1N6NA

Crystal structure of human rab5a a30r mutant complex with gppnhp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
167
structure length
167
Chain Sequence
b'GNKICQFKLVLLGESRVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-5A
publication title High Resolution Crystal Structures of Human Rab5a and Five Mutants with Substitutions in the Catalytically Important Phosphate-Binding Loop
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 56
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2002-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1n6nA00
5CYPA 1KK3A 1E79D 1F6BA 3AKEA 3IDQA 4E5UA 5E95A 2IYQA 2WWYA 5JMTA 3THYB 5JJKA 1BKDR 1QHIA 2G3YA 2C98A 2GVDC 3AV0B 3CR7A 3FMIA 2GJSA 3B1VA 2H16A 2RB4A 4KAXA 1W4CA 3NHBA 2BKUA 3A6PC 3OEED 4JVMA 3CO5A 1NRJB 4PFSA 4URXR 1X6VA 2DR3A 2KWIA 4LZZA 3EA5A 4N0DA 1G9XA 3DL0A 4LJ4A 3TUZC 3SOPA 1HE1C 1DAFA 2JAQA 1U2RA 3RS7A 1UAAA 2DHRA 3GEEA 4D2IA 3NVAA 4B6FA 2JJ8A 2IA5A 1XMSA 4GZMA 3SNHA 4E03A 1F60A 1UBGA 2CCGA 2PCLA 4N1AA 2GJ8A 2A5FA 1R0ZA 1KI7A 3THXB 3LO5A 1LF5A 1TEVA 3KFXA 4DCNA 3SJCA 3NBYC 3VQTA 4EAQA 1G20E 3OIVA 1JNYA 2D2FA 4M2LA 5FOSA 3BB3A 3OIYA 4O2RA 4LGMA 3KQHA 2W0SA 3LVRE 2YC4C 1KI1A 1TU3A 2GZDA 4URWR 3ONWA 1W48A 2O8BB 3CM0A 3AP3A 3OIUA 3T1QA 1U81A 1LFDB 4Q7LA 1OH7A 1KSJA 2CHQA 3KJIA 5G53C 1ZNXA 3U44B 4K81B 3UK6A 1Z6GA 1KZGB 4IXMA 3GJ3A 3TE6A 3X1XA 4F93B 3L8ZA 4LPKA 4FI3C 2R62A 4BASA 1QG2A 4TL9A 1XXHA 2GJKA 1TNDA 1B0UA 3KKQA 3K0FA 2G9NA 2FFAA 3ZYCA 4S2EA 1OB2A 1FPMA 5J5CA 3QG5A 2ZR9A 3RS4A 1VECA 5C4GB 3CRW1 4MGZR 4IVQA 5FBLB 4DKXA 5LD2C 2ODNA 3CX8A 1X8KA 4C0LA 4LV8B 3BERA 2OE2A 3AF0A 4Q4JA 4DIDA 5B64A 3NXSA 121PA 5DI9A 3QVVA 3J81k 1ZUHA 2GF9A 2YHSA 4I1VA 2QA5A 3N2EA 3GMTA 3OFND 4B75A 1CBUA 4DLXA 3EZ7A 1G5TA 4HDQB 4D81A 1N6HA 2RGNC 3K0CA 3CF6R 1UKEA 2ZJZA 4TN1A 1D8TA 1P62B 3C5CA 2QL6A 2LKDA 1RRGA 4MUAA 4HB0A 4Q9KA 2XXAB 3TK1A 3OE7A 2FNAA 2FOLA 3IGFA 1CJMA 3ZVNA 4JLAA 4BZQA 1AGPA 2GJ9A 4C9BA 2ZJ5A 4YMSA 2WAYA 1IOZA 1U98A 4V0KA 4JKIA 2C9OA 2KBFA 5K8UA 3W5IA 1SVMA 1M74A 3LBIA 4FD2A 2F6RA 2NZ8A 2DFTA 1VG8A 4BLTA 4W5WA 4LJ7A 4DDTA 3SC3A 1N3BA 2AK2A 2IHYA 1FMJA 5CDFE 4Q7MB 2GRJA 2IW3A 3OE7D 1NKSA 3SJBA 3D3QA 2FX3A 4YONB 1DOAA 1KI2A 1X8LA 2YNMA 4NTZA 2OZEA 3R8FA 4DLYA 2JLSA 1XMIA 3FB4A 4EQ6B 2VP6A 3I8SA 1O87A 4QFMA 2GCOA 2VPPA 2YWEA 3QY0A 4CEJA 2D74A 3F0TA 3KB1A 4KYIB 4YXWA 3AVTA 1G7SA 4HUTA 3T5GA 5CB6A 4YC7A 2O0KA 5JCPA 1II8A 2ZUDA 1OV4A 4NKRA 1SKQA 3TVTA 5J40A 3U2QA 1OH6A 5EE9A 3LLMA 4TQAA 1NBME 4RFSB 3ZS8A 2R6DA 5DHFA 1E6CA 2AWOA 3O8DA 4A4DA 4DIEA 1N2CE 1T5IA 4UNSA 1GNPA 3M4YA 2W6ID 2WJIA 2ECKA 5FL7A 3VHXA 5IDVA 5JI2E 1LS6A 4TL6A 4ZPXA 4ACAA 3RDPA 4B2IA 3ND8A 4YXWD 3WNDA 4Z54A 2B8WA 4JZKA 2N46A 4DLWA 3B1YA 1E94E 2EWVA 4FW9A 2EU8A 4LHWA 4DWJA 1Z08A 4OI4A 5FL7D 1DELA 5CDFA 1G4UR 4JLKA 3EZ6A 4KXFB 2HF9A 821PA 2ZS8A 3KKOA 4C30A 5EZ6B 1YR9A 3MGCA 1JR6A 2ANCA 2P0EA 4GRAA 3MD0A 1NY6A 2CJWA 3R9XA 3QXXA 3WMEA 4RY2A 5EE5B 2O0HA 3T1OA 2XAUA 4K8OA 3DEFA 2QNRA 2Z83A 1G17A 2EFHB 4KI0A 1RKBA 2JJ2A 4JL5A 5DSZA 5A5GA 1SVOA 4G1UC 4HLQB 3BJIC 2ZI6A 1YR7A 4TTPA 3CIOA 1GRRA 1NBMA 2ZRCA 3U3RA 3AUYA 1E9BA 3W3AA 5FPSA 1UKVY 5FUVA 1NY5A 2IYLD 1QHSA 4S35A 4CRWB 1WA5A 5AJZA 4P31A 1IJEA 2BMFA 3AVQA 4B47A 4FWTA 2R65A 4RD2A 4EDHA 3C8UA 2BBOA 2JJ2D 4B6EA 2XEXA 4LYAA 3QE0A 3B1ZA 1G8FA 2ERYA 2ZS9A 4PQFA 3HDTA 1G3UA 4LYFA 1FZQA 1MR3F 3K1JA 3BH6A 1G291 1NBMD 2CNWD 3OHMA 3UATA 3SN6A 2IWRA 4OI0A 3KKMA 2ZPTX 4KFSA 2OFWA 1P2TA 2ZI5A 1JJVA 3K8YA 3L0IB 3VKGA 2XTNA 1FX0B 3U4QA 5L3VA 3IHWA 3NEYA 4OJKA 3L8YA 3FFBA 5DHAA 1G6OA 1JQJC 2REOA 3OF5A 5HCNA 1G8YA 4GOJA 2V6IA 1UBCA 2V55B 2XTZA 4AYWA 3SBDA 2ZETA 4PSVA 4ZDIA 2FU5C 3THWB 3TVDA 4ZDWA 2FE4A 1S3SA 3W3ZB 4Q01A 2QEQA 1D2MA 3QF4B 1SQ5A 4B71A 1NJFA 3IILA 3KQKA 4FXPA 4IFEA 3GLGB 1HQYE 4MRRA 3K53A 4Q1CA 1GTVA 4PPFA 1ZP6A 1CR2A 2EYUA 2OFXA 1SULA 1T8UA 2OSBA 3AF3A 1N0WA 5KSZA 3CWQA 2V4ZA 4M1MA 3PFIA 5L3QA 4LV6A 3SBEA 4PSAA 1IY1A 4JVNA 5M04A 3SYLA 1VCOA 2B6HA 1FTSA 1T4GA 1V43A 3EC1A 1GFIA 4LBVA 3H2YA 1R8QA 3TQFA 4B76A 1OHHD 3IPYA 4DJTA 2OBMA 1XEXA 2ZXUA 4KLNA 4GP7A 5CJPA 2FPMA 1S0UA 3C16C 4OHWA 1NIPA 1JBKA 4OYHA 4DSNA 3VNVA 1XF9A 4QL3A 5FR2A 3LQQA 4QHTA 2HYIC 2XITA 3F3YA 4B44A 2F43B 1NLFA 2CEAA 5HTKA 3G82C 1A5TA 2CVFA 2IF0A 1IQPA 1Z6XA 4JLNA 4TYWA 1NLYA 4OBEA 3K9GA 2V1XA 3TH5A 1AS2A 2GAOA 1E9EA 2W0MA 5B57C 1KO4A 1XTQA 1CR4A 5JBQA 1JXMA 4D6PA 1DAIA 4I99A 4L16A 4FCVA 1R5BA 1P5ZB 2ZRLA 4ZIRB 3KX2A 3B2EA 3K70B 1IONA 1XTRA 1DAGA 3THYA 4NCJA 2C77A 4PX9A 4B34A 4TYQA 4WA7A 1YZQA 4DSUA 2ZYUX 4AYXA 2A78A 4Z1MA 3ZH9B 2D06A 4WZBE 4LC0A 2IYSA 1E1QA 2KBEA 1Q0UA 5C46F 2NIPA 1Z47A 1P4SA 1HURA 1RVDA 1RRFA 2RHMA 1KGDA 3AF2A 1KDRA 1W4BA 1ZU4A 1EFHA 1YZLA 4Q19A 2YJTD 4KSBA 4LX0A 3K0FB 2GHIA 3DZDA 2VHJA 4RJLA 2W2XA 4OHZA 3K0SA 2P5TB 1OH5A 3EX7C 4Z1MD 1XTJA 1Z0JA 2ZI4A 3AVPA 2HV8A 4JVLA 2VRWA 4G5GA 4TQ9A 3WHKA 1CEEA 1KJWA 4TT3A 1NJGA 2ZJ2A 4IKEA 3H84A 4FN5A 2A3RA 4Q1FA 4CDGA 3GLHB 1G8PA 5GJBA 4U7DA 1C1YA 3K0CC 2NGRA 5ELXA 4JVSB 4IDOA 4FCWA 1GM5A 1W44A 4TZ0A 4C7OB 4AC9A 4JLDA 4DDWA 2ERXA 4RD0A 2J7KA 2O8BA 2UZ3A 5D3MB 4PZYA 2CL6X 1GZSA 2YV5A 4O0MA 3I4LA 2WWGA 5E4FA 1N6PA 2KE5A 4MKHA 4POAA 5GJVC 1Q57A 4YMWA 2AXPA 4TT3D 3U3OA 4ABYA 3U44A 1WE2A 4P32A 1ZD9A 1CR0A 1W36B 2BVNA 2W2VA 1AKYA 2R6CA 5AK0A 4BFUA 3W9YA 4BLRA 2A5DA 2XZLA 4RVCA 5F9HA 1TQ4A 2C9YA 1ZM2A 2BBWA 4X8OA 3TQCA 4FIDA 3W90A 3RYTC 2GEDA 5EP3A 2JLUA 2ZR7A 1COWA 4GL2A 4IDPA 2ODWA 5BN3A 5KOYA 4GMXA 4ASUA 4URYR 1XJ0A 1KSFX 4A8JC 3T1VA 5JCZA 4YLGA 1R10A 1Z6AA 3ZZUA 3W6NA 1PJRA 2A2ZA 3FMPB 1FUKA 5FR1A 3AM1A 3TNFA 1JEEA 3NG1A 2RHDA 4CEHB 1I4TD 5JEDA 4NYIR 3LLUA 4DLUA 4G5QA 1E2PA 2PEYA 5AUQA 2GK7A 3IO5A 1W4RA 4PC3A 1Z6YA 3DM5A 4NCIA 3F5FA 3TAUA 4RD4A 1TF5A 3CR8A 1IXSB 4MUBA 1WRBA 3LBNA 1OPXA 2IS6A 4PAQA 2E9SA 3P4XA 2XXAA 3FKQA 3GJ6A 2D4HA 3FYHA 3IBYA 4MDEA 3IIMA 3W8NA 4QM6A 2FN4A 3CH4B 4JBXA 4A36A 3AP2A 1JPNA 2IF2A 4CGZA 1VPLA 1G7TA 4OHXA 5KDOA 1OIWA 1OYWA 4F4JA 3EC2A 4GNKA 4FINA 3HJNA 2ZE6A 2ZIAA 2IS1A 5AUNB 1S3GA 1KHTA 1XMJA 1NF3A 3BOSA 4JYBA 3QEJA 1I2MA 4M9ZA 4U5XA 1U0HC 1Z5ZA 5KSOA 1A82A 2CMKA 1C4OA 1ZC3A 3WMFA 1XFAA 2ZI9A 5KYKA 2A9KA 5H70A 1H8HA 2PEZA 3CF0A 1TTTA 4TYNA 2JLVA 1OXUA 4DC9A 8OHMA 1ZU5A 1U8AA 3I92A 2OV2A 4EQ6A 1II0A 2C95A 3LH5A 1W5SA 4Q00A 2J87A 1GL6A 2R9VA 5FTKA 2QAGB 4Q4HB 1XTIA 2GTPA 1Q20A 3P1JA 4A6XA 1ZUIA 5FBWB 2AX4A 4RFSA 1H8HD 3V4FA 4QJ5A 4CEIB 4TYPA 1TX4B 2IUTA 2A7QA 1KI9A 4HAXA 4US2R 1GOTA 5J4YA 3FDIA 1O3YA 5SZIA 1NSTA 4LBWA 4XWKA 4JL8A 2Q3MA 1AIPA 2XZOA 4AG5A 3TJZA 3X1WA 2ZSBA 4B33A 1AQYA 2ZRPA 1AZSC 4GOXA 1OFUX 1Z0DA 3CW2A 1K5GA 1U8YA 3AVUA 1U9IC 1XMVA 1W0JA 2FSIA 2PLFA 4K46A 4MH0R 4D26A 1ZAKA 4I4LA 3W8RA 1HEIA 1YVDA 2ZRFA 4MQBA 4UXIA 4OK3A 1L2TA 1G6HA 2DFNA 3UXMA 2XGJA 4R98A 2RGAA 3I3SR 4HUQB 5FOUA 5BYJA 1ZD8A 1GWNA 2ONJA 4II7A 2RGCA 3UWKA 5C18A 2F55A 3AVXA 1IHUA 1Q3TA 1DO2A 3HWSA 4LI0A 1BYUA 3EARA 3BC1A 5JS8A 4ZCMA 2IYVA 4MGYR 2CVHA 2AD5A 1T3SA 3VR4A 3AVOA 2J3EA 2VHQA 2P67A 3Q72A 3KJGA 2OM2A 1XRJA 4L5BA 3LV8A 3I73A 1CU1A 3X2SA 3GLGE 1HYQA 2GBLA 1YKSA 1TU4A 2JGNA 2WKRA 1U94A 2QMUA 2ZRIA 4LHZA 5BW8A 2XB2A 1GL9B 2CXXA 2F7SA 4PC7A 1WBDA 1KIMA 2BEJA 4DSTA 1ZNWA 2BWJA 3AKYA 2IX3A 4LUCA 4MYCA 2AKAB 3AF4A 1OXVA 3EIQA 1FQKA 2I4IA 2AN9A 2RKOA 1IN7A 1DVRA 4JLOA 3NBFA 1PZNA 1UDXA 1VYUA 4PZLA 2WJVA 3CLVA 4QM7A 2WMOB 2IYYA 5D3QA 2J5XA 1Q22A 5KUTA 1FP6A 2J1LA 2YOHA 3OESA 2BCGY 4I1OA 1X86B 1TQ2A 3SHFA 1N25A 4LHYA 1FX0A 2PX3A 3M0EA 1XEXB 3DO6A 4C4PA 3U7GA 3RS5A 4D80A 2HJGA 2P6NA 5F3WB 1JJ7A 4JT2A 4KV9A 2WKPA 1JPJA 5AR1A 3FTQA 3BH7A 1EFCA 1GKIA 4GI7A 4XVQA 3THWA 5F9FA 3K9NA 2MSEB 2PZEA 3NBZC 2ZJYA 4BLOA 3QF4A 2XZPA 2XX3A 2F1RA 2G88A 4D4MA 3GLGA 3MRSA 4Z8YA 3MWKA 2QUZA 2QPTA 1KDTA 1VG9B 1EXMA 4A0GA 3CF2A 5FUWA 1G3MA 2JATA 4NE2A 3MFYA 2ZRDA 5J47A 1AA9A 4IDHA 1JAHA 2WKQA 2XNSA 4UXJA 1IN4A 4QG7A 4QGHA 4LSGA 3VTKA 3PUYA 5K8TA 1SXJC 5JJLA 1DADA 1KOFA 1DAEA 3PEUA 4Z8XA 1W4AA 1S9DA 1UEIA 2QMEA 4PC1A 2WWWA 1F3OA 4EPXA 2DCUA 2OO7A 5H8WA 2OAQ1 4GDFA 3GJ0A 2J9RA 4TSFD 3VFDA 4ZI3A 1DO0A 1J70A 3AGQA 3DKPA 2Q9AA 2ATVA 3DM9B 4M9XA 1JAIA 1OXSC 4Q66C 4D82A 3P4YA 1OXXK 3LXRA 3D6TB 4HEJA 1FQJA 2W6JA 4LCBA 1CJUC 1HT2E 2F43A 4NH0A 4DSOA 2CDNA 4NCHA 1KDOA 1ZNZA 1D9XA 2ZTSA 4PAOA 2GZHA 2Q9CA 2X77A 3GLHE 4HAVA 2ZVPX 2ZSEA 2MSDB 3UWOA 1XJQA 4EPRA 2HXYA 1CJKC 1T9HA 4L9WA 3BD9A 2KSQA 3EG5A 2WWHA 4C2UA 4ZIRA 4PHTA 2K5UA 2W6JD 2B7CA 1A7JA 5FTMA 4IOKA 2QGNA 4M53A 2IEZA 5CM8B 5BQ5A 4W5JA 4A9AA 4B2PA 1QHGA 1U0LA 4Q9HA 1IXZA 4KBFA 3B82A 2JCSA 1JI0A 2HUPA 2O8DA 4CVNA 1US8A 5EXSA 2FGKA 2YOGA 3RNLA 1N5IA 1CR1A 1ZYUA 3I72A 3KUDA 4EPVA 3RHFA 1J2JA 3K70D 3O8BA 3WHLA 2NPFA 3PCRB 3QOFA 2CBZA 1N6IA 3OFNA 1OJLA 1CF4A 2IC5A 1ZBDA 1H65A 3W6PA 1HE8B 1UBEA 1U90A 3DOEA 1MRSA 4TLDA 5AUPB 3P20A 3LA6A 4QJ4A 4AG6A 1J8YF 4YMVA 3T34A 3GLHA 5G41A 1Z63A 3VKHA 4ZCLA 4JLMA 4PO1A 2ZI3A 4XVUA 5CIQA 3TW4A 5EQTA 2RGXA 4XSHA 4Z51A 2NTYC 4RD1A 4C7OA 2QTFA 1KJYA 3Q3JB 3LX8A 4KODA 5FOWA 1KMHB 3GJ5A 4Q4LA 5D3MA 3VX3A 3NWJA 1L4YA 3T12A 2YOFA 4A0RA 5EP4A 1M7HA 2O8EB 4A6PA 3B7GA 3C14C 2V8OA 1OKKA 2F9MA 2NZJA 3LBHA 1W49A 3X1ZA 1N6OA 1FP7A 3PENA 1OIVA 4PR0A 1OFHA 3WY9A 1RC8A 2EFEB 2W00A 5SZHB 2MSCB 5CK5A 2QG6A 4M9SA 2IT1A 3M6AA 1F2TB 1VCMA 4JT4A 2WIAA 4AD8A 2BV3A 4US0R 4G5SA 2QP4A 4Q03A 1XPUA 4GSYA 1FNMA 3FMFA 1ODFA 3HU2A 4DCUA 1EFRD 1YU9A 1W36D 1OKKD 2WWIA 1OH8A 3LX5A 4C0JA 1NNEA 1S4QA 4AYTA 3G5UA 3MLEA 5JHHB 2QENA 4HDOB 3SU8A 1MO3A 1S96A 2GCPA 1JB1A 5JWOA 3SQXA 4EJSB 5EUQB 5JS7A 1CXZA 4BRWA 3RSLA 2AL7A 4PPQA 1K8RA 1ZIOA 3OAAA 4CEHA 3SR0A 2W6IA 1KO1A 1S1CA 2VP4A 1J7KA 2ZRKA 4NDZA 5FBQB 1XDBA 2QBYB 3JZMA 2BJVA 1N6NA 3R20A 5FTNA 4BPBA 3I1FA 3T61A 2GKSA 1CULC 1LVGA 1PLKA 4M1YA 3ZVMA 1BYIA 1E32A 3MG9A 2P3SA 2BM1A 1UM8A 4MGIR 1KK1A 4BFVA 3SDZA 4F7WA 3QENA 4QBFA 1NL3A 5TARA 3GFPA 5FH9A 3OAAD 4QKQA 3AGPA 4HAWA 1GVNB 1Z07A 2QTHA 2QGZA 2V54A 5CLLA 4RZXA 3RC3A 5IF9A 4WOPA 3ND9A 4EUNA 1EFUA 4CYMA 2QM8A 4P4SB 2P5SA 3KDSE 1IN6A 1Z2CA 3L2OB 3MUFA 3AQ4A 1ESMA 1JR3E 2J45A 4KYUA 4QNMA 2EVWX 5E7MA 4Q9JA 3EASA 2BMJA 5BYKA 2ZYWX 1OYYA 4CZ2A 1LB1B 5H1YA 2IUSA 3VR3A 1PLJA 1NN5A 2OLKA 4TTRA 5CLQA 1NMYA 4QNRA 1QG4A 1WQ1R 1JALA 3TSZA 1XBTA 5BXQC 5FOVA 1MOZA 4HB4A 4TMZA 3KXKA 5CB8A 3BH0A 1Z8FA 1WBBA 2ZRHA 1GG2A 1L8QA 1Z6TA 2BHRA 4HZIA 2CHGA 2FGJA 2QSZA 4LDJA 3CH5A 3T06B 4CF7A 2WAXA 2C2HA 1ETUA 1OLOA 2GBLC 2R2AA 3EA0A 3IHLA 4IOMA 1CS4C 1E69A 1EFTA 3CUEF 2QAGA 3PQCA 1L7VC 4Q4HA 4NYIQ 4BUJA 4YMUA 4Q1BA 3GEHA 2X8AA 2Z0MA 1RRCA 4CEIA 2FZ4A 1W2HA 4B43A 1RZ3A 1VHLA 2GJAA 2P65A 4LJ5A 4X8HA 1M1YE 3QXCA 2CNWA 3U3MA 1E0JA 3WYAA 4KO8A 1HUQA 4F38A 4TMWA 1CKEA 2ZRNA 5KSYA 4IFBA 1J8MF 1ELOA 1Z06A 2FZLA 1UF9A 3D7MA 5DLQC 3WRYC 3CWZA 3CRMA 3VR5A 1ZM7A 1Z83A 1G16A 2XSZA 3JVVA 4XWOA 3U6BA 4IXNA 1XX6A 1YR8A 3UKDA 1TQ6A 4EFMA 1JR3A 1MV5A 4Q7KA 2IHBA 4U02A 5TDHA 4HUQA 1VYVA 4WZ6A 4BQSA 2OCAA 4DLSA 5CIWA 3PEWA 2X1VA 5FTJA 3ZD6A 2GVZC 3E5HA 3ZVRA 3B1WA 1S9HA 2JJ1A 2TMKA 4DCSA 4PQYA 2WICA 2XSZD 2IEYA 4A2WA 1ZINA 1AS0A 2BM0A 4JSTA 2RGDA 1NVVR 3TSOA 2VH5R 2ZEJA 1JR3D 4HB3A 3QBVA 3HU3A 1E2HA 2ASEA 4D25A 2DPXA 3HR8A 1LV7A 2QMHA 2R8RA 2QU8A 4B3GA 2PZGA 2ODEA 2JJ1D 4IDQA 3GJ4A 1NVUQ 2DWPA 5HE8A 4MRSA 5EXTA 1NKTA 3TLXA 2WWFA 2J7PD 3PJRA 3B85A 1SVIA 4PTLA 1TMKA 3VX4A 3MWYW 1OHHA 4JJKA 2H8KA 2CE2X 4ZDKA 1TF2A 1ZW6A 4B74A 4C2TA 1DARA 2ZANA 4A0FA 4M4SA 4UNQA 3A1SA 2DFKB 1ZUNB 4Q7JB 3B13B 3FOZA 2JIZA 3TW8B 4HLDA 1X1RA 4BFSA 1P9NA 2QY9A 4NMMA 4DHEA 2X2EA 1GAJA 1XNJA 1Z22A 4AKHA 3E1SA 3BGWA 3Q5EA 3N70A 2DWOA 2YINC 3QJYA 4ESHA 4HDCA 1P9WA 2QORA 2VHUA 2WPDA 4URZR 2PH1A 3QKSB 2ZUCA 1GILA 2GILA 1RE0A 4TL7A 2Z43A 5HE9A 3DDCA 3FE2A 3O47A 1N6KA 1P6XA 2JIZD 3QPUA 5CYOA 4DB4A 4LOAA 1E3MA 1LS1A 4RD3A 4TMXA 2G0NA 3TUIC 4D4JA 2D3WA 4ILEA 1GDDA 1MH1A 3NC0C 4FWIB 1E9DA 1CRQA 2WPDD 4F4CA 5F98A 1UKYA 2OG2A 2OESA 3A4LA 4KFTA 4F91B 2ORWA 2DY1A 2GESA 4TWZA 1G8GA 3IIKA 4WAUA 3RANA 2ONKA 4KBGA 3VNUA 3JZAA 3I62A 2ZAMA 1PV4A 1TEXA 4A92A 4OQMA 5ANRB 5B58C 2REXB 1NG9A 1D5CA 1XD9A 4M22A 4MYUA 1P60A 4KSCA 2O8DB 1GL7A 2H1LA 4GMDA 1LF0A 1US8B 1I4DD 5EP1A 1PVOA 4HLUA 3EPKA 3GEIA 5LDDC 1G41A 4LJ8A 4FMDF 2BEKA 3BB1A 2VP5A 4G5RA 2ORIA 3D8BA 4Y0VA 3UMRA 3ZGXA 3VMFA 2YZ2A 1NIJA 4TMKA 5SZKB 1XB2A 1WF3A 2W58A 2G1JA 2QT1A 3R7WB 4PO8A 1QHXA 4D4KA 4M1WA 3KKPA 4YQFA 4Q21A 4DLZA 1WCV1 3V4RA 4B32A 1Q3HA 1KZ7B 3VR1A 3HU1A 1AJEA 1HA3A 3PUZA 5KHOC 1Z0AA 1P75A 3QSYA 2VLIA 1W36C 2AFHE 2B7BA 2AR7A 3Q9LA 2FEOA 2BBSA 2O8FB 1Q1ZA 3X1YA 2WTUA 5EZ5A 1T8TA 4HYYA 4O2LA 4GOKA 4IOLA 5KDLA 3WMGA 3WNCA 1YHNA 2HLDA 2VF7A 2B8TA 2ZSFA 1R7RA 5AUOB 4X8LA 3ICQB 2IYRA 2ZS7A 5GVRA 4E07A 2YC2C 2YWFA 1SVKA 4GZLA 4KITB 5JEEA 3GFTA 3PG5A 1G7CA 3LXXA 3RS0A 4DCVA 3MJRA 1D6JA 1QHNA 4BLQA 1CJVC 3A8TA 2QPAA 2ZM5A 4QHSA 3GLIE 1OB5A 3T15A 2FPLA 3FKSA 2KI5A 4DBLC 2HLDD 3CPEA 1ANKA 3P27A 1E2DA 1T0HB 1VKJA 2ODBA 4CT4B 5BN5A 1F5NA 3A58B 3Q7PA 1SKYB 3AKDA 2QAJA 2VP9A 3EIHA 1Q21A 3QNUA 2GF0A 2WOJA 3REGA 2D62A 4IHQA 4NU0A 1AKEA 5DI3B 4Q5IA 5L8VA 4P4TA 3JVUA 2IWHA 4TZ6A 3FKSD 3ADBA 4LJYA 4M1TA 1KMHA 2O5VA 3I61A 4URVR 1CRPA 4R2IA 2IXGA 3N2IA 4R7ZA 1XCPA 4QBIA 2X2FA 2LKCA 3ADDA 2IYWA 2H18A 2EFDB 4MKIA 2O8EA 3QF7A 1FUUA 3R9WA 3H1TA 221PA 4QGAA 5FOTA 4BWYA 2J0SA 3IUYA 4DEYA 4CT5A 2R6FA 2C04A 2IS2A 3GJXC 3ZJYA 5AJWA 4B3BA 2FV8A 1XJCA 4TLEA 1F2TA 1AZTA 1G5RA 1KI8A 3QKRB 3UMSA 2ZJBA 2C96A 3LW7A 4FMCF 4LPSA 5IK2A 5J4VA 4A8JB 5KO2A 1EWQA 1MO6A 3TR5A 1JECA 2O0JA 2OILA 4DEXA 1J99A 1R4AA 3OZXA 3HYTA 3UPUA 1GIAA 2Q0HA 5J4KA 2E1RA 3BB4A 4N0EA 1E2QA 2OCBA 2QAGC 1RFLA 4NONA 1KSGA 4EJSA 4G01B 5TMPA 1S2MA 3NDBB 1G3QA 1HH4A 3QPWA 2ZUBA 3A1TA 2CCJA 2RGNA 4DVGA 1KI6B 1F2UB 4ZV4A 5IK2D 4JBYA 2QBYA 4MRNA 3TUJC 5CM9C 4G3XA 3RWMB 3BAFA 2WSSD 3SYKA 1KTVA 4W5HA 2YVUA 4L4UA 3T35A 1JEDA 5JI3E 1GUAA 3SJAA 2QROA 3M1IA 4ZKEA 3IEUA 2FMXA 1E9FA 2IBMA 3TRFA 3NH6A 3LY5A 4NBSA 2IXFA 2JLXA 1CJTC 1V5WA 2G0TA 3WNBA 2OUKA 1X3SA 1SHKA 4NP6A 2AXNA 4NL4H 4RFVA 2V6JA 2VTKA 4PC2A 4PPNA 3S1AB 3D31A 3LWNA 3AVYA 1YZNA 4CIDA 3B78A 3U7HB 1IM2A 1NMXA 1YJ5A 4P4SA 3LDAA 5DISB 3V00A 2WHXA 1IAQA 3L0SA 4Q18A 1IY2A 1NVXQ 2G1KA 3AKCA 4B35A 4C0KA 5GADl 3FVQA 2X19A 2SHKA 4US1R 1DEKA 2ZR0A 3C5HA 4DRZA 4GP6A 1E9SA 2J46A 3Q8XB 2AFIE 2WWXA 3KB2A 1MKYA 2FJUA 2VIIA 4B3DA 4EPYA 2BOVA 4HZUB 2W2TA 4XOIA 1X8JA 1KNQA 4PAMA 2J0QA 2VL7A 4ITRC 1PUJA 3ZZ0A 4QGFA 2GK6A 3TKLA 2V7QA 3EZFA 5K8LA 3U5ZB 2GXUA 4M8NE 1YZGA 4Q1AA 1AK2A 5DO9A 3ZQ6A 5JWRA 4G0NA 2CL0X 4BFYA 3VR2A 1FMLA 4DLTA 3MSXA 1NLZA 4HSEA 4QRHA 4C0BA 4E09A 4C0HA 5FPYA 4P4UA 5DGXA 1Q1BA 3CX6A 3EPJA 2NPIA 1KSHA 4P0TA 3RRNA 2YKGA 3VR6A 3GD7A 1R0WA 3MWLA 4OI1A 1W1WA 2JEOA 2V7QD 4BFZA 3PIRA 1HV8A 3MJHA 1NVWQ 3C7KA 3TGPA 3VHLB 1RYFA 4BRUA 4RD6A 4EFNA 5E7JA 5JFGA 1LTQA 4TMTA 4IVRA 2WIBA 4A1FA 3A4NA 4DCTA 3KJHA 3R9IA 2PJZA 3L0PA 3ADCA 4KCGA 1QVAA 1MABB 1E2FA 3C41J 2BMDA 2V3CC 1LW7A 1J90A 1ZJ6A 2O52A 2NOAA 1JXOA 5LBIA 2WMNB 5H68A 3UG7A 3LD9A 2GWHA 1E2LA 4IJMA 4OQXA 5LB4A 5J4HA 3FHTA 4R2HA 1YZUA 2I3BA 1N5LA 2QP9X 1G7RA 2GEUA 4UJ5A 5JRZA 1M6NA 1FW6A 2Z4RA 3QBTA 1SVWA 3R8CA 5IHPA 3IQWA 4NCNA 4V02A 3RC8A 3QVUA 1TL7C 4B3CA 1EX6A 3OIWA 1W47A 4F4IA 3B9PA 1KKMA 5DYGA 4PZZA 4HLCA 3ETLA 2DWQA 2FDCA 4Q47A 3B9QA 3EPHA 2WVJA 2XB4A 4TMVA 3BFXA 1XZQA 2Q3FA 1RJ9A 3ZVLA 2QP3A 4TSFA 3PUXA 5DIFA 1MRNA 1W7AA 4DXAA 3RWOA 4G5OA 4M1SA 4AKEA 2VHCA 3NC1C 2WJJA 4NCKA 5KSPA 2FEMA 2XJ9A 2CLSA 3WYFA 3EXAA 2GXSA 1DBSA 1VG0B 4IOJA 3AEZA 4A2QA 3KXLA 3PR1A 3VAAA 4TYYA 3IO3A 4JLVA 4OJQA 3LFUA 2JASA 1YRBA 3A36A 3DMNA 3E70C 1TF7A 3KQLA 4W7SA 3SFZA 2GNOA 3DZ8A 1ZCAA 1Q1EA 4I1UA 3DVLA 3QKSA 1XTSA 5FBRB 3OEHD 521PA 2C99A 2FWRA 2JLQA 4XD7A 4BECA 4D0LB 1N5KA 5SZJA 1NVVQ 1G1MA 3EWSA 1BS1A 3U3KA 4BLSA 4MYTA 4C0QC 4PXAA 1TPZA 2IYTA 1XU4A 5AJXA 2PX0A 4M21A 2ZI7A 3U60B 1XXHE 621PA 1JQLB 2F1JA 4XIGS 1R5OA 4XWAA 1M7BA 3LNCA 4TL8A 4DLVA 1QF9A 2FSGA 3RS2A 4AK9A 1SXJB 1XTKA 3BS4A 3SJZA 1M8PA 2CK3A 4XD7D 2FA9A 5F2EA 3GLFB 5A0FA 4O3MA 1E98A 4DZZA 3F8TA 2D7CA 1E1RA 1G3IA 2QRNA 3RRYA 3T5DA 2DYKA 4ZKDA 4LK2A 4IRUB 1E99A 4TQUS 2EFCB 3SQWA 1G5PA 1BIFA 2UKDA 3EIEA 4IDNA 4PANA 4UNPA 1DS6A 4NYJR 4BE7B 1E2IA 1M7GA 3GJ7A 4KVGA 4QBHA 3K0AB 2E87A 2Y8EA 2OBLA 2IYUA 3A4MA 1DE0A 5AJYA 5KTYA 1R5NA 2CK3D 2AKYA 3IIJA 1AQUA 5FOXA 3DHWC 1FFHA 1MO4A 1W46A 4LYJA 4ACBA 1E1RD 1M34E 2C78A 4AKIA 3P26A 4JJZA 1E4YA 3BBPA 3FFAA 3R7WA 3CRQA 4C0AC 1SKYE 2O8CB 1E2MA 1Y3AA 1P61B 1M2OB 4AWXA 2QSYA 1GNRA 4KJZA 2NQ2C 1YZTA 2H7VA 3BIFA 4MA4A 4QJ3A 1IBRA 1GNQA 1DAHA 3HYRA 5FPHA 3A37A 3AVVA 1ZIPA 4LHVA 1E96A 2F3TA 4UQOA 4WVFA 4EPWA 2B92A 1XEFA 2A30A 2WJYA 4LBZA 2VSXA 2O8FA 5C1BA 1S1MA 3KQNA 2NO9A 4NPHA 1DAMA 1G18A 5DYIA 3TIFA 3B1XA 2D2EA 5KNCA 1P2VA 4WXRA 1T3LA 4GPTA 3H86A 5L3SB 2FF7A 3U6KA 4W9MC 1EFRA 1FL9A 4Q48A 4KU4A 4BFTA 2IL1A 3EAQA 2Z6VA 4GFDA 4URUR 1E0KA 4PO9A 1AGRA 2IUUA 1AM4D 1EG7A 2QE7A 4JMPA 2PMKA 1E2KA 3ASYA 5JWHA 4AI6A 2RGEA 2V1UA 1OFIA 2ZU6A 1XCGB 2J0UB 5EXPA 1A1VA 3CONA 4WW0A 1NG1A 1XWIA 1DG3A 4BFWA 721PA 1A2BA 2AK3A 1AS3A 3QEOA 2VF8A 4EJSC 2RGBA 3GLIB 2JLRA 3NDPA 5LD2B 1QHHB 3PVSA 4P3YA 4I1SA 4TLAA 1BOFA 1P72A 2PCJA 4QHYA 2QE7D 5FPKA 1EESA 1E4VA 3GP8A 5JECA 1Z29A 3EWAA 1H8EA 2R6AA 4OQLA 1GITA 5JZVA 1OT3A 3KUCA 4UJ3A 3C15C 3HR7A 3A1WA 4WIAA 5DI3A 1N6RA 4KHZA 2NO7A 4BZPA 1YRAA 2VEDA 4V0LA 3G0HA 2ZRAA 2ZRMA 1TADA 4OQNA 5HKKA 2GEVA 5DE3A 4BEJA 3RABA 2DBYA 5FUXA 1KNXA 5JSZB 3O8CA 3A1VA 1BO6A 1SGWA 1H8ED 2ZSDA 4BFXA 4RKEA 1OSNA 2QMOA 3AVWA 5JRJA 1E0AA 2QN6A 1E9RA 2JDIA 4L15A 4NYMR 1WXQA 2Q3HA 3E2IA 1W5TA 3B6EA 4Q4AB 3HPQA 1SVLA 3QKRA 1N0VC 2ZYVX 4A8JA 2NO0A 5HKKD 4AIIA 2XTMA 3ZQJA 3MMPA 4RKFA 2J0VA 3QKTA 4M9QA 2P6RA 1G21E 4MITA 4EFLA 3PUVA 2LCFA 1U8ZA 5FFMA 3SHWA 1U0JA 4MKGA 2CHVA 2JDID 3RLFA 2RH5A 1NI3A 5FI1B 1NSFA 1QVRA 3I8XA 2ZRGA 2IYZA 2VA8A 5G40A 1XD2A 1K5DA 1N5JA 1KI6A 1F2UA 1VCNA 4JLPA 1OW3B 1KY3A 2EQBA 3KTAB 3C4JA 3QG1A 4OKSA 1KI3A 3TMKA 4FMDB 2C8VA 2F9LA 3W6OA 3HPRA 2JLZA 3U7EB 2ZJOA 4RCYA 5EP2A 2BMEA 5C2JB 2NG1A 3K09A 1IJFA 3VU9B 1E0SA 1A4RA 4JIMA 2C5LA 2YWGA 4GT1A 3CZQA 4NHOA 1ZM3A 2KB0A 2ZE5A 5DH9A 1VMAA 2PT5A 3AP1A 4RCZA 3GJ8A 3PUWA 3UMFA 1P73A 2BC9A 4HAYA 5EE3A 1Z0IA 2P2LA 2WBLC 3BK7A 4UNNA 5TVKA 5KNDA 1ONBA 2OXCA 4M1KA 3S1AA 5FI0B 1KK0A 3W34A 2F1IA 4EKDA 3EPLA 1F48A 3IQXA 4V03A 1XPRA 4ON9A 1QBKC 1NN1A 1QHYA 1W0KA 4QGGA 3QUSA 2F3RA 4V0OA 4H1UA 4H9GA 5FL3A 1RYHA 4PSKA 3V9PA 2ATXA 4DDVA 2CLCX 3DPUA 4HZUA 4B2LA 1P2SA 4B73A 1RIFA 1ESNA 3EZ9A 4L8GA 3QXJA 1T6NA 4H1VA 4AY2A 3AF1A 2BDTA 5L3RA 3TR0A 1E2NA 4DB2A 1N6LA 2CLDX 4TLCA 1TUEA 2J7PA 5GJCA 4A82A 5LB2A 4ARZB 1W0KD 1HT1E 3FWYA 2FH5B 1Z28A 4JSYA 1VIAA 4DLRA 3ZDQA 4IEIA 1VDZA 4LV5B 3CRVA 2OCYC 4LYHA 3UANA 4XVRA 2A5GA 3CNLA 4LWZA 4XTRA 2I1QA 2ZE8A 4MRPA 1P3JA 3NH9A 2QT0A 2EYQA 2BKEA 1U9IA 3AH8A 4PQRA 1RJ9B 4R71A 3O8RA 1KDPA 1Z3IX 2QTVB 4FCTA 1ZD1A 3CKLA 2J59A 2KJQA 4Q02A 1X1SA 5IRCD 1T0JB 2PBRA 2Q6TA 4ESVA 3ECCA 2Q21A 2QRZA 1KYIA 1GRNA 1XPOA 5BWMA 3BWDD 2A5YB 4KFRA 4QC2A 2ZRJA 4B48A 2H5EA 4MRVA 4UKDA 1RPZA 3SYNA 4EIWA 2WJHA 4MYHA 1MABA 3ZD7A 4JLJA 2C03A 2IYXA 4GBMA 2OEPA 5A4JA 1E2JA 5CK4A 4DT1A 1KJZA 1Z0FA 1GKYA 2CE7A 1YR6A 4C3ZA 3SI7A 1B23P 1G3RA 3LQRA 2ZAOA 4FMCB 3KXIA 4YDHB 1DPFA 1LNZA 1P7CA 3SEAA 4XH9B 5LPNA 2JLYA 1VYTA 3U3JA 2G77B 1OF1A 2OHFA 1G64A 1P2UA 5AJVB 4P33A 1G8HA 3NEJA 5G3ZA 2LWIA 4LBYA 3RRZA 3L82B 2HT1A 3L0OA 2QI9C 1D9ZA 3K70C 2ZRBA 3ZZTA 1EK0A 1E2GA 2JA1A 1SXJE 2L0XA 1I4LD 1L4UA 1D2EA 1KO7A 1R0YA 4UXHA 3GLFE 4OHYA 1KO8A 1DTSA 1UDWA 2AHOA 2UVQA 1E9AA 3MCAA 2Z5FA 5C4MA 2FSFA 2DB3A 2ZSAA 2WJGA 1FOEB 4EPTA 2HEIA 4D0NA 3Q5DA 1TQDA 2GXQA 3SZRA 1E2EA 1CTQA 1IN8A 3KZ1E 4WZAE 1R6BX 1RW4A 4YDSA 2H17A 2AWNA 3QI2A 1IXRC 4JLBA 5JJIA 4UNRA 3CNOA 4KVAA 2HCBA 4HB2A 2PLRA 3Q7QA 3CNNA 2GETA 2FFQA 1UADA 1Y63A 2NO6A 2MMCA 2VQSA 2ZVQX 1VG1A 4Q1EA 1R2QA 4WBSA 4IVPA 3KQUA 4X8MA 3LW8A 5GVSA 4M1OA 2VBCA 1IY0A 4NZYA 1NN0A 3NKVA 4HAZA 5K8IA 2QQEA 2ZJ8A 4V0ME 2F1HA 5J4LA 3GPLA 5TV2A 3T1TA 1RRPA 4ZO4A 2GZAA 2WOOA 4JYCA 1WDTA 2FPKA 1SXJA 1UKZA 5HR5A 3CX7A 1XXHB 1SHZA 4OHVA 1OIXA 2EWWA 4LRWA 3GLFA 2VHTA 2HT6A 2FFBA 4XJXA 4BZXA 5KPJA 2PL3A 4ZI2A 1HQCA 4OK6A 3THXA 2RAPA 1SVSA 3MWJA 3UG6A 1E1QD 3SS8A 2HXSA 1ZVQA 2HCJB 2REBA 2FSHA 4D4LA 3K0AA 3I5YA 4RZ3A 1Q1QA 3H4MA 2ANBA 4LY6A 1YE8A 1SXJD 1PUIA 3BFKA 4PC6A 4Q4JB 3THOA 2OAP1 3BXZA 4C0SA 3H0KA 3TBKA 1XD8A 4LJ6A 3CZPA 4DUGA 3SFVA 3IBGA 3UIEA 2QQ0A 2NO1A 3EW9A 4Y0AA 5B30A 5HZKA 3ZLJA 3PEYA 2O8CA 4E22A 5KDDA 1UFQA 1XEWY 1EX7A 3GCGA 4A2PA 4B3FX 2ZE7A 2VP0A 4JL6A 1HY3A 4B3XA 5P21A 2ORVA 1PLLA 2CCKA 4JS0A 4OL0A 3SE0A 4V0MA 1DAKA 2GAAA 4J0QA 4AKGA 3KJEA 2PJRA 3CBQA 4DUGD 2XNDA 2ZREA 3L43A 3RRMA 3WBJA 2ZU0C 4U00A 5FTLA 3MAAC 1XZPA 2QPOA 3WBKA 2OLJA 2GXAA 2PZFA 4MGKR 3PXGA 5L3SA 1ZNYA 1MT0A 5JHGB 4JBWA 3HP1A 5EJEA 5EE1A 4ZDJA 3ASZA 2IXEA 3FGNA 5EE0A 4RZ2A 1NMZA 5KU1A 2OFOA 2H57A 2QM7A 5UKDA 2J0UA 4AURA 3FMOB 4LJ9A 1GP2A 4Q9IA 3ICEA 1T5LA 2XNDD 4Q9LA 2R44A 1KO5A 4NYJQ 4TLBA 5KNBA 2G6BA 1GRQA 1COWD 2J41A 2Z4SA 5DNYB 3GLIA 2GCOB 3RVBA 4CEJB 2HYDA 5E3HA 3WYGA 1QHHA 3A1UA 4ASUD 2JLWA 2WSSA 3QIAA 3AUXA 3KL4A 1D2NA 1OXTA 3LVQE 3GQBA 3P32A 2H92A 6Q21A 4PHFA 2FG5A 4L9SA 5KPDA 3I5XA 3B8HA 4MDFA 1II8B 2OXRA 3IPXA 1XCMA 1DG1G 3WRXC 1WP9A 1Q12A 2HDNB 1WB9A 2D7DA 4O25A 3K9LA 3KKNA 5EUMA 5HPYB 3K0EA 3K09C 1XD2B 2VSOA 4F92B 1ZC4A 1KAGA 2C9CA 2WV9A 1GSIA 1EWRA 3PITA 1XP8A 4BEBA 2ZJAA 3QPVA 5TXGA 1G19A 1S8FA 5JSZA 2RGGA 4HAUA 5B2ZA 1FNNA 2W83A 1I2DA 1WMSA 3FHOA 1KI4A 2XJ4A 5CJ2A 1KK2A 1QRAA 2DFLA 4Q4AA 3WXMA 3U7FB 1UPTA 2N1BA 2WSMA 1HTWA 1CP2A 4TTQA 5EXXA 5IT5A 4BLPA 3NTUA 1R0XA 4M0LA 2CJWB 3CPJB 5E7IA 4A15A 1IN5A 3QXHA 5AWFC 4RSGA 3U61B 2VYFA 421PA 1MO5A 1UEJA 2RMKA 4V0NA 1Z2AA 2ZYTX 3QQ5A 2VSFA 1W2GA 1ZMXA 3WP1B 5HCIA 2GA8A 2PMDA 1AN0A 2HJVA 3GFOA 1YZKA 2WM9B 4KLZA 4YMTA 3KFVA 2AD1A 3B60A 3KTAA 2IK8A 3AB3A 3ZIAA 2ZITA 4HATA 3DKVA 1TAGA 1VHTA 2GDJA 4XTCS 3FHCB 2VP2A 3EZ2A 1G4AE 4BGDA 2WZQA 3W5JA 3BRWD 1A2KC 1OE0A 4RZUA 3CRRA 3REFA 1UJ2A 4MKFA 3VU9A 3RSOA 2GCNA 1SZPA 2OT3B 1ZCBA 1C9KA 3VKWA 1QDEA 1KY2A 1VTKA 2QZ4A 1N0UA 4FMBB 3NBXX 3FPAA 4KFUA 5FPTA 3ZIAD 2BJWA 1VIYA 2IS4A 2BCJQ 3PEVA 4NYMQ 3K9HA 3I32A 5DN6A 2ZROA 3U4QB 1W0JD 3DMDA 2R6GA 4HI0E 4WXPA 2Q9BA 4Q1DA 2CL7X 1CLUA 4PHHA 2B21A 1P9RA 5TB5A 5G3YA 1T3HA 2EW1A 3LRPA 4LHXA 4QXAA 1R8SA 4R9UC 4LJAA 1TUIA 2A5JA 2NMVA 1CIPA 1II9A 3PV0A 2FFHA 1KAOA 1KMQA 2OCPA 1FTNA 3WP0A 3NHAA 4DT1B 3BFVA 3IKJA 5DN6D 5FBVB 4IW3B 1BMFA 1OFTA 2I1VB 2BBTA 3RS3A 2RCNA 4ARZA 3NIBA 1U99A 3QKUA 1T91A 2UZIR 4A0HA 1UBFA 3Q85A 1ZM9A 5L3QB 4QBGB 4OI2A 2YYZA 2P6UA 3RAPR 5GJWC 3QXSA 1EGAA 1GKUB 2YWHA 4PHGA 2PT7A 2XOKA 2MMGA 1VCIA 1BMFD 2G83A 3CB4A 4ZCIA 1NN3A 1YQTA 2BIFA 3TSWA 1E9CA 3ADKA 4OK5A 4I81A 1BH2A 1K6MA 2VO1A 3LAWA 1Q44A 3DOFA 3OEHA 1E79A 1ZM4A 5HZHA 4HLUC 4LC1A 3TAHA 5TY0A 2EFGA 4PPGA 4D0GA 5BN4A 4OQFA 3IEVA 1LY1A 1ZRHA 5JLJA 3X1DA 4IEEA 2ZQ5A 3BE4A 3ZS9A 3N5CA 1KKLA 3B5JA 2XOKD 3CPHA 4XSGA 2OBNA 4N3NA 3OEEA 4QOSA 4CW7A 4ERNA 4DDUA 1NP6A 1QZXA 5CITA 2N42A 2V9PA 3BORA 4JKYA 5FUYA 1XEWX 1Z0KA 2HF8A
chains in the Genus database with same CATH superfamily
2Q1YA 1KK3A 3IDQA 3R3JA 1A4UA 1XYVA 2YRWA 3DDOA 5HFNA 3THYB 1VHJA 3G7NA 3WKBA 1QHIA 2C07A 2C98A 2WG1A 1R6AA 3AV0B 3CR7A 1UDCA 3FMIA 2VC2B 1HDEA 5LP6C 1KAQA 2RHJA 4A0SA 2RB4A 4HX2A 4PS0A 5EVCA 1SC9A 3K96A 3A6PC 3OEED 4JY7A 4JVMA 2E82A 4BNVA 5DX1A 4URXR 2P79A 2DR3A 2KWIA 3QYFA 3DNFA 1B8OA 3DL0A 3HR4A 1YJAA 1HE1C 1DAFA 1OFUA 5GV8A 5JASA 1UAAA 4M0CA 1W96A 2G7ZA 3O03A 1FYEA 4GZMA 1MTOA 1VLQA 3MWFA 2CCGA 4UVGA 1DIRA 3RUAA 2C7RA 2QYHA 1E59A 2A5FA 2O7VA 4KXWA 1S89A 3RI3A 4W99A 4MS3A 1RKUA 3ZE7A 3HC7A 4DCNA 1OREA 1QB8A 4N41A 4KN5A 2WHYA 3KNZA 3N5KA 4M2LA 2D2FA 2RGYA 1YZ3A 2C3UA 4NBWA 5FOSA 1QONA 3UB2A 4R1QA 5LM3A 2I2CA 2WT4A 1D1QA 1SBHA 3KQHA 2XQGA 3WTCA 5LUBA 3ANMA 1TU3A 2GZDA 3QU5A 4URWR 4ZYTA 5CCXA 1OLUA 1O96A 2O8BB 3CM0A 3I9KA 1U81A 1QGED 5FQOA 2CXHA 3JVIA 3RANA 4EEKA 1GFWA 1X1CA 4K6CA 2W6QA 2H1OA 4ZOBA 3U44B 2DM6A 3I12A 4K81B 3K2IA 3UK6A 5BV7A 5JZMA 3GGGA 1IBKB 3WTBA 4IWNA 4OXRA 1H3NA 3IQHX 2IPLA 1N34B 4YJHB 1L4EA 1V8DA 4P58A 3S8MA 4BASA 5HIAA 1QLWA 2B4AA 3TPFA 1SKMA 3ZDEA 1XXHA 1VMIA 1C9NA 1YJCA 1XZIA 2QW0X 3CLKA 2IV2X 3R7NA 1TNDA 2WFLA 5HKOA 3CKKA 1B0UA 3F74A 4AMBA 2VDUE 3DZGA 3RM3A 1SU8A 1OB2A 1IQRA 2P2GA 1RRKA 3PYMA 3WJAA 3ZHQA 4B80A 4DAOA 1DBVO 1SY7A 3GCXA 3OURA 1QKIA 5B3JA 3RS4A 5C4GB 4BJ6A 2JFNA 1CUEA 4BYMA 3CRW1 1EP2B 4MGZR 3UXEA 4DBLE 4DKXA 5B2EA 3W5VA 3RJMA 4Y9TA 3WB0A 2ODNA 4MUXA 3TM4A 3LWDA 2A1TR 3BL5A 3JATB 4OQPA 2ZVDA 5K3DA 121PA 1XQVA 3ICOA 1Y1SA 2BGTA 1H4TA 2IOHA 1L6IA 4XX0B 4Y6QA 3PGJA 4I1VA 5DTIA 4XFDA 2P5YA 2AHRA 1V6CA 4ZHQA 4DLXA 2M1ZA 4JBGA 2D0DA 2X7JA 4D81A 5KKCA 2VLBA 3CF6R 5DEIA 4RX1A 3AF6A 3PDWA 3KJFA 1YQEA 3S0JA 3ZV4A 2PKYX 1D8TA 2BUCA 4Q34A 3NUZA 4FYWA 1RRGA 4HZGA 5JZSA 2H6EA 5F7XA 5EZYA 5FA8A 3TK1A 5DF1A 3IGFA 4QFBA 4YQYA 3PL1A 1CJMA 1Q1NA 4RENA 1H2HA 4BZQA 5AM0A 2GJ9A 1ODIA 4QUKA 2VTBA 2PXCA 2I3AA 3BCHA 2WAYA 3L0BA 3BM5A 4JKIA 4YWHA 1JEJA 1QRRA 2BEVA 2WT8A 1TZ2A 4Q12A 3UV6A 1M74A 3R1IA 7REQB 2F6RA 1I2BA 3FWZA 4W5WA 4LJ7A 4YCCA 2ZIZA 1K98A 5B58T 4Q7MB 3C0KA 1LZKA 3OE7D 1I2AA 4QYSA 1U3FA 4HPXB 2QVGA 3FTPA 4ZICA 4ZI7B 1DOAA 1KI2A 5CGZA 4INOA 3R8FA 4PVDA 3QBDA 2JLSA 1XMIA 1EJBA 2A1UB 4N40A 3OQVA 2VHYA 2FZEA 4MWZA 4HRVA 1QMGA 2RK3A 2GCOA 2YWEA 4I3GA 5BSVA 5ESXA 3F0TA 1FVHA 5LSAA 4NBNA 1NW8A 3EDMA 2E55A 1SBTA 4QELA 4HUTA 1AXRA 3HI4A 5CB6A 4YAUA 2EQ5A 1II8A 2ZUDA 3FOBA 3KAKA 3R44A 1GDHA 4ER5A 5K3FA 5EE9A 4FOPA 1DDOA 1NBME 3HXMA 1CEEA 2OVFA 4UAVA 1P7VA 5DHFA 3O8DA 3ZBUA 5IZCC 1T5IA 3GCWA 1EBFA 1GNPA 2C5HA 3DMYA 1NHWA 2YHAA 5JI2E 3TSAA 2H0AA 2O3UA 3TE7A 4HF7A 4ZVOA 4N5MA 3RDPA 3ND8A 2B8WA 3VR5H 2XCLA 3ZI0A 4M8KA 1PEDA 2XZTA 4JODA 2AMLA 2N46A 2HK7A 1K0FA 1E5VA 1N4DA 1XZKA 1QHEA 2WWTA 4CM1A 4DLWA 2GGSA 1C8BA 1KR5A 1TDJA 1SXIA 3EXG2 3GLSA 1POWA 3EVCA 1NGSA 2J5RA 3A6KA 4DWJA 1U9YA 2RE8A 1OQAA 1J2RA 1RLUA 3UHOA 4XGNA 4QTXA 3SM9A 2ECQA 3N6XA 3STTA 1V2GA 3EZ6A 2HNKA 1QQAA 1YUMA 3DE4X 1NUUA 2IV3A 1DHRA 4JOSA 821PA 3F73A 4C30A 1GA6A 3FZGA 5EZ6B 3RLIA 5LP6F 3IOBA 1E4EA 3QEKA 4G4SP 2ANCA 4DPLA 2P0EA 2PLWA 1DFIA 2PVSA 1PJAA 2A1TS 1MA0A 3MD0A 3PVZA 1ZL0A 2TECE 4GQBA 4MR9B 5HS6A 3MTEA 1XHEA 2QNRA 3DCIA 4RK1A 2WU3A 2K2WA 1G17A 4W1SA 5K6AA 3X43A 1ICIA 3FF1A 4R9VA 3SEFA 1JHVA 1WSDA 3WICA 5DSZA 3ZCQA 4DV2B 4G1UC 4HLQB 1A9YA 3BJIC 2C7QA 2IUYA 3UB4A 2G5CA 2OGUA 5BPFA 4DR2B 4A8TA 3CIOA 1G6KA 3HGQA 4J0HA 5EMNA 1D2GA 3NI2A 4UHKA 4UZEA 4DOMA 1KIAA 3H97A 2P7IA 1V47A 3M6IA 4G37A 4IQ0A 4R0NA 1VGVA 3UAOA 2PLAA 3NWPA 3KD2A 1S2IA 5AO9A 3ZH2A 3K9CA 1X42A 5F3RA 5AVZA 1NUPA 5HXAA 2P9QA 2YDXA 3DMTC 5AJZA 2VDWB 4B0PA 4RD2A 4EDHA 2QK4A 3C8UA 3DEIA 4BU0A 3QLEA 4OTZA 2Y1GA 3ZU4A 3B1ZA 3QH4A 4OF4A 4RK4A 1G3UA 3AFHA 1Z36A 4LYFA 1FZQA 2PQ2A 2YXEA 5E7QA 5HX7A 3LX4A 1YT5A 3KELA 4NFLA 3W5UA 2FEKA 1P1JA 2JGEA 3IUPA 3OQBA 1Y1LA 3SLRA 3TAXA 5I51A 4HC4A 4KFSA 1VXRA 4Y2GA 2D13A 2OFWA 2XUFA 2GSWA 4LTNA 5TMDA 1RBYA 4S2UA 5C7OO 1JJVA 3JY6A 5E6SB 2XYRA 1C9JA 5A4KA 1LI4A 2GLTA 1FX0B 1UKCA 3HL4A 4L4SA 1ESDA 4BNJA 2XEDA 3L8YA 4FP9A 3F7TA 1G6OA 1JQJC 1ZCJA 2A59A 3HGMA 2PBZA 3NEPX 3AHCA 3OF5A 4K9NA 4C0XA 4GOJA 2IVFA 1UBCA 3RT9A 1VBNA 2XTZA 3SFTA 4J7CA 1Y7HA 4OJNA 4KUGA 1ETHA 4AYWA 1THMA 2FG7C 2GDZA 4ZDIA 2I34A 3E6AA 1YGPA 3I9MA 2PS0A 2QEQA 1HLDA 2P1RA 5EMJA 1JKIA 1IAVA 4YP7A 3MTDA 5EI5A 4DG5A 3LWBA 4QUIA 3IILA 5C31A 1UL1X 3FOFC 4LRTB 1FMCA 3OCXA 3H2JA 4HH4A 3SXJA 5G0WA 2PKQO 1ZP6A 3VOSA 4JP2A 2EYUA 4CMAA 2W6NA 1UXGA 3JR3A 3IAUA 4ER7A 1N0WA 4ZK2A 1SJ9A 4FEYA 4X20B 4UM9B 1OC2A 2B78A 2B0CA 3OBIA 1FNDA 3NJ8A 1T6YA 3GPCA 4RF5A 1GLNA 1WL8A 4R1OA 2SECE 4A10A 4BBJA 4LV6A 2G1PA 3HZOA 4WH0A 1IY1A 3DD5A 3G0GA 1G0NA 2JPDA 3B7WA 4M36A 4BO2A 1SCUA 2BY4A 3I5AA 2IXTA 1J5EB 2H2HA 3JW8A 3KLMX 1XIVA 3L4BA 4F1WA 1V43A 3EC1A 4F8JA 4JV5B 3DE5X 3G3EA 3H2YA 3SAJA 2X0IA 3K9QO 3PA6A 4GX5A 2UYQA 1I13A 1MAWA 2PK3A 2OBMA 8ABPA 3II6X 2PGXA 1S3FA 3H65A 4MIYA 5C52B 2WQ7A 2ZXUA 3DE3X 5D5PA 3AI7A 4GP7A 4TSRA 3VKVA 1PZMA 2FPMA 1NIPA 4DSNA 1K3TA 4GWLA 4OYHA 1B26A 2O5RA 2IZ0A 2Z2JA 4QL3A 5ITWA 1V4NA 3OC0A 4P3OA 2WINI 3DUFB 3E82A 2GLXA 3MLBA 2HYIC 5BMOA 2MHCA 1QRDA 3F3YA 4B44A 2C4VA 5HTKA 4O02B 1QV6A 3RTAA 2HHCA 2VJMB 3QHQA 5DHUA 1YQQA 4UDXX 5MFPA 1OH8A 2OG1A 2G8NA 3BDAA 1OBFO 3NHLA 1YNOA 2IP4A 2RHGB 2HQBA 4JLNA 1NLYA 1AUQA 1A7UA 2W8BB 4DZRA 1AS2A 2GAOA 1E9EA 3H5WA 4EP1A 3MA0A 2NYVA 1XTQA 1OTXA 2Q2QA 3GLRA 3PXUA 1JXMA 4XE5A 1Q7CA 2FX2A 1JDBB 3HVUA 3IDAA 4FJ0A 5ALRA 1CQZA 3GWZA 3P2KA 1N8SA 4BV3A 1R5BA 1P5ZB 4YCMA 4ZIRB 2C42A 3NIDB 3PKZA 3B2EA 3K70B 1MB4A 4MUNA 2PIDA 2I62A 4PRYA 1YZQA 3DYIA 4TYQA 3VISA 5EAIA 4DSUA 3CVYA 3ZJTA 1F2DA 3LBFA 2CVOA 2HQOA 5T8KA 1F0NA 3ZH9B 2NVUA 3SMQA 4LC0A 3ND7A 3ZCPA 2PT6A 3ETNA 3C8DA 4QPJC 4JI8B 1E1QA 1U8TA 2LNDA 4HPJB 2KBEA 4K28A 5C46F 2NVOA 1Z47A 2QKYA 1P4SA 4J0FA 2GS9A 3OA0A 1CB7A 2RHMA 1KGDA 4I9GA 5JJ5A 4EUFA 4YJDA 1KDRA 4HDSA 2O3JA 4OFXA 4AXBA 5C8YF 1RAEA 3M7IA 2NVWA 3DV2A 2GHIA 3DZDA 3STXA 4PZDA 4RJLA 3O8QA 1MDBA 2P5TB 2QZ9A 4RIEA 3S2GA 1QV7A 4Z1MD 1HFKA 1XTJA 1RC1A 1AUXA 2ZI4A 3AVPA 3THSA 1TJYA 1JVBA 5KYUB 3G7SA 1KJWA 4V39A 1NJGA 4IKEA 3WB1A 1CQWA 4UE2A 4FN5A 3N58A 4C03A 4OUDB 1AQLA 3ZD9A 3CVOA 4E2YA 1DJMA 3A27A 4WZAA 2FKAA 1QR2A 3WAGA 1K6JA 4UTVA 4RDXA 2XQKA 2H51A 4IDOA 4PBTA 4BDSA 4ND2A 4JLDA 3UJAA 4GR9A 3ROEA 1M0TA 2I6UA 5IXSA 1WMDA 1Z68A 2YWJA 2X9GA 4PZYA 1TZJA 5MGNA 4YP5A 1XNRB 1Q0TA 1K5HA 3UCEA 2ZYRA 4OJTA 2JBAA 4POAA 2WNIA 3CW9A 4LN1A 4YMWA 2EJTA 3U3OA 4ABYA 1NKVA 5L6MB 4P32A 1J97A 1P0CA 1CR0A 1OWMA 1YDHA 1ZD9A 5B7GA 4L74A 4CLOA 1Q0QA 5G1OA 2OHGA 2IZOA 2WW8A 3N7AA 3DFFA 4Q05A 3W9YA 4YRKA 3PRKE 4O4LA 3WLJA 2C9YA 3I4CA 1CZUA 1ZM2A 1TYEB 4RTLA 4DV3B 1SCJA 3W90A 4DLKA 3HM9A 2G9VA 3OZIA 1NPDA 2WZDA 1H2ZA 4R16A 1MVNA 1A4XA 4PLGA 3COJA 2WIKA 3MM4A 4I2VA 5BN3A 4ASUA 4URYR 4HRAA 2BGGA 4PG6A 2HA2A 2Y1KA 2FPUA 1KSFX 3JS5A 4P7GA 2R1TB 3U26A 5JCZA 4YUZA 2H7CA 1JE0A 3TTVA 5A9SA 1S2OA 4PLHA 2D54A 2A2ZA 5D86A 1G66A 1Z4MA 1S7GA 2ASVA 3BWXA 3LCVB 4K6FA 4REMA 1EVJA 1C29B 4XB1A 4CEHB 1I4TD 5JEDA 1EFAA 5CBPA 2CL5A 4NYIR 3LLUA 4NBKA 5TQ0A 3JD1A 3TX2A 1DBQA 5C32A 3W2HA 1YI8A 4C6RA 1E2PA 5KYWA 3PC6A 5AUQA 3ND5A 2GK7A 1ZVJA 1RVV1 3H7AA 1K7XB 3PEFA 4UCXA 4ZCPA 4RDIA 1EA5A 2HA5A 4D79A 3LBNA 4K87A 3OFKA 4J90A 3OPYA 3MWDB 4PAQA 3DOJA 4TTSA 4X3CA 4FFBA 1F0YA 3P4XA 3GJ6A 2JJQA 1JL3A 3AIOA 1Z6ZA 3RF6A 1X1AA 1DEXA 2G1AA 3TJRA 2RAFA 1J20A 2VTVA 1A9PA 4JBXA 2DPMA 3F71A 2W2PA 4QOHA 3QYPA 2EW8A 2G4VA 1A0OA 3AP2A 4O4IA 3WZ2A 5ILOA 1DQSA 1MQ8B 1TZBA 1VPLA 2EX1A 3GFSA 1OIWA 1OYWA 4AW9A 4E5DA 5DWVA 4F4JA 1H6CA 5ADVA 2B69A 4F84A 1CVIA 4GXQA 1BDHA 5KSWB 2CB0A 1P6UA 2ZE6A 4MNTA 4J3NA 4CKZA 1S3GA 1KH3A 4FLMA 4X9XA 1GN9A 1XSEA 3KOWA 3BOSA 4YHBA 4YMGA 3AWIA 3F5SA 4KAJA 1TMGE 1FQOA 1HRKA 1ZJJA 4EHHA 2KHZA 1A82A 1GLVA 4UUQA 2ZBRA 3ENQA 3BMCB 2HX1A 3T3HA 1GQQA 1P2FA 1S2DA 2A9KA 5H70A 3ROTA 3ROQA 3W05A 3IXMA 2HJWA 1VGQA 3KDPA 1TTTA 1Y82A 1XFDA 1U8AA 1XLTA 2BFPA 2D2IA 3G1TA 3OKCA 1GYQA 3SHTA 4D57A 2C95A 3LH5A 4U7TB 1Z15A 2OZKA 3GNLA 3KZCA 4HVCA 4NCAA 4OSOA 4W8GA 2I6SA 3RADC 4CPDA 5CR9A 3QX8A 2VNIA 3OJOA 4L4RA 5F9MA 3LT0A 2QAGB 1U0RA 4U7GA 4BNGA 1BCRB 2AJTA 3BRWA 3D6MA 4QYMA 2E4UA 3P1JA 3PICA 4R6XA 5IMSA 4QODA 1ZUIA 5FBWB 3FXAA 2G71A 4RFSA 3U31A 1H8HD 1R6VA 3THRA 1MJHA 1CUGA 3I6IA 3M4XA 2IUTA 1XK7A 2A7QA 2R48A 3HJBA 1ADGA 1W581 3WL8A 3DF7A 1RXSA 4UVEA 1T0PA 3T7IA 2FHPA 2H1IA 4RM3A 4OLBA 4M46A 4LBWA 2TSYB 1RMQA 3H1AA 2Q3MA 2F9FA 2I4NA 2XZOA 1UPAA 5BY2A 1DDIA 3DW3X 5C3UA 3JALA 2R84A 3Q87B 4JJIA 4L4YA 4PY2A 2PS9A 1RXVA 5F7OA 1TM2A 3WBBA 4LOJA 1ZICA 1K5GA 2NUPA 3AVUA 3C3DA 3PX7A 2PLFA 2PWYA 4FNGA 1O58A 4PG5A 4D26A 2FWBA 4YH1A 2NU6B 4WBNF 1NXQA 4L28A 5IFKA 4F4HA 2AI1A 4S0ZA 4OK3A 2DFNA 3FCOA 4QXMA 4RHFA 1RPZA 3N6VA 1L4LA 2ET6A 4FFSA 4D99A 1MOQA 2VCEA 1GWNA 3RU2A 4A27A 2D0PB 1LRJA 2IUFA 3K1AB 3OPQA 3T7SA 4C6TA 5C18A 4U6QA 1P29A 3TRIA 2F55A 1YCHA 3AVXA 1BJRE 2RONA 5GOTA 5K3AA 4DADA 5ADWA 4C78A 4LA4A 2J3KA 5TNXA 1DMRA 2FZVA 2PSHA 2VPQA 4AB1A 1RLIA 1LFAA 2H54A 3BC1A 4IIYA 4EYEA 4XDYA 2QDKA 3R7SA 1XZMA 1KQFA 3OM8A 3CSUA 4MGYR 2Q45A 4NV0A 4ZCMA 2FF5A 3MT8A 3VOTA 5KMGA 2AD5A 2M6KA 4P92A 4MDYA 4HGRA 3ORFA 5DNEA 3WK5A 2P67A 3Q72A 2Q3BA 3LXUX 2OPHA 3HQ4O 4KE8A 2P9FA 4QASA 5CB0A 3HNOA 1JGTA 2XWBF 2GBLA 3HDYA 1DNPA 2OVBA 1BS2A 2O05A 4AUNA 4F45A 2XB2A 1SOMA 4I55F 4F3NA 1A88A 3KQSA 4PC7A 1N7GA 1Z5PA 2FZGA 5DBFA 1N8TA 2BWJA 4BO3A 3AKYA 3C6YA 2EEZA 2Z58A 1MIOA 1XEAA 2DFVA 3EIQA 2RKBA 2X1LA 1FQKA 2BF7A 1I0LA 4J4TA 3ILSA 3HBJA 1O2DA 3ZWOA 3OJEA 1U3VA 1OZGA 3IUNA 4JLOA 5KVQA 4E5YA 1QCCA 2C2MA 1PZNA 1UDXA 5ITSA 4JYZA 4MVJH 3PD7A 4EKGA 3DAGA 1EGVB 4QM7A 2O1SA 2IYYA 2J5QA 1ZIDA 3C87A 3IPCA 3PXEA 4QT0A 1FP6A 2H3HA 2J1LA 2YOHA 4E2FA 2I71A 3HABA 2IE8A 3PC8A 2XCRB 5AI0A 3VI4B 2ZLBA 1UOEA 4LHYA 4LVUA 4RIHA 4RLFA 3OCWA 3DO6A 1KDYA 3F5DA 3RSSA 2V6MA 3A1DA 1M8JA 3QYAA 4QDJA 1RI5A 4JT2A 2ISCA 2MYNA 2XMPA 3L1KA 3N74A 4KV9A 2PKCA 3HKEA 5HSGA 4N5DA 3NDIA 5IVKA 3AFMA 3MJ4A 2Q9UA 4ZT7A 3UWDA 1IHPA 1W19A 2IY9A 3FTQA 4RWEA 3F6EX 5ICSA 1V5GA 3K9NA 1SC4A 3NHZA 4NG5A 1W76A 2ARKA 2JEYA 2ZJYA 3NBZC 2W6OA 4QVGA 5LCXA 1Y3CE 1GKLA 3ZHVA 2HMWA 3RQSA 4CCAA 4YT8A 1GCAA 1SIWA 6ADHA 1QS0B 3GLGA 2YQ4A 4B3TB 4EHJA 1J7JA 1O97C 3UT0A 3I0ZA 1KDTA 2K6GA 2PT9A 4HMPA 2YUIA 1Q7TA 2E89A 4A0GA 3CF2A 3NJ4A 2RB5A 3HUEA 3KEMA 2JIOA 2JATA 1MFPA 1NXTA 1SPXA 2N0SA 2LXNA 3BCSA 4NE2A 4IDHA 1ZD3A 2WKQA 2XNSA 1RJDA 4NJEA 5EHGA 4WTOA 4Z4QA 3INRA 1U2EA 4LSGA 3PUYA 4W5QA 4KPGA 1ICEA 4WLFA 2CKDA 1DAEA 3ZBQA 2IYEA 5F64A 4PC1A 5EN4A 4FT2A 2X0DA 3WK6A 5M5BA 2PUAA 5D1HA 2ZJFA 3BIWA 4S1VA 2OAQ1 5H8WA 3A14A 5K5EA 2J9RA 2V59A 1PT5A 1ESZA 3DKPA 1A9XA 1DIBA 1QRSA 4KPUA 1TE2A 2ATVA 3DM9B 4R1SA 5CNKA 5B1DA 1JU9A 2F4VB 3HJFA 1EBUA 4BO5A 1CQJA 5F3DA 5FORA 3P4YA 1Z8HA 2BFCB 2MYUA 3S1LA 3NORA 1OWNA 2O4UX 3D6TB 4N65A 4MW7A 4OGGA 5COAA 4BRZA 2ZIEA 1E9VA 2XD4A 3D7RA 3R9XB 1D9XA 3ICCA 1P7PA 3C1TA 3HA7A 3G8DA 1TIPA 2DP4E 3GUVA 3CN7A 2WQ6A 1G6Q1 1U2GA 4HEQA 3M9WA 5M7EA 4JU9A 4M7PA 1KHHA 1VLHA 2WF7A 1U7UA 1NWHA 1V1RA 2HNAA 3BTUA 4WADA 3ZDRA 2B3DA 2XUZA 3K2BA 5D01A 3ASVA 4ME6A 3C48A 4CCYB 4QREA 5LP6B 1Z2EA 3U37A 1N8NA 3E7DA 3EH2A 4DKJA 4YRJA 3WIVA 2VPZA 2EJWA 3QVSA 5BXYA 1YQUA 3B12A 4GAEA 5EHXA 1CY2A 2Z57A 3IUMA 1W5AA 2QGNA 4AJJA 1QFSA 2IEZA 1N77A 1J4AA 1DEOA 3PI6A 4PYQA 1QHGA 2UV8A 5DCLA 4B2PA 1I2ZA 1U0LA 3TXAA 3UMJA 1PEKE 5KYYB 1U4SA 4J03A 4KBFA 1BX1A 4ZK6A 2I6XA 5LA6A 3TLGB 2X76A 3TLAA 3UJ3X 1EAMA 1X2EA 5IHXA 1US8A 2W90A 2XKBA 2DFDA 1MTZA 2FGKA 2YOGA 2QQ5A 4OQEA 3ZEAA 1R37A 1ZYUA 1GG8A 5EZQA 2WZBA 5CVDA 4ZZ1A 4TRNA 3FPEA 3UPDA 3NM6B 3PCRB 3W79A 3ZG6A 4M1EA 3SIRA 3E8SA 2AZDA 2Z08A 3FBTA 3N53A 4BN0A 3IPLA 5EQDA 3OE4A 3O2JA 1WPXA 3WNQA 2IC5A 2QYOA 1H65A 3W6PA 4ENSA 2QRUA 3DOEA 1MRSA 5CXXA 3GHHA 3P20A 2IVZA 5BN5B 2YJGA 2Z04A 2JZNA 1J8YF 3OJ0A 3GLHA 2YVQA 4II3A 4HD8A 2ZI3A 3WO0A 3FSEA 3OQJA 5CIQA 3AB8A 1D07A 2IYOA 3OZCA 4UXJA 2RGXA 4D5EA 4C7OA 2QTFA 1QC5B 3A6EA 3NV7A 1T5DX 1EFKA 5TE9A 3W2IA 1KMHB 2NO5A 4DA7A 1XALA 5JAHA 4KX5A 4TKZA 3ILVA 5EWJA 4ZT2A 2YOFA 3DQPA 3PC4A 3HEBA 1SQFA 1PL7A 4E5KA 3Q8WA 4KUHA 2VN8A 1M7HA 1T8SA 3A70A 1AUOA 1JFLA 4J16C 4O63O 3C14C 1H2XA 1SBIA 1OKKA 1UFOA 2E37A 1RJGA 4WLUA 1L5SA 3KPYA 1M2WA 1E20A 1W49A 3X1ZA 4UBOA 4M8LA 3PENA 2W4IA 1OIVA 3S5UA 4FX5A 4S1PA 2H2FA 4Q9NA 2KS6A 3CT6A 1BE6A 1XZGA 2YQ5A 2EFEB 3IJPA 4QLBA 3CUKA 1I7LA 4N49A 5AW7A 1ZH8A 5AM5A 4D3YA 1U7OA 5IN5A 1VCMA 1W1UA 5CDHA 3SR4A 1IOWA 4D8TA 4G5SA 4JUBA 1XDZA 2M32A 2R1VB 1XPUA 4MW2A 1ODFA 1D1PA 1I6KA 3WJ7A 4EG3A 3RFCA 3MCWA 4F8YA 4D9CA 4CUKA 2BFWA 3CLRD 2C5BA 1W36D 3VA7A 1PFGA 1JVSA 2ZCUA 3OLWA 4X7BA 5KWVA 3OJCA 1NNEA 4QWWA 2WF5A 3B5IA 3G2IA 2QXTA 3G5UA 3TDMA 4LMPA 3ZWWA 1MO3A 1S96A 5JWOA 5EUQB 5BOSA 1TW2A 4DZTA 5JS7A 4MWDA 3RSLA 2AL7A 2PD3A 3ZGVA 1K8RA 1ZIOA 3BD8A 3OAAA 3NANA 1J7KA 4MWSA 1MX1A 4FYPA 1ONSA 1XDBA 4OREX 2BJVA 2VTEA 4R3WA 2F3QA 3E5MA 1CDZA 4IIBA 3U49A 2K7FA 4PG7A 1K88A 3LYUA 4IV8A 1QX4A 4W6QA 1O5TA 4YJ3A 4C3OB 2CFTA 3UC9A 1BYIA 3ZVMA 5HFAA 3DZJA 1BDJA 2BM1A 2IPXA 3MTIA 2H63A 3M4NA 4HWTA 4MGIR 3V1MA 2ZM6B 5DJ5A 1VHQA 2B4KA 4JP1A 1B3BA 2HHJA 4UD6A 5K8VA 3HFGA 2ATEA 4F7WA 1GZUA 3QENA 3PT9A 2GPAA 1L0BA 4D74A 3OQIA 3AXTA 1BWPA 5I48A 2JARA 2YWXA 3HY3A 2J30A 4Y2QA 5FTWA 1FVXA 5KNDH 5L95A 2QTHA 2O7NA 2VWHA 4IXDA 4CYMA 2C29D 2QM8A 2NQTA 2BF4A 2K7ZA 3CZ5A 3K8QA 2RBGA 3KDSE 1PNOA 3L2OB 3LM8A 4X61A 1ESMA 1JR3E 3P19A 4RSMA 2QUIA 1UOQA 3BEDA 5E7MA 5K0LA 1Q0LA 4Q9JA 2BMJA 2ZYWX 1OYYA 2WHPB 4N9QA 5H1YA 1ONNA 1F17A 4FYYA 1JKMA 4L85A 1NN5A 1GY8A 3U80A 4N7JA 3U39A 3UK1A 3LPDA 5JCXA 5JVDF 3U56A 2NU9A 4X93A 1MOZA 4PFJA 1U7TA 3BH0A 1P0PA 4EKEA 1GG2A 4WJLA 3NTOA 1V6AA 2QTLA 1N2GA 1GDTA 5K0FA 1AGYA 4JX8A 3EVZA 4EHDA 1OLOA 5C8YB 2GBLC 2HRQA 3EA0A 1EFTA 3JQEA 2LP4Y 3WRXA 5C5CA 2Q0QA 2G4LA 1RS0A 3HLKA 4EQZA 4NENA 4C43A 2BSQA 2AYZA 4B43A 4TRRA 3UQYS 1K63A 2GJAA 1LV8A 1X39A 1M10A 1T4BA 1E89A 3ULKA 4E31A 1VJ0A 3C6QA 5AIAA 9MHTA 1CKEA 1EINA 1PYGA 2J0EA 1ZONA 3L7YA 2HU5A 2XMQA 4LY3A 4PO3X 5DLQC 3WRYC 5A7FA 3DO5A 3CWZA 1Z0UA 1IEQA 3HN7A 2NU7A 4U9IS 3VR5A 4YUXA 1WUJS 3P9KA 4NPAA 1EIWA 1ULTA 2R8BA 3JVVA 1AC5A 4GLOA 1R4ZA 3VYTB 4JSRA 3TLKA 4LFCB 4GGMX 1YR8A 3QLVC 4LXXA 1KBQA 2Q6LA 4R1PA 1PX0A 1MV5A 3PD1A 3I6ZA 1PT9A 2IHBA 4U02A 4RMNA 5TDHA 4HUQA 4BMOB 1UH5A 2OCAA 3ZD6A 3HCFA 2X1VA 1AF4A 2AFIB 3WK8A 2PBLA 2W6CX 3Q2OA 2P2NA 4MB2A 1S9HA 1WCIA 2NTVA 4UMVA 5ER9A 2Z6AA 1U7XA 4OATA 2ZWVA 3ETCA 3GP3A 4CLEA 2DUMA 4BWFB 4QTYA 4AJNA 1WMAA 2X3YA 3FHLA 1H9BA 4HWRA 4U8GA 4H77A 3TZQA 2GZSA 4EBFA 1A76A 1NVVR 3QJGA 3FSRA 3GJSA 3TSOA 1PNVA 4H4CA 2Q7XA 4IQFA 1NHGA 1Z5VA 2WVHA 3CV3A 3K1YA 3QBVA 1VJCA 3PX3A 4PYMA 3S70A 3HU3A 1JA9A 4EVSA 4ZJYA 4IO0A 2OO5C 3B8EA 3RFFA 1VBKA 1OGJA 4JEMA 3HR8A 2A94A 4R0MA 4CG2A 5HKBA 3UHPA 1LV7A 2QMHA 3G0CA 2QU8A 1LQ2A 3ZTWA 4KVZA 3ZWQA 2Y9PB 3GJ4A 1NVUQ 2DWPA 4L22A 3T5TA 2AOTB 2V7BA 3BHJA 1NKTA 1O89A 1ZRMA 4XQCA 3SY8A 4BWVA 4IGAA 4AMZA 1M1YA 1U0FA 4CV3A 3SYTA 5CXUA 1R3DA 3FNQA 1TMKA 3PNSA 2HA6A 3MWYW 4ITVA 5KJEA 3RYIA 3VX4A 4HGZA 4OD0A 1P7ZA 1IEWA 1RWVA 2B35A 3ANLA 5IEBA 1MG0A 3RS9A 2WF9A 4F96A 1ZW6A 4ZDKA 3VKFA 1DRUA 2NZWA 3ISTA 5MN4A 1L5GB 2ZANA 4A0FA 4A8PA 4M4SA 3HLYA 3UT6A 3QFRA 4EUEA 5D00A 1KRXA 3TW8B 3LGXA 1HLFA 1X1RA 3E1KA 4B5LA 2P75A 4BFSA 1BVHA 2V9ZA 4EKIA 2O23A 4ETMA 1M6VA 2MJLA 2IZ1A 2O06A 4X62B 1Z22A 4W63A 3MC1A 1M1NB 1T25A 1RKVA 4EGAA 2CV1A 4HYEA 1P45A 1U2ZA 2XQFA 3A7DA 3QJYA 3KSDO 4RYDA 1BGXT 1O0SA 2QORA 1C9EA 1Y80A 2WPDA 4R8LA 4URZR 1YS1X 3QKSB 5GQSA 3ZD8A 2A84A 1UC9A 3HZZA 1WKBA 3UCXA 4FR0A 3Q8KA 2I54A 2IU0A 3FE2A 1Q6ZA 2E4YA 4IUBS 5IS2A 2WVAA 4KYTA 5CYOA 1E3MA 1CDEA 3QPAA 1VPWA 4M0UA 5EGNA 3NKLA 4D4JA 2GQ0A 3TUIC 4WPGA 2OGTA 4ILEA 1GDDA 5CLFA 4K3VA 4C1BA 2PUCA 1FA9A 3AW8A 4Z7QB 5F98A 3ZHBA 1RQPA 1UKYA 2LIPA 4FYIA 2YZGA 3U3ZA 3VU0A 3A4LA 4UHHA 4F91B 4F5ZA 4GWKA 3H1PA 1EGHA 2HDOA 5IXJA 2Q99A 4X1OA 1YQ9A 4DY6A 3SZMA 1QGUA 3DLCA 4BO6A 5FWXA 2EKLA 1VM6A 4KGDA 3UOWA 2ISQA 3DOIA 4BNUA 2FWPA 4C89A 2ZAMA 3P0JA 3NWOA 4QECA 2V97A 1SD2A 2ZDHA 3E3LA 2Z1MA 1LDGA 4CG1A 1TTQB 3M81A 2REXB 1NG9A 1ZMTA 4MYUA 3NBMA 2O8DB 1P60A 3ON5A 2BTOA 2HW8A 1P0FA 1UC8A 1R9NA 3T5MA 1B16A 4DQXA 1CE8A 3M2PA 3GOQA 3JR7A 4RVGA 4LJ8A 1B7GO 1NW5A 2BEKA 3F96A 4FMDF 4P34A 4F04A 2QOEA 4HDRA 5AHXA 3UMRA 3ZGXA 2C5SA 1P31A 1JNXX 1GQSA 1QP4A 4TMKA 4AIRA 3L7DA 2ZYIA 1WF3A 3TIXB 1XVTA 3FJ1A 3WLOA 3EQ6A 3DB1A 4PO8A 2C82A 1ZGGA 4M1WA 4WBNB 4HNVA 3BMOB 4DLZA 1L5HA 3DL4A 3EXG1 4WT7A 4UPEA 1KZ7B 1GPWB 3HU1A 4TVOA 5B37A 3LZDA 3KT6A 4J0IA 4IEFB 2D1TA 5ILGA 1GZ4A 1Z0AA 2BEUA 1OGYA 1A8QA 3C3WA 4M9CA 2FEOA 2F17A 4DJDC 3FUWA 2O8NA 2WF8A 4L72A 5EZ5A 4OXQA 1QSGA 2E3JA 2Q0SA 2RBKA 3TD9A 1XQ1A 1C2TA 2BZ0A 3QWFA 1JMYA 1VL8A 4KN8A 4CMGA 5KCZA 4URFA 4MYRA 1HFJA 4XYLA 4HWGA 1JF8A 4CIBA 5IF3A 1A95A 5ALLA 5K0GA 3ICQB 2IYRA 3EDOA 3QFSA 1JMKC 3RU3A 4CL3A 4ERXA 4ZO6A 4GMKA 2FVYA 5L40A 3IE2A 5JEEA 3PG5A 1G7CA 2AMYA 1D6SA 4NDNE 4AJ9A 2J9XB 3CLUD 4N7RA 4DCVA 4F5DA 4XFKA 1KPGA 2JBWA 3KWFA 3AR6A 1C9MA 3BK1A 4FBGA 4QPDA 4OIFA 4GR5A 1RT9A 1Y8RA 2CFSA 4TS4A 4B40A 2NN3C 1R8XA 3U0BA 4FEEA 3T15A 1Z9BA 5KNBH 4I55B 4YJ2A 3CEHA 5LFAA 1Z4QA 3FKSA 2KI5A 1O94D 3ZDFA 4BNMA 4ZVNA 1TJ5A 1E2DA 3MMXA 5AJHA 5T64A 4DSZA 3A6GA 4CT4B 1KU0A 3U7QB 5KREA 3A58B 2OPBA 5IM4F 1HKHA 2HTEA 1XLUA 3WGYA 1W4ZA 4Y1FA 3BXHA 1P4AA 2ADOA 3TNDA 4M1QA 2WOJA 3REGA 3LECA 2D62A 3OM0A 4HDMB 3ITEA 5DI3B 2P4EA 4EG7A 4P4TA 2YRXA 4BQFA 3ADBA 1KZYC 1Z33A 2QTAA 1RZUA 3G23A 4LJKA 4WDRA 5DIZA 1W30A 3AW9A 3PHLA 4URVR 1CRPA 1KE2A 3VO1A 2IXGA 3CH6A 3QLUA 4R7ZA 4WGGA 1GTRA 5A0VA 1ZIXA 5HM8A 2ZRQA 3SDBA 4GDMA 4B6QA 2H4HA 2LKCA 4M0KA 2H18A 2EFDB 3U19A 3QF7A 1LK0A 3DTYA 4OXNA 5DNDA 4LZAA 2NAPA 1ULZA 5JCOA 4D9JA 4Z0PA 3AERA 1ODKA 1RE1A 1KP3A 2FI1A 3H4TA 4FOSA 4CT5A 4BQNA 1ULUA 2IS2A 1U5BA 1VLJA 1UR5A 4RPIA 2AZ4A 3DW1X 1NI5A 5AJWA 2FV8A 3WDSA 4GNRA 4R8SA 1A5BB 1GL3A 1TT5B 2FWNA 3L6RA 2IKSA 5AW5A 4LDZA 1F2TA 1AZTA 1I36A 2OBYA 2WYOA 5DZSA 3UMSA 4E94A 2FDRA 3FCYA 4LPSA 3KAJA