2RBEA

The discovery of 2-anilinothiazolones as 11beta-hsd1 inhibitors
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
260
structure length
259
Chain Sequence
EEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title The discovery of 2-anilinothiazolones as 11beta-HSD1 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 94
structure length 259
sequence length 260
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2007-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2rbeA00
1OOEA 3D5TA 4W6ZA 2PZMA 3ZW8A 3RBVA 4CM9D 1E1KA 3WB9A 4A73A 1UXIA 1QYWA 4W9NC 3VPSA 1DFGA 3AY3A 3S1LA 4XYLA 2DVMA 3TQHA 3JQ8A 4XD2A 1ISMA 1VL0A 4BL5A 2F1KA 4Y6SA 3B1JA 3I23A 2ZCUA 3PXXA 4E5NA 1GR0A 1K6IA 4BGVA 2AEJA 1A27A 1P0FA 4MVJE 3N74A 1XSEA 3FTPA 1QV6A 4TWRA 5G4KA 1ULSA 4JIGA 5L9AA 3PHIA 3FBGA 3AFNA 4YRDA 4UUOA 3K2EA 2FZWA 5ES3A 2EERA 5IDWA 1IY8A 1MB4A 3KLPX 4F46A 1EQ2A 4UEOA 3T7EA 3ZW9A 3PQEA 2WDZA 4EDFA 4D42A 1B14A 4IIUA 1YOVA 4CODB 5I8WA 2D0IA 2PH3A 2HRBA 4ILKA 3UICA 2GO1A 3GG2A 2P2SA 3CIFA 4KTTE 4YT8A 2YDYA 4AJJA 1NP3A 1UXKA 2IYOA 1CJCA 2VT2A 4BO9A 4AJOA 3KEQA 1P1JA 3IL2A 2EP7A 3EVTA 4NR0A 1AGNA 4JBGA 2PK3A 4E6PA 4DYDA 5BQFA 2VWHA 2GUGA 1H2HA 3INRA 3R1IA 4GX0A 5CEJA 4A10A 1RYDA 4BO4A 4Y6PA 1HLDA 4B7XA 4IM7A 2V65A 4KUGA 4ZQGA 4J6FA 5A3VA 3VAZA 4TMFA 1AE1A 3F4LA 3ZU2A 1DIAA 2YV2A 1WP4A 1HL3A 1KS9A 4JP3A 9LDTA 1P45A 1B16A 1W0CA 2RAFA 2Q45A 1H0KA 4UVHA 2CNBA 1U8FO 1Y8RB 2Y0CA 2Y99A 3W4IA 2I76A 5KVCA 1B15A 3KTDA 4PLHA 3GVPA 4W9NA 2FSSA 1HDOA 1XLTA 2VYND 4QXMA 3UF0A 3B1FA 3K73O 1UP6A 3FCOA 4O63O 4Z9YA 1DBVO 5ICMA 4R68A 5CDUA 1B0AA 4OKNA 4OJNA 3GFBA 3UN1A 5IN5A 3AY6A 3BYZA 3EVNA 3OBBA 4IXWA 2NADA 1X15A 3LT2A 1C3VA 4RF2A 1RM5A 3PGJA 4IMPA 2CF6A 4M87A 4LK3A 3I9KA 1IHXA 1GQYA 1LRKA 2VCYA 5KJFA 3BMCB 5COAA 4D3SA 3A28A 4CM1A 4YCAA 1E7WA 4ND4A 4JQCA 4D79A 2EW2A 1BGVA 3VHRA 4FOSA 4Q3EA 3H9EO 1P1HA 5CDTA 3Q2IA 4HWKA 3ZV3A 5TGDA 3U3XA 1YBMA 2B83A 3L9WA 4WKGA 4W7HA 5K9ZA 4KUHA 2BH9A 2Q3EA 2X1HA 4NQZA 1DC5A 2BLLA 3D64A 4RF4A 3BHIA 3EAGA 4RF3A 2H1SA 1PGPA 5AYVA 1HDRA 1HEUA 4OL9A 2EF1A 4FB5A 5CAEA 1PS9A 3IKTA 5B4TA 3IJRA 3DR3A 1NNUA 4WLNA 2CDCA 3L77A 3HB4X 5TT1A 2C07A 1U3WA 3P2OA 2GYYA 4Q3BA 1Q7GA 2CMDA 1SB8A 2C5EA 2D5AA 4TVBA 5DBIA 2Y0EA 3ZGYA 5FF9A 4DQXA 4W4TA 4L0QA 3IS3A 2Q4EA 1W8DA 1EUZA 1QYCA 1H6AA 3FNGA 4HNGA 4IMRA 3HZZA 4J1TA 1UDBA 3AUUA 3WBFA 2ZB8A 2DTEA 2RHCA 4FFNA 5I9NA 1RJWA 2AMFA 2FY8A 3CINA 1BWSA 3I9OA 3SLGA 4CR7A 2NM0A 1T25A 4H3VA 1XU7A 3E9QA 1S7CA 4HADA 3WYCA 5ITWA 2Q2VA 4IJWA 4CV1A 2PLAA 5EINA 4YJHB 4BNWA 3GY0A 4WE3A 3UHAA 4CUJA 5DCWA 1AUPA 4JX8A 1I5RA 4Y67A 3B70A 1FDTA 3BTVA 4NBWA 3OJFA 4QO8A 3S2GA 3VZPA 3V1TC 3ZWMA 2WJPA 4PG5A 2ZTMA 4FC6A 4BNVA 1MG0A 1PU2A 2GNAA 1KC3A 1U7TA 1WLYA 2XPCA 5A05A 3DOCA 1NHWA 3AFMA 5K0ZA 2O7SA 2Z95A 3F47A 4QSMA 1UR5A 3ULKA 3BMNA 1X7GA 1JKJA 4YWJA 2B5WA 3UCFA 1VE9A 1GAEO 3L0DA 4JNKA 4RVHA 1NXQA 4R1SA 1MUUA 4DBVO 5C7OO 1DPGA 2VYVD 1ZNQO 3U49A 3E6AA 5JS6A 5GY7A 1GCUA 3ZN2A 1MC5A 4P4NA 2C54A 4G81A 1E7QA 2C7VA 2Q1WA 4E2XA 3JQ8B 5ILOA 5J23A 3CXRA 4BUCA 3AUAA 2C82A 2PKQO 3F46A 1HYGA 1KETA 5L51A 2B4QA 2VTDA 3WTBA 3NTOA 4K1LA 5I7EA 3DZFA 1FF9A 3AOEC 4MO2A 4RVUA 1A9YA 1DAOA 5JCJA 5TX7A 4D46A 4R3NA 3DHNA 3LSYA 3GHYA 1R4NA 2VHVA 4WLOA 1YBAA 3D4PA 1ZMOA 4J1SA 3V8BA 2EG9A 2PFGA 4ZJUA 1OI7A 1HZZA 1N7HA 3OF2A 5CDYA 5H82A 3PQFA 3JCZA 4R9SA 4ND3A 5FI3A 2JFHA 1NQ5A 3ETDA 4D44A 1ZEMA 4B8ZA 4E12A 3W6ZA 2JD0A 2FMUA 5HRUA 1QR6A 2R00A 4FPXA 3TZKA 5KVSA 2JJYA 2UDPA 3EC7A 4NIMA 4WEQA 1E1LA 1U5CA 3G3EA 4EYEA 1YL5A 1NWHA 2CVZA 1ZUD1 1PWXA 2B4TO 4R01A 4D41A 1YONA 4BOYA 1ZJZA 3G17A 1IYZA 5L53A 1E6EA 3Q3CA 5AXCA 3SLKA 4CM8A 4YRBA 3H9QA 2OUIA 1YB5A 2X5OA 2PZKA 4QTZA 2P9EA 2JFFA 4TROA 2DQ4A 2Y67A 3RC1A 5IJZA 3NGLA 4I8XA 2X58A 5ITVA 4Q9NA 1DIRA 1ARZA 2O3RA 1CDOA 1A71A 1PJ2A 4AJEA 4DREA 4INAA 3ZNQA 3KYDA 2NLOA 4NU6A 3WYBA 2G5CA 4DPLA 1XWFA 2PH5A 3TWOA 2HSDA 1JLLA 4GPD1 4R5MA 4WCDA 3QVWA 3RBXA 1DC3A 1ML3A 4GAEA 2NQTA 5IXSA 4YTEA 3HADA 5A9SA 3DBHA 2B69A 3I9NA 4KP7A 5T57A 3S2EA 1YDEA 5JLAA 3GDGA 3V5NA 4PLCA 1DFIA 3QW2A 4L4RA 1YS4A 3SJUA 4CQMA 5B1YA 2NTNA 1P77A 4RV9A 5TF4A 3FR7A 2G0TA 4MP6A 4Y9DA 4Z3KA 3WQQA 4A7PA 1EBUA 5HS4A 1JW9B 3HNPA 4PLZA 2IODA 3AOEA 4PG6A 3ROPA 3S55A 3F6YA 3G49A 4RVFA 3I83A 1CQJA 3GGOA 4NBTA 3IJPA 1X0XA 2BHLA 2VTEA 1FDWA 2J5QA 1PJ4A 4FDAA 2EHDA 4XWYA 1Q0LA 4N18A 1TEHA 3G1UA 1JKIA 2I3AA 2BFPA 1GQQA 3IIEA 2WYUA 4JXKA 1C1DB 3CE6A 3BHMA 2JHGA 1UXGA 4B8WA 1E3WB 3DMTC 1K89A 5KJEA 4D3FA 4XDZA 5A9RA 1GADO 1ADCA 2D1YA 3F5QA 3QWAA 2ET6A 1QSGA 1LUAA 3FSRA 4W99A 5FI5A 1KEWA 4WOJA 5KJ6A 2CZCA 3M1LA 1OMOA 2X9VA 4MVJA 3U4HA 3PDJA 3FHLA 3MOIA 1G0NA 4MVJD 4NJOA 1IL0A 1GPJA 2BGKA 1ZSNA 4MKZA 1Y1PA 4Y6RA 5EPOA 1NTOA 4O1MA 4LCJA 2EV9A 3GMDA 4Z0TA 4BNZA 3IP1A 2Q1TA 1U7HA 1M67A 5EQFA 4GSKA 1C14A 3RC2A 2FN7A 4ALLA 2VOEA 4IQGA 1UXHA 1PTJA 1SC6A 1G0OA 1GYQA 2O7QA 1PJTA 1ISJA 2ZATA 3PVZA 4J1NA 3L6EA 4M1QA 1C0LA 1YH3A 2RHRA 4QT0A 5TJ9A 3RUIA 4ZRNA 4NU5A 2J3JA 3Q9NA 2D3TA 1T1RA 1R0LA 2B36A 4GLLA 1OFGA 1X7DA 1CYDA 3ZH2A 3RC7A 1K0UA 4YJFB 4GI2A 3ZHBA 5IZCC 3H2ZA 4M49A 5IDYA 3VPXA 2NVBA 1EFKA 2GZ1A 3GF4A 1VC2A 1V3VA 4JJGA 1ZK3A 1V0JA 3OJ0A 2W2KA 3F4BA 1UJMA 3MEQA 1LSJA 2VNAA 3ONFA 1LSUA 1BG6A 3A14A 3JYQA 1U28A 1ADGA 1EQUA 1XU9A 3W1VA 5BNFA 2AQHA 1R66A 2C20A 4ZU3A 3S8MA 2VT3A 2H5LA 1G6KA 1ZIDA 4BKRA 2VHYA 1PQPA 4CV3A 1LDYA 4FGWA 4FN4A 5I9MA 1I0ZA 3RD5A 1SO8A 4K6FA 2EGHA 4E13A 3LK7A 1TT7A 4FSHA 4ZGWA 5B4UA 3C7DB 4RQTA 3ZZNA 4CM4A 3V2HA 2IRWA 3LDHA 4OHUA 4FW8A 1IB6A 4KTVE 3PP8A 3DFUA 4NNJA 1ZSYA 2ZIZA 1WZEA 4ALJA 5JPIA 3VTZA 4OKIA 1XKQA 1KEUA 1GEEA 1T4DA 4BMVA 2O23A 1PJLA 3GAFA 1H94A 4IJUA 1VRWA 3PEFA 1H9BA 2OBNA 3OM9A 1NR7A 4QEDA 1KIFA 3CSDA 5I7VA 1ZVMA 3HE3A 3CEAA 4XA8A 3JD3A 3VDRA 3UGKA 4AG3A 3KXDA 4MVJF 1HZJA 5BSHA 4RVGA 3BMQA 4TSKA 4FD3A 4F3YA 3HQ4O 1PL7A 4RVSA 4F45A 2ZYGA 4RJTA 3NT4A 4J1QA 4DXHA 3NX4A 1XHLA 1DXYA 4MP8A 2NQ8A 2DFDA 1GY8A 2NV6A 4HFRA 4TQGA 3M2TA 4CUKA 2I67A 4RCVA 4PLYA 4E3ZA 1N9GA 4GKBA 3H4VA 1V9LA 2GZ3A 1JTVA 4QUKA 4XKJA 4LISA 3K6JA 4NK5A 5JNLA 3ZWAA 2QZZA 3PJFA 3EYWA 4BNLA 4KDEA 2HDHA 3U09A 2EWMA 3OQBA 1T2AA 4CM8B 1KVQA 1LA2A 2NSDA 2C0CA 2NTJA 4XZ3A 2WEKA 1BXGB 4A03A 5JAZA 4ZD6A 2HK9A 2YV1A 4Z3DA 4CLDA 4D3DA 1E5LA 2PGJA 4BKQA 4BO2A 5A1TA 2BI8A 1ZZEA 3GVXA 3H5RA 2NU8A 1NM5A 4NJMB 2J3KA 2O4CA 2BI7A 3C7CB 1M6HA 3VZQA 3QWFA 1TT5B 3ETGA 5A9SB 2FRDA 3PPIA 5B4VA 4I9HA 3ZV6A 1ZEJA 3H3FA 3ROKA 1P1KA 2H6EA 3C85A 3ON5A 3FR8A 1MP0A 2P91A 1UZMA 3GZ4A 3NYWA 1HT0A 5IG2A 1I8TA 3C3XA 3VZRA 1KERA 4HX5A 4UUNA 4D43A 1VLLA 3Q11A 1E92A 3ZCXA 3ENKA 4R1TA 4UUPA 3DZKA 3PTZA 3PFWO 4H16A 5G0WA 4AVYA 3WICA 4BO3A 4GWGA 1Q0QA 4CV0A 2AQKA 1LLUA 1DLJA 1O94A 2UVDA 2PA3A 3PK0A 4N5MA 1J6UA 1HLPA 3WSVA 4UULA 1ZKMA 1P44A 2FP4A 2DT5A 2QX7A 1AXEA 3GHHA 1GUFA 3E82A 1LC0A 5JDCA 1PJBA 4OXNA 3GK3A 3P7MA 4ROSA 2Q46A 4EJ6A 4J90A 1CQIA 4L73A 5F1OA 3PHJA 2WD7B 3ZHZA 3DZJA 4D45A 1WVGA 4IJKA 4LVUA 3DTTA 2V6MA 4GGPA 4Q3DA 2LDBA 3PLRA 4E21A 5A03A 1HE5A 1LX6A 4BNYA 3DWFA 1GPDG 3EMKA 4YAJA 4RVDA 1O5IA 4LW8A 5I7SA 1L1FA 2X0JA 5IZ4A 2HJRA 3PHLA 1OZAA 1Q2XA 2GGSA 2OOSA 3BZUA 4TZTA 5G0TA 2GERA 4FFOA 4PVDA 4WK6A 5T67A 4NFYA 4PLPA 4UREA 3VH2A 1DFHA 1SBYA 5DF1A 2AQIA 4ID9A 3AU9A 4C7JA 2HU2A 5H81A 5JC1A 4CM9A 2YV3A 4AL4A 1ZSVA 1YVEI 3HG7A 3IUSA 4DIOA 1HWYA 4YA6A 3C24A 3AI3A 4BQRA 3AWDA 3H9JA 1VL6A 2P68A 1RM4A 3IP3A 5JY1A 3CMCO 1F14A 1YQXA 4JN6B 3IDSA 4IGFA 5DBGA 4HUJA 4CMIB 4JJFA 1PEDA 3GVHA 4TRJA 1IE3A 2VWPA 2X4GA 5A3JA 2ZB3A 2YHIB 1E3IA 4UVIA 3GH3A 3A4VA 3JYNA 5DCUA 5I7FA 3NRCA 2I99A 1DC4A 4Z0PA 1Z7BA 4MVJP 3SEFA 3D3WA 1GEGA 3CH6A 1GFSA 1IUKA 4OO3A 5KWEA 2C5AA 2P5YA 2GN9A 3LVFO 1WZIA 3H9UA 4IGEA 4IINA 4FOOA 3LLSA 2X7HA 2WTBA 4FIZA 4B3JA 3ROMA 4MVJI 4BV8A 3D4NA 1WWKA 3B6ZA 4DYVA 1Z6ZA 1I2ZA 3GLQA 4WCFA 3MJEA 3N58A 5GZ1A 5L7YA 5BNIA 2I3GA 3PRJA 4Y98A 3WGIA 1PJQA 3FWNA 1F0YA 1CWUA 1NQAO 4IY1A 4R51A 1M6WA 3HFSA 2ZJ1A 2X22A 4EEZA 3WGGA 3BA1A 3LZ6A 1Y6JA 3L07A 4CL8A 3QLJA 3NTRA 2E82A 5IN4A 1C0IA 4LSMA 3WNVA 4HXYA 2FPPA 1TLTA 1Y5RA 4KOAA 1DAPA 1D1SA 4GLOA 3SXPA 5L45A 1LC3A 2Y1FA 3RVDA 1C1XA 2UYYA 4KWHA 4M55A 1GQ2A 3DQPA 1HF3A 3DZBA 5H83A 5JAIA 4QECA 4IZHA 1FDVA 1JVBA 2AG8A 2E48A 2E6UX 1XDWA 1W6UA 3HN7A 1IZ0A 3AM3A 2DM6A 3H65A 4G2NA 3WWZA 4HFJA 4FFPA 3DEYX 5MDHA 3A06A 1U3VA 4OXYA 1E3JA 2VYNA 3PDUA 3MZ0A 4BB6A 3TZHA 3MJCA 4AJLA 4BMNA 1Q7BA 4CMEC 1N9GB 3RASA 1PL6A 3I9LA 4CLRB 2NVUA 1DO8A 1B2LA 1V3UA 5JO9A 1ENOA 1HDYA 3SJ7A 3D3EA 4A5OA 3I52A 4DGSA 2W2LD 1W73A 4Z0HO 4BNUA 2LDXA 1ENYA 2AXQA 5CDGA 1LDEA 1ISHA 3IKVA 4ZVVA 1DRWA 4XB2A 4YR9A 4GVLA 3KOUA 3TNLA 1LRLA 2Y1CA 2GN4A 3PGXA 1WPQA 3WGYA 3L6OO 4EUEA 1XYGA 2OGUA 3QP9A 2I5PO 3I3OA 3QHAA 5EL0A 4AFNA 4CM5A 1TXGA 4R41A 3V1YA 3HFGA 2IEDA 2Y93A 2Z1MA 1Y9EA 4I5GA 3QSGA 3JSAA 4X54A 2H63A 2W4QA 3HHPA 2OHXA 1NX6A 1X0VA 4NG5A 2DUWA 1ENZA 3HB5X 3QQPA 3RU7A 4R1NA 3RUAA 3DHEA 4P22A 1ZXLA 4QFDA 3FPLA 1ENPA 2J3IA 3K2BA 4CM3A 2BFOA 4EW6A 2QYSA 1E3LA 1QYXA 1Z74A 5EMHA 4DLLA 3G1TA 4CLEA 4EBFA 3FN4A 4XIJA 3JD1A 2V6FA 2ZQZA 5F5NA 3RROA 1MLDA 3H8VA 1PZFA 3JTMA 4Q3AA 5JXWA 4JGBA 4EI2A 3WGZA 4PG4A 4RPLA 2CVQA 3EHEA 4U6QA 3JQ7A 3EZYA 3KO8A 2O3UA 3K9QO 3S2IA 1LNQA 4YJGA 4IDBA 4H15A 5TT0A 1Y9AA 2UUOA 1HE3A 4XGKA 3WLFA 3N7UA 4R4JA 2R00C 4NBVA 1JAYA 1AHIA 3CPSA 2POQX 9LDBA 3GUCA 3GEMA 3PWZA 1ADFA 3EDMA 4YRAA 1BDMA 1MXFA 5F1KA 1Y7TA 1XQ1A 8ADHA 2HMUA 2C29D 1BW9A 2XOXA 2YYYA 4CMEA 1YJQA 1ID1A 1PGOA 1XELA 1R0SA 1DOHA 1SAYA 1X7HA 3L9XA 3JQAB 3WMWA 3ZV4A 4RPKA 1H93A 3QWBA 4ALMA 4BNXA 1F12A 5HBRA 3RUHA 3RFXA 4KQWA 3A1NA 5IAAA 1LDMA 3E8XA 3ZWYA 3TOXA 2AG5A 3NT5A 4OSPA 3OFSA 5B37A 3RAJA 1LEHA 2PWZA 3QVTA 1M75A 2JCYA 3CZMA 4RDHA 1Y81A 4TZKA 4ND2A 2AEMA 2DBZA 3QA9A 3OEYA 3W4JA 4E5PA 3BMOA 4OIMA 2VYVA 5ER6A 1X1TA 5DOVA 3CTMA 1OC4A 3E18A 2Y0DA 1HDCA 5A06A 3BHJA 3Q6IA 1EMDA 5KTKA 1E77A 1ZFNA 2JCXA 3KV3O 2GN6A 3EY4A 4A2CA 5BSFA 2VWGA 5L4NA 3LQFA 4E2WA 1JDJA 1JWAB 3ABIA 4FFMA 2FR1A 4O59O 1WAMA 2P9CA 3WIDA 1IULA 2OP0A 3M1AA 3ITKA 3GQVA 4MINA 3R3JA 4GVXA 4FS3A 3WJAA 4KQXA 2CVOA 3DBVO 3I1JA 3ANMA 4XQCA 3GRPA 4CL3A 1P33A 2VRCD 4KMSA 5G4KB 1T4BA 4YBZA 3DBRA 2YFHA 3D3WB 1V35A 2AEFA 4UUMA 2BGMA 3JQ9A 4DRYA 2BELA 3DAGA 4CR8A 2GDZA 2HK7A 4IQ8A 4GX2A 1GU7A 2A4KA 2HMTA 3MOGA 4WOKA 3PLNA 4BQPA 4RPJA 1BTOA 2PV7A 2VUUA 3GR6A 1YOVB 2QYTA 1B8VA 2OXIA 1JVSA 3OQ6A 5IDXA 3FI9A 3ETEA 3JD0A 4YJDA 5HWSA 1UDCA 1RM3A 4XDYA 4MOWA 1O89A 3GEDA 3GNTA 3H5AA 4ZQHA 3OA0A 3ZU3A 4DBZA 4BNKA 1VSVA 3IOYA 1GYPA 1EEHA 2TMGA 1LRJA 3UH1A 4KWIA 4PZCA 5EESA 1WDKA 1EK6A 2Q1UA 4U0JA 3PZRA 3HDYA 4RLHA 3VPFA 3Q2KA 4ZHSA 2D4AA 4BNGA 3ONEA 1EK5A 1EUDA 1K2WA 1U1IA 4YB8A 3JQBC 3WS7A 2CSUA 3ONDA 4E33A 1ORRA 1GCOA 2IXBA 3DONA 4XYGA 4XB1A 2JKVA 3DB2A 4PVCA 1PR9A 4IDAA 4WLFA 4RPHA 2DBVO 2HLPA 4J91A 2CD9A 2AE1A 1YRLA 2GSDA 3WBBA 5L7TA 1HRDA 5FYDA 5DDIP 3RUEA 2Q2QA 2BGLA 3W8EA 3ZNNA 2FPIA 3RIHA 3KYBA 3BIOA 2NVWA 5CPBA 3FNEA 1O95A 3RCBA 1DRUA 1RKXA 5AOVA 1SB9A 4DIBA 1Y8QA 2P4QA 1MV8A 4TKLA 1UAYA 3RU9A 2BF7A 2C59A 1U3UA 5A04A 1NQOA 1LXCA 4U8GA 3JQGA 1VM6A 3GG9A 4FJ0A 4GGOA 4QQRA 4ZQEA 3TDKA 5L7WA 1LU9A 3EGOA 1QP8A 2Q49A 4CMBA 4YXFA 1V8BA 2OMEA 4EJ0A 2X23A 4YQYA 3RKUA 1P9LA 3R0IA 1JA9A 2NVUB 4BNMA 1PJSA 2X0IA 5BT9A 6ADHA 2B35A 1C0PA 3FRJA 1FMCA 1LQTA 3G0OA 3F9IA 4BNFA 1SEVA 3WMXA 4WPGA 2X5KO 3WX0A 3NT2A 1WDLA 3L4BA 1LI4A 2HMSA 5DP2A 4BO7A 3PFFA 4J9UE 3OIDA 2DFVA 1EDOA 1R12A 4OSOA 4PZEA 4RORA 5LC1A 1YL6A 1X1EA 5KVQA 3AY7A 4U6SA 5LDHA 1PX0A 2E4AA 4R69A 5COQA 1Z7EA 1UZLA 2JD2A 4NZ9A 4W82A 1KVTA 4ESOA 2VN8A 1M76A 3GPDG 1R4MA 2ZTUA 2I66A 4WJZA 4OAQA 3ZU4A 1N5DA 5DT9A 2P5UA 4II3A 1O9BA 4BMSA 5DBFA 1A9ZA 3JQBA 4JBHA 4M54A 3H7AA 4MVJM 4XQEA 3L4SO 1K6XA 1X13A 4IIVA 1LSOA 4GWKA 3DOOA 1NASA 1P31A 2ZYDA 4GQAA 4UVDA 3WIEA 3DTYA 2Y68A 3TZCA 1ZK4A 1ADBA 2BRUA 2TMDA 4U7WA 3E9NA 3FBTA 2QRLA 1IPFA 5TRTA 3MWEB 1NFQA 3WDSA 4OQYA 1N7GA 1CF2O 2CDBA 2JAHA 2GLXA 4G65A 4B7CA 4J2HA 4DWVA 5K6AA 3JYPA 1BXKA 3QVSA 1XEAA 4M8SA 1H9AA 2XXBA 2E49A 3ASUA 1LTHR 4NI5A 1I10A 2OFPA 3PI7A 2AHRA 3SC6A 1BW9B 2PZLA 1IPEA 2JD1A 4JBIA 3DMYA 2PD4A 3UKOA 1D3AA 4BO0A 1DIGA 3QWHA 4IS3A 2B37A 1T2EA 5TS3A 4YT5A 1I3NA 1ISIA 2I9PA 3ZWVA 5HS6A 2IZ0A 1E1NA 3BMNB 4LN1A 4OYRA 3KBOA 2EJVA 2PTGA 4CV2A 1KEVA 1YWGO 4WEOA 1RWBA 1I01A 2EJWA 2VUSA 4XQ9A 3CKYA 4K28A 2GF2A 4PIVA 3KHUA 1T2CA 2HAEA 3GC6A 1VI2A 5C7LO 2YW9A 1P1IA 2DU8A 5EN4A 1QG6A 5JFOA 4NDNE 1BHSA 3RBZA 1KVUA 5A9TA 1DIBA 4NBUA 2XXJA 1WMBA 1GV0A 4AJ2A 4DQVA 4MIEA 5T8KA 1U8XX 3GMSA 1ULUA 4YAIA 1NPYA 3O9ZA 3GUYA 2X9NA 4GBJA 1E0DA 2QHXA 4E2YA 4RZHA 4CLHA 4IBOA 3EK2A 3G79A 2J8ZA 1VSUA 5JDIA 1B7GO 3T4EA 1VJTA 4NHEA 4HP8A 2HKIA 1BMDA 1R4NB 1YDWA 1XQ6A 2A92A 2YQ5A 4EGFA 2O2YA 3I4CA 3IAHA 3NDIA 5EJ2A 1U9JA 4J7XA 2YQ4A 2VZ8A 4PRKA 1NQTA 5JDCC 3DFZA 2CFCA 1C0KA 2AA3A 4JP2A 4KUEA 5AXDA 5TQVA 3VDQA 1HE2A 1YE3A 1Z82A 1ONNA 1ISFA 2O50A 5C37A 3AUSA 4CMGA 1JKFA 2A35A 4BS9A 3DXFA 2PGLA 1HXHA 1DJQA 4I5DA 3SC4A 3GNQA 4UVGA 1PGNA 4D0SA 1G1AA 3IUPA 4FFRA 2J6IA 1V3TA 1Y8RA 1B3BA 2PKQP 4E31A 2HMVA 3BTOA 3ICCA 1O8CA 3WG9A 4E32A 1TVEA 4J0EA 7ADHA 4DL9A 2HQ1A 4NBRA 1YO6A 3E5RA 4Q39A 3FNHA 3OQ1A 4NFHA 1PR3A 5IF3A 1QLJA 3PJEA 4S3MA 2VNSA 4BVAA 4J4TA 2HJSA 4CM6A 2V6GA 2WWRA 3KYDB 4XR9A 1FJHA 3ZDFA 5HA5A 4MKRA 1P74A 4MVJH 3QV1A 1T2FA 5G4LA 2WM3A 4ZICA 3DBHB 3JQDA 2R2GA 3BMCA 3VKUA 4MP3A 3AU8A 3OJLA 2IZZA 4PLVA 3LC7O 5CDSA 4CQMB 2EGGA 3C8MA 4PCVA 5KJCA 4ONEA 1NHGA 4PGFA 1EFLA 1JWBB 2GASA 3ZWBA 4WNCA 1ISGA 4R9RA 3U5TA 1U5AA 3WOHA 4E5KA 1NVTA 3RSHA 5JY6A 2Y1GA 1ZXBA 1KYQA 2DPGA 3IQDB 3TFOA 3ZU5A 4DA9A 1I24A 1YL7A 3ANLA 4B7UA 4K6CA 3E5MA 1NAHA 2D59A 3MJSA 3VPGA 4DUPA 3HDQA 1KY4A 5ER9A 4CUZA 4BGIA 4O0LA 1DSSG 1YJ8A 3K31A 1PZGA 3DDNA 4WCFC 3H6KA 3K30A 5A02A 5C3MA 1ONOA 2YZ7A 4CLOA 4J16A 4OM8A 1MC4A 2AW5A 2VZ0A 2EKQA 2X86A 1F8GA 3RJ5A 5CFZA 1EBFA 2NUAA 5JYEA 4XJSA 2PD3A 4DLAA 5TJHA 1R16A 5AXAA 3JQ6A 2PKRA 1VKOA 4TRRA 1R4MB 3W8DA 2RCYA 1PSDA 4ZN6A 1E7SA 5F3RA 2J5RA 3K8ZA 1SPXA 1EZ4A 3M6IA 4AJ4A 4Z6KA 4NK4A 5AQ1A 3NEPX 1T26A 3RI3A 4B4WA 2OZPA 4RO0A 1PGQA 4BO1A 3OEWA 4J49A 1HKUA 5EIOA 3LT0A 4FBGA 1XA0A 3AOGA 1E7MA 1K6JA 3WXBA 1A7AA 4LRSB 2ZK7A 3WTCA 3DO5A 1ZCJA 1GZ3A 2O3TA 3MTGA 2WSBA 5L4SA 3LU1A 3Q1LA 4ZQFA 1OC2A 3E03A 4MPDA 3BAZA 2RBEA 3OETA 3C7AA 4BNIA 5HM8A 1DHRA 2OORA 1GD1O 3PJGA 2HCTA 4GMGA 1FK8A 3HWRA 3JV7A 4GMFA 1NVMB 2VRBA 4BIIA 4N54A 4RGBA 2EP5A 1A72A 2FWMX 3ADPA 2VHZA 2I65A 3Q0EA 5L4LA 1UP7A 2W2KB 3PQDA 3VVBA 2SCUA 3HUDA 2WE7A 3ITDA 4GL4A 4OOEA 2ZB4A 4JJIA 4MIOA 1SEPA 4RF5A 3W8FA 1H2BA 2DLDA 4YQZA 3UCXA 2ILTA 5FFFA 5DZSA 1U4SA 4AJNA 1JN0A 3PWKA 3UW3A 1KEPA 2IXAA 4FJ1A 1Z75A 1BVRA 2NU7A 2IYPA 1VKNA 3X2FA 1CEQA 4OGWA 1XCBA 4RDIA 4BV9A 4P4LA 4ZA2A 4HNHA 3ZV5A 4UEJA 1A4UA 4CM4B 1EE2A 1HE4A 5AVOA 3E1KA 2PZJA 3JQCA 4BNHA 4MJLA 4C7KA 2FOIA 4L9RA 5F21A 4LGVA 4XEHA 3WFIA 3I9JA 1T2DA 3GN2A 4DIFA 3TRIA 3WQRA 4YYZA 1LLCA 2BMAA 2FHSA 4UAGA 2PGDA 3D1LA 3OECA 3VPHA 3D4OA 4BB5A 3GPIA 5ICSA 3HDHA 5F5LA 4CMAA 1FXSA 3WFJA 3D0OA 1GUYA 5AXBA 2ZJ0A 3O26A 3D7LA 1P1FA 1LJ8A 2X6TA 1HDZA 1M66A 2BKAA 4UEKA 3AK4A 4FR5A 3K96A 4ND5A 1B26A 5L3ZA 4IPTA 5KNLA 1D4FA 2DTXA 3V2GA 3BMQB 1QXSA 1J0XO 4I1IA 5CEFA 3UXYA 3ZWOA 2QRJA 3ZNPA 1VPDA 1K3TA 4YVFA 3RJ9A 1YXMA 4PG8A 1ZK0A 5JMWA 4E2ZA 5L40A 4IDEA 3FNFA 2CDAA 3WGQA 2YY7A 3QWIA 1J49A 1UUFA 2IEBA 4HBGA 1PJ3A 3ANNA 1AXGA 1JQBA 4DPKA 1DLIA 3DZHA 4URFA 3T7CA 4AICA 3CUKA 1MXHA 2W2LA 4XGNA 3GRKA 2P4HX 3JQFC 4Z9XA 3WR5A 4XX0A 3GT0A 4N5LA 3SVTA 5T5QA 3WGHA 4BGUA 1DJNA 3K5PA 4F6LA 3QIVA 3RUFA 4A27A 1P3DA 1J5PA 3QVOA 3T4XA 1BRMA 1EUCA 3B1KA 1GL3A 4AJIA 4K26A 1MGOA 5GZ6A 1QV7A 1JU9A 7MDHA 2DUUA 1YGYA 3FTNA 2OP1A 2PR2A 4HKTA 3LT4A 2Z5LA 5I9LA 4I5FA 2X9GA 4OXKA 5ENVA 3VKVA 4E5YA 3MJTA 5JC8A 1D1TA 3ENNA 3KLMX 4BKOA 4EUFA 4J43A 5CP8A 1HTBA 2IDZA 4ALIA 1C1DA 2VOJA 2C2YA 2FR0A 3H5NA 3H2SA 4DLBA 1SCUA 1E3WA 5G0UA 4XYMA 4TRMA 4J7CA 3F1KA 2P9GA 1GDHA 1Q1NA 2OBYA 2EEZA 4GX1A 4EJMA 5FEUA 3NAQA 1EDZA 1U3TA 2J3HA 2Y1EA 5ENDA 3OMLA 1B8PA 4XYBA 3KRTA 4A26A 5BSGA 3Q9UA 1I3MA 4CJXA 3JQ9C 4LRTB 3UVEA 2HRZA 3FWZA 1A7KA 3MCVA 5THKA 1K5HA 3NJ4A 2GN8A 5JO0A 3KM0A 2ZYAA 3NKLA 5JW6A 1R0KA 1LQUA 5JSFA 2X0NA 1R37A 2VHXA 3VH3A 4CLOB 5FWNA 5CPFA 1E3EA 1PJCA 3EW7A 3NDJA 3ZHXA 1MFPA 3HDJA 3RFVA 1B3RA 3WJ7A 5KIAA 1MA0A 4XR4A 3LC1O 4P38A 5MGBA 1P0CA 4B4UA 5DULA 4L4SA 4ALKA 1A5ZA 4O6VA 3WLEA 1UP4A 4PLGA 3W4KA 2O3SA 4CPDA 2X5JO 1H6BA 1KVSA 2DPHA 2D8AA 3JQFA 4J3FA 4PN3A 3FD8A 4FC7A 4YJFA 5KKAA 4IXTA 2BFAA 2JL1A 4JCOA 2EW8A 1EVIA 2JAPA 2DKNA 1UZNA 1HDXA 1VJ1A 2VHWA 4CMCA 4EZBA 3GN1A 4XCVA 4XQGA 4WECA 4CMKA 2ZKLA 1AHHA 1GUZA 3TN7A 3KVOA 3ZHYA 2I6TA 3MJ4A 4D7AA 2VQ3A 3AM5A 2B5VA 5KKCA 2IE0A 3ZNOA 3RQSA 3P5SA 2WD8A 3OH8A 4YAGA 3O8QA 1UXJA 2FSVA 3QVXA 3VH1A 1ZMTA 4QFCA 4XIYA 4J2OA 4N7RA 5KJ1A 5HTOA 1XGKA 5ADHA 1DRVA 2G1UA 4E30A 1L7EA 8LDHA 2W90A 3GVIA 4JROA 4CQLA 3PZBA 5TNXA 3NUGA 4GSLA 3RFTA 1EE9A 3GOHA 1UH5A 4IDDA 1GZ6A 1F8FA 3EZLA 3BXXA 4WUVA 1DB3A 1LDGA 2YUTA 3P19A 4WLEA 4DC0A 4DC1A 1XG5A 2JFGA 3WYEA 4WLVA 2VZ9A 3TF5A 3K92A 3UAGA 5IDQA 4UVEA 4QX6A 4LMPA 2Y05A 2QW8A 1MFZA 2Y66A 2VRCA 4HY3A 2Q4BA 3AI1A 4XRGA 3I9MA 4CMHA 1N1EA 1NFRA 3GFGA 4Q3NA 5THQA 4MKXA 1IZ9A 5TSDA 1E3SA 5BSEA 3L4BC 3HSKA 4II2A 4YPOA 1Q7CA 2IZ1A 1PS8A 1PWZA 1KC1A 3GVCA 3E48A 2Q99A 2QRKA 2R6JA 5JYDA 4Y8VA 4E0BA 4LVCA 3GA0A 3U4DA 4J4HA 4EEXA 2ZCVA 4H7PA 1E6WA 2YJZA 4WCFB 4IDCA 5JCJD 5KCZA 3QRWA 1QORA 1HETA 5TC4A 1NVGA 1HYEA 1WMAA 3P2YA 2NTVA 3KB6A 4O5OA 5JBIA 4BO6A 1YBVA 1I2CA 3WSWA 3L6DA 1NWCA 2UUPA 5DP1A 2HMWA 5G0VA 4IDFA 3TZQA 1WNTA 1BVUA 4OOFA 3O38A 1YQDA 4FGSA 4D0RA 1QRRA 4J0FA 4ND1A 3ZWNA 2WE8A 4YT4A 2D2IA 2UAGA 3MTJA 3LLVA 4NFSA 4CLXA 5I8ZA 4NPCA 3TSCA 3U62A 1LSSA 1C1XB 2YFQA 2QIOA 3V2UA 4CR6A 4P8RA 3ZI0A 3OIFA 4GKVA 1HSOA 3AUTA 3H3JA 5B12A 4B4OA 2NNLD 3R6DA 3F1LA 2V7PA 1E7YA 5K6AC 4IJVA 2CY0A 1BXGA 4FQ8A 1LLDA 1U2GA 1TI7A 4M89A 4F6CA 3PWSA 1A4IA 2W8ZA 2J5KA 3GNSA 4B3IA 4PLTA 1R6DA 3RKRA 1DHTA 3PYMA 2X0RA 1QLHA 4L4XA 3TFQA 1PQWA 4BHTA 4NJMA 3X2EA 1LBEA 4A0SA 1N2SA 1Z45A 2Y1DA 3I6IA 1V6AA 5JAQA 2WYWA 3ZWXA 2NU9A 2YDXA 4J4BA 1TT5A 3NJ8A 2C7GA 2ZTLA 3CZRA 2C2XA 5A5FA 3JD4A 3OJOA 2NU6A 2YHUA 4R3WA 5KOIA 1DEHA 1O0SA 3C1AA 5A5EA 1PS0A 3PYXA 4CQMD 1P1RA 4PLFA 1N92A 1YB1A 2XAAA 3VH4A 2EXXA 5EQDA 4IUYA 3QY9A 3PIIA 1U2DA 2PY6A 1ZBQA 3JD2A 2E37A 3KSUA 1DIHA 4LSWA 4ITUA 5T6BA 1YKFA 2BFMA 3OJEA 1SOWA 3W6UA 1UAGA 2DBRA 4FJ2A 4BNNA 5CG1A 2QQ5A 1DC6A 2Y1OA 3OICA 1IOLA 4GH5A 4L74A 3GAZA 2O48X 2DBQA 4NH4A 1ZO8A 5T8KC 4R5HA 1KBZA 4EITA 2FPGA 3GZNA 4XRRA 4N5NA 2Q50A 4RLSA 4WLUA 5EERA 3DAFA 1SZJG 4MIYA 1L7DA 3V1UA 1ZH8A 3LT1A 4XGIA 4DTIA 3KEOA 5JDIC 4IZIA 2WD7A 3UFXA 2EIHA 4R16A 1YB4A 2G82A 2OO5A 4TRNA 2Q1SA 3SX2A 3JYLA 3DBLA 3STHA 3KETA 2VUTA 5G0SA 3TL3A 1QYDA 3GEGA 4ZRMA 1TB4A 1Q0HA 1GV1A 3AW9A 4PG7A 2Q2WA 4PFJA 3HJAA 1HSZA 3I4FA 3MWDB 5T64A 1E1MA 3KYCA 3NDRA 5U4QA 1VJ0A 5U9CA 3JQ7B 3PYLA 4LCEA 3AJRA 4YJGB 1PZHA 4W7IA 4J7UA 4WGGA 3PHGA 3TPCA 5JMPA 1UDAA 1I3LA 4PRLA 5KVVA 3PIDA 1MG5A 2Z1NA 3WQSB 1OBFO 1WXDA 1Z73A 3UOGA 3VVCA 4MDHA 3E9MA 2JHFA 4YAEA 1VL8A 2V6BA 3VOSA 5IFLA 3VZSA 1FDSA 2A9FA 4ZQBA 1OAAA 1J4AA 4RZIA 1NR1A 4AJPA 3TJRA 4OH1A 3VC7A 1EVYA 1JAXA 2WMDA 5LCXA 1PIWA 1I36A 2DTDA 3KUXA 1NPDA 4L76A 4CMIA 4C4OA 1MX3A 1TA4A 1PZEA 2G17A 3FF4A 3KZVA 1SMKA 2XF8A 1H6DA 3NV9A 1H5QA 3DOJA 1BXZA 2DAPA 2EKPA 1F17A 2O2SA 4S1VA 4BGEA 2D5CA 4PZDA 2YHIA 4P4GA 4BNJA 3PJDA 1PGJA 1RYEA 3BMOB 1CETA 4TVOA 4HFMA 3GGGA 3O8QB 4FFLA 2B4RO 2GR9A 3LF2A 1D7OA 3LYLA 1T24A 4DMMA 3ST7A 2AE2A 3WWYA 4YAKA 4CQLB 2GPTA 3SBOA 5BNTA 1R15A 4G5HA 3LC2O 1ZK1A 1E7RA 2EKLA 2VWQA 2ZTVA 2GZ2A 3DMTA 3R3SA 3DHYA 1N8KA 4L8VA 4DQUA 4WASA 3JYOA 3M2PA 3C1TA 4WNIA 3HN2A 4YEDA 4XJTA 3DBRB 5GMOA 6LDHA 3JQEA 4RQUA 4BKPA 2ZQYA 1HYHA 5JAMA 4IDGA 1EVJA 3U9LA 3U4IA 2PD6A 4GX5A 1NPTO 2FR8A 4L75A 1BDBA 4BO5A 5JCXA 1LLQA 3NGXA 4BNTA 3A9WA 1ZJYA 4M86A 1HDGO 1KOLA 3ORFA 2QZ9A 3ADOA 3OP4A 4E4YA 1T1SA 3GDFA 4PLWA 3LF1A 2HO5A 4U5QA 4YDRA 3OSUA 4OMUA 3AM4A 3DC2A 4Q3CA 3NTQA 3OHSX 2AQ8A 2B0JA 4CMJA 1BSVA 5BR7A 3ZWWA 2UV8A 1EVZA 1QYVA 3U4CA 5LDGA 2NACA 2CF5A 1LDBA 1NAIA 5IZCA 1PL8A 5F1PA 1H6CA 2G76A 3F3SA 3UUWA 4TKMA 3O4RA 1GZ4A 5DOZA 3QJ5A 5CHEA 4CLRA 2WYVA 4MVJG 3RUCA 3S2FA 1W4ZA 1U4OA 3IC5A 2H9IA 4KZPA 2CUKA 4EUHA 1CRWG 1X14A 3KSDO 4QO7A 2HK8A 3INGA 5DNAA 4IS2A 4NMHA 1D8AA 2JCVA 3IMFA 1LDNA 3FPCA 3U0BA 4AJKA 5CEEA 1Y8QB 5IXYA 2HUNA 3DAPA 3CMMA 1RM0A 3MJVA 3AI2A 3WNQA 3JQGB 1SNYA 1NFFA 1NYTA 2F00A 4J9VA 4BKUA 1O6ZA 4B4VA 4ALNA 5TIIA 5G2OA 2GRAA 4XYEA 4AJ1A 4CM7A 1DDOA 4RPGA 1YQGA 5C7IO 3OIGA 2RIRA 3GDOA 2ZB7A 1Y5MA 1AN9A 4JK3A 3RUDA 2DC1A 2OL4A 4E5MA 4IQ0A 4OQZA 3D5QA 3O03A 3UCEA 4R1UA 4RL6A 1IHYA 3QE3A 3RWBA 5JE8A 3ZWCA 3INTA 2O3QA 3COSA 1QKIA 4DMLA 3TL2A 3BTSA 3TZ6A 4AJHA 2NWQA 1I2BA 4DPMA 4DVJA 4HFNA 3DL2A 3ZWPA 1ZW1A 3C1OA 5TLSA 1E5QA 4Z9FA 1SOVA 3GGPA 2BD0A 3GZNB 3DZGA 4U0KA 4I9NA 1XIVA 3PHHA 1E6UA 5U1PA 4YT2A 1PQUA 4R54A 2W98A 1N1GA 1ZK2A 3EUWA 3DZIA 2QG4A 3KSZO 4K9DA 1CERA 1I3KA 4I5EA 1GYRA 1RPNA 3TOZA 1S6YA 5GZ3A 1F06A 4FCCA 4YJHA 3DBLB 2O3JA 3VTFA 4B3HA 1FDUA 4I9UA 1KVRA 2RH4A 2O4UX 1KY5A 5ILGA 4LMRA 1B8UA 2FZEA 5C5IA 3OA2A 3KYCB 4JLWA 2RH8A 3ASVA 3JQAA 5L95A 1I33A 4HV4A 3BTUA 1M2WA 1XR3A 3H9GA 1I32A 2X8LA 3JQAD 1WW8A 5A4DA 5CG2A 4B79A 5COBA 3I5MA 1GTMA 2GCGA 1ONPA 4BO8A 1CIVA 3RC9A 1I30A 2GD1O 3F5SA 3ICPA 3WGTA 2PNFA 1WDMA 4YACA 2A94A 4I08A 1NBOA 5DCYA 3ROQA 5DN9A 1QMGA 3B20A 3I6QA 3WGOA 4KDFA
chains in the Genus database with same CATH superfamily
4JYMA 1EP9A 5A0VA 2JAUA 3ND8A 1ZYUA 2B1IA 3PDIB 3CF4G 2REBA 4P84A 2J9FB 3OCUA 4GXRA 3RBVA 3W5CA 5CD1A 4P35A 1ZRNA 5LXTF 4NV0A 3D31A 3WB9A 3H42B 3V4SA 3AY3A 3S1LA 2X0DA 3EVEA 4FP9A 4PQYA 5DJ5A 5JBNA 2UUBB 4I1SA 2FN3A 5JNVA 4U3JB 3LH5A 2RGGA 3HCPA 4MW2A 2PX5A 2C97A 4KU4A 1GR0A 2J59A 4MXDA 3R3ZA 3VU9A 1MB3A 3DOEA 3DG9A 5ITZA 2AEJA 3ZIAA 1DO0A 2E5WA 2GDJA 2JJ2A 3AFHA 1XSEA 4V3CA 1QDUA 1ZITA 5G4KA 5H80A 2WJ6A 1ULSA 5L9AA 3PHIA 3N59A 4CCWA 2AIRA 3DMGA 3B8HA 4YRDA 3AFNA 5ILQA 3QYFA 1S3IA 1IY8A 1XYYA 1BS2A 2WFZA 4FYPA 4N12A 4YCCA 4F46A 3KLPX 3BSYA 3M89A 4RKFA 3PIRA 2WIFA 1TIBA 1KEZA 1YR7A 2GTPA 1TYEB 3D1VA 3PQEA 4I4TA 1KQFA 2Z8XA 1ORVA 3CX3A 5IK2D 4BATA 4EDFA 2IW1A 1KARA 3JALB 1W76A 1V11A 3ZK7A 1YOVA 4B6QA 1AD2A 5BORA 3OMWA 4D4GA 2VEDA 3T1HB 1DBWA 5C35A 3H1BA 2BMVA 2I54A 3UICA 3DVAA 4DJTA 4MRNA 3C3JA 4ACBA 4QPNA 4C0HA 2YIJA 1OE0A 2YDYA 4CCSA 4DWWA 1CZHA 4B75A 1OZHA 3EQ8A 5AH0A 1JDVA 2MOKA 4AJOA 1P1JA 2GAIA 4QUAA 3IL2A 3PE4A 4MMZB 4JBGA 4E6PA 2BGNA 2WIBA 5JZSA 5BQFA 4O1IA 2HA2A 1PQ4A 2LE0A 3A27A 4NYJQ 4F3RA 5IDWA 4PGHA 1C7RA 4A10A 3KUKA 3TSAA 4B7XA 2FWPA 1W44A 2RBKA 2XMGA 2ZRLA 3F4KA 4I6GA 4TMFA 5A3VA 3SJAA 2ADOA 4XWKA 4EJFA 5EJAA 4BE4A 1T8WA 3IAM6 4A1FA 5J1SB 2J9XB 4E6EA 4Q00A 4JBLA 3ENWA 3ZE6A 3EVZA 2EFHB 4JLKA 3WYFA 5I4KA 2VDQB 1W0CA 3FZGA 4WOCA 2JK0A 1QFXA 3TSWA 2QUIA 1YMUA 4WBSA 5EIHA 4MEBA 4RW0A 3VSDA 4F84A 1HMYA 1HE8B 2MJLA 3PUJA 3UM9A 3KTDA 5FTJA 2ORIA 2PBZA 3GVPA 1MENA 3M70A 2FSSA 1E2UA 4UNSA 5CTAA 1HDOA 2IHNA 4JVOA 4UZEA 2H31A 3P9RA 5FYQA 4B48A 4YUXA 5DLEA 2Q1YA 1ZD5A 1DBVO 5E3HA 3K1TA 5LYYA 1MZVA 2ZAYA 3GZTB 4OJNA 3D6TB 3WIUA 1SBQA 1YMQA 2XXAB 2EARA 1L6IA 3NG1A 2GCIA 4FZ3A 4FZVA 1CJUC 3ZG6A 1C7EA 2PZ8A 2UZ1B 3NIDB 3DW3X 3LT2A 5BOVA 3PD7A 4GOLD 2WU3A 4L4UA 4FILA 2CF6A 4CEIA 1YR1A 1JLRA 2ALJA 4KV9A 2I62A 4LK3A 2PYDA 1PV1A 3FYHA 3GLKA 4C7MA 3FHOA 4Q0MA 1FYDA 3IVAA 1XEFA 2VCYA 1P2UA 3BMCB 2OBFA 5COAA 2MYUA 5GJCA 2PH7A 1NNSA 3Q6MA 4G4SP 4YCAA 1H1DA 1E7WA 2RFLA 4C2BA 4XWTA 3HZOA 4D79A 2Y1KA 1FFYA 4UOEA 1K1EA 4GPZA 3V4PB 1HRKA 3EVDA 5EUBA 5CLQA 2LD4A 3M7IA 3GIDA 2AN5A 2LCIA 4Q4AA 3DE7X 3FLEA 1XFDA 2C3MA 3Q2IA 3ZV3A 4B33A 3RU2A 5TGDA 5D86A 3TRKA 4ZV4A 2CLOB 3GB9A 3JX9A 2QM7A 4JOSA 3RTAA 1TF5A 5FBHA 2PLFA 2HYDA 1IK6A 2E89A 2XMSA 4GFDA 4RF3A 5I01A 1ZR2A 4JQYA 1UM8A 2J48A 4XQ0A 1KGSA 1M34E 1PGPA 1VLZA 3DYVA 5CCEA 4E3WA 1HEUA 1XT6A 1A2OA 1R5OA 2EF1A 3BB3A 3C2QA 4IKOA 4FB5A 5BW8A 3IJRA 1DRKA 1NNUA 2H0QA 1FPMA 2WICA 1U3FA 3JU3A 4Y3UA 5EP4A 2C07A 4QAJA 4B6EA 1KTIA 1V6SA 2YASA 3P2OA 4Q3BA 1Q7GA 3KD3A 1JV2B 4MEAA 2QEQA 4MQFB 1SB8A 2D5AA 4QOGA 4TVBA 4IOKA 1HZZC 4FHGA 4YRFA 4BECA 4OH7A 3GLIE 3CZ9A 2Q4EA 4NCIA 1R0CA 1W19A 1QYCA 3BWCA 4RZ3A 1AKYA 3FNGA 3HZZA 4WBNA 3WBFA 4ZYTA 3L1VA 2DRIA 3LZDA 5BVHA 4CF5A 2FPLA 3LPCA 1NW5A 1H8ED 1DOZA 2AMFA 3MWEA 3NS7A 4K8RB 3NJRA 3S6JA 1QDLB 2NM0A 4H3VA 5LFAA 1XP8A 3W9SA 4P4UA 1BXRB 3SQMA 3DCJA 1RRFA 1XU7A 2XQIA 4HADA 2QPLA 2YN4A 3AL3A 3VNRA 3WYCA 3MMPA 1I1NA 1RWOA 1XTBA 3ESDA 3IXQA 4IJWA 5IHPA 2H16A 4UHFA 5HKOA 4P4SA 4L8YA 4HSEA 4G37A 3O2QB 1ZH6A 3I2FA 3MUNA 3NBXX 4A8PA 4E14A 4CUJA 1T8UA 5DCWA 4ENQA 2WYOA 5BSTA 2R7MA 2DWPA 1ACJA 2WF7A 1CUYA 2Q3FA 3B70A 3S2GA 1VHWA 4LI0A 3RS3A 3LYUA 4KR9A 3WO1A 3MJRA 3V8PA 1TQ4A 4JI0B 1EFHA 1I0IA 1K7SN 3DWGA 1WUHS 4PV7A 2NAPA 1U7TA 5K0CA 1FIUA 3D59A 5E6SB 5A05A 4MHSA 1CY4A 4RVNA 1KNXA 3EF3A 4DQLA 3PT5A 2Z3ZA 3OPYI 3FY4A 4XJVA 3F47A 1WSAA 5FQNA 4BE9A 1EGQA 4JBXA 4F96A 2DBYA 2JIPA 5L3QB 1E20A 1QK3A 1C81A 4S0XA 4YWJA 1IRXA 3P9CA 4C22A 4IUCS 1Z9BA 1L8OA 1R5JA 2A3NA 2R2AA 4TS9A 5H4HA 4U2BA 2RGNA 1M54A 2NXWA 2IXFA 3HCOA 3SXUA 5DN6D 2OZLB 3KKLA 4KODA 4ZC1A 4R1SA 2OBLA 2ZRMA 5AI0A 3WP1B 3UATA 1E58A 1MUUA 3PR1A 5KX5F 4IEEA 4XASA 1ZNQO 2AWOA 5JS6A 3H75A 1NDUA 1OLUA 4N41A 2N46A 4J0QA 5TVGA 1U0GA 1VLVA 1ZZGA 4PO8A 1KDVA 3L8FA 1SXJB 3JQ8B 2HADA 4DA4A 5HRAA 1E0SA 3HO8A 1CUGA 4BUCA 1N6OA 3F7OA 2PKQO 3JAWB 3IP6A 1XZJA 2P6MA 1OLXB 3NTOA 4J0CA 5ABPA 3AHJA 2HUPA 2YS7A 4K1LA 3W90A 1C4KA 5JECA 5DNUA 4D80A 4B82A 1G8JA 1DAOA 3GL9A 2PUAA 1Z0IA 3DDOA 2AFRA 3DHNA 3LSYA 1TRKA 4TXNA 3VR2A 1TZMA 5AVVA 4WLOA 1D2AA 4ZOEA 2EJBA 2CDNA 5KTMA 1YBAA 3D3JA 3L7CA 3TB4A 4ZJUA 2EG9A 4RIHA 3WYNA 5CXXA 5I8PA 1V2HE 3DLAA 3MSXA 5H82A 1EAYA 1ZAKA 2HWKA 4M9QA 4L78A 1OV6A 1P9OA 2CV2A 1KJYA 4D44A 2H51A 4OQEA 1YVDA 4G5FA 1ZEMA 4CKZA 2IOYA 4N0PA 3ZBQA 3SF8A 3B9PA 2EBWA 3FOZA 3FLMA 4PNEA 2FMUA 3ANXA 3AEXA 3QKRA 1YZ3A 1PG5A 2WWXA 4G8CA 3EYAA 5AKXA 3ER9A 1ZJ4A 4FPXA 3HA2A 2H1RA 1K9SA 3EC7A 2UDPA 4RA6B 3RS7A 3WWDA 1E1LA 2GD6A 4UPEA 3TLXA 1U3GA 3G3EA 1B0PA 5DM2A 3GEHA 4G3XA 4LJ5A 4L51A 4NARA 3UQYS 1JFTA 3QNMA 4B4KA 1PWXA 2NV0A 1RKVA 2LR0A 4R01A 3WY9A 5C4IA 4D41A 1Y63A 5KQLA 1YONA 4BOYA 1FX0A 3EDOA 1C9NA 4KK3A 5J2UB 1YDMA 3E22A 3KQWA 4FLMA 4RFSA 3L8GA 3SLKA 4RHXA 1JJIA 1N5JA 4E5VA 2X5OA 3MJDA 4LWQA 4TROA 2AZ4A 2DQ4A 6AT1A 4QUIA 5LP6F 5DSTA 2QRUA 5B4UA 4CKYA 5ITVA 1SHJA 1EUQA 1U7PA 4GLBA 3GXOA 3V7WA 1X1SA 1ZD9A 3EXG1 4FHFA 4QEKA 4TYNA 1A71A 2IEZA 1CRLA 2Q9AA 3ZNQA 3KYDA 1Q7EA 2NLOA 4NU6A 3WYBA 1RMQA 2G5CA 4Y2RA 3EEOA 1ESMA 3PQ6A 3KQUA 3GFQA 5KTSA 4WCDA 1C7JA 1GP2A 3RBXA 3FIJA 1JXQA 1NXPA 5KYTA 1ML3A 2CJWB 4V3BA 1PZXA 1GZHB 1HYBA 4MJXA 3TM5A 5IXSA 1HTTA 2WILA 4HDOB 1NVKA 3PX3A 1SK8A 4XX0B 1M7BA 3RS0A 3V5NA 4CZ2A 4LDJA 1WD7A 4ZC8A 1Z35A 3QW2A 1P91A 1YS4A 3R3UA 4HXEB 4L4RA 5CXSA 3S1SA 5B1YA 1MDBA 2NTNA 4YV0A 2EG5A 2OSBA 4PXYA 1FL9A 2WFAA 4RV9A 4YQEA 3FR7A 2DUJA 4GUDA 4MP6A 5TF4A 3VOAA 3W2GA 4AXXA 1NYLA 4KV7A 5HKLA 1EUCB 3WQQA 5DK6A 3T3IA 3HNPA 1K68A 2ZJBA 3A3OA 4RMNA 3H2GA 4UTXA 3BRQA 4B6PA 1MR3F 3G49A 1FYVA 2OESA 2FDXA 3A37A 3DHVA 4IAOA 2H1HA 4IOJA 4R40A 4RA9A 4V24A 1CS0A 3AIKA 4REQA 4IWNA 1VL1A 4BCBA 1X0XA 4RXMA 1RAEA 2X13A 1MTOA 4B35A 1JAZA 3OFNA 4BU1A 1MAWA 2YHSA 3KYIB 4XPIA 4N6OA 3G1UA 1Q95A 1JKIA 1T29A 2XDAA 1KQOA 1T9BA 1UPAA 2OLEA 2BFPA 2WWWA 4PGMA 5HIIA 1F2DA 4BVGA 2OK7A 4WKBA 5C32A 1C1DB 1YVRA 1ZHOA 2G0AA 1ECGA 2L42A 5L6MB 2BZ1A 4JY7A 4XDZA 1Z4KA 3L41A 4ZO8A 4KN9S 4M1YA 1DUSA 3QWAA 4LEIA 3FSRA 1PUJA 3NQ41 3VR3D 1A96A 4U2CA 5FI5A 4PTYA 5EEGA 3W1WA 4A23A 3WOVA 3OX2A 5JZVA 2BFCA 2X19A 3ORYA 2OGTA 3RUPA 2PUWA 2PLRA 3M1LA 2BKVA 3MGGA 3U4HA 3MOIA 5EE1A 1K8QA 5TE9A 3ZDYB 2BTEA 1IL0A 2Z4SA 1IWPB 2VJQA 2R79A 1K75A 2JFPA 2FWBA 3FSGD 3ORHA 5EPOA 1NVVQ 1NTOA 1UFKA 3MF4A 5CAEB 4TVKA 7YASA 2PUFA 3FHJA 4BXOA 2ZE7A 3D2LA 4DV6B 2P2DA 4BNZA 2D0PB 5FBVB 3IP1A 3AJ8A 3LV8A 2FWJA 4H2DA 4UEQA 3U0VA 4DHEA 5L6LB 2MIIA 4JSRA 4DSOA 5EQFA 4AYTA 3RC2A 5A4KA 1QCDA 3VO1A 4EG5A 2FN7A 3TXXA 3HCEA 4BP1A 2P40A 2GAAA 2LGJA 4PIPA 2VOEA 3OZAA 3NC4A 1YKSA 1UXHA 1PTJA 1Y34E 1GYQA 1WZUA 3EVFA 4P7BA 2BFFB 4EFLA 1M1YE 3M9XA 1I3CA 1U0EA 1HUQA 5K3AA 3FPGA 1YH3A 1RMTA 4ZCQA 1UF9A 3VR4H 1Z6AA 2RH5A 4R84A 2RGEA 5E6RA 5K3OA 1W25A 1USIA 2PAAA 2J3JA 1X1BA 1T1RA 2FFHA 1Q7RA 2YFYA 3HYRA 1PL0A 1T8RA 1CYDA 1IONA 1JJFA 1L2TA 1X7DA 2YZKA 3BQNB 3C1UA 3F6SA 4HYTA 4TLLB 4YJFB 5E8RA 2IYNA 4C2TA 2ATEA 5IC4A 5EY5B 3P9NA 3U3OA 2GZ1A 2OD9A 4MCJA 5JFGA 1QB7A 3OTWA 4OHOA 1L8AA 3IEVA 2VJPA 2FX2A 1FFDA 2W2KA 1M7GA 3A1UA 1UJMA 4RNCA 1LSJA 4EVSA 3A14A 3IPCA 5MF6A 1M8PA 4HH4A 1FS6A 3Q3IA 3BN3A 3BAFA 4OQFA 4MAMA 5AM4A 2OHVA 2C20A 1F2UA 1I14A 3EXEA 4BV2A 5JAHA 1WB6A 3ER8A 5TEVA 3E3MA 4BKRA 5AHWA 5JATA 4J3JA 4X66B 1F0NA 5BOSB 2H17A 4EK9A 4CV3A 1LDYA 3R23A 4FGWA 4FN4A 5I9MA 1I0ZA 4Z9AA 4V2IA 1JALA 4U7GA 2W6JD 3TEFA 3HHEA 3QKWA 3VJMA 4ER0A 4U2KA 1AM4D 2XIQA 3C7DB 2WA1A 2A5JA 3OC6A 4CM4A 5LQMA 4FNGA 4FBLA 3NTUA 4IHAA 3ZGOA 4JSYA 2GBPA 2IP2A 2IRWA 2REXB 1W0JA 3IEXA 3KXIA 1H3FA 3RYIB 3UXHA 2QQFA 1ZIYA 3P9SA 4Z4EA 2J6CA 5DXJA 4ALJA 1KAOA 2ZULA 3PNLA 5HJ2A 4ZPJA 2YBDA 1MRSA 4LJ8A 5C9ZA 1UXOA 3DW1X 1PJLA 5FL3A 2A1TR 1H94A 2GNOA 5KYWA 4IJUA 1PEKE 1VRWA 1YFKA 1II8A 2HO4A 3QUCA 4CKCB 5KNDH 1AMOA 4OL0A 3PEFA 5KWSA 1JG2A 3VDXA 3WISA 4CN8A 5TMDA 4QEDA 3PXEA 1WCIB 4H7FA 1G4AE 1J8VA 3ICEA 1NQUA 2QMYA 1I4WA 2R6HA 3E9RA 5DISB 5JTTA 1ZQ9A 4PBSA 4B17A 4MVJF 3NDBB 5F33A 3AL2A 2BMWA 2IOQA 3G2HA 1NLYA 2CLEB 3BF8A 3U4QA 3I04M 3LPAA 4JFRA 4Y2PA 1MH9A 2B8EA 3PUKA 3TVTA 5IBCA 2C78A 3NT4A 3R7LA 3U7QA 3UJAA 4Z1OA 4YREA 3NX4A 1XHLA 1DXYA 1C1HA 4RJIA 5IPFA 1RZRD 3OEHD 1Z28A 4P08A 3WA6A 2H1FA 3F3YA 2VH1A 2I67A 4K81B 3ZH9B 3QEAZ 5BWMA 3OO0A 1T5OA 1Y3DE 4HZGA 3L05A 3T9DA 4RWZA 1JJBA 1GRQA 1JTVA 1WVMA 2GZ3A 4AXBA 2CXTA 5JNLA 4HATA 3K6JA 4NK5A 1L5LA 5LKRA 5CNKA 3UUGA 3R7SA 2P79A 1YS9A 1YQ9A 4M9CA 5I5GA 3HJHA 1IJFA 3K0AB 3W34A 3X1XA 1C3JA 1XZGA 2B4AA 1NI4B 1QHNA 2HDHA 2P75A 4KDEA 4KR2A 1YS2X 4JDUA 3MA0A 2NTJA 4DLWA 4IH1A 2WEKA 3CNEA 1JQ3A 2JLVA 3L0CA 4P7JA 2RJ3A 1DKRA 2QM8A 2VH5R 2F43B 3R75A 4ZD6A 3SQLA 1L4EA 3PEYA 5AKYA 2H1LA 1LH0A 3PE3A 4CLDA 1E0AA 1YFLA 2DX7A 1E5LA 2QZPA 4PAMA 4PGGA 5FL7A 5SICE 1C1YA 3AFOA 4BKQA 2I2AA 3N2KB 3W3AH 5CDHA 3H5RA 1A82A 3WMRA 1W59A 1NM5A 3UXEA 1IHDA 1QP4A 2O4CA 2HB6A 1DT3A 1SVLA 3F6PA 3HY6A 2BTQB 4X5OA 2F17A 3QWFA 3VZQA 4XX1A 1N2OA 4JLSA 3ETGA 4MQMA 5UKDA 4HEA1 3E2IA 2F67A 5B4VA 3TIFA 2RGRA 4F9GA 1L7PA 1ZEJA 2WNIA 3PB3A 4UXIA 5BW4A 4JJAA 3ROKA 1B73A 4NOMA 5IAKA 4YRRA 4DJFC 4QUJA 3GLGA 2RHLA 3EMVA 3GZ4A 1OBVA 4F1JA 4RHCA 5DEOA 5IG2A 4HX5A 4UUNA 3VNSA 1VLLA 4Z4QA 3NTVA 3K5HA 2KJQA 3ELDA 3O4VA 4CIVA 1RLJA 3K5WA 4ZMBA 5JROA 3DZKA 3PFWO 2R96A 4AVYA 5G0WA 4BO3A 4KH0A 4ATNA 1PNRA 2AQKA 3QELA 3CVXA 2I80A 3EDYA 2MHCA 1A9TA 1VE3A 2LCQA 2FX3A 2PGXA 3DMPA 4AX8A 4BIMA 4ZEMA 1P44A 2FP4A 1JG3A 2DT5A 1UDWA 2YWXA 2XMCA 1ODIA 1CE8B 3OWOA 3E82A 4GBGA 1LC0A 4IOMA 4UNQA 4ZO7A 5FR2A 4BZPA 5JDCA 2I2WA 3EZ2A 3N2YA 4EL5A 2Q46A 1XDUA 3DKVA 4J90A 1CDDA 2EAUA 1CQIA 3OY7A 5FULA 5JH7F 1QFZA 3B82A 5HSGA 1AUXA 1IOZA 3PHJA 3WZLA 3ZHZA 4AROA 1MJHA 3IB6A 1VHDA 4F5WA 3KKKA 3F98A 3R40A 4KXFB 4Q1BA 5AKKA 5BRNA 4TTTS 3C0KA 1EXNA 3U4GA 3DTTA 2V6MA 3DE4X 4JIMA 4C0LA 5EWLB 3QX8A 1E6LA 3A2MA 2XTNA 3PR3A 4J75A 1V7PC 3VNBA 2O57A 2OCYC 5A03A 2XUFA 4BNYA 3KTAA 1GPDG 3EMKA 4G1EB 1X3LA 2AFIB 4JL8A 3KUCA 3OEEA 1YHNA 1FEZA 5IZ4A 3PHLA 5CB0A 1Q2XA 2I3BA 2GGSA 3HN6A 2OOSA 3BZUA 3NYQA 4TZTA 2GERA 2XLBA 4FFOA 1OD6A 4FMDB 5EXPA 1PJRA 4JYAB 4QUEA 5KMGB 3AP2A 4JP5A 4UREA 1S8AA 1UFVA 2RGUA 4ZCRA 5BYKA 4N03A 3VH2A 3X3HA 1HA3A 4XOIA 2QN7A 1SBYA 2KHZA 1NQVA 2V0NA 1J07A 5JD3A 4C06A 3NVKI 2QR2A 4FWBA 2AV6A 3AU9A 4OHFA 3WHPA 5DBOA 2JNWA 3EIFA 4WTOA 3OCCA 4ZIRB 4X0EA 4DA7A 4DIOA 2D13A 5IMSA 1N5LA 4O2BA 1NRIA 4C88A 4BQRA 5J59A 2RBGA 3AWDA 3ZJYA 3H9JA 5C31A 5KNCH 3LXMA 5CLGA 2W70A 3SS7X 4CTMA 1F14A 3TX2A 4JN6B 1UBJS 1D2MA 2V97A 5HCNA 3NEJA 3OOHA 5CFOA 4HUJA 4CTNA 5HE9A 5AUPB 2XKBA 1NJ5A 3K1JA 3OE4A 2OLJA 2IF0A 5FNZA 4GNRA 1XMOB 3PNBA 5B1EA 1SELA 1STOA 1SBNE 1Z4JA 1X80B 2ZB3A 1VL5A 1E9VA 2VH2A 1TA9A 4HDSB 1QJCA 3A4VA 1ZD1A 3JYNA 4PQEA 4ZTBA 2CB0A 4TKVA 1I1HA 1B93A 1YNOA 1KO4A 3KOOA 5I7FA 3B78A 2OM6A 1QH1B 3OQIB 3LTEA 3G9XA 1TGVA 2OZVA 3D3WA 3PDHA 4L6AA 5LD2C 5JCOC 3CH6A 5LPNA 4HGZA 1GFSA 5MGNA 2IS1A 2GN9A 1RLMA 4IFBA 4IGEA 3H9UA 1VBNA 3ASYA 5IK2A 2YV5A 4EVQA 2WTBA 4FIZA 5CYPA 1RI1A 4B3JA 1NSTA 1GGKA 4I9FA 1P4HA 4BV8A 1E2KA 1UFRA 3O95A 1EG2A 1C9MA 2HDOA 2PAFA 3M81A 3UT6A 1Z6ZA 1KDTA 4I55A 5DGXA 5ECDA 4NVRA 4CDRA 5LU8A 1RI5A 2ZI7A 4RX1A 5BUQA 4EBBA 2I4MA 4DE5A 1W52X 2YVUA 1ZRHA 2GN2A 4R51A 5ALHA 2PSSA 3HFSA 2IH5A 2FSIA 2X22A 2M6KA 3LM8A 3NORA 4AMBA 3BA1A 3HV2A 3N2IA 1QO0D 1Y6JA 1U0BB 3QLJA 5K8CA 4IHKA 2E82A 4RSRA 2HDWA 4D9HA 1EJBA 3C3MA 3GUHA 2FPSA 4I9GA 1OLSA 4RHYA 3ZCPA 1P1CA 5IN4A 4QTTB 3FDJA 1SH7A 4LSMA 4RS4A 1SUSA 4KLZA 2HQSA 4ZAFA 4UMFA 4DBLC 1PKEA 2I1QA 1LC3A 1P0PA 2Y1FA 3I37X 1C1XA 1P61B 2EQAA 2QTGA 4KWHA 4X20B 5JAIA 1HF3A 1RI4A 3DZBA 2J0UA 2VK2A 2XODA 2V0CA 3GUVA 5KPDA 1FDVA 2E6UX 3A1FA 1XDWA 2VSYA 2XOKD 2YHAA 1QFYA 1IXZA 4I4CA 2VJMA 4V0ME 1IZ0A 1YKGA 3HVHA 4DM3A 3H65A 3MINA 5MN6A 4QUGA 1W49A 4WJKB 4AP9A 4EPRA 2OG2A 5CLLA 2OV4A 3DEYX 4TXJA 3UWPA 3K4QA 4TTJA 3MZ0A 3K6SB 2AFHE 4R0NA 3FMOB 3A1DA 5EP1A 4BMNA 2QK4A 1D8TA 1N9GB 2BP7B 5BN1A 4DCMA 1DX6A 3V8VA 3TUIC 4DN6A 1B8NA 4G41A 3VNAA 5ARBA 2NVUA 1WBBA 1DUIA 2BV3A 3ED5A 4RWEA 5I3CA 4HQKA 4J0JA 4X90A 1RRKA 3KAPA 4Q4LA 3SJ7A 1HDYA 1IQRA 1V5FA 2W2LD 2KB0A 1KEEB 1V5GA 5CDGA 1ENYA 2DHEA 4NBSA 2FEPA 1GVNB 4WNAB 9ATCA 2XNJA 1BAPA 2AMLA 3IMGA 3KOUA 2XQVA 3TNLA 1TCUA 4EMUA 1LK0A 3WGYA 1AKVA 4AKIA 4IEFB 2XSZD 2KE5A 2ANCA 4CHGA 4R41A 3V1YA 4CM5A 3VJRA 1C41A 2IEDA 1XLWA 4Q9KA 2VTVA 4GQBA 1OAKA 2OVFA 2H63A 2W4QA 3HHPA 5FADA 3HL4A 2ECPA 1X0VA 1KZYC 4P4TA 5DGTA 5F23A 1YIAA 3GI1A 4Y2XA 5HBGA 3WLIA 4YUYA 4XM0A 5BT8A 3GLHA 3BWEA 4C5CA 2COKA 3PHCA 2LCFA 4UEWA 3DHEA 2KM1A 1HO3A 1NDQA 1ZXLA 1YI0A 2GXAA 3JSXA 4YAFA 4UTRA 1WR8A 2D74A 4MTLA 4WA7A 5CNMA 3VBEA 3BCRA 4CM3A 2BFOA 3OQNA 2HW8A 1I1OA 2O1WA 5EI5A 2BM8A 4ZCTA 3V42A 2YL2A 5D5PA 3UTDA 2AOUA 4DLLA 1CRZA 4CLEA 4L4ZA 3ZXSA 4EBFA 2GM4A 1JQAA 3JD1A 3V1KA 4HAWA 1QZZA 1XMQB 3AT1A 3I2YX 1YE5A 2DPLA 1V48A 3H8VA 2YWFA 1GQSA 3KWMA 4CT0A 3DEFA 3W6NA 1ZOSA 1GNRA 4IEIA 3Q98A 4ICIA 4U6QA 5LB2A 1N1DA 4O4HB 1XCGB 3EOAI 1TIKA 5EZ6B 4EABA 1LNQA 4YJGA 4A2PA 5DYGA 1H8EA 3QMVA 3WLTA 1V7CA 4BUJA 1XDDA 5F7OA 5TT0A 1KDOA 1N0HA 2UUOA 1C9JA 1W35A 3MMXA 2HOQA 4M9UA 4NE7A 3N7UA 4QQKA 5BQOA 3WLFA 4AQYB 3PJRA 4V38A 1I6WA 1TK9A 1P2BA 3CPSA 3N28A 1NI5A 3PD0A 3BE5A 3GEMA 1M2GA 3GUCA 1F4LA 3PWZA 4V0LA 3VI3B 1CQPA 1BDMA 1UM9A 2Q3LA 5DTJA 1R6VA 1SVIA 3G0CA 4LPKA 4QIHA 3HS3A 2OG1A 1NF9A 3HLTA 1XQ1A 4Y7CA 4P1ZA 4Q9LA 5KHAA 3U40A 4ETIA 4ZI7F 2HMUA 2C29D 2ONKA 4D8TA 2IOFA 3V8NA 1ID1A 4QNNA 5B36A 2A7XA 1IEXA 1A98A 2NT3A 3KJIA 2WV7A 4IKPA 3JQAB 5FUWA 2Q8PA 3ZV4A 4BEJA 1KWGA 1KOGA 1F12A 1MB0A 1WXQA 3PRKE 2X3FA 5HBRA 4C43A 3RRNA 1MT3A 1L1EA 3RFXA 4KQWA 3A1NA 3MVEA 1VGQA 4X64B 1KA9H 4JI6B 2NYUA 5I48A 3D3QA 3RYHB 3NT5A 2VQDA 3BA6A 2ZSDA 3EZ6A 3HWWA 3NW9A 4G1VA 4RAQA 1ZLXA 1IM8A 3IO5A 3QVTA 1U02A 1OX6A 3D6FA 3CZMA 1GU0A 2JCYA 2VBGA 3NBKA 3ZX5A 4BASA 5DN6A 1T1JA 1R5NA 1HLGA 2DBZA 3OEYA 1DCMA 3AJ9A 3LW7A 1HDEA 1YK1A 3BMOA 1X1TA 4WJLA 2Z4RA 3CTMA 4AIRA 1T8SA 2BM0A 2OE2A 1OWPA 3GFFA 3WK8A 1JDBC 5DXFA 4E09A 4ND7A 4U7DA 3SDBA 1C0EA 5FO0A 4A2CA 5I9IA 4A6EA 3RSOA 1DKUA 5DTEA 3LQFA 4E2WA 1A2BA 4MWCA 5KYYA 5IEBA 4IJMA 4NG4A 1P7YA 2ATIA 1IULA 3WIDA 3DCIA 2DLCX 3GQVA 2DY1A 4EDHA 2IYWA 1OZFA 3VU9B 2FGJA 3IVCA 1KH3A 1QCZA 4FS3A 1OGIA 4J0DA 5ENZA 3WJAA 1VGRA 1E4VA 5EXEA 3WQBA 3I1JA 5DU2A 1TFUA 2DFNA 2J87A 5BUSA 3DZ8A 2GQ0A 4KMSA 2QV0A 5G4KB 1FFXA 1OIWA 1T4BA 2RGAA 3DE3X 1OU4A 5A4IS 3CPEA 1NVBA 1FZQA 2JCBA 5J5VA 3VNVA 2YFHA 3K70C 4GF5A 3KKOA 4URWR 1BKDR 4OGLA 4E4TA 4PQRA 4DRYA 1YR8A 4F91B 2E4VA 4XWWA 4I4TB 4DG9A 4HDKA 4Q7MB 1GU7A 2HMTA 1WHTA 3EXFA 2FW9A 4WOKA 4EHLA 4NDZA 2PV7A 3QQ5A 4DR4B 1YOVB 5TV2A 4CIDA 1T4CB 1THZA 5GADl 2OXIA 1VG8A 3U9TA 3OQ6A 5GTDA 2F9FA 3FI9A 4JA0A 4YPFA 5JV5A 1JYSA 5ARDA 1YZVA 3DVAB 4FONA 1TU4A 3BSSA 1DTEA 1O89A 4PHCA 3HM9A 3PV0A 4AN4A 5KTPA 3Q5GA 3H5AA 3ZU3A 3OA0A 4DBZA 2D8MA 1PR6A 1VSVA 2YWJA 4D98A 1JAHA 3WGMA 1R27A 4KWIA 1RADA 1WDKA 3Q7EA 3R7BA 2W2VA 2VF5X 3K2QA 1D0IA 4DEVA 2HZBA 1U1IA 3MD0A 3OOJA 4XTRA 4U2FA 2IWRA 4Y2UA 4E33A 1ORRA 4JZKA 2RCNA 3P52A 4G86A 3UWKA 4P3NA 4F9TA 1ZJ6A 3NCHA 4JLPA 3UAZA 1WDWB 3ZZ1A 2AG6A 1I2MA 1TD1A 2WWGA 2FN4A 2MSEB 4XTCS 3FRHA 4WLFA 2O20A 2DBVO 4B3CA 2MSKA 4J91A 4G5YA 2C2BA 2R8YA 1VMIA 4H6PA 2R8XA 5L7TA 1HRDA 3O8DA 2AVDA 4W1SA 5DDIP 3W8EA 9GPBA 2CLIB 3RIHA 3KYBA 5HK9A 2HJVA 3FYUC 3SQWA 5ES4B 2Q3MA 2REOA 1O95A 1RKXA 1SB9A 4LFAB 3VM6A 2H4WA 2C59A 1W1WA 4HDQB 1ZA2A 2UZ3A 1DARA 1UT6A 3F6CA 2AJLI 4H0CA 3TLEA 2C1EA 4AMVA 5FUXA 3JQGA 1VM6A 4B85A 5CA0F 1NJSA 5DHFA 3EPKA 5L7WA 3KE8A 5T6MA 3EGOA 3KD2A 3DLIA 3E0QA 2PT5A 3Q88A 4Z9BA 2PNJA 1VPTA 1YCHA 3U3JA 1PJSA 1U28C 1GGVA 5J1TB 1JFFA 1G3UA 5J43A 3GBPA 1FFGA 5BT9A 4D9EA 6ADHA 3FRJA 3T52A 5HKKD 1U4NA 4EB6B 1EYZA 4OQNA 1YFZA 3CJQA 3DZCA 4CEIB 1FVFA 3W5VA 4BNFA 1YQEA 3L1HA 2EWWA 4H31A 1RACA 1ZUNA 4OQLA 4BFCA 2BTOA 2AJCA 3EIEA 2BEWB 1U8YA 3L4BA 4K1XA 1P6XA 4GC9A 3PFFA 4ZEVA 5HF9A 3WNDA 3BWBA 3UBMA 3CX4A 2HIAA 4LX8A 4XM1A 1EK0A 4DG8A 5LMZA 1EDOA 1R3UA 1TVCA 3KJGA 2BEVA 3RT7A 1YL6A 3LHSA 3SZUA 1OFHA 2QMUA 2WJVA 3MGAA 3D3NA 3FYTA 5KVQA 5ICCA 3ZVMA 2HF8A 4FYJA 3FHCB 1N6NA 1OZGA 4MRMB 2VJKA 1UZLA 4W82A 1QONA 2JKYA 1KVTA 2QUZA 3BFPA 2XNSA 3FSGA 4FLFA 3UW1A 3RRYA 4EFKA 3A4LA 4EPXA 1N5DA 1TZCA 3AHCA 4HMOA 5DT9A 5IANA 3GLFE 1N32B 1CJVC 3T9AA 3UHFA 1N2HA 4H59A 1X7ZA 4II3A 2JJ8A 4NAUA 1O9BA 2REQA 3MIIA 2BMEA 2HJWA 1U9IC 3PI6A 3CSUA 3S44A 1XYVA 3TLBA 3ZDRA 4A36A 2MYTA 4MVJM 1MMFB 2UZ0A 3L4SO 2AJTA 2PSFA 3ZDZB 1JPUA 4JUBA 4YECA 4KDCA 4MB0A 4RD0A 3WIEA 1CT9A 1T9HA 2CHQA 1RPTA 2J5XA 3RGGA 1QFJA 3TZCA 4D97A 4WBNB 1D2NA 5HHTA 2XBUA 3E9NA 3S1AA 3C4JA 1FP6A 2IYVA 5TRTA 2LVBA 2A33A 2ZE8A 4HWOA 3MWEB 3RREA 2N1MA 3A4IA 1N7GA 4OQYA 4G65A 5G40A 2R0QC 2O59A 2PPVA 3SR4A 1NZDA 1XLUA 1IC6A 3MBOA 4D6YA 5C8YB 1XEAA 4K0RA 4H60A 1A8HA 2QT0A 5AI4A 2Q41A 2ZIEA 1LTHR 2WMNB 1KDRA 4NI5A 3VJLA 4LJ4A 2OFPA 2AOTA 3DP7A 2EJTA 5I9BA 4JI3B 4G63A 4RY0A 3SC6A 5ICEA 1BW9B 2Q4RA 1YZQA 1YIDA 2PZLA 1IPEA 3NZEA 4M98A 4XD7D 1Y5LA 1Z6GA 5IM4F 3FHTA 2VXCA 3DMYA 3LRPA 3AVPA 3LBFA 2Q9BA 3UKOA 1R6TA 2F3PA 5I7WA 1L5QA 4MWDA 4C7OA 3KQOA 1IOVA 4DSAA 4UHDA 1L8LA 1YVUA 3QWHA 4IS3A 1Y0BA 1A9PA 1A69A 2FMHA 1SU7A 1F6WA 2VPWA 1I3NA 1ISIA 2I9PA 4O4IB 3CBGA 5K0EA 3IDAA 3Q8XB 3QW4B 5HS6A 3RIEA 5LSAA 1YWGO 4IIXA 2OFFA 1I01A 2CHGA 4XQ9A 2CLHB 4YI5A 3U17A 1YA6A 3NOOA 1T2CA 3W77A 5C7LO 1RWNA 4YMIA 3EZXA 3N70A 3TTUA 1L6RA 1YMVA 2JIMA 4EJSA 4NDNE 1BHSA 1EU1A 2JGEA 5A9TA 4QOIA 3CE9A 4AJ2A 3RVOA 3Q0TA 5HFNA 4DQVA 1YDFA 3Q8KA 1T4MA 3VZDA 4B73A 1BKSB 5FA8A 5KQGA 3GUYA 5E1DA 5E4FA 4XH9B 3TD6A 4GMHA 5DHAA 4RZHA 1BN6A 2IPAB 3TYXA 4HLNA 4IBOA 3AJDA 1VSUA 3LZCA 2CHFA 3T4EA 1VJTA 4WN3A 2IYQA 1RPAA 5JDIA 5KYNA 3O90A 2HKIA 4LJSA 1QHEA 1YDWA 4NZPA 4NECA 3RWOA 1C7IA 2A92A 3BE8A 1UWKA 4GP7A 3B85A 4YLEA 3KDSE 4QPDA 1FNSA 1XVAA 4PRKA 1NQTA 2WF8A 3A3PA 3DBIA 3DFZA 4CDNA 1KYYA 5AKGA 3E2MA 1G3QA 2VP0A 4KUEA 4DOMA 1RZRA 2H4JA 3H5IA 3SF8B 4JVSB 2ODQA 4EGQA 5DW3A 5AICA 3QKRB 4KNVA 1ISFA 1QHFA 3KR0A 2D1RA 4P3XA 2VPPA 3H9BA 3ZY4A 4GEKA 3DDWA 4QJ4A 5ALDA 1MAHA 2G6TA 4RBNA 1YJAA 3C70A 2YOFA 1K5GA 1XPOA 2ZVJA 2G6BA 3F49S 1HXHA 5BP7A 4QM7A 2YWEA 1QK5A 2TYSB 3GNQA 4UVGA 4UNIA 4FFRA 1FX0B 3MT8A 4HNRA 1VPWA 1B3BA 3E22B 2ZRNA 4RFSB 4DC9A 1FNMA 5M5BA 5LYJF 2ZIUB 2AZTA 3TE7A 5JJCA 4E32A 1TVEA 7ADHA 2KX7A 2M6RA 3QXGA 1KK2A 2HQ1A 4LBZA 4NL4H 2C95A 5CNIA 5BSRA 1Q44A 1QCYA 3FNHA 3I9FA 1G8YA 1AQ6A 1GA4A 1DWPA 1IUPA 1N2EA 1QGAA 1QLJA 2VNSA 2WHPA 4BVAA 3WHIA 2HJSA 4M6WB 5ADUS 3RYFA 4BFLA 2V7XA 3KYDB 2FFJA 2QRQA 3DJFA 4IX1A 3ESCA 5ITSA 3HCBA 1KFCB 4CG3A 3K8OE 3KKEA 4XR9A 1YTUA 2A0KA 5A4MS 1DCFA 2EC5A 2VPQA 1B0UA 5KDDA 4RKRA 1P74A 1QM5A 1KDPA 2Q6TA 2E2WA 1JIXA 3DFIA 1X19A 3LRTA 4NX2A 4P80A 1T2FA 5G4LA 2WM3A 4ZICA 1BA3A 1FRQA 2FN9A 3KDAA 4RMIA 5FHQA 2II6A 4H4CA 3AU8A 2AF4C 2IX9A 1WOYA 2WWHA 3CT4A 3WYDA 3IODA 2AD5A 2LXNA 4ERNA 3DMNA 1J09A 3K8QA 5KJCA 4X65B 4F8YA 4ONEA 4BLQA 1NHGA 1DKLA 1JQEA 4BVKA 1EFLA 4P33A 4QKQA 5AT1A 2PVPA 4YP1A 5K4HA 4WNCA 3IH5A 2HF7A 1ISGA 2ROQA 4R9RA 2D62A 3U5TA 2FZVA 3BPSA 3CW2A 4MS1A 2Y1GA 1ZXBA 3OU7A 1QGDA 3ICVA 3UAYA 5IKMA 4HX2A 1XF1A 3ZU5A 2C7PA 3Q3HA 1NJGA 3BXFA 1CS0B 1E9SA 3E5MA 4REQB 4CIWA 2WSYB 1EHIA 5B6JA 3VPGA 2ZBDA 4Y9UA 1A5AB 1KY4A 5AVSA 1BE6A 1FU8A 2C4UA 3E8SA 1O7JA 1VLHA 2Q4DA 1DSSG 1YJ8A 2JATA 2GCNA 4I36A 4BGIA 3K31A 3NMUF 3SHVA 3LX8A 4P36A 3DDNA 2OSVA 2ZT7A 3H6KA 4PSKA 3IEPA 4CLOA 4YAUA