1MORA

Isomerase domain of glucosamine 6-phosphate synthase complexed with glucose 6-phosphate
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
366
structure length
366
Chain Sequence
b'GDKGIYRHYMQKEIYEQPNAIKNTLTGRISHGQVDLSELGPNADELLSKVEHIQILACGTSYNSGMVSRYWFESLAGIPCDVEIASEFRYRKSAVRRNSLMITLSQSGETADTLAGLRLSKELGYLGSLAICNVPGSSLVRESDLALMTNAGTEIGVASTKAFTTQLTVLLMLVAKLSRLKGLDASIEHDIVHGLQALPSRIEQMLSQDKRIEALAEDFSDKHHALFLGRGDQYPIALEGALKLKEISYIHAEAYAAGELKHGPLALIDADMPVIVVAPNNELLEKLKSNIEEVRARGGQLYVFADQDAGFVSSDNMHIIEMPHVEEVIAPIFYTVPLQLLAYHVALIKGTDVDQPRNLAKSVTVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSAMINE 6-PHOSPHATE SYNTHASE
molecule tags Glutamine amidotransferase
source organism Escherichia coli
publication title The mechanism of sugar phosphate isomerization by glucosamine 6-phosphate synthase.
pubmed rcsb
total genus 140
structure length 366
sequence length 366
ec nomenclature ec 2.6.1.16: Glutamine--fructose-6-phosphate transaminase (isomerizing).
pdb deposition date 1997-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01380 SIS SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1morA01
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1morA02
4JV5B 4B3MB 3FXAA 4U6NA 1NRIA 5BY2A 1U0EA 2PUWA 1IBMB 2UXBB 2V4MA 4JI2B 1X94A 3ETNA 3Q7IA 3FJ1A 2I22A 2VQFB 1IRIA 2I2WA 4JI4B 4DV4B 5IWAB 4B3RB 1JEOA 3JAMA 2E5LB 4LF8B 1X9IA 2UU9B 4JI8B 5A2QA 1TK9A 1U0FA 3CVJA 2CB0A 4S12A 4DV2B 2VQEB 4DUZB 3PR3A 2CXPA 4IVNA 5BR8B 1DQRA 2CXOA 5LMNB 2O2DA 4DR5B 3HJBA 1TZBA 4LFAB 1HM5A 2ZJ4A 3EUAA 1WIWA 4JI7B 1N36B 2HHHB 2CXTA 4OX9B 2DECA 4JI3B 1NUHA 3C3JA 3IFSA 3KNZA 4M0DA 4TOIA 1FJGB 1Q50A 2UUAB 4JI0B 2CVPA 2CXQA 1MOSA 2YVAA 4AMVA 1C7QA 4DR2B 1X9HA 3TBFA 5LL6P 1HOXA 4YY3B 1IBLB 1GZVA 1JLHA 3NBUA 1GZDA 1I94B 1X92A 1U0GA 1IBKB 1N34B 1N32B 4S1WA 3Q88A 1M3SA 2PGIA 1HR0B 2UXDB 3J81A 4DV3B 3OTOB 4K0KB 1KOJA 2XHZA 3SHOA 4DR7B 1JIQA 4LF9B 1C7RA 4JI1B 1VI6A 3M5PA 2PUTA 3FKJA 4LFBB 1MOQA 2XBLA 5I01A 1HNZB 3LJKA 4X66B 2DF8A 2O2CA 3ODPA 1HNXB 1VIVA 3OOJA 2VF5X 1ZZGA 2AMLA 3TRJA 2ZJ3A 1J5EB 1HNWB 4KHPB 3G68A 1VI5A 5FLXA 1TZCA 4LF6B 4GKKB 5IT9A 2CXRA 4DR4B 4EM6A 1G98A 4X62B 2UUBB 3J7AC 1B0ZA 4DR6B 4X65B 4B3TB 2X3YA 4DV7B 1IATA 3JX9A 2ZM6B 4DR1B 4GKJB 1XNQB 1XNRB 4LZJA 3HBAA 3BJZA 4DV6B 2CXUA 2J6HA 1T10A 4NXMB 2UXCB 1XMOB 3QKIA 3T1HB 2PUVA 2F4VB 1MORA 4YHHB 3I0ZA 2A3NA 4X64B 4DUYB 2VF4X 2CXNA 4NXNB 1XMQB 3FF1A 4DR3B 4AQYB 3J80A 3T1YB 4JI5B 2Q8NA 2E5FA 4LF4B 3UJHA 4JYAB 4LF5B 2WU8A 4LF7B 3BCHA 2CXSA 4JI6B 4DV0B 4DV1B 4DV5B 1J5XA 1VIMA 1XTBA 4B3SB 4LFCB 1N33B 2UUCB 1JXAA 5LMUB 1N8TA 2POCA
chains in the Genus database with same CATH superfamily
2RAVA 2QRPA 4K28A 5I7OA 3DG9A 1ZSNA 3EGXB 3LZDA 4REQA 2ZITA 3T9CA 4D79A 4DQ0A 2FPWA 1CF4A 2QVBA 4ER6A 1G0OA 2V5VA 3MWKA 4BKOA 2H8GA 5F7OA 3BIWA 5FI5A 2XUAA 2YOHA 2FPRA 3KWJA 1IK4A 1G8MA 1PS9A 3F4BA 4XQEA 4XWTA 1JXQA 3VPCA 3WZLA 3U7FB 3KKPA 1R88A 5IFKA 4AL4A 1GFWA 4E22A 1W25A 1Z7BA 1PWZA 4XCQA 5J59A 2KQUA 3T35A 5JQGB 5KOHA 2P9HA 3CO5A 3Q6IA 5GAJA 4AZ3A 2XAAA 4PR3A 4BVGA 3TLYA 1QLWA 1NLUA 5C32A 5DI3A 5M7EA 1WXWA 4HDMB 4UOQA 1QQBA 4PX9A 4KVAA 1CIJA 3N2KA 1BXKA 3D3KA 3PWTA 5GM1A 1PJSA 1NQUA 1T8PA 2F8LA 1R7RA 4PTLA 4AXXA 4BFWA 5CW2A 5MGBA 2BFOA 3LCVB 5TGZA 2ODAA 2XTAA 3EFBA 4CM8A 5FUBA 3K0CA 2DG2A 1JN0A 3A3KA 4X1IB 3JQBC 4XIYA 4AX4A 3B9QA 1EX7A 4D9MA 5JCJD 5KSZA 1I7DA 1CPYA 2G5TA 2O8DA 2Z57A 3HYSA 1D8TA 1WMEA 1J39A 2BMWA 3PUIA 4BLTA 1HYGA 3NHZA 3N0WA 2TMDA 1TW3A 2V5AA 5AI5A 3FKJA 3IX7A 2WYWA 4H3SA 4NNJA 4AYXA 5KCZA 4J0QA 3EVTA 4JENA 1YQEA 5A05A 4OQ4A 1WJGA 3T0IA 3WIDA 3ZHYA 2YC4C 4UDOA 4KU4A 1QDLB 3CWQA 3TM5A 3HTXA 3C74A 4CDGA 2FWMX 4N0PA 1YNOA 1OB2A 3DE0X 3DZHA 1R0BA 1A7JA 2RK3A 5AW3A 1XCOA 4L8GA 1H0RA 3H4IA 3QVGA 2I29A 1YCDA 1QIGA 3D8BA 3KAJA 4KDEA 3RI3A 2A8YA 3SF0A 3PDIA 1GYQA 1QCCA 1Y9AA 3EDMA 3OWHA 4C7JA 1C8LA 1Z88A 1GPMA 3M6WA 2BHRA 4K8RB 1M1UA 2NVUA 2I2XB 3LT4A 1H4TA 4QPCA 3TUZC 1GNQA 2RGYA 1RRMA 3GK3A 5A3RA 2FK8A 3E7WA 4DF3A 3ROGA 2DFKB 3EH1A 3IPAA 2BJWA 3FTCA 3N5KA 4MAMA 1U0NA 3EISA 4MUMA 3X1DA 1U5BB 2GEFA 5A7GA 4EHNA 4BNWA 4EW6A 1GPBA 3OJLA 3ZWKA 2PJUA 5HW0A 2Q5JA 5SV2A 3I52A 1PG2A 5THKA 3KQLA 5L3SA 3NUQA 2VBIA 4DUYB 3OY2A 4DQUA 3O91A 2JI9A 4L3WA 4IZHA 1TYDE 1RBZA 1KIAA 1Q1QA 3SYLA 3L4SO 2HA7A 4POAA 1E9AA 2DT5A 2O0KA 1VSQA 4V0RA 4Y6RA 1SQGA 1D09A 3PXXA 1DAHA 2Y1EA 4XSGA 3W3ZB 1Y4UA 2KI5A 3BAZA 3GV0A 1RAEA 4S1OA 5BP7A 2RBEA 1MPTA 1NMSA 3QMVA 3C3XA 5JNLA 1P81A 1YR8A 3FGNA 3L5KA 3PU6A 3TD2A 4LDQA 5BSKA 1HEIA 1HSOA 1UDWA 4KP7A 4ZT6A 4XSVA 5L4LA 1KSFX 2FUEA 3H3XA 4KSBA 3D5EA 4EG6A 2XTJA 5JISA 5LYYA 4TZ6A 4JVSB 1NNUA 3IALA 4PC7A 4RHCA 3S2YA 3T9BA 3ENQA 4A1OA 1OI3A 5ESXA 3U3RA 2W6IA 4EHFA 3L4BC 2NZJA 3DBRA 1VJGA 3BE6A 1KORA 3CNOA 4WY5A 4PYLA 4YHBA 2OCIA 2C9MA 4YO7A 1MHTA 2FPPB 1LLDA 5EXEA 5H83A 2P0AA 4C78A 4Y2TA 4E4TA 4DV2B 1UXHA 2P69A 2EERA 5IVKA 3AR7A 4CEHA 2CXOA 1US8B 4GDMA 1QUEA 4TYMA 4OU5A 2QSUA 1IZ7A 3UHJA 2VHZA 2DFDA 1FLAA 1X1EA 3MAJA 4MWBA 2VXCA 4KUEA 1L4KA 4WCDA 3IR6A 4AW9A 3KVRA 5FTKA 2DWUA 3HDHA 1ZN2A 2GNOA 2QNIA 1XZLA 4WXPA 3L8CA 4A8TA 1RFGE 1V37A 3JWGA 3OE7A 3AHJA 2ODTX 2C9BA 1CY6A 4J7UA 2HLHA 4AF7A 2KJQA 4B81A 4C43A 3U6KA 3IJPA 4WOJA 4BLSA 4B4KA 4Z4EA 4PGAA 2AEFA 2O1WA 5EI5A 2CNDA 6CHYA 1Y1LA 2PZLA 4HB4A 4BV3A 4YAJA 1I1QB 4HJXA 4DTCA 1V45E 1PG5A 1YB6A 3DT8A 3BRSA 5LXTA 1PJZA 2FEKA 2WM3A 3MLEA 3SXUB 5I7EA 3DM5A 3D7SA 1GGKA 3CKKA 3O6VA 3UJ7A 5KQGA 3HG7A 4FYJA 2PMBA 1AS2A 1E96A 4U5XA 4K9OA 3P1JA 3VSBA 1Z37A 4HH1A 4KFUA 3EGWA 1L7NA 4TXLA 2OSVA 1SK8A 3B3FA 4ZI3A 2JLXA 4AY4A 5IHPA 3OZEA 5IN5A 2HJWA 2OVFA 4QNRA 1IIBA 4AJKA 2ZDHA 2ZJOA 4IWNA 2XR1A 2QUIA 2W83A 3QW4B 4MMZB 2O0HA 5MFZA 4RK1A 3OCVA 4E2YA 1XEWY 2NNWB 3JSXA 4KXWA 4RTJA 3THWA 1JXOA 1RQPA 1KI1A 2VJMB 3LY9A 5U4XA 3B2NA 5GZ1A 5JR3A 2QRJA 1KWGA 4JLNA 3LSYA 4J0JA 4PYIA 2FSUA 3WLFA 1LJLA 3GEIA 4JUBA 4NLLA 4WMLA 3NKFA 2EIXA 4A8JB 3AIOA 1KMQA 4MNTA 4L85A 3ZTWA 3HBAA 1U99A 2GVNA 2XQGA 3EIUA 3MS2A 4X8LA 1EDZA 2O5CA 3GWZA 2NAFA 3TSCA 3UFXA 4NMHA 3TIIA 4CTMA 2HL6A 1MCZA 3D4NA 5FBWB 3T5DA 4XEHA 2Z6AA 1YDFA 2REXB 3FOEC 1MABB 2FZCA 3PK0A 1KZ9A 4OHCA 4ZO6A 2XT6A 3HWX1 3L1UA 5H82A 4BV8A 4AWAA 1JT2A 1FUIA 3PLRA 3EPKA 2NTYC 1O9HA 1T8SA 1BYUA 2G0AA 4D6XA 4CI0B 3IMEA 3W7AA 3IE1A 3U40A 4CMBA 2C9YA 2J3QA 2ZT5A 3LUCA 4UE6A 5E95A 2WSLA 3UJHA 1UJBA 1AZWA 3VUEA 1XYGA 3TNJA 3J7TA 2DB3A 4UJ5A 1DBWA 4IDOA 2JFBA 4L9AA 4C76A 4XJXA 3HXPA 3LKZA 1K7FB 4JOQA 3ZW7A 5C35A 1DBPA 2QN9A 4ZGWA 2XNDD 3P2MA 3DPIA 4O4HB 3OESA 1IWOA 1F48A 4MCIA 4CV0A 2PUWA 1P5FA 1A96A 2VBGA 3KB6A 2BHTA 1D5CA 5ADUS 4EFDA 3PEFA 3SF8A 2C3MA 4KCGA 1R74A 3H7IA 5D3QA 1PD1A 1QB8A 3PE6A 2GTHA 1TNDA 2NYAA 3JPWA 3P2JA 4NZZA 1YTUA 1IQRA 5DISB 4ZTBA 1GQYA 1RMQA 2W2XA 3GN2A 3QFFA 4RLFA 1NGSA 3F73A 3I9JA 1IQ0A 4E1AA 5JQGF 4ZK2A 1AKEA 1HM5A 4DSAA 1RPNA 3MN1A 4BQRA 1WIWA 2OGWA 4ND1A 5D5QA 4BU0A 4MROA 1P4SA 3ZYZA 2OESA 1SBIA 3GGOA 4JL5A 3CS3A 2FUCA 3LE8A 4OLFA 4WHMA 3K71B 4KR6A 5EINA 5ERGB 2Y2UA 1N0HA 1LNQA 4FZ3A 3QPDA 4MV8A 4AMVA 1CR0A 1T4BA 4RSMA 1SAYA 5C34B 4Z1MA 4ZCMA 1OV6A 1QVRA 3HB7A 1LPNA 4DNQA 1QBGA 1A9QA 1R5OA 3ZDRA 2XYHA 4EUKA 5IMBA 1UT8A 4LOAA 4ED9A 1CW2B 4HRYA 5FUWA 4F93B 1I01A 3PGKA 1EK0A 3R8FA 3IQEA 4MR7A 5CA1A 4NESA 5BSRA 5AUOB 5BO5A 2ORYA 2Q9UA 3Q7SA 5TLSA 2H1VA 2I1WA 3GUVA 1NLMA 1PK7A 1ZG3A 2D1RA 3H18A 1D2MA 3KLNA 3M5CA 4M89A 2JFWA 4QUGA 3EQ9A 5F2OA 3IV7A 3ZHRA 1UIRA 2QRGA 3KJFA 1B2LA 1Q11A 3GBVA 4LYGA 5DGTA 5NLLA 3ENVA 1IULA 2G9VA 1JDPA 1M6VA 1KK1A 1Q1ZA 3QI2A 1J9ZA 2LE0A 4R1PA 5AKJA 3WLHA 2OBLA 4OJQA 1Y4SA 3RVBA 1Z18A 1L3CA 4QICA 4LGVA 1WX1A 4LX8A 3G2JA 2P9BA 3RU2A 5F7ZA 4MMXB 4MLPA 1TZJA 3F8SA 1K63A 1YU9A 1H4VB 1WP9A 3GDHA 4DSOA 4EW1A 5EE9A 2WSYB 4C4PA 3X1KA 2PPLA 3PQ3A 4P86A 2R87A 3H2KA 4DNFA 4EPVA 3M4ZA 4RPJA 1SHUX 4PBTA 2VBFA 3MHPA 4Q1DA 1GRCA 5ALKA 4NULA 4CHGA 3EPHA 5HIAA 3LFUA 1O6FA 3CKYA 3P19A 1DBQA 2GZ2A 4FLEA 4EG0A 4ZCTA 3HI4A 3LLCA 3T9FA 3TTVA 2QBYB 2DLCX 1PR1A 3I83A 4TUYB 5IM5A 4XM2A 1RKVA 2PZAA 3VHRA 2CLEB 3THSA 4AI6A 3DZIA 2FRVA 3CN9A 3I30X 3NC0C 3HLYA 2V9CA 5EJ5A 4O33A 1MFZA 1YZGA 2WJIA 7ABPA 2QD4A 4KGZA 4C03A 3A6HA 1OTHA 3V2UA 4ZT7A 4B6SA 2H06A 3RB8A 4I5FA 3GGPA 3HKEB 5EERA 3J80A 3O26A 1E1RA 1SCNE 1Y1QA 4DGSA 2XXAB 2OHFA 5TE9A 1SMKA 1G19A 4KACA 2J87A 4R16A 4YRSA 2W2MA 2ILTA 5FWYB 4U1RA 2J08A 3D3QA 2XH8A 4B9EA 4M0KA 3DPUA 3FDZA 3FCCA 2Z04A 4GX0A 1EXDA 1LDGA 2IY8A 4A27A 1PVOA 1SVLA 2GBIA 2UUOA 2IHVA 4KNYA 1TPZA 1QOQB 2VP0A 1V1RB 3JU3A 4FE3A 3SJBA 3OA2A 5FQOA 1I3LA 2GEKA 3L7JA 5AKHA 3WMFA 2A5YB 1OVGA 2YWRA 4FBLA 2ZEJA 4N8SA 5GPBA 1EK1A 3WLPA 2H1HA 2ORWA 3KQWA 5EEGA 4BVEA 1VHWA 4IFTA 2DGDA 5FFFA 3SC2B 5BNFA 2F3UA 1ZNQO 2HXGA 4HDOB 1F51E 1JR6A 1TF2A 3HFRA 4L5BA 3WOHA 1TPYA 4I2VA 2PO5A 4RHXA 3H86A 3A36A 3ZVKA 5I51A 4GQBA 1WPQA 2CF5A 4JUFA 2A0KA 1Z0UA 3OZSA 3L0SA 1GEGA 3GLGE 4FBGA 3E1GA 2H3EA 1PRYA 4GX2A 2ACEA 1EFLA 1XZIA 4HB2A 5YASA 5LQSA 5A9SA 4EJ2A 4UPDA 1U8ZA 2IEYA 1D0IA 3NDPA 3KQMA 3MJVA 4ARCA 3L04A 2G06A 4CGYA 1VMAA 2NXJA 1FLNA 2EOAA 1DXHA 4UASA 2GILA 4ZVKA 2CSXA 4ERXA 4S1VA 1EPUA 3Q88A 2QLFA 2H2DA 5CTJA 4ZYZA 5IABA 3PXDA 1FZTA 1DLIA 2ZUWA 2JJ8A 2YXPX 2ZYTX 3N0TA 4G24A 1J49A 3DKIA 4NDZA 3FBTA 1HF3A 3OFSA 1UZLA 3O8OB 1Z35A 4IIJF 1X7WA 3R7SA 1ZGJA 3ZVMA 3UPTA 2QXTA 1JHMA 1T1RA 1N0UA 2WPDA 4A6EA 2OXRA 3FNFA 1BWSA 5FKJA 2ZRMA 4A3SA 3PX2A 1GN9A 1N2BA 3OQNA 1AY0A 3MMZA 1JWAB 1X0VA 2PWBA 5IAEA 2O3TA 2FR1A 2L82A 2JARA 1E0KA 1FJ2A 4GZLA 1FP1D 4QU8A 1BW9B 3PQ8A 4M87A 5ARDA 1SU6A 3IKJA 4DCTA 2OZLB 4LA4A 3A2KA 5F4BA 1E64A 2MSEB 3PE3A 3SHQA 3QKSB 4XI9A 1NVAA 1YDWA 4ZCLA 2NQ8A 5D6OA 4EJSB 5CD9A 1U4NA 2FNAA 1QX4A 4R4JA 1KP3A 4FHDA 1OI2A 2WOOA 3BCSA 3IHLA 4GMXA 3K9WA 4HXYA 3B5IA 4G9EA 3GU3A 5F5NA 3TNYA 5HNKA 2HRDA 3Q2KA 3TK1A 2EJWA 3WFJA 2QUAA 4XR9A 3G2QA 4ZZ3A 3KKOA 4KYIB 3LRXA 3VPAA 2AOTA 3IQIX 5IMSA 4D9HA 2VTVA 3N7AA 1X38A 4F2GA 5DGCA 2O7RA 3IESA 2ZWPA 2B8EA 5FA6A 5H9VA 1PUIA 3JQGB 2VATA 4KPGA 4X0EA 3GEPA 1OT5A 1R6BX 1W9HA 2HSDA 2OBBA 2PKYX 2WILA 3GVCA 4JQYA 4JR1A 1J56A 2COKA 2Z9DA 4QHTA 2G71A 4PSDA 1WLYA 2D3WA 2AL7A 2O8EB 1NP7A 2A9FA 1NVKA 1V71A 4JH0A 3KSDO 2IPNA 3TCXB 1LY1A 4W6ZA 1S2MA 4EARA 5F3DA 4KH1A 4UBOA 2NZUG 2QN2A 4M60A 2QPOA 4O3FA 4ZOQI 5EA2A 4BLRA 4K05A 3I4CA 4I2NA 4LXHA 1XXLA 2BKEA 4XVQA 4ZV7A 1IBRA 4MULA 1X7GA 1MV5A 2C4HA 4XARA 2ZXUA 3L0ZA 4LDPA 1GGJA 3R3WA 4PXYA 2HYDA 5EIBD 5BXYA 2IZZA 7MDHA 5JDIA 5T4EA 1X0XA 2HSJA 3DO6A 4QPDA 1W2GA 5JYCA 4M0MA 3QELB 4DYHA 4OHBA 4RKYA 4QULA 5HTOA 1PYGA 2SICE 1KYYA 1NZJA 2G9RA 3NIDB 4KIFA 1X94A 3RS9A 4C7OB 1UBFA 3FRHA 3LYLA 3LUKA 4UEOA 4RWZA 3H87A 4X1YB 3V42A 1Y4DE 3LUJA 1F38A 4MVWA 1MQSA 4EABA 3HJRA 4OP2A 2HY7A 3KLMX 3EOZA 1W47A 1J70A 1KVRA 3H2GA 3PEEA 1JMVA 2A0XA 3V8NA 4CBVA 1OH7A 1CJMA 1DWPA 3H11A 1DRJA 2EBWA 3D0RA 4CT0A 4YIHA 2HJGA 2Z4SA 4LJKA 2C4VA 1NF3A 4CDNA 1BE8A 4JJKA 1NUHA 1P3JA 2HCRA 3L1IA 3A2NA 4O5AA 4ZCSA 5EMNA 4MHOA 3ITEA 2EFCB 3E1KA 3I53A 3QNWA 4COOA 2QI9C 4HWSA 4BQPA 4ESHA 2WHYA 4H0FA 4UHJA 2QTAA 2CVFA 3U3XA 4GZ6A 7ADHA 2D5BA 1UMCB 5LQMA 1OIWA 1UWLA 1R8JA 1XXHB 3GW8A 3N2NA 4XWAA 1BROA 4PIMA 4Y7CA 2YHUA 3DTVA 3MAGA 3UWOA 4MV6A 5G3YA 1MIOA 4AP6A 2ZRDA 1NXOA 3BZUA 3GFBA 3P9ZA 4LV8B 3SKXA 3UAZA 3C85A 3MINA 1CUFA 3BRWD 4HC4A 4TMFA 3UKOA 4WA8A 2NOAA 2JIBA 3CGWA 3TPFA 5TDHA 1XD2B 5FQNA 5IM4F 4KREA 3ZCQA 3SQOA 3HSSA 3O84A 3VJKA 4UARA 2VRCD 3BWDD 1XA3A 1GNSA 4GOMD 1B8OA 1SVOA 3S55A 3ZNQA 4LZLA 4TYNA 4D26A 2BZ1A 3C6ZA 1T1JA 3VPFA 1WVGA 1FOEB 2X14A 3H2IA 3WIBA 1T43A 3RYFA 1R12A 3MUNA 4HXEB 1YJBA 4NS4A 1Z36A 2EXXA 5K3DA 4RAOA 1MAHA 3FHJA 4WY8A 1QP4A 1YTLA 4GWLA 4PRLA 1AMOA 3L1HA 1KP9A 4M1OA 5E1BA 1QH0A 4TLEA 1GKKA 1KJZA 1LRLA 5DOVA 1AV6A 4JT4A 4Y2GA 3DXZA 2R79A 5IKPA 4W5QA 1DTWA 1NQAO 2Y4OA 4RY0A 4QREA 2IHYA 4X61A 5ED4A 5LWQA 1OAOC 5H8WA 4P4GA 5HQJA 1JIKA 4CG3A 4TRMA 3VH1A 5HQTA 2HN9A 2FV8A 3MLBA 2GPTA 3O4RA 5SYMA 1XNRB 5CFZA 5BSMA 5KC9A 2FFQA 4Q4CA 3L8HA 1T5LA 4HMQA 4BEVA 1II8A 3O90A 2FPIB 2P9FA 3NHYA 3C4JA 4LK2A 4WK4B 4YQEA 3ITNA 5AM4A 3TQSA 3ZS9A 1XYVA 3B36A 3Q3IA 4KR0A 2ZB8A 3KJZA 4LW8A 1SKUA 2GD2A 5AICA 4XB6B 2P5TB 3IBSA 2A78A 2NSLA 1DB3A 2Y77A 3QVXA 1IYZA 3K2QA 1EJ2A 1Q7TA 2RHTA 2DOKA 5AK3A 1PSDA 1V5EA 4R8VA 1BVUA 4B2PA 4AAYA 4YUAA 2G09A 1J2EA 1SNYA 3UFXB 2HPZA 5ALTA 4AY5A 1VMEA 1WMAA 2BRUC 4GOXA 3NIBA 4JJZA 4UMDA 1GCAA 4QE3A 1OHHA 2E3JA 2BM0A 3GELA 3F3YA 4X3PA 4YYZA 1ISHA 3HADA 4F3NA 1DAEA 5LXTF 1NC1A 3SIXA 1ONNA 1ZDMA 2DTEA 4IUBS 3SD7A 1H42A 4B3MB 4ZOAA 4MUAA 1AA9A 5LN1A 2C2HA 2QSZA 4OHVA 5FTWA 3O82A 3BB3A 4JR2A 4C30A 1JYFA 2OZEA 3A1FA 3DAFA 3NHKA 1P61B 2PKRA 4ZQEA 3DZCA 3W3AD 2PMFA 3CE9A 1GHTA 1FQJA 4ABYA 3ZVRA 3B85A 4MQMA 1ZXLA 2HF9A 4EUNA 2I6XA 3OKCA 5B6PA 1NRWA 1TGYA 3QU7A 5ALUA 1NXTA 4YLGA 2W6OA 1SXJD 2EV9A 2CLHB 3MEQA 3D6FA 4PZZA 5LLDA 4A2PA 2DTDA 3E3OA 1LBEA 3GOQA 3PXUA 3DOFA 2IIPA 4FX2A 2XNJA 3CM0A 4L16A 1RRKA 1A3CA 2DECA 4RCZA 5IAKA 1E89A 3AEXA 3RIEA 4EFNA 4EMBA 1XTJA 5GONF 3DZFA 4CL0A 3PC6A 1I7PA 3BMCA 4G3XA 2R6AA 1ZIXA 4URYR 3DZBA 4HS4A 2J9FA 4LWQA 2OY0A 3EX7C 5FWNA 1ML4A 2YHBA 4QM6A 1NI5A 2ZJ1A 3ND9A 5JSYA 3NUGA 2Q5QA 2Q27A 4QXOA 4DDKA 2C5FA 1YD7A 2I9KA 2FMXA 3DV0B 3S8MA 1BXGA 2X2OA 3AINA 4I1PA 2PRZA 4IYRA 4F38A 1ZIPA 2ENWA 2IHNA 2BZ0A 3M6FA 3T3EA 3EA0A 3JAWA 3D2BA 3LI2A 5D00A 3AIKA 3RRJA 5BWCA 5FFMA 5IF3A 1DC8A 2HIHA 3RC7A 4CMIB 3LBAA 2HMWA 2PNFA 2OAGA 3UUFA 4ZA2A 2BFMA 5A4JA 1VRVA 2DY1A 1HE1C 1NHWA 2FG7C 3TM4A 2J5BA 4F7WA 1PR2A 2LV8A 3O2SB 1CVLA 4HLUC 3GZNA 1Y1PA 2OCAA 1TTHA 2GVDC 3D2LA 2PH7A 5FF9A 2YBDA 2PS9A 1FXSA 3IDAA 4X6UA 1U9YA 5AKGA 1RZRD 5D5HA 2WAAA 1TMYA 3UXMA 1DIAA 2NZYA 4DAEA 1ZHHA 2QVZX 1G63A 1IE3A 2IHBA 2MT9A 4EYKA 5TMPA 1EFDN 5CVTA 3PHLA 1QANA 5F7XA 1U4OA 2YZNA 4KQIA 3RU9A 1TYEB 3NWEA 1U8AA 4A9AA 3BXGA 4Y0NA 3G5TA 3QVJA 2QZJA 1CHDA 4AN4A 4CTKA 1EP9A 4R5MA 1DINA 1IN1A 3CF2A 1GG8A 3NBQA 4P84A 3K72B 4UZSA 1GPNA 3UT5A 4ZVPA 3TW8A 2ZI4A 2Z2JA 2ECOA 1IJKA 4CL3A 3LCCA 1AQIA 2E18A 5T4FA 1S01A 4HCJA 5I7RA 2CUKA 1G2IA 2A92A 4OFZA 1Q22A 2XB9A 4GX5A 1JAXA 1OIXA 4I9FA 5G53C 1CUEA 2P11A 3G0CA 4DY4A 5K4AA 3GPCA 4MWCA 4OXKA 1W52X 4QXQA 1CRZA 2O3JA 1UBRS 2YJNA 1EVKA 1GGNA 1SC3A 2EW8A 4LWPA 1WXQA 1D2GA 1YHZA 3AUKA 1N33B 2D1QA 3SDSA 5JJCA 1N8KA 3H16A 1FPMA 3R6WA 4E2ZA 4C0HA 4BEWA 5BSEA 3DF7A 3T9AA 4RK6A 4OGGA 1UADA 4YJ3B 3T4PA 4HGYA 3IQXA 4ZANA 1EGHA 3TBKA 4B7UA 4L8YA 2O3RA 4M8SA 1OI4A 2AFHB 3FJ1A 3OJWA 5FWYA 5IANA 4MGYR 3FKSA 1CWUA 3NTXA 1TMGE 3TIGA 5C31A 2WWHA 2ZSIA 3AUYA 3HBNA 5K8VA 2E4ZA 5A0VA 2XT9A 3JVDA 3QOFA 4Q4HB 1UODA 5FWXB 4NZNA 4JJIA 2B35A 3U7JA 1YGPA 1QHEA 1ZGBA 1NPYA 3NIWA 4RW0A 4EQ6B 4AO6A 1F8UA 3E5MA 3L3BA 4M21A 3ZE6A 2CHGA 2J07A 1A1SA 1W35A 4H17A 3ZLBA 1MTZA 4UBLA 1GQSA 2I87A 1M2WA 5CH8A 1HQKA 1ZSVA 5J47A 3IUSA 2CK3D 2YYZA 1BQ4A 1YQGA 1YZKA 2QD3A 3EDRA 3W8RA 1QDUA 4A2WA 1KDOA 1TYBE 3PVZA 4GX1A 2QENA 3KZCA 4A6PA 4MH0R 3FX2A 2OBXA 3QQPA 4OUKX 2EFJA 3EC2A 4X63A 3FE2A 3T1TA 1T6XA 1HR0B 5JAOA 1D7OA 2IV2X 1RACA 4GR5A 1H85A 4EHJA 3A10A 5JCZA 4AS1A 1X3SA 2AOUA 2NMVA 1C4OA 1RXSA 3X1YA 3U9LA 3NWJA 2MCFA 1R0ZA 2R1VB 3C4QA 3ZOKA 3QTLA 5LKRA 1F9EA 4XCVA 4W7IA 1A76A 4HZUA 3DONA 1U8YA 1F0KA 2ES4A 2N47A 1DKOA 3CH4B 3F8TA 3I01M 2P8JA 1U2RA 3HL0A 1XEXB 3ZU3A 1U6KA 1JEDA 3OF3A 1CS0A 3BJEA 2XVYA 3WNDA 3VFDA 1O94A 1RLTA 4INZA 2AI2A 1P1JA 2GTIA 1N8SA 4YRLA 1EIWA 3OFNA 4O4IB 1EWYA 3CNQS 4ZO8A 2I6UA 5C3UA 4DN6A 4AF6A 2ZI3A 3LUDA 3U9SA 1YRAA 3QUBA 4H35A 4UXIA 3NNNA 2ZUUA 1YMVA 3ZI4A 3NGMA 4Z4GA 4JC4A 4ZCIA 4YA6A 2EATA 1DOAA 2GERA 5HGJA 3SC6A 1EZ4A 1U80A 2RHLA 2GAAA 3AFIA 3BMQA 3GGCA 1N5JA 4HEJA 4YREA 2Q9CA 1KOLA 3ESAA 1VSTA 1SBTA 1KMIY 1W2WB 4S2UA 2OMEA 4UDYX 1N6NA 4P58A 1ZSYA 4URHA 2V3WA 4ZPJA 2ZUFA 4FUQA 1A9ZA 1M2HA 1Q0PA 2IK8A 1WCWA 2ZXEA 2AW3A 3GEDA 3IHKA 1UBLS 4ROTA 5B57C 4MR9A 4OQMA 3WZMA 4FHZA 1OLUA 4YMVA 1DWUA 1DT5A 1RE0A 3ANSA 3HV2A 3ENNA 5DGIA 3LU1A 4N3AA 4B7AA 2XBMA 1YMQA 1E2HA 2ILVA 3C8MA 4BASA 3NNDA 3JQQA 4RGYA 4NYMR 2WUWE 5EIEA 2DPHA 1CFJA 4KRXA 1X7ZA 4CM1A 2CDBA 2C96A 1VGRA 4IX1A 5FLEX 3K1YA 1W0JA 4R81A 5E7JA 3IS3A 3I73A 1T4CB 4IEFB 1LA2A 3G2KA 1JFFA 1YZQA 5EUBA 3SY8A 1N5KA 3PTLA 4WXHA 3EXG2 3IBGA 2VYVD 3FUCA 2CL6X 3OQPA 4TSFA 1XK6A 1FJXA 4JC8A 2V0GA 4JI4B 1E7YA 2VNAA 1NJGA 1F7UA 2FR8A 5AK0A 3W5UA 1Y9ZA 3X2SA 1RBMA 5I4IA 3DZ8A 3F96A 4QWMA 1RP7A 4ZYYA 1C4XA 1TJ5A 5C4IA 3LGSA 5TQ2A 2GCIA 2AC2A 3BSYA 2X9GA 4BQNA 2P3LA 1XTIA 3PNBA 3E5HA 4HYQA 1N2HA 4PFSA 3I2JA 1PTKA 3RKSA 3CKLA 1Y6QA 3TVTA 2GN8A 1GA1A 1R8YA 2ERCA 3K9NA 4L8LA 3NXSA 4TOIA 4F3KA 3MWFA 1V6SA 2I78A 3HYLA 4IBOA 4JSRA 4Q37A 5TY0A 4MPDA 5FDFA 1NIPA 5EP2A 3V9AA 1KOGA 4ZHQA 5FPTA 1XK7A 4Q39A 5PNTA 1MAUA 2X8LA 3UN1A 1JBKA 3RLFA 1IBKB 1N32B 1E62A 1CJKC 5DWVA 3KR9A 5KPJA 4ZEMA 2YJGA 4E09A 2PS1A 5KNDA 4FP9A 2YNMD 3IMKA 2CV0A 4CXMA 2VDVE 3ETDA 1IG0A 4FKZA 1TK2A 4LXXA 4CKEB 4JDPA 4DJEC 2P1DA 4LN1A 4EX6A 4REQB 3AVUA 3QIVA 3AEUB 1AXEA 4HLDA 2QMEA 3TMYA 2AFIA 3AKDA 3FPAA 4HQFA 3V7UA 4XUDA 1DAOA 4NCXA 3PXGA 2DP4E 2BMDA 2DF8A 4YRMA 2D2XA 4G4SO 4D81A 2O2CA 3U7RA 1G3QA 1RM4A 3MC1A 4KN9S 5HM6A 2D7DA 3F98A 3N6VA 1KY2A 1QG6A 4NCIA 1PDWA 1R1DA 5JVDB 3LDHA 4W5OA 3TL6A 3T3HA 3HKDA 1CJCA 1ELOA 3T9EA 4AQDA 4EY6A 3LY5A 1U2SA 1R27A 3A3OA 1XZDA 1TW2A 2OBFA 4WFIA 3C8ZA 3F5QA 4MINA 3STUA 5P21A 4WN9B 3CLTC 3LBFA 4MI1A 1QFZA 2QRZA 4DCNA 1XYYA 1E6MA 3ND8A 1KH1A 5M04A 5EXSA 4MRPA 3E0QA 5CVJA 1N9KA 1UJ2A 1XKQA 1PWXA 1DO0A 3ANNA 3DCNA 3OQBA 3AK4A 3AKZA 4TYQA 3ZCPA 2UXCB 1N0VC 2J48A 4CJXA 1VB5A 3TBHA 4BN5A 1JX6A 4DCUA 3QEMB 2MMGA 4M0UA 1RWQA 3FIJA 2ZJYA 4ESOA 3NALA 5ALLA 3ELWA 1ZNZA 1WV0A 3QMPA 2XAUA 5LU8A 1CV2A 1EXVA 2WWXA 3LW8A 1NMYA 3JQ8A 5EE1A 1CJSA 4L9WA 3C6QA 3M2TA 3MYRA 5ALZA 1B42A 4FXPA 4UAUA 1IJBA 3MJFA 1QGUB 1TA4A 3C7CB 5L4NA 3BYZA 3LY8A 2DTXA 1FNBA 1K89A 3FGOA 4LRUA 4OHWA 3KQKA 5GOZA 1E6EA 4YI3A 4JA0A 1ETHA 3QWFA 4PYRA 3ZWVA 2QTZA 3ZWAA 1MAAA 1MABA 3AYXB 1T8UA 3PA8A 4MGHA 2O0JA 1JJVA 5EVJA 3CX7A 4E14A 5B4UA 3K4HA 1DAKA 2HX1A 5JVDF 3P8ZA 4DT1B 5KYUB 3SQWA 3NJRA 4IFIA 5AOCA 4ODIA 5B53A 1E9BA 4KEAA 3QUCA 4QDJA 4PN7A 4ZDJA 4DMMA 4MUBA 3WMEA 4I9UA 2A9RA 3HMQA 4MS3A 4ZGBA 2C5EA 4MVJH 3NEYA 3JQDA 4Q0MA 4TTQA 2RJNA 3HGTA 5HA5A 1VHJA 4GGPA 5BW6B 4D9CA 4OVKA 3L0OA 4Y6GB 3GMIA 2BMVA 4W5TA 2HU8A 1NULA 1X80A 4JB2A 2AJDA 2HWKA 2ZBQA 2WDZA 3RS5A 3DCIA 1SM4A 3S68A 2AMVA 1UMDB 4A16A 4BJ1A 4CDRA 1ACLA 3WOVA 1HOXA 1L7VC 5JUWA 1AZTA 1V3UA 1EDDA 3FWNA 2ZGVA 3JARA 4MRSA 5C5IA 1GL7A 2JLZA 2HQBA 2H5JA 1CQPA 2AXNA 3DCJA 2Q3BA 1L7RA 4F1WA 3ZQ6A 1NVDA 2WD9A 1LD3A 3M1IA 1PNTA 1MX3A 1E3IA 1Y82A 3E15A 3FSGA 4M7RA 2XJ4A 2IU0A 2PQ6A 3F2VA 3N8NA 3TAXA 4Q7JB 2DBVO 3D8RA 5DTMA 4K46A 1WPRA 3TLAA 5DIFA 5TF0A 4E5SA 5JJBA 4KQEA 5BWOA 2QQ0A 2RARA 2O2SA 3LYUA 4L27A 5BR1A 1JKIA 4OFXA 1BE0A 1PZFA 5TC4A 3W34A 4IXWA 4WNAA 3GEMA 1JQJC 3X2FA 1VGQA 3AZOA 1HORA 1T3LA 4FR5A 3D8TA 4WE3A 2BW0A 4R1MA 2PRIA 5IWCA 4AG3A 2C1ZA 5ALDA 1O5IA 4BFCA 3BC1A 3WGVA 1XVLA 2VNHA 3HYRA 4EELA 1MC8A 1W36B 1HV8A 4QBKA 2J0UA 1ZZEA 1NNI1 3G0OA 4G67A 1ZK1A 2ZIZA 4QATA 1J1ZA 3VA7A 2WIFA 4KPUB 2WE8A 3A05A 3IUJA 4F4DA 4LKOA 2DE0X 5JYDA 2QZZA 1TM3E 3ZXUB 2JNWA 1P5HA 3SICE 1WP4A 3C7AA 2ZI5A 3PQ6A 5A6SB 3STXA 4BGVA 2CCJA 4HLQB 4FSDA 4P36A 5DE3A 3V7NA 4A8HA 3R4VA 4PGGA 4EHIA 1M33A 2NU6B 5EJAA 2J6CA 2AJLI 3TLMA 1BKYA 3CCFA 3WY9A 2K2QB 3V1UA 4WWHA 2PGJA 4UNRA 1N2GA 5AVQA 2F4VB 1LU9A 1W1WA 4G1BA 1W96A 3I8XA 1AG9A 4HH3C 4MLZA 1P18A 1V9CA 1HSZA 5SZKB 3AUFA 4PLZA 3TLJA 1FNMA 4DQXA 1TO1E 1T6ZA 4RFVA 2Q7OE 1R0KA 1Y3HA 2QLMA 1SCDA 1N3LA 2Y93A 3MT8A 4ZHQF 4LQLA 1UUFA 3FNEA 3IDZA 3JASB 2OQRA 2BEVA 3W3AA 4MQFA 3ZCTA 3U3KA 1LS1A 2ASEA 3KYBA 1HDIA 3V4PB 4RC9A 3FW1A 2ZJZA 1JKJA 1KO4A 5B4TA 2WB2A 1U3CA 4H7HA 4BP1A 1U7WA 2JPDA 4JQOA 4B33A 3WK6A 1LW6E 1OBOA 1S2GA 4HNSA 1TMOA 2RGEA 3G5UA 2EJUA 4X44A 3S5UA 3U48A 4F5EA 5B64A 1YACA 4D4LA 3WKCA 2WTMA 1G8KA 3GFQA 1AGPA 1QH1A 1FFDA 1TOAA 3A0UA 4C0QC 1FMTA 4CFSA 1E1MA 3V1MA 5BRAA 1Q0TA 4JI8B 1IG3A 4H0NA 3T7EA 3D0OA 3VPXA 1NUAA 5GONB 3SGLA 4DLBA 2JAHA 3USZA 3G2PA 2AD5A 2BE7A 2GVZC 5A71A 2QA5A 5H3LA 3I5YA 3R41A 1FFCA 2GTPA 1KRWA 5M2QA 2F17A 4EJ6A 1V48A 3VV2A 1CQIB 1PL8A 3O8OA 4LTDA 3H9JA 5BUQA 2ZJ8A 2B34A 2CJPA 2FUNB 5ANRB 3RPEA 2AKAB 2WW8A 2OCGA 3QVLA 1QCYA 1TMKA 1X87A 2IODA 3BXXA 3D4BA 4GGOA 3BX1A 4WV3A 5F35A 5HG0A 2ZRQA 3RANA 4KR7A 1PGQA 5F1OA 3EZ6A 4PYQA 4WVLA 5HKKA 4Q7MB 3QY0A 3GRCA 3IE2A 4UUNA 1X8JA 2W2QA 2BDTA 1QLHA 2J9YB 4P54A 2J6BA 1GPKA 1SCKA 3OLWA 3HV0A 3OM9A 3PUXA 5B2ZA 3RUCA 2A94A 3DB1A 1FUYB 3MJSA 5F78A 1QVVA 2QORA 2Q3CA 3A9CA 2C07A 1VJ0A 4OHYA 3LO8A 4TYPA 4XDZA 1JWLA 3DDOA 3LPAA 4W7SA 2E7ZA 3ER8A 1ZS9A 3BCRA 3A1WA 3OAAD 4UVHA 1B6TA 5I7FA 2DPGA 2VKQA 5IS2A 3FRIA 4PICA 1P4JA 1YCFA 4FC7A 4BEBA 4IRXA 4ZZIA 4R2LA 1RVV1 4RTRA 2JANA 3OLZA 3H9EO 4YLEA 2A59A 2BM8A 3ZGYA 3B1KA 4FC6A 3WP0A 1T25A 1JSLA 3KJNA 3M83A 4E4YA 4GE0A 2GN6A 4PX2A 5AJZA 3AGPA 4F9FA 4EM6A 1G98A 4YRCA 4X62B 4AO8A 1DG3A 4YJ3F 1L4EA 2GSDA 4DCMA 4YRIA 2EJTA 2QK4A 1AXGA 3C43A 4XIIA 2PZKA 3W2FA 4YLYA 3I1JA 1H1LA 3VZCA 1GPYA 5CURA 1L9XA 5BV2P 2CL5A 1PJ2A 1BMFD 3HCCA 1AHIA 4F6RA 2F3TA 1QC5B 5KSOA 2XUQA 3TIFA 4L4ZA 1CJUC 3R9XA 2VHCA 2I1LA 3G5AA 2V9ZA 3MB5A 1WZEA 4X8OA 4Y9RA 1HRKA 1GN8A 1HXHA 1TJPB 3AUXA 3RIMA 2OFPA 3O83A 3PJEA 4TRJA 2Y1KA 4FI3C 2D3TA 4IQ8A 1PJ4A 5B7PA 1H6AA 1NAHA 4D8YA 4HN2A 5I48A 1JIVA 4NQZA 1JU9A 2A4MA 3ON5A 2ZB4A 4ND6A 4R1TA 5DPMA 4E31A 3SF8B 4R9SA 2KWIA 3ZE1B 2OZPA 2XKAA 5AJXA 4E15A 3H65A 1AGYA 2HRRA 2ZKIA 3EXAA 3QEJA 3HNPA 4BMOB 4E33A 1RKXA 3TVDA 1RM0A 3G1UA 1XEAA 2Q6KA 3JQGA 3LG2A 3ZU2A 4KXYA 4X95A 4YROA 1GY8A 5IVHA 4AJHA 4DMKA 3TZQA 4MS1B 5CCDA 4NEHB 2DKOA 4HUQA 1OWMA 3DFMA 3IVRA 4JWKA 4HB0A 3ZXSA 3SYTA 1OREA 4XDHA 5MFPA 2ZBVA 1FDTA 5BMVA 2I33A 1WHSB 1QNLA 3CRMA 5EIAA 1PT8A 1JRLA 4A0RA 3OOWA 3FCEA 2VPQA 4I1UA 1KC3A 1M1YB 4GH5A 3AP1A 2XDYA 4HLNA 5KDLA 4E70A 1G38A 2V5UA 2EF0A 3UXHA 2JIZA 3LDGA 1HTBA 4QYSA 1OWOA 3PGXA 1B8UA 1IHYA 2WVGA 3QYPA 4B2IA 1D2CA 2W0SA 2Y6UA 3ONDA 2XUZA 5CM2Z 5CCBA 3K0SA 2GASA 5A4IS 3V2GA 4AZVA 2X8WA 3OPMA 4DG9A 5JBNA 821PA 2PY6A 2B37A 2PUGA 4ZAVA 1IB6A 4KDCA 1O9BA 2B1JA 1U8XX 4KXMA 4LYAA 5FX2A 4I4IA 2XWJI 4AIRA 3DE7X 1OBHA 5CAEA 3QELA 4P4UA 2D2FA 4FYMA 3PD0A 1NVUQ 2JKZA 3HUUA 5ES3A 4Q3LA 3T1OA 4E51A 1ACJA 5E1MA 1BH6A 3EPJA 1WZCA 5EMHA 3DV9A 3COJA 2VDJA 3Q9NA 4IJ6A 4WNIA 3MOSA 4YS6A 1QZXA 3IP3A 5HCIA 5A0TA 1Q16A 1MFPA 2HAEA 3OEHD 1F8FA 3HHPA 3HMKA 3N76A 3N8KA 3PGVA 3THYB 2LPMA 3ME5A 3DMFA 3RT1A 4B45A 1FFEA 1AHNA 3HH8A 3PRKE 3O38A 2UXDB 5MN5A 1G3MA 5FFNA 3F2IA 3TB4A 3FYUA 3TOVA 4YPOA 3FLMA 1PJTA 3H2HA 4MQUA 5CLIA 5CIWA 1TADA 2DT8A 4P4NA 5F1PA 2CJWB 2F2TA 1E2UA 1DUSA 3LGAA 2AFIE 2C31A 2QMHA 1NDHA 1SO8A 2YQZA 4FYXA 3IUNA 4KAJA 2GZ3A 4L0QA 4Q9JA 1YZFA 1V7QA 1KK0A 2WHPA 3GRUA 1NI4A 2HLDD 3GX1A 1TFUA 3N3AC 4BY9E 4FS8A 3RVLA 4JYBA 3TKLA 1YKSA 2ZPTX 1Q57A 3WMWA 4W5WA 1T1SA 4CM3A 3GC6A 4DW8A 4W82A 1SKQA 1SVWA 1SHTX 1HLPA 4XQCA 1KAHA 3EARA 4U2DA 2O1SA 3EIWA 4YGYA 1ECGA 3ES9A 3IJ5A 1ZEMA 4C3UA 3K09C 2Q1UA 3EGOA 3NTRA 4RVNA 3AEUA 3KEFA 1T2AA 2HV9A 3R0IA 4QEZA 1NVXQ 4RVFA 4DQDA 1BDHA 1QFMA 4MVYA 2HMTA 5LXTB 3QWAA 5BQ5A 1MC4A 4FNMA 1GTVA 1CC1S 1X6VA 2NYRA 2RH5A 4MKZA 3GAZA 4DWJA 1RYHA 4YMIA 3IOYA 1Z2NX 5HX7A 2I3ZA 1U31A 4BRSA 1YULA 1DAIA 3E8MA 1UXKA 4V39A 3UJDA 1FSZA 1CY0A 1EB9A 3RJTA 1RJWA 4DM4A 1FE8A 4F4HA 1RI4A 7AT1A 1I3CA 4WOKA 4OJTA 3R6LA 1SQ0A 3MHTA 4D8UA 1MB4A 4OLJA 2HDWA 1DEXA 1Q7RA 2PXXA 3FI0A 2FPKA 3NG1A 2VRCA 4L4YA 4LZPA 4V0OA 4RULA 5AJTA 1NMXA 2DPYA 3Q1LA 2VJAA 3LTEA 5ERXA 1E3WA 3HDTA 5LUBA 2WJVA 1GO2A 1J9EA 2PANA 4DC0A 4R69A 1QR6A 4JXJA 3TG8A 5E2BA 1CRPA 3WXBA 2H1FA 4M55A 2X6RA 2ZS8A 1FP6A 2JLCA 3IAUA 3QU5A 4KGXA 4WESA 3E23A 5C8DA 2HA5A 1SFRA 2VLBA 3ZG6A 2OEPA 3CVWA 1TYZA 4WCFC 5EWMA 4R3UC 3OCWA 3TQCA 4MUJA 1HGXA 3TX2A 3C2QA 3CZQA 3Q7EA 4NBTA 4PO3X 3MCAA 3RNOA 3SEZA 4F86A 2G1AA 721PA 1P29A 4GRDA 5LLTA 5DH9A 1SD5A 1WA5A 3N2KB 1QHYA 3TDMA 4PANA 5EJ9A 1SKMA 3C3MA 1IBMB 3T5MA 1J2RA 2DPLA 5FLKA 4EHBA 2FR8C 4HNVA 1LK7A 1QFYA 1NW9B 4EUFA 1K8ZB 1CDZA 2R7MA 4PC2A 5EAIA 2QR5A 1ISSA 4HZGA 4AKGA 1JAHA 3KSMA 3EH2A 1K86A 3H19A 4O25A 4V0NA 1Y80A 2ZLBA 1V8FA 5DBGA 1OH6A 4UTZA 2IYEA 2J7PA 2P5UA 3PENA 4YR7A 1XDZA 4UUBA 4V2UA 4CIYA 3K3PA 3R44A 3A11A 521PA 4CEJA 3K30A 3LPDA 1HQDA 1U7UA 3L49A 1X8KA 1E5QA 1F5NA 3PTZA 4B73A 4P80A 1A2OA 5KNCA 1QVAA 1MKYA 4NEQA 3AM5A 2JHCA 3ULKA 3SZMA 4JELA 4BS9A 5TIIA 5E1OA 1E9EA 2PMCA 4GS5A 2CF6A 3V8MA 4K6FA 3DEHA 3HXTA 4FOPA 5K0EA 4YJDA 4GICA 4MYCA 2OR3A 5DMXA 5K4HA 1GZDA 1TM4E 1P7PA 2CVHA 3HY4A 4LHWA 3JWJA 3T6KA 2IHUA 3MBOA 5E8JA 1JAZA 2QZSA 2IDZA 3JSAA 4IF6A 3WTBA 2PZFA 2P6RA 1YOVB 2VJKA 2O57A 3OLXA 3QI7A 5IH3A 4ZVSA 3SOZA 4HFMA 2XQJA 3OT1A 2A30A 1JEQB 2EBFX 2CWDA 2AR9A 2UVPB 3EVNA 4PTYA 1BZYA 5IXJA 5A7HA 3P9CA 3ZV4A 1I36A 5L3QB 3GMSA 3ZS8A 3BB1A 3Q3HA 3NVAA 3SBDA 2H63A 4QKQA 4JUCA 1Z29A 5DSZA 3TW8B 2O9JA 4UEWA 2FXIA 5BMOA 1UBNA 4RGQA 5K0FA 1Y7LA 1XVAA 4M1KA 3AEYA 1LC0A 1WAMA 2Q4TA 2CLMB 3ZIAD 3U60B 2P4SA 1Z6GA 2DYKA 2B4KA 4NV0A 3V4OA 4OXYA 4HQLA 1Y6ZA 2XA9A 3II6X 1UOOA 3DL0A 2AR7A 4FMPA 3GEBA 1U7XA 4LC9A 2Z5GA 4BMPB 3R5FA 3CLUC 2DJIA 3AHGA 3JQ7B 1PR3A 1N5LA 3LT5A 3MCVA 3NYWA 5AM5A 5A4DA 4IX9A 5ITWA 1KEKA 4RHUA 5SZIA 4X3OA 4Q3BA 4W5HA 2XMGA 5FUMA 3BL8A 3GZNB 5K2MA 1NBHA 3RAJA 1FMCA 1GGVA 1R9GA 2XECA 4PAWA 3UXYA 2F1OA 4LVUA 4AKTA 3WR5A 2A35A 4L72A 1KA9H 3CRQA 4BLQA 3DUFB 4IDFA 1SQFA 2ZRAA 4LRYA 3N2IA 3OQ1A 5F7JA 4JAVC 1RXCA 4BQOA 3MWJA 4XYLA 3BK2A 1A8UA 3KSZO 3DEAA 2VZ0A 1HETA 3GP3A 2ZM5A 1LDMA 4FZRA 2VYCA 3MMNA 3L6BA 4FINA 1U4SA 4O2AF 5ITVA 2EF1A 3BH6A 4FYWA 2IE0A 3RBVA 1HKUA 2HBRA 3T7RA 3HP4A 3BTVA 4Q4HA 1G7TA 1W29A 4F04A 4PWZA 2E1PA 1RZ3A 4G25A 3M49A 4B3SB 2GLTA 5KVCA 1LBTA 1W5BA 5L40A 3TD6A 4GMGA 4RYDA 1CUBA 3KT8A 3TRDA 1ESNA 1XQXA 3Q9SA 5FPHA 3AR6A 1UKEA 3MVEA 2F3QA 1XZGA 1P0FA 1R0CA 5DLPA 5JMOA 3ESQA 3OTGA 5BYAA 4YAUA 4IIXA 4MR8B 3UKJA 3W1EA 5KYWB 4NI5A 1D6JA 1FDOA 4WDQA 1JFSA 1U63A 2F1JA 3PPYA 4CFZA 5A5GA 4ENRA 1GZ7A 3A4NA 1THZA 3AX6A 3DL4A 1O03A 1YCHA 2A9QA 2HWWA 3D2CA 3AP2A 1QHHB 2C04A 1XR3A 2EVWX 4Q1FA 4HGRA 4PINA 3LP6A 4UFNA 1I13A 1NQOA 2J7PD 2QMYA 1FSFA 3FTNA 4HGPA 3U4HA 4CHTA 3UMRA 3K70D 2IYSA 3L41A 4N6GA 3AETA 5JZ9A 2ET6A 3BD8A 2HDNB 4Q4AA 4YV0A 3GI1A 1RNLA 3JXEA 2EFHB 3VRHA 1OE0A 2VPZA 3DWGA 2MIIA 2N9UA 4N5DA 5AVYA 4IGIA 3W4KA 2GYUA 2YS7A 1VL0A 1ESEA 5JD5A 1EFVA 4ZO4A 4IXMA 3CX6A 4YP5A 1N2OA 3RFFA 1E4EA 3VGPA 1E2LA 1RFLA 4PCUA 5BSTA 2EBUA 3MA0A 3REOA 2VJMA 2GCOB 1IL0A 4F5ZA 2RHJA 1K0UA 3RVRA 1E1YA 1QJ4A 1P5ZB 5C3MA 4M9ZA 3DM9B 4R2JA 2OCLA 3SSMA 3A0RB 1SUBA 3U0BA 3W8NA 1VJ1A 4QOIA 1HURA 2P79A 1D2NA 4RD2A 3WGHA 5IZCA 4BNFA 4FLMA 2ZTLA 4G84A 4OH7A 2FPIA 4JSYA 1T6YA 2V59A 1EUZA 4U5QA 2PO7A 1YDGA 1H3EA 4LRSB 1H0HA 3P0JA 2JIRA 2PL1A 3SZLA 1Z62A 2LUOA 1ZJ4A 3W5AA 1SOAA 2WEKA 1NNLA 2D6FA 3Q8WA 4HEA6 1CYEA 1YC2A 2FU5C 2BL4A 2J1LA 2GKOA 4C5BA 4B3TB 3E53A 1V35A 2CMFA 4P81A 4PLTA 3N2EA 3ET5A 4ON9A 5E3IA 4CMEA 1TX4B 1W5TA 3H1TA 4NCKA 4HAUA 5ADHA 3PQ4A 1NU6A 1NVFA 1U3GA 4IG9A 2GF2A 5I9SA 4BAUA 2ENUA 4KXQA 1QIDA 1N1MA 2W90A 3NVMB 5G4LA 1ZOIA 3KC2A 4ZVNA 5BPHA 2A5GA 3KOYA 3DVAB 1ZIDA 4JGBA 1LPBB 1M1YE 1UZUA 5BQFA 2F64A 3UV3A 1F3OA 3BJMA 3EY9A 4JJGA 3OQHA 4MPJA 4N3NA 5KYYA 3RSQA 2G1KA 1LPAB 1E6UA 2YNMC 4DCPA 5J2UF 1EH5A 3AM3A 3QE2A 3QVGB 2QJWA 2NPOA 1PFWA 2HT6A 4QQ8A 1YVUA 3RO7A 4C7MA 4ARZB 4A0FA 1G21B 2Y05A 5JSUA 5DASA 3WGKA 4PHCA 4QOJA 1KBZA 1WO8A 1E8NA 2PPVA 3ANLA 4HS9A 4XKJA 5LZ9A 1NG1A 3G02A 1MVLA 3QFSA 3E7DA 3QOXA 5LJIA 3ZTTA 1C0KA 1DC3A 2BFFA 4LJ4A 3RSGA 5GVSA 4GZ5A 1G6OA 3AR4A 1N78A 1V3VA 1RQLA 1WXHA 4TX1A 3GY0A 1W4ZA 2GZSA 4R8LA 1INLA 3M6MD 2XBUA 3EXG1 5EXXA 3HLTA 3WIEA 4CG2A 3NRCA 4X94A 1SD1A 5CIQA 3ROFA 4ASUD 3V8BA 2ZYRA 2Y8EA 1PSZA 2ZULA 4IV0A 6AT1A 2YWBA 4FMDF 2WQ7A 3PRJA 3ZIDA 1UOPA 1BX0A 3VR0A 4GRAA 2WKQA 3C14C 5DV9A 2GA8A 3A6PC 1MRSA 4CKYA 3D81A 4G85A 3L0CA 5IJ0B 1NJ5A 3WO1A 1GRQA 2WJGA 3ZQ4A 4DQVA 1E7RA 4TMVA 2J0UB 1HLFA 4LJ5A 4OB8A 3AB7A 3SNKA 5HTKA 4C7OA 3I6BA 4XE5A 3AW9A 4BCDA 4E3ZA 3I2KA 1EESA 4I99A 1CQJA 4P3NA 1YB1A 5B36A 1NXPA 3ONWA 3R9WA 5KCMA 4PSCA 1E2EA 2IZOA 1IJEA 4NK4A 1SVKA 1QDEA 2RHBA 2O7VA 3S99A 4R2IA 1X77A 3HKCA 5EXTA 3BMOA 4A2CA 4ZVMA 4AS2A 1G7SA 1ZO8A 2WC1A 2V0CA 2OK8A 4PO8A 5B12A 5B7GA 1L3IA 1LTKA 3RK4A 5KNBD 3G82C 1GP2A 1A98A 1RI2A 2RC6A 4MQEA 1M1NA 4QUBA 1VFPA 1XLUA 2FPUA 4Y1RA 3IPLA 2QRVB 5T6BA 3F7NA 2QTNA 1Z0IA 3U17A 3FOZA 1MGPA 1ZK4A 2FAXA 2HH9A 1OROA 4X00A 1O4WA 3UHPA 2OO5C 2XOXA 1EZ1A 4M8LA 1MQ8B 1QX3A 2OV4A 3HA3A 3KX2A 1L5LA 5LSAA 3ELYA 2I5PO 3D31A 4UDNA 3Q87B 2EEZA 2BAGA 4LXUA 4RTQA 5JBIA 1E94E 1C30B 3T9DA 2QLJA 1CNEA 3COYA 4LIPD 4PG7A 2IU4A 5WRFA 1ZHOA 3K70B 4EYOA 4DSNA 4FQ8A 5FT9A 1AKVA 3PXAA 3D7NA 3KLOA 5IHXA 1VXRA 1L4NA 2BC9A 5DX1A 1VRWA 3A7EA 3WA6A 1PL6A 4RPGA 2Q5HA 1F8YA 1CR4A 4LOHA 1Z47A 2RKWA 3ZHUA 5AXDA 1X15A 4CQLB 1SC9A 4EG5A 2E48A 1RC1A 3A1VA 3FTFA 1ICEA 4WFKA 1SXJE 2HO5A 2WFLA 1D1SA 1YJAA 2Z6UA 1X7WB 5FBKA 3PFKA 4OHZA 4CMJA 1YUMA 4S1NA 5LQRA 4JR0A 4O2AB 1DX4A 1UBMS 5F3WB 2Q8NA 3OPXA 1H2EA 3ETCA 3FCXA 4XFJA 5DOZA 1ZI8A 2JRCA 2FK7A 1QPBA 1DG9A 1P0QA 3E7PA 4X1KB 1YBHA 1E2JA 4HWOA 2C2GA 4DV0B 3FWHA 4HNAB 5AHWA 2BZGA 1VIMA 3ZZ1A 2B4QA 5DVZA 1ZQ1A 2NM0A 3W3AH 1YF3A 2CHFA 1BXRA 2XB6A 4GC9A 2EL9A 2C4MA 1LJUA 4FR0A 5LA6B 3DKKA 1FDIA 4INJA 4EG3A 3OECA 5IUNC 5IRCD 2V54A 1ODIA 3AVQA 2UYHA 1SR8A 4LSGA 4AZ3B 2UXBB 1Q17A 4JDUA 3JRXA 1IRIA 1HDRA 1DQPA 1Q14A 4LXGA 5AKXA 4DIBA 5FHRA 3TOZA 4BKMA 1C0EA 2O5RA 3DFZA 3DWFA 3QU9A 4N49A 1IN8A 3E7XA 2CB0A 4KI0A 4MCJA 1NE2A 2B36A 3PR3A 1SC6A 1KKUA 4OMDA 1NL3A 2JCBA 3CLKA 2COEA 3O8NA 2O19A 3KYIB 1K6XA 3ICWA 2XDAA 2ZDGA 2CLFB 3PICA 2DUUA 4B6OA 2DR2A 5AK4A 3A4VA 3L43A 3B60A 3OE4A 1N2SA 4NH0A 2DSNA 2G5PA 4QELA 5CFRA 2HHHB 4LGCA 1E5XA 3HDYA 4F2PA 2VHEA 1XZ8A 2XB4A 3GNLA 3HN6A 3DNFA 4NBUA 4Y2YA 3ZGNA 3G8CA 3IB6A 1PTJA 5B1SA 3NLLA 4BB0A 3V34A 3IIKA 1TLLA 1K5DA 4HDRB 3LHSA 1XU7A 5EWJB 2IBMA 3OT4A 4O4JA 5E6SA 2IP2A 5CVCA 2MSNA 3LQ1A 1FQOA 1P62B 5I7UA 4D0NA 1J9GA 2F6RA 1LCIA 5L8VA 1KOJA 2QPAA 5K0SA 2TYSB 4UM9B 3H9UA 2CDRA 3CRRA 1H0KA 2B94A 2HR1A 4DDWA 1JSXA 1T36A 2WNSA 4TKVB 4BUCA 5BW5A 3LS2A 3GLFA 1GUBA 1U90A 3ESYA 1VQ1A 4MUGA 4H77A 5AXBA 4EI7A 1WNFA 4ZJZA 2AOWA 1H2AS 3FOBA 4FFMA 1S9DA 1HBJA 4PV7A 2ZT6A 3CTPA 4U2FA 3EQZA 1ZL2A 3UPUA 1RWNA 3DB2A 3Q0EA 2GBGA 4WVFA 5D86A 3BL6A 2VF5X 5HGXA 2FPSA 5DRTA 4MDFA 2DBZA 1RQXA 2R47A 4KAFA 4I1YA 4N54A 1E3DA 5H7XA 5L3VA 1NY5A 2BFFB 2GPSA 2WB4A 2YYSA 3Q72A 1IMOA 2VPXA 3H6KA 3E9QA 4K03A 3RR2A 2O2JA 3MAAC 4UM7A 4DDMA 3TS1A 2X1LA 2P75A 5H3CA 4CM9A 3O3MB 4OTZA 1Z33A 2HJSA 3WC4A 2JB9A 2C4UA 5COBA 2IV7A 2YN2A 3MCWA 2CYAA 2WSIA 2ZWOA 2NZXA 3IQHX 3ROQA 5KMGA 4LZNA 1ZKMA 1CY8A 3LQFA 1G8FA 4R3WA 4MSUA 4Z1MD 2G76A 4N7BA 1E5VA 2HQOA 1ZM7A 1BC5A 1Y89A 3AI2A 3CWZA 3P9NA 2D1YA 1Z9BA 4TLLB 4U00A 1S3GA 2FQ1A 3GQVA 3AY0A 1XHLA 3QG1A 1GD1O 2OGTA 4MITA 4X54A 5J4LA 5CFPA 2PMWB 2Z2IA 1C80A 5CYPA 5TMDA 1CRWG 4QXPA 3RRZA 4ALLA 3DMRA 4B5LA 3H6GA 1LI4A 3DLBA 4N9WA 2ZSDA 1N6HA 4JUIA 1YKFA 4KXLA 5FHQA 4C0JA 1ORVA 4F1KA 3EJ6A 1CUUA 3IAS6 1KZ1A 3FROA 4M46A 4BBJA 1PR6A 1GSAA 3CEAA 2CD7A 3E8XA 4R54A 4TSFD 4XQGA 1TTPB 1UDAA 3OLYA 4KODA 4C4ZA 4CIXA 2A5JA 2R00C 2R9VA 1SPBS 2ZJFA 3DHWC 2WVJA 3A14A 2P4QA 2QT9A 1BKSB 3GVIA 4OI2A 1PK8A 1DHRA 1HG1A 1SA0B 3DZDA 1YZHA 2QR3A 2P1ZA 3MWEA 4G5GA 4H0CA 4PXSA 5AXAA 3QKUA 4CCYA 4LRXA 5BYJA 1OU0A 3FLAA 2I7CA 2GSWA 1YL5A 2WTUA 1R37A 1T8WA 1Q7GA 3IH5A 4YV1A 5ALSA 4GVLA 1NBEA 1ECBA 1E58A 1XPUA 5IBQA 1GAJA 1Y8QB 3ZDAA 5MGNA 5J2TB 1CXZA 1FFAA 3IXMA 5E6UB 1WMSA 5A2QA 1BDMA 4PQRA 1KJWA 5BR8B 1Q95A 4K9RA 5EMMA 4ZQBA 3NT4A 3PFGA 4DR5B 2PQMA 3O7WA 2J45A 2E49A 4H15A 5HKBA 2EKPA 3GJYA 3LAWA 3GDFA 4OQDA 1AQYA 3EUAA 4OQPA 3AY6A 3H8VA 1P9NA 3IQZA 4P3OA 5BV1A 4MYUA 1U6IA 5CH5A 4OUDB 2H08A 4RKFA 5A9TA 3VH4A 4OSOA 1ZMOA 5GJBA 2NTJA 4N03A 1E1CB 4OATA 4AULA 4EA6A 4Q9KA 1ULZA 2ZB2A 4BX8A 3EIQA 3LXRA 2YV4A 4BO5A 2V98A 1KI2A 1WKBA 2IT1A 4NBKA 1C2TA 3FD8A 4LRQA 3ZVLA 2HMSA 1U0RA 3E3LA 4QRIA 1C4WA 4RE5A 1H2ZA 1MF7A 2APJA 3WNBA 1HZJA 1EFPA 1NQWA 5IDXA 2DQZA 2OLKA 3N5CA 4G0WA 1DPFA 4D8XA 1QH8A 1T5DX 3V3TA 4HUTA 4EZEA 3A6JA 1FMJA 3F0TA 4WJLA 4HPXB 4EIWA 3H0EA 2ZZKA 1F0PA 3W04A 5DM70 1SCUB 2SKCA 4L1KA 5IKXA 2WD7B 1TEVA 3EIXA 5AM2A 2VK4A 3EWIA 3IP8A 3SYNA 1RADA 2GBPA 1TM1E 1YT5A 1Z0AA 2CZGA 1WSWA 3NEPX 4MAAA 1T15A 2OUIA 3WQHA 4OY3A 3U6BA 2E87A 2VZEA 4O8ZA 4MJ7A 1QWOA 1MB2A 3LXMA 5J3JA 2JVIA 2Y6VA 3RIXA 1J5EB 3NS7A 4MVJE 5BXQC 2IKQA 2WT9A 3ER6A 3R1IA 2AT1A 4Y1FA 1BGVA 3SFTA 4BDSA 1H2BA 4EO7A 4KQ1A 2JLRA 2J31A 3L7DA 4EFLA 3P52A 3GH1A 3NTOA 4RVDA 1IATA 2IVFA 2Z95A 3DMGA 2NU9B 2AQHA 2NXEA 4QL3A 3EFEA 3JR7A 1GFZA 3VNSA 3QNMA 4WX2B 1FCJA 1CE8A 2GHQA 2VHYA 3ERCA 4PHGA 1IPHA 5TSDA 4M53A 3DE4X 3PKJA 2QVYX 1ZM9A 4DJDC 1XZAA 5DBHX 3DV0A 4KO8A 1IEVA 3ROEA 4NCJA 1BW9A 1CJTC 1LK0A 3O4VA 4FDUA 1FNNA 1O6BA 3LBIA 3PUKA 4OXQA 4BEJA 1CQZA 4RO0A 4RF4A 4Z86A 4R98A 4UW9A 2YICA 2C4KA 4OMFG 4BNMA 1KJIA 1VYVA 2CFRA 3CZ5A 2HRZA 4M22A 3HU5A 1QG4A 3QYJA 4CVNA 5T3YA 2JAPA 3OX3A 4IFBA 3LDUA 4HBZA 4HDKA 4J16A 4NG4A 1KI7A 4MTCA 4ES6A 1JHVA 4B2LA 3KVVA 4B3DA 2FSVA 3BQNB 4O3MA 4K6OA 3OZRA 1M54A 1FVOA 3ZDCA 2MOKA 3I2YX 4OJMX 4BP9A 1U5AA 3WYCA 3ZYCA 3WGJA 1DC4A 1E3QA 3IQFA 3KUDA 1BVRA 3EGIA 4L76A 1U1FA 4I8IA 3HM9A 2VSOA 4GE3A 1WXXA 5B4VA 1WB6A 2NN3C 2P9CA 5BMVF 3CIOA 1O1YA 3K1AA 4MWEA 4QYTA 4TQUS 4E4RA 4F4CA 1MXFA 3KEOA 4UATA 2GD1O 3L0PA 4GYWA 4MPRA 1UC4B 4ZVUA 4DLVA 5A6SA 2IYPA 3EUFA 5KHLB 1GAWA 1P45A 1L8OA 1IN4A 1JR4A 2WKWA 5A4AA 2ZQYA 3DXXA 1KVUA 4WERA 1G21E 3L8FA 4QFCA 3QFTA 2FN4A 2PUEA 1QKKA 1Z34A 2A57A 3NP9A 5FAXA 1FSSA 1IOLA 1T9AA 3ZQKA 3DBRB 3CPHA 2I76A 6ADHA 4EF5A 4EW3A 4PGFA 3AVTA 3IIMA 2Q3JA 3AYZB 2I4MA 3N6RA 1KI6A 1EVYA 4P22A 3AR2A 1E2BA 1US8A 1EJBA 2JJYA 2FSFA 2EP8A 2UZAA 4PX5A 4L5YA 3OQMA 2AXQA 2JA2A 4D25A 1J0XO 4NV1A 1BKDR 1I2CA 4EBFA 2RAPA 4TT8A 4BNJA 2J0EA 4RA9B 5FAKA 3ZDYB 1ZRHA 4BPBA 3GRAA 3M3DA 5JAMA 1NN1A 2XCTB 1SKYB 1JIUA 2F9MA 2QRMA 3GUCA 1GPLA 1S7CA 1DQSA 4NU5A 4ZAFA 2BKVA 2JCXA 1Y63A 2YYYA 2XWSA 2P9GA 2CY0A 4OQQA 3JD1A 1AOXA 3GLVA 1RJ9A 3THYA 4MB2A 4V0LA 1JSCA 2Q6LA 4XPIA 5DEOA 3V1NA 3HS3A 4WBSA 4IOJA 1TCUA 3KELA 3T7KA 5DBEX 2WUGA 3WS7A 3UBTA 2NP6A 3EODA 3IHTA 1KEWA 2YCLA 4LY6A 3KM0A 3DAPA 3DAYA 3GAFA 3EMDA 1C1YA 4I8DA 4YQZA 4HT3B 1XCGB 1CQIA 4IUCS 1JECA 1FRNA 2F8TA 4ZI2A 1M5TA 2UAGA 1KE1A 5JXWA 4GDFA 1V39A 4PPNA 2FSHA 3SVZA 4EBBA 1W36C 4I5EA 2WHPB 3G8BA 4GWGA 3VNVA 1XD2A 1NWHA 3WMRA 1ODJA 3BQMB 3GWGA 1YRYE 3K16A 4RHEA 2FP4A 4BVLA 4GLLA 2NSDA 4DCVA 4YYEA 1O95D 4L57A 4MWTA 3DFIA 4XRRA 1QYXA 4O8CA 3ZZNA 3CR3C 3OJEA 1WW2A 3NR2A 5G1OA 4LJRA 4EI2A 4CETA 3QVUA 1SWWA 1LC3A 2VWGA 2YFQA 3AXSA 2Z2KA 2XZTA 4LZZA 1EAMA 1JE1A 4BKUA 3PPVA 1Y8RB 1ZAYA 1VCMA 4KLZA 4OBBA 3NBMA 4J07A 3I04M 1Z63A 1GPWB 2RHRA 3B9PA 4ND4A 1RPJA 1M8FA 4IDPA 1YE5A 3ILSA 3REQA 4IUDS 4H3KB 3Q0IA 3HCFA 5IM4A 1H93A 5F23A 1UC5B 1XZHA 1N57A 4X8MA 2YJ3A 1KQ3A 2VTKA 1CS0B 4YRDA 1RKBA 2YHIA 2YOFA 1D8AA 1RWKA 1WQ1R 3NAZA 3RUAA 2WT4A 3VHXA 1Z13A 1NSYA 1Z2PX 1XZNA 2GH1A 1E2GA 1YB4A 3Q9LA 4CR7A 3O3NB 4LYFA 5GJWC 1Z74A 1CDOA 3FKSD 1XLWA 2QR2A 1QYIA 5IU6A 3QLUC 2EX4A 3A4IA 3BZBA 5HS6A 4NBVA 3QPWA 3HCNA 4HDMA 5HJ7A 1XRRA 2BEKA 2HXYA 1UKAA 1DV2A 4NZPA 4IIHA 4O59O 4FE7A 1PUXA 2GX6A 1P1BA 2I2AA 2MR5A 2VJCA 3PNLA 4IZIA 4N41A 4F7DA 1EE2A 4QBFA 4YRKA 1I2AA 5JZMA 7MHTA 3AIIA 3FYSA 3JALA 4Q3OA 1O89A 2OV2A 2QX7A 2X76A 3TZ6A 3UT0A 4C4XA 3LQ2A 4R2XA 3HPQA 2A84A 2H65A 2ATXA 2VS1A 1RE1A 1WMBA 2X5NA 2XDQB 3IEXA 4O02B 4D57A 4I1OA 2XIQA 1ABFA 1HYBA 1YA8A 3SSAA 1RRVA 2LP4Y 3GCDA 4LJ7A 4MKRA 4G63A 4UAJA 1IONA 1XLVA 2W8ZA 4XGQA 1N2IA 3V4ZA 4Q6WA 2CXHA 1IZYA 5CR9A 2J3KA 4H7IA 1H23A 4GWKA 3WDKA 5A2GA 1MVOA 4RK0A 3MQ4A 1IHUA 3BDVA 1N6PA 2VRWA 3FDIA 3N2GA 3N70A 5D3MA 1NVMB 5EKUA 4CN9A 1Z6XA 1Q7EA 4OXRA 3KQUA 2HXSA 1Z22A 1AE1A 1X1SA 2VYNA 1VMKA 1I1HA 2WJYA 4YALA 5DKFA 3K31A 3B5JA 3LYHA 4GXQA 4LDNA 5JTUA 3BIXA 3EVAA 1KTIA 3FPLA 1ZCAA 2X7JA 2QT0A 2ZUVA 1TM7E 3AB8A 3CIFA 2O1XA 5G1NA 4LHZA 2NV0A 2XBLA 3MIZA 4N82A 4BO2A 3AR8A 4YCNA 3LP8A 2O2IA 2PT7A 4JFAA 1U02A 4TPKA 4BHTA 3K94A 1A82A 5KTSA 2FZWA 1JR3D 4UCFA 3U61B 1BRMA 1L4FA 1WXGA 4MW2A 1L8XA 1V16B 3K53A 2WINI 1ULAA 2I71A 3D5TA 3DOIA 2OQ2A 3KPYA 3QXCA 2VTEA 2WBLC 1IEQA 2ZUBA 1JMYA 1JB1A 2CDCA 3L0BA 4RPKA 4CQMD 4XVUA 2B8JA 3FWZA 4TT3D 4HB3A 1J22A 3AQ4A 3FF4A 4M1WA 3MPOA 5DP2A 1FU4A 2C2WA 1P9WA 4LJ9A 1RMTA 1I6MA 2P78A 3ZV3A 2FN7A 4OI4A 1QYRA 3U4IA 1S4QA 3NHLA 1P0IA 3F90A 4JX9A 2BONA 4KK3A 1LPOA 4RMHA 5D8DA 2UVPA 1XL0A 4GUAA 4Z0TA 5L45A 2J7KA 3IIJA 4NNOA 4L75A 3M5DA 1GRVA 1SHZA 2Y0DA 3T0GA 1G7RA 3SHFA 2YBEA 2IU6A 3OWOA 4IDEA 4QVIA 4G4IA 4DIEA 2VP9A 1R6XA 3BGDA 3LNTA 1RM3A 3NIFB 1EK5A 5CHEA 4B8YA 3TGLA 2G17A 3L4JA 3ZC3A 2IC5A 4M7WA 4PLCA 1DNPA 2HWUA 2HHLA 3NBKA 2JFHA 2VF4X 3MTBA 3PRHA 5DHRA 5KVAA 2IPXA 3QXJA 1PNVA 4AN1A 1G3UA 2GM3A 5DI9A 1RC8A 1V25A 5AW5A 3U13A 1WHTB 1H8HD 3S40A 3PXBA 5ERYA 4WBNA 5AXCA 1RHKA 5DM2A 2Z83A 2PV0A 2Q21A 5FIUA 5FPPA 1PEDA 4ENWA 3L6DA 1JSZA 4LFCB 4J49A 5CXQA 1RJDA 4MS4B 2WPNA 3W8DA 1NYQA 2VNKA 5FR1A 5PGMA 1N5OX 2ZFUA 3L7LA 1COZA 2DHRA 3EBPA 2R5NA 1N3IA 3EQ8A 2I6QA 1G5TA 3CRZA 1ZOOA 3EXEA 2EWWA 3KK0A 5SZHB 5JANA 1I3OA 1D03A 3DHNA 3TEFA 4B1FA 2DUMA 3LPCA 4MV1A 3JAMA 3HU1A 1B6GA 1N9GB 3QOYA 3YASA 3H97A 2XOKA 2H2WA 5KQRA 5F5XA 4D8TA 2X5XA 1O6ZA 3HVRA 1NHGA 3PXEA 1NM5C 1Z4LA 1XN4A 1PU2A 3QU2A 4P7FA 4AWBA 3HJBA 2Y9MB 3ZBPA 1BYIA 2P5SA 2NXWA 5CMLA 4WT7A 4GPAA 4PBRA 3QE9Y 1Z75A 4DDHA 3UHAA 3NETA 1MR3F 1AZLA 1XDBA 3PHGA 4TVKA 4DIDA 4YPFA 1J21A 4US0R 3OTIA 3W1VA 3I72A 1B76A 1L7DA 1ZNXA 4L51A 2UUAB 1G64A 3HJUA 4D3ZA 3GNTA 1JUDA 1MDBA 2H92A 3ASZA 4LNAA 4BJHB 4CT5A 2V8OA 4RD6A 1YOBA 3CHYA 4CV3A 3MB8A 3DA8A 4WCFA 3RC3A 4AG5A 1IN6A 1ZK0A 4PHHA 4H1UA 4KX5A 1CZRA 2Q07A 3ORRA 3UENA 1PGNA 1KSGA 1O3YA 3F49S 4NMMA 1IHDA 4NU0A 1FYWA 2X0DA 1WEHA 3ZGVA 3I62A 1XWIA 2NZ2A 1M7BA 3WLIA 4AICA 2BLNA 4IGKA 4QBGB 5IKEA 1JEAA 1QAMA 3KKKA 4ITRC 1SURA 1XZJA 3E3NA 2ZKLA 1QHXA 3I6MA 4OMCA 1Z2DA 4ZAYA 3LJKA 2JLSA 2O2ZA 2PX8A 3IVCA 4IS3A 5FUVA 2H57A 3D6TB 1ZUWA 3OEHA 3T3DA 3LDFA 1H6DA 3A26A 4YAGA 1Y5LA 4HAZA 1QGED 4JBNA 5KX5B 2ADFA 4Y2JA 5IKMA 3I9OA 3EZ9A 2ANBA 1B43A 2R1TA 2WAXA 3L7KA 3R6GA 3K6KA 5DBIA 3N59A 4PO9A 1I5OA 1BEZA 2H2IA 3AF1A 1N5MA 1NMZA 3G85A 4LG1A 4UD2A 4BFUA 5IC4A 1VIYA 2WFMA 4DV7B 2ERXA 3AM1A 4XWGA 4K6MA 1A88A 4TT3A 4EGJA 1TVCA 2K7ZA 2WIBA 2D59A 1L5ZA 4YT5A 5J23A 2HRCA 4BE4A 4BVKA 5B30A 1N9ZA 1Z4KA 4P38A 3QEOA 4PPQA 1JLSA 1EHCA 3B8HA 3ISTA 4UUOA 4DLUA 3DT6A 4HX9A 5COQA 3O31A 3L06A 1GTL1 3URMA 5KWSA 1E79D 2PT9A 5B1YA 3IODA 3R76A 5CDUA 4A8PA 4G01B 5AW7A 1E0DA 1O6CA 2FRDC 3WHLA 1QB7A 2A3NA 2FZKA 3CLSD 5LQJA 1ODKA 2GBLC 3EG5A 4J94A 2FKNA 1C5KA 1GM5A 4HYTA 1GT91 6Q21A 5JCXA 2GM9A 4O4LB 2IHTA 4QBTA 4ZRMA 3LZCA 4HRVA 1LZLA 2FFBA 2XZOA 1O0SA 2JLUA 2PVSA 2LKCA 3DSRA 1Z6ZA 1C1HA 3A6KA 1XAGA 2BEWA 3OD5A 4URFA 4LV6A 2NO7A 2HJ9A 3UGKA 4DAOA 4RF2A 2VUHB 2QL7A 1LUAA 1QGYA 2RHGB 2AG8A 3FR7A 3WGQA 5L3SB 3CV3A 3DOOA 2GF9A 3OUUA 2J6IA 4TV9A 4QYIA 2UYYA 3KUUA 4DEYA 5K01A 4HJRA 5CB8A 1JH9A 2JL1A 1MOZA 1P7CA 1MEEA 1WXEA 2RGNC 3DTYA 4G5XA 3Q7IA 3OF5A 4XW2A 2I2WA 3ZWOA 4D4JA 4LYJA 5CNKA 1ZQ9A 2D74A 2R3SA 4GP9A 4I50A 5DN6D 5AVTA 3EWNA 2F55A 1J00A 1FFWA 4S12A 2ONJA 5A04A 1VPVA 3RSFA 1G17A 3HGQA 2Z9BA 4FGZA 4Z9BA 5FOVA 5LZ7A 3TJZA 3RQSA 1D2EA 3P7MA 5BNZA 1I2ZA 2QVLA 3K0FB 1NLFA 1WB4A 5K03A 4HUQB 3QVSA 5JWHA 3C7KA 1VTKA 2H52A 3NBXX 1Q0QA 4KN8A 4MKGA 4V0ME 3OH8A 3U4QA 3B1ZA 3GFTA 3BFPA 1KPGA 3GEGA 1GRRA 3LV8A 2I4LA 4NMXB 4X1YA 4BC0A 2VUSA 1KDZA 1DAGA 1FBTA 2HMAA 1XMVA 2MWMA 2RIRA 1GVNB 2VP5A 1I9CA 3QPVA 2Z8YM 1ES9A 1EU1A 4G0NA 1G1MA 3RHFA 4JL6A 1CLEA 2RGWA 4BNDB 5C7OO 4COKA 3WXMA 2YVKA 2ZSUA 4CMIA 2QTCA 4OF4A 4QDOA 2YFHA 2O23A 1ILWA 4TZ0A 3T7TA 3V2IA 2G1UA 3UMVA 4OI0A 4P2GA 2AE2A 1UWKA 4H18A 3O8RA 1FFXA 4UBNA 5EZSA 1UP4A 2PH3A 2V7EA 5DHAA 4ESEA 3NX4A 3KWMA 4FEGA 2NIPA 1Y8CA 3GZ4A 4G41A 3U5TA 1RXYA 4BVHA 2AVNA 3K0BA 1QH1B 1V5IA 2SCUA 5I7WA 1IPEA 1Y37A 4B4WA 2EWMA 1RLIA 1COWA 1MNQA 1TUBA 3OIYA 4YXWD 1QPZA 5JRDS 4R6WA 3TW6A 5EKXA 2C5BA 2XNKA 2XYQA 3ZE8A 4L8FA 1U2EA 1I2MA 2LKDA 4MW7A 4TWIA 4ZOEA 3SLGA 2JLQA 1GAEO 2PL5A 3LY7A 3O4HA 4TTJA 3DOUA 1E69A 3H1EA 5TMEA 3G7UA 4P08A 2ZG6A 1A5SB 1E9RA 3PI7A 2PS0A 3BUSA 5AKZA 4CCYB 2WM8A 4K9QA 2PJRA 1XF9A 1WTAA 4ARSA 4UU7A 4ZV4A 2G5CA 3TCNA 2PVPA 3TLZA 4YMTA 3TGPA 1NW5A 4GOKA 5J5CA 5KKCA 2D2IA 4N5NA 1ZX1A 1I33A 5C8YA 2Q2OA 2GKSA 3MWDB 3RRMA 1XJ5A 4JLPA 1YS1X 5JFTA 5REQA 3DE5X 1KYIA 4UREA 1YRHA 1ZPDA 3JD4A 3CX4A 5EKSA 4XOIA 1QV9A 5E6RA 3FYHA 5EUMA 3MELA 4JBIA 1JLKA 3VDXA 2BD0A 4IM7A 3RYIB 3WYEA 4YHHB 1PFYA 4QVKA 3VMMA 4FW8A 1OZFA 3VR5D 3OSUA 3B78A 4Q9LA 2R8BA 5EJMA 2ZTUA 1BX1A 5GP1A 4I4TB 1KAOA 3V8VA 4CV2A 2NVWA 1CVRA 3HY3A 1PV1A 3LK6A 4K9SA 2DPXA 2JLBA 3BXPA 7REQA 1P2DA 2CLCX 2H0QA 1FA9A 1F4LA 1CG6A 5HOQA 1Z7WA 1PKXA 1U2GA 4UUMA 5T57A 5IYZB 2OGSA 2H11A 5AI4A 4Z99A 3ZDXB 1EZZA 5BSUA 2RKBA 1KL7A 1S6YA 4IIJB 4D9NA 4P1ZA 1SJ9A 4GYKA 4DADA 5I9NA 3ICPA 3ADCA 2IBTA 3KL2A 1GR0A 4V0MA 5SY6A 2GFQA 3PNOA 2VR1A 1RJEA 3U44A 1N2CE 2Q5OA 1PQWA 3DE6X 4BNIA 3BHMA 4FHEA 2AK3A 4QUKA 2GT1A 3RUHA 2C2YA 3FTPA 1GIAA 3QH4A 1YR7A 2DQSA 2ZQZA 3RADC 2WWRA 3FUWA 3MGGA 4LMPA 4D4MA 3A4MA 4FW9A 3U9TA 3I4LA 3ZQJA 2QX4A 1KFKB 2RK6A 2OMKA 1MIHA 3AT1A 2F43A 3KFVA 3NOXA 2FZVA 4HDSB 1WNTA 2W6ZA 4JLJA 4ZU1X 1CUCA 4I6GA 4F85A 4PONA 2AK2A 2Y68A 1ZFNA 3OVMA 1DCTA 1L4UA 1AUPA 1X39A 2J41A 1MBZA 2IYWA 4CKBB 5CEFA 3REGA 5LP6A 1A2KC 3A8TA 2EU8A 1NQ5A 3MSXA 4LHSA 4WY2A 4AJOA 4KLCA 1CUSA 1NJ8A 2PM8A 2GK7A 3OCZA 4M9QA 4C0WA 2ICAA 1DS6A 1DKLA 2QEQA 1TA9A 2QYHA 1SUPA 3ONFA 3FMPB 4HFRA 3ZUPA 2NU9A 1JI0A 1U65A 3E81A 3ROKA 1ZHFA