1MORA

Isomerase domain of glucosamine 6-phosphate synthase complexed with glucose 6-phosphate
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
366
structure length
366
Chain Sequence
GDKGIYRHYMQKEIYEQPNAIKNTLTGRISHGQVDLSELGPNADELLSKVEHIQILACGTSYNSGMVSRYWFESLAGIPCDVEIASEFRYRKSAVRRNSLMITLSQSGETADTLAGLRLSKELGYLGSLAICNVPGSSLVRESDLALMTNAGTEIGVASTKAFTTQLTVLLMLVAKLSRLKGLDASIEHDIVHGLQALPSRIEQMLSQDKRIEALAEDFSDKHHALFLGRGDQYPIALEGALKLKEISYIHAEAYAAGELKHGPLALIDADMPVIVVAPNNELLEKLKSNIEEVRARGGQLYVFADQDAGFVSSDNMHIIEMPHVEEVIAPIFYTVPLQLLAYHVALIKGTDVDQPRNLAKSVTVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Glutamine amidotransferase
molecule keywords GLUCOSAMINE 6-PHOSPHATE SYNTHASE
publication title The mechanism of sugar phosphate isomerization by glucosamine 6-phosphate synthase.
pubmed rcsb
source organism Escherichia coli
total genus 140
structure length 366
sequence length 366
ec nomenclature ec 2.6.1.16: Glutamine--fructose-6-phosphate transaminase (isomerizing).
pdb deposition date 1997-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01380 SIS SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1morA01
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1morA02
4X66B 3EUAA 3HBAA 4LF5B 4DV6B 3T1HB 1VI5A 4DV5B 5LL6P 2UU9B 1IRIA 1GZDA 1XNRB 3HJBA 3TBFA 5LMNB 4DR1B 4LFAB 1N32B 2CB0A 3J7AC 5IT9A 2PUVA 4U6NA 1U0GA 4YY3B 2VQEB 4JI2B 4LF8B 1KOJA 1JEOA 4JI1B 1NUHA 2O2DA 2PUWA 4S12A 1T10A 1XMOB 4TOIA 5A2QA 2CXTA 1X9IA 1JIQA 3NBUA 4DV4B 4B3TB 4DV2B 2J6HA 3J81A 3I0ZA 2DF8A 3FJ1A 2UUBB 2XBLA 2CXRA 4KHPB 1I94B 4DV7B 1X92A 2CXUA 4JI5B 4DR5B 1NRIA 3BJZA 3T1YB 1HOXA 1TZBA 1U0EA 1VIMA 2VF5X 3LJKA 2VQFB 4JV5B 4OX9B 3FKJA 2XHZA 2O2CA 2UXDB 2V4MA 3JX9A 4IVNA 2F4VB 2WU8A 3Q7IA 2UXCB 4YHHB 4LF4B 1N33B 2DECA 2VF4X 4EM6A 2I2WA 1JXAA 5FLXA 4GKKB 3BCHA 1VI6A 1U0FA 1HNZB 1J5EB 1ZZGA 4DV3B 4X65B 2YVAA 2PUTA 1HNWB 2X3YA 1FJGB 1HR0B 4JI3B 3TRJA 4M0DA 1IBMB 1B0ZA 1TZCA 1XMQB 3OTOB 4LFBB 2CVPA 3FXAA 4LFCB 2CXNA 2E5LB 2UXBB 3Q88A 2HHHB 4DV1B 3M5PA 4X64B 1X94A 3UJHA 1HNXB 1DQRA 3SHOA 1C7QA 2CXQA 4S1WA 1MORA 4B3MB 3QKIA 3C3JA 4DR2B 2PGIA 4DR7B 3IFSA 1J5XA 1X9HA 1HM5A 2ZM6B 1WIWA 2CXOA 4JI8B 3OOJA 3JAMA 4DUYB 4LF9B 4DR4B 2I22A 4NXNB 2AMLA 3KNZA 1VIVA 1XTBA 1G98A 1TK9A 2POCA 4K0KB 4JI7B 1Q50A 4NXMB 4JI0B 1IBLB 2Q8NA 3FF1A 4AQYB 2A3NA 1IBKB 5LMUB 4DV0B 4LF7B 3G68A 4GKJB 4AMVA 2UUAB 2ZJ4A 4JI4B 3CVJA 2CXSA 2ZJ3A 5IWAB 4B3SB 4DR6B 1IATA 3J80A 3ODPA 1XNQB 1N8TA 3ETNA 4JYAB 4B3RB 4LZJA 1GZVA 2E5FA 1MOSA 1JLHA 4JI6B 5BR8B 1MOQA 2UUCB 3PR3A 5BY2A 4DUZB 1M3SA 5I01A 4DR3B 1N36B 4X62B 4LF6B 1N34B 2CXPA 1C7RA
chains in the Genus database with same CATH superfamily
2R7NA 3U0BA 4WBXC 4Y2XA 1BE1A 2JK1A 3O2JA 4FDMA 5FEMA 2XAUA 3ZHXA 3LHSA 4LXHA 4EHKA 2DETA 3P0FA 3RVOA 2JLSA 2QUAA 5BQ5A 5JBNA 4AW9A 1XNRB 1VLMA 1D09A 1XA3A 3PXXA 3R4VA 1TO2E 3ZVRA 4F21A 2MSKA 2Z83A 3EFOA 1D2RA 1GQSA 1T9DA 2JFHA 1VOTA 3JQAD 3TOXA 5H80A 5TQ0A 3U7JA 2H65A 2ZRAA 2WPNA 2WFLB 2PSDA 1VHDA 1WLYA 2JBWA 3B6IA 3LFHA 3MWKA 4P7KA 4HEA6 1TYCA 3ILVA 4MNTA 3ZCRA 2VUTA 1WPRA 1V3QE 3CNBA 2NPOA 3WGIA 2BHSA 4DV4B 2BGGA 2HRZA 4GW3A 2CJWA 3L04A 4ZXFA 2B4AA 3WNBA 2G1UA 1K7XB 1Q0UA 1VYHA 2GBLA 2XBLA 2YMPA 5HG0A 4BYMA 2FRXA 3BFKA 2D5LA 2FG5A 3DD1A 3GT7A 3K1JA 3DZJA 4Q1EA 4RSRA 5D1NA 3UXHA 3W04A 3AT1A 1UDAA 4LGMA 3ZGLA 5H4GA 1H42A 2A5JA 1TPYA 1V1RA 3BAZA 5DYTA 5EXPA 4TWJA 2QUZA 2WMYA 3M3PA 4MR9B 4B46A 1EWQA 2CDCA 3LY9A 5C9ZA 1TIPA 1A4XA 1XK6A 2ZI3A 3W6UA 5GIPE 3FETA 1U6IA 4B43A 4LHXA 2A4MA 2YQ5A 1XLTA 1PFQA 3FHLA 2E85A 4D25A 5GMOA 2NO1A 3T99A 4GL2A 1HNZB 2X0DA 3IAM6 3IR6A 4XQEA 4JR1A 2VJOA 3DM9B 1ZR4A 1FPMA 1IC6A 1SVSA 3D8SA 3N7AA 3W2HA 1E59A 4FN4A 1HE3A 5ALRA 1GGEA 2IPOA 1QHGA 4KQXA 4TWIA 5GV8A 4ZYVA 1PO7A 2XUAA 1VIAA 1PUIA 1RM0A 3GPDG 4HRXA 5ALWA 5JEDA 1P39A 3AJEA 2B1QA 2QLTA 5SY4A 3A0UA 2XUJA 3RF6A 4DMCA 16PKA 2FPOA 3SZRA 3GRPA 1PQPA 1FRFS 2C4VA 2ZBRA 3FW1A 5B57C 2RGNA 2AS0A 2ZJ7A 4RIGA 2GBFA 1X1EA 721PA 3JQ9C 1D0IA 2KHZA 2NVWA 3QVWA 1GKLA 4A0SA 3PHIA 2GPSA 3C3JA 3AHEA 3HHPA 4LYYA 5TQVA 1GKKA 2ZR8A 4IKOA 4OQXA 4UPEA 3PV0A 4DRXB 3DMHA 4JEMA 3WLJA 2FCRA 1G2IA 1AS2A 3WFZA 2ZJAA 3TW8B 3NEPX 1DXOA 3CEMA 1D3AA 4TPKA 2WW8A 4RHXA 1IQUA 1PAUA 4MX8A 3H5RA 1MEEA 1QOZA 4GDMA 2IYLD 5JG7A 2Q1YA 5CVDA 3RUFA 3NTOA 4BWYA 2TYSB 4HNVA 2I54A 1MO2A 3BJEA 2JIBA 3HJUA 3MA0A 1Q1AA 4EI2A 3JAKA 1YB6A 3LKDA 3DZGA 2ECPA 2O05A 1UBGA 1CJSA 1P74A 1Z5UA 2IP2A 5EQDA 3HK2A 3ZE7A 1FFWA 1XZAA 4PR3A 4PLVA 4EGSA 2PUEA 3ZEAA 1D2CA 4IAOA 4L76A 5AHXA 4S0ZA 3RO7A 5KYWA 4PNEA 3KYCA 1U0JA 4K46A 4FGUA 2C7QA 5MGNA 4JA0A 3MT8A 4U3JA 1NR1A 2E6KA 2EJUA 2I4MA 1NZDA 3DGFC 4KGZA 2HM7A 4YCDA 1SU8A 2P1DA 3ITKA 2HLPA 5THQA 3OPYI 1UXGA 1YS1X 1JDUA 2RHLA 4BU0A 5JAIA 2R25B 3ZUGA 1ELOA 1N6LA 1GYPA 1R50A 4L0CA 3RRNA 3OQPA 1TOAA 2ZT8A 4M0PA 2DFTA 3UV7A 8ATCA 3CRMA 1KQ3A 3KWFA 1H6BA 3ZVKA 1IHPA 2YHIB 4OUDA 4MYSA 2PT7A 4MCAA 3D3NA 5B1YA 2FWMX 1J00A 1XZKA 5EKUA 2VZ0A 3OU2A 4LRQA 2TSYB 3E1KA 5E9AA 2CMDA 2EJCA 3IBYA 4HRAA 4OP3A 1DWPA 1OWPA 2CNNA 4MUXA 4PO3X 3TXYA 3UYKA 3K2QA 1P31A 4FIZA 1N5IA 1Y8CA 1DTSA 3C24A 3HACA 5C1IA 4ZI7A 3WMGA 1XEWY 1KQGA 3ISVA 1KMNA 4J1TC 4XGIA 1JA0A 4JJKA 1I4OA 4QYSA 1P2TA 1R16A 5KJEA 3OQMA 1GCGA 4ARZB 4DQVA 4DILA 5ADUS 2VFAA 2UUBB 2O19A 1X92A 1GRQA 1U11A 1A69A 1O94D 3B3QA 3KP1A 1GNSA 3PU6A 4FOOA 2H16A 4GGMX 3P52A 2AFHE 1N2SA 4YAWA 4DWVA 4JXJA 3W6NA 4ZVSA 1DCFA 3BJMA 3HPQA 3Q3HA 4TVOA 1P0IA 1RQLA 5EP2A 5JE8A 2XMCA 1KMHB 3HYTA 3ZBUA 1CF4A 5GGXA 4MKXA 4RV5A 5DNYB 5TT0A 1UQRA 1RTTA 1Z0SA 4LY0A 3RYFA 5DNCA 5JVDA 2P3LA 3FCUB 2PZFA 1L5LA 1YONA 2I2WA 4IS3A 2NXCA 2QY6A 4W5HA 2I29A 4D5GA 3RS4A 2UAGA 1QXSA 5ALPA 3WDMA 2C07A 4IDPA 2H7XA 2I2BA 5DWVA 1VRCA 3DTYA 5KTYA 1WMBA 3EJWA 4UFPA 3GIWA 4ZQCB 3DVQX 1MAVA 1M75A 2IU3A 3EZ6A 3INYA 2HWKA 2ZJ0A 1UXHA 4ZOAA 1NW3A 1BDMA 3CR7A 3HDYA 3KTAB 3QJ5A 4GMFA 3PR2B 2ZW9A 1YMQA 1ONPA 4EELA 4F11A 3BWDD 5IFKA 3AVTA 4E22A 1UMDB 1C8BA 1T6YA 1FF9A 2YJGA 3W5AA 2AH5A 2HAEA 4WY8A 3BJIC 1V3UA 1FS5A 1LD3A 1H5UA 3TDNA 3UMCA 2D4HA 3WYEA 2XVZA 1KF0A 1JR3A 4QHSA 3BYZA 1UKCA 2BIFA 4ZAZA 3UAYA 4HYEA 2NZ2A 3LL7A 1JHUA 2ZEJA 3MNFA 5E3IA 3O84A 1QQBA 1SKYE 4M60A 3Q7SA 3ROEA 4YT2A 2FAXA 2GCGA 1RKQA 2NO4A 1SWWA 3NALA 4Y2RA 5SZKB 3VAZA 5LLDA 3NTQA 1WABA 2Y0PA 1VDMA 4AZVA 1V8BA 1VB3A 2P11A 3WP0A 3LLUA 5DDIP 3U3KA 4TXJA 4A6PA 3EPPA 5JO0A 1ES9A 2X1MA 5IF3A 3AG5A 2DWOA 1GTMA 2D59A 3P9CA 5LYJA 4J76A 3WGOA 1L3IA 2P9ZA 3THWA 2OV1A 3MJTA 4P22A 1VKJA 1E4EB 5AICA 3TX6A 3E22A 3L05A 2NQ2C 4CM1A 4EAAA 1DJNA 2VPWA 2X58A 1Z6GA 2GF0A 3JYNA 3K73O 3PNBA 3L6UA 3VU0A 2VTBB 5UKDA 5K0CA 3CZQA 2WSSD 1GAXA 4WKCA 4WZZA 1P3JA 1SUCA 3SC3A 2VK4A 4P3XA 1J2RA 3VHXB 4FFRA 3FWPA 4GQIA 2YWFA 4P92A 1HRDA 4GC5A 1U9IA 2D3TA 1L6RA 1V5EA 2I55A 3D81A 1MDBA 3H2KA 3UAWA 5FBHA 1JEYB 2BMVA 1N75A 1MG5A 1V1MB 3WL6A 3HXOA 3G0CA 3PXGA 4LJYA 2B82A 4QTXA 1YQGA 2BMEA 1K3UB 2JC3A 1ESZA 2ZUDA 3ELBA 3KDAA 2JKVA 3LIPA 3OPNA 3EIXA 2BONA 4YAUA 3AEUB 4XJTA 2QMYA 3K94A 3SHQA 1PL0A 2OYRA 1GSAA 1KEEB 3VU9B 2J6BA 2JARA 5JMOA 2IFTA 2VYFA 1IPFA 4MH0R 4JDUA 2JCXA 3MGKA 4RLHA 3CKKA 3A6HA 3DMDA 1Z82A 4IINA 4UEWA 5B37A 1JSCA 4H31A 2GTHA 4BZWA 1XAHA 2V7WA 1YWGO 2XGSA 2G4LA 4Q1CA 1SHZA 1W4CA 2IZ5A 1VPWA 1QIEA 1COZA 1JIJA 2VT2A 2I3ZA 3I1JA 3O6VA 4FSHA 1Z13A 1ISPA 1RPNA 1UODA 1TDJA 5LDGA 5JH7B 4A6EA 2VDPB 2YXBA 4LRSB 3UYLA 3WRYA 4C22A 1JVSA 1UJCA 1UPTA 4NBRA 4HPXB 5KHLB 1IHOA 2Q2QA 4N3GA 1SIBE 1JHPA 3S1LA 3VYVA 5HUQA 5KPJA 1CS4C 1NLYA 4IGKA 2GT1A 4LQDA 1MJHA 3CUEF 4QBGB 4U2EA 4MRSA 2GOYA 5FUXA 1ZMOA 2UXDB 3Q3EA 1AB6A 1J8VA 2XODA 4JENA 1QO7A 4RW0A 5FBWB 1P1KA 5ED0A 2SBTA 5BSWA 1OX6A 4G0XA 2WKPA 4IXTA 2GZRA 2DY1A 2YZ2A 4L8FA 1PR9A 1F0NA 3B70A 1OXBB 2Y3IA 1KSFX 1X1TA 1RYNA 1GQQA 1I9CA 2J85A 2VCHA 2VT6A 3IDZA 3PPIA 4ZOCA 4BQEA 5JI2E 1BN7A 3GU3A 4BLPA 5BMVA 2C9YA 1T13A 3HEBA 3B2QA 3HWX1 4KXNA 4O3FA 3MGAA 4CV1A 3DOUA 5FTMA 5KREA 3K8YA 1KQNA 2GPWA 2I6GA 1AQ6A 3OZTA 1TZMA 3W6PA 4H6VA 5D5PA 1B8VA 2GJSA 2PSSA 4HB0A 4IJQA 4KITB 2BW0A 3BXFA 1TW2A 3O4JA 2A9OA 4PAGA 4RKQA 3LO8A 3H3XA 3QVTA 3VR5D 1RC8A 2RGCA 2P1RA 2R6CA 4KXUA 2AR9A 1E77A 3PFHA 2C2OA 3B9PA 1XHEA 1ZH2A 3OIGA 1A77A 1MV5A 1RIFA 1R9JA 1Y82A 2ZTHA 1GA1A 3LQQA 4ISCA 1N1GA 4R16A 4YJHA 3T7KA 2FZ4A 1XD2A 2VLIA 3DP7A 4MKFA 1ADGA 1TD1A 3U17A 3ESRA 1W7AA 5K51A 1AH2A 2POCA 5CH8A 4CEHA 2R6AA 3VHRA 1JKMA 1PW5A 1VG9B 2OFWA 3R20A 2A86A 3KYDB 5GONA 1QYIA 3FCOA 3HKBA 7MHTA 3TFOA 1NBWB 1ZW1A 1A7AA 1E3JA 3H97A 4OXNA 1LSSA 4TGLA 1YC2A 1WDMA 4CTJA 4A8TA 2QX9A 5CT6A 4O63O 4D43A 2R00C 4PX2A 1NFQA 2J0UA 1NXOA 3MMZA 1IUPA 3OIVA 3OTQA 1BFKA 4FILA 4WLFA 3CX4A 3E2MA 3OLZA 1BU5A 3LVRE 3WADA 5IUNC 3GLGB 4H77A 2P2YA 5DCWA 3RRFA 4H4DA 3WMRA 2A1IA 3PUIA 5CDFE 3ED1A 3AFOA 3A1NA 1S3IA 3VR2A 1J8MF 4DLAA 2W6JD 4DR3B 3CBGA 4BMOB 1X9GA 4KTTE 1AHNA 1RXCA 3O8QA 4M87A 4O4HA 1XNJA 2ZRMA 1D6JA 3AXSA 1OROA 4DARA 4P4SA 2LGJA 4EY7A 1DUSA 3ONWA 4IIVA 1EK6A 1S3SA 3P0RA 3B9BA 2H57A 2W37A 2X14A 1WXDA 3HH8A 4N5IX 4D9KA 4BEWA 2O9JA 4EPXA 4JR0A 4QJBA 5AVTA 1SCUB 3CSUA 421PA 4WUVA 4Z7JA 2BFPA 2W11A 1P9LA 1RU3A 4OHOA 2BTQA 4PBSA 3WMEA 4DJ5X 1UT6A 3PZRA 1KOFA 3QTTA 3EPRA 1C0PA 2FPPA 2P6OA 2VEDA 4KO4S 4QRDA 5TB5A 4ZTZB 1RP1A 4QM6A 3WFIA 2B5OA 1TRKA 5BPHA 1WXQA 3A1FA 3MGBA 3NU1A 4QICA 4QFCA 4FUQA 3A3OA 3OSZA 2G28A 2GJ9A 3ETLA 4I50A 5I6DA 3ESZA 1ZKMA 5KNLA 1VE1A 4YXFA 1UPAA 1UWCA 1ZSNA 4GP9A 2YJTD 4FQ5A 4EJ0A 1F7UA 1WP4A 2WOJA 2OBYA 5IJWA 1CBUA 3ZNQA 2OO3A 3LHDA 3KOUA 1FTNA 2X3FA 4R1OA 4HUJA 5DHPA 1NNUA 1I0IA 5A1JA 1W5BA 4V3BA 4DY4A 3EXEA 1R00A 1DAOA 3CLTD 1G59A 1WZEA 3EGEA 3GHHA 3A2LA 1VJ5A 3B6EA 4FGSA 5L4NA 1GILA 3UGJA 2W6OA 2A2ZA 4JEUA 3K0EA 1NUSA 4QBHA 5LBUA 2F9FA 3PWZA 4WGFA 3VNSA 3KQWA 1T6BY 4UEKA 1MJFA 3VUFA 5CYGA 5EXDA 5ITZB 3A6PC 2QRLA 1BWSA 1Y8QB 1T5TA 3WQSB 3R5XA 4RMIA 1X87A 4BZPA 1YKSA 1G7SA 2BWJA 4BGIA 1N57A 1XAGA 5LA6B 4MICA 3F6PA 4PZUA 2XKAA 4HDNA 2G4CA 1T4DA 3AF2A 1XIVA 1PK8A 2YINC 3AKEA 3NONA 3T3HA 5C52B 1NP7A 4MWDA 5K8LA 1PT9A 4KWTA 3WYGA 4RVSA 3HLYA 4EFKA 1SC1A 4Q02A 3WYNA 4S1WA 1U98A 2HU8A 5LZ9A 3L01A 3P27A 1EVYA 3I6BA 1PZEA 4A0FA 4BNMA 2PBRA 1VKOA 3L7IA 3OF2A 2HK9A 2BFEB 3GPIA 1GZHB 1T6XA 3KELA 3WWYA 3ICQB 3TZQA 2P3QA 1RBYA 2RBEA 2ZB8A 1XRQA 1U7DA 3JATA 4FNMA 3R5SA 4QRIA 3R9XA 4JHXA 1Q44A 3TZEA 1MV8A 3BS4A 5AK3A 4Z49A 2IYPA 4KACA 3RYHA 1B76A 4FYKA 4EG4A 3R5FA 3ILHA 3ENWA 2BBWA 2NUAB 5JALA 3HA3A 4Z53A 1JIVA 5F9MA 4RZIA 3Q8LA 5A5DA 1XBTA 4FOLA 4M1KA 2I78A 3UJNA 4U2GA 4J1QA 2YRWA 6GPBA 5CLJA 2FETA 2HJWA 2VJCA 4L28A 4ZQFA 1CUBA 5KU7A 3HEAA 5E4YA 1NJ6A 4YRNA 3BQMB 1TJNA 4NZYA 1H65A 1CUDA 1JBQA 5IULC 3GN1A 4KOAA 5DBOA 1Z2EA 3PNVA 2VSYA 3ZLVA 3AY0A 4RY8A 4ARCA 1XTKA 1WQ4A 4XOIA 4EOGA 1D1SA 3DD5A 4ME6A 2F3TA 3NUGA 3T61A 5BW8A 3UMSA 3QKRB 4FHEA 4IO1A 3LTEA 4CLXA 3O38A 4NV1A 3CRVA 4AUMA 1G0NA 2OSVA 3IIMA 1KK1A 3NEJA 1B42A 2PUBA 3LK7A 4NAVA 1OZAA 2EGHA 1G291 2CNWA 2YRFA 2HREA 2ZIFA 2ZSIA 4GLJA 3GJTA 1AKYA 2G82A 1XDUA 4HWPA 4P31A 3LD9A 4QGSA 1Y5IA 1KU6A 1P2DA 2CXXA 2WJ3A 2ZUEA 3F71A 4ZOBA 1Z0JA 2H08A 2PMDA 1B4DA 1J21A 5B58T 4KE9A 4KNWA 2KW5A 2AG6A 1X3SA 4GYWA 5ANRB 5L8VA 1ZL2A 3QVVA 2I76A 2X6TA 3FGPA 1KI7A 2PX0A 4UM9D 1IN8A 1DS6A 1CJMA 2ZETA 4M6WA 1ZJ6A 2QW8A 3P4XA 1PHRA 4B79A 1E3QA 2AG5A 4DA7A 5DP1A 2NVUB 1W44A 2ZVJA 4QOFA 1Y3FE 4GLFA 3L93A 4RGBA 2CVFA 2CHEA 3H13A 4F1KA 1C8VB 2BFWA 1UXJA 2P8SA 3AFNA 3U4QA 2VF7A 2TMYA 2FEXA 2E3JA 2F6RA 2IDMA 4R9RA 1N6KA 2B94A 3W5CA 1N6PA 3LPDA 3PDUA 4LDPA 3WK6A 5F5LA 3OP4A 5KNCD 3AUJB 1GGNA 2POQX 3M6UA 4RQTA 1I01A 3MJFA 5CVEA 3X1JA 2FNAA 1L5VA 1RWQA 2NT4A 3IBCA 2VP0A 3U9SA 4D0LB 5CD9A 1GUYA 3DNMA 2W2KA 3GAAA 2IRWA 3EC1A 4G9BA 5JH7F 5KSYA 3I62A 1CUSA 5JCOC 1EPUA 4RBNA 1U1DA 3VA7A 5B3AA 1GO2A 4H27A 3B1XA 3H6HA 4L27A 3IP6A 1U5BB 4R3UC 4P84A 1QR2A 3M2PA 4RD2A 2O4CA 3T5MA 4ZAVA 5HJ5A 1NVDA 3M0EA 2H1CA 3L77A 4FE3A 1ZIOA 4HS4A 1ZN2A 2F9LA 2J46A 2X1HA 1YZ3A 2IYOA 1GD1O 2Y1KA 2ZU0C 3CR8A 3B5JA 1H0SA 4ER5A 4AVYA 1M6VA 4B9EA 4OUKX 1NTRA 3DOHA 1GZ4A 1QBGA 1O4WA 3R7AA 1GUDA 5BV8A 3R3SA 1I9GA 1FXWA 4FBMA 4ERNA 3S4YA 3UC9A 5AK5A 2B8JA 4GG1A 3IVCA 3N0VA 4LMAA 5TS2A 3UWOA 4QU5A 2IX3A 4N48A 4HGPA 2R6ZA 3F2IA 1GUAA 4GF5A 3L4KA 3SZMA 4ZIRB 5CXQA 3E35A 4F4CA 1ID8A 3E82A 4JOQA 4LXTA 1VA5A 2WU0A 3FZQA 4FJ2A 4NMMA 3AETA 5KWJA 4AQYB 1YHNA 2C2ZA 2OG2A 1H2RS 3B38A 4XIGS 4US1R 4Z1MD 3KL2A 2PSEA 4QYWA 4NCNA 2O0LA 1IDOA 2ZSBA 3M5CA 1USKA 3MQ2A 3O4VA 2JHPA 1H5NA 4UPDA 3TMKA 5JJLA 4AZ3A 4G25A 4DKXA 3VZDA 5C0OE 4OHZA 3B7PA 1J0BA 3OY7A 4KK3A 3P9RA 5CGQB 5BWLA 1G64A 1QGZA 3Q3CA 1KETA 1WCIA 5BY2A 2ST1A 2ZRHA 3AVQA 2W6JA 3BMQA 1NVMB 3NHZA 3V8EA 4FEGA 3UAXA 5EN4A 2VNHA 4KXFB 1IDN1 2OL4A 2XPCA 1P0PA 2GA9A 4BYGA 5CLHA 4F5WA 4GUAA 5IAGA 4NIMA 1ZYUA 3I01A 1G8YA 1R6XA 5KNBA 1Y9DA 3WLAA 4W5OA 4A5SA 1J8YF 1J0EA 1FBTA 4ZK2A 1J1ZA 3W3AD 4Y6LA 4KR2A 5ETJA 4Q66C 3PA8A 1HQYE 3LUJA 1YV9A 2VP2A 2Z57A 3O82A 4K1LA 4MI1A 1PP4A 4HL6A 2UZ0A 3NNNA 3R5TA 1NMXA 1RYDA 2O07A 2FFRA 2QNIA 1P4RA 4QQNA 4Y9DA 3KQQA 1TQ6A 1DC4A 3CRW1 1VGRA 5DW3A 1F7VA 2PNFA 1E6CA 3QE2A 1UZLA 5EZQA 4CKCB 1SC3A 3KOMA 3HCDA 1L7VC 1QH1A 3QXHA 1S8AA 2B61A 3PHCA 1JT2A 2D5AA 2ZIXA 1FU7A 3JQBC 4D92A 2EW8A 3NKFA 2Y99A 2FUKA 4J0IA 1Q1EA 3TIFA 3EGIA 3HJNA 4A7PA 4NBUA 2QUBA 4EARA 3O4FA 2R8XA 1OFVA 3BCUA 4GKKB 1DOAA 1EE9A 1KFEB 2IZ7A 4CUJA 3QBVA 1P8AA 1C4WA 2GM5A 3BQNB 3LP8A 4PZEA 4LYFA 1QIFA 3U1BA 3ZXSA 4XASA 2QP3A 1C3JA 3BIJA 1WS6A 3N75A 3TRJA 2QIOA 3ID6C 1DMRA 4OXXA 5K6TA 1VYUA 2FK8A 3GH1A 1V8PA 4IJ5A 4XLTA 4MIKA 3HKEA 2PMKA 3C5CA 5DEIA 3H9UA 5AT1A 4KOEC 3UJ9A 4X64B 3HBLA 5HUHA 5AW9A 1E3DA 3KOOA 5EMMA 4FFVA 2FF5A 1XEXB 3ACBA 4WDRA 3KQKA 1B2RA 4RVCA 1ZA1A 2FSUA 1T24A 3IOCA 3COPA 4N3BA 1A4RA 1CUXA 3TZBA 3F6CA 4OIFA 4IZOA 3TZLA 3W9UA 3X1XA 2JI4A 1F0YA 3IHTA 3QPCA 3GL9A 5REQB 2YV5A 3V8PA 4LF9B 2A3RA 1PGOA 1RQPA 1A98A 2FP3A 2NM0A 3ZW8A 4E0BA 3MMSA 5HJEA 2ZQ5A 3OLYA 4KR3A 1YDGA 1ZEMA 4AO8A 7REQA 4ZCSA 1P4GA 4GKJB 1U3UA 1HE5A 4TSKA 4TXMA 1QGYA 3CUUA 1Y7LA 2P2ZA 4BFTA 5JSKA 4DCUA 2WYUA 4OLHA 3QEKA 1ZC3A 3SZUA 2HPZA 5CDYA 2GAJA 1RXUA 3FUWA 3N8NA 5CFRA 2GA8A 1X1QA 1II0A 1JN0A 1YRBA 4Q3DA 1GL7A 2H9YA 5CT8A 3IEKA 5BR1A 2AHOA 4ZAGA 3IOMA 3I30X 4B3RB 1IL0A 5AVXA 5DM2A 3KPUA 2UVDA 3TOSA 3K6SB 4JUIA 3I0NA 4R8KA 5C81A 3M4XA 1E96A 2IUTA 5BN3A 4A8JB 1DGQA 1EGAA 3PLNA 6REQA 1XMIA 3V7NA 3ZHYA 2DLCX 1QAOA 2ZJOA 4OJMX 3K53A 1V95A 2XZOA 4E2WA 3V1KA 2ZS7A 3CLUC 1RKVA 1TT5B 4YMHA 2Z9CA 4X6LA 4IDAA 4Z4GA 1C3EA 3B1FA 4X1IA 2FI1A 2Z2KA 3P45A 1GQOA 3COWA 3ZU4A 2QT1A 1NVVQ 3QXJA 4B6EA 4F2PA 3MAJA 1M8GA 1N92A 1R5JA 5F7ZA 1U7PA 1ZM3A 4W7HA 1L5ZA 4CQNA 3B3FA 2FUNB 1AF7A 3H86A 2JGNA 2P90A 5AKLA 4AQDA 4KQ9A 2J1LA 4EI7A 2PUHA 3M5DA 5KCMA 3ITNA 1K3FA 2VP5A 1LK7A 2YXDA 1FS6A 2BBOA 5JANA 2HWYA 3A7EA 2ESRA 4ZHSA 4EG6A 5AOVA 3FTDA 1GCIA 4IKPA 1E1CA 4EQ6B 2DWUA 1JFSA 1CJUC 2BGKA 2EJTA 3HVKA 4KXYA 3ZVLA 4CQLB 5JJ5A 1X7DA 1A2OA 3FKJA 2IYAA 4JX9A 2XZLA 1NAIA 2ZI7A 4WLOA 2ZYSA 3ND6A 1OFTA 3TLAA 5F4BA 2Z5VA 4C6RA 3EF0A 3AONB 3EGOA 3Q3IA 1C1DB 2HGZA 4DCSA 3TPFA 1LNSA 1S2GA 1SWVA 2XUKA 2DQZA 3OT1A 2C03A 2PBFA 5KNCA 2NUPA 3AI3A 4JJ4A 4KI0A 4WZAB 1P1HA 1X7ZB 3IXMA 2XMDA 3CWZA 1RAEA 5EKXA 1P75A 1D1PA 2QQFA 2ZK7A 1YULA 2ZJ8A 3OQIA 4ITUA 5I7OA 4HMOA 1KZ4A 4PZPA 3ZU6A 4LGYA 1BDIA 3S5UA 1HTWA 4XDGA 2QTAA 3ANXA 1VLZA 3W8FA 4V1CI 3A4NA 3RYCB 1ZDMA 3EHDA 4MUBA 4G37A 1Z6PA 5EJGA 4KNYA 4FFLA 2OECA 3OIUA 3S40A 4X94A 4J0CA 5KWSA 3ASZA 4TQAA 3D0KA 4MWZA 4U39A 1FJ2A 1Z5GA 2CJXA 1EVJA 3DMTC 4MQMA 4UPVA 3WRXC 1VHQA 5A6VA 4PGFA 4BFYA 4KBFA 1MX3A 3K32A 1QFMA 4QNMA 3LT1A 5IBPA 3VI3B 3S8EA 1WJGA 4MGHA 1MVOA 1AKMA 3S27A 1MVLA 4I5GA 5T4EA 2FPIA 1R4AA 2SCUA 5JS7A 1T29A 4L85A 1RXVA 5EE9A 4Z1MA 2QZJA 5G02A 4MAFA 3E7XA 5F77A 1R10A 2WSMA 1ULZA 4DQDA 4EI8A 2XJ9A 1GPJA 2C8JA 4J49A 1QSGA 3D3WA 4NH4A 1R0RE 4QFBA 4V0ME 3WV4A 1KI4A 4R2LA 3TQFA 1JUDA 1Y9AA 5LZ8A 2CVZA 1S8NA 2X2EA 3ABOB 4L5CA 2ZRPA 2W2VA 4DYDA 1YZTA 4QDZA 1IQPA 1U7TA 5CA0B 2OCIA 5TIIA 4FHGA 4KDEA 4NFYA 3OPMA 5FH9A 5JFGA 3L02A 5LCXA 4WOBA 3ZE8A 4H7FA 5IDYA 3W8NA 3SHVA 5JWRA 3ZZMA 1POXA 3PL5A 1G2QA 2BTOA 3E5MA 4GVXA 1WHSB 2NO0A 3F98A 1IXYA 3AOEC 2Q99A 1PJBA 3EXHC 8ABPA 4R51A 1L4MA 1SZCA 2O3TA 4KLCA 4Z0TA 3UOWA 1PFYA 1CZRA 1DKMA 5J59A 1ZRNA 3O4GA 3KALA 4ZCQA 4HJXA 1Z45A 4TZTA 5JNWA 3SGLA 1SVUA 3G1TA 1S5PA 1Q12A 1RYEA 3OO1A 3W3AA 4BGUA 1HLDA 1DO0A 1MEOA 1XZQA 4JXZA 5JIBA 1KEPA 2HSDA 3QVUA 4BL5A 2HF9A 1WETA 4RD4A 1DSSG 3K70C 1DT3A 1RWOA 3RFVA 4TXLA 1ODLA 1U7OA 4WN9A 3HNOA 2QPOA 4RVGA 3NNSA 5BQ3A 1OYVA 1P5HA 2CCJA 2REBA 4RU1A 1UOQA 3K0BA 3I5XA 2B1GA 1WY5A 1JQBA 2E7ZA 2ORED 2UZAA 4KQKA 3DPIA 3PSHA 3UBMA 4F71A 4A4DA 2R8EA 3QI7A 1HDYA 4L8GA 2BEVA 2O6LA 2PL3A 2FZKA 3ESCA 4Y2JA 4WHMA 5SICE 5TGZA 3S70A 5JAMA 1QVZA 4I46A 4BPBA 3Q12A 1U7WA 5GJCA 5CFLA 4DQXA 1Y98A 3WY9A 3CEHA 4LHVA 1U2GC 5FPPA 2PUFA 2OP0A 2XNHA 3KSRA 2WTAA 4EITA 5FO1A 4F85A 5C4IA 2J9RA 2GEKA 1PJLA 3PFKA 4J94A 4N7RA 13PKA 1LBQA 3FUUA 4NCKA 4WZBB 4L8YA 2O52A 4OV6B 3SFVA 1DEXA 1GU1A 5AKKA 1A88A 4HAZA 4TKLA 2V5AA 5BSMA 5J47A 4QBIA 4X97A 1EUCB 3ROXA 1EH5A 4O2BB 1JR2A 4JI3B 4HRYA 1IULA 3CYFA 3VBEA 4AECA 2IC5A 3TGLA 1ST2A 3GDOA 4F9GA 1QHHA 4MR9A 3HJHA 4Q21A 5T7BA 2QTLA 2V7QA 1AVTA 2LIPA 4XPZA 5CPBA 1HC7A 2B25A 2UXBB 3R6GA 1QLWA 1FDRA 2IXAA 3BHJA 2IIVA 1X2BA 3DJFA 1E2MA 4Y0VA 4MEBA 2VJMA 3RUEA 4EO7A 2JCGA 3KZVA 1MNAA 3NHUA 3NHWA 2WBLC 1J0CA 4LJ5A 3GJSA 1DG3A 2GH1A 4FX2A 2W71A 1MQ8B 1IEQA 3BXXA 3EGXA 4LISA 1CP3A 2XT9A 3RSSA 1IOWA 2GI4A 3X2FA 2PR7A 3HN2A 3OBIA 2DHRA 1E2HA 4F3YA 1XKXA 1PWZA 1Y3CE 1ZZEA 2VZ9A 4O1IA 1FDVA 3TBKA 1CB7A 1QQ7A 1D1QA 1XVTA 2AFVA 2OD2A 1XZPA 3EBOA 3IAUA 4K8RB 3FVVA 4BZQA 3NHPA 3IQDB 1FUUA 2LKCA 5F64A 1VJTA 2AFHB 3RQSA 4DQUA 3I3SR 3ISJA 1JJAA 5C1BA 5FWNA 5A0VA 1EX1A 1AMNA 3X1YA 4WJZA 2VHEA 2HSJA 3PRHA 3V42A 1JDBB 3VKGA 5HK9A 2YN4A 4X92A 1B6SA 4BO4A 3T8YA 5IM5A 1ML4A 2O8BB 2MMGA 3LPAA 3O0DA 5C37A 3CO5A 2JRCA 3MIIA 2JFWA 3AGQA 1J8DA 3GLSA 4U2DA 3TLZA 1HDXA 1NPTO 3E7FA 4JJ6A 4K3UA 3FROA 3HUEA 2IEGA 3C2QA 3SQOA 3RVJA 3HV2A 4FOPA 4LZZA 3DH0A 3I8OA 5AVRA 3V8MA 1DQPA 3I42A 2R1TA 1Y5RA 2PS3A 3W1VA 1AO3A 1PKXA 3A1TA 5F33A 4EZIA 2QLLA 4C7BA 4N0EA 2RK4A 4OHKA 5HQTA 1XJ5A 1MCZA 1QUFA 1S9HA 1TA4A 1WO8A 3DL2A 3NM5A 5JPIA 5BRJA 3N2KA 3I4CA 3VDMA 1SJ9A 1BHQ1 3OESA 4YRQA 1RRFA 2AG1A 2QD2A 2GYVA 4NBNA 2Q5FA 1I2BA 2XCQA 1FX0A 3TCNA 2E4UA 4XE5A 1FDOA 1C3XA 4YRZA 3GOQA 2FWAA 3RH0A 3VU1A 4YCJA 3AV0B 3CX6A 3QPAA 2YW9A 4V0KA 1KDRA 4AY6A 4R9NA 3O03A 3E2IA 3UV3A 1U28C 1QNLA 1EFDN 2LCIA 3EUWA 3K1AA 3CNLA 4KE7A 3CR3C 4QOHA 4Y3UA 3L0BA 2OFOA 5ESDA 3EIQA 3MCAA 3B7GA 1EHCA 4U5QA 1V3VA 3MFYA 2ZCJA 4EG0A 3LWDA 4QT0A 2YHIA 4J16C 5I7RA 3INRA 4AX4A 4MWGA 1R8YA 1Z6AA 2H63A 2MDTA 3HR4A 1RLMA 2VH5R 1TVKB 4EYKA 4UATA 1E4OA 4X1OA 4FSDA 3PUYA 4ALMA 1Q95A 2ZS9A 2B4KA 4G07A 4DGQA 4HXYA 1WZ2A 2CZCA 2UXCB 3FSEA 4C30A 3EPJA 4L5JA 2R8YA 1ORDA 3SFTA 1NGSA 3RVBA 1L0BA 4PLCA 1WMAA 4DBVO 2D4AA 3OHSX 1LQ2A 2G71A 3K8OE 2IZ0A 3IDSA 4G1CA 1SCBA 2AOTA 4QUKA 5TF4A 1VE9A 4CKYA 5B3KA 5K8VA 5JAQA 1H05A 3D7MA 2C5SA 2YMQA 3RHZA 1YJ5A 4KSYA 3WKCA 5K0EA 3UATA 1PFVA 5C8DA 3L9WA 2RAVA 2YIDA 3LUPA 5IKMA 1Q7EA 1KR5A 1ZIDA 2V7XA 4BNFA 5A4JA 3LY7A 1H85A 4FR5A 1G2PA 1W0KD 3SD7A 3U39A 5I48A 3IT3A 4MVWA 4AQ7A 4ZRDA 4ESOA 4HR7A 2X0KA 1T36A 3P2IA 3VR6D 1A9TA 1L7MA 3LL4A 4AZ0A 5BN1A 1ND5A 3FBTA 3MGGA 4DPLA 4LX0A 5E8JA 2QD3A 3WJ7A 1N2IA 1OCEA 1ZGZA 1LK0A 3QM1A 3WAGA 1WZNA 5JWOA 1G63A 1EFRA 1UQUA 1JIKA 2CVQA 5A4AA 4ZYXA 3NDJA 3B20A 3U4IA 3OZUA 1CQWA 3ONEA 2H51A 5BQXA 5IHXA 1N1DA 4F7DA 1H0RA 4WD3A 4EGJA 3KQUA 1YFZA 5AHKA 1QFYA 4QJ3A 2OTCA 3EEOA 3RVMA 1DU4A 2W00A 1M76A 2NV0A 3Q9LA 3Q2OA 1UMDA 2N1BA 4DV0B 4MRAA 3WYFA 1EFVB 2QTTA 3IUEA 4HWTA 3R1IA 1Y89A 1YJAA 1DAMA 3JQGB 4LA4A 5EMLA 1A8QA 1QQAA 3AIIA 3C6YA 1CF9A 2KJQA 3D9QX 4ZEMA 2Z1MA 1MO5A 1RQ2A 1E92A 4I8IA 4CVNA 4ZMSA 1OBFO 1PK9A 1V7CA 3I9MA 5K3SA 2XDQB 2YZMA 1SEPA 3NGXA 2PTHA 3IPYA 3K5PA 3NXKA 1HX7A 4GMKA 5J9FA 5AXBA 1UC4B 3N1UA 3OJLA 2ZATA 5L7WA 3M81A 3K9FC 4ND5A 4K9RA 4C2BA 1UJMA 4K81B 4LY6A 1I2MA 4R3NA 5ENZA 3K5WA 5CXUA 4PLTA 3KDSE 4BV2A 1WTAA 3T4XA 2YWCA 5JTTA 2GD6A 3D0RA 1Z8DA 3TVTA 4B7ZA 1E4EA 4F72A 1P19A 3AHJA 1OWMA 3P2MA 5F35A 2PPLA 4ZJUA 1VJRA 2ZJ2A 1EQ2A 2A5DA 2VTBA 5DMXA 1K89A 2AOXA 3DAYA 5IT9A 2RI6A 4OAPA 1T3ZA 1GEGA 1R5BA 1DQZA 2MMCA 3VH2A 2EFGA 2LXNA 2HHCA 2QV7A 1EE1A 3NYRA 1GNVA 1XCBA 4HPJB 4MUFA 3ILYA 4GICA 3IMFA 5AW1A 4BRUA 3OVMA 4MQ6A 5DHUA 2IF0A 2Z95A 1NNLA 1JHMA 2CZGA 1NBMD 3MQFA 3OE4A 4Q5IA 3CRRA 3EB9A 3H5OA 5D6OA 1UUFA 2H52A 4FFOA 1TQHA 2CKDA 4GGOA 5AK0A 4EKDA 3IKJA 5ADHA 4N6NA 4S1PA 1CDOA 3ZY4A 3REQB 2HYIC 4E03A 4NCBA 5CD1A 5G4LA 1X7XB 2NZYA 5DN9A 3TTXA 1L5HA 2OZEA 2RIPA 5K05A 5FYDA 2JGFA 2HRBA 5HFNA 2CMFA 2ZRJA 2YY7A 1R9MA 2G5GX 3JV7A 4JODA 4PAMA 1ACLA 1NI5A 1TKCA 3L06A 4OQFA 4XRGA 4U7TB 5BR4A 2A5YB 2KI5A 3BDIA 4XWTA 1SB8A 4B80A 4Y1RA 4Y1GA 5J40A 2ZFUA 3L40A 1SELA 1Y5MA 3A36A 2RI0A 1KR2A 3L6RA 4XDHA 4CPDA 3SM9A 1SK9A 4AIRA 1HDGO 3KSMA 4NJEA 4WBSA 3BWVA 3BK2A 4CF7A 5JH7A 1C81A 1PT8A 1W6RA 2I6XA 3DLAA 4RFSB 4G4SO 1N2JA 3D59A 1CIVA 5E7MA 1N2GA 4KNVA 1PL6A 2D2FA 1BXRB 1KPHA 1JBKA 3H05A 3NOVA 4L9WA 2X5KO 1HTTA 1VKNA 2Q28A 2DBZA 4AWAA 4C29A 4CF6A 3HDTA 4ZOQI 2GPYA 3KZKA 1GY8A 4ARVA 4H3KB 2ZZKA 1G18A 4R31A 3GUZA 5HQ3B 3ZUPA 4BNWA 4KMRA 3EARA 3IA7A 3E1GA 4N0QA 4OH1A 3WLHA 1AHPA 2H9AA 1X8JA 3TFWA 3EZGA 4QDOA 1ZVVA 1OXSC 1J9EA 1B15A 2D0DA 1RAAA 2QA5A 5G0SA 3WYAA 4ENTA 2Z5LA 4EW3A 5FF9A 4FBGA 1K68A 4KWIA 4DGSA 3KKOA 2Q5OA 4PS0A 1X80A 4O2BF 3IEIA 5FL7A 1QP7A 3I0MA 4Y6OA 2PS1A 6ABPA 1RZUA 3O90A 5BN4A 2VCYA 4PIVA 4WKNA 5T67A 4PS1A 4DDWA 2YYYA 4PPQA 1MXFA 6YASA 3S2UA 1EWYA 4KQEA 4BX8A 1AM4D 3D8TA 3DHEA 1H5QA 3OCCA 4NL4H 2NU9A 4QGBA 4V0NA 2DUUA 2NIPA 5DZSA 4J75A 1RABA 1JIUA 5CDSA 3BUSA 3A6DA 1HEUA 2GBLC 2XF8A 3IP9A 3QENA 4M49A 1TQDA 4X1YB 4ALNA 2O48X 3RVSA 1TA9A 1K6JA 2OZLB 1S6YA 1P7WA 4ZVUA 1ONSA 1PNVA 1A9ZA 5DU2A 4EJFA 1YT5A 3G2OA 3AFHA 3FYTA 1KXZA 2EKZA 5EIWA 3SYLA 4UARA 3UJ7A 4RK4A 4JC4A 2Q29A 2OK8A 3EBPA 1KJIA 1PR2A 3MJVA 4N39A 3OICA 3R76A 4B35A 1O6ZA 1Z6XA 5DM60 1U3GA 1IHUA 3ZDBA 2WFAA 4UULA 1I8TA 1JF8A 1ZMTA 2WAOA 4PZ9A 4DC1A 5B4VA 2DWQA 2WG2A 1XZBA 2G70A 1Y6GA 4KR7A 2EF1A 2OUKA 1A8HA 1W85A 2QV0A 3DVLA 4HSEA 1FUEA 3LX8A 4YJFB 5ALSA 4PQFA 3AXTA 1ZCJA 2DSTA 1SC4A 1DARA 3DVAA 5A7HA 4UUPA 1VCNA 1HDCA 3UH0A 3G1UA 2H85A 4HQ6A 2CFTA 4HAOA 2I34A 4GWGA 2GX6A 5CX4A 3UGKA 2V7UA 3ESXA 4BWVA 1OOEA 2C8VA 2C7VA 4HQ0A 1RQ7A 2VTKA 5F3DA 4QJIA 3FI9A 2FJUA 2RGNC 4RTSA 3B1ZA 3R7BA 3DZIA 4MGZR 2QP9X 2OLJA 4BC1A 4D1YA 2RGYA 1QF7A 3HKCB 4TSFA 3EA5A 4N3AA 3FDJA 4GRDA 4IDNA 5FRDA 5MDHA 3WLRA 4I1VA 1GR1A 2Z43A 1Z6YA 1NPYA 1QE0A 1J49A 3RVDA 1DV1A 4X6XA 2AHRA 3VC7A 1KZGB 3G2PA 1HEIA 4URYR 4J7XA 3N5CA 4YMWA 5IYZF 3ZU5A 5K3EA 1VMDA 1RXIA 4QVKA 5CXSA 3WVNA 4DM3A 3ILXA 1W5TA 3L79A 3M6IA 2MWMA 2ZYHA 3G5TA 1V2HE 1NVFA 4RVUA 3WZ2A 5T6MA 2BFBA 2X40A 2NPIA 3E8SA 4D6YA 3DOOA 4FPXA 3TFQA 3GWZA 1TZCA 3DB2A 2C4UA 4YXWA 3KKEA 1IY2A 1DOHA 2DR0A 1W0KA 3NM4A 5DEOA 5LUAA 2JFVA 3VH3A 1EIZA 4YEDA 1E62A 3REFA 3VR6A 4HH3C 3BWXA 4RKFA 2Z6AA 3E5NA 2M6LA 4JK3A 2XNDD 3KVOA 2WT9A 3LRTA 1AOXA 1RJ9B 5BV7A 1B8OA 2Q7DA 1BRMA 1JDVA 4K03A 1YR7A 3EGVA 4PYIA 2B5VA 1TCAA 4WKBA 1WHTA 4AKTA 3ZCVA 4HATA 3SHTA 4P7GA 3RIYA 2IT1A 1ESEA 3BN3A 5M3BA 2PGDA 5A03A 4M36A 1V7PC 1XYYA 2PZ8A 3DHWC 4INPA 1XFDA 4YUAA 2NTNA 1JMYA 1KSJA 1T2AA 2FSHA 4CM4A 1MB9A 1D2HA 2WD7A 4P33A 3IQZA 1K63A 1OLOA 2JFBA 5AVQA 4PYRA 1ODTC 2Q27A 5JAOA 4II7A 1DG9A 5FPHA 4X3CA 4F97A 2P5UA 2QTHA 3ENKA 4J4TA 1XDDA 4FFDA 1GG2A 1IN5A 1VRWA 4N41A 4K0RA 4RA9B 1GL3A 3LW7A 4G65A 2AA3A 1N2BA 2O1SA 4HDAA 1H3NA 2C42A 5H0IA 5E6RA 4L95C 3RFCA 4LF6B 1Z47A 4HB4A 2ZI5A 4XR4A 3BRWD 3TSOA 3DR5A 4AROA 1Z0AA 4XLLA 4RKYA 4B3XA 3TUJC 3HM2A 3LX5A 2NUAA 5J4VA 1ZOPA 2I9KA 3U7FB 2IH5A 2QI9F 1EWTA 1F8YA 1NNSA 4WASA 2EFHB 1OMOA 3QH4A 4CLDA 4D99A 3J7AC 2JFUA 4IIXA 4XJXA 1R6UA 2OXRA 4J3FA 2YMLA 1Q83A 2CV2A 3PITA 3QA3E 1D7AA 1T34A 5AJXA 4F2WA 4DNXA 1FFHA 1FQKA 2XYVA 5LOVF 1LCIA 5K6AA 2PUAA 1T10A 1ADYA 2P9QA 4EY5A 2CLMB 5LB2A 4CCWA 1Q19A 5CP8A 2PKYX 1X15A 3T94A 5IZ4A 1ODKA 5A3VA 3RRJA 4N3NA 4CR6A 2IV3A 3DTNA 1B3BA 3K9QO 3LKZA 4ZT5A 3QKRA 5DYNA 4J0HA 4ZCLA 4M1MA 1GFSA 1CUJA 3FPGA 3PNLA 2WLSA 5K99A 1X7YB 3ESDA 4OOEA 3I76A 4OHBA 5GZ3A 3WLKX 3DWIA 4WK6A 2O1WA 4I1OA 1DAHA 1M2NA 3QHQA 1XLWA 1BHO1 2K7ZA 2QN6A 3D6UA 3DQZA 7MDHA 1RE0A 2FW8A 1UZNA 2ZPUA 2DUMA 4FT2A 4GPZA 1L3CA 2NSDA 1O1YA 1LLQA 2MSWA 2OYCA 4FOTA 1LLUA 2J3LA 2HI0A 4F6LA 3M33A 3TDMA 1SVIA 4YBRA 1X38A 3RAPR 3VV3A 2FSVA 2ZT5A 5EYPB 3HL0A 3WGZA 4C4RA 1G66A 2X76A 3KJNA 1N7IA 3PXUA 3F96A 4HDRB 4F4IA 5LFAA 4E5VA 1OWNA 2CNKA 2NQTA 1SUIA 1JFRA 4AULA 2IH4A 3UMBA 4PC1A 1LF0A 3DFZA 3H65A 4X6YA 1P6XA 1H2FA 1ZI9A 1CKEA 4KUEA 2MYTA 3JQ8A 3SHOA 3L7JA 1FLDA 1SUBA 5BR7A 4I99A 5C80A 1QWOA 3TL3A 4PY2A 3K15A 4TLMB 2RGAA 4YRAA 3LT4A 5AVWA 3GA0A 4Q7EA 5KYVA 5BWNA 5M34A 1OFGA 1VLQA 2A5GA 2PX4A 2AOUB 3GQVA 2UV8A 3HA2A 3LBIA 1RC1A 3MJRA 3ZQ4A 2ZIGA 1YZQA 4C0BA 3QVJA 1CUYA 1FSGA 3SKXA 1M34E 1ZBDA 2H4XA 1SIUA 2WWGA 4NPAA 1QAQA 1HOTA 2HB6A 1NFRA 2WUEA 4LN1A 5DI3B 3ELUA 3K0FB 4MYHA 3R8CA 5BOSA 2RCNA 3ZWKA 1U5BA 4KRFA 1NULA 1P4HA 1NASA 4LI3X 5FORA 5FLEX 4BV3A 2C9DA 2WE7A 1Y1TA 4J8PA 4C6SA 5B4UA 3BKXA 3GGPA 4DBLE 5DOZA 3I9OA 2NXWA 3NATA 1SGWA 3UMRA 4E21A 4H6PA 3TRFA 3WKAA 1AN0A 4OSPA 4D8UA 1TU4A 5L95A 3GCZA 1QC5B 3AI7A 3QW4B 1G9TA 4GRAA 4NYMQ 4YDQA 4CGZA 1U9ZA 1U3VA 1O95D 1YZFA 3MAAC 3VO2A 1DAPA 3N53A 4N5NA 1L5WA 4PN3A 2AN1A 3PXAA 4GKAA 4IGAA 1PVVA 1R0BA 3R0QA 3BSFA 1DC3A 2A58A 4YLEA 2W6CX 3HBNA 4RO0A 2KX7A 2XXJA 1M1YE 3NYWA 3RC7A 3NM6B 1KEUA 2LCFA 2BFCB 3K0AA 3KOWA 2IOHA 4BVBA 4NOMA 2GPTA 1II8B 1XCMA 1YO6A 4RD0A 4EMTA 1YJ8A 4AS2A 4NULA 4UZFA 4BGEA 3G89A 3BAFA 4E4TA 3BGDA 1XN1A 1DADA 3F6SA 4LC1A 4UUOA 3EZLA 3KKKA 4YBZA 2P35A 3DA8A 3FNEA 2CLDX 1R88A 4NDNE 1OB2A 4JQZA 1JJBA 1NJ8A 1ZUHA 2I7CA 2IDKA 2UVPA 4MA5A 3UPDA 4D9BA 2VQEB 1QPBA 4AMZA 3AESA 1AKRA 1PUJA 3CV3A 4IV5A 5KOJB 4DG9A 1EA5A 4C7MA 2B4TO 2WWHA 4FHDA 3SQMA 1COWD 1ZEJA 2WQZA 5KTRA 3G13A 3DTVD 1KAHA 1UOEA 4MKGA 3A7DA 4NX2A 4YRSA 3FKSD 2D8AA 2JDID 2VDUE 2IIQA 3N28A 2HHLA 1VG8A 5HOEA 2Y1OA 4OM7A 5EPOA 1QG6A 1EWVA 2QRNA 3LQFA 5ITWA 1AKEA 1ORWA 2P1ZA 3CINA 2RJNA 3FDZB 5IBCA 1L4EA 2HCRA 3SY8A 4G2NA 1JVNA 2G1PA 5CJPA 4AY5A 5ALEA 1UP4A 2QX8A 2PPVA 5IP5A 2BMAA 3OZSA 3R0VA 3VR1A 3ETHA 2F4VB 4EY8A 3TDKA 2VYND 4G0PA 4LHSA 2ZAYA 2YMMA 3LS2A 3OD5A 1IAVA 3O9ZA 4FQ8A 5A0FA 1UC9A 3C3MA 2WNIA 4GZLA 4LDQA 4KIWA 4MUJA 3UC5A 4Z51A 4E08A 3QLVA 2PQ6A 2ZGVA 4JSRA 3VSCA 1A9SA 2GZ2A 3FYDA 1Y6ZA 3LC2O 4G5GA 4OQPA 4WA8A 4CCYA 2D0OB 3MELA 3MUFA 4NBSA 4S1NA 4IH4A 1L4NA 1GZ7A 1ZRSA 3CLRD 3KKNA 1NE2A 3ZN2A 4EI9A 4G0VA 4EPRA 2JHFA 1ZH0A 3VXKA 1IE3A 3FXAA 2ADMA 3TSZA 3ND8A 1TYAE 5BSTA 3PT9A 4B85A 2DERA 4MJ3A 3LIIA 5AM5A 2JIRA 2XNDA 1G8HA 3N76A 5TVKA 2D3WA 3M8KA 4TKUB 2QE6A 3U4DA 3IXQA 2YV3A 4HGQA 2R85A 2Y1EA 3DPSA 2PNJA 2W2LD 3I45A 1QRDA 4TTAA 1UKBA 2VDRB 2Q9UA 5CVCA 4BKPA 3H11A 4DLUA 2IK8A 2ZE8A 4PLGA 3PDCA 1WUTA 5FOQA 1I1HA 3CRQA 4CMAA 4P4TA 4FLFA 5JRJA 3AVUA 4R2WA 1L7NA 3DZFA 3MOSA 3PUWA 4OBWA 3D6VA 3WYDA 1BRTA 3GCWA 3BXPA 5E8RA 1M2KA 3ZE2B 5IT4A 3ND9A 5EJMA 2FSGA 4JI4B 4MINA 2VUUA 4RLSA 2XDYA 1F1BA 1F12A 2YH2A 1FMLA 3NASA 2YVKA 3ODPA 5K8JB 4LZWA 2QTMA 3ZI7A 4KGXA 3LSYA 2JFFA 3A3PA 5E9JA 5AUQA 4HCJA 3EODA 3FYUB 4LQCA 5HM8A 5REQA 3PKZA 4QT4A 1NF3A 4ALIA 1ZMBA 2FZVA 3CN9A 3QK7A 4OHMA 5FBZA 2V6MA 2RFLA 3IMGA 4L74A 3VZSA 3BRWA 2YX1A 3LPMA 5L3SB 1TX4B 2XQJA 3MWDB 2P4SA 1MNQA 1B6GA 1VGQA 3KRTA 4EIWA 1Z6ZA 1P5FA 3H9JA 1F5NA 1E6LA 2PYZA 2Q5EA 3KYIB 3N8IA 4JFRA 2ZBPA 5CCBA 4UBKA 3AKZA 4GECA 1OXMA 5IC4A 3I64A 3QKWA 3SYNA 4KXXA 4F2HA 2PS9A 2JD2A 2JA2A 2D1SA 4B3DA 2X4IA 1YB5A 3AFIA 3LUFA 4ZTBA 2Z30A 2C2YA 3F97A 3CB2A 2XKJE 5JMTA 3BC1A 3GCDA 3RUIA 2GWRA 3SF0A 2N9UA 2O3RA 2VNIA 3MTBA 2MTBA 4U8GA 2IPNA 1X13A 2GN1A 3I1IA 5F51A 1MC5A 4CQJA 3A4TA 4N5HX 4IJVA 8GPBA 1Y9ZA 1CETA 1I2DA 1Y1QA 1V1JA 1W1UA 3N6RA 1KZ9A 4GYKA 2O59A 4Q3CA 1QFSA 4CTNA 1TT5A 1OPXA 1ZNXA 2OHVA 3TLCA 1P80A 3B3GA 3MCVA 1Y8RB 3RTCA 4BQIA 4OHFA 4HNSA 1PV1A 2ZRBA 3HEMA 3WQBA 4A23A 4YMGA 3G17A 1NPDA 1JHVA 1OI2A 5A04A 2PDAA 4B6PA 3AR4A 1AKNA 2IHZA 3LX4A 4G0QA 5IAJA 4ZOLF 4CM5A 3VJRA 3M1LA 2PRKA 5F2EA 2X0RA 4ZCMA 2HA7A 3GJ0A 4MIEA 1ZD1A 4JU8A 3H5IA 3FOAA 3T34A 2Z6UA 1L5QA 4L9SA 2Y1XA 4K86A 2JK0A 3U3OA 3CVYA 1U6JA 2RI1A 2R5NA 4DV3B 3RT7A 3BT7A 3OM8A 4ZA2A 4BN0A 9MHTA 4AYXA 3A6ZA 3TB4A 2XUOA 2VQDA 1JYSA 1MVNA 1KAGA 2FW0A 1EX7A 2WJZB 1Z5NA 2CFOA 3OPQA 1H23A 4G0OA 4RNCA 4RQUA 5ER9A 5BNTA 1XMQB 3A9CA 3GA7A 1WU8A 3QFSA 5E0KB 4ZK6A 5EJAA 4V1CB 1V8ZA 2O7RA 3P9IA 2CLCX 4GXTA 1HT1E 2ILVA 1KFKB 1TLLA 1G5RA 2CXQA 4CF3A 4E5YA 3AC0A 3GJ8A 5DGTA 4BATA 1C9YA 3HRIA 1FK8A 1R5OA 4WXHA 3AI2A 4TZKA 3AQ4A 4YP1A 3ECAA 1D2MA 1ULHA 3D54D 4WZAA 3RGGA 1MHTA 4W99A 2FV8A 1VHWA 1HM5A 1XQ6A 5ESWA 3SM3A 4NK4A 3CF6R 5JXGA 1J24A 1PQYA 4RE5A 3UHAA 9LDBA 3JAMA 2YS7A 3OKAA 4ASUD 1R3UA 4BMVA 2QVBA 3AP1A 2XJ4A 1ZG3A 4JOSA 5LP6B 1JTFA 1Z5VA 2GGSA 4PANA 1PI3A 1W0JD 2QVZX 1CHNA 1AK2A 3WIUA 1I6WA 1T2EA 5KINB 3VDXA 3L7CA 1WB9A 2OT3B 3MWGA 1IFXA 3PDWA 1GADO 2JEZA 4JJIA 5J23A 4I4NA 3S2FA 3VDNB 4EUKA 1BCSB 4F06A 1CUIA 3QYAA 4RIFA 5IZCA 4OXIA 4K6HA 2WJGA 1C4KA 1EYZA 1O5IA 2YKGA 2R751 3FTNA 3LY8A 5H4HA 1YS4A 3C4QA 1IY8A 2VDVE 3PR3A 5TS3A 2O8FB 1Q3HA 3M9LA 4Z3OA 4GP7A 1E0SA 4RPIA 2PRIA 1U9JA 1KI1A 1PR3A 4MR7B 1VCHA 1PVDA 3HUTA 3VX3A 4YUYA 821PA 5IJ0B 2A0UA 4W9MC 3CWCA 1IWPB 4OB8A 5FNVA 2HTEA 4U2CA 1CERA 3ZI4A 1UKZA 3KOXA 3LQ1A 3NB0A 4DWWA 1V9LA 3ZIUA 1R6TA 4YPOA 3EDYA 1G55A 3DXZA 3ETJA 4N0DA 3GFGA 2GVDC 3N2ZB 2MR5A 3PUXA 1WEHA 4R8VA 5JZ9A 4L8LA 1LDEA 1RYYA 3DFIA 1A8PA 1C0LA 1JPNA 2AMJA 2QAGB 2WUGA 1COWA 3LA6A 3RJ9A 1YE8A 1IUKA 4AJIA 3DTVA 4O5AA 1DKOA 4QFDA 2HCBA 2C61A 1F0PA 2WHPB 1PJSA 3FKSA 2JDIA 3H83A 4WRRA 4JQOA 3RVPA 2ZIVB 1TC1A 3T9FA 3WBJA 5K8CA 2GNAA 1Z8HA 4ZC8A 3WYBA 5TRTA 1PG5A 4TKVA 4BBPA 4JP1A 2VBCA 1WMEA 4ESVA 1JA9A 1PFUA 4CTOA 3JQFC 1Z3IX 2WQ6A 3L3BA 4I4TB 3U16A 2NAFA 2CLHB 1ISJA 3AUAA 3QZUA 4JSYA 4ZJYA 1UK8A 5TQ2B 1P2SA 2NVBA 2WJJA 1G8KA 2Z1NA 1A72A 1L5FA 1VBFA 1XZEA 2VYNA 3C7TA 3GT4A 2Q62A 2MSDB 3KE8A 4GSKA 3HJFA 2A84A 5C7LO 5GJVC 4EM6A 1JV2B 5EZSA 2H54A 3WXMA 1H93A 3GJRA 1E6EA 3HYLA 3BMOB 3CWQA 3OY2A 4EJSC 2OCKA 1UIRA 1MB0A 4TS1A 3K3PA 4JWTA 3ZE1B 4B2YA 1YA8A 5FOTA 3BZBA 3EXFA 1RAGA 2ZUFA 2H18A 4Y1FA 4TMVA 1I4LD 3SR3A 4F9EA 4G97A 4BMDA 4GPTA 4DCPA 1YF3A 1YVPA 2COEA 3L0ZA 3OJXA 1QH0A 1ZN9A 4LFBB 4PEVA 2XUQA 5CVJA 4F38A 2E5WA 2IU6A 2QHXA 3LGXA 2ZRCA 1LS6A 3BB4A 4PQRA 1ZI8A 5I9BA 1UT8A 4WZBA 2BF7A 2JBAA 1JR3E 1N3IA 4H7DA 2PUDA 2AC7A 1NBHA 1NP6A 3LF1A 3PCRB 3FSRA 2W2LA 1XMVA 3AVYA 5K3CA 3T54A 1L7AA 1PL7A 4IOJA 3K6RA 2BKVA 1S2OA 2ZS8A 2ZVQX 3QHAA 3ZGNA 4EB0A 1EUCA 1UINA 1AQNA 4O2BA 4O08A 3KQOA 1I3NA 4DIUA 2QW0X 4ON9A 1P1JA 1XEAA 2UZ1B 2VQ3A 1ISFA 2VSXA 3LECA 4HQRA 5A5VA 3S55A 4EZEA 1BX1A 3PJRA 5HX7A 1KP3A 8LDHA 3N2NA 4AJJA 4R71A 3OSUA 3MRTA 1NI4A 4U7GA 1EGMB 1NJFA 4GYJA 3HUUA 5CEEA 4I81A 2COUA 3HPRA 4JIMA 2PKQP 3HVRA 5DP2A 5JYDA 1VIYA 1GPLA 3MWJA 1YR6A 4OYLA 5K0GA 2AI2A 3S8YA 1GTL1 3SOZA 3JD0A 4XGQA 3ZGZA 2ID4A 4NCIA 1YQTA 2Y6UA 2HXYA 2V7EA 3QBEA 1NWHA 4HLDA 1P0FA 4XCQA 3SJ7A 4AWXA 4LTNA 5B1SA 4DUZB 1AZWA 5BW5A 3DPUA 2PSJA 1OH7A 1TCVA 2A92A 3RIEA 1L1QA 2XE8A 1XDBA 2AFHA 4BFVA 4E70A 2WZCA 1SU7A 3HADA 1DAKA 2XWJI 3I34X 4G4SP 4OIMA 2PLAA 1F2TA 3LI2A 2BFNA 3D4BA 4FHFA 1JI3A 3TL2A 3TLXA 4F3KA 4B4VA 4EDHA 4JSTA 4NS1A 2J9FA 3IP1A 4MP3A 1N2CE 1FYVA 4RKWA 5FTLA 5K0BA 1H9AA 4AI6A 1E0DA 3IUSA 5IEJA 1STOA 4TYQA 1UBHS 1HQDA 4O4LA 2XSZD 4FR2A 4BV9A 1WBBA 4EVSA 1GARA 3QE9Y 1LF5A 2C31A 2GF9A 2IYSA 4MDEA 1Q3TA 3DULA 2K6GA 3ZE0B 1JNYA 2HA3A 4C43A 2PZGA 4P3OA 2NMVA 3H0CA 2BUAA 2DTXA 2HDWA 1GLVA 4IIFA 4U1RA 1G5TA 2GARA 3AM3A 3KR2A 1V6SA 1ZHFA 3SSOA 3WI7A 3B2EA 1BQ3A 3ZLJA 1F14A 5LM3A 3HP4A 1H2WA 1DC5A 4JNCA 5F76A 4JBWA 2LV8A 5DB4A 3W5IA 1EK5A 5HJ7A 3ZDAA 1K5GA 3P9ZA 1MAWA 1LY1A 2QKYA 2Z1DA 4MUEA 3B1YA 3U7QB 5I5EA 2H48A 3I58A 4P54A 5FA5A 4CKWA 2IYNA 3CZ4A 1DX4A 1Z4QA 4YV0A 5IYZA 1RDFA 5DLPA 3ZXYA 3P1JA 1N33B 1AN9A 2QY9A 4IDQA 1XJQA 1C30A 5FHQA 1XWIA 4MARA 3ZCTA 4M1OA 1MT0A 4LRTB 3EWIA 4RPJA 4CG1A 1IOLA 4E5NA 3DCJA 5L7TA 2ZLBA 1KZHA 1TYZA 1NN0A 3N0RA 1HY3A 1XB2A 2GTPA 3D8NA 3USCS 4DLSA 4ND4A 5KNBH 1JSRA 1RXYA 3A2KA 2GJ4A 3WDLA 3IPCA 1A8UA 1KGSA 3M6LA 4ATNA 1EAYA 5EESA 2OFFA 5F7XA 1Z73A 2BR4A 2QF7A 3CGWA 1KOLA 2GEUA 3LBYA 4RL4A 2IJGX 2CLKB 3AY6A 3DBHB 4UTOA 2GD1O 2KMLA 3HG7A 3EBLA 2NYAA 1TCBA 4Q3KA 3TD6A 3CY6A 5F9HA 3LHFA 3S2ZA 3UH1A 4GSYA 4JT9A 4Q7KA 2FFHA 2G7ZA 3UHFA 2EU8A 1V35A 4CLRB 4HYQA 1ZD4A 3P0HA 1JQKA 4DIKA 1KYZA 4FP9A 4FYYA 4ANFA 2CD7A 2O7SA 5J4YA 2YFKA 4OJQA 2ZPAA 5KHAA 5BSEA 3A37A 1VXOA 3EIOA 3BSWA 1BH6A 4Z6KA 5HIAA 1E6WA 5AP9A 2YXPX 4ZHQB 1QX3A 3KKQA 4H7IA 2BR3A 1KIMA 1P2VA 4KQJA 1BXZA 1EHIA 1W0JA 3E0XA 4X0EA 1HLFA 3NP9A 3NBYC 3TR6A 5CIWA 4EA7A 4BP8A 1U0HC 5HZGA 4F46A 3V9PA 3OH8A 1E3IA 4N18A 2V7GA 1SKUA 2X6RA 4MUHA 4CL3A 2DPMA 1PZHA 4DWOA 5IMSA 5IX8A 2XITA 4QVIA 2R86A 4CFSA 4W5NA 4OXQA 3K8QA 4JVOA 1T2UA 4CCSA 3V7YA 3TGPA 2ERXA 4HLNA 4JLWA 4U0JA 5T4HA 4OGFA 2AWOA 4JP3A 3G2NA 1OYWA 5G2OA 2HY7A 3RROA 2EQBA 5DHFA 1L4YA 4PX5A 1Z5PA 2JAPA 3W5JA 4L9AA 3HB5X 1L4FA 3MT0A 4HEHA 5AJUA 4DJAA 1ID1A 2WU1A 2VUIB 3MYYA 4NE7A 1B41A 1FW8A 1HETA 2WA1A 1MABB 4KLAA 1L1FA 3KKPA 2VA8A 4RORA 3ZC3A 1ISHA 1MA3A 2BEUA 1QAMA 3P9PA 3RS2A 5JHHB 2J5RA 3W06A 4DAEA 4YJ3B 1FU8A 1I6KA 3VZCA 1M66A 4P7JA 4UM5A 1T2CA 1XZ8A 2PT6A 5GM2A 5JD3A 3C3EA 3PIDA 3PE4A 5T8KC 3EAGA 2HQRA 1YZNA 3D7RA 4TMFA 1USGA 3Q7TA 4LBVA 4U00A 3TR0A 4INOA 4URZR 3MWFA 1RHJA 2E49A 3ORRA 2F43B 2VHYA 1ATIA 1EHYA 5HK8A 3O1JC 3L6DA 4ZVLA 4DM7A 3OECA 1YU6A 1VHJA 2ZQZA 2YWJA 3PWSA 1XZCA 1WUHS 4OH7A 5COAA 2XE7A 3ANYB 5CW2A 5ALHA 4I8DA 2ACKA 1A5TA 3ROPA 4EB3A 4CQMB 3Q8KA 4X00A 1Z0ZA 5C8VA 2YW2A 1PWXA 3JR3A 4KMMA 4K3VA 2J6IA 3TQSA 1TE2A 2X7HA 3C3KA 5EWLB 3RC1A 3FOCA 3BIWA 2FK7A 2IITA 3F5QA 4MB2A 3VNRA 1FVHA 1GGFA 4MI9A 1ZJ5A 1XRSB 3TRHA 5GAJA 3ZCXA 4HQKA 3JRNA 5IWCA 5E0OA 1G9SA 1BS2A 1YR9A 1SXHA 3IPAA 2CC2A 2DECA 1QE3A 2P8JA 3KT6A 3QVMA 4G9EA 2NSLA 4WY2A 4XLZA 2QAJA 4G5XA 2R0QC 1Z9BA 2CEAA 4V0OA 3GQBB 4E13A 4S1TA 4Q4LA 3REQA 5G41A 4QGFA 1AV6A 2VHVA 3W3ZB 1X7XA 4IIBA 1I2CA 1EQAA 1NG9A 3LC7O 2B2XA 3RU3A 5FUQA 5HGXA 1JU3A 4YCBA 3FUXA 1BGXT 5DFAA 2OO7A 2X4DA 4NCAA 4DMKA 3CXUA 1N3BA 4I4TF 3F9RA 5A6SA 4WCFA 1CLEA 1IY0A 3PQ2A 2AG8A 2AXNA 2B37A 3USES 1O4VA 4BECA 1N5MA 4ITRC 4RTLA 3SQNA 2GAOA 1FPQA 2J33A 3M34A 1BMTA 4KIGA 2F00A 3WB2A 3WS7A 5BNIA 2QENA 4U7HA 5DH9A 4CIXA 3N07A 5EEGA 1NXWA 2EP7A 5CDFA 3SLKA 5LDHA 2ZXUA 1JXOA 1CZHA 2FYTA 3ZXUB 1QMPA 4JL8A 4G1VA 1QDEA 2CXOA 1E2NA 1GDHA 4HXGA 3GG9A 3QU9A 1YR3A 1T1IA 3P5SA 1L7RA 4LRUA 3KFXA 2C5LA 3ZHCA 2IZ6A 3CNQS 4MZXA 3SI7A 1XTBA 1CVLA 2ZVDA 4LNAA 5LLTA 4ES6A 5KPDA 2Q8NA 4AC9A 5B7QA 2O20A 1XTTA 2FSSA 4QJ5A 5JS2A 3JARB 2X5XA 2Y71A 4FFBA 3RASA 2ZBQA 3E53A 521PA 1PJQA 1SHKA 2CY0A 3B53X 3IV6A 3MLBA 3C6ZA 2XVYA 4GWLA 1PR0A 3M3HA 4IIJB 3VSBA 1Z0DA 4BRZA 1SCAA 2V6IA 4OJYA 5ALXA 5IEBA 3ENNA 3Q0IA 1J2YA 4PAWA 3T38A 4MV9A 1KO5A 3OEED 4TVBA 1R1DA 4DFDA 4JYAB 5LXTB 5IXSA 4EUSA 1XV5A 1QTQA 2XBMA 4UU8A 2AUMA 1VG0B 4G8CA 4IV8A 3EQ8A 4UBNA 1XU7A 3HZOA 5MN4A 4M9ZA 1T3TA 3SKYA 4AFNA 5C31A 1PRYA 4F91B 1IM2A 2R4UA 3G2IA 4TMZA 3TNLA 3OWHA 3CX7A 5BPFA 2QMOA 2JI9A 3MBKA 3ZGVA 2R9VA 3HXPA 5JEEA 1SZPA 1D8TA 3RREA 2GZSA 3LQYA 1FNNA 1ULUA 2X9VA 1RI5A 1QKJA 4NEHB 1MGOA 1U9YA 2X1VA 4MWOA 2XOEA 3ZLTA 2A7QA 5ARBA 4LQ4A 3OCVA 2V58A 4TVSA 1UH5A 4NMLA 3OZAA 2IGBA 2CNLA 4ZVRA 1M8FA 2EVWX 3ORYA 2XSZA 2PTGA 4WXMA 4RTNA 2OZLA 2EJBA 3TRDA 1KYIA 2B0JA 4UBOA 4AMYA 2PANA 4BN5A 2BSAA 2OBMA 2Y66A 5CG1A 5IVPA 4KVAA 5HQJA 1R8JA 2H29A 3TEFA 4LZNA 4MS4A 2XXAB 2FSFA 3IIKA 1UBCA 4PC2A 2O8CB 2DHQA 3STYA 2JZCA 3E3LA 3SZ3A 4B5LA 3KHUA 1ECBA 4KHPB 4H1WA 4LE2A 4WEQA 1WEKA 1EI9A 3A4VA 4D9JA 2Q46A 5I4BA 2FDXA 1U7HA 3KJEA 3VPCA 3EOAI 3ZTTA 4C1NA 3EXIA 3KJZA 4O0LA 4LCEA 1NVTA 1FFXA 1OZGA 3L82B 4X95A 4LSGA 1DAIA 3ZNOA 4UDOA 5LQRA 4F5ZA 2XB8A 1N5LA 4K5QA 1Y6FA 4U7DA 3PNQA 2OR3A 1WW2A 3L7NA 1ZH6A 4MZDA 4JN6B 5YASA 3LCJA 3WLQA 1B6RA 1OI3A 1YR8A 1G8PA 2IEYA 1ZITA 5HFAA 3GEHA 1U7XA 3PXDA 5CX1B 3V7WA 3A9VA 4OFZA 3DAHA 1NVVR 4N6OA 1DKLA 1H6CA 1Z56C 1KC1A 1C3VA 1Y42X 3M6VA 4JX8A 5IAEA 4AMGA 5A9SA 1XR3A 3SSMA 5FLYA 1OYYA 2WWRA 2K87A 1IIBA 2A14A 2QUKA 3ADPA 3HKCA 4LVNA 4D0RA 3I9LA 3FLEA 5TEWA 2RBGA 2O8NA 3IIEA 4E14A 3DEYX 3OCJA 3QF4B 2PXCA 2QYTA 1CY6A 3OZIA 1SBCA 1U2RA 3E27A 4LV8B 3L07A 1K7CA 1IY1A 2YN0A 3AU9A 3ANTA 5DLQC 2R66A 2IWHA 3ZTWA 3U19A 3V1MA 4UUQA 2JAXA 2R1ZA 2ZYWX 4XGRA 1MUUA 3RNLA 3PDIA 5A9TA 3U62A 2FOLA 4D26A 4ZZ3A 4RHCA 3HJRA 4R2IA 1K4KA 1K6MA 5E6SA 2WV9A 4QUJA 4Y2UA 1OY1A 5JARA 1GGHA 3R7NA 5KI6A 1P7YA 1AXGA 1T0UA 4NCJA 3KLPX 5G1OA 4B7CA 3OWOA 1U2TA 1W88B 3HU3A 3AVOA 2YBEA 3ORQA 1M0SA 1NW7A 3QG5A 2NG1A 5HFJA 4UAUA 4F4JA 1U8AA 2GZ3A 4G63A 2BT4A 2VXBA 2ZJFA 4J0FA 3FLBA 3N6XA 4QQFA 5AVVA 1TEXA 1O7JA 5I4CA 4ER6A 4UREA 3NV7A 1YFKA 4C07A 3WG9A 1NV8A 2GERA 3FF4A 4HF7A 1CEQA 4LUCA 1PSDA 3BBPA 3P0IA 1H2YA 3GP5A 1YQDA 1Q1BA 3OF5A 4COOA 2D1QA 2WPDA 3OU6A 1R4NB 1TCCA 2A1UB 2P9JA 3ONNA 1DFHA 1P9NA 4GBMA 3TLGA 1OWOA 2JEYA 1UCFA 2DFVA 3LE8A 4X90A 4BGVA 5HM6A 2Y1CA 5B36A 5DM4A 3I73A 3COJA 4OXYA 1MENA 4I3HA 1L5MA 2UVQA 3TI9A 1C3OA 4RHUA 1GQYA 1KMQA 2FY8A 3F74A 3RK4A 4MHTA 4WVFA 2FOXA 1I80A 3GFRA 4DCCA 3ABSB 1L9KA 4IJKA 2HDOA 2JJYA 2CLOB 4MGYR 4O02B 2YZ7A 4ETNA 4WFQA 4XPIB 2XWBF 1UKAA 2ZB7A 4WNAA 3KC2A 5AW8A 3FKQA 4WOPA 1SM4A 4R6WA 3NC0C 4PRLA 2EJWA 3UANA 3UICA 3UZUA 5KQPA 1U63A 2B6NA 2Q3MA 4F92B 2ALJA 5CK4A 1YI8A 1CEYA 1KZ1A 2V7TA 3IEXA 1RJEA 5JJIA 2D1TA 1LJ8A 5EUBA 2DYKA 5TARA 3CLKA 2Y1GA 2IZOA 2F9MA 2OCXA 2ZUWA 3W5SA 4ICIA 3T12A 4UZSA 1G41A 3SE7A 5IJXA 3SS8A 2XZTA 2OESA 4PPGA 1M34B 4HNAB 5AW2A 4TYNA 2WIKA 1YJXA 4QWMA 1FDTA 4RWEA 1OA1A 4Q4HB 3V34A 1LJLA 1Q16A 4ROTA 2X8AA 3IT1A 3PC6A 3G23A 5C2JB 3QP9A 1BW9B 3C14C 2ILTA 2XGGA 5KYXA 1DB3A 4G09A 4JIGA 4NZPA 4YJ3F 2AJBA 4ZOLA 4B2LA 1X0VA 4FR0A 1ETHA 5FBVB 3CVUA 3DBLB 4FYXA 4GWKA 4UMVA 1KRHA 4I55B 1I1OA 3X0DA 2Q4BA 3W4IA 4J9VA 1XA0A 1QFZA 2JJ1A 3SXJA 1Y5LA 5LJLA 1AJEA 4QDXA 3NW9A 3GUCA 1P4AA 2ORIA 2X2OA 3DZKA 4OA5A 5EINA 1PVOA 1QBKC 2XHEA 3AR7A 2B2NA 4I9HA 4LV5B 4B4KA 2MYUA 3ZWPA 4E15A 5IH3A 4B0PA 1RZVA 3GHYA 3HNPA 3FPSA 2CCKA 1VLHA 4JT4A 1KVQA 1M1YB 3B52X 2VATA 2W4IA 2PQMA 2Q4DA 2VDNB 3WGYA 3GEMA 2E21A 5E4TA 1S2MA 1FNDA 2P0YA 1KVTA 5J1TB 1Z4IA 2IS6A 2B1RA 1NP3A 2V7VA 1ZH4A 2OENG 1MB2A 1N1EA 5DYGA 2HIGA 2YNMA 1A9XB 3B1JA 2IWRA 4GMXA 1DOZA 5IK2D 4C4PA 3JYHA 2WYVA 2P30A 2XOXA 1UBOS 1M2OB 2R1UA 3BJRA 4RPGA 1SKMA 3V5NA 4JQCA 5EYPA 3ZHRA 1U1IA 5IKXA 3TL6A 3BTVA 4MIOA 4KK4A 4K26A 3NHBA 1W36B 4G41A 5PNTA 3MJDA 1FE8A 4CMCA 4L4XA 3ZOKA 1MQ9A 2P6NA 5CRIA 3ROMA 2HADA 1LGYA 1XNHA 1U7ZA 4UFOA 3RBZA 4JGBA 2HFKA 2DKNA 1WSDA 1USUA 2G08A 2R4TA 1EUDB 3D7KA 3RTDA 1TTTA 1SXPA 4FZRA 2CFSA 4RTMA 1DP4A 4ZCRA 4MW5A 1WX1A 4IM7A 4OFBA 3UO8B 2JGDA 1CE8A 1WZCA 4XDYA 4QREA 2P67A 1LQUA 2AC4A 3ETEA 3QOWA 4N82A 2CK3A 3OEEA 1F6WA 3QTLA 3BRCA 4G1FA 4QUAA 2JIMA 4XEHA 3VPFA 2A0FA 3KUUA 1BYUA 2QM7A 2DUWA 4FBLA 3RIMA 2EZ4A 3WQHA 4I08A 3H1FA 1G17A 3KVYA 4M21A 5DI3A 3K0FA 2VWPA 3GWGA 3C39A 3KLNA 2CXPA 1WB6A 4TV9F 4V24A 2PLRA 4CIBA 4LYGA 5MN5A 4BNXA 3WWOA 1ZUWA 4ZC1A 4LF5B 1K06A 2FN3A 1U9CA 4OREX 4NXNB 5K3AA 4CN8A 4MYUA 4MS3B 5AM2A 1G19A 4MLCA 1XTQA 4OQLA 3PHBE 4P7BA 2EIHA 5C1PA 1NOKA 1VTKA 2P41A 3RCBA 3NIWA 1KTIA 1IJKA 1DWUA 3PWTA 1RJDA 3E4DA 3HABA 2GCIA 3EC7A 3I04A 4P86A 2IZZA 5T64A 3VKUA 1GPUA 1QC5A 5JR3A 2E48A 4KDRA 3M83A 2C2WA 2HCJB 2XYGA 3GOHA 4LYHA 1LBIA 4KSCA 1E3MA 1F4VA 5LXTF 3NHSA 2C5HA 3MBIA 1J5PA 1IQ0A 1YDMA 3KJFA 5L3ZA 3WFJA 3DT6A 3DLHA 1WA5A 3PFBA 4ZDWA 5M5BA 5IAAA 2VK1A 4MVYA 2HSZA 3I28A 1K7SN 4GLLA 3W1WA 4W63A 3ZY3A 2OB1A 1OVMA 3K92A 3V2HA 3ROFA 2QTBA 3AUTA 3JU3A 4CNQA 1II8A 3H1TA 2C96A 3I9KA 3NC4A 2JLXA 2I0FA 4OYHA 3Q5GA 4D3FA 1D9ZA 1SVMA 3H9EO 1W52X 4HTFA 1YCFA 5DXAA 2GAAA 2WIAA 1OZFA 3K16A 3Q2IA 1X7GA 2L0XA 4DLBA 3AB3A 4M4SA 1Z75A 3H9QA 3VJMA 2NADA 4YUVA 3OZ7A 4FE7A 4K6MA 1LQTA 1PFKA 2EIXA 3EZFA 1DHTA 2BZGA 2WU8A 4A36A 2PZBA 5EIBC 2Z6VA 5CJJA 1YZUA 4BB5A 1Y4ZA 3V32A 3FCYA 3RHFA 1RW4A 2BPOA 2C4WA 2ONJA 4D8TA 4G9GA 5DTJA 1EXMA 1S3FA 3OHMA 2YOFA 4GI3A 1ZK3A 1Q14A 4G4IA 3M89A 3WOVA 1SBHA 5KYGA 1T91A 1O8CA 1H6DA 4MGKR 3OQ6A 1RWXA 2GYWA 3TO5A 3F9IA 4I5DA 4X9XA 1IHDA 3GBVA 1DRVA 4LJLA 1AV7A 4D46A 3QX9A 5KHOC 5D85A 1YZVA 1KDPA 2WABA 3EFOB 1AB5A 2PD3A 3C16C 3RSQA 2IEDA 5TQ0B 1WG8A 2A0KA 3JQPA 4C4AA 4B32A 2D2VA 2J31A 3TN7A 1F8XA 2J0EA 4BFUA 2P9HA 1X6VA 3JD4A 5K4GA 2IBMA 4TLLB 5KQGA 3NEYA 4H60A 1NXTA 1HORA 1H0HA 2JHCA 2FQQA 2I71A 3P71T 2HFJA 2CJWB 3FPLA 4N4AA 1DBQA 1KPGA 5LB4A 1PT5A 3FFTA 4CMIA 1Y3DE 2JGIA 4DJJA 1A9RA 2B8WA 3NBAA 5AFSA 5LJIA 5JCJD 1E3LA 3EIEA 1P72A 3EPHA 1H66A 1RQGA 4R1NA 2G0NA 3KZOA 3TSCA 4EFMA 1QRSA 1V1RB 3K72B 3UV6A 2JKZA 1KERA 3LW8A 4U4AA 3CONA 3SVZA 1DLIA 4J7CA 1XAJA 2P4UA 4MWBA 4H1TA 2C3PA 4TKUA 3KJXA 2NPFA 2I6SA 3RJTA 3RVNA 2QYOA 1T9AA 3JD1A 3GLHE 1XDZA 4NTZA 3KZXA 4NMWA 4H17A 5FBLB 1O0CA 5IT0A 3AV3A 2WJVA 1NVEA 4OHWA 1RAFA 2FWNA 4R0NA 5JV5A 2QM0A 1I30A 4G5SA 4KIJA 1ORIA 5D84A 1BFUA 1NQWA 2DPXA 1LV8A 3WGQA 4E88A 1U2DA 3AY3A 1FFYA 4C08A 2BFFB 4MW6A 3AK4A 4HGNA 1JDSA 4ACAA 4QGGA 1GZDA 1LC0A 4AK9A 1ZC4A 2V97A 2PBZA 1MQAA 4MO2A 2X3UA 1BMQA 3JZDA 1PTJA 3CM0A 2LNDA 3AR5A 4JXKA 4MB6A 3GFPA 4GD3Q 4R1UA 4GFDA 5D7BA 1XRLA 2GBIA 3IO3A 1ND6A 3RD5A 3VAYA 2VPYA 5JW6A 1QIJA 4IDDA 2GUWA 2GPNA 4WWHA 2QVGA 3S7TA 1IIRA 5EXXA 5A71A 2YZGA 2EATA 1AUQA 4ETIA 4GBGA 2R8OA 2V74B 2QR5A 5L3SA 1KI8A 3NOQA 4YMSA 4HNUA