4F5WA

Crystal structure of ligand free human sting ctd
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
193
structure length
193
Chain Sequence
GNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDRAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Transmembrane protein 173
publication title Crystal structures of STING protein reveal basis for recognition of cyclic di-GMP
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2012-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4f5wA02
4KSYA 4LOLA 4EF5A 4QXQA 4F5EA 5CFQA 4QXOA 4F9EA 4LOKA 5BQXA 4KC0A 4EMTA 4EMUA 5CFRA 5CFNA 5CFPA 4QXRA 4KBYA 4F5DA 4EF4A 5CFMA 4JC5A 4QXPA 4YP1A 4F5YA 4F9GA 4LOIA 5CFLA 4LOHA 5CFOA 4F5WA 4LOJA
chains in the Genus database with same CATH superfamily
4C4PA 3A3OA 4L9AA 3ZE6A 1R74A 3EEQA 1SKUA 4IJ5A 4ARAA 2ODTX 3CNEA 2GHRA 1UXJA 1SUAA 2E37A 3THWA 2O1WA 2Y9MB 3WBJA 1M2FA 3L0YA 1RZVA 2LCFA 3BMXA 5CT6A 5GGYA 2NUAA 1J0CA 4R9VA 4NYJR 4X1OA 1WPXA 4QICA 1XRRA 4R7TA 4BYGA 3K70C 1YBVA 1WW8A 4GOMD 3QUSA 8ATCA 3G2JA 4IGEA 2DC1A 5K09A 1VJ1A 1LX7A 2B7LA 2PXXA 2C57A 1C3XA 3OHSX 4A2QA 5HP4A 3Q5EA 1RLOA 1RJDA 5JD6A 2R6JA 2WIKA 3VBEA 5FWXB 3PQCA 2BY4A 1M7GA 1YZTA 3KKLA 3GN1A 4JLWA 3FD8A 2J3LA 3DKVA 2R6R1 4IIXA 4IIDA 3QENA 4B48A 3W8DA 4MK4A 4Z9FA 3QXXA 4MRVA 4NMXB 5EJAA 5GOZA 3N6XA 5INTA 4IAOA 1D4ZA 1EQUA 2SHKA 4ZC8A 5DI3A 1GL7A 4GI1A 3QJ5A 4IILA 4X8LA 2HLDD 1F51E 4L5BA 3WRXC 1AMNA 5BQPA 2JB9A 5TT1A 3MTBA 1BGVA 1G0NA 1JDPA 2X0KA 3AJDA 4QEDA 1MBZA 2VKQA 5DYTA 4KPFC 4CMJA 3GYGA 4PS1A 3OLWA 5EJ6A 3EAGA 1U0BB 1KAEA 2ZE7A 4BNXA 3W5VA 3N2IA 1Z0DA 3OTGA 3U61B 1DV1A 2A94A 4FU0A 4K2HA 5F1PA 1C4OA 1KBZA 1V5WA 2JHGA 3BTVA 4W6ZA 4UU0A 1M34E 1G8SA 3PC4A 1QVAA 3IKLA 4DYDA 5IAAA 4KN8A 1HNXB 5JWOA 2H9AA 4OMUA 5LXTA 3PEUA 1E1YA 4E15A 1C8VB 3EMKA 2AXNA 3IEXA 2H4XA 3P0JA 4ZOLF 3WAJA 4KH1A 3GT7A 3TQSA 2FN8A 3DQQA 1EZZA 3GLFA 5NLLA 1T34A 4HUQA 2OBXA 1J00A 4MP8A 3BE8A 3IQZA 4KYTA 1OX4B 4YGYA 4RYLA 3FOCA 4QREA 3M4YA 1U0HC 2HBRA 2ZIUB 3PQ6A 2Q41A 5KHLB 3RHTA 3F2IA 1ZUHA 4MRNA 2EKQA 2PXAA 3B20A 3ET5A 3M4JA 4W5TA 5IVDA 2Z6VA 3VTZA 3RVSA 3Q0IA 1T4CB 4AJPA 3WMGA 3BTUA 4MDFA 1OWMA 5T5QA 5I9BA 1KY5A 3WK9A 5IMSA 2JGIA 4TVOA 2BBTA 1T5SA 2OCKA 4DSAA 1M54A 4NV3A 4HGOA 4AAYA 4P3KA 2DKNA 1WDKA 2IHKA 2JLBA 4OP2A 3C3AA 4H77A 3EFBA 4U6SA 3DM5A 2Q1WA 5K3DA 1EI9A 1LJUA 2JBHA 1FFDA 3RIGA 3WKDA 4EG7A 4G0WA 2VT6A 2VZ9A 2E18A 2JVJA 1C9EA 3BHIA 4ZI2A 1F17A 3F1LA 4LZJA 1JEAA 3R6TA 4PFQA 1XNQB 1QNFA 5F4ZA 2WHRA 1YC5A 1H9CA 4KWIA 4JUIA 1H8HD 2FXIA 1MOQA 1TF7A 3G82C 3N2YA 3NM4A 4KFTA 1OGYA 2FOIA 4ZVTA 5FBHA 1BCRB 2J9FB 4ECAA 4RK6A 4UFOA 5JBQA 1UKVY 1BROA 4BO5A 5ELMA 2L82A 4ZYUA 4AULA 3O1IC 4I8DA 4B3CA 1NMZA 4KXNA 4BGUA 2BEUB 3AI7A 4RE6A 3ZWWA 3E53A 3BL6A 3G02A 3NH6A 2WK1A 1ITZA 3E18A 4TRRA 2OESA 4RD6A 3I6QA 4QA9A 3OD5A 1FS6A 4BFCA 1KGSA 1G8HA 4IV8A 4OG2A 4UAVA 4HDKA 4QHTA 1FW8A 2OTCA 4A10A 1GA1A 2LDBA 2Z98A 1RKXA 4MTCA 1X92A 1XZCA 2C00A 3KYIB 5C37A 5KVVA 4HWRA 4CG0A 3IKVA 3L40A 2J6CA 4BN5A 3DC7A 2JEOA 4II7A 1WOMA 1OBOA 1T10A 1QHYA 4QQKA 5IF3A 3LAWA 2JGEA 1C30A 2CLDX 2IXAA 3I9MA 2NPIA 2I3ZA 3GGSA 1VKOA 2XWJI 4ZVMA 2R65A 2ZXEA 3P45A 3TZEA 2H3HA 1QVVA 1DTEA 4XA8A 4K6KA 2J3IA 1NE2A 1YBFA 3U9TA 2HNAA 2DOKA 3T52A 3TR5A 4RPLA 1SCIA 1IXKA 4IUYA 3LQ2A 2ACKA 4JCOA 5DHPA 1Y8AA 4O59O 3EVNA 1KI1A 1N4AA 3O83A 2ZAMA 1B6SA 2ZG6A 3KPVA 3INTA 3M1LA 3I4FA 2WUDA 2CVOA 5ITZA 5AR1A 1U28C 3COVA 2K7ZA 1Q92A 4RO0A 1LDEA 1WCIB 4P4TA 2JGKA 1P0MA 5HZHA 3MHTA 1LFDB 4OQZA 1K1EA 3ZGZA 2CYAA 3QNMA 3R24A 5SY4A 3RRXA 1TL7C 2ZCJA 4IWYA 1I24A 5L53A 1G9TA 3AV0B 2OP1A 2I62A 1YB6A 4Y0NA 2WA2A 4IMRA 1LLUA 1BMFD 3BBLA 4HX5A 4D6YA 1MC4A 3V7FA 4DJEC 5K0ZA 2JEZA 3ISVA 3O94A 5EUBA 5J59A 3Q10A 5FOWA 4KXUA 5ALDA 2ATXA 3DONA 3HBFA 4CM9A 1UM9A 4LEIA 3RROA 1GZ5A 4LWPA 2C3OA 1TTPB 3ZDQA 2FB9A 1K5PA 3C70A 2W2LA 5EMNA 3DE6X 4NNPA 4M9SA 3V1KA 3ZHZA 2NUTB 4WA8A 1X8KA 2PGLA 4UEOA 3IUYA 3BL5A 5LA6B 1Z6PA 2VH1A 5IVHA 1UDBA 4OHUA 2WABA 1VRWA 1S01A 2OT3B 4K9DA 1KVRA 1GNRA 1SK8A 3IJEB 1YRWA 2R6GA 1NW3A 3MD9A 4M54A 5FBLB 3W2IA 4O3MA 3TW8A 4E1BA 5E8RA 1RHMA 1GKLA 3ZHCA 4I5EA 4V39A 2IU4A 2IIBA 3NG1A 4JJ4A 5LQCA 3H3XA 3AR6A 3JQ7A 4U7FA 3DYVA 3LRPA 3LUFA 5ILQA 3L8ZA 3RBXA 1FP2A 3U6BA 3TAHA 5C51B 1NSYA 2QYHA 3NZEA 1H93A 4G5FA 2QBYB 5FBZA 2CVZA 2OPHA 1WCXA 4UAJA 2QG9A 5ER9A 1KYZA 2H5LA 1PFKA 3CU5A 3ZWDA 4UXIA 3G0BA 3W5UA 5GOTA 3SBEA 3ZZNA 5JZMA 1R0YA 1VYHA 1KMQA 2XGSA 5J4HA 3T41A 1V47A 4P6VF 4Q18A 3NBAA 4JLKA 4X44A 2C7QA 4DIBA 4QYIA 2BEKA 2H5JA 2M6LA 3RO7A 4YRBA 4WOCA 5JD4A 4EHDA 2O4UX 5IYZF 3SQLA 1QFJA 1T4GA 2ZUUA 5I9IA 2X5XA 3PX3A 4IVPA 4RKRA 3FCXA 2RHOA 1KQFA 1OCEA 1ZOSA 1XRSB 2EKBA 2PFSA 3GLUA 3OJLA 3T5CA 3L2OB 1YQQA 3VISA 5BRJA 2QORA 2W6NA 2IXTA 2AZMA 2FNAA 3AIOA 4N6NA 4WY8A 5HZMA 1JWAB 2XWQA 1FJXA 1Z33A 2TYSB 2CMFA 2VJBA 4H1UA 1RXCA 2RH5A 1LK7A 1XLUA 3KB2A 3R6DA 1SVSA 4J3FA 4IIFA 3ZBQA 4HC4A 1TOAA 2IOFA 1Z82A 4G2NA 3OCYA 4OF4A 4PG7A 3T15A 1OHHD 3IMEA 4EITA 4LUCA 1AV7A 1UXGA 1M6VA 1L1RA 3PPWA 3QXJA 4C2BA 2Q0SA 1G4UR 5AT1A 2GPNA 5THKA 4LOIA 1XPRA 1JHUA 1HX7A 1PJSA 2O1EA 1AS0A 2PO5A 4CKCB 2BFBA 1HDYA 3ANNA 5H59A 4DBVO 3CVVA 1NWHA 4BX8A 1W9HA 2O2SA 2PFGA 4C7OA 4KEAA 3AEKB 2KBEA 4BFWA 1VG1A 5EMKA 3EXIA 4F1JA 3JPWA 2ZYTX 4HAXA 5TPWB 2P2DA 1FEZA 3EG5A 3TG2A 2PMFA 1P2DA 4E4TA 4DV1B 1TA4A 4OJNA 3KWLA 2ZYUX 4K81B 5IZCC 3ASZA 2XUPA 3RRNA 1NDQA 1P6XA 2R44A 3LHFA 3T8YA 5LNK1 5LLDA 3LPDA 1IQRA 1XEWX 3OCVA 2YZ2A 3ROFA 4ZV9A 3H17A 3QU5A 2ZB7A 2CXPA 4FJ0A 3BCSA 3B8EA 3BCUA 1DGQA 4ESOA 4KPEC 4KR9A 1PK8A 1QS0B 3U3ZA 2FGJA 2IDJA 1ORRA 2OBNA 4JITA 3TLCA 2AB0A 3QLVA 1WPRA 1FFSA 3GRRA 2J67A 4MCHA 1WZIA 4OBWA 3PUKA 5TQ0A 4KOAA 4REOA 2ZIEA 2ZOSA 3V46A 4B75A 4UBJA 1WDTA 2KMLA 3WTBA 4G1FA 4JIMA 1C29B 3VX4A 1W29A 3ANSA 1GAEO 2FK7A 2QNIA 4P4LA 1LNQA 3ZGYA 4ESEA 3VNUA 1CS4C 1NLFA 1CJBA 2YIJA 3FWHA 2E4YA 3M3PA 4PSAA 5DV9A 5GP1A 2DT8A 4Z2AA 5FBVB 1Z0IA 3P4XA 3KG2A 3B51X 1M74A 2I2AA 3E58A 4ETNA 1FJ2A 2FLWA 5IYZB 4TVSA 1YQEA 1Z6QA 1OZGA 2IOFK 3LQFA 1GN9A 3CQ9A 3PNOA 2ZWVA 3K0AB 4EI8A 3PDHA 5K51A 3J81A 4XSHA 4OHCA 1SHLA 4C43A 4D6XA 1Q1GA 3JQPA 3IP8A 1R9GA 1FMJA 3GOHA 4R5MA 1DIOB 4ILEA 4EKIA 3HDYA 3OT5A 3JALB 3LQYA 1ZR4A 2B1RA 2W48A 1RAAA 4RKEA 1E69A 4ESHA 4QPDA 4M0DA 1FTYA 1IMJA 1TKRA 3ZK7A 4Z7NB 4U2KA 3LT4A 2REQA 4KX3A 5GV8A 1JG2A 4LXGA 3LPLA 4LV5B 3TZHA 1W75A 5DEOA 2APJA 3VKGA 3PS9A 2H07A 1V45E 2N75A 4GNRA 4KV9A 5AQEA 3ADCA 3FOZA 1AHIA 1JSXA 2FE4A 2VPZA 3G89A 1BNCA 1QOPB 3U81A 4HLCA 3VYUB 1SBYA 4KKVA 1BOOA 1KI7A 2IU3A 1CY0A 3M5DA 2YJGA 5FUQA 5FYQA 1MC1A 1CLEA 1XRPA 2D06A 4NG5A 3NAQA 3LCRA 1Z5NA 3PUZA 4MS1B 4TXLA 4X45A 3WLRA 4XWKA 1W5TA 2PMWB 3G5LA 3KL4A 4P98A 4E2XA 2C9OA 5K3OA 3FFAA 1ZKMA 5LD2B 1KDVA 121PA 3PJDA 2OCGA 3LQ4A 1ORDA 1BC5A 2VH5R 4F6RA 4L28A 3H7IA 3KZOA 4X8HA 1YA4A 3PGKA 1BJTA 1VZ3A 2OVBA 1QHIA 3B2QA 4IQ0A 5DWVA 3RUPA 3A4LA 1V3TA 2XKJE 3PI7A 2K6GA 3EW9A 5E6UB 3KAQA 4ENWA 3ID6C 3ICCA 1W47A 3KUDA 4J1NA 4XDHA 2HLDA 2NLOA 2UUAB 4NBVA 2ERCA 3W0LB 1G3MA 4G3XA 2VYND 3C3MA 1X7XB 4M87A 2QD2A 5DXJA 4MA0A 3TVDA 1VM6A 2CDCA 3D5TA 1E0AA 5ADVA 1Y8QA 3A1WA 2C1EA 4AJLA 1UWKA 2IX9A 2MR5A 1FFXA 4R1MA 1M1NB 1M33A 5CFRA 1KY4A 1ZESA 1BA3A 2FSHA 4R1NA 5D7NA 4ZZ2A 4UBOA 4Z51A 3GUHA 4YQYA 4R9SA 2AQHA 3TSZA 4EJSC 4M36A 1I4EB 2OOKA 2X5NA 2G83A 2VXCA 4FD2A 4TRNA 5B3AA 3S1LA 3MJHA 5C1IA 2FEKA 3V34A 3O4VA 1CERA 2WWWA 3CCFA 5LZ4A 1VMDA 2VF2A 2ICAA 1MVNA 3WRXA 2PUWA 3NWPA 2IOQA 4M9CA 3SEAA 1NQUA 5AQ1A 2NYAA 5BNTA 4TTRA 1K5GA 5EQFA 2PVSA 4KN5A 1L7MA 2V7WA 3HXQA 1HG0A 1OKKD 3WKBA 1OT3A 3WB9A 3WGGA 4DLWA 5JNVA 4J2TA 2R8EA 2OGTA 4QPJC 2ETXA 4TTVA 2A78A 2JFZA 3ASUA 4QVGA 4JVOA 1PD1A 1WMSA 3OU2A 1LDMA 1Q2UA 4IW3B 3T4UA 3I30X 5E0KB 3UO8B 2FEAA 3G9XA 1UKCA 3KPWA 3IKTA 1H6BA 4RZXA 2OV2A 1NAHA 3JWIA 2VWHA 3P9PA 1EPUA 2A14A 2B36A 2NNLD 2ODQA 2P9QA 2R1TB 1IULA 2IKQA 3IR7A 4K6OA 3WWZA 4DM4A 3A9SA 3D4NA 2I3AA 3WHIA 1P17A 2PRZA 4C78A 1TF2A 1D1SA 3LO5A 3PGA1 3QMVA 2WPDD 4X24A 1P5HA 1ZGGA 3ESDA 3A26A 3IR6A 1G9XA 3CO0S 1GNTA 4LXYA 4M1YA 4U39A 4WY5A 4O2RA 2I4MA 3H8SA 2CCGA 5E1BA 3A6PC 1J33A 1VP9A 1W88B 4CEHB 3IBTA 2BFAA 1ZJWA 5A5DA 3EZFA 3TLMA 3ROPA 2YN0A 3N8KA 3OO1A 4JX8A 1UZAA 1H8HA 2WG0A 4IFEA 5H68A 4ZMSA 3PNPA 4TV9F 3D1LA 2QY9A 5E7MA 4BDTA 4ENTA 1JLMA 3WL7A 4OKSA 3HV2A 1P7CA 4MNTA 5TMBA 3NNSA 5MGBA 3Q12A 3T6KA 4X66B 2J46A 1LWOA 3D2BA 2OV3A 3Q1LA 2QX8A 4H1TA 1B6GA 3NIGB 3DSRA 2OXRA 4XVUA 3PQ8A 5DSXA 4F8EA 2I4NA 1JBEA 1QZTA 2QRZA 4IIJF 4JBGA 4WEQA 1E2IA 1HETA 3LXXA 4NFSA 2NPOA 4AWXA 1MP0A 3QVKA 3PF8A 1QOQB 1GQOA 1NF2A 1PBNA 1ZJJA 3OPVA 2QGFA 4TKUB 3C8HA 5JRJA 1FQOA 3UG6A 3VNSA 3WJAA 4DADA 1F9AA 1SXQA 1WTCA 5A4JA 4BJ1A 4AN0A 3RTBA 2E85A 3WG9A 4NLLA 3UHAA 1ONPA 5K8CA 3OE4A 1JJAA 4J0FA 3A9RA 2KM1A 2EQBA 4JLPA 3WL5A 3E8SA 4WKGA 1IBRA 4RFLA 1J2RA 1EFKA 3AP2A 1E5VA 1VLQA 3IYLW 1S2DA 2ECQA 2F2TA 5KJCA 1CJUC 2AVNA 2B6NA 1J97A 3TYXA 4OO3A 2C8JA 5DGDA 4K9OA 2Q1YA 2IZ6A 3DMDA 3F49S 3I5AA 3KT0A 2PT9A 1RRKA 3C87A 3ROMA 3SP1A 1XFAA 4A73A 4CKWA 1VC2A 2ZYGA 1W5SA 4V2IA 4PLVA 2G0AA 4XUDA 3HFJA 4HAZA 1Z5UA 2V6JA 4JUDX 1P31A 4IZOA 5CP8A 3BE5A 4PQFA 4YTEA 5C7YA 1PP4A 3B6EA 4POAA 1EK2A 3KR0A 3B9PA 4KQMA 1G2QA 1Q19A 1PFWA 3WLFA 4WUVA 1GKKA 4MVJE 1BMFA 4ZVKA 4DMKA 3BGVA 4KLZA 5FBKA 2B98A 3GFSA 3TXYA 3UWOA 4AN4A 4KRFA 1JHMA 1T2AA 4FDUA 5MDHA 2VDUE 1R4NA 1ZC4A 1XQXA 3UPTA 3RJMA 2P6OA 1JXQA 1K9VF 3OFND 1CUYA 1EMDA 1P1JA 4HAUA 1FDSA 1GUAA 2F8SA 5IF9A 4RSHA 3X1DA 4A92A 4MUMA 4YPVA 4URFA 3PJGA 5A2GA 5JS1A 3ETGA 4R8VA 1D1TA 4BPRA 1SC1A 3ONDA 1LLDA 1V96A 3QU4A 3R4VA 1H3NA 4OEHA 1KYIA 4Z0HO 3ZH2A 3NDRA 3V42A 4RZUA 4IV0A 2IWHA 3WLHA 3FDZB 2W2OA 5K3BA 2GF2A 2QRVA 1E7SA 3TTTA 3OA0A 2X77A 1E2EA 3BYZA 5AI0A 1Y3FE 4L76A 1JJBA 1JYFA 2IOYA 1AC5A 3DE1X 1QORA 5CLLA 3D8BA 2GJ9A 3DTVB 3L0PA 5C53B 2ZPAA 4DWJA 4QLAA 1ZNZA 4BRUA 2V0GA 2XMDA 1Z2EA 1JDJA 3OZVA 1T9GS 4WWHA 1A04A 2H1VA 4NJOA 1D8AA 4OQQA 5TF4A 3ZU2A 4EGQA 4UTPA 2XAAA 1UZLA 2EERA 2HUNA 3RR2A 1Q84A 1BHQ1 1AN0A 1QX4A 4KWEA 1POXA 5K45A 2Q8PA 1N9GB 3ICQB 3QTTA 2AYZA 2ZKLA 2BFDA 2XMGA 1HUQA 4S3MA 5DXAA 4I36A 2QTWB 2NXCA 2P4EA 5I9LA 1U5BB 1IK4A 1NVTA 1UK9A 3G5TA 3H6HA 5AKXA 3RYCA 1R12A 2QMQA 1ZJZA 4MQLA 3T9DA 2HNKA 4ND3A 2PWZA 3WDKA 4RHEA 3TIIA 4EG1A 3VSCA 1YJCA 3DXFA 3CRW1 3O4HA 1ZBDA 4NF2A 1JXAA 4CMEC 4KFCA 4ZT2A 4MEBA 4ND6A 1KI8A 5J4KA 5JIBA 3KQPA 3PRJA 2EZTA 1PWZA 2F43A 3F9CA 5EMHA 2NUAB 2Q5OA 1FSSA 2G5GX 3RWMB 1Q0UA 3A1CA 4XD2A 1DBPA 1XGKA 3FGZA 3BMCB 3SXPA 5HKAA 3TMAA 5JQGA 1E2MA 1JQBA 4ZO9A 3A9VA 1SK9A 2C2WA 4H15A 1TZJA 4N4AA 4QXMA 4C5AA 3WVNA 1Q21A 4H0NA 5TMDA 3EVTA 3KQNA 1YZYA 1USGA 3H1AA 1KO4A 3L1UA 4NEQA 3SICE 2X86A 3ZKAA 2BEWB 4G67A 3TZLA 4JB0A 4ENRA 1MQSA 4LWQA 3H1FA 4G41A 4MI9A 5BNWA 1SXJC 3A36A 4EJSB 2YVQA 4K0RA 5JJLA 3S5UA 1J20A 5EMMA 4MMXB 4Z8XA 5JI2E 5DI3B 5F12A 4MH0R 1V1RB 2VTEA 1QR2A 1MIHA 4X6LA 3VHLB 2A67A 4DILA 2GCOB 1SJ9A 3L4SO 3IDFA 4DQ0A 4BKOA 1OY1A 5FLYA 1C7IA 1KYYA 3VMFA 4MDHA 3EIWA 4F2WA 4LXXA 1WUHS 4R2KA 4A0QA 4ZEWA 4B6JA 4ZDWA 4D74A 5F9HA 1ESCA 1QK5A 1QP8A 2VVTA 3FKQA 4RTSA 1S3FA 1AHHA 1TRHA 1OXTA 2XEXA 2J7KA 3LZCA 3LCVB 4ZQBA 1E2NA 1ISGA 1SXJD 5KYUA 4S05A 1J1IA 3V8VA 3MMXA 2FXVA 1O94A 3NAGA 5FJJA 5LXTB 3OX3A 2DE0X 3TCKA 1KQOA 5AI8A 1NVVQ 2G0NA 4J8PA 3NBFA 2Q28A 3ND5A 3NPMA 4G0MA 1QIDA 4HUQB 3F7TA 4V1CI 5FV4A 2LV8A 1NXPA 1NLUA 1KO7A 3ZWYA 5BV0A 4KQJA 2D5BA 1R88A 5IZCA 1YTUA 4AS2A 2N1BA 5HKLA 4IVRA 5KTSA 5DM70 2ZETA 1B7GO 3SN6A 4AO7A 3FOAA 2XB6A 1OVGA 1PE0A 3EIQA 3LT1A 3UXMA 2AZ4A 2JA2A 2ZW9A 3I5XA 3O82A 2A4KA 3H2HA 3T7AA 1WBBA 3BC1A 4K2AA 3FW1A 2QRNA 1HDZA 4EHJA 4KO3S 3CEPB 3RYTC 5M34A 3KLOA 3ZZTA 3ZU3A 5JDIC 1AK1A 1U0TA 2WHXA 3FRIA 1FLAA 4DMHA 2HHAA 5KYKA 3IT1A 1WB9A 1E92A 4WBNF 3HB4X 5F33A 1EJBA 2AYXA 2ZRDA 5HJ2A 1U90A 1MV5A 3COSA 2X0JA 4EGJA 4D4JA 1KHTA 2J31A 1B93A 1QBGA 2RHRA 3S1AB 3LC0A 2ZSBA 1NXVA 3E9MA 3JQBC 3V80A 2IEIA 1D2GA 4HWPA 1Z3IX 1L5OA 4Q1VA 4JY7A 4Z0TA 2BN4A 2CXNA 3RLFA 3N8DA 4MKXA 4U9IS 3IVCA 1EDDA 5C7IO 2B3DA 4K9NA 2GD0A 4XIGS 1DXOA 3WYBA 2W2TA 2WF7A 5DT2A 2VHEA 5J2TF 1RXWA 1SU7A 2Q1UA 1IU9A 2JLRA 3P27A 1XU7A 1E5TA 4JJ7A 3IQWA 2YS7A 2C77A 4HDKB 1ZH2A 3HDTA 1E98A 4J49A 5HE8A 1PUJA 2IV7A 4KAXA 4JROA 1TJPB 3HB0A 1XDSA 1VPEA 1O89A 3MCVA 3TW0A 2V5VA 3NHWA 4YDSA 5LBIA 5BSRA 4IJWA 4EMTA 4E07A 5IJ0A 3ZU5A 1Z17A 3HFRA 3QU7A 1CLUA 2DR2A 1BN6A 4PONA 1AGNA 1AO0A 1ENZA 2X2EA 2UZIR 1XZLA 1KC1A 4KQCA 2DMRA 4RNCA 1EK5A 2BGLA 4X8OA 5CNKA 3TN7A 1WUKS 1D5WA 4EDHA 3GJXC 1S6YA 3FN4A 3G1WA 1EA7A 1RC0A 3NHFA 5HTKA 3H1TA 3IEKA 2WZDA 1F8FA 5AXDA 4CV3A 4EKNB 3W06A 2C4NA 2G9UA 1YOVA 4L8FA 5C8YF 5ITZB 4Z4GA 3E22A 3QMMA 1RYMA 1R2QA 3WGLA 1XMQB 3Q88A 3ZIDA 1RLMA 1Z39A 3FYUC 4MVCA 1BRTA 3IUNA 4X9XA 3D2AA 1ZP6A 2RGGA 3USCS 4H3SA 1CJKC 4GLBA 1PZMA 2IL1A 1ZONA 2ZATA 3L7JA 2FA9A 3FNBA 3HJBA 3R2JA 1L5GB 2WUEA 2HY7A 2ZQ5A 3CUTA 4I5DA 4RJJA 3OIWA 4FR0A 1EVQA 3FJYA 2I6XA 3ESAA 1VSVA 4UJ5A 4IQ4A 1DCKA 1EBBA 2H1LA 1NI3A 3FFBA 3L02A 3L46A 3I8XA 3QY0A 3RTGA 1UM9B 3ZHXA 2IYWA 1EVKA 2O0LA 3O4JA 2XNKA 5AUQA 1A2QA 3PFBA 9LDBA 1DCFA 1JR2A 3U37A 3IQDB 2GAJA 3FETA 3DKPA 5A71A 3ENQA 4WBNB 2IC5A 5KOJB 1W93A 3A6JA 4HUJA 4INOA 1P44A 3A58B 5KYYA 4EK9A 4Z8YA 3PX7A 3ZHTA 2AWNA 5A3QA 4WL0A 3ESBA 5JE8A 1C9MA 2RK3A 1EZ4A 2G7MC 2PZFA 2VHCA 3U3RA 4Q4CA 5HKKD 4K26A 1MPTA 1IEXA 4RMNA 2JJQA 1PVVA 4GL4A 4F91B 1WPQA 5HFNA 1VE6A 3CNBA 4JJIA 3D4OA 2EDAA 3FCAA 1KFEB 3CN9A 4UKDA 1OPRA 1MR3F 1E5XA 3JQ7B 2CNWD 4YJGB 3UXHA 1RXSA 2EZ9A 4DV7B 2JH8A 1NQWA 2XA9A 2EKPA 4RQUA 3RRJA 4WFJA 4H2DA 3NUQA 3E84A 3DB2A 5J4VA 3A70A 1JHZA 3STTA 3PGVA 4URVR 1DKMA 1NMXA 2YNMC 3A0UA 2OXCA 1COWD 2AA3A 2BEJA 1K86A 2AQKA 3DO8A 2WT4A 3L05A 1IFXA 4P5DA 3PEEA 4MRSA 2VSXA 4L74A 3WLIA 4JI4B 2ZWMA 5F76A 4PG4A 4GOOD 3RK4A 3GAAA 5BSHA 3K1ZA 1IXYA 5H0IA 1U81A 4GBGA 1SBCA 5CTAA 4QOHA 1CK4A 5C31A 4N0EA 5TQVA 3EDCA 1XI2A 5FWAA 3T7RA 5D5QA 2XKKA 4J0GA 4G63A 5IKOA 5DWQA 1EJ6A 1BVYF 1WABA 1K7EB 1Z6TA 4G5QA 1UXOA 4BCCA 3CT4A 3P5SA 5ARDA 5AKLA 1EXMA 4UUMA 4ZCSA 1UDWA 2OECA 1GILA 3RHSA 3FCCA 4CM1A 3ZDBA 1UBMS 3ICOA 3C6ZA 4P3YA 3H5AA 2A86A 4OHFA 2I6TA 4I4NA 3UF0A 4LW8A 2AC7A 4N9QA 3S27A 1T5DX 1VMEA 3BJIC 3ZI0A 5BMVF 4OB7A 3M5CA 3SSMA 4B45A 1N7GA 1RYNA 1U8CB 3S44A 3LX6A 4R1LA 1M6VB 1WXGA 2XNHA 4NCKA 2B9EA 1B0AA 5AI4A 1JR3D 3AW8A 3KUXA 2AT1A 4MW2A 1CT9A 2O6LA 1W85A 4FNGA 4F4HA 3HXOA 2HR1A 3I73A 4RY8A 3B38A 1SM4A 3NT5A 2X4LA 4UDNA 4EHBA 4GWKA 2BELA 1U9JA 2YJTD 3QQPA 5DCYA 2BFBB 3E7DA 4FTWA 4B71A 5BSFA 3CX6A 5HZGA 2CVFA 4YP7A 5MN5A 2DM6A 1ULTA 2Z4SA 2QM7A 5KOHA 3R5JA 3D8NA 4QEZA 3EXIB 4JGBA 2WT8A 3NP7A 1MO6A 2P8JA 4GXTA 3IUBA 1E4VA 5DYGA 3ZCUA 1AQLA 4D81A 2EJWA 4F8YA 3OMLA 4B8ZA 2M1XA 3NORA 2Z1MA 4A2PA 4NOMA 1P0FA 2R6FA 4KXYA 4NXNB 4PE5B 2JJYA 4PPNA 3L0DA 2GFHA 1E1NA 3DVQX 4RTQA 1RM4A 4F9TA 3WBBA 5B7GA 1GAQA 2IPXA 2IXEA 3FXAA 4CU5A 1TLTA 2Y0EA 1N6OA 1AUQA 1MFZA 3B1YA 3IC5A 3BXFA 3OFNA 2NU6A 1NULA 3GVHA 1UPAA 2O0JA 3AJ9A 1QZ3A 4LTDA 4NL4H 3LJKA 3SEQA 2ZM5A 4C1BA 3HV0A 10MHA 1E3JA 4RGQA 3N74A 1Z7EA 2VT3A 2B5VA 3CT6A 1EA5A 3QEKA 1TNDA 3BS4A 4PG5A 4QARA 1VJDA 2W6OA 5IM5A 4Q3EA 5KSOA 4JXZA 3TOVA 1RE0A 3N2GA 1Z0UA 3OJFA 4N3NA 5KDLA 2O23A 5KHAA 1O5OA 3O7MA 4JI7B 4FVTA 3RI3A 3D4IA 5EZYF 4RFSB 3RBAA 4Z9YA 4CIXA 4O0LA 3U0BA 3JD0A 2BI8A 3DOJA 3ZHVA 3FPEA 4II2A 1TMGE 4BUJA 4XWYA 2J4DA 4QYSA 2F1RA 2O07A 2QN8A 2ZZKA 1E3DA 1L5FA 2A7QA 2L19A 2LCIA 3SHQA 4Y2TA 1AMUA 3T3OA 1TD9A 2R7NA 1M66A 3FLAA 2J3HA 4P2BA 5BV2P 3OWXA 5CNMA 2C2OA 4UHEA 3JWGA 2VQFB 1ORTA 3LSYA 4D9FA 4JQCA 3MJFA 3G7NA 4QUAA 2XB8A 4J90A 1VTKA 1NBIA 2EBUA 1VE3A 1KSFX 2G71A 2QTBA 3FZNA 3H2BA 3UOAB 4AXBA 4TKVA 3QITA 2VHYA 3VZPA 3UM9A 1JU3A 5HNKA 4V2UA 4FYIA 3I01M 1PQUA 4JOCA 2XUZA 1H2BA 4QBTA 1HKHA 2JGAA 4Q1EA 1BW9A 3AM4A 4DF3A 1GZDA 1Q20A 4ZVVA 4DCNA 4DA4A 1MW9X 3O21A 5ED0A 4EG0A 4PANA 5B5SA 3UOWA 3LW7A 1XXHA 1T5BA 1ZRMA 1XX6A 5EWLA 1FYEA 1RAGA 1W5EA 3W8NA 4B79A 4AYTA 1DDIA 2UUOA 3LHDA 5C18A 4S1TA 4Y1EA 4L78A 2GCIA 1EVLA 2HJWA 4ZTZB 2O14A 2PWPA 3GDGA 3KQKA 4URXR 2ETVA 3LKDA 4M60A 3TPZA 4RD4A 1TVCA 1KK3A 2FFBA 5CCDA 3NCHA 3V6LA 3STVA 4F6RB 1BOFA 1MTZA 1QH1B 2WWIA 1SKMA 1C1YA 4FW9A 3MOIA 3WGIA 2A1UA 2BHTA 4FOPA 4ZEXA 4RHXA 2O8BA 2CLMB 1LBIA 1FK8A 4DDUA 5EIOA 1HT0A 4HNGA 4NHOA 2WE7A 1ZNYA 4LN1A 5K0EA 1AKQA 2GPAA 4LKOA 2Z2JA 4DR4B 3E6AA 1JIXA 1YS9A 2G67A 1TU3A 1PYOA 3EUFA 4GE0A 4K6GA 4PLPA 2IUUA 4DSZA 1FUEA 3K70B 4PRZA 2WQ6A 3RG8A 1T6YA 1KRHA 5FIUA 3B89A 3QF4A 1I1QB 1ZM3A 1FFXB 2DP4E 3GOQA 4IDBA 4B35A 1CB0A 1JIKA 3M1IA 2A1IA 1KJJA 2BKEA 3R75A 4EY8A 1PT8A 1ZWLA 2XLBA 4P0QB 2PGNA 3TDKA 1TZ2A 3BXXA 2G80A 3EC1A 1DKQA 2F90A 1U9IC 2HYDA 1UMCA 3FHOA 4R8LA 3RYHB 4JGGA 4OQEA 2ZR0A 1HOXA 3O8QB 3UT6A 3CVXA 4OLAA 3JU3A 2Q46A 2WJAA 1ZHHA 2IPOA 5DGIA 1L7NA 3ED5A 4MW1A 4G81A 1IOWA 2C4MA 3MYRA 4EBFA 1QBKC 4EW1A 3ENVA 3I83A 5BYKA 1YI0A 3SQDA 2BW0A 5ICSA 2A9RA 2FN3A 2GH1A 2ZIFA 5AHOA 2WM2A 4F3RA 1QFXA 1Q0SA 1VHQA 3LUHA 4WDRA 5FFMA 2BM1A 5T67A 3ROXA 3SQWA 5A0VA 5DLDA 3PFWO 2WLSA 3UAXA 3UMMA 3EIFA 2OV6A 4LC0A 2IWRA 1F2DA 3OIDA 4HH1A 2OCDA 3DZDA 1ZH6A 4IJVA 2ZXUA 3MILA 1SCQA 2GEFA 2ZYVX 3BIXA 2ZUFA 2V6IA 4JCCA 3R5KA 4CEIA 2GTHA 4FGLA 4AK9A 1E3LA 2ZRKA 2Y6UA 1DWOA 2Q1SA 2BC9A 5HM6A 1RQPA 3FPFA 1BWPA 3CMCO 1PO7A 2NV2B 3H5LA 2WVHA 3L77A 2GA8A 2IYEA 2YINC 4FMPA 5HRAA 4OFWA 3ZX5A 3DDSA 1M3SA 3MUEA 4IHJF 4NOJA 1HA3A 3IA2A 3CF2A 2ODNA 1W25A 2PXHA 4MJXA 1EFRA 2ONCA 1UWCA 1AKYA 3QPWA 1OGIA 2C92A 5C80A 4ZO4A 3DXXA 2QGZA 4TV8A 4CV0A 2AOTA 3H6KA 3QU2A 2PFKA 4JL6A 1P9WA 1A97A 1CRQA 2GERA 3EDRA 3BGDA 3L1JA 3LT0A 4PPQA 5HJEA 4LYDA 4ZO8A 1WU7A 1Z5OA 3R3WA 5TVKA 3DDUA 1UPCA 3FYDA 4I4TA 4D9CA 1NBEA 1SA0A 2GD1O 4V0OA 3K0FA 5CDHA 3DLHA 1CQIA 3K53A 4BNIA 5JDIA 1OT5A 3KDPA 5AKIA 4DBLC 1VKRA 2R8ZA 4IO0A 1CDOA 1WSDA 3EGDA 2R8OA 3HO8A 4M83A 4AUKA 3D02A 5JCZA 4ZI3A 3LVRE 1XQ9A 2ZSHA 4E5DA 1Z68A 2ZRBA 4V1CA 4DXAA 3JQBA 1N2CE 4JZYA 3BVPA 3DWGA 3BWEA 2IBTA 3B5IA 4IO1A 3AUTA 3E5NA 1BKDR 1LW6E 3CLRC 3VTAA 1C3OB 1AKNA 3R5HA 4OL9A 1ORWA 1P7WA 1RAIA 4RY0A 1TGVA 1M2EA 3N53A 4KXXA 2AMLA 1GPYA 4BB9A 3CG4A 4GUDA 4DGSA 1K7FB 1LVUA 2JHCA 2N3ZA 3OTQA 1PG0A 4GPAA 4XM2A 1NBAA 1IUKA 1XU9A 4CKWB 2DUUA 3DPIA 1TM1E 1USKA 1MKYA 1R6VA 2IP4A 3NOQA 1A4UA 3H75A 2WAAA 5AYVA 2WV7A 3WKCA 4B5KA 5JO0A 4Z2YA 5JS2A 5LKAA 3EB9A 1FXUA 2WW8A 5L3RA 4LE2A 6ADHA 2C3PA 1KZ1A 2PX6A 4EUSA 2GN0A 3V4OA 1VDZA 1Y9DA 4Y8VA 2P41A 3CLRD 3EAFA 1J2EA 4H6WA 1YRHA 5B1IA 1DQNA 1M7BA 1V8OA 1ZI8A 3OZCA 3I5MA 3GEDA 2ONYA 4J4HA 1ZEMA 4MV3A 3X1JA 5JAIA 5KJFA 3ZV7A 1FSPA 1AZLA 1LU9A 1PF7E 3AUAA 1KERA 3PUIA 1EGMB 3QEOA 5AKEA 1BGWA 3GJYA 1L8XA 1R4NB 3NOVA 4GF5A 3UW1A 4DCTA 4CGYA 5B3LA 2BV3A 1WL8A 3C3CA 3PQFA 3HXKA 3LUBA 3EOAI 4JGIA 5G41A 3GLIA 1FE8A 4BNLA 4HDQB 3MYYA 4JB8A 2K7FA 1GWNA 1JH9A 3H87A 3MAJA 4P81A 3L8YA 4R2WA 3GG2A 4NH4A 5SZKB 2V9ZA 3U4QA 1A98A 4JEMA 4MQ6A 5AH0A 4PSDA 1K8XB 3FYUA 1E8DA 2PA0A 5KNLA 1XRQA 3MCWA 1T6ZA 2V7BA 3W3AA 5K6AA 1P3JA 1OWPA 3G6KA 2I5PO 2QRVB 3BPSA 3FLBA 4U0KA 1XEAA 2BMAA 3F6RA 3HH8A 4ZYTA 2C2YA 4UTZA 3EVEA 4QPNA 4I1PA 4DJFC 2MYNA 4HQOA 1FZQA 3E3OA 1ZJ4A 3QWFA 4RSGA 3Q2OA 3FTPA 4PFKA 3QX7A 4CCAA 2REBA 4GNKA 1H0HA 4YP6A 2HSEA 2ZJ6A 4OHPA 4IINA 4D4LA 3AX6A 3NYIA 4NBUA 4NG4A 4J1TA 1SG6A 1PYGA 3H9UA 2FX3A 1CEQA 4LJ4A 4TMWA 1S0UA 3NAZA 3WJ2A 1COWA 3DNFA 5AJUA 4W1PA 1VE1A 3V48A 5JDCA 2GVDC 5IJZA 4WCVA 4PHHA 3GLFE 1H0SA 4QX6A 1QYDA 1EFLA 2WOOA 4OYLA 4C6SA 2O8DA 2CW5A 2D2VA 3UIEA 5KSZA 3VH1A 3RYCB 1C4XA 3T0IA 2VA8A 4II3A 4B85A 3DJFA 4P86A 3RUFA 2C2KA 4DDVA 1ZVVA 1LTHR 1WG8A 5JNWA 3TTYA 1I0IA 2RGDA 4LY6A 4URZR 4G85A 5F52A 1VXOA 5A03A 2PJUA 3ESYA 5KJ1A 2TECE 3HACA 1BQ4A 2V65A 3SDBA 1QHHA 2DWCA 2C5BA 4Y2PA 1OLSA 1QPGA 2CE7A 2YNMA 4NMLA 4XJSA 4ZREA 5C4GB 3KOMA 2WHPA 3BF8A 2F43B 4QATA 5DI9A 4NCNA 1ZG3A 2VATA 1UCFA 3W79A 1ZGJA 5BUCA 4DCPA 5CH8A 1UKYA 3G9UA 3K92A 5JQGB 1HLDA 2CT8A 1ZUD1 4G0VA 3SQNA 4US0R 2QB5A 3LBIA 3MD0A 4MS4B 4LSGA 1E1CA 3IIEA 4A1FA 4EF5A 1BVUA 1WXIA 1JR3A 2XDYA 2A8YA 5HF6A 3KQHA 2YVKA 1IN4A 2FU5C 1P61B 2J08A 1CP2A 2P4UA 3QUBA 1KMIY 4ARBA 2JFPA 4C01A 2I91A 5E6RB 4IH4A 1RQ7A 1NUUA 2DHEA 1NDHA 3WL3A 2VBGA 2Y76A 2BGIA 4KQEA 2RGWA 1WNTA 1SCDA 1AXGA 3NTVA 5GADl 2BGGA 3U3JA 4PG6A 3E1SA 2ZE5A 1CUIA 2RARA 1WHSA 3BZWA 3HABA 3CINA 4DW8A 1AV6A 4F4FA 4EYQA 2O7QA 1KXJA 1DFGA 2QAGA 4M38A 1J8YF 1RU3A 4CFYA 2VAMA 4BNNA 1LPPA 1MCZA 2H2GA 3A6DA 4JP1A 4DJ5X 2MR6A 4Z1MD 1E9VA 2JGMA 1JDBC 2HA5A 3K9WA 2O8CA 5LB4A 1AMOA 3SC6A 1E1QA 3OC6A 4BNHA 2V7PA 2ZRCA 4WXMA 1U3FA 4ZVQA 1I2BA 1YVPA 3IMGA 5H80A 2BE9A 1R50A 4CMHA 1K6EA 5IH7A 1B73A 2DPLA 3MAAC 4IEFB 1JZQA 5EP3A 5U4QA 2QAJA 4IBOA 1R8QA 2PU5A 2CCKA 2Q9BA 3NDJA 3KR9A 5DX8A 1I2DA 3H2ZA 2WB2A 1TXGA 3T95A 1NBMD 2H08A 1M6YA 4M98A 4Y2HA 2Z9DA 1ZIPA 2WINI 2JJ1D 2CCJA 3BMNA 5EWJA 3MCUA 4AZWA 2YWDA 5LZ9A 1P1RA 4J0JA 5FNVA 2GZDA 3G0DA 4JI5B 4BS9A 2P67A 4MWDA 3TKAA 3WGZA 4MKIA 2I55A 2P9JA 2FDRA 3PUXA 4J1QA 4KSYA 2DFLA 2RGEA 3S2FA 1W36C 2ISSD 5B6PA 5B36A 4RTRA 3O4RA 5L3QA 4D41A 2IGBA 4OHXA 4UPDA 4AX4A 1B4DA 3QPDA 2OLEA 4F3NA 3U3XA 2C29D 1KDYA 1KDTA 1G21A 2D1FA 4MUKA 1HV8A 5E1MA 1ZRNA 4GVLA 5AD1A 1JEYB 4ZDJA 3OZAA 5COQA 3X2FA 4FDLA 4EW6A 2E4XA 2YZGA 4GEGA 2V1XA 2Z2KA 1BX1A 3OLVA 5TE9A 4NECA 1CZKA 1RWOA 3H5OA 5CT5A 2I1QA 3F74A 3DZCA 3L1HA 5SV2A 5DNCA 1GAXA 5GONA 4GOLD 2AC4A 2X6QA 3C4QA 1W36D 3K0HA 4AKTA 1FXWF 4YRSA 1WXDA 3HUEA 4QXAA 4L27A 4B6EA 5ALZA 2JIZD 2XA1A 4YA6A 4UMEA 3MBIA 1LSSA 4KO2S 4P7FA 1CUSA 4NCJA 4ZQHA 2X0IA 5HF5A 4AXXA 3QOFA 1JYEA 2E4VA 3IBYA 1K0FA 3GA0A 1GA6A 3G85A 3SM3A 2VRCD 1V7CA 3PHCA 1M1YA 2QK4A 3HJFA 1S3IA 3CB4A 4G5YA 4DQLA 2R1VB 5DIZA 1RXEA 1PR9A 2TMDA 4NPCA 3H7AA 1R6AA 4DLZA 1YBMA 2UXDB 2GZSA 4I9GA 4QDJA 3VGPA 4RTJA 2HQOA 4BATA 5JNTA 3AFOA 1F4VA 1CX9B 3KALA 4B43A 2VDWA 5LL6P 1LK5A 2YJ4A 4QRHA 1U0NA 1PGNA 3T3NA 5EYPA 5KWSA 4BY9E 5DKFA 3ND7A 1OZHA 1FQJA 1I5EA 3BH0A 3DEYX 3UMSA 1XLWA 2I9PA 4KDEA 4I19A 4LFAB 1F9EA 5CK5A 3L4BC 1F0PA 3QLJA 5SZIA 2LBPA 1Y1TA 3LK6A 4JWTA 3TOZA 1SKYB 4WQMA 3HVKA 1FF9A 2NV0A 2VP9A 3VDMA 1VPWA 4G6ZA 4TQUS 3TJMA 1XJCA 3TCNA 1JTEA 1N4DA 2YVUA 2C97A 1GTJ1 4M0LA 3EFOA 1YNSA 4P93A 2JCSA 1YOVB 5IXJA 1JB1A 3NWOA 3E22B 1S4QA 1YVEI 3O75A 2WTXA 3DFFA 4KMMA 4LHZA 5DTIA 4ZZ0A 1MW8X 4X1IA 2Q9AA 1LPBB 1XHLA 2Y1DA 2ZK7A 3GC6A 3NC1C 3QA3E 4A8JA 4YV1A 2OKGA 3I0ZA 5ALPA 5BURA 4CKBB 3JAKA 5E8JA 4R81A 1BQ3A 1QMPA 5L8VA 4IXWA 2A5JA 1NDUA 4B3XA 4G4GA 3KJHA 4HMPA 1MV8A 3I37X 4XPIA 1BAPA 3HYCA 2YMLA 4W5HA 3AI3A 3BZUA 4YT4A 1UFRA 2PMBA 1XVUA 3D6TB 1E8MA 1BN7A 2LIVA 4IEEA 1RLIA 3WAGA 2OV4A 3H1PA 5JJ5A 3EGXA 3EXHB 1X7YA 4TQ9A 5J1SB 3QYAA 1RWKA 1SQFA 2FZVA 2AF3C 3OESA 3INGA 1FW6A 2IHYA 3L6UA 5IJAA 5JBIA 2DUJA 2PUTA 5TS2A 5A5FA 2LE0A 3AR8A 4IDCA 4JYPA 4BU0A 1LQUA 2H1SA 3EC2A 4KWCA 3JYQA 4C21A 1BSVA 3ER8A 2OUIA 4K03A 3WAKA 1E2BA 2II6A 2O52A 2OUKA 3L0SA 4X20B 3P52A 3SYLA 4AY4A 4BGDA 4QJ5A 1T5OA 5P8WA 5CPFA 5C4IA 1DJOA 4YHHB 2OD7A 1ZH8A 3CKYA 4MYDA 5EZ5A 3OIFA 1DOAA 4CR7A 3HCAA 4RCVA 3V1MA 3HKBA 3EPKA 4YFYA 2EF1A 2IDKA 2XWSA 6ABPA 3RIXA 3UHFA 3ES9A 4LV8B 4K8RB 1F8YA 5DYIA 1CZUA 1W5AA 3CV3A 5GY7A 4CTKA 4W5NA 5JALA 1P72A 1VLJA 2FWBA 5EJ5A 4D8YA 1BWRA 3EUAA 1PTJC 1P9LA 2Q6LA 2J3KA 3UVEA 5FX2A 3X1ZA 1HDCA 1QKIA 2GD2A 3GIDA 3HB9A 1GUFA 1Y3DE 1OSNA 4HNAB 3RUIA 1L1QA 1RJ9B 2YJ6A 2QIPA 2I7VA 2P4HX 2WZQA 2X9NA 4PYMA 1XALA 5THQA 3K5PA 3ANLA 3NJRA 2CLIB 3RVBA 4I50F 4H31A 3RVQA 3TNLA 1QIJA 2G82A 2WHQA 5EIFA 1T4DA 3L49A 4YT8A 1ABFA 2J9XB 1K9SA 4RA9B 721PA 1D07A 2GLUA 1QWSA 2WTMA 3KO8A 3N2KB 4MGZR 3BAZA 3AIKA 3GD5A 1D2AA 1V37A 1MNAA 4OI1A 4NULA 1KE1A 4YP1A 2WTEA 5BYJA 5LMZA 1QVZA 3I9LA 2BLNA 4HATA 1TQ2A 3JQAB 3SNKA 2XITA 2W5UA 2I2FA 1O96B 3ILVA 1RXUA 3H1GA 3IE2A 4IRMA 3KOWA 3PRYA 5K2MA 4KXQA 3WLJA 1Y6GA 3HVIA 4L6AA 3ZXIA 1W85B 1BKYA 4JXKA 1L7AA 2VWGA 4RY9A 1TI7A 4JJ8A 4Q39A 5AK0A 4TUYA 5CAEA 1YJ5A 1IHUA 1RAEA 2C54A 2JFXA 2ZTMA 3H2IA 2P3LA 3KYDB 1R15A 3QPVA 4O2BA 4BAGA 4I6EA 4PEVA 2GN6A 3KK0A 3D54D 2WIJA 2X4GA 3LYAA 3OFJA 4M7PA 3OQOA 4M9RA 1EXDA 1LS6A 4Q4JA 5AHKA 1JRLA 1L4HA 2D4HA 3WIBA 1VYTA 1V8PA 3JD3A 3TM4A 2JLXA 4YALA 2H4FA 5KC9A 3L0IB 2CMKA 2HL6A 3KXPA 3ED1A 1DPGA 3DAYA 3BG5A 3K16A 3K0CC 4ZXPA 1Y1LA 2CXOA 3TIGA 2WD7A 3OIGA 5LZ2A 1QGED 4G23A 4RHCA 3J81k 2QZSA 2OHGA 3CLVA 3O8OA 4GPTA 2WSLA 5F1YA 1TYAE 4O6VA 4REQA 1WVIA 2JANA 5FD8A 5B1YA 2NU6B 2PM8A 1PVOA 4YROA 5PNTA 1D7OA 2VJNA 3FSEA 3MFYA 4MUEA 1EB9A 4GL2A 2GRUA 4CM6A 2Z0MA 4X65B 3URKA 2PD3A 2CXRA 4LFCB 3ZKWB 1J5EB 2J0EA 3DE5X 4PBRA 2PX8A 4OJMX 1TEHA 4PQEA 3T61A 3W4JA 1I4DD 4I5GA 1FBNA 1Z38A 4LXQA 4MKZA 1D3AA 3HL4A 4RH1A 1GR0A 5ILGA 4ECEA 3E9DA 4RCZA 4QWMA 2X1VA 3V4FA 2DBRA 4BVBA 5BSWA 1XAGA 1U2DC 4LZPA 1KPIA 3VHQA 5B7PA 3LQKA 1QO9A 2GJ8A 5IT9A 2Q0QA 5CA0F 2FZKA 3GA5A 3HJHA 5EIEA 2V7XA 2CNOA 3H0EA 2H0RA 3TGPA 2AN9A 5JY6A 5HILA 3KU4A 1UPTA 1VJ5A 2R1UA 1GRNA 1Q5PA 3FVVA 4IDDA 5BWBA 4ON9A 4V3CA 4B3DA 3D4PA 3SYKA 1JQAA 5E2BA 3ZGNA 5KTNA 1JLLA 2PCJA 1TUBA 1NJ6A 4F3KA 3CRRA 5BSEA 4YVFA 1ZQ9A 3F4KA 4OHKA 3OIUA 4NPHA 2OM6A 4IY1A 5E4TA 1N2OA 3K9HA 5E9WA 3LDHA 3CLHA 5JR3A 3THYB 3OTOB 5KTRA 4JELA 1AN9A 1PFGA 3ZLJA 2GZMA 2QR5A 2Z8YM 1QTNA 4KIJA 5E4YA 1ISFA 3JD4A 4AP9A 4TKVB 2ZRJA 2AD5A 4I55A 4LYYA 1RPTA 1DIGA 2QRPA 1ZMRA 1J5PA 1PJ8A 2D6FA 4EPXA 3Q8WA 3AZOA 3IQXA 1HFKA 3QBDA 1C14A 4GS5A 3KV1A 4AICA 1K7CA 1IUPA 3M2PA 4N3CA 5KTPA 3VH2A 2JJ2D 5EWLB 4X1KA 1UDRA 3LC7O 4TMFA 1VIDA 4QFBA 4MO2A 4B0OA 3DJYA 4LYJA 3UQZA 1LUAA 4UCFA 1EHCA 4FFOA 3GJTA 1KYXA 2XUAA 5ADHA 3IPAA 2C7OA 4MW6A 1PNQA 1VHWA 1YQ9A 2QM8A 3DE3X 3QUQA 5CLIA 3SHFA 5H1YA 3E3NA 3L9XA 5LP6C 1EXNA 5BN4A 2P27A 3LXRA 4ZJUA 1EVIA 1YE3A 4YFVA 2A1UB 1IZ8A 3EZXA 1OGJA 3HJNA 3AJAA 1P8JA 3ETHA 4P54A 4PVDA 5AM4A 1RS0A 3T7EA 2RK4A 4NC9A 2ORYA 4WADA 3V1YA 2WFZA 4BMYA 3F6PA 5A4KA 3CG0A 3GEIA 5ITSA 3LZ6A 1E9CA 2ZUEA 4D9NA 2EX0A 2OBLA 1A5ZA 3DV0B 3SHOA 2A0KA 3CYFA 1W34A 2X0NA 3BBPA 3PUHA 4U8GA 2BT4A 4X90A 5D2CA 2DRIA 1MFPA 2O8NA 3NC0C 3QF4B 1WZNA 4H3VA 3U4AA 4AURA 4ARCA 2XZDA 5BWMA 1Z0JA 3B48A 3KQWA 2XWPA 4NSNA 1NRXA 3CSDA 2BF4A 1XK7A 1D1PA 4UM9D 5CB4F 2FWMX 3PNVA 1K88A 2GPYA 3FMVA 1E32A 1E99A 4EFKA 4LDRA 4KITB 1Q0QA 3L4EA 1OILA 3E4CA 3KNZA 1UMCB 1GGHA 4UAUA 5IBQA 1D8TA 3AFMA 3MJSA 5E95A 3OP1A 2R0QC 4ZCRA 1YWGO 4LJLA 3F5MA 3NBQA 4UXHA 2CLCX 5LQJA 3NHUA 1XDZA 5IK2A 3C3KA 4MROA 5IRCD 3PWZA 4OHYA 4I0WB 2AZDA 1M1UA 2PKXA 3C3JA 1Z83A 1PWXA 1YVRA 4EFNA 4N82A 3ZE9A 3PL1A 1PWEA 5AVTA 1YRLA 5AVRA 2O5CA 1AKVA 2VNIA 2W0SA 2A5GA 2GWRA 1KKLA 3BEOA 3OY2A 1CR6A 4YRPA 3K8OE 2IRWA 1FDIA 1P4JA 4KE6A 1RMYA 1JKJA 1G5HA 5I4IA 1NXTA 2DLNA 1KF0A 4A6XA 4J0EA 4F5WA 1WOYA 2G9QA 2JVKA 3Q11A 3ZD7A 1Q3TA 4GMKA 4CEIB 2HBZA 3DV9A 3UJCA 2IW1A 4JUFA 3ZCTA 4BFSA 1EM6A 4O2AA 2V8BA 4FSDA 1C1DA 1V16B 2ZSJA 4OCZA 2OWEA 2I4OA 2EVWX 2G17A 1L7OA 3LPAA 5T41A 3SE7A 1YS4A 3K9GA 4ZI7A 4MWSA 3VR5H 1W7AA 1DKOA 2EJVA 1CBUA 3TQRA 2QQFA 2Z1DA 3N7TA 4M2LA 1WZEA 1RPZA 5TJ9A 2Q5QA 4L4RA 5CJPA 3H18A 3Q9LA 3UEOA 4HRXA 4WK4B 2C8KA 3IBSA 1D0IA 4D4KA 5EESA 1DC8A 1X2BA 2AOTB 2GB4A 2H8KA 1OIVA 2VNAA 2VJKA 3X1XA 1N1GA 3LTNC 1II0A 4AJHA 3IAS6 2FQXA 3PA6A 2O57A 1GZUA 4IF4A 1ST2A 4I4TB 1SA0B 2R48A 5CCXA 3LLVA 3WSVA 2ZYDA 3P9QA 4YPFA 2P0AA 2D2EA 2YWRA 2UXCB 1UBFA 4EKDA 1F5NA 5FORA 2XMPA 3QMPA 2HPVA 1TQ4A 2VBCA 3QBVA 5TV2A 3R8CA 1VKJA 1ZCJA 2W00A 3MAGA 2J4CA 3ORRA 4G1CA 4JMLA 5JSZA 2IUFA 5F3DA 3ZHQA 2G3YA 2RIPA 1CG6A 2IT1A 3FNFA 4HADA 4B31A 4FLEA 3K0BA 4CF3A 2ZDHA 3L0BA 4GOXA 5C7LO 1DJNA 4V1CB 4B4UA 3KKMA 4DCSA 2B9VA 4BO4A 2FLKA 5JJBA 3KXDA 3VC1A 3OD1A 3GMTA 1L4FA 1PNRA 1POWA 3NM6B 4TSRA 2YMQA 2XKAA 2RI1A 1E4OA 5KWIA 2QTVA 1Q74A 1DG3A 1OAKA 1VMAA 2I3BA 3X1WA 1QYWA 5KQPA 1FYXA 1OH5A 4XM0A 1QAMA 1MX9A 3RT1A 5JOQA 4CKXA 3ESRA 1YJBA 3HCFA 3C7CB 5IKXA 2JCBA 3MGBA 4C3VA 2ZCUA 4D9MA 1E77A 1UC4B 2CL6X 1RRPA 3N75A 5D3KA 5HZKA 1BEEA 3M6UA 4U7DA 3KZCA 3OFKA 5K8LA 3U2QA 3SZOA 1CTQA 3T7DA 1MB2A 1X7ZB 2NT4A 4MI1A 4Y1GA 3V8MA 3AT1A 1QXSA 4OGKA 3UENA 3DQZA 3U4CA 2DH5A 1XCOA 3S8YA 3MT8A 1Z2PX 5CRIA 5B2ZA 4G37A 3D59A 2ZI9A 4HGZA 1YS6A 4YJ3A 4BQEA 2Y4OA 1KY2A 3TFWA 5JC8A 4BJ3A 2Z58A 4FMCF 4MOWA 3WX0A 1O95A 3EYAA 3JQ6A 2FW0A 3ROKA 3K9LA 4FDTA 1BHO1 2WWFA 2YIVX 4CMGA 1NAIA 4IXDA 3RJZA 4DXHA 2JW5A 3BD9A 1ZD2P 5EJIA 3SZLA 3KUUA 3ODGA 4OM7A 1HOTA 3HPRA 4NRDA 5FPSA 2BR4A 3SQMA 3TUJC 3R3HA 4JVSB 1RBMA 3W7AA 1BVHA 5AKZA 1EP1B 3ADDA 4GZMA 4U2DA 4D2IA 2I76A 4GP6A 4R1TA 4DQUA 4ASUD 1N75A 2GZAA 3R09A 4LOHA 1H6DA 3F97A 5D3ZA 3OOSA 1V8FA 2HH9A 1UOQA 3QMWA 5DNEA 5ALYA 4MINA 5J5AA 1D4OA 1PLLA 3GW8A 5DHQA 3HM9A 3ECSA 1W0KA 4F04A 3IIMA 1Y63A 1PJZA 4N39A 2O20A 2GPWA 4BEVA 2JIDA 2GN8A 3RVKA 4IXMA 3HDJA 4YDRA 1IRIA 5C5EA 3NAMA 5BUQA 3LYUA 3JQ8A 4ZRDA 3WA7A 1MRNA 2GN9A 1WV0A 4BRWA 4DPMA 3H04A 2PG3A 3UJBA 5B64A 3IVGA 5KKNB 2D59A 2HLHA 4AUEA 1C0IA 5C8ZA 1C41A 2E4ZA 2HHLA 3WWPA 1C0EA 2GCGA 2P35A 3PKJA 5GTDA 2O8DB 1B41A 1PQPA 4HVTA 1J0BA 1OASA 4PNPA 1KQ3A 3WFIA 5U9CA 4YGXB 3NRBA 4MUYA 2X22A 4ID3A 1VCOA 3H42B 4RIGA 2JKVA 1X94A 4BGVA 1KTIA 3HXTA 3R7WA 3T5AA 2XT6A 4ZCTA 1DCMA 1QHHB 3QXSA 1YAJA 4OBXA 1HH4A 3SM9A 1HRDA 4F2DA 1F20A 1OLSB 1NX9A 1V7ZA 4R2MA 2GQ0A 4RVGA 2GXUA 2J3DA 3QY9A 4HDCA 4N03A 5EE9A 4QM7A 2I8CA 1A77A 1SVUA 2P5UA 3ELWA 3M4ZA 5EA2A 2PWYA 5IP5A 1O6FA 1NY5A 2FLVA 1YUBA 4IDQA 4AFNA 3HO1A 2VJMA 1HT2E 3V4LA 2QV0A 1DXYA 1Y8CA 2O9JA 3ZD9A 1O97C 3IDOA 2JI4A 2IIPA 2VG8A 4Y18A 3TLXA 4JKOA 3EA5A 3R9XB 3SNHA 3HU3A 1QB7A 3GB9A 2EZ4A 2VPPA 3D8TA 4PLWA 3TB4A 2QMHA 2P11A 1Z0KA 3H9GA 1BQEA 4ZARA 5HMMA 4B7UA 5LDDC 2O2CA 3HGQA 2CLEB 2NSLA 4D3SA 4RZSA 5L4LA 3HBNA 4UVHA 3A1FA 5A1JA 5HGXA 1IBKB 3CVWA 4MW9A 1DP4A 2QAGB 3BRSA 1BEZA 1M0SA 1YB4A 3T1HB 5T4FA 1G8PA 1Z0ZA 2HRDA 2YN2A 2BTEA 1Z73A 3TRDA 3BIFA 1U8TA 1HZZC 2Y0PA 3RM3A 5KPDA 4M1KA 2JLCA 1O97D 2Z5GA 4GPD1 1K0UA 1TZKA 4L57A 2NU7A 1GEGA 3WKEA 2Y93A 2ZRNA 3JYPA 3C5CA 1XVIA 1RMQA 2DJ5A 3B3AA 2RHHA 3UKJA 4FN4A 1GZ3A 2V7TA 2E6UX 2QU7A 4R69A 4UCQA 5HIIA 2Q21A 4M8LA 4ZYWA 1GY8A 1RADA 4FP9A 3IT2A 2HD4A 3GY0A 4P53A 5A6SB 1P9NA 3X2SA 2NTEA 4B34A 2VF5X 3SJCA 1FY2A 1RE1A 2QLFA 4OV6B 2HA6A 4MO9A 3DEAA 2ZAYA 1K7XB 3PC3A 1ZHOA 3CUWA 5EWJB 1SKYE 3BMNB 4GE3A 2N42A 3AY0A 4H60A 1YZUA 3IRUA 1XTIA 1GDHA 1XZDA 3KVRA 5FNVB 2D1YA 4UVEA 4E13A 1AGXA 1JHVA 3AIMA 4F4CA 2QPOA 5T4HA 3SMQA 5IM4A 2JZCA 3SI7A 5T8KC 3DBVO 5HWSA 3ONEA 5L3QB 2A1TR 4RANA 1K98A 4YRTA 4CV1A 5EKSA 4ZIRA 5L4SA 3GAZA 3DAOA 1PZHA 3L5OA 3VAZA 1V5EA 2OD2A 1G21B 3M49A 4RFVA 5I9MA 1VXRA 1NQAO 3IBCA 3IH5A 3PKIA 1QK3A 1A9YA 1ZOLA 5AOAA 1R5BA 3MEQA 1VRCA 1ZMBA 2VK2A 5I3CA 1M6HA 1HNZB 4BAZA 1OI4A 1R9JA 4ZKDA 1CUFA 4XRRA 3PEFA 3UV6A 5J5CA 2WJJA 4MQ5A 5G1NA 1ZD5A 3GH3A 3VAAA 2FPXA 1D03A 5ALMA 5LPNA 2IYZA 1QH0A 4UHFA 3U56A 1T3GA 5J47A 2F1KA 1JKFA 3RGGA 3WHLA 3CEHA 2KHZA 2PU7A 4IDOA 2I67A 5CBPB 2CHGA 3HLTA 5TXGA 2EX1A 4AX8A 4IJKA 5DGXA 4DMFA 1RTKA 4NH0A 4Q4AA 4CT5A 1CQJB 4JLNA 2IYRA 3GBVA 4GQBA 2QQ0A 1M1YB 4KR2A 1C9KA 1FDWA 1V6SA 1VFNA 2PRSA 2YV2A 4JU9A 2IYVA 4GP9A 2EAUA 2VHZA 3T5PA 1Z13A 4RTNA 1XZMA 3M34A 3MGGA 1T35A 1LBSA 2WEKA 2X14A 3VRHA 4DDKA 3NMUF 1MJHA 3RFUA 3OE5A 4HH4A 4XI9A 2VDWB 1NHWA 4MW4A 2BGKA 4D02A 3LT5A 4PZCA 1E2UA 3DGFC 4K88A 3RODA 1RFGE 1AGYA 3PC7A 1JYSA 1R5NA 2JHAA 1RBQA 5DSZA 1UIRA 1S8AA 4QFDA 3QOXA 2VSYA 2NP7A 2ZI6A 2OEPA 1RM5A 2FR0A 1Q57A 2JZNA 3B1WA 5DB4A 3CM0A 3CUYA 2EL7A 2OQIA 3ZXXA 4BNGA 1JHOA 2CHUA 1EFHA 3HBMA 2C58A 3VPDA 2JCVA 1YCFA 2FE1A 2WJ6A 4EB6A 4PHGA 2FW6A 5HHTA 1P33A 2QRMA 4K9RA 3R7AA 2AXPA 4RXUA 1YKGA 3HJAA 3AFNA 1ZR2A 5D3QA 1XD2A 1YMVA 3TTXA 5A7HA 16PKA 1NKTA 2JIBA 5DGHA 3QV1A 4A8JB 4XCQA 3PDJA 5E9QA 3U9SA 1YRBA 3L0CA 3AIIA 4UUAA 4BNDA 4J7CA 4AW9A 2CHEA 2AG5A 1CVLA 4MV6A 5DXFA 4XPIB 1J0EA 5ALWA 1F38A 1SUIA 1Z8DA 2VNJA 3A6HA 4X1YA 4GRAA 1TKBA 2VOEA 1J22A 1Q1ZA 2FMFA 2ZIGA 1DE0A 1VSBA 2GFIA 3NB0A 4CMKA 4INZA 1PR2A 3EGXB 3ZWBA 1X7YB 1T5IA 2JK0A 4OXQA 1AX9A 4E5MA 3ZWMA 5BQXA 4K9PA 3SBXA 4K0KB 3WB0A 2QTTA 4LF4B 1NUPA 2RKOA 1SUWA 3LGXA 4N3BA 1AY0A 3C74A 1RQRA 4FHCA 2OCLA 1ND6A 1HQYE 2BSXA 4GI2A 3WGHA 1PK9A 4TSFA 1NBWB 3QE4A 1KSHA 4WOJA 1U80A 1M8PA 4EG4A 4KDFA 1X8LA 3R6LA 3RE1A 2GXAA 1BIFA 1QFZA 2QJRA 4JP3A 1W2GA 1YRQA 2Q62A 2QL7A 4J7AA 5GWXA 1KE2A 3UN1A 3GARA 1E1RD 3UK6A 3CX3A 3SMVA 4DAEA 3T5GA 2FSSA 3BA1A 1AGRA 2F1OA 3IILA 5KIAA 1E79A 3W2EA 1MG5A 4CTMA 2HZBA 2I87A 1OLUA 1SBIA 1XRLA 5I5EA 3D8HA 2CZGA 1G38A 4F93B 3RIEA 2IITA 1MD9A 1HYHA 1MB9A 1H05A 1VJGA 2B3TA 2RFLA 4ZP1A 5EL0A 4AJIA 5F5LA 3PSHA 5JCXA 1YMQA 5LU9A 5MFPA 5A5EA 2P3QA 4JBXA 2Q50A 1KDOA 1N1MA 1U6IA 4CQMD 3PPIA 4M4SA 1JDZA 2WNIA 3TZCA 3D8SA 4OLJA 2Z3VA 4R8MA 5KYXB 3ZZ0A 1PJ4A 4FZ5A 1Y37A 3FM9A 4HN4B 3BWBA 1WEHA 2OQ2A 2NUPB 5JFTA 4GO1A 4B40A 4YT2A 1M8GA 4ZC1A 2PUHA 1CY2A 4LS3A 2OFFA 4Y2QA 2HF8A 2P4QA 3W5HA 3ZHUA 3WMXA 4KQWA 5TIIA 3C2QA 3VM6A 1OBHA 2WM8A 3H13A 4M86A 2BGUA 1ISJA 3LW8A 2RSLA 3PZRA 5TQJA 1ONSA 3SJAA 1EGVB 1V0JA 2AL7A 4YBZA 1ZGZA 1PGOA 3U4HA 5I8WA 5LWHA 1YK1A 5JMTA 3PNSA 4K46A 4JSRA 4BNKA 3E4DA 3RSOA 2HEIA 4RGBA 1XYYA 3CISA 1E6UA 3K9BA 1I5OA 3RWOA 2QTCA 1PNVA 3GFTA 4EFDA 2PIDA 3AC0A 4C5BA 3JCZA 2QLLA 1ECCA 5CAEB 4ERNA 4DV6B 3TWOA 4OQNA 1ZLXA 1S2OA 3EARA 4HWGA 4KN6A 4MYTA 4CFSA 2HSDA 2A3NA 4WEOA 1IDOA 1ID1A 3T9FA 4C3OB 1JF8A 4LPKA 1R0RE 2EKLA 3HGTA 4AMZA 1XNGA 4Q4JB 5BSVA 4LZAA 2YHBA 4A5OA 4KP7A 1IM8A 3HU1A 1XXHE 2QJTA 3N2ZB 3T1NA 1CYDA 4NYJQ 4O8ZA 5AICA 4GPZA 2QXUA 2O2XA 3WK4A 1EUDA 3RCBA 2GRAA 4KK4A 2WD7B 4O4IA 5FFNA 2XLCA 5HBRA 5TPZD 4P3NA 5BN3A 3QK7A 4C87A 1XCBA 1O77A 3VTKA 3EULA 4RVSA 4REQB 4YRFA 1DADA 5EPOA 2QEQA 3CEAA 3TH5A 1FIUA 3VH4A 1N92A 5J2UA 1E2FA 3LOUA 3GGDA 1P39A 4HNHA 1DB3A 4RV4A 5E4JA 1A4XA 4B32A 5GZ1A 5IUNC 1XJQA 5JH7A 3MMPA 5IT0A 3QEBZ 4OMFG 3OFVA 5FRDA 4AZTA 1YZ3A 2FPIA 4RSMA 4JYCA 4OY3A 4B73A 1OWLA 1GT6A 3KU1A 1XVLA 4YEDA 1UBUS 3LF1A 1RWXA 4YS6A 1IOZA 3Q15C 3P8ZA 3EG9A 3GHHA 3I3SR 1U98A 1EFCA 1Z5GA 2E7ZA 3M0EA 3NEPX 1CUCA 1QRAA 5FWDA 5H16A 5ITVA 3DZBA 3PNQA 1ZM2A 3C6KA 1ZK3A 3ETCA 5HCIA 5KX5F 3VQTA 4BTVA 5HPYB 1KKMA 3KAPA 2P3SA 2YV4A 1G20B 5AP9A 1NX6A 3V7YA 4E3ZA 2WYOA 1A4IA 3HRHA 2ZZNA 2IIVA 5GJCA 2Q2VA 4ETIA 1QOZA 2RCNA 1TUBB 4J91A 4QXOA 2FDXA 1UC8A 1UZUA 4F38A 1XLTC 1R3DA 1D7AA 3I1FA 1PFVA 3I2HA 4P58A 4K9MA 3RPEA 3WDMA 5JY1A 5AVOA 3M6MD 2XE6A 3KJIA 2ORWA 2OGZA 4QUIA 4D25A 2XSZA 3OZBA 2WIAA 4P4SA 4C4XA 4ZK2A 2FQ1A 1WJGA 1FDUA 4K9LA 3F6EX 1I4LD 2FJUA 2I34A 4NDNE 1OI3A 3QLUC 3QXHA 4DDMA 2GJKA 2Y67A 3OZIA 4Q02A 2RH4A 2ZU6A 1QP7A 1QVWA 3ZR4B 1JJIA 2GBPA 3FLMA 4GIBA 4HX9A 3RUDA 3SJZA 4WLOA 3HXMA 3F9IA 3LUPA 2DEUA 3GLRA 2I9KA 4X1KB 3FPHA 4C05A 2F17A 4AZ3B 4BFTA 4OQFA 4JX9A 2F1JA 1IG0A 3VR4D 3GJ8A 3K1YA 4YWJA 2PD4A 4G0QA 4QJBA 4WTOA 1X14A 4AJEA 2DFKB 4D1YA 4G8DA 1B26A 4MUHA 1SKAA 1CZHA 1A5BB 5AI9A 1C9YA 5AKGA 1P1KA 1B00A 1E3TA 1JEQB 2HZ7A 2PRJA 3AVPA 2QZ9A 1U7TA 1VI2A 1A9OA 3BULA 3KQVA 3C14C 3PHJA 4ILKA 5AHXA 5ALUA 1QVRA 4MDEA 2X0RA 3KTAB 3OPQA 3U7FB 3RV4A 5DMHA 4FYXA 4IGAA 4O1MA 4QSMA 1EEHA 1XYGA 2I0FA 9GPBA 5DM60 5A0TA 3B3QA 4J3JA 2FPRA 3CF0A 3DDCA 7ABPA 5EE3A 4NY1A 1ZK0A 4EPTA 2NU8B 1WKVA 1DAKA 3T1VA 4TMXA 3UPDA 4BTLA 1NNEA 1YBAA 1DX4A 2AUTA 2QSJA 3MGCA 4EA7A 5IAEA 4C4AA 1VL2A 3KSUA 3CVUA 4HB0A 3HTXA 2Y77A 2A5YB 3O95A 4L5IA 2DTEA 3PD1A 3I4CA 1JFFA 2IF0A 1NVXQ 1NXXA 1R8XA 1QH8A 1ZGBA 1I0ZA 5C34B 1SZJG 3SC3A 1CHDA 1SH7A 1TKAA 3BXZA 3WGJA 3CJQA 4TTTS 3WWOA 1RJFA 1Y1KE 3GMDA 3GLTA 5KX5B 4KDRA 3B36A 3UG7A 1YC2A 4S12A 4YK7A 5B1DA 1ZVMA 2XODA 3BJMA 3ADBA 2JF0A 3S6JA 3O9VA 3L7DA 3UA3A 4NI5A 4GX1A 1WPGA 4IGKA 5I7AA 4ANFA 4C14A 4M7WA 3VVCA 3EQ7A 1T6NA 3T9BA 1KOJA 2YVLA 4LNHA 1YE5A 5KYVA 5TC4A 1JEJA 1FU7A 4EYSA 2VK8A 2WLTA 2QVXX 3R74A 3V8BA 4CG1A 3WE7A 2BM8A 1TYZA 3PC6A 3CVYA 1JKJB 3NW9A 1R6BX 3U3OA 3LA6A 1HE2A 1N6HA 1MAWA 1AVTA 2IYFA 2XJ9A 2BZSA 2YXEA 3AP3A 4D0GA 5G2OA 1QGDA 4Y2SA 1VPVA 4EI9A 1RJGA 1PR3A 4PTZA 3T54A 5ALTA 1I4TD 1RR6A 1PD0A 3GRKA 3IXLA 1SBQA 4D92A 4MCAA 4DG8A 1Z16A 2A5LA 2HRRA 3LUCA 3NATA 1C1DB 2PL5A 1ZL0A 3CNOA 4UPVA 2R6ZA 4O4HF 1FJHA 4C7KA 4ZI7B 1ZS9A 4YN3A 1GA4A 1ZH4A 3GIWA 1I3MA 3TM5A 2RCYA 4PVCA 1XEWY 4NESA 1R18A 3IPLA 3R5XA 4WCDA 4MV5A 3RQIA 3FCUB 1L1EA 3ZDFA 4DYHA 1LBEA 1UXHA 3GLIE 1ZDMA 3B7WA 2HU7A 4L7VA 4RMHA 2QXTA 5T8KA 5A5GA 3TQTA 2BMVA 1ZGAA 4IMJB 3SIRA 1XMVA 4WZBA 3OQ6A 4RK5A 4PCVA 1OC2A 4LRYA 1V6CA 3K1JA 1KIMA 1L4KA 1W73A 4XLTA 4D9EA 5IT4A 1AG9A 1GU7A 5BSKA 4HHEA 2ZVPX 1ZGCA 2F3SA 4G5OA 2W6MA 3IO3A 2E55A 7MHTA 4HH0A 1RKQA 2GD6A 3B6MA 3BREA 3G13A 3ROGA 2QM3A 5JSZB 3KX2A 2M2IA 1BXKA 3MJCA 1NVEA 4LISA 2TS1A 4G2TA 2QTRA 3N0XA 4X64B 1CP3A 3GROA 1ESDA 1ULHA 2Q0HA 4J6EA 1LVHA 1AGPA 4OLHA 3A3YA 1UODA 4Q9JA 5B4TA 5GINE 3V4ZA 3CXRA 4AT1A 4R7ZA 3MUNA 3RSQA 1QGAA 3KJNA 4KWHA 3FDFA 1CD5A 3SR4A 3FOWA 4QTUB 1QQ5A 3QBEA 1RVV1 3AG5A 1Y4UA 3IULA 3PR1A 3I2JA 4KR3A 3KEOA 2QTVB 2HMAA 3LFHA 1B76A 3NKVA 2C83A 3RASA 1B1AA 4W4TA 1NQTA 2PBRA 3SF8A 4ZYYA 1M1ZA 4U63A 2AN1A 1FPMA 1XV5A 2DF8A 2O3UA 4JVLA 1VB5A 3HA2A 2DQ4A 3H2YA 4LBYA 4KTVE 4MVJD 2YFYA 4HGQA 4HJXA 2ZYHA 2IH5A 2J5XA 3P9XA 3R0VA 4OSEA 5KAPA 3ZHBA 5ARCA 1H4TA 1XKLA 2R4UA 2VLBA 2X8LA 1IEWA 3DO6A 5FPTA 4E70A 4MP6A 3M2TA 4N47A 3OT1A 2H65A 5ENVA 2CJWA 2YASA 3HWSA 4GMXA 2TSYB 1GTL1 1BHJA 1TRKA 4YXFA 2KSQA 5E7IA 4KBYA 2XNDD 2GYVA 3EHEA 2A58A 2XT0A 4YJ3B 5IAGA 1TTTA 5CVTA 1OF1A 3QKUA 2IYSA 4J0HA 4S1WA 5CVEA 5AKKA 4DBZA 2COUA 2EP5A 3M6WA 2DY1A 1EZ1A 1FTSA 1JR3E 2XDQB 2CMDA 5F7ZA 2WWVD 5KSYA 2OXFA 4COKA 1K6JA 1NXOA 5KWVA 1VSQA 3JY6A 4CMIA 3I42A 3NI2A 4TS4A 3NHMA 3WB1A 3OX1A 5JCOA 2B2CA 3ZGXA 5EXPA 2E9SA 4K3UA 4N40A 3IBGA 2H06A 4RULA 4QGFA 4ISCA 3U1VA 5LN1A 5LQRA 4ALMA 4KRGA 1OE0A 4XYMA 5ALOA 2VAVA 4H35A 3ZBPA 1T1SA 2TMGA 3OEEA 4NYIR 1M9NA 1QQ7A 4DRXB 1X1CA 3PR3A 3I09A 4WASA 3K4HA 4EKEA 1XEXB 1NRIA 2HGZA 4DLVA 2AKEA 3PB3A 5B7NA 3VO2A 1KVSA 1RWWA 4B3BA 4OXKA 3CF4G 2DG2A 2EYUA 3EIHA 4LOJA 3HFGA 3IV6A 2GYWA 2ORED 3FTQA 1C1HA 3NGMA 1D9ZA 3T5BA 1B8UA 1D5CA 5L95A 1E9RA 3EAQA 5C3MA 5FAKA 2QTMA 3OJCA 2NQ2C 3IAM6 2X7XA 3JQ8B 3M4NA 1CV2A 2ZRLA 3QA9A 3EGOA 1XMSA 4OQPA 4PCLA 5K99A 1G55A 1VL1A 1Z34A 2ID7A 4LCJA 1A8UA 2YXPX 1ISSA 2B1JA 3GEGA 3ICWA 4BLSA 1JB9A 1W2WB 3PE3A 3Q85A 1JG3A 1ZVKA 1OD6A 3NVAA 1WA5A 3N87A 4DAOA 5LQAA 4JT2A 4IRXA 1DQSA 4RETA 1NJ1A 1N2BA 2OXIA 2VL7A 3EZGA 3GH1A 5EXSA 1JG1A 1BJRE 2J5RA 1US8A 4QYTA 4Q24A 1Y4SA 4ZEOA 1VBMA 2P6RA 5DDIP 5K8UA 1GLGA 1CR0A 2ZYSA 4EJ2A 3IXMA 2PX0A 4DA8A 1G21E 1RI3A 4QL3A 4UVIA 3STYA 1QV9A 1UH5A 2VHVA 4FFBA 1DS6A 4QNRA 4BV2A 2A4MA 2AX3A 4HPXB 3KLMX 3N58A 3KLPX 2SECE 4Q1FA 4L5YA 1NW4A 2RHTA 1DKLA 4BBAA 4XLZA 5L3SA 2QOEA 3BHMA 4B6FA 4E2WA 2VJMB 5CIYA 1BDJA 2HCFA 2N47A 2VIIA 4LZLA 4PLGA 1SCNE 2NO0A 3CW8X 3ZHOA 1LV8A 1R8SA 2CL7X 4PHTA 1VCIA 4IS3A 3D31A 3BB1A 1ZC3A 2FHPA 1BMQA 4HDMB 1QQ6A 2ECKA 4LX0A 4NK4A 3OTHA 3AI1A 2WJZB 1M6NA 3DMHA 4FFRA 3KFVA 3LHIA 4QIHA 3DA8A 1E7RA 2JAPA 4F2GA 5AFSA 2H31A 2YZKA 3VX3A 3ZDZB 3ZS9A 2FZ5A 3GPCA 1ZN2A 2C2HA 3TLBA 3A3PA 1U99A 1XKTA 2O1SA 1M1YE 2Y05A 2Z56A 4N8EA 4RA6A 3CCCA 4A2WA 5JZBA 1BDIA 3AETA 3FTEA 1GYPA 3U4MA 1QF6A 3BZBA 2F4NA 3LU1A 1EBFA 2O59A 3VR3D 2PL3A 5A02A 4FIDA 4Q3KA 3U48A 4EMBA 1VHJA 5E1OA 3FNGA 1JLKA 2DHCA 1QK4A 1X7GA 2F1IA 2OMEA 2VHJA 2ZJYA 2ZBDA 3C48A 3FRJA 4L07A 5KAMA 2PQ6A 3FNHA 4P3PA 5CFMA 1T26A 1DDGA 1KP3A 5BQFA 4CL0A 1GAJA 3CLSC 4WCFB 1KY3A 2DKFA 3IKMB 1Y9JA 2HIMA 4EPRA 2RKBA 5HK8A 3JARB 3VVLA 2WYIA 2WMNB 4YRQA 3ITKA 5F73A 4C08A 1AKEA 3PPXA 8AT1A 1Q1EA 2WM3A 4CIAA 1EG2A 2MTBA 2OO5A 3BGIA 4GVPA 3RB8A 1UUFA 1XJWA 1E7WA 4NCBA 4FDMA 4ZAYA 2PRKA 1OXSC 4KRXA 2JLSA 3TBKA 1YNOA 4KRYA 2X5JO 4M1EA 1DHRA 1YZNA 1FP1D 3QVOA 4J1SA 4ZIRB 2ZRHA 3TB6A 4L72A 5DISB 4FBGA 4LJRA 3JVIA 4M1WA 1OH7A 5AHWA 1T9GR 3C7AA 2D4AA 4Y7DA 3CLSD 3SVLA 3ZH9B 1KZGB 1MEEA 2IV3A 4DA7A 3NKFA 3PF9A 2BM9A 2W6ZA 3EF1A 5FPPA 2A0XA 3GRPA 2JAHA 2QR2A 5JCJD 2O8EA 2QUZA 1W52X 2C3MA 3B5JA 2FFRA 2XMBA 2CHFA 2MINA 2CDAA 4OSOA 1TMYA 4ZOAA 5M3BA 4BMXA 4NDAA 5JYBA 3F3YA 3NALA 1A9ZA 3H4TA 1VPLA 2GAFA 3WLTA 2LKCA 5IC6A 3EGVA 4LXTA 2XW6A 4M8KA 3AOEC 1CDEA 2A9QA 4F0JA 1TQHA 2DU8A 3ZY5A 4YX9A 1C9DB 4H18A 5LZ5A 2XJ4A 5KBYA 1GL9B 2JAXA 3TK1A 3UGJA 3UK0A 1VG0B 3MGAA 1GKUB 3BFXA 3VNBA 5TR9A 3JYLA 4EB3A 3JVDA 4M6WA 1U5AA 4LRWA 4LGVA 3C0KA 1EX7A 3ROZA 2BDUA 4YMVA 1TTHA 2R97A 3IP6A 3VYVA 2WTUA 4PO1A 3S7TA 2XHEA 3KJQA 3MCTA 2ZXFA 4IWXA 4Z4CA 5EWMA 2EOAA 1H5QA 1ENYA 1PIWA 1HSZA 3NS7A 4H1HA 1ZU5A 4ZT7A 1MF7A 1N8NA 3KTFA 4CCSA 5I01A 3FB4A 5G40A 1WVMA 1NLZA 1W30A 2G4LA 2Q3LA 1CVIA 2C7BA 2BVNA 1AKRA 2PKRA 2VYFA 4CKYA 4UZFA 4H7HA 1FNMA 1XTPA 2B34A 4BMDA 4E5NA 1L5QA 4H4CA 3B6JA 1MAUA 3BILA 4M22A 4YACA 1Z4LA 1TAHA 1Q77A 3A8TA 3K9NA 3LPCA 4NZNA 1UOEA 5ECWA 1W4BA 2OYSA 2PGDA 4CUZA 4NIMA 1VBFA 2FWJA 2IJGX 1ES9A 3RIHA 1XDBA 1Z36A 2AHRA 3QHQA 3HEBA 1B14A 1OYYA 1OJLA 1QIKA 4B81A 3M82A 4CN8A 4QQ8A 4KBFA 4EO4A 3GLHB 4JQYA 1NIPA 4Z3DA 1JQEA 5M29A 3GUUA 3V5NA 4J9UE 4TYMA 4EW2A 3JR3A 3ZLUA 2VUSA 3KDAA 4GICA 1ZITA 4PYNA 5TGZA 4EZIA 3F2VA 1NRWA 3IV7A 2MSNA 5U1PA 4DV3B 4UHBA 4S1VA 1UKZA 4ZQEA 3AKCA 1GARA 1NR1A 2EATA 4PIVA 4IJUA 4ZCLA 3IPXA 3Q7IA 4XE5A 1L5KA 1QHXA 2V5AA 5HQTA 4DBLE 4GZLA 4BOYA 4C5CA 2RE8A 2B8NA 1P1IA 1T91A 4BJ6A 4CLRB 1HE8B 2RHDA 2PKWA 1W5BA 4WSOA 2DCUA 1IXRC 3W2GA 3GUZA