3ROEA

Crystal structure of mouse apolipoprotein a-i binding protein in complex with thymidine
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
233
structure length
233
Chain Sequence
AVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSKSPPTVLVICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQKMDIPFLGEMPPEPMMVDELYELVVDAIFGFSFKGDVREPFHSILSVLSGLTVPIASIDIPSGWDVEKGNPSGIQPDLLISLTAPKKSATHFTGRYHYLGGRFVPPALEKKYQLNLPSYPDTECVYRLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Apolipoprotein A-I-binding protein
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Mus musculus
total genus 75
structure length 233
sequence length 233
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.1.99.6: NAD(P)H-hydrate epimerase.
pdb deposition date 2011-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3roeA00
3RU3A 3ROEA 1JZTA 3RREA 3RRBA 3ROGA 3RTCA 3RTAA 3D3KA 3RS8A 3RTEA 3ROXA 2AX3A 3RO7A 3ROZA 3RT9A 3RNOA 3RU2A 3RSSA 3RSGA 3RSFA 3D3JA 2O8NA 3RTDA 3RTBA 3RS9A 2DG2A 3RTGA 3RRFA 3RRJA 3RT7A 3RSQA 3K5WA
chains in the Genus database with same CATH superfamily
3P9CA 4WA8A 1NBMD 3WO1A 4FB5A 4PE5B 3IESA 5F7ZA 2BJHA 1CRLA 4TRJA 2MR6A 1Z68A 5FFMA 3DTNA 3THXA 4Z4FA 3EVFA 5L95A 4QELA 2PA3A 2P8SA 2CJPA 4ZCLA 4DCOA 4US2R 2ZP1A 3IDAA 5K0EA 4P31A 3MEQA 4YVFA 3NHUA 4LZAA 3BTOA 1A9XA 2P69A 3O3CA 4DILA 3UXEA 3VZBA 1RR6A 4UBLA 3CCBA 2B7CA 2OECA 1QG0A 2ZB2A 4X94A 3BWXA 4UD2A 5IW8A 4EW3A 1HLDA 3OA0A 1V41E 1WMAA 2WYOA 3REQA 3BH0A 1ADJA 1NFFA 4OAOA 4HCJA 3ORSA 5JROA 1SBYA 4LHEA 2Q3CA 5BR7A 1E5XA 4IEIA 4OQXA 1MJFA 1FXWF 2Y66A 2PTGA 3QOWA 4CEIA 5J47A 1TMYA 1V7QA 2Y6UA 3HKEB 4N8SA 8ADHA 1GAEO 1VL8A 4BGIA 4ZDKA 1TVEA 1Z2NX 1JEEA 3EXHB 3FNQA 5KCMA 5CVTA 2C88A 3WQBA 1SBIA 3IX7A 2ZULA 3CR3C 3D6VA 4PVDA 1RTTA 2ZRNA 1KMCA 4QD3A 1DXOA 4G37A 1JLKA 4IHAA 3F6BX 1DKOA 4LSZA 3S7ZA 5H1YA 3AVUA 4IDHA 5G2OA 1WXFA 2FJUA 3WKCA 1N1DA 3K1ZA 4OYLA 2QD5A 2DFLA 3N70A 4KJXA 1NVBA 3DS8A 3HL4A 3HJAA 1JWBB 3EBOA 3SJUA 3JSXA 1H1LB 3W3AD 3ZJYA 3I34X 5A1JA 4DHEA 1K7CA 3Q4GA 1BD4A 3OOJA 4MGHA 3QY0A 5TNXA 1E63A 1E3MA 3LGSA 4FNGA 5JDCA 1EFVA 1PDOA 1S3FA 4DA6A 1HQYE 1NTOA 4EFNA 3ROPA 2GF9A 1Z7WA 1RPJA 4FEEA 3C8ZA 2WY2D 3V4FA 1HZZA 4EW2A 3C14C 4JU9A 4FQ8A 3PRKE 1W93A 1MENA 5FYDA 3L7MA 1Z4KA 2WG1A 4FU0A 2NMVA 1YGYA 2IDKA 4R3UC 4WEOA 4LF6B 1FRZA 1DI0A 2OFWA 3TTSA 5JU6A 4QFBA 4Y6OA 1KP9A 4RLHA 1KO8A 4EVIA 1UDCA 1QCCA 3GAFA 3PG5A 2E4YA 4C3UA 2PUFA 1H05A 2NO6A 4YQEA 4P3XA 5J3JA 5EKXA 5KDDA 3EWNA 1E3IA 3UIEA 2QAJA 1RU3A 1R6DA 5I48A 2BEVA 1I94B 4BBJA 4YAKA 4WXRA 5K8VA 5LYJA 1Z7YA 3K0AA 1QFSA 3H13A 3MT8A 5HKKD 3JZMA 2FDRA 1O97C 1OUMA 2XXBA 3WBBA 4LHWA 4K8OA 2V0GA 1NN3A 4UOZA 5K8TA 2IS1A 5A3RA 1N6PA 4JGGA 2OHXA 4Z3OA 2QTAA 3HYLA 3MTJA 1BXKA 2PCJA 2VK4A 4L57A 2R751 4RSHA 3SMVA 1CX9B 1JHOA 1JIVA 1GZ6A 4L4SA 4BWYA 1EM8A 2BKUA 1GM5A 1OXVA 5KTNA 4LS3A 3I2YX 5DHAA 1GGMA 2PO5A 1WVMA 2VTDA 4KVFA 4XWAA 1ZUIA 2RHWA 1QHEA 2DKOA 2PGJA 3ANLA 1MXFA 4J4HA 4M1WA 3RFFA 1NQ5A 1Q3TA 1SCQA 3WRYC 1XNQB 3W7BA 2X0RA 4FMPA 4KFTA 3V46A 5H59A 2XT6A 5F23A 3AFOA 1I30A 3LPDA 1LNZA 3TXAA 3G88A 3RFUA 4WA7A 3HKBB 2QJOA 1Q1AA 3QYFA 2B1QA 2RJOA 3STTA 1E7WA 4NBLA 4RVHA 3DDWA 4HGYA 1AC5A 3ON5A 4PO9A 3LC2O 1XO1A 1IK4A 5M2QA 4XARA 3ZBQA 1YB6A 4ER0A 4GSYA 2PSHA 3A11A 4P4LA 3P0RA 4EZEA 3NTRA 2GZHA 5KQPA 4YCNA 3ZVMA 4WECA 2CV0A 4YAWA 2Q07A 1YBVA 2C3MA 2XR1A 3TLGA 3G2PA 3DDOA 3FPEA 4ZQEA 3M3DA 5KYWB 2PUBA 3DD1A 3RLFA 1BOOA 3BYZA 1KEVA 1E4EA 1Z4QA 1P91A 3M1AA 4NS1A 3UMFA 4CLOB 2ZBQA 2YVLA 1CDEA 1N6OA 3DYIA 3H6HA 2G5CA 4O4LF 3LYUA 2Q5IA 4QGGA 3GRVA 3UWMA 3AEZA 1PQUA 3DMDA 4UHDA 3RT7A 4IH1A 4F9GA 3VNUA 1U1GA 4RSGA 5H4GA 4WV3A 2OAEA 1S2GA 5K3OA 1B4DA 1JTFA 3T9FA 3IP7A 5DGCA 5LSAA 4WLUA 9ABPA 2WJJA 4EP1A 1Z0IA 2I1WA 2L69A 3G1TA 1EGAA 3DHWC 4K0RA 3VPGA 2BC9A 3ANXA 2D8MA 1XVIA 2J3JA 2YW2A 3JQDA 2QJFA 3NTQA 3S81A 2QB5A 3PLAE 1B3BA 4LMAA 4WH0A 5T6MA 2VTVA 2ZPAA 4CV0A 5F76A 3DFFA 4TXLA 1KI8A 4L6AA 1Q0PA 2XJ9A 3HWRA 3CWZA 3T5GA 1USIA 3WWYA 3AV3A 4BGDA 4LXYA 1XZGA 4AUMA 3EQ9A 4QASA 1I6LA 3V8NA 1M6HA 3IERA 2TRSB 3PXAA 4IIYA 1L7OA 1WZUA 2XVMA 5FEMA 4INAA 3H5TA 4EQZA 1K63A 3P0EA 2G8NA 3INYA 1UC4B 3D43A 3ZQUA 4JP2A 3GA5A 1E2PA 1NVGA 3Q5DA 4H15A 4YQYA 5JECA 5AJTA 2J6BA 4W1QA 1Z5PA 3WTCA 2I3DA 4IO0A 1R12A 1IZ0A 3L0SA 4GLJA 4CTJA 3BB4A 1U5CA 4ZVQA 3F47A 3RRZA 4KREA 2HCBA 2B5VA 3PF8A 4NCIA 4B0PA 3JVDA 4HYQA 1KK3A 1RIIA 1RM0A 2FWAA 3W34A 4D3SA 3IMCA 2GDZA 1XJ5A 4B85A 4NBWA 5DGIA 1RAAA 2GBIA 2ZUBA 4QFMA 1T43A 3NX4A 2BR5A 3WLNA 1JHVA 3HJTA 3AIIA 4AO8A 3DL2A 2IP2A 3EVDA 3FMOB 4U8GA 5GOZA 3INNA 3AR5A 1L4FA 4B3FX 5DTQA 3QITA 2X4IA 4PZYA 2QSJA 4FR0A 1I6WA 3FFXA 4WHMA 4JI4B 5EC8A 1UXKA 4URVR 2YIJA 3UATA 3L6DA 1ECGA 4TXJA 1RPTA 2O8EB 1P3JA 2DY0A 4EA6A 4PYOA 4JUCA 3CONA 3ZI0A 6NULA 1A98A 4FUTA 3T52A 2O2YA 4R1MA 4WESB 3CRQA 3OZUA 3JU3A 4GYYA 3CX8A 4F7WA 1JJ7A 3FH0A 2NXWA 1H6AA 1DJPA 3N2EA 4PQFA 4RMHA 4C4TA 4G9BA 1E3LA 1MAAA 2JFQA 3KHSA 4CV2A 2AS0A 2A1IA 2J5RA 1EHIA 3EASA 3H5VA 3OJCA 5AKXA 1R66A 4X7RA 4N39A 1NSYA 7ADHA 1PNRA 2RHDA 4IMJB 1DSSG 4PG6A 5I6DA 3IV9A 2B7LA 1KI6A 2XQKA 3IVAA 4LRWA 3OZFA 3RASA 5FKJA 4LHYA 1AA6A 3GLGB 3OD1A 1XQWA 4BO3A 2PRKA 1MPXA 3H9GA 1B1CA 2QNIA 2PV0A 3PX2A 2B9VA 1D5CA 2IHZA 2NUAA 2RGAA 5CK5A 4ZXPA 2HFKA 2Z2XA 1P1KA 2Y92A 4MA0A 4HLUA 5F4BA 4NULA 3SR4A 4CIVA 1JHPA 3OFND 5BSUA 1D8TA 4IFTA 3AI2A 4O3MA 3P4YA 3CRW1 2GNOA 3SZLA 2JI7A 5E4JA 1NXOA 2JIMA 4ND8A 1XJQA 4D43A 4H1WA 3K71B 1J06A 3GGCA 4JLKA 4RFVA 2XOKD 3AP3A 3GJ3A 3PTLA 1OBCA 3U6KA 5I7SA 3FBWA 2PANA 1DC3A 2QDKA 3FDXA 4O25A 4EOGA 2OHVA 1YL6A 1ISHA 1J2UA 3O2JA 1NQAO 4CCWA 1YB7A 4A36A 1PTKA 1U65A 4ZYVA 3BB1A 4Q9JA 5AHRA 3BGWA 4HDSA 3VAYA 3S8YA 4WD3A 2MT9A 4F11A 5TQ2A 4J3FA 3PTZA 2FPXA 2ZJOA 2FSGA 5JVDB 3UT5A 1SQ0A 2NYVA 4WLOA 3UQZA 4CKZA 3OZDA 3Q8KA 5IYZF 2DPHA 5HXAA 1H5NA 1NRJB 2PJDA 4QBTA 2ZAOA 4BVFA 1OBFO 2FEWB 3PGA1 2H2AA 1NNEA 3TXXA 1E94E 2XEXA 4GPEA 1W19A 4POAA 2R5NA 2A0KA 5JI3E 3BUSA 3KKOA 3QX8A 2J3LA 4YT5A 2XE4A 3BFKA 5B4TA 3H6GA 1B7GO 1U1IA 3FMPB 4OQQA 4C0BA 4XIGS 2O3RA 3DXYA 2PFSA 1F1BA 2NTNA 1TF7A 3ASUA 1DB3A 1JJVA 3HJUA 3PGMA 4V38A 3W5VA 4BQFA 2VZLA 4X1KB 1LBQA 3FHCB 4M83A 4C6HA 3IHWA 4JI1B 3TIXB 1KBOA 3DBLA 3OPQA 4BO0A 1I33A 3I42A 4U2BA 2W2XA 1VJ5A 1BE0A 1PE0A 3ED1A 5T4HA 5IJ9B 3JR7A 2ZFUA 4M9CA 2DMRA 2PO7A 3GLTA 4D8WA 1SD5A 3BTSA 4DCJA 5CJJA 3GLHA 5DYNA 4ZCIA 2VT6A 4J16A 1XQYA 4L08A 4Q24A 2IWRA 9LDBA 2JLZA 5CA0F 2QQEA 1OC2A 3F5DA 5AUQA 2CVFA 4AS2A 3EQ8A 2Q3JA 5FWYB 3D6AA 1DZIA 2ES4A 4AJ9A 6REQB 2GXSA 2LIPA 5JSQA 2E85A 4WZZA 1GCOA 1KEPA 4Q7MB 5KJ6A 1IOWA 1P7ZA 1YRHA 3T4XA 5C31A 4YMTA 5HGXA 3U7JA 2JZNA 3FGOA 3JYPA 4HNRA 4HR7A 4BNGA 2GA9A 4KGDA 4AJNA 1OAAA 4JJZA 3T34A 1MO3A 3UO8B 1PL0A 1Q92A 2A4KA 3VZCA 4B71A 3EGVA 3NBFA 3E0XA 2IU3A 3RSFA 4RGBA 1KI2A 4M8SA 1CUHA 4BU0A 4P7JA 4OHZA 2IOHA 2XUHA 3ZVKA 1ZWKA 3A1WA 1Z6TA 1P1IA 1UC5B 3DL7A 3N28A 3TH5A 2V4UA 5JZMA 2ZE7A 5A7HA 3N5KA 2COKA 2ONJA 1T3LA 1HDZA 3IJ5A 1ZSYA 2J9YB 1E8MA 1IOZA 5K0JA 1P9LA 2J85A 3OKAA 4KR2A 3OQMA 1I5OA 1L5HB 3KEMA 2A0WA 4D6XA 2ASVA 3NVMB 4MDFA 3UBTA 5LC1A 4MQ6A 4KWCA 3HUTA 3I05A 3SYKA 1AD2A 5B4UA 5HUHA 3UPUA 1H93A 1FNCA 1FVHA 2ODEA 4XCXA 2VNKA 4FZ3A 4U2GA 1H5QA 1RLIA 2WD7B 1PJBA 3NHWA 4H3HB 5ALUA 2JH8A 2ZBDA 4H2DA 4GUAA 4L73A 3C7AA 3IV6A 5LYYA 4GPZA 4PTYA 2Q0XA 3CNNA 1TFRA 4ZEMA 3DE5X 3IVGA 5JNLA 1H2WA 4MI1A 5FUMA 2IW3A 5ITSA 4F46A 3BK7A 1YFJA 3T38A 1Q0LA 3WVNA 4JZKA 3OWHA 3E22A 3PKZA 2FW8A 1GPBA 2XX3A 4N8EA 1OWMA 1Q7GA 1TJPB 4OH7A 1RZUA 2XMSA 1GLVA 3CNQS 2A88A 1YOVB 2AUTA 3TLMA 4EZBA 1E7SA 1W0JA 2FE4A 2XMCA 3OQOA 5EJ4A 3NTXA 3R8CA 2X2PA 3ZWWA 4G25A 1WD5A 3OJEA 1X87A 2BFEB 2G1JA 1I1QB 3AH8A 4KTVE 3T8YA 3ZQKA 4BECA 3CUTA 3Q10A 3H1AA 3BL8A 3HSKA 1A9PA 5CUQA 5DHRA 4NMWA 4KWHA 1Y8QB 4S1NA 1R0LA 4FFPA 3OC0A 3U39A 5EWJA 1TUBB 4MDHA 3SS9X 3BXPA 4KFUA 4NX2A 4CMAA 1M6YA 1A2OA 2BHRA 3QF4B 3T12A 4JT9A 1DQZA 2AFHB 4B3XA 4G1EB 3DBVO 1BXRB 3WL8A 1JQJC 2QP9X 5L3QB 1I10A 3NHJA 2Q6VA 4GI2A 4GMXA 2YL2A 4CEJA 2EWWA 4ZOCA 1RI3A 2GJAA 4F8EA 2FFHA 3ORYA 4I3FA 4R68A 1OTYA 1W30A 4EY3A 2ZBRA 3CT6A 5DYTA 2WSMA 1EH5A 4IJKA 3RWMB 1XNRB 1V47A 3EG5A 2A57A 3NDPA 1TLLA 1PS0A 3CUKA 1YZLA 2OBLA 3UK2A 4Z5XA 2LV8A 2CJFA 1RKVA 4KDEA 3DO5A 3KRTA 1D2HA 1KI9A 4JJGA 4CIAA 4D5EA 3BBPA 2IU6A 3GOQA 4Q12A 2NP7A 4E70A 3MLBA 2Y67A 4PLHA 1E1RA 2D2XA 2EARA 3K0EA 4PG8A 3RVNA 1JSRA 1S3IA 4YV0A 4NDAA 4A5OA 4K7JA 4C0JA 3QM1A 3GD7A 1FDVA 2A1TS 4O1HA 3ZX4A 4BFUA 1ETUA 2ZI6A 4QODA 1U7TA 2QQ0A 2XZTA 2C2MA 2Y1OA 4Q4AB 5ECWA 3RVKA 1E3QA 4IJUA 2OORC 3L9WA 3S2SA 2OILA 2DT5A 1NHGA 2PXCA 3E58A 3KFXA 3LT1A 1II8B 2IPAB 3JQ6A 2FH5B 1HYGA 4A8JA 4E46A 5CFRA 5M29A 4AYTA 4X5OA 2WMNB 4WL0A 2E6KA 3OLWA 3GV0A 1B0AA 4XE5A 1QOQB 4K6HA 1ULBA 5IBPA 3Q72A 3UCXA 4DTCA 2XH8A 4U6NA 1R4AA 3IB6A 5DGXA 2R9VA 4O6VA 1P18A 2R00C 1NAIA 3KAKA 2Y0BA 4A2PA 1GTG1 3CW2A 3LUGA 5LR6A 1QP4A 2FI1A 4HWSA 1F2TB 1JYEA 2C5SA 2BGIA 3DDHA 1AKUA 3LWBA 4OV6B 4QULA 2PY6A 4N01A 2HDHA 4RPIA 4UTNA 5J2UF 3PFBA 5CVUA 1LW7A 4F5DA 3G5TA 3Q5GA 4G1UC 3PWZA 4PC1A 3MT0A 1W7AA 3JASA 1XZ8A 1LQTA 4J1QA 2BTQA 3H8WA 4QTXA 1GP2A 3F0TA 3K09A 1G3IA 2GPYA 2O14A 1CUSA 2A9RA 2PHZA 5JQGF 3C3PA 3LDUA 3PPIA 3TW4A 3VKVA 1UBUS 3A2MA 5K0BA 1TQ2A 3O83A 2MIIA 2FWNA 4QXAA 1DELA 1Q1GA 3WS7A 5A4KA 1THGA 2ZJYA 3OETA 3QE0A 4K03A 1YR8A 2FLWA 2WHPB 3IQZA 3UK6A 1QHFA 1ORWA 1XC7A 2VYFA 2ZWIA 1KARA 2JLBA 3KEQA 1AQLA 4NBUA 1A2KC 4RPCA 5E4FA 3UUGA 3W6ZA 4UAUA 1DJLA 3O8OA 4MRRA 1SPXA 3A6FA 3ISJA 4Q7EA 2PKQO 1ZXXA 4MIEA 1RCTE 3BAZA 4CU5A 1ZN2A 1YUMA 3W1WA 5KDLA 4DPLA 2IDMA 2F43B 5TARA 3FNEA 1FXUA 1UFOA 4HSEA 1T0UA 4ZAVA 3NBXX 5TJHA 2JJ1D 3RK1A 1PFUA 3ZCUA 3DD5A 1F7VA 1I13A 2PRSA 4Q66C 5DNVA 1J9ZA 3ESBA 3W2GA 5JAQA 1FQWA 5CGQB 5J4VA 3H5IA 1N2SA 4Q9IA 4ZT7A 5DNCA 2AXNA 3EUWA 1GN8A 3MJRA 1RYFA 3MELA 4Q3EA 2AYZA 3L5OA 1RJ9A 3W5JA 1NXTA 3ZWXA 1URPA 3DFMA 3IPAA 1FTGA 1ZNZA 2DR3A 1XLTA 4WX2B 3ZWNA 4CLEA 4LFBB 4I1UA 3V1MA 1XUOA 4FOPA 1FX0B 1JYSA 3D3KA 4P3PA 4RZQA 5SYMA 1DDGA 3R74A 3VKGA 4QJ5A 2ACWA 4CN9A 4EG4A 4GXTA 1EDOA 3NH9A 3N76A 3PNKA 1ES9A 2DSTA 1ONPA 1Z9BA 3PKJA 4Y0NA 5ALKA 2K7FA 1ZRMA 5C5IA 3FMFA 2P62A 5E6UB 4GD3Q 3LF1A 3R0JA 3TECE 5CPFA 1O96A 1T9ZA 2QD3A 5FBWB 3LQKA 1VRWA 3L7AA 3VOSA 3OUZA 4FJ0A 3BVPA 1UBTS 1S5PA 2ET6A 4KO4S 5E6RB 3ZLTA 1Z74A 3K9CA 5ABPA 4QTUB 2ZVJA 1RZVA 3NOQA 3KKPA 5A4JA 2PLAA 3FGNA 5IM4F 1UJMA 4I1YA 2YY6A 4MLDA 1U0NA 3KV3O 3SU8A 2O20A 3L0PA 1MAUA 2VZ9A 2D3WA 4IJVA 1AU9A 2FDCA 4DWJA 4S04A 1FW8A 1TEHA 3ZBPA 4LHXA 1R8QA 5AVQA 4IDGA 2IV2X 2GNAA 3WNBA 4KDRA 1GCAA 3VX4A 1GR1A 2O5VA 3CVJA 4LMRA 3F4BA 5CJ2A 4DV2B 1Y8RA 1RQLA 2NPFA 3IYLW 4TMTA 3U9LA 1F8UA 1SK9A 3GHYA 4LISA 3EIXA 2X0DA 3DCJA 1PTJA 3VR4A 3QVWA 4NZZA 1T2CA 3C98A 3F96A 4LCEA 4A92A 2H3EA 2SICE 2FEXA 3TNFA 2O5CA 1B15A 2G1KA 2IDJA 1XT6A 2GA8A 2QQ5A 4KIUA 1QPBA 3EWSA 5IEBA 1XEFA 1NYRA 1Z25A 4R1OA 5IPFA 2H65A 1ZCBA 1JDTA 2FV8A 3NEPX 1TO1E 3D0RA 1R27A 2XUIA 3O8DA 3LKVA 4K28A 4EW6A 3VBEA 5IAGA 4YT8A 3CV3A 5BSWA 5BV1A 4BB6A 3U7EB 4DF3A 2C0PA 1U99A 4Z4IA 1ZCFA 2C9ZA 2WT9A 1EUDB 3B12A 4KFSA 5K3AA 3UKOA 4F93B 5JE8A 4WJLA 4UVDA 1BA3A 5A4DA 4MLZA 4NV0A 4MVCA 4UHJA 1ORTA 1Q22A 3JQCA 4W8HA 5HGJA 4HH1A 4DC9A 1ZJWA 2JAOA 4DCUA 1QYDA 4W5TA 4EYQA 4NTZA 2Q3EA 2QM8A 5DM4A 4BV2A 4MR7A 1DBSA 3U5ZB 4ENQA 3ZZTA 1BGXT 1UM9A 1EX7A 1HDRA 3LD9A 5LPNA 2WTUA 2ST1A 4CL0A 5U4QA 3ZDXB 2ZB4A 1OKKA 3WLLA 3DZBA 2A5DA 4DG5A 1H2XA 1MDBA 2H4XA 1KOGA 4R51A 3NIBA 3IR5A 4IF4A 5IVPA 4I5GA 1IOLA 4ZTBA 1E6CA 4ZK2A 5BWOA 2P1ZA 4K9RA 3R1IA 3P2EA 2AYXA 4K88A 3Q0EA 4GZMA 3DEZA 4L8GA 3TD6A 3D7NA 3D31A 1M0WA 3U5TA 1VG9B 3D7MA 4NLLA 3N2GB 3SYMA 2AD1A 1M7GA 1KFKB 1XELA 1X7ZB 3KK0A 3MWJA 2W4QA 3WDLA 4C01A 2YMMA 3VPFA 2C9BA 1TCBA 2R8XA 3K0FA 4DGQA 4QUAA 2H0AA 4CG2A 5LYJF 1PK9A 2XYPA 1U5BB 3KQQA 2YWDA 4NHOA 1MTOA 1ND6A 3PR3A 1KDOA 4QU8A 1HWYA 3CO0S 3REOA 3ZX5A 1KMHB 3JVIA 1H8ED 2I03A 4JZYA 5DX0A 1AKNA 1QO0A 2EP8A 1DQRA 1NRIA 4IKOA 3FSGD 3QJYA 4DSUA 2L42A 2VWPA 4BMCA 4XYMA 5F2OA 4FZRA 5IBQA 4IZIA 1M74A 3VNVA 1UAYA 2ZZMA 2OMEA 1VKZA 3OUTA 3LC0A 2XDQB 3L8FA 4A15A 2ZUFA 1DKUA 3FCSB 2IP4A 2K87A 2QX6A 4UMFA 5FLEX 3CS3A 4WZBE 1VKRA 1GA4A 5KSZA 5TIIA 1UPAA 3BWEA 3LCMA 4DLWA 1K92A 3AR2A 4YT2A 3OCXA 3C85A 2PS0A 2VHJA 1JF8A 4LSMA 3WLAA 2ZSKA 2J45A 5DSXA 2YCLA 1ZVJA 1NPYA 5A3SA 2Q0QA 5AD1A 4EHIA 4DMKA 5HS6A 5FH9A 4JROA 4FOTA 2Q5CA 2BGLA 3OAAD 2INGX 3VZRA 2WWHA 4PFQA 1FMCA 5AJXA 3WDSA 2RHCA 1K06A 4FINA 1LSUA 4HX2A 1OXKB 3HJGA 3DWEX 4ESEA 3F46A 2AZDA 1OXUA 3D8HA 3ENNA 3PRHA 1LUAA 3PC2A 2H17A 3H83A 3P71T 1W8DA 1JDZA 1JHAA 2F3PA 4P3OA 4DMUB 3EIEA 2A5GA 3I37X 3K72B 3KDAA 1VB5A 1GLNA 2R6JA 4JSYA 1C1XB 4LOKA 5E9JA 3TRIA 1X80B 1VQ1A 4ABYA 1T13A 3T3HA 5JTUA 3PRYA 2HHCA 4MQMA 3QELB 1O95D 2LKDA 2I5PO 2VK1A 3M6AA 2G5TA 4G6ZA 4W1RA 4W82A 3UVEA 1Y1SA 1P1FA 2VG8A 4E13A 1KWGA 3QKTA 1H4SA 2C2HA 5BSRA 1RXVA 2RHRA 1UKZA 4KK3A 4M98A 1NF9A 2B1RA 3WRWA 1PR9A 3BF8A 1P77A 3HYCA 2ZUTA 2HDWA 1LFDB 2OGZA 2PX4A 4R2KA 3S1AA 1T2NA 4IGAA 1QHIA 2CHQA 4F1KA 3T9BA 4IZOA 2YBEA 4P0QB 5L6LB 1VIDA 1NI3A 2D54A 5HIJA 2PZLA 5AK0A 1V35A 3ZE1B 4HWGA 4X8OA 1KL7A 3VH2A 2FQXA 4B43A 5AKGA 1II9A 4QBIA 4IVRA 1NSFA 5EKSA 3AF2A 4MIKA 1FLVA 4AF8A 5EIBD 2DG2A 3EPLA 4YRMA 4AS3A 4WNAA 1JNXX 1EFUA 3A58B 3EIWA 1VHWA 1MAVA 1F0NA 1YRAA 3FNFA 2W6ZA 3R7WA 2FF7A 1X1DA 5EQTA 3T4UA 2WSSA 4MI9A 4K1XA 1JDNA 4YAUA 1YRQA 1YVDA 3TPCA 1PZFA 2M1XA 3EF0A 2HTFA 2IGBA 3HU5A 1ESNA 1V48A 4CR8A 3O93A 2RKBA 4KE8A 1GT6A 4KHPB 2VI5A 4NE2A 1ZVQA 3HDYA 3AJRA 1ILWA 2BFBA 2IXEA 1TF5A 4GL4A 1QGED 2OHFA 1HORA 2X1MA 4L0CA 4Z8YA 1YH3A 3ECCA 3PQ5A 3QA3E 4U2DA 3RGWS 4YMVA 1HMPA 2VP3A 3QX7A 4ZO4A 3KD2A 4MV7A 1DAOA 2PT9A 4DV1B 1T4GA 4AYWA 4KKVA 4AULA 5KEIA 3MJCA 1PS9A 3OEEA 4UEWA 4MVJA 2OCXA 5KNDH 2PUCA 4JBWA 1IPFA 1W34A 3LI2A 3ETGA 1EZ1A 1T9AA 3IE2A 1NRWA 1EE2A 1XXHE 2B25A 3G23A 3ITKA 4J0JA 5GWXA 3TSYA 5CB4A 2P9FA 3DCIA 3ZWMA 1EDEA 3EFOB 5AI4A 4W9NA 3Q2IA 3CH4B 1INLA 3RCBA 5JLJA 1C7JA 1UOQA 5KTYA 5IDQA 1J1ZA 3L6CA 2LD4A 1K8YB 2EFCB 2V7QA 2FRVA 3F6EX 1RYEA 1JIUA 3BX1A 4WOPA 3A6HA 2A86A 1JPJA 3CC8A 3RSLA 4C3VA 1E0AA 4G24A 3KJNA 3NOVA 4HPWA 3L0BA 2YOGA 4PGMA 1RWVA 3FKSA 4BJ5A 2PH3A 1ODIA 3QF7A 4KZKA 1WPXA 4L3WA 3L06A 2WM2A 1YAHA 3QQPA 4GVXA 2WHXA 1W88B 2H59A 2GCPA 3BWBA 2IYYA 3OP4A 4IBOA 2EBHX 2EKLA 3CISA 3HMKA 3PGXA 4FCTA 4KO2S 4NR0A 4LCBA 5DZSA 5AH0A 2WSYB 4TL8A 2WF7A 3ROEA 4EQ6B 2OLKA 2OZLA 3EYWA 3LBFA 2DPXA 3Q87B 4G4GA 4GBGA 4WY8A 4EJSC 3NUGA 2D1SA 1GCUA 3DZKA 3P96A 4NEHB 4YRJA 3W78A 5A5VA 4KN9S 2F8SA 1WZ2A 2P2SA 3A32A 3B3FA 3KVNA 3GRYA 2HIMA 3Q88A 1TZBA 4IDNA 5EJ9A 1VIMA 3WLFA 1UWCA 3IVXA 2ZM6B 4UM8B 5H3CA 3WMGA 5HF5A 5LQAA 5E8JA 4Z54A 2FSVA 4Y2RA 3OCZA 2R60A 4UUOA 1GYQA 5C0OE 5TY0A 3D5EA 3P2JA 1XD8A 2OVFA 2Q6KA 1QRRA 3FWZA 2B1GA 3MTDA 4P3YA 2JJYA 1IXKA 3N75A 3ROFA 3BF7A 4A3SA 5FTLA 1W87A 3HADA 3D6UA 4K0KB 1KY3A 3ZXSA 2GCEA 3QEMB 3FUVA 3TOZA 4D42A 3DAGA 3IAM6 3P9YA 5TMEA 1K7XB 3AUYA 3ROGA 721PA 3WMXA 1Z2CA 4BDTA 5B3JA 1W25A 2XLBA 4DXHA 2IZ5A 2YFKA 2RBGA 2AUMA 2B4RO 1L7MA 5CMLA 4ZU3A 4BEBA 1PHRA 1DPGA 3GYBA 2F8LA 4HXEB 4N54A 5LZ2A 2V03A 4B73A 2PKCA 3IL2A 4CQLA 3AUFA 1VYTA 4YRZA 1XKLA 1I4EB 2B8TA 4NYJR 1DRJA 3CJRA 3QW4B 5AJUA 1YZ3A 2A30A 2AW3A 1G20B 4E14A 1P80A 4QVKA 4JC5A 5F3DA 2AIRA 3LVFO 5C80A 1QCDA 3F5FA 4KWIA 3H9CA 2YTZA 3LHKA 4BQNA 3EXFB 1KQNA 4XJXA 1PKXA 4EG0A 4RTRA 2ZJFA 1C1YA 1SFRA 1C9DB 2H18A 2I9PA 3DM9B 3IPLA 5DT9A 5DP2A 2X1LA 2H7YA 5HTKA 2Y3IA 2IA5A 3MJTA 4FFRA 3U3ZA 2HR1A 2GSDA 2AFIB 1T9CA 1Q0SA 4FYYA 5KTPA 4MA5A 1Y8CA 2PRYA 1V5FA 4II7A 4G2TA 1PT6A 2C78A 2X9NA 4E2WA 5BQPA 1NXSA 3PS9A 3SKYA 2HF7A 1E96A 3CKKA 4D8XA 2WJAA 2DTEA 3CUEF 2IZOA 1FFXA 4TQAA 5K6TA 3THYB 5TPZD 3UJ6A 1NBHA 2V5AA 1TQDA 1UH5A 3VSCA 1N5OX 1K9VF 3M6UA 3QI2A 4JJ7A 4IOKA 4FE7A 4QU5A 4R0VA 4EA7A 4OFZA 3GLFA 4MJ7A 1H4TA 1SA0B 4PLGA 2JGJA 5ADHA 1F38A 4J0GA 2O05A 1S8OA 2NSHA 5B7QA 5EEHA 2HRQA 3LHFA 2EJBA 3DP9A 1MRSA 2Q7XA 1C1HA 4HGNA 5TS3A 1E2IA 2YCBA 3NV9A 2VRCD 1MRNA 4P84A 1EK2A 3WGLA 1HDIA 4ZD6A 4AAYA 3ENQA 4IGKA 4Y1RB 1SBCA 4HQ6A 2CMDA 3A1CA 3RVLA 3OFKA 3I6ZA 1N2CE 1RAIA 5FUQA 4EG1A 1OLSB 2MINB 3CEPB 4TKUA 2E82A 4AMYA 4F3KA 1CB0A 4PF1A 4LF4B 3QV2A 4XOUA 1PKEA 3ZWOA 2QE7D 5J5CA 1W85B 3HJNA 3TG2A 1YBMA 3EGCA 4D81A 1I8TA 2VZ8A 2WW8A 2XY4A 3DBRA 4HAWA 2JFUA 4QLOA 5AJVB 5EXXA 1SRRA 3GPCA 1C8VB 4WCFC 3WBFA 1EZZA 1PVDA 4DANA 1PV4A 2XF2A 4BOYA 2FPRA 3D3WB 4JVSB 5ADUS 1Z8HA 2X6TA 1KAMA 4QUJA 3U1VA 5JFTA 4CL2A 3H2YA 1K7SN 2JLQA 3HCEA 5CVCA 3CXUA 3D4BA 1PUJA 2D0DA 1ABEA 2V0NA 3D2BA 2M98A 1TJYA 1C5KA 1YC5A 2RCNA 2RK3A 1B8UA 1ZESA 4FIDA 4JJEA 4M8LA 4UZFA 3RIMA 4RPHA 1H1TA 5A6SA 1S3SA 2CUKA 4Q5IA 3H11A 3M3PA 5ALLA 2DZDA 4ENPA 2CLHB 4EA8A 3DL4A 2AKAB 4JOQA 3WQRA 3PT5A 4YP7A 2XXAA 4E5VA 4URHA 4LJRA 1RIFA 3R9XB 3CSSA 3DBOB 3JQAD 4HZUB 5BRAA 1JZTA 1PQWA 3ZU3A 5AM3A 3RC8A 2R6GA 2C4HA 2DWQA 4PIMA 4TTIA 4GT1A 1T5HX 5KYVA 1YR2A 1JG2A 1KSJA 2BTOA 2ZSUA 5BVHB 2JHPA 3PC8C 1JAHA 1OROA 1QXSA 2ONKA 2PRZA 3NBYC 1V6CA 4BUZA 3CB2A 4MKFA 3VVLA 5C1IA 2G4CA 2AFVA 1UP4A 4Y6PA 3G7SA 1J2TA 4IZHA 4ZOBA 2GCIA 2GUGA 1IM5A 2YWXA 3E9CA 2XYQA 1AS3A 1I4LD 2Z9DA 2JK0A 1KMIY 2E87A 2ZSFA 3UMSA 1OPXA 1Y5NA 4GE0A 4CIWA 2FSUA 2E4UA 3I3SR 4WXPA 1DXYA 4MGZR 2Q4DA 1DMSA 3BA6A 1X2EA 3GJQA 3LCRA 1R00A 4NRDA 1WSAA 4U4AA 2PVCA 4LBVA 3ITNA 4BIMA 3FYUC 3JX9A 1FVFA 2DPMA 3EC7A 4IL5A 1WOYA 2HSZA 4GSLA 1O94A 2GCNA 4FKZA 3BKXA 4ZHQA 4ETNA 1VSQA 2VHXA 4MW7A 4O2BB 4MI6A 3NHZA 4EM6A 1JSXA 2W4MA 3K0KA 4I8IA 4WLEA 3ZHQA 3MWYW 3ABSB 3QFCA 1CY1A 1SCDA 4EHFA 4B6RA 4UHKA 3HM2A 3ADDA 3RWOA 1M8JA 1RWOA 3BMQA 5KTTA 1VL0A 4JT2A 1PDVA 2GN1A 2B4KA 5FULA 4KR6A 1AMOA 3SYTA 1BJRE 3DQZA 1FFCA 1QYIA 2H2HA 3JPWA 1MC4A 3GMDA 3DWGA 3B8EA 3VZSA 4ZALA 1I4DD 2FP4A 3CX3A 4XQEA 2MDTA 1JEAA 2XUZA 3LBAA 4QUDA 1K3UB 3EA4A 1MJNA 3NH6A 1LRKA 1LSOA 5IULC 3A0UA 5F7JA 1NPTO 2WVGA 3VR5A 2ZRGA 2X40A 2H63A 3B52X 3N6VA 2XTNA 4IIJB 2R6FA 2Q8PA 2VYCA 2ZIXA 5E2AA 3ZKWB 4DMHA 5GIOE 1I3KA 4HDAA 2X8LA 1DS6A 2VWGA 4L7QA 3WSVA 3T1NA 1R5OA 2CCGA 1EFAA 2Q3BA 3P5BA 5LP6A 4RKWA 3ZNNA 3SX2A 1P5RA 5AKYA 4YDHB 1M1ZA 3LFTA 5AVXA 2OGSA 5HHTA 1OV6A 5DW0A 3RJZA 1PEDA 4LJYA 3AVVA 3OX4A 2NVUB 1XHFA 3VC1A 3SLRA 1MX9A 3Q6MA 4ENTA 1UWVA 2WAXA 5LN1A 2HWYA 5JNRA 4H1VA 4Q82A 1E79A 3QA9A 1JTEA 3BG5A 3DEJA 3ILHA 1IN7A 4G0PA 4WCVA 3USZA 1ISJA 4WBNB 1TZKA 1YJAA 1T5BA 3B20A 4QGHA 3K4QA 2OK8A 4ACAA 4B46A 1G7SA 1XZLA 1UXHA 3KLNA 4OREX 2JI9A 4RAOA 4XYGA 4Y1FA 2WWVD 3QIVA 2D0OB 3LNCA 3N5CA 5JV5A 3ZJTA 2QUHA 3MYRA 3QXXA 4MR8B 4A23A 2WDZA 2H00A 4JC8A 1SZDA 3RRNA 1Y3CE 5JWOA 4W9MC 4B4OA 1BN7A 2O48X 1H22A 2XB9A 2ZRAA 2UZ1A 3AVPA 3QRWA 4K9OA 2PGIA 1Y1KE 1JG7A 2GN0A 5EMLA 1USKA 4P93A 5TRTA 421PA 5IYZB 3UW3A 1T6YA 3TOVA 2PKYX 4AF7A 2NNWB 2WIFA 4BMNA 4BHTA 4ANFA 3X2SA 4P7BA 3QWBA 2V54A 4PX3A 4YXWA 3RIHA 1MD9A 3ICPA 4AJ1A 2BFFA 5T3YA 2PPVA 3K0BA 4N65A 1HT0A 4L5CA 1SOUA 1U0LA 5DM2A 2DAPA 3STWA 4AO7A 5K09A 4CV1A 5JOQA 2GXAA 4MGYR 1GVNB 3DVAB 1WWKA 2G40A 3SP1A 2JEYA 3HVJA 1PP4A 1JE1A 4G41A 1T2UA 1AKWA 1L7XA 1Y9AA 2I8AA 2BKAA 1WZNA 2YWGA 2ZXEA 3EW7A 3K20A 3NJRA 4G65A 2IUYA 4HEHA 5B3JC 4IIEA 4KXXA 1GTVA 1OWOA 3IT1A 5A3JA 1BWSA 1OFUA 2F6RA 4L4XA 2C83A 2PEYA 2H2WA 1R3DA 2XBUA 1NX9A 3HA5A 3Q9NA 3R9KA 2QG6A 2AEMA 1E7MA 4HNSA 4L50A 4XR9A 5BMVB 3UG6A 1J5XA 2Y1KA 4RV4A 5IHXA 2EFEB 5TF0A 4DT1A 1MW9X 2KQUA 1KDTA 3O21A 3LT0A 4ZV4A 4R01A 5L3ZA 1WULS 3KXLA 3KZMA 1OGIA 4G0MA 3WFIA 1JR6A 4HGZA 4JYMA 1RACA 4N12A 1RQNA 1VI6A 3KALA 1VCHA 3F71A 2C9DA 4FR5A 1Q5PA 3BWDD 4F6RB 1YWGO 2D4AA 3ZHUA 2G83A 3NAZA 1NW8A 1H69A 5ITZA 2J09A 3ZJ4A 1A1VA 4QBHA 4OIFA 4I5FA 2GJKA 1L8QA 2G8LA 3P20A 4LCJA 1FK8A 1PWYE 5CEFA 3W8NA 4N49A 2Z43A 1NMZA 1SKYE 3NYWA 3O2NA 4DCSA 3EDOA 4FWIB 3VR6D 3EQ6A 2JFZA 3FTCA 3HV0A 3JQBA 2VQ3A 3ZH2A 3LCCA 4AWBA 3ICCA 4KQIA 1EE1A 1Z3IX 5EXTA 5IN4A 2OMKA 1QX3A 2H9IA 4NPHA 4RIHA 4OYRA 2H1FA 1FFHA 3SQOA 8ABPA 2UXDB 1ZOLA 3DW3X 4UUNA 3I73A 4LTMA 3JYLA 2GD0A 2QX7A 1PS8A 1GYPA 1UMBA 3OIYA 4KQKA 2JLRA 2XWQA 3TRKA 3SVZA 3KTAB 1U90A 2GYYA 1R2QA 2QL6A 5JWRA 2ENWA 3WLMA 5IEJA 2LTAA 3ECSA 1U2EA 4BO7A 1L7VC 4G1MB 2VSFA 4ZQHA 1FNBA 2QUZA 1PJ8A 2QD4A 1R8SA 2QM3A 3BXHA 2GYUA 4ZV7A 3RSOA 3V1UA 1ZISA 4X66B 1RI5A 1ODLA 3OLXA 4PHCA 1SAYA 4DG9A 1IM2A 1KR2A 4YUZA 3HEMA 4K40A 3CTMA 1CDDA 2YXLA 3ORQA 5JALA 3X2FA 1LBTA 4AXXA 1J8YF 2QI9F 1F8GA 3ZCTA 4QECA 4IGEA 2A9PA 2WVHA 4RNCA 4U9IS 4ZYYA 5IZCA 1NI5A 1T5OA 2XB8A 3QUAA 4ARZB 1XF1A 3H8SA 1LJ8A 1HDYA 4RWZA 4R1NA 1BQ4A 4DLNA 5J2TA 1OAKA 2XF8A 1JHMA 1NMXA 2RGNC 3GH3A 1RC1A 5I7RA 2ILTA 1AF4A 1PDWA 2DUJA 2IXFA 4FEAA 2AOWA 5K4HA 5LBUA 3TIIA 1GTMA 3KZCA 4AM8A 5JJIA 3PX7A 1GOTA 1MVNA 2XRMA 1IUKA 5K3FB 1JEQA 3A9RA 5GAJA 4NVRA 5K2MA 3RRXA 1E1QA 3DQQA 2VXOA 1DL5A 4IXWA 3BD8A 1DT5A 3D7SA 2CVQA 5BXYA 4KV9A 4DJEC 5IJ0A 3TGPA 3KB6A 5GM2A 4PYMA 4XDHA 3RVMA 1QHXA 5IABA 4NXMB 1FDUA 5FQNA 3KBBA 3RTCA 3L6EA 4LVCA 3JD0A 3KG2A 1GPDG 5EP1A 4BNDB 4Q4CA 4DV7B 3NFRA 2YINC 3Q15C 4AC9A 3SAJA 2F9MA 4I9NA 4JWTA 3L4JA 2PGNA 4KX5A 1YJXA 2GARA 2VYVA 3W7VA 1H2BA 1DO0A 1KJZA 2H48A 3HBJA 4NP6A 1PFQA 5BWNA 3N6RA 3CG0A 3ZI7A 3RVPA 5KQRA 4BRWA 4GHWA 4YRPA 3W3AH 2BSAA 2PZEA 2QNBA 5E8RA 2FZKA 2BBOA 2P0EA 2OLEA 4C4XA 3WGOA 3SQNA 4GE3A 4R9UC 2Q99A 3F97A 2FRDC 3G7NA 4JOSA 1M2HA 2JJMA 4YCCA 4J91A 1KVTA 2J3DA 1ZSVA 2QM0A 3I9FA 3TEMA 4M6WB 4OA5A 1RLMA 1YU9A 1Q11A 3G13A 4BB0A 1UBJS 1ZNYA 2QIOA 3QP9A 1IZ7A 4ECAA 1I2ZA 2GN8A 2QYTA 2II6A 3K6KA 2DBQA 4BEJA 3IP5A 2VK2A 1MAWA 2MTBA 1ODJA 1NMYA 1L0BA 2BLNA 1E92A 5KYYA 1OX4A 2BKVA 2QT0A 2M6KA 5E3JA 2O8DB 3CW9A 2HMVA 3O8CA 5LJLA 3GEBA 3G2NA 4MUAA 3FWNA 3TEFA 1K2VN 2O2ZA 1IWPB 4F3CA 4ESHA 1R10A 2AEEA 2EW2A 4A27A 5EHNA 4GC5A 4NCNA 1GQ2A 1QNLA 3BSFA 5CX1A 3SNKA 5GTDA 3KVOA 1NNLA 3DH0A 5CH3A 3TPFA 4V0OA 2NAPA 3COSA 3FCUB 3JQ7A 4XM1A 2ICAA 3RM3A 1K8XB 2BZ1A 2ZU0C 4M0KA 4HQ0A 5EPUA 1K6EA 3WGVA 1J1UA 4MXDA 1FP4A 3HKDA 1WTAA 3ENVA 1ILEA 1VM6A 4RFSA 1FA9A 3I0NA 4K9KA 4R98A 4ZGBA 3DCNA 2ZUEA 3GIWA 1MB4A 3T15A 3CCCA 2H8KA 2ZIGA 1CUVA 1Y7LA 3GLSA 5C8VA 3ELDA 4BRZA 3WL7A 2YIVX 1X1QA 2GNPA 5BN3A 4Z9YA 3QJGA 1FFYA 1UT8A 1QRTA 4M49A 1B8VA 3OU6A 1JFLA 3KKEA 1X7HA 2RARA 4C7BA 1LBSA 1US8B 1E1KA 3HN7A 5ISMA 1S96A 1LDBA 1M76A 5JDIC 3C4JA 3G2MA 2BM1A 3GA7A 5BY2A 1PGJA 4II3A 3HLTA 1MO4A 5JQGB 3EXIA 2CLDX 3NEJA 4ZT2A 1QM5A 1IIBA 4ASUA 4NAUA 4V0NA 4C1BA 1XTVA 4KR7A 1GTL1 3FNHA 4LDNA 4XM2A 3IAHA 1QK5A 3UHJA 3RUCA 2BGGA 1R1DA 1U2TA 3B6JA 1S2OA 5HRCA 2NSJA 2LW7A 4WLNA 3VH1A 1L7DA 1NVEA 2J3EA 1CZNA 2WSIA 2Q41A 4DDWA 4ALMA 2CL0X 1MO5A 2BFDA 3IBSA 4UHBA 2FZVA 4GLFA 2VYNA 4JN6B 4B3GA 3F9RA 3H1TA 3HFJA 2JGLA 5ED0A 3L6UA 5C37A 4I46A 1QH1A 2YIMA 3AHHA 3JALB 1TC1A 2VDWA 3AWDA 3OT1B 4EB8A 5JW6A 4P8RA 4YMWA 1JR3E 4EH1A 2X8BA 5H3HA 5EJ7A 3CF4A 4I9GA 3V5NA 1ULHA 3W8FA 1GTRA 1EWQA 4X54A 1OPRA 5LVAA 3LX8A 1YQTA 4RIGA 4QOSA 3WADA 4AL4A 2DJIA 3O1HB 1L5NA 3TZKA 2A8YA 2JS7A 4JB3A 4M60A 4CFZA 3VU9A 2Y1DA 3C6MA 3H0KA 1NVFA 3V4LA 1GGHA 1Z15A 5DHFA 3WHPA 4TKVA 4Z3KA 1EGMB 2X4LA 3GFOA 1NDHA 4UARA 4D0RA 3LUCA 1QS0A 4FGJA 2K7ZA 4OGGA 2EIXA 3WMRA 1IHPA 3W8RA 4NPAA 1Y42X 3GJRA 1L5FA 5BN5A 5MFZA 2XSZD 2IP1A 2WQ6A 4PLTA 4YCBA 1PX2A 5CNJA 4XJTA 3TX6A 4ON9A 1RBZA 4M8NE 3ZHVA 1J0EA 3HH8A 2JFWA 3V42A 1UF9A 4YCMA 3DOJA 4EBFA 4YV1A 1GG2A 5CB4F 4Y0VA 4KI7A 5MN5A 4H59A 1CZKA 2KM1A 3KYCA 1R16A 3WRYA 4JFAA 2UZ4A 4ZYTA 1QYVA 2VSOA 3ROZA 1NF8A 3ERCA 1AXRA 3ABQB 4UUPA 3Q3IA 5I7FA 1ESZA 3MMZA 2CLKB 5D01A 1H1DA 4U7HA 5AM5A 2CLOB 1EX6A 4E5SA 1Z37A 4XQCA 1ZOSA 5A4IS 3THXB 1A5SB 1OXSC 3KKQA 4HNAA 3CPHA 3OLQA 4NAHA 3CEJA 3ICEA 3VAZA 5EKTA 4ZHSA 2GKGA 5GGYA 5LB4A 4PIVA 1O6ZA 4KLNA 1TAUA 5I47A 4IP0A 4UMEA 1O0BA 2GFIA 3A1EA 3WGNA 2A1TR 2LCQA 1IL0A 2HUNA 2X7HA 3FPLA 1KFJB 3I83A 3KIPA 5HIMA 1HXHA 3SLKA 4ADSG 1NR7A 1ESCA 2ASEA 1K8RA 2EYUA 4LGMA 1G42A 3REQB 1SUWA 3LXUX 4D79A 1UMKA 5TMPA 4D4IA 4IQ8A 3SD7A 5DX8A 1I4OA 4KPGA 1R4NA 1LPBB 4CEIB 3THRA 2QGNA 3HXMA 2R6R1 4NZOA 5K3DA 4UFPA 2XUKA 2HLDA 1CXZA 5HK9A 3IQXA 2B1IA 4P32A 1EKXA 2RMKA 1X7GA 3GARA 3WWDA 2QAIA 1XYYA 3JZAA 4LTDA 3JD3A 5HKOA 1Y81A 2CXOA 1CRQA 3WK9A 2Y76A 1DJOA 1Y1PA 1DV2A 3EXAA 4B7XA 4ZO9A 2VJAA 2ZR0A 2B4YA 3KVVA 1OLUA 3E7PA 2QPOA 2HJRA 4KN5A 4KQ6A 3IBCA 1WTCA 5H5JA 3LOQA 5IAKA 1JQ5A 3RTAA 3WGKA 4BQSA 1DBIA 1EFVB 1EVEA 1Y5MA 1PR3A 2O0LA 3A31A 3EEBA 5AM4A 4J94A 4CQMB 5JISA 5COQA 2CGEA 3ZW9A 2GKOA 2OCDA 4E4RA 5DTMA 1UXJA 3DE2X 2FG5A 2YW9A 3LGAA 2H0RA 1KI3A 4Q9DA 4YALA 4BV3A 3EGDA 3QNMA 4AZSA 1NN0A 2BHNA 4M0UA 5HPYB 5C7LO 1EVYA 3X1YA 1E61A 1S01A 5JXWA 3DM5A 3KEGA 1ZEJA 3I4LA 3ZIAD 3MPOA 4JXKA 1FSZA 2BEVB 1BGWA 4R1LA 4DNFA 5LYJB 5KYUA 1ZI9A 3QWFA 1T3SA 3K0AB 4G4IA 3FTFA 3GLQA 3OOSA 3NYQA 4LSGA 1WKCA 2P41A 4XOIA 5DTRA 5E0OA 5G40A 3RVQA 3UCEA 2GJ9A 2VP5A 1Q3HA 4ER5A 5AI6A 4UKDA 2P90A 4BVGA 1AQNA 1RKUA 3I6BA 2ZE6A 4W7HA 1QVWA 3WIEA 2JVIA 2BH2A 3MJVA 1CB7A 4MICA 4TKZA 5DMXA 1I0IA 1ZBDA 4MRMA 1EM8B 1O6FA 3RS9A 2QORA 4RD1A 3FF4A 4ZYXA 5KDOA 5DV9A 3TQIA 1Z2DA 3NCHA 5KTRA 3ZHYA 4MZDA 2B82A 2VRBA 4X7BA 1K4YA 5C46F 3DMNA 3T0GA 2YWCA 4ZVNA 1FMFA 3CYFA 3ASZA 1XMXA 1T0BA 2CF6A 3KYDA 3HRKA 3LQYA 2P68A 3NM5A 5IZ4A 1SC4A 3WLOA 5JAPA 1FP7A 5EESA 4RAQA 1YI0A 2O1XA 4ZMSA 1PX0A 2A0UA 4MMZB 4XI9A 3BDAA 5D7NA 2C95A 1NR1A 1U3CA 2Q3LA 3MTGA 3ZNOA 3LVQE 1RXYA 2FXIA 3AUXA 4BNWA 3CRVA 1CHNA 2PCLA 3TIFA 4BNVA 2F55A 1SBQA 1R6AA 2J9GA 3H65A 5AM2A 3TQRA 5C4MA 3NHPA 2B34A 4XB6B 1ZJJA 4RADA 4XIJA 1C8KA 1Q0RA 3E6AA 1E77A 2WKPA 4M38A 5AVOA 4GWGA 4CU2A 5L7TA 2DPLA 4LGVA 1L9KA 4PG7A 2WQZA 3TLGB 1W44A 2QRVA 3BDIA 4DLAA 4YRNA 1C50A 1MTZA 4GYKA 1SXJD 3S6JA 2AR9A 3T7IA 1TEZA 4Y6QA 1CS0A 1E4EB 5HF9A 3U1TA 4NZYA 4R8SA 4QXPA 4GQIA 3V00A 1U8XX 3V33A 3ZQ6A 4TQGA 1U2SA 1NXXA 2BKLA 2X8AA 1LX7A 4KUEA 5EJ8A 2WE7A 1CJKC 2UUCB 3E5RA 4Y9RA 4M1MA 3GBVA 3OIUA 3Q8WA 4YQFA 2AN4A 1CZLA 1UZAA 1HNWB 4KDFA 2BDUA 2PUJA 1I4TD 4FFLA 2Z2YA 5IH7A 1ID8A 1Y9JA 3JWJA 2BF4A 3KJIA 4KQ2A 4AN0A 2L19A 4LGYA 3ZY6A 2V4ZA 1N0HA 4MAMA 3QH4A 3V8QA 4D8VA 4LXHA 1YNOA 3RV4A 1M2NA 5FADA 2A92A 3WHIA 1J09A 4MQFA 1ARZA 2ZAMA 4GLLA 2HQ1A 1YFZA 1M7HA 4YFYA 2O1EA 3GEDA 3GJ7A 1ORVA 1R0YA 4MV8A 2AYYA 2QRNA 1E3JA 1GTZA 1HK7A 3MT7A 4FHZA 3TNLA 3QKIA 3J7AC 1ACMA 5BUZA 2OESA 3SXPA 1JXAA 1LU9A 3W6NA 3HCCA 1FRFS 4BFXA 4BO1A 2EHDA 1WUJS 4IAOA 1OKKD 9MHTA 1QTIA 4XRRA 2H3HA 4E5NA 3SICE 5KHAA 4UTRA 3T7JA 1C3VA 3I32A 3ZD8A 3Q12A 3QVXA 5FBQB 4ZT5A 1C4XA 4DWVA 2WV7A 2YYYA 2NO0A 3DAYA 2HNKA 4I1SA 3W6PA 4V0LA 4KSCA 3MGCA 2HK7A 2KWIA 4IMIB 4M9SA 5HDBB 5TB5A 3UM9A 4CLHA 4XGIA 4BN5A 3B3QA 3GQVA 4IGIA 4JMPA 4QOGA 5T4BA 3VGPA 2O54A 4X71A 3ZHCA 4D26A 2FQYA 2RBKA 5LJIA 1YGPA 4Q4JA 4ZVRA 4BVEA 2JATA 5BNWA 4ZHQF 3U3MA 1J8DA 1OU0A 3LO5A 2BGKA 3R7AA 1DBRA 1JIKA 3MBOA 2DULA 4IUCS 1R0RE 1DQYA 2WABA 3WQSB 1WV0A 1ML4A 3DBIA 3PXCX 1BJTA 3Q85A 1FNMA 2FN8A 3DEFA 2O2DA 1KJJA 1ZICA 3EIQA 5K01A 3PWTA 3CX6A 3WLJA 4M0PA 4TV9B 4YPVA 1FP2A 1GQFA 1QE0A 2Q3FA 1DCMA 4XD7D 2PAAA 5BP7A 2CUNA 3GRZA 1RXWA 3MMNA 4EARA 4YTEA 4WQMA 1NQWA 1I51A 1U94A 4OMUA 4F6LA 4AZ3A 4CMKA 4LZZA 1UBHS 1TPYA 3MINA 4M1OA 1QWSA 4Y6SA 4L85A 1FYFA 3O73A 4OP2A 5EERA 1N3YA 4NCHA 1G63A 4X6YA 4DMLA 5KKNB 5IFKA 3C7DB 1KI6B 4MKZA 3LQQA 3S68A 1IQRA 2OFFA 3RNOA 4E88A 1GU7A 2BGWA 2C8KA 2KSQA 3AUAA 2NT4A 4FFVA 1E2JA 5TEWA 3RSSA 4RW0A 1V3QE 2OXEA 4URZR 4JQOA 1L7PA 4N6OA 3LL4A 4X3OA 3UUWA 3FNBA 1MORA 4YV2A 2VFAA 4XFKA 4R40A 3COZA 2NUAB 5IMSA 2QTBA 3AF5A 5CA1F 3LPLA 4MRPA 1L6IA 1S0UA 4URWR 5HJ5A 5ERXA 3PJDA 3VO2A 4D9HA 4X9XA 5EYPA 2FZGA 2A0FA 2P6MA 3QLJA 4JSTA 5DW3A 2Q29A 5FOUA 1VJCA 2QF7A 2JDIA 4ND8B 2CN1A 2Y1GA 5ALTA 3U9SA 3ZG6A 2XQFA 4MS1B 5GADl 1JDBB 3B5IA 3HWX1 3PNQA 3WC4A 2O0HA 2TMYA 4OLAA 4OCZA 1RRKA 1GUYA 4HDMA 2CDBA 2X77A 2WPDD 4Q48A 4JI3B 5AW7A 4CIXA 1YS9A 1HEUA 3C6YA 2CB9A 3QHQA 4IOMA 1K6XA 1MABA 5CH5A 5EFOA 4BKRA 1G5TA 1PV2A 2W2OA 4FYPA 3RE1A 4ZDIA 2Z83A 4OM7A 3BB3A 1V95A 3KU1A 4HDSB 1P9RA 5TQ2B 4NCAA 2LVBA 3MS4A 4N5NA 4RACA 3PFWO 3S2FA 3TO5A 2IPOA 4X8LA 3UT5B 4EFKA 3EK2A 1ULZA 5ICFA 4C20A 4MW2A 3KWMA 4OQDA 3JV7A 4RYDA 5IVIA 1SHKA 2DSNA 1B1AA 3BRCA 5KCZA 3M1LA 1CC1S 2QBYB 2EFYA 5AJWA 5A3VA 3IQIX 3LSTA 4UM5A 1WCIA 4DRZA 1FZTA 1IAVA 3I8XA 4H6PA 1GGVA 3TBHA 2IPMA 2F7SA 3GQBA 2C4KA 4AX8A 4B6FA 3VV3A 2FPLA 3CNEA 4LQ4A 1GSOA 3LT2A 4BMYA 1BU5A 4FP9A 3FROA 3GLIA 3M33A 4TL9A 4B3HA 1UFQA 3IDFA 1XZHA 2GKSA 1FFGA 4GM0A 1P1JA 4Q7KA 5EMHA 3DBLB 2I87A 3HL0A 1UPUA 3IHKA 5I9MA 1I1NA 3GMTA 3S44A 1SK8A 3WAGA 3KOYA 3OPVA 1ECCA 3X3HA 4BRSA 3PL1A 1GKIA 3A6ZA 3ADPA 5D51S 1EXVA 2OZKA 4CMIA 4FBGA 2LNDA 5CLQA 2QVCA 3N2ZB 4S1VA 4I2VA 3N58A 3AR9A 3BD9A 3OEED 3PUZA 4A6DA 2XYRA 1B8OA 2GN9A 3KD3A 3Q5EA 2DHEA 4MCIA 4IEFB 3B6KA 2NU8A 4CTKA 2B5WA 5K05A 1N2ZA 3OY7A 3CZ5A 3KKNA 2FPSA 2X2FA 4Q3CA 2YV1A 3RYCA 2YVKA 2R1ZA 3ROTA 3FVQA 3IIIA 1WCV1 1CIPA 1LV7A 1DEKA 4LKOA 3UY4A 4KWTA 3PQ6A 4FE3A 3E2MA 3D1VA 5MN6A 2G28A 1KYZA 3G5LA 3Q7TA 1BVRA 1DBQA 1U3TA 1DHTA 5CAEA 1TGYA 2EAUA 2A9OA 3HJRA 4QYXA 5A9TA 2B9EA 1RHRA 2XE7A 3BD6A 2ZZNA 4N3CA 1VYHA 1A4IA 4JT8A 2I4TA 4FDVA 1O9HA 2PGLA 1OZFA 2YFHA 2HQOA 2JHCA 1RWNA 2OORA 2XBMA 1P61B 3OCWA 3UJBA 5H3LA 2KBFA 2QN1A 3DNFA 1VZ2A 3ML1A 3T7RA 1ZD1A 3K7EA 1C1DA 1RYYA 1TYAE 4E3WA 2XTMA 4R05A 4ZYLA 3ADKA 2J31A 3BMNB 4MOWA 5HBRA 3RIXA 2CT8A 4BV8A 3PEWA 2FFJA 2W2MA 2A3RA 2IYQA 2Y4NA 1Q1QA 5FAXA 1RW4A 3UWSA 4B09A 4CUKA 5KMGB 2FPWA 2R6HA 3U4CA 3KKLA 2R00A 4Y0AA 1Y89A 1NZJA 4RIIA 2UZ3A 1V8OA 3RBZA 4EPTA 4Y9UA 2X0EA 4GRIA 1J1IA 5AW2A 2I2WA 1F5SA 2OQRA 4HN4B 5AJHA 3ZGYA 1FUEA 2HX1A 4YPFA 4LJ8A 1PV1A 1T2FA 2YN2A 2OBYA 4BLOA 3DMFA 3NXSA 2V1UA 1KC3A 2OV2A 3BWYA 4RLSA 4TT8A 4XFDA 3W7AA 1QB8A 2X6QA 2ZSAA 3ZYZA 1Z47A 4LK3A 4YS6A 3E5HA 1QG2A 3EC2A 2HK8A 3K0CC 2AL7A 2DECA 2B2XA 1E1DA 1CVIA 3VOBA 4A1FA 1ODCA 2XGMA 3EIHA 3MB5A 4YJGA 5KYNA 3ND8A 2A5YB 3MBKA 3P9PA 4D4HA 1DO8A 1S4QA 4DLSA 5F77A 2DEUA 2XGJA 5JADA 4Q05A 2HNBA 2J0UA 3E22B 4P83A 4K87A 4MPTA 1JB1A 2EQAA 1MUUA 3QWAA 1II0A 5CCBA 4A73A 3CN7A 1R8XA 3OVMA 2RGEA 1UAAA 1U0TA 4FZ5A 2GZSA 3OD5A 3UMVA 1TZ2A 3PCRB 2D6FA 3DFIA 1VGVA 2V55B 2XNDA 1USUA 1BDMA 1UBCA 4JJAA 4ENSA 3IMFA 4L5JA 4UBOA 3MGGA 1ZN8A 4Z1MA 4NI5A 3C16C 5DI9A 4BMOB 5CFNA 1P6UA 3QXJA 5FI1B 4P35A 3WQQA 2IL1A 5DWVA 1ZMXA 2HMWA 2O19A 1QIEA 1E6UA 5CCXA 3G5UA 3CKMA 2W00A 4X6XA 5CLIA 1KAEA 1BNCA 4GLBA 3ID6C 4KYVA 2QN7A 1JHDA 2JLSA 2QR2A 1ST3A 4PYNA 4RCZA 2IS2A 4FX2A 2ZKIA 1EU1A 1E2BA 2EJTA 1NBME 4J9VA 2Q6TA 2I6QA 3UANA 1MN6A 4GMKA 4EPYA 3M6LA 2QGZA 2HIGA 4RTNA 1JJBA 3D8RA 4MO2A 3V1YA 2D06A 2YC4C 1Q7EA 2PQMA 1QG4A 3NM6B 4J43A 4NONA 4P7FA 3V55A 1HUQA 3IP1A 3VQTA 2BP7B 621PA 2FQQA 2OAP1 1RLUA 2IX9A 3IOMA 5DI3A 1BWQA 1HKHA 2GRAA 2QXYA 3L77A 5EJ6A 1UR5A 3JWIA 4UE6A 2WWYA 1ZOPA 2DKFA 3BXGA 1QKJA 1X7XA 2AEJA 4UXIA 1JW9B 1ODFA 1WHTB 1NBWB 1FJ2A 1OXBB 4R81A 1H6DA 4FFNA 3HWSA 1JFVA 3DDCA 1W94A 1PWXA 2QL9A 3MWKA 3DOUA 5FR1A 3WLEA 2WD9A 3M6VA 1FU8A 4DQ0A 1LC0A 1ISMA 1V16B 1ATIA 2C4NA 1TM2A 1C7EA 2C29D 2OZPA 4FMDB 4FYHA 2BGUA 3AB8A 2JFFA 4D02A 3BK2A 2X5XA 3AETA 5TX7A 4KLRA 1ORIA 1Y1TA 4IDDA 4X3PA 1RJGA 1HETA 1Z73A 1BS9A 3OLCX 3P7MA 4E12A 5EIAA 2IITA 4A6XA 3PHIA 4KZPA 1W96A 1WXWA 2H1VA 4A8JB 5ELXA 1I6MA 5B1YA 3QIAA 4D3FA 2HMSA 3QMMA 4P4SB 3LC7O 1S2NA 1M33A 1WEKA 1ISRA 3K9WA 2G5GX 4AZTA 4YLYA 2GQ0A 2VP4A 1GDHA 4YAFA 3P9ZA 4HRVA 3V32A 1HT3A 1MV8A 4GW3A 2GVNA 5D00A 1V4BA 7MDHA 2IHUA 10MHA 3V4SA 2XHZA 3HP4A 4X95A 1QKKA 2VQ6A 3FSJX 4BO2A 2Z6UA 5HOEA 4D82A 4NE7A 4BP8A 3JASB 4U9UA 2BTQB 2WF9A 4HN9A 4X7PA 1GUZA 3N53A 1PJ4A 4DM7A 4IQ0A 2CHVA 4LPKA 2CFIA 2FPUA 1XEXA 1NQXA 4B47A 4U00A 1J00A 2RK6A 4RA6A 1NVTA 1RJEA 2CHFA 3AHIA 4BJHB 1LS1A 2GFQA 2FW1A 3HGQA 4HRYA 4I8DA 3S28A 4ZTUB 5JRDS 3HKEA 1YCGA 1N9ZA 1W47A 2B4TO 1YS7A 4DDKA 1JQEA 5EZ5A 3CNBA 4BRUA 4A0RA 4JP8A 5JNWA 1W48A 3UGJA 3F9CA 1CJCA 4IFBA 3O8OB 3AZPA 4EABA 1QDLB 3AM5A 1GPH1 2SHKA 1FNDA 3SJ7A 3DQPA 3QSGA 4LRUA 5I7UA 3UB4A 2X2OA 1O6BA 2AR7A 5TQVA 1YKFA 1IZ9A 2AUNA 3H2HA 3H84A 3R77A 5CRIA 3IP9A 1Z2PX 3V7UA 4OLHA 2FWMX 2Z8ZA 4MI3A 1L8LA 1PUIA 4TTPA 2WWXA 3TPZA 3ZLUA 2JVJA 5IAOA 1XAIA 1A72A 2AB0A 5I5GA 3H1FA 4F1JA 1I24A 2V8BA 2P2DA 2TSYB 3WO0A 1T8UA 1W4BA 3ELWA 4LOIA 2I2XB 1RJ9B 1CVLA 2TECE 1D7OA 1XWFA 4N41A 1BW9A 3PJGA 2C61A 1Q7TA 1IIRA 2O2CA 3C8MA 4J0FA 2WPNA 4DW8A 3GEHA 4MYHA 1T3HA 3CGGA 2FYTA 4BKUA 3DFKA 3MK31 4RV5A 4D0NA 3HB9A 5C81A 2I67A 2ZSHA 3D4NA 3LWNA 3TI7A 3TS1A 4HWPA 5ESRA 5C8DA 3LPNA 1C4KA 1A8HA 1KYTA 1WXHA 2HBYA 2JB9A 2VLBA 3G9QA 3R7LA 1O96B 2QRMA 3D3NA 1Y9EA 5ER9A 3VJKA 3WXMA 5EHXA 2VHZA 4UDYX 4Q39A 2IPNA 1I0LA 1QDEA 3QPDA 1U7XA 2DVMA 2G82A 1A4UA 1OI3A 4CDGA 4C0HA 1OW3B 5CBKA 2JIDA 2OM2A 3O8QA 4BYMA 5K6AC 4A0GA 4E1BA 2YZ7A 1X7YB 1EESA 4LYHA 5JAOA 3DCYA 3W06A 4ALLA 5IDXA 1YTUA 1H2HA 1ZMBA 1T8WA 2V7VA 4O4JA 4IKEA 3RNLA 3EVBA 3QYAA 4I9UA 4PWYA 1OF1A 3KSAC 1EVZA 2OWDA 4UM9D 2F48A 2W2VA 3AUJB 4RK6A 2NO9A 1P4RA 1Y8RB 3M81A 3GJYA 4JJ4A 3EODA 3GFFA 3GJZA 4OXNA 3F74A 5HEKA 3KQUA 4FILA 4MPPA 1P4AA 1IYZA 2HD4A 3NAMA 3WHKA 3E03A 2XWSA 3L1HA 4TTAA 5BW5A 1SKUA 2P0AA 1Q6YA 4RZHA 3R7BA 4GR5A 2X8WA 4BP3A 3HKBA 2NG1A 3T3EA 1LA2A 4A8PA 1GD1O 1M0TA 3VPSA 2ZTUA 1N7HA 1EJ2A 1RXIA 9GPBA 4L0DA 4JQCA 4RH3A 4EENA 1E79D 5D7BA 3OEHA 1GAQA 2WNIA 3MUEA 5C8XA 1KQPA 2SCUA 3QU5A 4B3JA 2HT1A 3OMXA 5ENZA 5J23A 2VJBA 3IJPA 4HQFA 5CTJA 1AKTA 3JYQA 1JLLB 2CZCA 4A16A 3A05A 3AEXA 3A9UA 2PUTA 3TLKA 1UBMS 4JJ6A 4Q02A 3GPBA 2ZB7A 1C8LA 2PU7A 1NAHA 1J23A 3FBTA 4MR7B 4OOEA 1UM9B 4CUJA 4ETIA 2XCTB 1EWVA 1IEWA 2DQSA 3VYVA 2GPSA 3KZVA 3WJ2A 1T9BA 5EMJA 3W9UA 3ZU6A 4NESA 4YI5A 3AOEC 1H0RA 4MWZA 3WL6A 3WL3A 1NY6A 2P30A 4FYJA 4BFVA 4TLMB 5JS2A 1NY5A 4J0KA 3OUUA 5AI9A 1GT91 4DCPA 2H4HA 5FBHA 1YQ9A 2FP3A 3G59A 1P1RA 3O4FA 4LC0A 1PG2A 1X1AA 2VXBA 4M1KA 1KH2A 2LPMA 3K0FB 3PB3A 4D4JA 4M7WA 4H0FA 3AKZA 3CPEA 4TRNA 2CY0A 1Z45A 2NTJA 5LD2B 4R9VA 1Q50A 3LNTA 4QICA 4YX9A 2EC5A 4CMJA 2NACA 1QDUA 1RCUA 3C5EA 5ALVA 5LUBA 4GPD1 1LQUA 4HNUA 1DC7A 4PN7A 4CLXA 6REQA 1U3FA 2JGKA 3ZR4B 1DC4A 1KEWA 2BFCA 2E55A 1AUPA 4G8DA 3GLRA 4FBMA 4I99A 2E5WA 1WB9A 1VC2A 2REXB 2W37A 3F7MA 1LGYA 1VPDA 1UFRA 2C7GA 2BKXA 5JTTA 5TE9A 3KYJB 4D57A 3V4ZA 3CZ9A 5BWCA 2GF0A 2YZKA 3AINA 3QYPA 1T26A 4D9MA 4KYIB 4PZ9A 1HYHA 3GVCA 1T0IA 1A5ZA 3QUQA 4HX5A 2EF1A 4DYVA 1GAXA 1S8NA 4JB2A 2J9XB 4KUHA 4PNPA 4FEGA 4MW1A 1R5JA 5CNMA 5TXGA 4S0XA 3A37A 3LRXA 3T7KA 5K45A 1UBNA 4IW3B 4C2UA 1UQUA 3WG9A 1HE4A 1QO9A 2JGEA 1B0UA 4C7VA 4U7WA 2YHBA 5DK4A 1EFKA 1W6UA 3C5VA 4KYTA 1TA4A 3NTLA 1AF7A 2XZDA 2VHCA 2A0XA 2PSSA 5ULLA 3FHOA 3ZHBA 3JY6A 2CXNA 2ZYSA 1Q16A 3S1SA 3DW1X 2ZWPA 3PR2B 5B55A 4EJSA 4ZVMA 1QOZA 2PL1A 1TKBA 1N77A 4IRMA 3GB9A 1QTRA 2GK4A 1HOTA 1X3LA 3UENA 3CRRA 4RCYA 1D7AA 1HYQA 3UWDA 3ZGNA 1C3OB 1L5LA 3WBJA 4WFJA 5K51A 4BGEA 4YR7A 1TIBA 4RCVA 4O4IA 3T94A 2RHGB 1UQTA 3VBCA 3HACA 4UPDA 4W4TA 3D02A 4YP9A 2ZR9A 1SVKA 2Q3DA 4K6OA 3RWBA 2FOLA 1E1CA 3WL5A 1JXMA 1ZINA 2P9TA 1CYDA 4UC0A 3O74A 1PWZA 5K3CA 1KP3A 1T3GA 3Q7SA 4DLLA 4OY3A 5IDVA 3IAEA 2Q4OA 2WU0A 2BEUA 4N0PA 4R8LA 3S1AB 2FPGA 2ZJBA 3UZUA 2H2IA 3G2OA 5IXYA 2HO5A 5ALZA 1DO2A 4DB2A 5JJCA 1E64A 1SVMA 3C0KA 2JLVA 1VBKA 4JKIA 5KHOC 4LC1A 1E3WA 1EGVB 1W4CA 2CCKA 4KW7A 1C3XA 4J0EA 3MT9A 4MUFA 2Y2UA 1O08A 4NMHA 4UU0A 4OU5A 1TK9A 1SY7A 2QX4A 4BP1A 1QQ5A 1Y4ZA 4X93A 4RH0A 2XNCA 1LDYA 3JWHA 5KNBD 1NJFA 2A67A 1ICEA 4ATNA 3W5BA 4WNAB 3L1JA 3P27A 4HUQA 3B3AA 2P3SA 2WP8J 3W05A 4AMZA 3R7WB 4ES6A 1QPZA 1CQZA 4NQZA 2ZJ4A 5EUMA 4ZZ1A 3NO4A 1EX1A 2GDJA 4PRLA 4BASA 1T9HA 1XTZA 4JUAA 1M2KA 4W5HA 4MCHA 2W6QA 4ZQBA 1Y7TA 5E7QA 4FNAA 3V9AA 3K9QO 3JRNA 2GD6A 3WDMA 3HCWA 1RVV1 3BC1A 1X13A 1JVNA 1CUYA 1QZTA 3CE9A 3GLUA 3B8HA 1PHPA 2PYZA 4B4WA 5JPCA 1IBLB 5F98A 2BFBB 1TADA 2OC9A 1FFWA 3BICA 4CTNA 1N0VC 1M75A 4WTOA 3L0YA 4OHXA 3HABA 3PICA 4PZ0A 1J8QA 3D8NA 1Z38A 2JD1A 4ZJUA 2ZM5A 1XX6A 1J2YA 4YNBA 5EWMB 2IV7A 4D3YA 1ECLA 1C9JA 3RK4A 5MDHA 1NMSA 3LY5A 5F1KA 2FUNB 3WJ1A 1ZCAA 3AI1A 3CVUA 5EINA 2X14A 1ZVMA 2PJUA 5C8YF 3JAWA 5THKA 2XVYA 1HPLA 3CJQA 4OEHA 1U8TA 3TAXA 3U4GA 2NU6A 2IVFA 3OQHA 3NT5A 3THSA 3C43A 3GFQA 3Q6IA 4KC0A 4UMDA 4DADA 5EIHA 3EGXB 1R50A 3FZEA 2FEAA 3A6JA 1Z6YA 1KU0A 2DF8A 3I61A 5CGZA 2PFGA 5DNDA 1EUZA 1XALA 4B34A 3LXRA 2CLLB 4L3VA 2H9YA 5AP9A 4EG3A 3T41A 3GWGA 4UFNA 1U0RA 2NQTA 3GAMA 3SHWA 4RTJA 1OC4A 2NZVG 4DRXA 3G1WA 1S89A 1NTRA 2C97A 2YQ4A 3Q8XB 2Q5HA 4HGQA 4RJLA 2P65A 2C1EA 1WXXA 2YFQA 4RWEA 1Y8AA 4BNXA 2IQIA 5BRNA 2C5HA 5FNVA 1EE9A 2OZLB 4ZC8A 1L7EA 1HFKA 1RWPA 3HVRA 4H7KA 5A03A 2RHTA 3KOMA 1LTQA 2QOEA 1NQUA 4KEAA 3RJMA 5IUKC 1D1PA 4WZAA 4WCFA 2XW6A 13PKA 1PL8A 2WT4A 4E2YA 2XV1A 5FFNA 1Z08A 4IIXA 4DSNA 1M2JA 4KFRA 2BM0A 4RHCA 3ZCPA 2ZETA 2VJQA 1JR2A 3DWIA 3OE1A 2ZPUA 1L6RA 3F6SA 4PAMA 5EQJB 3ESCA 1RJDA 1A2BA 2DGDA 5IANA 1HFJA 1JDPA 1L4YA 2ZEJA 4YRCA 2O6HA 3PT9A 3LUDA 4HVAA 4JOBA 4J0IA 1Y48E 2C7VA 2I33A 4DCMA 5CFLA 2XKKA 1Z8FA 1GL7A 5C5EA 1Y8ZA 4MVXA 2EBUA 4UQOA 3K1AA 4D74A 4R2HA 5ALWA 3O47A 1S1MA 5CT6A 1J9GA 4YMLA 4EI8A 2IGTA 4G0VA 1PJLA 5EY5B 5LMUB 3R44A 2IZ1A 3QI7A 1GUBA 1N75A 1Q0HA 4B3MB 1DUIA 4GDMA 3AFHA 3UKJA 1W4ZA 3FLEA 2PDAA 3PLNA 1NMEA 4CQLB 5CNIA 4MP8A 3NC1C 1SWVA 2OCBA 3PC8A 3GI1A 1ZR2A 1G0OA 4FHEA 1WXIA 2GB4A 1IXSB 2CMFA 3B2QA 4I1RA 4ACBA 4AJ2A 4IFIA 2PWBA 3DKRA 1M5RA 5KOHA 3MUFA 1PG0A 2ZJ5A 4AWAA 1U8YA 3GVXA 3L79A 2C5EA 5BSHA 2A2ZA 3NHSA 4EF6A 1V5GA 3KM0A 2XITA 1U2QA 2Q6OA 1YQQA 1NONA 4X1IA 2C96A 4YMGA 3WSTA 3FYUA 4X63A 2W6OA 1JQKA 3PNYA 2VEOA 5LQRA 1JHQA 2J07A 4YRAA 5CLLA 1JBKA 1E3SA 4EY7A 2VZEA 3TOXA 2W6IA 4RKYA 4RE5A 1YOVA 3IHTA 2QV7A 2W2LA 3GJTA 4DUZB 1P19A 1FFXB 3SFVA 2W48A 5EHQA 2HHLA 1XZFA 2ZU6A 3G8YA 4QT4A 2CNWA 4BEVA 4MS3A 4OXXA 3FPBA 4DUYB 1QIJA 2BFEA 2C4VA 3A8TA 4H77A 4KR0A 1PJAA 4DFDA 5LKAA 1F17A 1EMDA 4AP9A 2VAXA 2K5UA 1Y8QA 4OQZA 1SQGA 1WO8A 2GPAA 4X1YA 4A6PA 1JILA 3ZCRA 3E9YA 4B7AA 4TT3D 1L4HA 1QH8A 4BMZA 3LYHA 3UPTA 2ISSD 3ZEAA 1ENZA 1H2YA 2L18A 5D6OA 2TMKA 3KQPA 4GBJA 3PFIA 5E7IA 5LQJA 4PLVA 2GVDC 5BV8A 1PL7A 1BKDR 3KAQA 4OQEA 3IFSA 1RAFA 3L41A 1BXRA 2Q6LA 3M5DA 4BC0A 3OOEA 1T4BA 3DAFA 5DN6A 4OI4A 2OPBA 1T6ZA 3QFHA 1A7JA 3FW1A 3AVTA 1P44A 1EFTA 2RGWA 3EY9A 4LZLA 3RFTA 1Z62A 1C0KA 3AL3A 4UBJA 3VNBA 1F6BA 3G6WA 3M82A 4TKUB 2O0JA 4NFLA 1LPPA 1JJAA 2BUAA 4K9DA 1UOOA 1IN5A 1HI9A 2MWMA 3KOXA 1P7WA 3GW8A 4HWOA 1F4LA 1TOAA 1YBAA 1EXMA 2Z1DA 3SHOA 1LLDA 4F5EA 3EVNA 3ZNPA 3X43A 2DHCA 4LY0A 4OB6A 5GONB 2YKGA 2GAAA 4GP7A 2M32A 1BMFA 2CMGA 2I71A 1LPSA 1VJDA 2R8BA 2ENUA 3N74A 3R3UA 3RSGA 2JFGA 1JU4A 3ABZA 3L4BC 3IP8A 4LWOA 2B8JA 4L7VA 1SOWA 2A9QA 2ZYVX 3JD4A 2GR9A 3EQZA 1H8HA 3UUEA 1ANKA 5E7JA 2EQBA 4PSKA 3SVTA 3VR6H 1NRXA 2NNLD 1SHZA 2CFCA 4HJXA 3VHXA 3MCZA 3VC7A 5CDFE 1W2WB 1SU7A 2FWIA 4HXYA 2DUUA 3AG5A 4OQFA 3TLYA 5JCPA 5BSKA 4CMEC 1J56A 3BXFA 5J59A 2XXAB 2Q9CA 3IBTA 1HSOA 5I01A 1VKOA 1F20A 5HG0A 3QKSA 2QM7A 2G6TA 2R79A 1N6HA 5ELMA 2BFOA 3F4KA 4Q37A 4S0ZA 5DBOA 1KDYA 3U4QB 1RYZA 3K05A 5EZQA 1QX4A 3HCAA 2ZXUA 2W6JA 5B4VA 4JUFA 4TTRA 1RP7A 3RIEA 3VA7A 3ICVA 5J4LA 2XRYA 2FUG6 2OKCA 2A3NA 3FFWA 4NE9A 4JHXA 1MBZA 4QQNA 5CVJA 3U9TA 1ZKMA 4EECA 3D2CA 1TM1E 1Y7HA 3OKCA 4I5EA 4CHGA 3PE3A 2DYKA 1CY8A 2H4JA 1Q12A 3UAOA 3WIVA 4HMQA 3OCYA 2Q1TA 4U8HA 3RIGA 2FETA 1GVHA 2CVZA 1RQXA 3O9MA 3EVGA 5DGHA 2IS4A 4BO5A 2OHGA 2FJ0A 1JTVA 3B1WA 1Y5RA 2VBIA 3B85A 4L75A 4CT4B 1DPFA 2K2WA 1BJKA 2QMUA 2R85A 4HMPA 5BOSA 4B17A 3TXYA 1YDGA 1N3IA 3I58A 1DINA 3GCZA 2I4NA 1SURA 3IP3A 4Z86A 1FDOA 1CJMA 1N0WA 2I8CA 2OQVA 2EBFX 2I34A 2JEOA 4OJKA 2EWMA 1WNFA 3JQ9C 4MZXA 4WSOA 1CJVC 5GJCA 4HBZA 4M88A 2OO5C 4QVIA 3UG7A 3D6HA 2R84A 2XAAA 2OZVA 5B6PA 3BMQB 2XTJA 4CQNA 2CBXA 1DEHA 3AR3A 3EIUA 3GEEA 4LPSA 1WVIA 3DE1X 3T1QA 2I6GA 1JALA 4ZQIA 3EUAA 4RZ3A 3PDUA 3ZH9B 4Q1EA 3G49A 4BLWA 1KDVA 3CTPA 1FYDA 4JC0A 3IOEA 3RGGA 2KS6A 1G98A 1VL1A 1VBMA 1WP4A 4M1QA 4F6CA 1X9IA 1JMKC 1DAFA 3EQ7A 1PFWA 1BG6A 1YZNA 4DQLA 3AF6A 3UB2A 2X15A 1GFIA 3ZJ5A 3HB5X 1ZXBA 3ORFA 4MWCA 4QPCA 4LI0A 2R1UA 4MKGA 4LXTA 2XDYA 3TMYA 1COWA 2X9QA 5GVRA 4DAOA 3I5YA 1B16A 3UJPA 3EZGA 4YV7A 4RJTA 4G89A 4JDUA 1LQ2A 2MR5A 5E6UA 1T4MA 2ZIXB 4TMYA 1PJRA 4HB4A 2DXIA 3OQBA 3TZBA 5ICSA 4ZT3A 4PYIA 1LDNA 4LZOA 2YJZA 5LP6B 4XB2A 5KQSA 1PZHA 2ZS9A 1JSZA 3BQ9A 3HCBA 3FPGA 2JIQA 1FP6A 2FZ4A 2WIAA 3QX9A 4R8VA 3QLEA 3HJFA 1WDTA 5LQDA 1XA3A 2HLPA 4GKBA 3HR7A 3OPYA 4U63A 2YUTA 3ZHZA 1J39A 2ZR8A 4HNVA 5CDGA 1RHQA 4F4DA 2YZ2A 3GF4A 2VPTA 3PC7A 1VA4A 4BCDA 2H07A 1VXOA 2CD9A 2J3KA 3CRZA 3RBXA 3O8NA 4G0UA 3NANA 4B4VA 4JEIA 3SFZA 3ELYA 1F9AA 4LJ4A 2HO4A 3RSQA 4U9HS 3WK7A 4N47A 5F9HA 2RGNA 1YBHA 1B42A 5FBKA 1NU8A 3RG8A 2I62A 3WZ2A 4YRTA 5DLPA 1JLRA 2RC6A 3O8RA 4KL8S 1D04A 2NO1A 1LVUA 3BMXA 2NPOA 2UZ1B 4X45A 4PLCA 1Q17A 1BEUB 2G77B 1XF9A 5JBNA 1DTSA 4Y2QA 1ACLA 3EWIA 2AFRA 3VMFA 3EW9A 1QGUA 2PZGA 5G4KA 1H9BA 4P92A 3VDXA 4KOAA 1L5OA 5B64A 4NZNA 3NWEA 4XLZA 4OGFA 3ODPA 3AVWA 3ZXYA 1G6OA 4MPJA 5AMXA 3SYLA 3EXG2 2BFFB 2GMWA 5B1SA 3MWDB 4ARIA 2LUOA 5TJ9A 2GJ8A 5CDYA 2VQEB 3VNRA 1PGQA 3SQMA 1OXMA 2B78A 5AJZA 1XNJA 3R0IA 3SE0A 1XRRA 3C3JA 4FBLA 1AGXA 1MW8X 1LSJA 2W6CX 5C35A 3SZOA 2BFAA 1YZUA 2C7PA 2Z6QA 2WHEA 4AYXA 1FDWA 2ZI5A 2AK2A 4JGBA 5DCUA 5HK8A 5C52B 5HOQA 1FU7A 3E15A 3HFSA 2JGIA 4DT1B 3FPFA 5DKFA 4BBZA 1X1BA 3KSUA 2HXYA 2P11A 4LF7B 1QZXA 4MP3A 3EPRA 4GICA 4D9BA 2FTKE 2FRDA 3CLRD 4LKRA 3EZYA 4NAVA 5ESWA 3Q3JB 3FTDA 4EUKA 4ZI2A 3H5NA 2NV0A 1NW5A 1SJ9A 1WRBA 1Y7PA 3QU4A 1SOAA 4Y2VA 1H2EA 1M72A 2UYCA 3DTYA 4GI7A 1W36B 4P3NA 1ETHA 4NV1A 1P5JA