3REFA

Crystal structure of ehrho1 bound to gdp and magnesium
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
173
structure length
173
Chain Sequence
GKIENGKKALKIVVVGDGAVGKTCLLLAFSKGEIPTAYVPTVFENFSHVMKYKNEEFILHLWDTAGQEEYDRLRPLSYADSDVVLLCFAVNNRTSFDNISTKWEPEIKHYIDTAKTVLVGLKVDLRKDGSDDVTKQEGDDLCQKLGCVAYIEASSVAKIGLNEVFEKSVDCIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Rho-like small GTPase
publication title Unique structural and nucleotide exchange features of the Rho1 GTPase of Entamoeba histolytica.
pubmed doi rcsb
source organism Entamoeba histolytica
total genus 55
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3refA00
3WMEA 5JWRA 5BW8A 4MGIR 2C99A 2R62A 1C9KA 1TU4A 2HJGA 4BLOA 2A5GA 3AVVA 4ABYA 3U7GA 4O2LA 2GXQA 2ZJ5A 2ZITA 4BLSA 4D4LA 3EPHA 5UKDA 4L8GA 1XXHE 4P4UA 3MLEA 3KJEA 1CIPA 4C0BA 2JIZD 1RE0A 3QKRB 5H70A 1XPOA 1NVXQ 4K46A 2FEMA 3HU2A 2QMHA 2FDCA 2DHRA 2W6IA 4G3XA 4FW9A 4QHTA 2KJQA 1VDZA 3I73A 5JMTA 2J0QA 1T91A 1IBRA 1PVOA 5KNCA 3F3YA 2WHXA 5EQTA 5G41A 1OLOA 2WSMA 1VPLA 5E3HA 4BZXA 4NYMR 1VYTA 5JS7A 3UXMA 1D2EA 1II0A 2QGNA 2WM9B 2PT7A 5AJZA 5IK2A 1TL7C 3TW8B 4TZ0A 1XEFA 4AKHA 2IS4A 4F92B 2RGNC 4D80A 4MUAA 2P5TB 3PCRB 4FI3C 1EX7A 2ZAMA 1NNEA 1MOZA 2BBWA 3H84A 3OF5A 4JVSB 4B76A 1CKEA 1G64A 1L2TA 4MQBA 1X6VA 3W6PA 2FN4A 5J47A 4C4PA 1G4UR 4L15A 3RS7A 3J81k 1KI6A 1NRJB 1BYUA 1OYYA 3CUEF 4WOPA 5SZHB 2C5LA 3KQHA 4OQLA 3P27A 5DO9A 4FMCB 2HF9A 3WNDA 2FSIA 1FX0A 2UKDA 1NY6A 2H7VA 2ZI9A 3NBFA 2DBYA 3QEJA 5CK4A 3ZS8A 4DC9A 3D6TB 4TT3D 4A4DA 1GITA 3B78A 2RB4A 2A2ZA 3GJ4A 3EIHA 3W3ZB 1E9BA 2CJWA 3GJ3A 1OE0A 1LFDB 4RSGA 5DYGA 3FOZA 4YMTA 3VNUA 1NSTA 2QUZA 1E0KA 1JPJA 2PH1A 2QSZA 3LW7A 4A9AA 2BJVA 3IHWA 3FVQA 1GL6A 3OHMA 3I62A 4X8OA 4ZCIA 1C4OA 4B73A 1XFAA 2G83A 2ZR0A 1EFTA 3PUXA 3MD0A 1Q57A 4DLZA 2MSDB 4V03A 4TSFD 1WBBA 4D26A 2WWHA 4KFRA 4M1TA 2H57A 1XMVA 1P3JA 2Q3FA 1KK2A 5JEDA 2O0HA 1Z63A 4LBYA 2W00A 4KFSA 5FTNA 1ZNXA 4MKFA 3NC0C 1KO4A 4ZPXA 4Q1DA 5F98A 2X8AA 1W5TA 4TLAA 2A5FA 4AWXA 4E03A 2Q3HA 3LBIA 4FMBB 2DFLA 4L9SA 5H1YA 5DGXA 3UANA 1US8A 2VLIA 4Q7JB 2MSEB 5FUXA 2GESA 2OE2A 2ZRFA 5L3QB 4D82A 2QMOA 2ZR7A 2HCBA 1II8A 5TV2A 2JLVA 2ZYWX 1YU9A 3K1JA 5FL3A 1YR9A 3REFA 1E2MA 1HT1E 1XD2A 3AEZA 2GAOA 5J4HA 2C98A 1I4TD 2QQ0A 2WWXA 4A82A 5ELXA 3PJRA 3ZIAD 5G3YA 4KBGA 2IS1A 3UWKA 1E2PA 4BFZA 1IN8A 1KAGA 2BKUA 2B7BA 2GEDA 2H17A 3SBDA 2GCOA 1Z06A 2XJ9A 2CCGA 1HURA 4N0DA 5FOVA 4MGYR 1YQTA 4MRRA 2Q0HA 2YVUA 2YC2C 4UJ5A 2ATVA 1ZU4A 4ITRC 5CITA 1FPMA 2C95A 3QVUA 4HDQB 1UPTA 1NJFA 1Z0DA 5AR1A 4AIIA 3IGFA 1K6MA 1RFLA 3KFXA 2KI5A 2R6CA 3HR8A 3WP1B 3PITA 3REGA 2OCAA 1NL3A 4ON9A 2BMEA 2Q9BA 5KSZA 2BCJQ 3EA0A 3GJ6A 2CEAA 3KTAB 2F7SA 3MMPA 5DI3B 4ESVA 2IW3A 2GETA 2IUTA 2KB0A 1UEJA 3UKDA 1W49A 2XX3A 3IKJA 1AA9A 1IOZA 5BYJA 3CWQA 4RD2A 1CXZA 3GQBA 1P5ZB 1TUEA 4MYTA 1E1RA 2OAQ1 2OV2A 2QPAA 1OH7A 3DMNA 5HKKA 5GADl 1QDEA 3S1AB 2IA5A 3BD9A 2J0UB 3Q3JB 4HDCA 2F43B 1PUJA 3OIVA 4MA4A 5FR1A 3DPUA 3IQWA 1FP7A 4H9GA 3LQQA 4CDGA 1N0WA 1MO4A 1B23P 4PC7A 3GLHA 3Q9LA 1G16A 1V5WA 4QGHA 1SVWA 3Q7QA 2VRWA 1R0ZA 1GOTA 3OEHD 4CGZA 3GLFA 1H8HA 2WMNB 4PPQA 1FNMA 3T35A 1AN0A 3NBYC 4B74A 3BH0A 4UXJA 2BV3A 4W5WA 4HATA 5KUTA 3MG9A 1LTQA 2B92A 3B1VA 4N0EA 4LV5B 4RFVA 4D81A 1G20E 1T3LA 4D4JA 1QHIA 5JWHA 2YOHA 2D74A 2IBMA 4PAOA 2ZREA 4TWZA 5AWFC 1OH6A 1CTQA 4BQSA 1EWQA 4V0ME 4CRWB 1G17A 5EZ6B 2XNDA 1KK1A 2ORVA 1SZPA 1D9XA 2LKCA 1Q1QA 3UMFA 4PTLA 1X8LA 2X2FA 4Q03A 4FMDB 3IPXA 2OBLA 2R44A 4TLCA 1TF2A 1Y63A 2YV5A 1UBEA 3E70C 1LS6A 4IXMA 2HYIC 3K0EA 2CL7X 1TU3A 3GD7A 1XWIA 3QF4B 1XTIA 2AL7A 3CRMA 4URUR 1D8TA 1YZTA 3OIYA 3I5XA 4DSNA 3U5ZB 3GEIA 2F3TA 1XEWX 4M9SA 2D2FA 2JIZA 5F2EA 2X2EA 3LW8A 1Q22A 2AN9A 1HV8A 3MCAA 4F4JA 5IF9A 3CZPA 3DMDA 1XEXB 2DFNA 4LSGA 4Q4JA 5KU1A 3AM1A 2VO1A 3HR7A 3RAPR 3IIMA 1G7SA 4OQMA 4EJSC 1M2OB 4YMWA 1NN1A 4ACBA 3NHAA 4LJ7A 1J90A 2G6BA 4PSKA 5SZJA 4C7OB 3VKWA 1D2NA 3BRWD 1S1MA 1TTTA 1G7RA 1Y3AA 4FCVA 3CPHA 2XAUA 4LX0A 3JVUA 4GP7A 4BASA 3ZD7A 2CCKA 4LBWA 2F3RA 5G40A 3RYTC 2YKGA 3SYLA 2J7KA 1DADA 2NOAA 1KDRA 3KJGA 1UBGA 2BMJA 3AB3A 2IF0A 3ZH9B 3HU3A 1LW7A 3SN6A 4RD0A 1RRFA 3WNBA 1SVIA 4DBLC 1OHHD 4NHOA 1G8FA 2NQ2C 1TNDA 4TLBA 1CR1A 4Q1AA 4JBXA 3GLIE 4TLDA 2ZM5A 2UVQA 1UDWA 4B71A 2NPIA 4CW7A 5CLQA 1JQLB 4IKEA 4CEIB 3CX6A 1ZP6A 4NE2A 2QY9A 1NSFA 3EIQA 3VHLB 5DHFA 5CB6A 3RSLA 1EESA 4IEEA 4B3BA 4XIGS 1NG1A 5EE9A 1GNPA 3NVAA 5L3SB 3IBGA 1QRAA 4HUQB 1DAHA 4IOLA 4EFMA 4PHGA 3KB1A 1NMXA 1J2JA 1SVLA 5FFMA 2AKYA 3TAUA 1VG8A 1ZVQA 1ZW6A 2XB2A 2EVWX 3BB1A 3EWSA 3HDTA 4ZDJA 4M1WA 1S1CA 4UNNA 1XTQA 2G9NA 1MO5A 1HY3A 4M9XA 2GTPA 4JLJA 2J87A 5EUMA 2JJ2D 3LBNA 1CLUA 5CK5A 4CZ2A 4PPGA 3BE4A 4RCYA 4UNSA 3NC1C 1KSHA 1JEDA 1F2TB 1SXJC 4PPFA 2WOOA 5CIWA 1W0KD 1E0SA 2XSZD 5F3WB 1KKMA 4R7ZA 1CRPA 2FPKA 5F9FA 4QHSA 1FZQA 1N6KA 1ZC4A 4LYHA 4LBVA 2C2HA 4ACAA 1UM8A 1G3QA 1A1VA 4M0LA 3BFVA 2NO7A 4BRUA 5DE3A 2GCNA 2GJ9A 3CX8A 1Z0JA 3KKPA 2YOGA 3WMFA 2EFGA 3TGPA 3ETLA 2ZRKA 4W5JA 1AQUA 4BFXA 1CBUA 1E1QD 1JAIA 1YJ5A 4RD4A 1LV7A 4DWJA 1E9SA 3SR0A 2O0JA 5FBRB 4BFWA 4HLCA 2BDTA 2QAGC 1NMYA 1ZYUA 4BEJA 5KHOC 2FH5B 4PX9A 3ZIAA 3GLGB 3X2SA 1UEIA 3Q85A 3TUZC 4YMUA 2FOLA 3AVPA 4UJ3A 3MJRA 1IAQA 1S2MA 4QJ3A 3BK7A 4RZXA 2VHQA 3SEAA 4TMKA 5EUQB 2F55A 1DAMA 1RYHA 1AGPA 4Q1EA 2GCPA 4MRPA 2V6IA 4Z1MD 3JZMA 2REBA 1UKYA 1TAGA 1U8ZA 2FSFA 2X19A 1KKLA 5EE5B 4C30A 4LJ4A 3WRXC 3OEED 2CL0X 3L43A 5FPYA 2D2EA 1KI6B 3AF2A 3BGWA 4QL3A 5JCPA 2ZI5A 4A0HA 3U61B 1BO6A 2IUSA 3O8DA 4HLUC 4IOJA 2HJVA 4JVLA 5L3QA 4A6XA 5KNBA 2R6AA 3ZZTA 3LBHA 4TMTA 1FX0B 3A8TA 4PANA 5LDDC 4HB3A 1DAKA 2W6ID 4OI2A 3VMFA 4EIWA 2O5VA 1KOFA 3ZYCA 1W36C 4H1VA 1EFUA 1KZ7B 2QORA 2QP4A 3EIEA 3X1XA 4TQUS 4EJSA 1GP2A 5KNDA 3SJBA 1E2QA 1GKYA 2R8RA 4YC7A 2WSSD 2YWEA 3A1WA 1YZNA 5C46F 4CEJA 1FP6A 2O52A 2VP2A 3FGNA 1Z83A 3ADKA 2F9LA 1X8JA 3B1YA 4LCBA 1NIPA 1MV5A 3KKNA 1W4BA 1XTSA 4TMWA 4ARZB 3TK1A 3QKSB 3DKVA 4KFUA 5JEEA 3MJHA 3OEHA 1G5PA 4MH0R 5F9HA 5L3RA 2CVHA 1KAOA 3WYFA 4MYCA 3QPWA 1DAGA 2VYFA 4O0MA 2A3RA 2EU8A 5B2ZA 2VP6A 4AKGA 3QOFA 4KSBA 1Q0UA 3QQ5A 1N2CE 1KMQA 4EPWA 3EC1A 3KTAA 2QMUA 2FPMA 2OO7A 1JJ7A 1D5CA 1GAJA 5LD2B 4LGMA 2Q6TA 1Z6TA 2AK2A 3U6BA 3CNOA 4TL9A 4HSEA 4N3NA 1OPXA 1GTVA 3H4MA 4IW3B 4WW0A 3PV0A 2WAXA 4IJMA 1KSGA 3DL0A 2JAQA 3B8HA 1G18A 1XD2B 3UG6A 1GVNB 1GL7A 4B35A 1A7JA 4XOIA 1U9IC 5K8LA 4RD3A 2F43A 4C3ZA 2AFIE 4YXWD 2VEDA 5G53C 2ANBA 4D25A 1VCIA 1XMJA 4HUTA 2IUUA 3LV8A 5CB8A 3U60B 1SXJA 1EX6A 2WJJA 2A7QA 3BB4A 3W5IA 3DM5A 1YRAA 1OIVA 3P32A 3P4XA 5BYKA 2PCLA 3TQFA 4DXAA 4US0R 1U81A 2O8FA 3SU8A 2QL6A 2O8EA 3EZ7A 4Q4HB 3T12A 1HQYE 3ZDQA 4QJ5A 5C18A 1NN0A 1R2QA 1WP9A 3U44A 4PQRA 1ZU5A 1XJCA 3KUDA 2WV9A 4IVQA 2BWJA 5BN5A 1HA3A 5DISB 2V8OA 4EDHA 1ZBDA 4A2WA 1U0JA 3R9XA 2AD5A 5FPSA 1YZKA 1KDOA 2AX4A 4WBSA 4AG5A 3FMFA 1UBFA 1TQ6A 4TYPA 4OK6A 3ZVRA 3BH6A 5FOXA 3K0CC 1VG0B 2VHCA 2WAYA 2HXYA 3B60A 3LX8A 5CYPA 2C78A 4PXAA 1ESNA 2XXAA 4GMDA 2WMOB 3M4YA 1GM5A 2Z43A 1DE0A 2J0SA 1ZNYA 5JECA 1HE8B 1N0VC 2X1VA 4QGFA 3TSOA 4LK2A 4QNRA 3GLHB 3U7FB 1DBSA 1AIPA 1AS3A 3BWDD 4JJZA 3CZQA 1XEXA 4NBSA 1Z6AA 1D2MA 1AS2A 3FFAA 1OIWA 3K8YA 4LJAA 1E2FA 5BQ5A 4HLUA 3GLFB 2FU5C 3SFZA 1T6NA 4I1SA 4ASUD 1XCGB 1WF3A 1HYQA 1YE8A 5HE9A 2Z4SA 4TL8A 1OXXK 4PHFA 2FV8A 1DVRA 3HP1A 3FHTA 2WKPA 2QRZA 5FL7D 1G41A 4HB0A 5EP3A 4LY6A 1R8QA 2SHKA 5BXQC 1G3UA 1UKEA 2AR7A 3T06B 2ZJZA 4M1OA 2IWHA 5AJWA 2D06A 2RGAA 2JLWA 3R9WA 1Q21A 3RS0A 3MWYW 4MKHA 1DO0A 5KSYA 3LVRE 4EPYA 2QPOA 3I5YA 3U7HB 2NG1A 3CR8A 4MKIA 1ZAKA 4GRAA 2H92A 4Q9IA 4BZPA 4CEIA 2HLDD 3QE0A 3WHKA 3CF2A 2QPTA 3WXMA 3L0PA 1PZNA 2C8VA 1O87A 5D3MB 3TSWA 3QPVA 1R10A 3I4LA 4NMMA 4DCNA 2NO9A 3I61A 2KWIA 1JR6A 1Q3TA 1KDTA 5JHGB 1NKTA 3B13B 1P6XA 2JDID 5A4JA 1QHHA 2J0VA 5GVRA 3QPUA 1BOFA 2RHMA 4IEIA 4Q4JB 3T1QA 2YWFA 3RDPA 3SBEA 3QI2A 3DO6A 4JL6A 3WNCA 4FIDA 3OFND 2C04A 1L4UA 2G0TA 1F2TA 1Z5ZA 3AQ4A 3TLXA 4A6PA 5K8UA 5BN3A 2V1UA 3W3AA 2D7CA 2QMEA 1FNNA 1WA5A 2QEQA 1SHZA 2VIIA 2ZRIA 4Z1MA 1I2MA 2FNAA 4TMVA 2DFTA 3U7EB 4WVFA 4B3DA 3OEEA 3IO3A 1G19A 3RNLA 721PA 2FF7A 2K5UA 4NYIR 1U94A 2ZJAA 1EFCA 4PQFA 5B30A 3JZAA 2OFOA 2ONKA 2R65A 1XEWY 4DLUA 4KYIB 1E69A 3AVQA 3R7WB 2R9VA 4G0NA 4U7DA 1XRJA 4BWYA 4QGGA 5JRJA 4TYYA 3CIOA 3CONA 4RZUA 1CRQA 2V7QA 5AJYA 2GZAA 3EZ6A 2BBOA 5KDLA 4NZYA 2PCJA 3GLGA 4XTRA 1CJKC 2VH5R 3QXXA 3DOEA 2EFEB 2W83A 3VU9B 4LUCA 1IJEA 5ANRB 4DT1B 1R7RA 1DAEA 2IT1A 2ZSAA 5FOUA 3RRYA 2VF7A 2WSSA 4C0SA 2P5SA 3EZ2A 5CDFA 5TVKA 3MWLA 4FINA 5JI3E 3F5FA 2AFHE 2NMVA 3FKQA 3BFXA 1NVVQ 4QFMA 5FOWA 4BUJA 5FTLA 4OBEA 1WCV1 1E0JA 3K0CA 1P2TA 4IOMA 2IYVA 2GILA 1KI4A 3K9LA 3LXXA 1X1RA 5EE1A 2QGZA 2J7PA 4QOSA 5TARA 4OK3A 3VFDA 4OI4A 2B8TA 1EK0A 4NU0A 1XPUA 1TMKA 4HLQB 5DSZA 4G5QA 3BOSA 3TMKA 2MMGA 2VHUA 2VSOA 4C0LA 3KKOA 5K8IA 2GVZC 4IDNA 2XB4A 3PENA 4GT1A 4OHZA 2JCSA 3T5GA 3VR1A 2HV8A 2JJ8A 2FMXA 1RZ3A 3OAAD 1KNXA 1G5TA 2ZI6A 3BS4A 1JAHA 3C4JA 4LV6A 2FA9A 4LBZA 2NPFA 5JJKA 1PLJA 1GNQA 2P0EA 4KAXA 4PZYA 3A4LA 1PV4A 3G0HA 3AGQA 4YXWA 4AURA 1M8PA 1X3SA 1R5BA 2DWPA 2G88A 3AGPA 4V0NA 1GRNA 3T1VA 3HJNA 4D0GA 3FTQA 3NHBA 2ZVQX 3FYHA 3MAAC 4ARZA 1G1MA 5DIFA 5AUNB 1G3RA 1G7CA 3H86A 2QG6A 1VIAA 2ZRCA 3QKSA 2XGJA 1NIJA 2AKAB 2CLCX 3VR5A 3ECCA 2VHJA 1ZCAA 4XSGA 1K5GA 2G3YA 3UPUA 1N6NA 3C7KA 3PEVA 5JRZA 1MT0A 3GJ0A 1P9RA 4TQAA 1EFRA 2Q3MA 3MUFA 3QUSA 2YZ2A 3KQKA 2E87A 2IHYA 4K81B 3GJ5A 2ODNA 4Q18A 4Z8YA 4UNRA 3LXRA 3ND9A 3PXGA 3TVTA 1VKJA 3B2EA 1IY2A 4HLDA 1XB2A 5DLQC 1KI8A 1VG1A 2KBEA 2O8CB 1KJWA 2NZ8A 4ILEA 5EP1A 1G3MA 4YMVA 2JEOA 8OHMA 2O8DB 1GKUB 2ODWA 3P26A 1CU1A 4NH0A 4EJSB 1X86B 5KDOA 2ZYUX 3PQCA 2IYRA 821PA 1E6CA 4JBWA 4JLDA 1UBCA 1KSJA 1ZM3A 2GEUA 1VG9B 2QSYA 4NP6A 4CEJB 1FTNA 1P7CA 4L4UA 4KLNA 1ZM7A 3ASYA 1MABA 3WHLA 1E2GA 2DFKB 3FMIA 1WDTA 4Q4HA 2CBZA 5JCZA 3W6OA 4ESHA 4DLTA 1W0JD 5K8TA 2I1QA 2FWRA 3AKEA 5KDDA 2BJWA 3UG7A 1F60A 5FI1B 4PC2A 3VNVA 4KODA 5LBIA 4RKFA 4GMXA 4HI0E 1HEIA 1KHTA 2CK3D 3BJIC 4LHVA 4ASUA 4HB2A 4NYJR 3TE6A 3X1DA 2FFHA 3NIBA 3SS8A 2PL3A 5FL7A 1QF9A 1LS1A 1ZD8A 2XOKD 3L8ZA 4DB2A 3A4MA 1Z0FA 2AK3A 4Q4AA 3QG5A 2IWRA 1QVRA 3DZDA 5LB4A 3VTKA 3CW2A 1IN5A 1JI0A 4HB4A 3CB4A 4KI0A 2RGCA 4YDHB 3IUYA 4DIDA 1E2DA 3B1ZA 2YINC 1E2IA 3P20A 2ZS8A 2RGNA 2GJ8A 2JASA 3EC2A 3PEYA 5J4KA 1NBMD 2J41A 4ZCMA 3U3KA 2G1JA 3GFOA 2BBSA 1W7AA 1SXJB 2HLDA 1SVKA 1RC8A 3H2YA 3CBQA 4MYUA 2EWVA 5EE3A 3EPKA 2ZSBA 2Q21A 4CEHB 4LPKA 1XPRA 3CWZA 4WAUA 3KQNA 2O8FB 2O8EB 1IJFA 4Q47A 4B32A 4B3FX 5AK0A 3DKPA 2JDIA 2NO0A 1GILA 4Q48A 5GVSA 2W2TA 1GRQA 4HZUA 1G21E 3U44B 3AH8A 4I81A 2BEJA 5DNYB 1EXMA 1L7VC 2EWWA 3SQWA 3PUYA 1N6LA 3CH4B 3ONWA 2PZEA 2VL7A 3K9GA 1TX4B 3LQRA 2HF8A 3OFNA 3FHOA 4RZ2A 4RJLA 4UXIA 2RAPA 4M1MA 5FTJA 1KO5A 4QGAA 2QP3A 2WPDD 3K9NA 2QAGB 4AKEA 4BLPA 2YWHA 4JVNA 3L2OB 2IX3A 3I1FA 1VECA 1OF1A 3THYB 1G9XA 2HYDA 1DAFA 1JR3A 5HPYB 1P9WA 4DDUA 3FDIA 2J5XA 4WXPA 5CYOA 3QXJA 3V00A 5TB5A 1SXJD 2HT6A 3KDSE 4HZIA 2CMKA 4NDZA 3RABA 4M9ZA 2IYTA 1Q3HA 4TLEA 2XXAB 2VF8A 2MSCB 5D3MA 5EXPA 3A36A 1CR2A 2B7CA 2WJVA 1ONBA 2ZYTX 2WJIA 4AG6A 3A37A 3QKTA 1J70A 3BXZA 3KJHA 2IYWA 4KITB 3W8RA 4F93B 1N6HA 4GI7A 3BFKA 2EFCB 3F8TA 4FMCF 2P3SA 5BWMA 2J59A 5L8VA 2P6NA 2VBCA 3T34A 4BFSA 4Q9HA 3W8NA 1F5NA 2ZE6A 3K09C 4DLWA 3AP2A 1ZIOA 1XXHB 4EPRA 2ZANA 4H1UA 1T0HB 5KTYA 1ZUNB 1OXUA 2Z83A 4PQYA 3TR5A 1M7BA 2LKDA 3LRPA 1W36B 2WIBA 3BC1A 4V02A 3RC8A 2KBFA 2Z5FA 1F2UA 4LJ5A 4OI0A 3K0FA 5FBVB 1TUIA 2AXNA 3LX5A 5FBLB 2OT3B 1MO3A 5HCNA 3NH9A 3MWKA 2GF0A 3ZVLA 4PC1A 2CE7A 2YJTD 5EZ5A 2C03A 1OIXA 1GKIA 1XNJA 4F4CA 2ZJYA 1V43A 3R7WA 3QJYA 2GEVA 3EX7C 3IILA 3FHCB 2RGGA 3RRNA 4NL4H 221PA 4AI6A 2FFQA 4B43A 4XTCS 1IY0A 1U98A 4M1SA 2PZGA 4NCNA 4ZIRB 2ZRMA 5KPDA 3A58B 1R0YA 3OAAA 5AUOB 1KI9A 3AVTA 1TEXA 1W48A 2A78A 3EW9A 3VU9A 3WRYC 4DT1A 5FR2A 5GJVC 3KKQA 2CNWD 2JJ1D 5JSZA 3GLFE 5J4VA 1QHHB 1I4DD 3K9HA 3BERA 4FCTA 2C9YA 2I1VB 2OHFA 3BBPA 1Z3IX 2ODBA 4JLVA 2ZRLA 3E5HA 4POAA 3IEUA 4DLVA 1ZRHA 4JBYA 2QTVB 2YOFA 3QVVA 1W36D 2RH5A 1XTRA 1ETUA 4PHHA 4EPTA 1FQJA 1E98A 2ECKA 4JMPA 1P72A 3O47A 3HYRA 1UJ2A 2RHDA 3GJXC 2O0KA 1DEKA 2QT0A 3ZZUA 2JLUA 1MKYA 1N6PA 3SC3A 1R0WA 3TNFA 2V6JA 4XD7D 3LWNA 1R5OA 1ZM4A 1AQYA 3A1VA 2OFWA 3SHFA 4PR0A 2XZPA 2OXRA 2ATXA 1IXZA 2WZQA 1QHYA 1DOAA 2A5DA 4QBGB 3U4QA 1W46A 2WICA 4P32A 621PA 2HUPA 2GKSA 4RVCA 4QM6A 2FFAA 5CJPA 1RIFA 4QXAA 1M6NA 1IXRC 2GK6A 5E7JA 1OH5A 4IVPA 1T8TA 5LPNA 4KXFB 3B85A 4JKYA 2IL1A 5TDHA 2ZAOA 3NH6A 3X1YA 2WWWA 2IS6A 4QBIA 4M1KA 2VQSA 1ELOA 4QG7A 2OBNA 5HE8A 3L0SA 3PUWA 3HYTA 4A1FA 2GK7A 2VP9A 1KMHB 3D7MA 2O8BB 3CLVA 1NVUQ 2GHIA 4B47A 3IPYA 2GJKA 4DIEA 1XX6A 4JLKA 4M2LA 4Q7KA 3CRRA 4Z8XA 4ZDIA 1W4AA 4OK5A 1W0JA 4LYJA 2ZRJA 4W7SA 3PUZA 3FWYA 1P61B 2FJUA 1OXTA 4KBFA 3GMTA 4LWZA 4FN5A 4BLQA 3QSYA 1KJYA 2XZLA 3WP0A 2CK3A 4F91B 1P4SA 3NBZC 4LV8B 1G291 4F38A 5EXTA 3LA6A 4TYWA 2XOKA 1CF4A 1RYFA 3T15A 2O8CA 2ZRPA 3KB2A 2HEIA 4BPBA 2RGBA 1GDDA 1XZPA 2V7QD 4IDQA 1EG7A 4R2HA 2NZJA 4A2PA 3TUIC 1ANKA 3K09A 4KCGA 1HH4A 3DVLA 3IQXA 2O8DA 3NKVA 4PO9A 1W4CA 4TL7A 2E1RA 1VHTA 3SOPA 3CX7A 2EYUA 2HCJB 1DELA 2TMKA 4C2UA 4LJ9A 2G77B 3NBXX 5CJ2A 2FFBA 3WBKA 1N5JA 1F48A 2GNOA 2WWIA 1UFQA 2WKRA 3C5CA 5C4GB 4A15A 2NTYC 1RJ9B 3B1XA 1NBMA 4C0JA 1E9AA 4FMDF 4E09A 2IYQA 3ZZ0A 1KO7A 1TPZA 1W47A 1OFUX 2ZPTX 4PAMA 1JBKA 5C2JB 4LHYA 1OYWA 3RS2A 2J7PD 4BFUA 2N1BA 1E4YA 3K70B 2GZHA 3R20A 1IN7A 3LFUA 5B58C 2FX3A 2J46A 2JLRA 1I2DA 3VX4A 1W1WA 5HZKA 1U90A 2IXGA 4CT5A 1G8PA 3QENA 1FUUA 4LDJA 4AD8A 1P2SA 2IEZA 4EQ6A 4QM7A 2WPDA 4M21A 2GXAA 2ORIA 1QHXA 3AVOA 4P33A 2GWHA 3KX2A 4Q5IA 1MO6A 4OJQA 2P2LA 3TH5A 1Z22A 1U8YA 4JS0A 4V0OA 4MDFA 1A2KC 1XD8A 4FXPA 4D2IA 3TJZA 1ZCBA 3U3JA 2P65A 1NG9A 1IQPA 1JEEA 4OHVA 4LZZA 3ZGXA 4CEHA 3AVYA 1NLYA 2BCGY 1MABB 2GBLC 4EKDA 2W0MA 2WJGA 2D7DA 3KKMA 3K70D 1JQJC 1S8FA 1CS4C 1S9HA 1XD9A 2ORWA 1C1YA 3GEHA 4QC2A 2JLXA 3AP1A 1WMSA 4DCTA 5CLLA 1EFRD 3ICQB 3Q5EA 3CRQA 1XF9A 1WB9A 2DWQA 3L8YA 4QNMA 4MRNA 1XJ0A 1VIYA 1Z47A 3A4NA 3B7GA 4JYCA 3NXSA 3SQXA 4URXR 1WBDA 5KYKA 2QAGA 3QKUA 3VAAA 3I72A 3MSXA 1YZQA 4GZLA 3U3RA 4HAWA 4Q4AB 1XTKA 5E95A 2QENA 3THYA 5C4MA 4EPXA 1MR3F 2BMDA 5L3VA 1XP8A 1UAAA 1UF9A 1N3BA 3W34A 1QHSA 1CR4A 2CHGA 1U8AA 1KI2A 3R8FA 1GUAA 1CJMA 4JKIA 5KSPA 4DDTA 5FBWB 2J9RA 4JLBA 1EWRA 3U6KA 1T0JB 2ZRAA 3Q8XB 4LJ6A 4PHTA 3EZFA 1CJTC 1YR8A 3KL4A 3CKLA 1QG4A 4OQFA 4CF7A 4DLXA 3AF0A 4WZ6A 2PT5A 2VP5A 2J45A 1BH2A 2VP0A 1TADA 3RWOA 3EZ9A 1JALA 1BMFD 1LNZA 1DARA 4KVAA 4PC6A 5FOSA 4BGDA 4BE7B 2QRNA 4OHXA 1XXHA 5LB2A 5E7MA 2CNWA 2JJ1A 2NO1A 3GLIB 4XWAA 4Q7LA 5FH9A 2BMFA 2V55B 3SJZA 4DUGA 5IRCD 5J40A 5G3ZA 3CH5A 2B8WA 5FI0B 2CDNA 4HZUB 4AYWA 5JHHB 4GSYA 3TVDA 3CF0A 3K0AA 5EP4A 3NDBB 1AS0A 3G5UA 2A9KA 1O3YA 5JWOA 4PO8A 2A30A 2IF2A 3RHFA 1OFIA 1T3HA 2H1LA 2W58A 3P1JA 3VX3A 1J8YF 4B33A 4DSTA 3IIJA 4XD7A 3THWB 1YZUA 1NVVR 4IDHA 4GFDA 3K70C 4GOJA 2R6GA 3PVSA 2AXPA 1AKEA 1Z28A 2A5JA 2OM2A 3CM0A 4DCSA 3HPQA 1ZINA 3B1WA 1E9FA 2ZRNA 2JA1A 2BVNA 2UZ3A 2X77A 1GRRA 1SXJE 3PFIA 4ZIRA 2GVDC 1PUIA 1S96A 1DS6A 4FWIB 4O2RA 1EGAA 3OZXA 4HAXA 2NGRA 5J4LA 2W2XA 3R9IA 3EXAA 2IC5A 2N46A 2PMKA 4II7A 4X8HA 2IEYA 1VHLA 3GFTA 5GJWC 4HAUA 4B44A 4DDVA 2IK8A 2BC9A 3MRSA 3QG1A 4HDOB 1ZD1A 4FWTA 2GZDA 2QA5A 3K53A 3SE0A 3W90A 4KO8A 4G5OA 1U9IA 2JATA 1NLZA 2GF9A 1OSNA 1HQCA 1E2LA 1F6BA 1LY1A 1Z08A 4QBFA 1M74A 5FOTA 1F2UB 2PBRA 3GEEA 4HAYA 2HDNB 3X1ZA 1IHUA 3IBYA 2CHQA 1JR3D 3K0FB 4KJZA 3NWJA 1E99A 1MRSA 5FPHA 2OLKA 1E3MA 4Y0VA 4A2QA 3RS5A 4GOKA 4JL8A 4KVGA 5EE0A 4M8NE 1KY2A 3TR0A 3PEWA 1CEEA 4AY2A 3ZD6A 2GBLA 5A0FA 1S3SA 2FZ4A 2OBMA 2PLFA 2FG5A 3QXCA 2R2AA 4D4KA 3VR6A 4R71A 2J3EA 5FBQB 2HT1A 4QKQA 1QHNA 1YR7A 1ZNZA 3O8CA 1A5TA 4DKXA 4EUNA 2JLSA 4W5HA 1JXMA 2ZE7A 4LHZA 5DI9A 4Q19A 3P4YA 4XH9B 2H8KA 3D31A 1SGWA 3AF3A 3RLFA 4L16A 5JSZB 1JNYA 3B5JA 1KMHA 1SVMA 4MRSA 4IOKA 4B3XA 3GPLA 1KNQA 4A0RA 2O8BA 5JJLA 2KE5A 4JSYA 4PZLA 5J4YA 2QBYB 1KSFX 2EFDB 5E4FA 1HUQA 1BIFA 1XU4A 4U00A 3TKLA 3W6NA 4ZKDA 2ZU0C 4D0LB 1ZM2A 1WRBA 4PSAA 1H65A 1HE1C 1NI3A 2ZS9A 4LRWA 5HR5A 2WJYA 2BM1A 4TQ9A 3UMSA 4B6EA 2EYQA 1XBTA 4QJ4A 1U99A 3KQUA 1TF5A 4WZAE 2AHOA 1N0UA 3SYNA 4CVNA 1S3GA 4I99A 2W0SA 4D4MA 3IEVA 2CE2X 4B2IA 2CLSA 2ZSDA 3KQLA 4TZ6A 1UKVY 4IDOA 1GSIA 4MGZR 2YNMA 5KPJA 3U4QB 1U2RA 4TN1A 2CHVA 4EPVA 3NEYA 5J5CA 2PJRA 4RD6A 2VHTA 3M1IA 4HYYA 4C0KA 1AM4D 4BFTA 1RRPA 4TTPA 4NCIA 2D4HA 5AJVB 1IM2A 4HEJA 4XSHA 2ONJA 1E9RA 4O3MA 1FMJA 2VTKA 4C0AC 1GNRA 4FCWA 3A6PC 1W2HA 2XTNA 3E1SA 1G8GA 3UIEA 4TMZA 4I4LA 2EQBA 1RJ9A 1N5IA 1ESMA 2JLQA 4UXHA 5HCIA 2W2VA 1N25A 2QT1A 2MMCA 3WMGA 3AP3A 3Q7PA 3JVVA 1T5IA 2QQEA 3ADBA 5JZVA 1A4RA 2WIAA 4LOAA 1R4AA 3KXIA 1SKYB 3THXB 4P4TA 1ZD9A 2QI9C 3C41J 4DRZA 3FPAA 3OE7D 3RRZA 2AWNA 2GXSA 3CPEA 2CVFA 1K8RA 5FUVA 5IT5A 5SZIA 3T1TA 3FB4A 4P4SA 4LJ8A 5DYIA 3RVBA 4PFSA 4PO1A 3EA5A 4B6FA 3SFVA 1SVOA 4ZV4A 1KO1A 1YRBA 3KXKA 2QTFA 4MYHA 1S9DA 4JL5A 4ZI2A 2OZEA 4LC1A 1Z29A 1U0HC 5DN6A 1M7HA 3T1OA 1R8SA 4NYIQ 1YVDA 3GJ8A 1YHNA 3N5CA 4DLYA 4L9WA 3CNLA 2H16A 3PR1A 4LJYA 2AD1A 2YWGA 4XWKA 2XITA 1FUKA 3HPRA 4BZQA 4Z54A 3I3SR 1YKSA 4JLNA 3CPJB 3FKSD 2WWYA 2F1RA 5FPKA 2R6DA 1OKKA 1CULC 1WXQA 4S35A 4GP6A 4F7WA 4V0MA 3GLGE 3X1WA 4QHYA 3PEUA 1KIMA 2PZFA 3RANA 2QU8A 5B57C 5AUPB 3VR3A 1ZUIA 4L5BA 2ZI4A 5EJEA 2ZRHA 4CT4B 1Z2AA 2ZQ5A 2I4IA 5IDVA 5CDFE 4MDEA 4JZKA 3GJ7A 4DSUA 4NYMQ 2WKQA 1Q20A 1OV4A 4RZ3A 3ZLJA 1CR0A 3OIUA 3U2QA 3ICEA 1NN5A 4KLZA 2C9CA 3BAFA 1BMFA 2EFHB 1EFHA 5DH9A 3L82B 2DCUA 4OYHA 4P31A 3DHWC 1L4YA 5FTMA 4U02A 2IYXA 1KO8A 1Z0KA 2Q9AA 3LAWA 4CIDA 1Q44A 3NTUA 1E2NA 1Z6GA 2JLZA 2WVJA 5AJXA 5JS8A 1BS1A 1FTSA 1WQ1R 1TQDA 1S4QA 4KYUA 4GOXA 5DHAA 4KV9A 4AYTA 3BIFA 3LO5A 2P6RA 3CRW1 1Q1ZA 4IFEA 3SZRA 2DR3A 4DB4A 2H5EA 1COWD 1Z2CA 2ZR9A 4EQ6B 3DM9B 4JLMA 1ZJ6A 5TY0A 4LC0A 2FEOA 1AK2A 2ZRGA 4BFVA 1FL9A 4URVR 3PG5A 4BFYA 3DDCA 3M0EA 1A2BA 1DG3A 4A0FA 1T8UA 4Q1CA 2QE7D 3N70A 4B2LA 2W6JD 2JGNA 3HU1A 2ZSEA 1KJZA 2RGEA 4N1AA 2PX0A 3FE2A 4D6PA 1KI1A 5HTKA 4YQFA 2ZIAA 2OCYC 3PUVA 2FSGA 4URYR 2QROA 3VQTA 1SHKA 1XCMA 2WTUA 1HTWA 1GWNA 1GFIA 4MKGA 1Q12A 1E4VA 1NP6A 4GBMA 3ZJYA 1QHGA 3GLIA 4QRHA 2BOVA 4PSVA 1K5DA 4WA7A 3IO5A 1BYIA 3F0TA 4LI0A 5BN4A 1RRGA 5FPTA 2VSXA 2IYYA 2QM8A 2QZ4A 3TIFA 2V1XA 3T61A 4RY2A 3CO5A 4XJXA 4Q66C 4KSCA 1L8QA 3C8UA 4JSTA 4Q9KA 3LLUA 5JI2E 2VA8A 3THWA 4Q7MB 4BLTA 2ERYA 4ZO4A 2RKOA 4DHEA 2ZI3A 4HAVA 5H68A 1VCOA 3B6EA 2PMDA 3AUXA 2ZJ8A 4NCHA 1TEVA 3B9QA 1FFHA 2ZE8A 1ZNWA 4OI1A 1OH8A 2WWFA 3SNHA 4NCJA 4XVUA 4A8JB 2REOA 4Q00A 3UATA 1H8ED 2IXEA 2ZSFA 2EW1A 1T3SA 3FMOB 4A36A 1ODFA 3N2IA 1OW3B 3TQCA 2QM7A 3I92A 2BKEA 4V0KA 4YMSA 3W9YA 4A0GA 1R6BX 2BM0A 2CXXA 1T4GA 3QBTA 1P2VA 4AC9A 2RCNA 2XJ4A 5CM9C 1DTSA 1VMAA 3AF4A 1PJRA 3A1UA 1AZTA 3K0AB 3GFPA 1W44A 3ZS9A 2ZU6A 4DLRA 3K0SA 3OESA 1XJQA 4NYJQ 2WJHA 4RFSA 1DPFA 4Q02A 1NKSA 4Y0AA 2ASEA 2GDJA 1E32A 3IDQA 1W5SA 3AUYA 4MITA 4QBHA 4YLGA 2IYLD 4S2EA 4B2PA 5KO2A 1NLFA 4MRVA 4DEXA 4AKIA 2CCJA 1E94E 3DOFA 4JLPA 3UWOA 4XVRA 1YZLA 3RC3A 5FTKA 1GL9B 1WE2A 1Z8FA 1A82A 4M9QA 4PC3A 3AV0B 5P21A 5EXSA 2OILA 3G82C 2ZUCA 1KK3A 4DSOA 1UKZA 121PA 4C0HA 5TMPA 1E9DA 5AUQA 1LF0A 4DZZA 2OUKA 5JFGA 3GLHE 2QP9X 4G5GA 4URWR 5JLJA 3FFBA 2YC4C 4C9BA 2WWGA 4DUGD 1IN4A 3W5JA 1CJVC 2QBYA 2XTMA 1R0XA 3RWMB 2QN6A 4UNPA 1Z0IA 4LPSA 3QKRA 3KUCA 2OESA 1XMSA 2F1JA 2ODEA 2ZJOA 4JLOA 4TT3A 5EP2A 1JECA 2PEYA 1SQ5A 1AZSC 2E9SA 3ZQJA 4GDFA 4D0NA 3OE7A 1CP2A 1OB2A 1E2HA 4F4IA 1NF3A 2OLJA 2ZTSA 4DDWA 3ADDA 1OFHA 3EASA 2F1IA 1P75A 2DPXA 2FE4A 3LLMA 1JR3E 2OFXA 1J8MF 2Z0MA 2ZRBA 3N2EA 1SKQA 3O8BA 4TSFA 2Q9CA 3AKYA 3QNUA 4IFBA 4U5XA 4Q9LA 1MRNA 2C77A 1D9ZA 4KFTA 1QG2A 1VCNA 2H18A 1N6OA 2XEXA 2ZYVX 1U0LA 4TTRA 1CJUC 2PLRA 1E79D 5CM8B 1DG1G 1MH1A 3FKSA 2ZVPX 2ZI7A 5JJIA 4E22A 2ANCA 1N5KA 2IYZA 3WY9A 3THOA 3SJAA 1W4RA 2BEKA 1XTJA 4Q21A 3AVUA 3TUJC 3MWJA 3THXA 4MGKR 4EFNA 1Q1EA 1QZXA 2V3CC 2YHSA 2RGXA 5JBQA 1J7KA 4DJTA 3V4RA 1N6IA 1AGRA 5A5GA 4GPTA 3TRFA 4OHWA 2FSHA 3CRVA 4RKEA 4M22A 3IIKA 5M04A 1G6OA 4A8JC 3KFVA 4G5RA 1KZGB 4Q9JA 4OHYA 2DYKA 2FPLA 1XCPA 2ZS7A 2JLYA 1XDBA 1AJEA 2V9PA 2VSFA 2P67A 1HT2E 4GZMA 4R9UC 5FUWA 3VKHA 2OG2A 2REXB 3T5DA 3TBKA 4DCUA 1XMIA 3VKGA 3ZQ6A 2OCBA 3KJIA 3V4FA 1E96A 5TXGA 2BBTA 2Y8EA 4IXNA 1B0UA 3ADCA 1G5RA 1COWA 1N5LA 4YONB 2BHRA 1J99A 2ZEJA 1X1SA 3DZ8A 1G7TA 3Q72A 2ERXA 3SI7A 3SYKA 4O25A 1VCMA 2ZROA 3QEOA 2D62A 3ASZA 3UK6A 2FZLA 2I3BA 4KHZA 2G1KA 1QBKC 3CR7A 3SDZA 3SJCA 1P62B 2QE7A 2W6JA 4NKRA 2IYSA 3V9PA 3AF1A 3QIAA 4RD1A 2UZIR 2ZJBA 1S0UA 2QAJA 2F1HA 4IHQA 4K8OA 4V0LA 2QNRA 3D8BA 4Q1FA 4Z51A 4JIMA 4R2IA 1BKDR 1LF5A 1P73A 6Q21A 2CJWB 3A1SA 2V4ZA 3VR2A 3QBVA 3NEJA 4PPNA 4X8LA 1FQKA 3D3QA 4GL2A 4B75A 3L0OA 4M1YA 3E2IA 4BLRA 2D3WA 1GIAA 4WIAA 3O8RA 4P4SB 1E9EA 5IK2D 4US2R 2BIFA 3BORA 3IHLA 3BB3A 5D3QA 4ZKEA 4B3GA 3R8CA 1IN6A 4I1VA 4JJKA 2FGJA 4R98A 4OQXA 1TF7A 4J0QA 5CIQA 3B82A 3C16C 1II9A 1IY1A 1F3OA 3ZVMA 3LD9A 3EPLA 1KY3A 3KZ1E 4MUBA 3UMRA 4B3CA 4C2TA 1KGDA 5FUYA 5DI3A 1OFTA 2ZETA 3AKDA 3L0IB 1ZC3A 4NCKA 4GNKA 1Z0AA 1US8B 1OJLA 2B21A 1R5NA 4IDPA 2XNSA 4WXRA 4BRWA 1DO2A 1II8B 4JVMA 4PZZA 3TAHA 4XWOA 4HAZA 1UDXA 3GCGA 4KU4A 1LB1B 2OSBA 4YDSA 1P2UA 4B48A 4X8MA 5HZHA 1Z07A 2J1LA 1SKYE 2LWIA 3RSOA 1IONA 1VYVA 3LY5A 3BH7A 3S1AA 3ZVNA 3LDAA 2J0UA 2ZJ2A 1H8EA 1NY5A 2VPPA 4P0TA 4W9MC 2ZUBA 2GRJA 1M7GA 1LVGA 1IXSB 4URZR 4UQOA 2GCOB 4FD2A 4G01B 421PA 2C9OA 3KXLA 1VYUA 1ZIPA 2GJSA 2RGDA 2A5YB 1KK0A 5DN6D 3MGCA 4Q1BA 4JYBA 2DB3A 3LH5A 2ZXUA 1T9HA 1AKYA 1G4AE 5B64A 3QF7A 3EPJA 3OIWA 2GXUA 4OQNA 1E9CA 3QXSA 1E2KA 1G8HA 1GG2A 1OKKD 3I32A 4DVGA 3TW4A 1NVWQ 2V54A 2C96A 2R6FA 4P3YA 2N42A 3PIRA 3C5HA 2IYUA 4IRUB 2DWOA 4OJKA 3VR4A 5GJCA 1Z6YA 1I4LD 2F6RA 2ZUDA 4TTQA 1Z6XA 1TQ4A 2NO6A 3FMPB 1Q1BA 1JJVA 3RS3A 521PA 3QXHA 3WYGA 2GAAA 2FGKA 4EAQA 4A8JA 1NBME 4ZCLA 2G0NA 3CF6R 1NJGA 5GJBA 2LCFA 3ND8A 2GA8A 1TQ2A 2CL6X 3H1TA 4Q01A 2WOJA 4I1OA 5H8WA 1NN3A 1X8KA 2P6UA 3QF4A 4LYAA 2L0XA 2WBLC 1OHHA 1SVSA 2OXCA 3Q5DA 1KDPA 1M1YE 1T5LA 2AWOA 3U3MA 1KI3A 1KYIA 4E07A 3EWAA 3I8SA 4LYFA 4BECA 4UKDA 1OB5A 1OT3A 2HXSA 1PLKA 4WZBE 2OEPA 4UNQA 4ZDKA 2RMKA 2CLDX 3QY0A 3EAQA 3WYAA 4OKSA 4JT4A 4M4SA 2PJZA 1PLLA 3AVXA 1P9NA 4TMXA 3EARA 3I8XA 1SULA 5KSOA 4DCVA 1FMLA 3VHXA 3A1TA 4C7OA 2B6HA 2KSQA 4C0QC 4G1UC 4DLSA 1VTKA 4DEYA 4M53A 3LNCA 4OL0A 3C15C 2GJAA 3TSZA 3B9PA 2JJ2A 2F9MA 1DAIA 1RW4A 2DY1A 1E2EA 1G3IA 4B34A 3RS4A 1E1RD 1W0KA 2XSZA 4PAQA 2XZOA 4TYNA 1FW6A 2VP4A 5IHPA 5C1BA 1RVDA 1E79A 4XVQA 3SHWA 2Z4RA 1ZM9A 5HKKD 1GZSA 3LVQE 1W2GA 3CNNA 3NDPA 1RRCA 4LHXA 1ZMXA 4Q4LA 4TYQA 4A92A 3M6AA 1RKBA 2YYZA 4AK9A 4US1R 1JB1A 2OAP1 4RCZA 4CYMA 5KOYA 5E7IA 3MFYA 3C14C 3HWSA 1G8YA 1XZQA 2ZE5A 3AKCA 3U3OA 1JPNA 2IS2A 3GP8A 5LD2C 4JT2A 1YR6A 5L3SA 1FOEB 4HUQA 3EG5A 1OXSC 3NG1A 1H8HD 2NIPA 2PEZA 4I1UA 1E1QA 1YZGA 1RPZA 4IVRA 4ERNA 1E2JA 1M34E 2QTHA 4RFSB 4ZI3A 1KI7A 5SZKB 2IHBA 4NPHA 3RRMA 3WBJA 2ZRDA 4LHWA 1KTVA 1N6RA 2IXFA 1D6JA 4TL6A 1E0AA 1G6HA 1UADA 1JXOA 1OXVA 1P60A 4EFLA 1NMZA 2PX3A 3AVWA 4ZDWA 4JLAA 4NONA 3DEFA 2XNDD 2OCPA 3H0KA 4E5UA 1ZUHA 2Z6VA 4AYXA 2XTZA 1QVAA 4BEBA 4NTZA 4G5SA 5EXXA
chains in the Genus database with same CATH superfamily
1Q17A 3B1KA 3WMEA 2QX8A 5CA1A 1PNVA 5TJ9A 1KWGA 3CLKA 1DBIA 2PZBA 1HM5A 1GKKA 1MG5A 4NV3A 5JZOA 4C1BA 2WFLB 5J2TB 1TD1A 1ZHFA 2E37A 2HNKA 3EOZA 3SQLA 5IZCA 1CFJA 3S7ZA 2ZT6A 3ZLUA 2ZITA 1B7GO 4R0VA 4BLSA 3JV7A 4XIYA 1S2DA 1XXHE 3ED1A 3P94A 1PNOA 3N2KB 3F71A 1YAHA 3KJEA 4HQLA 4NARA 4G07A 4W1SA 3RIXA 5CYFA 1XPOA 2RK4A 3WLRA 4Z4HA 4G2NA 3HU2A 2QMHA 1K97A 2DHRA 2W6IA 1VB3A 3F98A 3G5LA 3FNQA 5LL6P 1VDZA 2O2GA 4PZUA 4XJVA 2J0QA 2HWWA 4WCFA 2Z9CA 1A9XB 1USWA 5KNCA 5JXGA 4QO8A 4WOCA 1V6AA 2WSMA 5E3HA 2H8GA 1QYRA 3Q5GA 4EKGA 4NYMR 1VYTA 2VDNB 1II0A 1GPAA 2QGNA 2EJWA 5DMXA 4AKHA 1WUKS 4CUKA 1TUBA 5TX7A 1JSRA 4F92B 2QZSA 1J4AA 1ODIA 5KQRA 1EX7A 1UKCA 3B3AA 1UFKA 2ZXFA 4IUYA 4BWGA 2BBWA 4ZALA 2EKQA 4JVSB 1P0CA 4DW8A 5DEIA 2HU8A 2NSHA 4IJKA 1X6VA 4RSHA 1V8PA 1KI6A 2VT7A 3L77A 1OYYA 1W76A 2BDEA 3P9XA 3TAXA 1I7QB 5HF8A 1PZFA 5SZHB 1YVPA 4X3PA 2ZULA 3EVEA 5M5BA 2RG7A 4YS6A 3LFTA 5DO9A 2JH3A 4FZRA 4FMCB 4K6HA 1TYZA 3UC9A 4OMCA 4EY3A 5IG2A 3ER6A 1L5YA 1V6CA 2UKDA 4OY3A 4U4AA 5CK4A 2ZI9A 5KNDH 2DBYA 2MINB 1FJ2A 5ADHA 1AT1A 1O6BA 1XZJA 3ZW9A 3K1AB 2B20A 1UWCA 5AW6A 2WJWA 3EIHA 1YH3A 3GJ3A 2CJWA 2VUIB 1OE0A 3JS5A 3NHFA 3W3ZB 2VBIA 4YMTA 4AZSA 5JYDA 5LQRA 4H3SA 4L0DA 1P1RA 1SY7A 4P3XA 3DO8A 2H4XA 2YJ3A 5FHQA 3T5BA 2F17A 1CDZA 1ESCA 1JHQA 2JGRA 3GPBA 2E4VA 4M55A 5TQVA 4HFMA 1C4OA 4RHXA 3D5QA 4RK0A 1XFAA 1SBCA 2G83A 2H4HA 2ZR0A 2RKBA 1E20A 3DEZA 3U4IA 4PAGA 4HEA1 1OY1A 2M6LA 4V03A 4DLZA 1Y89A 2XYQA 4DJTA 1FE8A 4G97A 1HLPA 2YTZA 4KFRA 4M1TA 5FWAA 5FV7A 3PPYA 4I8IA 1G6Q1 2ZQYA 5IJ0B 1ORDA 5CU7A 2HM7A 1G1AA 1YVEI 2O3RA 4KFSA 1L5HB 1NATA 1PFYA 1J07A 2KX7A 3H8WA 4FGJA 3MTBA 4G8DA 4MKFA 3T7EA 3ZV5A 2EF0A 4FTWA 2AG5A 2G5TA 2O1WA 3JASB 2WWTA 3DE3X 4UHDA 4PYMA 4E03A 1TEZA 3LBIA 4L9SA 2DFLA 5FFNA 4Q0MA 4W5RA 1US8A 2J33A 1ZRMA 4AJPA 3JQGA 4Q7JB 5DBEX 2A58A 2GESA 3EIXA 3GZNB 1UWVA 4D82A 2QMOA 3DZBA 4WVLA 5TV2A 4JVOA 2JLVA 2J3IA 2VXYA 5FL3A 4JI7B 2HFKA 3QVGA 3REFA 1HT1E 1R3UA 2R1VB 3A1NA 3C6BA 2C98A 1I4TD 2QQ0A 1JHZA 3FAKA 1LK5A 2EZ8A 4AWBA 2PIAA 3ZIAD 4KBGA 2HX1A 1E2PA 1Q3KA 1WTAA 2XWQA 4C87A 1APBA 4HD8A 2BKUA 1UXHA 2GEDA 3SJ7A 2WJAA 3IOEA 1YR1A 3MWFA 2XJ9A 1O03A 2CCGA 1HURA 5FOVA 2Q45A 3PQDA 4MVJA 5LZ4A 2YZMA 4CNBA 4E3WA 2Q0HA 1ZU4A 1MDFA 5FQOA 4Z7JA 4ITRC 1CQIA 4LW8A 4XVHA 4F2DA 5CITA 1U0BB 1O95C 2WIGA 1FPMA 1XQVA 1IBMB 4HDQB 4GM0A 4AIIA 1Z0DA 3BHJA 4WESB 3WXBA 3GO4A 4BVHA 3JQAA 1K6MA 1SUDA 2CZQA 3KFXA 2O6HA 3R5TA 5TGZA 4BVEA 3DLBA 4GMGA 3QP9A 3RFFA 1N33B 2VDUE 3WP1B 1VE1A 4LS3A 4RJJA 1NL3A 2ZAYA 4WMLA 3REGA 3HCAA 5AI0A 1QO7A 2Q9BA 3CUUA 4BXOB 1WULS 1SCQA 1FTQA 2YCBA 3ENWA 2HMUA 1SCIA 3ZE7A 3ZWAA 4CCAA 2IUTA 4J1QA 2KB0A 2VT2A 1KYVA 3EHEA 3OLXA 4RJIA 4BVBA 3TXXA 1FMFA 1M8FA 1P77A 1AX9A 3GF4A 2F62A 1DBWA 2PFSA 3EPRA 4RD2A 4FZVA 2WU3A 3GQBA 1FW8A 1P5ZB 5KJEA 2NVUB 3MTQA 3W5SA 1USGA 1OH7A 2G06A 3H0EA 4B81A 4CMBA 2B8NA 3V3KA 3DHNA 4KUGA 2DR0A 5HKKA 4EECA 1EPUA 1NRXA 2F43B 4YJ3F 5J5AA 1PUJA 3HVJA 3RUCA 2YBDA 3OIVA 1SQ6A 4RM3A 4CTMA 4WCDA 3ZE6A 3AJRA 3M1LA 2X14A 4TPKA 4H9GA 1TRKA 4OD0A 4WEOA 4BMDA 1B23P 2J8ZA 5JALA 2VF5X 3IC5A 5JY6A 3Q7QA 1D2HA 1R0ZA 3GLFA 3A9WA 3L6BA 2BSXA 1Z25A 3QW2A 3DLIA 3T35A 1VI6A 1Z9BA 1ZXXA 2B92A 3B1VA 3E8XA 4J4TA 4MP3A 4RFVA 4YJFA 1YT5A 2OO5C 3KOZA 4X00A 5JRDS 3LZDA 1G20E 5T57A 1BW9A 3WJ7A 4D4JA 5CTAA 3CA8A 3ZXUB 2YWRA 3PJFA 4OQPA 2ZREA 5AWFC 3ACCA 1Z2PX 4UCXA 1RCTE 1U0NA 1Y7IA 4Q3EA 3KSRA 4MHOA 5JD6A 3B51X 3PHJA 4BQSA 3CLUD 1OH6A 1G17A 1NI5A 4JLSA 5FBKA 5EZ6B 3V2IA 1D4ZA 3QBJA 1KK1A 4YAJA 3SQMA 1KDYA 4D74A 4YV1A 1SZPA 1WABA 4MUXA 1ECLA 2AI1A 1Q1QA 2NAPA 2X2FA 2Q7XA 5E6SA 2NZ2A 1Z82A 2UVDA 4JXKA 5EHNA 5EUCA 4U6SA 2YV5A 3M6LA 1NAIA 4L27A 3LCRA 2Z8YA 2QJWA 1PRYA 1Q11A 5E2AA 2NXEA 4KV7A 3OMLA 1TU3A 1ZXLA 3GD7A 2LE0A 3SEQA 4NK4A 1PNQA 4ONEA 2RDMA 4KQ2A 1D8TA 1YZTA 2RHWA 4CFYA 3QU2A 4INZA 1S3FA 3FSJX 3DAGA 2J4DA 3IXQA 3PNQA 3GXBA 4FSHA 2HOQA 4KTTE 5D86A 4EEXA 3RU7A 3LW8A 1Q22A 2AN9A 1ZD5A 1HV8A 2QW8A 4RTSA 3MCAA 5ICCA 4WY5A 1MVLA 3ZI4A 4JHXA 4Q05A 2DFNA 3AM1A 4Q4JA 1CVIA 4CIWA 2VO1A 3R5HA 3WFJA 4WOJA 4RIIA 3RAPR 2DFVA 3KWLA 5DN9A 3QJGA 4EJSC 2I2BA 4ACBA 5L53A 4YAFA 2QTBA 3BF8A 1SK8A 2VJYA 1XRPA 2NYVA 1FEZA 1JYSA 1QBGA 2GPSA 1Z7YA 2FUG6 3ICVA 4IIJA 5DB4A 2LGJA 4Q7EA 5FO1A 1GR0A 3DZIA 4I2NA 5HKAA 5EFOA 4I9FA 2LW7A 1T1EA 3JVUA 4BASA 3ZD7A 3ZZNA 4EUSA 1PYGA 4LBWA 1Y8ZA 2F3RA 2LZ0A 4JJ4A 3CSDA 5LZ8A 4WZAB 3SYLA 4HX9A 2ZR8A 3BSSA 4DM3A 5A2GA 1KDRA 1LLUA 2J3MA 2JW5A 3AB3A 4AJ1A 2IF0A 4CXMA 3HU3A 3SN6A 4YRGA 5AW0A 1PR4A 4J8PA 4KO3S 1UPUA 3KKLA 1G8FA 2PJUA 3G5TA 4H3VA 4NHOA 5BT9A 3QU7A 4TLBA 1CR1A 1R88A 1VFNA 4LXIA 1UR5A 1UDWA 2UVQA 3E7XA 4MYSA 4OHRA 4CW7A 1JQLB 1M2JA 4CEIB 3PXAA 4F97A 1YCGA 2CFTA 3SNKA 5I01A 1IPHA 2W4MA 2QRHA 1UDAA 1EESA 4UASA 5CB6A 2XYRA 3SM3A 1Y4DE 1DQSA 2ZZKA 1GNPA 1TM2A 3MQ2A 1DAHA 2HIHA 3ONNA 3STTA 1I7PA 4BMVA 3ILSA 3OIDA 5E8JA 1J2JA 2GHQA 1ISRA 2JANA 1IK6A 2PRYA 2IYNA 1BKSB 2XRFA 4G0UA 1GYRA 4N49A 1RSZA 1RAEA 1VA5A 1ZW6A 1M54A 3VRHA 3HDTA 5CB0A 3I04M 3LUPA 4HR7A 1HY3A 2V6FA 4JLJA 4AFNA 5EUMA 2QM0A 3BE4A 3JQ8A 2G5CA 3DDNA 3CCCA 3K94A 1F2TB 3ZCTA 4DV6B 1HNWB 1J0CA 4DCGA 3D8HA 1W0KD 1E0SA 1I9GA 5F3WB 3JQBC 4R7ZA 2V7XA 3NJRA 4FU0A 2E4WA 4Y6GB 2R5FA 2JI6A 5K0NA 3DLPX 4CU2A 5CA1B 2NPOA 1ZC4A 2QD3A 4LYHA 5TMEA 3HWRA 2C2HA 1BCRB 5CX1A 5EAIA 1UM8A 2BEWA 3CUWA 4ZOQI 4M0LA 2A67A 3CZRA 1DKUA 3EY9A 3OFKA 4IH9A 5C0OE 3Q0TA 2RCYA 1U3WA 3E15A 4BU1A 3WGJA 4BRUA 1I0ZA 2WYOA 1CY1A 1FS5A 1ZMRA 3MXTA 3NWBA 3T4EA 4Y2GA 4WD3A 2GCNA 4QXOA 5BR7A 1BFDA 4MLZA 4ZI7B 3TRHA 2EFGA 1WXFA 4J2TA 4GKKB 4W5JA 5LQDA 3OETA 1FVFA 3RBAA 4L73A 1LV7A 1NVEA 1EE9A 1A9SA 1GTMA 1H85A 2OO5A 1F38A 2X9QA 2R6R1 4BEJA 3ZDAA 1X80A 5C5CA 2RI1A 2VDJA 3SDBA 1WD5A 4KK4A 5BWNA 3AL3A 1NAHA 3IE2A 3Q85A 3O4IA 3VR5H 5DXAA 1HYBA 3SKXA 3TUZC 4PRKA 2VHZA 1QQTA 3MJRA 4C4OA 3PQ2A 4EHDA 1TCCA 1L7AA 2Q5EA 4PIVA 4WV3A 5CFQA 1BDMA 4UHCA 4OYLA 1QIEA 3BYZA 4CQMD 1TUBB 1RYHA 3K73O 3LDFA 3O31A 5T3UA 2XW6A 1R8JA 4LHEA 4RS3A 3F78A 1YCDA 1PFVA 4I3FA 3ND6A 1UKYA 4MQMA 3VPXA 3INTA 2DOKA 3EVTA 2FSFA 2ONZA 3AR3A 1KKLA 4KRXA 1SUAA 4LJ4A 3S2FA 3RFXA 3TEJA 2WNSA 1J1IA 4GZ6A 3LYHA 5IJWA 4CQNA 2I4OA 5JISA 3TIXB 3AF2A 1KI6B 1PF7E 1B76A 2C88A 4PU0A 2HNAA 5D1NA 2ZI5A 1NZFA 5DTMA 2RI6A 3U61B 2Q8NA 1U9JA 5GIPE 2IUSA 3O8DA 4IOJA 1PEDA 1ICIA 1ULAA 4A6XA 1JDUA 4M7RA 1QTQA 2R6AA 4M86A 3IYLW 3L93A 4DOMA 3QEMB 4GYJA 3LBHA 2XBLA 4IY1A 4R40A 1Z17A 4YJKA 5LDDC 4IL5A 4Y9RA 3TQRA 1TM1E 1AQ6A 3KOUA 3NAZA 1KOFA 5CM2Z 3RG2A 1QDLB 3OF3A 2QP4A 4K9SA 3MELA 1H66A 1S01A 4UUOA 4TQUS 4EJSA 2BKAA 5KNDA 2RGUA 2EFJA 2QM3A 3WB0A 4AZVA 1E1KA 3O74A 2XA9A 3CUVA 2HIAA 3A1WA 3GL9A 4DDMA 5LFAA 5AKIA 4CEJA 2O52A 4ES6A 2VP2A 1A72A 1ZH6A 2XGMA 1M33A 1ETHA 3C3CA 1X9GA 5BWCA 3FWHA 5LDHA 1EVKA 1UFOA 2CFRA 4PLCA 1EP2B 4PY2A 1PIWA 1PWYE 1W4BA 3T41A 4ARZB 1GA6A 2GD0A 1BJRE 5ER9A 5DYGA 2WA1A 3X44A 4C6RA 1SD2A 5ECYA 2GCGA 2FEPA 2P0YA 4BX2A 4E0BA 4YT4A 1JQDA 4MIEA 4ZAWA 2YCLA 1M83A 3MJHA 4Y6LA 5HDBB 3EGCA 2HCFA 3WL4A 2CVHA 3IELA 1SURA 3DWIA 4R6WA 2AJDA 1VIMA 2AJTA 1ONPA 4ZVUA 4A16A 2IDZA 1EUCA 1OD6A 1SU8A 2VYFA 2A3RA 4WT7A 2A5LA 4OG2A 3MRXA 3QOFA 5HJ7A 3A04A 4CGYA 3R41A 4BBJA 2WVGA 3NHRA 2C5EA 1KMQA 1HOXA 4BJ1A 3DL2A 3G3EA 1J2RA 2OO7A 1I6LA 5K99A 1J8QA 4HVAA 4P7JA 4U0KA 1GAJA 2JKYA 3UJNA 3ESXA 3F4LA 3JQGB 1L5GB 3PTZA 2CFSA 2JVJA 1I30A 1OU4A 4GPBA 3UAOA 1Y5NA 3U6BA 3CNOA 4TL9A 3L9WA 4HSEA 1OPXA 4JD5A 4ENTA 1H5QA 3P0EA 5WRFA 1KSGA 1RRMA 4WXEA 1CR6A 1NNI1 3UT5A 1M2GA 3AL0C 2I3DA 3SP1A 2Q0QA 3CH6A 1U9CA 4QQ8A 3D81A 2OBXA 1VDMA 4RD3A 4C3ZA 2D7JA 2VEDA 4YAEA 5G53C 4D25A 3MWEB 3GDWA 3CZ4A 3LV8A 4H15A 3RLIA 2Z8XA 4ESOA 3PK0A 4OEHA 4Y2QA 2JGMA 4ZU1X 5AKGA 3O95A 3JQBA 4YYEA 3GPDG 3IDZA 4ZODA 4TYMA 4MK4A 4YRQA 4CM1A 5BYKA 4DXAA 1CQIB 3UTCA 1DKNA 2DG2A 4WNYA 1STOA 4NCAA 3EZ7A 2BAGA 3L6CA 3UWDA 3T12A 2HU7A 1DIRA 4PZDA 1FFBA 5K8VA 1NFRA 2FR8C 3F1KA 1WB6A 3B7PA 3T7CA 2PD3A 3SYRA 5C18A 1HPLA 3DD1A 5I7HA 2A4KA 5C5EA 2QYSA 3TTWA 3DYBA 3PP8A 4FIZA 1DBRA 4PQRA 4RK6A 4KNYA 1EDOA 3MK31 5C35A 4PGGA 1ZJ5A 5DOZA 3O3MB 1U7UA 2V9CA 2C2WA 3BRWA 3GLRA 3W9SA 2ZWOA 5ITSA 1ZBDA 1F9EA 2MYPA 4UMEA 2D0IA 1NBHA 4EHNA 1V8ZA 1KDOA 1YAJA 1P39A 2E82A 2O7SA 4UBLA 3BWCA 1NDUA 4PONA 4W8HA 5DM70 1TQ6A 4GICA 4EG8A 2UZAA 2IPLA 3LCUA 4WKPA 3ZVRA 2ASVA 3GQBB 3KOOA 4R81A 1PO7A 5FOXA 2MR6A 1VG0B 4DR6B 1JL3A 1E59A 1PFUA 2VNAA 2C78A 2UYQA 3L7OA 1FUIA 3SC6A 4RGVA 3TWOA 1Y3IA 1FNBA 1UXKA 2ZB7A 3H5RA 3LRXA 3OIFA 5ADUS 2XXAA 3MNFA 2H7YA 2WMOB 3HB7A 4S12A 3D7NA 3PSHA 2CXRA 4QUEA 2Y0BA 2OGUA 1QZ3A 5C34B 2XKKA 5AO9A 1AUOA 3TRJA 5TSDA 1IEQA 1GLGA 4OB6A 4L9AA 3U7FB 1AIPA 2XD9A 1DKPA 3A9VA 4JJZA 1XEXA 4MV4A 4NBSA 1RXCA 4CCWA 3BGVA 3FFAA 1AS2A 1ENOA 4LJAA 3GLFB 3T3NA 5FJIA 3E22B 4EL5A 5HWSA 3L01A 4QU9A 2IOHA 2Q27A 3SFZA 3HBFA 4HGOA 4I1SA 5EJ2A 1XCGB 1OAKA 1R6TA 1QHFA 3QOXA 3UNXA 2JFYA 4TT8A 4IQGA 2CDAA 5D8DA 1BW9B 5I9NA 2WKPA 2QRZA 3A6ZA 1P0MA 2HK7A 1G41A 2A14A 4PFKA 5FL7D 5EP3A 1Y6GA 4LFAB 1U2QA 1IUNA 3NASA 3ZY5A 2SHKA 4NICA 4X41A 4YT5A 4DMCA 3WDKA 4OOFA 1Y4AE 3KQOA 2O4UX 3Q6IA 4M1OA 2DMRA 2D06A 3LDHA 3B9BA 2XUHA 3PS9A 5JQGA 1QDUA 4KXVA 1Y6ZA 2R751 1DQNA 3GQVA 4ZHSA 4MKHA 5E6SB 5KSYA 1TIBA 1RMQA 3BDAA 3K35A 3KRTA 2YY5A 1YBMA 2QPOA 3I5YA 3DD5A 3UICA 2P2DA 1CYEA 4J90A 1KF0A 4NATA 4CKZA 4PBRA 4MKIA 1KIFA 3EEBA 4GRAA 4H35A 3GPCA 1MLDA 3W2HA 1TAQA 1WDLA 3ZUGA 5BUZA 4LXHA 4BP3A 2AMLA 4FHDA 4OHMA 3CNHA 2ZZNA 3L0PA 5KYTA 2K87A 3GRUA 2C8VA 2CMHA 2P8SA 1Z33A 3DOOA 2FW0A 4C5AA 3I4LA 3KNZA 4BB9A 4ZAVA 1Z7BA 1XAIA 3FVRA 1LDBA 1Q3TA 1KDTA 4WDRA 1JR6A 2WB2A 3OJFA 1L7NA 3HVUA 3NIGB 4B6JA 4FWBA 3ZWKA 4BWVA 3B13B 4F96A 3SXUB 1P6XA 2CUZA 2JDID 5CXXA 5A4JA 5IKMA 4YCAA 1Z5WA 3ZJUA 4NMHA 5GVRA 4CDRA 1EMDA 4Q4JB 2YWFA 3W04A 1EJ6A 4OLHA 4JBNA 4H1TA 3RTDA 4XAQA 1F9AA 5JAZA 2P9HA 3L1KA 3WNCA 5AJTA 3LY8A 2C04A 1L4UA 2ZTLA 1Z5ZA 4PYQA 2G09A 2GK3A 4D02A 5BN3A 1F2DA 2V97A 1DP4A 4IIJB 4LK3A 3Q8LA 1T4CA 4ZV9A 2HDWA 4TMVA 1SR8A 1UCFA 1E1MA 4MW4A 3DCJA 5BYBA 4QICA 2DFTA 1PQWA 2ZPUA 3F7MA 4Y6SA 2FJPA 4GLBA 3H4IA 3GHHA 2CXPA 2FMTA 1C9NA 2O3JA 1ZVVA 3CR3C 1L5MA 4MQ6A 3OZCA 4R69A 1YC5A 2FF7A 2C9MA 2K5UA 3TCXB 4NYIR 3TSAA 4P0PB 4G6ZA 1U94A 2VG8A 1N1EA 4INOA 3E3NA 3K6KA 4PQFA 2JI9A 3JQQA 3AVQA 3N05A 1E3SA 3AHEA 3UB4A 2VHVA 2MSNA 4U8HA 2AUTA 5JRJA 3CIOA 3CONA 1CRQA 4KQMA 2V7QA 4P4NA 5AVQA 1LQ2A 4B7CA 2N47A 2PCJA 3DF7A 4KGVA 4XTRA 3GLGA 1FYWA 2WJ3A 2EFEB 4ALNA 3VU9B 1GR1A 2X9VA 1OFGA 1DCMA 1W87A 4DGQA 4YCMA 1HDOA 1R7RA 2OM6A 3UMJA 2R48A 3IDSA 4X7PA 3KSBC 1TLLA 1N5OX 2HRBA 2VF7A 2WSSA 3E9DA 4FKBA 3EZ2A 5MN5A 5TVKA 7ABPA 2HQBA 4FINA 5DHPA 4K9MA 5AXCA 4OHBA 1UMBA 4ZCTA 4O2BF 4QT4A 4MVJH 4M0FA 1X0XA 5CNIA 1QH9A 1NVVQ 2JI4A 3BFXA 2G80A 1KDZA 5FTLA 2GZSA 3H9JA 1JIXA 3HRIA 3MOGA 3BN3A 5DJ5A 1WCV1 5BO5A 1GV1A 4FZ3A 5BP7A 1AURA 2B82A 1KI4A 4O4LA 3QPAA 3V55A 2H63A 3M6FA 5EE1A 5DYTA 2BSQA 5TT0A 4NOJA 2IGBA 4FOSA 5HS6A 5FXMA 3N87A 1T5OA 3PFKA 3M1YA 2W6NA 3PDJA 3COSA 5CX1B 1U3UA 4WERA 3GAAA 1MA0A 2C3PA 3KZNA 4BO9A 1TMKA 4H4CA 4NF2A 4LY0A 3ZXIA 4N18A 3VOAA 4AO6A 2VHUA 3TI9A 3GC6A 4C0LA 2CXSA 5LIRA 1AV7A 5AHRA 3DXFA 5BUCA 5K8IA 1T4DA 1R27A 2XB4A 3LRTA 3P9RA 1JIVA 1ZK4A 1UBSB 3BJEA 4G0ZA 4OHZA 2HU2A 2G7ZA 1TVCA 2HV8A 2JJ8A 3BF7A 1P7YA 1SMKA 1XHFA 4DG9A 2F00A 2PUTA 1EXWA 2VWPA 1HSOA 3TZEA 3GDHA 4R16A 1OZFA 3OQ6A 2P0EA 3DTVA 3IVCA 4PZYA 3A4LA 2VDMB 4YXWA 1M8PA 1X3SA 3CIFA 4G24A 3WTBA 2JC3A 3T1VA 4OIMA 1LDEA 2W2KB 3NANA 4JI3B 3C7AA 3FYHA 4NBVA 4YP6A 5HZMA 5DWVA 1QORA 2ZIVB 1G3RA 3QKSA 2Q5HA 2QG6A 2VYND 3SJUA 2AKAB 3VR5A 1XZMA 4Z4IA 1T6ZA 1XP5A 1MHTA 4WCVA 3F3MA 4E11A 4ZVNA 2G8LA 1V47A 3BQMB 3HNOA 5CGZA 2M1XA 5KMGB 1ISSA 1SELA 2XYHA 4DQUA 2Z04A 3IALA 2Y1XA 1ZVKA 4Y7DA 3UPUA 3OQOA 3PEVA 4RY9A 4NAHA 1P9RA 2VXOA 2Q3MA 2QRMA 3MUFA 1Y3CE 4HOYA 3JD0A 2E87A 5IBPA 5IP5A 1L7BA 2DUNA 3U5TA 3ZV3A 3HZRA 1SU7A 3HCPA 5LLDA 3EWIA 3H83A 2Q1XA 4MV7A 3TVTA 1VKJA 4XPIA 2HB6A 3E48A 4BQQA 1A71A 4W5OA 2YXEA 2Y99A 2HZ7A 4LDZA 1QTIA 2KBEA 1SUIA 5EP1A 4X54A 3EDOA 3O8NA 5LYYA 3KZMA 4G65A 4R05A 4BVKA 5FP0A 4TRMA 2ODWA 3P26A 4QARA 2PU7A 4E2WA 4EJSB 3RNOA 1Z38A 2ZYUX 1AK9A 2QI9F 1T9GS 1GT91 3JQCA 5H0IA 821PA 1RPAA 5KTOA 5JO9A 1WXHA 4RA6A 5ES4B 2OORC 4CEJB 1CF2O 3ET5A 4FFOA 4NE7A 1FLAA 5BQOA 3ZK8A 3ZZMA 1CERA 3GGDA 2A86A 3L7JA 1XQWA 3WHLA 1YRQA 2DFKB 4BUZA 3G5MA 4ZMBA 2CBZA 3CSUA 4LF8B 1A4XA 4DLTA 2NO5A 1R9GA 1U3DA 4I9NA 2B1IA 4QXPA 4ZXPA 3UG7A 1PFWA 3HK2A 3AW9A 3EZGA 3EXEA 5FI1B 1QV6A 1NI4B 3CMMA 4WOKA 4KODA 5GQSA 2Q0XA 4EI8A 3MPOA 4CKBB 3N8KA 3KEQA 4HI0E 4LHVA 1AVTA 3WLMA 1ZN2A 5HIMA 1INLA 3X1DA 1M6YA 3K4HA 5KQLA 5C53B 4HNSA 1R6XA 1T9ZA 2B25A 5JSFA 2O8VA 3B6JA 1QUEA 1ZD8A 1LS1A 4L0QA 2BM8A 4YP7A 1EWKA 2AK3A 4N9WA 2FQ1A 1QVRA 1TKBA 4P86A 5LB4A 1WPXA 3IHKA 7AT1A 3W5CA 1JI0A 4KI0A 3HFSA 4UFOA 3ZEAA 1PZMA 1H1DA 2RGCA 3UT5B 3IUYA 1E77A 4BMPB 3HJCA 4G5HA 1WF6A 1Z5NA 3B3JA 4W6QA 5CLJA 1MJFA 2GRAA 4IMIB 2GJ8A 3RSHA 2VJNA 3OD1A 4YR9A 1UKBA 3PEYA 3WK7A 4II2A 2FSVC 2J41A 3U3KA 1OVMA 2EXXA 4QOJA 1G59A 3LOUA 5K05A 3A26A 2HLDA 4M6WA 1T8YA 4YHBA 3HN2A 4WNAA 1R6DA 4TM7A 2PZJA 1I7SB 2EWVA 1JIJA 4EHFA 3JQEA 5J2TF 1XNRB 2E5WA 2ZSBA 4LPKA 2FN8A 1U2TA 2NYUA 3AEXA 3UHFA 3CWZA 4KXYA 2XB6A 4JJIA 2OO3A 1A4UA 2IP4A 4Z4EA 2X8LA 1UBMS 4D3DA 1ENZA 1F0KA 4RMJA 4BNMA 4B3FX 4KR2A 1UPXA 3VMMA 3U4CA 3LT0A 2P6PA 1ZN7A 3GZJA 4Q48A 3HXOA 3MGKA 1AD2A 1GRQA 3IOYA 5EUBA 3GRCA 4I81A 1T2DA 3K4QA 3GJRA 3ZHTA 3PUYA 1E89A 1C1DA 4XFDA 3ONWA 1R15A 4EYOA 4G26A 3OU2A 1BN7A 4OBBA 2AEJA 1TX4B 3LPCA 3LQRA 4RZ2A 1YXMA 3R9KA 4RIEA 2I4TA 4HXEB 1KAQA 2XCQA 4M1MA 1BXGA 4IF4A 4QOHA 1TC1A 1DNPA 4QGAA 2JFHA 2R86A 1J24A 5KQMA 2PSSA 3ZIDA 2BN4A 1VECA 2IKSA 2P2ZA 3L4EA 3ZOKA 3ZBUA 1WW3A 1A8IA 3PUIA 1H05A 1DAFA 1JR3A 4XIIA 3U4AA 5HPYB 4DDUA 2I76A 3CY6A 4TXHA 3HP7A 4U7JA 4UEWA 1SXJD 3ROMA 2HT6A 3DV2A 3KSMA 3MWDB 4O8ZA 3ZHYA 2XXAB 1D2CA 1Q3HA 5D3MA 3A25A 2VPYA 2ZJ3A 2Y2UA 4KAJA 1ONBA 2P9EA 3A37A 3QKTA 1TGYA 4AUNA 2H52A 3C7DB 3NM6B 1UQRA 4GI7A 1PT7A 2QD5A 2EFCB 1Z56C 4EQZA 4ZFNA 4FMCF 5F1OA 5B3KA 1Y7PA 2J59A 5L8VA 1JPVA 1PBTA 2P6NA 4KR6A 4LQ4A 4JU8A 4BFSA 3AERA 3PC8C 4Q9HA 1WCWA 1F5NA 2JIPA 2ZE6A 3EBOA 3G2OA 4Q34A 3RR2A 3SICE 3KQTA 4UM9B 1ZIOA 4UMVA 2O5CA 4XQGA 1Q0TA 1T0HB 3PNPA 1ZHHA 1CEYA 4GNRA 2XVAA 2I9PA 1GTSA 1M7BA 3F6RA 3DEHA 1T10A 5L4SA 3DZFA 2JZCA 5JROA 3WL6A 2R7KA 3NT5A 4HV4A 2KBFA 1JR2A 1YACA 1JZTA 3JAWA 4D98A 3DBLA 5ALHA 3WBBA 1IQRA 1TUIA 5KWSA 3LX5A 1P7ZA 2OT3B 4D45A 5JQGB 1MO3A 3T38A 2OORA 1RBMA 1XC7A 4DR4B 2GF0A 4AN1A 4M36A 5TNXA 2N75A 1PYOA 3OQVA 1FFCA 2YJTD 3I2IA 5GY7A 2EG5A 4AMUA 2CXOA 4LZOA 5A3JA 5IJ9A 1F8YA 2G1UA 1A5SB 3QJYA 4YN3A 2V9ZA 4HQRA 3IILA 2RGGA 1XL1A 3OM9A 3RRNA 1CX9B 221PA 2KM1A 2P9GA 2XUFA 4TRJA 3II6X 4AI6A 3VI4B 4EG7A 1PJ8A 1X1EA 1WV0A 2PZGA 2ES4A 3A11A 4M1SA 3VDMA 5KPDA 4UREA 3A58B 4PAWA 2CZGA 4YFYA 1KI9A 2ZBRA 4XLLA 4BMZA 3LC7O 4HX2A 2G4LA 4DT1A 2WM8A 2OVFA 3EVFA 1CEXA 2JJ1D 3DE6X 5JSZA 4M3NA 4REMA 3GLFE 3L02A 1JIKA 1SO8A 1I4DD 1DUSA 2GD1O 3B6KA 2I1VB 2X9GA 2OHFA 2XNCA 3D4PA 2ODBA 3K32A 5E1DA 3LUFA 3E3MA 5IASA 5ES3A 4FM9A 1L3CA 3U48A 2YJ5A 4UHJA 5JVDB 4D3XA 2QTVB 2YOFA 1V39A 3TTVA 4QAJA 1OA0A 4BMCA 1OLUA 3O47A 1WZUA 1UJ2A 2RHDA 4QRDA 3AIIA 1T4CB 2O0KA 2QT0A 3GRYA 1UIRA 5FLYA 2RHRA 5AP9A 4BMXA 3OLWA 1RI4A 1O4WA 2H2HA 3TNFA 4XD7D 4E2YA 3V6LA 2FSVA 1ZM4A 3TRKA 1FDOA 3ENKA 3SHFA 2OOKA 4PR0A 2HI0A 3NBMA 2OXRA 1ZESA 2QJOA 1HXHA 3U4QA 2PAFA 2WD7B 1MO2A 3DLTA 3OIGA 4GUAA 4K9PA 5GV8A 6GPBA 3V8NA 2FFAA 4LE2A 2VTVA 4BCCA 1JFVA 1RAHA 1ZWLA 2IHTA 1G5IA 1M6NA 3DYVA 1CYDA 4TWBA 5E7JA 1OH5A 3L5OA 1CJSA 4IVPA 5ALQA 1KMCA 4BKPA 4JKYA 3WBFA 5TDHA 4LGCA 4TTTS 2B4QA 2IDJA 1U1EA 3MFQA 4HNRA 4RVDA 3BMOB 2J07A 4QBIA 4XASA 4QG7A 2VQSA 3PQ4A 3CVXA 2OBNA 1SKUA 1VSBA 3PE3A 4MVCA 4XM1A 4A91A 1GZ7A 2HSEA 4RENA 4AZ3B 3ZCUA 1P80A 2JFNA 2V98A 5D3ZA 4QASA 5TQ0A 3UUGA 2UUPA 4ML3A 1U3FA 1OJ7A 2HMSA 3IPYA 1UMBB 5CVJA 3ZR4B 5K6AC 5EIFA 3I5UA 2H85A 3SHVA 4LGYA 4Q7KA 3S99A 3DHEA 2GPYA 1RADA 4GRIA 4TKMA 5CDHA 1KXZA 1W0JA 2ZWIA 2ZRJA 4W7SA 3PUZA 1YDHA 3SMQA 3DMRA 1P61B 4U63A 5FLXA 4XYBA 5YASA 3DNMA 4JH0A 1OXTA 1WM1A 1E5VA 3DYIA 4JBHA 4G56A 1LI7A 2IIBA 4KBFA 3F6EX 3TGWA 3WIEA 3QSYA 1BMDA 4IV5A 1DQZA 2NZXA 1KJYA 2YRXA 4JEUA 4QVIA 5EHGA 2IUYA 1OGIA 2I8AA 5EWLB 1T2VA 3C3KA 4BX0A 1EHIA 4Z2AA 4QZVA 4XWGA 3AF6A 1GZ4A 4ZAXA 1SD1A 3G2PA 4ZJYA 4LYYA 2XOKA 4IV0A 1RYFA 4KK3A 2O8CA 1AN9A 1YOVA 3K5PA 3BPSA 3KYBA 2RGBA 5AM4A 4E5NA 4IDQA 4BPBA 5JYEA 3GH3A 2A0WA 2J6CA 4FYKA 1B3BA 3FYTA 1ANKA 4JBIA 3ILYA 4R8VA 3G8AA 3DSRA 4D8YA 4CTNA 3OQNA 3NKVA 1V8BA 1W4CA 5GONA 1RAIA 3EZYA 3ASVA 2CVQA 4R1SA 2EYUA 3DG9A 3WKCA 4DQKA 1VHQA 1BWQA 2JH8A 4LJ9A 3PXXA 3JTMA 4L7VA 4BGEA 3NBXX 3SQDA 1ORTA 3TZLA 3PPVA 3OCUA 1EINA 2Z9DA 3KQSA 3I28A 3OFVA 2NTYC 1YTUA 3B3FA 2RC6A 1NBMA 3DE7X 2OYRA 1E9AA 5J59A 4C0JA 1OWNA 3IHTA 4HP8A 1GDTA 1RJDA 5D00A 1C9MA 1N3LA 4G25A 4KREA 3ENZA 1TPZA 3K2EA 3TG2A 5JW6A 1W47A 1YNSA 2R8YA 3L46A 4G1EB 5SICE 3C3BA 3KJXA 3GVPA 1RKXA 4I5IA 5E1BA 3M6VA 2PVCA 5BQ3A 3LI2A 5EYPB 1D4AA 2JBAB 3RS2A 2DX7A 2QYOA 4CLRA 2FWNA 4YAGA 4Y2VA 3DOIA 3EQ6A 3V4ZA 1QH8A 2H7XA 2Y1DA 4PCAA 5DXFA 1FFDA 3MOIA 2QUHA 4D3YA 4R2XA 1ZMBA 4M0PA 3GLUA 3L6DA 3T7AA 3CZ9A 3QMMA 5AK4A 2FX3A 3PSAA 3OA0A 3IUSA 2YNMD 4WZBA 3RVJA 2WHYA 5JDCA 3LPDA 1XA4A 2XE7A 2DT8A 1JHAA 2JHPA 3QVXA 3TNLA 5I6DA 5ICEA 3QENA 5JD4A 1MN6A 1WPQA 2CW5A 4TM8A 5AK5A 2C29D 4XPIB 5DHSA 4EQ6A 4QM7A 1GG5A 1S6YA 3L40A 1AKRA 3D4LA 2FPRA 4KGDA 3VNRA 3G13A 1ODJA 2O5RA 3G49A 2FPXA 2QU7A 1XZ8A 2PG3A 2ZYSA 4OJQA 3RVLA 1DC4A 3CTPA 2P2LA 3AESA 4EJMA 1KGSA 1U8YA 3B12A 3CXRA 3DAFA 4JS0A 3MLBA 3UENA 4MDFA 3WGZA 4DV3B 1KYYA 1KORA 1JYEA 2DQ4A 3AFHA 4C01A 5A3QA 1ZCBA 1T26A 2GN8A 3LX4A 4RBNA 1HO3A 5DULA 4HAIA 1B8UA 4K1LA 2Z2JA 4HQOA 4L7QA 1ADYA 4CEHA 3AVYA 2I65A 1A9TA 3IMCA 3LVFO 4EO9A 1Z0UA 5A1TA 4BGUA 1K9VF 4NABA 5E1OA 3ABRB 2FZWA 4XW2A 1XD9A 2OB1A 4LVOA 4YY3B 4L50A 2QVLA