4RD1A 4AIIA 3LA6A 2J0QA 1X1RA 2ZYUX 2VEDA 4DCVA 1KK2A 3TR5A 2GVDC 4QGAA 2W2VA 4BFYA 2ZU0C 4RCYA 3BJIC 3KTAB 3NVAA 5CYPA 3T35A 4KLNA 4DSNA 1UEIA 1GRRA 4BWYA 3AP2A 1XEWX 2F3RA 4EFNA 4Q4AB 5KU1A 4TLAA 5F9FA 1G3RA 2ZRHA 3SR0A 1EFRA 1VYUA 3U7EB 4EQ6B 5HPYB 2XNDA 1NVWQ 3GLGB 2VTKA 2QE7A 2ZRKA 2ZEJA 3SJZA 2JLZA 2OFOA 1G5RA 2JLVA 2WJIA 1IY0A 4ZIRB 1KKLA 3IIJA 4GOKA 2AHOA 4KITB 4YLGA 4WIAA 4A0FA 2QTFA 4C30A 4QBGB 4R7ZA 1K8RA 5A5GA 1Z5ZA 2Q3FA 2QPOA 1CJVC 3LFUA 4WXRA 2BM1A 5FOVA 1Q3HA 5JCPA 3C15C 3KQNA 2RGEA 2IUTA 2WICA 1ZUHA 3QXXA 2F9LA 2A7QA 1W4RA 4JLBA 2YHSA 2F1JA 1E2DA 3GJ6A 1VCMA 1G19A 3B5JA 4ILEA 3MUFA 2FU5C 4IOMA 1X8KA 2EWWA 5DI3A 2F1RA 3FWYA 1ZIPA 2LKCA 3IUYA 3LBHA 4RKEA 5EXXA 5DE3A 2A5GA 5JRZA 4YC7A 5ANRB 1Q1QA 2WJGA 1OB5A 5E95A 1CS4C 2QSYA 4MGYR 4B71A 1R5OA 4JKYA 3EZ6A 1NVXQ 3QJYA 3CH5A 3OAAA 4PX9A 2IEYA 3DEFA 3VR2A 4F4CA 3KQLA 1P2UA 2GETA 4OYHA 1BIFA 1DG3A 1RPZA 1ZYUA 3TH5A 4AKEA 4QGHA 3JZMA 3MAAC 2VHQA 4ERNA 5JFGA 1GDDA 2BMJA 4WXPA 5AUOB 4QHTA 4URYR 3B2EA 3PENA 3KKMA 1Y63A 2QT1A 1KO1A 1PJRA 3TNFA 3FKSA 3KQUA 3FFAA 4TL9A 4X8MA 4JBXA 2QI9C 4GMDA 2MMCA 1TQ2A 3THXB 4M1SA 4PO9A 4PZYA 3OZXA 3PUZA 1P3JA 3AGPA 1XXHB 1Q0UA 1NJFA 2W6ID 3VMFA 2WTUA 1UKVY 1Z0AA 3AVUA 2YWGA 2X77A 1RKBA 5FBLB 1KZGB 4A9AA 1Z83A 2PLFA 1DG1G 3AKYA 3HPRA 3G5UA 2JATA 2RCNA 3K70C 4GFDA 1ZM9A 2H1LA 3RRZA 3VKGA 1LVGA 4LBYA 4B35A 3ZD6A 3UANA 3U3MA 2ZSBA 3CRW1 3OAAD 3TUJC 3K9NA 1Q1ZA 3I61A 3G82C 1Z6XA 3CO5A 6Q21A 3WMFA 1F2UB 1DAKA 2QPAA 3TW8B 2C03A 2XTNA 4RFSB 2C77A 4HEJA 4HYYA 4LBVA 2DFKB 3TBKA 2ZITA 3EWAA 2AKYA 2GJKA 1JEEA 2O0KA 4GNKA 4JKIA 4IJMA 3TLXA 3RLFA 1KO4A 2NO0A 4L8GA 4B48A 2SHKA 5KHOC 1XBTA 2VP2A 4X8LA 3SC3A 4M1TA 1P5ZB 4I4LA 4XVRA 1G17A 2BC9A 2I1VB 2F9MA 4B6EA 2HXSA 4HDCA 1GKIA 1PZNA 1G8FA 5LDDC 1NL3A 3AKEA 3FMIA 3P4XA 4K46A 3W5JA 1IXZA 4A92A 2VP6A 4DDVA 3LAWA 4IHQA 1UPTA 2Q3HA 3LX5A 4QNMA 1PVOA 1GL9B 4M9ZA 3THWB 1E9RA 4HLUC 3T5GA 1DVRA 4OHYA 3GLFB 2YZ2A 1W46A 4E07A 3BFXA 2ZU6A 1T4GA 5J4VA 3GLHA 2OV2A 4DZZA 2CXXA 5TB5A 4DB2A 1XFAA 2WBLC 1Z0DA 4OI2A 4P33A 2O8DB 2P67A 2QENA 3QKSA 1DEKA 1XD9A 1GL6A 3SJCA 2BM0A 2QQEA 3X1XA 4IOKA 5FTJA 5F9HA 5LB2A 3SYNA 3KKOA 2XOKA 3EA0A 2G3YA 4AKHA 1KK3A 1SXJC 5TMPA 1L4YA 4BFUA 1KDTA 1IHUA 3BOSA 3CPEA 3RDPA 3EPJA 1TF5A 1XZPA 1KI1A 3QF7A 1Q1BA 1HQCA 1E2HA 1CTQA 1NLZA 2OLJA 4KYIB 1KOFA 5KO2A 4ZIRA 2ZUDA 4Q7LA 3R7WB 5FTKA 5KUTA 1FTSA 4Q9KA 2HYDA 1CRPA 1RFLA 3IKJA 2FZ4A 4PAOA 1DAIA 4Q03A 1HV8A 3UKDA 2ATXA 3HU1A 3C8UA 3LV8A 1AQYA 4F38A 1D2EA 1FUKA 1FUUA 3JZAA 4LUCA 1EFHA 3VX3A 5JZVA 3FDIA 2ZRDA 5JBQA 2J7KA 1W36C 1KAOA 3AUXA 2BMEA 2GXUA 4TSFD 3O8RA 5KNCA 4JLAA 5FBVB 3X1WA 1GNQA 1RVDA 2DYKA 1PV4A 3TUIC 1CJMA 1E2EA 2FN4A 2V6JA 2XOKD 4M22A 5JSZA 1TEXA 3K0EA 1GKYA 1X6VA 3FTQA 5FTNA 1XMIA 1UJ2A 4W5HA 2I1QA 1FNNA 3A4LA 1OXXK 5IHPA 2IYLD 4JLKA 4CEIB 4NE2A 2Z83A 5JWOA 3TIFA 4E22A 2BEJA 2R8RA 3AB3A 721PA 3EIEA 3ZLJA 4P31A 1P75A 1EWRA 2OZEA 4L9SA 3H86A 4DLRA 1ZRHA 2QY9A 4S35A 4IOJA 4KVAA 2CLCX 4BFWA 2QRNA 4LJ9A 1ZW6A 1MOZA 4Q48A 5CLQA 3ONWA 3W8NA 4OQFA 3KB1A 2FFAA 1E98A 2J46A 4XOIA 3EPLA 1CRQA 1S9HA 1ANKA 2Z5FA 4IKEA 3PIRA 2Z4SA 1E2IA 2ZS9A 1NIJA 4TYWA 4YONB 2CJWB 4C2UA 1GVNB 4FCTA 4D26A 5HCNA 3Q72A 4IXNA 2ZRFA 5H8WA 3KX2A 3OIWA 2XZOA 3HPQA 3I5XA 1KMHA 3KUCA 4BLPA 4TMXA 3SU8A 4HUQA 4XWOA 3QE0A 1JECA 1F60A 3AUYA 1AN0A 1JBKA 4LJ6A 1U81A 3C41J 5FR1A 4TTRA 4EKDA 1NVVR 5IF9A 3AF2A 3IBGA 3B78A 1E2NA 1CJTC 2XZPA 1KY3A 3IIMA 3AQ4A 1RE0A 2W0SA 4MYUA 4PSAA 4UJ5A 421PA 4A82A 1A1VA 4M1KA 4NYIQ 1US8B 1SKQA 4P32A 3WP1B 2FPLA 4URVR 3BBPA 1XD2A 1J7KA 1YZKA 1S9DA 4G5GA 3VKHA 1COWA 4LYFA 4N1AA 1VMAA 2IHBA 3D31A 4CDGA 4Q18A 1XCGB 2QMEA 5GJVC 1KSGA 3CR7A 2P3SA 4EDHA 1TF2A 3Q9LA 5G3YA 4D4MA 5K8UA 2JDID 4G0NA 1DOAA 4V0ME 2GAAA 4PC7A 5EXSA 2ZRGA 1RRGA 2PJZA 4AY2A 1GITA 5ELXA 1E1RD 2ODWA 2CK3A 2PL3A 3WYGA 3NDBB 1OH7A 3EIHA 1EG7A 1SVOA 5DNYB 4EJSC 1N0WA 1J90A 2F1IA 3IIKA 5KDDA 1C4OA 5EE5B 1CJUC 1KO5A 3QUSA 1Z63A 3WBKA 1N6LA 4OK5A 2OHFA 1OJLA 2VIIA 3TVDA 3UMRA 3IDQA 3VX4A 2WM9B 3AF4A 4O2RA 1CR1A 1X3SA 2FE4A 1W47A 3QEJA 2XTMA 4DT1B 1NBMA 3B9QA 5KYKA 1HE1C 5EE3A 3QXCA 2ZI9A 4Q9HA 1T3LA 4DHEA 2WAXA 2AD1A 3GEHA 4XSGA 2QA5A 3WYFA 4DDWA 4B74A 3CH4B 2IYZA 3U3JA 2NOAA 4PQRA 3PEVA 5EUQB 2G0NA 2ZR7A 3LXXA 4O0MA 2OCAA 4MUBA 1VHTA 4V0KA 5LBIA 3K9GA 4BZXA 2CK3D 4NH0A 2HDNB 1WQ1R 3AV0B 4G1UC 3UIEA 1E2GA 2WAYA 2FPMA 1HEIA 5FBRB 5F3WB 3QOFA 1W2HA 2NPIA 4KV9A 4ASUD 4ZO4A 4ZV4A 3K0AA 3QXHA 1H8EA 5KSPA 5CM8B 4NYJR 3REFA 1XCMA 2CLDX 2G83A 3HR7A 1JR6A 3MSXA 2H7VA 4MRSA 1UKZA 5K8IA 2A30A 1NBMD 1I4DD 3ZYCA 3AVTA 2C9OA 4HAYA 1P2VA 1QHNA 1JR3E 4DLZA 1Z6YA 5CDFA 2N42A 2BJVA 3UMFA 5L8VA 2C04A 1N5IA 2ZRMA 1VTKA 4QJ4A 4UNSA 2O8CB 2I3BA 1M2OB 1IN4A 1CBUA 1AZTA 1O3YA 1ZC4A 5AUPB 2GF0A 5HZHA 5J4KA 4MGKR 2OBMA 2GEVA 2DFLA 2ANBA 3KXIA 1GSIA 4A8JC 1CP2A 5TV2A 1HE8B 2FNAA 2RGBA 3O8BA 2GVZC 4JYBA 4DUGA 2CE7A 2CVFA 2FSFA 2WSSD 1RZ3A 1R0WA 5JWRA 3WHLA 1AM4D 2V3CC 3I1FA 3RRYA 2NMVA 1MO4A 1W7AA 2IYTA 3PUXA 1R6BX 1G3MA 2FPKA 3OEEA 2VSOA 2W83A 3B1VA 2CCGA 3B82A 3QPVA 4ACBA 4D0NA 2IYRA 3IGFA 4DCTA 4QGGA 1XJ0A 3H0KA 5KTYA 2BBSA 2EFCB 3UATA 1JAHA 3W9YA 1DE0A 1UM8A 3CBQA 2CJWA 2C9YA 4P4UA 1KI3A 4UQOA 4KYUA 4AWXA 1C9KA 5K8TA 3ZVLA 1V43A 2GHIA 3A6PC 3OIUA 4ESHA 3BFKA 3NXSA 4NBSA 3I72A 2G0TA 1J8MF 4C0BA 1ZNWA 2IHYA 3CONA 4D0LB 2WWYA 2WZQA 5FOWA 4YMUA 1PUIA 4DRZA 2Q0HA 3LW8A 1QRAA 1N0UA 1Z28A 2AXNA 4L5BA 1YZNA 3V00A 5HE9A 1JALA 1D9XA 3CNNA 4PPGA 3R9IA 2REBA 1N3BA 3OFND 4Q9LA 1K5GA 1YKSA 3Q7QA 3U61B 3U7HB 4TMTA 1HQYE 1G64A 1NVUQ 1E9CA 4U02A 2O5VA 4D2IA 3D7MA 1EGAA 3CM0A 2OXRA 1P60A 5EZ6B 4DSTA 4BLOA 2QMHA 4OI0A 1U98A 4JLDA 1N6RA 4RD6A 2JLWA 1JPJA 4C0LA 3K53A 2RKOA 4MKFA 4LRWA 5JRJA 3X1ZA 1E79D 3A8TA 3QKRA 3AF3A 1G3UA 4W5JA 5JI3E 1KSJA 3T1VA 1DAGA 1FMLA 1NG1A 3P26A 3T1OA 1YZQA 4A6PA 4MITA 2C99A 4TMZA 1FTNA 2JASA 4U7DA 1S8FA 4EFMA 1N6PA 1U8YA 3ZIAD 4BEJA 3ZZTA 3K70D 5C2JB 1U94A 4WZ6A 4DIEA 3THYB 2J41A 4QGFA 5E4FA 3WNBA 2B8WA 1MABA 4NL4H 3VU9A 2WPDA 3F0TA 3K0FB 2BKEA 4DCUA 3DKPA 3K8YA 3B8HA 3RRNA 2KE5A 3FYHA 4GP6A 4M9QA 4A36A 2XEXA 1FX0B 5BYKA 1OXSC 3TRFA 4C3ZA 1Z2AA 1Z29A 1ZD1A 2XNSA 4HLUA 3U4QA 1IXSB 1KTVA 4D80A 4F92B 1E6CA 2GAOA 2IBMA 4TT3A 5HTKA 3LNCA 2ZR9A 4PHGA 3KDSE 4UNQA 5SZJA 2FJUA 2JAQA 2GCPA 1N6IA 1E9BA 4LDJA 4BE7B 3TW4A 4US0R 3UPUA 1UF9A 1OKKD 3RHFA 2RHMA 5CITA 3WMEA 3N70A 2W2XA 1SXJA 3ADBA 1Q22A 1I2DA 3SJBA 5BN5A 2CBZA 5FUVA 4EPVA 2YVUA 2H5EA 4BLTA 5BW8A 1KJYA 3RS0A 3A37A 5BWMA 2QNRA 1KDOA 4KSCA 1CR0A 1ZD8A 4CYMA 1R4AA 1ZUIA 4P0TA 1KIMA 1OHHA 2ASEA 4PPQA 2EW1A 2IXGA 3LY5A 4UXJA 1WBDA 2WIBA 4M53A 5HKKD 4QHSA 3SI7A 3KB2A 1ZNZA 2IYSA 3B1WA 3R20A 1P9NA 2ZJ5A 1CKEA 3KXLA 2GK7A 4XH9B 1FFHA 2F55A 1TF7A 1OF1A 2OM2A 2W00A 1YJ5A 1ZU5A 4FW9A 5JWHA 4TYNA 3JVUA 1AGRA 2AN9A 3M0EA 4B73A 1UEJA 3K9HA 4JJZA 3ASYA 2EFDB 1F3OA 2BVNA 3CX8A 4NYMR 4XJXA 3L0PA 4TMWA 4HB0A 2XAUA 1KJZA 3HJNA 1CLUA 4Q1DA 2LCFA 2IWRA 4II7A 3AVPA 4HZIA 3MJRA 3U7FB 3W6OA 4DLTA 5C1BA 1CEEA 5DH9A 3I62A 4JBWA 2I4IA 2AK2A 5L3SA 1P9WA 4B3FX 1W0JA 2PCLA 2UKDA 2NZ8A 4I81A 3OHMA 4C0JA 2FSIA 1RYHA 1OHHD 2OXCA 1MV5A 2CMKA 3N5CA 4A15A 2DWOA 4WVFA 4OHZA 4LV5B 3KKNA 4V0NA 5FL3A 1PLLA 1DADA 1QHIA 2ERYA 3A1TA 3AF0A 1HY3A 1FL9A 2WHXA 4HLCA 3GFOA 3GLHB 4EPXA 2QP4A 2VP9A 4ESVA 2XGJA 3EAQA 4BFZA 4LHWA 5DLQC 4XWAA 3L0OA 4BFTA 2AFHE 3HYRA 1CF4A 4GT1A 1G7RA 3QKSB 3CPHA 1S0UA 2ONJA 2GK6A 1W36D 2Q3MA 4GOXA 2IYWA 2ZUBA 4LWZA 4NTZA 4Q7MB 3CZPA 2QP3A 4OHXA 1GKUB 3QXSA 4UNNA 5FUWA 4HI0E 4FXPA 2PZEA 3DHWC 3PR1A 5FOXA 4TL7A 2GCOB 2YV5A 2ZRCA 2JLSA 5J4LA 3CPJB 3GLGE 1NJGA 1VG8A 2XSZD 1JQLB 2BBTA 4YQFA 2BOVA 3DVLA 2X1VA 4NCIA 1W0JD 2YNMA 1RRFA 1ZAKA 4DIDA 1P4SA 1ZD9A 1BH2A 1IY1A 4Q4LA 2R9VA 5G3ZA 1G8GA 2CVHA 1OIWA 1LF5A 5B57C 621PA 4CEJA 1AKEA 2W6JA 2O8FA 4V03A 1FMJA 2R62A 3NBXX 2GZHA 4L15A 1E2LA 5FR2A 1FW6A 4M1WA 4KHZA 1P62B 4HAZA 1NY5A 4KODA 2BEKA 2W6IA 1E32A 2BHRA 3ZQJA 3FE2A 3QEOA 1AIPA 1SVLA 3DZ8A 4Q1AA 4PSVA 1GWNA 1VIYA 2VYFA 5JSZB 4YDSA 3THYA 2ZJYA 5DYGA 3CUEF 4P4TA 4RVCA 4TL6A 2KSQA 2WWIA 1OT3A 2ODEA 3K0FA 1N5JA 2QGNA 4DBLC 2EWVA 3ICEA 2ZVQX 5CK4A 2JLQA 4HSEA 3UMSA 3QSYA 1Z0JA 1FX0A 2ODBA 1AGPA 4NCJA 5B58C 5CB6A 4KU4A 1Z3IX 4C0QC 2P5SA 2A78A 4WA7A 3BD9A 3C5CA 2ZRJA 1ZNXA 2Q21A 4EJSA 2A5YB 2JCSA 2EFHB 2V1XA 3AF1A 4LHYA 4M1YA 4UXIA 3T15A 2W6JD 2NO9A 2OG2A 1TL7C 2NQ2C 4XTRA 3LLUA 1OXVA 4NYJQ 1VKJA 3O47A 3B6EA 3PXGA 5GVRA 3UWOA 2W0MA 1KKMA 1W48A 1XXHE 3FVQA 4C0AC 3GJ5A 4CT5A 3RANA 3ASZA 4HB2A 2HXYA 4JMPA 3U60B 1IBRA 3OE7A 4CRWB 1XDBA 3MFYA 2P6RA 1DAEA 1NN3A 4I1UA 4E5UA 1II9A 1KMHB 1GOTA 2PH1A 5SZIA 3LXRA 4FMCB 4HUQB 1E94E 4LJYA 1Q57A 3SBDA 2CHVA 2DBYA 4KFRA 4PHTA 4M9SA 1ZVQA 2AWNA 2FSGA 4OKSA 2WWGA 2ZSAA 3U6KA 2FFHA 4FCVA 2ORVA 2GZDA 2G88A 3CLVA 3TE6A 2CL7X 4HAXA 1Z0IA 4EUNA 1HYQA 1WF3A 4W5WA 4JIMA 1WMSA 2BDTA 4NZYA 1DARA 3CNLA 3FFBA 4NHOA 221PA 5FL7D 4US1R 1RRCA 3G0HA 3Q5DA 2D2EA 2WWXA 4KAXA 4WAUA 3PG5A 4LX0A 4B3CA 1VYTA 3GPLA 1XD2B 1AS2A 5G40A 1WE2A 1LY1A 4F91B 1G20E 2HCBA 3X2SA 2VL7A 2Y8EA 1OFIA 3K09C 4Q66C 3WHKA 1XTRA 2ZYWX 3EWSA 3OE7D 3FMOB 3I8XA 3DDCA 2WJYA 1EK0A 2FGJA 1ETUA 3HDTA 4LJ4A 5GJBA 4WZAE 2HCJB 3RS5A 3QBTA 3L43A 3WNDA 5JEEA 2ZJ8A 1ZNYA 4A8JA 5LD2C 2CEAA 4G5QA 4AYTA 2ZJZA 4TWZA 3N2EA 2QBYB 2IC5A 1A2KC 2XB4A 3SN6A 4B32A 4PO1A 2OBNA 3GLFE 3TR0A 4FWTA 1IN6A 1E2MA 1T9HA 4QXAA 4PC1A 2ZJBA 5FUYA 1IJEA 1GILA 4LC1A 4MA4A 2DFTA 1FPMA 1LS6A 4BASA 5CJ2A 3PEYA 2CCJA 1RJ9A 4IEIA 4QHYA 5FOSA 4DWJA 2A5JA 4WW0A 4UNPA 2A2ZA 4XTCS 5JS7A 3K0SA 4Q1BA 4IFEA 4TSFA 2O0JA 4ACAA 2K5UA 4P4SA 4RD2A 4DB4A 3QQ5A 2OLKA 4M1OA 4D82A 1HH4A 1WP9A 2B8TA 4JT2A 2GCOA 2YWHA 4LJ7A 1KNQA 2DCUA 4LJ8A 2HV8A 2ZI7A 3TAUA 1OXTA 3SOPA 1A5TA 4DLWA 4JSYA 4Q4JB 1TADA 1YZLA 3B7GA 4KO8A 3EZFA 4LK2A 1KJWA 2OAP1 2O8EA 4ON9A 2ZE5A 4OK3A 4TMVA 1SKYB 1HT1E 2J87A 2RGDA 4LBZA 4I1VA 1TMKA 5HCIA 2GCNA 3U44A 1SVSA 3W90A 2GRJA 2Q9BA 2IYQA 2QROA 1KY2A 3ADDA 2OSBA 1E96A 3EZ2A 4QJ3A 3K0AB 1NN0A 5SZKB 4TZ0A 4G5SA 3GCGA 4KFUA 3T34A 3VNVA 4LOAA 4HAWA 3BAFA 5FPSA 3FOZA 1AQUA 4N3NA 1QVRA 2P5TB 5E3HA 3A1UA 3W3ZB 1SVIA 3MD0A 3EZ7A 2V9PA 4B6FA 4C0KA 3R8CA 3WNCA 4OI1A 4QG7A 2G1JA 5FPHA 5E7MA 2QGZA 3BERA 2X8AA 3BE4A 2VLIA 4PZLA 1ZC3A 2O52A 2AL7A 4KBFA 1JI0A 2QG6A 3FGNA 1QHXA 3GFTA 1ZU4A 4B3BA 3FHOA 4TLEA 2BCGY 3KKPA 4QKQA 1TQDA 4EPWA 1G5TA 1X1SA 5CM9C 4O2LA 1SHZA 3EA5A 5AWFC 4IDHA 1E9DA 3OEHA 1KZ7B 3RRMA 1IOZA 2NO1A 3CRVA 4GI7A 4QNRA 5GJCA 3SQXA 1G7TA 2QMOA 4PC6A 4DEYA 2V6IA 3KL4A 3Q85A 4Q19A 5FI0B 2CCKA 2QTVB 3GLIB 1Z22A 3PVSA 2IYYA 1E4VA 2VA8A 1EXMA 2LKDA 1IY2A 5DN6D 4M0LA 3ZJYA 2Z0MA 3EG5A 3A4NA 4AKGA 4BRUA 4M2LA 3ZVRA 1YR6A 2ZIAA 2JDIA 2WKRA 3H4MA 3LH5A 1HUQA 2IK8A 3QF4B 4JSTA 1R10A 2ZAOA 2ZQ5A 4QBHA 4D4JA 1WA5A 3CKLA 5B30A 1XX6A 2W2TA 2JJ2D 3BB3A 4HDOB 2FA9A 1W49A 4I1OA 1OH8A 3ZDQA 2DHRA 4NYMQ 1E1RA 4A2PA 4BFXA 4TQAA 4AKIA 3BORA 1GG2A 3CZQA 3K70B 1SQ5A 3MWLA 3A36A 3OEHD 1E9SA 2YWEA 3DMNA 1ODFA 4RSGA 1XP8A 3ZH9B 4FMDB 4GZMA 2QU8A 4FMBB 3LQQA 2VHTA 4B33A 2IF2A 4BLQA 3SZRA 4ZKEA 2QT0A 3PV0A 4MRNA 4W7SA 4ZDJA 2IW3A 3TKLA 4PSKA 1A7JA 3CWQA 1G4UR 1MR3F 2R6AA 3GFPA 3K0CC 2VHJA 2PJRA 3R9WA 1IM2A 1QG4A 1ESNA 1MO3A 1ZM7A 4OL0A 1IAQA 3AP3A 2IL1A 1W0KD 5IT5A 1T3SA 1N6HA 1VG9B 1R0XA 1S3GA 1T3HA 1U9IC 1YZUA 4TMKA 4BRWA 2ZRIA 4KBGA 2GNOA 4HZUA 3QKRB 5H70A 2VP4A 2EYUA 3CWZA 5FBQB 4IEEA 1M7GA 2FWRA 5FPKA 1G16A 2A3RA 4XD7D 4FI3C 3KFXA 4Z54A 4P3YA 1G41A 4KVGA 3GMTA 4YMVA 2QBYA 1TQ6A 3MWJA 3CRMA 4I99A 3VKWA 4LY6A 3QBVA 5DSZA 4LYHA 1JPNA 1MABB 3VU9B 4ASUA 2JA1A 1YRBA 2R65A 4OHWA 2NZJA
chains in the Genus database with same CATH superfamily
2BV3A 5AR1A 5TQVA 1WPXA 4M0MA 1T0IA 5J23A 1MIHA 2Y67A 2OGUA 3ET4A 3WKAA 2GYUA 1O87A 3ASVA 1NM5A 1OLXB 3U4QB 3QFFA 5K01A 3QH4A 4UVIA 2BUBA 2O0HA 2ZXFA 3D59A 1YR9A 5CUQA 1MGOA 2ZYIA 1U90A 4L78A 4XB6B 3SAJA 5LZ9A 2XB2A 2GESA 4UVHA 3W3AD 1RKQA 1VJ1A 3GP3A 2E48A 3VR4D 1MB4A 2ZETA 2YCBA 4M86A 1I7PA 3IDOA 4L74A 4U5XA 5IAEA 3RS9A 3WK4A 1LNSA 1ZN8A 4XASA 4HBZA 5A62A 3INTA 1G60A 1TK3A 3BRCA 4HRXA 3ECCA 2IYVA 3CCBA 5AVJA 5BSUA 3RFVA 1XDSA 4AY3A 5A5FA 4NNOA 4RZQA 1NRXA 4X63A 2QG9A 4F2PA 1UPXA 1W73A 3CZ4A 3KB8A 1BEUB 3U3KA 4EA7A 3CLHA 5KBYA 4P7FA 4Q00A 2B9EA 1LCIA 4XIYA 2PD6A 4E2YA 1NF3A 3CNBA 1G3IA 4F12A 3JD4A 4CM7A 2Z09A 5EL0A 2IQIA 1T5IA 4IUDS 4UDXX 1U8TA 1YU9A 1YCGA 2D2FA 1KO8A 3WGJA 2DLCX 4KXYA 5EP4A 3F6YA 3DZGA 3UJNA 3IIIA 2FEPA 2PMCA 2J08A 3CF6R 3DCIA 4M49A 3BKXA 5BWCA 5A2QA 5E7QA 5AOVA 3FVVA 4G5OA 4QD3A 1LLDA 4XM0A 2B1IA 1SUCA 1Q14A 3EEYA 3ICOA 4DMKA 3ZTWA 2MMGA 1X38A 4OB7A 2QAGC 8ADHA 3NATA 2PT6A 1N7IA 4D8VA 1JFSA 1WETA 1Z0FA 3QMWA 4QRHA 4KWTA 5DX1A 3ZWQA 1JDBB 3UW3A 2Q3EA 3GHYA 4AICA 4MQ5A 1NR5A 3AKZA 1J0XO 3GEIA 1RAGA 3P2KA 5AVWA 1W36B 3BHIA 3KAJA 3KQSA 2PANA 2GO7A 3HUEA 1JPVA 4AY6A 5GOZA 4BNZA 5ECYA 3D4PA 3CGWA 4C6RA 1D1SA 2R2GA 1UMBA 4Z7NB 2QMUA 3MMPA 5AJXA 3KETA 1OH5A 1QU2A 3TVTA 3FNQA 3X1YA 1GG5A 4W1RA 3F3SA 3OA2A 2OE2A 1LEHA 3QBJA 4GH5A 5BMVA 2MJLA 3MMZA 5L3SB 1GTRA 4HNHA 3AEZA 2JIQA 4MRMA 1BHO1 4WOBA 2Z4RA 2VP0A 4XRGA 2GAFA 4M0FA 2DSTA 1I4WA 3H84A 1O89A 2H17A 4ND2A 4WLVA 4NOMA 3VYRB 3KQKA 1RS0A 3F5FA 1M1YA 3WMGA 2AR9A 1FDIA 3IV9A 4YREA 1GNPA 1WZ2A 1MV8A 3AEQA 5AW9A 1GRVA 1RQGA 4PG6A 1L5LA 1QTQA 4FYMA 4PYNA 4E03A 1LDGA 1XCPA 4C08A 2QY6A 5KOYA 1A4UA 2WC1A 2YOHA 2ZDQA 2F43A 2JKZA 3BHNA 4WBSA 3MG9A 4EY3A 5LMNB 3QF4A 3I83A 2JKYA 1GQ2A 2H2GA 3ORHA 1WW2A 3ICVA 2BI4A 2FZ5A 2OAGA 2R4TA 1SUAA 1ZWLA 4O25A 4DQXA 1NP6A 1YNSA 4IH1A 2AJCA 2RB4A 4TTQA 2HRRA 3EMBA 3NBYC 2I6FA 5IBRA 2WIJA 4B6RA 3LE8A 4G0QA 3H5IA 3CLTC 4YRDA 3RS7A 3TSZA 4F2DA 1XDWA 1AG9A 3VR3A 2XKAA 1J49A 5B4VA 3KE9A 1TKRA 4OAPA 4OMUA 5L3RA 5T57A 3HKEA 4IG9A 1QU3A 1FLNA 3D5QA 3ELWA 3QLUA 4MMXB 2BTEA 4KAAA 4WH0A 1V48A 4D0RA 2QZJA 3UHFA 2ODTX 1H5UA 5TQ0A 3DC2A 3GW8A 2G4LA 1DDIA 1E2PA 2XCTB 4KXFB 4KB5A 3C7TA 1LPAB 4DBVO 1J0EA 1EP2B 1UKBA 2WSLA 1K6XA 3MJCA 1UXKA 2UUOA 4UHEA 5EKDA 4BV3A 4R2XA 1JIVA 4M0KA 4D3YA 2P6NA 1MC8A 3NAGA 4MVJP 2JCVA 2VPWA 1OROA 5KAMA 2B21A 3PL1A 4FGJA 4F3YA 1GGNA 1XXLA 3DDSA 3WTBA 4BFCA 2VYND 1VGQA 3AGQA 3GZTB 2VUUA 1PEDA 2CYAA 1MMFB 4ZAFA 1JUDA 1GM5A 1TDJA 2JHFA 1DIGA 1NSYA 2CNWD 3KT0A 4IGFA 3ZH2A 8OHMA 3HUFA 4QOHA 3X43A 2GEUA 3VO8A 4DIOA 3AG5A 1N7HA 2BJHA 2IUSA 3OCVA 2GAJA 4M9CA 3QVMA 3CUYA 3EFBA 3KIPA 4IOLA 4WK2B 1SC4A 4Z1MD 4TSKA 1WV0A 3IODA 2C00A 3C3JA 3JSAA 4V0MA 3L1UA 3PRHA 1HMPA 3ZE1B 4KPYA 1CHNA 3SE0A 1A5ZA 1CT9A 3IAHA 2GF2A 3VOTA 5EIBC 2O05A 2YHBA 2SNIE 1I3MA 1RIFA 1VSBA 2C4UA 2NVBA 1MRSA 1FFDA 1PR6A 2BFCA 2FP4A 5EQDA 1A72A 1CY2A 1E77A 1GAQA 1ZICA 2WT9A 4NS1A 4AK9A 1ZUNB 3TW6A 4DM3A 1UINA 4ENWA 5JASA 3AUFA 4JL8A 1LTQA 1HDEA 4NE7A 1GCIA 5H68A 4HRVA 1R0YA 1M2NA 3N8GA 4D9FA 2PZGA 1J5PA 3KAPA 2EFJA 2O57A 1LD3A 2VNSA 4KCGA 5K45A 2JLXA 4E15A 1JA1A 3LTNC 1QB8A 4HY3A 1NXTA 4B79A 3K2IA 5IWCA 3LYAA 5BQXA 2CD9A 3ERCA 1YR8A 2PLNA 4EI9A 5I5EA 4LZZA 2VHCA 4L5AA 4QOFA 4F3KA 1BWPA 2SCUA 4ZCLA 3SFTA 2O19A 1OFTA 2UZ1B 3T7SA 2AVDA 1D2NA 2HHJA 2JBAB 2OK7A 1E59A 4P38A 4TXMA 1OLSB 2HHCA 2O8VA 4B4DA 5JBIA 4S04A 4IUCS 6NULA 3L8YA 3UHAA 1PJ3A 3IO3A 3TJZA 4R9UC 4GM0A 3G9ZA 3SHVA 3VNSA 5LNK6 1RNLA 2V98A 4IICA 4FN4A 4HAVA 2DC1A 1JEAA 2POCA 3IVCA 3M89A 1GNVA 3H6HA 2ORED 3QVWA 3O83A 4PZEA 3QWHA 1GAJA 3V4FA 1TK9A 3W34A 3U9LA 1IPFA 4JJFA 2LV8A 2BZ0A 2BKUA 3BQ9A 1Q0PA 1SCNE 4RTLA 2WP8J 1NFQA 2H4YA 3BWCA 4EABA 2H16A 2YVLA 2H06A 1B0UA 1XKLA 1RAHA 4OG2A 4IILA 4O1IA 4EUHA 1XDDA 4QC2A 1H66A 2A1TR 1P1FA 2OILA 4NZMA 4V2UA 3SHTA 4BPBA 4DA6A 1QBKC 5ILGA 5LLSA 3UT5A 4MQFA 4HNAB 4JGIA 2GERA 2GTPA 2PX8A 1GU0A 4NATA 1KRXA 5CTAA 3WGOA 5GJWC 3UGKA 2EX0A 5M34A 1Y3HA 2EATA 5J5AA 3B3GA 3M7IA 5D51S 1Z4QA 3BSWA 1U2DA 3VOBA 1KI7A 3QVKA 3LKBA 5A4JA 1NVAA 3CWCA 4M9XA 1M73E 2VEOA 1X39A 4C43A 4R5MA 4HK4A 3P20A 4CLDA 2ZT7A 3GDWA 4BVEA 4YUAA 2VUHB 3PPVA 2VT3A 2D06A 3ZX5A 3S7ZA 2D3TA 2EF1A 2H48A 2ZSFA 2JFFA 1YK0A 4UHJA 4YXWD 4ZDIA 5KOJB 4G0WA 1YTUA 2J07A 4BAGA 5K20A 1FUEA 2QPTA 3KWJA 1L4FA 3L4JA 5IX8A 1VL6A 1K5DA 3GWGA 2CNDA 2QTAA 1J22A 3AOEA 1Z2OX 1VKRA 2DWUA 1M34E 2H4XA 4R98A 4UZSA 2ZVJA 3IBTA 5JJIA 3CXRA 3EZGA 3NUZA 5DSXA 5ALVA 3A3OA 4ZVVA 4MWGA 1EYZA 4QREA 1A8SA 3WWYA 4RK6A 4AZ0B 5IAAA 5A4IS 1JAXA 1DTWB 2DWQA 4UZFA 3NDIA 5DBEX 2FSHA 5CDHA 1QO0D 4S2UA 2COEA 1EIZA 5JI2E 2ZI3A 3GY0A 1Q50A 5I3ZA 1UWVA 1AKNA 1K8YB 1WG8A 5H1YA 3RIXA 3WA6A 3IMKA 3FCAA 1C9MA 1LDNA 5EUMA 1ZUWA 3VV3A 1T9GS 4AO7A 1XT6A 3C3CA 1MT0A 1NW8A 1X2BA 2G07A 2TRSB 3FFTA 4CW7A 5JDCA 4D8YA 1JKJA 3BWBA 2DM6A 2F7SA 1LVHA 3K4PA 4XYEA 1QHFA 4C87A 1PRYA 1QXSA 1O03A 1SA0B 1S6YA 3W4IA 3L6CA 1VSUA 2VHYA 1UKCA 4JR0A 4S1WA 3FCEA 4EM6A 4I7EA 1M2VA 2J6IA 2V7QA 3HI4A 5CIQA 1XTZA 5EIOA 2I66A 1Z07A 1EFVB 3OPNA 3FTCA 1SVNA 4G01B 3W2EA 5HZGA 1ENPA 2GA8A 5JCJA 3S2ZA 4MYHA 3LQKA 3Q41A 2CXTA 3M6IA 1TU4A 1JHQA 4R3WA 1A9ZA 4CR8A 2C4TA 1N5RA 3H1PA 3EW9A 2VCHA 3HWSA 4TRMA 5JNTA 1LK7A 4B6PA 2IPNA 1HDGO 4UPVA 1EWYA 3K0CA 3KLOA 5AJYA 4QUDA 3FKQA 2AWOA 2EBHX 4R2JA 1D1TA 3WFJA 1J21A 1CVRA 1BKSB 1IPHA 1V3QE 1VPLA 4G9GA 5CB4B 3DVAB 3PS9A 4YI3A 1ORDA 4B83A 4K40A 4E5DA 1P6XA 3KJEA 2LWIA 1ZR2A 4P1ZA 3F1KA 3C8MA 4RELA 2HCRA 1P7ZA 1N1MA 5AVTA 4KN9S 4FBMA 3BL6A 3IIEA 4IQGA 1T25A 2OCXA 3HCBA 2QN8A 1N25A 2P9BA 4LZAA 2NU6A 3KDPA 4ENSA 2C3PA 2ALJA 2F8SA 2IOYA 3DL4A 3ODGA 3S28A 1CULC 1BWSA 1TA4A 2DRIA 2HWWA 5THXA 1BDIA 1X1AA 4GRAA 4H7DA 3NO4A 2P8SA 1C0IA 1S2MA 5ESRA 3MWKA 3E3MA 4ROSA 1PNTA 3WYBA 2ZBPA 2I3GA 3AVQA 5GM1A 4KFCA 2O5EA 2V7PA 3BA1A 2PXCA 4PTZA 4CIDA 5C5EA 5CT9A 1X7ZB 2HK6A 1VL5A 5LMZA 3IP6A 2NYUA 2OZVA 3DE2X 4Y0NA 3RSQA 3O3NB 4ZD6A 4DZRA 4UTVA 3OCYA 2H2FA 1TO2E 2WHRA 2QTHA 3W2IA 2CXUA 2VPTA 3AOGA 4JJEA 2VJOA 4US2R 1U2GC 2AQKA 2XT0A 4PC3A 5LJIA 4AJ2A 2V59A 1GGFA 4UC0A 2H07A 5FDFA 3ZLJA 1NVGA 2XCIA 2BF7A 4ZI3A 2AEMA 2D0PB 2D4HA 2ZYGA 4MIEA 1N34B 1LU9A 1M2JA 3EBOA 4PLYA 4PN3A 2A84A 1U5AA 3FSJX 1ULSA 4LE2A 3PDCA 1BJRE 3FAKA 4GL2A 3ZJUA 3OIVA 3AHIA 4J0KA 4RUKA 1I0IA 2I54A 1Y4AE 3AERB 4PX5A 4TLCA 5LZ5A 3T5DA 3WIDA 2R00C 4ALKA 4PPFA 2IH2A 1SUEA 3G7NA 3CPSA 5FNZA 1T5TA 3V80A 3I9NA 2BLNA 2YC4C 2FTKE 2J0VA 2MYPA 3C70A 3IESA 2QVCA 1RXYA 1WMBA 4GOOD 1FFWA 1C7JA 2QL6A 3D8BA 1VCNA 3JQEA 3PLNA 2GCIA 4QPZA 1FRZA 1OZHA 5G1NA 5J4YA 4BATA 5MDHA 2FPIB 4DY4A 3MERA 5FI3A 2UAGA 3PEUA 3VR5A 4D25A 4MVJA 2EFEB 4KXQA 3I9JA 1P44A 2PHZA 4FINA 4WXYB 3C45A 1YZVA 3UFXB 3Q7PA 3SHOA 3ZW7A 2QUAA 1HQDA 3BWMA 2O14A 3FMFA 4KLZA 4NCNA 4RNDB 1XROA 4BMOB 2GEFA 3N8IA 3HO1A 2YYYA 1PQYA 3DNFA 5LP6F 3C7KA 1W87A 2OFPA 3F5DA 3HCCA 1URPA 1UCFA 3FF1A 2XV1A 2QTBA 4UAUA 4UU7A 1JHPA 1R88A 4MS1B 1MOQA 2CF6A 2PTGA 1JEDA 3DXXA 2PBRA 4GS5A 4NZZA 4PQFA 4RHXA 3NB0A 2B92A 2DTXA 4PXYA 1VCHA 4ZQIA 2CSUA 4JP2A 3IAS1 1CQXA 3FB4A 2F3SA 2QD1A 4DCPA 2FEXA 3E3OA 1U0NA 3GUHA 1X7XB 3P27A 2H0RA 4W1QA 1D6MA 3P96A 1XWIA 1GPJA 1Z2CA 1Z17A 1JNYA 2OHXA 2PMKA 2WHQA 2ZB2A 3ISJA 3N7TA 2C95A 4BYMA 1Q6ZA 4JJKA 4UHCA 4ZTZB 4M1ZA 4NBUA 3JYPA 3NTUA 4DV2B 4DLXA 5C18A 4NAUA 2NYAA 3STYA 5C53B 4L5YA 5FOUA 3QLVA 4XKJA 1OV4A 5DW0A 2I6TA 4KN6A 1DBSA 2E37A 2XUZA 2WUFA 4XFDA 3RC3A 4X6UA 4BKOA 3L7YA 4NFLA 3GJTA 1VMDA 3BN3A 4PPNA 4BMXA 3D64A 1IJBA 2AXPA 6AT1A 2XDYA 4D8UA 5J1SB 2VNJA 3SBEA 1ATZA 5TPZD 1PQ4A 3CRRA 2I62A 1GVHA 3SS8A 3LC1O 3VSDA 1E3QA 1WOMA 5G0TA 2ZE8A 4FQ7A 4H6PA 3BS4A 3K0KA 1CR6A 5G53C 3T12A 4MRAA 2BGTA 5AVZA 1EVZA 5C46F 3FOWA 2PUCA 4DKXA 3BE5A 4F84A 1N9KA 3NM4A 4OVKA 5FLYA 4AY4A 4ML3A 2KJQA 4X84A 1QO9A 2C31A 2NXCA 3DEHA 4EG4A 2G7ZA 2C9MA 1DELA 3CS3A 1AA9A 4EQ6A 2GN0A 3EASA 2RHDA 1PS0A 2I6QA 1X8LA 2QX4A 4ECEA 4MVJM 2D1TA 2HJVA 1AMUA 3DFKA 3NT5A 5FWDA 2ZYAA 4I50F 4MUKA 2FRVA 1SUFA 4D0SA 1YBAA 3QU2A 1MX3A 3CKMA 2JGAA 5DN6A 4OD0A 3CUWA 1K7CA 1QGZA 2WU4A 5IAJA 2P2LA 1Q44A 5AJTA 2ABWA 3FMGA 2M32A 4MP8A 3RW9A 4BU0A 1T8YA 4GMXA 3NFRA 3OY2A 2HPHA 3O3CA 1UBEA 1ZXBA 3FYCA 4LZNA 2SKCA 3KT8A 2C98A 2X6QA 1KMCA 1QZXA 4BLRA 1W4AA 4GGPA 2X8BA 2JG3A 5A5EA 1J56A 3A32A 1YGPA 4Z0HO 2ORWA 1GCGA 1I1HA 3GGPA 5LCXA 4WESA 4BOYA 4XR4A 1U4OA 3NJRA 2ZVPX 4XWGA 2GXQA 5FUBA 4R7GA 2FPRA 3EMVA 3ZVNA 4YJ3F 3QTTA 3MXTA 2OL4A 3HBLA 4OHMA 1J0BA 4TYPA 4R8RA 1H4VB 1P33A 4KR6A 1UAGA 5BSTA 1R8SA 4MRMB 4YCMA 5E38A 3EE6A 2EJTA 1FOEB 2GILA 2EFGA 2VJKA 2WKSA 2I7CA 2O3UA 3HP4A 1L7AA 1BXZA 1SWVA 3UK6A 5C1DA 1BQEA 3BB4A 2HUPA 2JFXA 2OOSA 2XOEA 2FLKA 3L93A 2W11A 3LCUA 3I64A 5B1DA 3H9QA 2CY0A 1QMGA 3AEQB 2O3SA 3UPTA 2JGIA 5DOZA 4BO8A 4D5EA 4OMDA 1Z3CA 3D6AA 3FA2A 3PHBE 1RABA 2F43B 3GC6A 1NAIA 1X42A 4ZPXA 4IMRA 3AYXB 3HABA 1NMXA 5KVAA 3RQIA 1CU1A 4L08A 2G9QA 4K7JA 1QYDA 3F74A 4PZPA 3KHUA 2CXRA 1C4WA 3KYDA 1ORTA 3QU5A 3KAQA 4AG5A 1KC3A 4JT4A 3QEBZ 1XB2A 3THRA 4U2GA 2WY2D 3EPPA 1LB1B 4TKUA 3R75A 4UUBA 1A76A 2NNWB 1ZM2A 3WRYC 3QBDA 4IRXA 1JHYA 3OUTA 3R6GA 5EYPA 5JJLA 2PS9A 3EXEA 2I6XA 1F8YA 3HKEB 4C1BA 2MCFA 1C2YA 1Y6ZA 4XWWA 1I1QB 4P92A 3A2MA 5TQ2A 2OG1A 2HU8A 1P2FA 2H2IA 3K9CA 5H4HA 2VAXA 3UYLA 2JZCA 1QQ7A 1EESA 2VOJA 1Q12A 5TQ0B 4KO1S 4UM7A 1ESCA 4Q3DA 3GJ0A 2D74A 3SYMA 2RJOA 5LB4A 4JI4B 4Q5IA 3W3AA 2VH2A 4DDUA 2GPYA 3TW8A 1QF7A 3Q10A 3GDGA 3VR4A 3BK7A 2FFQA 2V6MA 4OSOA 2IS1A 4RU1A 3QUCA 2H7XA 2P6PA 4N0DA 2V9CA 5ALUA 1JLKA 2IE0A 3ETHA 4GI5A 1Z6GA 3E9YA 3GWZA 2GJ8A 3AXTA 4WCVA 3ZHVA 2ZULA 2M98A 3EUEA 4FSHA 2JFQA 3ETEA 1F51E 3GP8A 3L7JA 2JF0A 5EKUA 2AB0A 2WB4A 3Q3JB 3DL0A 5FHRA 5EP3A 2JRCA 3CEMA 3BC1A 3RFTA 3FOEC 3JR3A 3KYCA 1LXCA 2EGUA 1XAJA 4K88A 1DKNA 4BEJA 1N9GA 2XD4A 3R2JA 4MVCA 4AJIA 3OT5A 3THOA 5DTMA 1NRWA 1DJOA 5D01A 2Q1TA 3DO5A 3E4CA 1E92A 3U2QA 5K8VA 3BJMA 2CLKB 4AAYA 1M2EA 5P21A 4UFOA 2I2BA 2OCBA 2BFCB 1ZMRA 1VYVA 5I4CA 5NLLA 3GLFA 5BN4B 2BEUA 3E3AA 3P1JA 5F9MA 1EFTA 3PC7A 1X94A 3PFFA 4K0RA 1AUOA 3P5BA 4MWCA 2G4CA 1JEJA 1F14A 5HQ3A 4LV6A 4X6LA 4QOJA 1H2XA 1U28A 2A94A 1AXRA 2O8DA 3TXAA 4JVSB 3I6IA 1KOLA 3N05A 2JJ1D 3PXDA 5AW5A 4BN0A 3IJEB 1DKLA 1S1MA 4LXQA 4XIIA 4HWSA 1N5LA 3CF0A 1DO8A 1SXJE 2IKSA 3DYIA 4MI1A 2PR7A 1PFUA 1MVLA 2REXB 2O5CA 3U7GA 2GJAA 2SCUB 4G2TA 2GH1A 1ND5A 2KBFA 4IRMA 4R7TA 1EM8A 4J07A 2P2ZA 5EZ5A 3LD9A 5I7UA 1XVIA 4X65B 2ZM5A 2XTZA 3M34A 4R1OA 3CKKA 4QU5A 3MCUA 3BG5A 1E69A 4LWOA 5F98A 5KJ1A 1YOBA 1W5AA 4JXKA 1BE8A 1P2SA 2QXUA 2VPZA 1QX4A 3PVZA 3B1FA 4YRCA 5AYVA 3TSOA 3VH4A 3MWYW 4BNYA 4EGFA 3V7UA 3R6TA 3D1LA 1E9AA 5U4QA 1RI2A 2RGNA 4W8OA 2JLCA 3QY0A 1C7ZA 3Q8WA 1BMDA 1HQKA 4ID9A 2ZPAA 5ITZB 2MYNA 5HE8A 3RNLA 5AVUA 2AG5A 3QUAA 4P98A 5ADUS 1PK8A 2DOKA 2Q3DA 4URUR 3WL4A 4DA4A 4FHCA 5J3JA 1G6OA 3LP5A 1X86B 3HEMA 3FYDA 3DMGA 1AXEA 4BO6A 2FUKA 1X87A 2GPAA 4GZLA 2C83A 1TYCA 2HJGA 5CXUA 3ESQA 2CZGA 3RUEA 4B34A 3QVVA 3UT5B 4MQFB 3SSMA 1DTSA 2Q3CA 3DZJA 4NMLA 3V7YA 3WHIA 5CMLA 3SEFA 3HLTA 1P0FA 2IH5A 3N0TA 1V1JA 1DQPA 3Q7RA 2VSFA 3C5VA 4REQA 3NBUA 4GDFA 1HK7A 3GEBA 5DHAA 3IE0A 3KJGA 4BRZA 3IHTA 2HK7A 2Q7XA 2Z3ZA 1O54A 4RNCA 3GIDA 1EK5A 1M8FA 3M4YA 5EE9A 2JH3A 1PJCA 2IYNA 4KXNA 1RVV1 4Y2PA 1P9RA 2WWWA 3JWPA 2WF7A 5KX5B 4EFDA 1H2FA 1JG2A 1P2TA 1RT9A 4DPMA 3WJAA 1QHGA 2JK1A 3KR0A 4ALNA 3G8AA 5LZ2A 2FPOA 3PDIB 1YZHA 1RKXA 3QY9A 2ZIUB 2ACKA 2IS4A 3A26A 1IEQA 3GU3A 1K06A 1XMPA 2UVQA 1QHYA 2WMOB 2XA1A 3HN6A 3EIQA 3DM5A 4LY0A 4UDYX 1ZJYA 3RVKA 3GBSA 4C5AA 2DPHA 1EEXB 1G8YA 3KZOA 5IJAA 2AX4A 4R0VA 1SCKA 3ZGVA 1B26A 1B8OA 2VYNA 1E60A 5IBQA 1DKOA 3FH0A 3QGMA 1ZJZA 2HDOA 3FMPB 5ER6A 2C3OA 3NH6A 2C78A 3FIJA 1E4OA 3EGOA 4R2IA 1VKZA 4RLSA 5JPCA 3OM8A 4QDXA 1QP0A 1SZPA 4R6WA 4ZT5A 2Y76A 4KC0A 4A8TA 2O7VA 4Z1MA 4PRYA 1GV0A 3VC2A 1RXCA 2G4VA 1O9HA 1QH1A 3PFBA 3EGXA 2ATCA 3EQ7A 5SY6A 4ZRMA 3B9BA 2PGXA 1JJIA 5LJLA 1R16A 1JV2B 2B36A 2IY8A 2OZLA 2WJJA 3F96A 4L8YA 2ZANA 1EWQA 2B4YA 4XWKA 4YIHA 1M2VB 1T5DX 1E8DA 1M0SA 4UUAA 3GG9A 4IDNA 3BIXA 1JHZA 2WSMA 3OVMA 4JC4A 5F64A 4DDTA 3ZTYA 1UPCA 1CZNA 3KUKA 1QRTA 2H2AA 1A0OA 4E46A 4RABA 3D5EA 4Q21A 4WFKA 4ZA2A 3TNJA 4DMHA 4YGXB 4AF6A 2R2AA 3OEED 2DF8A 3UHJA 1I2ZA 2Z6VA 3D6TB 1BMTA 1FNMA 3LWBA 4TVKA 5FLKA 3I12A 1F8XA 3LC7O 3GJ4A 4PLVA 4QFMA 4XR9A 3RBVA 2WVAA 3MGKA 3D8UA 1XRLA 4HATA 4UBMA 3RU3A 4B6QA 1WB9A 4GNRA 4UUOA 1ZGJA 4QFCA 5A0FA 3THSA 5AQEA 4OF4A 4EHHA 1CV2A 4P36A 4QBFA 2XD9A 1K6IA 4GX5A 2QTGA 4S1OA 1XD8A 4GX2A 1JWLA 4V2IA 4RDXA 1KFJB 3PRJA 2C2WA 2R68A 3K32A 1K97A 1XZMA 3HHEA 2NU6B 3ETLA 4PNPA 3DAPA 3E03A 1OGIA 4K6FA 1R0ZA 4PLFA 4YMIA 2TSYB 3EZXA 4YMWA 5AKXA 1G21E 2WABA 3I6BA 3CR3C 4LJSA 5DTRA 3LM8A 1EFPA 2J45A 4LTNA 4EK9A 3L79A 3MSCA 1BN7A 2OLEA 5DI3B 4OREX 3TD2A 4YAIA 2YV3A 1PE0A 4BFLA 3OLWA 3QIVA 4K9LA 1WF6A 4LOIA 1D0VA 2QL9A 4IHAA 4OFXA 2IGTA 1H2HA 2VH5R 5JR3A 1CF9A 1DO0A 2O4CA 1FEZA 5ILOA 3AEUB 2FZKA 5FEMA 2GAIA 4DIEA 4DCCA 1YCFA 3QX8A 2ILVA 2XUPA 3KJNA 2VXCA 2WJWA 4PTYA 1A2QA 1WLSA 1UZAA 1NLFA 4I3HA 3K9LA 5CVVA 5G0VA 2A67A 2WYIA 1Z56C 4HN4B 1OD6A 3N2IA 1XTQA 3HBNA 5KC9A 3V4VB 4JD5A 3LTEA 3C39A 2ZRLA 3F6PA 5EESA 2PTHA 3UTCA 5JJKA 1FXUA 2RJNA 1M6YA 1YS1X 3WB0A 2YOGA 3I8OA 1ZMOA 2J3EA 4M88A 3DP9A 1B2LA 3FBGA 4G1MB 4TTSA 4DLSA 1H6AA 4UTPA 1UXOA 4BJ5A 1KPGA 1BE6A 1DMRA 3GIWA 4N12A 5DI9A 2Q5HA 3G1UA 4M8SA 3DPSA 4YV0A 3E18A 5TS3A 4YXWA 1Q20A 3GFGA 1IQRA 2Q3LA 4BLUA 4EW2A 3W8RA 1NPTO 4FD2A 3W9SA 1JG1A 1I3OA 1IQ0A 1M7HA 5HF5A 1NXSA 2PX3A 1BQ3A 3CNQS 2WPDD 3HRKA 3MLEA 4LGCA 3TTVA 4CV3A 2ONCA 1QFZA 3CX7A 1C9JA 1OWPA 4PINA 3TL3A 3V1LA 3VPCA 3KSBC 2BHLA 3ZCVA 1N6NA 1P19A 4DANA 5C3UA 1QBGA 2J30A 2RB5A 1XNHA 2PEZA 3KTFA 1QO0A 3VHRA 4BX0A 3BMCB 4OAOA 5IDXA 2HNKA 3C0KA 4MO2A 4MUHA 2QN7A 4ZVQA 4KPEC 4YCBA 5C4IA 2E4ZA 4RVUA 1Z8FA 1UK7A 2ZG6A 1QV9A 3HXOA 4LE1A 3COPA 5CDSA 4TT3D 1VYHA 2DR3A 3A6EA 3BCHA 4XIGS 3F7NA 1VE6A 2QORA 3CR8A 1VLMA 3EC2A 5IFKA 2PRZA 5DF1A 1GT91 4Q7JB 1CE8A 5LN1A 4UQPA 4L57A 1CJSA 3BGDA 1GQFA 2HRZA 2YJZA 1U3CA 2M9MA 5F73A 4A4DA 1D0SA 2PUBA 3FNIA 1D0IA 3BL5A 1R7RA 2AKAB 3EYAA 4X9XA 4BUJA 2A3NA 4RIFA 1JXMA 3INRA 5BUSA 4A2WA 4TYMA 2Q62A 3HBMA 3LRPA 1M0EA 1GZDA 2JIBA 1OIXA 1IATA 4G3XA 1SXJD 2ZBVA 5D7BA 4CLXA 2IOHA 1JYEA 5GGXA 1SMKA 3AFIA 4PN7A 1Y7HA 2GD6A 3GAFA 2B1QA 1JJBA 2PQMA 4NYIR 1KC1A 3BGIA 4D0GA 3IEVA 5ICMA 4V0LA 3KWMA 2ZUTA 3V3TA 5TT1A 2L0XA 2D62A 2A0KA 4AJEA 4MDEA 2W6ZA 1L9XA 3IBYA 4URFA 1PTJA 2PO5A 3I92A 3UA3A 1Z6TA 2QRGA 2WDZA 1NVVQ 3RIMA 3ZKWA 4HFRA 4RD1A 4A27A 3SC2A 3LA6A 1N2HA 4E33A 4CM9D 1S2OA 2OYSA 1X1RA 3U3XA 1E7QA 4HOYA 1K0UA 1KK2A 5KYXB 4XEUA 4QGAA 5LQDA 3JASB 4K9MA 2AFHB 4BFYA 1E58A 1J39A 3IDSA 3BJIC 4RCYA 1PJAA 2NYVA 3T35A 4KLNA 4CETA 3V4PB 3R24A 2H1CA 2I55A 2WSYB 1O0BA 3T7IA 4ZOLF 5AVXA 1QO7A 2FKAA 1SKBA 3AP2A 2DKNA 3N6RA 5DB4A 3RRJA 3OTHA 2PX4A 1QRRA 2JZOA 2P9ZA 2ZRHA 2AW3A 3BMQA 3D4IA 3I2FA 1RYEA 3FJYA 3OM0A 4XB1A 2QLFA 3E0QA 1HBJA 3S44A 3TFQA 4EQ6B 1SQ0A 5LDGA 3OQ1A 1TA9A 4F4HA 3ZE2B 3SJZA 4YX9A 1UK9A 1HE3A 3OI7A 4MSUA 2OFOA 2QVGA 2QVYX 3GB9A 3GCDA 4R51A 3RSGA 3NYWA 1AKWA 3RHSA 3V8NA 3VI4B 1IY0A 2M1ZA 4PBRA 1KKLA 2BFEA 4Z4IA 3RUIA 4KITB 3MB8A 9LDBA 4DTCA 1A2OA 1V8ZA 3V8BA 1PT9A 5JATA 1J0CA 2VHXA 1F4VA 3AFNA 2Q3FA 3Q6IA 2QPOA 4NNJA 3TZBA 5B1SA 3LFUA 3WLFA 2XVXA 1KP9A 3UGQA 5FKJA 3WGYA 1ZUHA 4L8WB 2VT7A 5H7XA 3QXXA 2F9LA 3UCXA 1QUEA 4NENA 2ONYA 4P08A 1W4RA 4ZALA 3G5TA 2F1JA 3VO1A 1E2DA 1U7UA 3PDUA 5FX2A 1EDZA 3KB6A 2GB4A 1FJHA 4WESB 3TRIA 4ILEA 2FU5C 3TI7A 5IJ0A 3KEFA 2CFRA 2AI1A 3FZEA 1MFZA 3OJ0A 3ZHCA 2UXBB 4RULA 3GT0A 2EWWA 3FWYA 1ZIPA 2XF8A 3LBHA 2WYWA 1THGA 1Q1QA 3A27A 1DBQA 2E4XA 2ZKLA 3HBJA 3O9ZA 4KE7A 4MYDA 3TNDA 1OB5A 1DC5A 1R5OA 1ULTA 2ECQA 1H5QA 4JKYA 3D81A 5JS2A 4F4CA 3Q9SA 3DEFA 1WB5A 3OIGA 5IM5A 4OYHA 4D44A 4F2GA 5C8DA 3T7EA 3KQOA 3PX3A 4BDTA 4IG4A 4B4WA 1ZYUA 2OC4A 4I50A 1JSLA 3BHJA 3WK9A 4UBLA 1IWBB 3PQ4A 2FPGB 4BAUA 3DCJA 4EG5A 4QHTA 4OHRA 3JWJA 1MVOA 3AG6A 4URYR 4YUVA 4BNVA 2CMFA 4DR3B 2QX9A 3FFAA 1HYEA 4JODA 4JQOA 3AIIA 4TVSA 2YL2A 1EZ4A 2I2CA 2MMCA 3EK2A 5BT9A 2LD4A 3EFOA 3HCAA 3IC5A 1BDMA 4M1SA 4PO9A 4HDKA 2XDAA 2IV3A 2J6CA 1F0NA 3KYDB 2BH9A 3OZXA 2C82A 2PXXA 2RH4A 4IIFA 5HP4A 4QDKA 3P0JA 3RIHA 1Q0UA 1NJFA 4MV0A 1YJBA 1KFKB 1Q7BA 5JS1A 2X77A 4TKUB 4EHNA 1FS5A 3E1KA 3SXUA 3HPRA 2PLFA 3R9KA 4DRXA 3K0BA 3DMYA 2O2SA 2P6MA 2WVHA 4I5GA 1OGYA 2N75A 2NLOA 2YMQA 3O2NA 4GFDA 2D5CA 5EYPB 1ILEA 4YJ3A 4LBYA 3VPGA 1JDPA 1TIBA 3OZWA 5BRNA 5TQ2B 1LPPA 2DFPA 1Y89A 2RHJA 1TYEB 2GZ1A 3OAAD 3QBEA 1S89A 2FQQA 3K9NA 5ILQA 5JZMA 1ABFA 1Q1ZA 2HDHA 2AYYA 3JS5A 4Y2TA 3I61A 1PZFA 2AEEA 5ESXA 5TE9A 3DKKA 1WX1A 3SMQA 2JLBA 2Q0XA 3TW8B 5IN4A 3VZDA 3ETGA 4LBVA 5TPZA 2DFKB 4Y6PA 1N0IA 3U37A 2IPLA 6LDHA 3EWAA 5LYYA 5CXXA 1RM0A 5CFQA 1JEEA 1FFGA 5LMUB 1VRWA 3BTVA 5KTKA 4KQHA 4RENA 3RAJA 2NO0A 4ZAYA 2JJYA 5TRTA 3A05A 2Q41A 4V38A 5ELMA 1P6UA 2JW5A 1X13A 5HGXA 4XVRA 1B6RA 4RHCA 4KPFC 3TLBA 4YMLA 2BC9A 3J81A 4H6XA 4DFDA 1JA9A 2I1VB 1R8XA 1SVUA 3NGLA 4PS0A 4YRFA 3WRXA 4Y6RA 3VISA 4B6EA 3KYCB 4B85A 2J5QA 3G2HA 2A33A 1B6GA 4WZAB 1NL3A 1N9GB 3IKMB 9GPBA 4G41A 2D0IA 5HMLA 2GM5A 4WV3A 3ZDYB 3NBAA 2V5AA 1LPOA 3OP1A 2VP6A 1RWXA 4KSYA 3H8VA 1YQWA 2E5FA 3AI3A 4KMOA 4M3NA 1UPTA 3TJMA 3TR6A 4QNMA 3UJCA 4M9ZA 1WY7A 4HT3B 1BAPA 1E9RA 1C1XA 2V5UA 3GLFB 3E9EA 4UE6A 1IZ8A 1W46A 4WOJA 3BM5A 4OB8A 1NI5A 2PD4A 4IIUA 2DQKA 4CIBA 2GYYA 4NV3A 5IZCC 1FFYA 2OV2A 4H16A 5B36A 2XWPA 4U4AA 3HMQA 1L5NA 9LDTA 1X7YB 4MEAA 2WP0A 2WBLC 4ATNA 2O8DB 4N0QA 4NECA 3SWWA 1G5HA 3QKSA 1EX9A 3R5KA 2EQAA 5JQGF 5LOVF 2BM0A 2QQEA 4ZGWA 4IOKA 1ADCA 4NQZA 4FJ2A 1TEHA 4KMMA 4P80A 4DA7A 5HX7A 1K1EA 4FDUA 4X1IA 2XOKA 5THQA 4AKHA 1WDLA 3QYPA 4OXRA 1EM8B 3C7CB 3H17A 3ADOA 1KDTA 3BOSA 3GMSA 1K8XB 1XZPA 3FCXA 3QF7A 3LP8A 4ZOCA 3L8GA 2QE6A 1E2HA 1NLZA 1S2IA 4XM1A 4W9NC 4ERXA 1X0VA 4RY8A 3T4EA 1EFLA 5KUTA 1ZJ5A 5EERA 2HYDA 1CRPA 3MCTA 3WY9A 3CRNA 3NI2A 1JBEA 1M9NA 4D97A 4WNAA 4U6SA 3TW0A 4UPEA