2RBEA

The discovery of 2-anilinothiazolones as 11beta-hsd1 inhibitors
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
260
structure length
259
Chain Sequence
EEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The discovery of 2-anilinothiazolones as 11beta-HSD1 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
total genus 94
structure length 259
sequence length 260
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2007-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2rbeA00
1GUYA 1J6UA 1NFFA 2YJZA 2VZ9A 1NAHA 4OM8A 4ZQBA 1DDOA 1W0CA 5TJHA 2HK7A 4ESOA 1KEUA 3B6ZA 2WDZA 4HBGA 4ND4A 3QQPA 4INAA 3UFXA 2W2LD 4HP8A 1L7EA 1C1DB 5A5FA 5A04A 5CDUA 1VKOA 1KS9A 1TVEA 2GN8A 2BI7A 1U3TA 2C20A 1QYDA 3S2IA 1K0UA 2UAGA 4XQGA 3OEWA 1W6UA 2X23A 3MWDB 3GAFA 1AGNA 2CDBA 2G1UA 4KZPA 1E5LA 2Q4BA 5F21A 4D42A 2X9GA 3D64A 1MFZA 3MJTA 3AY7A 3AFMA 2POQX 2Y66A 5TX7A 2YYYA 3KBOA 4WPGA 4B7UA 3ADPA 3PI7A 1PX0A 4F3YA 3QVXA 2Y0DA 7MDHA 4PGFA 4WNIA 3IJPA 4XRGA 3GK3A 1YOVB 3ICPA 1WDKA 3SJUA 1GPJA 4NJMB 4E31A 1GEEA 1F06A 3S2FA 2VRCA 2Q49A 5THQA 5L4NA 3HSKA 2EEZA 4MINA 2OHXA 2P5UA 2DFVA 3C7DB 1V6AA 1X7GA 1BG6A 1N92A 3FD8A 5JLAA 5LDGA 1NASA 3WJAA 3ZWAA 5B37A 5CAEA 4FFOA 3WFIA 4XD2A 3L6DA 3UVEA 4Z0HO 3RBZA 1Q7BA 1ISFA 2C5AA 2V6BA 1LLQA 3VVBA 5GZ3A 3R6DA 2JD1A 1NR7A 2CFCA 1HDGO 5DULA 4CMIA 2UV8A 1EVYA 3DZKA 4IJKA 4DC1A 4QFCA 1ISJA 1Z45A 4TRNA 3F9IA 5JAQA 1AUPA 2FR8A 3GMDA 1PJBA 4NPCA 4J16A 3ZDFA 1E92A 4YJHA 1G1AA 1IHYA 4NDNE 4GX0A 4MVJA 3GNTA 1N5DA 4RL6A 3NAQA 4MKZA 4XCVA 4Z0PA 3CMMA 2PR2A 3NJ8A 4XJTA 3WGZA 4BUCA 3VAZA 1GD1O 4R69A 4KQWA 2J3IA 1K5HA 3WDSA 4CV2A 2Q1TA 4S3MA 2GZ1A 2GZ3A 4RO0A 5T64A 1HE2A 5GY7A 3JQBA 4AJIA 4R1TA 1T2FA 1OFGA 2X58A 1MV8A 3M2PA 1B8VA 4ZVVA 4LCEA 3V8BA 4YT4A 3H9QA 1ENOA 3ADOA 3OJEA 5TF4A 3DR3A 1X7DA 1WP4A 1YRLA 4B4UA 1C0PA 1NHWA 4DQUA 1XEAA 2RHCA 5G0TA 4LW8A 4Q9NA 2R00C 3B20A 4Y67A 5KJ1A 3RUHA 1Z7EA 5ICMA 1MG5A 1SO8A 4R5HA 3RD5A 4CMAA 2DBRA 2D2IA 2O2YA 1HYHA 2VUSA 5EPOA 4G65A 3EK2A 1CWUA 3OQBA 1R4MA 2VHVA 2X6TA 2E37A 4D41A 4KWIA 5CG1A 4IDAA 3HFSA 4NK4A 1SEVA 1AHHA 2CF6A 1T1RA 2QYTA 3OHSX 4RPHA 4R51A 3AM4A 4ALJA 5G4LA 2DQ4A 4CMHA 1T1SA 2OP1A 2VZ0A 1KVQA 3PRJA 1PS9A 1G6KA 2Z95A 3GVPA 3C1AA 3PDJA 1U3UA 4R5MA 4EJ6A 1U7HA 1H6CA 4ZU3A 4MKXA 1Y8QA 3GNQA 1HDRA 4PFJA 4W6ZA 4D45A 2Z5LA 3D7LA 1O94A 3B1FA 3CZRA 2GN9A 1NWHA 2YFQA 3QVTA 3I5MA 4CMKA 1EQUA 1EK6A 1HETA 2G5CA 2JHGA 1KVSA 1R15A 1VE9A 3NT5A 5AOVA 4BQRA 1EFLA 2OOSA 1EEHA 4K6CA 2CVZA 3C7AA 2UYYA 2P91A 5BSFA 4QUKA 4FFPA 4FQ8A 1P1KA 4DUPA 1O6ZA 4ITUA 1NVTA 1ZSVA 4HADA 5HS6A 3LT0A 1HSOA 3RSHA 2HMWA 1I01A 3D5TA 2IE0A 4IDFA 3ZNOA 1X13A 3KSDO 5TRTA 5U1PA 3FR8A 2NADA 2ZB4A 2UUOA 4KP7A 3KETA 2GF2A 3D3EA 4NR0A 1PS0A 3DZJA 5C7OO 5JCJD 2ZK7A 2AEMA 4XR4A 1OOEA 3ZHBA 3WXBA 2AHRA 3E9NA 2XF8A 4J0FA 5G2OA 3PJDA 4MIEA 3GDGA 1PEDA 1L1FA 1E1MA 3PHHA 4XYGA 3PFWO 1FDTA 4CM5A 5IZCC 3ZU4A 4AG3A 3EZLA 1BW9A 3DFZA 4RQTA 1UXJA 5ENDA 3NDIA 2W2LA 4B4OA 5H83A 4BGEA 1GU7A 2EW8A 4W7IA 4WLNA 5ER9A 3ZV5A 1PSDA 1YO6A 2TMDA 3MZ0A 4BVAA 5T6BA 1J5PA 2EJWA 2G17A 3KV3O 3EC7A 3JQEA 3TZCA 3TDKA 2R2GA 2JJYA 3HDHA 1MP0A 3PVZA 2AXQA 3JQGA 1U3WA 1RKXA 2JHFA 4W82A 1E6WA 1X1EA 4YQZA 1P45A 1MXFA 3GDFA 1P1JA 5FEUA 4MVJI 4GX2A 1UZMA 5BNTA 2VYVA 4M54A 4YRDA 1JWAB 4CMBA 3JQ7B 4TRMA 2D1YA 2OP0A 4TKMA 3FCOA 2H1SA 4EUHA 5A1TA 3CINA 3PLRA 4P22A 1WWKA 4YAGA 2EG9A 4JGBA 2ZB3A 3LZ6A 3VKUA 3EVTA 4GPD1 4CQMA 3PTZA 4L73A 2DM6A 3ZW8A 1DFIA 3QE3A 2B0JA 5IN5A 4DPMA 3E1KA 3PGJA 1CDOA 2JFGA 2A35A 3LSYA 3RVDA 4HFRA 1I2CA 2ILTA 4GWKA 3GHYA 3V1YA 4CMEC 5I8WA 3E9QA 3ANLA 2GLXA 4RDHA 4DL9A 1WMAA 1YL7A 4YXFA 3GVXA 2JL1A 3PFFA 3KM0A 3INRA 2I3AA 4RCVA 3Q2IA 4PVCA 1I8TA 3S1LA 2PWZA 2QYSA 3NGLA 4WOKA 4AJHA 2A9FA 3QWFA 3RIHA 3D1LA 5DP2A 3U4CA 2NTVA 4UUMA 5AQ1A 5TQVA 5I8ZA 4E0BA 3Q9NA 4P4LA 4XKJA 4C4OA 4BNNA 5JO0A 1JU9A 1R37A 3VH4A 3VPXA 1NVGA 2PZJA 1VL0A 2O3QA 1C1DA 1ONNA 4CM8B 1QXSA 4FJ2A 4MVJD 1ZEJA 3LK7A 5I7FA 1NP3A 3JQFC 3BMOB 2DBQA 1OBFO 2BFMA 1W73A 4LVUA 4UUPA 1VLLA 1ULSA 4JBHA 1E1NA 5I7SA 3FHLA 4JXKA 4MOWA 2JAPA 2VTEA 4J3FA 4Z9FA 3FR7A 2Q46A 1FDSA 3W6ZA 4BKQA 3PLNA 2IZZA 2AG8A 1NQTA 2Z1MA 2C59A 3GQVA 2WM3A 1ENYA 2D59A 3ST7A 4XQ9A 4HUJA 5EERA 1A72A 1F17A 1YQGA 3Q2KA 1F12A 1JVSA 3FWZA 3PWKA 4GBJA 3GRKA 5L51A 1EFKA 5L4SA 5BSHA 3AI1A 3DFUA 1PWXA 3KB6A 1Y6JA 1PU2A 1YVEI 1DAPA 3JQAD 1ZXBA 2VCYA 5DBIA 1UDBA 4YRBA 3JSAA 5GMOA 2ZQZA 1R6DA 1XHLA 4EZBA 3FTPA 4L9RA 4UVIA 3QWHA 5BQFA 4CV3A 1QP8A 2PZLA 4XIJA 3QWIA 3GHHA 1SZJG 1LU9A 4DXHA 3JQDA 5A02A 2RH8A 3DQPA 4IDEA 4K9DA 3DZHA 4M8SA 2DVMA 4NI5A 1X14A 3I9NA 2OO5A 4FIZA 4J1NA 1QKIA 4D7AA 2BF7A 1ZK4A 1NAIA 3SVTA 4DLAA 3DAGA 2SCUA 2PA3A 3VDRA 3QV1A 3WLFA 3U3XA 2ZCVA 2JCXA 4W99A 2O7QA 4BO6A 3O4RA 2FPGA 3AU8A 3H3JA 1KVTA 3RUFA 4RPGA 1ZFNA 1YL6A 3P19A 3P5SA 4XJSA 3R0IA 1FF9A 3VPFA 3AM3A 5KWEA 5AXCA 1J49A 2Z1NA 2HJSA 3U49A 3IS3A 2X22A 1O9BA 5KKCA 4J2OA 4R9RA 2ZTUA 4ROSA 5DDIP 3UCXA 3ORFA 3P2OA 4CM3A 1Y1PA 5DCUA 5FWNA 3AM5A 2Q2WA 3UOGA 4YJGA 2P68A 5IDWA 4K28A 1H2BA 5TJ9A 5DN9A 3GH3A 1ZZEA 4CLOA 1Z6ZA 5DBGA 3JD4A 5HS4A 3TSCA 4YAJA 2O2SA 5HBRA 4ND5A 4L4XA 3RCBA 3ZWPA 4IIVA 4E5YA 4AJ2A 5A4DA 4CL8A 2PKRA 4Y9DA 2G82A 5TS3A 1CQJA 4ALLA 4B7CA 3QVOA 3GUCA 2BLLA 2DT5A 3FPCA 4YA6A 3WFJA 2IZ1A 4Z3KA 1KVRA 3ZWMA 3HG7A 4IINA 3DWFA 1U9JA 3DMYA 3VH3A 4K6FA 3WGOA 3DC2A 1ZKMA 3D4OA 1JW9B 1ZEMA 3N58A 4BO0A 3GPDG 3AU9A 1VKNA 2YY7A 4U6SA 2EP5A 4TKLA 4C7JA 1ZK3A 4PCVA 3LT4A 1ZJZA 1HDCA 3WWZA 2VOJA 4JLWA 4JROA 3ROKA 1Q0HA 4OJNA 2CVQA 2NU7A 4GGOA 3ROQA 3F1KA 1ID1A 3D4NA 4B8WA 3SLGA 1HWYA 2YUTA 1PJCA 1VL8A 3ONFA 4QXMA 4BNFA 1M6HA 4CLHA 3PGXA 5HA5A 2Q2QA 2PZMA 2WEKA 2WYUA 1M76A 4XDYA 1A9ZA 1HTBA 3COSA 5U9CA 4I5FA 1R0LA 2IXBA 3K2BA 4G81A 4N5NA 3HZZA 1PJLA 2DBVO 3PJGA 1Y9AA 2J5KA 5CDGA 3PEFA 4KMSA 3VH2A 1D4FA 1H9BA 2Y99A 1V9LA 3ENKA 4TMFA 3V2UA 3OMLA 1I3KA 2NTJA 1YBVA 2VT3A 3UW3A 1N9GA 5A3JA 3E6AA 2VWGA 3F46A 4Q3NA 4CV0A 4XB1A 2I5PO 4GX5A 4BL5A 2PD3A 1XIVA 1V3TA 2F1KA 2IEBA 4E30A 3O8QB 5CPFA 3DBHB 1BXZA 1SEPA 1BHSA 4MKRA 2E48A 4AVYA 3K30A 3AOGA 2FR1A 3OJLA 1B3BA 1GCUA 1KBZA 1RM0A 2FP4A 4M1QA 4ND2A 1ISHA 1EDZA 4JX8A 2J8ZA 3SEFA 3JQ9C 1YQDA 4KUGA 4R1SA 2DPGA 2HLPA 3BIOA 3SBOA 3OJOA 2ZYAA 5KTKA 4WCFB 4EDFA 1GUZA 2X86A 4RGBA 2ZCUA 2BGLA 1YDWA 4WLEA 1IYZA 2J6IA 3ASUA 1VJ1A 5L45A 2NUAA 2Q3EA 2C54A 1Q1NA 1I36A 3BHIA 3JYOA 3STHA 3DTTA 5GZ1A 2Y67A 1KETA 4PLFA 4EEZA 4BGUA 1UXGA 1UXIA 4Q3BA 2AE1A 3ZWBA 3KOUA 1HT0A 4ONEA 2FMUA 3DBLA 1VPDA 3KZVA 1T2DA 3OIFA 3QY9A 2GYYA 4BO8A 4BNGA 5I9NA 1DEHA 2CZCA 2YV3A 4FFRA 3M2TA 5TC4A 1E7YA 2CSUA 4ALKA 1ZK0A 3UHAA 1QG6A 3RJ5A 4A73A 1YKFA 4TZTA 1E6UA 2AA3A 5ENVA 4XA8A 3GZNA 3F4BA 4M86A 5L95A 2VOEA 1U8XX 2W8ZA 3PWZA 4NFHA 3VZSA 3HWRA 3ZHYA 2BKAA 3A4VA 4I1IA 3RU9A 2A4KA 3AUUA 2WE8A 4L0QA 1Z73A 1ARZA 2WWRA 2ZYGA 3GLQA 2DTXA 4B7XA 1ENZA 5I7EA 4XZ3A 3KRTA 3WYEA 4GKBA 1P9LA 1EK5A 1R4MB 3ANNA 1I30A 5C3MA 3UGKA 3FWNA 3M6IA 2PD4A 1TLTA 4MJLA 1ZMTA 2HU2A 2PD6A 2X0RA 3E5MA 4GKVA 4D3SA 3ZHXA 4RLHA 2C0CA 3RQSA 1H93A 2VYNA 3LYLA 3RC7A 5JAIA 1J0XO 1JAXA 1CRWG 2IZ0A 4R1UA 1VJTA 2NV6A 1Q7GA 6LDHA 5KVCA 4OIMA 3F47A 5KIAA 4BKUA 3I6QA 1V0JA 2GSDA 5C7IO 2FPPA 3OQ6A 3ZWNA 4CLEA 1GV1A 3ZNPA 2B36A 2ZKLA 3ITKA 2BMAA 2EIHA 1U4OA 1R66A 2C29D 5CEEA 2Y1OA 4J7XA 4NFYA 4IQ0A 3ZHZA 3GGOA 5T5QA 5K0ZA 1B8UA 4E13A 1K6JA 2HQ1A 1LEHA 3Q11A 4J4BA 2X5JO 2AEFA 2ZATA 4XDZA 2O23A 3FBGA 4J9UE 5HM8A 4YWJA 1HE3A 2X0JA 3MJVA 1IUKA 3WX0A 2PZKA 4PVDA 4UULA 3FNGA 3K5PA 4LISA 5L53A 5DZSA 1IPEA 1C0LA 2BFAA 1YB5A 4P4NA 1QV7A 2Q50A 4JJGA 1UZNA 1SB8A 1CERA 2I76A 2I3GA 1ZSYA 2ZIZA 1LC0A 4YAIA 4BV9A 2BH9A 2EHDA 2Q1UA 1E3WB 1BTOA 5BNIA 1MX3A 3PIDA 4YVFA 1MFPA 3TFQA 4ID9A 3TZKA 1BXKA 1JKFA 2AQKA 4YJFB 2BI8A 3WQRA 5L9AA 1UJMA 4NG5A 1PZGA 1HF3A 2GZ2A 3LQFA 3NGXA 5JS6A 4BKRA 3BTVA 3ZN2A 5TLSA 1ZK1A 3PJEA 3QSGA 4ZJUA 2CMDA 3H9EO 1NPTO 3VTZA 1YH3A 2FWMX 2QHXA 2J5QA 4W4TA 4XRRA 4RV9A 2OL4A 4HFJA 1RM4A 4U5QA 5JC1A 3AY6A 3ZNNA 1VC2A 1D1SA 4BB5A 4UVDA 3L0DA 3CIFA 4MVJE 4WKGA 4DPLA 1MXHA 5F1KA 3PWSA 3QVWA 3PJFA 3B70A 3GMSA 3LLVA 1D3AA 1DIHA 3ITDA 3V1UA 4D0SA 5C5IA 1T24A 1PTJA 1Q2XA 4YQYA 2GDZA 4CV1A 2X7HA 1A71A 3OIDA 1RPNA 1B3RA 1I3NA 4BNZA 1XWFA 1EVIA 4RVUA 2BD0A 1LBEA 1U8FO 5EQDA 3VPSA 3GG9A 4FFNA 1AN9A 3OM9A 1HLDA 4IQ8A 4NFSA 1Y5RA 1V3VA 4K1LA 3BTUA 1KVUA 3RKUA 3GT0A 1T26A 1UP6A 2CDCA 3FN4A 4ZQEA 4RORA 1BXGA 5JAZA 1ORRA 2FSVA 3KEQA 3ZV4A 3DONA 4FFLA 1SCUA 3QA9A 3L4BC 2X5KO 2DTEA 3EW7A 4GWGA 3W8FA 5T67A 2PGJA 1ENPA 4BHTA 4B3JA 3NV9A 1B7GO 4N5LA 4OQZA 5AYVA 2O3UA 2V6GA 2WD7A 4J6FA 3VKVA 2NU9A 4A7PA 4FDAA 5KVVA 4UEKA 4UVGA 5L40A 3VOSA 5K9ZA 5CEFA 4NU5A 2DKNA 1EVZA 4W9NC 4RJTA 5I7VA 1XELA 1TXGA 4R41A 4DIBA 2C2YA 3DZBA 5AXAA 4GVXA 4LN1A 3I9MA 4ZA2A 4CM6A 5KKAA 2OFPA 4W7HA 1NTOA 3OA2A 4FPXA 2Q45A 3WWYA 1KY5A 2E6UX 1E3JA 1CQIA 2VHXA 2EKLA 3GGPA 3ZGYA 1LUAA 3GPIA 4E5NA 3R3SA 3BMNA 1M75A 4KOAA 3NT2A 4A5OA 1PL8A 3NDJA 1WXDA 2NVWA 4FGSA 4E2YA 1UXHA 1IY8A 3WR5A 2NSDA 4YEDA 4R54A 3MWEB 2R6JA 4NNJA 2HK8A 3I83A 1RM3A 1BVUA 1Q7CA 1U5AA 1ZH8A 4BNXA 2YZ7A 4XYMA 4PLYA 4GMGA 2EW2A 4JP3A 3LDHA 1E7MA 1QYXA 1XLTA 3F1LA 3MTGA 4FOSA 3A1NA 3DO5A 2AQIA 3FSRA 1ML3A 2ZYDA 3NUGA 4PZCA 3HDYA 4H16A 4R4JA 4A03A 4NBVA 3NTQA 4CUKA 1U2DA 1O8CA 3FRJA 1Y5MA 3H2ZA 4CMJA 2UUPA 3F5SA 1PZEA 3QWAA 1IHXA 5A05A 5G0SA 1AHIA 2GN4A 3OEYA 1OC4A 3LLSA 1TT5A 4IPTA 1LLCA 1I2ZA 4OKIA 2GUGA 4E4YA 4PN3A 3AJRA 1R12A 3HHPA 1YDEA 5B1YA 3SX2A 5CEJA 2PH5A 1ZCJA 3GZ4A 3FNHA 2QRKA 5F5LA 3OQ1A 5ITVA 1FK8A 1I2BA 3U9LA 3RC2A 3BMCB 1IZ0A 4II3A 3T4XA 5KVSA 4YJFA 4NBUA 4IZIA 1VSVA 2NWQA 4AJNA 3O03A 4UUNA 3SXPA 3HFGA 4R3NA 3T4EA 1A9YA 1GZ6A 3KUXA 5EIOA 4AL4A 1GEGA 1QYWA 1LDYA 2J3JA 1HZZA 1ONOA 1HE4A 1HYEA 3EHEA 2NNLD 1IB6A 3AWDA 3GDOA 3O9ZA 5EL0A 3HN7A 2VUTA 2FHSA 1KC3A 2I67A 4WEOA 2O4CA 3UKOA 2UDPA 4FS3A 3NKLA 2IYPA 4PRKA 2D0IA 1DC3A 1R4NA 3IKTA 1NX6A 3AOEC 3DBHA 1GYQA 2FRDA 1H5QA 1JDJA 3EDMA 1QORA 2PV7A 3N7UA 3WTCA 4GL4A 3CKYA 1X7HA 4NQZA 3OECA 1SNYA 1ISGA 5A5EA 1T2EA 1E3IA 4RPLA 2B4RO 1ZNQO 1GFSA 1X0XA 4RVFA 2GR9A 4B8ZA 4ZGWA 1F8GA 1ZMOA 3WMXA 4BO9A 4E5KA 2YQ4A 1ADBA 3JYNA 3RWBA 3ZWVA 4L4SA 2J5RA 2BRUA 1TA4A 4IGFA 2NTNA 3C85A 1I33A 4PG6A 1A4IA 2JCVA 5COAA 4J4TA 2YV1A 2Y93A 1WVGA 3NYWA 1PR9A 3L6EA 4NBRA 3V2GA 4BO7A 3ZWYA 1A7KA 4PZEA 2XXBA 3TZQA 3W6UA 4YYZA 5BSGA 3DHEA 3UF0A 5JY1A 4EW6A 1T4DA 3I4FA 3I9KA 4YAKA 1DIRA 2ZB7A 2P4QA 1OAAA 1PJQA 8LDHA 4NBTA 4G5HA 3Q3CA 5EESA 1XCBA 1NQAO 1Y7TA 1CEQA 1F8FA 4MIOA 3DOJA 4YTEA 4RVHA 1HLPA 1T2CA 3GVCA 3UH1A 1T2AA 3PDUA 1E3LA 2RCYA 4DVJA 1N1GA 3QHAA 3PZRA 3ROPA 1AE1A 4QTZA 4DQVA 2NLOA 3A14A 2D8AA 4BNMA 3HNPA 2C7VA 3KTDA 4JBIA 5IXYA 4YB8A 3CH6A 1FJHA 2GASA 1M2WA 3S2GA 4P8RA 2X9NA 1E7SA 1JLLA 1GDHA 2HRZA 1DOHA 1X15A 5U4QA 1C0KA 1HRDA 3TJRA 3PHIA 5DOVA 2X1HA 3BMQB 4GLLA 3X2FA 2CUKA 3EMKA 4DREA 4WOJA 5JY6A 3GEDA 4BMVA 2YDXA 4F6CA 2B37A 2AEJA 3ZCXA 3I52A 3T7EA 4U0KA 3PYMA 3SC6A 5JMWA 1YS4A 2XAAA 1DFHA 4N18A 5DT9A 3G49A 3E9MA 4IZHA 1GY8A 1N7HA 1LNQA 4DMLA 4YT8A 2A94A 1WMBA 2OGUA 1EBFA 1PIWA 5JW6A 3C3XA 4CODB 1A5ZA 2C5EA 4OOEA 4ZQGA 4CM9D 3EUWA 4BNYA 3GVIA 3EYWA 2H5LA 4XR9A 4CJXA 5JCJA 5IFLA 4AFNA 3OP4A 5CDSA 1LDBA 3K8ZA 5JDIA 3Q6IA 1KOLA 5ER6A 4DRYA 2VHZA 1DRWA 4NK5A 1O0SA 3UCEA 3QW2A 1DRVA 4OH1A 3B1JA 3D5QA 4MPDA 4OL9A 3JQAB 3WQSB 5AVOA 5F1OA 1BVRA 3GGGA 4HY3A 1DHTA 2WSBA 4DTIA 1QMGA 1MA0A 2J3KA 5KJEA 2ET6A 2W98A 2Y68A 2I66A 5IZ4A 1PGJA 2DLDA 2W4QA 4XGIA 4WNCA 4JCOA 3MOIA 4HX5A 4AJJA 1YBAA 1LDMA 1ADFA 3O8QA 4YT5A 9LDTA 1S7CA 5KJ6A 3O38A 1HEUA 4LVCA 2D3TA 1Y81A 3HE3A 4NMHA 5COQA 5BNFA 5K6AC 1KY4A 5LCXA 3WSWA 5A06A 1IULA 1I3LA 4ZQHA 1JN0A 4A27A 1E7WA 4CLXA 4PG4A 4EUEA 4CM4B 1KEPA 2X4GA 3WTBA 2H63A 3G17A 1BGVA 1BXGB 1IE3A 3FTNA 4DC0A 3LF1A 1RJWA 1OMOA 4OO3A 4GX1A 4XEHA 1TB4A 2H9IA 4CM9A 2QQ5A 2EF1A 3DMTC 1YWGO 5KOIA 4QO7A 4OXYA 4N54A 4YBZA 1VL6A 5H82A 3A9WA 3H4VA 3VZRA 3VPGA 4ALNA 4CM8A 1UUFA 1NQ5A 5FYDA 1NPDA 1W4ZA 5L7TA 3KHUA 1GYRA 4MIYA 5CPBA 1AXGA 4IJWA 3GAZA 4PG5A 1U7TA 5FFFA 1UH5A 3JYLA 2XXJA 3DEYX 3L9XA 1D1TA 5DNAA 2HMUA 5B4VA 4XGKA 3PYLA 1Y9EA 3IIEA 3QIVA 2BELA 1NR1A 3EVNA 4IQGA 2X0IA 1P31A 1E3EA 4UAGA 1D8AA 4FC6A 3KYCA 4I08A 1AXEA 4II2A 1JAYA 3RKRA 4CQMB 2P2SA 1E0DA 5A03A 1OZAA 3DHYA 3C1OA 4IDDA 5G0VA 4YAEA 4DQXA 4CLOB 1IZ9A 2QW8A 2WE7A 2P9GA 3I1JA 4WCFC 2ZJ1A 5COBA 2OBNA 3ROMA 3DAPA 1WDLA 1QV6A 2FZEA 1NM5A 3D3WB 3FNFA 3GEMA 4TSKA 1BW9B 4NJMA 4XQEA 1I0ZA 4TWRA 5CDYA 3DBVO 1GL3A 4TRJA 4CLRB 3ASVA 3WGTA 1DB3A 4IY1A 2IYOA 3HN2A 1GZ3A 1NFRA 3WIDA 1S6YA 5IXSA 1PQUA 2G76A 5CHEA 4EBFA 3DAFA 2W2KB 4NU6A 2Y1FA 4L74A 5G4KB 4AJPA 3G1UA 3DMTA 1SPXA 4PG8A 1DRUA 1DXYA 1EUCA 1NVMB 4KTVE 3U4HA 3JQGB 4YJDA 4O0LA 3IP3A 4Z3DA 2YHIA 2YFHA 4E12A 3Q0EA 2QZ9A 3VHRA 1HYGA 3WB9A 1PGNA 4YJGB 3GNSA 3WLEA 3RASA 1C1XA 2O50A 5CP8A 3A28A 2XPCA 4R9SA 4CMEA 1P0FA 1WW8A 4IDGA 1DC4A 1N7GA 3NJ4A 5KJCA 4BNVA 3EAGA 1LQUA 2Y1CA 2NU8A 3M1AA 4WK6A 3H9UA 3DHNA 2EWMA 4J9VA 3GY0A 9LDBA 4UEOA 3H2SA 3NRCA 2VWHA 4DGSA 4U0JA 2W90A 5CFZA 4XB2A 5L7WA 3D0OA 1QR6A 2B4TO 1UP7A 3WGHA 4PG7A 5THKA 1GTMA 5F1PA 1YB4A 3F4LA 3PQFA 4L4RA 4PLVA 4ZRNA 1Z74A 2J3HA 4FOOA 3LVFO 4Q3DA 3OETA 1Q0QA 3ONDA 4XYEA 4DBVO 1H9AA 2PGDA 1Q0LA 3DZGA 3GG2A 4PLTA 4L8VA 2FY8A 4YR9A 1EUDA 4CQMD 1PQWA 3TRIA 2EKQA 1R16A 3JQBC 3LC2O 3K31A 3KYDB 5G4KA 1UXKA 2EERA 3WGQA 1PJ4A 4CR6A 4J91A 2YDYA 3K92A 1ONPA 1EUZA 1X1TA 4JIGA 5JC8A 5FF9A 5ITWA 2B5VA 1BDBA 1UP4A 1ZXLA 3HJAA 3JYPA 1P33A 3TQHA 1LI4A 2ZJ0A 3GFGA 2VNSA 1LRKA 2R00A 1JQBA 1V3UA 3TN7A 1SB9A 4EUFA 3DTYA 1SMKA 4HXYA 2VYND 4N5MA 3JTMA 4QO8A 4D0RA 4F6LA 4EYEA 3JQ9A 1E7QA 2YQ5A 4AJ4A 3IUPA 3H7AA 2BGKA 3TFOA 1CETA 5IF3A 4J43A 3WBBA 4CUJA 4E6PA 1DAOA 5IAAA 4B3HA 3TZ6A 3D3WA 3CSDA 4CUZA 3LU1A 4IJVA 2GRAA 4WCDA 4W9NA 4TROA 1NHGA 1RWBA 4MP8A 4TZKA 3L07A 2PY6A 3ABIA 2O7SA 4URFA 1B14A 1RM5A 3FI9A 4NZ9A 1K6IA 3IKVA 3ENNA 3RFTA 1U2GA 4CMCA 1P3DA 3PPIA 3MJEA 1KEVA 2I6TA 3I23A 3I9JA 4WLFA 4ZHSA 5F5NA 1WZIA 4BGVA 3F6YA 2QIOA 1DHRA 1V8BA 3LC7O 3WG9A 5KVQA 4RDIA 1K3TA 3AUAA 3RUCA 1WAMA 3BYZA 4EJMA 2F00A 3FF4A 2B83A 1YJ8A 1PGPA 5IJZA 4Y6RA 4RPKA 3UN1A 4E5PA 3BTSA 1JKJA 1PL7A 1Y8RB 4B4WA 1H6DA 2NU6A 2C2XA 3TOZA 1DFGA 4L75A 1MC4A 3A06A 3GVHA 3BMNB 2D5CA 5JYEA 3OICA 5DCYA 3GEGA 4PRLA 2WJPA 3ZW9A 4FJ0A 4P38A 4MVJF 3RAJA 1VJ0A 3IDSA 2P4HX 2OUIA 4GAEA 1XG5A 4E2ZA 3I6IA 3SC4A 3WIEA 1NXQA 3GRPA 1ADCA 5B12A 3MJ4A 1JKIA 3MJCA 3TF5A 4OAQA 4NIMA 2GGSA 4H3VA 1LC3A 4RVSA 4J7CA 1C14A 3GF4A 4D46A 4MO2A 1MLDA 2P5YA 1SOWA 1GAEO 1MGOA 3L9WA 4PZDA 2UVDA 3TPCA 4AJEA 4MVJP 5HTOA 1Z75A 1HDZA 4BNLA 5JE8A 3OJFA 3H9GA 3PQDA 3ZZNA 4ZRMA 4AJKA 3D4PA 2HMVA 3GC6A 4IXTA 3WQQA 1ULUA 3KEOA 3WYCA 1DPGA 3ZU3A 4D3FA 4CMIB 2GO1A 1ZJYA 4U7WA 1IOLA 1ZVMA 4M89A 4RZIA 1JA9A 5JDCA 4KTTE 1PWZA 3ON5A 2IRWA 3DZIA 3IUSA 3W8EA 3ZI0A 4EI2A 4YRAA 4JQCA 3U0BA 4OXKA 5G0WA 2B35A 1LTHR 5TT0A 2OXIA 5L4LA 1WLYA 1O95A 4LGVA 1PS8A 1HDXA 4IDBA 3LT2A 4NH4A 1E6EA 1LX6A 1UZLA 5GZ6A 2VZ8A 3CPSA 1QSGA 1Z7BA 2WYWA 1XU9A 2VQ3A 4QX6A 2G0TA 1GCOA 4O5OA 5T57A 3QLJA 1A27A 4O63O 1HZJA 1E5QA 1T4BA 3BXXA 3OSUA 3AOEA 2Q2VA 3IMFA 1P1IA 2O3SA 1R0SA 2GCGA 3F5QA 3INTA 4BKPA 1VI2A 1YL5A 1DJNA 2FOIA 3ZU2A 1D7OA 3NT4A 4BQPA 3TZHA 3V5NA 2IXAA 4FR5A 4O6VA 4E2XA 3WS7A 1EQ2A 1I5RA 2X9VA 4A10A 3KLPX 4YPOA 4PIVA 1WPQA 2GERA 3KXDA 4CMGA 3PP8A 1EBUA 1BMDA 1F14A 1T25A 3BHMA 1P74A 1QYVA 3S55A 4N7RA 3ZU5A 7ADHA 1YONA 1SC6A 1UAGA 2Y1EA 1QLJA 1PZHA 2B5WA 3BAZA 4R16A 4WE3A 5JBIA 3PZBA 3I9LA 4JK3A 1XSEA 4CR8A 2I99A 1YBMA 2HKIA 4B4VA 4XYLA 3P2YA 1WZEA 2O4UX 4BO1A 3U5TA 3JQ8B 2B4QA 4LRTB 2Q4EA 3IC5A 2LDBA 2Q99A 3MJSA 4I9HA 2NM0A 4K26A 1EDOA 4E5MA 4Q39A 4FB5A 1ZW1A 5B4UA 1ZO8A 2DBZA 4Z6KA 4J0EA 4ND1A 1CIVA 2AQ8A 3SJ7A 4DYVA 4MVJM 4ZD6A 3VVCA 2W2KA 3KYBA 4DA9A 2IEDA 2EP7A 1XGKA 3WJ7A 4AJ1A 4BOYA 4NBWA 1DJQA 4D44A 3DDNA 4QT0A 5BSEA 3NDRA 5IDYA 5MGBA 5DBFA 1MB4A 3K2EA 3E5RA 3HB4X 2NQTA 3G3EA 4LSMA 5DF1A 1MC5A 3KYDA 1LJ8A 1TT5B 4A0SA 4BNIA 5CG2A 4XX0A 5T8KA 2HO5A 3G0OA 4J2HA 3I9OA 3INGA 4IJUA 3JV7A 3RBXA 1B16A 3BTOA 3EZYA 3HB5X 3HUDA 3PQEA 4KQXA 4RF5A 3IL2A 1EE2A 3BMCA 4Z0TA 1TI7A 1ZSNA 4LSWA 4LMPA 4E33A 1BWSA 3RUDA 1DLIA 4JP2A 4BGIA 4XGNA 3TNLA 4R1NA 4RF2A 4MP6A 1O5IA 5BR7A 2CY0A 1P1FA 3CTMA 3C8MA 1FDWA 1H94A 2CNBA 3HQ4O 4Y6SA 3X2EA 3IJRA 3U4DA 5A9TA 2WMDA 3GZNB 1GUFA 4RQUA 5TGDA 1K89A 2O3RA 3B1KA 3C24A 5IN4A 2PH3A 4J49A 3PYXA 4E2WA 3RC9A 1HL3A 5B4TA 1FDVA 4GI2A 5ADHA 4EGFA 4FC7A 4BNHA 1B8PA 1JTVA 4NHEA 1DC6A 3RUEA 3SLKA 1ADGA 1ISMA 3AFNA 1LLDA 1XQ6A 3LF2A 5TIIA 4TVBA 3BZUA 2ZTVA 1PJ2A 2O48X 3HDQA 4Y8VA 3O26A 4DYDA 3MEQA 3H8VA 2BHLA 2EV9A 3NX4A 3T7CA 4QECA 4IM7A 3GUYA 1LSOA 1H0KA 3GFBA 3NTOA 1DC5A 4BNKA 3E03A 3FBTA 2GNAA 4ALIA 4JBGA 1DIGA 1PJ3A 5EINA 1E7RA 4GMFA 3OIGA 1XA0A 3OJ0A 3P7MA 4OXNA 3UICA 3JCZA 2D4AA 4LRSB 1VM6A 2I9PA 1PGOA 3JQCA 3WSVA 1ZUD1 5L3ZA 5FI5A 1DBVO 1H6AA 1E3WA 4E32A 3CXRA 5C7LO 4LK3A 2GD1O 3CZMA 4XQCA 4Y6PA 3RFVA 4WLVA 4XYBA 1LRJA 5J23A 1XYGA 2X8LA 3QRWA 1KIFA 4I5EA 4YT2A 1R4NB 4QEDA 4PLWA 5KCZA 3HDJA 3AK4A 4IBOA 4D43A 4IIUA 2EKPA 4QFDA 4DWVA 2FR0A 1N9GB 4JN6B 5JO9A 4P4GA 1X0VA 4HNHA 2P9EA 2VYVD 2HRBA 2OORA 4DIOA 4AICA 1CJCA 4DMMA 4LCJA 4M55A 4Q3CA 2QRJA 4J1SA 4FBGA 4UUOA 1LSJA 2DTDA 3L77A 4HFMA 1GR0A 5ILOA 1V35A 3ETEA 2AMFA 4WASA 2E4AA 2Y05A 3JD1A 2V6FA 5JPIA 3V2HA 4WCFA 1M67A 3WBFA 3VH1A 3JQ8A 4MVJH 4UVEA 2AE2A 3AI2A 4OHUA 3VPHA 4H7PA 4BO2A 1PGQA 2QX7A 4OKNA 3H5AA 4GGPA 4CM7A 4ZICA 2JFHA 3JQ6A 3UUWA 4CQLA 1E1KA 4IDCA 1ISIA 3M1LA 1KYQA 3H3FA 1YB1A 2VT2A 3S2EA 1PJTA 2VNAA 1FDUA 2WD7B 1UR5A 3CUKA 3QWBA 1HDOA 3R3JA 3U4IA 4U6QA 5AXBA 3RBVA 1UDAA 2PK3A 2DC1A 1U1IA 4X54A 4D79A 1HE5A 5JMPA 3ZWOA 2Q1SA 2YHIB 4GSKA 5IZCA 5CDTA 3DBRA 5KNLA 4FSHA 1GPDG 1Z82A 5F3RA 4FJ1A 1P1HA 3ULKA 3QVSA 4GQAA 2QRLA 3ZV3A 1HXHA 4Z9YA 2IDZA 4RVGA 1BSVA 1G0NA 3K9QO 4WLUA 2E49A 1PJSA 5JDCC 4GVLA 3BMOA 2HJRA 2V6MA 2VWQA 1Y8RA 3LC1O 4AJLA 5A9SA 1NQOA 4FN4A 2JD2A 1DO8A 3GR6A 1LQTA 2VTDA 5HWSA 3U62A 4Q3EA 1E77A 3IOYA 2PGLA 3ZWXA 2C07A 4UREA 1GQ2A 4QSMA 4ND3A 4HV4A 3U09A 3ZH2A 1DSSG 1MUUA 3PHGA 4U8GA 1OI7A 3GOHA 4WUVA 1XU7A 2X0NA 1J4AA 1PR3A 4HKTA 5JFOA 3Q9UA 5BT9A 4B3IA 4NJOA 1XR3A 4J4HA 4OQYA 2CDAA 2VHWA 3DBLB 3HADA 3ZWCA 4BKOA 3RUAA 1EMDA 3H9JA 3L4BA 3VTFA 4DLLA 2ZB8A 4J1TA 2C7GA 4J90A 3UXYA 2HK9A 4RPJA 4JNKA 1I32A 2HUNA 4CR7A 2A92A 1FXSA 4GLOA 1LDNA 3DB2A 3L4SO 6ADHA 1NNUA 2HSDA 5I9MA 3I4CA 3V1TC 3RUIA 3DZFA 1BDMA 1W8DA 3OH8A 5TNXA 5TT1A 3KO8A 4M49A 4F45A 4A26A 5MDHA 4EJ0A 1BRMA 2VHYA 2C82A 1WNTA 2DUWA 2FN7A 2GN6A 3KVOA 3G1TA 1CF2O 2JKVA 1GZ4A 3TL3A 3CMCO 5EMHA 4BMSA 1LRLA 1B26A 2VUUA 4F46A 3DL2A 4OSPA 1KEWA 4IMRA 2GPTA 1VRWA 3JD2A 2JAHA 1QRRA 3E48A 3ZWWA 4BMNA 5JDIC 1A7AA 4C7KA 5JNLA 4S1VA 3TWOA 1DLJA 2I65A 3K6JA 1B2LA 2O3JA 5ES3A 2OZPA 4OGWA 2FSSA 2XOXA 4IS2A 2YV2A 5KJFA 1ZBQA 3I3OA 3JD0A 1IL0A 2IODA 2CF5A 4L76A 4LMRA 1I10A 4Z9XA 5A9SB 4HNGA 4BNTA 5FI3A 1E3SA 3K96A 2NQ8A 5EQFA 2O3TA 4BIIA 3ETDA 1M6WA 8ADHA 1K2WA 1PL6A 2FZWA 3EY4A 3F3SA 4YDRA 1YJQA 4KUEA 5A3VA 5EN4A 3H6KA 1N2SA 3W4IA 2JD0A 1YE3A 5ILGA 4E3ZA 3JQ7A 4R3WA 4BO3A 5LDHA 1YQXA 5AXDA 1EVJA 3WGGA 3H65A 1U28A 2PTGA 3N74A 1WDMA 3GN1A 3BA1A 1HDYA 3H5RA 4MP3A 3W1VA 2WYVA 5ICSA 4O59O 3NEPX 4CLDA 1O89A 3VDQA 3E8XA 1DIAA 4MVJG 3E18A 4UVHA 2QG4A 5IDXA 3RFXA 4YACA 3UAGA 2NVUA 1NPYA 1UAYA 4IGEA 2OMEA 5EJ2A 4ZN6A 4WEQA 1ZIDA 4JJFA 1JWBB 4FW8A 3IAHA 1N8KA 4M87A 2VRCD 2X5OA 4Q3AA 5IDQA 5H81A 1I24A 4PLCA 4DIFA 1PZFA 1LDEA 2JCYA 1GQQA 3OA0A 2HAEA 2Q1WA 5HRUA 3UCFA 3LT1A 1SAYA 2HCTA 2HMSA 3WNQA 2Y0CA 1Y8QB 2PFGA 3RC1A 4DPKA 1R0KA 5JCXA 4CL3A 4I8XA 1RYEA 3ETGA 3WOHA 1MG0A 2AQHA 5L7YA 1C0IA 2WTBA 3AW9A 3DOOA 2VN8A 4YCAA 1F0YA 4PLHA 1LDGA 3NTRA 3RROA 4OMUA 2RH4A 3IQDB 3CEAA 4I5GA 3ZNQA 1CYDA 4BO4A 4DLBA 2V65A 3EGOA 4FCCA 1IPFA 3MTJA 1M66A 3W4KA 1DIBA 4I9UA 4Y98A 2D5AA 4WGGA 1GADO 4IMPA 5JAMA 3PHLA 4RLSA 4YJHB 4PLPA 3BHJA 3S8MA 3WGYA 4BS9A 4ILKA 2VRBA 4UEJA 4KUHA 1XKQA 3WNVA 2CVOA 2DFDA 4GSLA 4J7UA 1B0AA 4PLZA 2WD8A 1TEHA 2DAPA 1LXCA 2RIRA 3GN2A 4CLRA 5LC1A 3ZV6A 3AY3A 2DUUA 1A4UA 4OYRA 4R01A 4RZHA 1P77A 2V7PA 4FFMA 4D3DA 2H6EA 4GH5A 4E21A 1ZK2A 4IUYA 1KERA 2EJVA 3RU7A 2EGHA 3MOGA 3PK0A 4CQLB 4G2NA 2BFOA 2CD9A 4OOFA 3ONEA 3KSUA 3OFSA 1B15A 5JSFA 5G0UA 2VWPA 1YXMA 4AJOA 2E82A 4CM4A 4QQRA 5T8KC 3L6OO 4A2CA 3AUTA 4ZQFA 2PNFA 3K73O 1U3VA 1QLHA 1GQYA 4MDHA 3G79A 2HDHA 1U4SA 1EZ4A 3AI3A 3BMQA 3C7CB 3JQAA 4RF3A 1NFQA 3DBRB 1C3VA 2P9CA 1NWCA 1GV0A 1HKUA 4XWYA 1NYTA 4IS3A 4EEXA 1L7DA 1EE9A 1RYDA 2EXXA 4KDFA 4I5DA 3JD3A 1P0CA 2TMGA 3OF2A 3VZPA 4TRRA 4JJIA 5TSDA 3TOXA 4O1MA 5JXWA 1NBOA 1H2HA 1LLUA 1K6XA 3TL2A 5I9LA 1H6BA 3AUSA 2RAFA 3ICCA 4RVDA 2NVBA 3C1TA 4TVOA 1LSSA 4IXWA 3Q1LA 4BNUA 4TQGA 1G0OA 3PIIA 3ANMA 3E82A 5DP1A 5C37A 1SBYA 3R1IA 3JQFA 4WLOA 2RBEA 4RF4A 3VZQA 3JYQA 3MCVA 1OC2A 2PKQO 2Y1DA 1GYPA 1YGYA 4I9NA 2FPIA 3DOCA 1VSUA 3WMWA 4BNWA 1HSZA 3RI3A 5IG2A 4PLGA 2OBYA 2YW9A 1P44A 1YOVA 2LDXA 3PXXA 4CPDA 5A9RA 4HWKA 4EITA 2NVUB 2B69A 3W4JA 3GA0A 1P1RA 4B79A 2ZTLA 4WECA 2Y1GA 2RHRA 3PHJA 2BFPA 1TT7A 2HMTA 2JFFA 2DPHA 4HFNA 2Y0EA 5DCWA 3QP9A 2ZTMA 3QJ5A 4CM1A 2NACA 4BB6A 5K6AA 3FNEA 1XQ1A 4R68A 2EGGA 1UDCA 3W8DA 2ZQYA 1XDWA 3WICA 4BO5A 2DU8A 4KDEA 4ALMA 1LSUA 4WJZA 3CE6A 1JVBA 1KC1A 1FMCA 3OBBA 3WYBA 1N1EA 3KSZO 4XIYA 2AW5A 2QZZA 3FPLA 4DBZA 1LA2A 3KYCB 3RJ9A 4FD3A 2PLAA 4KWHA 4BV8A 3KLMX 4FGWA 2AG5A 1C1XB 1I3MA 2BGMA 1QYCA 2PKQP 3H5NA 1PQPA 4OSOA 5JYDA 1SOVA 4J1QA 5DOZA 3IP1A 3DXFA 4H15A 2YHUA 1U5CA 1E1LA 3WGIA 3VC7A 4BNJA
chains in the Genus database with same CATH superfamily
3OFNA 3GXBA 4O2AA 1HL7A 3F71A 1YUNA 4B34A 1R50A 1XPRA 3CGGA 3AINA 1NAHA 4I1PA 3IBYA 4M76B 4OM8A 4W1PA 1JDBB 1W0CA 3BWVA 4D6XA 4KLNA 3EQ2A 4ESOA 1KEUA 3KK0A 2P6UA 2FEOA 1S4QA 4EY7A 3OI7A 1CD5A 4ND4A 4JOSA 1QM5A 2W2LD 2R1ZA 3EIQA 3NHJA 5A5FA 2WYHA 4HLNA 1P75A 3JSXA 4G9BA 4M0DA 4RQAA 1TVEA 5A04A 2QGFA 1IEWA 2XB4A 2C20A 1ZHHA 1TC2A 2CFTA 2I2CA 3S7TA 3IKJA 1XAJA 3BS4A 3ETLA 3P27A 3EQ6A 2UAGA 4UPVA 4DMHA 1E9DA 1X1RA 4JELA 1L5LA 3ZCTA 2ZU0C 2X23A 3PITA 1YA8A 2NO5A 4C01A 4OJTA 2OEPA 1US8A 4YXWD 2OCGA 1AGNA 1XD2A 1LBSA 1OXBB 4TT3D 2Q4BA 3LPMA 3PX3A 5F21A 1MFZA 5JXHA 1E2EA 2P3QA 4KRFA 3NPMA 3FYHA 3ZXSA 3TQSA 4I19A 3AY7A 1N0HA 3AFMA 4B7UA 3K0KA 3KBOA 3O2SB 2O9JA 3C48A 5JZOA 2TYSB 2Q62A 4R0NA 1HNWB 1C3JA 2XH8A 7MDHA 5F98A 3ICPA 2PHZA 4PO1A 1MZPA 1Z28A 3HKEB 4V39A 1AKRA 1YJBA 4ER3A 1ZNWA 1GEEA 3LXRA 4QRHA 2JB9A 4IMIB 5THQA 3HSKA 3RANA 1UM9A 2VHCA 2OHXA 3FNRA 4MINA 4QELA 4QGSA 4I6JA 3AKYA 3OE1A 2B8NA 1BG6A 2KLBA 3EXFB 2GK4A 3SNHA 3B9PA 3N05A 3X3HA 1NASA 2BFFA 3EWNA 3WJAA 3A05A 4UQLA 3UVEA 3LQKA 2NT4A 5JQGF 1RZVA 1Q7BA 3N5CA 4DXAA 3LWDA 1E94E 1RHJA 2C5AA 2V6BA 2IOYA 3ZGVA 4MMYB 4FZ3A 1YHZA 5CFOA 3R6DA 2Q8PA 4X0EA 4O4HA 3R6TA 2HSZA 1HDGO 4EECA 3EBOA 5DULA 1EVYA 5I9BA 2YCBA 2QL6A 3L7IA 3CH4B 3T1OA 5LA6B 5CB6A 2ZYWX 1P7ZA 4IO1A 4AKTA 1KS2A 5FUVA 5JAQA 2R6HA 3GMDA 2C1XA 4B76A 1YSCA 2CLIB 2YV4A 1Z68A 4IDNA 3ZDFA 4KQ6A 5AKEA 3IKLA 4KR6A 4GX0A 1JIIA 3GNTA 4RL6A 1BIFA 3NAQA 4JR0A 4P6VF 3TNYA 4XCVA 1P29A 2AMLA 3DDCA 4L7QA 1GQOA 3IUQA 1KOGA 4QDXA 3HGQA 1E8NA 1W2HA 4ZAYA 5LZ8A 4BLRA 2CKMA 4R69A 2VJYA 4MKHA 4QOSA 4BBAA 5JRZA 1SVLA 1XNRB 5KYUA 5JASA 2BCEA 4AMGA 4RO0A 3B85A 5GY7A 3FPBA 3C3EA 1L4BA 1T2FA 3O4HA 4RMNA 3WADA 2FWBA 2X58A 1VE5A 2O5EA 3M2PA 4AQ7A 1SKYB 1UMCA 1VFPA 2FSFA 1P5FA 2Y76A 1LPNA 2XRZA 2JS7A 4JI2B 1Y7PA 2OB2A 3FKSD 2A67A 3JARB 1RTTA 4MRAA 4B4UA 2UUAB 3VPDA 4DAEA 2R84A 1PKXA 1XEAA 3CLKA 4OUKX 4LW8A 3ZTTA 5BSUA 2X8AA 2WBLC 4I2VA 2O1XA 2GNOA 3IVRA 4I2NA 4PPNA 2WUVA 3MF4A 1SO8A 2P8JA 5DT2A 3RD5A 1XVVA 5ICMA 5JEDA 2TMYA 2AFIB 1HYHA 4F5DA 4GKJB 1W44A 1NY6A 4HWGA 2QWXA 4C14A 1CWUA 1CX9B 1F8XA 1VYVA 4ZI7F 1QH8B 1R4MA 3AP1A 4KO8A 4RK6A 4X1KB 1MHTA 4DNFA 1MAHA 4IDQA 2D7JA 1JHZA 2VEDA 2X6TA 2QRMA 1E1DA 2XIQA 2Y6VA 4KWIA 4IDAA 4ZVUA 3UUGA 4D41A 2XE6A 4RULA 1BJTA 4BU1A 2CF6A 3AVPA 3U13A 2WTEA 1A69A 4OJYA 1QE0A 1JLKA 2N75A 3NM4A 4LFAB 4ALJA 3K8OE 4AN1A 5G4LA 5C31A 2EIXA 1T1SA 1CNMA 2OP1A 2VZ0A 2ZRLA 3ENVA 1GWNA 4BMXA 4BNYA 5JXGA 1WY7A 4BFSA 4BP9A 2D0DA 2Z95A 1U3UA 2WHRA 3K16A 3K2IA 5FJIA 4AX4A 3CCBA 3LP6A 5AM1A 4JDUA 4EJSC 4JI6B 2XUZA 3FLAA 4W6ZA 5A5VA 4EJFA 2JGKA 4YRFA 3D3JA 1BKSB 3KVYA 1JPVA 1JR3E 3IAEA 3UMVA 5DX0A 1U8ZA 1SBNE 2FCAA 5DVZA 1JDPA 4ME6A 1TGYA 5L3RA 2FX2A 3FSGD 1EQUA 1Q83A 5IASA 5FFNA 5JD5A 4L51A 5CK5A 4HDSB 1P7CA 1NRIA 1Q0PA 4XAQA 3VR6H 5DISB 2DYKA 4L22A 5BW8A 3C7AA 3IKMB 1AN0A 2XE4A 2HRRA 2OD9A 2R86A 4JLAA 4MUHA 4KSCA 5GONF 3THWB 3LKDA 1KAOA 4FHEA 4URWR 2JW5A 1FE8A 1XD9A 2GD0A 2V5VA 4QU9A 1M2NA 3RSHA 4ENTA 1I01A 2I55A 4OYYA 3EXEB 3UWOA 2H52A 1NGSA 3ZNOA 3EWSA 4LY0A 4O4HB 4BFVA 4AY2A 4G1UC 3VAYA 3PQ2A 1POWA 3B5JA 3IQWA 4YGYA 3M1YA 5P21A 4EG1A 1K08A 4X45A 1DP4A 3MB5A 3KALA 2XXAB 2MSLA 1RE0A 1P39A 5DHAA 621PA 1OWPA 3DAYA 1U0GA 1YR7A 2IL1A 2Y9MB 3WXBA 3ZXXA 2AHRA 2WWGA 5G2OA 3K71B 2YVQA 4TGLA 3EG9A 3I5YA 2P6MA 2Q5JA 2NIPA 1L1FA 4RMHA 3VC3A 3BQNB 3KKKA 4AMBA 3UOAB 2PUTA 3KWFA 1R6XA 1OF1A 1UBEA 2DGDA 3ONWA 3B1WA 2V4ZA 2YMQA 3R9IA 4DA6A 4AG3A 1BW9A 2XUKA 4FGUA 1UBNA 3O84A 3IE1A 2W2LA 4B4OA 5REQA 4HRXA 4EF4A 2CLKB 2P1DA 2ZSUA 4R2HA 1ORVA 3KCQA 4GECA 3ZV5A 1YO6A 1G7SA 5C4IA 4BVAA 1UAAA 5A62A 4CKYA 1N2CA 4GXRA 3V4VB 1QBGA 5FUYA 4L28A 4N1AA 4DRZA 3IKTA 4KRYA 3MMNA 4BVFA 2H8KA 3AIMA 4P82A 3JQEA 3H5VA 3TZCA 3ZVMA 2WIGA 4A91A 1MNQA 1Z6XA 1GGNA 4D0GA 2YWEA 5EUMA 1FLAA 1W46A 3L82B 3TE7A 3IEUA 2TMKA 1YQWA 1EJ2A 1P2VA 1E6WA 1KK3A 3ESZA 1OW3B 4RZXA 1KXJA 3G8AA 5HK9A 1GNSA 2AG0A 3OZAA 2A8YA 1JWAB 4FFVA 1NC1A 4Q4LA 4TRMA 3S4YA 2P90A 4L0MA 4RK4A 2BVNA 4P92A 2H1SA 2R5FA 2FW8A 2J41A 2ZBDA 1Z4KA 2W37A 3CINA 1Y82A 3KAQA 3PL5A 4LHYA 4PWYA 4WSOA 5CLLA 4ZOCA 3AXSA 2YY6A 5EHZA 2PKWA 3QBJA 3LZ6A 4QLOA 3UMFA 3WV5A 1EM8B 3NIGB 1AC5A 1B0ZA 1JJVA 1QO0A 5DYTA 5K0BA 2V98A 2JIQA 3RVRA 2B4KA 3RO7A 5JQWA 3O5AA 5BMVB 3EVEA 3K9CA 3D3NA 2HUPA 2HA0A 3JRXA 1U1CA 1GDTA 4AI6A 1CY1A 4MDFA 4CGZA 1ZM4A 2A35A 2JFGA 3LSYA 3QVKA 4QDTA 1I2CA 4CMEC 3FDIA 5I8WA 3AEKA 2GLXA 3M9XA 1QCYA 4HGNA 3OAAD 1WV1A 3TI9A 1EXWA 2J3EA 1Z15A 3KM0A 2Z2KA 3FZGA 3ZK7A 4TXMA 2N42A 1KWGA 2EBWA 4L8GA 2A2ZA 1ZL2A 4MQFA 4X3CA 3H9CA 4MPJA 3R76A 4HX2A 2W6ID 4C87A 5KNBD 1R0YA 4AJHA 2A9FA 5CCXA 1H5UA 3QWFA 3RIHA 2K7FA 1EJ6A 2FRVA 2F3TA 4UUMA 2WZDA 4L8WB 5I8ZA 1OLXB 1PYGA 1SU7A 4RKFA 3O1IC 4H3SA 4HX9A 2L17A 1KYZA 3DVAB 1JU9A 2WFLB 2MCFA 4MB6A 4DWWA 2FWIA 2C3YA 4L78A 1QB8A 1C1DA 1NONA 1L5OA 2ZGVA 4KG7A 5M3BA 5I7FA 3NOQA 2Z6AA 4QDJA 2BFMA 2WMOB 3IHTA 4UUPA 3TNDA 5KQSA 1IUNA 3KXKA 4G5RA 5IBQA 1E1NA 5I7SA 1VB5A 2HL6A 2JAPA 2VTEA 3KT0A 4WINA 3WFZA 4QDOA 2Q46A 1PFYA 4UHDA 2F4VB 1CFJA 1Q11A 3ZZTA 2O7RA 2V59A 4H0FA 5LDDC 5CGQB 1L5VA 3QNMA 2FN9A 3R8CA 1TMKA 4KB5A 1Y0BA 3BJIC 4RD2A 2D59A 2WA1A 1JLMA 4HUJA 4XQ9A 3K9NA 1A72A 4KKXB 4W5TA 1YQGA 5HVNA 2B7CA 1JVSA 2OXFA 1E1QD 3GRKA 1EFKA 2C2WA 5L4SA 4BN4A 4MYRA 1PWXA 1YVEI 3CB2A 2VCYA 4QUEA 1MC1A 2OWEA 5DBIA 1TM4E 3RT7A 1DBPA 1TQHA 4BAGA 4CCWA 4C3OB 2ZQZA 1R6DA 3UENA 4F93B 1OZ0A 4EZBA 3FTPA 4L9RA 1NJSA 3S27A 4DN6A 2CHEA 3QWHA 1NG9A 2AC2A 3LX5A 3HVHA 4CV3A 5CRIA 3U3JA 3ESCA 1I4TD 2YJ5A 2YWCA 5A02A 1G60A 2JFVA 3AJ8A 4IDEA 1RBYA 4K9DA 4C03A 3QLVA 2XD4A 2GPYA 3I9NA 2OO5A 2ONYA 1ONBA 1YZFA 2PZFA 1EE1A 2IHTA 2QQ0A 2IZ6A 2W6ZA 3PSHA 4UXHA 3SYNA 4DLAA 1ZR4A 1ZCBA 3JAMA 1Y4DE 2SCUA 3OM8A 5NLLA 2XODA 4G1CA 3VDRA 1LNZA 2X7XA 3QV1A 1XMVA 1ZD8A 3U3XA 2XWQA 4HVCA 2ZCVA 1QHFA 4AM8A 4RSHA 3D6UA 3OWHA 2OBMA 4UCXA 5A4KA 2A9JA 4V1CI 2P9FA 5BRNA 1KVTA 1ZUHA 3M6FA 4GM4A 3RUFA 3OZFA 4BWGA 2BSQA 2O5CA 1AF7A 3JVEA 3N3AC 3P2IA 3P5SA 3R0IA 1FF9A 2AT1A 2H7CA 1PR5A 2XMRA 4NEGA 3PV0A 3RT1A 4GMDA 3VMMA 5KWEA 1O3YA 1J49A 1UODA 4ITVA 3HKCB 3MYYA 2QP4A 1E9FA 3RU2A 3IS3A 3U49A 4RFVA 2XGJA 3KC2A 5E4FA 3UCXA 1CVRA 2IXTA 3ZVNA 1X42A 1Y1PA 3DEIA 5H3CA 1U7DA 3GROA 4QQFA 3U40A 3L0YA 1FFCA 3OEHA 1IC6A 4MB0A 2X4DA 1SHKA 4UOEA 3PGA1 1NVXQ 5JZVA 3G5TA 1B4DA 4UE2A 3VPCA 5GGXA 3DG9A 3LIIA 1XB2A 4NICA 5D87A 5EZ6B 5HBRA 2GUWA 3UMCA 2XBMA 1CK4A 1UFQA 1SJ9A 3HVUA 2G82A 4EFLA 3P2KA 2O2XA 1YR8A 4ZIRA 2AZTA 2H8GA 3QVOA 4B7CA 2DT5A 3FETA 1Q21A 5CM2Z 4LY3A 2WABA 5F51A 2IZ1A 4Z3KA 1ACMA 4AKGA 3ZWMA 4I4TA 3CISA 1W6RA 1VHJA 5DRYA 2IPAB 1XVAA 3VH3A 3D3KA 1O94D 4K6FA 3AVXA 3F74A 3N58A 5FT9A 4BO0A 4A5SA 1VKNA 3B8HA 1AKWA 5AJVB 3DDWA 2QTRA 3E15A 4A0HA 4H7JA 4UNRA 2F3PA 3OCXA 3WKDA 1VCHA 5ESXA 2P9TA 3D2LA 4KIGA 1D2HA 4UDXX 2CCJA 3AJDA 4TKLA 4GOXA 1ZK3A 2H06A 1NDQA 4ZCRA 2FJUA 1YIDA 2B25A 1L5YA 1JNYA 1QOQB 4M9QA 5D8DA 4X20B 2C2MA 2WY2D 1Q0HA 5LZ4A 1Z9BA 1JDSA 2NU7A 4D9NA 2O2HA 4ETIA 3D4NA 2YUTA 4BNFA 2ZJ6A 3C3YA 1M6HA 2YYAA 3PGXA 4BUJA 2AXEA 3FNBA 1XF9A 4U7FA 1LGYA 2WYUA 1M76A 3DW1X 3W5DA 1HTBA 3IPAA 5CM9C 4UHKA 3TMAA 3Q7TA 1P81A 2PFKA 2O7VA 3L7NA 1UOPA 5LZ9A 1Z5UA 1E2JA 1STOA 3JWHA 1PG0A 4KXVA 1F5NA 1NMQA 4F12A 1V5FA 1ZZGA 2J5KA 3PEFA 4BRSA 4QYXA 4ZAWA 1EUDB 4GOLD 2SKDA 1V9LA 4DRXB 3MQFA 3V2UA 2AJBA 2XRFA 3QLTA 3ZU6A 5FOTA 4Q9KA 4OHBA 2CL5A 1VP9A 3GDWA 2ODTX 3OMLA 5DW0A 2W2MA 1YBVA 1JS1X 3RW9A 2II6A 3L8EA 2A6PA 2WJGA 3HYLA 4WL0A 3UW3A 3E6AA 3S8EA 3F46A 2I5PO 2I8LA 3ZE8A 1RT9A 4GX5A 4AU1A 2J07A 1JALA 1L4FA 4HH0A 2O2ZA 2F17A 3RVLA 1IZZA 1MOQA 1XIVA 2FSIA 1V3TA 2IEBA 3EZGA 3QHPA 4M53A 4RELA 2V3CC 2AZXA 1P8JA 1G9SA 2ATEA 3PNVA 1J0DA 2V4MA 4YO7A 4U7JA 4UMVA 2E48A 2YIMA 3GARA 5K6TA 4OEHA 2FZ5A 2BFEA 1HOTA 1EDBA 2L82A 3ELDA 5BQOA 5C9ZA 5F2NA 5MFPA 3Q8WA 1OD6A 1Q0UA 3HB1A 4M1QA 1ISHA 1EDZA 4JKOA 3TLYA 5HJEA 2B9VA 1RKVA 2AG6A 3JQ9C 1O96B 1WHTA 2ZRAA 3OCUA 5LQRA 2BBTA 2HLPA 1RQ7A 5K8LA 4LTNA 2I54A 1I3OA 1E2LA 2JKZA 2R8YA 4EDFA 3LUGA 2BR3A 4OFXA 3BBPA 3NPAA 1Y3AA 2JATA 1H0RA 1IYZA 1XTIA 2ADOA 3EFOB 3UV6A 4J0IA 2NUAA 3UEOA 4R2WA 5ADWA 2Q9CA 2Q3EA 6NULA 3JYOA 3STHA 5GZ1A 3HL0A 1EVEA 4HGPA 4Y2RA 4L5JA 4ARZB 2VDWA 1D09A 4EEZA 1UXIA 4Q3BA 1RMTA 2DCUA 1S01A 1L4EA 2ZRFA 1QH1B 1HT0A 4JMLA 1MD9A 4BFXA 3DBLA 4I46A 1VCMA 4NCAA 3V42A 3EISA 5GP1A 1CY8A 3IV6A 1T2DA 3OIFA 4I3HA 3VISA 2WU3A 4QVGA 4ZCMA 2G25A 1THGA 3EIXA 2YV3A 3NRJA 3PICA 4O4LB 1VKRA 2IYLD 1Q3HA 1VDMA 2C5FA 2WTXA 3BM5A 4NZYA 2C5GA 4K9MA 1L8OA 1QG6A 2D5IA 3VNVA 5IKXA 2HHHB 4B2YA 4ADSG 5CVEA 3K9BA 3PNQA 1G3RA 1J7JA 1P4RA 3A6PC 3AXTA 3QBTA 2CXQA 5ENVA 4XA8A 3SF8B 3F4BA 4M86A 5L95A 2AKEA 2I03A 3PWZA 2RK6A 1TJYA 1VMIA 3U4QB 3ROXA 3EDYA 2P3LA 4JP5A 2GHTA 2EYQA 4O0MA 4QDZA 3VBCA 1SWVA 2EZ9A 5K4GA 4MMXB 1QZUA 1BROA 2FPUA 3CRW1 3HLYA 4LK2A 4TWIA 3OTOB 2GB4A 3N2KB 4OQEA 5ALTA 4FGKA 1WDWB 1KEKA 1ARZA 1DAKA 4GMKA 1V39A 1OA0A 2CMFA 3LCCA 1RXVA 3RTAA 3AI7A 1TU0A 4ZEXA 3LDAA 2MYTA 4DGQA 1NJFA 1ZLYA 3ANNA 5FHQA 4YFVA 3UATA 1Z38A 3AB3A 1JHVA 2R7AA 5KYNA 4S1NA 3STXA 4E51A 1YCDA 1L4YA 3GWZA 1N0VC 2HU2A 1YB6A 4GUAA 1EHCA 1IDN1 1RC0A 1YHYA 3E5MA 3TTTA 3OUTA 1Q77A 4RLHA 4WFJA 2HTEA 1I1OA 2Q5IA 4Q21A 1EP9A 1H93A 4HUQA 3RC7A 3ZJ5A 1J0XO 1P4AA 5JAIA 3RG2A 1FNBA 1KZGB 1SBTA 1YK0A 1RYMA 1Q7GA 5GIPE 4XUCA 1X2EA 4EHFA 3GLGE 4OIMA 3F47A 1XDGA 3I6QA 4K88A 5C7IO 3G89A 1KRXA 3ZWNA 2IWRA 1X7WA 1GV1A 5FLXA 3PF8A 2DULA 1C3XA 3ECAA 2A88A 3FAZA 2B36A 2R8BA 1E6MA 1R66A 2Y1OA 4J7XA 5DO9A 5AKYA 4NFYA 4L3OA 3I42A 4YIHA 2YJTD 5D84A 5LP1A 3GGOA 5ALQA 4CKBA 3H05A 5CURA 3LVQE 5I7RA 3AGQA 1L9KA 3GLIA 1N8NA 4KQJA 1LD3A 3GFTA 2O23A 4MQ6A 2Q5OA 3UA4A 5LQMA 1NBMD 3ROEA 1OH8A 2Y8EA 4AXXA 4KO3S 1E2KA 3WX0A 2ODPA 4PVDA 1PT6A 1AZWA 5L53A 1YJ5A 1AK1A 1C0LA 1UC8A 2QTTA 3WLKX 1JF8A 1SFRA 1CERA 3IOMA 2WVJA 3NANA 4J03A 2BEWA 1HKHA 1ZSYA 2I3GA 3NHSA 1LC0A 1XRRA 2DG2A 4Q00A 5K0GA 2RDMA 2BH9A 2EHDA 4XW2A 4B3GA 1BTOA 1MX3A 2XQFA 4RPCA 2YJNA 5EIBD 3F9RA 3WLRA 5AVZA 3VR3A 5C0OE 1ZXXA 1ZN8A 3HCBA 4XFJA 3TZKA 1JKFA 4MA5A 5FOVA 4BP1A 1J24A 2BI8A 3ELBA 1P7PA 5LPNA 2HDOA 4HWRA 4NG5A 5HQTA 1QH1A 3CURA 1LS1A 4HTFA 2CEKA 4O4HF 4DYHA 4GBED 3BTVA 3LW7A 4Q6WA 5KQGA 5F3WB 3PJEA 3GBVA 4ZJUA 3VTZA 2FWMX 2QNBA 2QHXA 4W4TA 1T8RA 1W581 3MRTA 4WA8A 3AY6A 3LLMA 4F97A 4XSGA 3SIXA 3K09C 1CUBA 4UVDA 3FKSA 4YAOA 3BF8A 4YK7A 3BL8A 4DPLA 1EXVA 2FJ0A 5DJ5A 4J3NA 5ALNA 5HK8A 3RTDA 1HT1E 2OFFA 3PJFA 4LG1A 2GTHA 3B70A 3LLVA 3Q6MA 1FSFA 2ZAYA 5CNMA 5E7JA 4JI8B 1WOYA 2WMNB 4K6MA 3EIWA 5C5IA 5AESA 4KXUA 1OH5A 3W05A 3VAAA 1G6HA 3NJRA 2PBZA 2QTVB 2GDZA 1BJRE 3M6WA 4CV1A 2R6AA 10MHA 1SIBE 4E4TA 1GNPA 1L7OA 2V9PA 3HCEA 1S8FA 1I3NA 1YRBA 2Y71A 3OIDA 4MQUA 3SFVA 4C0KA 1EVIA 1XMJA 3IQIX 2BD0A 3L49A 2D06A 3SC2B 3UHFA 2I80A 1QWOA 5SICE 3OFVA 4FFNA 4H7FA 1AN9A 1QCDA 5IDVA 3ZBPA 3ZCSA 4DT1A 4IQ8A 3AVYA 2OHHA 3EZ7A 3IBTA 4P4UA 4XOIA 1V3VA 3BTUA 1KVUA 5F78A 4MQLA 1T26A 1EFTA 2CDCA 2QTHA 3I2IA 3LFUA 4J76A 4JOBA 4V0ME 4ZQEA 5FI1B 3BRSA 3U26A 5ED4A 4CT5A 5CA1A 3COWA 4K9NA 2RJNA 3QA9A 5FQNA 4CF5A 3CF4G 1DEXA 4GWGA 2NMVA 1JE0A 1XXLA 4JVMA 2FVXA 2AYZA 1QRAA 2W6QA 2CLHB 2JASA 2UVQA 1YBHA 4ZIRB 2V6GA 1SG9A 4WXYB 2QMYA 4LZOA 3VKVA 2GXAA 3RJTA 2PZGA 2XRYA 2ZJBA 3M6UA 3PC8C 4OQXA 5L40A 2PS0A 2PMKA 1X7WB 4QUHA 2X14A 1BX0A 1S3GA 5CEFA 2WM2A 4Q24A 1R8SA 4NU5A 3MXOA 3P20A 3HABA 3WZLA 3H42B 3TTSA 5GJCA 2ONJA 1R0BA 1TXGA 4R41A 1RRKA 2C2YA 5B3KA 3T5AA 4LN1A 5T7BA 5DLEA 2NU7B 3WYGA 5IMSA 4R1LA 4OHZA 3K1YA 1XMXA 2H4JA 1AA9A 2B78A 3KU4A 3GBPA 1Z0KA 3OA2A 1H2AS 1YE5A 2WOOA 2H1FA 1UJ5A 2OESA 2PT7A 3HJRA 1N4DA 2BFFB 2FF7A 1W88B 5BSKA 1CQIA 2QDKA 3U4AA 2EFEB 4Z53A 1PJRA 1AQYA 2G07A 3DE6X 3WJ1A 3GGPA 1LUAA 2G4LA 2QX6A 1I4EB 4K3UA 5KMGB 3NT2A 3ADKA 4A5OA 3KSRA 1KF0A 3EGVA 4ZCQA 3Q8KA 4YAFA 4E2YA 2VHJA 2NOAA 4I3FA 1M10A 2UXDB 1I6LA 3P94A 1YU9A 3TQTA 3C5CA 4CCYB 3MWEB 2V6JA 3EPRA 3AG6A 5I45A 1UFVA 1ZCZA 2HK8A 3BEDA 5GONA 4D9IA 3ZCQA 1T91A 1KJWA 1TJNA 3DKIA 4BNXA 3UGQA 4JLOA 4XYMA 2OAGA 3K6RA 5JH7B 4JLDA 1KJQA 1Y8CA 1N2OA 1W2GA 2ZRPA 4JP3A 4BN0A 4DXDA 2ZI7A 1QYXA 2W93A 4J0GA 4N3BA 3MTGA 4G97A 1FYDA 1O87A 5JPCA 3NBAA 3FSRA 1ML3A 3HB9A 4DLZA 1U7OA 4R4JA 1OLUB 5BSVA 4B43A 5MN5A 2AOUA 2NTEA 1RI4A 4PSKA 3U3ZA 3VV2A 1T5HX 3QBEA 4MH0R 1U2DA 2YVLA 1O8CA 2ZFUA 1P18A 1E0KA 1WTAA 3C8HA 3FZEA 4HNAA 1C7JA 4DLRA 3IPYA 4TZ0A 1M9NA 2UUPA 2IYXA 3F5SA 4WADA 1XVLA 2QM3A 4FWBA 4D80A 1GRNA 1N5IA 2ZJ7A 3OFND 5D3KA 1M54A 4C22A 3FMVA 2GN4A 4KK3A 4OU5A 2Q6VA 4NAVA 1WUKS 2ZBRA 3QK7A 2ZE5A 3UK7A 3O4GA 2QVLA 4NZMA 2HJWA 3AJRA 5E4JA 2X40A 1DXHA 1O9GA 1XV5A 2JANA 3GMTA 1D9ZA 2HF7A 3L8DA 5AI8A 4NCIA 3V8VA 2FQ1A 1R00A 1VE7A 4MGKR 1M0TA 3OZIA 2H2GA 3ZHVA 3T4XA 3RVJA 2WV7A 4TLLB 5PNTA 5JECA 4OIFA 5K5EA 2OY0A 2WSSA 1CTQA 4IZIA 4G9EA 3GLIE 1JH8A 1VJ5A 3SXPA 4R3NA 1CZRA 1KE2A 3T4EA 1L8LA 1A9YA 4RS4A 4C88A 1AKEA 4PYIA 2PO7A 1Q0SA 4XUGB 1VLVA 1PRYA 3EHEA 2IUEA 1HLFA 4UXIA 3WI7A 1KHTA 3HN7A 5JFGA 2ZZNA 2QV7A 1T0JB 4INPA 2O4CA 2F8LA 4M7PA 2P6NA 4FS3A 4QOEA 1Q57A 3G0HA 2QN7A 3O8OB 1DC3A 3O8DA 1R4NA 2TECE 5LWHA 5DZSA 3TMKA 1SCQA 1GYQA 2P1RA 1D04A 2PYZA 1JDJA 5AVYA 1G7TA 1NX9A 5GPBA 3IQFA 1PQ4A 2W6JD 3N7UA 3F5MA 2HB6A 3TIGA 6PFKA 2XZLA 4NQZA 3WAKA 4ASUD 4F3TA 3OECA 4B87A 1TU4A 3A9CA 5A5EA 1A9XB 1O95D 1YFJA 1E3IA 3IPRA 5DIZA 4RPLA 4G56A 4M1WA 4WXPA 3L06A 2J7PA 1Z4IA 2K87A 3MXTA 4Q1VA 4C06A 3EOBI 4DNXA 1FMFA 2A7QA 5IVIA 2NZJA 1X0XA 2N3ZA 2X2PA 3ORSA 1J9GA 4RVFA 3ILYA 3WMXA 4AF8A 2ZI5A 3BIWA 3HKBA 4ZARA 2G9NA 3K3PA 3R5FA 2ASVA 1NM5C 4EHLA 4RYLA 3F3MA 3NWPA 4F3CA 5H68A 1EP1B 3MYRA 5HMMA 4DDMA 3SR4A 5JQGB 4PG6A 1GJRA 1A4IA 2E0IA 2QVZX 3AWIA 3W8RA 5BWOA 5EJ9A 2YV1A 1CLEA 1WVGA 1PR9A 1R88A 1Y9ZA 2YUIA 5I51A 3FIJA 2XXBA 1XHEA 4LZAA 3IT1A 3ILHA 1G20A 4QPCA 5BSGA 1U2SA 3UF0A 2M32A 2GVNA 3JATA 5E6UB 5FNVF 3HRHA 2FPPB 4YRTA 4C08A 2ZTSA 1OAAA 1QKJA 4LX0A 1KOFA 2QXUA 2IYVA 3Q3CA 4FR0A 5FNZA 3ZEIA 5BV1A 2QTZA 3UXEA 4PPGA 2PUGA 3OZDA 4EG3A 4YTEA 4RVHA 1E3LA 4HGYA 1UK8A 3HUUA 1G21E 4HDMB 4WY2A 1KJ9A 2Z4TA 3BD9A 4QNNA 3A9RA 2ZQ5A 3BRCA 1OBHA 3GCZA 4ZV4A 1SHJA 4WI1A 1B1CA 2IZ7A 4GI1A 1WVMA 1XZGA 2R4TA 3GA7A 4PZ9A 1N6NA 1RAGA 3GLIB 2GASA 1M2WA 1OU4A 3L7CA 2IV7A 4MRNA 2PJRA 5I9SA 4LDPA 1T35A 3O3CA 1JLLA 1GDHA 1QHHB 3KP1A 3GXOA 1HRDA 1XC7A 3MQ2A 1K2VN 2J3LA 3RABA 1CR4A 2X41A 2MSWA 3HMKA 1SQSA 4UPEA 2BGJA 1SRQA 3KSMA 3HXLA 1NTRA 3TAUA 3D31A 3X2FA 2BMFA 4CF4A 1UFOA 3LYHA 4DREA 4DUGA 5FTMA 1EGMB 4DMKA 2Y3IA 2ESRA 3CJQA 3GEDA 4JEUA 5D86A 4ZREA 1L5HA 1Z47A 4L6CA 3QELB 1K7SN 3UWPA 3PYMA 1MBZA 1OZHA 1P2BA 1TTQB 2I6GA 3SC6A 4N49A 3UAWA 2YVAA 5JMWA 3E9MA 2KLHA 2CVPA 1JQJC 2ODNA 1NN5A 3KQVA 5JSKA 3D9QX 1N7HA 4UEQA 3ICEA 3KQKA 4MROA 1LNQA 1Z2EA 2QG9A 4YT8A 1NE2A 1YZUA 2AZMA 2Q0XA 1WMBA 2OGUA 3UAXA 1NVBA 4B5LA 4C4YA 3FSJX 2GF0A 2N1MA 2GD6A 4P3NA 1W35A 3K32A 1BGXT 2WSYB 4ZT6A 5AJUA 2QSJA 4YP1A 4MIKA 4GYYA 4AFNA 4CJXA 3GEHA 3K8ZA 1UQTA 2Z3VA 4QPNA 2YXLA 3ZE1B 1OLSB 4G23A 4IH1A 4BZWA 2F3UA 1C30A 2GMWA 2BIFA 3Q41A 1AMUA 1JAHA 3D5QA 3EF1A 4Q1EA 3WRYA 3SFZA 4CIVA 3F2IA 1ZNYA 2O07A 1MJ5A 3JQAB 3UPUA 3T12A 1J5EB 2YBDA 3EASA 2OA0A 4YR7A 1DHTA 2RH9B 2WSBA 5LMNB 1QMGA 3C6ZA 2D8MA 3CZ4A 1MA0A 2J3DA 4FMBB 5KJEA 4AK9A 2I66A 2XDWA 2DLDA 1NLFA 3I09A 1LX7A 4XGIA 2JJ1D 4WNCA 4EHDA 2ZAOA 4JCOA 3MOIA 4HX5A 4YQEA 5KC9A 3N7AA 4AJJA 4RH1A 3T3PB 4TWBA 4NYIR 1ADFA 2GOYA 3O8QA 1S7CA 1T0UA 3OJCA 3E84A 3O38A 1DX9A 4X1YB 1RP1A 4N0PA 1H1LB 2EZTA 2A5LA 1GN9A 1P2FA 2OM2A 3ELYA 4MRMB 4WNAB 3R7NA 4AD8A 5K6AC 1KY4A 4PZAA 1QGDA 4BNDB 1CZUA 1RMYA 2HEIA 5HMLA 2FQWA 3L05A 1KOJA 5ULLA 1VL1A 4B73A 1GSHA 3BRWA 1T8TA 3F49S 4ZQHA 5K45A 3EZ6A 1VMEA 4FNMA 4A36A 5EE0A 1ZR2A 2R9VA 4PG4A 4V2IA 1VLMA 3JR3A 4YBRA 4EUEA 4DV5B 2VP4A 3D0QA 4UHFA 4FGJA 2VJQA 3BGWA 4RZSA 3SF8A 2WF5A 3ZY3A 4C4XA 5B57C 5IVPA 1M3SA 4G0QA 2BL4A 3LF1A 4KLRA 3OTIA 2OCXA 3Q3GE 2IVFA 5DPMA 3X1JA 3STTA 2ZVQX 3DMTC 3JARA 4GF5A 3L02A 1CRLA 4TPKA 1PN3A 4YBZA 1L0BA 2PS1A 4FHZA 5KOIA 4ZVRA 3H4VA 1UT8A 4GU5A 2F3QA 2J4DA 3G5UA 4ALNA 4CM8A 3JPYA 4G25A 4IILA 4UAUA 5CNKA 2I9KA 1PZNA 1UUFA 4K5QA 4QYMA 1QIFA 4K87A 1DX6A 4NE7A 3L1HA 1KMIY 1QDUA 1ZUWA 5EIBC 1OB2A 2I1LA 1C2TA 2Q9BA 4YY3B 4UHJA 4N5DA 1QAOA 4I9GA 1W25A 4F5EA 4JWTA 1TUGA 3A6ZA 1UDWA 1Y9JA 1U7TA 3OLXA 2GJ8A 1UT6A 3TOSA 5C2JB 1UH5A 1D1TA 2NN3C 4XX1A 3R9XB 4BAZA 4L5IA 3JAWA 2HMUA 1S8NA 1X19A 2HREA 3GPLA 2QZSA 1K7XB 2P9JA 3IXLA 1FU8A 1FU4A 2Q8QA 3IQZA 3QIVA 4LE2A 2FOLA 1PYDA 2FUEA 2E18A 4F3KA 4MVYA 1K88A 1NR1A 3EVNA 4IQGA 3BMXA 1X9GA 1ZJ6A 3I6YA 3VC1A 5KYXA 4YCNA 1IDOA 2ZBUA 3U16A 4E14A 2LWIA 2FZKA 3KYCA 1AXEA 1BMTA 1A97A 3FFTA 3P4XA 4GXQA 3TINA 4KCGA 5A03A 4MLCA 1H2RS 3DHYA 3H97A 4IDDA 5G0VA 4YAEA 3U37A 5A2QA 4WK0B 4CLOB 4E08A 4QJIA 3HPRA 4V03A 1YHNA 5EE1A 3I1JA 4IO0A 1HE8B 3ROMA 4UHBA 1WDLA 4JUFA 3LBIA 3NV7A 4TSKA 1P9OA 4R98A 3USCS 4N41A 5CDYA 2JZCA 3DBVO 3PUZA 3T9AA 1GL3A 4JUCA 4TRJA 5KTOA 3ASVA 3WRVA 1YB2A 3HN2A 3DVRX 4MVXA 3A1EA 1NFRA 2ZM5A 3UPTA 1PR2A 1NT2A 2GN1A 2H3EA 2AF4C 2ODEA 3RT9A 2W2KB 2ZIVB 1Q19A 3OCVA 1Z5NA 2QD1A 4ZTBA 1U2DC 1BHO1 1SPXA 1EX7A 3W04A 3QTLA 1JEYA 4A4DA 3H5TA 1EUCA 2IEYA 3HUFA 3RRBA 1BD3A 3EN0A 1DJMA 4O0LA 4DW8A 4AURA 3W77A 4EJSA 4DWOA 4K9PA 4EY6A 1D2NA 2Q5QA 1BU8A 5REQB 1QAMA 2OM6A 5HJ2A 4I3GA 4Y0VA 4AAYA 4E22A 4PHHA 5AJYA 1AHPA 1RW4A 1W34A 3VHRA 4L6IA 4NE2A 1HYGA 1FYWA 3JVVA 1SUEA 1PGNA 1V7CA 4Y0NA 4YJGB 4IRUB 3WLEA 1KFKB 4NVRA 3SBXA 3ZHOA 4WKCA 2P5TB 1MR3F 1JU3A 2W0MA 5FWXB 1JHQA 2GA8A 2M6LA 3NHLA 1LQUA 4WCVA 5CTJA 3Q7IA 4M9SA 1CZLA 2G3YA 4ML3A 2ADMA 1FNDA 2Y1CA 2ABWA 2QR5A 4RVCA 2A9VA 3AQ4A 1P4HA 2AS0A 2O0KA 3M1AA 3H9UA 2QYHA 3DHNA 4JBNA 4ASUA 4DOMA 1CF4A 2I6SA 4TVKA 5FA8A 4UEOA 3CT6A 2ODWA 3NRCA 4U0JA 1KI3A 1GG5A 1XZDA 3W5BA 2UUBB 3T4UA 5THKA 1Y7IA 2C84A 4I4NA 5JEEA 2LIPA 5ADUS 1Y48E 4AS1A 5KVAA 3F4LA 3S8YA 4I4LA 2OD2A 2JEOA 5LB4A 2XSZA 1Q0QA 3ONDA 4ZHQA 4DLUA 2HMAA 1DUVG 3DZGA 3GG2A 3KT6A 4B6JA 4C29A 3EPLA 2FY8A 4BX9A 3ZQJA 2BDEA 1PQWA 4DLYA 3PNBA 2XCLA 3DKRA 1ESZA 2PEYA 3H4IA 4ACBA 4C0LA 4ER7A 3A1CA 3FZYA 4C3UA 4LGCA 3K31A 3M89A 1S3SA 4MWEA 3CWQA 2C2BA 2EERA 3MGGA 3WGQA 4DQKA 5BVHB 4BPBA 2AOVA 1FBNA 2P4EA 1EFPA 1UBJS 4NYMQ 3PXDA 2QVGA 2XTJA 1R5BA 3EC1A 4JIGA 2HA3A 4P93A 3SVZA 3PC6A 4MZXA 2YYSA 5ITWA 4MEBA 3A1FA 2B5VA 1ZD1A 2WTAA 3UYLA 4QQ8A 1KFJB 4F8JA 4EPYA 3WXMA 4KXXA 3W5AA 1P33A 3H83A 1J2UA 2LBPA 1L7BA 3GFGA 2G5TA 2GEDA 1U3FA 3K1ZA 4PHFA 1R6BX 3TJZA 3O3MB 5K8CA 3G02A 1WW2A 3MB8A 4JI5B 1IQRA 1L5HB 3TN7A 1T5SA 4G0NA 4PQEA 1E4EB 1Z8NA 4HXYA 1ZGZA 2VYND 4WDRA 2H1WA 4QO8A 1FZQA 4EWLA 1NVUQ 1KPGA 3O9MA 4KXMA 4LYGA 1XZQA 5FORA 4M0MA 1LPPA 2XYVA 4Q15A 2YQ5A 2RB4A 2C7PA 1JA0A 4H4EA 3H7AA 4D25A 4P4SB 1CETA 4P35A 3ANSA 4X5OA 2WKRA 5IAAA 1DEOA 5KNDH 4GLJA 4IDHA 2QM7A 3DMRA 1RU3A 1E3DA 1KZ9A 3MUNA 3INNA 3F96A 4G09A 3EG5A 4IJVA 2WG0A 1KI2A 1KU0A 2ZW9A 4ZT4A 4A3SA 2LR0A 5CDFE 1CEEA 2MU1A 5TGTA 4DILA 2WT8A 3SXUA 4BLWA 4EKIA 2EZUA 3M34A 4GVPA 4JUIA 2CJYA 4NLLA 4TZKA 2FMKA 4U2KA 3ABIA 4MYTA 4URFA 3V55A 2RC6A 5KINB 5LIRA 4PXSA 3PFBA 4GNKA 4IOKA 4LMBA 4MXDA 3IQGX 4U2CA 5BV8A 1II9A 4NJEB 3ENNA 5KYXB 3OBIA 3ZDZB 3IT2A 1JSXA 1NNSA 1WSWA 1M0WA 3DNPA 5JZ9A 4KHPB 2YFYA 1G20E 3MJEA 3ROGA 3W6OA 1S1CA 3AVUA 1Q7TA 2C8JA 3IULA 4I0WB 1PNQA 1WZIA 4JI3B 1TL7C 1PK7A 4LC9A 3GGDA 3E0QA 1L8QA 1QP0A 1I0IA 4YUWA 1SCUB 2I2BA 1K3TA 3LPLA 2Q0SA 4Q1FA 3FX2A 1NBME 3RUCA 3K70B 4CEIA 3FJOA 2F00A 3N0XA 4QJ3A 5HHTA