1MORA

Isomerase domain of glucosamine 6-phosphate synthase complexed with glucose 6-phosphate
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
366
structure length
366
Chain Sequence
GDKGIYRHYMQKEIYEQPNAIKNTLTGRISHGQVDLSELGPNADELLSKVEHIQILACGTSYNSGMVSRYWFESLAGIPCDVEIASEFRYRKSAVRRNSLMITLSQSGETADTLAGLRLSKELGYLGSLAICNVPGSSLVRESDLALMTNAGTEIGVASTKAFTTQLTVLLMLVAKLSRLKGLDASIEHDIVHGLQALPSRIEQMLSQDKRIEALAEDFSDKHHALFLGRGDQYPIALEGALKLKEISYIHAEAYAAGELKHGPLALIDADMPVIVVAPNNELLEKLKSNIEEVRARGGQLYVFADQDAGFVSSDNMHIIEMPHVEEVIAPIFYTVPLQLLAYHVALIKGTDVDQPRNLAKSVTVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSAMINE 6-PHOSPHATE SYNTHASE
publication title The mechanism of sugar phosphate isomerization by glucosamine 6-phosphate synthase.
pubmed rcsb
source organism Escherichia coli
molecule tags Glutamine amidotransferase
total genus 140
structure length 366
sequence length 366
ec nomenclature ec 2.6.1.16: Glutamine--fructose-6-phosphate transaminase (isomerizing).
pdb deposition date 1997-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01380 SIS SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1morA01
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1morA02
1T10A 2V4MA 1XMOB 4DV1B 5FLXA 3FKJA 1HNWB 1VI5A 1TZCA 1IBKB 2AMLA 1XTBA 2ZJ3A 3J81A 4JYAB 1DQRA 3ETNA 2DECA 4LFBB 1N32B 2VQFB 1XNQB 3TBFA 1N33B 4JI1B 4S12A 1JEOA 3FXAA 3PR3A 4EM6A 2UU9B 2ZJ4A 4YHHB 2XHZA 4JI7B 4K0KB 2Q8NA 1WIWA 4U6NA 4NXNB 1B0ZA 4AMVA 4DV3B 4DR5B 2CXUA 3HJBA 4X65B 2ZM6B 2PGIA 4LF7B 3BJZA 1XMQB 1J5XA 3CVJA 1U0EA 3FF1A 4JI3B 2E5LB 1N36B 4LF5B 3QKIA 4DUYB 4JI5B 2UUAB 4LF8B 1MOQA 2YVAA 1MORA 1JLHA 5LMUB 3Q7IA 4JI6B 2UXCB 1Q50A 2UUBB 1IBMB 3Q88A 1N34B 2WU8A 4DR4B 1C7RA 3JAMA 1N8TA 4LZJA 3JX9A 4IVNA 4LF4B 4DV4B 3J7AC 1VIVA 2CXTA 3M5PA 1X94A 2UXDB 1IRIA 4DV2B 5BR8B 2X3YA 1TZBA 1HR0B 4LFCB 4GKJB 4LFAB 1ZZGA 3NBUA 5IWAB 1I94B 3KNZA 2CXSA 1C7QA 2J6HA 3OTOB 2CXPA 3BCHA 1X92A 4JI2B 4YY3B 2POCA 3FJ1A 3IFSA 1NUHA 2PUTA 4DR2B 4B3SB 4DR7B 5BY2A 4X62B 4OX9B 4DV0B 1U0FA 1VI6A 2I2WA 3HBAA 2I22A 1HNZB 2F4VB 4B3TB 2CVPA 2VF4X 3OOJA 4X66B 4M0DA 3T1YB 5A2QA 3J80A 3G68A 1X9HA 3ODPA 1XNRB 1JXAA 4JI8B 2PUWA 2CXRA 1VIMA 3C3JA 4LF9B 3LJKA 1GZDA 1KOJA 1X9IA 2CXOA 4LF6B 4DV5B 1FJGB 1TK9A 3SHOA 4JI0B 4AQYB 2CXQA 2UUCB 1HOXA 4DR1B 1IBLB 3I0ZA 5I01A 4JI4B 5LL6P 2A3NA 4X64B 2O2DA 3EUAA 2PUVA 1G98A 4S1WA 2UXBB 5LMNB 3T1HB 2HHHB 4DV6B 4GKKB 4DUZB 1U0GA 4B3MB 1IATA 2E5FA 2DF8A 1GZVA 4TOIA 2O2CA 1M3SA 4DR3B 4JV5B 4DR6B 1JIQA 3UJHA 1HNXB 2XBLA 2VF5X 2CB0A 5IT9A 1NRIA 1HM5A 4NXMB 2VQEB 2CXNA 3TRJA 1MOSA 4DV7B 4B3RB 1J5EB 4KHPB
chains in the Genus database with same CATH superfamily
2IPXA 1KQNA 3K9FC 2XE8A 4IGIA 1UPTA 2ZPUA 4OYLA 4WOKA 4HH1A 1LV8A 4HQOA 2ILTA 3H2IA 5TJ9A 4BP1A 1HYGA 3CZCA 3FWNA 1X2BA 2EGUA 1ZOSA 2AX3A 1PW5A 2I4OA 3F5QA 2UZ1A 1KJ9A 3IE2A 1QHHA 1XMJA 2FGJA 2OZVA 2P7IA 3BQNB 4BPRA 1N3YA 2VJYA 3JVIA 3MLEA 3TPCA 4RTMA 1ZH2A 2BYTA 3FPEA 1OY1A 3PHIA 3MFQA 1AZTA 1ISHA 4QO7A 1UBNA 2GZAA 3P27A 4IUCS 4JK3A 3EN0A 2HA0A 1Q1NA 3IHWA 4LHZA 4HX5A 4DVGA 3PXXA 4RKYA 3A4YA 3VJMA 5JATA 4B6QA 3HKCB 2EZ9A 1ISIA 1C0PA 3CZ4A 1BKYA 2B8NA 4RHEA 1P9WA 1A3CA 2AJLI 4DCTA 4XYLA 4B6GA 2C4VA 5BW8A 3CPSA 3M4JA 5CDFA 4AM8A 1K0FA 2IHUA 1JH9A 3CRRA 3EXIA 3NHKA 4TPKA 5DW0A 5HKLA 4EZBA 2VBFA 2MWMA 2QXTA 4ZODA 3SQWA 3FZNA 5G1OA 4EG7A 3BSFA 1PTJA 1U02A 4R8VA 4GL2A 2ILVA 3DMDA 4LYEA 3A9CA 4NY1A 1E2JA 4NV0A 4TVKA 4V0MA 4BNDB 2J9FB 4DHWA 5IXYA 3U3JA 5FB3A 1IRIA 2WYIA 5TVGA 1ODCA 3NT5A 2V4ZA 3NBAA 3ZWYA 3R3WA 2OO5C 3HKDB 3VVCA 3PC7A 1U6IA 1RWOA 3ZE0B 1N0WA 5K03A 1E9RA 1HTTA 1FQWA 1JYSA 1DV2A 1C1DA 1G7TA 1U2TA 3RYHA 5L3SA 2OPBA 4PSAA 2WF6A 1I4WA 3HBJA 4LBYA 4NHEA 1VFNA 1VLZA 2FXIA 2HREA 1YHYA 1M2WA 1MZVA 3X2FA 3ZIAA 4JAVC 1YFKA 1ZVQA 3HB1A 4WY8A 1TKAA 1W36B 4U2BA 4CUKA 3BA6A 3JYPA 4HRAA 2FPGA 4P5EA 4D6YA 3GGSA 4XLTA 3O26A 2J6BA 2QRZA 1VZ3A 5GIPE 3ZZNA 1A9TA 1C0EA 1D9ZA 1N7IA 3KZCA 1WBDA 2XV1A 5M5BA 3OJFA 4IIJB 3BOSA 1VKHA 3QI2A 3CB2A 1FJXA 4MGYR 3TIXB 1AGXA 4YTEA 1PDVA 3X0DA 2QLFA 2VNJA 2Y1GA 3ELDA 5NULA 1B00A 2B21A 4UJ3A 1R27A 5I51A 1UXGA 2B8JA 1ZIPA 4TSFA 2IF0A 2BKXA 2AUTA 1HEYA 3JSXA 1XRJA 4J0IA 4MIOA 5KOIA 2ON6A 4RKEA 3AMVA 3GA0A 5FQOA 4C0SA 2FRVA 3TR6A 1AXGA 4P58A 4S2UA 2DF8A 4UULA 1DWOA 1ENYA 1BWPA 3L4BC 3V8RA 3A9VA 3RUDA 2Q2VA 1YFZA 4V3BA 2X5JO 3W5SA 2HADA 3LHKA 3B7GA 3NALA 1N2EA 3JQEA 1H4QA 1QHSA 2W83A 4OI2A 2AN4A 3CN9A 1ZNXA 4KDFA 3PVCA 3RASA 3A4LA 1ZJ4A 3CSUA 1BVUA 4JLSA 4G09A 1EGHA 3DZDA 2GOYA 4J0CA 1EFKA 3QHAA 4JBGA 1P5RA 4NYMR 5THQA 3UIEA 1L4MA 1Z83A 4H7PA 4MS4B 3NAZA 1QONA 1XV5A 2RGWA 3O9ZA 3PE6A 3QX7A 2ZJ3A 5KYNA 2X8WA 3CM0A 3O4VA 2I8LA 1QIFA 2INGX 3LP5A 3LT1A 3CVOA 2IH2A 1KI2A 3UQZA 2VWGA 4ARCA 4QSHA 2H54A 1X38A 3AJDA 3QKWA 4IJWA 1KEWA 3VBEA 4D4LA 2I6UA 3ADBA 1DKLA 2VLIA 4OGLA 3SZUA 3C6MA 2B4KA 4X7MA 3T9AA 3DZBA 5GV7A 4QBKA 1S9HA 4XLLA 3INGA 4I2NA 2RGUA 2VWHA 4J0QA 1PJBA 4JP5A 1PBNA 1DIGA 1RADA 4FM9A 1M0WA 3QNWA 2H0AA 2CLHB 1K7YA 1QKIA 1MIOB 1U0EA 4Q4CA 3EZFA 1J33A 2ZYDA 1LY1A 4ND4A 1O7JA 2IXGA 4I81A 4C0KA 4WGFA 4PIVA 4OKIA 4PAGA 1NBWB 4UMFA 4HXEB 1YK0A 4CF6A 3A1TA 2FEPA 2JW5A 4R9UC 1POXA 3P5SA 4JEMA 4NFLA 3HCDA 2X9LA 3KTOA 5GPBA 3KUDA 2QX4A 3PZRA 4E30A 2HMTA 5BOSA 1ATIA 1D2AA 1NBMA 4FQ7A 1JRLA 4HGPA 1QIGA 4HSEA 4JSRA 5CUQA 5BW4A 2C96A 2ZYHA 1K86A 2XUPA 2F48A 3BL5A 3KXKA 5GADl 4ADSG 1YB5A 1IJEA 1RJDA 2D5BA 4AZWA 3F3YA 4KR9A 1C9JA 2OCYC 1M72A 1KMMA 1UJ2A 5JUWA 1RACA 3KVRA 3OTGA 2M6SA 5G3ZA 3CLSD 4LSWA 2AIRA 4MW7A 2VHJA 1YZQA 1OXKB 2D2VA 3T3HA 2HL6A 1E1RD 1JYFA 2WM2A 3AVPA 1F48A 4NATA 1BKDR 4TUYB 1XR3A 3U49A 3USES 2F3QA 4C5AA 4EELA 2R66A 4UAJA 4Z54A 3H1BA 4UTPA 1QGDA 2WJAA 4D4GA 4EG1A 2R0QC 5I7RA 3QX9A 4ESHA 1IK6A 4MQUA 4MWDA 3WGVA 3C3KA 3OC0A 4PYLA 2VJMB 5JRJA 2BL4A 4EECA 5HF5A 1WNFA 1N2CB 3EVAA 3USCS 2HA6A 3OZVA 1G3UA 1KU0A 3NIFB 1VIMA 5ES3A 1P1HA 5EMHA 1M75A 2OY0A 2H29A 1TVEA 1PT6A 4FYIA 1LCIA 1RJEA 1YUMA 3D31A 3EUFA 2CGEA 3K8QA 3KRTA 3LF2A 4H3HB 4J91A 4O4HB 3ZZUA 2PN1A 1VIAA 1TO6A 3TIFA 1FUKA 4BS9A 1TMKA 1QHEA 4WVLA 1BDJA 3CPEA 4IVQA 4XEHA 4LJ9A 5HIIA 5IFKA 3PLAE 4Q1CA 1M2NA 4L3WA 3PT5A 3FDXA 2GVNA 3GH3A 2WYUA 4W9RA 5AQEA 5AVOA 2PEYA 3KU1A 5AJZA 4MYDA 3QTLA 3IAAA 4A6DA 1J06A 3G2KA 4BVEA 1VFPA 3HBLA 1U3VA 4A0QA 3I2YX 1G8SA 2PNFA 1JN0A 2NZ8A 1KMQA 5HBRA 3RAPR 1YMVA 2Z2IA 1VMAA 3WNCA 5J40A 3B6IA 2HPZA 4OFZA 4FZJA 5L3ZA 4A0GA 4RDXA 3N2EA 3K1AB 5DH9A 4Q7KA 2PH7A 3G79A 1TK3A 2VDMB 1LLQA 4E6EA 3SBDA 4X6YA 4EVRA 5K0SA 1S2MA 1TD9A 3NHMA 1VCNA 3JWPA 1M34A 2ZROA 3CMMA 4MUNA 4MVJD 4XD7A 3WLHA 2GN2A 2CLLB 1K4KA 5CNMA 3OECA 4YMGA 5K8VA 4ZYLA 3I42A 2O8FA 3PNLA 4CMEC 2BD0A 3A05A 1JHMA 4RD0A 1WXHA 4PLFA 2HMUA 2ZSAA 4D42A 2BMDA 1JIIA 5FPYA 4G89A 3KQNA 2IXEA 5K0EA 1X1QA 1BXGB 3TW6A 1PTKA 5IK2A 3STVA 1OKKA 1E7RA 3EW7A 3HKBA 4EHLA 4UM9B 2IDMA 2VR1A 5B3KA 2DAPA 4EA7A 1TW2A 2E87A 3VR6D 1PJTA 1BMFA 1LQTA 3BA1A 4M1ZA 3H4IA 3QFHA 4PC7A 5ICMA 1BU8A 2P75A 4ZGWA 4Q15A 4Z4EA 1YL5A 1APBA 5AJUA 1E1QA 5DHTA 3DF7A 1E2EA 1LBHA 2SKEA 2XB4A 2XNDD 2XCIA 1DSSG 2QSJA 2IYYA 1XB2A 3KR1A 5DHSA 3W1EA 2J9YB 2O3JA 2PRJA 4QPDA 1S3FA 4RKQA 3S8EA 1X7WB 1AM4D 1XYGA 3G0BA 1GCAA 3ONNA 7REQA 5GZ1A 1MZPA 1NMXA 1SVUA 1Y4ZA 4JGGA 1CD5A 4R40A 4ZCMA 2XXAA 1PJ2A 1UDBA 3DMNA 3RS5A 5DB4A 4ZPXA 3UATA 2GCOA 3PQ2A 3HYRA 4MRAA 3FFWA 3I5YA 2N75A 5BWNA 1EVKA 3SS9X 3KHTA 2VSYA 2G04A 3RSQA 2ID4A 3S55A 4GU5A 2YICA 5E9WA 1BAPA 4GL4A 4RZIA 3GEIA 4Q37A 4Y7CA 1RYBA 3HXTA 1X19A 4NZOA 1XOIA 5GP1A 2AI2A 2YN4A 3VHQA 4M36A 4HFJA 1Y9JA 4D9MA 3LQQA 4AZVA 1W4AA 4PC1A 3BWCA 1IOZA 2XA2A 3TCNA 2H3EA 1FPQA 4HFMA 4JJ8A 1NDQA 2EOAA 3G2MA 2D0IA 2ZU0C 3DSRA 3HCNA 2PZAA 4JUIA 4LJSA 5AM5A 1M54A 4FKBA 4A82A 4RW0A 4PYRA 3EYWA 2Y99A 1OWOA 1KO7A 1ZPDA 3WTBA 3V32A 4XVCA 2A1UB 1FP4B 2Q99A 1F4PA 4A2CA 1V8ZA 3VU3A 4IFEA 3EUWA 4OJQA 1XEXB 4UUPA 3SHOA 1N8NA 5IC6A 2V74B 3G8YA 2DLCX 9LDBA 1T9ZA 3BH6A 3OCVA 1CPYA 1VYTA 1QLJA 2ZRBA 2JANA 1OMOA 4PX9A 4X64B 3PXAA 2J09A 3HMKA 1NFQA 3SR0A 2YV5A 1XDWA 4WKCA 1XCMA 2XAUA 5IS2A 2COUA 2QW8A 1HOTA 2ZIAA 4TL7A 4YWHA 2XXBA 3KTAA 2VG8A 4EI7A 3H5IA 1CJKC 4IIEA 1PJSA 1FVOA 4QGSA 1YASA 3S29A 4M0FA 1C7IA 4MEBA 2Z8YM 2FY8A 1OWMA 2WD7B 3ED5A 4DR6B 1JIQA 1W19A 2Q3LA 1M2FA 5ALFA 3TZCA 1HI9A 3H19A 2EBFX 1E2FA 5B6JA 3KXPA 5IKMA 1W35A 3FTEA 4B4OA 3B1ZA 1IQ0A 3UC9A 1XJ0A 1DWQA 5DRYA 4BVJA 4G4IA 3QW4B 1YAJA 2WJHA 1CNMA 4XIGS 4L1KA 3TFWA 4JQOA 4ZI2A 5DN6D 3MHTA 2MSKA 3RT1A 2XE6A 1Y7LA 2ARKA 2G82A 2R8BA 1XTBA 4HB4A 4OBBA 1GQ2A 3NTUA 4QOGA 3GN2A 2VZ0A 4E21A 2PV0A 4EGFA 2NU9B 1EQ2A 4YFYA 1N32B 1EA7A 3CX4A 4NYMQ 3TLEA 4WLOA 3DT6A 3FUUA 4GX1A 3OQMA 1H05A 3GJ0A 1KI1A 2AEFA 2CFSA 5CYPA 3TE6A 3LK7A 4ARSA 3G49A 3TL3A 1FDIA 3B5EA 5DRTA 1NE2A 1MGOA 2P8SA 4C7MA 1OTXA 2XNKA 2ZBQA 3HE3A 4DJFC 1R88A 1Y4UA 2NTJA 2XB9A 3LP8A 1KE1A 4HEQA 2QE7D 1RYMA 1H2WA 3P2JA 1GZ4A 2YCBA 2H2FA 1NNEA 3CXRA 4QXMA 5I4CA 4U7PB 1GZ5A 4RDCA 1L1FA 3RRZA 5FTJA 1RI4A 2WHYA 5CCDA 4MQEB 2QAIA 3RJ9A 1OB2A 5KNDA 2K4MA 4NU0A 2V3WA 3MWEA 5DULA 2C8LA 1EXWA 2CXTA 3HJFA 2YXBA 3BQ9A 2GJKA 3CLVA 3EMKA 3V7FA 3W8FA 2WUVA 1SVLA 3QK7A 4BE9A 1RQ2A 4AO8A 1UBCA 3O0TA 4A9AA 2NU7B 4EEZA 1FLDA 1KHTA 1V5FA 2TMGA 5DHRA 4HNVA 3NV9A 3AVYA 3H5OA 5FI3A 5C8VA 2KM1A 2IZOA 2AXNA 3BH7A 4URFA 1VE9A 4ZYTA 1CE8B 1JXQA 3T6KA 4HVTA 2EHDA 4WTOA 1KFBB 5KVSA 3NNSA 3EEYA 1AHHA 3JASB 3ZWAA 4RD2A 5DM4A 5KUTA 2G6TA 3OU2A 3DEFA 4ONEA 1UC9A 3QZUA 1V47A 4F4JA 3OQIB 1OGJA 2JNWA 2QPAA 3TJRA 2FWPA 3QYFA 3I64A 4MYCA 3CZAA 2NU6A 2L69A 5L4LA 2NQ8A 2I6FA 3FFTA 2X4DA 2NUPA 3THWA 3GT0A 5AT1A 2GYYA 4JBIA 1LRKA 4ZCPA 4HDSB 1B15A 1IY1A 5GONA 2ZVQX 1HOXA 1YDHA 1KORA 4J1TC 4OMUA 2AFRA 4Y2YA 3RYIA 4KR7A 1PFGA 3G2NA 1H9CA 2EFEB 3FSEA 1K5DA 1TJ3A 2VYVD 3T99A 5BW5A 1QFYA 4NK4A 3UGQA 3CURA 3COWA 3ZIUA 4G41A 3TRDA 2Z43A 2GN0A 4WFQA 1N3LA 2D3WA 2RIPA 3SYNA 1BFUA 3DMGA 3D8TA 1VRCA 3OIWA 1NIPA 3L8DA 2OXIA 1R6XA 2OBNA 1AQLA 3QVLA 4BV9A 4UCXA 4DIMA 5J2UF 4ZO8A 3VR2D 2Q4RA 3EFHA 1ZRNA 3AR9A 2F1IA 3AO0B 5CA0A 4D3ZA 3O31A 4HYEA 4O4JB 1BE6A 2PBFA 4DJAA 1IJBA 4WN9A 3W3AH 1JDUA 1JJFA 1H65A 3LOQA 1EHYA 5FLYA 3EXFB 1LLUA 1IHUA 4UNSA 1K6XA 1DBIA 3ABRB 5LQUA 2NV0A 1J0XO 4HATA 3WAJA 2X15A 1T9KA 1BO6A 3VR3D 3OQBA 5J63A 3CCBA 3DBRA 4X54A 4MPRA 1IZ9A 4RHTA 2G70A 4EG3A 3FAKA 2VAMA 1DOZA 1UQUA 2GPWA 3HN6A 1Z2NX 2JLCA 1P2BA 3EQ9A 3OA2A 1NVTA 5F7ZA 5K6AA 8MHTA 3Q5EA 4CQLA 4KW7A 1Y3FE 1U6KA 4EF5A 4KXVA 1R8YA 5IZ4A 2M1XA 2PSFA 4PTLA 4RMIA 3TNFA 4TRNA 2EBUA 1KEKA 1K5GA 4FX2A 4DEYA 4Z8XA 1OVMA 3B12A 4IKPA 1KJ8A 4AKSA 3I9LA 2QYOA 2ZTMA 1R37A 4ER3A 2MSCB 3DLHA 4HXFB 2RONA 4A16A 1EYZA 1S1CA 2JIRA 2JGEA 1M34E 1G8GA 1C3VA 2FPUA 4I55F 3Q85A 4O3FA 4JY7A 5AESA 4D0SA 1PK9A 2H2AA 2KW5A 2IF2A 1E2GA 3OJ0A 2IP1A 4HUQB 5TGDA 3BDVA 4K28A 3WSWA 4DBZA 1ZU5A 1HURA 3LZCA 2Y71A 4MQ6A 1IZ7A 4DLKA 3F6BX 1T4CA 2FPLA 4XSHA 4ILEA 4RKRA 2RJ3A 3ZS8A 2YQ4A 2YV2A 3GRFA 1MW8X 3B3GA 4MR8B 3NBFA 3H99A 1DBSA 5ALWA 1J0AA 1XKLA 1Y7PA 2HY7A 4GR5A 3UPDA 3T54A 2OAP1 3JQGB 1U0OC 4JI2B 2HXSA 2HU2A 3DVLA 1SB8A 1DO8A 1RE0A 3IUMA 4Q4JB 3C8MA 3UCEA 5KOJA 3M83A 4KE6A 3U4AA 1Y3BE 2V58A 3THXB 1LWNA 1T3GA 1T6ZA 2UAGA 1AV6A 2VXBA 3C85A 3NDRA 2WMOB 1Y98A 1XC7A 4IRXA 3QXCA 1EDOA 4AP6A 1JI3A 1YZHA 1A9XB 2YINC 5B1DA 2F8TA 1E9FA 1U9CA 2HN9A 2QP9X 5ER9A 2GN8A 2ZR7A 4ND2A 3D8SA 4ZYZA 3J80A 3SIWA 2Q4TA 1CX9B 1SG6A 1X80B 2AD1A 4TLDA 4CFYA 4KPGA 5CA1F 2G07A 4TKLA 5KWIA 1GGVA 3NB0A 1KTVA 2V65A 3RKSA 4NULA 4F3KA 1OUMA 1CJBA 1V4VA 1HLDA 3JD0A 3M70A 3MNFA 4HX2A 3WL3A 4C05A 1NQXA 3JQAB 4AJJA 1NXWA 2C2OA 2QTNA 2XITA 5DX8A 4LRXA 4NZZA 1VE1A 1QU2A 4QM6A 5CCXA 4UHHA 4ZA2A 5D6NA 4HKTA 2CMDA 5ECYA 3AR8A 3AFGA 2DTDA 4AYTA 1UBFA 1J21A 4HVAA 4LJ7A 1UANA 3LT0A 3F71A 5JV5A 1DG9A 3CCCA 4XUDA 3BWDD 3DYIA 3EWNA 3KDSE 2V7XA 3CNNA 4E3ZA 1RXEA 3F98A 3QJGA 5CH5A 5F78A 1CU1A 4MV3A 5FADA 3A1VA 2DH6A 1RBZA 2ZM5A 2YHIB 4RL4A 4ALJA 2IJGX 2GSDA 3EUEA 3K70C 4OGWA 2G63A 2Z8XA 2FUEA 1T3LA 3W3AA 3HACA 1NY5A 4M53A 5I9IA 4PN7A 3RWOA 4HP8A 3ZIAD 2R65A 3AESA 1U7PA 1ZRSA 3VR0A 3GIWA 3JQCA 5EQTA 2V7BA 4DA0A 1VHDA 1W9HA 2H1SA 2V4MA 3FF4A 1QHIA 2HSEA 4YRIA 4CQNA 2BPOA 2H4ZA 1I2MA 2Y05A 4YB8A 4CCYA 2JL1A 2PGAA 3L1HA 5BV7A 2UYGA 4P38A 3TZBA 4MGKR 1LDNA 2LE0A 5J58A 4B40A 3OD1A 4XJXA 2E21A 2J7PA 1F3OA 1QPZA 1JS1X 2O0MA 2VQFB 1VMDA 2HEGA 3EASA 1JHPA 3RAGA 4MWCA 4HT3B 2CV2A 5I8PA 1XEFA 1QG0A 4TSFD 5LYJA 3VAAA 4DWVA 1ONSA 2ZUDA 4JVNA 3QGMA 4PHGA 3P0IA 2E4UA 2V6IA 4MCJA 3PHCA 2QP3A 1B8NA 4R3UC 5J5VA 2B92A 5JTTA 1G4AE 2CLKB 4NXNB 2VAXA 4QDKA 3IAUA 2J45A 3ZWMA 2BONA 4ZP1A 1PV4A 3EXG1 4YV2A 3T7AA 5EEGA 5FA5A 4OI0A 2H4WA 2QS9A 3PE3A 1CVRA 3QXJA 5TMDA 1VL5A 1KTIA 1ZWKA 3LUFA 3Q8WA 3R1IA 2QVYX 4RK6A 5F35A 6REQB 1V2HE 2JI8A 4GBED 3TSZA 1TGVA 3I6QA 2CNDA 1W2WB 4AN1A 3GB9A 5JFOA 1DBQA 3L4KA 3V8PA 5KHOC 4YGYA 4JSYA 3E9DA 3KQHA 3MWFA 1J0EA 1FDUA 1RXSA 4BFTA 3VU0A 1XCLA 4ZOLB 1XF9A 4E12A 1BVRA 3GP3A 5EHGA 5CB4A 4ZD6A 3RYCB 4X8MA 2WINI 4TMFA 1KKLA 4A03A 3E22B 3EXHB 3LX5A 2W6CX 2WZCA 5ALKA 1OHHA 2JIMA 3IB6A 1XCOA 2H16A 2WY2D 1P45A 1R10A 3I12A 3PUZA 4OXXA 1KWKA 3RT7A 5ISMA 1QGED 2G5PA 5C32A 5FEUA 1E79A 1NXTA 3GBSA 1PNQA 1EP1B 4EX6A 1D1PA 4FBGA 4J94A 2HK6A 1N75A 4JEHA 3N2KB 1SKAA 2JKYA 1KDTA 1Z0KA 4RULA 3FOWA 2PJZA 4RK1A 5F7JA 5HJ7A 3LF1A 2ZJ7A 3UEOA 3WLPA 1SVOA 4EVQA 2JI7A 1UR5A 4KC0A 1I4OA 1DKOA 1NLMA 3GK3A 3KL2A 1Q21A 4CODB 5THXA 3AEZA 5J1TB 5B55A 4G97A 1YA8A 2R4QA 1T4DA 2WIFA 2ET6A 3A7EA 3O75A 3PL1A 3RO7A 1I5EA 2Z95A 3ET4A 1C3OB 4BWYA 4PANA 1KR5A 5C34B 3Q2KA 1NBMD 3GXOA 1Y7IA 2WKQA 2J3EA 4UTXA 3VYSB 3NAMA 2IXFA 3BVPA 3U56A 2ZJ2A 3IVXA 4C6TA 1JDTA 4B47A 4EJ0A 1TZMA 1NUAA 2WKSA 5B2ZA 5BV1A 4US2R 3IQGX 3C3YA 2G6BA 2GHTA 1CUXA 1UC4B 3RRMA 5LQMA 3KQUA 1R0RE 1Y4DE 2D0PB 3E81A 3ETGA 5HF9A 4LJ8A 1GSHA 1FNCA 3H3XA 5B37A 1CJMA 3DHWC 5H4HA 1A77A 4CDGA 1M9NA 1X9GA 1YB4A 3L7IA 3OMXA 3O8RA 3ANSA 4I50A 4YV1A 4U7GA 1U3DA 1OAAA 2IIQA 2ZQZA 5C80A 1WCV1 1KVTA 3UOAB 3SBOA 2BFPA 3DZGA 4PBTA 3JPYA 4BMZA 2YYSA 1G8PA 1F2UB 2BKLA 4MYSA 3RPEA 2BKUA 4GI1A 1M8JA 4U9HS 4CIDA 1W36C 3RS0A 4BECA 5ECGC 4LCEA 3F90A 2VPQA 4WK4B 4YA6A 3DR3A 3MAJA 4J49A 4MW1A 1ZGGA 1GU0A 3FKJA 1L7EA 3KQTA 1LV7A 2XQKA 4FOSA 3OCYA 5BYKA 1H66A 2H1OA 2JIBA 2IYTA 4ETMA 1DV1A 1V9SA 3SDBA 3OQ1A 4KXQA 1HQDA 1F5NA 3RGWS 3M6IA 1MOPA 1FBNA 1DC5A 4JT8A 3WNVA 5T4FA 4ME6A 1YJQA 3HEBA 5G0VA 1H2EA 2QRJA 1RT9A 5AI6A 5A05A 4IDBA 2QPTA 5JCOA 1YZUA 3TQFA 1V11B 1GZSA 4X6UA 1G2PA 5AW4A 3RTBA 4BWFB 1GPKA 1Y5IA 5C1PA 4XFDA 2HK9A 1MAVA 3OLVA 1IZ8A 4G0QA 1V6CA 3DAPA 1F20A 4HYYA 4ED9A 3KL4A 3EGEA 4TGLA 2BTOA 4EMTA 4NABA 1J8MF 4CKYA 3IDAA 5IVKA 1JLHA 3P9SA 2R7AA 4ZVVA 3WSVA 4ZICA 2AEJA 4FWIB 1N1EA 4Q0MA 3NR2A 1QQTA 4JT2A 2DPMA 3KKLA 1JV2B 3A58B 3PKIA 2ZCVA 4QJIA 3OTWA 3H9JA 1P1CA 1H8HA 3AIOA 3ZI7A 3L7CA 4UJ5A 4XD7D 3DEKA 2FSVC 5FIUA 2JZCA 5BMVA 1V6AA 2GRJA 1XRQA 2W6OA 3H1EA 2DYKA 3UKJA 5DDIP 4US0R 3B6ZA 1GRQA 5I6DA 1MT0A 1JEQB 1JSRA 3O6VA 2NM0A 1RMYA 4V0NA 2F8MA 4P34A 3OT4A 1SG9A 2J3IA 3PGJA 4EZEA 1BFDA 4UZSA 1B8VA 3HV0A 2FQXA 2QM7A 1UM9B 3GHYA 2CYCA 2QGZA 6PFKA 3TKAA 1OKKD 2AR7A 1K6IA 2BEWB 2QZPA 4UDXX 1A1VA 1BKSB 4FDAA 3GUHA 4HPXB 4CM4B 5A0VA 2XIQA 3U6KA 1XLUA 1BMFD 3JVDA 4RF4A 3ZLTA 1R3UA 2WU3A 1XPRA 3EIEA 3CNBA 4JBNA 2XBMA 3V6LA 4QELA 1R6BX 1I51A 2FZ4A 1E1QD 4RFVA 3ZWVA 5THKA 1W5TA 3IQEA 2FR8C 5TEWA 1J7KA 3DZ8A 3IA2A 2ZANA 2VYQA 3QPCA 2HF7A 4NCXA 4PO9A 4OQQA 2WJPA 3TCXB 5KZMB 4DMFA 2WTAA 5G4KB 4RPIA 1JR3A 2HSDA 3UVEA 2EXXA 1Z6PA 5EWJB 3DV9A 2CUNA 2A9QA 1P62B 1S2NA 3CW9A 4Q6WA 2PX8A 3L0DA 4KAJA 1Q92A 4CKZA 1ZGCA 4XWOA 3CLKA 3BX1A 3EF3A 5GY7A 3TK1A 5M04A 1YTLA 3P0JA 4IWYA 4KDEA 4QXAA 3AY7A 4DA6A 3AY6A 3SJCA 4ZIRA 1EG7A 3KFLA 1ITZA 3KEFA 3QLEA 4E5MA 2WI8A 3FMOB 3CLTD 3O92A 2FJUA 5F2KA 4PS1A 2FX5A 1SKUA 1K3UB 4Q24A 5KHLB 1L5QA 3EIXA 3HPQA 2ZU6A 2DETA 1YIDA 5CIWA 1K89A 1DLIA 4NZYA 4R1QA 3T1QA 3F7MA 4H7FA 4YIKA 1AKQA 1CRZA 2JGDA 1ZUNA 1FDTA 1WDMA 2X5KO 1HYHA 1P44A 2ADOA 3DM9B 3I6ZA 4BDSA 4ENSA 4QJ3A 2ZS7A 3HJAA 5HIJA 2OV8A 1EVLA 3QHQA 4AMZA 1QV6A 5AW0A 4JITA 5KQSA 1V8DA 1N0VC 3ZU5A 3SZGA 3OT1A 5ELLA 5EZYA 4G4JA 5J5CA 3R6DA 1XU9A 3PLRA 4U3JB 1UMCA 4IOJA 4U2CA 2CSUA 3WWPA 3HFJA 1GDDA 3DO6A 2VRNA 4CV2A 5EE3A 2YQ5A 1CZNA 2YW2A 3DB1A 3EJ6A 2PLAA 3L0PA 3DUFB 4FNOA 2VPPA 4PLHA 2FRDC 3UMCA 1DTWA 3MGCA 4P3YA 4U2GA 4HN2A 2OBLA 1PK8A 1ORTA 2AC7A 2PGXA 1ZN8A 4Q01A 2GDZA 5GV8A 1E9CA 1FLVA 3BHNA 2O2SA 1JTVA 4ZMSA 3CR8A 1T9CA 5LQSA 3QVKA 5KYXA 1P8AA 1E66A 2Q07A 2VPXA 2YH2A 4U4AA 4B82A 2PMCA 3Q2IA 1HA3A 3OY2A 3HJHA 4JMPA 3U26A 2ZIFA 2OL4A 2UXCB 3FVWA 2WF5A 1ZK1A 4BVAA 1UDCA 1KF0A 2ZRPA 2JZNA 4UTZA 5B1EA 4LZLA 3ZWXA 4IGKA 1N8TA 5HNKA 1YRQA 5HFJA 5I48A 1GTG1 1H6BA 3AF3A 1TEVA 3WLJA 3KHUA 1H2FA 4IICA 2W00A 4HVLA 1O4WA 1P9OA 1D04A 1GT91 4HAIA 3L07A 4Q1DA 1GKYA 1KY4A 1GG9A 2OCIA 3KBBA 1N7GA 3JAKA 1E1LA 1Z62A 3C41J 3U62A 5ED4A 2CJWA 4EKDA 1DNPA 1W5EA 1SKBA 1SZJG 2BFCA 2CXSA 2JFUA 2C3MA 3CW2A 1YDWA 3COVA 2DU8A 4P08A 2VNKA 2AGVA 1EA5A 3S2FA 3UT5B 3IIMA 3LHSA 3KEGA 3PDWA 3O73A 2XW6A 4OXRA 4KDRA 5EIOA 2BZSA 4EY4A 1ZSVA 4CJXA 3KOUA 3U5TA 2ZWPA 4CLOB 1RLIA 2NZVG 1NQTA 2Y2UA 3EZ2A 4NOKA 5AI9A 2NZYA 2YVQA 3F5SA 4D2IA 4RCZA 2VDJA 2X6TA 3G9TA 2ZB2A 1BJTA 2XUAA 3BRWA 4ZANA 1WZCA 3R9IA 4YMUA 1SUEA 2DSNA 2XMCA 3RVNA 2VBCA 1FE8A 3LCMA 3WHPA 3SVTA 3GQBA 4TM7A 3CVUA 1YT5A 4RU1A 3HA3A 1TD1A 2M2IA 3IUSA 4O0MA 5CM2Z 4P54A 5KQMA 1QJ4A 4CTKA 5E3IA 2Y1OA 1JG6A 4S1NA 4AY5A 1SU7A 2COKA 5KNDD 4BX3A 1YKFA 1NJ8A 3VZBA 4F8YA 2A30A 1UMBB 1DCMA 2E3JA 5AVSA 3L1VA 4Z4CA 1AHIA 4AMGA 1GM5A 1G9SA 1NBEA 1UL1X 3QELB 4IEEA 1UBRS 2P69A 3Q72A 4GP6A 4JOQA 4F4HA 1U8ZA 5CVTA 1ZMRA 2FK8A 3E7PA 4RD3A 2P4UA 3P9RA 2X1MA 3NX4A 5CFZA 2F6RA 4EHFA 5HP4A 1NW7A 1QFZA 4GRAA 1JG4A 5LA6A 1E69A 3TRHA 2X5NA 4I4LA 4TVBA 4FR2A 3FPGA 1GPYA 1J7JA 2QVGA 2VF5X 4OYYA 1T0IA 1CZKA 1YFJA 2HI0A 5TF0A 3OEEA 4KR3A 3DJFA 5DBFA 4PYJA 3IXQA 4WE3A 5LQDA 1TMYA 1QHGA 4P4UA 5H8WA 1AMNA 1VXOA 3TCKA 2CEKA 3ZBUA 4DAOA 3BAFA 2WIAA 2VJLA 3L6CA 5E6RB 3OURA 1UPCA 5ALEA 4O8CA 5E8JA 2JHFA 4CLRB 3KKPA 1HZZA 5AK5A 1FTYA 1ZKMA 1K1EA 4Q3AA 3PDIA 1Z5UA 1PGPA 3L0OA 4RVNA 1G8JA 3L40A 4N65A 2R96A 5CW1A 2C7BA 2QRLA 4ALIA 2Y1EA 1RQNA 2QRQA 2P65A 2D1YA 2G71A 2RI6A 3WDLA 4L7VA 4B3TB 5JT1A 4UDNA 4BKUA 3G0HA 2H06A 3LKBA 5DNYB 3EWAA 5LMZA 2XODA 4RY9A 3C24A 1VMEA 3AC0A 2E5LB 1B16A 1FMLA 2WNSA 3OTIA 4LQDA 1NFFA 1ZUD1 3DD5A 3GYGA 3OZIA 4FFOA 2VZEA 4S35A 4R1TA 4IQGA 5H70A 5KDDA 4DIOA 3BKXA 2N42A 3ELUA 4LC9A 4NC9A 1H6CA 1MJNA 3UJ9A 1I9CA 5DNUA 4TXMA 1T13A 1HE3A 2P9YA 2WHEA 4JU9A 2R11A 5FUYA 3AUKA 1ISGA 4IOKA 4I5FA 3RTCA 1E2IA 4CEJB 1DCKA 4HB0A 4FR5A 4F6LA 5C7IO 3SX2A 4JXJA 3QPAA 1RRPA 1CP3A 4ZZ0A 3EG9B 2WAXA 1J49A 4YJFA 3AHIA 4RK7A 4ISCA 4A23A 2RHLA 1M6NA 1QRSA 3R5KA 4Z0TA 1GA6A 1SCQA 4LFCB 1XCBA 3K9CA 3EGXB 4QECA 3DNFA 2Q1UA 2E0IA 1CDEA 2PL1A 3UOGA 1DWUA 4Q9DA 1GTSA 4IHQA 4F8EA 2HRZA 3L6BA 3O4FA 1U0JA 3IOEA 4G6ZA 2J0SA 3DAYA 3DTNA 3FJ1A 4OHKA 4C21A 2WJGA 4GNRA 2APJA 4OHXA 3T5AA 1O08A 3Q0TA 2QSUA 3GNLA 3ON5A 4YFVA 3RR2A 3OHPA 3UA4A 5K6TA 3C3MA 3FCSB 3GMTA 3QVGB 2X2FA 5D3ZA 3KOYA 4DLZA 3O3NB 4X7RA 3WMXA 3S4YA 2JH8A 3LUHA 2QVLA 3IOCA 4HBZA 3OX1A 3UWKA 3ZQUA 1WB9A 1KYZA 3VNUA 2W2XA 4HRYA 3O21A 3SSAA 3HBMA 1C4OA 2IOYA 3NHJA 4FYVA 3HM2A 3KZ1E 4BYMA 2WQ7A 1X7DA 2ISQA 3UYLA 1H3EA 1LX6A 3ENZA 4UQOA 1QTIA 3HGMA 3IURA 3LBFA 4XWGA 5HMMA 5I7HA 3AERB 3U9LA 2IUTA 5DWQA 4ZTBA 3NANA 3OX4A 3G1UA 4NBUA 1Y8ZA 4Z8YA 3HWRA 1KRXA 3G9XA 1CV2A 3KD2A 3N7UA 2EP5A 4IMJB 5DHPA 3T1HB 5F1OA 4EI9A 1GO2A 5KYGA 1OB5A 2XCOA 4DUZB 5CG1A 2ZLBA 1JGTA 1W8IA 4D43A 1VSVA 2J9ZB 2ZDHA 1K75A 3WGJA 5I3ZA 1XMXA 2EFDB 1C7JA 4QTUB 4GVLA 1WCIB 4L50A 5I7OA 2DUJA 3ILVA 3GOHA 3FOBA 5IH3A 4Z3KA 1TADA 3AOGA 2I76A 2IDKA 1E8DA 2HPHA 2BFMA 3U1VA 1G3QA 2BR3A 4UD6A 1JAYA 4XTCS 1W0JA 4PQFA 2QR2A 5SZKB 3HFRA 4I8IA 1P0PA 1WVIA 1P6QA 4E5YA 3A2KA 2WQZA 4GNKA 1M10A 1MVLA 3KR2A 1JR3E 3QV2A 4Y0AA 1DFHA 2R5FA 4XYGA 4E4YA 3R6GA 3QVWA 1NVGA 5K3FA 1K98A 1XQXA 3MT7A 3NVDA 1JIUA 5JPIA 1X6VA 5F98A 3OEYA 4HLNA 1N2JA 1FFWA 2EFGA 4LOJA 1MC1A 2EKPA 2X0EA 4D99A 2OQIA 3HWWA 5DNWA 1BS9A 2P41A 3LCJA 5EJGA 3L01A 3QUAA 2B69A 4GUAA 1ZLYA 5KMGA 2MR6A 2Y4OA 5FAXA 2OHJA 2QB5A 3UY4A 4AUKA 1NHGA 4KFRA 3CF4A 4XR4A 4RVGA 1W4BA 3BXXA 5KTRA 1R0SA 2Q0QA 1BGXT 5J4LA 3OM1A 3NP7A 3ZDQA 4CPDA 1Z08A 3IUPA 2Q29A 4F9EA 3JQPA 1PW7A 1VA5A 3WAGA 4LXXA 4Y2VA 3TDNA 1D4FA 4DLLA 3I62A 2ABWA 3GRUA 4GGPA 1T6NA 4F1JA 4KPUA 2OD9A 2PH1A 4WMLA 1AN0A 2H18A 2PAFA 3DLPX 1O0SA 3HGQA 5KWVA 1RWVA 1G5PA 2PVSA 1E6CA 1SQGA 2C3OA 3A3NA 3CGGA 4C2AA 2O3SA 3VSAA 4BNGA 5CXUA 1QVZA 2Y0BA 2ZI9A 5B58C 1QTNA 5CRIA 5IJWA 3IOBA 3E7FA 3W05A 3IO5A 2YXPX 4XIYA 4HD8A 4LHSA 2H57A 3MBIA 4IXDA 4J7UA 1E96A 1S4MA 2YW9A 1HR0B 2O0KA 3H86A 5IJ9B 2JLYA 4BB5A 2RGNA 4DXDA 1RXUA 4LFAB 2RSLA 2DFTA 2XVAA 3R09A 2WFZA 2J7PD 2RHOA 4RSGA 5EMLA 3W7VA 4MMZB 5GGXA 4AI6A 3GGDA 2IHJA 4KIJA 4X91A 4XSVA 2CDRA 1N9GB 1P2FA 3WDKA 4JB3A 2OMKA 4TV9F 4FYXA 5DYNA 3UUGA 3JRXA 1OXVA 4RV4A 2XZOA 3COPA 2EF0A 3L0BA 1ZBDA 3K0CA 5HM8A 3N2GA 4YAGA 4YASA 1P7CA 5DP2A 2IV7A 2WVGA 2ATIA 3DOJA 4P7KA 3F8SA 3VJRA 2QD3A 4H4CA 3RVLA 4B1FA 4E22A 4CKWB 5CDYA 4U7DA 4GPZA 1NWHA 3C3JA 1C1XB 1Y6JA 2HLHA 3OJOA 1U7TA 3AJ9A 2B34A 4PYIA 3EGWA 4RVUA 4W5JA 4EX7A 1Z4LA 1WXQA 4BZXA 1DHTA 4FDTA 3FKQA 1E3EA 5LNK6 2VK4A 4PFJA 4J6EA 4JC8A 1CW2B 2J7KA 2NZUG 1S0UA 2WZQA 3I73A 3WK7A 4WACA 4L8FA 5EHIA 4JLVA 1EZ1A 4AL4A 4BP8A 1XNJA 3VPGA 4PFKA 1U3FA 2HAEA 3TQCA 3L6EA 1GAEO 3KJIA 4B83A 1OHHD 2WYVA 2QEQA 1QO9A 3AGPA 4GZ5A 4XQ0A 4MWEA 4V1CI 1CRQA 1P18A 1T15A 4EW2A 3I2JA 2YWCA 5JJBA 1E79D 3QBDA 2FFBA 4TLAA 3URMA 2YJGA 4B8YA 3PU6A 2XWSA 2JCXA 3DJYA 2MSLA 2ZTHA 2R4TA 1AKVA 5CX1A 3W6UA 1O0BA 1N6KA 5DGXA 1Q2XA 3HYCA 3I8XA 2UUOA 1A9SA 5CVJA 4J0FA 1FUUA 3L04A 3U40A 2WW8A 5FXMA 2GCNA 4KAFA 4DKJA 1OBHA 3C5HA 3F1LA 3PJEA 4HNRA 4J9UE 1MX3A 1XU4A 3VUFA 3LPNA 3P8ZA 2HMVA 4OA5A 4ZRMA 4ZWNA 3V4RA 2VTBA 2QN8A 1RQGA 3QVTA 1U8YA 2WYWA 3FLEA 2HPAA 3AOEA 4MCHA 3U7EB 2ZUUA 4RXUA 1P7ZA 1MC8A 5LQCA 1YTUA 1UKEA 1HORA 1SCUB 3RIHA 1HYBA 3GEPA 3UMBA 1A7AA 1PGNA 4LK3A 4DIKA 3KYDA 3B2EA 4HN9A 1MX9A 1GSIA 2XHZA 3A32A 2F59A 5K3DA 4YRPA 4ZVNA 2AC4A 2QROA 2ZB3A 3X44A 1BHO1 1O03A 1VCIA 1J0CA 4WPGA 4FOLA 4MR7A 1E1CB 1KVSA 4LYHA 3KZKA 2G1AA 1PJ4A 2Q4EA 1ZVMA 4HF7A 5BWCA 1CZOA 2UVDA 3KWJA 2Q9CA 1O77A 5E3JA 1Z5NA 5F2EA 3LW7A 3AI1A 1II8B 1DG1G 1ZM9A 1ESZA 1WHTA 5F23A 2D13A 1A0OA 2AYXA 4IZHA 4YRSA 2IOHA 2Q1YA 2YC4C 4BMOB 3J7AC 3GEEA 1MV8A 4IJVA 2OFWA 1QCDA 3VHLB 1SUCA 3OFVA 1E2KA 1L7NA 1ORDA 2JIOA 1V5WA 1FDVA 1FTQA 1DJMA 1LWOA 2R7KA 4ZVRA 3FWPA 3A11A 3L1KA 3GMDA 4DW8A 3E5RA 3FM9A 4FDLA 3GJ4A 4C14A 1T3HA 4N5DA 3IKMB 3TLZA 4TV8F 1MJ5A 7ADHA 1Y63A 3IAXA 4IGFA 4IAOA 4F7DA 5C37A 1U5AA 2WLTA 3RHTA 1R4MB 2ZRAA 4RHFA 3DBLB 2RC6A 3NV7A 1TF7A 3VAZA 2VFAA 3K0FA 4KOEC 2WHPA 4P1ZA 4XOUA 3SIRA 1ZSNA 4GRIA 3V2GA 4INJA 2YJTD 2Q6OA 1H9AA 2GJSA 2Q2QA 2G72A 3OU7A 1UK7A 4HOYA 3NETA 5LD2B 4BO4A 1T8UA 1X8JA 1A7JA 3H2ZA 3LC2O 3N05A 1M1XB 2P4SA 1N1GA 2WG1A 4KH1A 5FTMA 2H1LA 2VQ3A 4I3FA 4OHWA 1SC4A 3ONWA 2FZVA 2RGDA 5BRAA 4L3VA 1LDGA 2ZSEA 2F64A 4NDNE 4RDIA 3NWBA 4UHJA 4WBNF 3TTVA 2FEXA 1KPHA 3KQOA 4KKXB 4ZQFA 1H8HD 2UVPA 4IYRA 3SLGA 1B2LA 2QAJA 1IEQA 4KXUA 2ZRFA 5IAGA 1SXJC 2XRFA 4FFSA 4R2LA 3BIJA 4JLBA 4XPIA 4B33A 2JB9A 1DPFA 4II7A 1YGYA 8GPBA 4JXKA 3U9SA 2B5WA 1RLMA 4UCWA 2BH2A 1ZK3A 4J0HA 3TBHA 5GJBA 1U2GA 3LU1A 3R0VA 1D1TA 1CDDA 1FP6A 1GPMA 3O3MB 2C4MA 4ZOCA 3GFRA 4CG1A 1O2DA 4ZQHA 4QUEA 4AS1A 1BOOA 1Y8RB 5H3HA 1E3TA 4M88A 1UK9A 2VHWA 1E1DA 1BXRA 2AOUB 1U4SA 3HDYA 3LX8A 3P26A 3BYZA 2CZQA 4RMGA 1Z5WA 5B4UA 2I8CA 2JGAA 1P9NA 1BDMA 2QTTA 2O7QA 2C07A 4AC9A 5LOVA 2QMQA 4AAYA 2O8BB 1U7ZA 4R6XA 3CLRC 3HKEA 3W9BA 1ABBA 1XFDA 4W63A 3FZGA 4QHYA 1BYUA 4GKBA 4AIRA 3C3DA 4H77A 3C8HA 3P4YA 2YR0A 4AJLA 3D3QA 2HD4A 4OQDA 2R9VA 1VECA 3JS5A 4B6SA 4TYNA 3MWDB 1JR3D 2ECFA 3TNDA 4AYXA 5LBTA 3T7TA 5LNK1 2QYTA 3M6LA 3NWPA 4YCLA 1QDEA 1E4VA 4RPCA 5E7QA 2G0AA 1C80A 2BTQB 4JQYA 1OFHA 1H8EA 3UHFA 5ICGA 1DKUA 3O9VA 3OPNA 2YMLA 3F7TA 2P9EA 1Y9AA 3OUTA 4YRFA 5FOXA 3ZHZA 5DVZA 3ZCQA 1JKJB 4B6JA 4PNEA 5FWAA 4OYHA 3WO1A 1JILA 1P4GA 3ANTA 3HB4X 4ZOAA 1HSOA 3RHSA 3ZX5A 1EE9A 2CDCA 1JHVA 2VF2A 3H4VA 3GLGA 4N8EA 2ZITA 4MWGA 4M1EA 3T7IA 3E23A 4C7KA 1J2TA 1P6XA 1W29A 2RAPA 4JI7B 1TYCA 2XCQA 2O7NA 1NQ5A 1SVSA 2FU5C 4LDJA 1KYWA 3H87A 4A1FA 2OMEA 5FF9A 1EFVB 4DV4B 3D81A 3B5JA 5HEKA 3A3YA 3Q1KA 1C4KA 4B74A 1FQKA 3I2FA 4DCNA 2B6HA 2BFFB 1TL7C 3KSMA 1L8OA 1LDYA 4MR9B 4U7WA 4AURA 1I94B 1GUYA 3QYAA 2HBZA 4L7QA 3HVUA 4QDZA 3T61A 6GPBA 4NCBA 1BCRA 1Z35A 2PRSA 4ESOA 1SFRA 4BLOA 1N2IA 2ZSBA 3VH3A 4PO1A 1YCDA 3CO5A 3SSNA 2HMSA 1EM6A 1PDOA 1WAMA 4RJ2A 5JBIA 3GP8A 1ZMOA 1KS2A 2NACA 3KBOA 5SZIA 4NU5A 3ZU4A 2A5DA 1ANKA 4JR2A 4E3WA 2J1LA 4HQNA 2BRUC 4I5IA 3VZCA 1T2AA 2DUMA 1E7YA 1Z47A 4J9VA 2E9SA 4MHSA 3IQDB 3RSSA 3T5DA 5KX5F 1FZQA 5G0SA 3T1TA 3NM4A 1JZSA 3WVNA 4Z9BA 2QKYA 3I23A 2HUPA 4LJLA 4MXDA 4LI3X 3LDHA 1OPXA 2JHCA 1OX4A 3ID6C 4QLAA 3H97A 5SY6A 1K6MA 4AYWA 4LMBA 2C0QA 1PR1A 2GWRA 2OP1A 3I32A 4JB2A 2XOXA 2D1FA 3QXXA 1QC5B 2Z0MA 3BIOA 4RFSB 5AUOB 4QGGA 1T26A 5CU7A 1M2OA 4BJ5A 4ZTZB 1KYIA 4YJ3F 1Z39A 4U9IS 2V7PA 4RMNA 3SYKA 5IHPA 1YL7A 5DGIA 1QQBA 2R5NA 1Z8DA 3DT8A 4NWIA 2OKCA 3QE3A 2GWHA 1I3NA 3CR7A 4AJ4A 5C52B 4Q7EA 4Q03A 4ZXFA 1WDTA 1P61B 4Q9IA 5TS2A 1FU7A 1L1QA 4D8WA 3P0RA 4O4LF 1EK6A 4JVMA 3DFUA 4PV7A 5DMHA 3BRWD 1E5LA 2WNIA 4AB1A 4YMVA 2X19A 1FMFA 3WJ7A 2QNIA 2RG7A 4FE3A 3MN1A 4IXWA 1HNWB 4GXTA 2HLPA 4RPJA 4UE2A 2QPOA 4BRWA 5HFNA 2BE7A 2BFEA 4ZVPA 4KRFA 3AT1A 2ODPA 3B9BA 3L4EA 1VXRA 3B13B 3SC2B 4F60A 1YU9A 3KQPA 3QM1A 1CUYA 3B7PA 4WQMA 5DSZA 3FOFC 4G1BA 1P1JA 4P7GA 1RIFA 3RVJA 3JQBA 5ALGA 4EG6A 5CNKA 3C7AA 5FV7A 3WGLA 1ZC3A 4NTZA 5L3VA 5ER6A 1RM4A 2OM2A 1T43A 1BC5A 3FCUB 1YR7A 5INTA 1OLUB 3WLNA 2O8EB 3ZHRA 3WL8A 3SQOA 4I46A 5JFTA 4G1EB 1SBQA 2YVAA 1OFIA 1XRPA 1OFTA 2W6JA 1NVKA 3MT0A 1JEDA 5EJ2A 3ORSA 3OEED 4IF6A 4PSUA 3RBXA 5HFAA 2WPDA 3Q41A 2AZMA 2JDID 3SHQA 1BNCA 2NOAA 4MW4A 3PFHA 3B48A 1GFIA 4KGZA 2JLXA 1EBBA 2FMKA 3F3MA 3GT7A 1IIRA 2PM8A 3HNPA 4I66A 3KKKA 2PSSA 2LNDA 3JALA 1H2AS 4HAUA 1U63A 3SE0A 1NKTA 2B2NA 3AM5A 3UMJA 1Q0PA 4M8LA 1NF3A 1ZJZA 1E6UA 4L8VA 2I80A 4RH0A 1KK2A 4OQNA 3TOXA 4K40A 4B79A 1X70A 2ZOSA 3M3HA 6YASA 1RYDA 1ZC4A 3CH7A 2Y1DA 4J4HA 1P4SA 3RSGA 4D0NA 2J3LA 1N1DA 2YWXA 3CG4A 4IH9A 4JUFA 1EK5A 4L76A 2M6RA 4A0HA 1XEWY 3GGCA 2GVDC 5JECA 1U9IA 2MU1A 1KETA 4KWHA 3SQMA 1AF7A 2VBGA 1FFGA 4GWGA 3ZBTA 3LBAA 1U7WA 2H4HA 1Z0UA 1MMFB 3E0QA 4HFRA 1KFKB 1QOQB 1ZUWA 2GYUA 2QSYA 3OEHA 3OY7A 4Q7MB 3IT1A 2M98A 4UUBA 3RYFA 3SX0A 4RIIA 1IXZA 4D74A 2O8DA 3I2HA 4GBMA 4XGIA 1V7CA 1NTOA 2G9QA 4YJHB 4MRMA 4INOA 5KYKA 4UHKA 2XDYA 5K0NA 5LUAA 1P5HA 5F76A 3I3SR 4TL9A 5AUQA 3U4GA 4WAUA 4CHTA 4JI0B 1YA6A 2QM8A 3KSRA 1EMDA 1NOIA 1X1SA 2IP4A 1ACMA 5FOSA 3DB2A 1LTKA 3GRYA 2A86A 1WHSB 2JGRA 3CX7A 3KO8A 5IKOA 3SOPA 5FWXB 3S1LA 1QIJA 2DHEA 5BVGB 2EFCB 1M8PA 1Y1LA 2RGBA 3BXOA 3GA5A 3FGNA 3B51X 3I05A 2QV7A 4FHZA 4J4TA 3ANNA 3UHAA 1MPTA 1NMQA 5KYYA 1L5HA 3A6HA 3V1KA 2CUKA 3AI2A 5HQTA 4NK5A 2O2JA 3OQOA 5GJVC 1T24A 4JZKA 4O4IF 2J4CA 2D59A 1ZGZA 4GZLA 3BKWA 1V7ZA 4MUBA 2C7PA 3U44A 5K0GA 1HTWA 2YIMA 4BGUA 4JEIA 1IJKA 1NVBA 4G0OA 4TKVA 4TQ9A 4YH1A 4ARVA 4IH1A 4HTFA 5K3CA 1XZGA 3MXTA 4J1NA 2OOSA 3U3XA 2VF8A 5JS2A 4ZAZA 4JUBA 1GL6A 1SVMA 2GGSA 1PWXA 1P7WA 2PZEA 3ELWA 3H65A 4G5XA 4JLMA 1M8KA 1Q84A 2Y1KA 3PF9A 4QDUA 1GTRA 2FX3A 1RRMA 2OLEA 3MMZA 5TXGA 4AWAA 3L46A 2AG1A 4RENA 3D43A 4QU0A 4UHFA 2O8CA 1WABA 3N2ZB 2GASA 4K6GA 4OSPA 4J0DA 1J2UA 3CKKA 2X6RA 2FCRA 2PXCA 5ITVA 4L07A 3HL0A 4Z1MA 2Z58A 3ILYA 3IQIX 4O2BA 4PLWA 1XXHB 3EPKA 1LGYA 2IQ5A 1SIUA 1K7EB 3D7RA 3JZMA 3FYUB 3R0ZA 4LXHA 3V46A 2FE1A 1AD2A 3ZE7A 4YP6A 5JALA 2BDUA 5F9FA 3M5WA 1N5OX 2VK2A 3E61A 4KAAA 5FOWA 1MHTA 2VYNA 3GGJA 2R5WA 1H93A 1IUNA 4GIBA 4ITRC 2ZSFA 2FEKA 3P19A 1H69A 2RGEA 1EDZA 4K9LA 1EQAA 5HYVA 1XMPA 3OBBA 3ZLJA 1FK8A 4LHVA 4Q1FA 1W0JD 1B93A 1X13A 2ZJFA 3DC2A 2IPLA 4B17A 4OVKA 4UUOA 1BGWA 5UKDA 3V4LA 1C9EA 3KVYA 4RY2A 2A0YA 3B38A 2I7DA 2CEAA 4LXYA 4J16A 4EFMA 2F67A 3AUUA 3PNYA 2Y27A 1NX9A 3V48A 1OXXK 4DYDA 4V0RA 5H81A 4HGYA 1I1HA 5I4BA 2BSQA 3ZHUA 4B7UA 2E1RA 2O59A 2XKKA 4WUVA 3LV8A 4NEQA 3KFXA 3NI2A 1REQA 4HVCA 4EENA 2E49A 1EP3B 3SZRA 4IZ6A 3W5BA 1KZ6A 1XSEA 3O8QA 1X87A 4I4NA 3G02A 2AFIA 2DBQA 1NJSA 4X62B 4DFDA 1U0FA 3U4IA 4JQCA 2K2QB 4LVNA 4MJ3A 2XBUA 1YRWA 3V4SA 4BQSA 2P9QA 1OZAA 4G8DA 1GNLA 3GLGE 1NJ1A 2GYVA 5BSUA 3PDJA 5I4KA 4Z3DA 3A6FA 3JWEA 2W43A 5CIYA 5H0IA 3DE2X 4HPWA 3TZ6A 2GCEA 3UV7A 3TLXA 3BXPA 4BQQA 4CFSA 3SLKA 4DQDA 4NJEB 1XNRB 3O3CA 4CIXA 5DNDA 4BMXA 1M33A 3FIJA 4OKNA 4E4TA 3V80A 4G63A 5EHXA 3K7EA 3M81A 5JWOA 4QYWA 4BPBA 2E85A 1UBSB 2QPLA 2RHCA 5E7IA 2IL1A 2XF2A 4TMTA 2DTEA 2CUTA 2FPIA 2W6QA 3UAGA 4R0MA 2EW8A 3CR3C 4EGAA 1NXPA 4URZR 2ZPTX 1SKYB 4ZC1A 3LQ2A 1U28A 1X8KA 3U37A 1JHZA 2VHUA 5A2GA 3RUHA 2Z3VA 1U8TA 2R1VB 4GXQA 1JHDA 2ZSUA 4QJBA 5TRTA 4YQZA 4U5QA 3GFVA 2EC5A 1BU5A 1QR6A 1U7UA 1Z0SA 2FSIA 2IYXA 3DLTA 3WGGA 3B1JA 5AICA 1RC0A 3UAYA 1NC1A 2YXLA 4WJKB 4AZ3B 2ZSIA 3O84A 1R0KA 3GAZA 4GMKA 2WWIA 2FP4A 4C0JA 3H9BA 1QG4A 1NN5A 4FMDF 5IYZA 1LPNA 3FROA 4YXWA 2Z98A 4DDWA 2Q7OE 1U8UA 4N0PA 1JT9A 2AYYA 1XLTC 4FMPA 3PUXA 2OXFA 4D8UA 3UJ7A 4E6PA 4OMDA 4G5QA 4NJMA 2G1JA 3ETNA 5PNTA 3VPSA 3R3SA 4X1IA 3OQNA 1YE8A 2RG1A 2D00A 4U1RA 2V6JA 4MWTA 5BV2P 3EGDA 1I4TD 3RS8A 4RZHA 1SUFA 3PI7A 4PG6A 3WFJA 2XCSB 4MWOA 5DPMA 2YTZA 4Q12A 3HXLA 4AD8A 2E4YA 2F8LA 3GVXA 4PR0A 1GTJ1 2BH9A 4AG6A 5HVNA 1EZ4A 2D8AA 4AT1A 5HUJA 1VOTA 1QBKC 1JYEA 3MTQA 3SYMA 2CCGA 2E4AA 3DTVB 5BMOA 3A6LA 3GLIE 5BN1A 5P8WA 3GL9A 2JIQA 1AKYA 2F9FA 2GTHA 4HX9A 4H35A 4BV3A 2C7OA 4HB3A 4MRNA 2QRVA 4LZJA 3DEJA 4Z4FA 1AIPA 2I9PA 3WE7A 1HTBA 4Q3EA 5DXAA 1MENA 1NNUA 3BCUA 3MCWA 4MMXB 1S2OA 3JAWB 4A27A 3CUTA 4KQKA 5A4KA 1RKQA 1XZKA 4FJ2A 3ZE8A 4UMVA 5BUCA 2VUSA 4ZOQI 1T8YA 3EODA 3PQ7A 1AVTA 3K30A 3QEMA 4IBOA 5AD1A 5HXAA 4TWAA 1SXJE 5BVHB 1C7QA 4S0XA 4TTSA 4UTNA 1UWLA 1NW5A 2TMDA 3GJ5A 3LIIA 1TYEB 4M9UA 1XQ6A 2O57A 1R6AA 2Q4BA 1U0TA 2D8MA 2KX7A 4M37A 2TYSB 5CYOA 2V9CA 5CDTA 3A9RA 2I3DA 1RRKA 3FTDA 2P5UA 2WF9A 4P36A 4D6PA 1VMIA 3FGPA 3BB1A 3ZWCA 4Y9TA 1W1IA 3HG7A 2DPLA 3BGVA 1XZQA 3DHNA 4LQCA 1W4LA 4CG0A 3AJRA 4EHAA 3KPWA 1GPJA 4RH1A 1J20A 2BSXA 2YV1A 3HLTA 4TXJA 1DQSA 4XQCA 1YQGA 4HSGA 3VHXA 5FWYA 5ESRA 3FVQA 4EABA 5JZSA 3VJLA 1EGVB 1NDHA 2CXQA 2X22A 4AVYA 4HEJA 1I24A 2AN9A 1A04A 3N8KA 1PIWA 1UKCA 4X45A 2DFPA 1FCJA 4OQFA 4PLVA 1MO4A 4UW9A 4BQFA 1KO4A 3DXFA 4PZAA 2GESA 1QXSA 2UXBB 4BQRA 4DCGA 2XIJA 4A1OA 4LV5B 5LFAA 4DV6B 3PA8A 4W5NA 4NYJR 4PGAA 2HCFA 4JROA 2FJ0A 4LRQA 3SZOA 3MQFA 4KYUA 1L5YA 4XIFA 4P4SB 3W6NA 3AEKB 5C1BA 1X7XA 4IX1A 4Z7QB 1Z33A 3GHHA 1WW3A 2DPXA 4KVFA 1RBYA 1YQDA 3JW8A 4D5EA 3A25A 4A8TA 4J2HA 2BFBA 4UM7A 4WEOA 4B3RB 2DWCA 4K3UA 1GT6A 1G2IA 1FNBA 3OIGA 1HG0A 2D74A 2RGCA 3L5OA 4A2QA 4PGGA 1XE3A 4IXNA 3GO4A 1IRXA 4YWJA 5D6OA 2IYEA 4UZEA 4TLCA 4K6HA 3ONEA 3ABZA 4C4XA 2IE8A 1UJNA 2AMYA 1WXFA 3QWBA 2C2KA 1TVKB 4JX9A 4UDYX 1XX6A 4DREA 1DC7A 1QK4A 2XUDA 1OZFA 2G7ZA 3DQQA 3IQXA 3VU1A 3UFXA 4V0OA 2GA8A 3SMVA 4KO4S 1Y1TA 4KQ9A 3X1KA 1KI6B 3RROA 4FOTA 3B1WA 4CWAA 4EB6B 4YR7A 5REQA 1BVHA 2G9VA 3ONDA 1B0PA 3GX1A 1VYVA 4CF3A 1BX0A 1D07A 3OPYA 2CXUA 1INLA 2EBWA 3Q6NA 4K9PA 1M1UA 3M82A 2GHIA 4F85A 5IJ0B 2OOKA 5KEIA 1DPGA 3C8ZA 3NHRA 1F60A 4GF5A 1E3LA 2NO1A 3QLVA 1EVQA 2VHQA 3G9QA 1Z9BA 4LNHA 4WCVA 1CFJA 5EIAA 5SYAA 3T5CA 4PPNA 1P1RA 3MWYW 3H17A 2C84A 4F91B 3SDSA 4HDQB 2P2DA 2IS4A 4Y30A 2GD2A 5CB6A 4C3VA 2WHXA 5JBNA 1L4GA 3I5UA 3K09C 3L7JA 2EX1A 3PVZA 1O9BA 2XA1A 1KERA 4R69A 5TGZA 4BZWA 1QNLA 5HF8A 1K3TA 3Q8KA 1IXKA 3E35A 2W2KA 5HKBA 2X9VA 3EHDA 4WNAB 3JD3A 3EQ6A 3MK31 3WGQA 1G4HA 5K5EA 3BFKA 1Z6GA 1QIMA 4C4AA 1C9DB 3SBEA 4KUHA 1GPBA 5HZKA 4YUXA 1FYFA 4B2PA 3WIUA 4AY6A 1QV9A 5GOTA 1ADYA 2AXPA 1JJAA 1CZUA 3C45A 1JHOA 1H8ED 3LOPA 5H02A 3RARA 3KELA 1QH8B 2J3JA 1GU1A 4ZV9A 1P0FA 2Q6KA 3OD5A 2GEBA 1JKFA 4CBVA 1QB7A 2P2LA 2XH8A 2NWQA 4BFZA 1CUZA 1UC5B 4DM4A 5BN5A 1T0BA 1O5OA 1SOMA 3OVMA 1A9YA 1R4NB 1MUUA 2NYAA 2Q2NA 3TOVA 4TVSA 1GAXA 1T35A 3G3EA 4KYTA 4I4IA 5FO1A 3TI7A 3EARA 3HRKA 1D6JA 3DPIA 3L93A 3PWZA 2B8WA 4JBLA 1WZIA 5K8IA 4EL0A 5B58T 4F3NA 1FFBA 3BMOB 5EJMA 5EXEA 3L6OO 3GRKA 3BMCA 2YNMA 5A3JA 1JA0A 2E4XA 5ALSA 3ZYZA 4NNOA 2ZT7A 3HMQA 4MS1A 3STXA 2JFFA 2W71A 3KZVA 4KVGA 3NVMB 3ZCTA 5K3SA 3FY4A 5BR4A 2BI7A 5EOVA 4FWTA 1THTA 3KVOA 1WPXA 1KXZA 1NBAA 1OA0A 2VSQA 4H08A 4RCVA 4D9JA 2AQIA 5BYAA 4PYMA 1ODKA 1DUVG 1YVDA 1CXZA 4GYWA 5FNZA 3H11A 3MWKA 1G8HA 3QHPA 2J08A 4BBJA 2VJAA 4EUHA 4U2FA 1BEUB 1XVTA 3LUDA 5LD2C 1Y8CA 2HPVA 2IGBA 2P2NA 2QGNA 2GBCA 3AF5A 3CYFA 1Q3TA 2PFGA 3CPHA 1WMBA 3U7QA 1I2DA 3PT9A 4V0SA 1A7KA 3R24A 4OATA 1SXGA 2FPKA 2EKBA 1RFLA 1TT5A 4OG2A 5TARA 2ZZKA 1NKSA 4MWBA 1ECGA 2QTWB 3QXHA 5KTPA 5L95A 2C9BA 4G4SO 4ZVLA 4G84A 3SXUA 1RAHA 5AUPB 5KYWB 1JIVA 2ZJ0A 1ZH6A 4XVRA 4BYGA 1GYPA 1Z0ZA 2CVHA 3MILA 3X1ZA 2HQSA 2Q6LA 4YHHB 5DGDA 4FDUA 2YWBA 3H4MA 3ECSA 1GL9B 3QPUA 5KAMA 5TMPA 2ZTLA 1LI5A 2QF7A 3DD1A 4LAFA 5LU8A 2Z6UA 1JDSA 4OI4A 1NJ2A 4LRWA 3EG5A 4H9GA 4BL5A 2ATVA 3QVSA 1E2HA 5C46F 3WNBA 4AZ0B 1DC8A 5AW7A 2O9JA 1S2LA 2AX4A 1Z28A 2ZPAA 3UWSA 2ZCUA 4JOSA 4DZTA 3QEJA 1ZA1A 4N7JA 4AECA 3S7ZA 1YU6A 5DSTA 1RKBA 1UWCA 4EA8A 4Y3UA 3B52X 2DFVA 3ASYA 3D6NB 1RM5A 3ZG6A 1J2EA 3AWIA 3EIOA 3A4IA 3CONA 4P3KA 3SQDA 4FHDA 4IVNA 4W99A 4YRCA 5JSQA 4IEIA 1JEEA 1V48A 1GVHA 1WWKA 1VJCA 3LFUA 3S2EA 4WY2A 4FFBA 1XU7A 2ONYA 2RB4A 3QEKA 4IWXA 4L5CA 4LGMA 1NJFA 3DW1X 2PL9A 4Y0NA 3UAXA 5L6MB 4YECA 1NQUA 1UXHA 3K32A 4HO1X 3UT6A 4BN5A 3RYTC 2J32A 1NI4A 3G59A 3SSMA 1F8GA 1E9EA 1X92A 2YJ5A 5L8VA 5KINB 3ZVMA 4JLJA 3WDMA 3TLBA 1G63A 2RC5A 3IA7A 3S44A 1CETA 2DR3A 3FSRA 3RABA 3IAS6 3NS7A 3VU8A 5E0OA 4EZIA 1B6SA 3VOSA 4F5ZA 5C81A 5JD6A 1TVCA 3WYEA 4MEAA 1QGZA 3PNQA 4MRSA 5GONF 4GFDA 3ITNA 3AETA 4B87A 2OZLA 3R9KA 5J59A 4ZDJA 1SGWA 2JHPA 3NBMA 4LOKA 3LBNA 1YUBA 4MQBA 3VH2A 1PT9A 4L22A 2W6JD 3GPDG 5A5DA 5L7TA 3AG5A 4J1SA 3RM3A 4TV9B 5LZ7A 2CLOB 4XB1A 2W0MA 4BCBA 2WPDD 1VE5A 2IYZA 1ZI6A 3FX2A 3P9KA 4I9UA 4LYYA 4R9VA 1M2VA 2PY6A 3LT4A 3JD2A 3GCZA 3CKLA 4F21A 2C95A 3ES9A 4EIWA 1OWPA 1X7ZA 3E7WA 2DUWA 2GF9A 4AZSA 3O1LA 3FTFA 2JS7A 3CWZA 4YPOA 1HC7A 3TL2A 2NGRA 2QR3A 4O2AF 3S27A 1ZIDA 2H31A 5L45A 4FFWA 1F1JA 4IDGA 5JMTA 3U16A 2C0CA 3LBIA 1CB0A 1FMCA 2XMGA 3KVVA 2FSHA 1TCBA 3P9CA 4N9QA 4MI9A 3FFXA 1HDCA 4BGIA 1QMGA 1CR6A 2LP4Y 4IMIB 1P7VA 1KAMA 3VC1A 1S01A 3JD4A 3SR4A 3BL8A 3CXUA 3EZNA 4BV2A 4NONA 4C7OA 1KP9A 4Z7JA 4QFDA 1Q6YA 3U09A 3AUTA 4DEVA 1G21E 1XLWA 1VHWA 4M38A 3EPHA 4JYZA 2W2PA 1JJVA 4FB4A 1SU6A 2VEOA 3KXDA 3L7DA 5EEHA 4Z5XA 5KSZA 3KSBC 4QNNA 5CP8A 4ERXA 1J5EB 2NO7A 3PICA 1RPJA 5BSFA 3B7WA 1ZXLA 2P2GA 1V3UA 3IBSA 3OEHD 4GOJA 3JWGA 4CM8A 4R41A 1BQEA 1DXOA 3LWBA 1CEEA 1Q7CA 2QLNA 4P3XA 2YVKA 2H1CA 5A9SA 1RQRA 4GX2A 3D02A 3CLUC 3FMPB 3KUXA 4MV4A 3EZ7A 4N3GA 4C4OA 3QQ5A 2ZEJA 3NBQA 1L3IA 4TS4A 3DOEA 2PX3A 5HCIA 1D8AA 4R1LA 3TEMA 1AKEA 1MF7A 2H08A 2PKQO 4QYIB 5IDYA 3ETDA 4GR4A 1M83A 1T8PA 4MINA 5A3SA 4BFCA 3DOUA 2KB0A 2OQ2A 4CU2A 2A84A 1WXXA 1E0KA 4GD3Q 4BRUA 4R7ZA 5HJEA 1ZU4A 2HU7A 2V7UA 3TECE 2ZM6B 1A98A 1QO0A 2DHDA 1BXKA 1LDBA 2JEYA 3H2JA 5I7SA 2BM9A 3ZCUA 1E2UA 4JDPA 1UPBA 2HZ7A 2HFKA 3UNXA 1DAEA 2XA9A 3ZQJA 4CG3A 1WD5A 4OIFA 4POAA 5D85A 4JI6B 3OZCA 2JVJA 1U2EA 1TECE 5G0UA 4WGGA 3CRVA 3HP4A 3RF6A 2VTEA 2Z8YA 2GFHA 3NBZC 3BJMA 3ENWA 2QWXA 4RIHA 2GILA 4Z7OB 5CEJA 4X20B 1PSDA 1P1FA 1QYRA 5LMCA 1RFGE 4MK4A 5JSUA 3F6RA 4FCWA 2IHVA 4I1OA 2C3PA 4NFYA 1K63A 4NQZA 3QMPA 1F0YA 4PG4A 1HT0A 1VL2A 4FPXA 3KOWA 2BCJQ 3QWAA 2OD2A 2Y0EA 1LLCA 2Z5VA 1JTFA 5HX7A 2Q5LA 3GLHB 4U2DA 4WNCA 1MV5A 1Y3IA 3E84A 3IELA 4PNPA 1O95A 1KEPA 2DP4E 1JL3A 2HB6A 2IDJA 3EOBI 2WG0A 3GH1A 3LC7O 3H8VA 4YNBA 4FNGA 3PJGA 2BOVA 4O6VA 4Z1MD 4ZQCB 1XMIA 2I1QA 3HKCA 2ZRHA 4K0RA 5FLKA 2P9GA 4O5AA 4D6XA 4EPYA 1JB1A 2K7ZA 2J0QA 1B26A 2X7HA 4H7DA 4RYDA 1HNZB 5JJIA 1QFJA 5JEEA 4KL8S 4BVKA 4EHHA 4LZNA 2GM4A 1A5AB 4JGIA 2NTEA 2B2XA 2I62A 4E5VA 5LP6C 1CNEA 3SS8A 3MRVA 4Y2JA 3UMFA 3EDRA 2VYND 5TQVA 1ZS9A 3X1WA 3M33A 1TDJA 2WJ4A 4EMUA 2NXJA 2JRCA 3ETHA 2VQSA 5D3MA 1KJJA 3DBIA 1AS2A 2IS2A 2OZKA 4U00A 3LCCA 1P5JA 2H4JA 3WKDA 2G4LA 3AG6A 1RYNA 2YBDA 4RL6A 3C87A 1S8OA 1R1DA 1O97C 2J0EA 4CR7A 1I6LA 2UUCB 3QLJA 4DNOA 1NP7A 2QV0A 3HKDA 4UXIA 3V5NA 3GUVA 5B2EA 1I3LA 1KPGA 2LVBA 2WRZA 3KQVA 4MNTA 5ALTA 1UJCA 3VOAA 3JWIA 4AJPA 2WWTA 2VK8A 2YZGA 3DEAA 4TLBA 3PRJA 4Q5IA 5CH3A 3OE5A 5ERGB 1F8XA 4RSHA 4BRZA 1E61A 1OIVA 1M2JA 4WCFB 3M9LA 2FUCA 1WPGA 3CJTA 1BX3A 3BFVA 1KKMA 3W5AA 5LSAA 1MO5A 4KN5A 4E5PA 4P35A 4I1PA 5T8KC 2PCLA 2LKDA 1TQDA 4FLEA 1OXBB 1E2MA 2JFGA 2VA8A 3M1YA 3U4DA 2BM1A 3UHJA 1AURA 3IAS1 4JELA 4DV7B 2AJCA 4ZHQF 1QX3A 1C8KA 5EE0A 2OENG 3ZVKA 4E46A 4IIJA 2O7SA 4OAQA 3LTNC 4C87A 3P2IA 2QUIA 5B1IA 3F4KA 4BB9A 3R5TA 2NT4A 2GF0A 1SOAA 2ATXA 4JJFA 4KCGA 2W4MA 1YA4A 1GGKA 1MDFA 2F62A 4Q00A 1QRUA 4BO2A 1AUQA 1KAEA 3DLBA 3LGAA 1F12A 1P19A 2OBYA 3KR0A 4DYVA 3GRCA 4EWLA 3AFNA 2EJCA 2FLKA 2V03A 2ZWIA 1ZNQO 2VDKB 3DYVA 3ZOKA 1FW6A 3K53A 3I76A 3KJEA 3PEUA 3QOXA 3ND5A 4OH7A 1N3IA 1OBVA 1U9YA 5TQ0B 2HK8A 3V9PA 221PA 4AG3A 1CIVA 1XMSA 2WE8A 3DULA 1I2AA 2PT7A 4ZCLA 3BF8A 4XDZA 1SIWA 2DG2A 2IDZA 3AUFA 1YR8A 3KFVA 1JFRA 4G9EA 1A76A 2YRFA 4MPPA 2V7GA 1Z4NA 2P2CA 3Q4GA 2YIDA 2XCLA 4ENPA 1H2BA 1R5NA 4R7GA 4E09A 2HR1A 4N7RA 4MPJA 3V9AA 5K0FA 2UZIR 4LHYA 1WV0A 3AI3A 4B32A 2ZR8A 1V39A 3H9GA 5ESXA 4CQMA 1TUGA 2WJJA 4YJGB 2OAEA 2IYAA 2WU0A 4EKYA 1F7UA 3ETLA 5IEBA 3NOQA 4A15A 2QZZA 3W2HA 4YXWD 3IMKA 3K5PA 3WA7A 3P5BA 4G5GA 2ODQA 3AUXA 2F2TA 3LT2A 3C3PA 4N5HX 2WHRA 3RAEC 4DDTA 4QAJA 4YYZA 3WQHA 1N7JA 3CU5A 3NTLA 5IULC 2H4YA 1Q16A 3AR4A 2ZAIA 4FJ1A 4YT2A 3I2KA 1HDEA 3A36A 3BM5A 4BO0A 4ARUA 2HCRA 4LTDA 1MIOA 1WXIA 2CL6X 5BY2A 1UMDB 2YJZA 3QI7A 2H4FA 4D57A 3TG2A 5JEDA 3WGIA 2FWJA 2GLUA 3IUEA 3V34A 3E2IA 1PL0A 2FGKA 2ZJ1A 1KP2A 1XJQA 3EFEA 3NASA 1SC1A 1KQGA 1J09A 4OLFA 1JA9A 3GPBA 4JT4A 2JA1A 3RSOA 4EW3A 2D54A 1JXMA 1M1YE 3AHEA 1I4DD 4R9SA 4G86A 4MUXA 2I67A 4XM0A 1TUIA 3ZD8A 2F1OA 4DSNA 3AHCA 3BRSA 3AF2A 1W87A 1I36A 2FMIA 3EE6A 2XVYA 1CIJA 1E4EA 1PLLA 2O4CA 4RJIA 3Q6IA 3UFBA 2M6LA 4Z3OA 2W8BB 1E0JA 3IXMA 2PUVA 3A6JA 3LKZA 4IIVA 4UVIA 1JECA 1CG6A 2QI9C 2YN0A 5M3BA 3V8EA 4YAKA 3SM3A 4JVOA 1ZR4A 1ISPA 1T5TA 1A2BA 2C4UA 1G8YA 3FZQA 3I2GA 2AOWA 4KRXA 3DAGA 4TUYA 3TXAA 3OSZA 1OREA 3OC6A 1X1BA 5KNCH 3PK0A 1I7QB 2XSZA 1N4DA 5FA8A 3AFOA 4OD0A 1IYZA 4CV3A 2QTZA 4H0FA 4E7PA 3S1AB 3VJKA 2GPAA 3LY9A 2VH2A 4RQBA 4UTVA 2QX6A 3R76A 4MVCA 1NQAO 1JEAA 1N2CA 3UW3A 4QATA 4BRSA 1PEDA 2G17A 1XKXA 3EF1A 1QRTA 2VDLB 4YJ3B 2H2HA 2PMEA 3VYRB 1AQNA 3IPYA 2NX2A 3TGPA 1N5DA 5LP6A 1GGJA 3D64A 3HUFA 2ZKIA 3QP9A 4B76A 1PNRA 4ZJPA 4O4HA 2AB0A 1CUGA 2Y8EA 5FYQA 2NU8B 2BAGA 4ETIA 3QE9Y 1QX4A 1DAOA 4HYTA 5L4SA 4MULA 1EIWA 2AWNA 2PWAA 3PCRB 1C9NA 2WFLB 3CE6A 4WZAA 1Q77A 4GPEA 5DNAA 1C4WA 4LJKA 1CT9A 1SD1A 4PF1A 2LCIA 3VVLA 5EXXA 3OI7A 3AX6A 2CLDX 4FS8A 2H5LA 1HT3A 1WSAA 2BFOA 1GAQA 3JATB 4YLEA 4A4DA 3WHKA 2C8KA 2HU8A 2YJ6A 2J87A 4LGVA 3VKVA 4CKCB 5IF9A 2OESA 3O5AA 3OOEA 5KJ6A 3UXMA 1Z6AA 1YB1A 3R6WA 4AXXA 2QXUA 1E32A 4ER7A 4AJEA 4HGNA 3P52A 3H42B 4HGRA 5DM1A 2PZLA 4LF7B 2HLDA 3SQXA 4JJ6A 3CVJA 1PJZA 5F9HA 3J7TA 4PQYA 2ZI7A 3H3JA 2PZJA 4K9RA 1UQTA 4P5DA 2J0UA 1IEVA 1O3YA 1NATA 2JK1A 2POQX 2TSYB 4RS3A 3KETA 2W2NA 3O82A 2GS9A 4F93B 2VAWA 1QYVA 4G85A 1E2QA 4K8OA 1W5SA 4IVPA 3DG9A 1DG3A 2PS9A 3HB7A 3ROMA 2FEOA 2X0NA 2WOJA 1OBCA 1LLFA 3LUBA 1UBGA 3OE4A 2OHOA 4JR0A 4HDKB 4PIPA 2EF1A 1M6HA 1G6HA 5KSPA 2E55A 3BTVA 4QQKA 3TOCA 3PPIA 4OL0A 1T2DA 5JE8A 1X1DA 1L5FA 2J6HA 1WMEA 2WPNA 2RBEA 5T6MA 2YV4A 3GAFA 4EY7A 3R9XB 2X4LA 3GVPA 5CK4A 3V7UA 3RQIA 4D3DA 3V8MA 2JJMA 1P1IA 3N1UA 3PRYA 2DJIA 1XWIA 3SE7A 2O06A 1EFTA 3W34A 4QG3A 2WV7A 5AXDA 1NM5A 2XQVA 4DLBA 5L4NA 4HLUC 1A8PA 4GE0A 3HQ4O 3DE4X 5HS6A 1WCXA 821PA 4M9QA 1GCUA 3QVXA 1I8TA 2H0RA 2PRKA 2IK8A 5LJLA 1ODTC 4DMMA 2PUEA 3WHLA 3N74A 3RGGA 1JNYA 1E98A 2YKGA 4I4TF 5DEIA 2FPPB 1SB9A 3ZHXA 2BR4A 2JKVA 3O8OB 1JZQA 3MXOA 1Z17A 2XPCA 2JFHA 1GKUB 4FHFA 4RVHA 3RG2A 2XKAA 4ABTA 5LJIA 1W0KA 4MHOA 3M8KA 4IIUA 2QTLA 3UICA 4URWR 5FKJA 3C16C 5A4FS 2N1MA 1N2XA 2AL7A 3ZDAA 2O2DA 5BPFA 5F64A 4EHIA 4GLJA 2V1UA 4UOZA 4TM8A 1RZVA 3K4PA 5C8DA 5AIAA 4GOND 4ILKA 5T7BA 2V1XA 1XK7A 5EMNA 2VOJA 2EW1A 4DY6A 1SIOA 3WKBA 1BWQA 3FDIA 2GN1A 3OAAA 1A8IA 1ORRA 2GZSA 2NV2B 4J0EA 4MV6A 3C6ZA 2V96A 2AI3A 3UB4A 1JFFB 5G1PA 3B1KA 3VU9B 4EQ6B 2PRIA 2QRHA 1NG9A 2AJDA 2H07A 4BCDA 3OLZA 5K4GA 4KR2A 2DBVO 3MYYA 1OQAA 1Q0LA 2JASA 3DE0X 2UYHA 2NQTA 5AVRA 1QVVA 1PF7E 2Q6IA 3JQDA 1IOWA 3K1TA 3L3BA 2GAIA 4G25A 4NZMA 4PE5B 3ZZMA 2XGSA 4C6SA 4CZ2A 4DCOA 4LOIA 5IXJA 1CR0A 1NMSA 4S1OA 5EKDA 3VKWA 3UPTA 4W9MC 1A8QA 4MAFA 5DXJA 5FWDA 1JMVA 1GLGA 2CB9A 3BF7A 4F3YA 1E0SA 1QOPB 3NTQA 5EN4A 2UZ1B 1U7XA 2EHJA 1ZVJA 3RH0A 1SUWA 1PSZA 3IT3A 3K1JA 3PEFA 4LY0A 4EYEA 1QGAA 1UUFA 1LBIA 5EJ8A 3VR4H 1E8MA 2PL3A 1MJGM 1FRFS 1E3JA 1Q22A 2YNMD 3ETJA 1AHPA 1VKRA 3O8NA 3OPVA 2C9YA 2G9RA 3IS3A 5U4XA 1IE3A 1Y37A 1G9TA 4U6NA 5E4TA 3NXKA 1L7AA 2YJ4A 3JR7A 4MUYA 4CM7A 3PC8C 1DAMA 1SOWA 1PYOA 1XTRA 1Z36A 4N48A 1J00A 3L4JA 1G2OA 2RE8A 3F5MA 4YP0A 4TKUA 1MOQA 3CNLA 2HWKA 2X4IA 3AU9A 1B3RA 1T9BA 2G3YA 3BTUA 5IASA 5B2FA 4K1LA 2D0DA 2R6CA 3TL6A 2QTGA 4CV1A 5TPZA 1WW8A 5ADUS 4NENA 3LLCA 2AS0A 4JL5A 1ZH8A 3OOHA 3TM4A 3WX0A 4HB2A 1ZGJA 5AM2A 1QQ5A 4J3NA 1P72A 3G9UA 3GR6A 3L77A 1YQQA 5D5PA 1QNFA 4LDRA 5FNVF 3RUAA 2BGMA 1FB5A 1RZ3A 4XLZA 5CM9C 5BRJA 5CYGA 3CVXA 3DVRX 2JG3A 4DLWA 4RLSA 3VZRA 4I99A 5IAKA 3GJ3A 1ZD3A 3R5JA 4TT8A 5JS6A 1A4UA 4RHXA <