1N6NA

Crystal structure of human rab5a a30r mutant complex with gppnhp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
167
structure length
167
Chain Sequence
GNKICQFKLVLLGESRVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Crystal Structures of Human Rab5a and Five Mutants with Substitutions in the Catalytically Important Phosphate-Binding Loop
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Ras-related protein Rab-5A
total genus 56
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2002-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1n6nA00
1CJUC 2RH5A 1IAQA 1TL7C 2CLCX 2G6BA 3AP3A 3PUVA 3W34A 3KFVA 5F3WB 3GJXC 3NBZC 4ASUA 4EDHA 3L82B 4MRPA 1XF9A 5EJEA 4H1UA 3THXB 3KJGA 3K0CC 3PXGA 2V6JA 2FZ4A 4OI4A 4DDTA 4ZPXA 3VKHA 1DAKA 4D82A 5F2EA 4G1UC 3D3QA 4KXFB 4BFZA 3CLVA 3KJHA 1W0JD 1Q21A 1KI9A 3U4QA 3ND9A 4GOJA 3RS0A 5FBVB 4TT3A 3KXKA 3LDAA 2Q9CA 2OESA 1GKUB 2BEKA 3CO5A 4QBHA 4CYMA 2FFAA 3EPHA 1QG4A 2KBFA 2XOKD 4OJKA 3GLFA 4GRAA 2ZJYA 2WWXA 1DOAA 1E0JA 3FGNA 4WA7A 2N46A 3BC1A 4D2IA 1QVAA 1NG9A 2DCUA 4TN1A 3IHWA 3VR1A 3BH0A 3L8YA 1E2IA 1RYHA 4HLUA 2WVJA 1A82A 2IYWA 1H8HD 3NBXX 1U8YA 4JT4A 1E2JA 4LZZA 4LPSA 4TQ9A 1ZUNB 4IDOA 3GFOA 4IVRA 4DLTA 5EQTA 2E9SA 2REOA 1VG1A 2ZI9A 3QBTA 2ZQ5A 1NJFA 5EXXA 3SFZA 1PUJA 3DDCA 4KV9A 2CK3A 3UK6A 3Q5EA 4MUAA 3TQFA 2IUUA 1FQJA 2DBYA 4CT5A 3SZRA 2LWIA 1XTQA 3CX7A 3Q3JB 3ONWA 2J41A 3REGA 4A0FA 2IYQA 5IF9A 1XFAA 2V54A 2RCNA 2X19A 1MH1A 1N3BA 3ZVRA 2WPDA 1JNYA 2ZS7A 2REXB 4JSYA 2IYSA 3BJIC 1XD2B 3OIVA 2FFHA 1GKIA 1XEWX 2ZYUX 3KL4A 3MG9A 1M2OB 1S3GA 1SVSA 4P32A 4Z1MA 4KITB 2YV5A 3QG1A 2QG6A 2V9PA 3P4XA 1N0WA 1VYUA 4DCTA 5CDFE 4AKEA 1EESA 3K1JA 1BKDR 3HYRA 4LC1A 3SS8A 3B8HA 1G3QA 3FMFA 2JIZA 1CEEA 1OFIA 1VIYA 1VG9B 5H1YA 4DEXA 2IF2A 4A82A 5FTJA 2JLYA 2W2XA 3PVSA 4FWTA 4WBSA 2ATXA 1HTWA 3JVUA 1ZM4A 1WMSA 2GWHA 4YXWA 3FHTA 3C5HA 3PUYA 2JDIA 4Q4HB 1UBFA 4V03A 2BIFA 1RC8A 3MGCA 4C2UA 2YKGA 3H1TA 2GRJA 1COWD 4Q02A 1G7TA 5TB5A 5FUXA 1MO3A 3MWKA 4JLNA 2WBLC 2UKDA 4JL5A 1P2SA 4JSTA 4DIEA 1BOFA 1X1SA 3A1UA 3VHXA 3B1VA 3RS2A 1RRCA 2ZE6A 3BK7A 4MDEA 2RKOA 3PCRB 1G8PA 4PHGA 2V3CC 4KLNA 5SZKB 2XNDD 3IPXA 3P20A 3CUEF 1T5IA 2B7CA 4GP7A 4C0LA 1GVNB 3IDQA 1JR3D 2PT7A 3L0OA 4IOMA 5HKKD 4PPGA 5J4LA 1CR2A 2LCFA 2IHBA 2JJ8A 4ON9A 1TTTA 1EWRA 4LDJA 1NI3A 1QBKC 4I1SA 4Q01A 1AIPA 1IN4A 4RY2A 3K9HA 2ZI5A 2J0UA 2J7PD 2CHGA 4DDVA 2NQ2C 2P5SA 1KO8A 4IXNA 5AJWA 3AVVA 5AWFC 3AQ4A 5KNCA 4BLRA 1KK3A 1YR9A 3PV0A 1VCNA 3EZ6A 1BYIA 2GEVA 4ZCMA 2HT6A 1FTSA 1GRRA 1RVDA 3HU3A 3KJIA 4D0NA 2Z0MA 4WOPA 5IHPA 3ZZ0A 2JLWA 4B35A 2CNWD 4TTRA 4HAUA 2PCLA 4P4SA 421PA 2D2FA 1ZUIA 4B6EA 4BUJA 4NYIR 4I4LA 4MYTA 3GLGE 1TNDA 2ZI6A 5EP1A 3FVQA 4M1TA 3QSYA 2BM0A 4QKQA 1ZC3A 3LLMA 1TU3A 1TQ6A 2OZEA 3IIKA 3LO5A 3T35A 4A0HA 4XH9B 3ZD6A 4K8OA 4Q9LA 5F9HA 3QPWA 4PPQA 4PQYA 3AVQA 3JVVA 3X1WA 1ZM2A 3K53A 1R6BX 4JKYA 4LC0A 1Z07A 3GP8A 4ZI3A 1EXMA 2JLZA 4HUQA 1MR3F 4DXAA 3HR8A 4M9XA 3W5JA 1OXSC 2QUZA 3O8BA 1N5KA 3LFUA 1HY3A 2XITA 4L5BA 3Q7PA 2GAOA 2YOGA 2F43B 2WJJA 2ZRLA 1KO4A 4OI1A 1QHSA 4MGYR 1NBMD 5KU1A 1LFDB 1HE1C 4WZBE 1TEXA 4Q00A 3UMRA 2IK8A 3GLIE 1K5GA 3L0PA 3CPHA 2BC9A 1ZBDA 1PLLA 1II8A 1KO5A 5GJBA 4DC9A 1G3RA 4P4UA 1U0JA 3MSXA 1UKEA 1FMLA 3C15C 4EQ6A 2MSCB 3E2IA 4JBYA 3CNLA 3SHFA 2GXUA 2AWNA 4RD3A 3SR0A 3ADCA 1N6PA 2W2TA 4ZDIA 4UKDA 5FUVA 4CT4B 5CITA 2Q3MA 1FW6A 1ZM3A 2XXAB 1EFRD 2CK3D 3R8FA 4J0QA 4MYHA 1W47A 1G5TA 3PUWA 4NPHA 4QM6A 1NL3A 2FSGA 2ZRGA 1UDXA 3AF2A 1M8PA 4XOIA 1NIJA 3X1DA 3UANA 1JQLB 3K70C 4LJ4A 4BRWA 1XJQA 1UKZA 2VRWA 4DUGA 3SI7A 5BW8A 2Z4SA 4RZ2A 1XPOA 5JI2E 2F1RA 2WICA 3QKSA 1XB2A 1US8A 1F60A 3AUYA 3N2EA 5FTKA 4Y0AA 4B48A 2FZLA 4KBGA 2FEMA 1CIPA 3RRMA 2A7QA 4L15A 1BMFD 1YKSA 3AP1A 3FMOB 4LBZA 2V8OA 4NONA 3OIUA 2FX3A 4LRWA 4BZPA 2QE7A 3AP2A 4O2LA 4F4CA 2RAPA 1OT3A 2ANBA 2QQEA 5E4FA 3TMKA 2FPKA 1E79D 1QF9A 4UNSA 1RZ3A 3GJ6A 3VR5A 1NLZA 3UWKA 4PQRA 4UJ5A 1ZCAA 1JAHA 1QZXA 4LYFA 4JLMA 3HR7A 4NBSA 4TMZA 2J46A 3O8DA 1T3SA 1VPLA 1H8ED 2ZAMA 3DMDA 4JVNA 1MV5A 4KODA 4JBXA 4DRZA 1F3OA 2Q3FA 1H65A 3ZS8A 2QPOA 1E1QD 3B6EA 2ODBA 3WYAA 2WMNB 1WBDA 2BJWA 2AK2A 4TZ0A 1Q57A 5BQ5A 2YHSA 2ORIA 1K5DA 2OG2A 5D3MA 5A0FA 5BXQC 5LD2C 4AI6A 1OSNA 1TF2A 2AX4A 2V1UA 2ORVA 4Q1DA 1X1RA 5FOTA 4ZIRB 2EU8A 1M74A 1TQ4A 5EZ6B 1W44A 3CM0A 4CW7A 3IO5A 5DISB 3ZDQA 4AD8A 1N6IA 2VHQA 3EIHA 3PEYA 1E9RA 2IYXA 1X8KA 3EZ7A 4X8OA 3D7MA 3TR0A 4AIIA 2O8EA 3U7HB 4LK2A 3UMSA 4RFVA 4B34A 1M1YE 3DL0A 3B7GA 1R4AA 2GJAA 1FNNA 4MGKR 4V0NA 5FOWA 5CB8A 4MKGA 4RCYA 1JR3A 4TQAA 3QKTA 4BWYA 2IS2A 1Q12A 3TUIC 3C4JA 3PEWA 3FE2A 2ZI7A 2RGCA 4A2PA 2WJHA 4ZKDA 1HYQA 2YWHA 3IIJA 3RHFA 2DHRA 1G7SA 1FP7A 5DYIA 3U3JA 2HEIA 4A2QA 2P2LA 2O8DA 4GBMA 3TW8B 1Z0AA 5JCZA 4B2LA 2PZGA 4LX0A 4NMMA 3ECCA 1IONA 1QDEA 2CVHA 5AUQA 4GPTA 3W6OA 2ZJ2A 1SGWA 3A1TA 4GOKA 4LCBA 5JEDA 4K46A 3KQNA 1PLJA 4AKHA 2RGNC 3B85A 1JBKA 2WTUA 2HYDA 2R6DA 1LV7A 2IWHA 2VP4A 3MUFA 5EE1A 3X1XA 2N42A 4MKFA 4A0RA 4ARZA 3QXSA 4DCNA 2J45A 2ZRNA 1KKMA 1KI2A 4HYYA 4Q4AA 2HF8A 1L8QA 4ERNA 2EYUA 2PH1A 5B2ZA 4JLOA 2YOFA 5D3MB 4QJ4A 3CONA 3LBHA 3MFYA 4Q7LA 1OYYA 1OXUA 4LBWA 3T5DA 1EG7A 4ITRC 1D5CA 4L8GA 1AZTA 3WNDA 5EE3A 4NYIQ 1E6CA 2J7KA 4LBYA 5FPYA 2BBSA 5D3QA 2K5UA 1JALA 3DKVA 4Q9HA 5B58C 2ZRAA 1A7JA 3RSLA 5E95A 3T1OA 4D6PA 1S3SA 2A30A 2QMUA 5FR1A 4L9SA 5SZHB 5J4YA 2HJGA 1VMAA 5DNYB 3RDPA 2GNOA 721PA 4EJSA 2DFTA 2IWRA 3FFBA 1IY0A 1GKYA 3RWOA 4JMPA 5JJKA 3KXIA 1D9XA 1GWNA 2GAAA 2IYLD 2QTVB 4KFTA 4PC7A 2HCBA 2XSZD 1ANKA 2GKSA 5TV2A 4CVNA 5TMPA 4DSTA 2OUKA 2VP9A 3QVUA 5CIWA 2QP9X 1US8B 1R0XA 1N5LA 1SKQA 1E2PA 4C3ZA 3UG7A 2EQBA 1XMVA 1GM5A 1II9A 2UZ3A 4EAQA 2Z6VA 3H86A 2XGJA 4C7OB 1EFRA 1DAIA 4DSOA 1S96A 2ORWA 3I1FA 2MSEB 2C96A 1Q3HA 2V7QD 1LY1A 2ZSEA 3IGFA 3KTAA 5JEEA 1T91A 2ZYVX 4AURA 3ZVNA 3EZ9A 3LA6A 3QXHA 2WAYA 2ONJA 4B3FX 4EJSB 3RS7A 3RLFA 1VCMA 1Y3AA 1TADA 3AKDA 4HB0A 4ZCIA 4US2R 3KX2A 2GEDA 1ZCBA 2OFXA 1DE0A 2JASA 2V1XA 3R9WA 1ZRHA 2G88A 1Z3IX 1XNJA 5G41A 2AFHE 3VKWA 3TVTA 3GLIB 2WWHA 3F8TA 4E03A 1IQPA 2CLDX 4M1SA 1J2JA 4C4PA 4TYNA 4PAQA 1WXQA 4A6PA 1QG2A 2JLUA 2OBNA 3T15A 2C9YA 1W2HA 2BOVA 3QKSB 4EPXA 1W36C 1U2RA 5CM9C 4R2IA 4B2IA 4QHTA 3A58B 5DGXA 2ANCA 3NKVA 1Z83A 3CNNA 5G3YA 5LB4A 4OQNA 1FMJA 2H1LA 1XCPA 4EJSC 2F1JA 4Q4JB 1AZSC 3Q72A 3T06B 4G5GA 4OHWA 2IF0A 2YC2C 4DIDA 4G5RA 1NY5A 1OXTA 2HV8A 2HYIC 4DLRA 3E70C 1M6NA 3OFND 1TF7A 2EFEB 4TL6A 3FWYA 1W1WA 2ECKA 4JJKA 4M1KA 2C5LA 3SJAA 3QOFA 2YJTD 4YONB 2C78A 2ZR7A 4NH0A 3GLFE 2Q21A 4CZ2A 2IXGA 4LJ6A 4PC2A 4YMTA 1ZM7A 1PVOA 4LSGA 3EC2A 1ZAKA 3DO6A 2QM8A 1W4RA 2YNMA 3I32A 3MRSA 1OFHA 1EFHA 4Q7MB 2X2FA 1CKEA 3ZVMA 2FSFA 3LBNA 2P6RA 3V9PA 5CK4A 4ACBA 3PQCA 1BO6A 5E7JA 4LJ8A 2F1IA 1VYVA 3NHAA 1VHLA 4CDGA 3O8RA 2D2EA 4CEJB 3I4LA 2ZREA 1COWA 1FTNA 4Q4LA 5G3ZA 1NN3A 2JEOA 3K0CA 2IXFA 1T4GA 2YC4C 3EX7C 3RRYA 1RYFA 1CRPA 1G3UA 2PMDA 2VHJA 1OKKA 2QNRA 3EPLA 1G5PA 1F6BA 2BM1A 2ZU0C 3RAPR 3U3RA 1TUEA 5JHHB 521PA 1TMKA 1NF3A 4IOJA 2OLKA 1SULA 1EFCA 1MO4A 4PAOA 1AA9A 2WIAA 3LWNA 5H68A 5E3HA 3I8XA 1JEDA 1LB1B 1G5RA 1EGAA 1QHIA 1TEVA 2ZRPA 3KKMA 3OEHA 2J9RA 4LJ5A 4XTRA 4R9UC 1XJ0A 3TNFA 1U0HC 4RZ3A 2CE2X 2H17A 1E9DA 3UWOA 4Q5IA 3BB4A 4KJZA 1QHHB 4OI0A 3M0EA 3VMFA 2Y8EA 3ZLJA 4MUBA 4QHSA 1NVXQ 2VP0A 2WIBA 5AUOB 5EE0A 1NIPA 1CP2A 3B9PA 3U6KA 2CXXA 2RHDA 4O25A 2D7CA 2NPIA 2VL7A 3GLHE 2WJYA 3U7GA 2ZUCA 1NKSA 2ATVA 3PIRA 4QNMA 4LYJA 5EP2A 3TH5A 3TLXA 3V4FA 1IY1A 4GT1A 2OE2A 5EZ5A 1Z0JA 4TT3D 1FP6A 2PBRA 4GZMA 1E0KA 3JZAA 4RFSA 5P21A 5SZIA 3NDBB 2QMEA 4IFBA 3GLIA 2GJ9A 2FEOA 1Z2CA 3L0IB 3CRMA 3RVBA 3WP1B 4BFVA 2JATA 2OCAA 3A8TA 3HYTA 1CBUA 3AF1A 4G01B 4TLDA 3V00A 3CRRA 1ZU5A 1N0UA 3BORA 4LJYA 3FMPB 3IPYA 3QIAA 1EK0A 2W58A 2GETA 1NLYA 1J70A 1G17A 3RWMB 3QE0A 1N5IA 3KUCA 2HUPA 1MABB 3NHBA 1LTQA 4FN5A 2X8AA 4GL2A 5KDDA 5HPYB 3AM1A 1DAGA 1KAGA 3OIYA 3WBKA 2QEQA 1BYUA 2A5JA 4JYBA 2GTPA 4HDQB 4I99A 3QKUA 4C0HA 5CJ2A 4KFRA 1IM2A 1G3MA 5DYGA 1BS1A 2JLXA 2FN4A 5EUMA 4ARZB 4E22A 1CJTC 1KO7A 4ACAA 4C0SA 2NMVA 4QXAA 3UXMA 2DFNA 4YDHB 3GJ7A 2YOHA 4GNKA 4Q66C 1Z0DA 1NRJB 1NVVQ 3CKLA 4BLPA 4FIDA 4V0LA 2ZE5A 3GJ3A 2HCJB 1R5OA 3TKLA 1HH4A 4KLZA 4LJ7A 5KSZA 1N25A 5AJYA 3LX5A 3AVUA 3F5FA 1YZQA 1TU4A 4BLQA 5JS7A 4QBIA 2G83A 3PG5A 4LHWA 3TUZC 2LKDA 4FMBB 2JJ2A 5DN6A 1VIAA 3LW8A 2WV9A 4MA4A 1F2UA 3PJRA 5JCPA 3CF0A 4QGHA 2D4HA 3NTUA 2GDJA 3AVWA 2P5TB 4D4MA 2GCOA 4GMXA 1KDRA 4RVCA 1K6MA 3E5HA 4R71A 3TSWA 5DSZA 4EFNA 3OFNA 1GITA 3H84A 4OHZA 3VHLB 1O3YA 4YXWD 5EXSA 1YZUA 4URYR 5TDHA 4HDCA 1IOZA 2CCKA 2NPFA 3EC1A 1NVWQ 1GL6A 3RNLA 1NSTA 2L0XA 1DO2A 1YZNA 2A5FA 1G18A 4TQUS 1FOEB 5FL7A 4PAMA 1Q0UA 4Q7KA 5L3VA 4YMSA 1YJ5A 4U5XA 5KNDA 1CR1A 1G291 2JCSA 5JWHA 3CB4A 2IBMA 1MO5A 3X2SA 2AXPA 1IBRA 5C1BA 5ELXA 4WZAE 2XB2A 1ODFA 4NU0A 3H0KA 4E07A 4KVGA 5J40A 4OK6A 1I4TD 4NYMQ 3AVTA 4HLDA 4LPKA 4MRNA 3G0HA 5TVKA 1T3HA 3KQLA 4QRHA 3U7FB 2TMKA 2C98A 4C0KA 5IK2D 1ZIOA 1HQYE 1AGPA 1AQYA 4KSBA 3VR3A 1KKLA 2IXEA 3M1IA 1G64A 1CR4A 1S1MA 5CLQA 4D4LA 2J5XA 5HZHA 5BYKA 3CR8A 2W6IA 3K0SA 4HAWA 3QF7A 1KNXA 1SXJD 2BMFA 3I5XA 1P2VA 3DZ8A 1GDDA 3GJ5A 3HU1A 1E4YA 1ZNYA 4UJ3A 2Q9BA 2ODEA 1OFTA 4B3CA 4CRWB 3O8CA 1JB1A 2FNAA 3WYFA 1W48A 4LYHA 4EFLA 2HDNB 1ETUA 2JLRA 1JECA 2B6HA 3K0FB 5L3QB 3WNCA 3SQWA 3H4MA 2CDNA 4C0QC 3K09C 1DG1G 1Z63A 4MGZR 1MABA 4D26A 4BGDA 2ZS8A 2GESA 3QVVA 5KTYA 3KKNA 4L4UA 1E94E 4OQFA 3TRFA 3DZDA 1GNQA 4B33A 2XNSA 5FPTA 3P4YA 1NBME 4PZZA 2REBA 4TTQA 5AJVB 2ZRJA 5KPDA 4F38A 3ZQ6A 1LW7A 3GMTA 4KVAA 1I4DD 2ZSAA 3CWZA 3W6PA 2OM2A 2WOJA 4AKIA 2NIPA 1P73A 4A92A 1D6JA 3N70A 2JLQA 3BH7A 5LBIA 4JIMA 2SHKA 4MQBA 4M1WA 1HEIA 3AKCA 4LGMA 4JVMA 2ZJBA 2PLRA 5TARA 4GMDA 4X8HA 2ZUBA 3OHMA 3GLGB 1SVWA 1UEIA 1UPTA 5F98A 4DDUA 2A5GA 5JRJA 3CZQA 1KI6A 3BB3A 3O47A 1EFUA 4YLGA 4QM7A 1Z47A 1M34E 2NZ8A 3BXZA 1T0JB 1WDTA 1XXHE 4ZDWA 4BFWA 2QBYA 4S2EA 4HAXA 1G7RA 1XZQA 3SBDA 4PFSA 2AHOA 2PX3A 3WHLA 1WB9A 1B23P 3THOA 3IILA 2A5YB 1E3MA 1S9DA 3GFTA 4JS0A 1KDPA 3NDPA 3EWAA 4EPWA 2WSSA 1OYWA 2ZIAA 3ND8A 3U6BA 3IUYA 3TAUA 5EP3A 3CRW1 2BV3A 4IEEA 2KJQA 3KTAB 3ICEA 1GG2A 1O87A 2ZTSA 3FMIA 4WVFA 3BB1A 1KSHA 2G0NA 2X1VA 5EE9A 4C7OA 3C41J 1NVUQ 5FL3A 1XZPA 5L3QA 2OEPA 1U8ZA 1XDBA 1Z0IA 1E2HA 3EXAA 4NCNA 4XJXA 4CIDA 1OLOA 1AS3A 4M53A 3AF3A 1YVDA 2UZIR 3U3KA 2HLDD 3SDZA 3RS3A 2FGJA 1GFIA 1KMHB 1W4CA 3B82A 4JLBA 3BFXA 1NKTA 4DDWA 4UQOA 4NHOA 1II0A 2R65A 4S35A 3TQCA 1E9FA 2EWVA 2FWRA 2R44A 2DWQA 2NO1A 2CLSA 5IDVA 4DSNA 2W6JA 1OB5A 3T5GA 1OV4A 2ZRFA 3K9NA 4PQFA 4PC3A 1Z6YA 1ONBA 1AN0A 3A37A 2OXRA 3SBEA 1D2MA 1JPJA 3G5UA 2ZSFA 2OAP1 5SZJA 2C8VA 3DHWC 1PZNA 4HB4A 1GNRA 4XWAA 1ESMA 4DZZA 1DAEA 2D3WA 5AUNB 2MMGA 1W0KD 4UXHA 2XZPA 1U0LA 5DLQC 4LV5B 4FD2A 1ZNWA 1G4UR 2D74A 1GSIA 5KNBA 1TF5A 3REFA 1NN5A 3SYKA 5FBRB 3LLUA 1PUIA 4AYXA 5FL7D 5C4GB 4Z8YA 2GILA 1DAMA 1G3IA 4Q03A 3AGPA 2IS4A 4QGAA 5G53C 1FQKA 1OFUX 2CNWA 3WRXC 4DEYA 5JZVA 2F6RA 3KB1A 5CM8B 1U9IA 2F55A 4V0ME 3EAQA 5J47A 3ADBA 1P72A 2P0EA 4GSYA 4FINA 5CYPA 2FDCA 4B3GA 3EW9A 1N6OA 4HATA 1KK2A 2GVDC 2QMHA 2GA8A 2BVNA 3SC3A 1SKYB 3L0SA 2GJKA 4QBFA 1SXJE 3NC0C 4TL8A 2H7VA 4POAA 3AVOA 3RANA 1UBGA 1KK0A 1F48A 2D06A 4TLEA 1G20E 1RFLA 4P33A 1MRSA 1R0WA 4BLOA 4P0TA 4A2WA 1RPZA 2MMCA 5JSZB 2QQ0A 2OBMA 1KMHA 2O8EB 2W00A 3TIFA 3UPUA 1KYIA 4N3NA 2CJWA 1E1QA 3FHOA 3NEYA 4LBVA 2GBLC 4W5HA 3GEEA 6Q21A 2AL7A 4F91B 1Z2AA 1JJ7A 2IC5A 3F0TA 3VU9A 4B44A 2BJVA 2G77B 3KJEA 1JAIA 4PR0A 1HE8B 4XVRA 3WHKA 2P67A 3BGWA 3CIOA 1GUAA 4IOKA 3RC3A 5HKKA 2FFQA 4C0JA 1E1RA 5LD2B 2QAGC 3KQKA 4OKSA 1NVVR 4XIGS 1WA5A 3IQXA 1CJKC 3C14C 4NTZA 2QROA 1G19A 4HZIA 3SU8A 5FPSA 1ESNA 5FFMA 1HUQA 2VYFA 3X1YA 1Z0KA 4URZR 4TYQA 1DG3A 4C2TA 1VECA 2FOLA 1KSGA 4FMCB 3W8NA 3TR5A 1NN1A 3OESA 3AV0B 2JLSA 2Q0HA 4KYUA 1J90A 1UKVY 2FU5C 3LXXA 4PO1A 2QRNA 2QL6A 2DFLA 5L8VA 4PZLA 5CJPA 4FCTA 1IN8A 1DO0A 2J1LA 1WCV1 2ZUDA 1XXHB 4I1OA 2WWYA 2I1VB 5CIQA 5LDDC 3LV8A 2XSZA 2XTNA 1FNMA 4TZ6A 2VHCA 3L8ZA 1Y63A 1G8YA 1Z6AA 2DWOA 3QPUA 4HDOB 4V0KA 3C8UA 2WOOA 4JLPA 3MWYW 3PR1A 2OT3B 5J4KA 3VU9B 1VCIA 2XB4A 2O8BA 221PA 1J99A 2ERYA 3TAHA 4TLAA 5FUYA 2OCPA 4Q1CA 5HE9A 4BFUA 3QF4A 2HLDA 2ZPTX 3A6PC 2VHTA 1Z6GA 2J59A 1LS6A 3VKGA 2GBLA 2WKPA 5J4VA 1E2NA 1TUIA 2N1BA 8OHMA 2XAUA 3CH5A 3DMNA 4OHVA 4DT1B 1CJVC 1D8TA 5KO2A 2J3EA 3KXLA 3NVAA 4JLAA 2O8DB 4JJZA 3MAAC 1NSFA 1OH7A 4OHYA 3NH6A 1XTKA 4L9WA 3QI2A 3RSOA 3QXXA 1GRNA 2CHQA 1RW4A 2FJUA 1IN7A 1IN6A 1FX0A 1P60A 2QAGA 4LY6A 5CYOA 4B74A 1P3JA 4DLUA 4LHXA 4U00A 4XWKA 1XCMA 4PPNA 5LB2A 2WJGA 4NKRA 2F1HA 1GL7A 4TLBA 2ZJAA 1FL9A 1G8GA 1WF3A 2G3YA 2X77A 3NEJA 4I1VA 4LOAA 1E9EA 2A3RA 3LVRE 4RD4A 5FI0B 4ZI2A 3RS4A 3KQUA 4IDNA 1T0HB 1UF9A 3RC8A 2JJ1A 2QA5A 3ZD7A 3ZS9A 3NIBA 1XTJA 1G1MA 2P6UA 2WM9B 1E1RD 1Z22A 4EPTA 1R8SA 4W9MC 3ASZA 1GNPA 3HPQA 1MO6A 3B1WA 4M2LA 1IXSB 1UBEA 5KSYA 1DVRA 1KNQA 2C77A 4LHVA 3WP0A 5FOVA 3KKPA 4GI7A 4BLSA 5GVSA 4RKFA 4GDFA 5J5CA 1WQ1R 4WW0A 2V7QA 1A2KC 1X3SA 3B13B 3SJBA 3DOEA 4Q47A 4P4SB 5FTLA 1XTRA 4OQLA 1YU9A 2Z4RA 3QKRA 2OFOA 1NN0A 3K9LA 3P32A 4Q21A 2KBEA 2NTYC 2ZYTX 2ZYWX 1EX7A 1OH6A 1M7HA 1SXJB 2OXCA 1MT0A 3IEUA 3B60A 4M22A 4UXJA 1P61B 1VCOA 4OK5A 4M1YA 4Q9IA 1GTVA 3JZMA 2PMKA 1HURA 4BFTA 2HXSA 1E2QA 4JZKA 4QGFA 2Q9AA 1OXVA 2CE7A 1Q44A 4EPRA 1L7VC 2J0UB 1Z28A 2WJIA 1MOZA 2QT1A 1YR6A 1YZTA 1ZD1A 5B30A 1G7CA 5B57C 3MMPA 4US0R 4TYPA 2PZEA 3FYHA 2IX3A 3QBVA 3IQWA 5GJWC 3K09A 4A8JA 5KPJA 2R2AA 1IHUA 1NMYA 4P4TA 4BFYA 2WKQA 5L3SB 2JLVA 1LNZA 2XZLA 4UXIA 4IDQA 3LBIA 1AS2A 4JLVA 3KQHA 3CR7A 4IVPA 2BBTA 2F3TA 3VX4A 4A9AA 4D80A 4HZUB 1I4LD 2G0TA 2WWIA 2XOKA 3R8CA 3B78A 2ZRBA 4DHEA 4GP6A 3S1AA 3TSZA 121PA 4JYCA 3OIWA 1S1CA 2G1JA 3PENA 4NDZA 4M0LA 4AYTA 2Z43A 2G9NA 1R2QA 2ZSBA 1SZPA 1NG1A 2OAQ1 2W6ID 3EWSA 5ANRB 4A36A 4YC7A 1W4BA 3GLGA 4IVQA 1EWQA 4AKGA 1GILA 2JA1A 3E1SA 2QPTA 4JT2A 3WRYC 2GZAA 3TGPA 5EUQB 5A5GA 4HEJA 2QZ4A 4PO8A 4TLCA 3SJCA 1R8QA 2C04A 1EX6A 4WXPA 4B3BA 1JR6A 3FFAA 4BZXA 3NBFA 5AUPB 2WPDD 2WSMA 4NZYA 2RGXA 4HUTA 2H92A 1Q20A 2ZAOA 4EPVA 3ZIAA 3PUZA 4B71A 1FUKA 4QJ3A 2RHMA 4RD2A 4DLVA 5FTNA 4PO9A 4TL9A 4ZKEA 1P7CA 2R6FA 2OHFA 2PJZA 3LVQE 4LJAA 3NG1A 2OBLA 2ASEA 2NG1A 2O0HA 2W0MA 3CPJB 4A0GA 5KSOA 1E9SA 2NOAA 3HPRA 4UNPA 3SFVA 4BE7B 2GF9A 4CEIA 1XJCA 4AY2A 1A2BA 3LNCA 4FMDB 3K8YA 1W0KA 3QENA 2AXNA 3N2IA 4V0MA 4F7WA 3ADKA 3CRVA 2CCGA 4GFDA 4BZQA 2IYRA 3B1XA 2VSFA 5HE8A 2KWIA 5TXGA 4DLXA 3QQ5A 5BN3A 1S0UA 3VNVA 3KZ1E 1E2GA 1YQTA 4F92B 4A8JB 4IRUB 1SKYE 2EFGA 2FF7A 3I5YA 3UG6A 1NP6A 1U98A 2OSBA 2QM7A 2QORA 5KDLA 3SN6A 1W5TA 1GOTA 1ZVQA 3EPJA 1AQUA 3GLFB 1F2TA 1YRBA 3GJ4A 5DN6D 1Z29A 3GCGA 5FOSA 3I72A 3FKSA 2ZRDA 2PZFA 3DOFA 2R9VA 4GOXA 4LWZA 3VR2A 1QHYA 3L43A 3RYTC 4B75A 5JMTA 2ZSDA 1P75A 2ODNA 2XTMA 3CW2A 3KKOA 4QGGA 5JHGB 1T5LA 2CHVA 3EA0A 1F2TB 5BYJA 1OH5A 5F9FA 2AKAB 2F9MA 3W3AA 4XVQA 1E2KA 1E0SA 1R0ZA 1GP2A 4DT1A 2A2ZA 3HP1A 2CCJA 2IYZA 3OEED 5DE3A 3RRZA 1G21E 2J7PA 3LW7A 4IKEA 5BWMA 4DLZA 4FW9A 3EARA 5DHAA 4D0LB 2ZM5A 1KOFA 1QRAA 1W0JA 4URXR 1KI1A 2RGBA 2VQSA 3TUJC 1IJEA 1FZQA 4YMWA 1IXRC 1DEKA 3U44A 3TK1A 4NYJQ 4Z1MD 1T9HA 1R7RA 2H18A 5FBLB 2C99A 2KSQA 4DSUA 3UMFA 4DLWA 2V55B 2PCJA 4I1UA 2YZ2A 3ZIAD 5HR5A 1W36D 3IBGA 1YRAA 3T1TA 1ZC4A 3MLEA 3THWB 4PSVA 2B8WA 3KUDA 2I3BA 2XTZA 3PEVA 2NGRA 1OHHD 4G5OA 3U3OA 4V0OA 4Y0VA 4B6FA 3IO3A 3T1VA 2XZOA 1XD9A 3I61A 1KSJA 5CB6A 5K8TA 1E98A 1XRJA 2E87A 4PPFA 2GXQA 1U81A 3LD9A 1VKJA 4FMDF 2FH5B 2ZI3A 2QE7D 2XX3A 1TPZA 2I1QA 4OI2A 1RKBA 2ONKA 2QSZA 1ZW6A 2NO6A 3VR4A 1AKEA 1GRQA 3J81k 2DR3A 1Z0FA 2XJ9A 1XWIA 1KIMA 5GADl 1E0AA 3NWJA 4LV6A 2VHUA 3FPAA 4LV8B 3L2OB 4JKIA 1A1VA 2OFWA 4RJLA 4EUNA 1CXZA 3K9GA 5A4JA 3FOZA 2O8CA 2F9LA 2FE4A 1OIWA 2FGKA 1XTIA 2WHXA 2ZR0A 3CPEA 5K8LA 4DB4A 4HLCA 2GJSA 1N2CE 1QHHA 821PA 2H16A 1OHHA 2ZI4A 3W6NA 3GEIA 2ZJOA 3R7WA 4K81B 2GEUA 2HXYA 3IIMA 5JSZA 3DPUA 5LPNA 5M04A 1XEFA 3FB4A 3GFPA 3CBQA 4M9SA 2CL7X 3CH4B 1P9NA 4KFUA 2QSYA 2C9CA 4RFSB 3K70D 2IYVA 4F4IA 2QP4A 1E9BA 3GJ8A 4IOLA 2ZROA 4DLSA 3SOPA 2O0JA 3R9IA 2QN6A 4MKIA 5KOYA 3T1QA 3QEJA 1XMIA 5BN4A 5H8WA 2IS1A 2XJ4A 4LHZA 1XD8A 2VIIA 4EKDA 2XEXA 4DCSA 2X2EA 2P6NA 2ZRKA 3TSOA 1X86B 4BRUA 1E2MA 3RS5A 5CK5A 3QUSA 2JJ2D 4XSGA 1SXJC 1BH2A 2VPPA 4TMTA 5HCIA 1F5NA 5DHFA 3QKRB 5FUWA 3TE6A 3RRNA 2H57A 3EG5A 1KY2A 4IDPA 1YE8A 4LHYA 4B3XA 1DAHA 4QG7A 1KZGB 4MDFA 3MCAA 4XSHA 3WNBA 4QHYA 1GIAA 4M4SA 3UATA 2IL1A 4DVGA 2O8FB 4Q4AB 1KDOA 5GJVC 5C46F 4A4DA 3N5CA 3U44B 4IJMA 1E96A 2VF8A 2CMKA 5JBQA 2NO0A 1X6VA 4XD7A 5FOXA 3W9YA 2IEYA 3AKYA 4TSFA 1MRNA 3I92A 3EA5A 4V02A 1S8FA 4TMXA 4E5UA 3EIQA 2ZETA 1S2MA 2BWJA 4Q1EA 4B47A 2QAJA 1UADA 1XP8A 4AG5A 2CBZA 1OB2A 3AEZA 4ASUD 3A4LA 5DI3B 3SHWA 1KHTA 4B76A 1KJWA 1WRBA 3KB2A 3ADDA 4Q48A 5FTMA 4D0GA 1E99A 3MD0A 5C4MA 2F43A 2PL3A 2MSDB 3F3YA 4B32A 1KO1A 1KK1A 4IEIA 4NCHA 5DI3A 1OJLA 3FHCB 3TBKA 4CEHB 3PEUA 1VTKA 4ZO4A 3SQXA 2QY9A 4IDHA 1OPXA 5KUTA 3GLHA 4N0DA 3VTKA 1RE0A 3EZFA 3ASYA 3KFXA 4G5SA 4JL6A 2AWOA 1AK2A 1M7GA 4O3MA 1U90A 3OEEA 4MGIR 3TVDA 4TMWA 3U3MA 1E9AA 1NY6A 2AR7A 3BD9A 1J7KA 1IN5A 3K0AA 1JEEA 3PFIA 3QPVA 3SNHA 1JPNA 1N0VC 4O0MA 3G82C 4KAXA 1IXZA 3M6AA 4NP6A 4H1VA 1PLKA 2PT5A 2VSXA 4UNQA 3C16C 3T12A 5KSPA 1L2TA 4Q4HA 1U8AA 2BMDA 2Q3HA 2ZANA 1JJVA 2C03A 5GVRA 2PEZA 2R8RA 2CL6X 2WSSD 5JI3E 1SVMA 1RJ9A 2YINC 1D9ZA 4DBLC 1DPFA 2QENA 1KI8A 3K0EA 1NNEA 1SVKA 1OKKD 2KI5A 4BFXA 5HZKA 3AVXA 2EW1A 3AKEA 1P5ZB 3LRPA 2YWGA 5EE5B 5H70A 4NYMR 2AD5A 4LUCA 5AJXA 2E1RA 2BCJQ 4CF7A 2ZU6A 3FTQA 3T61A 5C18A 2WMOB 3EASA 3BERA 2ODWA 4PC1A 3SYLA 4KHZA 4NCJA 5FR2A 2J0SA 4HLUC 5DO9A 3QNUA 4BECA 4HI0E 2LKCA 3FKSD 4Z54A 4KBFA 3QXJA 3EIEA 1TX4B 2VP5A 1W36B 4ZCLA 4MRSA 2DWPA 4W5JA 3TW4A 1RJ9B 4B2PA 2W0SA 4ZDKA 5AR1A 3OAAD 3ZJYA 4QFMA 2IYUA 1Z6XA 3A1SA 3WXMA 4EPYA 1YZLA 3SYNA 3M4YA 1W7AA 2UVQA 1Q22A 5JWRA 3TJZA 3SEAA 1QHXA 1NLFA 1ZUHA 3CNOA 1ELOA 4ESVA 2B7BA 1XBTA 3BWDD 2VSOA 1UBCA 1KGDA 3OZXA 4D4KA 1XMJA 2HT1A 4U02A 3KKQA 1E2FA 4NCIA 4DKXA 1W4AA 1Q1BA 4M1OA 4DJTA 2XXAA 1KMQA 4EIWA 4XWOA 1B0UA 3A4NA 4HB3A 1P6XA 4URUR 4ABYA 4G0NA 1A4RA 2ZVPX 3Q8XB 3LY5A 5JWOA 4C30A 4EQ6B 1XPUA 3GLHB 3EZ2A 4DWJA 1LF0A 3QY0A 1ZU4A 3CX6A 1XD2A 1R0YA 1SVOA 3MJRA 3R20A 3ZZUA 4Z51A 3CWQA 2GF0A 4O2RA 1ZMXA 2VLIA 2DPXA 1DADA 1HV8A 2AKYA 4TTPA 2ZJZA 3THWA 3A4MA 2QRZA 4IFEA 2EYQA 3HDTA 3V4RA 2FMXA 4QNRA 1D2NA 3AVYA 1G6OA 2BKEA 2FG5A 1CF4A 2YWFA 2HF9A 4RZXA 4B43A 2QI9C 1HQCA 1XU4A 4A6XA 3NXSA 4Z8XA 1BIFA 1P9RA 4JLKA 4D4JA 3K0AB 4Q18A 2AD1A 1Z08A 5DI9A 5HTKA 5TY0A 2I4IA 2RB4A 2IHYA 4OYHA 2BHRA 5C2JB 1N6KA 1W5SA 1ZM9A 3FKQA 1KZ7B 1LVGA 2BBWA 3LQRA 2WAXA 2ZEJA 2VO1A 3GQBA 4JVLA 3BIFA 3OE7A 1C4OA 1K8RA 1UDWA 4XTCS 5IK2A 3VQTA 5HCNA 4D25A 2D7DA 4YMUA 2OCYC 3OEHD 2Z5FA 1UJ2A 2BKUA 3Q7QA 5B64A 1ZIPA 1UFQA 4P3YA 1AS0A 2A9KA 3Q9LA 1Z6TA 2YYZA 3QG5A 3DKPA 2FFBA 2Q6TA 2PLFA 4FCWA 1Q1ZA 1YHNA 5E7MA 3I73A 5IRCD 4RZUA 5FI1B 1CJMA 3GPLA 3ZYCA 1F2UB 5CLLA 3I62A 4YDSA 3OE7D 3AF0A 5AJZA 4M8NE 4PZYA 2O52A 5JLJA 2ZITA 3LQQA 3VX3A 2WWGA 2RGGA 1G8HA 2NZJA 1E69A 1TQ2A 4QL3A 4W7SA 1LS1A 4KSCA 4A1FA 3W90A 2R6CA 2ZR9A 3RABA 3B1ZA 2BEJA 1UEJA 2EFHB 4RD1A 4OJQA 1WP9A 4ZIRA 2QMOA 1XMSA 1E4VA 4B73A 4WZ6A 3FDIA 1ZD8A 4R2HA 3HJNA 4PHHA 4TMKA 3AGQA 2YVUA 1UM8A 1XEXB 2ZVQX 1OIVA 2D62A 3IEVA 1U94A 3MJHA 1ZP6A 4UNRA 3VR6A 2GVZC 2FA9A 4QC2A 4A8JC 2O8CB 4NL4H 4OHXA 4M9ZA 4N0EA 4DUGD 3W8RA 3VAAA 1QHGA 3BFVA 3VNUA 1AKYA 1XTSA 1JXOA 2H5EA 2IEZA 1W49A 1T3LA 3C7KA 4C9BA 4OK3A 3U7EB 4RCZA 1SQ5A 1VG8A 2BMEA 3DEFA 4B3DA 5JS8A 1R5NA 1W2GA 2F3RA 4URVR 5UKDA 2GCOB 3ZQJA 3ETLA 1KI6B 2GK6A 2NO9A 1N6HA 4Q1AA 4ZDJA 1C9KA 4LJ9A 3C5CA 4M9QA 1Q1EA 4R98A 4KYIB 2ZE7A 2WJVA 3AVPA 1G4AE 1YR8A 1AGRA 1DBSA 4US1R 2VEDA 4G5QA 3U2QA 1U99A 1QVRA 2JGNA 2YWEA 1C1YA 1P2UA 3P26A 4JL8A 2ZRHA 3CF6R 4I81A 4PSAA 3R7WB 2QPAA 4BEBA 1HT1E 1SVLA 2BBOA 5AK0A 3H2YA 2JAQA 2JJ1D 3AUXA 3BH6A 4WXRA 1TAGA 1KI7A 1R5BA 4URWR 2IYYA 1Z8FA 4HZUA 4P31A 4F4JA 4D81A 1Z5ZA 4JLDA 1G6HA 2W2VA 2F7SA 3ICQB 2A5DA 4KI0A 4L16A 3ZGXA 1G9XA 2PEYA 1N6LA 3IHLA 3MWLA 5JRZA 1J8MF 1OE0A 2EFCB 4XVUA 4BEJA 2ERXA 2W83A 2FPMA 2VP6A 3DVLA 5GJCA 3HWSA 4FCVA 2IW3A 1XXHA 3VFDA 3K0FA 4ILEA 2EVWX 3THYA 4AK9A 1G8FA 2J87A 1V5WA 4LYAA 4X8MA 5FBQB 3UKDA 4HAZA 1E32A 3K70B 3WY9A 1RRGA 4OQXA 1KSFX 4FWIB 2WKRA 1TQDA 3D6TB 4W5WA 1Z06A 4PC6A 1P9WA 2JDID 4Q7JB 4CEJA 2GHIA 1T8UA 3P27A 5BN5A 2IT1A 2H8KA 3PITA 1E79A 1I2DA 1CULC 4IHQA 5IT5A 4MITA 1SXJA 3D8BA 4KO8A 2ZXUA 2IS6A 4RKEA 3B1YA 4MYUA 3LXRA 4HUQB 2NO7A 3CZPA 1ZD9A 3KDSE 1G41A 1KJZA 1ZNZA 3QEOA 1H8HA 1KAOA 2V4ZA 2VF7A 2ZE8A 2BMJA 1CLUA 1HA3A 5G40A 4A15A 4TYWA 2AFIE 5JJLA 2ZRCA 1YZKA 3ZVLA 3BRWD 4BPBA 2ZS9A 2GK7A 1ZNXA 1RIFA 1NMZA 1XX6A 3LH5A 3WMEA 5JFGA 3AB3A 3B5JA 1PJRA 2IYTA 1XEWY 2GCNA 3CX8A 1DELA 1EFTA 5E7IA 5L3RA 4PSKA 4PHFA 5FPKA 1KDTA 4Q9JA 4OBEA 1YZGA 1PV4A 3OF5A 2EFDB 4II7A 1X8JA 2XNDA 2DY1A 2O0KA 2P3SA 4QBGB 5K8IA 3U5ZB 3A36A 2BDTA 4OL0A 3NH9A 2WWWA 5EXPA 4HAVA 4QOSA 1JXMA 5K8UA 1NJGA 5KHOC 4HB2A 4HLQB 2FPLA 1D2EA 5JJIA 1CTQA 4DLYA 1DS6A 4MKHA 2R62A 4MH0R 1CS4C 1N5JA 2AN9A 4JLJA 2OO7A 1E9CA 4ZV4A 1S9HA 1W46A 2W6JD 2PJRA 1ZYUA 2RMKA 3ZH9B 1IJFA 2ZRMA 1OW3B 4CEHA 3P1JA 1AM4D 2B21A 3PUXA 4F93B 1FX0B 1DAFA 2B8TA 3WYGA 1A5TA 2QGNA 3B2EA 3DM5A 4EFMA 2VBCA 1VYTA 4X8LA 2RGNA 1RRFA 2IA5A 3R9XA 1GAJA 4UNNA 1CR0A 2ZJ8A 3BBPA 1GZSA 1OXXK 1ZJ6A 3AH8A 4PANA 3SJZA 3BOSA 1OIXA 2QP3A 4TSFD 4CGZA 4AC9A 4KFSA 3DM9B 3GEHA 4PXAA 3Q85A 3X1ZA 1E2DA 2OV2A 4TWZA 1WBBA 1GL9B 4RD0A 4TMVA 3I3SR 2R6AA 4TL7A 4WIAA 2FV8A 4WAUA 5KYKA 2RGDA 4C0AC 2P65A 2O8BB 1KTVA 2OLJA 4E09A 2CVFA 2DFKB 4MRRA 3S1AB 1FPMA 2OCBA 2FSIA 3LAWA 4CEIB 1IY2A 1H8EA 3W5IA 3ZZTA 2QT0A 4AG6A 4AYWA 2DYKA 2GXAA 3MWJA 4Q4JA 3BAFA 4NE2A 1R10A 2R6GA 4FXPA 5CDFA 3EPKA 1Q1QA 2GCPA 1KJYA 2CL0X 3A1VA 5L3SA 2BCGY 1KI3A 1HT2E 1P4SA 2C9OA 3LX8A 4BLTA 1NBMA 4IW3B 2ZRIA 4OQMA 1ZINA 2VP2A 4DCVA 5FPHA 1T8TA 1VHTA 4G3XA 2HJVA 4MRVA 3CF2A 2QTFA 1U9IC 5KDOA 2QBYB 1Q3TA 1J8YF 2QGZA 3U61B 2QTHA 2GXSA 3U60B 4R7ZA 1NMXA 4M21A 4YMVA 5EP4A 4QJ5A 4JBWA 4PHTA 1UAAA 4M1MA 1N6RA 5EXTA 4BASA 2GZDA 5FBWB 3SE0A 1VDZA 3THYB 1CRQA 4RD6A 4YQFA 2J0QA 1XPRA 3B9QA 1N6NA 5FOUA 1X8LA 1OF1A 2WZQA 4GZLA 2WWFA 2VA8A 1AJEA 4FI3C 1XCGB 4HSEA 1JQJC 3CRQA 1BMFA 3THXA 1E2LA 1E2EA 3WMGA 1L4YA 3GD7A 3UIEA 4Q1FA 4TYYA 3I8SA 1SVIA 5J4HA 5DH9A 2J0VA 2CJWB 2IUTA 3WMFA 2RGEA 2VTKA 1JR3E 3QXCA 1XEXA 3W3ZB 4H9GA 4KU4A 2IUSA 2Z83A 4PTLA 2O5VA 4Q19A 2V6IA 621PA 1L4UA 1FFHA 2KE5A 1P2TA 5JECA 1SHKA 4DCUA 4DB2A 1II8B 3NC1C 2GJ8A 4RSGA 4N1AA 4FMCF 2PX0A 3U4QB 3OAAA 1P62B 2CEAA 2B92A 3BS4A 4PX9A 3QJYA 1FUUA 4ESHA 1RRPA 1SHZA 3BE4A 4U7DA 1G16A 2GZHA 4JVSB 2EWWA 4MYCA 4KCGA 2RGAA 5FH9A 3IKJA 3BFKA 4NYJR 4C0BA 2A78A 2OILA 3A1WA 4NCKA 2KB0A 4Q1BA 1WE2A 1DARA 1V43A 2QAGB 1LF5A 4AWXA 1OH8A 1MKYA 2QU8A 1VG0B 4LI0A 3GJ0A 4BFSA 2DB3A 1T6NA 3AF4A 1YR7A 4Q9KA 1DTSA 1JI0A 4IXMA 2G1KA 2C2HA 1S4QA 1UKYA 4HAYA 2O8FA 3HU2A 1KY3A 1KI4A 3T34A 1QHNA 2VH5R 2AK3A 3D31A 1CU1A 4XD7D 4BQSA 3NBYC 3Q5DA 5DIFA 2FSHA 1I2MA 2JIZD 2ZJ5A 3QF4B 2C95A 1M7BA 3IBYA 3WBJA
chains in the Genus database with same CATH superfamily
3AEKB 4H7PA 2CLCX 2RAUA 3PUVA 2D0OB 2MTBA 2BRUA 5DTRA 5F3WB 4WOCA 1THTA 3L82B 4MRPA 2JKVA 2VLBA 2OHGA 3D2AA 2BZGA 5DULA 3SM9A 5EJEA 3PXGA 2D6FA 4CKWA 1DQNA 2XCSB 3JWJA 4UTVA 4J16C 1DL5A 1YK0A 4P2GA 8ADHA 3HGQA 4FNGA 2MYTA 3E58A 3F9IA 4FFLA 4G1UC 3DR3A 4GEGA 5F2EA 4BN0A 1G5FA 4EX6A 1J9GA 1N2GA 2F3PA 3FPCA 2J48A 2ODAA 3ASUA 4ZREA 2IQ5A 3ND9A 3PFNA 4GOJA 5AW2A 1E66A 1H5UA 4TT3A 1O5IA 3LDAA 1QGOA 1Z88A 3VC7A 7MHTA 1JDVA 2Q9CA 3BQMB 2H54A 3RVDA 3EZLA 2BEKA 2D5BA 3RW9A 3AY3A 1N2CB 3TWOA 1FFDA 4DUYB 3L7CA 2DTDA 1BEUB 4PNEA 1UBLS 2WWXA 1TU0A 1WVGA 3FGNA 3JTEA 1TVCA 1UC9A 2CVQA 4FYVA 3A6LA 4WGGA 3WK6A 2OHXA 1QVAA 2DCUA 1T6BY 3RBVA 2ZTMA 3TZEA 4CKBB 3A32A 2XRMA 1YRYE 2R79A 2HRZA 3R0IA 1RYHA 4HLUA 4ZZ3A 1NYQA 1P0MA 1QS0A 1YBFA 3HH8A 1U8YA 3ND7A 2D5LA 3WLKX 4JI2B 5H0IA 5FDFA 3FPJA 1USKA 3D59A 3IPRA 2PWAA 3OQPA 1EVQA 3DGEC 4JC0A 4DLTA 2FZVA 2R1TB 3DPSA 1FTGA 5GQSA 4BV8A 3V9AA 2EJWA 1F0NA 1TOAA 1X1EA 2REOA 3QBTA 2ZQ5A 5AW9A 3IOMA 4F4FA 3BHMA 5CCBA 3DDCA 3CTPA 1TK9A 2CK3A 4KV9A 4MUAA 3FVWA 2VDUE 3CX7A 5BRJA 1O97C 5G4LA 2J41A 1G20A 4A0FA 2AF4C 2JHPA 2WAOA 3SLKA 1AV6A 4KQ2A 1MH1A 3G79A 3NHJA 1RAAA 4O4HF 3HB5X 3GDGA 2XMPA 4CLDA 1B73A 1JNYA 2YR0A 3LPDA 2X1LA 3PYXA 4L6IA 1QCDA 5CBPA 1RR6A 3BJIC 3OIVA 1GKIA 3RG8A 4NEGA 4RVOA 1TYBE 3MG9A 1M2OB 4QXQA 1NPTO 4RJIA 3WE7A 3P4XA 2IOHA 5IXSA 1BD3A 4CDNA 2VPTA 2WA1A 4LZAA 3K1JA 3DC2A 3HYRA 1IZ7A 4FK8A 4LC1A 5F1YA 5IKOA 3SS8A 2CV1A 4HTAA 3VO8A 1G59A 3ZU6A 5FT9A 1Z5NA 4RF5A 2UXBB 4ESOA 1E6KA 3E81A 5DP1A 1OFIA 4MIKA 3REOA 5H1YA 2W2LA 3LUCA 4WQMA 2C2ZA 3KJQA 3BGOS 3PVSA 3S28A 4LQDA 2H3EA 5B7GA 3N8HA 3UOGA 3CYFA 3JVUA 3VBCA 1ZM4A 1FIUA 1SVNA 1CE8A 2X22A 3QVSA 4RDXA 3GGSA 4YXWA 1JAZA 1R6AA 1N2SA 3C5HA 2QZJA 1DKUA 2C3PA 1UBFA 1O89A 3BA1A 3BGSA 2PSFA 4MV8A 2GBFA 3PRKE 3RT1A 2BHTA 3EGEA 4RHEA 3MGCA 4WY2A 1COWD 2GO7A 1G7TA 3OZ7A 2AOXA 5EKSA 4HSGA 4MGEA 3ABQB 4B09A 2PLWA 1FQWA 2UKDA 3M6MD 4IIJF 4EX7A 3DLTA 1P2SA 5D01A 4DIEA 4JJEA 3A1UA 3DW3X 1RRCA 3BCRA 1GG8A 1NYLA 3BK7A 3D2BA 3F49S 5AVUA 3PCRB 1R64A 1W1UA 3ZDYB 5SZKB 1YIAA 2C5GA 4EA7A 3M6FA 1BWQA 1QZTA 2DJ5A 3VJKA 3IE1A 4GP7A 1QK5A 3F4KA 4TWAA 2FUKA 5G4KA 3ZGYA 1GT6A 1JR3D 4FLEA 2PT7A 4Q37A 4JQYA 3VNQA 4GPBA 1O6FA 5DX8A 4FEEA 3BXOA 1VE3A 2I66A 4EZBA 1CR2A 4ZAYA 1TTTA 4ON9A 4RA9A 3L1UA 4FGSA 3NBAA 3PP8A 4JC8A 4BAZA 1QBKC 4F06A 1KZYC 2O50A 1AIPA 2QXTA 2BLLA 1O58A 1BDIA 3OM8A 2Y6VA 1QE0A 3TTSA 2Q0QA 3AZPA 4CLEA 4ZVPA 1SIOA 1XRSB 4EG1A 3V97A 2ZIEA 5B7QA 4R81A 3RHTA 4RULA 2ZYHA 3DCIA 1OREA 3OMWA 3PV0A 1P18A 2O7SA 4AJHA 3QFHA 3EZ6A 4XFKA 4QO7A 4YAFA 3TZHA 1CETA 3FYUB 4IUCS 4ZCMA 2XUZA 1PX0A 1UXJA 5DCYA 1RVDA 2EBHX 1M2VB 1R9JA 3AEKA 1UBJS 3R6DA 5DV9A 2BMAA 1ZG3A 2CNWD 2JIOA 4WKNA 3F3SA 4RVGA 1ZUIA 3CJQA 4BUJA 4NYIR 5BSGA 1GUDA 4MYTA 3ST7A 3C6KA 3O7WA 3FVQA 1T2DA 3PPXA 3PXAA 2Z3ZA 2BM0A 3QSYA 2AJCA 2C07A 4L7VA 4ZEOA 3CR3C 3RBZA 3T35A 2R11A 3NEAA 1PZGA 1D0VA 2I99A 3L8DA 4XH9B 1Z5PA 2ZATA 4YBZA 2AOUA 3JVVA 3RUIA 5AVQA 1EP9A 1ZM2A 4FFMA 4U9IS 3RS9A 3RCBA 2Z08A 4RSRA 2WVHA 5T6BA 3THRA 1QH8A 1EXMA 4OL9A 1M3SA 4DXAA 2VKQA 4M9XA 4XGNA 1UPXA 1BE0A 1LSOA 2Q29A 4LNAA 1MA3A 1GQQA 4RWZA 4L6AA 3QUTA 2CVZA 4PZPA 1FRFS 3HFJA 1PR5A 1TDJA 2BEUB 1K6XA 2GAOA 4L5BA 4WJZA 2WJJA 4LF5B 1VPWA 4MGYR 2R00A 3WIEA 1HE1C 4WZBE 5AXAA 1TUBB 1TEXA 4Q00A 3EQ7A 3WYDA 4PICA 2IK8A 3N58A 4XUGB 2D13A 1K5GA 2VNIA 4GLOA 1DRJA 5D8DA 3HSKA 1HQKA 1II8A 1KO5A 1JS1X 2E3JA 2JAUA 3NJ4A 1G3RA 3OZEA 1A5BB 1BQ4A 1RCUA 1L7PA 4A5SA 1L7BA 4OOFA 1N9KA 4ZCQA 3MCUA 1ZL2A 1QAMA 3C15C 3R9KA 4EQ6A 2EARA 3AM4A 5T64A 1ULAA 3O8QB 3CNLA 1ZUD1 3GUZA 1VJCA 3OFSA 4ZAXA 5E6SB 4UBNA 1N6PA 2Q5HA 4ZYWA 3O1IC 2Y9PB 5ESDA 3FH0A 2P62A 1YJXA 1YRLA 2PYIA 5FUVA 5IC5A 1VSBA 1W96A 4CT4B 1G8MA 1CG6A 1E1YA 2IY7A 5GGYA 4AZVA 3KLBA 3U1BA 1FW6A 2HWKA 3DAOA 4J0QA 5G0SA 4MYHA 2YCLA 3SM3A 3FWNA 3V4SA 5A3JA 4IP0A 2Z8ZA 2IJGX 4TXMA 2ZYDA 1TM1E 3AW8A 1NIJA 4JWKA 5B6IA 3QU4A 1KQNA 5DYWA 5M2QA 4BQRA 3EXHC 5KTMA 2PKEA 2VRWA 4ED9A 1JIVA 3X44A 2QIPA 2F1RA 3OTWA 3FTFA 3OURA 2NSJA 1US8A 2EEPA 3AUYA 4JITA 1DXHA 4FT2A 4AMUA 3F1KA 4KBGA 4PYQA 2FEMA 1D09A 4ZQGA 3BRWA 4N47A 3K8QA 3PXDA 3L1JA 3L7BA 2QRVA 3HABA 3W79A 1Y8RB 4LBZA 5HBGA 4NQRA 3OIUA 3BTOA 4F4CA 1OT3A 4U7TB 1PYGA 4BMYA 2ZCJA 1I2CA 4OJYA 1MC1A 4K9SA 3P9CA 4RS3A 1XF1A 1PJQA 1X1QA 4JJ7A 5PGMA 4KNYA 2FPKA 4WVLA 3UMGA 2WF6A 3GJ6A 4G8JA 1IN1A 5DLDA 2HA6A 1FLNA 1V26A 4YR7A 3GNTA 4PQRA 4QDUA 4UJ5A 4Y1RA 1U8UA 1YRWA 1V5GA 2FG6C 4N3GA 3HR7A 2VDKB 4NBSA 1IY8A 2PVPA 4JVNA 1NXQA 1MV5A 2VUTA 1QE3A 2JFHA 3UFBA 3UBTA 4DRZA 4LKOA 1F3OA 5AP9A 3ZS8A 4D96A 1RJGA 3EGWA 4ENSA 1DJPA 4OLAA 2RIRA 5FLEX 3WYAA 3Q0IA 4WN9A 1CHDA 3DFUA 2ECQA 4TWJA 3GAZA 3NATA 3A3PA 2BJWA 1WBDA 4MAMA 4PLWA 2FW1A 4JVOA 1Z36A 3CEPB 3KR9A 1Y6RA 1DFIA 2DZDA 2ORIA 3FXAA 1RZRD 4L51A 5KTSA 2RD2A 2O3SA 3OKCA 5IKXA 1C5KA 1OSNA 5D85A 3RTGA 3DEJA 3UFXA 4MLPA 4N5MA 2AX4A 4MS4B 3ZKWA 2V1UA 1RKVA 1Z7EA 2ORVA 3I0MA 1SCUA 5AKKA 2HB6A 1PI3A 3EGDA 2WZCA 3PWTA 1RBZA 2YW2A 3CM0A 4WACA 3V1LA 4YPOA 5DISB 1EEHA 3ZDQA 4AD8A 3G1WA 4WXYB 1LK5A 2XE7A 2ZFUA 4DV1B 2GYYA 4ZVTA 3DDNA 3L92A 1E9RA 1AGNA 2PZLA 4I46A 4BMDA 3MUNA 3CVWA 4KHPB 1X8KA 5HFJA 3D7MA 1RRMA 1GV0A 4UM7A 2WF8A 2GZRA 2JH9A 1MJGA 2Q9UA 3HHEA 4MDYA 4CM3A 1CUVA 4JJIA 4C4TA 1E7MA 5JANA 1R4AA 2FVYA 1LPPA 1B1CA 1FNNA 1NA5A 5FOWA 1E62A 4S24A 2RI0A 4RCYA 4TQAA 1WVIA 3ND5A 2HU8A 3VVLA 1C1XB 1Q12A 1P33A 4A1OA 1GZ6A 2V97A 4FB5A 1VE5A 4YMTA 5HQ3B 3OJWA 4E5PA 1HYQA 3NYIA 4L5AA 2DHRA 3O8OA 1G7SA 4PIPA 5I9LA 3K92A 3PDUA 5F5LA 1D0IA 2P2LA 2O8DA 4GBMA 4DIKA 3VOTA 1U1IA 1X1DA 4I9NA 1Y7LA 1S2LA 2CVHA 4BBPA 4GPTA 2ZJ2A 4Z0HO 1SGWA 3LUKA 4DDMA 4K46A 5H80A 4MICA 3OTIA 1F6WA 2W8BB 3RASA 3B85A 2I3ZA 2ZBVA 3OLZA 4MWGA 3LP5A 2HYDA 1T5SA 2R6DA 5ALMA 2A5LA 2BDEA 2IWHA 3X1XA 1S7GA 3UB4A 1A9TA 3GLVA 4MV1A 2ZXFA 2N42A 2I78A 4I1YA 3RGGA 3UA4A 3GHHA 1SQSA 2JI6A 3PJDA 3RVJA 3ZQ4A 4XJSA 4G63A 4MQEB 3C4QA 4RHTA 3FWPA 4HYYA 4RV9A 1SCDA 1HYEA 2HF8A 1CERA 5FULA 5KQPA 4X63A 4WLEA 1Z82A 4YVFA 5C5IA 2VDMB 3U7IA 4GF5A 1J0EA 1XVAA 5HM8A 4WZZA 1MIOB 3UNXA 5LVAA 4YCAA 3U80A 2YHIA 4P83A 1UFRA 3CSUA 3ANLA 3GF4A 4TTIA 4WZBB 1IJBA 2GSWA 3M2TA 2X3YA 3BJZA 4BPRA 1EG7A 4I9GA 4O4JA 3KE8A 3ZN2A 4KDEA 4DAEA 1RJEA 5EE3A 4NYIQ 1E6CA 4E1VA 1UBOS 3UH1A 3KVVA 4L28A 4HDKB 2EX0A 1JALA 3MIIA 4N0MA 5B1HA 2JGKA 3R5TA 1YCGA 2ZRAA 4E4RA 3BIXA 1YZ3A 3RSLA 3LQKA 3ZHCA 5IZCC 1K3UB 1V5FA 1S3SA 2FW0A 2PX5A 4PWYA 1HX7A 2QMUA 3VH2A 5J4YA 4HGYA 2JBWA 4C6TA 1TIPA 1VMAA 1RXVA 4LDAA 4RACA 1VKOA 3RDPA 1QIEA 5KNCD 3HO8A 1YFJA 4CQMB 3WJAA 1RI1A 3FFBA 2A57A 3OM1A 3WJ2A 1FQOA 3KXIA 2IYLD 1GWNA 4IS2A 2CL5A 4NI5A 4G0XA 5B55A 5T57A 5EIXA 2HCBA 2IX9A 3QZUA 4RQUA 3OY7A 4GM1A 2XSZD 1T9DA 5EWJA 2Q41A 2UUOA 1WHTA 4DSTA 5TMPA 3OT1B 1WZ2A 1Z0SA 3WGNA 2ZCUA 3GO4A 4RVFA 2QP9X 3L79A 1RPAA 1SBIA 2J08A 3PQ2A 4UAJA 2WIFA 1SKQA 1EWKA 4C3ZA 1IHPA 1I4OA 2FXVA 4EJ0A 1GM5A 1II9A 2UZ3A 5I7EA 3WKAA 5CFZA 2ORWA 3KTDA 3M5WA 4AB1A 4OSPA 3IDFA 5HBRA 3W78A 1J1IA 2H65A 2CJYA 3CA8A 5JEEA 5DNWA 4PGFA 3BDAA 1T91A 3I9FA 3HJBA 1NW6A 3V2UA 1TJNA 1MU0A 3NRJA 4B6PA 2HRRA 3IEMA 1I1QB 1G98A 3IC5A 4EJSB 3RLFA 1KOJA 1Y3AA 3F67A 4FFSA 5D7NA 1XG5A 1NVGA 4MCHA 1NUQA 2GAFA 2GEDA 2OFXA 1NW5A 1M9NA 1SUFA 2CLLB 2QTZA 2WT8A 5ALXA 2V1XA 1EK5A 5LWQA 5MN5A 1EGQA 1XNJA 1Z0UA 2OHOA 3D6VA 3TVTA 4EUHA 5BVGA 5FPPA 2CLDX 3I05A 4OXYA 4TYNA 2PXCA 4C4PA 1WXQA 2XUOA 1QG2A 4INAA 3OKFA 2IIVA 5IBQA 1D2HA 3ZQUA 3EW7A 3H2SA 1W19A 1ORRA 1L7QA 3KYIB 4EPXA 1MXHA 4IJUA 5FHQA 1IQ0A 4M6WB 4FFBB 5JD5A 1YJQA 1JN0A 1E6WA 2CY0A 4R2IA 4Z49A 1Q92A 3WIUA 5IZCA 5DGXA 5LL6P 4PNZA 2P2SA 3WADA 5LB4A 2OK8A 5DBHX 1E5VA 3SG0A 3B5IA 2H1LA 3OFJA 4KAFA 2F1JA 3T06B 5IM4F 4OHWA 2YC2C 5IYZA 3D6MA 4G5RA 4MUMA 1PT8A 1OXTA 1V45E 4INPA 4DLRA 4JFRA 4N8SA 1KQGA 1ILWA 3Q7TA 3OFND 4RV4A 5KWJA 4R9NA 3RTAA 4IDGA 3IBTA 5E6SA 2ECKA 1GQYA 1HF3A 1K6JA 5B1YA 3N8DA 2Q28A 3BHJA 5SY4A 1XL0A 3QOFA 3SJAA 1H1LA 3MS2A 4YONB 4FOLA 3L7DA 2WJPA 2A59A 2XDAA 3SC2B 2IXGA 4LJ6A 3N9IA 4HBZA 1OMOA 1ZM7A 2QRGA 3PJEA 1PVDA 1U5CA 4L8LA 4LSGA 3EC2A 1V4VA 1NQ5A 4GVXA 4DBZA 1IQRA 3I32A 3MRSA 3ZDBA 1UOPA 1GTRA 2W2LD 1XR3A 3KSBC 4JUIA 4XASA 1RXIA 3W7BA 2P6RA 1IVYA 3BD7A 5DWVA 1PBNA 3V9PA 2OO3A 3A27A 1PQWA 2DC1A 4IZIA 4ACBA 1U3WA 3S2IA 2JG3A 2Y66A 3INNA 1AHHA 1QO0D 2F1IA 1VYVA 3G17A 5JJBA 3R0VA 4BKOA 2BEUA 1D5WA 1W581 3NDJA 1FFCA 3I58A 4CEJB 1E59A 4YLEA 5G3ZA 2P35A 2RK4A 5EHNA 1YA4A 3EX7C 1RYFA 1G3UA 1UKCA 1ODIA 2UUCB 4BEVA 2LUOA 2PMDA 4D44A 3P4UA 1HDRA 2YVKA 3VC1A 1G5PA 1F6BA 2VJNA 2WMDA 1C3OA 5AO9A 1FJ2A 1XGKA 1AXRA 2C8LA 3D6NB 2RAFA 1T1IA 1TMKA 1U3FA 2C2KA 2GS9A 4ABTA 1Z8HA 1D1TA 4MZXA 4MA5A 2VH1A 4YAOA 5LQKA 1PYOA 5EL0A 1MB0A 1U04A 4RENA 2BM8A 2WIAA 4O4HB 3CEAA 3DUWA 2CWDA 2HRDA 5E3HA 3DC7A 4IO1A 1JEDA 1JHPA 3ZDAA 1EGAA 1QX3A 3JAKB 4JELA 3OEHA 3TNFA 1HPLA 4V1CB 3T9EA 4N0QA 4RMHA 1D7AA 4RZ3A 3D54D 2H17A 1HE2A 4DBVO 4O29A 1N7JA 3BB4A 2FPXA 4EH1A 4OI0A 4IYJA 1A9RA 5KTKA 4BVGA 1DZIA 3VMFA 3K6SA 1FXWF 4K40A 3ZLJA 3L8MA 4Q34A 4QHSA 2YY7A 2VJAA 4HWKA 5IEBA 5EE0A 1KERA 1R4NB 1EDZA 2GBGA 3BA6A 5DIZA 5BMOA 2H9YA 4AU1A 3CVUA 2NADA 1LVHA 1ZMRA 4NBLA 4ZK6A 4KE6A 2NPIA 3ANNA 3GLHE 2V45A 5J3JA 2YMLA 1COZA 2XYHA 3A3KA 2G67A 3H3XA 1XKQA 1GCOA 3QW2A 5DLPA 5B4TA 1I14A 1PDOA 1O8BA 1Z0JA 2A67A 2QTVA 3X1MA 2PBRA 5P21A 1E0KA 4DMHA 3TTUA 5I5EA 2XZTA 1FRVA 2OORC 3CUVA 1N1GA 3EDQA 4IFBA 4E15A 3EEBA 3RT7A 3M89A 3T5CA 3ZW8A 2QAIA 2JBAA 2AFVA 5FP0A 4YUXA 3TL2A 1X3LA 4TV8F 2P11A 2D7JA 3UYLA 4XLLA 1Y42X 2JATA 3A8TA 3S1LA 1M2OA 3JVDA 4TLDA 1CZLA 2NTNA 2TMYA 4I36A 2NYUA 2DOKA 3IPYA 4F96A 1FU4A 1C29B 1EK0A 3QIAA 2PQMA 2ZBUA 1G38A 2DQSA 4D3YA 2JGAA 3T0IA 1TYZA 3CTMA 2GFHA 3H5RA 1N5IA 2WINI 3O95A 4FBGA 1LTQA 3RK4A 5JSUA 2R4TA 2X8AA 5AI5A 4ZJPA 4P35A 3WBKA 2QMYA 2QEQA 3IEPA 5LMCA 4JYBA 5CHYA 1ZY2A 5JMPA 2GTPA 4J1NA 4C0HA 5CJ2A 3MMZA 1CE8B 4YWHA 5DASA 3ZCQA 5HWSA 2VYVD 2C2GA 3COSA 2EG5A 3L07A 3PX3A 1WUYA 4P38A 4UCFA 3V1KA 1CJTC 1KO7A 1KOLA 4ACAA 3FN4A 4ARZB 4QXAA 2DFNA 2CUKA 2OGSA 3LCCA 4YDHB 1JFFB 3EGIA 4XQ0A 1NRJB 2NO4A 3K05A 4EUEA 3TEFA 4BLPA 2QTLA 4EJFA 2ZE5A 5K0JA 2QK4A 1ADYA 1XLTC 2PM8A 3IODA 1YQEA 2XWBF 4J0KA 3RYFA 5KSZA 4NLLA 2VCYA 3LX5A 3AVUA 3Q88A 5H82A 2CDRA 3K9CA 4FU0A 1T15A 4XWGA 5EY5B 5A04A 4BLQA 3HU5A 5JS7A 3KSDO 4ZO9A 4JYAB 1Y4SA 1PL8A 1TM5E 1X80B 2DUWA 1XLUA 2ZQZA 4RPCA 5DN6A 3WK9A 4C4YA 1TVMA 2V7BA 4L4YA 4BN4A 2Z9DA 3OCCA 3F6EX 2D4HA 2GTHA 3NHWA 2P5TB 2GCOA 1U65A 3AERA 3ZWQA 3ZY4A 3QEAZ 3IJRA 4H0CA 1C30A 3TSWA 4I9UA 1M2HA 1VQ1A 4LTMA 3IAEA 1WPXA 3ORHA 4B7UA 4GWKA 4HX9A 2NZYA 3IAAA 2GLTA 3NEPX 4YRQA 2DFDA 3D8TA 2GBPA 3VR3D 4IJ6A 4BY9E 3UWPA 2FPPA 5EIHA 1GPMA 2JGIA 3IT2A 1W93A 1R4NA 1HYHA 4GUDA 4M0DA 1NVWQ 2NPFA 2NZWA 1Y3FE 1RKUA 3WL5A 2QI9F 2A5FA 1L5VA 3C5VA 1G18A 3DB2A 5CW2A 5J58A 1FOEB 2J5RA 5FL7A 4K88A 3ILSA 4PAMA 4BQQA 2CFIA 1IK6A 1AHNA 2HO5A 2BI8A 5KNDA 1W75A 1K88A 1CR1A 4ETNA 5CEFA 3BREA 5JJ5A 1Z5UA 3EHDA 3OJOA 5LQDA 4JHXA 2ZAIA 4KQWA 2AXPA 3WLTA 3RSGA 5TT1A 5ELXA 3IEIA 3D8NA 4P1ZA 2XB2A 4B6GA 3D6HA 2J32A 5AKLA 3OD1A 3H0KA 3Q2OA 3V7NA 2A86A 2D5IA 4C7JA 3ZD8A 1WO8A 1PT9A 3U9SA 4MVYA 4UTXA 4CKXA 3T5AA 5KTTA 3QVOA 5CVEA 3AVTA 2X14A 4HLDA 1QP8A 4MRNA 3M6XA 4YFVA 3T3IA 2CXOA 3LBFA 2TMKA 5FFFA 4C0KA 2HNAA 2PX8A 2XDQA 3R77A 1NOIA 2WTEA 4DF3A 5D87A 4ZARA 3DW1X 4UE2A 3S2SA 1L4FA 2Z95A 2ORYA 4NAHA 3M1IA 5BV7A 5CLQA 1CR4A 4GLLA 3TSCA 4GR9A 1M34A 1QOPB 5DBIA 1RJDA 4HN9A 5KTPA 4TRMA 1GU7A 1WSWA 3BMCB 3I5XA 3ZVKA 1P2VA 3X43A 3C3DA 2L42A 2BZ0A 1PFQA 3HU1A 2BE7A 3KC2A 1X7DA 2NT4A 5CLHA 4LRSB 4WZAB 5BPHA 1CPYA 2RKWA 3B2QA 1O1YA 4FYKA 1N5RA 1RM0A 2POQX 1O0SA 3B12A 3JYLA 3OX3A 3HO1A 2ZSHA 3O8CA 2DGDA 2A0XA 4I0WB 4LYHA 2HDNB 3KPUA 3CZMA 1JECA 5JDIA 5LYJF 1DEAA 2OM6A 2XUHA 4RL6A 5L4NA 3VSCA 2CDNA 2FSSA 3V1UA 2QMZA 4AJLA 1X7XB 3MTJA 5JATA 2GNAA 4D9MA 2X4DA 4OP3A 3JYNA 5DU2A 4D26A 2AFIA 4GQIA 8GPBA 3FFXA 1MJHA 1UZNA 1AURA 3ZUGA 4O33A 2JK1A 1E94E 4G1EB 3OCXA 4OQFA 4TTAA 1GNQA 1TYEB 4MB6A 4MQMA 5IYZB 1F7VA 1U28A 5FPTA 3WVNA 5JIBA 2REBA 4ZYZA 1UPUA 4B0OA 2WSYB 3GLTA 1B6SA 4TTQA 1SXQA 2ZRJA 3T38A 1PL0A 3R4VA 4TXLA 1Y6QA 3GMTA 3Q41A 1YMVA 1I4DD 2ZSAA 4H0NA 3HZRA 5EEGA 1VSTA 2JBAB 4ZRDA 5BN4B 4Z3KA 5GZ3A 3QFFA 4EARA 1ESDA 1NAHA 3FROA 3HVRA 1C1DB 4CIAA 3CGWA 1T43A 2FPGB 2SHKA 4M1WA 4LGMA 5L3ZA 1E4EB 2JVJA 2IDZA 4M3NA 5TARA 1FFXB 2JCBA 1YL7A 2PX4A 1NYTA 5KYGA 5BWLA 5JAUA 1CUXA 1ZPDA 4P81A 5DM1A 1PR4A 3KWLA 5JPIA 3ZE7A 1O94A 1X7ZA 4YLGA 1IBSA 1Z47A 2NZ8A 1WDTA 3SBDA 5BMVF 1H6CA 1EJ6A 1XZQA 4MYRA 1WDKA 1WB9A 3A6FA 3THOA 1V35A 4A8PA 3WFIA 1X7WB 3G59A 1G5IA 1GADO 1WXEA 3E15A 4K9LA 4RMGA 3JQAA 5D5HA 4A0SA 4C4SA 3WTBA 1C0LA 1QYXA 3IUYA 3NRCA 1KH3A 4JDPA 4O2AF 4YCBA 5ALYA 2BV3A 5JC1A 1V41E 2C7VA 2KJQA 4RA6A 6REQA 3PSHA 1VBFA 1EGVB 2H9IA 4F56A 4MUIA 4PBTA 4XLZA 3BB1A 4I4TA 1KSHA 1Z74A 1EPUA 1G2QA 1FP4A 3N3AC 5E2IA 5EE9A 3C41J 1P0CA 3P9SA 3QX8A 5I7AA 1NVUQ 5BR8B 1ML3A 4F6LA 2AYZA 5AM1A 2WM8A 1IU9A 2Q2NA 1DEOA 2UDPA 2P2YA 1XDBA 3I2GA 1Z0IA 4NCNA 1LRLA 4R5HA 3H11B 4XD2A 3UJ3X 1OLOA 4CIDA 1XFDA 1YVDA 2ON6A 2XDYA 4PQEA 5G1NA 3U3KA 3LOPA 3VR4D 4L9AA 4WK0B 1U3UA 3SDZA 3YASA 2O6LA 4QLAA 1CUAA 3BMCA 3DVQX 1NKTA 5HEKA 2A9OA 3KEGA 2V7XA 4I5IA 4X1KA 3BFJA 2ST1A 2C20A 3H65A 3T9AA 8AT1A 1II0A 1Y9AA 3NW9A 2R65A 1U7ZA 3TZLA 2JVKA 4MB0A 2Q6OA 5IYZF 4BB5A 2NO1A 2B7LA 1EDDA 4XYMA 2I8LA 2JJMA 2W6MA 2E4VA 3K9NA 4GR5A 2J3QA 1VJ5A 2P2NA 1XNGA 4QXMA 5F9MA 4EMUA 3C43A 3VDRA 1D2MA 1JPJA 2OAP1 5IJZA 3BBLA 4WLOA 3LK7A 3LPAA 2V7UA 4X3PA 5GONA 1PZNA 5KEIA 4YT2A 3OTQA 5JZOA 1THMA 1IATA 1PYDA 1U2ZA 4DZZA 2WSBA 3D81A 5AUNB 2QYSA 3SK0A 2O7VA 3H1GA 2JKYA 3AYXB 1GFSA 3T7AA 2OFFA 4AAYA 1SZJG 3LT1A 1G4UR 2D74A 4HWRA 4J9UE 1TF5A 2WUFA 3D3JA 4GX0A 4O08A 3OLXA 4UUMA 5K3AA 1O7JA 2FR0A 1PUIA 3IVXA 5FL7D 4GRIA 2IH2A 4Z8YA 2E49A 4Q03A 5JZ9A 3AGPA 1A69A 4HN2A 4OV6B 5G53C 1OFUX 2CNWA 2FN7A 3WRXC 2UZ1B 3IALA 2F6RA 3IPCA 4DEYA 5LOVB 4UU0A 1U9IA 1NUAA 2G36A 3CKYA 4YXFA 2ZUWA 3R3YA 2IP1A 4MKXA 1P72A 3AG6A 1GGKA 1NATA 4NENA 2P0EA 2VUHB 2P2ZA 2PGNA 4FINA 4OMUA 3WRXA 3AY7A 3KVRA 1OXBB 2WQZA 3OJXA 2E2WA 2AFHA 4JP1A 4MO2A 4AIRA 4TKUB 5K03A 1KK2A 1TMGE 2DG2A 1LSJA 3DQQA 1DCKA 1E3TA 3ZWXA 4FQ5A 3AC0A 3GMIA 1KEZA 3P5BA 1GNLA 3N8GA 1ESEA 4ND5A 3SQMA 2XGSA 3E0XA 4QBFA 1SXJE 2JHGA 1J25A 5C4IA 3W3AH 1XNHA 1UXIA 2JLCA 3E4CA 3AJAA 1XVLA 3AVOA 3NC0C 4POAA 4TL8A 1KK0A 1BTOA 3VYVA 5IAAA 2YRFA 4CMIB 5BV1A 3GDHA 5TNXA 2WLSA 2IXTA 3KK0A 4FZRA 2CNOA 1RPZA 2NUTB 4PRLA 5EPEA 2JVIA 1D1PA 2SKCA 4R1OA 2XWJI 3GGPA 4FGWA 1RWWA 4H1TA 3TIFA 2PKCA 3FCYA 2HNKA 1EUQA 4N3NA 4IGAA 1BMDA 3BMOA 4BU1A 4C06A 1E1QA 3P2MA 3NEYA 2FOXA 2GBLC 2J31A 4MSUA 4W5HA 4WLVA 4QYIB 1XRNA 2HSGA 1Z2AA 1JJ7A 1JZQA 3NHKA 1EFVB 3F0TA 1J0XO 3O1JC 3QYPA 4UUNA 2BJVA 2G77B 4Q3DA 3VU9A 3W2TA 2IP2A 3DB1A 3G89A 2XXAB 1SCUB 3TLBA 3URKA 1HE8B 3MVEA 4QDTA 2ZDHA 2V8BA 2P67A 3OT1A 1A04A 1JIJA 4LAFA 4QRDA 4CKZA 2PL5A 5EWJB 1UH5A 3RC3A 2QUAA 4UU7A 4A23A 4DLKA 3A9UA 4GIBA 3GNLA 1RP7A 2QAGC 3ZW9A 3QV2A 5CX1A 1Z3CA 2ZIZA 1ENZA 4QVKA 3TM5A 3TCKA 3ZZMA 4BX3A 4HNSA 4MQLA 3MW8A 5LM3A 3IQXA 1DDIA 4IH4A 5EJFA 4NTZA 1PJ8A 4IIFA 1ESNA 4EHIA 1NZDA 2JFQA 1UPBA 2COUA 2VYFA 3ACDA 3RTDA 1AQLA 1EWYA 2M98A 1LTKA 2NXWA 3AJ9A 4BTVA 3R5KA 1KMMA 1T6ZA 4LOIA 1ORTA 1VECA 2YQ5A 1HTBA 4ER3A 1HLFA 1HDIA 3F5MA 2O2YA 3TR5A 4TKZA 2C7PA 1NN1A 4YV2A 3AR6A 2YWJA 1TI7A 2IIPA 4XIIA 4ZV9A 4BNGA 3LXXA 1FPQA 5LU9A 1IVNA 3ZHOA 4M0UA 5F2NA 3FZGA 4PZLA 3N2KA 3SXUA 3T3GA 4LNUA 3WL8A 1G20B 1MVOA 1XXHB 1XJ5A 1QKIA 2I1VB 2VK4A 3A6DA 1P7VA 3G2QA 3O9VA 5CIQA 3TLKA 4RSHA 1K4MA 5FNVB 4U7JA 2Z1DA 3L8ZA 1OY1A 1Y63A 2BSXA 3QPUA 3Q3GE 2BZ1A 2OQVA 1IQUA 3FPGA 1A9XA 2VHZA 1CIJA 2OXFA 3IKMB 1C50A 3PR1A 4JLPA 2V5UA 4B85A 1VCIA 4D1YA 1XZBA 4EKGA 4DR6B 2J4DA 1GXSA 1J99A 2CMFA 1WF6A 2IKSA 1T9GR 4WV3A 5J63A 1JA1A 4HKTA 1V37A 4F9TA 5FUYA 2QNBA 5HE9A 1ACLA 1DUSA 3FUVA 3FX2A 3O3CA 4BQOA 4DYVA 1Z6GA 4LFCB 1LS6A 2RKBA 3VKGA 2GBLA 1TUIA 3LXUX 1HK7A 1REQA 2Y1LA 3ULKA 2VUIB 3DEZA 4ARUA 4ZHQA 1ZWKA 4YHBA 2WUEA 4AP6A 2COKA 3I2HA 2D0PB 4I50B 5ER9A 5F73A 4QGSA 2O8DB 1U3TA 1U0RA 1GPLA 4WKCA 3NH6A 4OHYA 3CCBA 1IZ8A 1XQVA 3ODGA 3QI2A 3RSOA 2XA9A 2IU4A 4DC0A 1LU9A 1X7YA 2DBVO 1NBEA 3LF1A 2CHQA 2FJUA 1IN7A 1IN6A 2QAGA 4PNPA 5IJXA 1VI5A 2GB4A 5CYOA 2CLKB 4B74A 1P3JA 4MUFA 3ZGVA 1CYDA 1OAAA 2O0LA 2EJTA 4FGZA 4H08A 4LHXA 1U7PA 2GPTA 5CNJA 4XWKA 2JIQA 3U1VA 3VGJA 2WJGA 1R4MB 2WILA 3DTVD 1KEEB 5CPBA 3VO2A 2W71A 4QD3A 2V0NA 1GL7A 1Y4ZA 2QG4A 1FL9A 3OCZA 4MIYA 2I71A 2MT9A 1WF3A 2WTXA 3BQNB 2X77A 3M5PA 4N03A 5TIIA 3KT6A 1E9EA 3C8DA 4EBFA 4ZZ0A 1WV1A 1L0BA 2ISCA 4MP6A 3SP1A 1T9ZA 2C4MA 8MHTA 1JHRA 3WJ1A 1JSCA 1UF9A 1BJKA 3TPCA 7REQA 4CF5A 4IJQA 5TQ2B 5JBNA 2CHUA 1I2ZA 2P6UA 4MPDA 2OLEA 2PKQP 3P2JA 3O75A 4S2UA 3A7EA 1Z2OX 3G2LA 4W9MC 4OUKX 1MJNA 4JOBA 1GU0A 4ZZ2A 4B8WA 2BFWA 1MO6A 2I3DA 3A3NA 3EJWA 1UBEA 1MF7A 2GF2A 2VG8A 1I8TA 1IAVA 1TLFA 1KNQA 1UUFA 2C77A 4HGOA 4LHVA 3PB3A 3DULA 5F33A 4HQNA 4EW3A 4RTNA 3KKPA 3QA9A 1E8NA 4OGWA 5YASA 1N78A 4BMPB 5GVSA 1J23A 4GDFA 5J5CA 1X7GA 3HEBA 4LDZA 3QLTA 3OM0A 4ETMA 5FA8A 3AUFA 1YU9A 2GYUA 5FWAA 1C9YA 1Y80A 5AXBA 4BDTA 3K9LA 4AY3A 3P32A 4QREA 4YGXB 2QLLA 3DE3X 2ISQA 3AHDA 4FKBA 2OXCA 1J0DA 3RSZA 5SICE 4UXJA 3B60A 5GOZA 4HEQA 5F5XA 1VCOA 1NRWA 1X77A 3KQVA 3RV3A 3STXA 4D46A 3JZMA 5EC8A 1HURA 1TTPB 1QOZA 2CBGA 4QGFA 2DT8A 3K5HA 2Q9AA 2X15A 3ENKA 2X9LA 4HTFB 2H0RA 4TTVA 1Q44A 2G5TA 1EFAA 2VNKA 1CHNA 4JI5B 1M1YB 1G21A 4F97A 3KTFA 5LZ8A 1T9AA 2WJ3A 5BVHA 5JALA 1YR6A 5B30A 1P5RA 3ESAA 4PG6A 4PYJA 2GCEA 5CXUA 4TYPA 2PZEA 4LXUA 3MWDA 3QLVC 4ZT6A 3JX9A 5FBZA 1L5OA 1NV9A 3A3YA 3FYHA 4K5QA 2IX3A 4ID3A 1OFGA 5GAJA 3G88A 3IQWA 3GA7A 5GJWC 3K09A 1E5QA 3GRCA 4L4RA 4HNHA 1EM8B 3TYXA 2YV1A 1B41A 5IJAA 3CLKA 3PGMA 3UAOA 2RARA 4ADSG 1UPAA 3KQHA 4Y6SA 2II6A 2FUEA 4IVPA 3E53A 1BMTA 4ZO6A 2R2GA 3VX4A 1PWXA 2DY0A 1IG3A 1R3UA 1Y33E 1OC2A 1HXHA 2XOKA 3OQVA 1KTIA 2ZRBA 3C3JA 4RFLA 4GP6A