1N6NA

Crystal structure of human rab5a a30r mutant complex with gppnhp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
167
structure length
167
Chain Sequence
GNKICQFKLVLLGESRVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Ras-related protein Rab-5A
publication title High Resolution Crystal Structures of Human Rab5a and Five Mutants with Substitutions in the Catalytically Important Phosphate-Binding Loop
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2002-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1n6nA00
1TNDA 3IIKA 2QZ4A 4MGZR 2I1QA 2HF9A 2KBFA 4H1UA 4V0MA 2OO7A 5SZIA 2VP6A 2BJWA 1NMYA 4TMVA 4O3MA 4Q02A 2V7QD 3R8FA 4HUTA 5CJPA 2VHTA 2ZSFA 3Q7QA 5CYOA 3K70B 4TYNA 5TV2A 3QF4B 5TXGA 1W2GA 1XU4A 2ZSAA 4AG5A 1KMHA 2JAQA 4ERNA 1OYYA 4DLRA 2GF9A 5IT5A 2PJRA 3EIHA 2QA5A 2KSQA 1EWRA 1Z0KA 1X8LA 1RE0A 2ORWA 4D0GA 2A5GA 5FTJA 2GESA 2XITA 2F9LA 2N42A 3ZVMA 3K9HA 4RFSA 4NCIA 2GKSA 3C5CA 2AD5A 2LCFA 3I73A 4S35A 4BLTA 4HLDA 2AFHE 2K5UA 4A9AA 1T4GA 1ZIOA 4OYHA 2BMFA 4P32A 4Q1AA 4Y0VA 4XTCS 4Z54A 3TIFA 1XPUA 3KL4A 1IQPA 1F2UA 2OLJA 3A1UA 1IN7A 4KSBA 2RGXA 4B73A 1C4OA 1DAFA 4YMSA 1U8YA 3TUIC 1KJYA 1UF9A 4LJAA 3LFUA 4KJZA 2CMKA 2PCJA 3AM1A 2RGBA 4ZCLA 4LV6A 4IOLA 4LHWA 5BN5A 2FEMA 4Q4HA 2UZIR 5L3SA 2JDID 2V1UA 3JZMA 5FOSA 2FDCA 2N46A 2A5FA 5IK2A 5JS8A 1N0WA 4QHYA 3ZGXA 2O0HA 3CH5A 2OBNA 1TTTA 3DM5A 1TPZA 1G3RA 1P2VA 2H8KA 1TQ2A 2WOOA 1NG9A 3U4QA 3T35A 2HT1A 2ZRAA 1MR3F 4PQYA 5TARA 1AIPA 2BCGY 2X2FA 3LQQA 3REFA 3W8RA 1DG1G 4P33A 5A4JA 5DN6D 4TN1A 4B3CA 4BLQA 3SZRA 2ZRIA 4ARZB 1XTQA 5EE5B 3NDPA 1KNQA 2OFWA 2CHGA 2B8WA 4JJKA 2QE7D 4Q19A 3VR4A 1S3GA 3BE4A 3N5CA 1GL9B 3Q8XB 3VX3A 5CDFE 3GJ6A 3QKRB 4DDVA 4V0LA 3TR5A 2XNSA 3GFPA 4F92B 3TE6A 1Q1QA 3W6PA 4OKSA 4B3XA 1W4BA 3AP1A 3GFTA 4ON9A 3OEHD 4BZQA 1Q3HA 2HCJB 2OBLA 2IEYA 2NZJA 1KDOA 1S9HA 3LA6A 4NYIQ 4AYWA 4M1YA 1KMHB 1P3JA 1II8B 2D3WA 3CRW1 2CE7A 4CZ2A 3THXB 1E0JA 2ZRFA 4IDQA 1N6PA 4PQFA 5F98A 2W83A 2ZYUX 4MGIR 3C41J 3BK7A 3NH9A 4M4SA 1GVNB 2C95A 4EPVA 1Q0UA 3VTKA 4TZ6A 4IXMA 4DEXA 1E32A 4GDFA 4RFSB 1US8B 4LSGA 4EKDA 3ND8A 4Q5IA 4AWXA 3RS7A 4AURA 1FZQA 1T9HA 4Q7KA 1JR3D 5L3QB 4L9SA 2DYKA 1P9NA 1W1WA 1F2UB 1UKZA 4GSYA 5JWRA 2ZRDA 5KNBA 1G41A 3QEOA 1FNMA 1ZVQA 2XNDA 1XEXA 1BYUA 2CE2X 2IS6A 4D6PA 2KWIA 2ZRLA 2QTFA 5EXTA 2QMHA 1FPMA 3K53A 2ZJ5A 3IQWA 5DH9A 1XD2A 2QSYA 2FF7A 2FA9A 3AF0A 1E2MA 3NBYC 2W2XA 2FPMA 2H7VA 3FOZA 3W6OA 1OW3B 2FPLA 3PUZA 4N0EA 3QXJA 1HA3A 2FSGA 1KTVA 2CEAA 4JVMA 4KO8A 4Q4LA 1WB9A 3THYB 3B9QA 1E1RA 5CLQA 3U4QB 2V4ZA 3GLFA 4DZZA 1OIXA 1Z08A 3L82B 2WAXA 4RZXA 3QXHA 2G0NA 2IA5A 5D3MB 3WRXC 3OAAA 4JLJA 4CEIB 1R8QA 2BCJQ 2VSOA 2ZVPX 5KNDA 2P5TB 1GNRA 2GEDA 2ZRKA 2JLXA 1DAKA 3GP8A 1ZAKA 2ZJ2A 1SZPA 1CXZA 1R5OA 2ZRCA 3FKSA 5UKDA 1EGAA 1LVGA 1GILA 4HAZA 4V0NA 5HCIA 3GJ3A 3THWA 3GPLA 1TF5A 1EX6A 1AS2A 3DL0A 3L0OA 4XSHA 2C96A 2IXGA 5CK4A 2ODWA 4B74A 1E2IA 3FWYA 1G8YA 3FHTA 1EX7A 3KUCA 4PPFA 2ZI4A 2ZJAA 3BD9A 3PUXA 5L8VA 1SKYE 1NKSA 3EPKA 4MGKR 1JPJA 3KXKA 3I61A 2FE4A 3CH4B 5DYIA 3SFVA 3U3JA 5JRZA 1KOFA 3JZAA 3CZPA 2JJ2A 4GT1A 5IK2D 3U44B 1S1MA 1ZMXA 1XMJA 1BKDR 1E2GA 1H8HA 5HE8A 2R65A 1IN8A 2VF7A 4IVPA 2A2ZA 5KHOC 2IYLD 3FB4A 1W36C 3LW8A 5TVKA 1MKYA 2QGZA 1P72A 2GNOA 1MOZA 2ZRGA 1WRBA 2QPOA 1HYQA 3IEUA 2WTUA 1P73A 2P5SA 1G8FA 1KI6B 2B6HA 3B9PA 1SVIA 3MSXA 2BEJA 2NIPA 2RMKA 2ERYA 3UMRA 4WIAA 1LTQA 1G16A 4ZI2A 1M6NA 5TMPA 4PZLA 3I8XA 3CWQA 1EESA 1G5TA 1XEXB 2CJWB 4IVQA 1IHUA 3C16C 3UATA 3W9YA 2CDNA 1ZNWA 4PC3A 3CWZA 1TADA 4XD7A 2RGEA 1XRJA 4HB0A 4PAMA 4R98A 4ZKDA 3UWOA 3B6EA 2V55B 2Z0MA 3QG1A 1P9WA 4BFZA 3GJ0A 1Z6AA 1SHKA 3PEUA 1RKBA 3QPVA 1IJFA 2BHRA 4M21A 4PXAA 2QG6A 1M7GA 2QP3A 1E2PA 1Z5ZA 2BMDA 3P27A 3NC0C 3MFYA 3U2QA 5DSZA 2IYVA 2JLSA 2VLIA 1OF1A 2XJ9A 4LPKA 1KYIA 3GLFB 4HB2A 1CEEA 2XB2A 1XCMA 2BOVA 3J81k 2RGAA 4IDOA 1J7KA 1Z6XA 4IXNA 5CJ2A 4ZDWA 2UKDA 2RHMA 1RZ3A 4M0LA 1CU1A 2GK7A 4QJ3A 2IF2A 4UXHA 2AFIE 3ZD6A 3P4YA 3GQBA 3QE0A 5G3YA 3THWB 3IUYA 2ZE7A 5JJKA 4Z1MA 2WICA 4KBGA 2DBYA 2BC9A 4LDJA 2F6RA 3A36A 2YOHA 3ZH9B 1J2JA 2XZLA 1VECA 3ICEA 1TF7A 2VEDA 5FI0B 1ZUNB 3ZQJA 2JATA 4EAQA 2WJVA 3CNOA 1E6CA 2V1XA 4C7OA 1YZNA 2XNDD 1NLZA 1KK3A 1G7SA 1VCOA 1XEWX 5JJLA 4QBHA 4QM6A 4IW3B 1CBUA 1CIPA 3PVSA 4V03A 3TSWA 1G3MA 1G19A 4HDQB 4B2PA 2J0VA 2MSCB 4LJ7A 3NEYA 1CR2A 3T34A 1XDBA 1E69A 3GLHE 4GMXA 2DFKB 2QENA 4B6EA 2MSDB 1GKYA 3AVVA 5HZHA 1GUAA 2V8OA 3OAAD 1WQ1R 3RS4A 4QGGA 5HKKA 4GP6A 2O8CA 1ZM4A 3D8BA 4GOXA 1FP7A 2QY9A 3X2SA 3RS3A 2QP4A 3FKSD 1D2MA 2JGNA 3I4LA 4MRRA 2Q9AA 5GJBA 2F55A 2GWHA 4LYFA 1CJMA 3K9NA 3GD7A 1JQLB 4X8HA 1D9XA 1N5KA 1N6RA 4NCJA 3NBXX 4US0R 2P0EA 2OCYC 2W6JA 1SULA 1KY2A 3PFIA 4FD2A 4YQFA 2IS2A 4LHXA 4KI0A 2GILA 2QMUA 1ZM9A 5JJIA 3AUXA 1NLFA 3EWAA 4OL0A 3QKSA 4JLDA 2JJ2D 3VNUA 1Z22A 5JECA 4RD2A 4G01B 1G291 3VR6A 4Q7LA 1TU4A 3GLIA 1F6BA 4PHTA 3AV0B 1Z83A 3L0IB 3P32A 1X8KA 4QNMA 4RKFA 5LB4A 2GVDC 4IFEA 1QBKC 5EUMA 5HCNA 1ZRHA 1P7CA 3NG1A 4GI7A 4HZIA 3OE7A 2OSBA 3PV0A 4FMCB 1CJTC 1GNQA 1U99A 4TTPA 3AGPA 3W3AA 4P4SB 1K8RA 2WSSA 3KUDA 1BH2A 1TUIA 5EUQB 4A0RA 1E2QA 1U0HC 2ZAOA 2NQ2C 1L2TA 4C7OB 4YMTA 2REBA 3AUYA 5JWOA 1II0A 1P2SA 5BWMA 3RRZA 1BOFA 2IYQA 1P6XA 4DLXA 1PZNA 2GCOB 3F8TA 4PC2A 1ZNZA 1CKEA 3QPUA 1Q12A 2IXFA 3HP1A 1XXHA 3K0EA 4FMCF 4LJ4A 1G6HA 2GJ8A 3ZZUA 3AF2A 1LW7A 3W6NA 3K9LA 4LJYA 3IPXA 3BBPA 2RHDA 2QROA 4LV5B 2JASA 3ND9A 1PV4A 2WKQA 3RS5A 1P2UA 5K8IA 5AK0A 3E5HA 4CIDA 5EP2A 4IFBA 1ZD9A 2BKEA 4MGYR 4TMTA 5FPHA 3K0AA 4S2EA 1S2MA 4HSEA 2Z5FA 3KJGA 3OFNA 3O8CA 4Y0AA 2CNWA 1S9DA 2JLZA 4QHTA 2CLCX 3BOSA 4I1OA 4QL3A 1CR1A 1W44A 1KI1A 4Z1MD 2BEKA 2FGJA 3EWSA 1VYVA 3K70C 2EW1A 1FX0A 3QXSA 1N6KA 2IWHA 2AKYA 2J41A 3MWJA 1R7RA 3EZ9A 1RRFA 3NVAA 2VP0A 4BFSA 1L4YA 1U94A 3HYTA 2ZYWX 1ONBA 4KAXA 2VTKA 2C5LA 4B76A 2I1VB 4N0DA 1FQJA 4RY2A 4CEJA 4DEYA 2O8FA 3TUJC 1QRAA 1W5SA 2OG2A 3TBKA 4A36A 3NEJA 2VP5A 3VR1A 1F3OA 3GLIB 2F3RA 1OH7A 3LXRA 2Q3MA 4FMDF 1CRQA 1XX6A 3A4LA 3I3SR 1YE8A 1KI9A 3IHLA 4KSCA 4BLSA 3FHOA 3UG7A 5CK5A 5EXXA 6Q21A 5EZ5A 1T3SA 2WJJA 1W47A 3KKMA 4PPNA 2NPIA 5FPSA 2ODBA 2W0MA 1C9KA 5HKKD 4DLYA 1ZU5A 4TMZA 2HDNB 4UXJA 4R71A 1W36D 1U81A 1VIAA 5ELXA 1UM8A 2F43A 2V7QA 4BUJA 4NMMA 5BW8A 1JBKA 4WW0A 3SYKA 3ZS9A 3KX2A 5FFMA 1XEFA 3KKNA 1OXUA 3F0TA 3FHCB 1IN4A 1G20E 1LF5A 1QHHA 2W00A 1XFAA 4K8OA 1AJEA 3BB3A 3CX7A 3IHWA 1KO8A 3U60B 3RWOA 1GM5A 2W6JD 3QENA 1I4TD 4X8OA 1M7BA 1XXHB 2DHRA 4Q4JA 3W8NA 1PLJA 3AVUA 3KKQA 4A2QA 2GVZC 2B7BA 1KO7A 4MRSA 4XSGA 3B60A 3QBVA 1SVSA 3K09A 3D6TB 3TRFA 2WJHA 4CEHA 4UJ3A 1ZINA 1F48A 1FNNA 3GMTA 3SHFA 5J4LA 2VHQA 2OFOA 5KU1A 1WP9A 1OB2A 1KI7A 3I72A 2FG5A 2H16A 2FGKA 2XJ4A 3K0AB 4FCVA 1G17A 2DWQA 4ZKEA 1P4SA 1IN5A 2DFLA 3QKTA 1I4DD 1SVWA 2IUTA 1DELA 4A0HA 1XMVA 3H84A 3OE7D 2D62A 2WWHA 4DBLC 4HZUB 1XPOA 1TUEA 4GOKA 1LV7A 1SXJC 1FX0B 4NKRA 1SHZA 2ZU0C 3SN6A 2D2FA 1CULC 1XMIA 4FN5A 1ZC3A 4JKYA 2ZI7A 2X2EA 2QT1A 3QF4A 1MV5A 2ZRNA 5GJCA 1CRPA 2GAOA 2R6CA 4D26A 4AKGA 1UKEA 4B44A 5J4KA 1OH5A 3NH6A 1M34E 2PBRA 1Z0IA 4CT4B 2NOAA 3E1SA 1GG2A 4AYXA 1W2HA 2ZI3A 4JT2A 1VIYA 1IN6A 1UPTA 2IYUA 5BN3A 2LKCA 3IPYA 1NN3A 2Q21A 4BZXA 1XJ0A 1XTKA 4TL7A 1UFQA 1B23P 2HYIC 2QU8A 1Z63A 5FL3A 5M04A 3GLGE 2VBCA 1F60A 2ZYVX 3PQCA 1T0HB 2CBZA 3GJXC 4ESVA 4MYTA 1FW6A 4UNPA 2ZJYA 4O2RA 1E99A 1UKYA 3SFZA 1S96A 4I81A 3OFND 621PA 2FSHA 1ZYUA 3FVQA 2CNWD 4JLMA 1O3YA 3M1IA 3A8TA 3U7EB 3FTQA 4PTLA 4MKFA 1QDEA 3CR8A 4LHVA 3WNDA 2YHSA 3KQNA 1QHHB 3B82A 1G3QA 1KK0A 1UEIA 2VRWA 4OJQA 4OK5A 2OM2A 2BIFA 4A2PA 3CRRA 3EA5A 1NY5A 3CF2A 3HU1A 3IQXA 4IDNA 1AGPA 2L0XA 2OFXA 2WKPA 3RABA 4BZPA 4PANA 4DDWA 2W6IA 2Z4SA 4XWOA 2YWHA 4PZYA 2PX3A 1CR4A 1QF9A 4AK9A 1VPLA 3MRSA 1NN0A 2CCGA 2VF8A 3DOEA 4P4UA 4CEHB 2WIAA 4G5GA 3QI2A 3M4YA 2B92A 2AXNA 1X1RA 3GEEA 2ERXA 1XBTA 1EFTA 5FUVA 3W3ZB 3RSOA 1X1SA 1Y3AA 5LD2B 2C98A 4MUBA 1QHSA 3WYGA 3N2EA 1XZQA 4GP7A 4KVGA 3QKUA 3TKLA 2PMDA 2PMKA 1YRAA 3BAFA 1DAEA 3HJNA 5CB6A 3O8RA 3QKRA 1DPFA 2W2TA 4A1FA 5H8WA 3R7WB 4R2IA 1NBMD 1CJKC 1HEIA 2BM1A 1CJUC 4CF7A 3R9IA 2PZGA 3REGA 4UXIA 2QI9C 1SXJA 2B7CA 1E9FA 4W5JA 1II8A 3PUWA 3THXA 4B48A 2WJYA 4DIEA 4HYYA 3CPHA 4UKDA 4LJ8A 5C1BA 1X86B 2H5EA 4LY6A 3T1OA 1XPRA 1F5NA 2X1VA 1YR9A 1KO1A 2OV2A 4OI0A 1YZGA 1KI2A 1OXSC 2PLFA 2BWJA 4DCUA 1US8A 3U5ZB 1XWIA 1Z2CA 2ZSDA 4IEEA 3EZFA 3OHMA 3DHWC 3CB4A 4OQLA 3RLFA 2AK3A 2YWGA 3TQFA 1G1MA 4URUR 3DKPA 3VAAA 2BBTA 5IF9A 5L3QA 1KY3A 4G5QA 1DADA 4QBFA 3F3YA 4YMWA 5CIWA 3WMGA 1IXZA 2IBMA 4N1AA 4DVGA 3EPJA 1GFIA 4AYTA 4F4JA 3TQCA 1WXQA 3TNFA 2GEVA 3KTAA 1T3LA 3HR8A 3RAPR 3KJEA 2QAJA 1NP6A 2E9SA 4YC7A 4B33A 1II9A 3U61B 1GP2A 1P9RA 3WYAA 1I4LD 2AXPA 4WZBE 4A92A 4JS0A 5DGXA 3FKQA 4WXPA 1GITA 3QSYA 3GJ4A 2GBLC 4ASUA 4ZI3A 2JLUA 3X1XA 1GL6A 1N2CE 3K70D 1CTQA 4LYHA 3DDCA 5F2EA 2FV8A 2ZREA 4DUGA 3THYA 3TW4A 2ZIAA 4L4UA 3IEVA 5JI2E 3IO3A 5KPDA 3L43A 3AVWA 3QG5A 4URWR 4BASA 1GZSA 3AQ4A 1NNEA 1GOTA 4Q4AB 1AS0A 5J4HA 5D3MA 3SQWA 4CEIA 1I2DA 2AWNA 4D82A 3AVPA 3LDAA 4J0QA 2GZDA 2HXYA 1NL3A 1Z47A 3BH6A 4DB2A 1COWA 4X8LA 2QNRA 4KYUA 3EG5A 4KYIB 1U0LA 5JEDA 1YU9A 1W5TA 1NKTA 3EASA 1RC8A 1NRJB 4W9MC 2C99A 4RSGA 5F9FA 4DLZA 3G82C 1XZPA 2HEIA 4U5XA 2C9OA 3QJYA 1DBSA 4PHHA 2PT5A 2QUZA 5JCZA 1SXJB 2SHKA 1VYUA 1WCV1 2RAPA 3UPUA 4OI1A 1FUUA 3U44A 2V9PA 2QT0A 4JLVA 2VP9A 1E9CA 3AF3A 1NLYA 3QXXA 4MYUA 4JIMA 2W6ID 3K0CC 4Z8XA 4LWZA 4D0LB 5J47A 3LVQE 1TL7C 4KFUA 1IBRA 2A3RA 3ICQB 3LLUA 2ZROA 2EQBA 3A1TA 3FPAA 1LY1A 1MRSA 4WZ6A 4XWKA 1T91A 1XB2A 2ZITA 1KI6A 1U98A 3U3OA 2OLKA 4LJ9A 2OXCA 2Q6TA 4JSTA 1MABA 4KFRA 3PR1A 3KTAB 2P3SA 4A6XA 4KHZA 5K8LA 2CJWA 2YNMA 4IRUB 1AA9A 4RKEA 5DLQC 3U7HB 1N6LA 4QNRA 3EW9A 1BMFA 4XH9B 5EXPA 1ODFA 1ZW6A 5FTMA 3VQTA 2JLWA 1E4VA 4EJSB 1RVDA 3AKDA 3BJIC 2G83A 1E98A 3BXZA 2PEYA 3AVOA 2RCNA 1EFCA 1SXJD 4DLSA 1S1CA 2QAGC 1I2MA 4B47A 4LYJA 1AQYA 2GBLA 1WBDA 4NCKA 2V54A 1KSJA 2A30A 3T5DA 1QVAA 2AK2A 3WHLA 1RW4A 4KFSA 5E3HA 2V6IA 4Q66C 5AJWA 3BFVA 4RCYA 1G18A 4BEJA 1CP2A 3ADKA 2FZ4A 5AJYA 3DPUA 2G0TA 2FNAA 2OEPA 3ADCA 1NVVR 1JB1A 1UBGA 4IEIA 5B2ZA 4KBFA 2HYDA 1E2JA 3RC3A 3VU9A 2XZPA 3FMOB 4BECA 4YMUA 4GMDA 1GNPA 1ZP6A 2P6RA 1A7JA 1KAGA 1AKEA 1NN5A 3GJ8A 4Q9LA 3W5IA 4CVNA 4JL8A 3QF7A 5DI3A 1YZQA 2QSZA 2VQSA 3D3QA 1RIFA 3GCGA 4GNKA 4NHOA 4C0SA 1OT3A 5C18A 5JS7A 5EJEA 4MKIA 1XMSA 2CLDX 1JR3E 2FFBA 3T15A 2CLSA 3T1TA 4U02A 3WNCA 1AZTA 4KXFB 2ANCA 1ZCBA 3G0HA 4WA7A 3DMDA 3S1AA 3W34A 1WBBA 3X1YA 1OIVA 1NF3A 1JPNA 2G1KA 1T6NA 2Q0HA 2ZQ5A 3C7KA 1PJRA 4ASUD 4U7DA 3WP0A 4LC1A 4BFYA 3GLHB 4UNNA 4TWZA 4LHZA 1E9RA 4DUGD 2KB0A 3RC8A 3TMKA 4LK2A 2NO0A 4V0ME 3EIQA 5FOVA 3C8UA 4C0JA 1VDZA 2ANBA 2QN6A 4GFDA 4QM7A 2GA8A 3K0CA 1W49A 2JA1A 1GTVA 5DIFA 4TYWA 4UQOA 1BYIA 1LFDB 3EZ7A 4Q03A 4CT5A 3L0PA 1MABB 3SDZA 3E2IA 1W0JA 2ZE8A 1JJ7A 2DR3A 2IEZA 2JJ8A 1COWD 2LWIA 4XVQA 1O87A 2V6JA 4HUQA 4D4MA 1FUKA 1VKJA 2P67A 1HH4A 2ZJ8A 5IDVA 3VR2A 1IOZA 2ZPTX 2OBMA 4TYYA 2J7KA 2R6DA 1DE0A 1KK1A 2IXEA 3ONWA 4DJTA 1DG3A 1E2DA 3BGWA 2IF0A 2OUKA 1JAIA 1UJ2A 2C8VA 3LLMA 1KDTA 3ZZTA 3VFDA 1XTIA 1TX4B 2GAAA 2A7QA 4NU0A 3T1VA 4TL9A 1D2EA 1VG0B 5FBVB 4WVFA 3SOPA 3DVLA 5EXSA 1Q20A 1D9ZA 4JBXA 3WMEA 1E9DA 3QNUA 4JVSB 1L8QA 4Q7JB 5GJWC 1XF9A 2QAGA 2WPDA 1JALA 3MG9A 2JLQA 4PAQA 4DB4A 2YYZA 1NVXQ 2E87A 2HCBA 5CYPA 4CYMA 4R7ZA 3PCRB 3VU9B 3BWDD 2FX3A 2BMEA 3A1WA 1QG2A 1R0XA 3CO5A 2ZS7A 4YLGA 2GZHA 1HURA 1OKKA 4P4SA 1J90A 1SQ5A 5DI3B 1NMZA 2ZRPA 5JSZB 4JLBA 4JJZA 2VP4A 1M7HA 4Q48A 4TLDA 1IXSB 1ZIPA 1EWQA 1LS6A 1R0WA 4CRWB 4PPQA 1BMFD 3F5FA 3S1AB 5K8UA 4M9ZA 1AGRA 5EP4A 1G6OA 2F9MA 2GCOA 3KFVA 4BRWA 2GK6A 3MJHA 1E2LA 2GXAA 2P6UA 2GHIA 1N3BA 2H57A 4YDSA 3UXMA 4LUCA 4AI6A 5JRJA 4IDHA 1Z6TA 4KFTA 1ZM3A 2YC4C 4TMXA 1HE1C 4GOJA 1DAHA 3CLVA 1P75A 4XJXA 2XZOA 5JMTA 2OCPA 1DEKA 3BORA 4G0NA 3V4FA 4BFWA 4C0LA 2WWIA 1T8TA 3I5YA 5KDLA 2O0KA 3UG6A 4CGZA 2EVWX 1E1QD 1JXMA 2YV5A 3LBNA 4Q1FA 4MH0R 3QVUA 2C9CA 4LHYA 5B57C 3B2EA 5DHAA 4HUQB 4DXAA 1D2NA 1R8SA 1R10A 3TSOA 4TMWA 3MWLA 2Q9CA 1KNXA 2H1LA 2XTMA 2IS1A 3MMPA 2ZI5A 1QZXA 4PAOA 2C78A 4P3YA 2J87A 4N3NA 3RANA 4II7A 4HLUC 2DPXA 1AKYA 1N0VC 1YKSA 2DFTA 4V0KA 2WWWA 4RVCA 1RRCA 1HE8B 1E2KA 4ACBA 4B34A 4IOJA 1A82A 2HLDA 5KSYA 3SC3A 3C15C 4L16A 2A9KA 3C4JA 4OHWA 4PC1A 2J59A 5LPNA 3L0SA 3T06B 2F7SA 3LXXA 4O25A 2QAGB 2IUUA 1YR8A 2ATXA 3B1ZA 1BIFA 5F3WB 2OCBA 1G9XA 3AF4A 1YRBA 3ZVLA 4F7WA 1ESNA 1Q1BA 2ZXUA 2YZ2A 3U6KA 2ODEA 1K6MA 1N6HA 1QG4A 1LNZA 3QUSA 3PJRA 1Q1ZA 1RFLA 1IAQA 1X6VA 4A8JC 3PUVA 2GXQA 3A37A 1IONA 3CBQA 3Q3JB 1A5TA 3WRYC 1G4AE 3GLFE 1W0JD 2BKUA 3LX8A 1KGDA 2YWFA 4L8GA 5AUPB 4BRUA 4E03A 4LJ5A 2R62A 3O8BA 4C0QC 1BO6A 1FFHA 1Z8FA 4HAUA 3CF0A 4DLWA 1E0KA 3QVVA 3VR3A 3V00A 1G8GA 2QL6A 4O2LA 4Q47A 3FMFA 4D4LA 2EFGA 3LY5A 3PENA 4I1VA 5FOUA 1CLUA 2NO7A 3GJ5A 3Q9LA 5FH9A 1DAIA 1HQYE 4LC0A 4QGAA 4US1R 3V4RA 5LD2C 3Q5EA 4MQBA 4HLQB 5JHGB 1KO5A 4MDEA 2ORVA 4RZ2A 2W58A 4EPXA 3VX4A 1XTRA 1D6JA 4TT3D 3A6PC 4EUNA 5FUYA 1ZUHA 5J4VA 1YVDA 4ZV4A 1Q44A 2J3EA 2NTYC 2WPDD 2OHFA 3KB2A 3RNLA 3SQXA 1OH6A 3SJZA 2EWVA 3TLXA 1R5BA 1H65A 1MO5A 4ITRC 2DFNA 2QMOA 1E2EA 3TVTA 8OHMA 5JEEA 4TSFA 3B13B 3B7GA 2ODNA 4HZUA 5KOYA 3K1JA 2JJ1A 4CW7A 1E2NA 1PLKA 3VHLB 1NJGA 1OKKD 1UBEA 3AVYA 1NMXA 3G5UA 4RD3A 1N5IA 4EQ6B 4JLAA 3CR7A 3KZ1E 1L4UA 2JCSA 3B8HA 4G5OA 4OK3A 5FL7D 2J0QA 4C2UA 5BXQC 3OEED 3SEAA 3VHXA 4FWTA 4NYIR 2ZJBA 1JECA 3R8CA 2VH5R 4XWAA 3B1VA 3E70C 5JHHB 3JVUA 3T1QA 1WDTA 3CPEA 2GZAA 1Z29A 4HLUA 5DYGA 3GJ7A 2ZAMA 2ZRMA 1IJEA 4FCWA 3O47A 2DWOA 4DLVA 3DZ8A 4FXPA 3FGNA 2FFQA 4B2IA 3CRQA 1GKIA 3IO5A 1J8YF 4PFSA 4PSAA 3I1FA 2WIBA 3MUFA 4PSKA 3SJAA 1XD9A 2VYFA 4IOKA 4C3ZA 1J99A 1J8MF 421PA 1DVRA 4M8NE 2JLYA 2WMOB 1IY0A 1Z0FA 3TAHA 4Q1DA 1EFHA 2ZR0A 1NBMA 4NBSA 1SGWA 2NO6A 4HB3A 1AK2A 5AJZA 2KE5A 1AZSC 4AKEA 1JEEA 4RD6A 1LF0A 1U9IC 4U00A 1OE0A 5EQTA 1U8AA 3BFKA 1ZU4A 4BLRA 4RFVA 4B3FX 2Z4RA 2B21A 1UBFA 1G5PA 2UZ3A 2BDTA 1K5DA 3MGCA 2EU8A 3W5JA 5AJVB 2DB3A 2PX0A 4OI2A 3BRWD 3A4NA 3C5HA 5AUQA 4Q21A 4TMKA 4HDOB 2IYRA 5EP3A 2ZUCA 3MJRA 3O8DA 2HLDD 4Q9JA 2O8EA 2R6FA 2YVUA 2WOJA 1JR6A 4RZUA 1WE2A 3RSLA 3IGFA 1P2TA 2CL7X 2ZRBA 1ZUIA 2GCNA 1HTWA 3KB1A 3U3RA 3ZS8A 5HTKA 2O8DA 2XXAA 4US2R 5JFGA 2OZEA 1Q21A 1T5IA 3WBJA 1R0ZA 1Z07A 4LV8B 4ZIRB 4JLKA 4TTQA 5BYKA 1YZKA 1E79A 3U3MA 3WXMA 2VHUA 3C14C 4LJ6A 4OK6A 1MH1A 3MD0A 4K81B 4IHQA 3R7WA 4UNRA 3DEFA 4F91B 3V9PA 4LBWA 2FMXA 2WV9A 1XCGB 4LRWA 3UMSA 3CX8A 2IX3A 1TF2A 4BFXA 1YQTA 3NHBA 1XD8A 3MAAC 1Z0JA 4TZ0A 2ZU6A 2ONJA 4EIWA 2VSFA 4ACAA 1KJWA 3NHAA 4D0NA 3SJBA 3ZLJA 3NIBA 2QQEA 4EFNA 2E1RA 1OSNA 3OZXA 4NCHA 3K8YA 3FYHA 4LBZA 3CM0A 5C46F 2BBSA 2PT7A 4E22A 5CIQA 4KVAA 3SE0A 1DAGA 1B0UA 5GVRA 4Z51A 3DM9B 1YJ5A 4TLAA 3NXSA 2W0SA 4LPSA 4BWYA 2CHVA 2BJVA 4F38A 1N6NA 3M0EA 5FTLA 3EIEA 1VCIA 4E07A 1OHHA 5F9HA 1CJVC 1J70A 1PUIA 2J7PA 4TSFD 4EJSC 5C2JB 1W48A 2AKAB 4A8JB 4DSUA 2XOKA 3L8ZA 4PO1A 1Q22A 2JJ1D 4I4LA 3GLIE 1RPZA 3OIUA 5KNCA 3I92A 4B75A 5SZKB 3U6BA 1U9IA 3QEJA 1ELOA 1YZTA 5C4GB 1TAGA 221PA 2GJ9A 4RCZA 4NH0A 1WMSA 2F1RA 3NC1C 4MITA 2ATVA 1QHXA 1W4CA 4DSTA 3MCAA 3NDBB 1SVLA 1FQKA 2J0UB 2O8EB 3VKWA 3KKOA 2REXB 4GZMA 4QC2A 4Q4AA 5G40A 3B1WA 1ZNXA 4OHXA 4D81A 4I1UA 1KDRA 3ZVRA 1KZ7B 3Q5DA 4AY2A 4IDPA 1MO3A 1JNYA 2PCLA 2XXAB 2O8DB 1NI3A 3CX6A 3KXIA 3HYRA 3H86A 3HDTA 3PUYA 5SZHB 3R9WA 4M1KA 5KUTA 4ILEA 4TYQA 4DT1B 2QORA 1KJZA 1Z2AA 4OQMA 1NSFA 1XXHE 3Q85A 2KJQA 2W2VA 3L8YA 5H1YA 3RDPA 3ZQ6A 4JSYA 4QFMA 1XJCA 4C0KA 4L15A 4URYR 4YMVA 2GXUA 3KXLA 1G4UR 2CHQA 4NYJR 3FFAA 1ZD8A 4JKIA 1DOAA 1HV8A 5EP1A 4TYPA 4Z8YA 1EFUA 2WWGA 5DE3A 2G6BA 1EFRA 2X8AA 2R2AA 3AGQA 4HLCA 4JBYA 3EX7C 2QBYA 2YJTD 1KMQA 1W0KA 1E2HA 2G9NA 1Z6GA 2QM7A 4ZDIA 3LO5A 4OJKA 3KFXA 2BVNA 5J40A 4BFUA 2AHOA 2ZVQX 5CLLA 4R9UC 4BFVA 2RB4A 1P60A 3RRMA 1R4AA 5JWHA 4L5BA 3ZZ0A 1G7RA 2A78A 3I32A 4FCTA 5JCPA 4V02A 1FTNA 4M9XA 1Q57A 1AN0A 3LVRE 2BMJA 2RGGA 5E4FA 1KHTA 1HT1E 3EZ2A 1N6OA 2GXSA 2O0JA 2P6NA 4FINA 2NO1A 4MRPA 2CXXA 1DO0A 5L3RA 4H9GA 5LBIA 2AX4A 2FFAA 1E79D 1E4YA 1YR6A 2GJKA 2ZUBA 2IW3A 5CM8B 4G5SA 3EPHA 2OESA 3CNLA 3N2IA 4OQXA 4QJ4A 5BYJA 3UKDA 4F93B 2GETA 3PEWA 1ZNYA 3TR0A 1GRQA 4EJSA 1T5LA 2ZI9A 4MRVA 1XTJA 3H2YA 1U8ZA 4KLZA 1E3MA 2J9RA 2F1HA 3RRYA 2LKDA 1SKQA 3ASYA 3P20A 4ESHA 1HT2E 1HY3A 3ECCA 4A4DA 4NDZA 5LDDC 2KBEA 1NBME 2HV8A 2D7CA 4TLBA 1T8UA 1UDXA 2CK3D 2QPAA 3TSZA 3PEYA 2NPFA 4XOIA 4C2TA 3EC2A 3ZD7A 2OAQ1 3OIYA 4PZZA 1NSTA 2QTVB 2IS4A 2Z6VA 3OF5A 2AL7A 2QGNA 2YWEA 4TLCA 3BIFA 3H4MA 2FN4A 4Q00A 2YKGA 2QM8A 3OIWA 4URVR 2ZE5A 3JVVA 1PUJA 2ZRHA 5TDHA 3KQUA 1SKYB 4R2HA 5FBQB 1P62B 4QBIA 3TH5A 1OHHD 3WP1B 3BH7A 2NGRA 2J7PD 4HI0E 1DAMA 2XOKD 4JLNA 4UNQA 1G5RA 2NO9A 5H68A 1OXVA 3MWKA 4YXWA 5TB5A 2QBYB 5B58C 3EA0A 4HAWA 4C0HA 4LYAA 1M2OB 5HR5A 3KJIA 3H0KA 4PPGA 4QOSA 3SBDA 1KKLA 1FP6A 3GLHA 4XTRA 5GADl 2IYXA 2VL7A 3QY0A 1T0JB 2UVQA 4UJ5A 5C4MA 1QHGA 3X1DA 4OBEA 3HU2A 1G64A 2XSZD 2WJGA 4AKIA 5EE3A 4Q9KA 4JVNA 2JEOA 2IYTA 4NONA 1G7TA 4RZ3A 4PO8A 2IHBA 3NKVA 2IWRA 1RRPA 2CCKA 1NN1A 2CVFA 2AD1A 2MMGA 4OQFA 2OXRA 4C0AC 3LD9A 3MWYW 2MSEB 4LZZA 3P1JA 4NYMR 1G3IA 4ZPXA 1ZC4A 3T12A 3I8SA 1LB1B 4OQNA 1VCNA 1ESMA 3TJZA 4MRNA 4XVUA 2XTZA 2GJSA 3P26A 2JLRA 3D31A 4K46A 3A58B 3UWKA 5AJXA 1OH8A 5G3ZA 4GPTA 2EFEB 4XVRA 3KKPA 4PSVA 3QIAA 1XTSA 1KSGA 3W90A 4DCSA 2BBOA 2ZUDA 4M2LA 3SU8A 1EFRD 2ZS8A 4JL5A 3DKVA 1V43A 3QXCA 5CM9C 2PZFA 1QHYA 1EXMA 2J45A 1W0KD 2H17A 4I99A 2JLVA 1RRGA 4KCGA 3BB4A 3TGPA 1GKUB 5AUNB 5FR2A 1OXXK 3GEHA 4Q4HB 5L3SB 2Q9BA 4TL8A 5JI3E 2VSXA 1E1QA 3NBFA 4ZO4A 1IY1A 3UMFA 2PL3A 4TQ9A 2F3TA 1M74A 4JYBA 2Q3FA 3HPQA 4ZDKA 1OYWA 2EFHB 3VR5A 4NPHA 1Z3IX 2P65A 4G3XA 2XB4A 1E0AA 1XNJA 3P4XA 4DSNA 1Z0DA 2IL1A 3CRMA 3RRNA 3H1TA 3EARA 5E7JA 1TQ6A 5SZJA 3A1SA 4HAXA 5JSZA 2XTNA 3MLEA 3CUEF 4LX0A 3IDQA 3Q7PA 1OFUX 5EZ6B 3AF1A 1KI4A 1VHTA 3TVDA 3RHFA 3IIMA 5DNYB 2O8BA 2J0SA 4Q1EA 5FBLB 4DLUA 2IYWA 1D5CA 2FSFA 1RJ9A 4BLOA 5BQ5A 1Z06A 5ANRB 4DDUA 1NVWQ 1LS1A 1TEXA 2VA8A 1NJFA 3CZQA 1E9SA 4AD8A 1VHLA 5J5CA 4NCNA 3ZIAA 1AQUA 2XAUA 5EE0A 2GRJA 5HZKA 1VG9B 1KK2A 1SXJE 2A5JA 2ZE6A 4F4IA 1JXOA 1EK0A 3OIVA 5IRCD 2TMKA 3CKLA 1VMAA 2R6AA 1YZUA 1ZD1A 1ZBDA 4RD1A 5G41A 1SVOA 1ZCAA 1ETUA 4I1SA 2GDJA 3I5XA 2AWOA 2CCJA 4EDHA 4MDFA 4C4PA 1DARA 3ZVNA 2RGDA 2QRNA 5FPKA 1S3SA 1OLOA 3RYTC 4IJMA 2QEQA 4YXWD 3UANA 2H18A 4Q7MB 5KYKA 1P61B 4B43A 1Z0AA 2F1IA 3EZ6A 3UIEA 1YR7A 1W4RA 1XP8A 2O52A 2PLRA 4TT3A 2BM0A 1Y63A 2ZSBA 2XX3A 1XD2B 4JVLA 4NP6A 4UNSA 5J4YA 2OILA 3THOA 5E95A 1Z6YA 2ZS9A 2CL6X 3NTUA 1N6IA 4M53A 4EFLA 1IY2A 4B3BA 1AM4D 1SVMA 3K9GA 2DCUA 4B35A 2GJAA 1A1VA 3ZDQA 3A1VA 4GRAA 4EPRA 3SYNA 4BE7B 1XEWY 4JLOA 4TQUS 5FPYA 5KSPA 3SNHA 4DLTA 1UEJA 2FPKA 4D25A 3WBKA 3LX5A 2C03A 1IXRC 5FL7A 5FBRB 4ZCMA 5KO2A 3OEEA 4PHFA 2GCPA 1G8HA 4TL6A 3K0FA 1JEDA 4NL4H 4E09A 1NVUQ 4B3GA 5IHPA 1PVOA 2VHJA 1VG8A 2O8BB 5P21A 1GWNA 4BPBA 2ZYTX 4H1VA 1F2TA 4FMBB 4MKHA 3TUZC 4BEBA 5KSOA 4P4TA 1RJ9B 2YC2C 1PLLA 2QP9X 4DSOA 4NYJQ 4G1UC 3DOFA 2WKRA 4B71A 2IYZA 1Q3TA 2IK8A 1OIWA 3BB1A 2CL0X 4URZR 2QMEA 1ZM2A 3N70A 1H8EA 4M1TA 4XIGS 4RJLA 4EPWA 1GDDA 4M1SA 4MUAA 2I4IA 3PIRA 1M8PA 1OFHA 4IOMA 3RVBA 1NIPA 2QPTA 3WHKA 4A0GA 2X77A 3SR0A 1CS4C 1VYTA 4Q9HA 1A4RA 2WSMA 1OJLA 1E1RD 5G53C 3U3KA 4P0TA 1T3HA 1YZLA 2D2EA 2IHYA 1U0JA 3X1WA 3A4MA 4OHYA 4EQ6A 4A0FA 3FDIA 4F4CA 2N1BA 1HQCA 5GVSA 1OFTA 1CF4A 1ANKA 3CRVA 4RD0A 3AKEA 3EC1A 4PR0A 1UBCA 3PITA 4B2LA 4DCTA 4G5RA 3SBEA 1U90A 4W5WA 4EPYA 2ZJZA 4LGMA 1X3SA 4PX9A 4DWJA 4WAUA 2BV3A 4E5UA 3HU3A 5FTKA 4BQSA 821PA 2IT1A 2WMNB 3BH0A 4LOAA 1KIMA 4PC6A 1FMLA 5KDOA 2MMCA 2PZEA 2ZSEA 4Q1BA 4DCVA 3IBGA 3VKHA 1RYFA 3GLGA 3LRPA 3CNNA 4IKEA 4CDGA 3AKYA 4WXRA 4Q1CA 1G21E 1UADA 4FIDA 1Q1EA 2EFCB 1FL9A 1VTKA 2ZM5A 1S4QA 4Q01A 3ZIAD 4DIDA 1ZM7A 2RGNC 3R9XA 1OXTA 3SJCA 4KODA 4A15A 4AKHA 5HE9A 4JBWA 4P31A 5JLJA 1X8JA 3AVTA 2J46A 3FMPB 3SI7A 3ZJYA 1KI3A 5AWFC 2D06A 4PO9A 2IYYA 2QTHA 5KPJA 1G3UA 1H8HD 1R2QA 1UAAA 1EG7A 2VPPA 1UDWA 3U7GA 1E9AA 5FOTA 3FE2A 2QQ0A 2KI5A 1GL7A 1DTSA 2Q3HA 3K0FB 2GF0A 2ASEA 4KU4A 1SVKA 2ZJOA 1OFIA 1JJVA 3LQRA 4LCBA 2HF8A 2RKOA 4D2IA 4LBVA 3PEVA 2X19A 5AUOB 1F2TB 4NZYA 4MYHA 2VP2A 2XEXA 1U2RA 3TK1A 3AP2A 3RS0A 1GSIA 2C2HA 3QPWA 5L3VA 1KO4A 4HAVA 4A82A 4M1WA 1KAOA 4W7SA 1G8PA 1V5WA 1IM2A 2G77B 1JI0A 1OB5A 4GZLA 2PJZA 3L2OB 4TQAA 2G88A 4DHEA 5K8TA 3B1XA 3AP3A 5FPTA 5KTYA 3BERA 4XD7D 2WM9B 2Z43A 2P2LA 2GEUA 4YDHB 1NY6A 3ADBA 3K09C 4YONB 3NBZC 4ZIRA 3UK6A 1G7CA 521PA 4BGDA 4HAYA 2J1LA 5AR1A 2FFHA 2EWWA 4V0OA 3LH5A 4M1MA 2EFDB 4LI0A 4QGFA 1RYHA 2WWYA 1N5LA 4NE2A 3GEIA 4QHSA 2FOLA 4LBYA 4C0BA 3FMIA 2FH5B 1KDPA 4M1OA 5TY0A 2O8CB 2ECKA 1W36B 1QVRA 1MT0A 4NYMQ 1GRRA 3BC1A 3T61A 2FU5C 5KSZA 2WHXA 2JIZA 1P5ZB 1S8FA 3CF6R 1GIAA 1E9BA 4FMDB 2H92A 3QQ5A 3IILA 2RH5A 2YOFA 5FUWA 5LB2A 4ZCIA 3EXAA 2YINC 3BS4A 3LBIA 4FW9A 4HB4A 3GLGB 3IBYA 3FFBA 2EYQA 3AB3A 3LWNA 4W5HA 2WZQA 1WA5A 3HR7A 5FUXA 3K0SA 5DHFA 1XCPA 5FR1A 5FI1B 3KDSE 3KJHA 1GRNA 1FOEB 2R8RA 4GL2A 1XJQA 3WY9A 1H8ED 3RS2A 1NIJA 3LW7A 3QKSB 3IKJA 2ZETA 2D4HA 4PHGA 3X1ZA 5JZVA 1E9EA 1N25A 2FEOA 3QBTA 4B3DA 5EE9A 1GAJA 1TEVA 3AVXA 3OESA 1A2BA 4L9WA 3WNBA 2FJUA 2G3YA 2RGNA 3NWJA 4FWIB 2HT6A 4A8JA 3VKGA 4QXAA 1NVVQ 4HATA 2ORIA 1W4AA 4DKXA 4Q9IA 3KQLA 3LV8A 1A2KC 1YHNA 4O0MA 2VHCA 4QBGB 3KQHA 1QHIA 1TQDA 2Y8EA 2ZR9A 4JL6A 1DO2A 1MO4A 5FOWA 4ZDJA 2XGJA 4ABYA 5E7MA 1TMKA 5DI9A 2VO1A 1Z28A 1ZJ6A 2J0UA 2D74A 4QJ5A 4QRHA 2V3CC 721PA 3QOFA 4OHZA 4JYCA 1KI8A 2G1JA 4KITB 2WWXA 1KSHA 4WBSA 1D8TA 4JT4A 1W7AA 1VCMA 4HEJA 3AVQA 5CDFA 3SHWA 2AR7A 2ZEJA 2WVJA 1FMJA 4URXR 2REOA 5HPYB 3T5GA 2HJVA 3EAQA 2YOGA 2D7DA 4OHVA 4DT1A 2WWFA 4Q18A 1UKVY 2R9VA 1C1YA 3B85A 4DRZA 2DWPA 3WMFA 5A0FA 4D4JA 4DC9A 1W46A 5D3QA 3IIJA 1R6BX 4AC9A 4DDTA 4BFTA 1R5NA 3VNVA 2R44A 4PC7A 2GTPA 5DISB 3B78A 5EE1A 2IYSA 3SS8A 3ETLA 3D7MA 4TTRA 1OPXA 3RWMB 1S0UA 4QKQA 4JMPA 1N0UA 2PEZA 4FI3C 2O5VA 5JBQA 5KDDA 2HJGA 3PXGA 3CONA 2RGCA 2CK3A 2HUPA 2B8TA 1JAHA 2JDIA 2A5YB 2WSSD 5CITA 2EYUA 3HPRA 2OT3B 4M9QA 4KLNA 2CVHA 2FSIA 4MA4A 4B6FA 2HXSA 1E96A 2FZLA 1OV4A 2ZR7A 3DMNA 4M22A 4OI4A 4TLEA 3DZDA 4WOPA 1CR0A 4IVRA 2Z83A 1E94E 4MKGA 4QG7A 2R6GA 3SYLA 5B30A 5BN4A 1K5GA 2OE2A 2PH1A 2ZTSA 4C9BA 4CEJB 2A5DA 3VMFA 4BLPA 3PG5A 4NTZA 4C30A 2O8FB 2IUSA 2OAP1 1MO6A 2I3BA 2WAYA 4WZAE 4D80A 4A6PA 1M1YE 3CIOA 2ZANA 121PA 5DN6A 2FWRA 3M6AA 1WF3A 2C9YA 5DO9A 4EPTA 3I62A 1BS1A 3ZYCA 3LAWA 3LBHA 3AH8A 1TQ4A 2VIIA 1KZGB 2QE7A 1MRNA 2C04A 5B64A 1VG1A 2NZ8A 4PQRA 4MYCA 2NG1A 3OEHA 5GJVC 2F43B 1FTSA 4JZKA 2BBWA 3B5JA 4X8MA 3ADDA 2WBLC 2XSZA 4AIIA 3TAUA 4DCNA 1QHNA 2JIZD 2ONKA 5FOXA 5CB8A 2NMVA 3DO6A 1HUQA 1R0YA 3BFXA 4AG6A 5A5GA 1AS3A 4EFMA 2OCAA 3Q72A 3LNCA 3AKCA 4QGHA 5FBWB 4Q4JB 3U7FB 4HDCA 1DS6A 2F1JA 1TU3A 5FTNA 4A2WA 3EPLA 2WJIA 1E0SA 3HWSA 2ZRJA 2J5XA 1N5JA 4GBMA 4JLPA 4POAA 3R20A 1JR3A 2DY1A 3KQKA 2C77A 3B1YA 5E7IA 1KSFX 1JQJC 3TW8B 2AN9A 3CW2A 4ARZA 2QRZA 1KKMA 4B32A 5H70A 2ZI6A 4D4KA 3CPJB 1L7VC 1E2FA 4RD4A 3WYFA 3ASZA 4KV9A 3AEZA 4M9SA 3GFOA 2IC5A 1NG1A
chains in the Genus database with same CATH superfamily
3IIKA 2F59A 2QZ4A 1DHTA 2G07A 2HF9A 2YH2A 4MGZR 1E4EB 3AEQB 1I10A 1D2RA 2BJWA 3ZDXB 4O3MA 3U7RA 3LDHA 3B7WA 4KJXA 3ZNPA 2WKSA 2FE1A 2VHTA 2BSXA 3NWEA 4KV7A 1FP2A 2GOYA 2R68A 5TV2A 1CQXA 3D4NA 1UOPA 4TYNA 1EK2A 5F3DA 4IDFA 4AG5A 4V1CI 3LT5A 1JQAA 1Y0BA 4OYLA 1AKUA 3KQOA 2X6TA 1P1JA 2QA5A 2KSQA 1KEPA 1Z0KA 1Y9JA 1GXSB 5AP9A 4HXYA 3EVAA 1Y8RB 1QH0A 2DPGA 4H17A 1TYBE 5KKAA 3RSSA 4U2GA 1XRRA 5ALGA 4FILA 3IT3A 5BN3B 2NZUG 4KGZA 3K6KA 1BKYA 2O9JA 1AUXA 2C7QA 3ZVMA 4RFSA 2H85A 2NVUB 2EF0A 2AD5A 2J8ZA 3HGTA 4ZC8A 3RASA 5CEJA 3L5OA 3C7CB 1O54A 2K5UA 1T8PA 4XEUA 4JV5B 1ZIOA 2X5KO 1A8HA 4P32A 4Z54A 2IHUA 4Y0VA 3E4DA 3TIFA 3G9XA 4YJDA 4KI7A 4ZOAA 4U2FA 1Z4NA 3KL4A 2CL5A 2OLJA 3C4QA 4MPJA 1JTEA 2ZUSA 2PLNA 3I2HA 3GAAA 1DAFA 1E1MA 3IUNA 1U2QA 1KJYA 3MJDA 4FGLA 2Y67A 3DHNA 3NHLA 2JBWA 1WETA 2FW1A 3EDOA 5EEGA 1V0JA 3MM4A 3VTFA 5FADA 4ZCLA 1YZHA 4B8YA 2VZEA 1JIIA 3C24A 3VR5H 2DECA 4FKBA 5L3SA 1U7XA 2CYAA 3JZMA 1OXMA 3OIGA 1DRWA 2PUVA 2N46A 5FOSA 3GRUA 4EL5A 5LMUB 2FDCA 4WQMA 3UJ6A 5LJIA 4LIPD 4OXKA 1N0WA 3QRWA 1BE6A 3O0TA 1QGED 1SIOA 2Y05A 1FFEA 3P7MA 3B70A 3WWYA 3KEOA 1FU8A 2CDCA 1DIAA 4PLCA 3U4QA 2GEKA 4G86A 4RAOA 4ZZ3A 4ZJPA 2ZRAA 2VJOA 4ZMRA 1QS0A 1RKXA 2BCGY 2F3PA 3CUYA 3REFA 3W8RA 3WA6A 2CZCA 3MSCA 1XZAA 2XYHA 3QBEA 2YCBA 3DAFA 3VNRA 5A4JA 5EL0A 4YREA 5DN6D 3WLNA 3R9KA 4AP6A 2IEGA 3KL2A 3SZRA 4ARZB 3CG0A 4PTZA 3V97A 3KZKA 4JP2A 4P1ZA 2ESRA 1E63A 1HFWA 5F77A 2OFWA 2HMSA 3C3XA 3WGIA 3NMUF 4BQOA 4JJKA 3VR4A 1UMCB 4YFVA 5F12A 4N48A 3N5CA 1TVCA 4AN4A 1GL9B 4EZBA 4YUWA 3VX3A 1JS1X 3QKRB 4RDHA 5SV2A 2OBXA 2CXNA 4RHUA 4MB6A 4D9EA 2J31A 1BGVA 2EHDA 1Y1LA 2RAFA 3ENNA 2XRFA 1GCOA 1W4BA 4LY9A 3GFTA 4I9GA 1TLLA 3Q6NA 4ON9A 4Y98A 1GPJA 2PGNA 5IWCA 3AO0B 1CT9A 4KFCA 2HCJB 3MHTA 3AB8A 2UXCB 3PHJA 1S9HA 1C7IA 4I4CA 1M54A 3QVJA 4X1OA 2C94A 4AYWA 1BS2A 4BKRA 4CMEC 4FXOA 5A3SA 1Z74A 2BGUA 3L6RA 1QMGA 2YVKA 3LZ6A 4P98A 2ZRFA 1TAHA 1TIKA 4RBNA 4IDQA 1G1AA 1M75A 1YASA 1N6PA 1ZZEA 2VT3A 3CNBA 3GP3A 3BGIA 1JHDA 4I4TB 4B40A 1QH9A 1TK2A 5K0JA 4LJRA 4Z86A 3VC2A 4FFLA 4EPVA 3PGJA 1Q0UA 1VIDA 4R6WA 1XMXA 4Q3OA 1OC4A 3HY4A 4DEXA 4GDFA 1TD9A 2HQOA 1ABFA 1US8B 1KXZA 2ZJ1A 3IMEA 3RFFA 3ND8A 4AWXA 3RS7A 3LCVB 2W90A 3ZWPA 1HXHA 2ZTMA 3WO1A 4BVGA 1G0OA 1JR3D 5HMLA 2VEOA 4L9SA 2DYKA 3FWPA 3MW8A 3MEQA 2VDPB 2HW8A 1W1WA 2QYHA 4HWSA 3L7NA 4MQ4A 1CE8A 2X1LA 1JA9A 3PICA 5C5CA 5EPUA 4MULA 1JG4A 2GBPA 2WY2D 5HOQA 1EM8B 2HPHA 1N3LA 1PZEA 2XNDA 4NS4A 3WADA 4L8YA 5AI9A 1MAVA 4D6PA 2RHRA 4KTTE 2IVZA 4FIZA 1FPMA 5A4MS 5JMPA 2ZJ5A 5HFNA 1ZCFA 2QSYA 4M7PA 2VTBA 5EUBA 3V7FA 4BLVA 2OHJA 3OBIA 5AK6A 3FOZA 1U9JA 3LRTA 5ALUA 4N0EA 2YHIB 4IVNA 1O94D 2AH5A 4JVMA 3HGQA 3CX3A 1S8AA 2WLTA 4XGKA 1B6SA 3QHQA 4QU0A 1NJSA 1FJ2A 3L82B 3ASUA 2PAAA 3U9SA 2G0NA 3WMXA 4CEIB 1M0WA 5EKUA 5CA0F 2ZVPX 2P5TB 3IOYA 2ZRKA 3PQ8A 1O96A 1YCGA 3KU4A 2Y68A 1SZPA 1CXZA 3KFLA 4GXNA 4KPUA 4TWAA 3RI3A 1QOPB 1QCYA 4X6UA 3T95A 4FFVA 3ZV4A 5IUJC 4ZK6A 4JX9A 2YS6A 1GILA 4AJKA 1K08A 4XCVA 3UT5A 4RTLA 3THWA 3V7UA 1TF5A 1TO1E 2OCDA 1V5EA 3BMCA 4D6XA 3GPLA 1AUPA 1Q1AA 1YDMA 2Z1MA 4R3UC 2Z56A 4XSHA 4DV3B 3NFYA 5GM2A 4BO5A 4DLAA 1L4FA 2VDRB 2G7MC 3QU7A 1TCCA 1IAVA 3FWYA 1TKRA 4FQ7A 5DM1A 5EGNA 2HHAA 3EXG2 3SNKA 3V4OA 4ALIA 4ARVA 3BD9A 4KHPB 2BMWA 3PUXA 3E9DA 5FWYB 4BP9A 4HDSA 4LVNA 2YFKA 3OTGA 2GZRA 5B1EA 4BWVA 5JRZA 3DLCA 4U8GA 5HTOA 2H5LA 1M8JA 2XUGA 3IURA 2WHEA 2FCRA 2PGXA 2SICE 6CHYA 1OI2A 5F4BA 3RU3A 2X0NA 3U44B 3AV3A 2O4CA 3RRFA 4M36A 2UUBB 3DMYA 3VAZA 4AY3A 1ZMXA 1E6WA 1I24A 5DOZA 3G0BA 2R65A 1ZICA 1QR2A 4WN9A 1XZHA 2O6LA 3K1YA 1M1UA 2V7TA 3MT8A 5DN9A 5HA5A 3VZRA 4IVPA 5B37A 4F5DA 3T7TA 1BW9A 3U3XA 2JIOA 3ZK7A 5TVKA 5BRAA 3AZQA 1MKYA 3KZOA 3FTNA 3F96A 2ZRGA 4GGOA 1WRBA 2HCFA 3K94A 1XQYA 3BVPA 3PC4A 3PNOA 5I9LA 4PS0A 1P73A 4Q37A 2WTUA 2YDYA 3B9PA 4K9MA 1HT0A 3MOGA 3LBAA 1LXCA 4Q05A 1DZ3A 2R1VA 3NDBB 4MXDA 1U7ZA 4OQZA 4XWYA 2BSAA 1WHTA 5TMPA 2XOEA 2DU8A 1VHQA 1EESA 5KTNA 3C16C 3SIPA 3W9YA 2C2KA 4HB0A 1OMOA 3QVGB 4MX8A 1H69A 2VXYA 3E5RA 5KJ6A 4QBTA 3PQ5A 3OETA 4DMGA 1M0EA 4PX2A 3WHPA 1IEWA 1M7GA 2I7DA 1Z5ZA 2XWPA 2BMDA 1RMTA 4LDQA 1HK7A 5K0LA 3O0DA 1AXEA 2R1ZA 5I7HA 5DSZA 2ADFA 2IYVA 4GX1A 2J9GA 2WM2A 4ZMBA 3WAJA 5EHGA 3K15A 1P0IA 1OF1A 1PK7A 2BP7B 4S24A 1L7MA 2A14A 2BOVA 4IDOA 2FFJA 3OFJA 2ZFUA 4UBMA 2CT8A 2RHMA 4RTQA 3ANLA 3O2SB 1BHSA 1G20A 2ZAIA 1E3SA 2VZ9A 3ZY4A 2OV3A 4M0LA 2W70A 3X2FA 4BMNA 1KEUA 1WZ2A 1Y6RA 2RHHA 4CDMA 7REQA 2X4GA 3EOAI 1WUKS 1JHRA 2CKDA 4D02A 3FD8A 3KZCA 4JC5A 2AJDA 4J1TA 4OQEA 1UINA 3RAGA 3IUYA 2BYTA 4CTKA 1QIMA 3ZWNA 2BC9A 5ICFA 3A36A 5IH3A 4BFLA 1J2JA 1VECA 5H16A 2P90A 5DLYA 3W1VA 3QELB 3HYSA 4EAQA 3SQOA 4DQVA 2WJVA 5KVAA 4C7OA 2FUG6 2NPOA 1NLZA 3PGVA 1VCOA 3CG4A 4IDDA 5LZ9A 2C54A 4JI0B 2DWCA 4E2ZA 1XEWX 3DMPA 1GU1A 4QM6A 1RI2A 2HA7A 1G60A 3M9WA 1G3MA 3BMOA 3GUVA 4EHDA 1G19A 2A33A 1VIVA 3OD1A 1I3KA 1MEJA 2J0VA 3VTZA 1HDXA 1OZFA 4LJ7A 1CFZA 3KR9A 2G8NA 1CR2A 3F1KA 3NZEA 3OC6A 1DCKA 1E69A 5AI8A 2DFKB 5ALSA 3L1IA 3LQKA 4PBTA 5JE8A 2INGX 4B6EA 1VJ1A 1EBFA 4Z0PA 4N7MA 4RPKA 3O9MA 5HZHA 1XUOA 1FSSA 1WQ1R 5AI6A 4QGGA 4FYYA 4GP6A 2O8CA 1QX4A 2OSVA 4X54A 3MOSA 5KNDD 5K4AA 2P2CA 3GAZA 3L8EA 3SLGA 1YMUA 5TPZD 1PR4A 1AE1A 5C8VA 1ZN2A 3SM3A 2JGNA 2PWYA 4M6WA 4MRRA 4C7KA 3D59A 5EFZA 2F55A 1C14A 1ZRMA 4U7FA 4MJ7A 4EQZA 4EG4A 1YRYE 1P4GA 1N5KA 4RHEA 3SE7A 5FWNA 3UCXA 4GIBA 1QC5A 1LDGA 2CJPA 2RK3A 3CMMA 3CUKA 1B6RA 1H1DA 1L5MA 2P0EA 3PFWO 4H35A 1SULA 1KY2A 5CH5A 1O58A 2C07A 2X8BA 1D4AA 5CW2A 4ZVKA 4BVAA 1E64A 3HUTA 9ATCA 3OMWA 4YHBA 2QMUA 2RAUA 2JGKA 4YJHA 3EWAA 3P0HA 3AQIA 4TWBA 4Y9DA 3QKSA 2JJ2D 2Z2IA 3B6ZA 5D6OA 3RHTA 4BMVA 1K7SN 4CWAA 1T4MA 4PIMA 5JECA 4RHCA 3ZWWA 4B8ZA 5FUMA 1TU4A 3GLIA 4MWBA 2ID8A 5CX1A 4FK8A 3VUFA 1HE3A 4RMHA 1X8KA 5B3KA 5A62A 4QNMA 3ONEA 4P3NA 4PLTA 3V5NA 4D99A 1H2RS 2EGGA 1U2DC 2X4LA 4HZIA 3C3EA 3GLUA 3OU2A 1JR4A 2VKTA 5ALRA 4X1YA 3T1YB 1L4GA 5I7FA 2PWBA 3K35A 4JH0A 4B80A 3IQHX 1K8RA 2ZBVA 4OCZA 4GKKB 4UM9B 1KQOA 3AWIA 1M33A 1TUIA 2PZMA 4JBLA 2ZWAA 4PAWA 4F6LA 1E2QA 1TUBA 2ZAOA 1JWLA 1IZZA 1EFPA 4FVTA 4RK0A 1JPVA 5LQRA 1HKHA 1Y5NA 1EP1B 3KT8A 4J0GA 1YWGO 4EB8A 4YMTA 1FMCA 1FXWA 1NDHA 4LYYA 5JWOA 4RPGA 4Y6LA 5BWMA 2A0YA 3DVQX 3MIZA 4EVIA 1A9XB 3BGOS 2I7XA 1OBCA 2HB6A 2X58A 4B81A 5CFRA 4OQPA 4ML3A 5JDCC 1JYEA 4YLEA 2GCOB 2YWXA 4FYKA 1B42A 4PC2A 3WYCA 1O57A 1XN1A 2YWRA 4MV8A 3HP1A 4MWSA 4F5ZA 2GM4A 1KDVA 4LJ4A 1GTJ1 2XUFA 1H0RA 1V5IA 3PQFA 3W6NA 3FRJA 4UW9A 3EDYA 2XCLA 3OE5A 4LJYA 4OUKX 2SNIE 3BBPA 3IL2A 4RZHA 3ZJUA 2PBZA 5KYTA 1GARA 2QROA 4LV5B 2JASA 3AEXA 3ND9A 3PT9A 2WKQA 3RS5A 1P2UA 1LZKA 4CIDA 3U3ZA 2BKEA 4ZT3A 2G06A 1X38A 4QDKA 2NACA 1I3OA 4C7XA 2Q1YA 1V96A 3OX1A 3KJGA 1YFLA 1FW8A 2C2BA 3TZBA 1KBQA 2B4KA 4Y0AA 2J5KA 2FK8A 2YXNA 2QN7A 2IU0A 4KR6A 5JANA 4FZJA 3G2MA 5TEWA 1W85A 3OECA 3PC8C 4QU5A 4Z1MD 1HDIA 1VYVA 3VPGA 1Z17A 2BGJA 1YDEA 2O54A 4NBLA 5TJ9A 3QFSA 4V0RA 2EW1A 2WT4A 2A9FA 4X1KA 2J41A 4ALLA 3OCXA 2G9VA 4DV7B 4C5BA 1CUFA 4BFSA 4TVOA 4FLMA 1L4YA 3PR3A 1U94A 2JAXA 5JY6A 2HDWA 2YJ3A 2BE9A 2XWSA 3EY4A 3RKUA 1YJCA 1T35A 1SHUX 2FPOA 2NUAB 2WU8A 4L02A 3R0JA 4N0DA 4CEJA 2OP0A 2IHVA 1CF2O 2LXNA 3S8EA 4NQZA 2WJWA 1QRUA 1Q0HA 1VA5A 3V4SA 3RROA 5ENZA 3HLTA 5HFJA 2XWBF 4X6YA 3DF9A 3EIOA 3RAJA 5F1KA 3SM9A 3H18A 1OH7A 1XX6A 4CN8A 5ICEA 4G8BA 3S8MA 3UG7A 5CK5A 3LCCA 5IBPA 5F33A 2JW5A 3OJLA 3KKMA 4IZOA 3AJ8A 4WV3A 5CU7A 3S5UA 4KN8A 4N3BA 1A8SA 4S1NA 2W0MA 2X5NA 2CZGA 3A3NA 1JFLA 1DNPA 4GPIB 1W5EA 3VDRA 4DLYA 3R3WA 4EK9A 2ABWA 2HDNB 4R71A 2ZYAA 1N2ZA 1KAHA 1MW9X 2FR8C 2V7QA 2F43A 4IUBS 1TM5E 4KZPA 5DX8A 1XK7A 1PT7A 2B3DA 3EQ8A 2IYAA 3MRVA 4WW0A 4XFDA 3SYKA 3DB2A 1DPGA 3KX2A 5FFNA 1MZPA 1XEFA 3KSMA 3F0TA 1LF5A 3D6JA 3FWZA 1GGEA 2V7UA 5J3JA 1B8PA 1DIGA 2GHRA 4UHEA 3L49A 4PINA 3QITA 1OC2A 1AQ6A 1F1JA 1WDLA 1XXHB 1ENPA 4TWRA 1BXZA 2HRRA 4DJFC 4E1VA 3IKVA 5H4GA 3WB9A 3N2YA 3B60A 4I1PA 5J58A 1MEOA 1SVSA 2OP1A 3UJ9A 2HMVA 1SKUA 4U0JA 4OUDB 4EGAA 3ABSB 4Y7DA 3PF8A 1FNNA 3GMTA 3VO8A 1COZA 5CXXA 1KXJA 1GUZA 2H8GA 1I8TA 1QIKA 1KI7A 2BN4A 2FG5A 3VYTB 2FGKA 3RWBA 1B4DA 3FBTA 3K0AB 3CVYA 2DWQA 3AKZA 4ZKEA 1ULUA 2V65A 3EFHA 4WCFB 1AZLA 1I4DD 1R37A 4DA8A 4NVRA 5ITZA 1WTCA 4A0HA 4KO4S 3H84A 3BRSA 3JSXA 2P6PA 2RG1A 4D3YA 2EJBA 2Y1LA 1Y7HA 1TT7A 3HWWA 4LXHA 3UUFA 3QV2A 5JH7B 4WESA 1MXFA 2FQXA 3CMCO 1XPOA 1U9CA 5BO5A 1SHZA 3W3AD 3TQQA 2I65A 2GFQA 3TGLA 4QUKA 3KE9A 1IRIA 4GXRA 4FN5A 4P84A 3RW9A 1XHFA 1ZC3A 3ICOA 5LP6C 1BCSB 3QF4A 5C53B 1MV5A 3GRZA 3VHXB 1CRPA 2GAOA 1IVYA 3H6KA 1FP1D 1V1RB 2R6CA 4AKGA 1EJBA 3W04A 5J2TF 3EUFA 4HNHA 1KVSA 4KXYA 1TCUA 2ZWPA 5EXDA 1NW9B 2NOAA 3PVZA 3F5SA 1CVIA 3PVCA 1EFVA 1U8FO 4QPPA 4AYXA 1P2DA 3WBBA 2P2NA 1PG5A 1BXGB 1THMA 1UPTA 4ZQGA 1Z5PA 1EG2A 4B7XA 3HDJA 3V1YA 1PUXA 3G2HA 5JD3A 4BZXA 5KAPA 1Z37A 1JQKA 4TL7A 5LQKA 1KFJB 2HSWA 2YHUA 3FNGA 3JYPA 3OX2A 2HYIC 2J3HA 3L40A 5A0VA 5I9BA 3FGZA 4P81A 4ZYYA 1DZIA 2DFDA 1F60A 2LDXA 1P29A 2ZYVX 3PQCA 1N5DA 4FUTA 4OAQA 5LZ4A 3VVBA 3PU6A 3TQHA 1U04A 3BKWA 3PNMA 4UNPA 3OZGA 1G2QA 1MG0A 5DGCA 3VPAA 1NF8A 1X94A 3OU6A 3OFND 3QE4A 3RAFC 2R84A 3ULKA 4XD2A 3PQEA 4JLMA 2DMRA 1GT6A 3F9CA 3HCDA 4RHXA 2EBUA 3UK7A 4NCAA 1ZI9A 3DL2A 4AZSA 2AMFA 1QDEA 5LP1A 3CR8A 2D54A 3P5SA 4KMRA 4LHVA 4YJ2B 3KQNA 3B82A 4NZZA 5AK5A 1G3QA 1UEIA 2VRWA 1UJCA 4OK5A 1D0IA 2BIFA 2YN2A 4YCJA 3UHFA 3OUTA 3EA5A 4IDNA 4LJLA 4DDWA 1AGPA 2OFXA 2P9FA 2J9FA 2FOXA 2O14A 2WKPA 3CV3A 3NKLA 4LXIA 2QU7A 4PANA 2WJPA 4ZI5A 3SZ3A 3WKEA 3SPXA 5JALA 1UT5A 4JYMA 4CMCA 2YWHA 1TYDE 2Z5VA 6PFKA 1QF9A 1PTJC 1SCBA 2V7EA 1NFFA 1NN0A 3KV3O 3MGBA 3MRSA 4BTLA 3GCWA 2HSZA 5J1SB 4DRXB 4G5GA 2ZJ7A 3VR4H 3A1EA 3LCJA 1VMIA 1HOXA 1CDZA 1EFTA 5FUVA 1ZI8A 1LRKA 1FDSA 1PGPA 3I01M 3QVTA 3EDRA 5EAIA 1CY1A 2PVPA 4MUBA 1CFJA 4NR0A 1T9ZA 1XZQA 4OB6A 4N9QA 3JQAD 5LCXA 5H83A 5K0BA 3HN7A 2J30A 4KVGA 2Y1KA 3TKLA 2QG9A 5T4FA 4E2XA 3HJNA 3K4QA 4TS3A 5I7RA 5CR9A 4E7PA 4R8MA 2ZBPA 3ORQA 4JMLA 2F8SA 1DPFA 3UBMA 3IVGA 1K06A 2W2TA 4A1FA 2CJXA 5PGMA 2YR0A 4OHFA 1NQAO 2QY6A 4R2IA 2ZTLA 4QDOA 3S3TA 1D1QA 4G0QA 1J9ZA 4JU9A 1CJUC 4U7JA 3N0WA 2PZGA 4Y2RA 3PYXA 1IE3A 3KEFA 4JXJA 2EJTA 4W5JA 3DVAA 4GEKA 1H5NA 3PUWA 3OP1A 3RVMA 1SZJG 1GSOA 2IP4A 2FWBA 3HZOA 4HYYA 5C1BA 3L7MA 5F73A 4KR9A 4EHLA 5JXGA 1FDIA 1ORWA 1OX5A 2QR5A 4EY3A 1H5UA 3CNHA 4EECA 3I30X 1YR9A 3H9JA 1B2RA 3D7SA 2HSDA 3ZNNA 3VDMA 2I7CA 1KI2A 4DCUA 2BWJA 4M7WA 1Z2CA 4N7BA 2OGWA 2C9MA 4IRXA 4JUCA 4OQLA 1QIGA 1G1MA 4CMJA 3DKPA 4QELA 1OB5A 4G5QA 1YS9A 4QBFA 3F3YA 1IL0A 4HDMB 4KKXB 2HJRA 2JBAB 4X1IA 4YRRA 5BPFA 2QX4A 4N1AA 2XDAA 4EBFA 3JS5A 1NBEA 3CLTC 4FJ1A 4MPTA 4OGGA 3TMYA 3T3OA 1WQ3A 2IZ0A 1JQDA 3ZHOA 1UMDB 1L9KA 4TZTA 2G67A 2AXPA 3DD1A 4MJ3A 3O4VA 1IK6A 1MB0A 4JS0A 1WPRA 2H2FA 2WTAA 3JASB 1N3YA 4WXPA 1GITA 3GN1A 4GOMD 2AOTA 4QPZA 2GBLC 4ASUA 1QQBA 3ORRA 1SAYA 1IDN1 4B6GA 1CTQA 3CRZA 1BX3A 4KWIA 1DC8A 3DBHB 2FV8A 3T4UA 2A1IA 2QSUA 3TZQA 5HXAA 3FUVA 1C0PA 1ZZGA 3THYA 4MW7A 1MN6A 2ZIAA 4YUAA 3BIXA 3PQ6A 2W22A 5CB4B 3IO3A 5KPDA 3TLKA 4URWR 2OY0A 4BASA 4C03A 3RTCA 4MI6A 3L4JA 1GZDA 4Q4AB 1A9TA 4ZCPA 3WGJA 1GJRA 3TXXA 1FJGB 3SQWA 1UPUA 3PGXA 2I22A 2J4CA 1LJLA 3OPYB 4BNXA 4UTNA 2C2ZA 5U9CA 2A9VA 3KBBA 1HG0A 1OXBB 1NL3A 3ILXA 3E9EA 4IIXA 1I2AA 1KAQA 1PO7A 2IPNA 4M76B 3NATA 3LC2O 4X8LA 4KGXA 4PVCA 4GWLA 3L01A 4F96A 5JEDA 3IVAA 2GH1A 1NKTA 1ZL2A 2EGUA 2HD4A 2VVTA 3FPGA 1YJBA 1EFAA 3KOWA 3E3AA 5FB3A 4U5XA 2C9OA 1C1HA 2X41A 3V6MA 5F1OA 1MLDA 1HT3A 1TEHA 1NXQA 1SXJB 3DBLB 5DGHA 4RPJA 4KUEA 4PX3A 3HO1A 2Z3VA 1KY5A 5EEHA 5BQFA 3S2ZA 1Q2UA 3LOUA 3NOOA 4IZ6A 4E5YA 5KTKA 3NPMA 2C2MA 4BX8A 2QT0A 3O31A 5CGQB 4KQKA 4RY9A 4I1IA 1MVNA 2VP9A 2PRIA 5C1IA 3UC5A 1NLYA 1EJ6A 3QXXA 3WIDA 5DM4A 2ZIVB 4D0LB 4LWZA 2C42A 3JQCA 1NX6A 1TL7C 5BW6B 4KFUA 1SC3A 3ROZA 1MJGA 1YQWA 2MR6A 1GZ3A 5KOJB 1BX0A 2A3RA 2HBRA 3ICQB 5JMWA 3CISA 1Q7RA 1FTQA 2PKQO 4MPPA 3FPAA 1MRSA 2GRUA 4GPAA 4WZ6A 4H7JA 1XB2A 4XWKA 4WPGA 5IDWA 3V33A 2OLKA 4YAUA 1BEZA 4QTTB 8ATCA 2SKDA 3IE0A 4A8TA 5KX5A 4M0PA 3ZHYA 1E4OA 2QVLA 1PT8A 1WVGA 1X92A 2QTCA 3PDIA 3PR1A 3UWKA 1XI2A 3KTAB 3I2FA 4DQKA 1NUUA 2ACKA 4A6XA 4KHZA 4M9UA 5LP6F 3CS3A 4I4TF 5JV5A 2OZKA 4ND8A 5K8LA 2CJWA 1PR1A 4UHHA 4GEGA 1YFJA 4OH7A 4FYHA 2J85A 1YZYA 1WKBA 3QI7A 3EW9A 1R6DA 1G21A 3CX4A 3SSAA 3QTBA 1EQAA 5LDGA 4A8PA 5EWLB 1LUAA 3U4DA 2G4CA 4KN9S 4EJSB 1RVDA 2VNJA 1V11B 1QIDA 2VSNA 1HTBA 3EGDA 3ETHA 4U9IS 1CUEA 3VYUB 2G83A 3BK2A 1W19A 1V1MA 2COUA 2QXUA 2RCNA 2X40A 3A0RB 5CNJA 2RHTA 3PF9A 4E15A 1I2MA 4FONA 2HSJA 2FWAA 3SF0A 4W8HA 4MR8A 3D5TA 3NTLA 3KOUA 3TZ6A 4B3HA 3LVFO 5BW5A 3IERA 2A30A 4YCLA 2JGDB 1RW4A 1M2VB 2W6ZA 4Q66C 4RCYA 2VQ6A 4IF6A 3HBMA 4YQYA 1PAUA 4ED9A 3ADKA 3S81A 3DPUA 3K6SA 3ZCSA 4KMMA 2YX1A 1EEHA 1RNLA 2XQIA 4J0EA 2X9NA 5LLTA 3QPAA 1YNSA 4UU7A 5DBEX 5FLYA 4MUMA 3RC3A 3CCBA 4N7RA 1P0PA 5K8JB 1E3WA 2VZLA 2X9GA 2YXDA 1LDEA 3LKBA 3HADA 5C1DA 4Q3BA 4IQ4A 1UUFA 1KAGA 3W5IA 1AKEA 2EP7A 4Q9LA 2GN9A 4CVNA 4ZJZA 5DI3A 621PA 2O7QA 1WWKA 1YZQA 3UUEA 1JAZA 4PEVA 3RTAA 3ZKWB 4EG7A 1XTBA 4Q7QA 3PQ3A 1XP5A 2P2SA 4MP6A 1XMSA 1ZWLA 1PL8A 2W2KB 3N2KA 1CUSA 4R2KA 3T15A 1CJBA 1T9BA 2WIKA 3KD2A 2NU7B 3KDAA 4H31A 3WNCA 1P0MA 3OZDA 3ZLVA 4OM7A 4WADA 3G0HA 2W93A 3DMDA 3O84A 1A4IA 5JQGA 1W2WB 3ODPA 1NF3A 3HCEA 3I76A 4E2FA 2ZQ5A 4NV3A 3C7KA 4YYZA 5HKBA 1PJRA 4HLNA 3BD8A 5K20A 2E3JA 2QLLA 1XCOA 3RG8A 2PGIA 3GLHB 2H1HA 1DJLA 3ABOB 1E8DA 4NBWA 3RUAA 4TWZA 4AXXA 3PNVA 1E9RA 2G7ZA 3GAMA 3TMKA 4LK2A 3OUZA 4KTVE 4G84A 5E8RA 3LOPA 2J5RA 4I7EA 3FDZA 1EWKA 4FZRA 4G1FA 1B2LA 2VBGA 3FSGA 2JA1A 5DTIA 2RJ3A 5GTDA 5DIFA 4TYWA 4DIOA 3NPAA 1SZDA 1LFDB 3EZ7A 3FGOA 4CPDA 5DNUA 1ECFA 1MABB 3SDZA 3IOCA 4M3NA 4IDAA 4CCYB 2WK1A 3OLVA 3OBBA 3T9AA 3ENZA 1N5OX 3E2IA 4G6ZA 3IQEA 2JJ8A 3PL1A 2OC4A 2LWIA 2V6JA 4TLLB 1FU4A 5DCUA 4D4MA 1E7YA 5HKAA 2ZJ8A 5IDVA 3VR2A 3RSHA 2Z6AA 4RLQA 4EHNA 1G38A 2J7KA 1DE0A 3DMRA 3BGWA 1E2DA 4HGYA 4B7ZA 1GZ6A 1GTRA 1T9KA 1GYQA 1JAIA 3MTQA 3N05A 3VSBA 1ORTA 2C8VA 4DW8A 1RZVA 1FJHA 2IX9A 1BMDA 1XXLA 3ROKA 5EINA 4M1EA 1TX4B 3VFDA 4NU0A 4B79A 2H4WA 1FP4A 3L04A 3HYCA 1VG0B 4RACA 1NHGA 2WWRA 3JQ7A 3U1TA 2AN5A 5EXSA 3JWPA 1D9ZA 2H59A 3GIWA 3P97A 4Q24A 3GROA 4CLOA 1L8QA 2CVPA 1OAAA 2QAGA 1JALA 2Q27A 3RJMA 2JLQA 5LKAA 4Z49A 4K6GA 1H2AS 1GQSA 2JFGA 4RTJA 2W4IA 2E2WA 3P9ZA 3FIJA 2PO5A 3HKBA 5AJHA 3DV0B 2QTAA 3VU9B 1USUA 3BWDD 5E0OA 2KYRA 5CBPB 2BMEA 3ZDZB 3IUEA 1QG2A 4BBPA 4FYJA 4DV4B 3V4ZA 2GHTA 4JEUA 4YLGA 1HURA 4HRVA 3GFVA 4LYGA 1I7PA 1M6WA 3MINB 4KYTA 1JA0A 1Z4KA 1OD6A 2XCSB 2OC9A 3DO5A 3HN6A 3X3HA 2QVBA 1YB1A 4JJZA 4QX6A 5JSZB 1M2HA 4DA7A 4Q48A 1BQEA 1UM9B 3TW6A 3FPJA 4Q34A 2KHZA 1BX1A 2IUEA 3CLTD 3DE5X 4KE7A 4PPQA 1BMFD 2WB2A 5COAA 5E0KB 3OUUA 3MN1A 4AF8A 3EFOA 3KS9A 1HL7A 4BDTA 3IDAA 2DG2A 3DR5A 2QMYA 3NTOA 4D3XA 1TM2A 3O90A 4AI6A 3EN0A 4C0SA 2VC2B 1ZM3A 3C5EA 1QX3A 3O9ZA 4GOLD 5BRJA 1DAHA 4ZVOA 1P75A 2QR2A 4U7PB 4WCFC 2XZOA 1DEKA 3WGLA 1SUDA 1YIDA 3IAXA 4BFWA 5WRFA 4Q6WA 1Z7WA 4CTNA 1QPZA 1VPVA 2Y6VA 3QVXA 2MU1A 5C8ZA 4BC1A 3CZMA 4MKXA 4O5OA 1JXMA 3NJ4A 4Q1FA 1F17A 3R7SA 3UG6A 3Q9SA 3QVUA 2C9CA 2JFBA 3BIJA 5B57C 3B2EA 1K0FA 2X3UA 3Q7EA 4JUBA 4DXAA 3WL8A 1O95A 2QD2A 1R10A 3O8NA 2R0QC 3LUJA 2I4TA 3A25A 5DHTA 4C6SA 2FSPA 1M0TA 2Q9CA 3ABRB 2H1LA 4NENA 2XT0A 5FWXB 3PXBA 3MMPA 5DXJA 2C78A 4MB2A 3DKRA 2J87A 1T2NA 4N3NA 4HLUC 2DPXA 4GU5A 4WT7A 4XQEA 3SZLA 3RS8A 1DHRA 1GG5A 2GBFA 3W5DA 1GRCA 3O1LA 4IOJA 4WZAA 2HWWA 2HQBA 4EL0A 1OU0A 5KSYA 3C15C 2QJWA 3H0CA 5B2EA 2ISCA 4PC1A 4X3PA 1CS0A 1V39A 2J59A 3A3KA 2OXTA 5LPNA 4IP0A 1MPXA 3CEMA 3G8YA 3LXXA 4HRXA 3B6IA 4N3AA 4NABA 1CZRA 4PS1A 1NBWB 1OASA 1CCWA 3B1ZA 4D44A 1ZHFA 1PE0A 5F3WB 5KJCA 2HGSA 5LUAA 1ML3A 2C5FA 2P9CA 4FE4A 3ZVLA 5HK9A 4DWOA 2YZ2A 2ODEA 1K6MA 1JHZA 4FYPA 1W88B 3QUSA 4DYDA 4PF1A 1KIAA 3LUHA 4XLTA 2DBZA 4BNYA 2PQ0A 1X6VA 3GJYA 5AT1A 3P0JA 4A8JC 3HGMA 2GXQA 4QVGA 4CLXA 5AVTA 4LX8A 2ID4A 3NGLA 1A5TA 3WRYC 4FQ8A 1L4NA 3JAKB 1T8SA 1TW3A 1W0JD 1P0FA 3OPNA 2VBFA 2PU7A 3QVKA 4HEA1 1KGDA 1VOTA 4ROSA 3EYWA 2YWFA 4X20B 3RJTA 4AMUA 4DN6A 3O8OB 3H7AA 4LJ5A 4LJKA 3O8BA 1WV1A 4C0QC 3HMKA 4HFJA 5I3ZA 1K8ZB 4U9HS 3UXYA 3D5EA 3UA4A 5IM4F 1KEVA 1T25A 3AYZB 3CF0A 2WG1A 3Q41A 3QUQA 3MC1A 1E0KA 5T64A 3AR6A 3JATB 4MR9B 3V00A 2QL6A 5B12A 4D8VA 1A8PA 4RQUA 5A6SA 2QTLA 4Q47A 4PYNA 2EFGA 3LY5A 3GJZA 1WTAA 3CVJA 3PTZA 4I1VA 5FI3A 1K68A 3BFPA 3GJ5A 1DAIA 3GELA 2W48A 5IJAA 5TMDA 4MDEA 4TS4A 1KO5A 1ND6A 2BMVA 4EPXA 2YJNA 2Q4TA 5CFQA 5JG7A 3E22A 4MUHA 4QYIB 5J4VA 2BD0A 2VAMA 1Q44A 2J3EA 2NTYC 2WPDD 2OHFA 3KB2A 3NAMA 4ZVVA 4TS1A 4E31A 2IHZA 3O5AA 4YRJA 4ENTA 3PA6A 1AGXA 1FYVA 3PHCA 4ITRC 3OH8A 5EERA 3TVTA 2FEKA 4CFSA 4K26A 4CIXA 1N34B 4KXVA 2FPIB 3JQFC 3L6UA 1HMPA 3MTGA 5EGSA 1FTYA 5HIJA 1TMYA 3ID6C 4HZUA 5AXBA 1IPHA 3TIGA 1NXWA 2JJ1A 1I6KA 2IZOA 5KOYA 1E2NA 3BSFA 4PAGA 1NJGA 4XR9A 3AVYA 1NMXA 4AJHA 4K9RA 3U16A 4ID3A 2I9KA 1ZFNA 2YIJA 4JLAA 3CR7A 4FGJA 5CUQA 3I9OA 4S2UA 4G5OA 4ZCTA 2J0QA 3IR5A 3MBOA 4C2UA 2WC1A 3SEAA 1QTNA 2ZJBA 1SCAA 3AJ9A 3JAWB 4HDAA 1M1YB 4W99A 4G0VA 3SC2A 3RUIA 3FF1A 3FETA 1WDTA 4WY5A 2GZAA 1GTZA 2CDAA 1V41E 4ZI7A 3INTA 2WYUA 2ZAMA 2ZRMA 1IJEA 5HBRA 5THKA 5KWVA 4G23A 1EA7A 5K6AA 3FTPA 1G8JA 5HF9A 1U0FA 2AFHA 3PDJA 4HDNA 3UKJA 3HWRA 3D7KA 4IWNA 2WIBA 2OOKA 1T2CA 1XD9A 1VGRA 2EKQA 2VYFA 3M6UA 1P3Y1 4XCQA 3QLVC 4IOKA 2VAWA 5JZBA 1J8MF 2C5HA 2VSYA 2UZ1B 4LKRA 3SYMA 4BX0A 3PHHA 3JD0A 4OXIA 5KYVA 3WK5A 5JZSA 2JLYA 4F9FA 4I55A 4E5NA 1A2QA 1DDOA 3JQBA 5HKOA 1XWFA 1SGWA 4NNPA 1AK2A 4IHKA 5AJZA 4ND3A 1M1NB 2WNSA 1THTA 4RTMA 4YRNA 2R7AA 3OICA 5T41A 4K7JA 1OE0A 3HCRA 1ZU4A 5GGXA 5HEKA 4ZT4A 3C97A 1Y48E 4X7MA 4DYVA 1CZKA 3QUTA 4H6PA 1UBFA 4F71A 1NGSA 1XZIA 3P9YA 2FZCA 2BEUA 2NU9A 1IHOA 1WVMA 1Z26A 2OK8A 2PX0A 4L5CA 1HYBA 4CR7A 4LOKA 2IYRA 1NFQA 3O8DA 1S3FA 3MJRA 2HLDD 4S1OA 2WOJA 2WD7B 1PP4A 1IQUA 4BJ3A 2JAHA 4GI5A 1L5KA 3VYSB 4F2PA 1WE2A 2FX2A 5A9SB 2CL7X 5KYXB 2ZRBA 3C45A 3M70A 3LHDA