4F5WA

Crystal structure of ligand free human sting ctd
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
193
structure length
193
Chain Sequence
GNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDRAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of STING protein reveal basis for recognition of cyclic di-GMP
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Transmembrane protein 173
total genus 66
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2012-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4f5wA02
4LOIA 5CFNA 4F5EA 4QXRA 4F5YA 5CFPA 4EF5A 4EMTA 4F9GA 4QXOA 4F5DA 4EMUA 4KC0A 4EF4A 5CFMA 4KSYA 4JC5A 4LOLA 5CFQA 4LOHA 4KBYA 4QXPA 4LOJA 5CFRA 4F5WA 4LOKA 5BQXA 4F9EA 5CFOA 4QXQA 4YP1A 5CFLA
chains in the Genus database with same CATH superfamily
1SUCA 2LPMA 2YHUA 5B6IA 4D4IA 3AY0A 2QZ4A 3JQGA 3TI9A 2JLQA 4KXWA 1RFGE 4X71A 3GI1A 1QDUA 4CKCB 4D4KA 1AKNA 4RESA 1WDWB 3A3KA 4FZ5A 3IQFA 4IMJB 3F7TA 2PGXA 1UKYA 3UVEA 3IAM6 2WWWA 4QGFA 4JA0A 2W2NA 1QP8A 1L4EA 2CZGA 3CE6A 4IF4A 3DL4A 2IE8A 4O25A 5BSEA 5LOVA 2Y1WA 1TECE 3K6RA 2XE7A 1M76A 3EGEA 4DC0A 1S1CA 2GSDA 4PV7A 4YP0A 3GJ4A 3DZBA 1KVRA 1NW3A 4MP3A 3L40A 2VHQA 4GKBA 5AI8A 3A9RA 4UHDA 1VBMA 3TLEA 1TGVA 4HNAB 3C43A 4BMSA 1U7TA 4LYHA 1JR3D 4UCFA 2AMYA 3BXHA 4RPJA 3KXLA 1HDGO 1E2GA 1RQGA 3TRFA 1EFTA 1QYVA 4EHAA 3E9QA 1NXOA 5B64A 2ZCJA 4EZEA 2O50A 3A3NA 1KYXA 2BEKA 1DKMA 4UNNA 3I9NA 2J5QA 4K6GA 2B1JA 5CJ2A 3MJEA 4DSOA 4FFNA 2MR5A 3BMNA 5ALKA 2O52A 3H4IA 3MMSA 1JDJA 5HS6A 3OH8A 3EZGA 4IKOA 3W5CA 2GDJA 1E4YA 2Q3CA 3KAJA 1LJUA 1M6YA 3E9NA 1UWKA 1W9MA 2VH5R 3P2MA 4RTQA 1CJMA 1U0TA 3LKZA 4BNXA 4JWTA 4RY8A 1YZQA 5A5VA 2BMEA 1XO1A 1NW5A 5CD1A 3AG6A 2AH5A 4U5QA 4GVPA 4GDMA 1K1EA 3BL5A 3R0ZA 5DCYA 2HC9A 2BTQB 3P26A 5A0FA 1P7WA 3OQJA 4XM2A 5JO9A 2VRCA 2DG2A 1XRQA 3PA6A 1KWKA 4DIEA 1AB5A 2XRMA 3JD1A 4HYYA 4B6RA 2YFHA 4WZBB 1D1SA 1SNYA 3ORRA 5HG0A 1U1IA 3K09C 4J07A 4CODB 3TL3A 3A4TA 9MHTA 2E1RA 3D7MA 3G6KA 3KJHA 2IPLA 3EC7A 4I6EA 1YCGA 2PVCA 3GJ3A 1SOVA 1AQJA 1Y9EA 4LV6A 1J5XA 1KP3A 2B5OA 2QG4A 4C0LA 2A5DA 3AVUA 2P90A 4WBNA 3GA0A 3O03A 3GA7A 1EEHA 3I5UA 2BSQA 4WCFB 2DUWA 1Z26A 4D81A 1RRFA 1IHXA 5K0CA 5HX7A 1B6RA 4M0PA 3T5BA 2V97A 3FWKA 3V2GA 3R74A 3Q3CA 1U4SA 2ILTA 3WHIA 1CRZA 3TXYA 1L7EA 2VPIA 1BCRA 3DJYA 3F3YA 3LLSA 4BB9A 5CW1A 5T67A 2QU7A 3WL3A 2D54A 2ZJ4A 4C07A 4XIFA 2FKNA 4PYJA 1DJLA 2BT4A 2CJXA 3HLYA 4Q9IA 5KNCH 3E0XA 3Q8MA 1OHHA 2ZTLA 3EGDA 4Q4JA 4TSKA 2EQ5A 1ZAYA 1U0FA 4F2DA 3PC7A 4LOKA 1VLZA 3H2IA 3DTVD 4F9EA 1AF7A 2OB2A 4FT2A 1RXWA 1PSWA 1U2RA 2ZIZA 2E4YA 4DR2B 1R10A 5K0TA 2XYPA 3FTPA 2Y0EA 4BRWA 2PR2A 3FGZA 3MCZA 4A6PA 1NF2A 1LTHR 3IPLA 3H6KA 5JCXA 3C2QA 1ZSVA 1U7XA 4RKQA 1HDRA 2NPOA 3DTTA 3K9LA 3PIRA 3E82A 4KJXA 5F33A 4AG3A 3BMXA 4FCCA 2NACA 1ECJA 2ZAMA 3F9CA 1ODCA 3F97A 3MUNA 1SXJD 2GJ4A 2CZCA 3BFXA 3O26A 3OF3A 4TLEA 3SS8A 4BE9A 5BYAA 5JPIA 1FRVA 1JMVA 1SKYE 1YK0A 3H18A 4ZGWA 3NHUA 2OHXA 2R1ZA 4WN9B 1PWZA 1GZ4A 3P0FA 2EJUA 4MRMB 4LJ6A 2C0PA 1P5FA 1WMSA 4GXTA 2FW0A 3BQ9A 1PZGA 1W59A 1R0CA 4Q1FA 5BV8A 1SM4A 3EPHA 1C9EA 2OBBA 4J9UE 4X1IA 2E21A 2HXSA 4P5EA 1MX5A 4OYHA 2FZKA 1BMDA 3JYPA 5G41A 2P4EA 4REMA 2J46A 2GN2A 4J1QA 2HF2A 2WV7A 3QX3A 2IVZA 1NVMB 3LM8A 2FMIA 4ND6A 3LXUX 5HP4A 1IXSB 1RI2A 4YACA 1ZHFA 3RU2A 2C4MA 1NFFA 2A9VA 3M5DA 3R3ZA 2Q2VA 4EZBA 4G5RA 3PIDA 3O3OB 4ZALA 1W75A 4KGVA 2GO7A 3IKMB 1K3UB 2WZCA 2ZRKA 5KHOC 3LDUA 5KSOA 2BL4A 2R6ZA 4X3PA 1TT5B 2DC1A 3ROXA 3ENVA 4M0FA 4QNNA 3OIGA 1A72A 4XJVA 1FSSA 4JYMA 4Q1BA 2OILA 1R0LA 2NTVA 1E3WB 5EJ4A 1D6MA 1JHRA 2GR9A 3CT4A 3DUWA 3HM2A 4AMZA 4BEJA 2ZS7A 1YZ3A 4FOTA 3HN7A 4NDNE 3LGSA 3QPVA 3UC5A 2CFTA 3LK6A 4KXLA 3PJFA 2XODA 3PXAA 2ZRLA 5A0TA 3ADKA 3G49A 3X1DA 4B4UA 5NULA 2VIIA 3ICPA 5DFAA 4PSKA 5FL7D 3ZHXA 1QVRA 2HRQA 4KR7A 4U2DA 3JD0A 4NU0A 2D1RA 5IZCC 2AN5A 2O2XA 4GYWA 5KTOA 4O0LA 4ZT4A 1IUPA 4XJSA 4E09A 4CMIA 1EX6A 2RHHA 2G9QA 3CR7A 5CRIA 4ZVLA 1BKYA 1GL6A 5EHIA 3LC0A 1NUQA 3WC4A 3WQHA 3O75A 4YMLA 3GEIA 2Z8ZA 3HL0A 1MAAA 1EGHA 3KT6A 4EO4A 4MUFA 3D6HA 1XMJA 2HF7A 3S44A 1F20A 4ESEA 3BS4A 2EDAA 3FBGA 1SU7A 3L9WA 3EDCA 2CNWD 4A8HA 3VDXA 3DPSA 5IJ9A 1EYZA 5TQJA 1O5IA 2DMRA 3UV6A 3WWYA 4RJIA 2G6BA 4UW9A 1RMTA 3U7EB 2MSLA 1J6UA 4G65A 1C5KA 1TKRA 4J4TA 3ELUA 4L9WA 1Z6AA 4FW9A 5DNWA 3B9RA 1C7ZA 1WXEA 1NIJA 4F3YA 1EVQA 1TM4E 2PY6A 4L0MA 4RCZA 5A4JA 4YPFA 4N3CA 2PS3A 4HX9A 4OOEA 5JYBA 5L4SA 5JTUA 1B3BA 1U8AA 4FYIA 4L15A 4BL5A 2H92A 2B7LA 4KK3A 1JQBA 5D84A 1LC3A 2P9TA 1O4WA 3GGJA 2W2KB 2HMYB 1OI7A 4B73A 4JI7B 3GBVA 3OCYA 1SQ0A 2PJDA 1DCKA 1LS1A 3BB1A 4UFNA 5EIBC 4M9QA 6LDHA 4PZLA 3AHIA 3V1MA 2GZDA 3FFBA 4RC9A 3OICA 1SUPA 1Y9DA 3L1UA 4LDJA 3I9OA 3IIEA 3IRVA 1Q44A 2VRWA 2ZR0A 4NYMR 1LF5A 3DMYA 3WDLA 1QF6A 4EA6A 5HZMA 4Z51A 2XYGA 2BEWB 4X0EA 5EP1A 4ZVQA 3UYLA 2L69A 3KQPA 2VTVA 5KCMA 4KQGA 4Q37A 4DMFA 5SZHB 5K3FB 1EE1A 3MOGA 1B1AA 2RHTA 1NPYA 2WHEA 4JL8A 2QP3A 5B3LA 1LB1B 3VSAA 3PQFA 2RAVA 2VFAA 2Z2YA 4R7ZA 3VKVA 1TGYA 2HR1A 5A3QA 2FSVA 2QK4A 3QF7A 4OHUA 1IB6A 5B1DA 3W2IA 3ZWVA 2WWRA 3ZWDA 2ZB4A 3ZU4A 1MRSA 3F1KA 2HH9A 2OV8A 2WHXA 2IY9A 2ZCUA 5E1MA 2W00A 4JC5A 5L3QA 2DR2A 3JAWB 2QVCA 1RLJA 4YUYA 5HCIA 1WXXA 2EGHA 2GKSA 2YYYA 4L16A 5TIIA 3ILSA 2XI4A 4JBYA 1H5QA 2X9GA 3C3CA 4JJIA 2C8LA 2FPSA 1QO7A 1N8TA 2G80A 6REQB 4U7DA 2ALJA 1Z4IA 4KVFA 2A33A 1H2HA 2FA9A 1P77A 3SMVA 2CDRA 5E1OA 1N4AA 3I01M 4PLYA 3T61A 1CVRA 5ALSA 2W2TA 3ZE8A 2JHAA 1SVIA 2TMYA 1GADO 2V5VA 1UT8A 1NJGA 1E7YA 3AYZB 3KEQA 3KFLA 4H59A 4MQ4A 3LKBA 3OAAA 4YJ2B 4GS5A 2ADMA 3KQTA 1EK0A 4A0QA 4BO6A 3TZ6A 1RC0A 1UADA 5EWLA 2OXTA 1DAGA 3QWHA 1NBMD 3DCIA 5LA6B 2DQZA 3W9UA 4MRNA 1JMKC 1XLVA 1CY1A 2AR9A 3HPRA 3KJGA 1KEZA 3KQOA 3WLPA 1QU2A 4M1EA 2CLKB 1NQAO 1ZUNA 3MOIA 4LKOA 3RUCA 4I4TB 4LPKA 3F78A 4YRJA 4ZP1A 1C7QA 3MGAA 3WK7A 2PXXA 2DYKA 2VF7A 4IIBA 1NUHA 5CMLA 3DAHA 1FPMA 3JWHA 3BWVA 1XVTA 2LE0A 2PSEA 3U3JA 3EZ6A 3ZJYA 5JEDA 3E7XA 2RIPA 3K92A 1P18A 4UNSA 2VQEB 2PMBA 3VJKA 4J75A 1V7ZA 2JLSA 1U94A 2B98A 3TW8A 3A7DA 4B3HA 3S5JA 1RRPA 2D2IA 1WJGA 1XQYA 3RUEA 2ZVQX 4C7KA 2NSDA 1ZK1A 2GXQA 4AROA 1IY1A 1KPHA 4CKYA 1FVXA 3PI7A 3H9JA 5J59A 4COOA 5L95A 1IY2A 1CHNA 1FNBA 1M8PA 1L5VA 1JB1A 1VKZA 2K5UA 2AE1A 1QK4A 2WF5A 3IIIA 1OD6A 2IUUA 4BZXA 2CNKA 5B5SA 1Z2NX 1RQNA 1VJGA 3QVGA 4OA5A 2D0IA 3NAGA 1UBRS 3A6GA 3B52X 1RWKA 1ULHA 3VJMA 2C9CA 5FUBA 3WJ2A 3AXSA 4EJSA 3HRKA 1SN7A 4KNWA 1A9XB 1PJLA 4KI7A 2P4UA 1V25A 4R8VA 5T41A 3ZR4B 4ZMRA 5LL6P 1AM4D 3ETJA 4BWYA 1Y6GA 3DEFA 3SJCA 3R7WB 4MUNA 4YS6A 1QBGA 5TE9A 2I8CA 3RI3A 4RTRA 2HLDA 1P80A 3TRHA 2J5KA 1YDGA 5DNDA 1ZI6A 4PS0A 3JAKB 1ZU4A 3PFFA 3WYDA 4BP8A 1A8IA 2BLNA 1U3UA 1ORRA 3GFPA 4M46A 4TMYA 521PA 1W0JA 1A5SB 1KQGA 2JEZA 3AY3A 2O3QA 2AKAB 1Q50A 5KINB 2VJDA 1DBPA 3OSUA 3S3TA 1R3DA 3D3WB 5CNIA 2WIBA 4BCDA 2P6NA 2WUEA 3LUCA 3OE7D 1D04A 1SVWA 3ZXXA 3SVZA 4GSLA 3FCXA 1TCBA 1NVUQ 3GUUA 5K0FA 1J0AA 1PQYA 2QN9A 2E6UX 3BIJA 4OIFA 4YB8A 3K0FB 4OQNA 3DEJA 4ZEVA 1Y3CE 2NUPB 3F4LA 1N5DA 2IKSA 1RAIA 2XQIA 2GVZC 1YS9A 4GPZA 1UQRA 1IG0A 2QPLA 3O1JC 5ALNA 3U5ZB 3WQRA 3KWJA 4WXMA 1D03A 2WYOA 2WJ6A 1VE3A 2WJZB 3VYTB 3TE6A 2IEZA 4BO0A 3D6NB 5DCWA 2QGZA 5JANA 1PDOA 5E8JA 2BHNA 3LYHA 3ZQUA 1LXCA 4PG5A 3T7CA 4I46A 4TYYA 4B45A 2HPAA 2W8BA 5AHKA 5BRAA 3U0VA 3VQTA 3VKUA 4BMZA 4KUGA 4MS3A 4FN5A 1AGPA 2YJNA 4FEGA 4LG1A 4MQ6A 1DQRA 4KZPA 3RIXA 2YIDA 2O3JA 2CK3A 3EN0A 3ROGA 2QRLA 4PLHA 1PZEA 5K4GA 4MV3A 4U6SA 3SHFA 4IXDA 5HQJA 4QE3A 3R5FA 1IPEA 2B0CA 3B13B 1BW9B 1T26A 3M2TA 3NHMA 1LW6E 2CXTA 4CIAA 3QWAA 2D62A 1Q0ZA 4MQLA 2ZYSA 3AHEA 5FI0B 1JJIA 2C4KA 1E79D 1A95A 2IH4A 1PTJC 2YJ3A 3HYTA 4CM1A 3FB4A 3MMPA 3FTNA 2WNIA 3NBUA 3TVDA 3D6FA 2HTEA 3WHKA 2FEKA 3MWLA 4GX1A 3HUEA 3U9TA 4JSTA 5J4VA 1YBHA 1QB7A 4U8HA 4BKMA 3NXSA 4L8YA 5A03A 3WKDA 4EKNB 3UNXA 4M98A 4DREA 4WGGA 5EJ8A 4E6PA 3G8DA 4QJ3A 4ZCMA 3SVTA 2GPTA 3HRIA 2VJMA 4NSNA 2QXYA 1SCKA 4OGWA 5F98A 2B83A 4JBLA 3IOEA 1QZ3A 3R3HA 1JIUA 2EX1A 5MFZA 4H15A 3PFGA 4WNIA 3UFXB 2PMWB 3DFIA 1C41A 2B34A 5TXGA 4OLHA 2WF9A 4ASUD 1J8VA 3HDJA 1D2GA 3M1YA 3U7QA 4E4RA 3NC0C 3TG2A 5K0JA 4BY9E 3GJ6A 4XWGA 4EPRA 5AHWA 2QDKA 4Y1RA 3CX4A 3P20A 1JVSA 4Y7CA 1AZLA 2PZEA 4XI9A 3N8GA 3NHAA 4Y2RA 5HMMA 4AN0A 4WLEA 4JXXA 1J5EB 1AKRA 2FWPA 4D99A 3O4GA 1DAMA 3V1NA 1EVZA 4PG4A 4F4UA 3IQGX 5C8XA 2GBGA 5KIAA 5KTKA 1QG4A 3DWGA 3OZ7A 1K7YA 5K8CA 1HBJA 4C0XA 1F12A 3N87A 2GLTA 4RKEA 5G1PA 5LMNB 2IXTA 4GMHA 3C3AA 1LWNA 3GOHA 3NHKA 3PC8C 3VGJA 4GWLA 3PX7A 2QKYA 4C89A 1QB8A 3FBTA 5CJPA 5AVXA 3QEBZ 1V1MA 2ZBDA 4H35A 5L7WA 1K98A 4GVLA 1ADGA 1Y1KE 1PQWA 1E58A 2W43A 3AUJB 5C32A 3O7WA 1SG9A 2I65A 2XH8A 3AQ4A 3N39C 1ESZA 1EJ0A 4YO8A 1KE2A 5BVHA 2Q8QA 4QGAA 4I1UA 1ETUA 1LLCA 3FCOA 2ET6A 1SZDA 1HT2E 4XYGA 4J2HA 1S2MA 4IRUB 5BW5A 1ACLA 1RKXA 2PXCA 4LBVA 2Q99A 1FYFA 2DBVO 1BGWA 2X2EA 3R2JA 3U4CA 1UL1X 4MCAA 4EMBA 4P7BA 2ZUEA 1FUEA 2BMWA 3H1BA 3HE3A 5EZ6B 3VNRA 3HMKA 2NW6A 1FXWA 1ZRSA 1YASA 3BXPA 5H83A 2NVWA 1Z0KA 3PEWA 4LF4B 3WK4A 1NXQA 2KSQA 2VBIA 4RY0A 2G3YA 3G8YA 4V2UA 1SELA 3GAMA 4YJFA 2IYNA 3RFTA 5ADHA 3KQQA 1I4LD 3C1TA 2CLLB 5E7JA 1JI0A 4Y2PA 1IXKA 2IZ7A 1O8BA 3RUFA 2ID8A 3LLVA 1VBKA 2O7SA 3P1JA 4QQFA 4X24A 2EG5A 5EUCA 5TQ2B 3SYMA 4B3MB 2HM7A 4E5PA 3QVWA 1JBQA 2TECE 2H59A 4HMPA 3RROA 4F46A 4D0SA 1H2RS 4U9HS 3SQMA 1QHEA 1AC5A 1TK3A 4JITA 5H82A 3OCWA 4NZOA 4GSYA 4L74A 3H9GA 3VSBA 4KSCA 2J32A 2CLSA 4O08A 3LVRE 3F5DA 5AVZA 4IEEA 3X2EA 1YS6A 4GPBA 3MK31 1XF1A 1SK9A 2I4IA 2NTJA 2OY0A 3BQMB 3BD8A 3NATA 4JMLA 1K3TA 3G2IA 2QRVB 2QM3A 4ZT5A 3EEFA 3M2PA 3TTYA 1HUQA 2Y3IA 5I5EA 1HETA 2JBWA 2OCDA 2RGNA 3QXSA 5C5DA 1AN9A 1CK4A 2ODNA 2QTMA 1MT3A 3PX3A 1XVAA 1T1JA 2VZ8A 5F1PA 4DCUA 2R85A 5JASA 4O2LA 5DV9A 3HCEA 3O95A 5KPJA 1MT0A 1LBSA 2X8JB 2C88A 4EDHA 4RTKA 1SZJG 2BTQA 3HVIA 4H7PA 4LF7B 2CUNA 3AM1A 1J9ZA 5GWXA 5AI0A 4I1SA 5CLFA 1N3BA 1MJFA 1ZZGA 4Z7QB 3VPHA 1G4UR 2H1WA 2JJYA 3L7DA 5JWRA 2B37A 5H1YA 1KMCA 4TMWA 5J2TF 2DPHA 4HSGA 2ZWOA 1P29A 3V4LA 4D3SA 5LWHA 2QLLA 1LUAA 2ZS9A 3GCZA 4E1VA 4DA6A 4JYAB 3EUWA 5BV0A 3K4HA 4X1OA 2H52A 5BXQC 3LSTA 4OMDA 3OLYA 1TZJA 3KR2A 3OEED 4K88A 1DTEA 4ZK2A 4CTOA 4MVJE 2GF2A 4Y1FA 5IRCD 1N2IA 1E3WA 4QYWA 1E69A 3CY6A 3CHYA 5M7EA 2HQRA 2JGJA 2ZI5A 1NU8A 3W3AA 4BEVA 4D8WA 1CB0A 1GZUA 4M22A 1HDZA 3JWIA 4L75A 5H3HA 5ENVA 3QA3E 4DWVA 2PSFA 5IJWA 4J8PA 3ZDAA 1KHTA 4XVHA 2F64A 2O2IA 1JG2A 1WXWA 3WGGA 4B0PA 3QJ5A 2XHEA 4MPRA 1F6WA 3QVGB 4L72A 3VJRA 2UYGA 2OCAA 4W82A 2WWYA 1ZPDA 3L0DA 1N2GA 2A6PA 2VT7A 3MZ0A 3CUVA 4HTFB 4QUIA 1ATIA 4TL7A 1QLJA 5G3YA 3A6PC 1CNEA 3FGOA 2OYCA 1WHSB 1OAAA 4HDOB 4LRYA 3OCUA 3T7AA 2Z8YA 5DHTA 2BFFA 1Z5NA 3BCSA 1UAYA 2VNHA 3IV7A 4KXXA 4NP6A 1FUYB 1Y63A 4FSXA 4FYJA 3F6EX 1UBTS 3EUEA 5IK2A 3B5JA 3Q72A 1SUIA 2CNBA 2EP5A 3KPJA 3N3AC 4XVQA 1O5TA 4OJYA 1W4CA 1RHJA 4EG1A 1ZRNA 5LQNA 1J8DA 4L4YA 1DS6A 5A71A 3WGUA 1RBMA 1TFRA 4I55F 4Y9UA 2AVNA 4UC0A 2H2FA 2Y1GA 3WFZA 4KV7A 4BKOA 2H8GA 3JQBC 1GILA 4ZODA 4PIVA 2MIIA 4UMVA 1KC1A 2HK7A 3EVZA 5EIBD 2R68A 4F3NA 4POOA 1O87A 2GBLC 4B84A 3TINA 2Q4EA 4BQEA 2Q0SA 1SBTA 4CLXA 1LQTA 4B6SA 5BY2A 1P60A 3L7NA 4JR0A 4ZGGA 1J1UA 1X1EA 1Z16A 2CYCA 2H16A 1VRCA 2ZQ5A 5BVGA 1V11B 1YR6A 1HL7A 4E4YA 3PHLA 4CV3A 4J6FA 2VF8A 1WCXA 3VPFA 1QFXA 2H2HA 3UG7A 1O8CA 1JF8A 2NT4A 2UYQA 2Z3WA 2FLVA 4LISA 1TYDE 1KFCB 3EQ2A 4NJMA 5EIFA 3VM6A 3WNZA 4YDQA 2O1SA 5FNVF 4Z0HO 3WGVA 1PHPA 2Q5QA 2SCUA 2LRHA 1RZUA 1RP7A 3HUDA 3NONA 5AMXA 1M34B 3B1JA 5SYMA 3RKRA 3R9WA 1CVIA 3VTZA 2D3TA 5AOCA 3ONVA 2Q9CA 3ONWA 3SZOA 4AY2A 1AZWA 4X8LA 3DO5A 4AKIA 3RH0A 1SWVA 2HK9A 2ZSKA 1Z2CA 5DGIA 2J5XA 1SD1A 4DABA 5F2OA 3DPUA 4WDQA 3ESZA 4R81A 1XRPA 2YV5A 3OU2A 1I4EB 4YBRA 1XT6A 3WJAA 4DIBA 4U0JA 1MA0A 3LHKA 1G8JA 3TOSA 3JQ6A 4POAA 4K6CA 1GAQA 2B1GA 4ARZA 4CM7A 5DOVA 2ZYDA 1KZHA 3T3DA 5IAAA 4ENTA 3TUJC 3ACCA 3ITNA 4JLVA 3T1QA 4C2TA 1CUDA 2RHWA 4XQCA 1C3XA 4MROA 2AEJA 4BKRA 4PPFA 1N6NA 2IE0A 3IOYA 1NVVQ 4X8HA 4XEHA 1SB8A 4K6OA 4OM7A 4R68A 1NSYA 3CKLA 3O3CA 3UT5B 2AA3A 5B6PA 5BQ3A 3TEFA 3HL4A 1TE2A 2WD7B 3DH0A 5AESA 1OY1A 4EVQA 2IS1A 1MW8X 1G55A 1GPDG 1CSEE 4DKXA 3I8SA 5K2MA 3KUUA 1R3UA 1TLFA 2BFDA 2VP6A 1L8LA 2OBXA 1BKSB 3LGXA 5CT8A 3GQBA 1I2AA 2W2KA 2BR5A 5AXCA 4D82A 1N6OA 2DT8A 3BL6A 3HGQA 2BUBA 4QXRA 3L0OA 2JI9A 3NBYC 1QIIA 4N4AA 4Y1RB 1MQSA 4W6ZA 1YULA 3HB7A 2OHGA 4D74A 2JAOA 1Q20A 1USKA 2IU0A 3ZLJA 2NXNA 1PWYE 1ZCJA 4R6WA 1TPZA 3TTTA 1QZZA 2QI9F 1V4BA 4ER6A 3WXBA 4P54A 4YGXB 1R16A 4Q1EA 2D3WA 1ODKA 2XNHA 3BMQA 3BMCB 1MEEA 3G88A 3THRA 2G1PA 4WNAB 2R8PA 3ZD6A 4Q3DA 4FLMA 4BNZA 2Q7OE 1OI3A 2L42A 1K9VF 4DXAA 3QZUA 3GFVA 3NWBA 1T2NA 1Y37A 2VXOA 2FPLA 3RYHA 2H4XA 2BDEA 3JCZA 3N6RA 1XPJA 3AW9A 4IIDA 5E7IA 1H4SA 4QQRA 2WDZA 1WB6A 4MNTA 1NMZA 4LGYA 3NDPA 3OIYA 1EK2A 2AK3A 2AYXA 2IF0A 3FZEA 3P8ZA 1CEYA 4ND3A 3BHJA 4TUYA 1G8MA 1LPNA 2KS6A 1BWPA 1JHYA 3TLAA 3WZMA 5BOSA 1FU7A 3AJAA 4RQUA 2QTVB 2R5WA 1DRVA 4WDRA 1T4CB 2WSYB 2FY8A 1GJRA 1H23A 5LQRA 3D02A 2HZBA 2HLPA 1MORA 5DTEA 1U4OA 1OREA 2R7AA 2GFHA 2KYRA 3ND6A 2RK6A 1OIVA 4IHJF 3OX2A 4TTRA 4Z3DA 4RM3A 3UA4A 1IBKB 4P86A 1G8HA 1GTSA 3ABRB 2QWXA 5E3JA 2X6RA 3LCUA 4ZO9A 1YBAA 5KOHB 5KQMA 4A16A 3NYWA 3DBLA 3RTAA 4ND1A 5HUQA 3DAPA 2IPNA 1IQPA 2VHXA 4L08A 4LF8B 2F3UA 1I3LA 1TEXA 3OTHA 5B1YA 5D5PA 1KRWA 3M6XA 1B93A 1GY8A 1MO2A 3I01A 2YYAA 3Q7IA 4AIRA 3BK7A 3IT0A 1USVA 2EQAA 3D4IA 1HZJA 3OFSA 4BC1A 4D8TA 2BF7A 4MW6A 3U4IA 3RIMA 4AG6A 4DMMA 1ZR2A 1ECGA 2XTMA 4Z3OA 1MO3A 3CIFA 2ZUUA 5FUMA 3FB1A 3X1YA 2CE7A 4IJ5A 2QT9A 3SXUB 1RWWA 2H5JA 4JZKA 2CCGA 4AICA 4Y6OA 2FQYA 4K87A 3KFVA 1TLLA 3AVWA 2HYDA 2VXBA 1IUNA 1EDDA 2AOXA 3WTCA 1SXPA 1OWLA 1E0AA 1I5EA 3OX1A 2L19A 1HKUA 2BEVB 4JSRA 4E11A 2HGZA 3OY7A 5L7YA 2OAEA 2G04A 1U0RA 1QIDA 2IYLD 1DBIA 1W1UA 1FJHA 2P2SA 3L02A 1TIBA 3U3KA 1ENOA 1EXVA 1UZLA 2FQWA 2EEPA 2AR0A 2JRLA 4HVTA 4J16C 5EKUA 1OX4B 3KQKA 1T3HA 10MHA 3EULA 3L8YA 3Q9UA 2RAPA 2HIMA 1PWEA 5I7WA 2IEGA 3HK2A 3HS3A 1PQ4A 2NYUA 2PMKA 3S27A 3Q3VA 4AXBA 2V8BA 3GAFA 3IBSA 1TCUA 2QQEA 2V55B 5EHXA 2DOKA 2BKXA 2G25A 4FYYA 4L22A 1VRVA 3N2IA 3NBFA 1YCHA 3E23A 3RU7A 2RH8A 2Z6VA 1UJCA 3UPTA 3JPWA 1JHVA 2C1EA 4YX9A 3DKRA 5DLEA 1YWGO 3W06A 1LNZA 1ST2A 1JE0A 5CH3A 4BNDA 2QMYA 3H87A 3JZAA 1Z22A 3R4VA 3TW8B 3N2KA 1JDUA 3TKLA 1QIHA 1OSNA 1P3DA 1WKVA 2QHXA 3C5EA 4CKZA 2WP8J 3MCWA 3AUFA 3SDSA 4E30A 1Z6GA 3AJDA 2J5RA 5HF8A 4RCYA 5CEJA 1EUYA 4ZU1X 1QP7A 4OYRA 4EHFA 4UJ5A 1Y42X 2GPJA 1G6KA 4NENA 4WCDA 4EFMA 2RGGA 1GO2A 4O4HF 5KNLA 4RKYA 2GRJA 3QVOA 4HF7A 3X1ZA 1BWRA 1QGED 3LU1A 3N6XA 2VT2A 4AZ0A 3OE7A 1SU6A 4PVCA 4Z9FA 1YS7A 3IQWA 2YHAA 4MQFA 4HGPA 2ZXUA 3R9XA 3SLKA 1L5MA 1U11A 3OPYI 2PQ0A 2QRQA 4JDUA 4F1WA 1MW9X 3UWMA 4YJ2A 3GEEA 3P9KA 1V1RB 3CLTD 5IJ0B 1PUIA 2O8NA 5CLQA 1GPAA 3D2CA 2K2QB 1YZGA 3L18A 4TV9F 1W36B 1U8UA 3CMMA 1GKKA 1JEJA 1XZKA 3COZA 3HPQA 2TS1A 4EWLA 1ORWA 1XX6A 5BN3B 8GPBA 3HCDA 2OFFA 1W88B 5JH7A 1CR6A 2FSHA 2QTWB 1XTKA 2AV6A 1CZKA 2C9OA 2JD1A 2B94A 3EHDA 2VF2A 3O0TA 3ENQA 1MIOA 3OETA 4HAVA 1UH5A 2ZRNA 3T1TA 4PZPA 1Z0UA 1HSOA 3MNFA 1NN0A 2WK1A 4QPCA 4PIPA 5AI5A 5GM1A 4PEVA 4DPLA 5CB4B 5I3ZA 1V8PA 3T7IA 4JNCA 1YQTA 4FZRA 4BAUA 5JD5A 5JXHA 2ZJBA 4D56A 4MLCA 1IM8A 1VOTA 2VUSA 2X22A 3ONDA 5BVHB 1FRQA 2P5UA 4WNYA 3MHTA 4ILEA 3EDOA 3BD9A 3O1IC 3SJ7A 4KO4S 3OIUA 2QXUA 3TOXA 2WTXA 3N76A 3UJ8A 4NBSA 4MVWA 4PPNA 1N2CA 1Z7WA 4BJ6A 3BMNB 2ZIUB 5B30A 1C7JA 4D3ZA 3OKCA 4QRIA 3N2ZB 4YUXA 4P32A 2OAGA 1E1QD 3LUAA 1OH8A 3A9UA 2OV4A 4H6VA 1KOLA 4P80A 4G81A 1E1DA 4AJ1A 3PCRB 4ALKA 4DIUA 4F9TA 1QVAA 1NWHA 2W8BB 4NCKA 3V5NA 3I3SR 5JC8A 2J4FA 1RWMA 1Y8RB 3WGQA 2AZMA 3RARA 3U31A 3UJHA 1Z7BA 4KO1S 1QV7A 5AKHA 3WJ1A 2MYNA 2NTNA 4K0KB 1FSFA 4MB0A 2G70A 4UTNA 4BJ1A 1WP4A 4U9UA 2JIZD 4DLNA 2ECQA 3RHZA 2XADA 4JI1B 1K7XB 1S4QA 3AY6A 4CLRB 4B35A 1CY2A 4WHMA 3NBKA 4EB6A 2ZM5A 2Q4DA 2J0UB 4XZ3A 4U2EA 3FLMA 3JW8A 4N5MA 1ZK0A 4G1FA 4F8YA 5IVKA 3G82C 3UQYS 1PHRA 1WV0A 2CFSA 5ALZA 4N5LA 4UUBA 3AF5A 5HM8A 3W0LB 5JSUA 4X54A 1K7CA 3BSWA 3F1LA 4ZDJA 2CSUA 4CFZA 4MA0A 3T94A 1ZJZA 1NNSA 5L3SA 2AJBA 2H1SA 2QTAA 2Y0BA 3G02A 4V0MA 2Q28A 1RI4A 2HJVA 4R05A 2LWIA 1SXHA 1KERA 2P3SA 4Y0NA 1LC0A 1JDTA 4OP1A 2NX2A 3GLRA 1L5WA 4YQYA 2ISCA 4G8CA 4CTJA 1N77A 1N5OX 3RUDA 1N2ZA 4FWTA 4C30A 4JT9A 1EHCA 4TS1A 5G4LA 2ZR7A 3RO7A 1LRLA 3ZJ4A 1KI4A 2C9ZA 4B75A 4BCCA 2YQ4A 3LT0A 1J20A 1NVGA 1SBQA 3OCJA 2C96A 4ENQA 1AK2A 2KE5A 7YASA 2CVZA 2EW1A 3PXDA 2NO5A 1JPVA 3MRTA 4B6FA 4KQ2A 1RBQA 4PR0A 2E0IA 3LLCA 4L8FA 1IIRA 1DV2A 1OU0A 1QR6A 2I3AA 2VJYA 3GT3A 5AUOB 1VA5A 5GJBA 4NCJA 3KKPA 2FPGB 1C8LA 1MC5A 4UMDA 4B76A 3DFFA 3FPAA 3ZDRA 2C83A 5IXJA 3ITEA 1R9MA 4GM0A 2FMUA 4L4SA 4BZZA 2BFPA 4M0CA 4UXHA 4DE5A 4ZTZB 5DI3B 2R7MA 3MWGA 4XQEA 4KVGA 2O2DA 5JYCA 1N1DA 3E84A 4RNDB 4D4GA 4QM7A 3ZHRA 2Y0CA 4NBTA 2HMWA 4G67A 4YWJA 4D25A 3L7YA 2ZM6B 1G66A 3P9RA 2ZTVA 4J7XA 1D2NA 3IJEB 2G5TA 4U2FA 2V6JA 4W1SA 3C7AA 1FUIA 1DG3A 2WAYA 3AUXA 3CH7A 5E2IA 3AOEC 4I8DA 5EN4A 4CLDA 5C8VA 1W52X 1V9SA 2JFUA 2VS1A 5T7BA 2OCIA 1R5JA 2CB0A 1KETA 3RHSA 1QKIA 4E13A 3VOTA 1J7JA 4ND8B 5C35A 1OZFA 4YAFA 4YAOA 4XKJA 4WX2B 3CR3C 4L02A 3WL6A 2DWPA 3ZWXA 2ACVA 4FD2A 2I54A 4LXUA 2FN4A 4MKZA 4TRMA 4MQEA 5F21A 3GRAA 3S1LA 4DANA 5KOYA 3UPUA 2OFXA 1BQEA 1AUXA 2WM2A 2ODAA 4CDRA 5B1SA 1R5BA 3BXOA 4QUDA 3CX8A 1NRWA 3TFWA 1FMCA 1PFYA 3BMOA 3G5AA 3ZVMA 3M70A 3H8SA 4RK6A 3V6MA 5K0BA 4OL0A 2ZU6A 1R8QA 1XZBA 1DADA 3G0BA 2XWPA 2VP3A 3HV0A 4HH0A 4QTZA 1XTIA 3L0PA 1N0HA 1RJFA 1YTLA 3SYRA 2C04A 4DYVA 3SXJA 2AQHA 3H2YA 3T4XA 3RODA 2J3JA 2V7XA 2GCOA 1JEQB 5AW1A 2V74B 5BYKA 2ZB7A 3LC2O 4YRDA 4W5HA 1LSSA 8ADHA 5EXSA 1JEQA 5A6SB 1XCGB 3UMFA 3IPYA 1XQVA 5EJMA 3TRJA 3CBQA 1E2LA 1LPMA 4GP6A 3U61B 1CQIA 4UM7A 2GAIA 4CVNA 5B55A 2AG1A 2OK7A 4UMFA 3U0BA 4MV8A 1UBKS 3QWIA 3R0JA 4FHCA 4BFSA 1ND5A 4D9IA 4TTAA 2A0UA 2OFWA 3OT1A 4TLMB 1KFJB 2I1QA 4N49A 1VIYA 1B1CA 2AOTA 4Z0TA 5JSYA 1W5EA 4AS3A 2NPFA 3WYGA 2P0AA 4UM9B 2GB4A 2IYXA 1IZ0A 1VLMA 3HJRA 4JFAA 4WINA 2D7DA 4YJHA 3RLIA 4Q4JB 2R8ZA 4D9NA 2C94A 4NG5A 5BOVA 3CCBA 4MDFA 5EQTA 1LPSA 2H1IA 3RLFA 5ES4B 1IBLB 1WZIA 1X7WA 4DFDA 2O8BA 4L3WA 4M8KA 1KTIA 2RGXA 1M54A 2PG3A 3HXOA 2CNOA 3GRFA 4KWIA 4W5QA 1W5SA 2GN8A 1M0EA 4URHA 2ZZNA 3MUEA 3B1VA 2DUNA 4WLOA 2PGNA 2QE7D 4X7PA 4XSGA 4BNWA 5CFQA 2PSHA 3F6RA 4G37A 1E0KA 1FDSA 2PBLA 4H0NA 1N9GA 4Q3CA 1NJFA 4K9OA 2EYUA 2WDPA 2V9CA 1ZGAA 5F5LA 3OPXA 4OQMA 1KS2A 1VJ0A 1GGNA 4RHUA 3OCVA 4EW1A 3L84A 1A2QA 1GUFA 4WKCA 4DMRA 3AVOA 3HR8A 3H1TA 2ZTMA 1RLIA 4HMQA 1QF9A 5CFNA 1XBTA 3MSCA 1CUYA 1K8RA 2EJCA 2XHZA 1RPNA 3ASZA 3OOYA 5AKLA 4DYDA 3QENA 1KGDA 5ERYA 5CA1B 2JS7A 4M0UA 3IVCA 2J3LA 3M1LA 3TGLA 1VP9A 3OZTA 3GB9A 4Q9DA 3NHRA 3BH6A 4R2WA 4ZC1A 5K09A 5DOZA 1FEZA 2G4VA 5DHSA 1GRNA 2FGKA 2GK4A 3OJ0A 2Q8PA 4Y2UA 4WA7A 4B6PA 4RYLA 4XIGS 1ZW1A 3HVJA 3PEYA 2FW8A 1OTHA 2PS1A 1J97A 1XRJA 2YCLA 3SBDA 5LLDA 1SCUB 3ZE9A 2O48X 3MGCA 4N82A 4PINA 1YIAA 2P4SA 2Q3JA 3EFBA 4ACAA 1V47A 2J6BA 1KYWA 3H5VA 1MKYA 3RREA 3W5AA 3ANMA 5FOQA 1ZA2A 2CEAA 3GLHA 5JAPA 1P7CA 1W4BA 1Y81A 3B12A 2A3RA 2DY1A 2OP1A 5C80A 1XTZA 4BKPA 3TLMA 3C7CB 1W85B 1JLMA 2VYVA 2JHFA 2YV1A 1LW7A 1S9DA 3CUUA 2CJYA 2YYSA 3EQ8A 5KWSA 1KJQA 5LXTF 3I6IA 3ABSB 1KEVA 5BW6B 1TJ4A 4C3OB 3B1ZA 3KHUA 1IOWA 4GZMA 3OHMA 3GR6A 1ZM9A 5KNDA 3SNHA 2C2XA 1F06A 4PQGA 3VC7A 1NI5A 1U5BA 3C14C 1BU8A 1TAGA 4IUYA 4HAOA 1S2LA 3GPCA 3CF4A 3L04A 4GI5A 1VZ2A 1Z4OA 2ZU0C 3IIKA 2FWBA 3MTQA 3UAOA 4K1XA 4C05A 5AOBA 4AMVA 2BI4A 3VTAA 2BKEA 3OZRA 5JG7A 1XWIA 2GHRA 4K40A 1U2TA 4YMIA 4CEJB 1QHXA 2C5EA 2PCJA 3C8DA 2HCFA 4I1YA 1YRBA 4R5HA 2H5EA 4DMGA 3D8TA 3E3AA 1O95A 3QUQA 1XMIA 4NOJA 2AZTA 4S0ZA 4X93A 1IB0A 1PV2A 4AWXA 4RPGA 2OK8A 4B2PA 4QBTA 5BMVA 3V4OA 4EJ2A 1W8IA 3CTMA 1JU4A 1ISRA 2EHJA 4S04A 3CWZA 3PEVA 3AKDA 4QDTA 5CFOA 5K3BA 3LGAA 3B1FA 4EKEA 3PLRA 1EZZA 4H7KA 3KPVA 2EV9A 2J9GA 1QUFA 3NBZC 5FBLB 1PCXA 4JBHA 4GLOA 1ZGBA 4R31A 3B85A 4CF6A 1RXVA 4CLOA 5L3VA 3LVFO 2JFXA 4FPXA 4MVJP 2QSUA 3AY7A 4PZUA 4URXR 2W2QA 4A3SA 5ITZB 1H1LB 3FX2A 3ENWA 3OQOA 4DB2A 4G2NA 1FSPA 3QYAA 1YK1A 3O4JA 4FOSA 4LSWA 3IV6A 3PNKA 3QXXA 1Z4QA 5CCBA 3S1SA 4UQOA 3EBLA 4KMOA 1TYEB 4L4RA 1JAXA 1T5OA 1WDKA 3CH5A 2WR8A 3M83A 3Q2KA 1TK9A 4NNOA 4Q7LA 4QBIA 3UF0A 2QTGA 3PKIA 4NC9A 2A14A 3OT1B 5CH8A 4E4TA 5K8VA 1JEYA 3NYQA 1GN9A 3OQMA 4W99A 3HJBA 1RT9A 2K4MA 4IGAA 1WZ2A 4HGNA 1LWOA 1L2TA 2FEMA 3EA4A 3NV7A 4X90A 3QFSA 2PT7A 3H0CA 3U26A 3UUGA 2RE8A 4CLRA 2W0MA 5DM1A 5TS3A 5DH9A 1M5RA 5G2OA 1K2VN 2Q1UA 5JUWA 1U7OA 2XF8A 3I6BA 4ZVVA 1DC5A 2FZEA 1KPGA 4A82A 1NOIA 2Y9MB 2YZKA 5C8YB 1Y7LA 4QFCA 4UUPA 3B36A 1PR6A 3ZXSA 4A8PA 4DQUA 4MUGA 4HH3C 5FAXA 3CFYA 1FMFA 2ZWAA 3PRYA 4BN0A 1DDIA 1RYNA 5AM4A 3C6ZA 4OQZA 4KBFA 4MGIR 4JOSA 4FYPA 1ONNA 3R4CA 2IYQA 2H4FA 3F67A 4UBNA 2IHKA 3JS5A 4OGFA 4D9GA 1JIVA 1MAHA 1PU2A 1QNLA 2MT9A 5DHUA 5IBCA 2V0NA 2JH8A 4HNQA 4MQMA 3V1UA 5HKBA 1M2OA 4BWFB 1Z88A 2D4HA 5BSMA 1JQEA 1A77A 3EGCA 1N2CB 2D2FA 1Z75A 5CNMA 3TQRA 2PWYA 1R8XA 4UTXA 5EMJA 3RC3A 1Z6QA 1Z0JA 4HLUA 1W4ZA 3AEUB 2VBGA 2PGLA 3HB1A 3IESA 5L51A 2CXUA 1KSJA 4DUZB 1W5AA 4II2A 2FSPA 3ILYA 3RF6A 2R48A 4FBLA 4TKVA 4ZI7A 5EIEA 5EG5A 2FCRA 5EPUA 4H3KB 4P08A 3C6KA 3TQOA 4ECAA 3NPMA 4B31A 1BS9A 1FC0A 4AY5A 2BTEA 1UBJS 4E51A 4XYBA 5DM70 3A11A 2H4HA 2IYUA 4GBGA 5I7SA 2D13A 1QRTA 3NR2A 1ESNA 1Z34A 3S28A 5L4NA 4ND4A 1DBVO 3UCFA 1XKTA 4J1TA 4R1UA 4AKEA 3I0ZA 3OCXA 3B6IA 4HNRA 1K4YA 4QT0A 5G1NA 3ZCTA 5C8ZA 5THKA 1AX9A 1A69A 1FMLA 2J0SA 1EUDB 3WGLA 1KJJA 1NXVA 2PZ8A 3EOBI 5EXXA 4PY2A 1XZ8A 4FMCB 1XRLA 1GT6A 3G2MA 3TB4A 1ODLA 3RNLA 5ITZA 2QM0A 4P9NA 3MBKA 1Y6RA 2ECOA 4QOGA 3TZCA 4I1PA 3FVVA 2YV4A 3IO3A 4ND7A 4WOPA 1RM3A 5H9VA 5JZMA 3V3TA 4U0KA 3HXMA 4LBZA 2GAFA 3GMSA 3GT4A 4WOCA 1GAXA 2RB5A 3ZTWA 3WLIA 2OE2A 1VHWA 2W6ID 2R7KA 1EFLA 2YMPA 4X92A 4DB4A 3K73O 1KH3A 1CZLA 1KP2A 3IULA 3S81A 4K2HA 2BM0A 1V5GA 1TM7E 2A1TR 3FSGA 5E9QA 4AK9A 4BXOA 3ZCRA 3ND8A 4MKGA 3RIYA 2QN8A 4X1KA 5AKJA 1H0RA 1C3EA 4QXOA 2O5EA 4HN2A 2E4ZA 5CVEA 4TV8A 3J81k 1NI3A 3WGZA 4F3TA 2CZQA 3AERA 2CF6A 3PUVA 3DMTA 4IH4A 4XYEA 1HWYA 1BA3A 4TV8B 4Z4CA 4G1VA 2YJ4A 4V3CA 2Y77A 4HKTA 1IPHA 5M34A 1GR1A 2YIVX 1MIHA 1T0BA 3GFOA 3R5JA 2I7CA 1Z4PX 2NU8B 4BVFA 3DAOA 3I6MA 1Q91A 1Z37A 2IHUA 3PXGA 3VU8A 5KWEA 2GO1A 5JBIA 2R00C 1F0NA 3WWPA 1N3LA 3RSCA 2IDJA 1O96B 1QAMA 1UM9B 3B70A 3T4PA 5E3HA 3CVYA 1XN1A 2GCEA 4PRZA 4B7CA 2W6MA 1C0KA 2WF6A 2WFMA 2QMQA 1UBCA 4R0MA 2GBCA 3JSXA 3W2GA 4INOA 5T3YA 2E5WA 4Z8XA 1X7ZA 1NXSA 3M4JA 3PLNA 3DAYA 5A04A 4F4CA 3CVXA 4BUJA 1HQDA 1GPMA 1GCOA 1ZBQA 3EDQA 1UFRA 3D31A 2A7QA 2Z2KA 4E22A 3VHLB 1Q92A 4UNPA 2VJKA 1VSVA 3FBWA 3UATA 1YA6A 5I8WA 4E0BA 4LQ4A 1SKQA 2X7XA 3TNYA 3AF0A 3TZHA 4DLRA 4Z54A 5EWJA 2H5LA 2X6TA 2VA8A 1FFYA 3RU3A 3UV7A 4ZXFA 4HNAA 3D8UA 4Z2YA 3UGJA 2QYTA 3LFUA 3CNHA 4E3WA 1L9KA 2BFEB 2F3QA 1T5BA 1PEDA 1QPZA 4HLDA 3PFNA 1UT5A 1MABA 4MS1A 3FSJX 3T7SA 1C1HA 1OBCA 5F9HA 1YOBA 3OJCA 4PC6A 3W6ZA 3DDZX 2O14A 3CZ5A 1ORDA 3ZEAA 2NTEA 3A1UA 2E9SA 2WABA 2LCFA 3BGWA 1CFZA 4PTLA 3NDBB 1NSTA 4EABA 4P4TA 2HIAA 3KSAC 4DG8A 2HBRA 5G53C 1PS9A 2D59A 1BS2A 3KZNA 4XM0A 4MW2A 4IINA 3IEMA 1U0LA 4J7AA 1X7DA 1A9OA 4NYMQ 1DHRA 1ZR4A 2AFIA 4XH9B 2ACKA 2YMQA 3ADPA 4L5JA 3VTKA 2G36A 2XUDA 5ANRB 1ZXXA 3WMEA 4CM9D 2XYQA 3CRW1 1Y4UA 1I2DA 2QM8A 4Q16A 1F7UA 1SKYB 5I9BA 5F9MA 1Z7GA 3EY4A 4D0NA 2XNCA 2TMKA 2GN9A 4KLAA 5JE8A 5CIWA 2QD2A 3UKJA 3VR3A 1CPYA 1M3SA 5J5VA 3SOPA 3DE4X 1S2IA 3C74A 5LSAA 1AQ6A 2XDAA 4KW7A 4Y1GA 2P78A 2J31A 4BMOB 3PUJA 1C9DB 3KJXA 4RVGA 3ZU3A 2ZVPX 4RDIA 1ECBA 3TD9A 2FR8A 4FEAA 2PKQP 4WLFA 4EEXA 1W48A 4EO7A 4URUR 4L8GA 1G8SA 1UBUS 5JQGB 5C0OE 4FGKA 5FAKA 1WNTA 3KE8A 4YJDA 4XYMA 4BO4A 5KNCD 3CG4A 1ZDMA 4YJHB 4AWAA 4CXMA 1P2GA 2O54A 1FNMA 4RFLA 3DE7X 1OWNA 2ORIA 3H2JA 4R01A 1YE8A 2KQUA 2VATA 4QASA 4HEA6 3SR3A 5JNRA 2GUWA 3AF3A 3NDRA 3U3DA 1B0PA 1LTKA 3GN2A 1PVDA 1XTPA 4J43A 3VVBA 4D42A 1L4FA 2J3EA 4FFVA 2R8RA 3QPUA 4DBZA 2VSOA 4C4SA 2JIDA 3H13A 3KYCA 1XF9A 1A9XA 1QZUA 4GXNA 1MQ9A 3WP1B 3ZUGA 2WYIA 3UUEA 3M4YA 2C9DA 2F3TA 1FW8A 1OZAA 1SA0B 1V43A 4YJKA 4HGZA 3D8HA 2IOHA 3JQFC 3NX4A 3V2IA 1F5SA 2WT8A 4TV9B 4ZI5A 4AP5A 4C0KA 3WL7A 3IBYA 1BWSA 4KTVE 3CLUC 3H6GA 5TB5A 4RFSA 3TAHA 2I4TA 3G13A 5THQA 2B25A 4S1WA 2A35A 1FXWF 3ED5A 4O29A 1N8KA 4AS2A 3DBIA 1S7GA 3VBCA 1XEXA 3U19A 5L4LA 2YDXA 1DDOA 1PW7A 1JZSA 4DILA 1PR1A 2DR0A 5I9SA 3VSCA 3AZQA 5IXSA 2C2KA 4W1PA 5U9CA 3ASYA 4IZHA 2WLTA 5G40A 1PR3A 4N8EA 1U0SY 4AO8A 1QCCA 4NOKA 1KQOA 2ZAOA 3IOBA 4LGCA 1FYEA 3THYB 3U1BA 4LDZA 1BXGA 1TUBA 3CG0A 1L5QA 2QTLA 4B32A 5LQAA 4P35A 5JZSA 1WB9A 1E3EA 2BM8A 4WGFA 3BJMA 4RXUA 3KAQA 3SIRA 4H9GA 4DNPA 4DTIA 1USGA 2R00A 4ZARA 3LL7A 2H4JA 1C1YA 3IMGA 3IT3A 4I50F 4NTZA 3HCOA 4LW8A 4R8MA 3TZKA 4L8WB 1NBHA 1AQUA 4DTCA 1SOAA 5H4HA 5TT0A 3UUWA 5EJAA 5FPPA 5IF3A 3ORHA 3BSFA 5IAGA 1WA5A 2ECFA 4DJTA 6GPBA 3FDJA 1KOGA 1YC2A 2BCGY 1GZ5A 3H75A 3NNSA 3F2VA 4P84A 4BWVA 3W9YA 2OV2A 4EP1A 5KOHA 1JN0A 3TJRA 4BIMA 3BMOB 2K6GA 5U4XA 1NLYA 2R8YA 4WY8A 5LB2A 4B4DA 1U3GA 4B2YA 2I91A 2HT1A 4H1TA 5FOSA 1G5RA 5LIRA 3AJ9A 1NYQA 1OXBB 1WPRA 5K3SA 3W8DA 3OEHA 1F3LA 3OJXA 1NT4A 5TGZA 3RAGA 2YOGA 5BWOA 4IXWA 2A84A 3I09A 1GQQA 4BN5A 4B40A 4CF4A 3DDOA 1X1BA 2GA9A 5LQKA 3O94A 4EGQA 1BTOA 1Z0SA 4Q0MA 4HUQA 1UKCA 2QT1A 4HXYA 4QEKA 1VI2A 4R98A 3RYFA 4G0PA 3E58A 4UAUA 4DZRA 1YIOA 2QW0X 3BWEA 3KSDO 3UMSA 5IUNC 3IOCA 4YHHB 2BEVA 5PNTA 2XYHA 4E14A 4C7OA 5L6MB 1UM8A 1VGVA 3QNMA 3UMGA 3WWDA 3GD7A 3ASUA 1UMCA 3IRUA 5JDIA 5KYYA 1P17A 2BHLA 3F6YA 4M8IA 1C4XA 3ESYA 1G3QA 3DTVA 3ED1A 3MTJA 2B4TO 1UXGA 5K3AA 3TR6A 1EJ6A 3N2GB 4REOA 1WCIB 4XM1A 4LDNA 3W79A 3H1AA 2C1ZA 1TO1E 5TDHA 2YIMA 4ENWA 4RVDA 1QGUA 2A4MA 1PTJA 1GZ3A 3FZYA 4KIGA 5I7AA 3T1OA 4EB6B 2DCMA 2QOEA 5DBGA 3ZE2B 4CQLB 4V1CI 1U2QA 3MS4A 1TF2A 2F48A 3D9QX 2IZ0A 2XECA 1DT5A 1Z83A 5GZ1A 3RS0A 1L4LA 4PN3A 1UMBA 3HZZA 1N4DA 1JBEA 4WQMA 2MDTA 2ZIVB 4U6QA 1EK6A 2APJA 1ZGCA 2SKCA 2PDAA 3HN2A 3WHPA 3FH0A 3FFXA 5I6DA 4URFA 1TU3A 5SY6A 5EZYA 3OBBA 2N1MA 2JLYA 3FGPA 2GD6A 3DZIA 3F6CA 1N75A 3G17A 2FFBA 1O89A 4R4JA 2O5RA 4HP8A 4TQAA 1EWQA 2P79A 4EY4A 4K9RA 6ADHA 2C0QA 3K70B 1ZUIA 1T9GR 1FRFS 3STYA 1G6Q1 1R8JA 2H06A 4JX8A 1E7MA 4JEUA 2CLFB 4QT4A 5HBGA 3TECE 4O4JB 4I9UA 3UANA 3E2PA 3UOWA 4GO1A 2CXPA 4B9EA 4E5YA 4V1CA 1FFAA 2PTHA 4C0SA 1KVUA 1DZ3A 4DL9A 4K6HA 3BREA 3B6EA 4MPDA 5BP7A 4EKIA 2OMKA 5A9SB 5BSFA 4A6DA 1DIBA 3DHEA 3VR4H 4AF8A 4FYMA 1W5BA 1E7SA 3MQFA 4C29A 1V39A 2PUGA 2A5JA 4NFHA 1XVUA 3OTIA 3PWSA 5FCDA 5AVJA 5HM6A 1R8YA 3AFOA 3G0DA 2KLHA 1V9CA 2A0WA 1RYHA 3CQ9A 1O7JA 3WRWA 4KAFA 2VWQA 4EI2A 5JV5A 4XGRA 1F2DA 4Q7QA 2A9QA 4MUAA 2RHLA 4O59O 1JFSA 1TMGE 5IWAB 5TPWA 3EPRA 2WB4A 1KEPA 4OSPA 1NQTA 3QV1A 4H4DA 5BQ5A 1ZNQO 5EMHA 1QE5A 1B0ZA 3A3OA 1XZCA 3HDYA 3GUYA 1Z74A 4J0GA 4WL0A 5FYDA 2C8JA 2WJJA 3QX8A 3V7UA 3QRWA 3ZNNA 2VYVD 3H3JA 3JQ7B 4AD8A 1A9QA 3QYPA 3BPSA 1OFUA 4C0AC 3CZRA 4EG7A 2AFVA 1F1BA 3K35A 4AT1A 1OWOA 1KH1A 5KNDD 3TFOA 4CDGA 4XJTA 1VB5A 3PRJA 4V03A 3CLRC 1DUSA 3KE9A 2PE5A 1P9LA 2C5BA 2PIAA 2XMPA 4UHBA 3GLQA 3GP3A 1C8VB 1TKCA 2QIOA 1W5TA 1D1QA 4QEZA 5IKXA 1RC8A 4YONB 2GYWA 4EHDA 3BRCA 4FFLA 2XVAA 3BZWA 4IQ8A 4FHGA 2DLNA 3IO5A 1VSBA 2QZSA 1VFNA 2PS9A 2G0AA 1DAHA 1X3LA 3FPHA 3T0FA 1DC3A 2AF4C 2X76A 2Q2OA 3EDRA 5C2JB 4JOBA 2PLNA 1H05A 1O95D 1UT6A 5BN3A 3DL2A 3LHSA 5CDGA 3FGNA 1V7PC 2YVLA 4P3NA 4EARA 1JZTA 3ZZNA 1LU9A 3DCYA 4XAQA 4Y8VA 4OI0A 3FR8A 2O1EA 1K08A 2CLCX 4EJFA 4FGWA 3OZIA 4LJ5A 3SX0A 1Z3IX 3QSYA 4KX5A 2I34A 4MRVA 5EKSA 1DX4A 2JBHA 4S2UA 4U7HA 1U90A 3IKJA 1UKAA 3NTXA 1R5NA 4QOSA 3GZNA 4RA6A 1C80A 2P9BA 1PS0A 1XQ9A 1Z8NA 2HA6A 3FFAA 3KLNA 3CURA 3RTCA 2REBA 4H6XA 5CURA 4XSVA 1L4HA 5H5JA 3UOGA 4EAQA 2C92A 3JVIA 3L82B 3CRNA 4ZMBA 1ZN2A 3TLCA 1QHFA 1XE3A 1XU9A 2I5PO 3TQQA 1E8DA 3QJGA 1R0RE 4GLBA 3QIAA 2ZUCA 4B3SB 3ZY4A 2J1LA 2POCA 1JYSA 2WP0A 4X85A 2PQ2A 2EKQA 2ZR8A 3N8KA 4KNVA 5I4KA 2RHDA 1IE3A 1EIWA 4RQTA 1QFMA 3TZEA 4NAUA 1Q1QA 5B7PA 4CL8A 5D86A 1GFWA 4HDAA 1P0QA 4PZZA 5JAOA 4C04A 2FP3A 1XLTC 2YXEA 4O4LB 2YC2C 4QSMA 3HCFA 5FR2A 3SYKA 2Q3DA 4I3HA 1YRLA 1LPBB 3IGFA 4O33A 3MB5A 3DULA 2B0JA 2PUWA 1U0EA 3IYLW 3PGKA 4LOLA 4KXQA 5DTIA 3RS2A 5IHPA 1T1GA 4NS4A 4ZHQA 3AVXA 1UJ4A 4FDTA 1FRNA 3DVRX 4YCMA 4WMLA 3KL4A 4N54A 2F1HA 5K05A 3VR5A 2FFRA 3WBJA 3OLQA 1Q0PA 3C3EA 1KYTA 3Q6NA 3JQGB 5LLTA 2A4KA 1Y6QA 1FQOA 1LS6A 4UTPA 3NTVA 1C9KA 1HLDA 1ZM3A 4R9RA 1VMDA 1YF3A 2CBXA 1K6EA 1N0WA 3P2YA 1KY5A 3MM4A 1ZI8A 4IMRA 4BMVA 3PWZA 1J1ZA 4FQ5A 1BC5A 3VR1A 1Y89A 3GJ7A 4KB5A 3IXQA 4HUQB 4DMUB 3HFJA 5BMVF 2O2JA 3H9BA 5IAEA 1GDHA 2H00A 2YUTA 5F78A 2YJ5A 3NHZA 1Z5OA 5AM0A 3THSA 3ZK7A 2GD0A 4FC6A 3KEFA 2GZ1A 2OZKA 1E2KA 1TKBA 1DO0A 2V0CA 1ZIXA 3T8YA 5FPKA 2R1VA 4JR2A 1C2YA 1P33A 2JHPA 4U9IS 1YAJA 5TQ2A 1ENYA 1JHDA 1AE1A 3TEMA 3SDZA 1SVNA 1ID1A 1OLXB 3GMIA 5D3KA 1P8AA 5BNZA 3TZQA 4LYFA 1UC8A 2CWWA 5BNTA 2NMVA 1F8UA 4MOWA 1DOAA 4KNYA 1RKBA 2OHJA 2RI1A 5ESRA 4A4DA 3P96A 3I28A 3FYUB 3WNCA 4CMEC 1O08A 2VHTA 3KZCA 1B15A 2EKBA 2FVXA 3CNEA 5CGZA 1DJMA 3HU1A 4KU4A 1U8TA 5CBKA 1QG0A 2RARA 1T4CA 3FE2A 3W6UA 4LTNA 3W9SA 2XDQA 1Z4JA 4EA8A 3W5DA 5LDHA 2P5TB 3CA8A 4OVKA 1C0IA 3T5PA 4UEQA 3BBLA 1MENA 4HT3B 5C3UA 3OZSA 4DQKA 2FW1A 2VDLB 1LJLA 3DW3X 1OLUB 2LXNA 4IJ6A 4Z7OB 3EIOA 4BP9A 1YZFA 2HA0A 2AFRA 5AKKA 3TO5A 3HJAA 2A2ZA 1REQB 3LIIA 4ZQHA 2BDUA 2O1WA 3AVPA 3NUQA 1Y5LA 3PCXA 1CF9A 1T36B 4WBSA 3ZZTA 1ZWLA 1XRMA 1LI4A 4MYHA 1JTFA 1GAEO 2QJRA 3HP4A 1HE4A 3PGLA 5JADA 1G2PA 2AFHB 4I2VA 5T8KA 5J5CA 4UVGA 2HLDD 4KC0A 5DHQA 4BGDA 3ZE0B 5AW4A 1Q12A 1RKUA 5F2EA 4YPOA 5D2CA 4YMSA 5D8DA 2F8TA 4EFNA 4HB3A 1W36C 4FMDB 1NN3A 4OHZA 3TLXA 3QKRA 2PJUA 1L6IA 1SFRA 4KYVA 3EDYA 4ENUA 2ZYVX 5KAPA 3WGTA 3WGIA 4MKIA 1O94A 4EVIA 2P27A 4QTYA 2CLIB 1ENZA 1PSZA 1W0CA 2O2GA 1R6VA 4GR5A 4Z4GA 4YECA 2ZANA 3LUFA 2V59A 4ZIRA 1UR5A 2HJSA 2IP2A 1XDDA 2JCYA 1WZNA 1WLSA 3B6MA 5FFNA 4TXNA 2FR0A 3IP7A 2WWXA 3LA8A 3NFYA 3UFXA 2CVQA 1WAMA 3EXHC 2V03A 3JPYA 4BKQA 1NE7A 3EVBA 2P6MA 3D6MA 3GJYA 4HWRA 2NV0A 4BZPA 1E94E 2CL0X 5DT9A 4GMDA 3ZYZA 4G3XA 5E6UA 5FL7A 2PD3A 3M8KA 4O0MA 4LYDA 2AOUA 1JRLA 4LC0A 4LI3X 4OFXA 1X19A 1JMYA 2QZZA 2RCYA 1L4NA 4NDAA 1DPFA 1TPYA 1KO1A 2GD1O 2QNRA 2ZGVA 4BJHB 5I4BA 4MEJA 4HGYA 4BB0A 2D2EA 3ZV4A 2X8BA 4HFMA 1Q19A 2IIVA 5L3RA 2GSWA 1RYZA 5KTSA 4FN4A 5FI1B 2AL7A 4NZPA 3G8CA 3NASA 4LRWA 3IX7A 1UBFA 5COBA 2NUTB 3G2JA 3PS9A 4I14A 1UOEA 4QYXA 4D41A 5KYNA 3NG1A 4R69A 1NT2A 3JRXA 4JQSA 5DNVA 2XMQA 1SHJA 1L4KA 3NBQA 2B8JA 4BLPA 2DTDA 1CS0A 1MO4A 3C3DA 4FR2A 4LC1A 4MPJA 3KSRA 4NMXB 4YO7A 4AVYA 2FZ5A 1P1RA 2VZ9A 4HZUA 1GKLA 1I7DA 3AF6A 2HREA 2HQBA 4Z2AA 2C3OA 3ETLA 3A1DA 2DBRA 4R0NA 3TR0A 3VDNB 2FR1A 5HPYB 4CM9A 2XMCA 4LZLA 3RC2A 3WKAA 1E32A 2OZVA 3GDHA 3Q9NA 1XCLA 3LPDA 1MDFA 3C70A 2A9FA 3B6JA 4NJMB 5H7XA 4QYIB 4CM3A 2QDXA 1NHGA 1Q5PA 2AXPA 2V7BA 4MUMA 1T8WA 3EMDA 4MYCA 1YGPA 3UOAB 4LDRA 4ZT7A 1TCVA 1MBZA 5AVWA 3HVRA 4XDGA 3VGPA 3ACDA 1CZRA 4R41A 1VLVA 2BMJA 4ND8A 2ZIXB 2C3UA 3IEIA 4O5AA 3BWMA 2FOIA 4OB8A 4C03A 3U4AA 4D4LA 4N6OA 1NW4A 4WBXC 3EVDA 5C81A 2VQDA 2HMVA 4M1OA 3QFFA 4XFDA 1IY0A 2BGTA 2VSYA 3DOFA 4L73A 1W93A 1CE8A 3I9KA 2FEPA 4JVMA 1RVDA 2BZGA 3ZV6A 3WMRA 1AK9A 3WIOA 3QOFA 3K70C 2B9VA 3SZLA 1U8FO 4XGIA 3JWEA 4PR3A 1SHLA 2XMSA 3CN7A 1WBDA 3UXMA 1MC4A 2QVXX 3FVTA 3K2BA 3R6TA 4KE7A 3C16C 1OZHA 3QBTA 4IR7A 3TIFA 3MYYA 3WAJA 3K5WA 3H04A 4IGEA 2X5XA 2BM9A 4R0VA 4ATNA 3E9RA 4C4OA 5K6RA 3BB4A 3VDQA 3T3IA 1Z2AA 3ZX5A 1FMJA 3B7WA 1NW8A 3SE7A 1T0JB 4JIGA 3WGOA 3ROPA 2X58A 1Y1PA 2DRIA 2FOXA 2Q0QA 2XCUA 5KX5A 3BBPA 2HYIC 3CRVA 2GBPA 2ZRAA 4CMAA 2FPIA 2H6EA 1R0KA 3KQLA 2O0MA 3DDHA 3MWDB 4YTEA 1FFGA 1FJXA 1WMFA 3ASVA 3Q8WA 1S3FA 1T1EA 3ENNA 3HXLA 4AIIA 3ET5A 3H4VA 3GFBA 5DYTA 2EBHX 2YINC 3CIOA 3DC2A 3WSTA 4OMCA 4KE6A 4BFLA 2VYCA 2O2EA 5DI9A 3QBDA 3L8ZA 4EG8A 3S1AB 3VZQA 5A5DA 5CVTA 2E55A 4B1FA 3T3EA 1MB3A 5CCXA 2XLBA 4RIGA 2FWIA 3IT2A 4MXDA 4MJ7A 3PCTA 4JNKA 1J9EA 1J8MF 1XEAA 3GVIA 4YRCA 4EUSA 1PR9A 3KZOA 5HMLA 4I4LA 4MWDA 1N9KA 1TRKA 4HYTA 3AVTA 1GITA 1FDVA 3L41A 2I03A 2W93A 4B6GA 2HV9A 1CIJA 4FSHA 2IOQA 4MWGA 1JBKA 2JIRA 3O21A 3OHSX 2EWWA 2X9LA 3JX9A 4YNBA 2X4DA 3MGGA 4MVJI 1CJKC 2B4QA 2Q46A 2EZ4A 3LC1O 5IBRA 4WKOA 1VP3A 1L4YA 3FD8A 2IP4A 2OMEA 2KBFA 1E1KA 2VJNA 2N47A 4KFSA 5D3MA 4RELA 4LQLA 4EECA 1WR8A 5GVRA 3O2QB 4Q6WA 4B48A 3I1IA 4QG3A 1VLLA 1CEEA 3IPAA 1QQ5A 1U1GA 4CQMB 4DZTA 4AFNA 2DTXA 2W7TA 3FFWA 2X7HA 1H0KA 2PZJA 3NIFB 1WLYA 4AYXA 4Q05A 2FQQA 2H1VA 5J23A 1JE1A 1SOUA 4PX9A 2XOKA 4IXTA 1RI1A 1XHFA 1II9A 3H5WA 2PXHA 5CB8A 3MVEA 5F23A 4TROA 1YGYA 2ZT8A 1SAYA 2CVOA 4L3VA 2ZJOA 3A4VA 1E59A 3NFRA 3NTLA 1AGRA 3L6OO 4L5IA 4DJDC 4C87A 2E2WA 4CKXA 2NV6A 4HDRB 4OQEA 4BBPA 1G64A 3F9IA 3IIJA 2PX3A 5GONA 3PEEA 4I08A 2Z4SA 1UOOA 3ZV3A 1IU9A 5IDYA 3SI7A 3LY8A 1BX1A 3CX7A 3EWAA 3KG2A 2PMDA 2FCAA 4RLSA 4FS3A 3S8MA 2HQ1A 2P5SA 2Y99A 3EBPA 1U2ZA 1Q6YA 3I05A 3I04A 3Q7EA 4I2NA 3ZGYA 4W9MC 3AHFA 4ON9A 4TKUA 5DZSA 4ADSG 1C0EA 4F1JA 4XQ0A 1U0NA 1MIOB 2PKYX 1EK1A 2XKKA 1RAGA 1THZA 1DKRA 4G0NA 1ZD1A 2PQMA 5TLSA 3PQ8A 4G1BA 4O3MA 4UDXX 1TO6A 2JD0A 3RV4A 3AKCA 2VDVE 3K31A 4TRNA 4AO6A 2KX7A 4F92B 4GNKA 1TUEA 1ZHOA 1I2BA 3OJEA 2ZREA 4MV7A 2IOFK 2K7ZA 4N3AA 1EM8B 2NXWA 4L6CA 5ERGB 2XQVA 3U1VA 3CUWA 1TADA 4CJXA 5KHLB 2VDPB 4DVGA 1SIUA 3FCEA 4NEHB 1RW4A 1TUIA 5C8DA 1UZNA 3CR8A 4D44A 3AR2A 4ZJUA 3ZDFA 3K0AA 3D7LA 1IFXA 2GASA 3M6LA 4L07A 4ZAXA 3TSCA 4A92A 4EYGA 4OBXA 3VR6A 3ZHCA 3ZZ1A 2Q5LA 2NIPA 3RSHA 3ZW9A 5KOJB 1XTQA 4NCNA 1D7AA 2JFOA 1OA0A 4L9SA 4YRFA 2W2LD 3GT7A 2V7UA 3AINA 1GRCA 4AU1A 2NWQA 3THOA 2C2WA 2I33A 3A4LA 2ENUA 4O4JA 2OCKA 3AUUA 1KI8A 3HWWA 3K9FC 2X9QA 3IS3A 5FOVA 5IC5A 2H18A 3FMGA 4UE2A 4UM9D 5D1NA 5FFFA 1ULUA 1P74A 4ML3A 1FBNA 2J3DA 2HK6A 4KDRA 1M2GA 2CNLA 4NRDA 5EKDA 4HDCA 3GFFA 2AG8A 1WO8A 1XA3A 2ZRBA 3MCUA 3KZKA 2AX3A 4JJEA 5G3ZA 2QYOA 4LVOA 3OZCA 3L7KA 5KYWA 1QQBA 3T7JA 1C30A 3VC3A 2MYUA 2YUIA 4V0OA 5TC4A 3HVUA 1NR1A 4EELA 3ZCXA 5HKAA 2MMCA 2W2XA 2WA1A 4JP3A 3RB8A 1G2IA 4G4SP 4LFAB 2AUTA 3R0XA 2Z57A 4JSYA 5CM8B 2XQKA 4AUNA 1M0TA 3ZU5A 3X43A 2R751 3D3NA 4OGLA 3WLHA 3PTAA 2NO9A 4CQLA 1XELA 2C98A 4CIBA 2NAPA 4PGFA 1C3VA 1VFPA 4PAGA 3UMMA 2CV2A 4CKCA 5DULA 4Y2JA 1XAIA 3DL0A 3FYUC 1TEHA 2C00A 3ROFA 3WB0A 1B23P 4H0CA 3W7BA 5FXMA 1XK6A 1UFVA 3HJFA 4CL3A 5HKKA 2VNJA 1A5ZA 2GDZA 1G2OA 2PKQO 2ZE6A 2YWRA 3KKQA 1NUTA 4LS3A 2P9CA 1XRSB 3ADCA 1WDMA 2R1UA 4LC9A 2UVQA 1JAZA 3DEAA 5ILQA 1SEVA 1W6UA 4M53A 3GXOA 4FR0A 1CJUC 3PXBA 1Y4SA 1N3IA 4AZTA 2FSFA 2I1LA 2V7WA 1BRTA 4C6HA 3PNMA 3DL7A 1ZM4A 1GUBA 1I7NA 1YB4A 1DU4A 3TRIA 2WHRA 2CKDA 2Q5OA 3IHTA 1HQKA 1F2TB 2H1FA 4G4GA 2QL7A 2OM6A 4JP1A 4XX1A 2FDXA 1UPFA 3JARA 4PLZA 4ZZ2A 3UJBA 4D3YA 3OQIA 4I8IA 4MIOA 2BH9A 1EE9A 3IALA 2DQ4A 5DT2A 3AKYA 2YZNA 3HI6A 3ZLUA 4B6EA 5G02A 3B51X 1M5TA 5DE3A 1YQUA 2FH5B 3ZC3A 4B34A 4H6WA 3IP8A 1NR5A 5EKXA 5PGMA 2OAP1 3QKSB 1QYDA 3PTZA 4KV9A 5E6SA 1V3QE 2OZLB 1EDBA 2BFWA 4R2LA 1B0AA 2GHQA 4P33A 5DGXA 3WLOA 1YZNA 2JBAB 4MO9A 3F0TA 1YV9A 3KYIB 1LLDA 3L7BA 4R2MA 1W9HA 2QTVA 4TYPA 1QO9A 1X8XA 3Q7PA 4MHSA 2ERXA 1Y4ZA 4C7XA 2PJRA 4MVJD 2WJIA 3CSUA 7MDHA 2XDYA 4AYWA 3SLRA 3ANSA 1T6YA 3F96A 1WXGA 1Z0AA 1COWD 2X5OA 3HYRA 4KPGA 4BNTA 3KUCA 1XQXA 3C3JA 3GXBA 1A9ZA 3LOUA 4OQQA 2YKGA 1QDEA 2ZFUA 2CDAA 2JAUA 3DKPA 1W1WA 3G1TA 3JQRA 1P4JA 1RWOA 3WVNA 2NU7A 2YWFA 3PSHA 1YR8A 4RH0A 2FFAA 1FCJA 3OTGA 4MZXA 4UU0A 3M6FA 2ZDHA 5JMTA 2E82A 1PF7E 1R4ZA 1J2TA 2PH3A 2QUIA 3E70C 3HBFA 1RXYA 1OXSC 1ISMA 4MKFA 3KYBA 2IQ5A 3I5AA 3HNPA 3JAKA 4UDYX 3FMPB 1PYDA 3VSEA 1BDBA 2AG5A 4FHEA 3WICA 1ZMXA 1K68A 5LQDA 1FQJA 1U98A 1KDTA 4WNAA 5FD8A 5IZ4A 1ST3A 1XCOA 2HU5A 2JRCA 4MGHA 3GYGA 1S8FA 3LT2A 1HEYA 3CXRA 2CMKA 4LCBA 4EHIA 1EWKA 4BO5A 2P6PA 3BULA 4A8JB 1JKJA 2ZRFA 2WINI 4HY3A 4ZYUA 1BMFD 4JI6B 4EI8A 2BBOA 3IA2A 2WT4A 2VSQA 4MVXA 1KJYA 3NAMA 3O5AA 1FXUA 3VH2A 3WK5A 3QEAZ 1WCYA 3V00A 1GTMA 5ALHA 1XNRB 1E6WA 3QE4A 3UAGA 1UF9A 2XUKA 4PFJA 5AKXA 5P8WA 5A7HA 1E5LA 2BFDB 4REQA 3REFA 4N9WA 1OVMA 4TS3A 4TS4A 5F3WB 3OQPA 4ZYZA 4JUFA 3VO8A 3PR1A 3WA7A 1SZCA 1Z33A 2ZUTA 2QUBA 2O1XA 1O4VA 2D5AA 1FUUA 4XWOA 3O8NA 1FP7A 1J0EA 3B3QA 3NBXX 3VR5D 3WK6A 1O57A 4YCNA 3HCRA 2YN0A 3KP1A 3ZW8A 3EX7C 1IN6A 5JS1A 4LJKA 5L40A 5ADUS 3AL0C 1P0FA 1E2DA 1XKLA 1YQ9A 4QU8A 3G0GA 2W6JD 3HYSA 2WHYA 4H16A 4IGIA 1KQNA 3WIVA 3WLTA 4A2QA 4CF5A 4ZZ0A 1Q1BA 2ZJ7A 2R6GA 3KHSA 2LTAA 4LHZA 2E5FA 2Q49A 4GZ3A 2O20A 2EJBA 3FYSA 4P36A 3EPPA 4IOMA 4PONA 4GKJB 2WQZA 4GR4A 3EYWA 5BN5B 3VFDA 2CLHB 1RAAA 1NN5A 2NG1A 1UMDB 5F35A 2Y92A 4EX6A 5AT1A 3K15A 3UJ7A 3CUTA 4GM4A 2WJVA 1A7AA 1JKXA 2WIAA 2WE7A 4MEBA 2YWHA 4UPEA 3GLIB 2WPNA 1DQPA 2Y27A 2HHAA 1SXIA 1DXHA 2Z09A 4DS3A 1TD9A 1MAUA 3BH0A 2VP9A 1DWQA 5MN5A 1OYYA 3NB0A 3RGWS 1N25A 3VAYA 2GWRA 4ETMA 2XVXA 2AC2A 2WI8A 1WKCA 1FLAA 3WGKA 5D6NA 5JNVA 3BUSA 1Q6ZA 3ZKWB 4EI9A 5HUHA 5J1SB 1AKWA 4KWCA 4Q15A 4JWKA 4ARCA 1YACA 2GPBA 4GMKA 4IV8A 4J0EA 4W7IA 4DVJA 3FYHA 3GLHE 1FDTA 4X6UA 5HF5A 1ULTA 4B33A 3ISJA 3LQFA 2H4YA 4FFMA 4TVBA 4EATA 1BE8A 2GNAA 1F14A 5DSTA 1I4DD 4DPKA 1EVEA 2FPOA 1L7MA 1KSHA 3A26A 3NRJA 4BLWA 4YUAA 2GA8A 4P4UA 3G9ZA 4X41A 5AJZA 4JB8A 5KNBA 2PEZA 2F9LA 2J8ZA 3GEHA 5IT9A 1E2QA 1FFHA 1QGUB 4BMXA 5B1IA 1GVNB 3PFHA 4NH0A 1L5KA 2J3HA 4R83A 4EY6A 5L45A 2PGIA 1F9AA 2UVDA 4CDMA 2BH2A 3D4BA 5JPCA 3PDHA 4FWBA 5LZ9A 5FO1A 1N1EA 4QIHA 1POXA 1E2JA 1YR3A 2Y1XA 4TKZA 2B21A 3H7IA 2GMWA 3T3PB 1HGXA 2IYAA 2ZYAA 2ZSFA 1SOWA 3MRXA 4FLEA 1E2HA 4MEAA 2REQB 3V2UA 4YYEA 1YJXA 3NOOA 3VUFA 5TEVA 4ODIA 2GQ0A 2NYAA 3RK1A 4ZO7A 2Z5VA 1TVKB 4JENA 3DBVO 4FHZA 4J2TA 2G8NA 2ZITA 3C8UA 4WZZA 5FLKA 4CIDA 4N3BA 1YS1X 3O4FA 1X1QA 2WM3A 3QI2A 4JEHA 4TTVA 4Y6LA 4LE2A 4UXJA 4EG6A 5JXJA 4BLRA 1AKYA 1I0LA 3HO1A 1KK1A 2ZIEA 4JVOA 2JFBA 3FPJA 3GQVA 2XZTA 1R4AA 3ZVLA 4X94A 5IANA 4QNMA 1G18A 1S3SA 1LVUA 3GNQA 1NPTO 4XXHA 4QWMA 4Y9RA 3VO1A 3HQ4O 1YRAA 2H5IA 4J0HA 3JYNA 4BO9A 2RJ3A 2B3TA 3IH5A 3FMOB 4G9BA 4OI4A 2BBTA 5HJ2A 2OORC 3EXEB 4ONEA 4RSMA 2BAGA 1JQLB 5AQEA 5HA5A 5KI6A 4E08A 2O5CA 2JI7A 4U7WA 1GWNA 2XCOA 3OZFA 4EX7A 1R4MA 4PYLA 1D0SA 4M9RA 5IKPA 1L1RA 4LXXA 3NKFA 5EXDA 3PR3A 4DC9A 3QE3A 1GGMA 5FTMA 5C5EA 1XPUA 3B9PA 4OU4A 1YB2A 1ADBA 1U3VA 3ZCSA 2XOEA 4KMSA 3TQIA 5D1HA 3MSXA 4MMXB 4YJGB 2P9ZA 1BE6A 1G8YA 3IAFA 2JL1A 2W58A 2OXCA 2CWDA 3NUZA 2VA9A 4NX2A 4LFBB 3HACA 2NZWA 3I30X 2Q6KA 4BVKA 5B12A 2D6FA 2WB2A 1XCPA 3SM9A 5KDOA 1NC3A 1OE0A 1ZU5A 4OHMA 3NEAA 3LPLA 1C9YA 1JT9A 4KIJA 5HZGA 1QF7A 3DWIA 4U7GA 2XCLA 2O2CA 3CYFA 1E1NA 5F7ZA 3GUVA 5CDUA 1JB9A 3BXGA 1J56A 3ZK8A 3R7WA 4N3NA 3MCAA 3BMQB 3S2IA 1FDWA 2QLBA 1YDHA 3V4PB 3PHBE 4MIKA 2FAXA 2WWVD 3RWOA 5K0ZA 4RTJA 3FPKA 4ENRA 3PQDA 1NRJB 4MGEA 3QLVC 5F1OA 1Z5PA 3PD1A 1ISIA 4R1MA 1WIWA 4B3BA 2HHHB 1R0SA 3O73A 3R5KA 2IBTA 2GEDA 1EVIA 4XIYA 5EE0A 4AB1A 1E89A 4LHVA 4F4HA 1C8KA 3TIIA 4X44A 1U7UA 1EGQA 2CD9A 2PZFA 2ILVA 1JALA 3MW8A 2FZCA 4NZNA 2DBQA 4RHYA 4JGBA 3W4KA 2COEA 4QKQA 1LZLA 1DMSA 4HI0E 3N58A 4G8JA 1YBFA 4YYZA 3SR0A 4YUWA 1LNSA 5CFLA 1N57A 4TTTS 3URKA 4UCXA 2XR1A 1RQ2A 3UO8B 1BXGB 1TUBB 2X0JA 1B8VA 3RG2A 1K0FA 4UM5A 3LNCA 1NDQA 2ID4A 4MRPA 1PN3A 4C2UA 1IJFA 4CV0A 4TQGA 1IOZA 4BNHA 3TRKA 1R66A 2G1UA 4TMZA 4X1IB 4YRNA 3FI9A 1EX9A 1WSBA 1FX1A 3H2KA 2PFKA 2FW9A 1ZEMA 3A04A 4P34A 4M8LA 1ZD8A 3GRUA 5FDFA 4B7AA 1RHMA 5HYVA 2DZDA 4H3SA 4TTIA 2B5VA 1OLUA 5M29A 2IH5A 3DZJA 3C3KA 5KDDA 5DWDA 4HNTA 2C84A 3PDJA 4N9QA 3V42A 3D6TB 3GK3A 1VBFA 5AXAA 5I9IA 4DR1B 1YD7A 2BFMA 2DUUA 5IVDA 3I2FA 1AZSC 4FYHA 2R6R1 3O8OB 1BH6A 3F3MA 2JB9A 3R6LA 1I80A 5CVCA 3RABA 3E7PA 3K1YA 3RC1A 4Y6RA 5BSRA 1J2RA 2VF4X 3ZHSA 2IXAA 5JLJA 3UCXA 4JR1A 4Y2XA 3PKZA 4KKXB 1SQ5A 3HWSA 2VQ3A 1C2TA 1OAKA 3L6DA 4RV5A 4UD6A 3FUWA 1KP9A 2HUPA 4D3DA 4HNSA 1RHRA 4HH4A 4I5FA 3U13A 3R3XA 1SG0A 1KI3A 1ULSA 4H7HA 4PLCA 4TMFA 3UUFA 5K0GA 1QYIA 1YQGA 3ER6A 5F51A 3U4DA 3QA9A 5TT1A 4DEYA 1MV5A 4ZIRB 1IAVA 4ZQCB 3SX2A 4ZPJA 3KHTA 2CB9A 1ZLYA 2ZQYA 2IPXA 3H0EA 5FOTA 1WX1A 2AXNA 3DOJA 1CR2A 4GWKA 1NMEA 4LA4A 4BFZA 5C46F 2FEWB 2Z9CA 3FTCA 3U4QB 4LZWA 3JQBA 5FV4A 4N5IX 4MAFA 4NZ9A 4YAWA 4FGSA 3F49S 5U4QA 1UZUA 3ANNA 5LMUB 1MF7A 1QTRA 1J06A 4MB2A 1F3OA 4U3JA 3ERCA 3Q2OA 2GEJA 3CNQS 1NLZA 4UEJA 4FDMA 4GBJA 5JCZA 3E9ZA 3AWIA 3CU5A 2I22A 1W49A 3RWBA 2RIRA 2PGOA 4H2DA 3GLVA 4ZAGA 4RIHA 1DINA 3B53X 3FVQA 5BT9A 1CFJA 2AVDA 2N9UA 3K1TA 3KV1A 5FTKA 4IVPA 4QBHA 4E5UA 3FWPA 3NT5A 2O8CB 1BJRE 3C39A 4RF3A 4HO1X 3A6KA 5HSGA 3UTCA 4FVTA 2I4NA 2YVQA 3D8SA 2FTKE 5EP4A 1U31A 3P5BA 3PGXA 3ZE6A 1VL8A 2I6UA 2YS6A 3A31A 4QFBA 4A10A 1IEWA 3ZIDA 4D4JA 5KB3A 5D01A 1Q22A 3EE6A 1VYHA 3N70A 3C5WP 1Z4MA 2B4AA 3FM9A 4GXRA 1SJ9A 4P2BA 5FF9A 3RHTA 3NAZA 4RVFA 1OAOC 4OLBA 1H2WA 4G4IA 5P21A 2YR0A 2AT1A 1ZMTA 3MF4A 1WPGA 1GV0A 2GBFA 3FYCA 2OBYA 5BPHA 1AQNA 2GZRA 3OT5A 3PVZA 4KZKA 1X2BA 1QK5A 1PNOA 3DVAB 1UXOA 3FOEC 1H6AA 1VYTA 4D0LB 5AQ1A 1P44A 4BMCA 3EZFA 4NDZA 4CKBB 3GWZA 4D5GA 3AFNA 2CLOB 2JI4A 3GEGA 1PKXA 3D1LA 3HNOA 4Q01A 1V7QA 3PWKA 1Z5GA 2C58A 5EQJB 1P4GA 4YRRA 3BFVA 2CJWA 2H9AA 2C0CA 4KWHA 5TJ9A 4RF4A 5T6MA 3I1JA 3REOA 4CL2A 2GYYA 4EY8A 3B2EA 3JQAD 4J7CA 4Y9TA 2ZJ3A 3VR6D 2C2BA 3H8JA 1YVEI 4WKGA 2ROQA 4MUJA 4R71A 1JDVA 221PA 2HCT