1N6NA

Crystal structure of human rab5a a30r mutant complex with gppnhp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
167
structure length
167
Chain Sequence
GNKICQFKLVLLGESRVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Crystal Structures of Human Rab5a and Five Mutants with Substitutions in the Catalytically Important Phosphate-Binding Loop
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Ras-related protein Rab-5A
total genus 56
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2002-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1n6nA00
2ZYWX 2QAGA 2V8OA 3H2YA 5SZJA 3RC3A 3T5GA 3W8RA 1DEKA 3BAFA 4B76A 4BZPA 5KPJA 1UM8A 1XPUA 1X1RA 1TU3A 5BN3A 4MKIA 4D82A 3RS2A 5ELXA 3BS4A 3IPXA 1UKZA 1TMKA 5FI1B 1XDBA 1K5DA 1OYWA 4RZ3A 3KX2A 1NLZA 5G3YA 1SXJE 1UPTA 4Q02A 4JKYA 4LPKA 3TMKA 5JWRA 3JVVA 3P4YA 4LPSA 5GVRA 2X1VA 4YDSA 2HUPA 1YZLA 1IJEA 3D3QA 2HYIC 1BO6A 2ZU0C 3K0AA 1GDDA 1CIPA 3X1WA 3U3JA 2B92A 2QM8A 4LC1A 1GL6A 4OI2A 5CDFE 2G0NA 1A7JA 3B7GA 1TF2A 3SJCA 2AN9A 4V0OA 3A1WA 3QUSA 5P21A 4ACAA 2RMKA 2CVFA 1AQUA 1KI2A 1RRFA 4JL6A 1RIFA 2HCBA 1QHHA 3ZD6A 3UG7A 2ZR0A 5LB2A 1UF9A 4BRWA 3NDBB 4YC7A 3ZVMA 2H16A 5DISB 4MDFA 4PTLA 5CIWA 5FUXA 3GLIB 1X6VA 4QXAA 4UJ3A 3DEFA 4DCSA 2RGNA 2ATVA 3RSLA 3UMSA 4B3BA 2ATXA 4B6EA 5J5CA 2XOKA 4I81A 3AKEA 2ZJ2A 4YMVA 1DTSA 1ZNZA 4YXWA 1G3RA 4POAA 4GOXA 3A4NA 4FCTA 3NWJA 4TL8A 3LBHA 1NRJB 2QROA 2P5SA 2XAUA 3MG9A 3GD7A 5E7IA 3R7WA 1IN6A 1OFUX 1DS6A 2ORIA 2RAPA 1R8SA 3FFBA 4MRVA 1BKDR 2WWIA 3SI7A 3QBTA 1UEJA 3K0AB 3B1XA 2OLJA 4N3NA 5E95A 2ZI9A 4G01B 2KJQA 4PC1A 4Q5IA 2IXGA 1Y63A 3NIBA 3QXCA 4GRAA 4Q48A 4BFVA 3HDTA 3V9PA 1QF9A 4Z8XA 3KKPA 2PL3A 2RGAA 2IHBA 3SBEA 1T0HB 1UADA 4DDVA 1QHSA 4C2UA 4MYTA 4DB4A 2IYYA 5GJWC 4QGFA 4TL9A 4EUNA 3PCRB 5EP3A 2CMKA 2BV3A 4FMDB 4LJ8A 1W0KD 1KI4A 4E22A 1AM4D 1IONA 1KNXA 4ZI3A 2FZ4A 2FOLA 2AXPA 4TWZA 2R2AA 2GCOA 4Q4LA 4Z1MD 2PZEA 3PXGA 4BLRA 3T34A 1LW7A 2L0XA 1IN4A 1KO1A 1SQ5A 4Z54A 4M9XA 1KMQA 5IT5A 4BE7B 1EFHA 1D2EA 1IAQA 1ZD9A 5JJIA 2NMVA 4UXIA 2GK6A 5AR1A 1RYHA 5TXGA 3WMFA 4Q4AA 4TLAA 3JVUA 1ZM4A 3TIFA 1EWQA 1W46A 1J8YF 4ITRC 2UZ3A 4ZIRB 2PLRA 2ZRHA 2J41A 4IKEA 1N5JA 3PEYA 3AP2A 4LV8B 3OIUA 1F2TA 1E79A 1NN3A 2F1JA 5DYGA 3KTAA 4FMBB 1W36C 2LKDA 4TLDA 3BXZA 4LHZA 1D2NA 1GNRA 2OSBA 3GLHE 4LUCA 2BM0A 3X1ZA 4PC6A 5L3QB 2QMEA 3G82C 3LA6A 3SOPA 1N5LA 2F1HA 4DT1B 5CM9C 2QTHA 2ZSDA 4IVQA 1Z6AA 1TU4A 2GTPA 2YHSA 3GJXC 3U7HB 2QORA 1BS1A 2OHFA 1XMSA 2ZRAA 1T5LA 1KY2A 2E1RA 4M1WA 1FUKA 1E1QD 3IIJA 3RABA 3I5YA 5GVSA 1CKEA 4S2EA 1XXHB 1QG2A 3U7GA 2JLXA 1NN0A 1CLUA 1QRAA 4ERNA 1E96A 2YOGA 5KUTA 2VHTA 1ODFA 5KOYA 3THWA 3CZPA 3HU1A 1E0KA 3A4LA 5EP2A 1EGAA 1ZAKA 3QXHA 4JLJA 3X1XA 2OFXA 1GSIA 1OW3B 4FMCF 3FFAA 2Q6TA 2RGNC 4BASA 3TLXA 1KK3A 5JCZA 5FOVA 1P2SA 2C95A 3HR8A 1NY5A 4LY6A 3OEHA 4CEJA 3TAUA 2V6IA 2A7QA 4NCKA 3EX7C 4N0EA 1XD2B 2QZ4A 2RGXA 3Q9LA 5C4GB 4BLOA 3UMFA 3AP3A 5FBRB 3IHWA 2CL6X 4MGKR 3SQXA 4KXFB 4H9GA 4HDOB 3FDIA 1W0JA 4GL2A 4QG7A 1BMFD 2ZYTX 2H17A 1GITA 2QT1A 4TT3A 5BYJA 1G7CA 3P26A 4NE2A 2DB3A 1HH4A 3QKUA 4IEEA 5SZIA 2O8FA 3KXIA 2WWFA 4XJXA 2KE5A 3CW2A 1J90A 2D3WA 3SHFA 3RHFA 1VYTA 2IL1A 1S0UA 1DVRA 1KGDA 1XJQA 2NZJA 3CH5A 4F92B 2J1LA 4NDZA 4TYQA 1I4LD 4YMTA 3BERA 1XXHA 2X19A 3A1UA 4DKXA 1Z28A 4CVNA 1FFHA 2ZSFA 1YE8A 5JJLA 1GM5A 4BUJA 4FIDA 5FOTA 1WMSA 1UBGA 2A5DA 2YJTD 3D6TB 1RZ3A 3NC0C 4R2HA 2FDCA 1U90A 3HYRA 4TMTA 4NHOA 2WJJA 2OXRA 5DYIA 5EE9A 1KI8A 4OQNA 3T1OA 2HLDA 5DE3A 4AD8A 3QG5A 5HR5A 3IBYA 4MGIR 4RSGA 2OBMA 3TBKA 2GJAA 2CXXA 4QHYA 1W49A 4JLKA 2JCSA 3E2IA 1YQTA 1X3SA 2A5FA 1MRNA 2GXUA 2XTMA 4UNNA 5CM8B 1RYFA 5EZ5A 4EKDA 4HLUC 2JGNA 1LY1A 2FJUA 1OPXA 2GAOA 1OXTA 3GFPA 1DAMA 4QJ3A 3N2EA 3VX4A 3KKQA 1G3UA 4NL4H 1YZUA 2HLDD 1OJLA 4LV5B 4OK3A 4JBYA 3T1VA 1KDTA 2BJVA 2VRWA 2O8FB 2FA9A 1XXHE 3BE4A 4B34A 5HCIA 5TMPA 2ZI5A 3VNUA 2J46A 1GKUB 1P75A 2A5JA 4TQ9A 3IKJA 3RS3A 1W36B 1XPRA 5DI3B 1E9EA 4N0DA 5B30A 1RRGA 1N0UA 4QBGB 1JNYA 4UXJA 2OV2A 2FEMA 2OCBA 4V0MA 1M6NA 2BVNA 1U9IC 1WDTA 1IHUA 2AX4A 2W6JA 3IBGA 2J0SA 2FG5A 2DWOA 4EFMA 2PT7A 4LBYA 3NH6A 4Q4HB 2XZLA 1ZMXA 3LLUA 1E2JA 3FHOA 3PQCA 4S35A 4BFSA 3NDPA 2KBFA 3B1ZA 4DLUA 4B2LA 1OKKD 2ZEJA 1AGRA 1TUIA 3CLVA 2QAGB 3KB1A 1SKQA 4PQRA 5D3MA 4AG5A 1YJ5A 2OUKA 2OLKA 4OJQA 2R6GA 4LOAA 4LSGA 3FMFA 5L8VA 1DAIA 1E32A 3NEJA 3MGCA 2AD5A 3CPJB 1E2LA 1NP6A 2BKUA 4M0LA 4M8NE 3PJRA 1C1YA 1R5BA 3LXXA 2FMXA 3GJ5A 4TLBA 1FW6A 4ZPXA 1DAFA 1HT1E 2WJGA 1GUAA 2Z0MA 2QMHA 4MA4A 4PZYA 3FYHA 2BCGY 2QPOA 5KPDA 4TYWA 3AF3A 2XXAA 4GPTA 3THYB 1G16A 5AJZA 2RGCA 2O5VA 4BZQA 4EJSC 4HYYA 1ZYUA 2FH5B 4B3DA 3W6NA 3DM5A 2AR7A 2CK3D 1X8KA 3FTQA 1YU9A 2ODNA 2QI9C 3OAAD 5TDHA 5CJ2A 1VMAA 3DM9B 2BWJA 2FU5C 1RFLA 4KFRA 3RVBA 2DPXA 5E3HA 4D26A 1RW4A 5JRJA 2FGKA 1T3LA 1Z0AA 4LHXA 4RZUA 3ZZTA 3NBZC 1QHIA 5FTKA 1VTKA 2GETA 3KKOA 4L9SA 1SZPA 3PEWA 1F2TB 4TMXA 4O3MA 2YWGA 2C9CA 2OCYC 1IY0A 2XTZA 4I1SA 1XBTA 2FX3A 4Q7JB 421PA 2QE7A 3CM0A 4LJ4A 2NZ8A 4Q7LA 1KMHB 4IDQA 1G7SA 221PA 4HZUB 1A1VA 3EZFA 1ZM9A 1GZSA 2ZRBA 1OF1A 1OFIA 3D8BA 1M7GA 1TQ4A 4KO8A 4PHFA 2OBLA 3U5ZB 4ARZA 1E2GA 3SHWA 4DCTA 3AB3A 4EFNA 2H57A 2GJ8A 3PUZA 4G5QA 3ZD7A 1NF3A 1OFTA 1KSFX 2C9OA 2OESA 3Q72A 4GOJA 4M2LA 3UATA 1ZNXA 1AKYA 1CR4A 2G83A 3QPWA 4BRUA 4HLCA 5TV2A 2OZEA 3LVQE 1U99A 5TB5A 1PUIA 4QGHA 3KL4A 4C2TA 2VHUA 3AVYA 3BH6A 2R6AA 4DWJA 3NBYC 1E2EA 4A8JB 3NXSA 1YVDA 1VIAA 4HLUA 4BLQA 3E5HA 1Q1QA 4NH0A 4NTZA 1Z07A 1XTIA 4LCBA 4KSCA 4Y0AA 1DAGA 3GJ6A 5C2JB 3T35A 1ZCBA 4TLEA 3M6AA 2F43B 5JWHA 5FPHA 1GP2A 3RRNA 3QI2A 1KSGA 2JLSA 2N1BA 3K9LA 1G8GA 1WRBA 2MMCA 2X2EA 1I2DA 5LDDC 1KAGA 1X8LA 2ZJBA 3I73A 1KMHA 4A8JC 1U9IA 2W6IA 4HAWA 4G3XA 5FUWA 5KNBA 1YR6A 1KI9A 1SULA 2J3EA 5GJVC 3LVRE 1T5IA 4B3GA 3LXRA 1Z22A 4DCNA 1ZD1A 3ZVLA 2W2TA 1HEIA 4XD7A 5JSZB 1M2OB 2Q3HA 2PLFA 4ASUA 3ECCA 2BMJA 2Q3FA 4MQBA 3ONWA 4B3CA 3U7EB 2GEUA 2QE7D 1IXRC 4W5JA 1XMIA 2QAJA 3IHLA 4UQOA 2ORWA 4HATA 1DADA 1KNQA 3U3RA 1KO7A 1XCGB 3L0SA 1VG0B 1Z0JA 2D7DA 3AF4A 3B13B 5J4LA 3WNBA 2DBYA 2IS6A 4C7OB 1S1MA 2R44A 4L4UA 1CRQA 2W2VA 1DE0A 2JATA 2H8KA 4M22A 4TMWA 2DCUA 2F43A 1LFDB 4ESHA 1E1RD 5E7MA 2A2ZA 1PLJA 4O0MA 1CJMA 2ANBA 1RPZA 1T91A 3K9NA 4NU0A 5L3SB 2ANCA 5KSZA 1CJTC 3S1AB 3CRMA 4LJAA 2IYVA 1G6HA 4AKHA 4CEIA 3KDSE 1XRJA 3K0CC 2VP9A 5FPSA 3BJIC 4TZ6A 1W44A 2BHRA 3IDQA 4LJ6A 1EESA 4C0AC 1E4YA 2VPPA 3Q7QA 3F5FA 4KU4A 1YR7A 4HZUA 4B6FA 1GOTA 2V7QA 3THWB 2QG6A 2AFHE 2UVQA 3UK6A 2EWWA 1VYVA 3BRWD 3CIOA 4DSUA 3ZVNA 2QPAA 1KJWA 4CIDA 5KNCA 2Q9CA 2IA5A 4QRHA 4ESVA 4F38A 2P0EA 3W3AA 1PVOA 4RD1A 4IDPA 2ZS9A 3NBXX 2GDJA 1R6BX 3NBFA 1US8A 2CBZA 3MAAC 4F4CA 3MUFA 4EPVA 3P1JA 4DCVA 3LFUA 4NKRA 4JLMA 5FTMA 2KWIA 1KI3A 1N6IA 3CNOA 2BC9A 5EUMA 1KSHA 2GBLC 3KQKA 1XCPA 2QMOA 2ZRDA 4PFSA 4JLNA 4HAYA 5KNDA 1Z0FA 1ZJ6A 4C7OA 3LQQA 1KDOA 4F93B 3L0IB 1TF7A 4W7SA 3RRZA 2KI5A 121PA 5CYOA 5CK5A 1SHZA 4NYMQ 1FTSA 1XP8A 1XU4A 3AGQA 2W0SA 4PXAA 1YRBA 1COWA 1U8ZA 5FTJA 4CYMA 3CNNA 2JLRA 4IVRA 4B3XA 2F1IA 4DT1A 1VCNA 5JEEA 1MO5A 4OQFA 4B32A 4Q9HA 1RC8A 1HY3A 3JZAA 1US8B 3QPUA 4QGGA 5FBWB 3CBQA 4MUBA 2WSSA 2EFCB 3R7WB 1JQLB 1VECA 3B85A 4DJTA 5UKDA 2YINC 2AWNA 1MOZA 2BKEA 3GLGA 4FN5A 1GKYA 2BMFA 5H68A 3U3OA 1HE1C 4OYHA 2WBLC 4CDGA 1MO4A 5JCPA 5IHPA 3RS7A 3VKGA 2XSZA 1D9ZA 4FCVA 2O8CB 2GXSA 3QE0A 4XD7D 1ZNYA 1QBKC 1FZQA 2QL6A 2ZI4A 3C14C 5FPYA 5FL3A 4RZ2A 2IS2A 4AYXA 3KQHA 3SN6A 4DLSA 4RKEA 1GL7A 1XTSA 5DHFA 4J0QA 3TQCA 1EX7A 4P33A 1T8UA 3W6OA 4DRZA 4TLCA 2ZROA 1KKMA 4JJKA 5IF9A 1W4RA 4C0SA 4NYJQ 5EZ6B 4EIWA 1G291 1W7AA 5F9FA 3TJZA 2BDTA 4EPRA 1DAKA 3FHCB 4DHEA 1CR1A 1Q3TA 3KKNA 3UANA 1G3QA 3MWLA 4DDWA 2QRZA 4HB0A 1QHXA 1NN5A 4WIAA 4FCWA 3DL0A 1N0WA 3KZ1E 4RCYA 3SJZA 3A36A 3WYAA 4U5XA 1KK0A 4UNPA 2CL0X 2J87A 5L3SA 2Z4RA 1WBBA 2GZAA 2VIIA 3CX7A 3I1FA 1E94E 1S3GA 2ZVPX 721PA 4JLPA 1CEEA 1CF4A 3K09A 4PC2A 1W0JD 1G20E 1FX0A 4ZKEA 1SVSA 1FL9A 4D4KA 3DPUA 2QAGC 4X8MA 4OL0A 5CLLA 1JR6A 1N6HA 2OXCA 1XEWY 2XNDD 2XTNA 4C9BA 1P2UA 3KTAB 2IYSA 4AKIA 2AK2A 4UJ5A 1ZM2A 4Q1BA 1OH8A 2QSZA 2ONJA 4XOIA 3AF0A 1GKIA 3DMDA 1TAGA 2C2HA 3T1QA 4B75A 4BFUA 1S3SA 1T8TA 1EWRA 2F7SA 1Q3HA 2ZRMA 2FFBA 4Q4AB 1NL3A 5FOXA 5AUPB 5F3WB 1UDWA 1IXZA 2F55A 4YMUA 1S96A 2WJYA 1F48A 3EARA 3DZDA 3RDPA 3X2SA 2ZUBA 5B57C 4PPNA 3N70A 1G5TA 2ZAMA 1OB5A 2DHRA 3LLMA 3NTUA 4Q4JB 2GRJA 4AURA 1IN7A 2ODWA 2W00A 2ZRIA 4IVPA 1E9FA 1Y3AA 1IN5A 1TEVA 5JS8A 4CF7A 2B21A 1TX4B 2J0UB 4JZKA 4ZCIA 1EX6A 4ABYA 4CEHB 4M53A 3ADDA 2FPKA 1F2UB 3FMPB 3MCAA 5GJCA 1FQKA 2G3YA 1KYIA 5C1BA 1N6PA 1SGWA 3LH5A 1E0SA 3Q3JB 2GEDA 1GIAA 3FHTA 1FUUA 2EFDB 1DARA 2ZTSA 4XWOA 4ZCMA 4OI4A 1KZGB 2J45A 2IYTA 2WAXA 4QL3A 2O8EA 2QNRA 4L15A 4Q4JA 1G4AE 2BJWA 1NMZA 2QTFA 5H1YA 4UKDA 5DI9A 5K8UA 4BFWA 1NMYA 3M1IA 3C15C 4I99A 4C0KA 1BH2A 4GI7A 2J0UA 3SYLA 4B74A 4OQXA 3REGA 1KJZA 4LBVA 2MSCB 4EPYA 3I32A 2G1JA 2WWYA 2GESA 1QHYA 5F9HA 4OBEA 2FN4A 4Q47A 4CEIB 1XD9A 2LKCA 1LTQA 1NKSA 3QENA 2VLIA 1DAHA 5G53C 5KSYA 2BM1A 3FMOB 1K8RA 2O8BA 4I1OA 3U44B 3GLIA 1GL9B 2D62A 1E2QA 5EE0A 4JT4A 2A30A 2SHKA 1XD8A 3Q7PA 1ZCAA 1Z08A 1N6OA 2JJ1D 4XTRA 1KJYA 2JEOA 2N42A 3THYA 3LQRA 1ZD8A 4LJ7A 5HTKA 5J47A 5JHHB 2WSSD 1HURA 3ADKA 3D31A 3I72A 1IQPA 1WA5A 1AS3A 3U6BA 1E9CA 1MH1A 2YC4C 1H8ED 1Z6YA 2NQ2C 1B0UA 3I92A 3UWOA 2F6RA 5FR2A 5HKKD 2O0KA 1T0JB 3TK1A 1BYIA 2B8WA 1P4SA 2I3BA 3W5JA 3QOFA 1WBDA 1FMLA 1B23P 1G17A 1WF3A 1II8A 1R5OA 1U94A 3IGFA 3K09C 4IFBA 1L2TA 3ZZ0A 4WZAE 3VNVA 1UFQA 1I4DD 4HAVA 5CB6A 1MABB 2F3RA 1P9RA 4TZ0A 4EJSB 4X8OA 3QG1A 4M1OA 2C98A 2ECKA 1KO4A 1R7RA 4IOKA 4LX0A 3IQXA 5KSPA 1IOZA 1NJGA 1SVMA 1JBKA 1J70A 5EE3A 3DDCA 2BMDA 4BFXA 3AVXA 2ZI3A 2DFKB 3RC8A 3U4QA 1XTRA 4P31A 5FL7A 2F9LA 5LD2B 1OV4A 3QVVA 3SJBA 2ZRLA 3PEUA 4B47A 4KBFA 3A1TA 3BFVA 2ZS7A 3UPUA 1E9DA 1P73A 4LRWA 4EDHA 4JLDA 4LZZA 2HV8A 1OXXK 2ZRKA 3KKMA 4A2QA 3CZQA 4TTPA 3RWOA 2GILA 2ZRNA 2X8AA 3B82A 3W5IA 4Q1FA 1LV7A 4E5UA 2WWHA 1NSTA 1Z2CA 2BBOA 3X1YA 1G18A 1Q22A 5J4KA 1OH6A 2DWQA 2IT1A 3KUCA 4RD4A 1R0XA 4URYR 4MRNA 1G64A 4OJKA 5A0FA 4EFLA 2Q9BA 3MFYA 4PQYA 4EPTA 2DFNA 3HPQA 3HYTA 1AS2A 4URVR 4C30A 4Q1DA 4XIGS 4M1KA 2WKQA 1G41A 1S4QA 2ZSBA 3C4JA 5L3QA 1Q0UA 3QEOA 1Q44A 3EASA 2BEJA 3TUJC 4NMMA 1WE2A 2BBWA 1TTTA 1HTWA 2J7PA 4WXPA 3TH5A 4A6PA 4CGZA 3K70B 1G1MA 3TNFA 2H7VA 3IO5A 4JBXA 5HE9A 4RD0A 3IIMA 4N1AA 3B9PA 3V4RA 1NJFA 3BORA 3CX6A 4OHZA 4GFDA 3DVLA 2HEIA 1E1RA 3WYFA 4EPWA 2NOAA 2CLCX 2YC2C 5AJWA 4GMDA 1VG1A 2V1XA 2IYLD 2XX3A 5EP4A 4IEIA 2AFIE 3B60A 1E1QA 2E87A 1PLKA 4EQ6B 2FSFA 1ZC4A 2FPMA 4TYNA 3CR7A 3VHLB 2CJWB 4IJMA 1AZSC 3VR5A 1R0ZA 2W6ID 3SBDA 1IM2A 4D0LB 2QBYB 4LK2A 3CPEA 3OIYA 4II7A 3NKVA 2V54A 4LJ9A 4UNSA 2A9KA 1N5KA 3EW9A 2JJ1A 4NYMR 4QBIA 1W48A 2X2FA 1GTVA 1P2VA 2NPIA 2PX0A 4TQUS 3O8BA 4US2R 4TYPA 3S1AA 1MV5A 2VP4A 5DHAA 1ANKA 1G7TA 5LB4A 2BBSA 3AP1A 1R4AA 2FSIA 2OG2A 2QM7A 2CHGA 2ZJ5A 4QGAA 4RFSA 4A0RA 3EPKA 3PITA 2GCOB 821PA 3NG1A 2IK8A 2CJWA 1XJ0A 2WJVA 1FP6A 4KLZA 1YR8A 3I5XA 2ZUCA 4NYJR 1ZVQA 3AV0B 4DBLC 4DLVA 3EAQA 5EJEA 2VP6A 4Q18A 3RRMA 2EYQA 3R8CA 4KFTA 2JDIA 4IHQA 4PANA 2FZLA 2WM9B 2WIAA 4FW9A 2IYZA 1J8MF 4URWR 2QGZA 2ZXUA 5CDFA 3U7FB 3CKLA 1MR3F 1XX6A 3U3KA 4IXMA 3PUYA 1KTVA 1NVVR 1L4YA 4GZLA 1JAHA 3KFVA 1Z5ZA 3WMGA 2BEKA 2GZDA 1N6RA 2EYUA 2J0VA 8OHMA 3B1WA 2FFHA 1JQJC 2WJIA 2CLSA 5EE1A 2VSFA 2D7CA 3U60B 1UBEA 3G5UA 1JAIA 3RNLA 1E9BA 1OIVA 1N5IA 1SXJA 3PUVA 1T4GA 4QNRA 2A5GA 3ETLA 3D7MA 4MGZR 1Z6TA 3QY0A 1T9HA 3U6KA 2CHVA 3QKRB 5DN6A 2I1QA 2MSDB 3H1TA 4PHHA 1E2KA 3IQWA 1NN1A 5EXPA 1XTJA 3TAHA 1GILA 5JEDA 3CNLA 5AUQA 5AJYA 1JR3D 3W9YA 3PUWA 3WNCA 3SQWA 2OO7A 1CS4C 2EQBA 2P3SA 4ACBA 4A6XA 3IEVA 2J7PD 1NG9A 2FPLA 2VL7A 1CXZA 2ZI6A 4PSVA 1TADA 3WRYC 3BC1A 1F6BA 1SVKA 2N46A 1S8FA 4IDOA 4AI6A 2WHXA 4B48A 4A0GA 3OIWA 2ZREA 3RLFA 3WHLA 4Q4HA 4GZMA 2GVDC 2ZS8A 3BWDD 3C41J 4H1VA 3A8TA 2Z6VA 1ESNA 4OK6A 1OT3A 2PT5A 1UKVY 1D9XA 5H8WA 1MABA 2ZVQX 1LVGA 2XJ9A 4DC9A 3RAPR 1VG8A 1N6LA 2ZITA 4D25A 4EAQA 1F3OA 1Z0DA 3NVAA 1ZUHA 1YZQA 2QEQA 5G40A 3CRQA 4OHXA 4JT2A 3VKWA 4ZDJA 1PV4A 3U4QB 1LF5A 1J99A 2ZUDA 2ZPTX 5TARA 3VKHA 2FSGA 4OHVA 1BIFA 5K8LA 3LBNA 4DSOA 3MWKA 1P60A 1YHNA 2HDNB 3ADBA 3KJGA 4FXPA 1W36D 1NLFA 1CRPA 1Z0KA 2PJZA 4PSAA 1R5NA 4ZDWA 2O0JA 1D6JA 3U61B 4KHZA 4GMXA 3V4FA 3OE7A 2CNWA 4DLYA 2Q0HA 5EUQB 5KDLA 1E9AA 3TSWA 2JLZA 3GQBA 1T6NA 4P0TA 1ZUNB 1FNNA 3K53A 4D81A 4H1UA 1VYUA 2X77A 1A82A 4P4TA 1DO2A 1AGPA 1JALA 3VTKA 1GRNA 4I1VA 3DKVA 4LDJA 4BFZA 1XEXA 1CBUA 4K8OA 4E07A 3FKSA 3KJHA 4A9AA 5AWFC 1OSNA 3VQTA 3K0FB 4G5OA 3O47A 2F3TA 4LYJA 4D2IA 3TW8B 1ZIOA 2C8VA 1P9NA 2FE4A 4C3ZA 3GEIA 3ASYA 1CU1A 2EVWX 4PC7A 4B43A 3VR1A 4WOPA 4BLPA 2CCGA 1X8JA 3VU9B 2XNSA 1KI7A 1UKEA 4DLRA 4HLDA 1LB1B 1CJUC 5CLQA 5KDDA 1FP7A 5KSOA 3ZQJA 3BGWA 5AUNB 5CJPA 2ZI7A 4QC2A 2PCJA 1Z3IX 5TY0A 4XH9B 3C7KA 3TE6A 3SC3A 1MO6A 4AYTA 1W5SA 2ZQ5A 3FOZA 1KO8A 1S9DA 2QRNA 1F5NA 3QKRA 3C8UA 2CNWD 4GP6A 3DKPA 1JEDA 2ZJYA 3H0KA 5DH9A 3QF4A 4PHGA 1S9HA 1WP9A 1Z06A 3LWNA 1BOFA 4IOJA 1WQ1R 3QBVA 4D0NA 4D4MA 4QNMA 4DCUA 3A58B 2NO6A 2KBEA 2W2XA 3MSXA 1N0VC 4LJYA 4NPHA 1HA3A 2IYQA 1E2MA 1S1CA 2A78A 4U00A 1ZRHA 3GCGA 1VHTA 5HE8A 3B8HA 2WTUA 5L3VA 5K8IA 1QHNA 3SE0A 4RD2A 1W2GA 4C0JA 4IFEA 3CX8A 4M21A 2NG1A 2IW3A 1R2QA 3QXJA 2O8EB 5AJVB 4RFSB 2P2LA 5BN5A 2JLUA 1FMJA 1RKBA 1ETUA 2ZJZA 4QOSA 5KDOA 4OHYA 3PEVA 1QVAA 2PX3A 1AS0A 1M8PA 1IXSB 2DWPA 3FPAA 2XEXA 2FEOA 3TSOA 3MJRA 2GJ9A 4BPBA 1NSFA 1DO0A 2C04A 4JL8A 1WB9A 1AIPA 2GJKA 5A5GA 3AKYA 2EW1A 3KQNA 1ONBA 2IWRA 1E98A 3L82B 1RRCA 4MRPA 4RY2A 3ICQB 2J7KA 5AK0A 1GWNA 5FBLB 3PENA 4JLBA 2IS1A 1VCIA 3CF0A 4MGYR 1OIXA 4QJ5A 3P27A 4JBWA 5EXTA 3FKQA 4FI3C 4PZLA 1E9RA 1G3MA 4LGMA 2REBA 4URZR 3MWJA 4LWZA 4U02A 2ORVA 4JJZA 2YNMA 4MYCA 2C03A 4HAZA 4X8HA 1E79D 5C18A 4TMKA 1HYQA 2O8CA 1OYYA 4Q03A 4PZZA 3A37A 2H18A 2D2EA 1G7RA 3QNUA 4BECA 1A2BA 3ZVRA 1SXJB 4KODA 3QQ5A 4ARZB 5DI3A 1ZNWA 4KJZA 3B6EA 2XNDA 1CP2A 3I62A 2GBLA 2VF8A 1NLYA 4CT4B 3ZS8A 1JPJA 2OE2A 3TR0A 2P6NA 2XZPA 4YLGA 4NCJA 1KZ7B 1P61B 2WICA 2W0MA 2CE7A 1VIYA 1OXUA 5EP1A 3WHKA 2PMKA 2B7BA 4US0R 2RGDA 5AUOB 3SZRA 5JHGB 4DLZA 4FMDF 4L5BA 4WZ6A 3LO5A 1DG1G 1ZU5A 2BCJQ 1W0KA 1FQJA 4MUAA 4DUGA 4MKFA 3AVTA 3EZ2A 2JDID 1C9KA 4DIDA 3GLHA 2EFGA 5FBQB 1G8FA 3BD9A 2FSHA 2CE2X 2VP2A 1K5GA 3K0EA 3AEZA 2VBCA 1JI0A 4TTQA 5FOSA 1KDRA 1G5PA 1G8YA 1LNZA 1N2CE 4KFUA 2ODEA 5LD2C 3CB4A 2GNOA 4P3YA 4XVRA 3C5CA 1JECA 3JZMA 5JMTA 2ZJAA 3EA5A 4Y0VA 3RANA 2IUSA 4C0BA 4JVNA 3LW8A 1T3HA 2ZR9A 2HT6A 4TSFD 1G8PA 1YZKA 2MMGA 1G19A 2PZGA 2XB4A 5FPTA 1U0HC 2XGJA 1EFRD 3ZIAA 5HCNA 3R9IA 1XZQA 4CEJB 3AVWA 1P5ZB 3GLHB 3UXMA 4YMSA 1VDZA 2GWHA 4LJ5A 2IEYA 4NCNA 1VCOA 4P4SA 2AL7A 3VR6A 1JXMA 2O8DB 4YXWD 2ZE6A 1M74A 2ZSAA 2XOKD 4X8LA 1J7KA 5E4FA 4AY2A 3TR5A 4Q1EA 1N25A 5LBIA 2OFOA 2RH5A 5DNYB 3KJIA 5HPYB 2VHJA 4F4JA 3OAAA 3E70C 1TUEA 1COWD 3VHXA 5FH9A 2ZM5A 1Q21A 2PMDA 4V0KA 4CW7A 4D6PA 3ASZA 1DAEA 2CK3A 1XTQA 2OBNA 4A1FA 1CJKC 5HZKA 1ZUIA 3WY9A 2WSMA 4DEXA 3GPLA 1XEXB 4V0NA 1PJRA 1VHLA 2XZOA 1XEFA 1G8HA 3HPRA 1II8B 3T15A 3SDZA 5GADl 2FFQA 3ZLJA 1E69A 2VEDA 4JSYA 1AQYA 2WZQA 4NONA 5IDVA 3ZZUA 3ADCA 3GLFA 1GRRA 4CEHA 3CH4B 3O8RA 1AK2A 1ZU4A 2VQSA 4BEBA 2GK7A 4AIIA 3MRSA 1YZGA 2DFTA 2NO0A 3HR7A 3QXXA 3AH8A 3T12A 2IBMA 1OKKA 3FGNA 2WVJA 4TMVA 2VO1A 5G3ZA 1KI6B 5G41A 3WRXC 4OI0A 1MKYA 2AHOA 1W4AA 2V7QD 5EXSA 2WWXA 1UEIA 1TPZA 1U0JA 3L8YA 1M7HA 1QHGA 2XB2A 1EFRA 4RCZA 3SU8A 3Q85A 4OKSA 1CULC 2WKRA 3TRFA 1N3BA 2QGNA 2O8BB 2RHDA 3IPYA 4TSFA 5JZVA 1II0A 3HP1A 4BZXA 1R0WA 2PJRA 1ZW6A 2HYDA 2P67A 3LD9A 3EZ9A 4HLQB 3CONA 3BIFA 3W34A 2PEZA 5DO9A 4FWIB 1RRPA 1N6NA 2YWHA 4IRUB 2Q9AA 2YOHA 1XF9A 3CPHA 5FL7D 1NG1A 2IWHA 4XTCS 4RVCA 5DIFA 2FGJA 4GP7A 1E99A 2V9PA 4FWTA 2QY9A 5L3RA 3U44A 3QKSB 2QA5A 3IILA 4HAXA 3VX3A 3B1YA 3CRW1 3OIVA 1A2KC 3BFXA 2PBRA 3K1JA 1G21E 4YDHB 3EWSA 4PC3A 1SHKA 3QKTA 4G5SA 2IYWA 3VAAA 1JR3E 2NGRA 1NVUQ 4L9WA 4B33A 4MYUA 4NP6A 1A4RA 1ESMA 4DB2A 2DY1A 2V1UA 2CHQA 1NVXQ 4ASUD 4B73A 1TQ2A 2FV8A 2OAP1 3KQLA 1G4UR 4K81B 1NBMD 4PAOA 2C96A 4JL5A 4XVUA 3W90A 3R9XA 3OFND 2P65A 3TVDA 2G0TA 2I4IA 1E3MA 4DXAA 1H8EA 2NO9A 3L43A 4LBWA 1XJCA 2ASEA 4Q9LA 2O8DA 1KK2A 4PAMA 2VTKA 3AKDA 4Q21A 3VFDA 3GLFE 4US1R 1QHHB 2C77A 4E09A 2IEZA 2YVUA 4V0LA 4B44A 5JRZA 3KFXA 5IRCD 4QHSA 3GJ4A 3K0FA 3T5DA 3NHBA 4QKQA 1F60A 1YZNA 3GFTA 1HV8A 5KTYA 1Z63A 4Q19A 2Z43A 3HWSA 2R6CA 3H86A 3LW7A 3NC1C 1R8QA 3Q5DA 3AF1A 3EC1A 4Z51A 2RCNA 4Q9IA 1L8QA 4JYCA 4TT3D 4RZXA 4LHVA 1BMFA 4ON9A 3T06B 5CK4A 4LYAA 1Q1ZA 1RJ9A 5EQTA 1DPFA 3WBJA 1P62B 1XB2A 2D06A 3GEHA 2WPDA 3TUZC 2QU8A 3C16C 1E2NA 1GNPA 3K8YA 4D4JA 1O87A 3EG5A 1P6XA 4YONB 4D80A 4URXR 1AKEA 4BFTA 3T61A 4WW0A 1XFAA 3OEHD 3GLIE 1G6OA 1CR2A 1LS6A 1DG3A 4BLSA 4WBSA 3N2IA 4PO9A 4CT5A 4MH0R 5JI3E 1Z6GA 2FWRA 4KVAA 1T3SA 1Z29A 4OHWA 4AYWA 1XD2A 2R9VA 1J2JA 3VR4A 1Z83A 4A0FA 1MRSA 4Q7KA 4B3FX 4Q1CA 1KOFA 3E1SA 3FE2A 3RWMB 4OQMA 2O0HA 2QQ0A 1W1WA 4QJ4A 2RB4A 1P3JA 5BW8A 2VH5R 4DLXA 3QF7A 4ZKDA 4LV6A 3BK7A 4JLAA 1IY1A 1E6CA 2D74A 1Q1BA 3NH9A 4XWKA 4DZZA 4DEYA 3SFZA 2IX3A 2BOVA 3UG6A 2YKGA 4PQFA 2QN6A 2FFAA 1HQYE 3OF5A 5JWOA 5A4JA 3T1TA 2RGGA 1R0YA 2QENA 1EK0A 4DLTA 2CDNA 1AZTA 3ND8A 2QUZA 1ZBDA 4RJLA 1EFTA 2XITA 3GJ0A 2C78A 4B2PA 4AKGA 4E03A 5FTLA 2REOA 3LAWA 3BOSA 3PUXA 1I4TD 1Q12A 2ZETA 4JYBA 4R9UC 2VHQA 4IOLA 4EQ6A 1CR0A 3EZ7A 2QP3A 5JLJA 3CO5A 1AN0A 2P6RA 2DFLA 5B2ZA 2GAAA 2Z83A 3BB4A 4M4SA 4G5RA 4IW3B 4A92A 3TGPA 4HSEA 1JXOA 2NIPA 2GCPA 2OCPA 5BQ5A 3RYTC 5M04A 4V03A 4DDTA 5JSZA 1XCMA 2ERXA 4KVGA 2ZJ8A 1OXSC 5FUYA 1OIWA 3LDAA 4QHTA 2R62A 3UKDA 1R10A 4MRSA 2UZIR 2YWFA 3KXLA 1X86B 2WJHA 2D2FA 4K46A 1Z0IA 3FVQA 2R6DA 2PEYA 4JLOA 3AVPA 1FX0B 3PFIA 2GF0A 3SJAA 4F91B 5ANRB 4GBMA 4LC0A 3OE7D 1E9SA 4KFSA 2KSQA 5DLQC 3ICEA 4DLWA 4GSYA 1I2MA 3LV8A 4DVGA 4QM7A 3CRVA 1XTKA 3AF2A 3O8DA 5FOWA 2GZHA 2JAQA 3SEAA 1E4VA 3NHAA 1M7BA 3TVTA 1KY3A 1SVOA 4W5WA 4R7ZA 1XMVA 5IK2A 5KO2A 5BYKA 4Q01A 2IHYA 3THXA 1RVDA 2ZRCA 1RE0A 1S2MA 2O52A 2ZYVX 3AVOA 4PAQA 5SZHB 4A4DA 3UWKA 2YV5A 1TL7C 3THOA 2J0QA 3Q8XB 3U2QA 3LNCA 3BB3A 3TQFA 1O3YA 1UBCA 2XSZD 4OI1A 3IEUA 4PPFA 1GRQA 2WIBA 5JFGA 5CITA 3K70C 2YOFA 3TKLA 4PX9A 4O25A 2ZYUX 2QP9X 5LPNA 2OM2A 2QBYA 5C4MA 1NIPA 3QIAA 2BIFA 3AVUA 2G9NA 2A5YB 2OEPA 3HJNA 4B71A 5JS7A 3A1VA 1UAAA 4YMWA 1LF0A 3CWQA 3L0OA 4KITB 5F2EA 4MRRA 3WP0A 3SYNA 2PCLA 1H8HD 5JJKA 3QEJA 5B64A 3GP8A 3AVVA 2WV9A 4WA7A 4IDNA 2YYZA 2JLVA 4M9SA 2JIZA 1L7VC 4Q66C 3NEYA 2F1RA 2CL7X 1ZIPA 4W9MC 1JR3A 4KI0A 4RKFA 2HJVA 4OK5A 3TUIC 1Z6XA 2ZU6A 3EPLA 4LYFA 5J4HA 1TEXA 2VSXA 4UNQA 2OILA 2EFHB 3HU3A 3ZGXA 3VU9A 1KKLA 3L2OB 2JJ8A 3B5JA 4O2LA 1GNQA 3BBPA 1UBFA 2AKAB 1DELA 1SXJC 3EIEA 4ZDKA 4YQFA 1BYUA 3PG5A 4TMZA 4FINA 5C46F 5GJBA 5JECA 2ZJOA 2OFWA 4IDHA 2HXSA 4KLNA 5BN4A 4LHYA 3VR2A 3M4YA 4FD2A 1ZINA 2Q3MA 4G5GA 4EPXA 3WNDA 4JKIA 4Z8YA 1W47A 5FTNA 1DOAA 4HAUA 2OAQ1 2A3RA 2ODBA 2ZAOA 5DSZA 1JJ7A 3SFVA 3QSYA 1CJVC 1Q1EA 3BH0A 1EFCA 1D2MA 2GKSA 4M1YA 2LCFA 5TVKA 3OHMA 3KXKA 1P9WA 2WMOB 3QF4B 2HF8A 1ZP6A 2QMUA 2UKDA 3GEEA 4UXHA 3G0HA 1KIMA 2JA1A 1D5CA 4D0GA 4B35A 4ZDIA 5CB8A 3ZIAD 1XNJA 3W8NA 3A6PC 3M0EA 4HUTA 1P2TA 1SVIA 2H92A 1NBME 2K5UA 4A82A 1FNMA 1JB1A 4JVLA 3SS8A 2JLQA 5JBQA 1AJEA 4R2IA 2B6HA 3HU2A 2NPFA 1E0JA 2VSOA 3K9HA 4P32A 1NI3A 2EWVA 4ZI2A 3WMEA 3CUEF 4W5HA 5F98A 1D8TA 1P72A 4A36A 3KQUA 2WWWA 1NY6A 1IY2A 3H84A 3MMPA 4NZYA 2GA8A 1E2IA 2V3CC 1N6KA 5FFMA 3QJYA 1OHHD 4TN1A 5J40A 2Y8EA 2Z5FA 3LRPA 2Z4SA 3MD0A 1Z47A 3Q5EA 1JEEA 1FPMA 3RS5A 4WXRA 2WMNB 3AVQA 1KDPA 4JMPA 4DUGD 2XJ4A 4ZO4A 1QZXA 3DOFA 4NCHA 5BXQC 1IJFA 2WKPA 2ZANA 4C0LA 3R9WA 2H1LA 3OESA 2OCAA 4LBZA 2IXEA 1MO3A 1IN8A 1E0AA 2P6UA 4TL7A 1OLOA 3J81k 3EZ6A 1G9XA 2IUTA 3W3ZB 3PR1A 2VYFA 4GNKA 4JVMA 4AKEA 3I61A 1QG4A 3RS4A 2JASA 2J59A 2RKOA 4PR0A 3P4XA 1ELOA 3EIHA 4Q9KA 1NBMA 2CEAA 1Q20A 5H70A 5E7JA 2J9RA 5K8TA 5FOUA 3AUYA 2G1KA 4M1MA 2ZE7A 4L16A 3TW4A 1NVVQ 2F9MA 1GAJA 1NMXA 2RGEA 5CYPA 1GFIA 1VPLA 1ZC3A 2YZ2A 4CRWB 3GLGB 2LWIA 2FF7A 2NO7A 3GJ3A 4A15A 2D4HA 3GLFB 4V02A 1YZTA 1V43A 2CLDX 3P20A 1KAOA 2HXYA 2ONKA 4Q7MB 3UMRA 3DMNA 5KYKA 4EJSA 1TNDA 4QBFA 1FOEB 521PA 1OXVA 2ZR7A 3K9GA 4JLVA 4IXNA 5D3MB 1CTQA 3KUDA 1KI6A 1M1YE 2I1VB 1SVWA 3EPJA 4F7WA 2V55B 3P32A 5J4VA 4ZIRA 1GG2A 2P5TB 4PHTA 3KJEA 4BQSA 4ZV4A 1G3IA 4KV9A 4PPQA 3LX5A 1EG7A 4WZBE 3DO6A 2B7CA 4IOMA 2ZE5A 1HT2E 4AWXA 2GF9A 3SR0A 4G1UC 2CCKA 2HT1A 1LS1A 5D3QA 3ZDQA 1TF5A 4C0QC 4R71A 2WAYA 4G0NA 1SVLA 4BLTA 5EXXA 2GXAA 4M9ZA 2IYRA 1H8HA 1W4CA 1KHTA 2RHMA 1G5RA 1L4UA 1Z8FA 4V0ME 1NKTA 4XWAA 3F0TA 3CWZA 3QKSA 3REFA 2IC5A 3EIQA 4NBSA 2XXAB 1II9A 4XVQA 2NO1A 4A2WA 4GDFA 1VCMA 3PIRA 2ZRJA 5AJXA 3OEEA 4URUR 2ZE8A 4RD6A 1YRAA 3SNHA 4U7DA 1KSJA 4R98A 2JIZD 4DDUA 2CCJA 1XWIA 4ILEA 2B8TA 3DZ8A 1PUJA 3EPHA 5HKKA 4KYUA 3ZS9A 1U2RA 1P7CA 3I3SR 4HDQB 2ERYA 4BEJA 3B9QA 5JI2E 2C9YA 1HE8B 2AWOA 5KU1A 2HCJB 2IYXA 4TL6A 1AA9A 1XPOA 4HI0E 1IBRA 4Q00A 2ZSEA 3F3YA 4TQAA 4QFMA 4A8JA 4MKHA 3L0PA 3I8SA 1F2UA 3FWYA 3RSOA 3WP1B 2IUUA 2G77B 3ZYCA 5B58C 1U81A 3CF6R 1X1SA 3LBIA 1W4BA 5CIQA 1W5TA 2W6JD 3AKCA 2ZRGA 1K6MA 4OQLA 3L8ZA 4Z1MA 2QTVB 2AKYA 4PPGA 4XSGA 3KB2A 4B2IA 3N5CA 5HZHA 2VA8A 4PO1A 4HUQB 2BMEA 2J5XA 2HJGA 2EU8A 3LY5A 4GOKA 3I4LA 3GJ8A 4KCGA 3WBKA 5IK2D 3OZXA 4JVSB 1FTNA 2AXNA 4ZCLA 3EWAA 1OB2A 5J4YA 4KSBA 2WOJA 3A4MA 3ZJYA 3WYGA 5FBVB 3CRRA 4KAXA 1U98A 1Z2AA 1KO5A 4HB4A 1H65A 3WXMA 3EC2A 1PLLA 4MYHA 4I4LA 2VF7A 3OEED 2QP4A 2IF2A 4AC9A 4M1TA 1QVRA 2W58A 4A2PA 4C0HA 3THXB 4P4SB 3GMTA 2JLWA 4LHWA 4HUQA 3BFKA 3A1SA 1MT0A 2REXB 4RD3A 1HUQA 3BH7A 4M1SA 5FPKA 3PVSA 2ZIAA 2QQEA 3AM1A 2V4ZA 4P4UA 3FMIA 3IUYA 2GHIA 4C4PA 3MWYW 1VG9B 3ZH9B 3K0CA 3QPVA 3W6PA 3IIKA 1NVWQ 3MJHA 5KHOC 3O8CA 3AQ4A 5EE5B 1ZM3A 1OH7A 1Q57A 4MITA 3SYKA 3LX8A 1TQ6A 3AUXA 4NCIA 4XSHA 2VHCA 4BFYA 1GVNB 3AGPA 6Q21A 4UNRA 3V00A 4AK9A 5SZKB 4JSTA 2QSYA 2EFEB 3GLGE 2JJ2A 4LI0A 5DN6D 4FMCB 4Q9JA 1E2PA 2GVZC 3EXAA 3I8XA 3VMFA 3K0SA 1V5WA 4RFVA 1SXJD 4WAUA 5FR1A 4HZIA 2QT0A 1SKYE 4A0HA 2WOOA 2WWGA 4JIMA 4NYIQ 2RGBA 4TYYA 2G6BA 2R8RA 4PO8A 4WVFA 2H5EA 4Q1AA 4TTRA 1NNEA 3ND9A 1JJVA 2OT3B 4I1UA 3RRYA 2GEVA 4NYIR 2DYKA 1E2HA 2PH1A 2W83A 1SKYB 1TQDA 3X1DA 3GJ7A 2MSEB 4KYIB 3CF2A 5FI0B 1W2HA 2KB0A 2JLYA 3C5HA 3F8TA 2TMKA 621PA 3EA0A 4HB2A 2Q21A 1OFHA 1EFUA 2NTYC 4BWYA 2JJ2D 5DGXA 4F4IA 4DSNA 1WXQA 5BWMA 1OH5A 2R6FA 4PSKA 1YR9A 2DR3A 2IYUA 1KI1A 2AD1A 2ZRPA 4GT1A 3B1VA 2WPDD 3IO3A 1UDXA 2BBTA 1U0LA 2IXFA 4O2RA 1PZNA 3K70D 1OE0A 3R20A 2YWEA 4D4LA 2ZRFA 3QXSA 3ZQ6A 3QVUA 2C99A 2IF0A 4HEJA 1E2DA 1M34E 4QBHA 3OFNA 4KBGA 3RS0A 3U3MA 1A5TA 1KK1A 2QPTA 1E2FA 1VKJA 3R8FA 2C5LA 1XZPA 2GCNA 4HB3A 1C4OA 3TSZA 2G88A 2GJSA 5FUVA 1HQCA 2FNAA 3VR3A 4CZ2A 1U8AA 1EXMA 1WCV1 2VP0A 3DHWC 3DOEA 1UJ2A 4DIEA 2E9SA 1U8YA 4M9QA 3UIEA 1ZM7A 1JPNA 2IS4A 1NIJA 4DSTA 4L8GA 3B78A 3MLEA 2CVHA 2V6JA 3GFOA 1XEWX 3B2EA 3H4MA 2HF9A 1OHHA 1UKYA 3FB4A 4MDEA 1RJ9B 2GXQA 3PV0A 1YKSA 3FKSD 3BB1A 4QM6A 4BGDA 2PZFA 3CR8A 2VP5A 4MKGA 4HDCA 1DBSA 1QDEA 4AG6A 2AK3A 2R65A 1XMJA 4LYHA 4JS0A
chains in the Genus database with same CATH superfamily
2ZYWX 3PPYA 5SZJA 5B5SA 1XPUA 1I5OA 5KPJA 2W37A 3GDOA 4MTCA 1RXEA 4DV7B 3E9CA 4FDAA 3W1WA 5EHZA 4Q7QA 3RS2A 4FNGA 1B76A 3GFGA 4KC0A 1UKZA 4MYSA 3G85A 1XDBA 5FI1B 1I36A 2WFAA 5K2MA 5HOEA 5CPFA 4EUFA 1NLZA 5G3YA 4IQ4A 4JKYA 1EFVB 1K88A 1M1YA 3IB6A 3DONA 5D7BA 1YSCA 1H6CA 4LPSA 4DCCA 4KL8S 4EW1A 4F5ZA 1PHPA 2DPHA 2HUPA 5BSHA 4MR8A 4BY9E 3JD2A 1C0PA 4QYXA 3ND6A 3ETDA 1ISSA 1BO6A 4PYMA 2ZU0C 1PO7A 1XVAA 3DOJA 3QSGA 4RSMA 4IIJA 1H2HA 4OB7A 5KQGA 3C3PA 3QY9A 3FPEA 5K3FB 3QP9A 1O97C 1WLSA 2AIRA 4HTFB 4WL0A 4Z4HA 5I8WA 1SUSA 5CCXA 1GL6A 4OI2A 5BN3B 3AMVA 1A7JA 2C4VA 1OUMA 3M6UA 1R00A 4RH1A 1WJGA 5CDUA 4IKPA 1MC1A 1DDGA 4P8RA 5IEJA 1DC5A 5TLSA 3B12A 3LS2A 5DEOA 5FEMA 1AQUA 1KI2A 3H65A 4JL6A 5EERA 5L53A 3O5AA 3SVZA 4OH1A 1B26A 1NPYA 4F1JA 4J0CA 5EIBC 1M1YB 2O7RA 5K8CA 1IB0A 1UF9A 1V6CA 1O1YA 2XWSA 4MWBA 5GWXA 3BAZA 4KN8A 1NMEA 3G1UA 4HZGA 1FDIA 2ZJ7A 5A5DA 4BNYA 1JLMA 1NXQA 4IDBA 2OORA 2HHAA 3H8SA 4UPEA 4L07A 3KLMX 4DCSA 2BDEA 5CA0F 4H0FA 2ATVA 1PEDA 1F14A 5ALUA 3G79A 4IIJF 4F04A 3DAHA 3UC5A 3EE6A 4EHFA 1DTSA 5JD6A 5DBFA 1F9EA 1GGEA 3E2PA 3MTGA 4GOXA 2AG6A 4TL8A 4KIFA 1N8NA 2XH8A 4LS3A 2RHWA 5I7UA 1DXHA 3TZLA 1TT5B 5FNVF 1RADA 2QROA 3ZV6A 3B20A 2XAUA 3MG9A 1W94A 3GD7A 5E7IA 3R7WA 3IP8A 1QQ6A 1CV2A 3W2TA 4DAOA 1H2BA 3VUEA 4E70A 1CG6A 2R85A 2Z1DA 3MF4A 4MTLA 4P5EA 1BKDR 4YQYA 2WWIA 1U3DA 2ZIXA 2ZIUB 3GUYA 3U16A 1BA2A 1W9MA 1ESCA 2ZKLA 4Q3EA 3MS7A 1TLFA 3UHAA 3KQOA 1E4EB 4Q5IA 3TQQA 3NIBA 3QXCA 1PEYA 5FXMA 2VDUE 1R6TA 2V8BA 2JK0A 2PL3A 3G7SA 1F5SA 1OLXB 3HL4A 1UADA 2IITA 3SKYA 1QHSA 2PNFA 4MYTA 4ZXFA 1D5WA 1OC2A 3HEAA 4PM4A 2AC7A 1UL1X 5MN5A 3T5BA 4TL9A 4RVUA 2E1PA 1R1DA 3PNOA 2CMKA 2BV3A 1RWKA 3C24A 2J30A 4FMDB 4G4SO 4WKOA 3ASVA 5K4GA 1WVIA 5JRDS 1QWSA 2NTEA 4KXUA 3COWA 4KQMA 3WO1A 4B7XA 4GSLA 4F85A 2FZ4A 2I2BA 1A1SA 1UT8A 3EZLA 1EJ0A 3LYLA 3RD5A 5HKOA 3P2YA 2LR0A 4AMGA 4Q4LA 4UFNA 1JJBA 2PZEA 3DW3X 3WRWA 5E6UA 4G6ZA 2OK8A 3LOUA 5F2NA 1CRZA 3RF6A 5HJ5A 1SQ5A 4P58A 4M9XA 1FFSA 2P3LA 3VHXB 1MB3A 1BE0A 4F2WA 2HRBA 2NMVA 4KWIA 2ZPAA 2FOXA 1TGYA 2GK6A 1RYHA 4GECA 5TXGA 2FP3A 2BGKA 4TLAA 2K4MA 1TMGE 3KT0A 1ZM4A 5FAKA 4GEKA 2UZ3A 4E12A 1C3OB 2PLRA 3TLAA 5G2OA 4YO8A 1U1CA 3VUFA 3W5UA 4IKEA 2YZNA 3UAGA 4MMXB 3NVMB 4LV8B 3TNDA 3M6IA 3BHJA 2F1JA 1LX6A 3F6BX 5FA5A 4QLOA 4CE6A 4CMAA 4EA9A 2XLBA 4CM4A 1JHUA 2OSBA 4KIUA 4R6XA 4LUCA 3G2PA 2WTXA 5F3RA 1EUDA 5FWXA 3UV3A 3BF8A 3SCZA 1EYZA 5L3QB 2I03A 3SOPA 1N5LA 3BWXA 3ILXA 5BV0A 5C3MA 1ZI9A 2Q50A 2O7QA 2QTHA 4KACA 4RMGA 1Z6AA 1UMBA 1SC4A 3N7AA 4F3TA 2XTAA 3FNEA 4D4GA 2QORA 3A3YA 3O8QB 1Z6QA 3V8MA 3BTVA 1JEJA 4CM6A 1U2QA 3FCEA 3C43A 1UDRA 3OM1A 4PPYA 3AEKB 2B3TA 3WV5A 5DULA 5GVSA 1XRSB 4LDAA 3I5AA 1BQ3A 4WQMA 4XM0A 4C5CA 4FKBA 5CVUA 4JJFA 2DSTA 5KUTA 1CZHA 1P3DA 4JNCA 2XMPA 3THWA 2PL1A 1WXFA 1AVTA 1Y1LA 5KOHB 3JATB 4TT8A 5B2EA 1M66A 3HBAA 3RT7A 5BORA 2J5KA 1GPKA 1U2ZA 5E6RA 2ZCJA 4OLFA 2X1LA 1E8DA 5TMDA 1IRXA 4FMCF 3CKYA 1H1LA 1YS4A 3H97A 3T3GA 4O5OA 3TLXA 4L4XA 1EXNA 2HPHA 4MULA 2CNDA 3KZVA 1NX6A 2HRZA 2PGXA 3SZMA 3HR8A 4WFQA 1GAQA 4ZV9A 3VISA 2GFHA 4XAQA 2J4CA 1PWXA 2VLBA 3FW1A 4KIGA 4N0EA 4TKVB 3NYWA 3ROPA 3V1TC 2QZ4A 3LYUA 4E31A 3T5PA 5J5VA 4P53A 1BSVA 4ZP1A 3TTUA 3V5NA 3GNTA 4DA4A 3SQXA 3DF7A 4KXFB 4HDOB 1WVGA 3ZZMA 4FSDA 3ABZA 4F46A 5LXTA 4UM5A 2PUGA 4HQKA 1O96A 1HLGA 1Q6YA 2HBRA 2NSYA 1GITA 4NE2A 3P26A 1AHPA 2DB3A 2GCGA 3FZNA 4IEEA 1HFJA 2O8FA 3NT5A 5E4JA 2WWFA 4XJXA 2KE5A 2GF2A 3DZBA 4JJIA 4OOFA 1J07A 1YB2A 1JJFA 1KHHA 1KYWA 3JR7A 4FYWA 3ZPXA 5T4BA 1A9TA 3OT1B 3OWOA 1XJQA 2C9MA 2FPUA 2NZJA 4RY0A 3HM2A 4TYQA 5EIEA 1DOZA 3OY2A 1ODSA 2X19A 3QU4A 4DKXA 1Z28A 4MUNA 4CVNA 5JMWA 1USUA 1JLRA 1Q77A 3IAAA 5B1HA 3NMUF 4S0XA 4L8LA 5BQPA 1V1RA 1VLLA 2HFKA 2MU1A 3DTYA 1DIAA 4R0MA 1KJJA 3NC0C 1ZGZA 2BTQB 5JD3A 1UQUA 3EDOA 5C8XA 1IATA 3HYRA 4TMTA 2VQ6A 3NJRA 4LSMA 5L4NA 2CJPA 5DYIA 5EE9A 3V1UA 5EWJA 1P2BA 1Q74A 1UAGA 1WIWA 3Q8WA 5CT5A 1BVHA 2HLDA 5DE3A 3Q8LA 1KARA 1NNSA 1ZXXA 3IBYA 4IDAA 2FUG6 4JYPA 4MGIR 3GN1A 2PKYX 3TBKA 2PUAA 1K7SN 1MORA 2XQFA 4BMXA 1JU9A 2C7VA 3HK2A 3PDUA 2L82A 3GUCA 4ND6A 2EEPA 2VFAA 3E2IA 4K87A 2WK1A 3VC1A 4F3RA 1YQTA 1X3SA 4JB8A 3IFSA 4O4LF 4REMA 1ADCA 4R9VA 1YIDA 3S7TA 4FN4A 4HWOA 2JGNA 3PCTA 4NFSA 3A9VA 4GEGA 1RABA 4QJ3A 4RBNA 1CFJA 1NUSA 1QAOA 2BFFB 4RJIA 5BYBA 3ELUA 4OK3A 4LV5B 2VRWA 3HI6A 4CUKA 2V59A 2IU4A 2XKAA 2R66A 3ZWNA 4LX8A 1R8JA 3DV0B 5IKXA 4X90A 3TRKA 4R1TA 4E4RA 2B69A 2J46A 5I3CA 1GKUB 3K16A 1P1IA 4ENQA 4K9KA 4TQ9A 4RTJA 4GLJA 3RS3A 1XPRA 5F23A 2RAVA 5IU6A 1EFPA 1RRGA 2HU2A 4CF3A 1N0UA 3TG2A 1W8IA 1DCTA 3HKEA 1WDTA 2B37A 1IHUA 2AX4A 2R8PA 4O08A 5G4KB 1ARZA 4LRUA 5EFOA 4YDQA 2PKEA 1JS1X 3C6MA 2DWOA 4EFMA 2J0SA 3VSEA 2FW6A 3PNPA 5BO5A 4IRXA 4PZ9A 5IP5A 2COUA 2JFZA 3RAGA 1W19A 4H1HA 3FHOA 3G5MA 3JAWA 4Q3DA 2PLNA 4BWVA 2ADMA 4Q16A 3H11A 3DHEA 4ZYUA 2KBFA 3RC9A 4DLUA 4EY5A 1P1RA 1OKKD 1E1LA 1WHTB 1PJAA 3GLRA 4B2LA 2XOXA 1YVPA 3I6BA 4AG5A 2Y9MB 3CEPB 4P34A 5AW9A 5TJHA 5L7TA 1SBIA 5BQXA 1YK0A 3JRXA 2D0DA 3B3GA 4ARAA 2FCRA 2W5UA 4QFDA 5H82A 2WLSA 1DAIA 1G5QA 3QRWA 3NEJA 3NT4A 4L95C 1FYDA 3C3YA 3LFTA 3MGCA 3DTVD 5ALKA 1NP6A 2BKUA 4M0LA 1BU8A 5DPMA 1C1YA 1REQB 3LXXA 1JVSA 1XAJA 3OF2A 4TLBA 3TGLA 1FW6A 2OB1A 1RTKA 2QXTA 3CUKA 1EJ6A 3QYPA 4Z9YA 4BNZA 1DAFA 1HT1E 2FZWA 2Z0MA 4PZYA 3JYPA 4MA4A 4PU0A 3WLTA 5FLXA 4TYWA 2JFYA 3N8HA 4WK4B 3C6QA 4C9BA 2O5VA 2HCRA 2IV3A 1DLIA 4DY6A 1EM8B 2PKRA 1CWUA 5TMBA 2P68A 3W6NA 1RKXA 2AR7A 2J07A 3DM5A 3KK0A 3DYBA 3PT9A 2EGHA 4IXTA 4KE8A 2Q4RA 2II6A 3HR4A 4E3WA 2I2AA 4BQQA 1AN9A 2VXOA 4OVKA 3FTQA 1U9YA 5K99A 1RFLA 3AY7A 3RVBA 2WA2A 1P1FA 2BFEB 4XJTA 4ZRNA 4D26A 2O5CA 2C3PA 3ZZTA 2VWHA 4FEAA 2EWMA 1QHIA 3U31A 4ZYYA 3UW1A 2GETA 4H31A 1NW7A 4LCEA 5JASA 1VBFA 4BE4A 2IU6A 3A05A 4IQ0A 4TMXA 3WG9A 1J8VA 3RBAA 2XTZA 1EGMB 1JNXX 4KQFA 4I1SA 3V80A 1O94A 3VR6D 421PA 3F5QA 4A10A 4B6OA 5CTAA 2AZMA 2CFRA 2NZ8A 5JAQA 1VLVA 1J20A 4IDQA 221PA 4QDZA 1A9YA 3EZFA 2HK8A 3NHPA 3Q3EA 4LDPA 1JT2A 1QGED 1OF1A 4IIVA 4GI5A 3ZWXA 2CEKA 4KO4S 2QD5A 1KFBB 4Z86A 3F5MA 3NBUA 4HOYA 3UWDA 1YL6A 4X7RA 4AN4A 2OBLA 4P80A 4RV5A 3U5ZB 5L4SA 3UM9A 2A84A 4DCTA 4BO5A 2AE1A 3KKKA 3OECA 3WIDA 3DV2A 4CF6A 2GJ8A 4TYMA 4J9UE 1NF3A 1WL8A 1DWUA 2OESA 3Q72A 4EHIA 1LBSA 4QJBA 2PXXA 3NBKA 1AKYA 1MOQA 1LTKA 3AHIA 1PGOA 3QPWA 3TM5A 4RO0A 4BMCA 4N3CA 5AHXA 2HRQA 2VBFA 3EQ9A 4J1QA 4KRGA 1KP3A 1HOTA 1U99A 2JPDA 3LVQE 4JBHA 1FRFS 1OROA 5TEWA 4AJJA 4BU1A 3NBYC 1E2EA 4RW0A 3NXSA 4MHOA 1VIAA 1AUPA 4NTZA 3EXEA 3ZWPA 3V4ZA 5CAEA 4FOSA 1WHSB 4I55F 1DAGA 1AHIA 3GJ6A 4TMFA 3M6AA 4IV5A 5LQUA 3L41A 2GSDA 3ELWA 2F43B 3RVOA 2M32A 4EB3A 3EH1A 4B82A 1KSGA 1CUUA 2JLSA 2GEBA 3COPA 3DZIA 1QZ3A 2W4IA 1QANA 4RVNA 3WL7A 5JAOA 2MMCA 2X2EA 3FHLA 1CUWA 1OAAA 4PVDA 5LDDC 1KAGA 3K1AA 4QYWA 1KMHA 1QP0A 4G3XA 5THKA 2H1CA 5KNBA 5IVIA 1YR6A 1Z0ZA 3RGWS 5I9SA 1Z8HA 4DCNA 3WLSA 3TF5A 1R6DA 4ZYZA 1GTL1 4HFJA 3TDNA 1XHFA 2OYRA 2D5CA 4HTFA 1HEIA 2F8TA 3LCMA 5KINB 4BOYA 1M2OB 4ATNA 3LMKA 3LPCA 3CLHA 1B8OA 1ZRMA 1Y1QA 2ZB4A 1AF7A 4M7PA 3G2IA 1NA5A 2HSEA 3K2BA 1R6XA 4X93A 3ZJTA 2Q3FA 3HFSA 3PD0A 4F4UA 1UC8A 2WFMA 3DVQX 4B3CA 3U7EB 2GEUA 4KQKA 4GYKA 1WTCA 1CY8A 1Y5MA 1HLDA 2BTQA 3AC0A 4KH1A 4I3HA 2WYWA 1KNQA 5LQDA 2YIJA 3MRXA 1WP4A 3TKYA 1GT91 3WGZA 4JFAA 5KAPA 3ZWOA 1KO7A 1N2CB 1XCGB 1QQTA 5JH7B 1VG0B 2D7DA 5CAEB 3ZGVA 3WNBA 1COZA 4OF4A 3DCJA 4FGWA 3AEUA 5SY6A 4QU0A 4UBJA 1DE0A 1NQWA 2AG5A 2H8KA 5J2TF 4TMWA 4ESHA 1QGUA 3HGMA 4I7EA 3C3XA 2A2ZA 1EWTA 1MAAA 1CJMA 3MGGA 1IL0A 5HX7A 4NU0A 1IHOA 1KDZA 3EXIB 4J76A 2OGTA 3PT5A 2O14A 3JS5A 1RWBA 2PL9A 4AKHA 1K86A 3K0CC 2VP9A 1E60A 4XD2A 3T0IA 4BKPA 1R6VA 4RZQA 3K15A 4LJ6A 4L8YA 2QT9A 3PP8A 5ICCA 1E4YA 4Q1VA 2AF4C 4B6FA 4LQLA 3IT2A 5DBGA 1EE2A 2QG6A 3H1EA 1PR5A 1O94C 1GZ3A 2AYXA 2QX8A 4NPCA 5CA0B 2J08A 1BX3A 2AI3A 3V2GA 2RHTA 2NXCA 1YULA 1WCXA 4ER3A 1HNNA 1HGXA 1U0BB 1G2PA 3MT9A 4MUHA 1PVOA 1ULUA 5PNTA 3M2TA 2VDRB 2GDJA 4C20A 1E7SA 2HMYB 3H5OA 4XDZA 2Y27A 3SVTA 2CBZA 3MAAC 4WZAA 3WFZA 2Q1SA 3MUFA 3WXBA 3P1JA 1TAUA 1RLMA 1TZKA 3R41A 4OAQA 1MNQA 4UHEA 4URHA 5ALXA 3KALA 2BC9A 3FVRA 4MB0A 2GBLC 3KQKA 1XCPA 2QMOA 4PFSA 4OU4A 3U7RA 2F3UA 4JLNA 4DRXB 4EKGA 1UOEA 1ZJ6A 5KNDA 3FLAA 2QYSA 1KDOA 4S1WA 5ARDA 1L5YA 2R6HA 3EDMA 3REQA 5ADWA 1SHZA 2N47A 4HRVA 4KO1S 1FTSA 4NI5A 4NYMQ 1XU4A 4I08A 5EYPA 4Q9DA 4WOCA 4V39A 2ID4A 5IDQA 1F8YA 2JLRA 4QDOA 3M89A 4JUDX 4ZTBA 3ZVKA 2J3DA 2IPAB 2Y0EA 1GHTA 1IOWA 4WK0B 4BEWA 5JH7F 1HY3A 1NDQA 2FPPB 3BXHA 3QPUA 4KN6A 3CLTD 2L18A 2V4UA 4KLAA 4UDNA 4D9CA 3A6HA 4O33A 3M83A 2EFCB 1YMQA 2P2ZA 3B85A 3CFYA 3EA4A 3WISA 4ETIA 3WLOA 3GLGA 3MCTA 4WESB 4ZTZB 2H7XA 2XUIA 1HQKA 1H22A 1GKYA 1P6QA 1NPDA 3TDKA 1HE1C 3U3OA 5LR6A 2W6NA 1YC2A 3GFVA 5IUKC 4CDGA 1UMCB 2WFZA 2QRMA 2G09A 5IHPA 4LQCA 4MW9A 4BBJA 1OBCA 3QVLA 4GOLD 5EJMA 5FBZA 4MWGA 1DQPA 3Q12A 2GXSA 4L3VA 5DRYA 3C5VA 3OD5A 4QASA 5B7QA 3UMCA 5FJIA 1QO9A 3IDFA 3W2FA 3ZLTA 1KR5A 3KJNA 3PQ2A 5DTMA 2IS2A 1NVEA 2AN3A 4DLSA 1U8CB 1GL7A 2HRDA 2PMCA 4RHXA 1NI5A 3TPCA 2CL5A 3LKVA 2P9YA 4MUFA 4TLCA 1A9XB 4G37A 1BW9A 1W4RA 4NYJQ 1PBTA 2V97A 2IZ0A 2XVAA 3U4CA 2ZUWA 3TJZA 3WLHA 1UJ5A 1R4MB 4MAFA 5ICFA 4EO9A 4EPRA 2XMZA 2F1OA 2MINB 4GPBA 4N12A 2C07A 3R5FA 1CR1A 4RJJA 2WJAA 1P39A 2MCFA 4L3OA 1Y8CA 3TG8A 1N9ZA 1P80A 3NCHA 4NMWA 4OJNA 4P0PB 1NN5A 5A3QA 3TINA 3WL4A 3KZ1E 4RCYA 3UPTA 1INLA 1RYYA 3GOHA 3PFBA 4P3XA 3W4IA 1KK0A 4YUZA 2J9XB 2B2XA 5FNVA 3T3IA 1ECPA 2Z4RA 2NYRA 2P6PA 1N8KA 1JMVA 1E6KA 3CX7A 3P2OA 5ALZA 4LNHA 4HNTA 4G9BA 1MHPA 4ENSA 5IULC 2CV1A 1ZS9A 2JFBA 4EKYA 3KKEA 4GC5A 1SBNE 3K1YA 4YN3A 1V3VA 1LFAA 2OAGA 5LYYA 1PF7E 1WU8A 5IDXA 2BSXA 1NUAA 4D4KA 3DPUA 1OOEA 2B5VA 4QGBA 4CKYA 5K0EA 1OFVA 1XEWY 2IPNA 2XNDD 2EC5A 1WMDA 2BGMA 2X13A 4MQEA 4AKIA 4LE1A 2N3ZA 1ZM2A 1XLTC 2ZVJA 4Q1BA 1T4CB 1GV0A 3ULKA 4I5DA 3OLZA 5EWJB 4QGSA 2L2QA 3NHLA 2Q2WA 4XOIA 2FSPA 3MMXA 1TAGA 2FMUA 1XA4A 3T1QA 4DW8A 2YVAA 5A0VA 1S3SA 1T8TA 1EWRA 1YZ3A 1M34A 2F7SA 1DL5A 1IOVA 2Q6LA 3DB1A 1NL3A 2NXEA 5FOXA 4LZWA 4LXUA 4YMUA 4L85A 4R1UA 4U2GA 1G21A 1FEZA 1F48A 2M98A 3G2KA 4EFKA 3ZWQA 3RUHA 1P5RA 2IXBA 3RDPA 5FFNA 2ZUBA 2EZ8A 3QIVA 4Z49A 5B57C 2NZWA 2ZAMA 1OB5A 2VRBA 2DHRA 1F8FA 2AOVA 3NTUA 5A03A 3GN2A 1GG8A 2GRJA 1MFZA 1FTWA 2J4FA 4K2AA 4JUBA 4RM3A 1WF6A 3H5VA 5SYMA 4C6TA 1M76A 1XIVA 4DCOA 2R97A 3O9MA 1Y3AA 2B34A 1IN5A 3I2JA 3OCCA 4CF7A 1RHUA 1TX4B 2J0UB 2OKGA 4ZA2A 4ZCIA 1FDRA 4GKVA 4M55A 3FMPB 2A1TS 1QR6A 4FOLA 1W581 1FQKA 4NNPA 4XDYA 4BHTA 4WUVA 3D8HA 3I9OA 3ZUPA 1XQ9A 1N6PA 1SGWA 3L6DA 4QAJA 1M0WA 3ZK8A 4EL5A 5GZ3A 1UK6A 3UO8B 3PTLA 1GIAA 4XWOA 3Q0TA 1DARA 3IAEA 4KHPB 3CH6A 3ZDYB 4QL3A 2J9FA 2B0CA 1DQYA 4IMIB 5K1ZA 2H2FA 4KXYA 2PXCA 2D7JA 2JS7A 2RGYA 4WY5A 4D7AA 1G4AE 4G41A 4BJ6A 2ILTA 1NMZA 2QTFA 4LF4B 3AR9A 3OX2A 5KEIA 5K8UA 2REQB 3HO8A 2B25A 2BYTA 1OWLA 2XQGA 4I99A 3T7DA 4C0KA 3SYLA 2J0UA 3AUTA 3GJTA 3REGA 3ISTA 3QBDA 1Y4AE 2Z6UA 3ZHZA 2HRCA 3G1WA 4M36A 3I32A 4XWTA 4KZKA 4QELA 4MEJA 4BNHA 4CQNA 5A2QA 1QAQA 3BRQA 4A1OA 5F9HA 2FUEA 5CLGA 3X1KA 5H4GA 3E35A 4Q47A 3KLPX 1XD9A 5I7OA 2CMGA 5TC4A 1Z45A 5B1SA 3KKZA 3QE2A 4RZHA 1WUJS 5KSYA 3OD1A 3N8IA 3SC4A 1P0FA 4I1OA 2Q1XA 3V8BA 5IFLA 2DF8A 1E2QA 5ELLA 3IKMB 5EN4A 1L8LA 2SHKA 1XD8A 4BNUA 4F97A 2JJ1D 2Q07A 2WUFA 1XTBA 4OATA 5BR1A 2YDXA 1L4MA 3K5PA 2A8YA 2N42A 3TQOA 4KNVA 5G0VA 3T9EA 1OAOC 4BNNA 4DCJA 3CCFA 4RVGA 1IJKA 1YQ9A 2G04A 3SVLA 1D1QA 1WVMA 4UAUA 4FJ1A 2NO5A 4HDSB 3T54A 5JHHB 1I33A 2W2KB 3ANNA 5K6AA 3D31A 3P96A 3C3EA 3C70A 2WD8A 1MH1A 1U4SA 3NWBA 1H8ED 3UWOA 1GA1A 1XO1A 3I92A 1GVHA 4OQQA 3PD1A 4TS1A 5FR2A 4RTOA 1DUSA 1T0JB 1JQAA 2P0AA 2YN2A 3S2ZA 1IIRA 3NAZA 4IGIA 3H75A 3OICA 1G17A 2XYRA 1II8A 1KJ8A 1R5OA 4FZRA 3JARB 1WEHA 1JVNA 4NAVA 3F97A 3HDHA 3I0NA 4IFBA 5ECYA 3GCXA 4BTEA 4DXHA 4LOIA 3GLVA 5BPHA 4GICA 3UAZA 2AMLA 4FHGA 5ERXA 1I4DD 4HX5A 3QVJA 1H9AA 4MR7A 4PIPA 3TIIA 2F3RA 3AB8A 4HH1A 4BU0A 5CB6A 5IT0A 2YJNA 4M1OA 4O6VA 2Z56A 4UHJA 2R4QA 2ECKA 2XRYA 3FOBA 4PN7A 2I33A 5AHWA 1FK8A 1YOVA 4RACA 2TYSB 5AK3A 5KSPA 3CVXA 5E4YA 1YS7A 5AVOA 2PZ8A 1JW9B 1M2OA 3DDCA 5AK6A 3GUVA 2I54A 3ESBA 1BGVA 1OBHA 3UK2A 2DEUA 1HDZA 5AHRA 4LY0A 3A9WA 2G5GX 4AL4A 2R25B 3BGDA 2F1KA 1OV4A 1WAMA 1N9GA 1Z7BA 4RMHA 4ZQFA 3A1TA 4ILKA 1P73A 5E6RB 2B0JA 2W6MA 2HV8A 4A2QA 5A62A 1QK3A 3A3NA 3T7SA 5ADVA 2VJQA 1JHAA 3RWOA 1GTJ1 2CBGA 2X8AA 3JQQA 1NLMA 4GW3A 4MYRA 4REQB 4XCVA 3W5IA 3ZR4B 5JZSA 3O73A 2WB2A 1C30A 1QV7A 2WWHA 1NSTA 3MQFA 1TU0A 4RUKA 3U37A 4DKJA 4DBZA 3LOQA 5B53A 3R3HA 3VKVA 1HYHA 2IT1A 3KUCA 4RD4A 2AFIA 5F4BA 1K7YA 4URYR 4MRNA 2I34A 3GFBA 3FAZA 4IX1A 4OJKA 4R8RA 5EIHA 5C1PA 1QF6A 1WY5A 2HEGA 4IH4A 3GAZA 3DDWA 4Q82A 1MX5A 4ER7A 3HSKA 5JCXA 2AKEA 2GPBA 3CX3A 3U4AA 1F20A 4QOFA 3MJ4A 4URVR 3A1DA 3IAUA 3RFTA 1LZKA 2V5VA 4XIGS 4M1KA 4G5FA 4P3KA 4Z4CA 1S2OA 2XNHA 1G41A 1S4QA 4EB0A 1CDOA 2DBZA 1R64A 4U3JA 4XLTA 4WLEA 1EVLA 4XWYA 3TUJC 4AY3A 4DG8A 2QMQA 2WHRA 1HTWA 2VRCA 1G1MA 1H1TA 1YR3A 3HCFA 3KXPA 1L4HA 1QX4A 4KDEA 3N2LA 2PUJA 3AESA 4NEHB 3HS3A 1KOJA 2PRIA 3P2EA 4JBXA 3ZWVA 4BQNA 2UV8A 4L0MA 4MQMA 4AP6A 1WKVA 4BNFA 1NJFA 1XAGA 3L7JA 3HBLA 3W0LB 9MHTA 1M0SA 4CIVA 4FWBA 5AM0A 4IIXA 3S2GA 3EEOA 3B5EA 2CXUA 5BT8A 3BFPA 3ZEIA 2GZ2A 3L04A 4TWAA 1P0MA 3JYLA 1VG1A 5JLAA 5K20A 4Y2HA 5T4HA 4J8PA 1N2EA 2DHEA 4TYNA 2FEKA 3CZ5A 3VHLB 2CJWB 3VR5A 1R8YA 1IY8A 2W6ID 1SZDA 2JCGA 4E2ZA 3AIKA 3CPEA 1EQAA 2YUTA 4HN2A 3VA7A 3EDRA 5DBOA 4WADA 2Z95A 1JIVA 3U19A 1U0EA 2JFGA 1E3DA 2XQVA 2WQ6A 1DQNA 2JJ1A 4AAYA 4YJHA 2X2FA 4BKUA 4EI2A 3SMVA 1ULHA 1GTVA 3HU5A 4JQCA 4COKA 4G0VA 4N82A 2JRCA 2P1RA 4HQNA 4TYPA 1XZBA 1FB5A 3RASA 1MIHA 3GEMA 2OCXA 4DR4B 5LB4A 4E5KA 1DJMA 4IS2A 1R4AA 2FSIA 3GP5A 3WGQA 4RFSA 5DVZA 4ER6A 4GXTA 3DXYA 3I9NA 3BT7A 3K8QA 1BXZA 1E6MA 1TYCA 4J4TA 3WDLA 1X2BA 5KNBD 2Q27A 2I2XB 2WAMA 1YR8A 3I5XA 2PSHA 3P0EA 3ZG6A 2HA6A 3DPIA 3AV0B 4DBLC 4MIKA 1NSYA 3EAQA 3DT6A 4G89A 2VP6A 3G68A 3RRMA 2EYQA 1QIIA 3V3TA 3BMNA 4D43A 2QDKA 2IZ6A 3NOXA 3OMXA 3R8CA 3UJ6A 5A1TA 1V3UA 1ZIXA 3FOAA 4KEAA 4IHQA 3DWGA 4KFTA 4B4KA 5JT1A 4FYHA 3CLTC 2FZLA 3LXMA 2WW8A 3T7EA 1HYEA 3SIRA 4FW9A 4N65A 4XX1A 1VSBA 3W9UA 2Z8ZA 3H3XA 4JJEA 3ZJVA 4Y2QA 2QGZA 2I78A 3QU5A 3OCYA 3CKLA 3PXDA 5A3JA 2JAHA 3U7FB 1OASA 4QZVA 1MJGM 2ECFA 3KPJA 3N58A 5EKUA 2NM0A 3DYIA 3M2PA 4B0OA 1FRNA 4OV6B 1W9HA 4UCFA 2CSXA 3D6AA 3BJRA 3H2ZA 4GZLA 4EP1A 4UEQA 2K2WA 3EJWA 3IOYA 2HWXA 3S1SA 4ZI7A 4UUNA 4BBAA 3MB5A 1G59A 2FFHA 2JARA 3RVQA 4Q4CA 2J32A 1ITZA 5DDIP 4V1CB 2IVZA 4Z4FA 1DBVO 2D7CA 3U60B 1UBEA 5A4AA 3G5UA 2RHJA 1HT0A 1AKQA 1N5IA 1OIVA 3HY6A 3PUVA 4O2AB 4TRMA 4LMAA 1T4GA 1M83A 2A5GA 1SBQA 2P9QA 2PUVA 4QNRA 5EKDA 4M0DA 1WXIA 2Z57A 3QY0A 5FO1A 3U6KA 3QKRB 1HFKA 2I1QA 1E7WA 2YHUA 3A6ZA 5K3DA 5FUMA 2EJTA 2L42A 1E2KA 1NN1A 1DCMA 1HORA 3HV2A 1GILA 4XIYA 5EXPA 3TAHA 5JEDA 2X2PA 1NVMB 4N03A 3MJDA 4N5NA 3B6IA 4WZBB 5ALJA 4YV0A 5A9SA 2OO7A 4FIZA 1GAWA 1M5UA 3W2HA 4LVCA 3TW0A 2VL7A 3ZWMA 1RPNA 2WPNA 3KWFA 4YRPA 4MHSA 2W8ZA 1W5FA 2VNHA 2N46A 4NK4A 1PK9A 4IDOA 4AI6A 2D5IA 2OM6A 5IANA 2ZREA 3N2YA 4GZMA 3KSZO 4RMJA 1A76A 5KNBH 2H2WA 3A8TA 2Z6VA 1N2CA 3JYHA 3AR8A 4JOBA 4RWZA 3SF8A 4U1RA 2ACVA 2JHPA 2ZVQX 3D8UA 3E0QA 1EK5A 3JPYA 2VUSA 3PK0A 3K9BA 1T8RA 4R8MA 3CLUD 1ZHFA 3KPWA 3RAPR 4DC9A 4EOGA 3I9KA 1ABEA 4LJRA 5HQ3B 1JU3A 1F3OA 1D03A 4I4TA 1R4NA 4MS1A 3WLLA 1CDZA 1JQ5A 1PBNA 1NYTA 1SUAA 2FW1A 3SD7A 1ZUHA 3BKXA 5CGQB 5G40A 3HXQA 2Z1NA 4YNBA 3L0YA 2ZUDA 1J99A 1ZMTA 5JANA 3VKHA 2QS9A 2PM8A 3FYUB 4E5VA 4FFSA 1C3JA 4ROTA 1A04A 1AX9A 2EG9A 3LBNA 4HMQA 4UMEA 4YGXB 4RTKA 2IH2A 1P60A 4L5IA 4EA8A 3GJZA 3KJGA 3WK5A 4CR8A 4L0DA 1VKZA 3F6EX 1S3IA 1V9LA 2UDPA 1NM5C 1LJLA 4DCMA 1Z36A 3MPOA 3HBMA 3GK3A 5AM5A 4CKZA 1QTRA 1WABA 2EL9A 1R5NA 4JBLA 2O0JA 3FNRA 5JAPA 4KHZA 4GMXA 2GUGA 3OE7A 5B6JA 1CZKA 4IIHA 1GDTA 1U80A 4PGHA 1JE0A 1TYBE 4K9RA 3CE6A 2X14A 1ZUNB 3D0OA 2DR0A 4R2WA 4B40A 5BNZA 4H1UA 4H0CA 3I53A 4MP6A 2XVZA 1AGPA 1CF9A 4XWWA 3EFHA 3D2LA 1S2NA 4BNIA 5CXQA 3EX7C 1KFCB 4AJLA 4S04A 1HG0A 5CB0A 1BDIA 5A0TA 3OURA 1CBUA 5CA1A 5LQKA 1KC1A 3W2GA 4WXEA 2PH7A 1IH8A 2NYVA 1OSNA 2VT2A 3EVNA 3EW7A 4TV9B 3N07A 4PSUA 3BD8A 4HR7A 4IMRA 3TXAA 4CKXA 2R4TA 1LBQA 4MKZA 1UANA 1J1IA 2C8VA 3JRWA 3LT1A 4PGAA 4UQPA 4D2IA 4F86A 2FE4A 1Z4MA 1I2AA 2M6RA 4YRCA 4B43A 4LY3A 1N2XA 1FCJA 3RJ5A 4MJXA 2CCGA 3E0XA 1GGMA 4Y2JA 4W6ZA 1IHDA 1BGXT 3LKDA 4GU5A 4MARA 4QVGA 1IEXA 4HLDA 2LPMA 1U7DA 4HGYA 3RYHB 4QEKA 5LYJA 2BFNA 3ZGYA 1Y8AA 3OLWA 1V7QA 1EAYA 5FAXA 2I4LA 1X14A 2Q4EA 3LHFA 5TY0A 5ER9A 3THRA 4XH9B 3EQZA 2AVNA 4DM7A 4GPEA 4ID3A 3SLRA 3SC3A 3AY3A 4CG0A 4ZC8A 3ZHQA 3RSFA 2OOSA 2WWTA 1F5NA 5EJGA 2HBYA 1Z37A 3QKRA 4GP6A 4WT7A 3D0RA 4X00A 1AXGA 1JEDA 4UUPA 3IA2A 4KPYA 3C8ZA 2ZTHA 3L6EA 4BP3A 3H0KA 1AB5A 4ZN6A 4PHGA 4UU7A 1V39A 3IE1A 3D1LA 1W6RA 4BVJA 1WQ1R 1QYWA 1G9SA 1N1EA 1RYNA 3DHNA 1JX6A 3H8WA 3OZWA 4UATA 3TNYA 4F4HA 2GKOA 3KQYA 4ALKA 3D3WB 2DWUA 5L4LA 4PXSA 3DL7A 2PQMA 2Y66A 1VPWA 3I42A 2LE0A 1F3LA 4U00A 3GCGA 1VHTA 1VGQA 2QX4A 4QYIA 1NJ6A 1GGJA 3V6LA 3HG7A 4E32A 3SE0A 2KLBA 3DC7A 4WZAB 3WMRA 4M21A 4KQIA 3SZLA 4KXQA 1WPXA 3UAXA 2BZ1A 3OUTA 1PIWA 4RYDA 1R2QA 2PSSA 4RGVA 2ZBFA 3DNFA 1RKVA 2BHSA 3D6FA 4NAUA 3EB9A 4OU5A 1QVVA 1FMJA 1C3VA 1WW2A 2LCQA 2C7GA 3IUQA 4OLJA 4EARA 3ZE2B 5JNLA 2PX3A 1AS0A 1U9CA 3AHGA 3DCIA 4WY2A 1JEQA 3GBSA 4U6QA 3R4VA 4MKXA 4UCQA 3BGOS 3FPAA 2XEXA 3DAOA 2FEOA 5KHLB 3ZHOA 3QHPA 1JLSA 4QUHA 3TSOA 3FUXA 2B82A 1NSFA 2C04A 4UBNA 1T0UA 1P33A 5KZMB 2GJKA 2A0XA 4QUEA 4HNSA 5A5GA 3AKYA 3DXFA 5HKLA 1E98A 3DDZX 1EJBA 2XIJA 4HVAA 4MRPA 3NHFA 4CF4A 1NTOA 2D8AA 2F64A 2Z08A 4ZALA 5BSEA 2ZT7A 3CEAA 1EB8A 3CSUA 3ENVA 3HXOA 1WV0A 1OZ0A 5HZGA 4PE5B 4QJ5A 1OIXA 2B5OA 4W4TA 4WJKB 4EBFA 2G6TA 2YJ3A 3P27A 4P82A 4EX6A 3FHJA 4JBWA 3RTDA 4CKBB 1E9RA 1G3MA 3L4BC 4BLSA 3HA5A 1IZ7A 1O58A 2QVGA 5C18A 1E79D 1NM5A 1I9CA 2QJOA 4YRLA 3ICWA 2O8CA 3E2MA 4Z9BA 2BFMA 1YAHA 4DV4B 1QLJA 2H18A 1ETHA 5DOVA 3O9VA 1N34B