2RBEA

The discovery of 2-anilinothiazolones as 11beta-hsd1 inhibitors
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
260
structure length
259
Chain Sequence
EEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title The discovery of 2-anilinothiazolones as 11beta-HSD1 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 94
structure length 259
sequence length 260
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2007-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2rbeA00
3IKTA 5CDUA 4BB6A 1QRRA 1LC0A 4O63O 3KETA 3NX4A 5GZ3A 3EVTA 4RVUA 1E7WA 5JDCA 1NQTA 4FGSA 3S55A 1PWXA 4R1TA 3WSVA 3JQ8A 3DAFA 4IMPA 1CQIA 1DIAA 1NASA 4OKNA 4Z6KA 2EIHA 3AWDA 4M87A 5U9CA 5L7WA 4ND4A 1EZ4A 4TRJA 5BR7A 3BMCA 2QX7A 4EITA 2B4QA 4QEDA 4URFA 2WEKA 1M76A 4IDAA 5TF4A 1VI2A 4JNKA 1O6ZA 4RQUA 1UXKA 3KTDA 3LU1A 5EPOA 4E0BA 5JDIA 3TJRA 4N5MA 2JD1A 3TPCA 4HFJA 2C5EA 2BGLA 2I76A 2VZ0A 2EGHA 1DO8A 3F47A 4YJGB 4DMMA 2ZQYA 2TMGA 3UKOA 1VL0A 1X0VA 1GUZA 2BKAA 4XYGA 3PTZA 1E7SA 3IJPA 3VVCA 1Q7BA 2OORA 5C7IO 4KZPA 1EFLA 1GEGA 5IDQA 3MJEA 3U5TA 1NFRA 3PLNA 8ADHA 2HSDA 2EWMA 5A4DA 1IULA 2VNAA 3ZU3A 1Y8QB 4WASA 4L73A 4DXHA 5HM8A 3DXFA 4Z3DA 4Q3CA 1J4AA 1NPTO 4IZIA 1U3TA 4O5OA 1NR7A 1K6IA 4HX5A 1RM4A 3U49A 1VRWA 3KYCB 3ENKA 4GWGA 1PX0A 1MC4A 2VT2A 2AEMA 4FFNA 4PLWA 4XQEA 3U0BA 1A7KA 1SOWA 2HMUA 3AUUA 3COSA 3GR6A 3SJ7A 3GGGA 3HFSA 3VC7A 2TMDA 1BDMA 1QYDA 3PJEA 3NEPX 5L95A 3Q6IA 3GC6A 3KSDO 3RQSA 1T2FA 5TT1A 4BO6A 3D64A 5JDIC 5I7VA 4AL4A 1HF3A 1NYTA 3ST7A 4NK5A 3PP8A 4IDFA 4XGNA 4W82A 4XB2A 4XYLA 1AHIA 3JQ6A 2GGSA 2X9GA 4CV3A 3DMYA 3GZNA 2WE8A 1N5DA 3D0OA 3JYOA 3LT2A 4QUKA 1Z75A 1LI4A 5F1OA 3GNTA 4LMPA 4E2ZA 1VKNA 4XYBA 3UAGA 5L9AA 3PFWO 3OM9A 4FC6A 1Y9EA 1RJWA 2GZ1A 4CMCA 1JAYA 4R68A 5DCWA 4LN1A 4NI5A 1PJ2A 2O50A 2IE0A 3LSYA 4NPCA 3KV3O 3W4KA 3RCBA 3RSHA 4C4OA 3V1TC 4Q3NA 2RH8A 3CSDA 3DQPA 5F1KA 3DHEA 4EYEA 5CG2A 5CDTA 3MJTA 1E1KA 1YL5A 1GY8A 1KEUA 3RFVA 3CE6A 1QR6A 4J0FA 3TZKA 2HQ1A 3VH3A 2GCGA 1ONPA 3GRPA 2Q1WA 1LLUA 2PZKA 4GH5A 2C20A 4K28A 1SNYA 1RM5A 3FBTA 1LQUA 4L75A 3EW7A 1NX6A 2JL1A 5DP2A 4GGPA 3B1FA 2HCTA 2AEFA 1W4ZA 3FNEA 4PLTA 4AJKA 4BO4A 7ADHA 1O95A 3JYPA 3WYEA 4JROA 2VN8A 4GQAA 4J3FA 4RDIA 4FCCA 3W4IA 5A5FA 1XG5A 5FEUA 4A10A 1HDOA 4BV9A 2V6MA 5H83A 3GVXA 4AJJA 3FD8A 4J4TA 3O8QA 3ROMA 3VPHA 3V2HA 4MVJE 2C54A 1Y5RA 3Q11A 1GQ2A 2HAEA 4M54A 2ZTVA 4GX0A 1E7YA 1VM6A 3G49A 4INAA 5ITWA 1V0JA 3VZQA 1KYQA 5F21A 2EJVA 5JMPA 5ENDA 4A2CA 4IM7A 1ARZA 2CF5A 3F46A 3VH4A 4J9VA 5G4KA 4LCJA 1KOLA 2C2XA 4YAGA 5AYVA 3TN7A 1EFKA 2C7GA 2O3JA 2JFFA 1YBVA 3D4NA 3IS3A 4IS3A 1BXZA 1ZK0A 4YRBA 2NVUA 2JCYA 1I2CA 1DRVA 2POQX 1MG0A 4LSMA 1K0UA 4PLYA 3C3XA 4PZDA 1HDZA 1XDWA 1P1FA 2VUTA 4FS3A 4YJFB 5L45A 3HB5X 4CLOB 1KY5A 1F12A 3KOUA 4OQYA 3X2EA 2AQ8A 3H9UA 1C1XB 3EYWA 5DBIA 1B3RA 1U9JA 2O23A 3QHAA 3ROPA 4BB5A 1ISGA 4YQZA 3NYWA 4BS9A 3FR8A 1MP0A 3GH3A 4CMGA 4J2HA 3WB9A 5IXYA 3T7EA 2B83A 1E3LA 3SBOA 3WQSB 5I9NA 3JQ9A 2YQ4A 2VNSA 3JQGA 2R00A 3OEYA 3JQ8B 3B1KA 4Y9DA 4F6CA 5G4LA 1IYZA 3KSZO 5BT9A 2I66A 3JSAA 2JHGA 3IP1A 1WNTA 2Y66A 1EUZA 1PJLA 2YZ7A 3BMCB 3FNGA 3E1KA 3PYXA 4IZHA 1YJ8A 3Q0EA 3ENNA 4GSKA 4NU5A 4RVGA 3TQHA 4BO8A 3NTOA 1V8BA 2GYYA 2X58A 4UEKA 4YRAA 4BL5A 3TZCA 4RZHA 3DBHB 4LW8A 3U9LA 4XKJA 1EMDA 3LZ6A 3NGLA 5ES3A 4IJWA 1E1MA 3TZ6A 2R6JA 4FR5A 5H81A 4OO3A 2HMSA 3RKUA 4GMFA 3GN1A 2P9GA 1PR3A 4WUVA 4C7KA 1KY4A 4R1NA 5TQVA 4QTZA 1C0IA 4Z9FA 1M2WA 1JVSA 3GG2A 1YS4A 1PIWA 2X23A 4GKBA 3HDQA 1U2GA 4DVJA 5EQFA 2NV6A 1ZSNA 1J6UA 1WDKA 3I1JA 4GVLA 5DBFA 4EUFA 1P0FA 2CUKA 5JFOA 1UXHA 3U3XA 4JJGA 2EGGA 4BQPA 4AJ4A 2C0CA 1H0KA 2O3RA 3H5NA 2Y99A 5L53A 2HRBA 4B4UA 4BNMA 5B4VA 5KOIA 3QJ5A 2AQIA 2HLPA 2Q1SA 5A3VA 3GDGA 2ET6A 4B7XA 4L8VA 4ZHSA 4AJ2A 5ER9A 1E7RA 2GR9A 2X4GA 5MDHA 1WPQA 3B1JA 2D4AA 1SCUA 3S2FA 3AY6A 4JBHA 4QFDA 2VYNA 4YQYA 4M89A 1ZEMA 4X54A 1VSVA 4YCAA 4XGKA 3H4VA 3OIDA 4UUPA 1EDOA 4DQVA 1SEVA 2AG8A 3QW2A 1R15A 3ZNNA 1GL3A 2DLDA 4D43A 2BGKA 1U4OA 1GV1A 1A4UA 1GEEA 1NWHA 4DIFA 4EEZA 4MO2A 4W99A 1QV7A 3GVHA 3GDFA 3WICA 1YQXA 2EKPA 3I9OA 1GCUA 1M67A 1NXQA 1D3AA 3OA0A 1UDCA 1HE2A 4OXKA 4E6PA 4UVIA 3K31A 4CQLA 4N18A 2FN7A 2VQ3A 4DTIA 3H7AA 4CV1A 4EBFA 4CMHA 1YWGO 4Y8VA 2FPIA 4CLDA 4OOFA 2OXIA 1TT7A 3PDJA 4MDHA 1U3UA 4DYVA 3C1OA 4UUOA 3IUSA 3ZCXA 4DRYA 2AHRA 5J23A 5TT0A 4DPLA 3ANLA 1J0XO 4MVJA 2NVBA 1GYRA 1MFPA 4QSMA 3ZV3A 4O1MA 3R3SA 2X0NA 4RLHA 4TRRA 4YDRA 4DQUA 3D5QA 3RUEA 1MV8A 5IZ4A 4OSOA 3F5QA 3KEOA 3NAQA 1ISIA 1Z82A 4FIZA 4WCDA 4ZA2A 3UHAA 1P9LA 2Z1MA 3FI9A 3UGKA 4BQRA 1QG6A 2OZPA 4PFJA 3ROKA 1FMCA 3WGHA 2Y1OA 2VHYA 3IDSA 4U8GA 1SPXA 3GUYA 1A9ZA 4Z3KA 1L7DA 2UAGA 1WMBA 2BFOA 4IIUA 1TEHA 5EINA 1HSOA 3HHPA 5LC1A 4B3HA 2AA3A 2AG5A 3O8QB 2BI8A 1ULUA 4JQCA 3RBZA 4J4HA 3EMKA 1TB4A 4PCVA 4FC7A 3WGGA 3NT5A 4OXYA 4UVGA 4CM1A 1Y8RA 5IJZA 4U0JA 4RVDA 4WNIA 3H5AA 2Z95A 5JAZA 1SEPA 2VWHA 2EERA 2Q4BA 2JAHA 1F14A 1CF2O 1O8CA 1SO8A 4XQ9A 3WGOA 4PIVA 4WCFA 2C07A 1Q0LA 4PG4A 1MUUA 1QP8A 3KB6A 2DVMA 3RFXA 5KVSA 1PJBA 3AOEC 4BKPA 5FWNA 1R4MA 5CG1A 3RUHA 3E18A 2W4QA 3PIIA 1HRDA 4BO2A 5ADHA 1M66A 3DAPA 4G2NA 2J5QA 4W9NA 2PGJA 5T6BA 3OICA 2DBVO 2P68A 5IDWA 4B4OA 2VTEA 1B15A 4RO0A 7MDHA 1M6WA 4KP7A 1DIGA 2OP1A 4IPTA 1G1AA 2UUOA 4RGBA 3AM3A 1P1KA 4W7HA 2Q2WA 1QKIA 2VUSA 3JQFA 5CP8A 2PZLA 3PXXA 1U1IA 1CETA 2FR1A 1E6WA 2X8LA 4GPD1 3Q1LA 4LSWA 4KDEA 4AJLA 3I9MA 3N74A 4Y6RA 4WEQA 2Q1TA 3H3FA 3PHGA 2C82A 3O38A 3I9NA 1U8FO 2VYND 5KJ6A 5IAAA 1VC2A 4EJMA 4Z9XA 4HP8A 4J7CA 4CLEA 1SZJG 3OEWA 2PH5A 4WJZA 1BTOA 4O6VA 1H9BA 3OJFA 4RPKA 1QV6A 3DMTA 3RAJA 5BQFA 5JO0A 3JD2A 3RUIA 2DQ4A 4XD2A 3EHEA 1NVMB 4MJLA 4L4XA 4XR9A 2O7SA 1X1TA 1ADBA 1AN9A 1W6UA 1Z73A 4PLHA 1ENZA 3QVXA 1MX3A 1HDGO 5EN4A 4MIYA 2A4KA 1SAYA 2P9EA 1ZBQA 3K2BA 4MP8A 4EW6A 3BHJA 5IN5A 4BO0A 3FBGA 4JBGA 5KJCA 3U62A 5B12A 4QECA 1KVSA 3JQFC 4Q9NA 5CDGA 4LVCA 3FPLA 3EGOA 2FSVA 5ENVA 3BIOA 3G1TA 4MVJD 4XZ3A 3P2YA 2A35A 2ZB8A 5KJ1A 3M2TA 3KYCA 2BGMA 4PZEA 4EDFA 4QO7A 4RZIA 5EQDA 3TFQA 1JLLA 5CEJA 1NQ5A 4LVUA 3AOGA 3H9JA 5F5LA 5U4QA 3X2FA 3S2IA 4MKZA 4P22A 1BRMA 4AJEA 3BXXA 4DMLA 3RASA 3KUXA 3OJLA 4D79A 3U4IA 1M6HA 1SC6A 1KVUA 4N5NA 1DFIA 4Z0HO 2C29D 3GK3A 1XLTA 1GADO 1E3IA 3HDYA 3RD5A 2YV2A 3EY4A 4J0EA 2D3TA 2RIRA 2B35A 2H9IA 5DOVA 2VHXA 4ZQGA 5FI5A 4YT4A 4LMRA 3QSGA 5THQA 1X13A 3IJRA 5EMHA 1C0PA 4ONEA 2XF8A 1WZIA 4R3NA 5F3RA 2CFCA 4EI2A 3IUPA 4II3A 4R3WA 4YTEA 1LDBA 2ZYGA 3ETEA 4WOKA 3UCEA 4B4VA 5IZCA 5KWEA 4RPGA 4QT0A 1I3LA 4Q3DA 3AUAA 3ANNA 3DOJA 4M55A 3ADOA 2FP4A 2P4QA 4DGSA 5JC8A 1DIBA 3OIGA 1HDCA 2Y1FA 3RIHA 4A0SA 1KETA 1UP4A 2O7QA 4PLGA 3H6KA 2I5PO 1GV0A 3I4FA 4OXNA 3SC4A 2X7HA 4KQXA 3H2ZA 1PTJA 4WECA 1Y81A 2GN4A 1T26A 1HSZA 4GI2A 3GAFA 3ZWAA 3F6YA 1LJ8A 3PIDA 3JD0A 3WFIA 2HMWA 1P0CA 1PJTA 4XX0A 1WAMA 3RUCA 1QXSA 3ZV5A 4E13A 3P7MA 1K6XA 3JQEA 4E30A 4EUEA 4CM6A 1T4DA 3R6DA 3SJUA 2Y0CA 4XGIA 1VJ0A 1LU9A 1YB4A 1QMGA 5A5EA 2LDBA 1U7HA 1NR1A 3E6AA 1Q1NA 4BMNA 3W8FA 1H6AA 1NP3A 1HE4A 2ZYDA 3OQ6A 3GEMA 2Q99A 1QLHA 4XRRA 4AJOA 1ISHA 2PKRA 4CUKA 4LGVA 3DOOA 3RUDA 4AICA 5IZCC 2Q45A 1ZO8A 1H93A 1ONNA 3L9WA 4CR6A 1XU7A 3AI2A 1OC2A 4WLVA 3ZDFA 1KVRA 3OJOA 4HNHA 4EUHA 4FJ0A 3E5MA 3EZYA 2EF1A 1DHTA 4ZRNA 5TRTA 2GO1A 1EE9A 1Y8RB 3DTYA 3H8VA 5AQ1A 5G2OA 4NG5A 4BMVA 1GR0A 2WYVA 1R66A 4TZKA 3GDOA 3VDRA 1HDRA 1ZJYA 3O4RA 1B2LA 5K6AA 1YBAA 2DFVA 2GNAA 4WCFB 1GPJA 2DUUA 4ALLA 4ZICA 5TS3A 5MGBA 2J3HA 2QG4A 4L9RA 1R4MB 2XAAA 5TLSA 1GFSA 3CMMA 4B8ZA 4ZJUA 3L07A 1B26A 2J3IA 4MKXA 1XIVA 3CUKA 3SLGA 2I3AA 2X5KO 3BHMA 1PGJA 4RDHA 2O4CA 3L6OO 4CM3A 3RJ5A 4DQXA 2B36A 2GSDA 3QA9A 4FBGA 5TNXA 4PG6A 1C1XA 1ENOA 2JD2A 1DRWA 2UDPA 1DFHA 1RYDA 2HO5A 2RH4A 1IHXA 3PWZA 4CODB 4YAIA 2ZATA 4HY3A 2WTBA 1NHWA 3MJCA 5A02A 1XU9A 1I2ZA 4HFMA 2EP7A 2NU8A 2XPCA 4GBJA 4LISA 3LT4A 3CZMA 2Y0EA 2W2KA 4RLSA 2B5VA 3PK0A 4KWIA 3JV7A 3S2EA 3K73O 5CPFA 1PZEA 1I10A 4YT2A 3E82A 3PEFA 1MFZA 4J6FA 4R1SA 2GN9A 1HKUA 4RPLA 2X22A 2X5JO 1O9BA 2DC1A 3GMSA 5K6AC 2VOJA 2ZIZA 3QRWA 4P38A 3ABIA 2D1YA 1KBZA 2JFHA 1DC4A 3DBHA 4J1SA 3DR3A 4E5PA 1LDGA 2H63A 2I99A 1H6DA 1E3SA 1LRKA 3EUWA 4L76A 1EE2A 1B0AA 2NLOA 4LRSB 3D1LA 2GN8A 2V7PA 1B16A 3B70A 2E82A 4HBGA 1BVRA 1FF9A 1XSEA 2V6FA 4KWHA 2DPHA 4I1IA 1EBUA 4BNVA 2FPGA 3PQEA 1ZMOA 5C7OO 4CPDA 2BH9A 2ZCUA 1XQ1A 2CF6A 4RF3A 3WSWA 3KBOA 2QRKA 5T64A 3M6IA 4ZN6A 1YL6A 3C24A 2YDXA 3WYBA 3LT1A 4FDAA 4BO1A 4DYDA 1KEWA 5IF3A 1K89A 3PQFA 1OFGA 3UN1A 3ITKA 1NWCA 3FN4A 3I9KA 3DHYA 1V6AA 3JQ7A 4ND3A 3WLEA 2YFQA 3QWAA 5HTOA 4OJNA 1XHLA 1B3BA 3BHIA 3JQDA 1M75A 3KVOA 2EW2A 2FZWA 1PS0A 1EQUA 3GNSA 3RU9A 3SEFA 1LSOA 1ZH8A 2IYPA 4PG8A 3HG7A 4UUNA 2DPGA 3GAZA 3Q9UA 1XGKA 1I5RA 1B14A 2NU7A 2RHRA 2PZJA 5ILOA 4FSHA 1ZK4A 1NFQA 1EVIA 2H6EA 3ZHZA 4BO3A 4NK4A 4GMGA 4NBRA 4D46A 2D5AA 4E2WA 1Q0QA 1X0XA 4A27A 2QHXA 2PY6A 1C0KA 1LDEA 3T7CA 1PZHA 3JQAB 4WGGA 1JWBB 3VVBA 3I9LA 1F17A 1DEHA 3I3OA 1PSDA 4E2XA 2NACA 3ZWOA 5A04A 2PGDA 3HZZA 1G6KA 4OGWA 1H9AA 3FWZA 4BNJA 2ZJ0A 1DHRA 1E7MA 5L3ZA 4IJUA 2X1HA 1DFGA 2UV8A 2RBEA 3NTRA 2CSUA 1U3WA 3C1AA 1EEHA 3GFGA 1J49A 3MJ4A 2IODA 3ZI0A 2VWGA 3AM4A 3WOHA 2AXQA 1XYGA 3FF4A 3FNFA 1P31A 5JE8A 3GNQA 2J5KA 4IS2A 4KTVE 3R0IA 1EVJA 1OAAA 1TVEA 1LA2A 4XB1A 2E6UX 4PRKA 1ONOA 3IOYA 5AXBA 3VTZA 3TOZA 2X5OA 1LNQA 3VPFA 4MOWA 4DC1A 1F0YA 1HE3A 1IY8A 1I24A 2G5CA 3LK7A 2XXJA 3A4VA 1BVUA 4XDYA 1K5HA 2Y93A 3HNPA 2O4UX 3GQVA 1RPNA 3NUGA 3ZN2A 3WS7A 2HKIA 1HYEA 4O0LA 4R1UA 1KS9A 4RPJA 3TWOA 3ZGYA 1U3VA 3QWBA 3JQBC 1PGOA 3KZVA 4YB8A 3PZRA 4BUCA 1HTBA 4YACA 1GU7A 2G82A 1XKQA 2LDXA 1UP7A 1XCBA 2W90A 5AXDA 2BI7A 2PGLA 1U7TA 3WGIA 1JVBA 5L4SA 3GRKA 3UF0A 3MJSA 2EHDA 1BHSA 1YGYA 2QRLA 1N1EA 5GY7A 3DHNA 4Y98A 3MWDB 1GZ6A 2X9NA 3TNLA 4CUJA 1GPDG 5JMWA 2UYYA 2VOEA 3M1LA 1T2EA 4BO5A 3EC7A 1FDTA 2PNFA 5JNLA 1A72A 1JAXA 1PL8A 2C59A 3QVWA 3M2PA 1DXYA 2GERA 5TJ9A 5HS6A 2WDZA 2YW9A 3KYDA 4ZQEA 2BMAA 4I5EA 4E33A 3ZU2A 3UXYA 1IPFA 2B4RO 2X6TA 4MPDA 3I83A 4I5FA 4OQZA 2W2KB 1E6EA 5TSDA 2FOIA 4JBIA 5I8WA 3HDJA 1OOEA 4J4BA 2OL4A 2DBQA 4OMUA 3U4CA 4ND1A 4D0RA 4JJFA 1I3NA 3GPIA 1ZZEA 4E5YA 1V35A 1E0DA 4NBVA 2QZ9A 5AXAA 4IQ0A 3QWFA 1Q2XA 1QYWA 2PLAA 3FPCA 1WW8A 1XELA 2Y1GA 4B7CA 4AJIA 2V65A 3CKYA 3TRIA 2X0RA 1UUFA 5HS4A 1WDMA 1HDYA 4LK3A 4P4GA 3VPSA 4NFSA 3JTMA 3Q2KA 3KHUA 2GPTA 1R0SA 4Z0TA 1A5ZA 3CZRA 2WM3A 3GFBA 4RVSA 2PK3A 1E5QA 2IZ1A 1EDZA 5JO9A 3U09A 1H2BA 4KOAA 3VDQA 3PWKA 4G5HA 4J43A 3HN2A 1BW9B 2HK9A 1X7DA 3K2EA 1NHGA 5AVOA 5DP1A 4DLLA 3AJRA 3ZU4A 5B37A 1QYVA 5G0TA 3RI3A 5DBGA 3WWZA 4HKTA 4FFOA 3FWNA 4TVOA 5KVCA 3SVTA 1C1DA 5B4UA 4PVDA 1HXHA 1EUDA 2YV1A 3KSUA 4B4WA 4CV2A 1WLYA 1I30A 1S6YA 1ZUD1 2OFPA 3FCOA 3GUCA 4XIYA 3JQ7B 5JAMA 3JYLA 4WE3A 3ZWBA 2FR8A 3R1IA 3KRTA 3DFUA 4S3MA 5FYDA 1E3WA 3WR5A 3H9QA 4B7UA 5ICSA 4ITUA 4U5QA 4IJVA 1MA0A 1IL0A 2OGUA 1DB3A 4NQZA 5L7TA 3RUFA 5CDSA 2O2YA 2P5YA 1DC6A 2ZTMA 3IIEA 4AJNA 4HXYA 5KJEA 4XEHA 5DDIP 1PZGA 5KCZA 1X1EA 3FR7A 4ZVVA 5CEEA 4CL8A 3WDSA 5L40A 1WXDA 1I2BA 4BKQA 3MTJA 4TZTA 1UXIA 4YRDA 4YJDA 3E5RA 4BNLA 5HWSA 4GX5A 5BSEA 4MVJH 1YE3A 4A26A 1NQOA 2NVWA 2WJPA 2ZYAA 2JKVA 1JKIA 3C8MA 4IJKA 3RKRA 2HRZA 4H16A 5DF1A 1WWKA 2QYSA 3BAZA 1T24A 5EJ2A 1HZZA 1PL6A 2FWMX 1X15A 2ZCVA 3PJGA 4CM7A 4IUYA 3WGTA 1FJHA 1PS8A 1FXSA 1H6CA 1NPDA 3OF2A 3RU7A 2CY0A 3STHA 1Z45A 1P77A 2JCVA 1R6DA 5CDYA 3AOEA 1DJQA 5TC4A 1A4IA 1BDBA 1YKFA 3C85A 4PGFA 4MIOA 4RQTA 2IYOA 3DWFA 1PJCA 3JQCA 4JLWA 4TWRA 3VAZA 5IFLA 1GZ3A 3WLFA 1R0KA 3FNHA 1CWUA 3BA1A 3C7CB 3G17A 4FFRA 5ITVA 2XOXA 1ZK2A 1RYEA 2FY8A 3W8DA 3ON5A 3S2GA 4ALMA 3E9QA 3EAGA 3BMQB 4BNGA 4K6FA 4XWYA 2Q4EA 5A9SA 2E37A 5EIOA 4D42A 4R54A 4KUGA 4HWKA 1Y5MA 2Q46A 2NU6A 1HYGA 2J8ZA 2HK8A 3Q9NA 3PRJA 1CDOA 3GG9A 2GUGA 3LF1A 4JK3A 4JXKA 3R3JA 2O3TA 4CLRA 3P2OA 1YOVB 3L6DA 3OFSA 1D8AA 3QWHA 4W4TA 2YY7A 5AXCA 5A3JA 3QWIA 3BTUA 3AFNA 3HN7A 2ZQZA 2IEBA 1F8FA 4ZQBA 3NT4A 2I9PA 1JU9A 4ID9A 3LLVA 1YXMA 3AY7A 2HJSA 2ZB3A 4G81A 1MG5A 1GQQA 5JSFA 4M1QA 4IBOA 4ALIA 4BNNA 2V6GA 5EERA 4M86A 1NM5A 2DM6A 4NBWA 1G0OA 1JQBA 1ZNQO 2BELA 4EZBA 4C7JA 4E5NA 4MVJG 5JBIA 1ENYA 2GLXA 1JN0A 3UCFA 3ADPA 8LDHA 3ZU5A 3NDIA 3GLQA 1UAGA 3VTFA 2O3QA 3KYDB 4UVEA 3I52A 3PDUA 5HBRA 2GZ2A 4ALJA 3DC2A 2WWRA 4R69A 3C7AA 2CDBA 3W6UA 3IL2A 1LRJA 2Y0DA 1KVTA 5KJFA 4R41A 1N7HA 4F3YA 1ULSA 2WD7A 3CMCO 4PLFA 4PLZA 2CMDA 4NJOA 4YR9A 1DBVO 5A05A 2I3GA 2C7VA 1I01A 2UVDA 2BHLA 4YYZA 2Q2VA 2FR0A 3PJDA 4DLBA 1PJSA 1E7QA 2NTVA 5G0WA 1VL6A 1X14A 2Q49A 1QORA 1N2SA 3HJAA 4J1QA 4D41A 5A03A 1I36A 3I5MA 4O59O 4EJ6A 1P44A 4XDZA 5JYEA 4HNGA 4KUEA 1OMOA 1D4FA 1FDWA 4D0SA 3FHLA 1PGPA 3JCZA 3L4BC 3INGA 4TSKA 1JTVA 1E5LA 3CEAA 1BXGA 1I3MA 3K96A 2P9CA 4UUMA 4XJSA 4D3SA 1L1FA 5L7YA 3HQ4O 2IXBA 1Z6ZA 5GMOA 1CJCA 1JKFA 1N7GA 1C1DB 4J7UA 5C37A 3O03A 4YWJA 1DIHA 1NQAO 3RC9A 1DOHA 3AM5A 5A9TA 4E5MA 3BTOA 3ZWYA 1U2DA 2FSSA 4I9UA 4J49A 3AW9A 3TDKA 3AK4A 2VHWA 1Z7EA 4BHTA 3INRA 1JW9B 1TLTA 1E3WB 5A9RA 5BSGA 3CTMA 1ZK3A 4XQCA 2J5RA 5TGDA 1HWYA 1KC3A 3D7LA 4MIEA 3PZBA 1GYPA 4AG3A 2H1SA 1BGVA 1IZ0A 5U1PA 2D0IA 2CDCA 3IKVA 4IDBA 4KQWA 3SLKA 1T4BA 4KDFA 3WX0A 4TRNA 5JCJA 2J6IA 3LC2O 1FK8A 4NBTA 2QRJA 3VH2A 5KNLA 1X7GA 2NQ8A 3A9WA 3JQAA 1E6UA 4NFYA 3E03A 4E31A 3WG9A 2I6TA 4IDEA 4E5KA 1A27A 5DULA 4TQGA 4OH1A 4EGFA 1EVZA 4ALNA 2H5LA 2HJRA 3G0OA 1MXFA 5DN9A 3V2GA 1YH3A 3P5SA 4GX1A 5T57A 2B37A 3BZUA 3JYQA 1CEQA 3DBLA 2VCYA 3WJ7A 3B6ZA 4OOEA 2C5AA 1UJMA 1IOLA 1NPYA 4BGVA 4DUPA 3NJ4A 4NJMA 3RUAA 4QXMA 4HFNA 2VWQA 3QQPA 1VJTA 4I5DA 5GZ1A 1HLDA 2NTJA 1E1LA 4FW8A 3WFJA 1P74A 4DIOA 1UZNA 2JD0A 3DTTA 2ILTA 4BIIA 1LBEA 2WSBA 2GD1O 2SCUA 4YJHB 3BMOA 1DAOA 2PTGA 1YDWA 1KERA 4KTTE 1P1IA 4WLUA 4R01A 1L7EA 1KEVA 1V3UA 4XJTA 3ROQA 3E48A 4R9RA 3NRCA 1I0ZA 1BSVA 2HUNA 4J7XA 4IDCA 1F06A 5BNFA 3OBBA 4MVJF 3OHSX 1DDOA 1E3EA 4NMHA 5DCYA 2EJWA 3QLJA 4WLEA 1O89A 3S8MA 2WD8A 5A9SB 2EXXA 2RCYA 1A71A 2EKLA 1F8GA 1C14A 1TXGA 2GF2A 3GVPA 3GY0A 4IXTA 5BNIA 5A1TA 3TZHA 1LLCA 2BLLA 2YQ5A 4MP6A 4CMKA 2OHXA 3DL2A 4CMIA 2YHIA 4CLRB 1T2CA 3ZHBA 4QO8A 1UXGA 4RL6A 1CYDA 3OMLA 3UUWA 3WQRA 3TFOA 3TSCA 1DRUA 3OA2A 4FFLA 3AUTA 1ZJZA 4IIVA 5ILGA 4K6CA 4BO7A 5I9LA 1N8KA 3WNQA 2CVQA 3TOXA 5KVVA 4PG5A 4YEDA 4GLLA 5JW6A 3DZIA 5ER6A 1LTHR 1GD1O 3AI3A 1DIRA 5KVQA 3WGZA 2WMDA 3PLRA 1N1GA 3L77A 4JN6B 4KMSA 1AGNA 5TIIA 3DO5A 1VSUA 2ZTUA 2PA3A 1HE5A 4EEXA 2P91A 4FQ8A 4IQGA 1PU2A 1YJQA 5JY1A 2V6BA 1BG6A 1WZEA 2AW5A 3PWSA 4JP2A 2DT5A 1J5PA 3PI7A 3QE3A 3DZJA 5T8KC 3K9QO 1EUCA 3E8XA 3SXPA 1N92A 4OYRA 5IDYA 1LXCA 3WXBA 3ASUA 3A28A 2VZ9A 4H15A 3A1NA 2D8AA 4XIJA 1ISMA 2WD7B 3ANMA 4UREA 1H5QA 3DEYX 3LQFA 4IINA 4PLVA 3GEDA 3RWBA 3ZWXA 1O0SA 2QYTA 4BNFA 4DPMA 4I5GA 5AOVA 2QIOA 3F3SA 1PZFA 2EV9A 3HSKA 4IY1A 4E4YA 1D1SA 4BO9A 5JY6A 2Q50A 2F00A 3LVFO 2QW8A 2NWQA 2YHUA 4JCOA 3FSRA 4II2A 3TZQA 5JCJD 1KEPA 4J90A 3QVSA 5H82A 3WMWA 1W73A 4GWKA 3U4DA 1YB5A 1R0LA 4R16A 2PV7A 3NDJA 3JQAD 2JCXA 3PYMA 4IMRA 1XEAA 4Y6SA 5JS6A 2YYYA 5I7EA 5L4LA 3LC7O 4BNYA 1CRWG 3GMDA 5CHEA 4B79A 3RFTA 3ZHXA 4L74A 3K8ZA 4WOJA 2NTNA 3GT0A 2PKQO 3RJ9A 1JKJA 1BW9A 1BXGB 1P33A 3GEGA 4JX8A 1VKOA 4CMEC 2OBNA 3BMNA 3LC1O 2OP0A 2DUWA 3VPGA 3OQBA 2Z5LA 1U5AA 5JCXA 1HLPA 2BRUA 4OSPA 1GDHA 3ONEA 4AFNA 4YT8A 3WIDA 2NNLD 1S7CA 1SBYA 2YV3A 2O3SA 3HADA 3QV1A 4W6ZA 2VTDA 4TKLA 5JDCC 1N9GA 1ZSYA 4M49A 4ND5A 4GKVA 1GUFA 2IRWA 2I65A 4WPGA 3UFXA 2BFMA 3NV9A 1Z7BA 1GUYA 3H9GA 3JD3A 4P4LA 2IEDA 1AUPA 1TT5A 1ID1A 1VLLA 4CM9A 4DIBA 4G65A 5BNTA 3T4XA 4TVBA 2D5CA 4RCVA 3HB4X 2BFPA 3SC6A 2Y1EA 1ZXLA 4H7PA 4ZQHA 1Q7GA 4CM8B 1LSJA 2GN6A 2DU8A 4J1NA 3WWYA 1NTOA 3VPXA 3ZWNA 2G1UA 4Q3AA 1MXHA 4I08A 1IB6A 4CR8A 2BF7A 3HFGA 3I6QA 3JQBA 4BKUA 1R16A 3RROA 1ISJA 4YAJA 2AMFA 1Y1PA 3DBLB 1CERA 2HMVA 2BD0A 3IAHA 4UVDA 5FFFA 4CLXA 3WYCA 2CVOA 3GHYA 3W4JA 5KIAA 2Q1UA 4HFRA 2PFGA 4NIMA 2X0IA 1AHHA 1UZMA 4NJMB 3KM0A 4R9SA 1E3JA 3H5RA 4F45A 2JFGA 3DZBA 1PJ4A 3OJ0A 3AI1A 3HDHA 2Y68A 1GYQA 1LX6A 2NQTA 3JD4A 4YAEA 3EZLA 3LT0A 1XQ6A 4FPXA 4BKOA 1XA0A 3QY9A 3RBXA 4YVFA 2NSDA 5K0ZA 3BMOB 5COQA 1DC3A 4RF2A 4DA9A 5IXSA 1RM3A 4GVXA 4W7IA 1YRLA 1T1RA 1EK5A 3UH1A 2AQKA 3EVNA 1IUKA 2EG9A 1GAEO 4XR4A 3N7UA 1X7HA 3BMQA 2BFAA 3NKLA 4N54A 2DFDA 4OHUA 4XA8A 3PFFA 5A06A 1IE3A 4L0QA 3DDNA 1U8XX 3MOGA 5JYDA 1EQ2A 2JHFA 5BSFA 1YOVA 4CMIB 1AXGA 3GPDG 1EVYA 2YHIB 4NFHA 1TA4A 3ASVA 4D3FA 1SB9A 1B8UA 4L4SA 1KVQA 3AUSA 1ZMTA 4A03A 3DOCA 4CL3A 3K5PA 3H3JA 2NADA 3A06A 1MGOA 4WLFA 1U5CA 2ZTLA 1R4NB 3D4PA 4BNTA 2DAPA 2X9VA 5CFZA 4OAQA 4F46A 5CEFA 5DOZA 2GASA 2RAFA 2VT3A 4Q3BA 3PJFA 1NFFA 3ONDA 1D1TA 1JA9A 2FPPA 3F5SA 4Y6PA 1PQUA 5TX7A 3ZHYA 1ZEJA 3VOSA 1H2HA 3MJVA 1D7OA 2RHCA 1OI7A 4ESOA 2NM0A 1MB4A 4RJTA 1H94A 3VKUA 3NT2A 4UEOA 4Z0PA 2FZEA 3LDHA 2VWPA 1VPDA 4BNUA 4CMBA 3GOHA 2HU2A 1V9LA 2W2LA 2AEJA 4FGWA 2QZZA 5C3MA 3ZWMA 3ZNPA 1A7AA 1DC5A 2HDHA 2PZMA 3G1UA 3N58A 4YBZA 4B3JA 4RF4A 3CPSA 1BXKA 4CM9D 3ZW8A 4MP3A 1HDXA 1C0LA 4CM4A 1UH5A 2Y05A 1BWSA 1G0NA 1PWZA 1V3TA 4F6LA 3T4EA 3DBVO 2Z1NA 5JC1A 2IZZA 4JIGA 1P45A 2OOSA 1ZW1A 1QYXA 3OQ1A 3ZWWA 4WEOA 1ORRA 4YT5A 4BV8A 1Q7CA 1C3VA 1LLQA 2A92A 3HWRA 4GL4A 5IG2A 2EEZA 4OM8A 2F1KA 3IP3A 1ZKMA 2GRAA 3D3EA 2ZB4A 1OC4A 1LDNA 3DBRA 4ILKA 4Z9YA 3P19A 4IDDA 4D45A 2XXBA 4ZGWA 4DC0A 3EDMA 4CR7A 1WDLA 3BMNB 4UAGA 1QLJA 1LRLA 1UR5A 2DTEA 1H6BA 4AJPA 3JYNA 3ZV4A 2EW8A 3F1LA 3WNVA 4XCVA 2AE2A 4ND2A 4Q3EA 1KC1A 4UVHA 3PGJA 3PVZA 4IGFA 5GZ6A 4BNXA 3AY3A 4RF5A 4HUJA 4BGEA 3ORFA 1V3VA 1HL3A 4PG7A 4PLCA 1E92A 1N9GB 3JQ9C 1LLDA 2D2IA 3OSUA 1YONA 4WLNA 1DAPA 4NNJA 2R00C 3QVTA 4MINA 3BTVA 5FF9A 4DBZA 2VRBA 3FTPA 1I32A 1LSSA 3F4LA 1T2AA 1ZXBA 1ZIDA 1TT5B 2P2SA 5BSHA 5CAEA 3ZWPA 1W8DA 3GGOA 2FMUA 5DZSA 4U6SA 4K9DA 2Y67A 2VHZA 9LDBA 4I9NA 3JD1A 4P8RA 4B8WA 2QQ5A 3DB2A 4CMAA 1CQJA 4BMSA 4IXWA 3PGXA 4FJ2A 2OBYA 5KKAA 1SMKA 3GZNB 1PEDA 1WVGA 3GVIA 1KIFA 4ZD6A 2Y1DA 2J3JA 1HT0A 2VRCA 5G0VA 2O2SA 3NDRA 1O94A 3DZKA 5K9ZA 4NHEA 1JDJA 4J1TA 1ZCJA 2CZCA 3L0DA 1K6JA 4DWVA 1SB8A 3OIFA 3D4OA 4E3ZA 4UEJA 1NVTA 3G3EA 1DLIA 2ZK7A 4JGBA 5EL0A 4RVHA 4TMFA 6ADHA 4BOYA 2D59A 4QQRA 4XYMA 5I9MA 5TJHA 2YUTA 4NU6A 3GA0A 4YJHA 3DFZA 3I23A 4ZU3A 5I7SA 1GCOA 2EP5A 2PKQP 5I7FA 3WTBA 1YB1A 3DONA 3DZGA 2X86A 5T5QA 4J16A 1P1JA 5B1YA 4IQ8A 3MWEB 3EK2A 5LDGA 3VZSA 3TF5A 1Y6JA 2C2YA 1T1SA 5JLAA 1PQWA 4RORA 3KEQA 4OIMA 5JPIA 1PR9A 1W0CA 2A9FA 4L4RA 3WQQA 3I9JA 4N7RA 1RWBA 2W2LD 4A73A 3V2UA 2W8ZA 3V1UA 3B20A 1A9YA 1FDUA 1YDEA 4GLOA 2B69A 1YVEI 2W98A 1ZFNA 4MVJI 4Y67A 4CQMA 1E1NA 1OBFO 3OP4A 1WMAA 1PJQA 1K2WA 2CVZA 1U28A 3UCXA 4IDGA 1EBFA 1MC5A 1I33A 3WBBA 1TI7A 1B8PA 4U0KA 2PWZA 3S1LA 4ALKA 3DZFA 1NVGA 1PGQA 1UAYA 3Q2IA 4FFPA 4HV4A 3WTCA 2FRDA 2I67A 3MCVA 3K92A 4R5MA 3GZ4A 4BNKA 1XR3A 3HE3A 3TL3A 1GZ4A 4J9UE 3IC5A 4K1LA 4M8SA 5DNAA 4B3IA 2CD9A 4FOOA 3UVEA 1U4SA 1BMDA 2YJZA 2OMEA 2B5WA 3BTSA 3PPIA 3BYZA 3F4BA 3RC7A 2AQHA 3DZHA 2DBRA 3CIFA 1VL8A 3KXDA 3L6EA 3LYLA 2B4TO 2P4HX 3U4HA 5G4KB 2WYWA 3L4BA 4I9HA 3VZRA 5JAIA 2YDYA 1LDYA 4R4JA 2P5UA 3W6ZA 4BGUA 1B7GO 3A14A 3OH8A 2NVUB 3OJEA 5LDHA 3QP9A 4WNCA 2Y1CA 2ZJ1A 1ENPA 3D3WA 1NAIA 4D7AA 5JXWA 1RM0A 3KLPX 3ZW9A 4LRTB 3I4CA 4YAKA 3WJAA 3VHRA 5C5IA 4XQGA 4NDNE 4EJ0A 4BKRA 3C7DB 4D44A 3MZ0A 5DCUA 3E9NA 3WGQA 5G0UA 1R12A 1WP4A 2G76A 3E9MA 3H65A 3L4SO 4FFMA 3GN2A 4TROA 3PHLA 3ICPA 1T2DA 4BNWA 3VZPA 2IZ0A 4GGOA 3KO8A 3KLMX 1LEHA 5DT9A 2G0TA 1B8VA 3CH6A 3I6IA 4I8XA 2GZ3A 1ADCA 4MVJP 2OO5A 4AJ1A 1ZK1A 4CM4B 3JQGB 5CPBA 1NBOA 3UICA 2VZ8A 3IMFA 4GAEA 3GF4A 4CJXA 3NJ8A 3AU8A 5F5NA 2VYVA 3WMXA 4E21A 3VH1A 1AE1A 2JAPA 4WCFC 1IPEA 1I8TA 4ZQFA 4R51A 3GGPA 4U7WA 1Z74A 4DBVO 3MOIA 1P1HA 2VRCD 1EK6A 3RC1A 1ADFA 3DBRB 4RV9A 4YJGA 3UW3A 1Y9AA 1PJ3A 3MTGA 4YPOA 2OUIA 3MEQA 3ETDA 3VKVA 1OZAA 5THKA 2PD4A 3ZNOA 1QSGA 3FRJA 2EKQA 1QYCA 3F9IA 9LDTA 4W9NC 1PGNA 3PYLA 4N5LA 4AJHA 1T25A 3ZH2A 5IDXA 4FN4A 3H2SA 2IDZA 3CINA 4DLAA 3ONFA 1YO6A 1Y8QA 1IHYA 5C7LO 5I8ZA 2VUUA 1YQGA 3ETGA 3PQDA 2DTXA 2E49A 3ICCA 3PHJA 4PVCA 3WBFA 3AFMA 3W8EA 4BNIA 3O9ZA 2E4AA 1JWAB 1VJ1A 1O5IA 1MLDA 1ZSVA 4FJ1A 3NGXA 1PS9A 1CIVA 4WK6A 4D3DA 4IGEA 4QX6A 3TL2A 1P1RA 1LC3A 2NUAA 2CDAA 5IN4A 4S1VA 4NZ9A 4E2YA 4XRGA 4PLPA 1LUAA 4WLOA 4MKRA 5JAQA 3GHHA 4A7PA 2IXAA 2NU9A 3NTQA 1UP6A 4AVYA 4PN3A 4TKMA 4CQMD 3M1AA 2PD6A 3KYBA 3F1KA 4K26A 4FD3A 3DMTC 1YL7A 3UOGA 4CM8A 4P4NA 1HZJA 4YA6A 2DTDA 5LCXA 3LLSA 2FHSA 3RBVA 1DSSG 3LF2A 3ULKA 2UUPA 3ZNQA 2GDZA 1GQYA 3O26A 4FB5A 2ZB7A 1LSUA 3WGYA 2ZKLA 2Q2QA 4J91A 5T67A 4BNZA 5L51A 3FTNA 1FDSA 3IQDB 4ZRMA 1NNUA 4DREA 3K6JA 2G17A 4CQLB 1HETA 4BGIA 2B0JA 2O48X 5F1PA 4LCEA 4RVFA 4PRLA 3WIEA 3RVDA 3RC2A 4R5HA 2YFHA 1PQPA 1RKXA 1SOVA 1FDVA 3ZWCA 4ROSA 5L4NA 4CM5A 4CLHA 5G0SA 3V5NA 2X0JA 1K3TA 4WKGA 4BVAA 2VHVA 2E48A 2AE1A 2PR2A 2JJYA 4CV0A 4CMJA 3W1VA 3HUDA 1PL7A 2CNBA 2HMTA 2R2GA 3QIVA 4OKIA 5ICMA 4JP3A 2HK7A 5EESA 3V1YA 3H9EO 5T8KA 5COAA 1YBMA 3QVOA 4E12A 2Q3EA 4NH4A 1UXJA 3OETA 5B4TA 4NBUA 4PZCA 4BNHA 4CQMB 3PHHA 4GX2A 4NR0A 1Y7TA 3ZV6A 3ZZNA 4JJIA 2PH3A 1DJNA 1E77A 5HA5A 3GVCA 1I3KA 4DPKA 4DL9A 1Q0HA 4TRMA 3CXRA 3INTA 1LQTA 3D5TA 4GSLA 3Q3CA 1ZVMA 1IZ9A 1ISFA 2DKNA 2VYVD 3ZWVA 3G79A 2O3UA 3L9XA 4Q39A 3OECA 1UDAA 1GTMA 4MVJM 4E32A 1ADGA 1DPGA 2WYUA 2A94A 3K30A 1R4NA 1LDMA 4H3VA 4QFCA 2WE7A 6LDHA 1YQDA 2PD3A 3DAGA 1UZLA 5KTKA 3V8BA 3SX2A 2DBZA 1AXEA 2J3KA 4KUHA 4XYEA 3AU9A 5KKCA 1HEUA 4A5OA 5FI3A 1HYHA 3C1TA 1P3DA 3PHIA 3ITDA 1DLJA 1NAHA 4RPHA 4J2OA 4CUZA 1ML3A 1UDBA 4OL9A 1XWFA 1VE9A 1R37A 4U6QA 5HRUA 4HADA 4CMEA 4YJFA 3D3WB 4FOSA 4UULA 4CLOA 5COBA 4YXFA
chains in the Genus database with same CATH superfamily
1YULA 2EZUA 2HEIA 5C53B 3IKTA 3NRBA 1X7YA 5B1HA 1JHYA 1Q0PA 3AERA 3LNCA 1DQZA 2YWCA 5KSYA 1K6MA 3VPDA 5F7ZA 2BISA 4C3ZA 3GMIA 4O63O 1F5NA 3IEKA 3NP7A 4RD0A 3K9LA 1DT3A 5JDCA 1ELOA 1NQTA 4FGSA 1SKBA 4KQ6A 2QKYA 2IUFA 5LQSA 3EGCA 5MFZA 5DPMA 1PWXA 2K6GA 3DFIA 4RD2A 4DR7B 3JAWA 2HLDA 2FN9A 1AK9A 3B9QA 3BDAA 3DAFA 1FFHA 1WKVA 2R8PA 4Z6KA 3JAKA 2KB0A 3AWDA 3MJFA 4JU8A 4EKGA 4W8GA 3QBDA 4XWKA 4ND4A 5TQ2A 2A1TR 3T5MA 3T3DA 1YK0A 3BMCA 3JVEA 4URFA 1XZAA 3TGPA 2RH5A 3R5TA 1E2DA 3IA7A 5BYKA 4OAOA 5AJXA 3A1VA 1RI4A 3IQFA 2B8NA 2PS3A 4MI6A 3OC0A 3CO0S 4OP3A 3LU1A 5K3FB 4ER5A 5JZBA 1WXHA 1FLVA 4WXYB 5ES4B 1NBMA 3TPCA 3SZRA 4DV3B 3F47A 1E2KA 1QHNA 5KNCH 1CZLA 4YJGB 5F2KA 5IBQA 3RGWS 4B2PA 3D1VA 3ELBA 4L15A 4DMMA 5I3ZA 2Z08A 2C2HA 4ZAYA 4DMGA 5I7OA 4HCJA 1E2QA 2OSVA 4LZNA 3I61A 2BKAA 3WLIA 1KJYA 3PTZA 2H0AA 3VKWA 1OLOA 1TUIA 3GV0A 3GRRA 3H2YA 3MUFA 3SYTA 1SCQA 2OV2A 2OORA 2IP1A 3CVVA 4KZPA 3WB0A 1J8YF 4HS4A 1GEGA 1W46A 5IARA 1MX9A 1RZ3A 4JR1A 1ZUHA 4V0SA 5ALGA 2GEUA 4JKIA 4BJ6A 4C0AC 1DJMA 2L69A 4WK0B 4WASA 4L73A 4DXHA 5B1DA 1Y4SA 5BYBA 2XWPA 3R24A 3ABZA 2JNWA 3CVUA 5IABA 1OTYA 3K5HA 4IZIA 2FDXA 4IQ4A 2RHJA 4N4AA 4PHTA 1K6IA 4HX5A 1VRWA 2YWEA 3KYCB 3ENKA 4GWGA 4CEJA 4FFNA 2AEMA 3FMFA 3U0BA 1A7KA 1SOWA 2A9JA 3COSA 3O4GA 3U48A 4D4KA 5K01A 3HJFA 1ZNYA 2ZRAA 4EPRA 1EIWA 5KDDA 2QLNA 2VK1A 5FKJA 3VC7A 1BDMA 1QYDA 3D0KA 5FNVB 2B3DA 4ZEWA 2Q6TA 4G8BA 5L95A 3RQSA 1T2FA 1DAKA 1K8QA 1MIHA 5CLLA 4BO6A 4D4IA 3D64A 5JDIC 4TYWA 2ZSJA 3C7KA 3HACA 4RY0A 4AL4A 3BE4A 2WLSA 5I5GA 1YTUA 1HF3A 1ULAA 4JLDA 1WTAA 3UENA 4JI8B 4CF3A 2GEFA 1DCMA 4MAMA 3TZEA 4ARIA 1PJAA 1Z39A 2AZDA 2X9GA 1BC5A 4NBNA 3BT7A 2WE8A 1OYVA 1RRMA 3D0OA 3JYOA 4MW7A 1AO3A 4QUKA 4C87A 3EAQA 5H3LA 4MW9A 3GNTA 1DTEA 4BZZA 4E2ZA 3FHOA 2QT0A 4XYBA 3UAGA 2GPJA 4EJSA 3OM9A 4FC6A 4Q4LA 1Y9EA 3CFYA 3D9QX 4G5YA 3OC6A 2GZ1A 3WQBA 1Q17A 2FEAA 1ODFA 2WJVA 2RHLA 1XNJA 5FLEX 5JMTA 1I5EA 4RIHA 1O0CA 4NCIA 3T5AA 1QFMA 2XMGA 4M8NE 1E1RD 4NPCA 3RCBA 2FQWA 3UV7A 2AFIE 2HUPA 1ZN2A 2P65A 2J33A 3OOJA 5AOBA 2FP4B 5AVZA 3SFTA 2D8MA 2DMRA 4LHEA 1YL5A 4IZ6A 1M6YA 5KYKA 1KEUA 5B7QA 3DEIA 4UNPA 1A1VA 3TZKA 2HQ1A 4LJKA 3VH3A 5I4CA 3B7WA 1LWNA 2BGJA 3GAMA 2IP4A 3A1CA 3LD9A 3OWHA 1J97A 1N4AA 3VFDA 1OYYA 2IPXA 2OY0A 3AJ9A 4XQ0A 5HF6A 4BP9A 3EW7A 4GP9A 3GYGA 3FMIA 5HIIA 2AXEA 1QM5A 1URPA 2VF5X 2HA6A 5GOZA 3QELB 3O21A 4U5XA 5CT9A 1L5LA 3HL4A 4ASUA 7ADHA 2AEFA 1W4ZA 3FNEA 4PLTA 4AJKA 3STYA 4LE2A 1VYTA 4LYYA 2DWQA 3NOXA 4B76A 4GQAA 2QRQA 4PFKA 4Z7NB 3KKLA 4RDIA 2ZBEA 3OUUA 4FCCA 5LBUA 4RPIA 1G9SA 1P0QA 5A5FA 5T3UA 3UV3A 1MZVA 2GEVA 3K0KA 3GVXA 4IIJF 2OHGA 1PNRA 3U7EB 3KKQA 4J4TA 3O8QA 4N8SA 5JS2A 3VPHA 4DNFA 1I1HA 3KXIA 4MMYB 1Y5RA 3SZMA 1XQVA 4DDVA 4DQKA 3PUZA 3QI7A 3OAAA 2I1VB 3R6TA 2CE2X 4GX0A 4CKBA 1VPEA 3G49A 4UHJA 3UM9A 5JMOA 5EIFA 4CF5A 4HNTA 1JSLA 1KH1A 1AKWA 1K8YB 2DHRA 5ELMA 5ITWA 3U7FB 1JHPA 3MT9A 3TH5A 5F21A 1VSQA 2EJVA 5CA0F 5ENDA 4A2CA 4UBOA 1KYVA 2C2OA 2R9VA 3GJ8A 3VH4A 1DKMA 1PZNA 5G4KA 1WO8A 4LCJA 1Z2CA 1A3CA 2CNWD 4ZQIA 2QPOA 1JEQB 2XZDA 1KOLA 2KLBA 4JENA 4YAGA 4W8OA 1XD2A 4DV6B 4NG4A 1Y7LA 1YBVA 2F2TA 2DETA 1BXZA 1H1LB 3GRUA 1ZK0A 3G13A 2JCYA 4LXXA 1ZOSA 4GW3A 1U0TA 1I2CA 3KPYA 4Q1AA 3RSQA 3ZS9A 3OFND 1CUFA 4UMDA 3C3XA 3CCBA 4PZDA 2DXIA 2HDWA 5D2CA 3SXJA 5HZHA 1W9HA 4F8JA 5AKKA 3RT9A 3HB5X 1X1CA 4WNAA 1WV1A 4A9AA 4HYTA 2VK4A 4UD2A 5CXUA 2AQ8A 3S99A 3UAOA 3H9UA 1C1XB 4A6PA 3PCXA 3Q7IA 4DSZA 3QHAA 2WQ6A 2BMJA 4BB5A 1ZHFA 1F1JA 1MP0A 1OJLA 1FJ2A 1EK2A 1VL2A 2AN9A 2PN1A 4J2HA 4CN9A 3E3MA 3UYLA 3WB9A 3M6FA 3MHTA 3PEYA 2VXBA 2COUA 3UMYA 1UQTA 3HRIA 1EB8A 2BEWB 1YUNA 2C03A 3JQ9A 4R98A 2ZZNA 4M9CA 1IN4A 1GJRA 4WKNA 2F1HA 1AHPA 4O25A 5JJCA 4I1SA 1O9HA 1IYZA 4RU1A 1NMSA 4H17A 4KQJA 1VMDA 2XJ4A 4OHFA 2CXRA 4GR4A 4QASA 1X7WA 5BRNA 3FNGA 3PYXA 4I46A 4N01A 3TL6A 4C4ZA 2J3EA 3ENNA 4MR8A 1OPRA 4LWQA 1X42A 1UMBA 3F0TA 4NAHA 4CKEA 4EYKA 2Q62A 4D5EA 3CLKA 5E6RA 1NXXA 3USZA 3P9CA 3O7WA 1OBVA 3U9LA 1ZCBA 5FJIA 4YJ3F 2X5XA 3DS8A 1HDEA 3NGLA 2YTZA 5FB3A 5LWQA 1XCGB 1GSIA 1MD9A 2PRZA 1DQPA 2R6JA 1ZOPA 2DJ5A 2HMSA 1Q12A 1E2JA 1JEJA 3KKEA 3RKUA 4PSAA 3ECSA 3HY3A 1C7ZA 3PR3A 4R1NA 1L8LA 3W5AA 1C0IA 1M0TA 1M2WA 4DLVA 1YS4A 1ZL2A 1P2BA 4HNAB 5B58T 1GKLA 2DWPA 2RMKA 4GKBA 1JA0A 3IKLA 3IUNA 4LXHA 4DVJA 4GU5A 2GBPA 2PU5A 2WJHA 4R1QA 3VBEA 3DXZA 1WDKA 2BGRA 4IIBA 3ZXXA 4EUFA 4X65B 1LPPA 4GI1A 2CUKA 4HYYA 3DZDA 3LKDA 5FUYA 4AX4A 4C29A 4QUEA 4BQPA 3H5NA 2F43B 2Q0HA 4B4UA 4AP5A 3RS0A 4XPZA 3RRMA 2H5JA 3Q4GA 2AQIA 3D59A 4IUBS 2HLPA 4ZO6A 4B7XA 4L8VA 5DGIA 2W70A 2FF5A 1T36A 3DCYA 5CLIA 2X4GA 3UPDA 2P9QA 4UPDA 3FW1A 1SCUA 2O14A 1O95D 3QPBA 2FPKA 2BFBA 3M6XA 4G9EA 2ZDGA 1ZD3A 2XZPA 4FE3A 1X94A 3CLTC 3Q12A 2JKZA 1XBTA 2P7HA 2PEYA 4LRYA 4M89A 3DKRA 2CDRA 1YR7A 4HJRA 1GILA 3H4VA 2IWRA 5IKOA 1CFZA 3OIDA 2BCEA 2GTPA 4R6WA 2E1PA 4MV4A 1B42A 2F48A 3SYMA 1DPFA 1PUJA 3Q2OA 1COWD 2BGKA 1UEIA 3BDIA 2AJDA 3CX6A 1D9XA 4DIFA 2JGDA 2YN4A 4W99A 4DA6A 3HXMA 2WNHA 5KWVA 4GMKA 3OA0A 3D3JA 1CUZA 1LK5A 1R7RA 2C4MA 2FW9A 3FJYA 3KELA 4IGKA 2IWHA 1TECE 3MPOA 4D4LA 3K31A 4CQLA 4IRXA 4N18A 4C4AA 4EBFA 1JF8A 1FX0A 1R0YA 2GM3A 3OJXA 4CMHA 2PUFA 2C9BA 4J3NA 2QRZA 4BU0A 1TUGA 2FPIA 4OOFA 2OXIA 3K5IA 3SG0A 4MDHA 1EP1B 3T54A 4H08A 1I9CA 1VP3A 5E6UB 4PIPA 4EI9A 2C5SA 1XPJA 3BB3A 4BFVA 3VI4B 5E9QA 1XZHA 1UK6A 3AFHA 2BDTA 3DEAA 1RLOA 3SD7A 1FEZA 3OOYA 2B21A 4L9AA 3OTWA 4WI1A 3FWPA 2BIFA 3R3SA 1G4HA 2X0NA 1U2TA 4TRRA 3ZLTA 4XDGA 4CT5A 4YDRA 2FCRA 2FR8C 3IV7A 5EMLA 1ULBA 5K45A 1MV8A 5IZ4A 3P52A 1GVNB 1HL7A 1TVKB 1NF8A 4OEHA 3KEOA 5SYNA 3V8MA 3AIMA 2HTFA 1FUKA 1Z82A 1U2SA 1YCDA 2CNDA 3QEKA 2Y6VA 1OPXA 3FOCA 2HU7A 3UHPA 1PFVA 4J29A 3I05A 1KFCB 4BQRA 5FBVB 2OZPA 2HJGA 2Z2YA 3OURA 3WGHA 1TK3A 3PHBE 3C5CA 2P6MA 3GUYA 1WKBA 2H7VA 2JEOA 1TJ4A 3UK7A 2P9YA 1A9ZA 4DKJA 5BSRA 1VGVA 2XTZA 4OAPA 2BFOA 2B7BA 3H83A 5LL6P 4HTFB 4B3HA 2Q5LA 4BX8A 3H0CA 1P3Y1 3IIMA 1IHOA 1ULUA 2W8BB 3BJMA 1MF7A 4JQCA 5DGDA 4F4CA 1ITZA 4KNVA 1QIMA 2EFCB 3SCZA 5K4HA 4HH4A 5IHPA 3WGGA 1CS4C 1U31A 2GZAA 5DM60 3BILA 4CM1A 2FG6C 3O5AA 2ZJ4A 3KJQA 5K20A 3KOWA 4U0JA 1UEJA 1QO7A 2QTLA 1QE5A 3UJCA 4C6TA 2XBMA 1J0BA 3H5AA 4WNIA 2GETA 2P0AA 3HS3A 3ZDZB 2VPPA 3OHMA 2VPZA 4BLSA 1SO8A 4Y1RA 2AF3C 3P71T 5FUBA 2VDRB 1Z6TA 2ACEA 2I6GA 2DVMA 1R74A 3PR2B 3RTAA 4BBPA 1WVMA 2IP2A 4W1PA 1R4MA 1T5IA 3RREA 4DOMA 3RVMA 4J0JA 3RUHA 4FB4A 5GONB 2BM8A 2X42A 3PIIA 3VU8A 2I22A 1G3MA 4Y2SA 3ZD7A 2PJZA 4W9NA 4KR9A 1D2AA 1ETHA 2VF8A 5T6BA 1R0RE 2P68A 4ZYLA 3TJZA 3RLFA 3EZNA 4RO0A 1M6WA 4A2WA 1DIGA 2J3MA 2OP1A 2WDPA 4IPTA 4DJAA 3NC1C 5J4KA 1PDVA 4QOEA 1D5WA 1G1AA 2UUOA 4TT3D 3VC1A 1RPAA 4HK4A 4W7HA 5HRCA 2RHBA 1G21E 3B6EA 2Q2WA 3GA7A 4G4JA 4Q3KA 4EGQA 1JHAA 4DVGA 3ESCA 1AKQA 4GPD1 5KQMA 2PUGA 3RM3A 4OBXA 4AJLA 4BAZA 2A0YA 3WMRA 4GS5A 1X1QA 3QI2A 2OB2A 4D4MA 4IV0A 5HKLA 521PA 5CBKA 2JIBA 1FP6A 4MWSA 2O8EA 2A78A 5IAAA 3NWJA 4EJMA 2A1IA 621PA 3MTEA 4JXXA 2XCUA 5BOSA 3FBWA 1N33B 1L7OA 4QBHA 5M5BA 5J2TA 1G55A 2IXDA 4O6VA 3OJFA 4RPKA 5F51A 5H9VA 2GFQA 3AEUB 4NCJA 3FX2A 3RC3A 3DMTA 2GKOA 2NPFA 3H7IA 3KP1A 3PXDA 4PIMA 4LNUA 2YWXA 4KMOA 4RH1A 5K09A 2LIVA 1VIVA 4GI5A 1K9VF 4KQCA 4I81A 4UFNA 4JYMA 3G9XA 2B1RA 1XX6A 1Z73A 1CQXA 2PU7A 4US0R 4OB6A 1BKDR 1B93A 3P94A 1X1SA 5EWJA 1MX3A 1II9A 1Z7WA 1Z6YA 4IG9A 1QB8A 1GG5A 5KS2A 2R4TA 3D7RA 4QQNA 2KLHA 2QL6A 1KI8A 1SAYA 2P9EA 3BK7A 4FZJA 4P3KA 5IN5A 1Q1GA 3JY6A 2XOKD 3CLVA 2Y76A 3C74A 1IATA 4IIYA 2Q6OA 3U62A 5CDGA 1KVSA 1VTKA 5KJCA 1DINA 1TCCA 4LVCA 4BGEA 3EGOA 5ENVA 5EQJB 5IT4A 3BIOA 4QJ5A 4DEVA 3IBTA 4PPYA 1QHHB 4Q05A 1C41A 4MUGA 1Q6ZA 2VQ6A 4EELA 4I6GA 4U3JA 4DDUA 2IOFK 3QU9A 2Y2VA 1IEWA 4QO7A 5EQDA 3R8CA 4AQ7A 2X15A 1Z5GA 4H1VA 2MSDB 1MEOA 2QENA 2X6RA 3BGOS 4FBMA 4FOLA 4LVUA 1TO1E 3AOGA 4N3AA 5CEJA 3MSXA 5DNDA 3PD1A 1ECBA 4RXMA 1VA4A 4WOBA 4X85A 1Q1EA 3BXXA 3IQIX 2QN8A 3P4YA 2IKQA 4JB3A 3ABSB 4OQFA 4EY7A 1M6HA 3GOQA 3HVIA 4A6EA 5DYWA 3NNDA 3FOAA 3P2KA 4CYMA 2EOAA 4IOLA 3W8RA 3ZCQA 1XLTA 2J31A 3E7WA 3PC8A 3EZXA 3FDIA 4R0VA 3RD5A 5C80A 3EY4A 5LXTB 4HHEA 4BRZA 1TCUA 2RIRA 2B35A 2PAAA 2GJAA 5D3ZA 2RKOA 3ZPXA 1UMDA 2CLOB 2F3PA 3L82B 1EKXA 2A67A 2NYAA 4XFJA 3QJGA 3HDGA 2BFEA 4KDRA 3ZX4A 1YVRA 3QSGA 4YT4A 4EO4A 1X13A 5EMHA 1W1WA 4UAVA 3W3AA 4PAGA 1T9GS 4ARZA 1EX6A 1W19A 3LM8A 3IJ5A 1NNI1 1W34A 4M4SA 1E9EA 4II3A 4R3WA 1LDBA 1V6SA 4FHGA 2ZYGA 3DVAB 4B8YA 3UCEA 2HCBA 5A0FA 1R6AA 2G28A 4IWNA 3NU1A 3SNHA 5EFOA 4KO1S 1UOOA 1K7SN 2CZGA 4ZOEA 3ADOA 1S2MA 3VKHA 2YS7A 3BH0A 1SK8A 1PR1A 1ZHHA 2C1ZA 5JSQA 1SXHA 2JKYA 3RIHA 3A4LA 3GJSA 1XTZA 1FC0A 3A3NA 3A26A 3H6KA 1GV0A 3I4FA 4RSMA 4OXNA 3PR1A 4OQXA 3H2ZA 3P26A 2G83A 2GH1A 2GN4A 3LJKA 3NM5A 1U2DC 4NOMA 2D1TA 4QT4A 2QB5A 1C7QA 4BDTA 2HMWA 1IAVA 1PJTA 4NF2A 1WAMA 4XX0A 3RUCA 1XVIA 2Y1LA 5H8WA 3Q0IA 1CRQA 3JQEA 4E30A 1BDHA 2H2DA 1C8VB 2B2CA 4X6XA 2QSUA 1T4DA 1GCAA 2FMXA 3T0FA 3OCVA 1MTZA 2QTNA 3ZKAA 2F55A 1Y3HA 1CB0A 3BXZA 1NXWA 1IBLB 1QVAA 1I2DA 1Y8AA 4JC0A 4Y2YA 1ZISA 4V2UA 4FT4A 1Q1NA 4S2UA 4DWWA 4REMA 3JPYA 3HKCA 3QTTA 5C1DA 4AJOA 1T0BA 2PKRA 5G1OA 3W6PA 2YCLA 4PO1A 1SCJA 2QXYA 3BL6A 5JZMA 1PFYA 1Y3DE 2XCLA 4HDMB 3RUDA 4AICA 4N5IX 2OBBA 3U7GA 1ZO8A 3W9YA 1H93A 3VNSA 1FVHA 4P3YA 4CR6A 4R6XA 2VHTA 3ZDFA 4BQOA 2ONCA 3EZYA 4OH7A 2EF1A 1DHTA 3AETA 4X64B 2GO1A 5JRJA 2V59A 5AQ1A 1R8QA 3VPBA 4KK3A 4YY3B 2XXAA 4Z4QA 2WYVA 2QE6A 3N0RA 4N6NA 1WXIA 2P6NA 4TZKA 3VDRA 1TIKA 4E88A 4N0EA 1UFRA 5J43A 4IKEA 2XLCA 2CYBA 1B2LA 2OHIA 3A0UA 5TVKA 1XCOA 1KJIA 1Q77A 2MSWA 1YK1A 4AZSA 5EP4A 4M1SA 2C78A 2CCKA 4JLAA 4RH3A 4YJKA 1Y33E 2GK6A 2YJTD 5GJWC 3KQYA 4LZJA 1Y7PA 2QG4A 2YY6A 4LOHA 3KQUA 2VZEA 1HLGA 3E15A 2O7RA 2R25B 4K7JA 4WA8A 3L07A 4MKXA 2H4HA 1FP2A 2QUIA 1XIVA 3CUKA 3HB1A 4FLMA 3SLGA 3T3PB 4JI7B 3OQIB 5BN3B 3FYSA 1M33A 3G2KA 3PGMA 1JLMA 1P18A 2JFZA 4DQXA 4PC7A 2XNCA 4ARAA 2DFKB 3TX2A 4QVIA 1OX4A 4G5RA 1TCBA 2HJHA 2PGAA 1PFGA 3LTNC 4B2IA 1UBMS 4AG5A 1A4RA 1GFWA 3OQHA 3PWZA 3HYLA 5AVXA 1ZOOA 3MJCA 1NHWA 4HX2A 4P5EA 1XU9A 1I2ZA 1Z4JA 4HFMA 5E1OA 2C7BA 3DQQA 4XJXA 4LISA 1FUYB 2Y0EA 3JPWA 1E2IA 1IQ0A 2B5VA 2BKEA 1J7KA 2PKYX 3K15A 1QAMA 3Q87B 1F2TA 3TR0A 3GFVA 2QV0A 4U00A 4R84A 5CPFA 4QJBA 4ESEA 3QNMA 1P6UA 3PEFA 1MFZA 5I7HA 5IT9A 1VBMA 1Z4KA 5GVRA 1V95A 4NATA 4NE7A 2CMHA 5HXAA 3DKVA 3QPUA 3IVXA 5K6AC 1YZYA 2VOJA 2YVUA 2ZIZA 3QRWA 4G6ZA 3TAHA 2R6CA 1XF1A 4KLZA 5CYGA 4DV4B 3BE6A 3ABIA 1YC5A 1MO6A 1P9OA 1I4EB 1M2KA 4C4RA 4V3BA 3DBHA 1GFIA 1U3FA 4J1SA 2CT8A 3DR3A 2Y27A 1SU8A 2I99A 3E3OA 4JLJA 5KVVA 5C51B 5J3JA 1M2HA 4AO8A 3EUWA 1TF7A 2H4WA 3AY0A 3BERA 3DL7A 3PG5A 3D1LA 1GKYA 2GN8A 4LY0A 4LTMA 3TLGA 2E82A 3FTFA 2V6FA 4DLSA 3LGXA 4FT2A 2X1VA 4I1IA 4IXMA 2FXVA 2J48A 3LVQE 1KMNA 3VQTA 1SHUX 3L0SA 3PQEA 4DM3A 2GD6A 3E2MA 3VDXA 3HDVA 3V4FA 2V3CC 1ZGBA 3JR7A 3OOEA 4QDUA 2VT6A 1PD0A 4GPIB 4IFTA 1SJ9A 1XQ1A 2CF6A 3V6MA 2AJ8A 3ZH9B 4RV4A 1SVIA 2QRKA 3U4GA 2ZM6B 4Q7QA 2VDNB 4DB2A 4AKEA 4I1VA 3SBEA 4P5PA 4ZN6A 3OEEA 5KHOC 3HU1A 1BFUA 3QEJA 2EDCA 2GRUA 1CUEA 2ZR9A 4X97A 3WYBA 5KOYA 4ACBA 3E58A 3GXBA 2ZVDA 2JANA 5FHQA 1K89A 3NP9A 3PDHA 1JECA 3JQ7A 1H42A 1MN6A 1ZGGA 3WLEA 3T4PA 4BMPB 3O47A 4PU0A 2YFQA 4BRUA 4QDJA 4D9FA 4OJNA 3TD2A 1XHLA 4NZMA 4PC1A 4MI9A 1YZKA 3FRHA 1QHYA 1IBKB 3KVOA 1IM5A 2WF9A 1QWOA 3CVYA 3SMVA 1LSOA 1ZH8A 5DI3A 2HBRA 4JT8A 3X0DA 2P6RA 4JY7A 4UUNA 1KJNA 3S2YA 2EFDB 1ZVKA 1B0PA 1DQYA 4R1OA 1SXPA 3TTSA 2G0NA 4I14A 2RHRA 4NQRA 2MSCB 2PZJA 4ZMBA 2QX8A 4FNAA 5KTNA 3W7AA 4FSHA 3IERA 4Z8XA 1JDZA 4KXUA 4KLCA 3LECA 1PJRA 3OLWA 4QTUB 5FCDA 5IYZB 4BO3A 2D5AA 1EJ6A 1X0XA 2WHEA 4JEUA 4N76A 5H70A 2PKEA 4OMFG 1KBQA 1C0KA 1IHDA 4I4CA 3LWBA 3L46A 1JWBB 5J5AA 3R7NA 3I9LA 2PS0A 2GARA 4XWOA 2QLMA 3Q5DA 2NACA 5BVGA 2JFUA 3ZWOA 5F7OA 5JVDA 1KR5A 1MZPA 4IZOA 2G9VA 4ZCQA 4BNJA 1W85A 2GBGA 3ENZA 4O4LF 1JR3E 4RIGA 5L3ZA 4D6YA 5LJIA 2XCOA 5ALQA 4AMVA 1RI3A 3EDYA 3QLVA 4QL3A 4CT4B 4KXYA 3THWB 3ICWA 3FGPA 3C1AA 1EEHA 4LVNA 4BFZA 3M3HA 2E5FA 2VWGA 4R2WA 2IQIA 3QBTA 2GK3A 3GT7A 3TKYA 1P4SA 2R6AA 1P31A 2WHPA 3D4BA 3OQOA 3GNQA 4WW0A 4G0WA 2H7YA 4IS2A 3R0IA 4O2BA 1OAAA 1ILWA 5KSZA 4XLLA 2E6UX 3UGTA 5IU6A 4GLJA 4D9GA 1OIXA 4RK6A 2A1UA 3HSSA 3B1XA 5AJUA 3AF1A 4HB3A 1P2UA 3C3JA 4MOWA 3OKPA 1P7WA 1GITA 4Q4AA 3PTAA 4XWGA 4MUBA 4OX9B 3LK7A 4KN9S 5M04A 3E70C 1G7CA 3A4VA 3E3NA 1BVUA 1WKCA 4G9GA 3ETLA 1NBEA 4AY3A 3CZ5A 2Y93A 4LDRA 2PE5A 3NUGA 1ORDA 2A86A 1QLWA 3GLUA 1C8KA 4X7PA 4C22A 2HKIA 1HYEA 1UPFA 4PEVA 4QHYA 1GT91 2J0SA 1N3IA 4ZDIA 3ZGYA 1JFFB 1U3VA 3QWBA 3JQBC 5EAIA 3KZVA 1RXUA 3RVQA 1OXMA 3NUQA 1GU7A 5D84A 3R7FA 1FTSA 5HE9A 1L5WA 2WJGA 3OOWA 5AXDA 4FWBA 4EGJA 1D5CA 2H1RA 3OQVA 2A0KA 4OHKA 5AI9A 3M1YA 3B9RA 3UYKA 4YCNA 1J33A 1CDZA 1DAIA 3E3AA 1IOZA 3PTLA 5FOVA 1WSDA 3GRKA 4FMDB 4K6KA 4K9PA 1EFCA 1OAOC 4WESA 2EHDA 2OBLA 3OPYB 2L2QA 1YGYA 1KF0A 3VO8A 2DB3A 2CXPA 3FY4A 3KQTA 1IUPA 1PKEA 3NRJA 4NV0A 2X9NA 1AQ6A 3TNLA 3W90A 5K8CA 1Y4ZA 1GPDG 2FSHA 2PT6A 3MM4A 4JUFA 4NKRA 3O9MA 3Q9SA 2WAYA 3BQMB 4QOJA 2UYYA 2WY2D 1V1RB 2R7KA 4ND6A 4W5WA 4BO5A 4OCZA 4BATA 4BEVA 3EC7A 3PRKE 4EG7A 1G5TA 2MCFA 3PQ6A 3T9FA 2Q21A 3WXMA 3KQSA 4RACA 1A77A 4DDKA 1PL8A 5T4HA 1XWIA 4EB8A 3M2PA 5ARCA 1DXYA 4DDWA 1A8HA 3QFRA 4MMZB 3F97A 4JI5B 3KYDA 3R0VA 4ZQEA 4YUWA 3ZIAA 4ZCPA 2G5PA 1M1UA 2BWJA 4LYFA 4OJYA 3GBVA 1G16A 3EEBA 1IPFA 4IRUB 1VYHA 2B4RO 2X6TA 4J07A 3EOZA 4G2TA 4ICIA 4W5JA 3KZ1E 4I5FA 1SN7A 2FKNA 2HRCA 3REQA 4ZI7A 2SECE 2C4NA 2W2KB 1E6EA 1K88A 3K0CA 2O1XA 2GXSA 4L16A 4MRAA 1NIPA 2W6IA 5BV7A 1A4XA 4D0RA 3IAEA 1AXRA 4KLNA 2PGOA 4G41A 4RJKA 2M98A 3NPMA 3CNOA 2JPDA 1PFUA 1Z68A 3FKSD 3I39X 3QZUA 5AXAA 5HGJA 1OB2A 1U02A 4BLWA 1QHIA 5ADUS 1QYWA 4DR6B 2Y1GA 4B7CA 2UVPB 2JLYA 4AJIA 2XEDA 4G0VA 3CEMA 2X0RA 1EUQA 1T8RA 1UUFA 1UXOA 1WDMA 3C3WA 3G2JA 1M1NB 4K9OA 2E4ZA 4KL8S 4LK3A 2J1LA 2VHQA 4WK4B 4ZZ3A 2PS1A 3WYFA 4GPBA 1UFOA 4ROTA 3S2UA 4N3NA 2A5DA 2FZLA 3I6YA 3BM5A 1PNQA 3QVLA 6AT1A 3CZRA 2WM3A 1CU1A 3ZE6A 3L8GA 3G0GA 1IZZA 2JJ1D 2PK3A 4DW8A 1E5QA 1BMFD 5IC6A 1HFEL 2AMLA 2BZGA 1JG1A 4KSCA 2PUDA 1NRWA 1GPH1 5L6LB 3HVKA 4ZCTA 4FHFA 5JQGA 3C6QA 3HXKA 1DKNA 1ZIYA 2VNIA 4J43A 1JHDA 1JHXA 1TQ4A 2H1HA 5EHXA 4U6NA 2QL5A 1N77A 3H99A 1UC8A 5D00A 3VZCA 1XROA 4EENA 3O8NA 2IYEA 1FFCA 3ZU4A 1IN5A 1MTOA 5G0TA 1E9RA 4E11A 2I7CA 3WWZA 1C1DA 4PVDA 1HXHA 3A6JA 4JQSA 5EWLB 1KRXA 4B4WA 1HH4A 2GAAA 4JSRA 1WLYA 1I30A 3HWX1 4IDNA 2HRDA 4ILEA 1ZUD1 4N5DA 4EYGA 4MQMA 4X00A 3FCOA 1U0HC 5JNWA 3ZLJA 2ZBDA 5JAMA 3I5UA 4M7WA 3IAM6 1VHWA 2V7GA 3JYLA 2XVYA 3ZWBA 2FR8A 3BH6A 4YNBA 1AKEA 2MIIA 3DFUA 5ICSA 2IL1A 1MO5A 3WR5A 2VJDA 2I8LA 2UYOA 3L79A 4ITUA 1JR3A 2H1CA 3M6VA 3U3ZA 4FSDA 5D3MA 4AT1A 1XXLA 2ICAA 4G0MA 1G8MA 1MA0A 3H04A 3IIKA 2OGUA 1DB3A 1PT7A 2NYRA 1S89A 1GUBA 4NQZA 5GGYA 3T7KA 1YI1A 4DSOA 1KDPA 1DC6A 3DG9A 5FR2A 4AJNA 5KJEA 1YFLA 5DDIP 1PZGA 1GPMA 5E6SB 4CZ2A 3ILYA 2NW6A 4TZ0A 5GADl 2Q5FA 2QDKA 3WDSA 1R1DA 5L40A 4EYOA 2W2QA 1I2BA 2W22A 3NZEA 1T9GR 2VPIA 1VKHA 3MTJA 2F4NA 4C4SA 1UXIA 1ESCA 2HC9A 3E5RA 4MDYA 3R5FA 4BNLA 4PQYA 5K1ZA 3DKPA 2RGDA 2HOQA 4MVJH 2XYVA 4BV3A 1S4MA 2HRRA 1R6BX 2IY8A 2SKDA 2YWDA 4NWIA 3WZMA 4CE6A 3RYHA 4EGAA 3W1VA 3F6BX 4LZOA 3KLOA 2CUTA 1W0JA 2W2VA 5DX0A 4MV1A 1P81A 3R0XA 1FJHA 3PC6A 1PS8A 2PQ0A 1V5FA 3ZOZA 3SKXA 3OF2A 2IUYA 2WJZB 3I1FA 1XDZA 1DG3A 1FYDA 1RCTE 4U2BA 4TQ9A 1MO4A 1P77A 5SZKB 4EI7A 2F4VB 5JZVA 1R6DA 1NA5A 2C9ZA 4MSUA 1FFWA 1NGSA 1XTUA 3ZXUB 3HRHA 2R1TB 3E4CA 3PFHA 1DEKA 3KUCA 5EZYB 3AR7A 1NW5A 5CA1B 4GDFA 5KQPA 2OFXA 3WMGA 3X1XA 4M6WB 3RSCA 1PJCA 2JCGA 3H2IA 3JQCA 1OFUX 4JLWA 2PUTA 3TMKA 3H05A 3WLFA 4C89A 4DXDA 3GLFE 1KSGA 5SZHB 2MINA 4WK2B 5TDHA 3G0IA 3CUTA 1GTSA 5BXQC 1X87A 3H1TA 2IOQA 5JNTA 1F8UA 4JV5B 4J6EA 5A5GA 1BEZA 4K9KA 3S2GA 1R50A 1RJ9A 4KEAA 4C2BA 4RHYA 1MVNA 2PAFA 3GEPA 1RRGA 4XWYA 3M4XA 4M9XA 3O4VA 1FTQA 5EKSA 4K0KB 4HWKA 3KDPA 2BMVA 1OKKA 2Q46A 2NU6A 1HYGA 2GZMA 3F5FA 1ZLXA 2XTMA 3VR6D 4DN6A 4PICA 1ZM7A 1CDOA 4U39A 3M6WA 2F9LA 2DJIA 5DBHX 1HZZC 2YYSA 1D8AA 3OFSA 1RXIA 2I33A 4MW4A 5A3JA 2REQA 2WV9A 3WNDA 4D74A 1C9EA 4UHCA 3GLRA 3ZDEA 4FHDA 3PC3A 1YNOA 3GLFB 5FA5A 4REOA 1DMRA 3AFNA 4MLDA 4DLZA 2ZQZA 3LFUA 5HILA 4ADSG 2E4YA 1GOTA 2IEBA 4EARA 1F8FA 2HYDA 1SQFA 5FI1B 2I9PA 2WJYA 2X8JB 2ATEA 1QK3A 2VH2A 4RK7A 1YXMA 3LXMA 3DEFA 3VR4A 2R8OA 4IEFB 5FP0A 2FFBA 4ZZ0A 1I7QB 3AVTA 1UM9B 5KSOA 5LN1A 3VC2A 4LKOA 5KNBH 3NHZA 4UQLA 4MROA 4JJ8A 2BR5A 3O74A 1ZNQO 1VCMA 2AR7A 4DSNA 4EZBA 3RHZA 1ENYA 3QTLA 4DDTA 1Z6PA 3ADPA 1C7IA 3ZU5A 2XGJA 3NDIA 3HMKA 1I4TD 3SXUA 2O3QA 4AYWA 3DC2A 1G66A 3T5PA 2WWRA 1EVLA 3C7AA 1KPIA 4LXQA 2O2XA 1W48A 5FBQB 3KR0A 3PE6A 2OGWA 4DRXA 3IEIA 2WJIA 2Y0DA 5DEOA 1RYMA 4R41A 1KYIA 1IB0A 1UKZA 3LCUA 1KARA 4PLFA 3UWSA 1QO0A 4LGCA 2I34A 3TXYA 1QP0A 1PG2A 1TO2E 4G0OA 1H05A 3WKAA 1J9ZA 1Z63A 2XQFA 4V1CB 2BHLA 2FRDC 3ZDRA 1QIHA 3KVVA 1E7QA 4F04A 3IAFA 1E79A 1UPXA 3ACDA 1YC2A 3AQIA 1L3CA 2WICA 4CETA 5LMNB 9MHTA 5DBOA 1RQ2A 3WLQA 1TAHA 3AESB 4J0IA 2DHEA 1NM5C 5SZJA 4LC9A 4S35A 3H11A 2GPSA 1WCIB 3PGA1 5TE9A 2CFOA 1ZNZA 3HU2A 1PGPA 4TV9F 1B1AA 2JLWA 2V5AA 5EXTA 5G1NA 5DLYA 2RJOA 3K96A 4DCSA 3L5OA 1ZX1A 2H59A 3LSTA 5SY6A 2WB4A 4YWHA 3WIOA 2APJA 1L1FA 4LK2A 4O29A 5LKRA 3HQ4O 3H97A 5PGMA 3TCNA 2DBYA 4DADA 4IV8A 4HVCA 5JS7A 3U1BA 2PLNA 4AM8A 1NXOA 2V3VA 2EBUA 2FCAA 5CVTA 1IVNA 5DSTA 1FFDA 1RR6A 2HLHA 2HO4A 1AGPA 2ORWA 4Q0MA 5ALKA 4URZR 3IYLW 2I6FA 2Y0PA 4XSGA 2Q27A 1PT5A 3VTAA 5A9TA 1RDFA 1T91A 1TRHA 1U2DA 3GPLA 2GK7A 3AW9A 1YU9A 2Q2NA 4DNOA 3UZUA 3AK4A 3B2EA 3OCXA 2C4UA 4H7DA 4CI9A 1C8LA 2GPWA 1JW9B 3INRA 5DHPA 1E3WB 1GGKA 4JC8A 5A9RA 2JLXA 2QTMA 1BVHA 1PD1A 3WV5A 1ZN9A 3L7IA 5D85A 4BUJA 2CXXA 1T8YA 3D8HA 1HWYA 2QZPA 1ZAKA 3LAWA 1GYPA 1T8SA 3QYAA 1IZ0A 4I99A 2D0IA 3CH5A 5U1PA 3RSSA 4KDFA 3LH5A 3HUEA 1TYZA 2ERCA 2WWVD 3WX0A 2GHIA 1DAGA 1XL0A 4UDOA 4AD8A 4GR9A 5AP9A 2O19A 4JAVC 1A2KC 1FK8A 3AJ8A 2QRJA 4NBTA 5KNLA 4PXYA 2DY1A 2IHZA 2WOOA 4NFYA 3QMPA 1LVGA 1QO9A 1T35A 3SKVA 4LF8B 3GLFA 2I6TA 3M5CA 4X3CA 5EXPA 5DULA 1KYYA 4F4DA 3R75A 4EGFA 1EVZA 4HN4B 4QRIA 4ZYYA 5KOHA 1N4DA 1EWRA 1KP3A 5DN9A 3BVPA 2ZM5A 1I7SB 5T57A 3BZUA 2V4UA 1Q83A 1YD7A 2VCYA 3DBLA 4UNIA 2VC2B 3NHFA 4XWTA 1CY7A 1K4MA 1MRZA 1NN0A 1RLJA 2FSUA 1J9GA 4WZ6A 4HUQA 3S8EA 1I5OA 2VRWA 4DUPA 2O54A 5AR1A 2CHGA 4QXMA 3TGLA 1RJEA 3BB1A 1M1ZA 2Y1WA 3QQPA 4M8IA 2JA1A 4J8PA 2GCEA 2NTJA 1VLHA 2WWHA 3IIIA 1XJCA 3M49A 3I37X 4FW8A 4U2FA 4KXNA 2JGAA 3WWEA 1ZCZA 4CCYB 4BIIA 1W94A 3NJRA 5DSZA 2NO5A 1SKYB 2D7DA 4ARSA 2GD1O 5CM8B 3IODA 1THZA 1GPNA 4WFIA 2P30A 4X41A 3N2KA 2PTGA 3GX1A 2IHBA 1V2GA 4XE5A 3WRWA 4BTLA 4ENRA 2HHHB 2G1PA 3QE2A 1P1IA 1KU6A 4XLTA 1ESZA 1ZD2P 4XJTA 4E07A 2BHTA 3OTQA 2HXSA 4U9IS 2BMWA 3N0XA 1I0ZA 1SXJB 3NRCA 4YGXB 4J7XA 1Y6FA 1ZAYA 1F06A 5BNFA 3OHSX 3B9PA 1WQ1R 5FOSA 1DDOA 5GWXA 5JNVA 1E3EA 2C3YA 3QLJA 1G3IA 3UAVA 2WD8A 2JLVA 2EXXA 2ZANA 1YZTA 2MSLA 5IBRA 3V7UA 2X2OA 4JI1B 5KNDA 1NLYA 1U1FA 3P9KA 4IOJA 1FMTA 4IXTA 4EJFA 1T3ZA 1T4CB 1V9SA 2ZIAA 1LLCA 3OE5A 3LUCA 3L4KA 1Y80A 4CMKA 1P75A 3EBPA 3GEBA 3AF3A 2YHIA 4S1PA 3FDFA 3QKTA 4Q19A 4CLRB 2XB2A 1T2CA 4Y6OA 1D6MA 5EFZA 4JT9A 3OMLA 3RSZA 3WK8A 3BS4A 3MT8A 1ODCA 1F2UA 5DYTA 1OLXA 4MKHA 4RIEA 3ZI4A 1PK9A 4FFLA 5LYYA 4P5DA 1ZJZA 5KSPA 4DSAA 4YRSA 5HKBA 1RWWA 1E64A 3GLTA 4H4CA 4D8YA 4WFQA 4RVNA 4GLLA 2ECFA 3KJEA 2WD9A 4ZT7A 5BN4B 5KWIA 1LTHR 5LP1A 2GA8A 3H3XA 4K9QA 1EVKA 3B48A 1N1GA 1QZUA 3L77A 4R2KA 5DNVA