1N6NA

Crystal structure of human rab5a a30r mutant complex with gppnhp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
167
structure length
167
Chain Sequence
GNKICQFKLVLLGESRVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-5A
publication title High Resolution Crystal Structures of Human Rab5a and Five Mutants with Substitutions in the Catalytically Important Phosphate-Binding Loop
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 56
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2002-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1n6nA00
3PUVA 3CH4B 1ZCAA 5EQTA 2QEQA 1LV7A 1NG1A 2UKDA 1JBKA 2PT7A 1T9HA 4TQAA 3GCGA 1U0JA 3CLVA 4JLMA 1LS1A 4C0JA 4NCKA 4LX0A 4G5SA 2GJKA 2IYSA 1N0UA 2CCGA 2FX3A 2HLDD 2QM8A 3WYGA 4ABYA 3O47A 2F43B 1XD8A 2IYQA 4EAQA 3VX4A 4EJSB 4PR0A 4AD8A 1G7CA 1KAOA 5E7IA 4EQ6A 4F7WA 2Q3FA 4WW0A 3TIFA 5IT5A 3OIYA 2W2XA 4CT5A 2BIFA 2V1XA 1KNQA 4TN1A 2VA8A 1DTSA 4O3MA 1U90A 3U7GA 5KSPA 3GQBA 4IOKA 3PUWA 4XTCS 4DHEA 1G8GA 2AWNA 4U02A 1ZAKA 2FN4A 3MWLA 5AUQA 2GZDA 4Q1DA 2VP6A 3CB4A 4B2LA 821PA 2DHRA 2R6AA 5B2ZA 4M9XA 1G5PA 5IRCD 3NBXX 2O8BB 2QPTA 4GBMA 2OLKA 1Q44A 4BECA 4DUGD 1DAKA 1FNNA 4KO8A 4RKEA 1P62B 2IF2A 5FTJA 1G21E 2Q3HA 2AKYA 3FOZA 1OH5A 3SFVA 3U5ZB 2GCPA 4UJ3A 5E95A 2ZRFA 3EIEA 1GTVA 4Z8YA 1YZNA 1MKYA 4CEHB 4NH0A 1MH1A 4B32A 4BZQA 5HE9A 3Q85A 3LLUA 1O3YA 3BGWA 4Q9HA 2OXRA 1OSNA 4OJKA 2A3RA 2JJ2D 3FYHA 3NDPA 3VNVA 4S2EA 4NZYA 2QP9X 1D2NA 3KUDA 4ARZB 2QUZA 1E2LA 3PR1A 3M1IA 4LBYA 1N6IA 1VCMA 1A1VA 4FCTA 2DWOA 2WICA 4FMCB 3TJZA 1CJMA 3ZVNA 1JALA 2RHMA 2OE2A 2WIAA 3GLGA 2ZR7A 5CK5A 2F1JA 2XOKD 4Q9KA 5KSOA 3NHBA 4DSNA 4KBFA 4OHYA 1R2QA 2RH5A 5GVSA 1KZ7B 4BRWA 1I4DD 5KTYA 1KI3A 2N46A 1XEFA 1KI4A 3K9NA 5FH9A 4AIIA 2GCOB 2AXNA 1AK2A 2IUTA 2PT5A 3GLHE 4N1AA 2Q3MA 3EG5A 4LJ6A 5EP2A 1D2EA 4CZ2A 4QGGA 3VR1A 1A2BA 3TKLA 3FE2A 1G41A 1EWQA 1P2VA 4DLUA 4JT4A 2AKAB 1G6OA 4X8LA 4EPYA 4B6EA 5DLQC 5FBRB 121PA 1IONA 4QHYA 3GLIE 1JR6A 1KZGB 1VMAA 4IKEA 1MR3F 4B3CA 2RGDA 3B60A 1KHTA 2JIZD 3WYAA 2ZEJA 3IPXA 1NSTA 3NBYC 2J0VA 4NCIA 1SVLA 1N5LA 3H4MA 2F7SA 3TH5A 4Q66C 1Q20A 2VP9A 3AKDA 1WCV1 2KBFA 2ORVA 4AG5A 2ZS8A 2ZU0C 3OIVA 2VHCA 2V8OA 2ZYTX 3CX8A 1CXZA 2GVDC 4Q19A 3LW8A 4Y0VA 4D0LB 3X2SA 4JLOA 2ZJBA 1FUUA 2C9CA 1Z8FA 4XH9B 2EFEB 3B7GA 1SULA 2UZ3A 1UM8A 2ATVA 1FFHA 5C46F 3BE4A 3PUXA 2OCBA 1P72A 2B8TA 2VP2A 2QBYB 4LCBA 3FMIA 1EX6A 4DEYA 4P31A 1C4OA 4QBHA 3SOPA 5G41A 2QORA 3V4FA 4JL6A 3AP1A 1E4VA 2FGKA 2H16A 2IXFA 3TUJC 1GG2A 4S35A 4B47A 3AUYA 3PJRA 3I61A 2ZRCA 3T5DA 1XD9A 221PA 4RVCA 2V4ZA 3QXCA 5GJBA 4HUQA 3KKNA 2GRJA 4GNKA 2FG5A 4Q5IA 3UKDA 2QTHA 1XEXB 1AGPA 4AYXA 2OFOA 4BLQA 4BGDA 2V7QA 3OAAA 4OL0A 4QBFA 3U6KA 4P3YA 2G0TA 1XCMA 1U8ZA 4V0KA 5FOSA 1SVSA 4D0NA 4YMVA 2ZRDA 3AVPA 3AVVA 2CMKA 1KI8A 2RKOA 3PUZA 3V00A 4M2LA 1E9AA 5A4JA 5F3WB 1G9XA 1YZQA 3T1VA 2ANBA 1W2HA 3W90A 1G4AE 2REBA 1AZTA 1DG1G 1N0WA 2XB4A 1ZNYA 2OT3B 1T3LA 1D5CA 3QEJA 4HDCA 4RSGA 3WHKA 1F2TA 2W58A 2X2EA 2ZYUX 2YWEA 3BS4A 1QZXA 3Q7QA 4PZYA 2BEKA 4X8OA 3ZGXA 1V43A 4ZKDA 2A9KA 4DDUA 1COWD 3R20A 4TZ0A 1A4RA 5UKDA 1DAGA 1TU3A 2O0KA 1OH6A 4LJ7A 5J4LA 2FPLA 2FSFA 2O8EA 3KQKA 2CHGA 3PITA 4D82A 4QM7A 2IS6A 2Q9AA 4BEBA 1CJTC 1G8HA 4FMBB 4HB3A 4ZV4A 1CS4C 5EP3A 4UNQA 5J5CA 3REFA 2ZVPX 3TLXA 1LF0A 5AUNB 4BLPA 4KVGA 1FUKA 1HYQA 1JAHA 1NMYA 2JCSA 3B85A 2EVWX 2G1JA 5KDLA 1RRFA 4BLSA 5JWHA 3I3SR 1ZMXA 5KPJA 2N42A 3UK6A 3Q5EA 4N3NA 3AVTA 3B6EA 1OHHA 5DHAA 2P6RA 3AB3A 2ZRKA 3S1AA 2CLSA 1GILA 4FW9A 4KSCA 3KKPA 1NRJB 3RWMB 3VR3A 3B82A 3CR8A 4BRUA 2GJ9A 4TLCA 5CJPA 5J4KA 2D7CA 2ZITA 1DAMA 5D3MA 4DCNA 2QMUA 1OV4A 1Z6YA 1GRRA 1J8MF 4JZKA 1E4YA 4O0MA 1NN0A 3N5CA 4P4UA 3A37A 4PXAA 4Q1FA 4UXHA 4KU4A 4FIDA 1R6BX 4DUGA 4DRZA 4DLTA 3AVXA 1Y63A 4PC2A 1NN1A 1Q3TA 1OF1A 4MDFA 4LV8B 4PC3A 1F6BA 3AEZA 1AGRA 2WMOB 2ZE8A 2EYUA 4Q4JB 3RRZA 2YOHA 2PZFA 5DHFA 4UNSA 4YMWA 4LJ5A 1W1WA 2OAP1 1X6VA 4EQ6B 1UKZA 2AX4A 2GA8A 2FPMA 3AKYA 1KI1A 1HTWA 2J41A 4RFSB 2FSGA 1ZJ6A 3LAWA 3ZDQA 5H1YA 2FA9A 1CKEA 2ZE7A 4R98A 2JLRA 4CIDA 1W46A 2C77A 1BIFA 4D2IA 4HSEA 4QRHA 2XOKA 2HCJB 1CIPA 4JVMA 1IN6A 1SXJD 3DOEA 5JECA 1IY1A 1Q22A 4Q4LA 2Q0HA 2ODEA 3ECCA 4WA7A 1FX0A 3O8CA 2WKPA 1XXHA 4K81B 1ZM3A 3FGNA 3NH9A 4LBWA 4JVLA 2IXEA 2XZLA 1QHSA 3VKWA 1H8HA 4JJKA 3SQXA 1I4TD 3P4XA 5DI3A 2ZI7A 1DO2A 1KSJA 1GNRA 3AVYA 4B76A 4BUJA 3ICEA 3CRMA 4HAWA 3RRMA 3QXSA 5TXGA 3B1VA 4BQSA 1N6PA 2WWHA 6Q21A 2AD1A 3GJ8A 1OKKA 2GBLA 1ZC3A 1T0HB 1NBMD 1DARA 3HWSA 4A4DA 4DDTA 2JIZA 1X1RA 2V6JA 4XD7A 5DN6D 1GKIA 3CX7A 3KKQA 4QM6A 3U6BA 1P4SA 3LY5A 4NKRA 8OHMA 4QNRA 5JEDA 2C9OA 5ANRB 5DSZA 4OKSA 2QP3A 1TNDA 3CM0A 2OILA 3GLGB 3JVVA 3NEJA 2DYKA 2FJUA 5FR1A 1XTIA 1XU4A 1JR3E 4JYCA 4D4LA 1OIWA 4M22A 1JAIA 4EKDA 1KK0A 5FOXA 3GFOA 3VU9B 4H9GA 3LV8A 1FL9A 2YWFA 4M1YA 3CH5A 4CEIA 2ZQ5A 3W34A 2ONJA 2D4HA 3B9QA 1KNXA 2R6CA 4BFWA 2QSYA 2D74A 1NIJA 2FH5B 1KO5A 4EUNA 3GJ0A 1U2RA 2KSQA 4US2R 5AJXA 1AQUA 3ZQ6A 2DPXA 2XJ4A 3K8YA 4ERNA 1E6CA 2J46A 4MYTA 3N2EA 2DWQA 2LCFA 1MRSA 3BJIC 4P4SA 1SVKA 1Z06A 1ZUHA 1W49A 4NCNA 1BYUA 1BYIA 1TX4B 1M7GA 4URVR 4LV5B 3ZH9B 3AUXA 3OE7D 4BFTA 4G0NA 3CRVA 2H92A 4WBSA 4BLOA 3C7KA 2ZRGA 2ONKA 5EE3A 3U4QB 2CL0X 3DKPA 1GL6A 2NQ2C 3OFNA 1ZM7A 1ZNWA 3TE6A 1A5TA 1RRCA 4BZPA 4C0AC 2AL7A 1A2KC 3BORA 3LX8A 4LV6A 3G5UA 1AZSC 3IEUA 1WA5A 1VPLA 2FZ4A 1MABA 2P3SA 4AKEA 3FMPB 4XTRA 3JZAA 1YR9A 4A0RA 4M9ZA 5CDFA 3FMFA 4OJQA 1ZM4A 3QF4A 1P61B 3BWDD 1KDTA 1EFRD 1Z83A 3F3YA 4URUR 4Q7LA 2BBOA 4GT1A 5KDDA 2ZU6A 4DC9A 3T1QA 2ZS9A 1RW4A 2NO1A 3ZD6A 3ADKA 3RS3A 2R6FA 2ZJZA 3QXHA 1E2JA 1TPZA 2WHXA 2JGNA 2ZUDA 1LVGA 1OFHA 3PVSA 2V9PA 1N6OA 1KDOA 1QF9A 4IDHA 4RZ2A 4V0NA 3K0EA 3OEHA 1XTJA 5DISB 2HUPA 4KFRA 3AP3A 2ZYWX 2YC4C 4JMPA 4Z1MD 2AK2A 2Z6VA 3LH5A 4LBVA 3SU8A 4FINA 1G3UA 1H8ED 1XTQA 2ERYA 2W0SA 5KU1A 4KCGA 1IY2A 1GFIA 1W4BA 1BH2A 1R4AA 4B3DA 3BAFA 2F3TA 2QN6A 3B1WA 5FUVA 5FL7A 3IEVA 1ETUA 5C1BA 4WIAA 5TMPA 4XVUA 2AXPA 2VHQA 4UNNA 1ZINA 4LHYA 3RABA 5HPYB 4ZDKA 1N25A 3C14C 1X8KA 3R9WA 4C9BA 2TMKA 1OIXA 2DBYA 1KO8A 4HAXA 3BOSA 3TBKA 4LHWA 3MLEA 5FBLB 4BZXA 3AGPA 3K53A 4CW7A 4TQ9A 3LXXA 4EPRA 4OQLA 3MWYW 3SQWA 2OFXA 2WPDD 4I1VA 4TSFD 1N5IA 4BPBA 4A8JC 2CHVA 2W83A 5TB5A 1EWRA 3MJHA 5KUTA 4EDHA 1GVNB 4L15A 2B7CA 5C4GB 2A5JA 2QNRA 1T91A 3REGA 2XTNA 4PHFA 1ZU5A 5ELXA 5IDVA 3S1AB 5DO9A 3U3RA 1W48A 2BV3A 2JLVA 1KO4A 5CM8B 3IIKA 1XRJA 4N0DA 5D3MB 1W36D 2J0QA 3FB4A 3HPQA 3W8RA 1GL9B 3P20A 3NBZC 3QBTA 4L8GA 4PZLA 3HU3A 1KKLA 1UBGA 2ZR0A 1TU4A 2GAAA 1WF3A 4LDJA 2GJAA 2BHRA 3QENA 1KJYA 1KY3A 3CX6A 2GXSA 1QHYA 1P7CA 3HU1A 1XMIA 3PQCA 4MGYR 2MSDB 3LXRA 4QJ4A 4M0LA 1HE8B 3EZ7A 3QXJA 3LW7A 5L3QB 3H0KA 3MWJA 4PPGA 3CF0A 4MRVA 3CR7A 2ZJOA 1WBBA 3L0PA 2QBYA 4HEJA 4ZPXA 1K8RA 3EPJA 1HY3A 5K8IA 2C96A 4NYJR 4MKFA 5L3VA 2PCLA 5DN6A 3Q7PA 2VQSA 1W0JD 2DY1A 5GADl 1NMZA 4MKIA 1W44A 4PHTA 1MO4A 3BFKA 3KXLA 4B44A 2OV2A 1N0VC 3D6TB 2H18A 4WZ6A 1SKYE 1GWNA 1O87A 2MSEB 4TTRA 4QC2A 3SYKA 4RD1A 3QSYA 4HYYA 3GPLA 1VYUA 1Z29A 3HJNA 1FX0B 2P5SA 4B6FA 1N6LA 1XXHB 3EIHA 4GOKA 1M74A 5TVKA 1QHNA 3THWA 1R10A 1PUIA 2CJWA 1YU9A 1P9NA 2WJYA 3KTAA 4A8JA 5AUOB 4NPHA 1XTSA 4BFVA 1ELOA 1OIVA 4DB2A 2H7VA 1ONBA 3GJ3A 4QJ3A 3BB4A 4CEJA 4EPXA 3AVQA 4PO1A 3RVBA 3I5YA 2A2ZA 3EC1A 3QOFA 3SFZA 2QTVB 4DXAA 4G5OA 1UBFA 3BXZA 4QHTA 3VHXA 2C95A 1Q1EA 3SJBA 1TEVA 1YRAA 4C2UA 4PSKA 2WWFA 4RY2A 1Z6AA 3C5CA 1ZM9A 1MV5A 5GJWC 3P26A 1OB2A 3O8DA 3FDIA 3IHWA 3EWAA 2RGNC 3THYA 1A7JA 2ZSAA 3W8NA 1KYIA 3GFPA 3NWJA 3EPKA 2QAJA 1VG1A 2QPAA 4E22A 1R8SA 1QVRA 521PA 1KAGA 1PVOA 2W6JA 2ECKA 5LB2A 3DZ8A 4DSTA 4A0HA 1X1SA 4DDWA 4KLNA 2J7PA 2PJZA 1E79D 1EGAA 5FPKA 4CEIB 2EFDB 2ZYVX 3OZXA 1G19A 5B64A 1QHXA 2AFHE 4D26A 4W5WA 3WP0A 3BFXA 1Q1ZA 1GKYA 3L2OB 1YZTA 1YR6A 4TMVA 4ITRC 1IJFA 3RHFA 1XJCA 3SNHA 3D8BA 1E9FA 2XNDA 1XDBA 3WNBA 5KNDA 2GJ8A 2I3BA 2ZSDA 1W4AA 1CR1A 1ZUNB 2AN9A 4WZAE 4XOIA 3DM9B 1E69A 2PBRA 1G8YA 3IO3A 3NBFA 5DYGA 3AF1A 1XX6A 1IBRA 3FWYA 1D9XA 4BLRA 4G5QA 2QT1A 4Q4JA 1CTQA 4AKIA 5JMTA 1IXZA 4D6PA 2ZRAA 2R8RA 1AS2A 2A5DA 2J0UB 2VP4A 2ZAMA 3ADCA 3ADBA 4G5GA 1E2EA 4PX9A 4Q4HB 5J4VA 3GLFA 2O52A 1E9DA 2JLSA 3KQNA 2ZI4A 4PHGA 1TUIA 1AIPA 2OAQ1 2CL7X 2ZROA 4IOJA 4PZZA 1KDPA 1Q0UA 4RFSA 5L3RA 2ATXA 1MABB 5AWFC 2WZQA 1TADA 1II8B 2R6GA 2GXUA 3OHMA 2BKUA 4HB2A 1SHKA 3QF4B 1B0UA 1HURA 1CEEA 3A1VA 1ZCBA 4TYPA 3WRYC 2A30A 4TT3D 3KKOA 4RZXA 4EPVA 1RJ9B 3I72A 2W6ID 2ODNA 4L4UA 3KJIA 1LW7A 4ACAA 3C16C 4TTPA 4ZO4A 4LHXA 4IDOA 1E0AA 1IXRC 2J1LA 4RD0A 1R0WA 5JLJA 4RD3A 3T5GA 1NN5A 3E2IA 1E1QD 2FF7A 1FP7A 2IYWA 5B58C 3P32A 3SJZA 3KB2A 3F0TA 2ZR9A 4IOMA 2C8VA 2QAGC 3C4JA 1L4YA 4PO9A 4Y0AA 4PQRA 2IF0A 1WBDA 2OXCA 2RGXA 2WJGA 3U60B 2V54A 3EARA 3ZZUA 2XAUA 1DVRA 2QPOA 3PCRB 5FPTA 2B6HA 5FTNA 1E2MA 1NF3A 2EQBA 1A82A 2XITA 5GVRA 2H1LA 2E87A 1QBKC 3GEHA 3TVDA 4C0SA 3QUSA 4OHVA 2FPKA 4B3FX 1BS1A 4I99A 1R0ZA 2QSZA 3RS4A 2FV8A 5BXQC 3VU9A 3JVUA 3OEED 4LOAA 4LC1A 1N6NA 1G3IA 5FPYA 2O0JA 3ZJYA 4QKQA 2FOLA 3UMRA 1QHIA 5G53C 1E9EA 3TGPA 4WOPA 1JR3D 2XB2A 1NP6A 4LRWA 1ZC4A 2VP5A 4A82A 3GMTA 4A0GA 2A5GA 4M8NE 3IQXA 2HJGA 2GETA 4QJ5A 5FUWA 4M9QA 3ZZ0A 1UADA 2A78A 4JBYA 2KBEA 4A6XA 1IAQA 3VTKA 4HB0A 1TAGA 1P73A 2VIIA 2ZRBA 5IHPA 1XPRA 4C2TA 1P6XA 1WXQA 3BK7A 4Q7KA 2YC2C 1KI6B 5FOUA 3U4QA 2BMDA 1BMFD 3AVOA 4JLAA 4MH0R 1J90A 4PHHA 2QENA 2KB0A 3L0OA 2WOOA 4BASA 2C03A 2WOJA 3AGQA 2C78A 3ZIAA 4DCUA 1X8JA 3SEAA 3RS7A 3GLGE 3HU2A 4NYIQ 2CDNA 5JCZA 1E1RD 2CCKA 4P4TA 2QGZA 4A1FA 4KSBA 5CJ2A 4URZR 2BMFA 3E5HA 4JL8A 2FEOA 4LJ9A 4YC7A 1G8FA 5AUPB 3VQTA 3O8RA 4XWAA 3K9LA 3BRWD 1JECA 3EZ9A 2H8KA 4F93B 4C7OA 3WMGA 4M1SA 4FMCF 3K70D 3IILA 3IKJA 1XZPA 4UNRA 1OB5A 2JLYA 3A1UA 5HR5A 3FKSD 3L8YA 3SI7A 2CVHA 4X8HA 3R7WA 4YONB 4DLXA 1SVWA 3SBDA 1GKUB 1VDZA 4D4MA 5F98A 4YXWD 2FFQA 2IL1A 4FCVA 2WM9B 4LHZA 2NO0A 4M9SA 1IY0A 5SZIA 4V0LA 2WJJA 2DFKB 1VCOA 5HZHA 2WJVA 1PV4A 4B34A 5EXTA 3WMEA 1S8FA 2RCNA 4QNMA 1T5IA 4AYWA 2YWGA 3SJCA 4NCHA 1Z3IX 1AQYA 2ZRIA 4WVFA 3THWB 1HQYE 1VKJA 1XJ0A 2CJWB 1XB2A 3KTAB 4A8JB 3R9XA 1HT1E 4F4IA 1P2TA 1S1MA 4JLPA 1KI7A 2B21A 4C4PA 1XF9A 1K5GA 4CEJB 1G20E 4CYMA 1KKMA 5EXXA 4OI4A 3FHOA 1VYTA 5L3SA 4QXAA 2DFNA 2QL6A 1OPXA 2GZAA 1UBCA 1YZLA 2D62A 2ZRNA 1OXSC 4GMDA 4F92B 4NYMR 5BWMA 1ZD1A 2FE4A 4MRSA 2DCUA 3K0AA 4HZUA 3OESA 4JT2A 5BN3A 1Z07A 1E2HA 2BKEA 1E94E 2BWJA 3A4LA 4O25A 4ACBA 4B73A 4AY2A 2HLDA 1TF2A 4X8MA 2PZEA 3EXAA 3TQCA 2OM2A 1TMKA 1L4UA 3THYB 2VPPA 1WQ1R 4NBSA 4RZ3A 3QVUA 1D2MA 1F2UA 3SS8A 2G83A 3PEWA 3K0CC 1PZNA 2QTFA 1VCIA 3KX2A 3SZRA 3UG6A 4NDZA 4LGMA 1GOTA 1U98A 2W2TA 3A4NA 3MJRA 3EZFA 2IW3A 2O8FA 2IX3A 2RGCA 3IIJA 1TQ6A 3P4YA 4TYWA 1N2CE 1KGDA 4TL9A 2HF8A 5J47A 5EP1A 4UQOA 1KO7A 1M1YE 2IYTA 4RD2A 1Z47A 5AJWA 5H68A 1E32A 4JS0A 1L8QA 4OQFA 2GESA 1E0SA 3TVTA 1J8YF 2O8CA 5LB4A 3OIUA 2CE7A 3M6AA 1F5NA 3DL0A 1QRAA 2XZPA 1CLUA 5EE9A 5L3QA 3U7EB 3NG1A 3GEIA 4GL2A 2D2EA 2ZUBA 1M34E 2CNWD 4KODA 3LBIA 4QFMA 1E98A 4MUBA 2D06A 1RKBA 1W0KD 1T3HA 5AJZA 3CWZA 3GLFB 3VR6A 2IWHA 2JJ2A 3K70C 4PO8A 3VAAA 4MRRA 1EESA 5DYIA 2BBSA 4DJTA 4BFXA 4LC0A 1E96A 3FKQA 4TL8A 2VYFA 4ZDJA 3QQ5A 2F6RA 2K5UA 2ZI6A 1N5KA 4FCWA 3VHLB 3BIFA 3RC8A 2WAYA 1ANKA 1UFQA 2WVJA 1YE8A 1E9CA 3T1TA 1M7HA 3PV0A 5J40A 3DHWC 3WNDA 1CJUC 2GILA 3RANA 2J9RA 2QG6A 5B30A 3TRFA 2WMNB 5HZKA 3N70A 1JI0A 1LTQA 1KK2A 3LQRA 4GZLA 3NKVA 4V0MA 2JLXA 5JJKA 3RAPR 2HT1A 2D3WA 2NG1A 5HE8A 1Z5ZA 2P6NA 3BC1A 4HDQB 3HP1A 2XSZD 5FL3A 4DLZA 2CK3D 4GI7A 4IXNA 3PEYA 2ZREA 3EW9A 4QGHA 5AJVB 4IVQA 4B48A 2REOA 2ZRPA 3RRYA 3B8HA 4B43A 3GLHB 2BVNA 3K0CA 3U3KA 1E9SA 1KO1A 1W4CA 2CLDX 3MWKA 2ZRMA 2W00A 3SYNA 3AF2A 3WHLA 3BD9A 1G16A 5FOTA 1YKSA 2YOGA 3WXMA 5HKKD 2G6BA 4HLUC 3NC0C 4DCTA 4JLJA 4LJ4A 4MYHA 3LVRE 2GDJA 1J2JA 2Z0MA 3Q9LA 1KI2A 3GLIB 2B8WA 1MO5A 4LPSA 4OBEA 5LBIA 2WAXA 3WBKA 1W2GA 3VKHA 3ZLJA 3K9HA 4F38A 1EFUA 5JWOA 2YJTD 2IYUA 3KB1A 1UDXA 2HV8A 3AF0A 3DOFA 5EJEA 4PAOA 5EXSA 3TSZA 4OI2A 4IFBA 2RGEA 4OQNA 4G1UC 2BOVA 3MMPA 4EPTA 2P2LA 4EIWA 1G7SA 1JEEA 2P6UA 4Q1BA 3SYLA 1K6MA 1IXSB 1Z0FA 4DIEA 3EPLA 1XXHE 1GP2A 2F9LA 2OEPA 5JZVA 1FTSA 1CR2A 5EE0A 3LBNA 4KI0A 1Q3HA 3CNLA 4JKYA 2ZI3A 4I1UA 4ASUD 4W7SA 1UKYA 1XP8A 5IK2D 1E3MA 1ZD8A 4IEEA 4LJYA 2MSCB 3IGFA 2NGRA 4KLZA 4C0KA 3TSWA 5LDDC 1XCPA 2Y8EA 3ADDA 2OCAA 2XZOA 5SZJA 4OYHA 1OYYA 3FMOB 5BYJA 3AVUA 3PENA 1TEXA 4FN5A 4TQUS 1UPTA 2OESA 1RRGA 5J4HA 3KJHA 2VHTA 2QRZA 1BKDR 3QKRB 3UWKA 1FQJA 1HUQA 2F1IA 4D0GA 1UJ2A 1G3QA 2H57A 3IBYA 4HAVA 2ZAOA 2J0UA 3A6PC 4Q4HA 1G7RA 3I62A 4UNPA 1U81A 1T5LA 2ZRJA 3AP2A 1M6NA 2ORIA 2GNOA 4UKDA 2H5EA 3PIRA 3RRNA 2ODBA 1U99A 2HXYA 1COWA 3ETLA 4I1SA 2ZETA 1II8A 3QY0A 1KK3A 2JA1A 3VR5A 2JLZA 2QRNA 2A5FA 4YMUA 1SXJC 2QAGB 5FBWB 4POAA 1KSGA 4ZDIA 4G01B 1KMQA 4DBLC 5FOWA 4C7OB 1W47A 1RJ9A 3RNLA 1G3MA 2HT6A 2P0EA 5SZHB 3L82B 2CXXA 4JLBA 4QG7A 5KOYA 4OHZA 3KQHA 4CF7A 3R7WB 4A0FA 2BBWA 1T3SA 2GF9A 2WIBA 4B33A 5G40A 5JSZA 1S9HA 1ZIOA 1DAFA 1OYWA 4M1TA 2R44A 2I1VB 2IYZA 3FFAA 4MUAA 2IYVA 5FOVA 1S96A 4RCZA 1XMJA 3B1XA 3B1ZA 4NYIR 3CONA 2ZRHA 1ZYUA 2W0MA 3NC1C 1S2MA 2WSMA 3O8BA 2G77B 3RYTC 3W5JA 3P27A 4O2RA 1S1CA 5L3SB 4HAUA 1CRPA 3KDSE 3HDTA 4Q4AB 4YQFA 4Q18A 2G1KA 3Q8XB 1F48A 1TQDA 2IYXA 2G3YA 2C9YA 4CRWB 1TL7C 3MGCA 1W4RA 1ZIPA 3K0AB 4ZI2A 1OXXK 4HZUB 1MRNA 1IOZA 1X86B 5CDFE 2DFTA 4HB4A 5FBQB 2WTUA 1P75A 3VNUA 2GK6A 2GZHA 4C3ZA 2IS4A 1I2DA 1Q12A 1T6NA 4Q00A 3E1SA 4EFLA 4AKGA 2ZE6A 1Y3AA 3NEYA 4EFNA 1YJ5A 1ZM2A 3UANA 1F2UB 1GL7A 4FWTA 2YWHA 5KPDA 3FHTA 2GXAA 1P2UA 3LLMA 3K9GA 1KJZA 4IOLA 3FFBA 5A5GA 4GDFA 1CBUA 4LYHA 3TAUA 2HYIC 4AG6A 1Q21A 5K8TA 1NLFA 1UEJA 1S9DA 4QGAA 1GITA 3ZD7A 2PEYA 5P21A 1DEKA 1NLYA 2KJQA 3KFVA 1HV8A 1XD2A 2PH1A 4LJ8A 2O8FB 1G7TA 1SXJA 3DEFA 1S0UA 3A1WA 1ZU4A 5KYKA 5KNBA 4DSOA 5KNCA 2IK8A 1S3SA 2XTMA 1KI6A 2F3RA 1DAHA 2O8CB 3ND8A 3LFUA 5JI3E 3SHFA 4DEXA 2HDNB 5CYPA 3TK1A 1TF5A 1OLOA 2ANCA 4AK9A 2GVZC 2V1UA 2J5XA 2FSIA 1Q1BA 4IW3B 1P3JA 4HAZA 1GZSA 1R0XA 1YR8A 4GOXA 1KK1A 1JQLB 1XMSA 2XJ9A 1D9ZA 2VTKA 2WJHA 4Q01A 4ZCMA 3UG7A 2VH5R 1EFHA 1SGWA 1KDRA 3CUEF 5BYKA 1NBMA 2JLQA 3D7MA 2ZI5A 3RSLA 5CYOA 5JRJA 3AV0B 3KFXA 4LHVA 4WXPA 4CT4B 2VO1A 2E9SA 2BDTA 2ORWA 2FWRA 5HKKA 3NVAA 3QG1A 2DWPA 1M8PA 3DKVA 4F91B 3BBPA 1VIAA 1U9IC 2XXAA 2MMCA 5DE3A 4PSVA 1UEIA 1XZQA 4D4KA 2PMKA 3VMFA 5TDHA 4W5HA 2VHUA 5CIWA 4ZI3A 2P67A 3B2EA 4A2PA 4NL4H 1LS6A 4DT1A 1JJ7A 1L2TA 5KDOA 1UBEA 4TWZA 1OXUA 4L16A 3SN6A 2QMEA 1TTTA 1W5SA 2OBNA 1G18A 1LB1B 3TR5A 2JDID 4P32A 1Z2CA 2ZUCA 1VECA 1EFTA 1UKEA 2ZSBA 3LBHA 1GNQA 2WSSD 3HR8A 1HE1C 2NZJA 4HDOB 2AR7A 1OFIA 1KJWA 1AM4D 5J4YA 1OXVA 4MA4A 3GP8A 3A1SA 2IBMA 4PAMA 1SZPA 3AKCA 4L5BA 1DELA 2YV5A 1JEDA 3I32A 3W6OA 4EFMA 3L0SA 5KHOC 2V3CC 4ZKEA 5G3ZA 4XSHA 2IYLD 3CKLA 3OE7A 4TLEA 3KQLA 3KQUA 2GEDA 2IXGA 4G5RA 4E5UA 2BM0A 3TW4A 2JLUA 1G6HA 2OO7A 2WKRA 4LBZA 1II9A 2IS1A 4MKHA 2VSFA 3DMNA 1EK0A 1OJLA 4JVSB 2Q6TA 4HI0E 3PG5A 4MYCA 1YVDA 4K8OA 3C5HA 4HZIA 1QG2A 1LNZA 3T06B 2Z83A 1QDEA 3L0IB 3AQ4A 5C2JB 3UPUA 2ZE5A 2XTZA 2NO7A 3TUZC 3TAHA 2R6DA 1W36C 1NJFA 3I92A 3QG5A 2R62A 2F1RA 3U3JA 5IF9A 4MGIR 2IYRA 4L9SA 3RSOA 1R8QA 4RKFA 1EFRA 3QIAA 3BB3A 1NMXA 1KTVA 3K70B 2V7QD 1Q1QA 5CIQA 1KMHB 3OAAD 2JLWA 2QU8A 4BFZA 2PMDA 2RGGA 1C9KA 1HA3A 1QG4A 1AJEA 5H70A 2QZ4A 4XJXA 5D3QA 2NZ8A 2FFHA 3QKUA 4Q7JB 1ZNZA 4OHXA 1E2IA 1JXMA 4DB4A 1WDTA 5DI9A 3SJAA 2ZIAA 4HLCA 3K0FB 3EA0A 4Q21A 2ODWA 2EYQA 2GEVA 4Z1MA 1AS3A 1Z0DA 3GJ6A 1H8EA 3QPWA 4LYFA 5CLLA 5TARA 4AYTA 3DMDA 3BB1A 4IVRA 4C30A 3U2QA 3RLFA 1VTKA 3RDPA 2RB4A 5G3YA 5C18A 1SVIA 1Z63A 4ZDWA 4TL6A 2V6IA 4A9AA 2F55A 4TMKA 3DPUA 4KFTA 2FMXA 2YVUA 1Z28A 4HAYA 4W9MC 2QROA 4TL7A 3PEUA 3RS2A 2ZJYA 2WBLC 1ZVQA 1RYHA 2X1VA 4YMSA 4WXRA 2B7BA 1II0A 3W6NA 2ASEA 1RZ3A 4QGFA 4D80A 1CULC 2Q9CA 1RYFA 3W6PA 4QBGB 5GJCA 2WPDA 4TSFA 4R71A 1MOZA 1IQPA 1WP9A 2D2FA 2B92A 4BFYA 1NVWQ 3AVWA 1GSIA 2RGNA 4LWZA 2IWRA 4KVAA 2J87A 1OHHD 1U94A 2YINC 1FPMA 5JSZB 3THXB 3AM1A 3C41J 1P5ZB 2JAQA 1GRNA 3MCAA 2ZVQX 3KUCA 4D4JA 2WWWA 4B35A 2CVFA 3UATA 4IEIA 3GLHA 2OG2A 3T1OA 2GAOA 1ZW6A 2PZGA 2JEOA 5SZKB 5JJIA 2X19A 4J0QA 1GDDA 1T8UA 4Q02A 2QY9A 1YRBA 4QHSA 2ZSEA 4M4SA 1X8LA 2A7QA 2NTYC 5AJYA 1YZGA 4Q9IA 1W5TA 4HLDA 4H1UA 3CRRA 4B75A 3GLFE 3GLIA 2JATA 4BEJA 1N6RA 2KWIA 3EZ6A 5LD2C 3TNFA 4LJAA 4PSAA 1GNPA 2I1QA 2GKSA 5F9HA 1E99A 3D31A 3W3AA 3CRQA 1WMSA 3U61B 2G0NA 2HYDA 4PTLA 2QGNA 1G8PA 4RJLA 1RPZA 1G5RA 3ONWA 4GFDA 3R8FA 2Z4RA 4IVPA 4NMMA 4ZIRB 2QMHA 4I81A 1VHTA 2GJSA 1W0JA 3SHWA 2PX0A 1SVMA 2WJIA 3HPRA 2YNMA 2IS2A 1YQTA 5JEEA 1VIYA 4M1OA 4UXIA 1R7RA 3NH6A 4Q7MB 3MRSA 1FW6A 3CF2A 4DIDA 1E0KA 5EZ6B 3BFVA 1GAJA 2UZIR 1OFTA 3I8XA 1OE0A 3QNUA 2C99A 2FU5C 2YKGA 4D25A 4MGZR 2XX3A 4A92A 1FQKA 2Z5FA 3IPYA 1G291 1WE2A 1XD2B 4II7A 5FTKA 3C15C 1T0JB 4KBGA 1SXJB 2LWIA 1IM2A 1W7AA 2NPFA 5FTLA 1XEWX 4DCVA 4Q1CA 5DGXA 1GM5A 4URWR 2X8AA 4KV9A 1H8HD 1Z0KA 3QKRA 4TYYA 3L8ZA 1SKYB 2JJ1D 3U44A 1E2DA 3EPHA 1JXOA 2GXQA 1CU1A 2PL3A 3U7FB 4RD6A 2JDIA 3X1WA 2IYYA 2C04A 2F9MA 4B3XA 1US8A 3EX7C 1KI9A 3IBGA 3VKGA 1OKKD 2IA5A 2WSSA 4BWYA 3R9IA 4F4CA 5JHGB 4TZ6A 1NI3A 2ZTSA 3HYRA 4XD7D 5JHHB 1OW3B 1SVOA 3BH0A 4IXMA 4B74A 1FP6A 3MSXA 4OI0A 3N2IA 4NONA 4P33A 3T15A 3A58B 2QAGA 2CLCX 4V02A 4JBXA 4PC7A 2AK3A 5EP4A 3DDCA 1FTNA 1MO6A 2FGJA 1XMVA 4IRUB 4KYUA 1KSFX 3V4RA 2Q9BA 1YZKA 2IEYA 1HH4A 4GSYA 3OIWA 3ZQJA 2XXAB 2BCGY 3LVQE 2C2HA 3MD0A 4TMWA 3WMFA 2RGBA 2O8DA 1B23P 4M1MA 1RE0A 1JPNA 1ZNXA 4KYIB 3SDZA 4C0BA 2ZI9A 1QHHB 4QBIA 1QHGA 3LWNA 3WRXC 4DT1B 2BMEA 1EG7A 4MGKR 1DPFA 1VG0B 4P0TA 4TMZA 5FPSA 3X1DA 2D7DA 2OCYC 1XPOA 4DKXA 1E79A 4AKHA 1NVXQ 3NDBB 1G1MA 3THOA 2P5TB 1HT2E 3CIOA 1Z6TA 3QKSA 1RC8A 1HQCA 2NPIA 4PAQA 1F60A 1JPJA 2LKCA 1ZBDA 2QE7D 3R8CA 1R5BA 2QQ0A 4IDNA 3F8TA 2VSOA 2BBTA 3D3QA 3TW8B 5BN4A 4FWIB 4MYUA 3Q72A 1SQ5A 3OF5A 4OQXA 2QM7A 4Q4AA 1X3SA 1RIFA 3CW2A 1BO6A 1VCNA 1CJVC 4BE7B 1OT3A 2HXSA 2VEDA 1J7KA 2AWOA 2BM1A 2MMGA 2YYZA 3CBQA 3CPJB 3LNCA 3OFND 4TMXA 3GJXC 5EZ5A 2VSXA 3T12A 2OHFA 4LSGA 1UAAA 3RS0A 2Q21A 1DS6A 1EFCA 3Q3JB 1JJVA 4GRAA 4AWXA 4TYQA 4U00A 1XTRA 2QI9C 2OBMA 2BJWA 4DSUA 5JI2E 3QBVA 2WKQA 3QXXA 1QVAA 1NY5A 4R7ZA 3WY9A 3KZ1E 4B2PA 4DLYA 4XWKA 3IUYA 3WYFA 4JIMA 2NMVA 3QEOA 4PANA 2RGAA 1EX7A 3H84A 2OSBA 3I4LA 5E4FA 2CL6X 3M0EA 1R5NA 2HJVA 3K0SA 1Z6GA 1Z0JA 3NXSA 4JJZA 4M1WA 4QL3A 4TT3A 2W6IA 3GD7A 4JBWA 1NKTA 1DAEA 3VR4A 2C5LA 1U0LA 3KXIA 1N6KA 4NYJQ 3E70C 2VL7A 2G88A 2GBLC 1DE0A 4PC6A 3ICQB 3G82C 1E1QA 1MT0A 2VF8A 3OEHD 5K8UA 3JZMA 4FD2A 1IN8A 2AFIE 5L8VA 3C8UA 3L43A 3NIBA 4A6PA 5JS7A 4TTQA 1AN0A 5EE5B 4A2QA 4I4LA 2H17A 5C4MA 2I4IA 1M2OB 2N1BA 5FL7D 1G4UR 2BC9A 3IQWA 3W5IA 2A5YB 1E2QA 2ZSFA 2E1RA 4NCJA 4I1OA 2KI5A 1ZUIA 1P9WA 3CF6R 1LF5A 2XEXA 1BOFA 1YZUA 1VYVA 1CRQA 1OXTA 4IFEA 4GZMA 3NHAA 4JVNA 2AD5A 3DZDA 421PA 3H1TA 4MRPA 3I1FA 5FTMA 4Q1AA 1N5JA 4ILEA 1YHNA 3GFTA 5KO2A 1IN4A 3BH7A 2IEZA 1KY2A 4IDPA 1NVVQ 1IHUA 1U8YA 1UDWA 3CZQA 3EIQA 3HR7A 3MAAC 2ZJ2A 3QJYA 4JLKA 4LYJA 1JNYA 1XCGB 3OEEA 1CR4A 1DAIA 4HLQB 4IJMA 1LY1A 4LY6A 4PQFA 3U7HB 1NNEA 4URXR 3PUYA 2GTPA 2WV9A 1JR3A 2BMJA 1WRBA 4UJ5A 3IIMA 3KJGA 4OK6A 4Q9JA 2ZJ8A 1OH8A 4DDVA 4TLBA 2BJVA 3BERA 3TR0A 2IHYA 2NO6A 3LQQA 4NP6A 1L7VC 4DCSA 1W36B 1R0YA 4WZBE 4W5JA 2RAPA 3ASZA 3A4MA 4B2IA 4EJSC 5DH9A 5EE1A 5LPNA 4PQYA 3GJ4A 3TUIC 4BLTA 1XJQA 2JJ1A 4C0HA 5K8LA 1RFLA 1BMFA 2EFGA 4JL5A 1N3BA 2RHDA 2CE2X 1D8TA 4M1KA 4KXFB 3TQFA 2Z4SA 3EASA 2ZJAA 721PA 1NVUQ 3CNNA 4R9UC 2J0SA 4TLDA 3A36A 4DLWA 3QPUA 5HCNA 2PLFA 1E1RA 1CF4A 5FUYA 1NY6A 4G3XA 4EPWA 1GRQA 4YLGA 3RC3A 5KSZA 2EFCB 4DLRA 4TYNA 5CITA 2ZS7A 3DM5A 2R2AA 1TQ4A 1VG9B 3M4YA 3ZVLA 3GJ7A 3QI2A 4GMXA 4UXJA 4V0ME 1FOEB 3H86A 1N6HA 1KMHA 3DO6A 2FSHA 1FMLA 2GF0A 3FKSA 3MG9A 5BN5A 3IHLA 2WWIA 1G5TA 3K09C 1NJGA 1PLJA 4KFSA 2OZEA 1U0HC 1Z0IA 4YXWA 2ERXA 4LPKA 5FR2A 1E9BA 3ZS9A 2GEUA 2V55B 2Z43A 4V03A 4JSYA 1DBSA 3EA5A 4JLDA 1Z2AA 1Z6XA 3K0FA 2IUUA 2FFBA 4IDQA 5EXPA 3H2YA 4FI3C 4BFSA 1E2NA 3K1JA 5JRZA 3U44B 1OH7A 4LUCA 3B1YA 4HUTA 5AK0A 4AI6A 1H65A 1US8B 2X2FA 4Z8XA 1U8AA 1IN5A 3B13B 4OK3A 2QE7A 3UIEA 1P9RA 3KJEA 4K46A 1NN3A 1NL3A 3ASYA 3LD9A 3LA6A 4HATA 2IC5A 3AH8A 5KSYA 3Q5DA 2LKDA 3FPAA 4U5XA 5FI1B 2JASA 2QQEA 2NIPA 2XGJA 3SBEA 4CDGA 5JBQA 3AKEA 3EC2A 1FZQA 2F43A 2WWGA 3BH6A 4EJSA 2G9NA 2DB3A 3G0HA 3QVVA 1PLKA 2YZ2A 4HLUA 3WNCA 1D6JA 4E03A 4OK5A 5TV2A 3SE0A 2O8DB 4Z54A 5DIFA 5JFGA 2OCPA 2W6JD 5DNYB 1JQJC 5LD2B 3B78A 1C1YA 5TY0A 4PPFA 2J7PD 3QKTA 2ZRLA 4LZZA 4E09A 3THXA 3QF7A 1R5OA 3P1JA 4JLNA 2HF9A 5F2EA 5CK4A 3VFDA 4XIGS 3F5FA 2SHKA 3CRW1 2KE5A 5JJLA 1J70A 1ODFA 4YDHB 2REXB 3PXGA 4DWJA 4HUQB 2C98A 4KITB 2O8BA 3QKSB 2W2VA 4RFVA 2QP4A 2UVQA 3TMKA 5FBVB 4QOSA 2EU8A 3DVLA 4B71A 2XNDD 3B5JA 1WB9A 1G17A 2JJ8A 1E0JA 4NE2A 1CJKC 1GIAA 3I8SA 1CP2A 4Q03A 2BCJQ 4CEHA 5CB6A 4RZUA 3K09A 3T61A 5EUMA 1OFUX 1PLLA 1GUAA 1S4QA 2L0XA 4BFUA 1SHZA 2FZLA 3IDQA 5CLQA 4E07A 2WWYA 3FHCB 3LX5A 1KSHA 2CNWA 4JLVA 3WBJA 1P2SA 4NTZA 5GJVC 4ZIRA 5AR1A 1AKYA 4ARZA 1W0KA 4DLSA 1F2TB 3RS5A 4B3BA 2PJRA 1Q57A 1F3OA 3J81k 1MO3A 2CCJA 3EAQA 1T4GA 4H1VA 4ESVA 4JSTA 4Q47A 4WAUA 2IT1A 5CM9C 2VLIA 1V5WA 2EWVA 2O8EB 4U7DA 4FXPA 2IUSA 2OBLA 3X1ZA 1S3GA 4A2WA 1DO0A 4F4JA 5H8WA 4N0EA 4XVRA 4AC9A 2GCOA 2VF7A 2P65A 1DOAA 3QPVA 4ZCLA 1NIPA 3GEEA 3TSOA 1XWIA 2J7KA 1UKVY 5BQ5A 3ZVRA 4C0QC 4FMDB 4XWOA 3PEVA 3KKMA 3IO5A 4C0LA 1Z08A 3CPEA 4NU0A 3X1YA 2XSZA 2CK3A 2FEMA 5E7JA 2ZPTX 2FDCA 3KL4A 3W3ZB 4PPNA 2NOAA 4AURA 2GK7A 2EFHB 3FTQA 5M04A 2CEAA 4Q1EA 1XEWY 4LK2A 4XVQA 2J59A 3RWOA 1LFDB 3X1XA 1K5DA 2OLJA 4KAXA 1PUJA 4MITA 2ZXUA 1HEIA 4PPQA 3GJ5A 1Z22A 3CO5A 2CBZA 1CR0A 1VG8A 4PC1A 2DR3A 1ZP6A 2XNSA 2QA5A 3CNOA 4GPTA 4DZZA 4ESHA 1G3RA 4A15A 2QT0A 5BW8A 2OFWA 3VR2A 3ZZTA 1XFAA 5EUQB 4B3GA 4TMTA 1IN7A 5F9FA 1E9RA 1QHHA 1NLZA 1FNMA 1XTKA 3B9PA 4MKGA 5JS8A 4KJZA 2GHIA 1ESMA 4M21A 4Q48A 4JYBA 2RMKA 4YMTA 4PFSA 3PFIA 1RVDA 1SXJE 2YHSA 5FUXA 4US0R 3CPHA 2HEIA 4OQMA 4GP6A 4NYMQ 1E2PA 2BEJA 2R9VA 2VP0A 5B57C 1XEXA 621PA 2GCNA 3AF3A 1NG9A 3VX3A 4DVGA 4ASUA 4D81A 5IK2A 1TUEA 2O0HA 1Z0AA 1I4LD 4MRNA 3U3MA 2NO9A 2X77A 3T34A 1T8TA 3HYTA 3MUFA 4RD4A 3UWOA 3UXMA 5E7MA 4KHZA 4NHOA 1NBME 4MDEA 4CGZA 1YR7A 4DLVA 2OUKA 5DI3B 1M7BA 4FMDF 5CB8A 3LDAA 3KXKA 4YDSA 3CZPA 3I73A 2J45A 3ZIAD 2ZM5A 3SR0A 1AS0A 1NKSA 1P60A 3EWSA 3T35A 4XSGA 1NVVR 3SC3A 4ZCIA 3AF4A 1UF9A 2CHQA 4URYR 5JCPA 1XNJA 1XPUA 2R65A 2VRWA 1DADA 3A1TA 3MFYA 3UMFA 3WP1B 1J99A 1IJEA 2PLRA 2J3EA 2PCJA 4KFUA 1SKQA 5A0FA 1FMJA 4ON9A 3NTUA 4Q9LA 5JWRA 5FI0B 4GOJA 2PEZA 1EXMA 4Z51A 2FFAA 1E2FA 1VHLA 3W9YA 5HCIA 1KIMA 3UMSA 1DG3A 3QE0A 4MQBA 2VHJA 1RRPA 1NSFA 3ND9A 1E2KA 2ZANA 2ZJ5A 1G64A 1TF7A 2O5VA 4L9WA 1TQ2A 1AA9A 1U9IA 2VBCA 4CVNA 2AHOA 3LO5A 5FFMA 3LRPA 5HTKA 3FVQA 3V9PA 2FNAA 4R2HA 3EZ2A 4IHQA 1XBTA 4OI1A 1I2MA 2QMOA 2GWHA 2DFLA 5FPHA 1ZD9A 2YOFA 3ZVMA 2WWXA 4O2LA 3ZYCA 1E2GA 2HCBA 2F1HA 4A36A 1AKEA 2EW1A 4M53A 1PJRA 2EWWA 4V0OA 4GP7A 4TLAA 1JB1A 1ESNA 1ZRHA 4OHWA 4R2IA 4RCYA 4US1R 3ZS8A 1KOFA 4LI0A 4LYAA 3U3OA 2PX3A 5E3HA 4P4SB 4JKIA 3A8TA 2IHBA 3I5XA 3CWQA
chains in the Genus database with same CATH superfamily
3CFYA 3R7DA 4Q3BA 1XK6A 3O92A 1I0LA 4AJIA 2PT7A 3KD2A 3DTVB 1IBLB 1T35A 1U0JA 1U3DA 2Y3IA 1JZSA 1NJSA 4YHBA 4LX0A 4G5SA 4J4TA 3UH0A 4KGDA 2C31A 1SD1A 2ACVA 4HX9A 3T3IA 2NNWB 4DZTA 3VDXA 5JSYA 1OX6A 2EQ5A 4S1NA 2E48A 3DAFA 1LWOA 1IBKB 2Q3FA 4WW0A 3TIFA 3MB8A 4PHCA 1NAIA 5JQGB 1QWSA 2V1XA 1FDTA 1KNQA 1U7UA 2B9EA 2PGNA 2VA8A 1PBTA 3IR7A 1OX5A 1U90A 4K88A 5LQSA 1FP1D 3GQBA 4IOKA 2EJUA 5B2FA 1W76A 2FK8A 1G8GA 2Y77A 4U02A 2O6LA 1ZAKA 1P31A 2UUBB 3DDSA 3WGNA 3EXEB 1W0CA 2R8BA 3KTOA 4B2LA 821PA 5DM0A 5K3EA 4JU9A 3E5NA 2R6AA 3PDCA 3SIRA 3T0GA 1Z4IA 2GMWA 2VDNB 1NRIA 3HRIA 2LCQA 3C6ZA 1NZJA 1QV6A 3UW1A 1BXRB 4A2CA 1Q44A 3FBTA 3EUWA 4U7TB 2F59A 3ABZA 3S2YA 3PHCA 3GA7A 1OAOC 1ODIA 1P62B 3DVRX 5FTJA 1G21E 4C04A 4V1CB 2C9ZA 1I3NA 3MOGA 3SFVA 2RGUA 1CUEA 2B4YA 1XVLA 2DH6A 2ZRFA 2A35A 3EIEA 3A6HA 4AXBA 4INJA 3AM5A 4PEVA 4RTKA 2UDPA 1ZJZA 4R2KA 1NXOA 1L7DA 4GXTA 4UBLA 3ID6C 1UM9B 3TW6A 1HFEL 3FB1A 1QUFA 5DNWA 4AP5A 3DEZA 2ATIA 2FZVA 4CQLA 4AFNA 3I09A 1JX6A 5L9AA 3UW3A 4LBYA 1GPUA 2Q9UA 1R0LA 4UU7A 5M3BA 3V1TC 3X1JA 4CI9A 4E14A 4FCTA 5LLDA 3E9EA 2F8SA 2DWOA 2PNFA 2WICA 4MV0A 1BEUB 1NQOA 1JSLA 1YR2A 4TV9F 2ZSHA 2R0QC 3ZVNA 3GLGA 1QIDA 2WIAA 2VXYA 3OOYA 5ED0A 5JSKA 1F2DA 3A4VA 4XLZA 2D1TA 3WAKA 2DLDA 4RMGA 1Z0SA 2IIPA 4OXXA 3HLTA 3L92A 1LSSA 1OZ0A 1TB4A 2F2TA 5HA5A 3IQHX 1YE5A 4BRWA 1TIPA 3EEOA 3K9NA 1XEFA 2IZ7A 3WIEA 4N0PA 5FH9A 4O8ZA 2QVZX 3VYWA 2PT5A 4BRZA 1KORA 2BELA 2PL1A 1JHRA 2BSXA 3OQPA 2Q4OA 4Z0NA 3DEJA 2UZ0A 2Y67A 3L8EA 3T41A 3OOSA 3VR1A 1EK2A 1FNCA 2HSEA 3BZWA 3M82A 4TKLA 3OCJA 1L1FA 4WACA 3RH0A 3LUPA 4CL2A 3M6UA 1F8FA 4MR8B 4P53A 4X8LA 1DTWA 2AKAB 3SIPA 2XZDA 4B6EA 4EPYA 1R8JA 2VK8A 3JSAA 2AC4A 1JR6A 4BAUA 2BGTA 3CO0S 5HDBB 4BO7A 3Q1LA 3P5BA 2IOFK 3CEJA 5EGSA 4YVFA 3UUGA 1FDUA 3ZUPA 1Y34E 5K6AA 2R1ZA 4O63O 1C4WA 3NIFB 1G5HA 3PHJA 2VF2A 3VPFA 2Q29A 2C7BA 1ONOA 3MTDA 5EHNA 2C0PA 5DEOA 5FQOA 1QMGA 2ORVA 4AG5A 1U7OA 1TZKA 1PFKA 2OK8A 2ZS8A 2ZU0C 2NSJA 2OY0A 3AEQA 5K3FA 3DBVO 5T4EA 5BSFA 4Y0VA 1POWA 4HZGA 2FMKA 4NULA 5FWYB 4F8JA 4JLOA 3SYMA 3IP6A 2YBEA 2ZK7A 4XH9B 3U26A 3H5RA 1UM8A 4LRSB 4B3SB 1XVUA 2B8TA 1NQVA 4C7MA 1HPLA 4LCBA 4LQLA 3FMIA 4AMGA 5A6SB 1EX6A 1T10A 1C4OA 3T4EA 1WVIA 5G41A 4EGFA 2QORA 2WF5A 3V4FA 1WTCA 1BD4A 1E4VA 2FGKA 2W2QA 4LF9B 1JL3A 2I8LA 4B47A 3OLCX 5DWQA 3VJMA 4EZBA 1U0EA 3PJRA 3GAFA 5LR6A 1K3UB 5CBKA 3LPAA 4IUCS 3SHQA 2YYAA 3GNQA 4DCCA 4YRBA 4EJ2A 5GJBA 1KAMA 1XEXB 1AGPA 3H5IA 4JP1A 3T3GA 2Y68A 4YT4A 1JIQA 4H59A 1Y1KE 4P3YA 2G0TA 3NUGA 5ALKA 1QQ6A 3DLTA 4YMVA 4LE0A 2G7MC 1CF9A 1KAEA 1WDMA 3LRXA 4OIFA 1SR8A 5B2EA 3PUZA 2PUAA 4E94A 1O6ZA 3KD3A 1B43A 4JFAA 3HJGA 3QI7A 3JATB 2QJTA 1W2HA 1BMDA 4P3PA 2JFVA 2NVWA 4P93A 5LUAA 3GRCA 3EVEA 1G4AE 4ZVOA 1M1YA 1I6KA 1P77A 3IQGX 3TMAA 1DG1G 2XB4A 2PS9A 5SV2A 2GN2A 5IC5A 1G4HA 1UKBA 1OROA 1P4GA 3VR6H 2ZYUX 2YWEA 1HDYA 1Y3IA 3HBFA 4PZYA 2BEKA 1V43A 2GVNA 1Y7IA 3LUKA 3CSSA 2AOTB 1HWYA 1SOMA 3NU1A 1GT91 3OPXA 3ZK8A 1CJBA 1XSEA 3KQVA 4LKRA 3OT5A 2CXQA 5SY6A 1M34A 2DT8A 2V7PA 3CEHA 3VU3A 2DTEA 4BX2A 5A4KA 3R3SA 2PZMA 3AESA 1HC7A 1LSUA 2I6GA 2M1ZA 4XWYA 4B3HA 4D82A 4L5YA 1OLUA 5C35A 3PL5A 1TAHA 2B1QA 1A5AB 3EMDA 3KDPA 2CXTA 2YFQA 1K68A 1CS4C 5EP3A 2XUZA 3GUHA 3IUPA 1NXVA 4GOOD 4ALIA 4H7JA 3F4LA 1QAOA 2ACWA 3REFA 1LF0A 2WM3A 1KFKB 3ORYA 5J2UB 4W5OA 1HYQA 1JAHA 4HBZA 1H3EA 5AM1A 2OC9A 3IPRA 3LBAA 1GR1A 2O1WA 3OCXA 3QMPA 5JWHA 2BZGA 3WK5A 2YN2A 3P2OA 3LUDA 1NXSA 2ZRKA 3ESAA 3M6XA 1ADYA 4ZEOA 3S1AA 3I9OA 4JN6B 3IE2A 5E3IA 3SXUA 1APBA 3OH8A 3VR3A 3RWMB 1YXMA 2J6CA 2GJ9A 2COKA 2P4EA 3AIMA 2D7CA 4ILKA 3BDVA 4MW4A 1DAMA 3DTTA 3TKAA 4DCNA 2QMUA 4NS1A 3ZE7A 2PT6A 1XRLA 3HFSA 2RI0A 1YOBA 1J8MF 4S24A 4FBGA 3USCS 4ZCTA 4MCJA 3N5CA 1PW5A 2WFLB 3A37A 3UJHA 1NVEA 2ZIGA 4Q1FA 1JR2A 4KU4A 2W6OA 4FIDA 4C4OA 4KWIA 1P1RA 1SRQA 5IWCA 1V8FA 1RBQA 3AVXA 4J0IA 3VDRA 5BV1A 4KC0A 1JYEA 3DMPA 1XZMA 1VJ1A 4R0MA 4MDFA 5EG5A 3MK31 4D6XA 1RTTA 4PC3A 1A8HA 4UQLA 1AGRA 2OUIA 2ZE8A 1T1RA 3LS2A 2FW0A 4YRIA 2I8CA 1JPVA 2YOHA 2NTNA 3C3KA 3BULA 4JJFA 6REQA 4RH3A 1JEQB 3LXUX 2A33A 2XW6A 3BPSA 3RJ5A 3JARB 2LCIA 4M1QA 4NG4A 3C1UA 2J5RA 2J41A 3QM1A 5EJ5A 2J9FA 5E6UA 1S2GA 2BGLA 3LAWA 2FFJA 2NQ8A 3W9SA 3ZDQA 2XVZA 4EB6B 2B83A 4MLCA 1YB6A 1YQDA 4AY2A 1Z0UA 5DLYA 2C42A 5JNWA 3DR5A 1J0BA 1Y7TA 3BILA 2CUZA 3FAKA 2C77A 3H7AA 4N39A 2IH4A 2WR8A 1BIFA 1F4PA 3MBIA 4HSEA 3VBCA 3E0QA 5JQWA 4E4RA 4CQMB 5D1HA 4JVMA 1IN6A 3AZOA 1ZGAA 3K6RA 2GBGA 4V0RA 1X80A 4K81B 1ZM3A 2I4MA 4JJEA 2CJYA 3HJCA 3SQXA 1H8HA 4XDGA 4Y9DA 3P4XA 1YULA 1D5WA 2ZI7A 1OWMA 2ZTHA 1J2UA 3GT4A 1DO2A 1KSJA 1GNRA 5AM2A 4B76A 5JYBA 4F71A 3CRMA 3V8MA 3GIDA 3RRMA 5ERGB 2FW1A 2JI7A 2WWHA 3CLTD 2OKGA 4EHDA 2C3UA 4YJGA 1X7ZB 2AD1A 3GJ8A 5I47A 2GBLA 3CLUC 2QTVA 1T0HB 2XQJA 4L02A 1RM5A 2PX2A 4DDTA 5LJIA 4DR7B 2H2HA 5DN6D 2V6JA 1GKIA 4RGYA 3VR5H 5MFZA 2NO5A 3GMDA 3O91A 2HMVA 3DYVA 1HYHA 2HTEA 3C7DB 1P4SA 4EY6A 1PBNA 3AG5A 4MCHA 5HF6A 1U63A 2R48A 1PHRA 2OHXA 2BP7B 2XUPA 5AKGA 1JQ3A 4D8VA 5EJ8A 5ANRB 1NWHA 1AQLA 3LQFA 1OI7A 4NOLA 4R4JA 2GPAA 2OILA 4G86A 4FFMA 4QOFA 2Z2KA 3TZKA 5DEIA 4QPZA 4ATNA 1XU4A 2FVYA 3T7JA 3SHOA 5LNK6 3K3PA 2PUDA 6AT1A 5FAXA 4JV5B 2XDWA 3C3MA 1QDUA 4Q3OA 4ZOQI 4TTAA 3WWDA 4PSUA 5FOXA 1T5DX 4JBIA 3VU9B 3RTAA 3LV8A 2XECA 3V4OA 3RS8A 2JNWA 2B1JA 1G6Q1 1CQIA 2E18A 2HFJA 5BV8A 4KBYA 3UA3A 2A1UB 1VA4A 2EP8A 2HM7A 4G1FA 1Y0BA 3TTWA 2D74A 3JVEA 3Q40A 1KO5A 4G0VA 3GJ0A 3GCZA 4C87A 2ZOSA 4BQFA 4N01A 1UMDA 2XJ4A 1GNLA 3HGMA 3MB5A 1CHDA 3M1AA 3U3XA 4P4LA 1HDIA 2J46A 1GU0A 3NJ8A 3DAOA 3UK2A 2CNBA 2ETVA 4XVHA 2ZQYA 3L7YA 1Z06A 1W49A 4UTXA 2GPYA 4C6TA 5JJKA 1R15A 1PFYA 4F06A 2Y1FA 3BQ9A 4LV5B 1GUFA 3OE7D 2W42A 1XTUA 1MFPA 2JJMA 1X9IA 3HSKA 3ROGA 2H92A 4R5HA 3VH2A 2W2NA 3EZNA 2CL0X 1C7IA 3UQYS 4REMA 1SCUB 1ZM7A 3K7EA 3NO4A 2VPWA 4UE6A 4U7HA 2A1TS 2IP2A 3KZKA 5I3CA 3JZDA 4CM4B 3WS7A 5JJBA 3GT0A 4DLLA 3TJRA 4EG4A 4RVHA 2M2IA 2D5IA 4BZPA 4HVLA 1EFVA 4I8IA 1A2KC 1P6UA 2NUAB 1UT6A 1WA5A 1VPLA 2EX1A 2O2HA 2ZTLA 3BTOA 3HLKA 2ZCVA 1RABA 1MABA 3ZWAA 2P3SA 3I34X 3PSAA 3G9UA 2JIBA 2B5OA 1X77A 3Q0IA 4KQ1A 2FX2A 3ESDA 4KREA 1DV2A 4N03A 3LQKA 3PQ8A 4M9ZA 4AM8A 4COOA 3QF4A 5B1HA 2JZOA 2QUIA 3HYLA 1RZVA 4CODB 1EFRD 4NQZA 4I2VA 4URUR 4F2GA 2JI6A 2JGAA 4CCYB 3T7CA 2VH2A 1IH8A 2MYPA 3E5MA 1DKRA 4NMWA 4LDPA 3SSOA 2XT0A 4GI3A 1RE1A 2NO1A 3Q6NA 4FPXA 3O4RA 2G4LA 3DS8A 5LNK1 4NE9A 3UBMA 1XN1A 3E9MA 1DI0A 3BJEA 5HJ2A 3IP8A 2I54A 1E2JA 1PEYA 1TPZA 2R00C 3GBSA 3V9AA 2UXBB 4N49A 3K8ZA 1N8SA 3NHKA 1D0VA 3C4QA 4JYZA 3EEBA 1Y4ZA 3PYLA 5D6NA 3OQMA 3K5IA 1V3UA 4Y2RA 3EISA 2FRDC 4OLHA 4WNYA 2RH4A 4Z1MD 4ALKA 2F3QA 4Z3DA 3ROEA 4J1SA 4FINA 5KU1A 2X7JA 1BH6A 1XTQA 2W0SA 1IZ8A 1THZA 3F46A 2OZLA 1R4AA 1C9NA 3VTAA 3A05A 4LIPD 3B1WA 3W6UA 2Z9DA 4H6PA 3IEVA 1JG6A 4BMZA 2AIRA 1NMSA 3KVYA 5C1BA 5CCBA 3SICE 1B1AA 4QECA 5L45A 3IBCA 4YDQA 3DMYA 3VNAA 1V7CA 4EY7A 5HPYB 1TJ4A 1IUOA 3STWA 1DEAA 3R9WA 3VGJA 4V3BA 1M5RA 2FOXA 2H5IA 2TMKA 3R3ZA 5EKXA 3TBKA 4LHWA 4B6PA 1VB3A 2BN4A 3MLEA 1U7XA 4JK3A 2CNLA 3K53A 4HG2A 2KX7A 2QX4A 2B36A 4CW7A 5BN3B 4TQ9A 4EPRA 2CDAA 1W2WB 1NQ5A 2IY9A 4O3FA 4XB2A 1L5HA 1G59A 5D85A 1ZA1A 3F5DA 3CUKA 5DYYA 4U2FA 5TB5A 3T7EA 4A8JC 5C53B 2I62A 3T4PA 3I0MA 4F6RB 1X7XA 4V2UA 1T8RA 1VSQA 2V5UA 1AN9A 2FWPA 3IUSA 1ZICA 5ELMA 1B2LA 1ZMTA 2R66A 3G2LA 3Q15C 5LSAA 1T91A 1EB9A 3AUSA 3NYWA 4PHFA 3JRXA 4YP0A 5ELXA 2A88A 5ITZA 4QEDA 1ZRMA 2XWQA 3BMCB 2Z04A 4O4HA 1VP3A 2NVBA 2JLVA 1C0PA 1YAJA 2IPLA 3B48A 3AR9A 3QSGA 3IIKA 1W36D 5D3MB 3WWPA 3MA0A 3KE8A 3HPQA 3D4BA 2J0QA 3SIWA 1XDUA 5FCDA 1MIOB 1SURA 2P4HX 3W79A 3I2GA 4BO0A 3DFMA 1RM4A 4C07A 2B5WA 4OLFA 5FX2A 1UBGA 3ZNNA 4F3YA 1XZGA 3PI7A 1V8BA 4JYPA 2XE8A 3KB8A 4HWPA 2J6HA 3JSXA 5ICGA 3DA8A 1NPYA 3E1KA 1K1EA 1KY3A 4W5QA 1JQ5A 1P81A 5DTJA 2GXSA 4RF2A 4OEHA 1TIKA 3HU1A 3L0ZA 5DTRA 4MGYR 4TV8B 1ILEA 1NW8A 2VYVA 4KVFA 3LXRA 1RYEA 4QJ4A 4X97A 4M1EA 4YS6A 4NFHA 2WIFA 3EZ7A 3RJZA 1KA9H 2GSDA 2J5KA 2RK4A 3HNOA 3AL0C 2XR1A 2R00A 1R74A 3CR7A 4MRVA 3I6IA 5EKSA 5GGXA 3L0PA 3WADA 2DAPA 1RQNA 4ZPXA 2X0FA 3EPJA 3NEAA 1U5BB 3GN1A 2OORC 4CCAA 1R3UA 5KJ6A 1S2LA 4F97A 2J48A 5K3BA 3ZGOA 2IZ5A 2ZT7A 3E22B 1MO4A 4QGBA 4TN5A 1IXKA 3UT5A 2DOKA 2PRZA 4AECA 2WZDA 1V1JA 2LTAA 3GO4A 5EI5A 1KZ1A 1UP4A 5JC8A 1SKYE 2I34A 4XJVA 4U2DA 1NC3A 2E7ZA 5E9WA 2PGJA 3NHYA 1DCMA 1TT7A 3LTEA 3QUQA 4N7BA 4OD0A 3IKTA 3AI1A 2IEGA 4CIXA 4RD1A 3ABSB 1YBFA 2AUMA 1U7PA 2YZKA 2D00A 3O2JA 4HDSB 3SEQA 1BGXT 3QSYA 1UPFA 2W6CX 1E3WB 2FSPA 2AEMA 4MB0A 4UAJA 4YFVA 2ZXFA 1Z29A 1UDCA 3EA4A 1BVYF 4CF6A 1ORWA 1NM5C 2ENWA 1TE2A 5CDGA 1KYZA 2XRMA 3M1YA 1QHNA 1Z8HA 2NU7A 1C4KA 2P9HA 4ZICA 2X76A 4GL4A 4WERA 3TX2A 4A8JA 4M49A 5AUOB 4NPHA 3M6VA 3WK7A 4BFVA 1ML3A 1U7ZA 2OZVA 3IB3A 2H7VA 5EWLA 1TO2E 5BSUA 4NXNB 3KOMA 4AP6A 1GXSA 2QYSA 4D5GA 2FWNA 4PO1A 3TNDA 2WM2A 2A2ZA 4QATA 3SCZA 1HLGA 3GLRA 1M6WA 4G5OA 2D8AA 4GECA 2C95A 3EFBA 3HUUA 3SJBA 1TEVA 1YRAA 1NHWA 2RARA 3W1VA 2YY7A 1FSSA 3F9CA 4RHEA 3EZXA 3JPWA 1EDOA 2HGZA 1CK4A 2JAOA 2XKBA 1GLNA 2Q6LA 5BVGA 1QZUA 3L1HA 1LDEA 1GA6A 1JMVA 3PYXA 5AKLA 4WN9B 1EK6A 2BFAA 2H1HA 2P2ZA 3FDIA 1IHPA 2H85A 4D9HA 3ZGNA 5C7IO 3GIWA 1KMIY 2RGNC 3MINB 2ZB2A 4X6XA 5ALOA 4GI5A 3GFPA 4UDOA 3EPKA 1AQNA 1UJ6A 2Q2WA 1Z5WA 3ANLA 4K86A 4XSVA 1YI0A 1RKUA 3ETCA 4REOA 521PA 1IOWA 3UICA 4PBRA 1E7YA 1BW9A 1SUPA 2ECKA 1EVJA 1Q0PA 3F6SA 4DSTA 4DDWA 1M8GA 3KTFA 4RVSA 3FPHA 1V8PA 2Q6OA 2X2PA 1E79D 1GR0A 4CKZA 4KPUA 3DUWA 3GRZA 3DFUA 3FSRA 4CEIB 1Y1PA 2EFDB 3FCSB 2OORA 4MS3B 4QXOA 4B79A 1YB1A 2D59A 3O4FA 5TMDA 3G88A 4MV5A 4DXHA 1G19A 3CWCA 1QHXA 2AFHE 5E6RB 3D4NA 5C1IA 3T7AA 4NPCA 2XCLA 3E3AA 2Q3JA 3KYCB 3VPCA 4TMVA 3VR0A 3TZEA 1J22A 1L7MA 2DQSA 1IJFA 1PQUA 3HWX1 1XJCA 2FZWA 1WXFA 1VE1A 2EBWA 4DR2B 4X62B 4I9NA 3WNBA 1XDBA 2QS9A 2ZSDA 4D8UA 1A27A 5ITWA 3D6FA 1ZWLA 4F4DA 4IIHA 1E69A 4J29A 4TS9A 1NTOA 4FBMA 4L0DA 4MHOA 2G5GX 2PKQP 2VXBA 2AF4C 3AF1A 3LDFA 1IBRA 3FWYA 1D9XA 4RYDA 5LA6B 3FDJA 1EDDA 4IF6A 1YFZA 2G36A 1SCBA 2XT6A 2WYWA 4DABA 2TMDA 1NM5A 1K6EA 1SZCA 5CT8A 2J0UB 2OTCA 4D9GA 3A6DA 3JCZA 1JZTA 1E2EA 3FTNA 4N48A 4Q4HB 5J4VA 1E9DA 2NYRA 2CVPA 3EW7A 4IOJA 4TKUB 4KV7A 1AGYA 4PZZA 4RFSA 4C4AA 3OFSA 5NULA 4HNHA 4IAOA 3AM4A 1GPJA 3V7YA 2VHXA 5IJAA 3L7DA 2ABWA 2ATXA 3VO9A 1BHQ1 1XL1A 5AWFC 1HYGA 1TADA 4JI0B 1II8B 1N9GB 2QLNA 3EGXA 3OHMA 2BKUA 1U9CA 2H0AA 4AP9A 1Z7WA 2VT3A 3FBGA 1IHYA 1O95C 5FWNA 3DC2A 4BCBA 2P41A 3RBXA 3ABOB 3HXPA 4TYPA 3DKRA 2A30A 1QP4A 5JNRA 4CETA 5I7AA 2W6QA 3SKVA 4EPVA 1RJ9B 3I72A 2W6ID 3A6ZA 3DL2A 2PZKA 4FKBA 3AHDA 1DRWA 3KJIA 4TVOA 4ACAA 1JFFA 1Y82A 1MX1A 1G8SA 3LVBA 4ZVKA 3OCYA 1KPHA 3NCTA 3P9XA 2PWAA 4FYKA 4GWGA 4RD0A 4NARA 5TPWB 3ST7A 3ZKAA 1V8OA 2H6EA 3PE6A 1U1DA 5IVDA 1KH1A 4JI1B 1PVVA 2OECA 3E2IA 4PG7A 3KQPA 1RQPA 4CDNA 1N1DA 1KXZA 2H29A 2HWWA 2Q0QA 5IULC 4YJ2F 5A02A 1DKLA 1NQWA 4ZV9A 2ZR9A 2J8ZA 1LPNA 2C8VA 2CDRA 2Y6VA 3LPDA 3H9JA 4QO8A 5DM1A 1NGSA 2F3UA 3C4JA 4RF4A 5K3AA 2HCTA 4MI6A 1SG9A 4PO9A 3O8RA 4ZGGA 2GLUA 2IF0A 1A9QA 2OXCA 2RGXA 2WJGA 3BIXA 4W99A 2V54A 3HEMA 3I6MA 3EPPA 5AESA 2WPNA 1B93A 3G1UA 4FHZA 4MO2A 2XIJA 3ZZUA 4BV9A 1DVRA 3OPYI 1YJBA 2M6LA 1AK1A 4EA6A 4OL9A 1ZH6A 4DG5A 2HQBA 3HJBA 5FA6A 5JATA 2VTVA 1E1CB 4MRMA 1DJQA 5ESXA 3N2GB 1FFCA 2E87A 1LQ2A 5JOQA 3FSEA 2OK7A 3QUSA 4OHVA 2P4UA 3E9DA 2FPKA 3ISJA 5KMGB 1QPZA 3GRVA 2PWBA 5AFSA 2ONZA 4YJHA 3RS4A 4R1UA 2DKNA 2BR5A 2QD1A 1V35A 3H1AA 5KYUA 4DOMA 2CSUA 2HBZA 1ZGCA 4EF4A 1RS0A 4LQ4A 4FHGA 2NZYA 1K3TA 5G53C 5BNTA 3LLSA 4PG8A 3PC8C 1HZJA 1ZONA 2FPXA 3H19A 4C05A 4U4AA 2XB2A 3C4VA 2QUJA 3E9RA 3PRKE 1L4GA 1ZC4A 1VKHA 2FWBA 2HQOA 3FCEA 3QE4A 4W7IA 4NSNA 4B80A 2OGUA 1HF3A 1WU7A 4DMHA 3MUEA 5LKAA 3KTDA 1PSWA 5F4BA 1RLMA 4QJ5A 2B8EA 1M3SA 3H9QA 4KQ2A 5K20A 1TKRA 2A78A 4JBYA 2KBEA 1O58A 4QQRA 4P3KA 1O95A 1ZXLA 2ROQA 3AUFA 1FFAA 5A5VA 4AY5A 6NULA 2IHZA 4LZLA 4PAGA 2ZRBA 1S8OA 1XPRA 4C2TA 4MWSA 1RYZA 1FCJA 2ISQA 4DRXA 3BK7A 1RKXA 3Q98A 4IIUA 3U4QA 1QGZA 2ZFUA 4JLAA 1D07A 1DC5A 3RK1A 2QENA 4RA6A 4ZQFA 1RYMA 2GN1A 4FGSA 3VHRA 4EB8A 1LPAB 3PGMA 4EMTA 2GPJA 1KDYA 1TZBA 2P2SA 3HU2A 3L7OA 4JHXA 4MJXA 4NYIQ 4ZEWA 4RM3A 1WNFA 3M3DA 1E1RD 1NLUA 3G02A 2VQ6A 5DLEA 1YC5A 4A1FA 1GDTA 3RT1A 1QM5A 2D8MA 2I7VA 5AK6A 4OU5A 4URZR 5HFAA 4RK1A 3E5HA 1IFXA 1G8FA 4I9UA 3VQTA 4AW9A 1WCIB 5AK5A 3K9LA 1Z26A 3ZY2A 1F17A 1JECA 2YQZA 2ZB8A 1TXGA 2FAXA 4O1IA 5I4KA 3W5DA 4M1SA 4FMCF 4RKRA 3UFBA 2O7VA 1N2IA 1V5EA 2VUUA 5DSTA 1BDMA 2QTTA 4ER3A 5HR5A 5JV5A 4I2NA 2H3HA 1NSYA 3OZDA 4X8HA 3SI7A 3G5TA 1WQ4A 4YRJA 1CY1A 5COAA 3SBDA 1R4NB 3H1PA 3U31A 1VDZA 4PO3X 3IVMA 3PR2B 1S2OA 4R8VA 2FFQA 3UM9A 2WM9B 2NO0A 3L4SO 4CLDA 5SZIA 4YWHA 2NV2B 1QBGA 2BUCA 2WJVA 3IDOA 3GGOA 1U2PA 1GG5A 1UZLA 2JD1A 2OGZA 5EUCA 4AYWA 2YWGA 3SJCA 1NRWA 4EK9A 2JHCA 2VK4A 3LOPA 1TVEA 4D44A 4I3FA 3ED1A 5AVKA 1K5PA 2I87A 2NADA 1WWKA 3ESRA 4KRFA 5ENVA 4EG1A 4A6EA 2JAWA 1WMFA 1FP4B 1RM3A 3NTRA 4I4TA 1TA9A 4NCXA 3PL1A 3QPBA 1K5GA 3PC8A 2XYRA 3QWIA 4JU8A 4CYMA 1KKMA 5EXXA 3COSA 1ZOIA 3FHOA 5I4IA 4QXAA 5IC6A 1S2IA 5A2GA 2QL6A 3L79A 2V96A 1OPXA 3IJPA 4FILA 5H7XA 4KPGA 2H1VA 2AFIA 3BSSA 2D62A 1YCHA 2B9VA 5DT9A 2SBTA 4U2KA 4IDGA 4ZARA 2YRWA 4X64B 2FE4A 1NT4A 4ZZ3A 1XHFA 1U11A 1MOSA 1JHYA 3H18A 3W7AA 1U0RA 5DDIP 2NUBA 1V41E 2P69A 5IXYA 2O2DA 2BKEA 1E94E 2BWJA 4G2NA 1SCJA 5EKTA 3TOCA 1EXDA 4MS4B 4JWKA 2OM2A 1CQXA 2X5JO 4RZ3A 5F7XA 1A8IA 1UQTA 3RTGA 3O93A 4YJFB 3L5OA 1W5AA 4IDAA 4LZPA 1E4EA 3TXAA 4CR6A 1FDRA 3RTBA 1QFXA 3BT7A 1Z5OA 2QRGA 1U7TA 1VMDA 1PZNA 2PS0A 1YFJA 3H05A 1VCIA 1XRRA 4RFLA 3H8SA 2E49A 4LECA 5C32A 3ZWWA 4LGMA 4TX1A 1U98A 3PPYA 5G1NA 2YFYA 5HW0A 3GR6A 1PS0A 1NYQA 2IW3A 2O8FA 2RGCA 3AFNA 4M46A 1AURA 1TQ6A 1FJGB 1FP2A 2D1YA 3KAKA 1N2CE 4WVLA 1ID1A 1X1AA 2HF8A 2RK6A 3N0RA 5EP1A 4XUCA 5LUBA 1KO7A 1X38A 3ZD8A 3FI9A 4RD2A 3FSJX 4GLJA 1E32A 2PSDA 4OQFA 1SBIA 3TRIA 1GNTA 2HHLA 1D2RA 5LB4A 3OTGA 5KWEA 1XQWA 2ZYRA 5IUKC 4RACA 4ETIA 4MR9B 1SZJG 1PT5A 5ESRA 1QRAA 8LDHA 1JKJB 3R6DA 4RVGA 1CLUA 5IJ0B 4PZPA 1Z4JA 1R4ZA 1ULSA 5L3QA 5DXFA 2BSAA 1QIMA 2X8JB 4UUPA 3N8HA 3D2CA 5EINA 1RDFA 1NQXA 4QFMA 2WK1A 2F8LA 2O8NA 4OJYA 1W0KD 1T3HA 2WLSA 1ZG3A 1G21B 3E4CA 2IWHA 4DA6A 4HS9A 5JAIA 3KWJA 3VAAA 3BN3A 3A6GA 3V7UA 2ZB3A 5DYIA 4HXFB 3DSRA 2VQFB 2O2YA 1WUTA 5GONA 1QO0A 4RAQA 2Q1SA 5AM3A 1VBKA 2DR0A 4IIXA 2X6QA 4JXJA 1JG4A 2M6RA 1OV6A 3CW9A 1FLDA 3N1UA 3QQ5A 2P2NA 3JU3A 4FCWA 4RMJA 3RC8A 2WAYA 4Y3UA 3D9QX 2PO7A 1M1NB 3LDGA 3UOGA 3N05A 2Z6UA 1E59A 2PTGA 2ZBUA 4EGCB 3NC4A 3DHWC 5CMLA 1CJUC 1PJ2A 5AOAA 5J40A 4WZZA 2C5GA 3D3KA 3LYHA 4TT8A 4PYIA 3K6JA 4DN6A 4DMFA 3N70A 4NABA 3O4IA 1KK2A 1XMPA 2B3DA 3CE6A 3OU2A 5EHXA 1LK0A 1BFDA 2HNAA 1ZS9A 2IYOA 3C8MA 4NPAA 3RAPR 2JLXA 3W5AA 1W52X 4LF5B 4EP1A 1Z5ZA 3GX1A 3BC1A 4HDQB 3HP1A 3ZDZB 4DLZA 2CK3D 2FI1A 4IXNA 2CNNA 4D57A 5U4QA 1QONA 3IAS6 4NENA 4YAWA 4G23A 2H0RA 3B8HA 3I2HA 1V47A 1QK3A 3BJMA 4C03A 3U3KA 1E9SA 1Z4PX 4EI7A 4P7JA 3L4BC 2C7PA 4XRRA 2ZWVA 2CLDX 3OZIA 1C30A 4L51A 4GR4A 2O8VA 4AROA 4F1JA 3MBOA 3L1IA 2DETA 2RI6A 3TQOA 3BD9A 4DCTA 4OP3A 2XADA 4GVLA 3V4ZA 4EQZA 1QP7A 2A9OA 2BMAA 1KI2A 4OMUA 1Y42X 4UVGA 5HUHA 1JWAB 2V4MA 3I04A 2Z58A 3MQ4A 5G0UA 3H5WA 1I51A 1XDWA 1E8NA 2WAXA 2WFMA 5LBIA 3WBKA 1H2BA 5ADHA 2O2EA 4F84A 4QTZA 1C1XB 3F90A 3VKHA 2EKPA 1A69A 1EFUA 3S2FA 2YJTD 1K8XB 4B6OA 4B9AA 1UDXA 3ESYA 3AF0A 1HBJA 1ONSA 3QYJA 4PAOA 5EJEA 4IFBA 2X42A 4MUHA 4H7KA 4OQNA 3JQ9C 4A6DA 3VPGA 4MRAA 4XYEA 3SYLA 1YRQA 1YT5A 1ABBA 1E58A 1XXHE 5JZVA 3O5AA 1FTSA 1PGQA 1FSZA 4G09A 3UJAA 4B3TB 4WFJA 3LBNA 4KI0A 4K1XA 1GSAA 4JKYA 4UMDA 1TCAA 4DV3B 4ASUD 1C29B 1UFKA 4KP7A 4X7PA 1USGA 5K0CA 1RSZA 4IEEA 1ENYA 2MSCB 4KLZA 5ADVA 3BD7A 2R68A 1P5FA 3RFFA 1ZL0A 2Y8EA 2OCAA 2RG7A 3EXHC 3HVKA 5SZJA 1OYYA 1ZUNA 2XXJA 3FMOB 3EF1A 5BYJA 1U0BB 1TEXA 1S7CA 4R1NA 5J4HA 1ORIA 4FE7A 2VHTA 1CS0B 2QRZA 3NTOA 1RXIA 3HV0A 3MLAA 2D0DA 4XQGA 5DSXA 4EUKA 1BA3A 4X84A 4D1YA 2AYXA 3BGOS 1JI3A 3G0DA 1THTA 2PANA 1U3TA 4I55B 5D1NA 4D0GA 5IDWA 1W7AA 5M29A 1NWCA 3IS3A 3JX9A 5EMLA 5FA5A 1MHPA 4W9NC 1GZHB 3EBPA 1G7RA 1H1LB 3I62A 1SA0B 4UNPA 5B7QA 4WLEA 1M83A 3RQSA 3IAS1 4YHHB 2ZRJA 3ONFA 4GGOA 2AJBA 5AVWA 3ZPXA 5LOVF 1DQYA 1Z12A 3EDOA 5ICSA 2H5EA 3VOAA 4LY3A 2ODBA 3E3NA 3QY0A 3F9IA 1KK3A 2OB2A 3LGXA 5CRIA 4AF8A 4R41A 2YV2A 1IVSA 3MCWA 4QPPA 4IQ8A 1XJ5A 4POAA 5FNVB 3U4DA 2O7NA 1AHIA 1IMOA 4KE7A 1N75A 2BDUA 3LQ2A 5DK6A 4DBLC 4C7OB 1W47A 4QWWA 3RC9A 4BZWA 2H1FA 4Z3OA 5BSGA 2ZWPA 3OJWA 2P0EA 3L82B 2QKYA 2R11A 3BGDA 4QG7A 3KQHA 1PR0A 2HOQA 3QEBZ 1J9EA 4CF7A 1EFDN 2EGHA 4UBNA 3R7WB 5KNBH 5B6PA 1HQKA 4MDYA 2GF9A 2BUBA 2WIBA 5KNLA 5AVVA 5JDIA 3LKVA 4Y6GB 3VC3A 1TYAE 2APJA 1H66A 2FEKA 3CLTC 3A6FA 5EXEA 2NNLD 3MMZA 3DV2A 4P54A 2R44A 3DP7A 3U1VA 3FFAA 3I01A 3HJTA 3LPNA 4RETA 1S96A 2OXEA 2SCUA 3PWTA 3R9XB 1NNLA 3O9MA 4I5FA 1QX4A 3PD1A 4O4JB 1JQDA 1R9GA 3CONA 5MHTA 2BMWA 3V7NA 1T3GA 1XQYA 2ID4A 1AG9A 2ZUSA 4BRSA 3ZHXA 3W5JA 5CJJA 5BVHB 3L8MA 2BFFB 4AMVA 1S1CA 5CA0A 1H6DA 3IT3A 1JIXA 3HKBA 3FDZA 3KDSE 3FBWA 1U1EA 4L8FA 5K2MA 3SGLA 3STUA 1SRRA 7AT1A 4CRWB 3C1TA 3EXHA 2OCXA 4IIYA 5JALA 1UZAA 4KXXA 2X4LA 4COKA 1MRNA 3STYA 5TQ0B 1QH1A 1QYRA 1X86B 2GCGA 5ESDA 1L3BA 3EGIA 5CDFE 5JZMA 4YCNA 2YZGA 1M73E 1P75A 2O48X 3NAQA 1H6CA 1ZGBA 1I2DA 1TZJA 2DRIA 2OO5C 4EFLA 4XYLA 5AICA 9GPBA 1Y3AA 3S4YA 4AO6A 2C1XA 3S2UA 1ZM2A 3LQYA 3YASA 2G28A 4EFNA 5CVDA 1NF2A 1BHO1 1F2UB 1GL7A 1V4NA 3HYSA 2BZ1A 3V48A 4R54A 1GQYA 1DBRA 3NGXA 5KTTA 1KBZA 1H0KA 2Q49A 2N9UA 1IEWA 4IOLA 1E6KA 2HADA 4BMVA 2C7RA 4G0YA 4NU5A 4LYHA 3TAUA 5KKAA 1Q21A 5K8TA 1NLFA 3LGSA 1S9DA 2IV7A 1ZGZA 4JEIA 1C9MA 1H2YA 2WD7B 3D2BA 5JVDA 2KJQA 1Z62A 4BIIA 1XD2A 2PH1A 4LJ8A 3RCBA 1WHSB 1F2VA 3OFVA 3W2EA 2VCHA 3JQAB 1QYVA 1X92A 1GQ2A 5KNBA 5A62A 4DSOA 2IH5A 1U5CA 3AO0B 5G0TA 2Z3WA 2GN4A 5KINB 1CY0A 3RVQA 1JG1A 2O8CB 3QVGA 4MWTA 3VPSA 1GD1O 2JI4A 2QR3A 3E27A 4H3KB 4U3JA 5CYPA 3SHFA 4DEXA 1TF5A 3R76A 1OLOA 2ANCA 5BSEA 1E1KA 4FGUA 1Z4NA