2RBEA

The discovery of 2-anilinothiazolones as 11beta-hsd1 inhibitors
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
260
structure length
259
Chain Sequence
b'EEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
molecule tags Oxidoreductase
source organism Homo sapiens
publication title The discovery of 2-anilinothiazolones as 11beta-HSD1 inhibitors.
pubmed doi rcsb
total genus 94
structure length 259
sequence length 260
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2007-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2rbeA00
1GUYA 5CP8A 3ZHYA 3H9EO 2P68A 5T67A 4R1UA 3HJAA 4YA6A 4UVIA 3P2YA 4YBZA 4ND1A 3VH3A 3RFXA 3UUWA 4FD3A 4TKLA 3Q9NA 1ZUD1 2Y93A 3RJ9A 4C7KA 4UAGA 4EZBA 4AJEA 1XEAA 4YTEA 2C5EA 1GADO 5HBRA 3JQFC 4WLEA 4XIJA 4YJHB 1I5RA 1RYEA 5JSFA 1I3KA 4Z3DA 4BGUA 5G0SA 4BNXA 2W8ZA 3N58A 2JFFA 4D44A 3NT4A 1ONOA 2B5VA 5JMPA 2OO5A 3WQSB 1JKIA 3BTUA 4CMKA 3D3WB 1ISMA 4CM7A 1I36A 1YGYA 1M6WA 4PLYA 4GLOA 3V5NA 4YT2A 2FSSA 3AUSA 4IJWA 4B4UA 1G1AA 3EY4A 2QZ9A 4RPHA 2NQTA 3MTGA 4C4OA 2CNBA 2TMDA 2X5OA 1VL0A 3QLJA 1ZXBA 3LVFO 4E12A 3EK2A 2VN8A 5DDIP 5BNFA 2P9CA 4NHEA 2GZ1A 1U8FO 2GYYA 2VOEA 1FK8A 2P4HX 3RUAA 1B8UA 2CMDA 1UXHA 3C24A 1E6EA 1ULSA 1YB1A 1M66A 4R69A 4YWJA 5TT0A 3VPFA 4JK3A 4ALLA 2YV2A 4OSOA 5EMHA 3ZWCA 4PLPA 4BNFA 4R3WA 1VI2A 2A92A 1DC3A 3GZ4A 3C7DB 1LJ8A 1V3UA 3UW3A 1HDRA 1Z74A 1Y7TA 2NU7A 1V0JA 1JAXA 1HEUA 2EGGA 3WGTA 3ENNA 1U3WA 4B8WA 2FPGA 3R1IA 5CPBA 4KUGA 4TZTA 3GVHA 3I9MA 3NGLA 5TT1A 1ARZA 3IUPA 4TQGA 1F8FA 1U28A 3ZNQA 5KOIA 3EHEA 2PH5A 4LCJA 4GKBA 4FFLA 3UGKA 5DBGA 2G5CA 3MTJA 5C37A 5ENVA 1IY8A 2ZYAA 2VUUA 3GC6A 3S2GA 1BXGB 1Z73A 3H2ZA 5C3MA 1EVJA 3G1UA 1LI4A 1X15A 4IJKA 4R1NA 3CIFA 2BHLA 5DF1A 1DHTA 2DC1A 2HU2A 3KSDO 1YB5A 5EN4A 4YT4A 3ZHBA 4IJVA 5HRUA 3AUUA 2J3IA 4FQ8A 3OIGA 4A5OA 3KUXA 1ZSYA 2HMWA 3GY0A 2AQIA 4RJTA 1K6JA 4ILKA 3SC6A 1Y6JA 1MLDA 2NTVA 4JJFA 1Y81A 2EJWA 2HJRA 2HO5A 4UUNA 4L73A 5A04A 1H6DA 1PJTA 2CSUA 4RPKA 2VUSA 3GMSA 3DWFA 3QVOA 4K1LA 2PGDA 1E7QA 3RAJA 3ZN2A 2EW2A 3OA0A 1G6KA 1OOEA 3R6DA 1LC3A 4WLNA 1ONNA 2FPPA 2DFVA 2CF6A 2RCYA 5DT9A 1LDGA 2CDBA 4P4LA 3ZCXA 5KVSA 2Y0EA 3FR7A 4J4TA 3ANLA 4XA8A 2DT5A 1RM5A 4BNUA 1O94A 1R15A 2FZEA 4HX5A 1JAYA 3DBHA 4H15A 3LLSA 2CD9A 3ZHZA 1BXGA 1XGKA 4BIIA 3E1KA 4Y67A 2BGLA 2YFQA 4DMLA 1U4OA 3B70A 1PQUA 1IHXA 3AK4A 5HM8A 4BNKA 1E92A 4YJGA 4B7XA 3CMCO 4WGGA 4BS9A 1N92A 3CH6A 3DAGA 2BRUA 3SJUA 1GYPA 4IXWA 3ZWVA 2ZB8A 2VT2A 4PG5A 1LSSA 1JU9A 3RC1A 4I1IA 2J6IA 1P31A 3P7MA 1HLDA 3D4OA 3K2EA 3PHIA 4N7RA 3VKUA 2I3AA 3EC7A 4IDGA 4JNKA 3L77A 4Z3KA 3IL2A 2I65A 4L8VA 5JDCA 5IDYA 2CZCA 3A1NA 3PJEA 3RD5A 2F1KA 2OBYA 3KYDB 4BKOA 6ADHA 3OH8A 1LLDA 3C7CB 1NFQA 4M87A 1G0NA 2PTGA 1K2WA 2I9PA 5J23A 5JC8A 1LLCA 3DBHB 1T1RA 4NBVA 1DRUA 1HZZA 3AWDA 5JAQA 4EEZA 4MVJH 1EZ4A 1UZMA 1LTHR 2PZKA 2BELA 2J3JA 2Q2VA 4R68A 5A3JA 2Y1GA 4KQWA 4I5GA 1ZSVA 3PWSA 1O9BA 1IPEA 4UVDA 3WTCA 5B12A 5FYDA 1EMDA 2JL1A 2ZJ0A 4AL4A 4L75A 1NXQA 4BMSA 3QP9A 1XDWA 3RU9A 3FNGA 1ZXLA 2O2YA 3BMNB 3I9NA 1PQWA 3UCEA 4WECA 2FWMX 5JAMA 1T24A 1N1GA 1ZEMA 4B8ZA 3NTRA 4FGSA 5CEEA 1JWAB 1XLTA 2VNSA 4OQZA 4E5NA 1QYDA 4JCOA 4J3FA 2Q46A 2HK8A 1TLTA 3PWKA 1UXJA 4ZQEA 3KLPX 5COAA 4E2ZA 3QQPA 1E3WB 3IUSA 3ZI0A 4BNLA 3JQAA 1XCBA 4KWIA 2BLLA 1EK6A 4IDEA 1JVSA 2A9FA 3KYDA 4I5EA 4KP7A 5DCYA 3SXPA 4J7XA 4DPMA 5JCXA 3W4IA 3BTSA 2O3JA 4RZIA 4NFSA 3WS7A 5K6AC 3VPHA 4C7JA 2R00C 1GZ6A 4OMUA 3GGGA 3AY7A 3JQBA 1IYZA 1K5HA 1H6BA 3LT1A 5L4LA 3DC2A 1GY8A 3LF1A 1MGOA 4WCFA 3VDQA 5CEFA 4DQVA 2PD3A 1U7TA 3RJ5A 2HAEA 4AVYA 1IL0A 1P1FA 3ONFA 1HYHA 2C7VA 4A2CA 4DQUA 1N1EA 1BDBA 2BFMA 3W1VA 4MINA 4RF4A 2DU8A 1W0CA 1ZIDA 5G0TA 1NYTA 4ND2A 2YDXA 3V2GA 3WGIA 1PWXA 3ONEA 2GO1A 2PY6A 4OYRA 3GDGA 1CYDA 2Y1OA 4RLSA 2WYVA 3S2IA 3G1TA 1YS4A 5A9TA 1O89A 1ULUA 4JBGA 2E49A 2I5PO 3JQCA 3W8EA 2VYNA 3C7AA 3VAZA 1E3WA 2HK7A 4GX5A 3E82A 4XGNA 3S8MA 1ZK2A 1GCUA 1LEHA 2GDZA 1CETA 1W8DA 2CVQA 2R2GA 4XYEA 4PZDA 5JDCC 4YPOA 1HDXA 2UDPA 3OBBA 1U8XX 1LX6A 2NTNA 3ENKA 2AXQA 2DBVO 3TOZA 1UAGA 4RPLA 1KEUA 2GLXA 4XQCA 2NVBA 3BMCA 4YJFB 3COSA 4IQ8A 5L7TA 2O7SA 3ONDA 4P38A 3H9JA 1R4NB 4UVGA 3H5RA 1MUUA 3QY9A 3TF5A 3VZSA 1SAYA 4ZN6A 3AY3A 5JYDA 2GERA 2PKQO 1DIHA 2EG9A 2NSDA 3RBZA 3FNEA 2HUNA 1KVSA 4CLRA 3SBOA 4J90A 5IXSA 4OXNA 2POQX 4NJMA 3ITKA 3D0OA 1RJWA 3OJOA 2O4CA 3C85A 4ZA2A 3UN1A 1RM3A 3KXDA 3P19A 3F6YA 4DRYA 3TFOA 3ZV3A 4BO5A 1UR5A 3VPGA 4CM6A 5EERA 4R3NA 4Y6PA 2GCGA 1XYGA 4WNIA 4LSWA 2C7GA 4IM7A 4EJ0A 4P4GA 1ZFNA 3GEDA 4J43A 3PK0A 2DM6A 2O4UX 1PJLA 2FR1A 2IXAA 3RC9A 1SB9A 2VQ3A 2HQ1A 4FFRA 1O6ZA 1V9LA 4A0SA 1JTVA 3AUAA 3FWNA 4NBWA 4MVJP 3ROMA 4RVUA 5KJ6A 5I7SA 5G0WA 2B37A 1HDOA 3BTVA 2JHGA 4MO2A 2JCYA 4NMHA 4BKQA 5IN4A 5B4TA 1JWBB 5JXWA 2O50A 3TL3A 3V8BA 1K3TA 1GEGA 4F46A 3PFWO 2HMSA 4WLVA 4ZGWA 3ZU4A 5GZ6A 4DGSA 5HTOA 1F12A 1M75A 4P4NA 3KVOA 4II3A 4NJMB 3ZWNA 3OP4A 3EUWA 3H2SA 1NQTA 1NASA 3AW9A 4U6QA 5CEJA 2C20A 3NYWA 1Q7CA 5EINA 4Z9XA 2J3KA 4CMIA 3RFVA 1E0DA 4IDDA 5IDXA 4WCFB 1YBAA 4ONEA 4RPJA 3OHSX 3H65A 1ZJYA 1HSOA 4J91A 4RF5A 1RWBA 4DLBA 1C1XB 4R41A 3JD1A 4HP8A 2WEKA 4PZCA 3P2OA 1K6XA 3CTMA 3STHA 5L95A 2X9VA 1V8BA 3O8QA 1P45A 4OSPA 2Y1EA 4O59O 2RAFA 5JY1A 2C29D 1XQ6A 1YOVB 4CR6A 4PLWA 4CMCA 4BKPA 1A9ZA 5BT9A 5EQFA 4GKVA 3HB5X 1N2SA 5F1PA 1LSOA 2JAHA 4II2A 4CMBA 4FB5A 2B4TO 4GSLA 5T8KC 4EBFA 1MXFA 3WYBA 1Q0HA 3UOGA 1LSJA 3FCOA 1NWHA 2BF7A 2OZPA 2ZTUA 5T5QA 3PLNA 5L4SA 1ZEJA 3OMLA 3B1KA 3H5NA 1HF3A 1HL3A 3HG7A 4B4WA 3H9QA 2DPHA 3JYLA 3H9GA 2CDAA 3I9LA 4S1VA 1BW9B 3AM5A 1B0AA 1HDZA 2JD2A 3VDRA 1Q0QA 1T2DA 2EHDA 3WNVA 3JQAD 4BO1A 3H3FA 3JQEA 1UZLA 2WJPA 3HADA 1O0SA 5TJHA 2V6BA 1LXCA 4Y6RA 2ZJ1A 1C1XA 3U3XA 3ZNNA 5DNAA 3F1KA 1A27A 3E18A 1MC4A 1S6YA 4L9RA 3CXRA 3W4JA 4U6SA 4F6CA 4M86A 4UVEA 5A9RA 3NKLA 4OOFA 3K8ZA 3EMKA 3GVIA 2O2SA 1W4ZA 5DOZA 1WNTA 3HQ4O 4JP2A 1HZJA 1D8AA 1DC6A 1FMCA 4M55A 2V6FA 4W9NC 5G4LA 1DIBA 4PG4A 4AJ2A 2EWMA 4FOSA 3KSUA 2W4QA 3ETEA 4UULA 2NWQA 1QV7A 3DZFA 3PIIA 1Z7EA 4N5NA 2CVZA 4Q3NA 4FC7A 3RUCA 4U5QA 3VVCA 1U2GA 5TC4A 4ND5A 1CJCA 2NVWA 1YO6A 1A9YA 3WWZA 3DL2A 3AUTA 3RC7A 4AJOA 3TZCA 3VH2A 4Y8VA 3QSGA 4XRGA 3DHNA 1SPXA 1NFRA 5ADHA 3U49A 1Y8RA 4GI2A 2B5WA 5LC1A 4TMFA 3I23A 3BTOA 2JAPA 4H16A 2GZ3A 3PGJA 4PVCA 5GZ3A 3JYQA 4NK5A 4J1SA 4XIYA 4J0FA 3ZWBA 3K6JA 5KWEA 4Q9NA 3F47A 2IZZA 4W82A 5DULA 4ALJA 4JQCA 2W2LD 3KEQA 3M6IA 4ALIA 4H3VA 3BHIA 4XYGA 4BGVA 1QLJA 3LC1O 4GMGA 5DCUA 1GZ3A 3C8MA 3WGOA 1S7CA 1KC1A 1AE1A 1MB4A 1UXIA 4NBTA 3ICCA 3OM9A 1HE3A 4E2YA 4XJTA 1RM0A 2HLPA 4QXMA 1O8CA 4OXKA 1FDUA 2O3RA 1HKUA 1W6UA 3BMQA 5ES3A 4LRSB 1WDMA 4UUPA 5L4NA 3NDIA 1QG6A 3DR3A 3OICA 4QTZA 5CDUA 4GSKA 3OJLA 1WLYA 4IUYA 4XYBA 4OH1A 5BR7A 4CMHA 4BUCA 5IAAA 4YQYA 5JNLA 1KY5A 3MJTA 5U4QA 4E0BA 5BSHA 3EZLA 5EPOA 4CM9A 1UP6A 4HFJA 3F4BA 4DA9A 4B7CA 2ZB3A 2DVMA 3MWEB 2OXIA 2ZB4A 1GQ2A 1UJMA 1O95A 1TI7A 1BSVA 5F3RA 4DLAA 5DBFA 2JD1A 3RIHA 2NU6A 4CL8A 3U4DA 4O0LA 1DJNA 4CM5A 3PQFA 5CAEA 1XG5A 3L6OO 4RVFA 2WDZA 4FR5A 4J9VA 2OUIA 5L9AA 3HDQA 1P33A 4AJIA 4PVDA 5T6BA 9LDBA 3LLVA 1CDOA 1XA0A 2HCTA 3DXFA 4O63O 1H2BA 4CPDA 1D1SA 4AICA 3PGXA 1AGNA 1BMDA 5KCZA 1Y8QA 1YQXA 4N5LA 1N7HA 3PHHA 4MKXA 1YQDA 1DAPA 1HTBA 4IXTA 5I9MA 4NH4A 3PYMA 3ABIA 3M1LA 2PFGA 1UZNA 1C0LA 2P2SA 1U3UA 2Y1FA 4L76A 1JQBA 3BAZA 2QRJA 3WYEA 3MJSA 3G3EA 3IJPA 3WIDA 1IE3A 1I2BA 4JROA 1GEEA 4QEDA 5A02A 2QRKA 3WBBA 3KV3O 1R16A 4W6ZA 3RUDA 4JGBA 2H5LA 3U4HA 3OETA 2FR8A 2AA3A 4K9DA 1ORRA 2D5CA 4BB5A 1B2LA 1WP4A 4GX0A 4QFDA 3IDSA 4DREA 5H82A 2EGHA 3B1FA 2UUOA 4CL3A 4B4OA 4E5YA 1VJ0A 3DBVO 2UUPA 4BQPA 3INGA 4IQ0A 2RHRA 2I6TA 2E37A 3PEFA 3WMXA 4FJ2A 4GWKA 1DAOA 2VWQA 4K28A 1E6WA 3BMNA 2VYVA 1F8GA 2B0JA 4ZD6A 5COQA 1X1TA 3GZNB 3IP1A 2X5JO 2YDYA 2BKAA 2OMEA 2ZKLA 4UVHA 4WKGA 4LW8A 3C3XA 1ADBA 4WCDA 3M2PA 2B36A 3DOOA 3AOGA 4U0JA 1M6HA 2AEJA 3GNTA 3LQFA 5K6AA 1P9LA 2BMAA 2XAAA 4D42A 3WBFA 1VJTA 2CFCA 4IY1A 2GN8A 1BHSA 4PLFA 1DIAA 1HDYA 1E7RA 1R0SA 4B3JA 3RI3A 3A06A 4HBGA 2NADA 4DIOA 3IAHA 4XYLA 2D3TA 3Q11A 4EI2A 4QECA 5F5LA 4YJDA 2YQ5A 2DTEA 1A7AA 4PLGA 5H81A 3WFIA 5TNXA 3AU8A 2Q2QA 3GG9A 2E82A 4RORA 3HZZA 1PZEA 3N74A 3ZV5A 1IOLA 1YONA 3O03A 4NFYA 1BVRA 1TT5A 1E7YA 1I0ZA 4GPD1 4Q3AA 4A03A 1MG5A 3ANMA 4J2OA 3HE3A 4BHTA 4F6LA 4CODB 5FI5A 1HWYA 3G49A 2Q45A 3OEYA 5C7IO 1P0CA 2UYYA 3I52A 4CQMD 3E5MA 1H6AA 1ADCA 1A4IA 2ZATA 3M2TA 3DMTA 3F5SA 2HSDA 3ZW9A 3DO5A 4Z9YA 5F1OA 3NAQA 3NV9A 7ADHA 4J7CA 1YQGA 1IULA 3JD4A 2PZMA 4LCEA 5AVOA 1UH5A 2EW8A 3WQQA 1E1NA 3ZU2A 2PD6A 1VSVA 1B7GO 4WOKA 2WD7A 1D3AA 1T1SA 2IZ0A 2VZ9A 3AI3A 2WE7A 3RUHA 2GUGA 1SZJG 3MJEA 1DC4A 4HWKA 2I66A 1X0VA 4MVJG 3IJRA 1R12A 5ER6A 2X0NA 3WTBA 3GPIA 4AJPA 1ISGA 3QIVA 3ZWOA 1N8KA 3L9XA 5C7OO 4MKRA 4HFMA 3VOSA 3EVTA 1I30A 3GRPA 1HT0A 1LRLA 3QA9A 4EITA 4D7AA 1C3VA 5A9SA 4UREA 2Q4EA 4I9NA 4I5DA 4GGPA 1FDWA 2VZ8A 4LN1A 3OSUA 3H7AA 1V3VA 3RFTA 3RASA 3PIDA 1LUAA 2AG8A 2CUKA 4GX2A 3HN7A 4EYEA 4NU6A 4BNHA 4DUPA 1CWUA 5I7FA 2DLDA 4XR9A 2PGJA 2X0JA 1XQ1A 5KVVA 2X0IA 3I6IA 3F46A 1HDCA 4BNWA 2FOIA 3LDHA 1NQOA 4BNMA 5AQ1A 3DZJA 1X14A 2O3SA 4CM9D 2FHSA 3ZV6A 2J5KA 3U62A 4E2XA 1T25A 2VT3A 3BMCB 3NRCA 2RH4A 2X9GA 3GGPA 5FF9A 3UKOA 4CJXA 3AFNA 4OL9A 4Z9FA 4ALKA 3FHLA 1HYGA 1R4NA 2HDHA 3DONA 4WJZA 3G17A 2EP7A 4IMRA 3JQ7B 4GVXA 1ZKMA 1DIRA 3HUDA 1OZAA 2VHWA 2VTEA 2VUTA 4RVSA 1AXEA 1VE9A 3D5QA 1QYXA 1E7MA 1V6AA 1BDMA 1EQ2A 1U4SA 2IZ1A 5ILOA 4U0KA 4IINA 3DBLB 1ENPA 2HKIA 2VYND 4JJIA 3ZWYA 4CV0A 3ICPA 1LDNA 4KDFA 2EJVA 4WCFC 4ALNA 1SO8A 2QYSA 2GR9A 5BSGA 1OC4A 3FNHA 3KTDA 3PXXA 1UXKA 3RWBA 1NBOA 4Y98A 1ZZEA 1Y9EA 2JKVA 4WNCA 3PHGA 3I1JA 1OBFO 5TLSA 4MOWA 1J5PA 3KRTA 2O48X 3TDKA 1RKXA 4U7WA 5JDIC 3DMTC 4IJUA 3KYCB 1LRKA 3UAGA 1EDZA 1EQUA 3K30A 4EW6A 4Q3CA 5L40A 3FD8A 1GTMA 1KVQA 4FN4A 4BNJA 3JQ7A 3ZZNA 3KEOA 4WASA 2P5YA 4FFNA 1ONPA 4I5FA 3U9LA 4LMPA 3OFSA 1DHRA 1XSEA 3JQ8A 3I3OA 2GGSA 2PD4A 4MP3A 1YL5A 2VHXA 4PGFA 2I67A 1KVUA 1KS9A 2QQ5A 3L4SO 5CDSA 1GD1O 4ZVVA 3H4VA 3SLKA 3FI9A 3DZHA 1A72A 3F1LA 1F0YA 2Y66A 1CIVA 5DP2A 2H9IA 3WGYA 5KJEA 4RV9A 5L3ZA 3ZU5A 1NTOA 3D1LA 2X9NA 2VRCA 4J6FA 4CR7A 1BRMA 3HDJA 3WGQA 4DVJA 5JAIA 3HSKA 4CM8A 4DTIA 4NG5A 4GVLA 3OJFA 1DLJA 3W6UA 3GEGA 1WAMA 1YB4A 2WYWA 3SLGA 1JLLA 2FMUA 2FN7A 1YBVA 2V65A 5KJ1A 1Y5RA 2UV8A 3CINA 2ZIZA 3OQ6A 3JYOA 2PA3A 1FXSA 1G0OA 1YJQA 4YDRA 1SOWA 4M1QA 3NEPX 4BO4A 3DAFA 4UUOA 5G4KA 4DBVO 2D5AA 1Q1NA 1Y1PA 2HMUA 4XQGA 4RQUA 4MIYA 3JQ6A 1XKQA 4A7PA 5A5FA 2CF5A 2W2LA 2NUAA 2X8LA 3L0DA 2G82A 4UEJA 2NU8A 1GL3A 4YAGA 1XIVA 4WEOA 1OAAA 1P1IA 1PL7A 1U7HA 1YDWA 3RSHA 1DLIA 2ZQYA 1RYDA 1UAYA 3QWFA 1Z82A 2FP4A 3QJ5A 1HRDA 4DXHA 1I3NA 5CG2A 5K9ZA 4CM1A 1TB4A 1UP4A 4J9UE 3H8VA 3VH4A 4JIGA 1H9BA 2G1UA 1ZW1A 2HMTA 2YQ4A 5EJ2A 1X0XA 2WM3A 4CM4B 2B4QA 3GMDA 4TRMA 1HSZA 4CQLB 2NVUA 1KBZA 1MG0A 1Y8RB 1YE3A 1YOVA 5EIOA 3WJ7A 4LK3A 4YRBA 3ANNA 4E5PA 3IP3A 3LSYA 1PJSA 4PLHA 4Q3DA 3WB9A 1M76A 4J0EA 2W90A 5FWNA 4BKUA 1SCUA 1Q0LA 4D43A 3DBLA 1WMBA 1KEWA 1DJQA 4RCVA 4JBHA 4YACA 1V3TA 1I3MA 1IB6A 1MX3A 1VSUA 2O3UA 4NJOA 4YT5A 4ID9A 4ZICA 2GPTA 2OBNA 1AXGA 3QWBA 2X6TA 4GL4A 4CMIB 4BO0A 4RF2A 1P1KA 5DZSA 3WDSA 4WLFA 1H94A 1EFLA 4K6FA 2J5QA 5LDGA 1I10A 3LC7O 4YAIA 3WOHA 2AG5A 1PJ2A 1HETA 3VZPA 1YDEA 4AJ4A 1LDBA 2DBZA 4AJ1A 2VZ0A 2OL4A 4Z0TA 3PPIA 4FJ0A 4PG7A 3O8QB 4J1NA 4RLHA 3PDJA 4MVJA 1NR7A 2ZB7A 1O5IA 1ZMOA 1QYVA 3F3SA 2WE8A 3L6DA 4QT0A 1LDEA 1I8TA 3IC5A 4R1TA 1KEVA 1LSUA 3AFMA 3Q9UA 1TEHA 3GUCA 2Z1NA 3AJRA 4GMFA 3SJ7A 3DB2A 2WTBA 3KB6A 4QO8A 2BGKA 2GSDA 1N9GA 4BO3A 2YFHA 3PLRA 5KNLA 1GPDG 3BHMA 1QKIA 4PZEA 1GDHA 1NM5A 1PJ4A 5B1YA 5HS6A 1CEQA 4J2HA 3FRJA 1DIGA 4ND3A 1KOLA 1AHHA 1K6IA 3AOEC 4LVCA 4A10A 2EIHA 1DDOA 1H9AA 3PJFA 2EXXA 2FSVA 2VCYA 4I9HA 2VYVD 4I8XA 2O3QA 3UH1A 3A14A 2I76A 3INTA 3TPCA 5IDQA 3L4BC 2QZZA 3PYXA 4IDCA 1C0KA 2YJZA 4GH5A 1RPNA 3I9JA 4E32A 3NUGA 1ZK1A 5TRTA 3KHUA 1WVGA 4RGBA 5JPIA 2Q4BA 4CV3A 1T4DA 1LQTA 3UCXA 3W6ZA 2Y0DA 1SBYA 2PKQP 3N7UA 1U3TA 4D3DA 4BNNA 2C0CA 5CDTA 1C14A 1ISHA 1VC2A 3UFXA 3A28A 2PWZA 5IJZA 3SVTA 1MFZA 4HNGA 4OJNA 1ENOA 3GEMA 1KY4A 1E5QA 2Z1MA 1IPFA 1BXKA 2YZ7A 1GUZA 1SMKA 3PJDA 4OM8A 4ROSA 4CQMA 4A27A 3DTTA 2X23A 3D64A 2BD0A 1W73A 2WSBA 3Q1LA 1PJBA 4CQLA 2D1YA 1K0UA 5IF3A 5B4VA 1J4AA 1ZJZA 3PHLA 3DFZA 3Q2KA 5ICMA 4BO7A 2YW9A 1ZK3A 4IDBA 2B35A 3RKUA 4YR9A 1VKOA 3GHYA 4YQZA 4EJMA 5L51A 2XF8A 1LDMA 1DOHA 1B8PA 4KTVE 3GG2A 1KVRA 2Y0CA 4QFCA 2QW8A 4IZIA 4CMEA 3T7EA 1PTJA 5I7VA 2OFPA 4BKRA 4E30A 4X54A 3PFFA 3ZH2A 2Y99A 4EUFA 1TT5B 4D46A 5IG2A 1C1DA 2GN6A 4UEOA 4NBUA 3V1YA 2JFGA 3AY6A 3HN2A 3ZWWA 2PK3A 1AUPA 3R3SA 4FS3A 3L9WA 1LQUA 3NJ8A 3G0OA 3MJVA 4BNVA 2EKLA 1DFGA 1GV1A 1Z45A 3HHPA 1ZH8A 2IODA 1YKFA 3NT2A 3D4NA 4JLWA 4Z0HO 1GAEO 4PLZA 4WOJA 3PQDA 2BI8A 3JV7A 4XB2A 1SOVA 3PHJA 3U4IA 4O5OA 4PG6A 2JCXA 2G0TA 2Q1SA 4DPKA 5A06A 4RZHA 3T7CA 1M67A 2EKQA 5G2OA 1E7WA 3FF4A 3GDFA 3GNQA 4L4RA 1PEDA 2VWPA 2OOSA 1MP0A 3I4FA 4FGWA 4XRRA 3WSWA 2AW5A 4R54A 2YY7A 3PRJA 2IYPA 4FOOA 1SNYA 4Y9DA 4BNTA 1PL6A 3PDUA 4BNZA 1ZO8A 2NACA 1BVUA 3B20A 3C1AA 3H6KA 5A3VA 3K9QO 2DAPA 2ZYGA 3AOEA 4E2WA 8ADHA 2C07A 1DFIA 1PR9A 2CDCA 2G17A 4YVFA 4CLEA 1P0FA 2ZCVA 3DOJA 4XDYA 3WQRA 3JD0A 3UXYA 5TX7A 6LDHA 1P77A 1PR3A 2QYTA 5JW6A 5A9SB 2JD0A 5ENDA 3AM4A 5KJCA 3DBRA 1OMOA 4FFOA 3EAGA 2WYUA 4OKNA 4CLOA 1A71A 3CE6A 3OIDA 3ZV4A 2FY8A 3GAFA 2HMVA 1MA0A 3IS3A 1I24A 1BTOA 1U1IA 3D3EA 3LK7A 4M54A 1UDCA 5KJFA 1YH3A 3WXBA 4LGVA 1ENYA 4W99A 3JQDA 4XJSA 1QR6A 4AJKA 5IDWA 3ADPA 3ROQA 4CMJA 3TL2A 2UAGA 4TVBA 2J3HA 4K26A 3KM0A 1P1JA 1NVGA 4B79A 1E1MA 4DPLA 3KSZO 3S2EA 4MKZA 4ZQGA 4J4BA 4CV1A 1HDGO 1ADGA 4XGIA 2B69A 3UCFA 2DQ4A 2Y05A 4HKTA 1PQPA 2QIOA 4J1QA 1XU9A 1KYQA 5BSFA 5A4DA 2HJSA 5H83A 1X7HA 1XHLA 1U2DA 3JQGA 4K6CA 4QQRA 3VKVA 4NZ9A 3ZGYA 5A1TA 4IZHA 3HNPA 4TRNA 1BG6A 4M49A 4G5HA 2H63A 3GFGA 1EK5A 2EF1A 4CR8A 1DBVO 1U9JA 5T8KA 1NAIA 1QXSA 1ZBQA 4E3ZA 2PV7A 4BV9A 1WDLA 2VWHA 3WWYA 1E3LA 1Z75A 1B15A 2WD7B 2WMDA 4OHUA 3VH1A 2HK9A 3DZBA 5JAZA 1MC5A 3ZNPA 1YVEI 1DRWA 2GN4A 2R6JA 1SB8A 4NQZA 5TIIA 2DPGA 2C2YA 5BQFA 2DFDA 1N7GA 2A94A 3IKVA 2XXBA 2DTDA 2Y67A 5MGBA 1JN0A 3UHAA 2ZCUA 4E33A 2YHIB 4ND4A 4RVHA 3S2FA 2GD1O 1KC3A 2SCUA 2P91A 3JQ8B 4MDHA 4DL9A 5ITVA 1WZEA 1T2CA 3AI1A 3RC2A 4QSMA 2O3TA 1GQQA 2HRBA 4ZRMA 4CMEC 4B7UA 1DRVA 1WPQA 3UF0A 3OECA 4ZQBA 3RCBA 3PWZA 1QMGA 4WLUA 1GYQA 3H9UA 3EDMA 4PG8A 4MVJM 1WDKA 3HB4X 4YB8A 4HXYA 2PKRA 1CERA 2EP5A 1UXGA 2YV1A 3BHJA 4MVJI 4L74A 4W7IA 2NLOA 1LBEA 3DZGA 3DHYA 1E7SA 3ADOA 4YAJA 4AJNA 2QX7A 1JKFA 4DIFA 3B6ZA 4GX1A 2GASA 1I2ZA 4DIBA 5IZCA 4D0SA 1E1KA 4OXYA 3GAZA 5IXYA 3QE3A 3OQBA 4TRJA 2AQ8A 5GMOA 1PIWA 1QYWA 1N5DA 3GGOA 4R16A 4FIZA 4R5HA 1OFGA 3GRKA 4BGIA 4KZPA 3SEFA 4TROA 5DBIA 3VZRA 3DAPA 3LZ6A 3D5TA 2AMFA 1JVBA 1I2CA 1PWZA 3QVTA 4E21A 3HDHA 3WGZA 3GF4A 3V2HA 4RF3A 4W9NA 3WYCA 2XXJA 3QHAA 1YWGO 5K0ZA 2PZLA 1I3LA 1XR3A 2XOXA 4FSHA 3E03A 2NU9A 3IIEA 3JQBC 4L0QA 4NI5A 1X7DA 3WMWA 3PTZA 1NHGA 1J6UA 4MVJF 4O6VA 5ICSA 4BL5A 3CKYA 3LYLA 4IPTA 5ITWA 4CUKA 3RUEA 4DYDA 1DO8A 4KMSA 4B3IA 4R4JA 1P1HA 1TVEA 4IBOA 4PLCA 3Q0EA 2BI7A 4DYVA 2P9GA 4TWRA 3CMMA 4ZRNA 3V1UA 5BNIA 4N18A 3VTZA 4BOYA 1TT7A 2AE2A 2D59A 2RBEA 2VTDA 1VKNA 1J49A 3GVXA 1E1LA 1NPDA 4MVJD 3TZQA 2P5UA 1VLLA 1NNUA 5I8WA 3QV1A 3RUFA 4IS2A 3K96A 5JBIA 2DKNA 2H1SA 3FWZA 3ZWPA 2IRWA 1TXGA 4MVJE 2YV3A 1LRJA 5JLAA 4J7UA 4Q3BA 2X0RA 3JYNA 4XZ3A 1LLQA 5JY6A 1H5QA 3BMQB 4JN6B 4XR4A 2VRCD 3GA0A 3GN2A 5C7LO 1ZK0A 1PGPA 2X58A 4TVOA 3VHRA 3TSCA 4DWVA 4D45A 4BGEA 5KKCA 1IHYA 3T4XA 3GFBA 1Z6ZA 1CRWG 5L7WA 1HLPA 3EVNA 3LT4A 2WWRA 3BA1A 4KTTE 8LDHA 5FEUA 5HS4A 3SC4A 1VM6A 2GRAA 3CPSA 1MFPA 4BNIA 3GK3A 2JJYA 3V1TC 2AQHA 1Z7BA 3E9MA 3ZU3A 1Q7BA 1P1RA 3HWRA 5CFZA 3NGXA 1I32A 2VHYA 2PNFA 3FTPA 3IQDB 5A5EA 1FDSA 4IQGA 4RVDA 1A7KA 2BFAA 2NV6A 5AXBA 5DOVA 2C82A 1ID1A 3ITDA 4QUKA 5U1PA 3ST7A 3CZRA 1PJ3A 2B4RO 3OF2A 2VWGA 2ZTLA 1I01A 2VHVA 3ETDA 1MV8A 1Y8QB 3L07A 2G76A 4CM8B 4E5MA 3KZVA 4WPGA 3TRIA 3E48A 3VPXA 4BB6A 4EUHA 1HE4A 1IZ9A 3WGGA 3TFQA 4AG3A 4JJGA 1QORA 1B14A 2QG4A 2ZYDA 3D4PA 4CM4A 4D3SA 3NX4A 4HY3A 4LMRA 2EERA 4KOAA 4HV4A 5TJ9A 1AN9A 1DFHA 4GWGA 3BXXA 5JS6A 1ML3A 2B83A 5THKA 3MCVA 1L1FA 4Q39A 1LLUA 4I9UA 3RBVA 3M1AA 1GU7A 2D2IA 1LDYA 3GVPA 4N54A 5T64A 5DN9A 2PLAA 3ASUA 3R0IA 5AYVA 3GLQA 1PGQA 3JCZA 4XDZA 5AXAA 1R6DA 1X7GA 3JD2A 3DQPA 5COBA 3DMYA 4J16A 3PP8A 3R3JA 1NFFA 1NPTO 4LRTB 3X2FA 4LVUA 4KDEA 1X1EA 4J1TA 3INRA 5EESA 1U3VA 3ON5A 3Q3CA 2YUTA 9LDTA 5LCXA 4GLLA 2D0IA 4OAQA 3DFUA 1HXHA 2EKPA 4D3FA 4KWHA 3TZ6A 1P3DA 5JE8A 4ALMA 4L4SA 3PZRA 3K73O 1IZ0A 3GVCA 4LSMA 2NVUB 2W2KA 4NU5A 1PU2A 4J49A 4HUJA 1JDJA 4TKMA 3WSVA 3RUIA 3FPLA 4XEHA 5A03A 2OGUA 3K2BA 2ET6A 3A9WA 1DPGA 1QSGA 3S55A 2CY0A 5JCJA 2Q1WA 3TQHA 5KIAA 4KUHA 4CMAA 2X1HA 4JBIA 2VNAA 1K89A 5JYEA 3TOXA 3NDRA 1YJ8A 3K92A 1DSSG 3QW2A 4ZU3A 1PSDA 3KYBA 4UUMA 4TRRA 3W4KA 1N9GB 3H3JA 3DTYA 5GY7A 4Z6KA 4DC1A 1XU7A 3CEAA 3OQ1A 3PYLA 5FFFA 5LDHA 2FPIA 3F5QA 3FTNA 3MJCA 4Q3EA 2P9EA 1EBFA 2DBQA 3L6EA 2UVDA 1EE9A 2Y1DA 3CSDA 5U9CA 1HE5A 3KBOA 2BFOA 1PS0A 4AJJA 4HFRA 3C1TA 3I6QA 1KETA 5B37A 1DB3A 2Q3EA 4BMNA 4BO8A 4BNYA 1WMAA 3VC7A 4PIVA 3HFGA 3U5TA 1YXMA 5AXCA 4HADA 5JFOA 1R4MB 1E3EA 1R66A 1Q7GA 1VL8A 1YL6A 4W4TA 4MJLA 5I9NA 1U5CA 4WE3A 3HFSA 3OJ0A 4G65A 3RROA 2Q1UA 1L7EA 3ASVA 3ETGA 4JP3A 5IN5A 4OKIA 3DOCA 3RU7A 2AEFA 2E4AA 1CQJA 5JO9A 1GUFA 3TNLA 3NTOA 2Y68A 2HRZA 4XCVA 1PGOA 5TSDA 1GZ4A 1PS8A 2RHCA 3ZWMA 1DXYA 4IGEA 1CF2O 4CQMB 1ZSNA 1Y9AA 4H7PA 4UEKA 1PJCA 1M2WA 2ZK7A 5KKAA 1PL8A 4RDHA 3NTQA 1YBMA 5F1KA 5TS3A 1E5LA 3CUKA 5KTKA 5JCJD 3IOYA 3GR6A 1PX0A 3ZHXA 1IUKA 3QRWA 1I33A 1C0IA 1Y5MA 4PFJA 4MPDA 2A4KA 3K5PA 2JCVA 3GDOA 2D8AA 3O38A 5HA5A 3IKTA 1F17A 1BXZA 3QWAA 1HE2A 1PZGA 4CUJA 3JSAA 5TF4A 1BGVA 2OHXA 1NPYA 1EUZA 4EGFA 4YXFA 4YJGB 3U09A 4B4VA 4MP6A 3F9IA 1NP3A 2J8ZA 3EYWA 4MIEA 3WX0A 3MWDB 3VVBA 1E6UA 1LU9A 3DZKA 3FN4A 3OJEA 3ZDFA 1OC2A 4FFPA 2FZWA 1NR1A 2RIRA 3JYPA 1GFSA 3DDNA 3PJGA 4OIMA 1EVZA 3W8DA 4DLLA 3UVEA 2AHRA 3PVZA 2E6UX 4XQEA 4E31A 1X13A 3JQGB 4CLHA 3DBRB 2H6EA 3EW7A 5AOVA 3TJRA 4NNJA 3VZQA 4D41A 3CZMA 5BNTA 4S3MA 2AEMA 2QHXA 2X4GA 1QV6A 3U4CA 4KUEA 2GF2A 1KIFA 1XWFA 2X22A 2OORA 3QVSA 1NWCA 5MDHA 4XKJA 1EE2A 4PLVA 2PGLA 1NQAO 5DP1A 2C59A 2ZTMA 4NR0A 2FR0A 3LU1A 5CPFA 4ZJUA 1GR0A 1ZK4A 3G79A 1J0XO 3KO8A 1T2FA 5AXDA 1WXDA 4HFNA 2O7QA 2OP0A 4PRKA 2X5KO 4PCVA 3ULKA 1UDBA 3UICA 5JC1A 2IEBA 4NIMA 2BH9A 4XQ9A 3KYCA 4P22A 1UP7A 5ER9A 5JO0A 3RBXA 1PZHA 4LISA 5F5NA 4HNHA 1D1TA 5I9LA 4B3HA 1EBUA 4RQTA 3HDYA 4OGWA 3IMFA 1UUFA 2NTJA 4IS3A 4WUVA 1WWKA 4FBGA 3EZYA 4CLOB 3EGOA 4PN3A 3JQAB 1T4BA 1EDOA 1LNQA 4DMMA 4IGFA 5CHEA 4Z0PA 1P74A 1R4MA 1A5ZA 1KERA 3D7LA 2GZ2A 4N5MA 4WEQA 3V2UA 4AJHA 4DC0A 3NJ4A 3U0BA 3GHHA 2C54A 3LC2O 4ZQFA 3WGHA 3WFJA 3LT0A 3NDJA 2Q49A 3MZ0A 4JXKA 3GT0A 5THQA 4ITUA 4WLOA 3DHEA 4FJ1A 3NT5A 1LC0A 5JMWA 1JA9A 2Q99A 4YAEA 1H93A 5EQDA 3AM3A 1NHWA 3E9NA 4YJFA 1R37A 1TA4A 3TWOA 3WIEA 2WD8A 2F00A 2IDZA 1F14A 4AFNA 1PZFA 1HYEA 4CLDA 1RM4A 4M89A 4XYMA 4BVAA 3BZUA 3GH3A 4FCCA 4BO6A 2Z5LA 4J4HA 3WR5A 5G4KB 2QRLA 2BGMA 1VPDA 4TSKA 3T4EA 2P4QA 4GBJA 5DCWA 3SX2A 3FBGA 5TGDA 1MXHA 2LDBA 1EUDA 2ZQZA 2NM0A 1CQIA 3X2EA 1JW9B 1EEHA 2AE1A 1PJQA 3WNQA 3JQ9A 1B16A 1ZMTA 3I5MA 4OO3A 4YRAA 1UDAA 2EEZA 1GCOA 1DEHA 4NFHA 4E6PA 4FW8A 5L7YA 2CVOA 4EDFA 1GV0A 5GZ1A 1B8VA 1ZNQO 4YRDA 3AU9A 4M8SA 1YRLA 3GOHA 4NPCA 3P5SA 3S1LA 3JD3A 3QVXA 4ZQHA 2EV9A 5IFLA 4PRLA 3E9QA 1NX6A 2V6MA 3GZNA 3ROKA 3ZW8A 4WK6A 1FF9A 1QYCA 1ISFA 1XELA 3O26A 4RVGA 3Q6IA 1R0LA 2Q2WA 3OA2A 4OQYA 4BO9A 4RPGA 2IYOA 2W98A 4F3YA 4OOEA 2RH8A 1EUCA 4NDNE 2E48A 4P8RA 2JHFA 3GQVA 1KVTA 1FDVA 1NQ5A 1KEPA 1E77A 2GNAA 3MOIA 3GNSA 1NAHA 3WICA 3FBTA 5CDYA 4QO7A 4ESOA 2LDXA 4XD2A 1AHIA 2R00A 4RDIA 4G81A 3PQEA 2I99A 4IDFA 1ADFA 4INAA 2XPCA 1D4FA 5G0UA 4MP8A 1R0KA 3I9OA 1SC6A 1QLHA 4NK4A 1DC5A 1BWSA 4IDAA 1WW8A 3H5AA 3Q2IA 4R01A 3RVDA 2PZJA 2YHIA 4RL6A 4BO2A 2VRBA 1EVYA 1LA2A 1F06A 4R9SA 1B3BA 3TN7A 2GN9A 2AQKA 3MOGA 2IEDA 3C1OA 3K31A 4O1MA 2OP1A 1GYRA 2DUUA 3WG9A 1SEPA 1E3JA 1NVTA 3BIOA 1PGJA 2O23A 4F45A 4YT8A 3F4LA 4YJHA 2YHUA 2C5AA 3I4CA 3MEQA 3QWHA 4EEXA 2ILTA 4IIVA 2DBRA 1L7DA 3KETA 2V7PA 4U8GA 1ZCJA 3O4RA 3E6AA 3FPCA 1Q2XA 4GAEA 1ISJA 4R1SA 1BW9A 3RKRA 3QVWA 3KOUA 1FJHA 3BYZA 4CM3A 5FI3A 4RO0A 4A26A 4R5MA 2JFHA 4IIUA 1EVIA 1GQYA 3E8XA 4CV2A 3B1JA 3DZIA 5F21A 1VJ1A 4FFMA 3VTFA 4XX0A 1ISIA 2PH3A 4BQRA 4QX6A 4R9RA 1GPJA 2D4AA 5I8ZA 3OIFA 3ZNOA 1WZIA 1E3SA 3BMOB 1H6CA 4CLRB 4KQXA 1E3IA 4R51A 5BSEA 2X7HA 7MDHA 4FDAA 1SEVA 2DUWA 5TQVA 1T26A 5EL0A 2BFPA 3O9ZA 4E13A 2Y1CA 3JQFA 1OI7A 4FPXA 4XGKA 1ENZA 1U5AA 4MIOA 4GGOA 2VHZA 1VRWA 2ZTVA 1PGNA 3I83A 4CMGA 3ZWXA 1D7OA 5KVCA 4YAKA 1QRRA 1V35A 1C0PA 4E5KA 2TMGA 3ZWAA 5C5IA 3E5RA 5L45A 2NNLD 1EFKA 3LF2A 4XB1A 3W8FA 3FNFA 4D79A 3WLFA 3DEYX 1FDTA 2I3GA 1NVMB 5KVQA 3JTMA 4BMVA 1ZVMA 2J5RA 4DQXA 5I7EA 3ORFA 4D0RA 4I08A 4DBZA 3L4BA 3VPSA 3TZKA 5L53A 4YEDA 4TZKA 4Y6SA 2W2KB 1B3RA 3RQSA 5CDGA 3PI7A 3GUYA 2IXBA 4PLTA 4URFA 3ROPA 3BMOA 2A35A 2IE0A 3I9KA 4YCAA 3QWIA 3LT2A 4IMPA 3AI2A 3GN1A 3WLEA 5ILGA 4FC6A 3GPDG 5B4UA 4BV8A 1T2EA 5JDIA 2C2XA 2X86A 4GQAA 3JQ9C 3FSRA 3A4VA 4A73A 4AJLA 2V6GA 1QP8A 3TZHA 4EUEA 3MJ4A 2PR2A 1H2HA 3PZBA 4BNGA 5CG1A 5IZCC 5IZ4A 4ZHSA 4L4XA 2YYYA 5HWSA 1C1DB 3FR8A 3D3WA 3OEWA 4E4YA 2FRDA 3KLMX 4NBRA 2DTXA 2NQ8A 4CUZA 5A05A 1JKJA 5T57A 1A4UA 4W7HA 3WJAA 2VOJA 4JX8A 5G0VA 2Z95A 1YL7A 4CLXA 1T2AA 1VL6A 1P44A 2Q50A 4YYZA 1PS9A 4G2NA 4XWYA 2Q1TA 1H0KA 4EJ6A 1B26A
chains in the Genus database with same CATH superfamily
3H9EO 2XZPA 3E3MA 4MB6A 2QZPA 3HLTA 1H8EA 5T67A 2PEYA 2IBSA 3HJAA 4MUHA 1H9CA 1IBRA 1G6OA 4BRZA 3SQXA 4UJ5A 4YBZA 1OGYA 1EH5A 2MYUA 4FDVA 5NULA 1PUXA 1Y8AA 3DO6A 1ZUD1 3WWCA 2J1LA 5IYZA 3KELA 2AI2A 2HK6A 3D3KA 3MWYW 4JWTA 2C5EA 2O52A 3GFTA 2QMYA 4YCCA 4JP1A 3UB4A 3UFXB 3ZDDA 2VAWA 1AKQA 4OV6B 3ZQ4A 2W11A 5FPKA 2IS6A 5G0SA 1RBYA 1UOQA 3SMVA 4D44A 2EOAA 5HIMA 3SOZA 2VL7A 2B6NA 4HTFB 5C18A 2W2TA 5CYGA 2AFVA 3DT8A 3ZTYA 1ZR2A 3ZLVA 4LDRA 1ISMA 3IEPA 3NKVA 4CM7A 1TQDA 3PNVA 1F5SA 3GT4A 2PZEA 3QNWA 1KORA 4PLYA 3HN6A 3RV3A 3GW8A 2R65A 4TV9B 2E0IA 3HACA 1AVTA 3R2JA 1G98A 1Z2NX 4B4UA 3W5BA 3HNRA 4DR7B 3CN9A 3SDZA 4LZLA 2LNDA 1EQAA 1X94A 2Z98A 5KSOA 4G97A 2TMDA 5CLHA 4BMCA 3TTSA 1ZD2P 3QBTA 3OJWA 5DDIP 3OTQA 5BNFA 1G7CA 4ZI7F 4NHEA 3LMKA 3CVVA 1V4VA 2GYYA 4HX2A 2CBXA 1QCYA 3LGSA 4EO7A 2L2QA 1Q44A 2P4HX 3L02A 4BZZA 2XWQA 1E6EA 1ULSA 1YB1A 1EFCA 2K6GA 4V3CA 5TT0A 3T1TA 4BJ3A 5FLXA 2YV2A 4OSOA 2GOYA 4NYIQ 3VYWA 2ZRFA 1VI2A 1ZMXA 2X9QA 3GZ4A 3C7DB 3LD9A 4JMLA 2HXGA 2WYHA 2JASA 4MUFA 4KDCA 2E1PA 2HH9A 3VC3A 5B7PA 3MYYA 2ZE6A 4MIKA 1Y7TA 5C5EA 4TLBA 1JAXA 5EPUA 3KC2A 3I6MA 3FHJA 3EA0A 3R5FA 4NYJQ 4WN9B 4KUGA 3A9TA 4QDKA 3I9MA 1VRCA 2IXEA 3MMNA 5K3DA 1L7BA 3IUPA 3BCUA 4HVTA 4TQGA 3U9TA 1FRFS 2EFCB 1Y3IA 2WUWE 4F04A 3EHEA 5BWBA 1RIIA 3H16A 4JJ4A 5CGZA 5DBGA 3UGKA 4C6TA 1Y4DE 2E5LB 1J0BA 2WKRA 1RRFA 1VPLA 4U39A 2YJ3A 3T3EA 3ZJUA 1ESEA 1Z73A 3H2ZA 2ORWA 3KZNA 1Y9ZA 2VNHA 1PFGA 3G1UA 1U5BA 4IG4A 3G2OA 1EA7A 5IM4F 2BHLA 5DF1A 2DC1A 4HNSA 1XZLA 1JDBB 1JXQA 2HU2A 2X4IA 1JQKA 3AUUA 4FQ8A 4O5AA 4A5OA 1SBZA 4P53A 4HRAA 4A0RA 3UXEA 4E22A 4HZIA 4HLNA 2BEVB 3L3BA 1K6JA 4JJ8A 4L4YA 4ILKA 4TT3A 1OREA 3F71A 2HIHA 3C43A 4B7AA 3AVTA 1MLDA 3NQ41 1LPAB 4YAFA 3RYFB 3E9ZA 1REQA 3O4GA 1AUOA 2PT7A 3NHPA 2C4MA 4HYEA 4L73A 4LKOA 4RPKA 4WY2A 5A04A 2VHQA 1ZOOA 4FMBB 3GJ4A 3DWFA 1KHHA 3QVOA 2E4ZA 4F85A 2Q0QA 1N3LA 3QKIA 1EWVA 3E4DA 1OOEA 2Q41A 2ZI9A 4JT8A 3M9WA 3SICE 1NW3A 1ONNA 1XBTA 5KKNB 4CKBB 4CKCB 1TFRA 1QQ7A 2CF6A 1EDBA 2RCYA 4JI6B 4E7OA 1EFPA 2CDBA 4YN3A 1KZ1A 1HGXA 3W3ZB 5KVSA 4DJDC 1B4DA 1UIRA 2R8OA 4Z4HA 3ANLA 1HI9A 4BNUA 1GPH1 4V0SA 3DBHA 3L4KA 5GP1A 1C30A 3QXCA 2IYSA 4H15A 3FPSA 3IRUA 4N7BA 5DLQC 3TSYA 1ECGA 1JLMA 1T8WA 1XGKA 1YB7A 4WJLA 1MVOA 4L07A 2Z9BA 3OLCX 2YFQA 3H87A 4U7FA 3B70A 2XD4A 4EGAA 1ZA2A 4AMYA 4MV5A 1DQPA 2G72A 3DV0B 4CNBA 2EFDB 4NXMB 1JEQA 3EIQA 3IDQA 3UHPA 2P9ZA 2ECOA 2JGIA 3JZDA 2X15A 2WMNB 3N6RA 4PPGA 3ZIUA 1URPA 2W58A 4C0BA 4G5FA 3ROEA 2H1OA 1Y80A 5A4MS 2FN4A 2G0NA 4ZYTA 1HORA 3BUSA 1P9OA 3CH6A 2BPOA 3CEHA 4G4IA 1Q15A 4IXWA 5ECWA 1S1MA 3TQQA 2VT2A 3ZKAA 3C16C 3OPYA 5LKAA 2G1PA 1JU9A 1Z2PX 5HE8A 1OVMA 1C9KA 2CXNA 1P31A 2W6PA 2GFHA 1IVSA 3LHIA 3TQIA 4DV0B 1LCIA 1THZA 2QNIA 3GPCA 4J0QA 5AKJA 1Z6AA 4IDGA 2ICAA 5AW7A 2ACEA 5INTA 4IXNA 4HMPA 5CNKA 4BPRA 1ISPA 1TQ6A 3ZE6A 5UKDA 3EIWA 2X42A 3KYDB 1KO4A 2PX3A 1LLDA 1NFQA 1JDSA 4M87A 1G0NA 2PTGA 2QRVA 4HPWA 2R7AA 1QE5A 2C95A 5ECGC 3TQCA 2I9PA 1M0EA 2IDKA 5D6NA 1PFYA 1LLCA 4Q00A 3DBHB 3BFKA 2ODPA 4QBIA 3BRWD 3TLXA 1CUYA 1MRSA 1NMSA 2L69A 3UTDA 4Z4FA 2PZKA 3Q72A 3U7FB 2Q2VA 1NLMA 2O0HA 4K9OA 1UMCB 3SEAA 2GCIA 2WTMA 3EOBI 1DINA 3KOOA 3KFVA 2VATA 1Z0UA 3IXQA 4CYMA 3W8RA 4ACAA 3NYQA 4RTNA 2ZJ0A 4AL4A 5AESA 3GIWA 2H2WA 5HF9A 2XTZA 4BMSA 3QP9A 3I6YA 1WP9A 3FNGA 1ZXLA 2NO6A 2O2YA 3QPCA 4CKEB 1D9ZA 3HJTA 4PX9A 1ODCA 3LUBA 5LXTB 3FZNA 4LQLA 1ZNXA 3ROZA 4C7XA 1JWAB 1N6PA 1A77A 3IOEA 1ZZGA 2Q6LA 4E5NA 2JLVA 2IVFA 1IXYA 2Q46A 1NDUA 1AMNA 2R5NA 1KDPA 2ZDGA 4LWZA 5COAA 3WRWA 5C80A 3K5IA 1PTJC 4KBYA 3GELA 1KJZA 2TRSB 1PFWA 3QQPA 1UPBA 3IUSA 3LX5A 3JQAA 1J00A 2W71A 4LF6B 1QS0B 4JUBA 2PVPA 4IDEA 3A6KA 1YJCA 4J2TA 5DCYA 3UJPA 2AJTA 5JCXA 3W4IA 1ZUIA 1HOTA 1BX1A 1U5BB 2O3JA 3LBFA 4NFSA 3WKEA 3WS7A 5GTDA 4CIAA 5ADWA 3R7LA 2CCGA 1GAXA 2R00C 2WA1A 5FV7A 4JEMA 3CHYA 1N1DA 4L02A 1YVUA 3THRA 3LT1A 4G63A 4PAWA 2XKKA 1GY8A 4WCFA 2CJWB 2JBAB 4IXMA 4DQVA 4IDNA 2F3UA 2DUMA 2HAEA 2X2FA 5K3SA 4AVYA 1DEOA 2PKWA 1R64A 5JG7A 2P2LA 4QBFA 4DQUA 1BDBA 1WMSA 2BFMA 2ZSIA 1L5VA 3W1VA 5KNCD 4L2IA 3QF4A 2OQVA 5E1BA 5IASA 1NYTA 4ND2A 5CLGA 1ZS9A 3T5CA 3A6HA 3WGIA 5FQNA 3RS2A 5BVGB 2QTGA 1TYAE 2GO1A 3WLLA 4GRIA 4MW1A 1E5VA 3NPMA 3UT0A 1GG9A 3F67A 3GDGA 3VC2A 1NXWA 3UH0A 4C7MA 5HZGA 4OLJA 1O6CA 3DQQA 4V38A 1KFEB 3NHFA 3R5XA 5ALZA 3TPZA 3A1EA 2YVKA 3TJZA 2J32A 5A9TA 1O89A 3FMGA 1ULUA 2R87A 4I50A 3AT1A 1GJRA 3FFBA 4P83A 5FYQA 3PUIA 3JQCA 1JYEA 2VYNA 4JC4A 4KN5A 4MRRA 5EJMA 4GX5A 3E82A 3TNYA 1ELOA 3UYKA 4OB7A 3HK2A 4XQ0A 3ZY3A 5TDHA 4WBSA 1LEHA 1XTSA 1CETA 3UV7A 2X41A 1T10A 4KQ2A 2VP6A 5K8UA 1QO7A 5SYMA 4PZDA 1RZVA 4DDHA 2W6IA 3ZHSA 4YPOA 1COWD 3L8DA 1HO3A 2FAXA 1YR1A 2BTEA 2ZS9A 3U60B 2XDQB 3IAUA 3ENKA 3QX9A 2BONA 1XRPA 1FP1D 2E4UA 2AR0A 2RBKA 1P2DA 2FU5C 2AJLI 2YCBA 3I8SA 2PT6A 4JZKA 1D2RA 3PPWA 4HO1X 4MR9B 2NVBA 3D7RA 4KAFA 4XQCA 3WGMA 5C4MA 3IEUA 4D9IA 3LKDA 4ZYUA 1BH6A 3E4CA 4B80A 4W5JA 3ONDA 2DGDA 1OD6A 1R4NB 1MHPA 4CEJA 3ILYA 2O57A 3IAXA 1RQXA 3U3RA 3QY9A 1C41A 1JT9A 2GCPA 2X6QA 4NULA 3TAUA 4ZN6A 3GP8A 3AY3A 2K2QB 1N0HA 3RBZA 5AK4A 1KVSA 4GUDA 3TKLA 4CLRA 5IXSA 3B3GA 1BEEA 2HSEA 3KR1A 3ZLUA 5LLSA 2IKQA 3W6OA 3HCRA 1GHTA 4NJMA 4Q03A 3ITKA 3UB2A 3EYAA 2C7RA 5DI3A 2AZXA 4KNVA 2XOEA 1M6EX 4XVCA 4ZA2A 5KYWB 2Y27A 1RM3A 1J0DA 3DDZX 1UJ6A 2HSZA 2VJOA 2FUG6 5F9MA 4IJ5A 1UR5A 1F6WA 1UMBB 2XB4A 3TXAA 4BO5A 5JS8A 1RWKA 5M7EA 3EXIB 4WOBA 2GCGA 4HDCA 3G9QA 1XYGA 2C4TA 4WNIA 2FWRA 1Q21A 1G8GA 1H8HA 1U1DA 3WK7A 2OVBA 3IQXA 4OATA 1IM8A 3BBPA 3CEJA 2CLMB 4X1YB 2DM6A 2O4UX 3G88A 5K3EA 2VRWA 1FFDA 2DY0A 1SB9A 2GJAA 3IIJA 2CL5A 2VQ3A 4JWKA 5EQTA 4ZT2A 2LTAA 1O8BA 3A27A 3V7NA 4A0SA 5JD5A 2QT0A 3FWNA 1PHPA 4M1ZA 3EZ9A 4QM7A 1WRBA 4IEEA 4ZQCB 1U2QA 2WILA 5I7SA 3UMMA 1WUKS 2B37A 4KNYA 4X92A 2JHGA 1HQCA 5PNTA 3P27A 2Q5EA 3LXUX 1PWYE 4IUBS 4JLDA 1OPXA 4Y2UA 4YDSA 1GEGA 3ILSA 2IEGA 3V8BA 5B2EA 2UYCA 2ORED 3ZU4A 4DGSA 2OBMA 3ZTWA 1F12A 1M75A 2JLCA 5AM2A 5IHPA 4P4NA 2VP5A 4E4RA 1K4YA 3MD0A 2G0AA 3KQUA 3ACCA 2A1UB 4DSNA 2ODEA 2A5DA 3AW9A 4WY8A 3WOVA 4X8LA 4U6QA 1AK9A 3UFXA 3U44A 1Q7CA 2FEXA 3GROA 4RFSA 2Q4TA 2PZGA 1FXWF 2GJSA 1Q0ZA 1J07A 1TM1E 2QAGB 3THYA 4ZEMA 1OXVA 3CWQA 2CC2A 1AXRA 1EXNA 3VOTA 2FSHA 4B32A 1Z88A 4ZVSA 1YBAA 3Q0IA 3I01A 4ONEA 5ANRB 4KR7A 1F2TB 1L5GB 1N7IA 2IUEA 3WNZA 3LAWA 1KGDA 1K4MA 1Z26A 1U0NA 4YRMA 3SFVA 1BXRA 4OG2A 2V54A 2V1UA 3JD1A 2CEKA 2EJTA 5DM60 4PZCA 5L95A 1KMMA 2YZKA 3CTMA 4IMIB 2X9VA 1CUCA 1V8BA 3S1SA 4BMXA 2Y1EA 3GJ0A 4OSEA 2RAFA 5KYUA 3RAFC 1F60A 5JY1A 1XQ6A 2DWUA 1DC7A 1TZMA 3OT5A 4PLWA 4BB9A 4CMCA 5E6RA 1U7OA 2AOTB 2ZAYA 5LDDC 4HQOA 5BT9A 2FCAA 3OMXA 5EQFA 1N2SA 2CXOA 4EIWA 5BPFA 4II2A 2GEFA 1BMFA 4ZQIA 3M4JA 3IE1A 5T8KC 4BVHA 1L8AA 3TQOA 3WYBA 2OYSA 3A0UA 1Q0HA 5JARA 2GPYA 3V1MA 2UVPB 4KI0A 3B1KA 3TIVA 5IYZB 1T9HA 5KWSA 1ANKA 1ZN8A 4HX9A 1J7JA 3HG7A 3IAS1 5FA5A 3RKSA 4AU1A 2XKJE 2DPHA 3FGOA 3JYLA 2A7QA 2CDAA 3I9LA 1DQZA 2R66A 2F4VB 1AUXA 2OZEA 5JMTA 2CCJA 1HDZA 2PO7A 1B23P 3VSEA 1PD0A 2EHDA 3NTLA 3NOXA 4MGZR 3CFYA 1EX7A 1TK9A 4Y1EA 3RNLA 1JG7A 1WB6A 4BO1A 2PJDA 4LZZA 5AWFC 3H3FA 4F84A 2WJPA 2XA9A 5IXJA 3HADA 3V46A 4E2FA 1NVXQ 3C7TA 1O0SA 3NALA 1RBQA 2V6BA 5TJHA 2ZJ1A 4GBGA 4MMYB 3V55A 3U3XA 3PKJA 1QYRA 2B0CA 3WBFA 5DNAA 4AKEA 4XUGB 4XEUA 1FX0A 4CCSA 2XCTB 4L9RA 2VPTA 3FKQA 3MAAC 3UMGA 2FFHA 2IYVA 2JGMA 3W4JA 1ZRHA 3Q12A 1PYGA 2O5CA 2HD4A 1P5ZB 5JD6A 4HNVA 3NASA 2OZLA 1KGSA 3NKLA 3RUPA 1ZHHA 1KI2A 1BE0A 3K8ZA 4LECA 2O2SA 1W4ZA 2ID7A 5DOZA 3TH5A 4GOMD 3V8MA 2HF7A 5G02A 1DXOA 3H9BA 3ORHA 3A58B 3VR6H 2CK3A 4E03A 4DSZA 1C3OA 1GR1A 3FRIA 4URUR 4W9NC 3G2QA 4FCVA 1GNSA 4B81A 1CB0A 3K5WA 1AGXA 2JAXA 4U2EA 2EWMA 4AIIA 3KSUA 1NMYA 3FLBA 4LGMA 1X7ZA 4O4IF 5K0TA 1VCNA 1DCMA 5FORA 3WAGA 3K2IA 4N5NA 1C9JA 1EP9A 1ULBA 4EOGA 1IHDA 2RK3A 1W5AA 4Q3NA 3RK4A 4II7A 4FC7A 1QZTA 1E0JA 3N39C 4WTOA 1NJGA 4BP3A 2QE7A 1MJGA 5TC4A 4AB1A 3HYCA 1JSZA 4TT3D 4QICA 5DEOA 2A5JA 4A36A 1YO6A 4UNPA 1ULZA 3SXJA 3DL2A 4GG1A 3AUTA 2IHKA 2BFBA 4AJOA 3I0NA 5EE1A 3TZCA 3PQCA 3NATA 1GVNB 2RGDA 3HUFA 4BKMA 4DR5B 3DHNA 2BV3A 3U49A 3ZGNA 3ZY6A 3RGGA 2RGYA 1L8QA 3AV0B 1P72A 3R24A 4TMFA 1U0EA 3KL4A 3LX6A 4MUNA 4OHPA 1XXHE 2XJ4A 4MS3A 4Y2SA 3OPNA 2B8JA 5JEEA 5TARA 2V45A 3F7OA 4HPXB 4D0GA 3K6JA 5JVDF 4EPXA 1FDIA 5P8WA 2IZZA 4W82A 3A6PC 4ALJA 4ALIA 1K8ZB 2OYCA 1MIOA 4H17A 3M81A 4RENA 3V4VB 3H5VA 4UCQA 3LVQE 1N77A 2A1UA 3L82B 3ES9A 4KPEC 3GPLA 3KCQA 2WFZA 5BO5A 3JS5A 4Q1VA 4YUYA 1MB4A 1UXIA 4PO9A 3PFCA 3R8CA 3ICCA 1O08A 4E2YA 1AY0A 4XJTA 4DQ0A 5K8CA 1RM0A 4RV4A 1RQLA 4NH0A 5EHZA 1O8CA 4IIJF 4OXKA 5LYJB 1I94B 2GZAA 3C48A 1HKUA 2NYRA 2RONA 4XPIB 1R0BA 2FMHA 3WLMA 4ETIA 3U7EB 3OCZA 3NDIA 3PVCA 4QTZA 2I7DA 5CDUA 4GSKA 3NHAA 4IUYA 2WZCA 4JVSB 4WKOA 4XYBA 2PCJA 5BR7A 3G5TA 5I7UA 3ET4A 3M5DA 1LGYA 4TMXA 5JNLA 1XVIA 1KY5A 3NANA 5U4QA 4NV1A 1MQAA 4AP6A 2OORC 1MQSA 1UP6A 2W00A 2QQFA 4TWAA 5K3OA 2Q3JA 4B7CA 3BRSA 1N5IA 1WA5A 1ZH4A 5FBWB 1JQAA 3GJ6A 4N40A 3I09A 1O95A 2NXCA 2WU0A 1AG9A 4WZBB 3M9XA 3FRHA 5K0BA 2GEVA 2NU6A 4L72A 3BH7A 1CEXA 3U4DA 1P0PA 2ZUSA 2QVXX 2XGMA 4O0LA 3U81A 1DJNA 3PQFA 2FUCA 3ZCRA 3OZSA 2FPXA 421PA 2FGJA 1XG5A 1ND5A 3GJ8A 3L6OO 4Z86A 3NDBB 1KQOA 3R3VA 1RI3A 1BJKA 2VHEA 2R85A 3BRWA 3VGPA 4UXIA 4AJIA 4IV8A 4DLNA 1QZ3A 5HHTA 3Q9LA 9LDBA 3LLVA 3DXFA 4MKHA 4H9GA 1LX7A 2A0XA 5EI5A 4N76A 1AGNA 2JLYA 2EZ4A 2DHDA 3RTGA 3MRVA 2VIIA 4N5LA 3G2MA 3N5CA 4AKIA 2R96A 1N7HA 2DPYA 4EMUA 4K0RA 3ETNA 5JSQA 4IXTA 2FUG1 2WHYA 3KAJA 1Z5NA 4Q34A 5ALJA 4AZSA 3D8BA 3O1IC 3PD7A 3C6YA 3AEYA 3PYMA 3ABIA 2O8CB 1SVNA 2Z30A 3KT0A 3B3AA 1UZNA 3B1ZA 2VSOA 3IV7A 1FVXA 1C9MA 3BDIA 4RH1A 4DCCA 2Y1FA 1H0HA 3WYEA 1JQBA 3MJSA 4U9IS 1RYYA 1R27A 2XWBF 3HJCA 4G1CA 4NY1A 2FI1A 4QEDA 1NW6A 1N3BA 1FNNA 2G7MC 3WBBA 5A02A 3KV3O 4W6ZA 3DUWA 1NVVQ 2JIZD 4M7WA 4X6YA 4F9FA 3N8DA 1OASA 2RHMA 4ESHA 2H2AA 3OETA 3AZPA 2G8LA 4PSAA 4BJ1A 5LZ9A 4JITA 4K9DA 1B2LA 3BK2A 1M6VA 2V0NA 1U04A 3B1FA 4X1KA 1NLZA 2GN2A 5D3MB 3F90A 4XARA 3KR9A 3C5EA 1G8FA 2HX1A 4ESVA 5H7XA 4OHRA 4K40A 2ODTX 1Y7LA 2P6OA 4IQ0A 3SS9X 3WLNA 4EF6A 2E37A 1RWWA 4HDRA 4BVBA 3PEFA 4CG3A 1BA2A 4GYYA 1XRSB 3RTBA 1LTQA 3ZJYA 4FJ2A 1MJGM 1CQJB 1UZUA 2DHRA 4RPIA 3E7FA 4DLRA 1CRPA 3CEPB 4FLFA 1K3FA 1YDHA 2IHVA 3PEWA 4KR0A 4Q16A 2BKAA 1EAYA 4RLQA 3QVMA 3CZ5A 4DMKA 3H5TA 1ADBA 1WU7A 3VI3B 2OCKA 5EKXA 2O0JA 3M2PA 5KQMA 2B36A 1T1EA 4U0JA 3EISA 1XP5A 2C2HA 1D8TA 2BMAA 2XAAA 3CLHA 1CY7A 2RI0A 4NFLA 4XVHA 3TLEA 1TTTA 2CFCA 1TEXA 2IY7A 4KRGA 5IJAA 2GN8A 5CCXA 1VB3A 3WMGA 4Z7QB 1HDYA 5G3YA 1E7RA 3NBAA 4G0MA 3LYAA 3RI3A 2YKGA 1IXSB 2NADA 2RHWA 3IAHA 2PWAA 4F3NA 4QC2A 2CXTA 3OWOA 3EXFB 3MS4A 4G41A 4QECA 2HEGA 1QGED 4HAUA 4TWBA 2GBCA 1H05A 3EAQA 3QLEA 4FE3A 1YTLA 1D9XA 1OAKA 2RHGB 4JQOA 2NT3A 4EQZA 1T3ZA 2KBFA 4O2BB 5BN3B 4QDJA 5TNXA 2X2EA 2YRWA 4N0PA 4D1YA 2V9PA 3QEOA 1Q19A 2CW5A 2Q2QA 2ZJOA 2WNSA 4ZYXA 1C7IA 1YD7A 4D74A 5HKKA 1H66A 4EPVA 1L7NA 3KKZA 1VB5A 4MQMA 2IYEA 3VR2D 1IAVA 4C14A 4GR5A 3G49A 2Q45A 2WFLA 3OEYA 4Z4CA 4XUCA 2OCDA 4H1HA 4YCLA 1H5UA 3R6TA 5K4HA 5T4HA 1RYBA 3TK1A 1H6AA 5IMSA 4RK7A 3QPVA 4YMUA 4L9WA 1A4IA 4RVCA 2ZATA 5E9AA 5IVPA 2GYUA 3BWXA 2HSDA 3GLIE 1KYXA 3ZW9A 2WOOA 1KRHA 2JHAA 4Z9YA 2F1JA 5H02A 3WSTA 3T9DA 4EW1A 2ZOSA 4EDFA 4N0EA 4LF5B 3HDTA 3ILHA 1UBHS 3NV9A 4IFBA 4WUTA 3MT7A 5DISB 5DBEX 4R7TA 2EW8A 3WQQA 1E1NA 1JR4A 2KYRA 1B7GO 3FCSB 3S8YA 1E9SA 1GPAA 4KLAA 3CLUC 3SHTA 1D3AA 4OBWA 4EFDA 4K9PA 1H3NA 3H1FA 2PRJA 1A8QA 2RAPA 3GZJA 3DNMA 2ACKA 3KPWA 1SULA 3W5JA 2P2NA 3IX7A 2YBEA 5BW4A 2CDNA 2JGRA 1GGJA 1LZKA 3IJRA 1M2OA 1R12A 4OI4A 4Z54A 4N3NA 1BEZA 1G5TA 4RPCA 5CX1A 5ALIA 3I5YA 4MKGA 3H1BA 1N8KA 3L9XA 5B53A 2X0DA 4B09A 2K2WA 1VHJA 3LFUA 2FZVA 2I34A 4MKRA 1EGAA 4UCXA 5LWHA 4FIDA 3RIMA 3EVTA 3E9RA 4P84A 3PR2B 3GRPA 3K53A 4C87A 3ED1A 3NVDA 2R47A 1OXTA 4B46A 5FUQA 4DWOA 2RD2A 3VR3D 1QB7A 1EWTA 1C3VA 1Y4SA 4UREA 5A9SA 1QP7A 2XDYA 2IOFK 1VECA 3FWKA 5HTKA 1QVVA 3BGDA 1GCAA 1THTA 4GGPA 4FKBA 4DB2A 1ADYA 3L5OA 1FDWA 4LYGA 3RLFA 4CDMA 4RY2A 3SIRA 3ZHQA 1GU1A 4ES6A 1L1EA 4UATA 3UJ9A 3M3HA 2QNBA 2CUKA 4KB5A 2JDIA 4NU6A 1XZQA 2BFCB 1Z4KA 1PT9A 2ECQA 5EXDA 3PCTA 5JCOA 2CLOB 3Q87B 5ES4B 2B1RA 2YX1A 4P1ZA 5GQSA 1DBIA 3H17A 3NONA 2X0IA 4JJ6A 4BNWA 3PEUA 4RTKA 3U61B 2CKMA 2H52A 4XSVA 1X14A 2O3SA 1EFVB 3EJ6A 3KQMA 4U9UA 1G38A 4RJKA 1JPJA 3S2SA 2VT3A 1I7PA 1GAQA 3NRCA 1I2MA 2OHJA 2RH4A 2X9GA 2F6RA 3BKWA 1XV5A 4ZVRA 3UKOA 3AFNA 1OLXB 2OECA 5DTRA 5TQ0B 1EP2B 1UPTA 2QV0A 1HYGA 1R4NA 3KFLA 3WLRA 4GR9A 1YK1A 4IMRA 4GVXA 5GV7A 3KEMA 2O8VA 5K3AA 3CW2A 1DIRA 4P31A 4UU8A 3ZGXA 5BRAA 2BM9A 2PQ2A 4D8UA 3IUYA 4RVSA 1AXEA 1VE9A 3EFEA 1VMEA 3D5QA 3DDHA 2GHQA 4IIDA 4EJ2A 2IZ1A 3WL4A 3KIPA 2GO7A 1JA0A 2PX5A 3SFTA 1X3LA 2H5EA 3ASYA 2PYDA 3CPEA 4KDFA 1LDNA 4Q02A 4P54A 3TTVA 5B30A 3TW0A 2O2GA 2OHOA 4QQNA 4TSRA 1TYDE 4UNIA 4BQIA 1NXVA 2G5PA 1SO8A 1E9RA 2B7LA 3B82A 1TNDA 3OT1A 3GGJA 3WV5A 4F93B 5D85A 1XVVA 5BSGA 1MR3F 3G2KA 4LSGA 1Q0PA 4OMCA 4TTPA 1KAMA 3G0GA 3RQIA 3V3TA 5BN3A 4OI0A 1UMKA 3UG6A 1FRQA 3ISJA 1OBFO 2ZUBA 4MOWA 1XVUA 3KWMA 1OT5A 4Y9UA 2LKCA 4ZZ3A 5JXHA 3HCCA 2W6ZA 3IT3A 5DWQA 1U0TA 2OFXA 1UWCA 1MAHA 3C8DA 1GPWB 2TECE 3TOSA 1BAPA 3ZY4A 5IX8A 2ILVA 4TTQA 5EJ7A 4Z1MD 2I4TA 2ZBVA 4RZ3A 4BNJA 3EPJA 5LQJA 1IJFA 2FQ1A 2R6GA 1H3EA 2ZM6B 1N2OA 1XD8A 3KJZA 4LMPA 4YROA 3U9LA 2I62A 2QRPA 1JRLA 4H7KA 2GHIA 4QL3A 3W3AH 1GNPA 3WRVA 1LPPA 1JILA 1YL5A 3LUKA 4KKVA 5CDSA 1KS9A 2QQ5A 4BEVA 1QWOA 5FO1A 3W06A 3MMSA 3GCGA 2WIFA 3LPCA 1WXWA 3KEFA 1DTSA 1M1YB 1YZFA 4MLDA 1CIVA 5DP2A 3TJMA 3OOEA 1YCFA 3OTOB 1FNMA 2YVUA 3BFXA 1MABA 1G21E 4GF5A 1BS1A 3ZU5A 3ESDA 4C0HA 2YZGA 3D1LA 3ZPXA 2VRCA 4DVJA 1F4LA 4Y1GA 1NUTA 2V3CC 5JAIA 3ANXA 4C4SA 1F2TA 3DYIA 4TYPA 4OJKA 3ODPA 4NG5A 3JZIA 3QTBA 3WBKA 5JJBA 1C3EA 1DLJA 1UANA 3OURA 2IHZA 3ND5A 4UFNA 4PINA 3Q8XB 4MUIA 4WDQA 1YB4A 2P7IA 2DWOA 2WYWA 4UD6A 3UJAA 1IEWA 3D3JA 3KKMA 1YBVA 1R7RA 4LVNA 4O4HF 5KJ1A 3BWDD 6YASA 4L5JA 3HSSA 3QMPA 1SOWA 2NO0A 3IVAA 3IBFA 4PHGA 5DB4A 1HX7A 3T9FA 3T7DA 5EQJB 4DBVO 2HSGA 1L5YA 2D5AA 2WB4A 1UKAA 1IBMB 1E32A 1Y34E 3MBOA 2V3VA 4XQGA 5EWJA 5GJWC 1PBNA 3IXLA 3JQ6A 1QKJA 4K6KA 1MPXA 1XKQA 3VZDA 4A7PA 2OCYC 4ZT7A 1NOJA 5JISA 4LZWA 3M5CA 3PC3A 4FMCB 5IVHA 2BTOA 2QPLA 3MWKA 4NJEA 4S2UA 5I3CA 1CQIB 5K0NA 1MX5A 1M72A 2WWTA 1L5HA 3KXLA 1XEFA 1PL7A 1YDWA 3LDUA 3PXAA 4B6FA 1Q0TA 3QITA 3SKVA 2NTEA 3C3MA 2ZQYA 3E1SA 1UAYA 1YRAA 3OTGA 1XHEA 3QJ5A 2FP4A 1X38A 3H2KA 4MA5A 1KIAA 3DVQX 3FYUA 1QVAA 4CM1A 2WTXA 4QIHA 1FBNA 2A2ZA 3PC2A 3M3DA 3VH4A 3WWEA 4YJ2A 4UCWA 2ZZKA 3DXXA 3QGMA 3HR4A 3LUFA 5A2QA 3OLYA 1X0XA 3ESBA 2DQKA 2WM3A 3EXEB 1NR5A 3GMDA 3I05A 4XX0B 2A67A 4POAA 2JZCA 5IW8A 1MG0A 2EL7A 2NXJA 3UPUA 2CHGA 4YRBA 1QPBA 3DWGA 4G8JA 5TE9A 1PEYA 1VQ1A 4L5BA 1S8AA 2IYNA 2VSNA 1BOOA 3FDZB 4E5PA 4RM3A 2CJFA 1L2TA 5BSMA 6REQA 5JI3E 2W90A 4LJ6A 1XJ5A 4ZOQI 1Q0LA 1C29B 1OYYA 3QSYA 1YZVA 1WMBA 1SVSA 5LP1A 2WIBA 2DR3A 4R1PA 2FWAA 4RCVA 1FX1A 2QPTA 3IR6A 3R41A 1VSUA 1WB4A 1MX3A 2CD7A 4JBHA 1M2VA 4YACA 4ER7A 4ID9A 2OBNA 3I28A 4B82A 1HUQA 1KJ8A 2JAOA 4Z4GA 1GPBA 2X6TA 3PEVA 4GL4A 4CMIB 3FNQA 1PDOA 4KIGA 4N49A 2EGUA 3L0ZA 2C7BA 2YV5A 3RIGA 4K6FA 4FDUA 4BDTA 2V4UA 5AHWA 4F5DA 1I10A 4Z1OA 1JU4A 1G1MA 4UBOA 1ZUWA 4CKBA 2FR8C 1WETA 1YDEA 5GADl 2DBZA 2Z4TA 5J59A 4AJ1A 2OL4A 3FYSA 1XU4A 2XIQA 4FJ0A 1EBBA 1KOGA 1E8MA 4K9LA 4RLHA 1N2EA 2QDKA 3MUNA 1F9EA 4WNYA 1EXDA 4Z2AA 2ZBEA 3VYUB 4Q24A 1XZIA 3ZCSA 4CKWA 4KPUA 3OAAA 2A3NA 3BK1A 3JXEA 3L6DA 1RJFA 4QT0A 1QGDA 4GZ5A 4OM7A 4QUHA 4BEBA 4PS1A 1PUJA 1MO6A 2WJGA 1EHCA 2AMVA 1RAHA 1YV9A 3AFMA 3Q9UA 1FFEA 1TEHA 3OZVA 2O5VA 1IEVA 3Q98A 2XIJA 5EZYB 5ERXA 1P7VA 1DP4A 3X1XA 4C06A 3LL7A 2Z1NA 3AJRA 4C29A 3UANA 1AN0A 1UJ2A 2IBMA 3AO0B 4H6VA 5CVTA 4NCXA 3UJCA 4GMKA 5H59A 3TD9A 6AT1A 2RGRA 1PO7A 3MCAA 1FLDA 3MILA 1GPDG 3O2SB 5FA6A 5FUWA 3RF7A 8ATCA 3S81A 5EIEA 3O8OB 3FNBA 1XQXA 4D82A 1JQ5A 2W6QA 3JAMA 2JCGA 4NEGA 1G20E 1X2BA 4PO1A 4GKJB 3JW8A 3OU7A 4B75A 1DG1G 1F4PA 2WTAA 2X8JB 4DZZA 4HEQA 2KPOA 3FH0A 3TR5A 1AHHA 2W2VA 5TPWB 4JDPA 1V7CA 1HNZB 1U0OC 1M1YE 2AOXA 4ETNA 2FSVA 1RU3A 2VCYA 1CVLA 3E05A 5KNBA 1GTSA 2D13A 4H1UA 1X2EA 1S4QA 3SNKA 3TPCA 1NUAA 3PENA 3L4BC 2Z08A 4L8YA 4LV6A 3K6SB 1C0KA 2LW7A 1D4ZA 1DMRA 1JQLB 5TRTA 3ZIAD 3CLRD 3NV7A 3UGQA 3BH0A 3LUDA 3DFFA 4G0ZA 1KOFA 2WA2A 4TT8A 1NF9A 3H5IA 3IPRA 1E6LA 1N34B 2GS9A 2ZG6A 3NI2A 3DCNA 4X6UA 2PKQP 2C4UA 3H1AA 1U3TA 3M34A 1V25A 2B99A 2BWJA 3N7UA 2OYRA 5DM70 5CDTA 3HU2A 2VF4X 2P79A 4HLUC 1FYFA 2ZXEA 3H1EA 4JHXA 4JOSA 4U2KA 4OHZA 1PSZA 2N75A 3NBKA 4N0QA 1GQFA 2CHQA 4DGQA 5IJZA 3ECSA 4WZ6A 4HNGA 1ZXXA 5EC8A 2O8EA 4MS1A 4AI6A 3KB1A 4RY9A 5HE9A 5KSPA 3CONA 1J24A 4BMDA 1SMKA 1E58A 2PYIA 3PJDA 1X42A 4IFTA 3TE7A 5HKKD 3DTTA 3LTEA 1BS9A 1JUDA 2BD0A 4AN0A 1W73A 1FLVA 1SKBA 1K0UA 2I71A 5B4VA 1F51E 5LQKA 1CEYA 4RA9B 1L8OA 5ICMA 2RH9B 4BO7A 1NKSA 1ZK3A 2B35A 2XVYA 3UBTA 3K15A 1U2DC 5L51A 2AD5A 5FWAA 1EGVB 4TUYA 5AHKA 3UT6A 3OHMA 1LDMA 2IIBA 3PXGA 2HWWA 1B8PA 3AP3A 2QRNA 3KV1A 3LP5A 3QYPA 4C9BA 4LFBB 1GTG1 2V7XA 2D74A 2ASEA 1SU6A 2VXOA 3AG6A 4KR3A 2C42A 2Y0CA 2QW8A 3WISA 3KJQA 4TN1A 4C0LA 1H5NA 2BI4A 2YASA 5D3MA 5JAPA 3KYJB 4CRWB 4TL6A 1PTJA 1RWNA 1WZNA 1GFZA 2ZS8A 4ZV4A 1XKLA 3P2MA 3FUCA 4U6NA 4YUZA 2DETA 3X1MA 3T9EA 3DXZA 5DBOA 4X94A 4X54A 3PFFA 4C5BA 1J9GA 1YUBA 2ZREA 5IG2A 1XAJA 1KBOA 1AJEA 3FUWA 2LWIA 2P11A 1A1SA 2IUYA 2PUBA 4ER3A 5EXSA 5E7IA 1K6EA 1XALA 4W9MC 4QOJA 1VLQA 3COPA 3MCWA 5CH8A 3FOFC 3GLFB 3OCYA 3R3SA 4JVOA 5CLIA 4DSOA 2D00A 4NZPA 6CHYA 1YRWA 5KS2A 1U81A 3CZQA 121PA 4GHWA 4JKIA 3MJVA 1U0JA 5DPMA 2XXAB 2SCUB 1Y6FA 4DM7A 3QHPA 2AF3C 3YASA 1Z45A 3W5VA 4PIPA 3ICVA 3PXCX 4Z0HO 2WFAA 1GAEO 1QOPB 3U40A 5LNK1 4DC9A 2B92A 2BCJQ 1FEZA 3JV7A 5K8LA 2BGUA 4PG6A 5A06A 2JCXA 2I8AA 4NSNA 4FZVA 10MHA 3QX7A 4G23A 1O57A 3GDFA 1LBQA 3GNQA 4M6WB 2DKFA 4L4RA 5JSKA 1MP0A 4MQUA 4XRRA 3ZGOA 2YY7A 2IYPA 1V6SA 4MDEA 4O2BA 3VNVA 3PI6A 4BNTA 2SKDA 4D6XA 4JLBA 5HGXA 4BNZA 1OYOA 4M38A 5LU8A 1PYDA 5LLTA 2PA0A 4N9WA 5D5PA 3VR6D 3DOEA 4JBWA 3ZHOA 4HYYA 4KLRA 2VA8A 5HFNA 4F2WA 5LQUA 4E2WA 1K7XB 2CDCA 2G17A 5E0KB 3ZHCA 5C8YA 4BLUA 1P0FA 3DOJA 4CHGA 3O93A 3WQRA 3UXYA 5TX7A 2C77A 3O5AA 4H77A 2KB0A 1P77A 2OGTA 5AW8A 2BGJA 5C46F 1BKYA 2C8KA 4GP7A 1AQIA 3GDHA 4Q4HA 5A9SB 5J4VA 1MB3A 4R1QA 5ENDA 4O4JF 5KJCA 2IX3A 1OMOA 3GLFA 4OKNA 2WYUA 5FRDA 4WA8A 5C9ZA 5TPWA 1IXZA 2LIPA 2GA8A 4CLOA 1E4EA 3VHQA 2EKZA 1EWQA 2E4WA 5TMPA 2VDRB 2E7ZA 2UVQA 1DZIA 1MA0A 1GRVA 4DUYB 4RMGA 3LK7A 1GQSA 1RRMA 3P2KA 3PA6A 3D5EA 1UFOA 3M3PA 3RW9A 1UDCA 2QUHA 1WSDA 1XN4A 3P71T 4GFDA 1EGMB 4W99A 2BFDA 2Z58A 2C9BA 4JEIA 1I2AA 2EW1A 4N48A 1SH7A 3CSSA 1ECCA 1FFBA 1L0BA 1P19A 1T5SA 1W52X 3CTPA 4KQJA 3DV0A 2P77A 1E1MA 4ZIRA 1OLUB 2HJHA 4MKZA 4LDJA 4W5TA 1KR2A 3ZBQA 4BTEA 1NVKA 2IZ5A 2ZVPX 2ZYVX 3IQIX 4DG9A 4XGIA 3K71B 5ECYA 1RIFA 2B69A 1RD4A 4G4JA 4N39A 1Z63A 1Y1TA 3B5IA 5SICE 3PPVA 4KYUA 4C30A 3IQFA 1XU9A 3OZ7A 4DA8A 4NONA 5BSFA 3AR5A 3CRVA 4AM8A 4U2BA 2KQUA 2ZQ5A 1VLJA 3JQGA 1OXSC 4PYOA 2YN2A 3VU9A 3MHTA 4NZ9A 4YCBA 4JI8B 3RK1A 3EPHA 4LXHA 3HNPA 4MQ6A 4TRNA 1W48A 2ZP1A 3ID6C 4P9NA 2GD2A 1RZRD 1E4EB 2JZOA 3GFGA 3DKVA 1MMFB 4RA9A 3QUBA 4Q05A 3R0VA 4DCUA 1CJVC 1PNVA 3D8TA 1ZWKA 3FJ1A 1LF0A 3WWYA 1E3LA 1Z18A 2QM3A 2WD7B 2WMDA 4OHUA 1E9EA 2HK9A 3SXUB 3ZNPA 1YVEI 5KNCH 1ZH2A 4I81A 4YLYA 1LI5A 4A0HA 2ZROA 4FS8A 2DLCX 5TIIA 3QUCA 1RXVA