2RBEA

The discovery of 2-anilinothiazolones as 11beta-hsd1 inhibitors
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
260
structure length
259
Chain Sequence
EEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The discovery of 2-anilinothiazolones as 11beta-HSD1 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
total genus 94
structure length 259
sequence length 260
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2007-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2rbeA00
4CL8A 5JO0A 5IF3A 2AG8A 3RFXA 4QTZA 4BGEA 1PQPA 3RFVA 2BRUA 3ROQA 3WGIA 1IHYA 1N7GA 4GAEA 4BMVA 4WLUA 2WYUA 1QV7A 4XYLA 1WW8A 2EV9A 4CJXA 1H2HA 3HDJA 2Z1NA 2WE7A 3HADA 4DXHA 4ZHSA 4D0SA 5EQFA 3WS7A 4Q3CA 5CPBA 4BO2A 1QYCA 1Q7BA 3ABIA 5C5IA 1PGNA 3WOHA 4BVAA 3S2EA 2PK3A 4KQXA 3A9WA 1HLPA 4WLVA 4PLWA 3RUFA 3JYPA 4PLVA 2ZQZA 5I8WA 4J2HA 3JQDA 3BMQA 2ZK7A 4A2CA 3BA1A 3RAJA 4DVJA 1GV0A 3HN7A 3ZV6A 5IJZA 1GZ6A 3H9JA 3JSAA 4QFCA 3PJFA 2HRZA 4R69A 4M86A 3FCOA 4UEKA 3CSDA 3C1OA 3BTUA 1E7QA 2O3JA 1P1RA 3IC5A 3IUPA 3TOXA 5A03A 3ZCXA 3ZW8A 4W9NC 1MUUA 2WTBA 1ENZA 4DQVA 1EBUA 2DBQA 2ZCVA 4PZDA 2QRLA 4J1SA 2C2YA 2Y0DA 1LJ8A 5F1OA 3BMCB 1VJ1A 5HS6A 2A4KA 3TPCA 4ALNA 1P31A 2OBNA 3JQ9C 3RCBA 3T7EA 5H81A 5THQA 2HQ1A 1NASA 3WWZA 3DZGA 1HL3A 4BL5A 3F5SA 4G81A 1PWZA 2QZZA 1GAEO 4LN1A 3WNVA 2GN6A 4F45A 4LW8A 1E7WA 5A06A 3AOEC 2YYYA 3D64A 4DA9A 4Z9XA 2I6TA 4U0KA 3AWDA 4R1SA 3H3JA 3T4EA 4L73A 2ZIZA 4XKJA 3JYLA 2EERA 5HTOA 3X2EA 4J1TA 1OC2A 2P4QA 3GR6A 1YONA 3AY3A 4YAGA 4C4OA 2A35A 2HAEA 1PWXA 4YTEA 1ISGA 5FYDA 3W4KA 4CLOA 3MJTA 4G2NA 3U4IA 1AUPA 1OZAA 3ZWXA 2DKNA 4JIGA 3NGXA 3JD0A 3TZCA 2AQ8A 4IJVA 4CMHA 1NNUA 3BMNA 5IZCA 1CF2O 4UVEA 4XR4A 4A73A 4XGNA 4TKMA 4IZHA 5FI5A 4E5KA 3NDJA 2IXAA 2ZYDA 3BMOA 2DU8A 2GGSA 1LSJA 2FRDA 1BG6A 2PD4A 4ZA2A 3ICCA 5KJEA 3D4PA 4ND4A 4CMBA 5GZ1A 1UAYA 1Z45A 5JW6A 1QYDA 4HNGA 4MP8A 3DZIA 1A27A 1TT5B 3AI1A 1XSEA 3EK2A 2FMUA 5TJ9A 5L4LA 4I5FA 3SJUA 2G17A 2XOXA 1DRWA 4YRBA 2GPTA 3JQBC 1Q2XA 3TQHA 4PLHA 2OOSA 4KUHA 4H7PA 4CM5A 3K2BA 5EJ2A 3TDKA 4J49A 4D43A 2V65A 3MOIA 2D2IA 3EMKA 2WYVA 1U2DA 3QWFA 4CUJA 5IG2A 1Z73A 1LQTA 2RH4A 3DEYX 3T7CA 4CM4A 4E2YA 5DCUA 4JCOA 1G0OA 2ILTA 3JQ9A 4ZVVA 1CQJA 5K6AC 2XF8A 1ISJA 3CMCO 4B7CA 1O89A 3TZQA 5C7LO 3AY6A 1PX0A 4W6ZA 2W2KB 3GRPA 3QVXA 4CLHA 4CM8B 2UUPA 3GNSA 1GUYA 2X23A 4YQYA 5CP8A 2RCYA 2X22A 2X6TA 3IJPA 4LVUA 4NG5A 3L0DA 4E2XA 4NJMB 1WP4A 3VDRA 2X9GA 4ND2A 1BMDA 4PG8A 3PEFA 3JD1A 3WR5A 3GAFA 1F14A 5L51A 2PV7A 5I9NA 4IDCA 2BFPA 3E5RA 4AFNA 1UP4A 5TRTA 2AEFA 2DTEA 1DPGA 1KS9A 5L95A 1YQDA 4KUEA 3G0OA 5DBGA 2PFGA 2JFGA 3QY9A 4U6QA 4YJFB 1KVTA 3AY7A 3D5QA 4CLRA 2HRBA 2OP1A 4YJFA 1U9JA 4J91A 2Y99A 1A7AA 3PFFA 3R1IA 3R3SA 3AFNA 2PKQO 3HQ4O 4UUNA 1I33A 3OEYA 3MWEB 4DLBA 1TB4A 2NACA 3Q9NA 4D3DA 3BMQB 4R9RA 3RJ9A 2P68A 4ALMA 1LA2A 5TSDA 1NQAO 4HFNA 3STHA 4XYEA 2IDZA 1X0XA 3AK4A 4MPDA 1ENOA 1PJTA 1ONOA 1HWYA 1GUZA 3V1TC 1GD1O 1L7EA 1RM4A 1EDOA 1B3RA 3NEPX 2PA3A 4BKUA 3EVTA 1MFZA 1I01A 1PJQA 2NVWA 4TVBA 3GFGA 4RV9A 3EY4A 2GF2A 4BNLA 4OOFA 1UDBA 3P19A 4UUMA 1GQ2A 1Z82A 3RUCA 2DC1A 4URFA 2X5OA 1ML3A 4JP3A 5BSFA 4RPGA 4IXWA 4CM9A 3PQFA 1AGNA 4U0JA 4J4HA 3DBLA 2O7SA 3GNTA 3IS3A 1YOVB 3H9EO 3ZI0A 1YB4A 2V6FA 4FGSA 3AUAA 5JFOA 4NI5A 4XA8A 2BFAA 2P9CA 4IJKA 3D1LA 3VTZA 2I67A 1ID1A 3DBRB 3QWBA 4JNKA 2VOEA 3ICPA 3JD3A 4EBFA 1QV6A 3JYNA 4ZICA 1NM5A 1WLYA 3I9OA 1ZK3A 3VZPA 2Y1EA 2J5KA 1TT5A 1KVRA 3GPIA 3VZQA 3WBBA 4YT8A 2JD1A 1X13A 3RKUA 4IDFA 4MJLA 2FPGA 4R9SA 4BMNA 4YDRA 4IDEA 3ASUA 5KJ6A 2VUSA 5I9LA 1HEUA 1Z7BA 4XIYA 4NBUA 3BMOB 4RO0A 2C07A 1PEDA 3ETEA 1SB9A 2JL1A 1V35A 2ZJ0A 2J3HA 3ONDA 3U4DA 1A72A 5CFZA 2HK9A 2ET6A 3BTVA 4OO3A 1ZZEA 3JQ6A 3AOEA 5FI3A 3SVTA 3PHLA 4XD2A 4YAJA 1D8AA 4OQZA 4CMEA 1SCUA 3S2FA 1FK8A 2YV1A 3ZHYA 2OP0A 4CQMA 2WD7B 1NAHA 3WYCA 1FMCA 3KSZO 4AJPA 2J3IA 1E1KA 1NYTA 1XG5A 2PH3A 2HLPA 2EJWA 3I1JA 3ZNOA 1V8BA 2VWPA 3U4CA 3RBZA 4YA6A 5KIAA 3C1AA 3ETDA 1ADCA 2DPHA 5DP1A 3RD5A 4YPOA 3QVOA 3UCEA 4D41A 4ZN6A 2GZ2A 3VDQA 2Y67A 3DO5A 2EXXA 3DONA 3TF5A 1I8TA 3JQBA 2B0JA 4YXFA 2DBZA 3RFTA 2ZKLA 2Q2WA 5KJCA 4DUPA 4HKTA 4PGFA 3GVXA 3V2HA 4BUCA 1H9AA 4WECA 4UVDA 2PLAA 4YWJA 2DFDA 4QT0A 4XYBA 5JY6A 1W6UA 2NU8A 1MFPA 1O8CA 1C0LA 3RSHA 4EJMA 2EP7A 3G49A 5BSGA 4J7XA 1HRDA 4OXYA 3SC4A 2BI7A 5C7IO 5L3ZA 4CQMB 3ZU4A 3AU9A 2P9GA 3OJOA 4CR8A 1A4UA 3DOJA 4NH4A 2Q50A 1Q0QA 4A10A 1B3BA 1WDLA 1D1TA 1PS8A 2WEKA 1XLTA 4JN6B 3TOZA 1XCBA 1N1EA 8ADHA 3U62A 1E3JA 5KOIA 5MGBA 5ENDA 2C54A 2O3SA 4PCVA 4DGSA 1YL7A 5JAMA 2Y1FA 3OA0A 2FWMX 2CZCA 2CNBA 3TRIA 4MKXA 1B0AA 1V3VA 3ZWNA 3HG7A 2Q3EA 1KEVA 1RJWA 4KQWA 4RZHA 3DOOA 4CM7A 2P5YA 2BFOA 4E2WA 4E5YA 2QX7A 4MOWA 1K0UA 2HU2A 3GF4A 4CMEC 1SBYA 1ZUD1 1LI4A 2DTDA 1N2SA 4TVOA 3VVBA 4E32A 2DUUA 1Y8QA 4XGKA 3GVPA 1IHXA 1UXJA 1X14A 1EE9A 3F4BA 1T2AA 4GBJA 5DBIA 3DFUA 1T2EA 3RASA 3RVDA 1R4NA 3KOUA 5EERA 4GX2A 4YBZA 1D7OA 2W90A 4IQGA 3U4HA 1I24A 1HXHA 1YVEI 1UXIA 2C20A 2W2LD 4B3IA 2NTNA 4UEOA 4D79A 2B37A 2EGHA 4A27A 3M2TA 4J90A 4OHUA 4UVIA 5U4QA 3GMDA 1GY8A 1U4OA 3ZWAA 2NSDA 3GZ4A 4BNVA 4BV8A 5TIIA 2XXBA 4HNHA 3E9MA 5CPFA 1QMGA 5L4NA 2PNFA 3FWZA 3LVFO 2EJVA 1CETA 4DYVA 4DWVA 3IQDB 1SOWA 2GN9A 3UVEA 4UVGA 3F3SA 3ENNA 4YT4A 3TNLA 2Q1TA 3MJ4A 3OHSX 1E6UA 3KLPX 3HB4X 3ZU3A 2AG5A 3FPLA 1E5QA 4RVGA 1YKFA 3V5NA 5IXSA 4FFOA 4PLFA 1Q7GA 1N9GB 1NWCA 3INRA 4ZJUA 1LDBA 1QRRA 3P2OA 4ZQFA 1W4ZA 4O5OA 1OMOA 2DM6A 3GUYA 2Q4BA 4GWKA 2PGDA 3FRJA 1KC3A 2R00C 2YDXA 4I08A 4II3A 4WCDA 5TT0A 3WTCA 4BOYA 4Z9FA 1D4FA 3FTNA 4TZTA 3BAZA 3GDFA 5L9AA 2E48A 1GEEA 3KSUA 4S1VA 3TZHA 2EP5A 5GMOA 2AE1A 2CD9A 3VKUA 1UXKA 3P2YA 5L7WA 3B20A 3ZHZA 1KEWA 2JCVA 3ZWOA 1HDYA 4QXMA 4NJMA 3Q2IA 1PJSA 1HDRA 3OA2A 3OMLA 2NUAA 4Q3BA 1JLLA 1PIWA 4CQLB 3SX2A 1LTHR 3FR7A 3LLSA 4OKIA 4WKGA 1E3IA 4BO0A 3H2SA 5J23A 1E3WB 1EQ2A 4CM8A 3JYQA 2X5JO 1DO8A 2VHVA 2VRCA 4EJ0A 3ZWCA 4K6CA 3QJ5A 2Q1SA 4MVJH 1I2BA 1WAMA 4MVJE 3R0IA 3W6UA 1BVUA 1X0VA 2X9NA 2CMDA 1Q7CA 4UEJA 1YQGA 2JHFA 4YR9A 5IDXA 1K3TA 5G0VA 2B4TO 1LC0A 5F1PA 4BNTA 4OIMA 3OJFA 2I76A 2EW8A 4NU6A 2FHSA 3QWHA 4PZCA 2IE0A 1UAGA 1Y8QB 4WOJA 4F6LA 3QRWA 3FNGA 5CEFA 1JKFA 1E1LA 1YXMA 2DAPA 3C8MA 4IPTA 1C0PA 5IFLA 4GQAA 3WYBA 1PSDA 3KBOA 3VHRA 1SZJG 3SC6A 2YUTA 4W82A 3VTFA 3PYXA 3KEQA 1PL7A 4BHTA 3WGOA 2PD6A 1DBVO 1HDCA 1XQ6A 2D5AA 4MVJI 3GQVA 3VPHA 2G82A 2RHRA 1KC1A 5CDYA 1GYPA 3CZRA 3IUSA 1DB3A 2B83A 4O1MA 3W8EA 1KIFA 1TA4A 2AHRA 3F9IA 3HWRA 1PQUA 1U5AA 3OIGA 4U8GA 3GC6A 4AJLA 2GYYA 1SC6A 4N5NA 4DQXA 4IMPA 4Y6RA 1JKJA 3UHAA 3JQFA 4WOKA 1D1SA 1ISFA 1VC2A 2YY7A 2DQ4A 1CJCA 4OJNA 3QVWA 1E3WA 1PZEA 4KP7A 2OXIA 4DC0A 3G1UA 3OQ1A 1XQ1A 4LCEA 4IJUA 1IY8A 3PDJA 3NUGA 1HETA 3A06A 4TWRA 3GHHA 1VL8A 3FHLA 1O95A 2YJZA 3ADPA 3D0OA 3BHMA 5A9TA 2HK7A 2GO1A 1GFSA 3PP8A 3GDGA 4RQTA 1X7GA 4R16A 4H16A 2VCYA 1MXFA 1XEAA 1Y1PA 1NP3A 3RC7A 3E82A 3QV1A 4CM9D 5H82A 4FD3A 3N7UA 1DFHA 1B8UA 1G0NA 3KETA 1C1DA 3RC9A 5G0SA 4YRAA 3F4LA 4XYGA 4MVJP 3I9LA 4RPJA 3H5NA 3S2IA 4E5MA 4ZD6A 1GU7A 3Q2KA 3E9QA 1N5DA 4BNMA 3PGXA 3DZKA 2PY6A 4JROA 4PN3A 2DBRA 5CAEA 1EFLA 1JW9B 3HUDA 3KLMX 4TSKA 3ZNPA 4J0FA 1L1FA 1HTBA 3ZNNA 3W8DA 4L76A 4CM1A 1PR3A 4IIVA 5I7FA 3IL2A 5DP2A 3KYDA 1H2BA 4RF4A 3VPGA 2OHXA 3ZV4A 3W1VA 2VWQA 3L77A 5EL0A 4ALLA 1M67A 4XDYA 3WJAA 1E3LA 4D0RA 7MDHA 3OF2A 4MIOA 4YT5A 3GOHA 5KVSA 5L40A 4TZKA 3BTOA 3Q3CA 2E4AA 1SB8A 3BZUA 5BR7A 2W2KA 1ISIA 4OKNA 1U4SA 2C59A 1R0KA 1Y81A 2D5CA 4RDHA 3ANMA 3WMXA 3P5SA 4QUKA 4CQMD 4J9VA 3WQRA 5LDHA 1NHWA 4XYMA 3LLVA 3OM9A 3UH1A 1J0XO 4K26A 3NTOA 1DOHA 3AUUA 1Y9AA 4A03A 3UGKA 3I5MA 1NR7A 4MVJA 4R1UA 1KERA 2JJYA 3ZU5A 1BVRA 2PKQP 3FWNA 4BO6A 2GASA 4YB8A 3TZ6A 5ADHA 4GPD1 3PWSA 1VL6A 4BKQA 3KV3O 1PR9A 4IQ8A 4II2A 1N92A 3WQSB 2NVUB 3K2EA 3PFWO 4LCJA 4E2ZA 4WNCA 3OH8A 1S7CA 3WIEA 1T2CA 2NU6A 4EI2A 4GX0A 3GMSA 4X54A 4NR0A 3OP4A 3RBVA 4TQGA 3W8FA 3O9ZA 3LYLA 4NBTA 4R54A 4IINA 1HYEA 3OICA 4IBOA 5HRUA 1EUCA 1EDZA 2O3TA 3I52A 5CEJA 3G79A 3PZBA 4ITUA 4RQUA 1T1SA 3H4VA 1H6BA 5B4TA 5CG1A 2D0IA 2UUOA 3BXXA 3VH2A 4OQYA 3CZMA 1NXQA 1DC5A 3BYZA 4HY3A 4MIEA 4YJGA 1LDEA 3DDNA 2PGJA 2V7PA 4M87A 3U9LA 1E7MA 2R2GA 5B4UA 4MP6A 1BXGB 1E77A 3KTDA 3KYBA 3PJEA 5KJ1A 1ISHA 1U28A 1LEHA 4OMUA 4FOSA 3IMFA 1LLDA 3DZBA 3KM0A 3ADOA 2QHXA 1JWAB 4NK4A 1TLTA 4DPLA 2GUGA 3BHJA 3T4XA 1O6ZA 2NVUA 1IOLA 2GN4A 3UOGA 4IDBA 1DEHA 1LC3A 1PGOA 2Q1WA 1CRWG 1FDSA 4ZU3A 4E33A 2I65A 4ALIA 4I5EA 1LDMA 1SAYA 2F00A 4Y9DA 1MP0A 1Z7EA 2DTXA 3WG9A 3PI7A 3RUIA 3UN1A 2VOJA 1PS0A 4HFMA 1N8KA 1R4MA 2OFPA 4BO7A 1ZCJA 2RAFA 1ENYA 2UDPA 4TMFA 1JN0A 1QYVA 5B4VA 1P9LA 2BGLA 1R4NB 1H0KA 2D8AA 3GT0A 1CDOA 3N58A 2C7VA 3PQEA 4C7JA 1GZ4A 3S2GA 3WNQA 3GH3A 3NRCA 1YDWA 3MJVA 2QYSA 2H1SA 4PIVA 1I2CA 1DJQA 3ANNA 1AE1A 4Q9NA 2AA3A 4ND5A 9LDBA 1GZ3A 4GL4A 1C1XA 3KEOA 1GUFA 2AXQA 2OL4A 4GKVA 3CKYA 5EPOA 5FF9A 4DTIA 1ZK0A 5KWEA 2JHGA 3DAPA 2JCYA 4RPLA 3UKOA 3PYLA 1PGPA 3VKVA 1V9LA 3ZWWA 1PS9A 1RKXA 1XU7A 4W99A 5TQVA 5F1KA 1RPNA 2B36A 4D7AA 1ZXLA 5LCXA 4Z0TA 3OQ6A 2GD1O 1ZJYA 3MCVA 4OH1A 2Q2QA 4WEOA 4XRRA 1RYEA 5MDHA 3ZWPA 5IZCC 4YAIA 3D4NA 3VPXA 2H5LA 4DIFA 3WICA 2GERA 4PLTA 1U3VA 2VTDA 3D3WB 3PHGA 2XPCA 3DAFA 4MKZA 4I1IA 1KY5A 3HN2A 1U3TA 3A1NA 1I36A 1NVTA 2UVDA 3AU8A 1VRWA 3FF4A 3MJEA 4J4BA 1E3EA 1AXEA 3QLJA 4KWIA 1TVEA 3HJAA 1A5ZA 1K6JA 2EIHA 4AJ2A 3GY0A 5AYVA 2X0IA 3DMTC 3MTJA 3PK0A 4YCAA 3PRJA 4S3MA 1B16A 1DIBA 2BGKA 3F5QA 5THKA 1XHLA 2O7QA 3O26A 4HBGA 1PZHA 3PHHA 3PJDA 3H8VA 2EKQA 4DQUA 5F5NA 1CYDA 3GHYA 1QXSA 4BNXA 5ES3A 1ZEMA 1U2GA 2EGGA 4CR6A 1M6HA 3JV7A 2YQ4A 5JYDA 1MV8A 3DFZA 3QWIA 4BNIA 1W0CA 4BO4A 2AEJA 3RU9A 3K96A 4B7XA 4HWKA 1Q0LA 4RVDA 3CMMA 3WLEA 4BO8A 1X1EA 2DFVA 4CV1A 5HA5A 3DBRA 4CMIB 5I8ZA 1LLCA 5DCWA 5A9RA 1O9BA 3F47A 3GGGA 4H3VA 3ZHBA 4JBIA 3JQ7A 2BHLA 5LC1A 5IAAA 1E92A 3L4BA 1E6WA 4R01A 1HDGO 2V6MA 1XDWA 2EHDA 2YZ7A 4KWHA 5JAZA 2NU9A 2Q99A 4XIJA 2JAPA 2B5WA 3PZRA 1XU9A 2Y05A 3PHJA 5L4SA 1PGQA 4J1NA 1H6DA 3M2PA 3AW9A 4CV0A 3RU7A 4E4YA 2IEBA 1QLHA 5ENVA 3OECA 1YH3A 3OSUA 1DLJA 1BRMA 3GA0A 1WDMA 2GNAA 3SLGA 1GR0A 2IODA 4J43A 3GEGA 4JLWA 5JMPA 1LDYA 4RF5A 3E8XA 4UAGA 4R1TA 4AJ4A 1P1IA 5CHEA 2D59A 4P4GA 1PQWA 4NQZA 5JPIA 3WLFA 4F46A 2OMEA 4E30A 2NVBA 2X4GA 2X58A 3WGTA 4P38A 6ADHA 1H94A 2W98A 3RWBA 1IB6A 1ONPA 1HYGA 3F1KA 2ZTVA 2I3AA 4NDNE 2I9PA 3HFSA 3B6ZA 3IJRA 5DT9A 1U8FO 4O0LA 1XGKA 1N1GA 1VSVA 2RBEA 2UV8A 4CMKA 4LSMA 2JAHA 4BQPA 1ULSA 2NADA 2YV2A 2GCGA 1X7DA 4UVHA 4FS3A 1Y5MA 3K73O 5FFFA 8LDHA 1PJLA 4J7CA 4AJIA 1WXDA 2CVZA 4B3JA 5KVCA 4L75A 3H9GA 1F12A 2JD2A 3E03A 3C85A 1PL6A 4DRYA 2HUNA 4P22A 4RPHA 4DBVO 4EDFA 4FBGA 3HHPA 4E12A 4NFYA 1DJNA 4RL6A 1GQYA 5CDUA 4XGIA 3I9MA 1R66A 3BMNB 3WFJA 1ZXBA 4FJ0A 1ZSYA 4M89A 4PVCA 2CDAA 3M1AA 2X8LA 2C0CA 4ID9A 1GCOA 3AM5A 4CUZA 1YWGO 2R00A 3UFXA 1YS4A 4L4SA 2Y1CA 5A1TA 4N7RA 2Y0CA 4UULA 1IYZA 4DYDA 4N18A 4GLLA 3RUHA 2I99A 3DOCA 1BGVA 1NPYA 3QWAA 2X7HA 1YBMA 1Z74A 4KZPA 1ZNQO 1N9GA 3JCZA 1HE4A 1DHRA 4Y67A 3ULKA 3VPFA 4FN4A 3PWKA 1A7KA 4XB2A 4BNUA 3VZSA 5JC1A 4WCFC 1NQOA 2B35A 3WMWA 1QYXA 2G5CA 3H9UA 3HDYA 5DNAA 3PGJA 4G5HA 2UYYA 3WQQA 1P0CA 3A14A 5EN4A 1E5LA 3BMCA 4B4OA 4FOOA 2VZ0A 3A28A 1WMAA 1Z75A 4CLEA 1PL8A 1LDGA 3E48A 1W73A 4RPKA 5I7EA 2BI8A 2YHUA 2WE8A 3AI2A 1ZMTA 3GEDA 1MC5A 2JCXA 5KTKA 2Q45A 5IZ4A 1NPTO 3I3OA 3QP9A 5A4DA 1HSOA 4IY1A 4N5LA 4AJNA 1UR5A 1RWBA 1KVUA 3TSCA 3MTGA 2XXJA 4R3WA 5A9SB 4PZEA 1C14A 1YJQA 2YQ5A 3G17A 4PG5A 4BNHA 3PVZA 1PZGA 1BXKA 4IZIA 5ITVA 4EEXA 2C82A 1K5HA 5DN9A 4RJTA 4Z3KA 4KDEA 3ZZNA 5KJFA 3HE3A 2BH9A 4CPDA 2SCUA 4LK3A 3O8QA 1DHTA 3IDSA 1HF3A 5TGDA 4A5OA 2G0TA 3RROA 2BLLA 1RM3A 4FB5A 3K6JA 3WJ7A 4EEZA 5GY7A 4NBWA 1NVGA 2BGMA 1OI7A 3RUDA 1F8GA 1SNYA 5AQ1A 2WD7A 1B14A 2I5PO 2VYVA 3JQEA 4QO8A 5G2OA 1C0IA 2OZPA 3X2FA 3VZRA 4FJ1A 3LSYA 4WPGA 4ZRNA 2DBVO 1FDTA 3LT4A 4QECA 1DIGA 5DBFA 2PZLA 2FSSA 1XELA 2BMAA 3U0BA 1K89A 3RI3A 2OUIA 1I30A 4J4TA 4OM8A 4BO9A 4YJHB 1DIHA 4H15A 4NBRA 3OQBA 5JY1A 4WLNA 3I9JA 1LU9A 1WNTA 3B1JA 4BO3A 5JXWA 2FN7A 1P74A 5JBIA 3NX4A 3H3FA 5IN4A 2C5EA 2O3UA 2CF5A 3H6KA 4NBVA 2V6BA 4N54A 1YGYA 3FN4A 4I9UA 3R6DA 3GVHA 3LF2A 4CLOB 4E13A 3CXRA 3ORFA 2VTEA 2AEMA 4GMFA 4R1NA 3KHUA 3L4SO 1BDMA 5DZSA 5H83A 4XQGA 5L7YA 3WYEA 5K6AA 1GADO 3MZ0A 1BDBA 2VZ9A 2Y68A 4M1QA 4M55A 4PLPA 5JDIA 3O4RA 5A05A 2ZYAA 1A4IA 3ZGYA 3Q9UA 3WGGA 4RLSA 4EW6A 4Y6PA 1NFQA 1TT7A 3BHIA 3TZKA 2CSUA 4I9NA 4PFJA 5JYEA 2Y93A 2WMDA 3FNFA 1CEQA 3OJLA 3VVCA 2FPIA 4QQRA 2VNAA 1E0DA 2ZTUA 1XKQA 1VE9A 4AJEA 5KCZA 5FWNA 4W7IA 3QIVA 5JDCC 4RGBA 3PHIA 4IMRA 2GZ3A 2O3QA 4LSWA 4BO5A 1DSSG 3WGZA 1YB5A 3E5MA 1E7SA 5ICSA 1RM0A 4RZIA 1F0YA 4KOAA 1PJ4A 1K6IA 1AXGA 3O8QB 2H6EA 1AHHA 1IZ0A 4Y8VA 5F3RA 4MVJD 3Q1LA 4F6CA 4J9UE 1T4BA 4M8SA 4YJHA 3C1TA 1IL0A 2VHWA 2Q4EA 2EW2A 2I3GA 1GL3A 4RCVA 4XQEA 3HB5X 3DWFA 3EZLA 3INGA 3HNPA 1HZJA 1KYQA 4FC7A 4C7KA 1R12A 2W2LA 1MG0A 5T6BA 3LT0A 3Q0EA 3Q11A 4XZ3A 1ZBQA 3Q6IA 1U3UA 2WWRA 3DBHB 4DLAA 3W4JA 4BO1A 3L6EA 3DC2A 1K2WA 4Y6SA 4CLRB 4CV2A 1KY4A 2O23A 2V6GA 3GNQA 3W4IA 4TRNA 1GYRA 2Z95A 4FQ8A 3ZH2A 1EMDA 1NFFA 2J5RA 1U7TA 4W9NA 5TS3A 2IZZA 3CTMA 3S55A 4XJTA 1ISMA 1TI7A 3KO8A 3ZU2A 3DL2A 3C3XA 5IN5A 1IE3A 1TEHA 3H5RA 1F17A 4OSPA 1HLDA 1K6XA 3FNHA 2HO5A 3PXXA 1MX3A 3SXPA 1SEPA 3DBLB 1DFGA 2WSBA 1A71A 4ZQHA 2NU7A 2IXBA 1UDAA 5TT1A 3UW3A 4B3HA 1ARZA 3E18A 3KRTA 1QLJA 1QORA 1HE2A 3FD8A 1EE2A 4MIYA 1XA0A 4Y98A 5BNTA 2DVMA 4CMAA 5AXAA 4ZQBA 1C3VA 4GX5A 3ROMA 1BW9A 4B79A 3JD4A 2VRCD 3O38A 4EYEA 2NTJA 3KYCA 2ZYGA 4AJ1A 3IP1A 1BHSA 3SJ7A 4GVXA 3EZYA 1LSOA 2QRKA 3H9QA 2QQ5A 4IUYA 4OAQA 3WSVA 4DC1A 5BNIA 1ONNA 4Z3DA 2O50A 4DMLA 1Z6ZA 4E5PA 1JKIA 1YE3A 4FGWA 1PJ3A 4Q3AA 4RF2A 3DXFA 3WDSA 1V3UA 5I7SA 4CUKA 1DXYA 1HSZA 5A04A 1VSUA 4UUPA 2J3KA 2EWMA 4K28A 2X1HA 1BSVA 1U8XX 2PZMA 1SO8A 4FFPA 1IULA 1T26A 4RORA 1UZMA 2C7GA 1P0FA 5ICMA 2VHXA 2Y1GA 3JQCA 1EK5A 1C1XB 1M6WA 2PR2A 4DPKA 4Q39A 2W8ZA 3ANLA 5T8KC 3WXBA 2C29D 4TRMA 2Q46A 1ZFNA 1G6KA 2YDYA 1Q1NA 1YL5A 4HP8A 4D3SA 1VJ0A 3PJGA 3FBTA 3KB6A 4E31A 1EZ4A 4OXNA 4NK5A 1P77A 3BTSA 4L74A 1GPDG 5A9SA 5B37A 1CWUA 4FDAA 4BNZA 1HDZA 1X1TA 3ITDA 4MVJF 1O94A 2FY8A 3E9NA 2GZ1A 1RYDA 1IPEA 1ZH8A 1GPJA 1NX6A 1MXHA 3IKVA 2A9FA 5B12A 2HSDA 3JQAB 1XWFA 5L53A 5F21A 3DHYA 4DMMA 4BKOA 1Y9EA 1EQUA 1FJHA 3E6AA 4EITA 1V0JA 1DFIA 3FPCA 1YBVA 4OGWA 3VH3A 4HV4A 3ZWMA 1JWBB 4BGUA 1ADBA 4Q3EA 3ASVA 4NFHA 4F3YA 4JBHA 1BW9B 2YFHA 1R15A 4M49A 1IZ9A 1XIVA 4IDGA 3DQPA 1F8FA 3JD2A 4FFNA 4GGOA 4D44A 2IZ0A 2X9VA 2YW9A 1E1MA 4A7PA 3K92A 4CM6A 4JXKA 2FR0A 4BNWA 1MLDA 2A94A 3L9WA 4GLOA 2VQ3A 2VZ8A 5A3VA 3F46A 1QKIA 1E7RA 2C2XA 2D4AA 4Z6KA 1I5RA 5I9MA 5BSEA 2IYPA 1BXZA 3IP3A 2J8ZA 2JFFA 3NAQA 1TXGA 4YRDA 1KVSA 3C7DB 1QG6A 2G76A 4J0EA 5JAQA 5G0TA 1JU9A 1LLQA 4JJGA 4OSOA 5T8KA 5A5EA 1B8PA 4ESOA 3LZ6A 3OETA 3GGOA 4L4RA 1JAXA 3JQ8B 3ZV5A 4B8ZA 2ZJ1A 2HMUA 2YV3A 3IOYA 4FSHA 2ZQYA 1JAYA 3G3EA 5JCJD 4NZ9A 5EIOA 1DIAA 1EVIA 3OIDA 4GKBA 1G1AA 2H63A 1C1DB 3RIHA 4CMJA 4ZQEA 2UAGA 4ALKA 3RC2A 4JJIA 2C5AA 3DR3A 2NTVA 3ON5A 4I8XA 5BSHA 1JQBA 2OGUA 1UH5A 4BNNA 2VN8A 3B1KA 4ND3A 4EUFA 3CUKA 3GGPA 3PIIA 4IDAA 5JAIA 4GWGA 2VT2A 2LDBA 1WZIA 5CDSA 2IRWA 4FFLA 4YVFA 4DPMA 1QSGA 1VKOA 2OORA 2O2SA 5JO9A 3IIEA 3M1LA 5TC4A 5K0ZA 3AI3A 5COAA 2POQX 2VYNA 1B7GO 1T24A 2VT3A 1YBAA 3FSRA 4TRRA 5DCYA 4HX5A 3CIFA 2F1KA 2R6JA 2CVQA 5FEUA 3EVNA 1V3TA 4HFRA 3TJRA 2QZ9A 1EUZA 4M54A 4J3FA 4PG7A 5JCXA 2FOIA 1T4DA 3ZN2A 4JGBA 3EUWA 3OFSA 1J6UA 4TROA 3LDHA 4A26A 3KXDA 4J6FA 1P33A 2NV6A 2DUWA 5COQA 5K9ZA 4U7WA 5T64A 2RHCA 1HDXA 2BELA 1U3WA 1QR6A 3A4VA 2PH5A 2O3RA 1SOVA 3D3WA 3NGLA 2CFCA 4YEDA 1F06A 1ZEJA 1C0KA 2YFQA 3SBOA 3U49A 4BNFA 3I6QA 4I5GA 5G4KB 3C7CB 3O03A 1E3SA 1WWKA 1ENPA 3RKRA 1NBOA 4AG3A 1ZSNA 2ZB8A 5G4KA 4DL9A 1VJTA 3EGOA 4E3ZA 2FSVA 2Y1OA 2J5QA 1R16A 4EZBA 1KEUA 4R68A 2CDBA 4ONEA 1DIRA 1KVQA 4L8VA 4RVHA 3H7AA 3QSGA 4DIBA 5EQDA 5F5LA 2WJPA 3I4FA 2ZATA 3EHEA 1UP6A 3WGHA 1R0LA 3V8BA 1JTVA 1FDUA 2Z1MA 3DTYA 4WE3A 3TFOA 1UXHA 3F6YA 2AQKA 5TNXA 4WLFA 4K6FA 3HDQA 1ORRA 2BKAA 1T2FA 1VI2A 3VAZA 1ZVMA 5HWSA 2B4QA 3OJEA 3RQSA 2QIOA 1ZO8A 4B4UA 2W4QA 3S8MA 3D4OA 2E37A 4GVLA 2J3JA 3ZV3A 5A5FA 5JCJA 3JQ7B 2WD8A 3TFQA 3AM4A 4FFRA 3ZWYA 2P91A 5HS4A 4MDHA 1FDWA 4NPCA 1JVSA 2FZWA 3H2ZA 4U5QA 3S1LA 4LRTB 1H9BA 3DMTA 1H5QA 1YL6A 3D5TA 4PLZA 4AJJA 1SMKA 3U5TA 4QX6A 1UJMA 1PJCA 2P2SA 1DC4A 1LSUA 3LC2O 3BIOA 4UREA 4Z0PA 1ZK2A 4FIZA 5BNFA 5G0WA 3ONEA 4I9HA 4JBGA 3DHEA 4J16A 4ND1A 1O0SA 3LF1A 4E21A 3ITKA 1NR1A 2WDZA 4Q3DA 1Y6JA 3NKLA 5L45A 2X86A 5DOZA 2O48X 2LDXA 3UCXA 3I9NA 2XAAA 3L07A 4HXYA 1JDJA 1CIVA 1Y8RB 4GSKA 4B4WA 1S6YA 3CPSA 1X7HA 1WDKA 4LMRA 5ER6A 2VHZA 4XDZA 5JMWA 1LDNA 2GSDA 4L0QA 4DIOA 2ZB7A 5DDIP 1BTOA 5KNLA 2Q49A 4PRLA 4L4XA 3TL2A 4PLCA 2AQIA 3FNEA 1UZLA 3GG2A 1HZZA 4FFMA 1PGJA 1CERA 3LC7O 5TF4A 4LRSB 3QVTA 5IDWA 3PQDA 4WCFB 4R4JA 3NV9A 3JQGA 1HT0A 5LDGA 3W6ZA 4EUEA 3LT2A 4IJWA 2VYVD 4WNIA 1LXCA 2EKLA 2Q2VA 4R3NA 3H5AA 2HMSA 2Z5LA 3ZWVA 2CUKA 1EUDA 1UP7A 4BKRA 5IXYA 2E82A 1U7HA 4HFJA 3GK3A 4FCCA 3NT2A 5G0UA 1P44A 2DLDA 5DF1A 1ZSVA 4A0SA 1E1NA 4BB5A 4PG6A 4EUHA 3NJ8A 2PD3A 4I5DA 3GVIA 3ETGA 3FTPA 4JX8A 4CM4B 1ADFA 4LMPA 3JQFC 3QVSA 2J6IA 2QW8A 1WVGA 2VWHA 5CDTA 4AJOA 2QRJA 4YAKA 5EMHA 4YT2A 3QHAA 1DLIA 2EF1A 2HJRA 4JP2A 4O59O 4XWYA 4XRGA 3U09A 5GZ3A 1LLUA 3ZWBA 3C24A 3GPDG 2A92A 2E6UX 4GMGA 4R5MA 3WB9A 4ALJA 4BGVA 4BIIA 3EDMA 1WPQA 1X15A 3PWZA 4EJ6A 3D7LA 1CQIA 1HYHA 5U1PA 3PLRA 4IGEA 4XQ9A 3PDUA 3COSA 5CDGA 5ER9A 3WIDA 5ILOA 3CH6A 1OC4A 1P1FA 4PLGA 4WASA 3MJCA 3AUTA 3EW7A 4K9DA 1LQUA 4LGVA 1N7HA 4E5NA 2YHIB 4INAA 4CLXA 5KVQA 3WSWA 4KMSA 3ROPA 4BV9A 4GH5A 2ZB3A 2TMGA 3SLKA 3TN7A 4ZQGA 5KKAA 4YJGB 1KOLA 1YJ8A 5T5QA 4CODB 2NWQA 1H93A 3B1FA 1OBFO 1I2ZA 3B70A 3P7MA 4B8WA 2VNSA 3UICA 3RBXA 3DBHA 2DT5A 3UAGA 2CVOA 3AUSA 1VKNA 3K30A 4FW8A 4IIUA 2QG4A 2FPPA 1ZK1A 4GGPA 4WLEA 1PU2A 1U5CA 2X0RA 3JTMA 4WUVA 2P4HX 3FI9A 4P4NA 2Y0EA 4W7HA 4D42A 1KBZA 4PLYA 2B69A 3QA9A 1WMBA 3OIFA 4MKRA 3GZNB 4IXTA 4JJFA 4QFDA 1MGOA 1UUFA 5JSFA 3PPIA 1PJBA 5TX7A 3LU1A 1XR3A 2NQ8A 3INTA 4BNYA 4OYRA 2NM0A 1NHGA 2WM3A 2FP4A 2ZB4A 4BKPA 2D3TA 1EBFA 4WGGA 3IAHA 1ULUA 3I4CA 1YO6A 3TWOA 5JNLA 1Y8RA 3WTBA 4IQ0A 5A02A 3K9QO 3OEWA 1E7YA 4OXKA 2IEDA 2CDCA 5AOVA 2BF7A 4B4VA 9LDTA 2CF6A 3V1YA 1GDHA 1I3KA 1AN9A 4Z0HO 3GN2A 2G1UA 3WWYA 2PZKA 3GZNA 1B8VA 2PTGA 5ITWA 3KZVA 4RVUA 1U1IA 2RIRA 3AM3A 4FR5A 5TJHA 5EESA 3M6IA 3NT5A 4Z9YA 2VUTA 3NDRA 3F1LA 3KYCB 1JVBA 4BGIA 3LC1O 1A9YA 1M2WA 2AE2A 3EYWA 1EVYA 2FR1A 3VPSA 1P1JA 2NNLD 4JQCA 3WX0A 3QQPA 5JE8A 1J49A 2B5VA 3GN1A 2FZEA 3NT4A 1M75A 2AW5A 1PJ2A 1LRLA 1NFRA 1W8DA 3DZFA 4ROSA 1NAIA 1B2LA 1EK6A 3KVOA 3V2GA 1IPFA 3ST7A 1DAOA 1QP8A 2GLXA 4HADA 1MA0A 1MG5A 2WYWA 3I83A 4FC6A 4LISA 2B4RO 3GRKA 1ZMOA 1YOVA 1FXSA 2PGLA 2Y66A 4IS3A 1J5PA 5KKCA 1EVZA 1P1HA 3GLQA 1YDEA 1ZKMA 4L9RA 3AOGA 4XCVA 4MVJG 2GDZA 1ZK4A 1L7DA 2GRAA 3DAGA 4W4TA 1NVMB 2FR8A 3MOGA 1XYGA 2IZ1A 5T57A 1LBEA 1PZFA 1NQTA 1ADGA 2BD0A 2NLOA 2VHYA 4XEHA 3RC1A 1OOEA 4UUOA 3VH1A 1DC6A 2P9EA 4QEDA 1KETA 1VM6A 2VYND 1NQ5A 1Y5RA 3JQ8A 3ZW9A 3WGQA 4BB6A 4MP3A 4PRKA 2O4UX 1KEPA 1J4AA 1MC4A 4KUGA 4BQRA 1P1KA 4E6PA 3UCFA 1GCUA 2X0JA 1YQXA 5AVOA 7ADHA 4O6VA 3PIDA 2CY0A 3NTQA 3V1UA 3ROKA 1B26A 3GG9A 3GAZA 3DZJA 4EGFA 4NJOA 1SPXA 4D3FA 4J1QA 1R4MB 3D3EA 4NMHA 5EINA 3CE6A 3WFIA 4CMGA 5BT9A 4WK6A 1JA9A 5T67A 1EVJA 1I0ZA 4MVJM 3EAGA 3NDIA 5AXCA 4ZGWA 2X0NA 1HDOA 1DDOA 4BNKA 3C7AA 5L7TA 1I10A 1I3NA 4DBZA 1GV1A 1Q0HA 4FJ2A 4QSMA 5JDCA 3GDOA 3DTTA 3I9KA 3IKTA 2PZJA 3DBVO 5BQFA 5IDQA 5I7VA 4G65A 5ILGA 3JQGB 1HE3A 2EG9A 1DAPA 5G4LA 1YB1A 4R41A 3LQFA 4ILKA 3I6IA 1I3MA 2HMVA 4TKLA 3EC7A 1T2DA 1D3AA 2HJSA 3HDHA 3HSKA 4LVCA 2ZTMA 4BNGA 4MO2A 4DREA 1UXGA 1E6EA 4D46A 5C7OO 5U9CA 4O63O 3OBBA 2OBYA 5DOVA 1UDCA 4J7UA 3JQAA 3LT1A 1B15A 4RF3A 1R37A 4RLHA 3QW2A 3ENKA 1EEHA 2P5UA 2RH8A 1GQQA 4YYZA 4FPXA 2OO5A 5JLAA 3LK7A 1LUAA 4AICA 4AJKA 1GEGA 2ZTLA 4CQLA 2PKRA 1O5IA 3HFGA 4B7UA 5CG2A 2PWZA 4BS9A 1ZIDA 2NQTA 3KSDO 1IUKA 4WCFA 3VC7A 5COBA 1FF9A 2JFHA 2X5KO 2YHIA 2HCTA 3KUXA 4XR9A 3RUEA 3ZDFA 3AFMA 4HUJA 4AVYA 4RVSA 4AJHA 4KDFA 3AJRA 1FDVA 2I66A 1BXGA 1BWSA 1YRLA 3L4BC 1QYWA 1MB4A 2AQHA 2IYOA 3G1TA 3N74A 5JS6A 4WJZA 5CEEA 4YJDA 4K1LA 1LNQA 2DPGA 1DC3A 1GYQA 4NU5A 2QYTA 4XX0A 1R6DA 4XB1A 4IS2A 5TLSA 2D1YA 4GX1A 5C3MA 4DLLA 4NHEA 4NFSA 3GFBA 1DRUA 2O2YA 4RVFA 4XQCA 4Q3NA 1M76A 3RJ5A 2E49A 3UXYA 4NIMA 4NNJA 1WZEA 1NPDA 1H6CA 3NYWA 1NWHA 4BNJA 3H65A 3JYOA 3VH4A 1P45A 2O4CA 1A9ZA 2TMDA 3NTRA 3WGYA 3E1KA 1ZW1A 3MWDB 4YACA 4D45A 4YAEA 3CINA 4R51A 4GSLA 2JD0A 5HBRA 4CL3A 2HKIA 4CMCA 1R0SA 1I3LA 1I32A 4CLDA 1LSSA 3L9XA 1VPDA 3R3JA 3PTZA 2AMFA 2VWGA 4CMIA 4ZRMA 4BMSA 4AL4A 1LRKA 1V6AA 1OAAA 3I23A 5AXDA 3MJSA 4JK3A 4PVDA 3L6OO 4CR7A 4IGFA 3UF0A 1HKUA 2EKPA 3K5PA 3NJ4A 4WLOA 3VOSA 1GTMA 2GN8A 2VUUA 4XJSA 4YQZA 3CEAA 5IDYA 4RDIA 3WBFA 2HDHA 1P3DA 3TL3A 4KTVE 3PLNA 1RM5A 3KYDB 3DZHA 1HE5A 3U3XA 1T1RA 1M66A 1H6AA 3GUCA 4MINA 3RUAA 4GI2A 2HMTA 6LDHA 1VL0A 4CV3A 3PYMA 3JQAD 3DMYA 4U6SA 2Q1UA 3DHNA 5C37A 5JDIC 2VRBA 1AHIA 3L6DA 3SEFA 5A3JA 3V2UA 3GVCA 4PG4A 1PTJA 3FBGA 3DB2A 4IM7A 4E0BA 3QE3A 2BFMA 1LX6A 1VLLA 2Y1DA 5GZ6A 2EEZA 1SEVA 4CM3A 3FR8A 4P4LA 2GR9A 2H9IA 3K8ZA 4N5MA 5DULA 3ZHXA 5JC8A 1Y7TA 4KTTE 4P8RA 1NTOA 2ZCUA 1T25A 2JKVA 3GEMA 4OOEA 3ONFA 1EFKA 5AXBA 3K31A 1OFGA 4IDDA 4OL9A 1ZJZA 2HK8A 3MEQA 4QO7A 2HMWA 3OJ0A 4TRJA 5HM8A 5KVVA 1DRVA 4J2OA 3UUWA 3ZNQA 3HZZA 4R5HA 1LRJA 1UZNA 4WEQA 5B1YA
chains in the Genus database with same CATH superfamily
1MJHA 2C3MA 3EULA 1Z8FA 1ZCAA 4CFYA 3U19A 5JO0A 5IF3A 1SURA 4Q3LA 3F6EX 4IEIA 4K0RA 4HDSB 1T8PA 1FJ2A 1PQPA 3BZWA 2YUIA 3FUVA 2B3DA 3RFVA 2OHHA 1SFRA 3E3OA 4BE7B 1NVUQ 1P2BA 4ED9A 1X7XB 3WGIA 1CJBA 2FPUA 1YA4A 4JYAB 4M9CA 2VRWA 3DOEA 1E1RD 3H2GA 4TM7A 5H9WA 3ZD7A 2J6BA 3OLQA 1QV7A 4K9KA 1AC5A 4XYLA 1SBNE 5KOJA 3EBOA 1H2HA 3IGFA 4UHJA 2Z1NA 4RJIA 4MPJA 5EQFA 2O8CB 2H07A 4F2GA 4YBRA 3WS7A 3KJHA 5CPBA 3H8SA 4LHVA 4BO2A 2GBLA 4XVQA 5JZVA 3MJDA 3ABIA 2FRDC 3LX8A 4HRXA 2ERYA 5FA8A 3ZDCA 5KUTA 4X3OA 2NO7A 5DX0A 2VJMA 4PLWA 4EY7A 5JPDA 2NN3C 3AJ9A 4J2HA 4WI1A 1L4BA 1NVVQ 2C2GA 2ZK7A 2ZYIA 5GVRA 5K8JB 2IH2A 1I5EA 3RNOA 3C6YA 3JSAA 4K7JA 5GONB 2FSFA 1T3LA 4F6RB 1L4MA 2IWRA 3WP1B 2JBWA 3FCOA 3BSYA 4RTMA 1EBBA 2E7ZA 2XHEA 2XZTA 3AI7A 2O3JA 1AGPA 1RJ9B 3N0TA 1XZCA 1CEYA 2CXQA 3IUPA 5ALTA 2VPIA 4KGXA 3ZCXA 1I4TD 1MUUA 2PT7A 5KDDA 1ENZA 2C42A 4DWOA 3RABA 4J1SA 1E5VA 1RI4A 1Z0UA 2IEYA 1JQLB 3BMCB 3N87A 4X6YA 4MULA 4TTTS 3ODGA 4RENA 3L7MA 2OBNA 3ZYCA 3T7EA 5BVHB 1QQ7A 4HRYA 2V0NA 1S4QA 1Z0IA 2ZBVA 3L7OA 1WXQA 5FKJA 4G81A 1VKZA 1AZSC 2PU7A 2QTHA 1E2EA 1JDVA 1FNNA 2ZB2A 3E7XA 3FZYA 1P5JA 1O6FA 1E7WA 1OLXA 1ZJ5A 3GT7A 1Q44A 1YQUA 2YYYA 1DWUA 3LIPA 4Z9XA 4U0KA 3ROFA 2RHJA 4Q0MA 2Z2XA 3H3JA 1Y98A 5E9JA 2OGWA 2ZFUA 4CNBA 3OZFA 3CUUA 4ACAA 4GYKA 5HTOA 5FOUA 2GLTA 4J1TA 2UYHA 3TW8B 5CXUA 1OC2A 3H04A 1M6YA 2P4QA 3GR6A 3KEGA 4MQ5A 1YONA 4FOLA 4F96A 1KIAA 1GCAA 1M8PA 2HAEA 1HQKA 3DEKA 4YAGA 5CFOA 3W4KA 2PLWA 1DJLA 3EARA 4D9EA 4CLOA 2HHLA 4LJ4A 1QFMA 2JRLA 3ZVNA 3ZDAA 1E9BA 4G36A 4INOA 5CVJA 1AUPA 1Z37A 5TPWB 3V4OA 3W34A 4DQ0A 2CV0A 4LOKA 2QPTA 3TLMA 5B2EA 3JD0A 1EJ0A 3TZCA 3M4ZA 2WFMA 4XR4A 4A73A 4DBLC 1PWHA 2B8TA 4P36A 2CCJA 3CC8A 3DLIA 5FI5A 3BMOA 4REQB 3GD5A 1L7AA 4IGAA 1BDHA 1SHZA 3BGOS 2R5NA 4EFKA 1LSJA 2PD4A 1BG6A 4V03A 3B7GA 3D4PA 4ND4A 3RYHA 3QMWA 4GE0A 2V7XA 3AY0A 5JW6A 4IFIA 3WWPA 4UTRA 5JD4A 4MP8A 2QK4A 4YRSA 2AX3A 5EJIA 1TT5B 2WQ7A 2WJ3A 1L5VA 3EK2A 3IMKA 4I6GA 2CL7X 4OQFA 3STWA 1EXMA 2JG3A 4I5FA 1T9GR 1ZD4A 3ZLBA 5HFAA 3C2QA 5H4HA 2IXTA 1KZ6A 2OD9A 1RKUA 1GXSA 1S5PA 1DT5A 2HA4A 4F71A 2RDMA 3MRVA 4HLNA 4C7VA 1FTSA 4QYXA 2BFWA 2XY4A 1ZU4A 3K2BA 2DF8A 2FPMA 4LYAA 1TYCA 4MUEA 1IZ7A 5IYZB 4E14A 2D2IA 3EMKA 3LHKA 3QKSB 3R6TA 4WVFA 3UT5A 2XMPA 3T7CA 2RH4A 3DEYX 2DLCX 3O94A 4RFVA 4CM4A 5DCUA 1HNXB 3QEAZ 2ILTA 3CH4B 2X8JB 1V11A 3A37A 4Z49A 1E9EA 3R0QA 5HDQA 3K6RA 1ORDA 4FEEA 4YMSA 1E9DA 3GCZA 3QEOA 1ISJA 4B7CA 4B71A 1O89A 2X41A 4NZNA 4M21A 1KIMA 5AM1A 3OCZA 2BTOA 1PX0A 4W6ZA 3D8UA 4H1WA 2H2AA 2VDVE 2VF7A 5CM9C 5T4HA 2XB9A 5KU1A 2UUPA 2AFIA 1QRUA 1BMFD 1FPMA 3OHMA 5FORA 2EX0A 3ASYA 1NIPA 4KBGA 4DNPA 4YQYA 1KMCA 3OLCX 1A5SB 2AN1A 1HTTA 5IKXA 3FDZA 2X6TA 3GBSA 3IJPA 3NIFB 2QRZA 3L0DA 3NAGA 1WP4A 4AZ0B 3UJBA 4ND2A 1BMDA 1PZNA 3OM1A 3A6ZA 3JD1A 5B1EA 4B8YA 4WFQA 5IUKC 5DNYB 5LMNB 1U0EA 4FZ3A 5AHOA 4XUEA 5ALVA 1Z5GA 1UP4A 3OZBA 3RSQA 3W5SA 3RVLA 3RBAA 2C97A 2VF8A 1TQ2A 3SJZA 2GETA 1RDFA 1TCVA 1XDDA 4LYEA 2PFGA 1QP0A 3GJ7A 4YJFB 3CCBA 3VKWA 2QJFA 1C3LA 1V48A 3AY7A 2PGXA 3D5QA 3T61A 2PJRA 4UAJA 2OP1A 1D03A 5AKKA 4KQKA 2Y99A 2GTHA 5DXFA 1QJ4A 4PV7A 3R9XB 2PKQO 2QF7A 5C0OE 3E05A 3MWEB 1TB4A 3OP1A 3Q9NA 3GI1A 3G0CA 1CQPA 2KI5A 4GPBA 1FSGA 5HE8A 1NBMA 2WKQA 1RXSA 4R9RA 2VF2A 1YJBA 4ALMA 2VP2A 4CG2A 3QJGA 3X0DA 2QL9A 3I1FA 3ZY4A 3AFHA 1Y0BA 3MMPA 3O91A 5C4MA 2IDZA 3JZFA 4YMLA 1J99A 1UWKA 1NRXA 1Z0SA 3SSNA 3AK4A 4MPDA 1ENOA 4RSGA 1J07A 1W4LA 1IJEA 2H0AA 1HWYA 1GUZA 2IW1A 4F8YA 2PS0A 1B3RA 2XQVA 1FXWF 3LDFA 3R5HA 3MS4A 2P75A 3V8PA 1NMZA 1UEIA 4KQ6A 4TVBA 4G0XA 2WWXA 4PPNA 3Q8LA 3EY4A 3O1IC 1VG8A 2PBLA 4OOFA 3V34A 3E7WA 5JCOC 4KVAA 3WNBA 2XCOA 4QE3A 3ZHCA 1Z82A 3QF4A 4I8DA 3RUCA 3M9WA 3SR4A 4BV2A 5F98A 3LDGA 4JP3A 3LPLA 1JQAA 4BQEA 4QYWA 4IXWA 4PHGA 5K7SA 1LKZA 3CN7A 5ANRB 2JVKA 4U0JA 2UZ4A 1VLZA 3H17A 5IYZF 3D3NA 1QRAA 5HSGA 5EZSA 3NHYA 2X9QA 1V6SA 1FRFS 3AEKB 1KQNA 4ZYZA 5BYBA 4FGSA 3AUAA 3ZEIA 4B4KA 4CU5A 4DIKA 4TV8A 5C4IA 1WHSB 4TTSA 3RO7A 2ZUEA 3AIKA 4XA8A 2BEWB 1KK0A 3BXHA 4E07A 1BWRA 2GSWA 3BXFA 4GI7A 1N3YA 3D1LA 2I67A 1TKRA 1OZFA 2GH1A 2FEPA 1TTHA 3VYRB 2C61A 3JD3A 2VCEA 2RAUA 2VPYA 3TKYA 2PMEA 4B6RA 5BUCA 1J06A 2P5SA 3A6EA 1ZK3A 3ZI4A 3GPIA 1X1RA 1LVUA 2KS6A 3G2NA 5A4AA 5D3KA 1P2DA 1L5OA 5TMBA 2V03A 1PI3A 3KWLA 4MJLA 4R9SA 5D87A 3K2QA 4IDEA 3ASUA 2J33A 2VUSA 4PC3A 3NASA 2K7FA 5KQSA 3ZWDA 3KEFA 4Q9KA 5AW3A 3KNZA 3FCYA 3O8CA 2C07A 1PEDA 3ETEA 4L8FA 3AUKA 2HCRA 1SB9A 3EWSA 4K46A 2AB0A 5EKSA 4Q7QA 2J3HA 3ZPXA 4D4IA 5K3EA 1A72A 1CVIA 2II6A 2N75A 1GM5A 3HO8A 5CFZA 3P2EA 1E3TA 1MB9A 1P73A 1YBFA 1ZZEA 3BTVA 3JS5A 2ISCA 2QN9A 4P7GA 1R3UA 3I9FA 4BASA 4ADSG 3T94A 4RSRA 3AEXA 2J7PA 4O2BB 5EHQA 1SCUA 3NG1A 1FK8A 2YV1A 4A8PA 3NH9A 1KOGA 1NAHA 1Z6YA 5CT4A 3E58A 3KSZO 4LBYA 2J3IA 4C0JA 2HV9A 4KI0A 4MA0A 4LWQA 2PH3A 1U11A 4H0NA 4MH0R 4YRFA 2IHTA 1P0PA 4O4HF 3G9QA 3T3NA 3VSBA 1QHNA 1TOAA 1V8BA 2VWPA 3FFAA 5JALA 4MB2A 1THMA 2WTAA 1PX2A 3ETDA 2IXGA 4ZO6A 5FTJA 3BSWA 1ADCA 1TVKB 3C6QA 1ZR4A 3RD5A 3HKCA 4YPOA 2P3LA 3IQEA 2Q2NA 4JJEA 5E8RA 5J1TB 2GZ2A 5JXHA 2ONCA 1TD1A 2Y67A 3MK31 5F4ZA 5I8PA 1Z3CA 3VYUB 3C8DA 4E88A 2HMAA 2H0QA 1W49A 3TF5A 1WP9A 2B0JA 4YXFA 4URHA 1LFAA 2DBZA 1MAVA 3CCCA 1AXRA 4DUPA 4HKTA 5EHZA 1SXPA 4MSUA 2L69A 1QGUB 4UVDA 1N2IA 5AOBA 4QT0A 1UT6A 1ZQ9A 2Q5QA 2E4ZA 4BEWA 1FZTA 1W6UA 4WY8A 4CKZA 4XWTA 2FG6C 3B1ZA 3WGJA 2EP7A 4EB6A 5C1PA 3MBKA 2QQEA 2EL7A 4EUKA 5IKEA 3THYA 1ZRMA 4TUYB 4CEHB 4OXYA 2BI7A 3PDHA 1BROA 4CQMB 1VXOA 2ZSHA 3ZU4A 4QUIA 3VNAA 2P9GA 3MS7A 3FRIA 4Y9TA 3WLNA 1DKPA 3RYFA 1H4TA 2Q50A 1B3BA 2BBOA 1T8YA 4Q66C 5H8WA 2OWEA 2H06A 1FA9A 1FB5A 1M2VA 3EGCA 1QB7A 3NBUA 5L3SB 3U62A 2WIGA 1O96A 1KYIA 3D6FA 3CLTD 1RXYA 2R8ZA 4N6NA 2I2FA 5JAMA 4YUVA 2CLMB 5K3FA 3LA6A 2Y1FA 2O19A 4I1VA 4XPIB 4B17A 2CNBA 5SZJA 4JLSA 4QPPA 2V8BA 4B85A 1E3DA 1Z63A 3O3CA 4IVQA 2Q3EA 3BRSA 3EXIA 3DOOA 1YZKA 2WUDA 3F6SA 2P5YA 3TIGA 3LP5A 5EJ6A 1BMQA 1FRVA 2QX7A 2IYZA 1H05A 3WRYC 4K3UA 1U2EA 3EMVA 3W6NA 1Z25A 2OBXA 2ZRBA 3L3BA 2PUDA 4WX2B 1Y6RA 3L1VA 4FNGA 2SKEA 4Z3KA 2DUUA 3K0FB 3LP8A 5C34B 1XQ9A 2ZI9A 4ZDIA 3UGQA 4TT3A 2CFIA 2VDOB 3W2FA 4F9FA 2CLFB 4F3CA 4DIMA 1S2GA 1BHO1 3WWZA 1UWVA 2R7KA 3DL7A 3RASA 3RVDA 1Y48E 1HYBA 2V9ZA 1YR6A 3ICVA 4RVNA 5B7GA 2YIMA 1FU7A 2QN6A 2W90A 3AILA 4N8EA 4LECA 1HXHA 4QHYA 4C22A 5BW5A 2W2LD 4B3IA 3I28A 2RSLA 2V55B 4I2NA 1C50A 4HDKB 2F1JA 5BV2P 3F49S 4X1OA 3SXJA 3WGLA 4EG3A 2I6UA 4UVIA 1GY8A 4NBSA 1OIWA 3WIUA 4G1MB 2PX2A 2NSDA 2HJ9A 2OLJA 3NVDA 4BNVA 3PQ8A 3AEUA 3AUJB 2O0MA 5CPFA 1FRNA 4ABYA 1QMGA 1BVHA 2OV6A 3LLUA 1MU0A 1UFOA 3E9EA 3TQCA 2ZAGA 1X9GA 3ZE9A 5AVKA 5LLDA 2VP6A 2XMZA 1OX6A 1EIZA 2SCUB 3N2GB 4JOQA 2GN9A 5T6MA 5KTRA 4UMVA 2O9JA 3F3SA 3PC8A 4EVRA 3PQ5A 4YT4A 5BT8A 3I64A 3MJ4A 2O2XA 3OHSX 4JEMA 3KLPX 3ZJVA 3ZU3A 4K0KB 5FBHA 5KNCA 1E5QA 2CJWA 1YKFA 3Q8KA 3V5NA 4Q9HA 1U63A 5IXSA 1C7IA 4PYNA 4ENTA 3N6XA 1LWOA 4FHFA 4F4HA 1Q7GA 4AUEA 3V32A 1L8OA 2GOYA 3AVYA 5EC8A 4TWIA 1QRRA 3P2OA 5G1PA 1W4ZA 1XCLA 4TS1A 3DPIA 1D4OA 4LJ5A 1DADA 5IC4A 3LPDA 2DH5A 4OQ4A 1EGHA 4ETNA 1V96A 2PGDA 2C57A 4QDJA 1A9RA 3HA7A 3KTAB 4WCDA 1WV0A 4EYQA 4BLOA 4LDZA 1VLHA 3PL5A 4M37A 5K20A 1T1GA 3GDFA 2E4YA 1UQRA 2XBUA 3TZHA 5KDLA 1FNDA 1N0UA 2DCUA 2EP5A 1V5WA 2CD9A 2ZBQA 3EISA 3N9IA 1XZMA 4IJQA 2FZVA 3VKUA 3FFWA 5L7WA 4HZUB 3D5EA 4CTJA 1FFWA 2XRZA 2BE7A 2GAFA 2H2FA 4GNRA 4IV8A 3Q2IA 1UFQA 1AMUA 1WX1A 2I3BA 3THWB 3OA2A 3N2YA 4XGQA 1AK2A 5ECWA 1JLLA 1VP3A 1PIWA 3TK1A 1F4LA 3UPDA 4DCMA 1OX4A 4OKIA 1G6OA 4P84A 4WKGA 4C6HA 1XVVA 4ZI2A 2VO1A 3CA8A 4BO0A 5J23A 1VGRA 4A8JB 1EQ2A 4IIFA 4EHFA 2X5JO 4D3XA 2VRCA 3WK9A 1RJEA 4RLFA 4MLZA 2BJVA 2Q1SA 4OUDB 1GNLA 1I2BA 4RCYA 2JJ8A 2WU4A 3VSCA 3AVTA 2H2HA 1JLMA 4MVJE 2PMBA 3WBKA 5DNCA 4HQ6A 4PGAA 4II7A 1XP5A 1GOTA 2O8BB 2YXBA 2X0FA 1S1MA 2ZWPA 4UEJA 1E9FA 2BHTA 3EIXA 1DAGA 1UBMS 4BEJA 3KG2A 3CUVA 2JHFA 2CLDX 2PG3A 1DV1A 4JNCA 3IBYA 5G0VA 2B4TO 1LC0A 4XI9A 1BQ3A 4JVOA 2EW8A 3VYTB 4RY0A 4QOEA 4A0QA 2IE0A 1GWNA 1TK3A 3WQBA 1RIFA 2QW1A 2DHDA 2QROA 2WJGA 2QBYB 2EBFX 3I53A 2DAPA 4HSEA 4UFPA 1R0BA 5DCLA 4BLTA 4GQAA 3X1JA 3B38A 3EGXA 2FV8A 5BYJA 2VXYA 1MC8A 3N2KA 4CQJA 1T0HB 1XYYA 2A9PA 2FG5A 1N0IA 3VHRA 1YGPA 1GA6A 1CRQA 3PVSA 4DR1B 2QUJA 2YUTA 1KAGA 3ZCVA 4G8BA 3Q85A 3D8TA 4HDKA 4XJXA 4OLFA 1G2IA 1PL7A 5FOQA 4B3DA 2XWJI 1H2EA 5TB5A 5IJAA 1DBVO 4M0EA 1J9GA 3O8LA 4Q4CA 1XQ6A 4MVJI 1II0A 5ICEA 4KW7A 5CX4A 2JBHA 2GVDC 4COKA 1PJAA 1HORA 5D7NA 3CZRA 3CGWA 1KIFA 1TA4A 4G63A 3DEHA 5KNCD 4YCMA 1WSDA 1Y1QA 3HY6A 1T3SA 4Y0AA 5HBGA 4E5VA 2O8CA 3L0IB 1OT5A 2GYYA 2VBGA 2FH5B 4N5NA 4Y6RA 1JKJA 3UHAA 4Z3OA 3PFIA 1EM6A 2EF0A 4KR9A 1GRRA 3WZMA 3GA5A 4KLAA 2D0PB 4KO3S 4YRIA 2F3SA 2IY7A 3OTIA 2Q3DA 4DJ5X 3QVWA 4D9NA 2BC9A 1K4KA 1CB0A 1XVIA 2VPTA 3EF1A 2D8MA 4MWBA 5CGQB 1GFIA 4TXNA 3CJRA 3EXIB 2B4YA 2XEXA 3GJ6A 1EVEA 3KR9A 2MSNA 1GPUA 1IY8A 2FWBA 4AZWA 3NUGA 1HETA 4KFCA 4TWRA 1KARA 3PKZA 4ZT7A 4JDUA 3LCMA 4D82A 1VL8A 2OM6A 3ADPA 5THXA 2X4DA 5FLKA 1OD6A 4BP1A 2IK8A 1NI4A 2XE7A 3DEIA 2BZSA 2IYRA 2A33A 1RPJA 3F0TA 3IR5A 3PP8A 4RQTA 3GLFB 1ESNA 4R16A 2DCMA 3JTEA 1O08A 4ZT4A 4G9EA 1DTSA 4JJ7A 2VCYA 4D3ZA 7YASA 1I2DA 5BW4A 1MXFA 1XEAA 3H19A 1Y1PA 1Y4ZA 1TD9A 4IIJA 4QQNA 5CVDA 5JSZA 3HJFA 3QV1A 1H0SA 3IP5A 2WVJA 2Q4DA 2WI8A 3G5MA 4TYMA 5DHRA 5A3SA 1EEXB 4AC9A 4ZCTA 1ZD1A 4WL0A 1B8UA 1G0NA 3BX1A 1C1DA 5YASA 2XTNA 2OFXA 1ETHA 4LVNA 4MQMA 5KOJB 4HVAA 2F62A 3I9LA 1VRVA 1Q19A 2AI2A 3OAAA 3ANTA 2G67A 4RPJA 3QOXA 4A9AA 3WRYA 2YOFA 3KKZA 3WZLA 3B7PA 3UYLA 1N5DA 5A4JA 2D2XA 1NV8A 2IF2A 2RGGA 3ESCA 4HJXA 3S81A 2GPBA 4XW2A 3HUDA 3UB2A 3T3DA 2AFHA 2IUUA 4JUIA 3ZNPA 4HGPA 1QF7A 4JT2A 4CIVA 1T5IA 2HO4A 4O2LA 2YY5A 4MUMA 5BQOA 3ZNNA 4EB3A 1KZGB 1NG9A 2PTHA 4JLVA 1OZHA 4RF4A 2OHXA 2DYKA 5EL0A 1BKSB 5GJWC 4G0NA 3DXYA 3GUVA 3FWYA 4TTQA 1GKLA 1SUCA 2CVPA 2FMXA 2VK2A 5J47A 1P61B 1SZPA 1JL3A 4LHZA 4KDCA 3FCUB 7MDHA 2XQGA 3GJRA 5KVSA 3GOHA 4TMWA 2JGDB 4E03A 4BX9A 1GSOA 4TZKA 5GOZA 2L82A 1QO0A 2ZULA 2E4AA 3JSXA 2HLHA 4AY5A 3BZUA 3AC0A 2MSDB 3E27A 1CUJA 2C59A 1YZQA 2D5IA 4MUIA 5J9FA 3ZOZA 2H8GA 3W5BA 3T5DA 1P1BA 1A7JA 1UOEA 2I8LA 2Y8EA 1QVZA 4OCZA 3EDRA 4UPDA 4CQMD 3DUFA 2NUPB 3W1EA 5LNK6 1H8ED 3GLGE 5LDHA 1NHWA 1UCFA 4XYMA 3U1TA 1MQ9A 3G8BA 4WXEA 1T6NA 2GAJA 2XODA 4KZKA 2BM9A 2CB9A 2FHPA 2JIZA 3AUUA 1Y9AA 4M60A 1Q12A 4MRPA 3T7AA 4AU1A 3MXTA 1DCKA 1ZGHA 5ALXA 2LKCA 3BH6A 1T9DA 3HU3A 1O95C 5E4FA 2CXPA 2IS4A 1OILA 3M9LA 4R1MA 2CV1A 4OK5A 1WTAA 2VP5A 5DN6D 1D5CA 1VXRA 5A5GA 1ZOPA 3UB3A 1G3IA 2GASA 3PTLA 4GZ5A 5EYPA 1JG6A 3D59A 3SZLA 1DKMA 2H0RA 5JROA 1VL6A 1XALA 2OFWA 4BKQA 4DWWA 1FBTA 1L7QA 2A1IA 3WL7A 3CUYA 3QBJA 4M9UA 3HKEB 1KTIA 1F9EA 2JFOA 1C3OA 1PG2A 2BFFA 2Q3LA 4JB0A 3WSTA 3T5PA 4KGDA 3RVNA 2CWWA 3H7IA 3M8KA 4DCVA 5IXJA 2A5FA 4E2ZA 3F73A 3HKBA 2OSVA 3WIEA 1UADA 2NU6A 4Z5XA 5AM2A 4WN9A 4P7FA 3ZIAD 4DNFA 1AD2A 2CHQA 1TZ2A 3MGGA 5B1HA 3OP4A 1J8QA 1R5OA 3PDCA 4ZPXA 3IUEA 1EX1A 4C6RA 1YZYA 2OZEA 4RGYA 3RS0A 4D57A 3O9ZA 2OXFA 1OYVA 3ESAA 4NBTA 4R54A 4IBOA 4WFJA 5DVZA 1EUCA 2BP7B 2AGVA 4UXJA 4I9FA 4ITUA 4BZZA 1D09A 1T1SA 1SG9A 4F4FA 5B4TA 2D0IA 5MN4A 2V3VA 3DVSX 3UTCA 4O4LF 2CNDA 3M6AA 3G6WA 4WBSA 5EZYF 1UFVA 1DC5A 2WFLA 2KPOA 2WICA 3DH0A 1LDEA 4HY3A 1JAZA 2PGJA 3B2QA 4YJGA 3UJ8A 3NO4A 3PCRB 5KJ1A 2EJCA 4MW4A 3I2FA 3PV0A 1Z36A 4RJJA 4BTVA 2C1XA 2GEDA 5ALYA 5J63A 4G0WA 2ZP1A 1P9RA 3L0ZA 3ADOA 4U7FA 3HWX1 3MC1A 1G1MA 3LQ1A 4DPLA 4GR9A 3H99A 3BHJA 4LDPA 1O6ZA 5BN3A 4MVWA 1IOLA 1YOBA 2C2OA 1DEHA 2XVAA 5AJHA 2WFLB 1ECBA 1JG1A 3NETA 4NZZA 2FEAA 3L7BA 1E64A 4BP8A 3LTNC 2RMKA 2WWTA 2I65A 4I5EA 2D7CA 1XN4A 4EABA 3WIVA 3FZGA 1QRTA 1SAYA 1KI1A 1MP0A 3QEJA 2DTXA 4E2FA 2OGTA 3ZGLA 3USZA 1GNRA 2G09A 2AWNA 3UN1A 3AV0B 2EFDB 3BORA 3JVVA 1PS0A 1SRQA 1WCIA 1IXSB 1RJDA 4PBSA 2HLNA 4UCQA 3A9UA 3ORYA 1ENYA 1L5QA 3IVRA 4TMFA 1FU8A 1JN0A 1NW6A 1IN1A 2FEXA 3LCVB 2GPSA 5C32A 2Q6IA 1T2NA 4GPIB 3PENA 3PQEA 4TS9A 2AMJA 4XD7A 4C7JA 4DMGA 4EI7A 4P5DA 2EGUA 5HHTA 2G9QA 4LRXA 1KPIA 3S2YA 1ZGAA 1NF3A 2QYSA 3NOOA 2UXBB 3LPNA 5HQ3A 3K0FA 1SVWA 3H11B 3C6KA 9LDBA 5F3DA 1A8HA 1O58A 4RWEA 4GL4A 2J41A 2XT0A 1GUFA 3KEOA 4GKVA 4L6AA 3CKYA 4PTZA 1V7CA 4W1QA 5FF9A 3U9SA 5KWEA 1OHHA 2PWYA 3V7WA 1LTKA 2RGBA 2VAVA 5LQRA 5K0FA 1CZLA 4DFDA 2GCNA 1EG7A 1HQDA 2Z56A 3HCAA 5ERYA 1V9LA 4XH9B 1VZ3A 1PS9A 2W8BA 1OXMA 1Z5WA 3FE2A 1QCZA 3GIWA 4MW9A 4Q4AA 3TNFA 3PPVA 3UJCA 5JWOA 2HJWA 4GW3A 5AW1A 1ONBA 2YZNA 3ILXA 2AIRA 1IXRC 2BKVA 5LCXA 4BNNA 1ND5A 3D6JA 2GD1O 3OQ6A 5EMNA 4WEOA 4FMDB 4IFBA 3EQ8A 4RS3A 4QGFA 5MDHA 1AKTA 1QO7A 2JZCA 3MW8A 4YAIA 2IYUA 4MYUA 1CHDA 1CUBA 3H1FA 1GILA 4PLTA 1U81A 2HXYA 1YVRA 2C9OA 4UARA 3MJHA 3AQ4A 4MKZA 3HN2A 3RYIB 1GKYA 2J4DA 1ABEA 2V7EA 3O8NA 1PKXA 4IXDA 5K03A 1WQ3A 4MHTA 1Y37A 2QVBA 4BQIA 3H5WA 4PWZA 3TBFA 3FF4A 3ICEA 2QGFA 1F8YA 1IUPA 1VFPA 4GI3A 2PEZA 1AXEA 5D3MB 4ZVOA 1TVEA 5IPFA 1OWMA 3TW8A 3HVRA 3NI2A 1UK6A 4PZ9A 1EIWA 2X0IA 3AINA 3DMTC 3PK0A 4HDMA 4TMTA 3RAEC 3PRJA 4ISCA 1GTJ1 1DIBA 3L02A 1I94B 4BPBA 3EGIA 3OU6A 3QVLA 1XHLA 5DSXA 3V42A 4D25A 1ZN9A 4TV8B 1CRPA 1IN5A 1VBNA 2EZTA 4AIRA 3PJDA 4E11A 1RTTA 3A26A 2QVYX 4EF5A 5E2AA 1QIFA 5EKDA 1E4VA 3AP1A 3GHYA 1QXSA 2V8OA 3CEMA 3WGKA 4BNXA 3E22A 3DT6A 1NF8A 3ZCQA 4M1OA 4BFXA 1ZM2A 2XMSA 2EGGA 3O7WA 4CR6A 4DB2A 3CUTA 1CQXA 1DS6A 1EX9A 3ET4A 2R65A 5JYDA 2V59A 3K1YA 4HAIA 1T6BY 5HIAA 3S2ZA 2YH2A 4M99A 2AEJA 3RU9A 5HK8A 1D6NA 4RTKA 3P94A 4JC5A 2XUOA 1KFJB 4DR4B 3VOTA 4CV1A 2OVBA 4UDOA 4EYSA 1L4GA 5DCWA 5A9RA 1RWMA 3EWNA 2WYOA 1KY2A 2V58A 5AI4A 1NLZA 5TPZA 1DBQA 2E4XA 2BHLA 4WXRA 3ZHBA 3PUIA 4N0PA 1T0IA 5FQOA 1NSTA 1E6WA 3L4BA 4R01A 1XDWA 4ZCMA 1Q57A 2YZ7A 2ZJ4A 4RM3A 2Q99A 4XD7D 2DPYA 4OVKA 2YCBA 3NCTA 3RFFA 4IH1A 2Y05A 3GT4A 3PHJA 1UPTA 4MS3A 4ARAA 3IPAA 5I7UA 5LMUB 2WSSA 3LBNA 4QUDA 3M2PA 5LBTA 3AW9A 3T5TA 3T7TA 3PEYA 3TMAA 3FX2A 1CSEE 3OECA 3U7HB 3P9SA 3T7KA 3FETA 1DG3A 1II8A 1CJUC 1DLJA 1GCIA 3I72A 1H2XA 2GNAA 2ZJAA 3C6ZA 3FCEA 5E3HA 4D4LA 4DDMA 4J43A 4EGQA 8MHTA 3NS7A 4ZAWA 4UAGA 1ABFA 5ALZA 1ZH0A 2BM1A 5CNMA 4C89A 4GOXA 3A05A 2XV1A 4F46A 1SU4A 1NC3A 1Z0DA 2YWFA 4AY3A 2X0DA 2X4GA 1POWA 3KJZA 2XQIA 2FFHA 4P38A 4WHMA 1H94A 2ZREA 5D00A 3O1LA 2W98A 4WRRA 5AJVB 5B3LA 3U1BA 3H5OA 1HYGA 1T5DX 3LX6A 1XKLA 3H4IA 4BFCA 5C4GB 4RGQA 4X3PA 3B6ZA 3Q15C 1JX6A 3I73A 4GOND 1LJLA 1A8SA 2CBGA 3DC7A 1CR4A 1Z29A 1VCHA 1U8FO 5DT9A 2RBEA 4CMKA 2MYUA 1PUIA 2JAHA 1YFZA 3MTEA 2DHEA 1QH9A 4L22A 4Q24A 5FUMA 1I4EB 4TN5A 1LBSA 2ZIVB 4UVHA 1XZBA 5IC5A 2A14A 5FFFA 4G0OA 2B78A 5DW3A 3RRFA 4XX0B 5LZ2A 1QVAA 3IHLA 5GVSA 1F12A 5LZ7A 2DH6A 3E03A 4ID3A 4EW2A 4BJ5A 4RPHA 1QHSA 4RD1A 3AFOA 2D2EA 5B58C 4M1WA 2OECA 1CHNA 2OY0A 4LY0A 3DV0A 4PC1A 4E12A 4NFYA 1DJNA 4B4DA 5AWFC 1N33B 5J2TF 4PQRA 1U1GA 2FDXA 1J20A 4M9RA 4KXLA 3WFJA 3N6RA 3WKCA 1T0JB 1UJ4A 3HLKA 4CG0A 4PSAA 4PVCA 3AT1A 1FTGA 1N5KA 4ID9A 3PR1A 3LHSA 2A86A 3SZ3A 2YV5A 1G8JA 1YWGO 2GI4A 3T5BA 5A3RA 4NULA 3LA8A 3BZBA 4MHSA 2M98A 2Z5GA 4ZI7A 2Y0CA 3LFTA 5KPJA 4XTRA 4FU0A 4LZOA 3OKAA 4NZPA 4L1KA 4DYDA 4IIYA 5I3CA 1GL6A 2ENWA 3RUHA 4FYVA 2Q2OA 5JMOA 2FZCA 4GQIA 1BFUA 4ENWA 2RH5A 3C8ZA 3FPJA 1UPCA 1W4CA 1ZGBA 2PRYA 3PC3A 4RMNA 4O8ZA 2MCFA 4GYYA 4DDWA 2BDUA 3JCZA 1DHRA 4GM0A 4JT9A 4WKBA 4OB7A 2QNBA 4Y67A 4JI1B 3ULKA 2YJ5A 3FIJA 1A7KA 2C8VA 1RWXA 4RPIA 1XEXB 5FOTA 5TV2A 4ETWA 2PZ8A 2CFOA 5JC1A 3G8DA 2WSSD 5J5CA 5C51B 4ZTZB 4HDOB 4HN9A 3WMWA 4OQQA 1U3FA 1OTXA 4FE7A 3H9UA 4MCAA 4Y2UA 1CZHA 3CJTA 3ZIDA 1DZ3A 3H05A 3WQQA 4BWFB 4YMVA 1P0CA 3A14A 4YMIA 3PGKA 1Y3IA 1XXHA 4X20A 2GMWA 2OZVA 3AJEA 3JARA 3JWEA 3W5JA 4HUQB 2YVKA 4B4OA 2GJKA 4EK9A 4KJZA 2F90A 1EP3B 1W73A 3SC2B 2WE8A 2Z08A 3AI2A 3L7NA 3QKIA 3L40A 5DW0A 4HNAA 4ZCQA 3ZLJA 3PNVA 1H22A 3UWSA 5IZ4A 2XVMA 3OU2A 4Q5IA 1MO6A 2Z6VA 1VE6A 3I3OA 3G89A 3A4NA 4A8JC 5I5EA 5AT1A 5A4DA 1XLTC 1HSOA 1HRKA 1B8OA 1K7XB 1RWBA 1UR5A 4X6XA 1ATZA 3FTFA 2D5LA 2G3YA 3MTGA 3JARB 2Z30A 3CZCA 2J6HA 4R3WA 1C3XA 2ZRJA 5AR1A 5BRAA 3QZUA 2YQ5A 5SY9A 4HVCA 3NDPA 1KEKA 2TS1A 3DB1A 1PZGA 4FNAA 2FKNA 3GUUA 3MUEA 4PZZA 2OYRA 4BFVA 2QD3A 5ITVA 2VJQA 4TL9A 3AERA 4JLAA 4W6QA 2AZ4A 1R6AA 1ZOIA 1K5HA 1V1RB 1TEXA 3O3NB 4M1MA 4OBWA 1ECGA 1N3LA 3FHJA 3FPGA 4MAMA 4KYTA 3WLIA 3HE3A 3T9DA 2A59A 2KE5A 2BH9A 5KJFA 1HI9A 4W8HA 4D26A 5FUYA 5TGDA 1PFVA 2H3HA 2G0TA 1G8HA 1TAHA 3G8CA 4KXNA 5EZQA 5FWAA 1U9IA 4ENVA 1MHPA 2BLLA 4G4GA 3RVMA 1J0CA 3K6JA 3DVAB 2XI4A 4EEZA 3GAMA 3LCRA 5E1DA 4JV5B 1F8GA 1PUXA 3USCS 2OMKA 1TF5A 3HCCA 2QZSA 4ZJZA 1JJBA 4YMTA 1B14A 2VYVA 2ACVA 3JQEA 3BDIA 4QO8A 4QPZA 3L4JA 1W76A 3TCNA 3LSYA 2QV7A 1GTRA 1SVLA 3FLEA 3VC1A 1X80B 2PUEA 1O1YA 2H85A 1DIGA 2HJGA 1QV9A 2PZLA 1H85A 4GSYA 3U0BA 2AZMA 1K89A 1U0TA 3PX2A 3V7YA 1I30A 1M6EX 3RYTC 4Y9UA 4BO9A 4YJHB 1W75A 4AB1A 3TRDA 5AVWA 4HB3A 4RYDA 1QAOA 4R8VA 2M6KA 4ARVA 4WLNA 4BO3A 4EKYA 1WNTA 4BFSA 2QRNA 3OD1A 4FEYA 3S27A 5JBIA 4I14A 4NOMA 2JEYA 3IKLA 4R2HA 1NKSA 1KJYA 2PZBA 5C8ZA 4G5RA 2RKWA 1TJPB 2JA1A 4I9UA 1NR5A 2IPOA 3LF2A 3KD2A 4CLOB 4OKSA 3CXRA 1MQ8B 4E6EA 3A9RA 4WACA 1QF9A 2AEMA 1LGYA 5KI6A 1U9IC 4YRZA 3BCRA 1OB2A 3IVCA 1SHLA 2DFPA 2ZBUA 3H4MA 4IZOA 4I99A 4IEFB 2VF4X 4LMAA 3I32A 3R5XA 1ISSA 5LNK1 3IVXA 1CNEA 4GQBA 1D2AA 2AKYA 3GFFA 3TZEA 3V1LA 5IJ0B 4EPXA 5DNEA 2H1VA 2ZDHA 1E2JA 2C84A 2WSLA 2ZS8A 4OQNA 4GL2A 1OVMA 3ZGYA 5HGJA 3Q7QA 2ZCJA 3O9MA 4L50A 1O96B 1H2FA 3UOWA 2J3DA 2Q27A 4DM4A 1ZHHA 4EW6A 1TT7A 5IHPA 2I87A 2CSUA 2A9RA 2FUKA 1JSLA 1CEQA 1L1EA 1T3GA 2VHCA 3FNFA 4IHKA 4O29A 3TSOA 3OJLA 1QG4A 1E4EB 1UMDA 4QQRA 2H52A 1E0DA 1SCIA 2YVUA 2ZTUA 4S1WA 4UM7A 2MU1A 4QREA 1U6KA 4G07A 3I58A 1VE9A 4QBKA 3UJHA 4A3SA 1BD4A 3P9YA 4B09A 5KCZA 4MWOA 5FWNA 4C0SA 4ML3A 4IMRA 2GZ3A 1IRIA 3CNOA 1ZISA 2ZUUA 5EMKA 1DSSG 5ALJA 5FHQA 4BO5A 4Z4GA 1YB5A 1E7SA 1V5GA 1XZDA 2FSPA 2GCEA 2W6OA 1WMEA 3DV9A 4B44A 4RZIA 3WMRA 4KOAA 1PJ4A 2HCBA 5I51A 1Y3DE 4PQYA 4Y8VA 5EP4A 3QG1A 3NOVA 4YIKA 3PDIA 3PBKA 4BJHB 4YJHA 1DRJA 4YJ2F 1KZ1A 1Z4KA 1J2UA 2I3GA 4CT5A 1PNQA 1F4VA 3DNPA 3INGA 3P1JA 4JL5A 3TPFA 1ATIA 2ZT6A 2XUZA 1GNVA 3P0EA 2VSXA 4FC7A 2PXAA 2C4WA 4BQNA 4L27A 4BX0A 4B87A 4KLRA 1NMYA 2V4MA 4JA0A 1Q74A 4BYGA 2G36A 2QX9A 4HGYA 1YJ5A 2GZAA 4RQBA 5E9AA 2GCOB 5LZ8A 4CLRB 3EC2A 2N3ZA 5FH9A 1X92A 4JBXA 3TD6A 4EDHA 3VISA 4ICIA 1KRWA 1DINA 1O94D 3LDUA 5TARA 3PITA 1SKMA 1EMDA 3K35A 4EG0A 3W5AA 1NFFA 2J5RA 5EGSA 1Q92A 5EP3A 4EHHA 1J0DA 4RHEA 1DCTA 4MGEA 2JI8A 3PIRA 2R751 5TS3A 1XZKA 1JRLA 2I6QA 4BLWA 4BNKA 3DO8A 4HH4A 5EVJA 1JEYA 3IQGX 3WB1A 1ISMA 1TI7A 4H0CA 2JJQA 4MI6A 4YUYA 1ECCA 1Z4IA 4NMXB 4ZZ0A 1NJGA 1OWLA 5JSKA 4Y30A 5ELXA 4A1FA 5JZ9A 3K8OE 4OSPA 3FSJX 4DR2B 1T9BA 2BI4A 1MOSA 1PBTA 1YI0A 1MX3A 4NYJR 3HCFA 3SXPA 3CQ9A 3EUEA 1X1AA 3HXKA 4G0ZA 5FLEX 2AYYA 1UDAA 3L05A 4EKEA 4YDQA 1E2NA 1RHKA 1QLJA 1UKBA 3HV2A 2XNSA 4C5AA 1OX4B 1QCYA 3ETJA 4HF7A 5D5QA 1EE2A 3U26A 5JAUA 1EFAA 3L4EA 1XA0A 4D8TA 4JGIA 3EZGA 2NO9A 3UAZA 1Y8AA 1ZH4A 5HRCA 4RD4A 3BWMA 4JB8A 3JAKA 4PTLA 4DA6A 1D07A 4C9BA 1SXJB 3OCVA 4GX5A 4NICA 1BW9A 1N6HA 1OZGA 1SVOA 1XJWA 2J07A 4JP1A 3JD4A 3O38A 4GZ3A 4ND7A 1V11B 5FO1A 3WLOA 2ZYGA 4AJ1A 1IWOA 2F8TA 1Q3HA 3DKIA 1PJZA 3BD6A 4KVFA 4LYJA 4OAQA 5GQSA 2A9OA 5SY4A 4PAQA 5IVHA 4Z3DA 2IWHA 4DMLA 4U7HA 4QTXA 2W2PA 2QLBA 1JKIA 1YE3A 4FGWA 4RF2A 3VPBA 1BIFA 3WDSA 4UNNA 1WB4A 1HKHA 4OQXA 1SUAA 2Q5IA 1GTG1 4J1TC 2M6RA 2W70A 5A04A 1E59A 3VPDA 1CQZA 3A6DA 4EPWA 1ID8A 2JLCA 4UUPA 2REQA 2EWMA 5EJMA