3ROEA

Crystal structure of mouse apolipoprotein a-i binding protein in complex with thymidine
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
233
structure length
233
Chain Sequence
b'AVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSKSPPTVLVICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQKMDIPFLGEMPPEPMMVDELYELVVDAIFGFSFKGDVREPFHSILSVLSGLTVPIASIDIPSGWDVEKGNPSGIQPDLLISLTAPKKSATHFTGRYHYLGGRFVPPALEKKYQLNLPSYPDTECVYRLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apolipoprotein A-I-binding protein
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 75
structure length 233
sequence length 233
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.1.99.6: NAD(P)H-hydrate epimerase.
pdb deposition date 2011-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3roeA00
3ROXA 3RTDA 3ROEA 3RT9A 3RTGA 3RO7A 3RTBA 3RS9A 3ROGA 2AX3A 3ROZA 3RRJA 3RT7A 3RU2A 3RTAA 3RRBA 3RNOA 3RSQA 1JZTA 3RRFA 3RTEA 3RREA 3RTCA 3D3KA 2DG2A 3RS8A 3RSSA 3K5WA 3RSGA 3RSFA 3RU3A 2O8NA 3D3JA
chains in the Genus database with same CATH superfamily
5DBGA 2ZRCA 4F5YA 1WF3A 3HI6A 1Q0QA 3DLPX 1KYQA 3SSMA 5ITZB 2QWXA 3E5RA 3A6DA 3IOEA 3ITKA 3DFUA 1N8TA 4C4XA 4DQKA 2IZ1A 5FOSA 4D3ZA 1GFSA 2JIDA 4OU5A 2QR2A 3G8AA 1MVLA 4DEXA 2J3LA 3RFUA 4MITA 5KYXA 1HYQA 4AJJA 4JI1B 1VPVA 2ZITA 3IE2A 3ZCRA 1AG9A 5K6AC 1WAMA 2XCRB 4ZV7A 3DL4A 3HKCB 4YY3B 2D5CA 1BFUA 1QGDA 3FFXA 3HA7A 4HDSA 5AESA 1CDEA 3PFHA 1QC5B 4AO6A 1MC5A 2RH8A 3NNDA 4R3UC 4E1BA 1AO0A 3C5VA 1F1BA 4H15A 1CJSA 4EPVA 3K15A 1B7GO 1YKSA 3ND6A 1Z07A 2WHYA 4V02A 3TG8A 1FDOA 1OIXA 5B2FA 4FJ2A 1SCNE 2OKCA 3H86A 1MEOA 1MO2A 4PG5A 5HRUA 4KN8A 2Q5IA 3ESQA 2C4WA 1KVQA 2X58A 3LE8A 1UMDB 4KX5A 4M1TA 3RQSA 1K8ZB 1SHLA 2A1IA 1XZDA 1ONSA 4C6TB 6REQA 1BJRE 4UCXA 3QYJA 4Q7MB 5JXWA 4BJ5A 1WKCA 1SIOA 2PGIA 2GNOA 3FDZA 3EFOB 4BLRA 3MD9A 3KV3O 2VZ0A 3OPXA 5LIPA 1PR4A 2I7TA 1NN0A 3ROKA 1U4OA 4ZYXA 1TGVA 1A27A 3R3WA 5GQSA 3KUDA 1M2VB 3A1WA 1OA1A 3CR7A 5FPTA 3SYKA 1Z0UA 3H16A 1XBTA 3PNPA 4Y1EA 3IUBA 2IXGA 2XQGA 2ZQ5A 3KKEA 5B30A 1RIIA 4I50F 4CEJA 2BRUA 3I83A 3A6HA 1EX9A 3G2MA 3WYAA 2ZSUA 1J7KA 5BYAA 2XQVA 3NIFB 3CZ5A 3GFQA 1R6VA 4CMGA 5E6UA 5JYCA 3KQVA 1LQTA 1BS2A 1U2PA 3PKIA 2HDHA 3OMXA 2BEJA 4BGIA 5KNBA 8ADHA 3ISTA 1E9BA 3CNQS 1T4CA 5ALUA 1TT5B 1G8AA 3EA4A 1XF1A 2NYRA 3PV0A 1GTSA 2BFDB 3ZCQA 4DMLA 4PNZA 3GJ0A 4GX5A 4W5JA 1BX3A 4X24A 4Y2QA 2KWIA 4R0NA 4S05A 4JQCA 1S8AA 4TPKA 5F23A 5F5LA 1JR3D 2B92A 5C3UA 4A5SA 4G0UA 1TUGA 4J3FA 1AQYA 3AW9A 2B8TA 3A9WA 3WLKX 5JS7A 2JIRA 1E1CB 3DE1X 3VZQA 4EL0A 4JLNA 1G17A 4Z99A 4H0CA 3VX3A 1TUBA 1UT5A 2QGNA 2C96A 3UOWA 4LC0A 3L1IA 2PU5A 4BRZA 1TB4A 3FPFA 5KWSA 5I7RA 3RF7A 1GPH1 1LX7A 3DVSX 3ETHA 3GJ7A 2AWOA 2AFHE 2OT3B 5FQOA 1KY5A 2YFKA 4K2HA 2WABA 3G89A 4TLDA 4EEKA 5AVOA 4ZI7B 3G2QA 1P72A 1XR3A 4FEGA 1V8PA 221PA 4QECA 2I4NA 2H4JA 4B76A 4GOXA 1QUEA 2H3EA 2JCYA 3P9KA 2WVGA 3LIIA 4TMYA 5ED0A 1QH8A 5H4HA 4FS8A 3MMZA 3KZOA 4MS3B 1PZXA 3L8EA 3W8RA 1T9BA 3HEMA 4DEVA 5HF8A 1GLNA 5AXAA 2CVHA 3RUFA 1L9KA 4ACAA 2FZGA 1YQXA 5HNKA 2GMWA 1J2TA 1Z4QA 4W5WA 3WGIA 1R27A 4IPTA 4AN4A 5FPKA 2SNIE 4Y2VA 5DIFA 4G25A 3LQ4A 3W0LB 3KSMA 2LD4A 4N0MA 4QJ4A 3ORRA 3JQPA 2GX6A 3ORHA 2FMUA 2YWHA 1D1PA 4MS4B 1T2UA 5JALA 2R8ZA 4JMPA 3KCNA 5IUKC 3UAWA 1TA4A 5HK9A 2PYZA 1XRRA 2WNIA 4EYOA 1SVNA 2G06A 3QFTA 2ONJA 3CXUA 4ZZ0A 4U8GA 2O7VA 4JQZA 1O3YA 4R8VA 3I9KA 1UFRA 1UAYA 4DDTA 2FAXA 1O95C 1SJ9A 5C34B 1I8TA 2Q1UA 2RAPA 4OH7A 3WFJA 1DWOA 1UP7A 4ADSG 1Q2XA 5C32A 3H9CA 2MINB 2NO0A 4IDGA 4COKA 3BS4A 5I7FA 3IMGA 3K0CA 1J7JA 1PD0A 3A2NA 5FB3A 4LOIA 2RGXA 4IIDA 1G8JA 2JCSA 1XZBA 2AZ4A 2KYRA 4PZCA 1NDQA 2WUWE 1ORHA 2B4YA 1I4LD 3DL2A 3IUQA 3ECCA 3TRJA 3C39A 1R15A 4UNQA 2VK1A 4JBHA 2CVFA 4IIEA 5LLSA 4RKYA 2NO6A 1G5PA 2GI4A 2ZRBA 2D8AA 1KDOA 1V5FA 2EIHA 2KLBA 5SZHB 4XWOA 3CIFA 3IIEA 5TQ0A 2ZUEA 3QENA 3L06A 4R71A 5AI0A 2O8NA 1ISHA 1U04A 2QD3A 4Z9BA 1NPTO 5FTLA 1MIHA 4J1NA 4RZXA 2JK0A 3K6JA 3AIOA 3DLTA 4QGBA 4DSAA 1JF8A 4MV6A 1L4KA 3I9NA 4D9NA 1JT2A 5D7NA 1UZAA 3B82A 4NXMB 1Y8RB 4GUDA 3BCUA 4FWBA 1JR2A 4NZZA 3K8QA 3HC7A 2LXNA 1JAXA 1EB9A 2ZW9A 3CSDA 4QFCA 1VIDA 3WYGA 4E1VA 3E9NA 4HWRA 4XIYA 3Q5DA 2LBPA 1EFPA 3BG5A 3LLMA 4NCXA 2IS4A 1COWD 4XVQA 3IBCA 2F3UA 2JLAA 2OV6A 3OKCA 4IHAA 4EUFA 1V41E 3B3JA 2CY0A 2RGAA 1AN0A 3ET5A 1Z82A 1YCGA 4D82A 4A8PA 1TO6A 2WU3A 4HSEA 4MGKR 3WADA 3QF4B 2XKAA 4C7JA 3K6SB 3CWCA 1GIAA 4C0JA 3DMTA 5DEIA 3ZX4A 4R05A 1FW6A 3HP7A 3C14C 4OUDA 2PUAA 3MNFA 1X92A 3HFJA 2Z8YA 4KTVE 2FZLA 5HKAA 1NIJA 3ZU3A 5CD1A 1A5TA 4GXTA 3G85A 4RKEA 5EG5A 3EGCA 1NX6A 2PE5A 3GCDA 5H1YA 1Z5GA 2WKQA 3OWHA 4DXDA 4CU2A 721PA 2VBGA 4BQSA 3LSYA 2DEUA 1YE8A 1VG9B 1GG8A 1YFKA 2VPIA 1M1ZA 1HMPA 4WD3A 2H31A 3HEAA 5GWXA 2PD4A 2I7XA 2Z3WA 3G59A 3SIXA 3GMSA 1T1EA 2ZE6A 1DI0A 8LDHA 1NW3A 3NATA 5IJXA 1AQJA 2OXIA 1KORA 1Z8DA 4P81A 3A4MA 5EAIA 3LF1A 1CS0A 4WN9B 4E88A 2BR5A 3FVRA 3OZXA 3OOEA 4RPHA 3UHAA 5E8RA 4BUJA 5CLLA 5B7NA 5KJ6A 1PG2A 4CV0A 2QAJA 2AMVA 1ZL2A 1R6BX 3MOIA 2FVXA 2IUTA 2OXFA 3EWIA 2Q0HA 1I1OA 1ZA1A 2O5VA 3IEKA 2ZSAA 2HJSA 3GRPA 4QQNA 3SZOA 2PKQO 1UXOA 1MAUA 2QN7A 3A1DA 4IOLA 5HSGA 1L4EA 4LJ5A 3TMYA 1IWPB 1G20B 5FFMA 1W34A 2WJAA 5TX7A 1HTWA 1W6RA 3D4LA 2J5QA 4CMAA 2GUWA 3CNLA 2X1MA 4EPRA 1GZ5A 1ZBQA 4I1UA 2BFNA 3X2FA 4XYBA 4NMWA 4LGCA 4PX5A 1ISSA 3DOIA 1FJHA 2VIIA 2XH8A 4B9EA 3EEIA 2AC7A 1N2ZA 3WB2A 3CLSD 1AGYA 1LDBA 2P9TA 4JEIA 3OCJA 2BCJQ 1CUVA 1MC1A 3EPRA 2RGYA 1NVBA 4DLWA 2Y1OA 3EPPA 5EZ6B 3GRUA 4N7JA 3GDOA 2VNIA 1LBSA 3H1EA 5JJKA 4RVNA 3TIXB 2EFYA 5CIQA 3OJ0A 5IAGA 4H3KB 3UOAB 1TADA 1EKXA 4GX2A 2Q5HA 1QV7A 1TX4B 1QYCA 1XJWA 3T54A 5ALZA 4KR2A 3DV0B 4DSTA 3KOMA 3C97A 3WY9A 2CUZA 1Y7TA 2PGNA 1JLLA 1ZHHA 4IDEA 4YYZA 4XGIA 1GUFA 2DR3A 2DWQA 3H19A 5ANRB 3ROFA 1XZIA 1XJQA 2VPYA 4BAGA 1BD4A 2ZBUA 2HFKA 1WM1A 4X1YA 3W7VA 3CVWA 4I55F 1GQ2A 1ZD5A 4IV5A 5EJFA 2CL7X 1P4SA 1R4AA 3H6KA 3OFJA 4LHVA 4PRYA 1O6ZA 3DHYA 3CTMA 3LYAA 4R16A 2NG1A 5EGNA 4L4YA 3V2IA 1J8MF 1HDYA 1EK6A 4RY8A 3H0EA 3V4ZA 1ND5A 1UXIA 1OBCA 1VMDA 3UJ6A 4R01A 4NNJA 2ZUCA 5LYJB 2ZOSA 5IMBA 4O0MA 1L3CA 4JV5B 1Z4JA 2B9EA 2G0AA 1XRMA 3JQ6A 2A9OA 1AIPA 4E2ZA 2ZXUA 1SUIA 2BKUA 2SCUA 1TO2E 1TVKB 5E6SB 2QRQA 5HMLA 5BSGA 3JV7A 4WW0A 2DT8A 4TLAA 5F35A 1GZVA 3AIKA 2Y2UA 2O1XA 5HKLA 2PZMA 3LUFA 3KD3A 1DAKA 3AF6A 2IH5A 4JI5B 3ZV7A 2DFVA 2PWAA 4E4YA 4HQNA 2QYOA 4PZUA 3SSNA 1D4AA 2B34A 1T9ZA 4KH1A 3O1IC 3QVKA 3MS2A 4L0CA 5JHHB 1V16A 3ERCA 2D4HA 4QYTA 4PEVA 5ALHA 2BGTA 4RPJA 4IV0A 3K7EA 3LW7A 3GLGA 2R751 3A7DA 3DBOB 3ELWA 3KTFA 2IYPA 3E8SA 1SGWA 3DDUA 5CCXA 4CN9A 1V1RB 3R2JA 3L6RA 1W6UA 4HQ6A 1WV1A 2J31A 1Q0HA 1YQTA 2NO4A 3ZR4B 1HT3A 1E6KA 1VE6A 2QT9A 3ETEA 3AF1A 4GRAA 3VH1A 3YASA 3IAHA 3P26A 4AWAA 2WTMA 1KAHA 4GI1A 2J0QA 2E49A 1IZ9A 1PWXA 2E4VA 4PAWA 2OHGA 1OBFO 2VHQA 3L8YA 5DSXA 1SB9A 5J3JA 2XGMA 2CLLB 2J9ZB 4JX8A 2VZ9A 1VPDA 2JBHA 5JOQA 3W5CA 1IAVA 1J5EB 4JLOA 4DCCA 3PI6A 1ZAKA 4QUHA 2BKEA 4IDNA 1E4EB 1XCMA 4O4IA 1NY5A 1Y6JA 1AV6A 2RSLA 1H3FA 3RC8A 4ZMSA 3TZCA 1GAJA 3EULA 3Q0TA 4N9QA 5BO5A 4TUYF 2VHVA 3LP5A 5BWLA 4AG6A 2XXAB 2WTNA 2WFAA 4GU5A 4ZJYA 3HH8A 5BXQC 5F5NA 3EVTA 2HLDA 5LB4A 3EF3A 3Q6MA 1ADFA 2GERA 5T67A 4YT2A 1WA5A 2A33A 5H9WA 4ZRMA 1S2MA 4JH0A 3S2IA 1C50A 4WBSA 3T7SA 4EFNA 4P0PB 4U1RA 1XCBA 4UU7A 3Q7EA 3G2PA 2IP2A 4TYMA 1KDVA 3I9OA 1M66A 2B83A 2PAAA 4GP7A 1AHPA 2VZEA 3MUNA 3PFNA 5KNCD 1PNTA 4EWLA 4MKHA 1XROA 4GPEA 3RU9A 2ISCA 4FYKA 4KREA 1WL8A 1H23A 2QRPA 4YGYA 2X3YA 3KTDA 4IX1A 4D3YA 3K4HA 2ONYA 3DT8A 3SJCA 3NHFA 2VDLB 1F5NA 1WZEA 3EOBI 4FGKA 2QX6A 1LV7A 2V6FA 3ABSB 3P97A 3R3VA 4FINA 5CCDA 4BZZA 4ZK2A 1I14A 3HKBB 5FD8A 2RK4A 4CL8A 2IH4A 5JG7A 4XX0B 3HYCA 2X76A 1H66A 5LDGA 1P4GA 4LEIA 1FRFS 1UBSB 4UMEA 3IILA 3ELUA 1IZ0A 5AK3A 5KQLA 2H4YA 1Z36A 5KPDA 4UE3S 4X3OA 2Q1YA 2K6GA 2QQ0A 1NBME 3UCFA 5CEEA 1YUMA 3GA0A 5KX5B 1ORIA 2BJWA 3D8TA 3CH7A 1K5PA 4I9HA 2OZEA 2WHPB 3QQPA 4YJ2B 4D8TA 5A05A 2BEUA 3CH6A 1OWMA 2HRDA 4F2HA 4AF8A 3IHKA 1QFSA 1QTRA 1NURA 1Y4ZA 4PX9A 1RU3A 2B4QA 6ADHA 3RU2A 1FTYA 3ZDAA 4B2YA 4G1UC 2ODTX 2AN4A 2C59A 2ILVA 2BHLA 3BSWA 5HS4A 3L6DA 3F8WA 1NF8A 2BGIA 1B6GA 4BFCA 5HCIA 4C06A 2YOFA 5CYOA 9MHTA 4WK2B 2XXBA 3LPNA 2M6KA 4IKEA 2FP3A 4X3CA 2ZB2A 4CTJA 2A9JA 4RQBA 5KYXB 1CQZA 1JXOA 3ITEA 4G0MA 2PVSA 5IDWA 2RBKA 3K1TA 3NOXA 4ZDKA 1DXQA 3BGWA 4FFSA 2M9MA 3DB1A 6ABPA 4ZHQA 4LXXA 1G9SA 3RVQA 4HDSB 3CY6A 3ZEIA 1DG3A 1M6YA 4IDPA 4JGBA 4M8KA 4R9UC 5JWOA 4NCAA 3T7JA 1SQGA 1Z22A 1UOPA 1XZ8A 3GFPA 1ZC4A 4G23A 4C04A 1KSHA 4PHFA 5DH9A 1M2JA 5IPFA 4F71A 4J0DA 3U4AA 2HDNB 3W7AA 3GGGA 3Q2IA 1BU5A 5D3KA 4IEEA 2GARA 2BBOA 4J29A 3O4HA 4RSHA 3P9RA 6REQB 4KR3A 3D8UA 2BDEA 2ZT7A 4PF1A 3GHHA 1IVSA 1E92A 1SVKA 1V7ZA 2J0EA 3JAKA 1PEDA 3FDZB 2FK8A 2EQ5A 1LRLA 1SA0A 1EIWA 1XLUA 4X85A 1D8AA 1QNLA 3RIEA 4E5NA 1ZD2P 4EO7A 3Q7PA 2I2WA 1Y3BE 1HT2E 3MXOA 4IKPA 1G18A 4X71A 3GN2A 1FYDA 1LLUA 4KU4A 3M81A 2QW8A 1MH1A 2WEKA 2P1ZA 1CUFA 3FCUB 1W4RA 4JUDX 3OU7A 4BX9A 3TK1A 1ADCA 1A9ZA 3E3AA 2VSNA 1P0CA 4MRRA 1C4KA 1X7YA 2GCGA 4CEJB 1UQRA 4V1CA 4UJ5A 3C8UA 3ANMA 1RM5A 1ZS9A 2GTIA 3K6KA 5KBYA 4FIDA 3S7ZA 1B0UA 2J30A 2ZTHA 3E9ZA 3DXXA 1ZN9A 4LHXA 4JJ6A 5E6UB 4WZ6A 4ZZ1A 3RVBA 3BAFA 4JR1A 3KOXA 2G76A 3M3DA 4HDCA 4M0KA 1XD8A 4QU8A 1T4CB 3VC3A 5ISMA 1XNGA 2Q8PA 5JXIA 4BKOA 3IEPA 5JMPA 2VDVE 2D3WA 3KWFA 2OM2A 2HIMA 5CCEA 1ESZA 3RUPA 1KYYA 4WHMA 4EGSA 1Z4IA 2VDNB 4ZMBA 4B3XA 2PUDA 1RCTE 3FNQA 2B1JA 1HZZA 1TVCA 1VRVA 3GZ4A 4M9QA 4ZT4A 1TUBB 3ST7A 3CW9A 2YHUA 4R5HA 2O2IA 3MWGA 1OF1A 2AB0A 4M9SA 3HO6A 5DGCA 4WKGA 3P0IA 1Y5RA 2FN8A 1U0JA 2GF9A 3ELDA 4L95C 2OYRA 4UTPA 2DHQA 3AH8A 2O8VA 4HQRA 2CC2A 1H2YA 1TF7A 4BNKA 3OEED 1CQXA 4JP8A 4ITVA 2WPDA 5IF3A 3UJNA 2R0QC 1QH8B 1QHXA 1GZSA 5D51S 3P4UA 3QBEA 1CZLA 3V1LA 2AG1A 2ID7A 1O95D 3DYVA 3JTMA 1A7UA 3U7GA 2YVQA 1UMKA 4U00A 3HEBA 1M1YA 2W43A 1SHZA 1U28A 2WJYA 4EY8A 5IHPA 4TOIA 3I0ZA 3QPWA 4D25A 3EZ9A 3V8PA 1LKZA 1YFJA 2O3RA 1SUDA 4Y1RA 4ZOAA 4Z6KA 1C3VA 1T0JB 3VO2A 1SCKA 1W30A 1E7WA 1ONOA 5EI5A 4P4SA 1BRMA 3IT0A 3DUWA 4C2BA 4LK2A 2O0JA 2W2PA 4YWJA 2GN4A 2D7CA 4R1PA 5FL7D 1AQNA 1S0UA 5KQSA 4XH9B 1OI4A 1I9CA 1W4AA 3PFBA 1PFGA 1E79D 3AOGA 3RS9A 2AFIA 1A04A 2VHUA 3F7OA 1RVV1 4IDAA 5CHYA 1BGWA 2QMQA 5ERGB 2JARA 2PKYX 2H29A 2D0IA 4RK5A 5JFGA 1G9XA 3DNMA 5U9CA 1FSZA 3HDVA 4PZ9A 2F55A 4NPAA 2A0WA 3FSGA 3DDOA 1W2GA 3FWNA 1RRMA 3NAGA 3NFRA 3C8ZA 3IMEA 3L0OA 4MVJG 4NE2A 3ROMA 4EX6A 2CYAA 1XALA 3NM6B 5IFLA 1GDHA 1XP8A 5EJ9A 4AS1A 2TYSB 4QNNA 4A0RA 1YI8A 4I9NA 2ZT5A 2WHEA 3CXRA 4YP1A 1E1RA 2NTYC 1JG7A 5TQ0B 1BVUA 1W85A 3GD7A 3GFGA 1K3TA 1UUFA 2CSUA 5A9TA 3UA3A 1C1XA 3NOVA 4KQ2A 1U2GA 3N8IA 4EHKA 4ZCRA 3OTHA 2R6CA 2P1DA 1KJNA 2H11A 1ZM3A 2GAAA 1J99A 1M6NA 1JDBB 2GPAA 3Q9LA 1F0YA 1F0KA 1J0AA 1CUEA 2ZRFA 4KAXA 1LBHA 2XKBA 4P54A 3UY4A 3DLBA 3W9YA 1C4XA 1Z9BA 3DDCA 5L3QA 1FNDA 1FFGA 1WB4A 4OAOA 3QMVA 1I36A 1OV4A 1IUNA 4LY3A 4EPWA 1XVLA 3H5NA 1HMYA 3R44A 3NHUA 3GVCA 4EHAA 5AKGA 1EFPB 4F96A 3DJYA 2YWRA 2PUWA 1MP0A 4M0CA 2DFPA 5EPEA 1W9HA 1UBTS 3SC6A 3NWEA 4HNAA 4I8XA 1C7EA 1XNHA 3SQNA 3CO5A 1E59A 3ED1A 4AMVA 3UPDA 1I3OA 1HEIA 4C01A 2V0CA 1JJFA 2FQ1A 5U4XA 4MUAA 4Q47A 5CXQA 2FWMX 4OUDB 1I6WA 4BZXA 4ZHSA 2WAYA 3NT4A 4QOEA 3VDMA 1L3BA 1NBIA 2PGJA 2YJ5A 3HJFA 2HHJA 3CJTA 4Q3DA 4Q6BA 1W8DA 1WUIS 3UUFA 2REXB 4IIYA 3D6JA 2BTQA 5EHQA 4DM3A 1R7RA 3QG5A 4DLNA 1L8AA 3NUGA 2HK9A 1XQ1A 2CXXA 1GG5A 2ZS9A 1ADJA 2TS1A 1EFRA 4RTKA 3O8QA 4DCNA 2F8MA 2X2OA 4URZR 1C0KA 5K0NA 3TLJA 1Y4DE 2R1ZA 2X5OA 3HY6A 4KPUA 3V9AA 1Q7TA 2WUFA 2BM8A 1X7XA 2DQSA 1PDOA 2ANCA 3C7TA 4XOIA 5HTKA 1G59A 1CS0B 4LJ6A 4AN0A 1MJHA 4OQMA 2Z98A 2GEKA 3IUJA 2P2ZA 2VHCA 1A7AA 3JZIA 4LZLA 2EDCA 1RYDA 1QQ6A 3O5AA 2I71A 4YGXB 1QO0D 1T1GA 3HN6A 3HFSA 1C9KA 1NFFA 3IXMA 3JQ9C 4RULA 5LL6P 2NVOA 4FX2A 1GDDA 4J0IA 1RZRA 2GWHA 2E6UX 2JD0A 1JHVA 1YKGA 1ZXLA 1JAZA 1E62A 3L8ZA 3P52A 5PNTA 2ZYUX 1D6JA 4J6FA 4C7OA 4JSRA 1UK8A 2VBIA 1N7HA 2YNMC 3HNOA 1ZMXA 3GZNA 3R6TA 1LPBB 4XTCS 4B4UA 2F43B 3FOWA 3N59A 4ZTZB 4JOSA 1RI5A 1CEXA 1ZGAA 2G8LA 4TVBA 1YSCA 4ENSA 1RHRA 1JL3A 1XJ0A 1MMFB 2C82A 3LOUA 2P7HA 3FVVA 4WTOA 5AVJA 3T1OA 3ER8A 1LS6A 2C31A 2EFJA 1YC5A 3Q87B 2YC2C 4I1RA 3V7NA 5ITWA 1JAHA 1B93A 3M7IA 3QI2A 3U61B 2HL6A 4KL8S 1NBAA 3VOBA 3G5TA 4XB6B 1HM5A 4QT0A 2CFTA 1VYVA 1SBNE 3NTVA 3PQ3A 4CM4A 5CFZA 4C07A 3H97A 2OPBA 2ESRA 1PEAA 1Z3IX 1JA0A 1JLLB 4NFLA 5FBQB 4RW0A 2YTZA 3HXKA 4XXHA 1P61B 1XTBA 2H9IA 2UVPA 3FHJA 1JI3A 3F6CA 4TN1A 4BO1A 4F5EA 4DA9A 2M6LA 4IEIA 3LU1A 3O92A 4C20A 4LC9A 5KYVA 4X1YB 4D4GA 3BSSA 2OVBA 4YRDA 4EY6A 1EFKA 1KI7A 4HAXA 2W00A 2LZ0A 3QFCA 4NOLA 1G2PA 4YVFA 5TF0A 2Z8YM 3E9CA 3RKSA 1T6BY 3H6HA 3FYUC 5KVCA 2FB9A 1Z7YA 2OBLA 4YLEA 4F91B 2WM9B 3U80A 3C1AA 1BS1A 2C99A 4R7ZA 3LYUA 4I46A 1XU7A 2ZJ5A 3QEJA 1PU2A 2AG5A 4PHCA 1I4TD 5ESDA 1WTAA 4NEHB 1GWNA 1YS4A 2SCUB 3K2BA 1BROA 1QH1A 4YV7A 5TV2A 1G5HA 2ZYHA 4K9SA 3KSUA 3ZEAA 4AM8A 2ZJYA 4QBHA 5DM0A 1QGAA 4YAIA 4Z2YA 3ZQJA 4BECA 1YHNA 2GYYA 1QPBA 1T8SA 2NADA 1VJ0A 2I6UA 4J1SA 3VAZA 2FLVA 2ZBEA 1TIKA 4KNWA 2B8NA 3ILSA 5FA6A 1EXDA 3IPLA 3F4BA 4GYWA 3KUKA 1KMHA 3PHBE 3U16A 4EUHA 3T41A 3TFWA 3ZYCA 4XR9A 1V16B 3NI2A 4G8DA 4L8VA 3ZWYA 4P4NA 4BV9A 2ZB7A 1RRVA 5F4ZA 4XFDA 4KWCA 4I4TA 3GLGB 2YFYA 1HGXA 3G6WA 4OBWA 4Q05A 3VTFA 4C0QC 1GZ7A 1IUOA 3I28A 4UFPA 4BTEA 4TWRA 5LXTF 3MELA 2X1VA 4IGKA 1LC3A 4MCJA 4RGQA 4BKQA 3FF4A 3A2KA 3FMIA 3RB8A 4Q1BA 3ROXA 4AC9A 2BMFA 3ID6C 1AXRA 2VA8A 5I7SA 3IELA 2V6JA 4UVHA 4YP0A 1UAAA 5CM8B 1T4DA 2I22A 2EZUA 5B1SA 5F2KA 3WNCA 2B2XA 1ZBDA 3HHEA 3K0BA 2AX3A 3MM4A 4KQEA 4KBYA 3BQMB 4M7RA 4O4IB 4LVCA 5DGHA 3IAS1 1ENYA 2KS6A 4MKFA 3WLMA 5CITA 2WU4A 4IXWA 4EZBA 1YZHA 1TAUA 1WDTA 1RLMA 3HU2A 3GRVA 2HU7A 5CTAA 2Y3IA 1R9JA 4PR3A 3A3OA 4QYWA 1W73A 3KR2A 3S29A 1NLUA 2EWMA 3LVRE 2G7MC 4ZO6A 1CJCA 5IH3A 1JNYA 2CL6X 4EG8A 2QBYA 2QZ4A 3L4BC 1M54A 3K8ZA 3U49A 1WBDA 2B6HA 1NWHA 1YZYA 1FU4A 1B0PA 3O95A 2H85A 3WYCA 1HQCA 3LDAA 3UQZA 4CMEC 3L04A 4P9NA 1P77A 4NZ9A 2NZVG 1IMOA 4AKIA 3A9SA 4MMYB 3STTA 3S2EA 3HTXA 4L6IA 3QLUA 4P5PA 3QPBA 4MUXA 1BE6A 3RIYA 1FP1D 1DKMA 3M4JA 2X4LA 3R8CA 1MB3A 1W29A 3T3NA 1IG3A 5KCMA 4Q1AA 2EFGA 3HU1A 1QRRA 2OBXA 2KLHA 1IHYA 5AK6A 3UKJA 2GN1A 1DCMA 1FOEB 4M36A 2P4SA 1K6MA 2OBMA 4YBRA 4AVYA 1O5IA 4Y30A 2VP9A 2EEZA 1DC6A 4FQ8A 2P75A 3V80A 5LZ9A 1C3OA 3EY4A 5I9SA 4JLBA 5DNVA 4N49A 1RXUA 2RG1A 2XYQA 5I7EA 4NG4A 1P7CA 2PZBA 1QHIA 2HXGA 3ZNNA 3OIUA 2A9KA 1KS9A 4AT1A 1E6WA 1KYIA 3CN9A 4HF7A 5F4BA 2BEUB 3N7AA 4NXNB 4CCSA 3GPLA 1Q0SA 2C42A 1UK7A 4LYHA 2OXEA 3V42A 5FI1B 4N82A 5CM2Z 4BZWA 1JFRA 3DQZA 4PPYA 1VDMA 3U4CA 3VOTA 2AJBA 3E9EA 1Z75A 3EYAA 4E08A 2GXSA 1B26A 3DO6A 1IL0A 4GPIB 4ZFNA 2G72A 2JA1A 3LVBA 3PK0A 2NX2A 3BIWA 4HNRA 4KXUA 1GR0A 4FLEA 1RP7A 1Z74A 3F9RA 3FCCA 3L40A 4IVQA 4AZWA 3H5AA 3QKSA 1EK1A 4UPVA 4ESOA 4TYNA 2QTZA 2IOFK 5AUPB 1DX6A 1Y1PA 1R8XA 1U2DA 4IYRA 4BMPB 4ZHQB 4Y2SA 1CUBA 4FU0A 1QP7A 3S1AA 3H1TA 4MIKA 2G17A 3SZUA 5BUCA 3IEIA 3BD7A 4V0MA 3E3LA 4EATA 5IVPA 4GRIA 1FIUA 4UQPA 2BH2A 5B7QA 4MV7A 3PDIA 2HCBA 4F4DA 2Q5OA 2YN2A 4FSXA 2EZ9A 5TC4A 2OQRA 4XYLA 5I8ZA 1GYRA 4UXJA 1SBCA 5FP0A 3QPAA 4K3VA 3B12A 4M9XA 2W2LD 3RVMA 4JN6B 3SSAA 1G8MA 2WV7A 2VP0A 2CCKA 3TINA 4D80A 2QYSA 3GLVA 1ELOA 1L7VC 1FMLA 1TK2A 4RGYA 2HQOA 1GV0A 3JAKB 5F76A 3HCEA 1XLVA 3C43A 1K6XA 1SA0B 4OHRA 3EIHA 5IW8A 1Z6XA 3M6LA 4W7SA 3SE7A 5AUNB 5JY6A 4RA9B 3GUCA 4RIGA 1PR1A 4CT4B 2GR9A 4HH3C 2Z30A 1GNSA 1Z68A 4KB5A 3AVTA 4XWYA 4EJFA 3TECE 5KINB 2A3RA 4L5BA 1P29A 1DLJA 1N3IA 1U9YA 2Q2NA 2VPTA 3GCWA 3QP9A 4J0FA 4JENA 5EQDA 3LUGA 1UP4A 3PDHA 1X7YB 4TYPA 1NKTA 3M34A 1OQAA 3SF8A 4V1CB 1VCHA 2Y8EA 3TQSA 2HA3A 4AY3A 4C7KA 1WP9A 1OU0A 3O4FA 3ZDBA 4Q3AA 2KE5A 3CZRA 2BSXA 1CZKA 1V25A 3MCZA 4MHOA 4E14A 2ZK7A 1XI2A 3NDRA 2BBWA 4WACA 1GQOA 4F9GA 4ENVA 4JYMA 4AKEA 1DG9A 3LIPA 2HBYA 3DP9A 1K68A 1NLYA 4KPEC 4C0SA 1WQ3A 4AROA 4JP5A 2RC6A 1BZYA 1A7JA 4J9UE 1VI6A 2O3JA 2XDAA 3MMXA 2N9UA 3PNQA 1FYEA 4BFWA 2FMFA 3SI7A 4A9AA 4RSGA 1R4NA 1IBLB 2VNJA 1LF0A 1Q95A 2RG7A 3NYRA 2AYXA 4TGLA 5PGMA 5U4QA 4A8TA 4W9NC 4R8RA 4DNOA 3KTOA 1YB7A 4OXNA 4EYKA 5AI8A 3KQQA 3CISA 5ER9A 4BKUA 4CM8A 3AVQA 2JAWA 3RJMA 4JI2B 4N76A 5KNDA 1JH9A 4QUGA 4MUNA 3ILYA 2Z5FA 3I2IA 1CW2B 4XYMA 4R83A 3SIWA 4F2PA 5HP4A 4ZCMA 1EXVA 1OX6A 1KZ4A 8OHMA 1TD9A 3QFFA 4L1KA 1CIVA 1OYOA 3THRA 1W9MA 3H2SA 5T8KA 4L6CA 1HH4A 3TRHA 1SVOA 1N7JA 3A1CA 3CURA 5ARDA 4GVPA 1K89A 4PGHA 3TSZA 3ZS9A 1TVMA 1VP9A 4OQPA 4TMZA 2QD1A 3EZXA 3N39C 1M1YB 1CJTC 3ECSA 4YJKA 1JU4A 621PA 3BD6A 4DQLA 2BF7A 2H2DA 2JK1A 2PJZA 3EVZA 1X3SA 3ZBPA 3IE0A 3GMTA 4OQDA 4RMGA 2ZU0C 3PTLA 1NJ2A 1GVHA 3OZFA 3PR1A 2XUZA 3SX4A 4I0WB 4HT3B 5CA1A 3D4PA 4O5AA 4P4SB 3VGPA 3PT9A 4P31A 3R09A 2CEAA 4OL9A 2XNJA 3IQGX 4RYDA 3D5QA 5ILGA 4BFTA 4AZVA 1DUVG 2ZP1A 2O2EA 4MAFA 2J5XA 4EJ2A 3VH2A 1R0WA 1M72A 1FDVA 2ADMA 3DV2A 2VRNA 2AFIB 3OJCA 1KA9H 1NG1A 4G0OA 4LYFA 5DO9A 2H4ZA 2AXNA 4GOJA 5E9WA 4QTYA 4WJZA 2FPMA 2VDWA 1JLKA 1D0VA 3C4VA 2VJLA 2PMWB 2GHRA 3K53A 3WX0A 5C5IA 3IP8A 1RACA 1CY6A 2VH5R 3ANLA 3QLJA 4CUZA 1WD5A 1GZDA 1QYXA 5GGYA 5AVVA 1QIGA 3GO4A 4PLZA 3ZU4A 4DPLA 3T3EA 3PZRA 1NUPA 4QJBA 4GR4A 1U1DA 4OQYA 1G6OA 2ENUA 2R1TA 3MMNA 5E8JA 3WG9A 3D54D 4AO7A 4NU6A 2QT0A 3HVRA 4ZQGA 1R74A 4UFNA 4LWOA 4Q3LA 1QYVA 1J00A 2D1FA 4C87A 3K1YA 2G25A 5EA2A 1U2EA 1W85B 2QNBA 1N9GA 1C1XB 4W5NA 1OWLA 5F1KA 1FYXA 3PRYA 2E5LB 2D1SA 2HI0A 2RH5A 1GPNA 3U56A 2MMGA 1ZGBA 1VL0A 5K0ZA 4OYLA 3NBFA 1PWEA 3EGVA 1C4OA 5J43A 1M5TA 1XIVA 5L3QB 3F49S 4LOAA 3MS4A 1ADBA 1OFUX 5HQJA 5TMBA 1Z6ZA 1KQOA 4HB2A 3HDJA 2CF5A 1L7MA 3M9WA 3RIHA 2ECQA 4M49A 5K4AA 1M0WA 5EP3A 2QGFA 4NAUA 4KQWA 3PNKA 3DL0A 3EVNA 5CVCA 2I91A 2RHDA 1DQPA 2XCQA 4Z9XA 3WQHA 4HNAB 2AHOA 1YAJA 1LRJA 1PZGA 3MJFA 1XL0A 4OMUA 4OKIA 5K3BA 3TQIA 1BXGA 5JTTA 2WUEA 1WKBA 4R98A 3JZAA 1RWWA 2H06A 4WIAA 1PGOA 3FAKA 2WWHA 3HR7A 3PD0A 2ISQA 4PBSA 1QKKA 2WWYA 3WMXA 5DLDA 3RIMA 2SECE 1JG3A 1Q7BA 3RM3A 1VM6A 4Q1VA 2BGNA 4EH1A 5DTIA 1L4FA 2OORC 1QOPB 3S40A 1J0XO 1XPJA 2BTQB 4NOMA 4TXNA 3ZV3A 4BATA 4F6CA 1C0IA 4J0JA 4F5DA 2LDXA 1VXRA 1CF9A 3LT1A 4K9DA 1Z63A 3KYDA 1L5HA 5I51A 5JYDA 3H13A 3LO8A 3H11A 3O8QB 4J1TA 4V0OA 3VMMA 2Q9BA 2YYZA 3IR7A 1H69A 4IIXA 4KPUB 4M98A 3L5KA 2WSLA 3GT0A 1KXJA 1ML4A 4GQAA 5FOQA 2VRBA 3OZWA 4PR0A 2DQYA 3KBBA 2OGSA 1X7XB 5H81A 3F98A 2HSDA 3T5DA 3OQJA 3N0RA 3RHFA 1T4MA 2PIDA 2YNMD 2A59A 1CDZA 5AHOA 1KF0A 3NASA 4IRMA 5CK4A 1U4NA 2QUZA 5IXYA 3HB4X 1SIUA 3B9RA 3KXPA 3LWZA 4ZXFA 1ID8A 2BGMA 2I4OA 1FDSA 2Y6UA 4KLRA 3TO5A 2Q4EA 1G5IA 2VPZA 3DOFA 2AEEA 3TKYA 4AD8A 4ZEMA 2P3QA 3A36A 3I52A 1EIZA 3UYLA 2EP7A 1V7QA 1ADGA 1O57A 1GD1O 5DHQA 3DNPA 3RRMA 4BDSA 1P3Y1 3Q8LA 2O7QA 4C7OB 4CNBA 3BRQA 2APJA 1U1GA 3U26A 5LBUA 3F73A 3GZNB 4KFRA 3E4DA 2P9HA 4BBZA 3G9ZA 5DWVA 1U0NA 4NCIA 5K3DA 1DAHA 4ICIA 3SHOA 4QUDA 2D3TA 2Q2OA 4LBYA 5E3IA 4EGJA 1Q6YA 3HA5A 3OPMA 2ZM6B 4G0VA 3ITNA 4X6YA 5FOVA 1UBEA 3TKAA 1FY2A 1PK9A 2AK2A 4HB3A 1GNVA 1OOEA 1USKA 1P6UA 3GD5A 3D4IA 3HB1A 2QQGA 1NU6A 4PNPA 1NZJA 1UWCA 2JZOA 3RUEA 1O0CA 3FOEC 4TWJA 2PSSA 4MJ7A 5CP8A 4H7PA 4DREA 2WHXA 1QK3A 1T34A 4Y2GA 2I65A 5IVDA 4CM4B 3NTLA 5HYVA 3ORYA 4O3FA 5EMNA 2OV8A 1JDSA 3RT9A 2BFEA 4EUEA 1E1QD 1Y4AE 3HMKA 3ZJVA 1XNRB 2UVPB 4PC3A 4AJNA 4JBXA 1Q6ZA 3BREA 1NYTA 5ECDA 3MCVA 3UPUA 2OCAA 2H9AA 2X6RA 3FZNA 3FHLA 1MAWA 3NKLA 5COBA 2VJPA 4D9EA 1ISFA 2GCIA 1ZA2A 3WJ2A 3NNNA 4B6RA 1KR5A 2A86A 5FBRB 2LE0A 1T5OA 3NT2A 4L27A 3SHWA 2MSNA 4E1AA 1APBA 3W8FA 2YX1A 3OCZA 2DFTA 1BE8A 1R5JA 1JEQA 1K75A 2OILA 1LPMA 2R8YA 2YJ3A 1MNAA 2R5NA 1ZH6A 3DONA 2WK1A 1NUTA 2P27A 3DOHA 3O31A 3ZE1B 1FU8A 4AJ1A 4FLFA 1F0NA 1QH1B 3AM5A 3HGTA 5CRIA 1QDLB 3PLRA 2BGKA 1ACJA 4NECA 3AJEA 5B3AA 2ZWMA 3EQ8A 1MEEA 4U9UA 5BWMA 2IYYA 5BPHA 1Z6YA 1T5LA 3SS8A 3EUAA 2CBXA 2WIGA 1ULAA 2XNKA 3JQFC 3VAAA 1KDTA 2W2TA 4A4DA 5FI3A 4K86A 1MT0A 3I2GA 4YDHB 5FOUA 1GAQA 4UULA 4ARBA 1KMHB 2EFEB 2ZRDA 3LP6A 3GLHE 3WP0A 4WBNF 5DM60 1R8QA 2VXCA 4IHKA 4TRJA 3KAJA 2Q7OE 1QFYA 5BWNA 2WB2A 4Z4IA 3TEJA 4CMCA 1NN5A 1RD4A 1XD2A 2WW8A 4MI1A 4I4TB 1L5FA 1NFRA 1WB5A 5EUMA 1Z73A 2O50A 4KQ1A 3B52X 2O2ZA 2ZIVB 1CJKC 3ER9A 4IXDA 4LCEA 5G0SA 2CGEA 4N7BA 4NENA 4ZGWA 4A8JA 4BBPA 4Q3BA 5DM1A 4FZ3A 1SIWA 5LUAA 5JJIA 4D57A 5DNAA 5K6RA 4LF7B 4D6XA 1MJNA 1I4OA 1Q17A 2J7PA 2ZPTX 1GV1A 3QU4A 1CNMA 5KQPA 2FQQA 1EP3B 1TQDA 2H54A 4MRPA 3RRFA 4ZRDA 1RKQA 4EG1A 2RMKA 4ZANA 4TSKA 3RREA 5A5FA 1TYDE 5LKRA 3NHMA 4CPDA 1G4HA 2O6LA 1RLOA 2PT7A 5GONF 3L4KA 4JWKA 3GLIE 1PG5A 2ORYA 5FUMA 1DCFA 2IIPA 3DE7X 1T1JA 3MTIA 3ZUPA 2RGUA 3IUSA 4DY6A 4HAZA 1B1AA 2A1UB 3C0KA 2C83A 2E48A 1FNMA 1N2IA 3TQOA 1BMTA 3AEYA 4X8HA 4EG3A 4LN1A 5HJEA 2QBYB 1W19A 1XQXA 3LQRA 3P4YA 3R9KA 3QYAA 4CF6A 1T5SA 3HCNA 3R77A 5AKXA 1XO1A 2JJ1D 1PJQA 3KR0A 3K2QA 4P35A 4B6EA 1MX1A 3LXXA 1NV8A 2NU7A 2GBLA 3IVXA 5DN6A 4KACA 5DI9A 4OGKA 1SG6A 2XPCA 1WY5A 4IJUA 4BO8A 1HLDA 4GI5A 4YJGA 3M49A 3IBGA 2XT9A 3C3WA 4B80A 1Z0SA 2GD6A 4RVDA 4H08A 5DBIA 3DEKA 1LU9A 1ESCA 1A76A 4WFQA 5FKJA 2C4TA 5DI3A 3WRXC 4DCMA 2R3SA 4BWVA 4D1YA 1C3OB 2DY1A 3PUXA 4HATA 4DSOA 4F5ZA 2VJQA 4LE0A 5D3ZA 1SVMA 4V0KA 4PLPA 3DC2A 4EVRA 4ZO9A 3GT3A 2VTBA 2ZJ6A 1I9GA 4ENQA 4J90A 4LJKA 1KNXA 1YH3A 1Z28A 3GFFA 2PMEA 5A3QA 3SQWA 4R6WA 1P2TA 2H6EA 2YZMA 2AOUA 1RLUA 2XCIA 3ZE9A 13PKA 2J5KA 1UIMA 4P4UA 4YRCA 4OHZA 1CRPA 5JO9A 4D3DA 1J22A 1RBQA 3II6X 4AZTA 3TCXB 5JXJA 4NAVA 2XMCA 4ILEA 2RFLA 3HU3A 2PQ6A 2FFRA 3PFFA 2XBLA 4K9PA 3FY4A 3H2BA 3QVLA 3V1NA 1BFKA 3NKVA 3TFOA 3HCOA 3WB9A 3QPUA 1GY8A 4IWXA 2E4UA 2HLNA 2PBLA 3I72A 2N46A 4HLUC 4KIGA 2ZE5A 2ZTVA 2EOAA 3PQ8A 1HDZA 2P9ZA 4G6ZA 3RNOA 3RPEA 1S2NA 1VE3A 3TDNA 5JH7A 3J81k 3TF5A 1KTVA 2D2FA 4JHLA 3S1AB 3GN1A 3M9LA 2C3UA 4ONEA 3PE4A 1OKKD 3NTQA 4GWKA 4OK3A 4Z4GA 3PDIB 2CHFA 1BHQ1 4W1SA 4DR1B 3HDTA 1MRSA 5LP6C 3DEAA 3OAAD 2DERA 1H2XA 5ALJA 1RZUA 2JLWA 1JMYA 4JOQA 2HAEA 4MQFA 3D1LA 1K7FB 5DEOA 5JJLA 4UOEA 2R84A 4XGRA 3KSAC 2XIQA 5JASA 5LP6F 3L0BA 3JPYA 3FTFA 2QAGC 1QX4A 1ORTA 1SMKA 2I2AA 2NACA 1RP1A 1PT9A 1QS0A 2OVFA 3A10A 4GX1A 4IVPA 5AUQA 3TR5A 2E3JA 2OCXA 4EMUA 2ERXA 2PX4A 3CCCA 3GYBA 2QZZA 4LHSA 4M8LA 2P0AA 2HCFA 3I9JA 3ZWNA 3PF8A 2BKAA 2VF7A 3H2GA 1ZRNA 3LA6A 4LX0A 4FW8A 4M60A 1AQLA 3VQTA 3KT8A 4OLAA 2QMUA 5LZ2A 1BOFA 3AM4A 3E9MA 1H2FA 1D9XA 1W25A 1ZMTA 2B98A 3HN7A 2E85A 3QU2A 3SF8B 4HEA1 3FYTA 3G79A 2IEZA 1L8XA 5E3JA 3WK9A 1W52X 1SK8A 3WNBA 4E5VA 2RI1A 1ZDMA 4PIMA 1ZIYA 3BMQA 3FNGA 2F1OA 3AF3A 1U7WA 2FPKA 3DF7A 1H9AA 3PUYA 5BW8A 4XSHA 4P98A 3H4TA 2AA3A 2WF8A 3Q5GA 3HXQA 4QUKA 2HX1A 4XLZA 3FJYA 5FPHA 3NJ8A 1XC7A 2QTTA 5A7HA 2WTEA 3BE4A 4CL0A 3KD2A 4E5YA 3RW9A 3PHGA 4PCLA 5KVQA 2VF5X 2OC9A 5C5EA 3QA9A 1JDTA 2ZT6A 1DEXA 3WXMA 3FJOA 3V7YA 2VQ6A 2FK7A 2Q6TA 3WMRA 5DN9A 2PRIA 3RS3A 3GLFE 1TMGE 1XDDA 4JKOA 5K5EA 1OYWA 3K31A 4OAPA 1EINA 3W6NA 2C7OA 1R4NB 1PS8A 3GK3A 1CY1A 1K7CA 1Y81A 4FQ5A 4PYLA 2GT1A 4XKJA 1IRIA 2Z4RA 1D6NA 5LB2A 1XNQB 4N40A 4CM8B 4HDOB 2Z83A 3URMA 5AXBA 1SC9A 4LDAA 3C2QA 2CDBA 2Q3MA 2WOOA 4GNKA 2FEOA 4IO1A 1T35A 5L3ZA 4B3MB 4LPSA 5GINE 5E7JA 2GK7A 2RI0A 2YIJA 3DXYA 1T9GS 2WOJA 5AP9A 3E48A 4GLJA 1WX1A 3UT0A 4B6FA 1I0ZA 3COVA 3K5PA 4XIJA 4DCOA 1VLQA 4MRSA 2UYQA 5DM4A 4PFJA 5CMLA 1HLPA 4WXPA 2CZCA 2I03A 1M7BA 3BILA 2CMHA 4BVAA 3ADBA 3OF5A 1IXZA 4EUKA 1HETA 5KYYB 1P91A 1G8GA 2Y71A 2ZTLA 3N28A 4KE7A 1KTIA 4KE6A 5EIXA 3QKUA 4DA0A 3U4IA 2G77B 2RH9B 1V35A 1YZNA 4KIWA 4LSWA 3QMPA 5BV1A 1K97A 3OTQA 4KPFC 4B4KA 3MMPA 1JG2A 4G37A 3SPXA 2NIPA 1LUAA 1PSZA 3EDYA 3OZRA 5CA1B 2RIPA 4GIBA 4W99A 1OLOA 4PVDA 3MCUA 4NMHA 1D2MA 2HCJB 1ORWA 3FNRA 1T4GA 3DDWA 2HU8A 2X1HA 5I9TA 4AK9A 2PZKA 2QM8A 3T9BA 2I67A 4YI3A 1SURA 4AMZA 1DP4A 1PJAA 3O6VA 2C20A 2VA9A 4LXIA 4YRNA 4JFRA 2E55A 1DDOA 3CQ9A 2VDWB 4BX3A 3ND9A 2C2WA 3FUTA 5D3MA 3ENZA 3DO8A 4OOEA 2WICA 3QNWA 3CRMA 3FOZA 2BTEA 1UBOS 1JYEA 2V6GA 1NI4A 4C4YA 5AW7A 2FDCA 3L7OA 4BPBA 1ODSA 4JUCA 5FUVA 1WU7A 1PNOA 2O2YA 3AW8A 1VKRA 2R1TB 1C8KA 1T3SA 2NZ2A 2O14A 5JNWA 1P81A 4P86A 1AZWA 1OSNA 1NNEA 2I9PA 4QJ5A 1JBQA 2WTUA 3SICE 1A50B 2PH1A 2PRYA 1N9GB 2I54A 4K03A 4Z8YA 1LW6E 3TCNA 3ZLTA 2C5AA 2NQ2C 3A6LA 1LFDB 1T3HA 2XRZA 4MKIA 3VYTB 5D5HA 3KQSA 5MF6A 1KIFA 4UU8A 5G1NA 4FYYA 4MUBA 4DE5A 3KKQA 2QENA 4E2YA 1C9EA 4KTTE 4CM5A 1OXKB 2IHYA 3SEZA 1HK7A 3F8TA 2I9KA 2HNAA 3CZQA 2IYQA 2ZYWX 4UPDA 5A4JA 2P41A 1XMOB 1EM8A 3VDQA 3I9V1 2VQDA 1C41A 4GBED 3DVRX 2IC5A 1Z83A 1J97A 3C45A 4A03A 4DLTA 1KEEA 4MVCA 1GILA 4DY4A 1BXGB 3ONDA 4P7GA 5EE9A 3WGUA 3OX2A 5JSYA 4BX2A 4CKWA 4G41A 1QG2A 4XDHA 3EQZA 3WNZA 1KEZA 4XGQA 3OPQA 3FPHA 1JKMA 3R8XA 1UCFA 3TUJC 5KKAA 5C7LO 2JEYA 3L46A 5CEFA 4I1YA 4XR4A 2EJCA 2P4UA 4UAJA 1DOAA 1GPAA 5LU9A 1M34E 2RAVA 3FFBA 1BAPA 3S99A 3KYDB 1L5HB 1PZHA 2XMGA 4MW0A 4R9VA 5DT9A 5F1OA 1YIDA 4A7PA 2DF8A 2QW1A 3H11B 1G291 3VR4H 3CM0A 3IMCA 2QJRA 4LDNA 4RORA 2BMAA 3ADKA 4HNQA 1RHMA 2FUG1 4URUR 1ZL0A 1Y9AA 2B5VA 4MK4A 2G88A 3G5UA 4FM9A 1OI2A 3IBYA 2I34A 3OIDA 3JR7A 4O8ZA 2GLTA 1L9XA 3M5WA 2AX4A 4N5HX 2GXUA 4LHWA 3EHEA 4NH0A 4B3TB 4LAFA 4YXWD 3ZIAD 1IPFA 3IKLA 4JELA 4U6QA 2ZIWB 3EW7A 3UGQA 4I9FA 4HJRA 3SNKA 3V46A 1KWKA 2KBEA 2FRDC 4WT7A 1XUOA 4JBWA 4A92A 2XGOA 2DJ5A 5G4LA 2PK3A 4CKZA 2GNPA 2F8TA 4FNOA 3VR0A 1UPTA 5EPOA 4YPOA 2UZ0A 4MDEA 4W5TA 5KUTA 1QLWA 3DLHA 1VCMA 2EZTA 4I6JA 5EE0A 2GHQA 4PO1A 5H9VA 2XHZA 4QC2A 5JCPA 1GGEA 2YJNA 3KALA 2YJZA 4TVKA 1CEQA 5DW0A 1HPLA 4DADA 4CUJA 2I7DA 4YQZA 3PDUA 1PJLA 4KPGA 3ETGA 1BDJA 1ZGCA 3NCTA 3G9UA 1CBUA 5TY0A 4EDHA 4U7HA 4ED9A 1BVHA 4E5DA 3TRFA 3K8YA 5K2MA 1SBHA 4LSMA 4RZUA 5E4FA 4YDQA 3WYBA 2HJWA 1HOTA 3MRSA 3H8JA 4NR0A 1BJTA 4BNFA 3NQ41 1H2AS 5KU7A 3OSUA 5IK2D 1UM9A 2EATA 1ZU5A 1VA5A 2XECA 3OLCX 2YWEA 4UHCA 4ZMRA 3DZCA 3GH3A 4G5FA 2BGRA 2BVNA 4DIFA 1KO1A 4PZLA 4JLUA 2HSEA 5J4YA 2BFEB 4D8XA 2DPMA 4PHHA 3SS9X 2GA9A 1KEVA 3WRWA 3BH6A 1TC2A 3WZ2A 1FSGA 2D59A 4Q7EA 2ZANA 3TSCA 2NUAA 2XYVA 1RWBA 4HPJB 1OWPA 1TU4A 2HF2A 3JQ8A 5B2ZA 2OYSA 3QMWA 4PXSA 4JYZA 2KSQA 5F7OA 1HEUA 1RI2A 4M2LA 1XHEA 4C14A 6CHYA 5K0JA 3KJQA 3T5MA 1QTIA 1HRDA 1C1YA 2IY9A 2OHVA 2QTCA 3KOYA 4UTZA 1JEQB 2R1UA 3V2HA 4ER5A 3KSDO 5ADWA 5IZ4A 5F2EA 2XF8A 2GYUA 3R5SA 4UUPA 5CAEA 1K98A 2L18A 2QR5A 3E03A 2PUVA 4RHEA 1T4BA 4CM6A 1CDDA 3PJDA 5A9SA 4FFLA 4R2WA 5HS6A 4LV5B 3HJGA 4MRMA 1IHOA 3Q8KA 5CDFA 4COOA 2IX3A 1NYLA 3C5EA 2WF6A 1UFOA 7MDHA 5G41A 1SUSA 2AQ8A 4IFEA 1RM4A 2QE6A 3QM1A 3JQAD 4R40A 5LBIA 3V7UA 2AGVA 1NY6A 1W4BA 3CA8A 1WOMA 3D2LA 3HVIA 3K09C 5ALLA 5EMMA 3U7FB 4ENWA 2VEDA 1GU1A 2PLFA 2VYVA 1OZGA 1YC2A 5AKJA 4HNTA 1YL6A 4LRWA 1IEXA 4MW2A 1VL8A 3BFVA 5LR6A 5KJEA 5YASA 5BNIA 1UINA 4RADA 4D8YA 1KQ3A 1XD2B 4OM8A 1USGA 1CUGA 2KM1A 2QPOA 3A25A 2Q4DA 1GN8A 3FUWA 3QFRA 3AFIA 3OZEA 4I1OA 4RJJA 1WUYA 4K05A 3V1KA 4V0RA 2GO7A 4QU5A 4L8GA 1W7AA 3C6XA 1LK7A 4HUQA 4NENB 2QORA 2F48A 4A8JB 4MYRA 5TPZA 2ZWOA 2JJ8A 2BP7A 2ZEJA 1H8EA 1JEEA 3NEJA 4LKRA 1R10A 2JGIA 2ZSDA 4OQZA 1PEKE 2PDAA 3JZDA 1X0VA 4PX3A 3MJCA 3WV5A 5JS6A 5JD6A 4ZCQA 4DKJA 3ADOA 3AUJB 1TZ2A 1HQKA 1MO3A 3BBPA 3S5UA 1RNLA 1EE2A 2RHWA 1SO8A 3UA4A 3PSHA 4KMSA 4MJXA 2WINI 4ZARA 3T9AA 4BFVA 1XHFA 2ZTMA 2DBYA 4HQ0A 4QHYA 1NGSA 2B4TO 3C74A 4BLUA 3QF7A 1HF3A 3WWOA 5J1TB 1VJGA 4UUOA 1MKYA 4Q7QA 2AUNA 1E9AA 2DLNA 4HRXA 3ZTYA 4B0OA 2GFQA 3KQWA 2CLMB 3GUZA 1W0JA 2ZR0A 2YXDA 1EZ1A 5HW0A 3QXHA 3QY0A 2XBMA 5ECWA 1EUZA 4HH4A 2QGZA 2NTNA 3DMYA 3PVZA 2OPHA 4J1QA 2B82A 5DTMA 1DLIA 3VSBA 1E94E 4J3NA 1L1FA 4E15A 3W1WA 4RJLA 1K8QA 1FRZA 1EVJA 4PNEA 1HYHA 1E1KA 2VNAA 2NU7B 2O5RA 1M73E 3NEPX 2WYVA 4M6WB 5EIAA 4BNDA 2DUNA 1X70A 3D31A 2ZE8A 3TNYA 2HU5A 4KQJA 5HKOA 2JLVA 3UKDA 4YJGB 1DMSA 2VG8A 4FFVA 1TW2A 4UXIA 4BVBA 3S1SA 1AF7A 1J20A 1QJCA 4R1LA 4F72A 5HKBA 1J8QA 3HBNA 1V3UA 1NPDA 3OSZA 5KWEA 4JBLA 3KT6A 4MWDA 3VV3A 3DHNA 5DI3B 3B53X 2J3JA 4OQFA 2ZS7A 4HXGA 3Q2OA 4NEQA 4C9BA 1IY9A 3PYXA 2C8VA 2WDPA 5IKXA 3AYZB 1C3JA 3DFIA 2BW0A 3KJGA 2GCPA 2PT6A 1D6SA 3EWNA 4ABYA 2YXLA 4FCWA 4RY0A 1CCWA 4RTQA 1CF2O 2VTBB 4MLPA 1Q1NA 4I81A 4QDXA 4DCSA 3QVUA 1QKIA 1FZTA 3V4PB 2OO7A 3B9BA 3PX3A 4UUBA 1V48A 2AOUB 1PW5A 3ASVA 5LJIA 1OBVA 1NXOA 2G9ZA 3N5CA 3KLPX 4TMKA 1OXSC 3W1VA 3CPSA 4J8PA 1NP7A 5CX1B 5AW9A 3LCCA 3RVKA 2KBFA 5TXGA 2JGLA 3ROPA 3TN7A 4A16A 2QM0A 2WQ6A 1DQYA 3DDHA 1IJFA 3D8BA 4H60A 1KRWA 1D3AA 1JKJA 4DAEA 2WQ7A 2Q28A 4B7AA 1KY2A 1P31A 2GM9A 2V55B 4PSUA 4EJMA 3TE7A 2IV2X 1K7SN 1PCXA 1T2NA 2VT7A 5J47A 4BCBA 3R3ZA 3MBOA 4J0HA 4PLCA 2P67A 3Q15C 4YALA 3B3FA 1I7NA 5JH7B 5DBEX 1RJFA 4LFCB 1MB9A 3IP9A 3KEOA 5CDUA 4EJ0A 1UXJA 5IZCA 2GKGA 2XRYA 3A8TA 3G1UA 5E1BA 3OQ6A 3DZDA 4JLJA 4RSRA 1G5RA 2FUG6 2XWPA 4M1WA 2VHZA 4AMYA 2PZLA 1I4EB 4IIGA 1D0IA 4INOA 1FFHA 4CJXA 4DRXB 3AZQA 4PCVA 1B6TA 2H65A 1XVAA 2GXQA 3D6TB 2P8SA 5AJXA 3FI0A 4MQFB 4QU0A 3H1BA 2H1RA 4FSDA 3RTAA 2ZJOA 1PGJA 2WJIA 5FWXA 2GKOA 2CJXA 2DECA 1RWMA 4PW0A 4U2GA 2V9PA 1O0BA 1JEJA 2NO5A 1K1EA 4D9JA 1EFUA 4L08A 1NVAA 3OIYA 4IDFA 1LD3A 3AHCA 4MA4A 4V0LA 1QS0B 4FMDB 1AZTA 5A02A 4F04A 2A5JA 4YH1A 2J1LA 3KVVA 1QMGA 1XELA 2YUIA 4MCHA 3ZJ4A 1DJNA 3OKAA 5ENDA 3N75A 3L9WA 3EEBA 4MRAA 3FNFA 4Y7DA 3FOBA 1KOGA 1I3MA 3T7AA 1W5EA 3H8SA 4P5DA 3DKVA 2QTRA 3CU5A 3ED5A 5JCOC 2HQ1A 3BMQB 4ROTA 3THXB 3NHJA 4X7PA 4GR5A 5JANA 1YVRA 4IGAA 4KVAA 4TQGA 2Q3HA 5ICFA 3SXUA 5MN5A 5FRDA 3HJNA 3NRBA 5DHFA 4B3DA 3WGHA 2B4KA 3A1FA 4J7CA 2DVMA 9GPBA 2A5FA 1Y63A 1USVA 3BWDD 4FGSA 4Q03A 4TKUA 1Y4UA 3G0GA 3VV2A 4BMXA 2BKLA 4D41A 4K0KB 1BGVA 2WYUA 2Y77A 4GDFA 2OP1A 2HWUA 5DX1A 2QRNA 4YAJA 2Y9MB 1G6Q1 4WKCA 5DISB 4E5UA 3EQ7A 5EJ7A 1RHKA 3JQBA 2Z5VA 1PVDA 4H6VA 2RHRA 4QTXA 2W90A 4A0GA 2PZAA 4AF7A 4DBLC 3L7NA 3G2HA 4TMFA 3HABA 1E2FA 5E3HA 3PFIA 4E2XA 1ST3A 3IRVA 1X1SA 1R00A 2OGWA 2LNDA 2JD1A 3GT4A 4GWGA 1ULHA 4AECA 5IT5A 1RPZA 1D2HA 1VL2A 1AUQA 1X7WA 4JU9A 1X8XA 5ESWA 3OZBA 4MV8A 3VYVA 3EEOA 2CFIA 2L82A 2JIOA 4BQQA 3IUNA 1LGYA 2CL0X 5FA5A 1YTLA 2GSDA 1YS1X 1TIBA 1Z08A 3CH4B 4BE9A 4E3WA 4XYEA 1TGYA 3LVQE 1L5NA 3LP8A 2FY8A 2WF7A 2XW6A 3CZMA 3KJFA 1VMAA 3FKJA 1IN7A 4YAGA 4GE3A 1J23A 1NW6A 3LRTA 1L5KA 1LDYA 2FI1A 3RC3A 3P2KA 3QG1A 5I9LA 4PQFA 5C81A 1TO1E 2IYFA 4GI7A 4LF4B 3NHZA 4DQDA 2C4UA 1J33A 2GF0A 2PWBA 3WZMA 2P6PA 3IR5A 3ZVMA 1QE3A 2C8KA 3HSYA 6Q21A 5HRAA 3FMGA 1D4ZA 3RU7A 2QL7A 4DC9A 2HMVA 2QRKA 4AICA 1Y1TA 4DFDA 2YXNA 4JJGA 3PFWO 3OIWA 4IJ5A 4ZCPA 2R96A 3IFSA 1MAHA 4L5JA 2JRLA 3PVSA 4NBSA 5JS8A 4ZREA 4P7JA 2CE2X 3OUTA 2YL2A 5DCWA 5I4KA 1TMYA 2QZPA 1X15A 2X5JO 3HRIA 4J7XA 2K4MA 4JITA 5C1DA 2BI4A 2QPLA 4Q82A 1JFVA 3U37A 2GCOA 5E4TA 4TKVA 4WLFA 4HV4A 1NXSA 2PUJA 4U7WA 5D3MB 1XLTC 4A82A 1U0FA 1Y7LA 1ZNQO 1W93A 1A9SA 1DJLA 3HPQA 1T26A 2DC1A 2Q21A 3SC4A 2J48A 2Y1XA 3QJYA 3ZZ0A 3EAQA 3TYXA 1YRWA 3A3KA 4RPKA 2HT6A 3N70A 4O29A 4DLXA 1I2BA 3JW8A 4G9EA 3FVWA 2JAHA 1R0ZA 2OBNA 3VGJA 2D8MA 1RRPA 4D43A 3ZDCA 2QG9A 3L1UA 4CXMA 2PEZA 4ZAGA 3NALA 2XE8A 4HAYA 1CKEA 2A94A 3KPWA 3UOGA 3MSXA 1AHNA 3ZQUA 4Z1MD 2VJCA 5DNDA 3C6ZA 2NZJA 5BQPA 4AKTA 5CGZA 5EE3A 2CB9A 5EIBC 5EQJB 1H22A 4L6AA 4MQLA 1VA4A 4WE3A 1JDJA 4JDPA 3IP5A 1PUXA 3AUKA 3L7LA 3SIPA 1R8JA 5B55A 4AJKA 3RADC 4BWGA 1BVYF 3VSDA 3K9HA 3NOOA 4PLTA 1CULC 1VSBA 2QRHA 1OWOA 2FW1A 2X13A 2XRFA 1EM8B 1SHUX 1SOWA 3NBMA 1JXAA 3TMKA 4HZGA 1ST2A 4BU1A 3MQFA 3A6PC 2Q6LA 2ZRGA 2R60A 4BP1A 2ZJFA 1KEEB 4FBLA 1E3SA 4X00A 5H3HA 3VR4A 4RJIA 4TQUS 4REMA 1Q0RA 2PKXA 4KQHA 3CJRA 5CT5A 5EZYF 5I4CA 2GZAA 4CKWB 4B84A 3I8OA 1NNUA 1MEJA 2UZ3A 5F3WB 2OFPA 4ZVTA 2Y0DA 1D1SA 1SD1A 1IRXA 1T13A 2AKAB 2ZBPA 4HYYA 2LIPA 2YHBA 4BVGA 4MW5A 1HV8A 1P9RA 3ZC3A 5KJCA 2XUFA 2HH9A 3DMRA 1A4XA 1MRNA 1ZM7A 4J2TA 4MQ4A 1BRTA 2W2NA 3A1TA 5GJCA 5L3RA 5IDXA 1ES9A 4RD3A 1V2HE 4HJXA 2IBSA 1JS1X 2OG2A 2HXYA 2WJWA 5DK6A 4B71A 5T5QA 3AGPA 1Q1BA 4TQAA 4U39A 3NS7A 2FG6C 4HTFA 2ZYRA 3WOHA 5LD2C 3RVJA 3PEFA 3DZGA 4M0PA 4PO8A 3FWZA 4I5IA 4ZOEA 2H5JA 3OWXA 5AW8A 3CNHA 4I1VA 1JG4A 3PC8A 1FB5A 4GGOA 2F3PA 4QG7A 1MA0A 3PRKE 5JC1A 1F3OA 3EYWA 4YO8A 2WSMA 5KQMA 3F0TA 3GEEA 4P22A 5KAMA 1HT0A 2LKCA 4WNAA 5TS2A 1BJKA 2O8FA 2D6FA 2G04A 4X61A 1L7QA 4MUYA 4OXYA 5BSKA 1ZEJA 3LLVA 3Q7IA 4L9AA 1N36B 3DEFA 1M8FA 4KXQA 1Q0ZA 2D2IA 2EW2A 3E18A 4R1SA 3IS3A 3N2NA 3VR2D 3X1MA 1PR2A 1OLUA 2A14A 3C5CA 1F48A 2IYZA 1IUPA 3Q3HA 5G40A 5I3CA 3ZD9A 4DLAA 4ZI5A 2F64A 4QD3A 5DF1A 1C0PA 1Y37A 2HMUA 2ZJ7A 4M88A 4GYKA 4MLCA 4Q9NA 3WGLA 5J4KA 1VKJA 3O74A 2C78A 4ARCA 1AGPA 1BHSA 1XMJA 3KELA 4EI2A 2BUBA 4EM6A 1DKLA 1DS6A 4G0ZA 4DZZA 4F93B 1HNXB 1E9SA 1WPXA 1UBHS 2ZIZA 1NDUA 3AHDA 4HLDA 1A3CA 1A4UA 5JQGF 3W1EA 2P6NA 3RK1A 2AFHB 1ZGJA 2J0VA 3H7IA 1WXFA 5C8XA 5DW3A 2VF4X 1F06A 4B3IA 1E9FA 1UM9B 5T4FA 2BZ1A 5HJ7A 1DO2A 3LBFA 3NRCA 3RAGA 3KE9A 3G3EA 3H0CA 2V1XA 2YVLA 1RZ3A 1ATIA 3PEYA 4BRSA 1NJ6A 2V97A 1OX4A 4KRFA 1U94A 1PFKA 2FFHA 2YV4A 1TJYA 4XQEA 5SV2A 4RLSA 1YMUA 4KLAA 4D96A 4A26A 5BWCA 1VG8A 2NUAB 1DFGA 4I19A 3EIOA 3JQ8B 3BD9A 3SZMA 1HE5A 4C2TA 1JYSA 3WK4A 4IQGA 2WD8A 4R8MA 2G09A 4GP9A 4KWEA 1U5CA 4CDNA 2X0FA 4L3VA 2IY7A 4DARA 5BYKA 5DLQC 1H2ZA 3HVHA 3KDPA 3ANSA 3LUDA 5J23A 1IN4A 3OU6A 5CAEB 4CKCA 1XTTA 4NJOA 2ES4A 5CH8A 3RS7A 3CNOA 5KOHA 4JJEA 3JY6A 1WXHA 3OQVA 3W2GA 5A9SB 3QOYA 3RK4A 1WU8A 4ND6A 5CFRA 4MRMB 2WU1A 4F9FA 3B1WA 3JWEA 1P8JA 3VNSA 3JZFA 1OGYA 4KAAA 1W5FA 4ME6A 4URHA 4W7IA 2VEOA 5K8CA 1JA9A 3WRVA 3WL4A 3IO5A 3UATA 3PT5A 4JJFA 1W581 3OZDA 5JEEA 3SMQA 3TEFA 2ATIA 1VKOA 1WXWA 4P33A 4QFDA 4ZTUB 4QWMA 1ZGGA 1KJYA 3L7CA 3D81A 4GGPA 3UYKA 2W2QA 1HL3A 2Y2VA 2N1BA 2H4FA 1ZW1A 5IP5A 1E9CA 4DIBA 5JNRA 4OBXA 3AHEA 1ATZA 2JGDA 2XOEA 3K92A 4MV1A 4MGHA 3LOQA 2GYWA 2X6QA 3Q3JB 1UBFA 1ZQ1A 1FFYA 3NVAA 1MJGA 4Y1GA 1QZUA 1P3JA 1QUFA 4OI2A 4IS3A 4HUQB 4RZIA 4TZKA 4EI8A 1IOWA 2UYYA 2BP7B 4DV1B 1K66A 1V8DA 2IPOA 1SBYA 4L8WB 4BASA 4YRBA 1M3SA 4NF2A 3UGTA 1IJBA 2NN3C 5ENZA 3TZEA 3U3MA 4LZAA 2QL9A 4RIHA 3VZRA 1OU4A 2B4AA 3ROQA 1GYQA 2FEMA 1GSHA 2H7YA 4N7MA 5DXFA 4DM4A 2G1AA 4B74A 1AS0A 4EUSA 1A1VA 4ZYYA 4CIAA 4AS3A 4JNKA 2JAUA 1KL7A 1P0IA 3GPCA 3VA7A 3SQMA 4YAWA 2P0YA 1ZU4A 2ZBDA 1VYUA 5I9BA 5J59A 2IKQA 5TRTA 3UCXA 3A1SA 5IH7A 1DIGA 4FWTA 2WT8A 4KXVA 2ZG6A 1WS6A 4GXQA 3R0QA 5A5GA 4CI0B 1GRVA 1I3KA 1X7ZA 4G0XA 4EZEA 1XCJA 4MINA 5KKNB 1P1IA 4C1BA 3AO0B 1ZIXA 4M0MA 3PTZA 3WK6A 1F8UA 1S9HA 4MI9A 2LCFA 3KG2A 2Q9CA 4JCOA 4PSDA 1WWKA 2CMKA 3VZSA 2FN4A 1U0HC 4AY4A 1YMVA 2IHTA 3GLRA 1PWHA 3CLRC 5JD4A 1OBOA 1H8HD 2C2YA 2DTEA 2W2XA 1IATA 2DUUA 4HX9A 3C3AA 4NCKA 2BV3A 4XLTA 4BNDB 2XCSB 5JNLA 1T1IA 1PR3A 4CRWB 1OROA 2DBRA 4ZOLA 1IXSB 2YYSA 5GP1A 2UYCA 3D7SA 1MN6A 1IM8A 1KP2A 4MB2A 2P35A 4UHHA 4EKDA 3AOEC 1L5QA 3AHGA 3DWIA 4JX9A 1R50A 4CE6A 1NRXA 5BUQA 1XEWY 1F20A 1KI6A 2A7QA 5HJ2A 5C18A 1MUUA 3S44A 2YMMA 3H04A 2I1WA 2X9QA 3RTCA 1NUUA 1DRUA 1SU7A 2AOTB 1BMFD 2AH5A 1NQ5A 1XMXA 1Z13A 2I3DA 2WWTA 3F2IA 4JJ7A 5AO9A 3ZXYA 3IL2A 2JLBA 4AZSA 2C2OA 2XZPA 4C0HA 4FUTA 1ZRSA 5GOZA 2ORED 1PFUA 3EARA 1ZWLA 2WIJA 2Z95A 3GI1A 3HJAA 3RODA 3T34A 3T3PB 4CR6A 4JQSA 1Q20A 4BV8A 4J4BA 1QRUA 1PGPA 1M2GA 2A4KA 3DAYA 2YY5A 2CB0A 3QTTA 4UDNA 3UB4A 5IDQA 3Q85A 3DC7A 4ZKEA 4RZQA 1Y1SA 2OQIA 4LJAA 4RM3A 3WGQA 1TYBE 2PY6A 3K9WA 2I1VB 3QVXA 4MV3A 2YCBA 4PXYA 4BN5A 3D2AA 3WHPA 3MGAA 3VZBA 1JKJB 1WRBA 4QDKA 4QNRA 5KDDA 1LPPA 3U81A 4OGFA 3COJA 1N33B 3H5RA 4WY2A 2FZEA 4QPNA 3KRTA 4WNCA 3ZHVA 1M2KA 2IT1A 1EDBA 1KNQA 4KK3A 4YCJA 5IT4A 3R6GA 4BQRA 3UO8B 2BHSA 1U7HA 4GMXA 1DKNA 5MGNA 3L84A 1U9ZA 3OFVA 4LGMA 2E1PA 3OCVA 4JUBA 4RH0A 1YBMA 1RPAA 1W36C 2MOKA 1VLHA 2BM9A 1WUJS 3U31A 4Y0AA 3BEOA 4H1VA 2JEZA 5FWAA 2V03A 2VAMA 1GGNA 1C80A 1ZIPA 4X1KA 5E7QA 3T12A 5ADUS 2BYTA 3DHWC 1KWGA 2RHBA 4LTNA 3BXHA 1WUKS 5EKXA 4II2A 4Q15A 2C2KA 2G1JA 3C3EA 3UMGA 5FWXB 1FMTA 1TZJA 3WTCA 4IDDA 1YRHA 4FONA 4OK6A 4OATA 2FSIA 1A2BA 3UMVA 1GPBA 4V1CI 4KC0A 1YA6A 1XCGB 1XZEA 3TQTA 1ZNWA 3O26A 4MUFA 4GMKA 2L42A 2V58A 2V98A 4V2UA 2J6CA 3FOAA 1MW9X 4OYRA 5JAIA 1AMUA 2O8BA 2WSSD 3O3MB 1FQOA 4RWZA 1CE8A 3HJBA 1JB9A 1ZAYA 4FMCB 4MUEA 4C3VA 2YNMA 5AM5A 3VO8A 2EBHX 1YJQA 3LPDA 3R7AA 4DG9A 4PAGA 1BMDA 2C94A 1SH7A 4MGZR 3PC6A 1LTKA 1MHPA 2C1ZA 4OUKX 5L6LB 3VR3A 1II8A 2OFXA 4X54A 2NYAA 3V32A 2FOIA 2PS3A 4OFBA 4UC0A 2DETA 5JI3E 2CVOA 1MC4A 3B1VA 2B37A 1LNSA 3BL6A 1FTNA 5THKA 3EOAI 3WL5A 4QHSA 4RZHA 4C05A 4KAJA 4TKUB 4CCYA 2VTDA 1NTRA 2F8SA 2CKMA 3GJ8A 4X60A 3H0KA 1H94A 2ZT8A 4FNGA 4XEHA 3A2MA 1UEIA 2BEKA 1N0WA 2X5NA 1CUCA 4JQYA 4L2IA 1IHXA 1F7VA 3JRXA 4CDGA 2YHAA 5F51A 1I7LA 3N8KA 1HUQA 3ILXA 3RTEA 5L6MB 1AJEA 4BMCA 2C2BA 2FWAA 4DZRA 4QVGA 2RKBA 3JYLA 1MB0A 1DEKA 3D4NA 1XAHA 4OXIA 3KPJA 1RXEA 2QIPA 3OZIA 5AJYA 2G71A 3TJRA 1X7WB 1CR1A 2YJ6A 2ZI7A 3HFGA 1H2WA 3EQ9A 4XJXA 4D2IA 1D07A 5K0SA 4IFTA 3DFKA 1REQA 4Q01A 3R8FA 4URYR 3SZRA 4YS6A 2XOKD 5KYKA 3ESAA 1GA6A 3BXZA 2ZIXA 3PC4A 1Z6AA 3MUFA 1ZVVA 3GFVA 4U7GA 1LDGA 1W5SA 1Z4OA 1V4NA 2EQAA 1DKOA 3TPZA 4EA6A 3VNUA 1Q44A 1U3DA 3EA5A 3GNLA 3KT3A 4RY9A 4YCAA 3AR2A 3TW6A 2WU8A 3CX8A 4AUMA 1C30A 1WQ4A 1U8EA 2VNHA 3ENWA 4DVGA 3K05A 5JSHA 1QTQA 3CFYA 2HJRA 5BV7A 1KDYA 3PR2B 4YO7A 3ZWMA 2D1YA 2C5GA 3BUSA 3O8LA 3R3YA 3UW1A 5LXTA 2EGHA 3BJIC 1V9SA 1SKMA 2J45A 4A1OA 1GAEO 2NGRA 4LUCA 2H51A 2ASVA 2W6JD 2B5OA 4BLQA 1GPDG 2P9JA 1FYFA 4LVOA 4CIVA 2OCIA 3B36A 2IHBA 1C9YA 1T2CA 2A0UA 1Q11A 5IKEA 1H1LA 1JQEA 1JHOA 3AL3A 3IESA 1NNLA 1DEAA 1S96A 4O2AF 2GCOB 5SY4A 3ESCA 2QSUA 4TKVB 5FJJA 2NO9A 5K3OA 1OI3A 1RWNA 4AJ4A 1HDIA 4B0PA 4BVEA 3ODPA 1YIOA 5JDIA 1GZHB 1KVRA 1KQGA 1GNTA 1PT6A 2GHTA 2WJPA 3FPGA 4UBNA 5EEHA 4BJHB 1HOXA 3SDZA 3WJAA 1BKSB 3G5AA 4M46A 4WESA 3NV7A 3B1FA 2DCUA 1YQGA 1L6IA 1ZESA 4PZYA 3WGGA 2W2KA 5LNK1 1LBIA 1UPXA 3O47A 1NQVA 3AC0A 4JS0A 4M0LA 4N0QA 3NXKA 2IU0A 3O8NA 3VC2A 5HIAA 4FR5A 4ABTA 4XM1A 4J0GA 1HYGA 3QVJA 1BQ3A 2Y05A 4MPDA 1NOIA 1P1KA 1TKAA 1LLFA 1JAYA 3ZHCA 3UPTA 4AZ3A 4X7BA 3UV3A 3OD5A 2VZ8A 3M4ZA 3D4OA 1W49A 3ETJA 3HPRA 2XQFA 4RD2A 2G6BA 4LZWA 2MR6A 1GNQA 1QB7A 3E3MA 4XLLA 4CODB 4US2R 2FF7A 1AQUA 1CP3A 1JEAA 1NW7A 3EASA 2H0RA 4G84A 2YDYA 4HLNA 4HQFA 4ODIA 2ZAOA 1Y6FA 2DBQA 2WKPA 2V7VA 2XWJI 4MCIA 1N5JA 1F8FA 4QPCA 5CM9C 3RASA 3U9LA 1AN9A 3B89A 3M8KA 5JMOA 4K6HA 1LDEA 2A9RA 4GDMA 4WKOA 4ZV4A 3D6VA 1V5IA 1KFKB 2YOGA 4JHXA 1HE3A 3WA6A 3WFZA 4U2CA 2BCGY 2FE4A 6NULA 1ECBA 3NEYA 3ETLA 3EMVA 1LZLA 1Q7EA 1T36A 1TMOA 4DB2A 1EFHA 1TFRA 1JYFA 2HHLA 3DDNA 1IU9A 1Z8HA 2C8JA 3I5AA 4MKGA 5EINA 2VUSA 5M3BA 1MGOA 1UF9A 4FP9A 4J91A 3SEAA 3GRCA 1P9WA 4YMVA 5ALTA 1ISMA 1TM2A 1XG5A 2CUKA 4O2RA 5FNZA 1G42A 2O19A 1Q0UA 4ZJPA 1GKYA 3HP4A 4HYEA 4FIZA 4HTFB 3R5XA 1I32A 3CLUC 1I2DA 3T94A 2EX4A 1Z5WA 2FSPA 5ALKA 3QEOA 1I0LA 1JPVA 3CX3A 3MTJA 4AWXA 3TTTA 4KQCA 4YJHA 2B25A 1IZ8A 2I2FA 3T8YA 2Y6VA 1CUXA 3D2CA 3AVVA 2X3UA 5FNVF 4HGNA 3KDSE 4PXAA 5DM70 1H3NA 3OOJA 4FC6A 3F96A 4WNAB 4WZBA 1QORA 3E5HA 3R0ZA 2NUPA 3V1TC 2O8FB 1QPZA 1G0OA 2CNBA 2HLHA 3HVUA 4LMPA 1WUHS 4X1OA 4CQMA 1SXJE 2EG5A 3ZCTA 1PJ3A 1G8PA 2X2EA 1OLUB 4R7GA 3U39A 4DEYA 3FCOA 1CRLA 2QN8A 2O2DA 3EIFA 5IARA 5JJBA 2UYHA 2ZUUA 4NFYA 2YXBA 3DGFC 3PQ2A 3QWAA 2AI2A 1PJBA 4E11A 5M2QA 1XZJA 1HRKA 3H9EO 1T1SA 1A4RA 3RSOA 3VFDA 3NKFA 2IYVA 2Q9AA 1KVTA 4Q48A 1I30A 5ELLA 2X7JA 2UUPA 4B7XA 1OC4A 3SP1A 1NVFA 1XMSA 4WMLA 2W98A 5A0FA 2IOYA 2JFNA 3CNEA 5K2OA 1KIAA 3LT2A 4U8HA 2JFUA 2XLBA 4NESA 1NR5A 2BE7A 4JXJA 4AQDA 1Q91A 521PA 1DQZA 2CLCX 2V6BA 4HVLA 3PPYA 4IIVA 5FO0A 3D3KA 1OKKA 1FNNA 1B3RA 2HD4A 4XIIA 4WWHA 2IBMA 4Y6OA 5HDQA 1ZEMA 4DV3B 1TTTA 1ETUA 2ACVA 1OX4B 4Y0NA 1KGDA 3PC3A 3EQ6A 1O58A 3DD5A 4D4KA 1ZOPA 2XUOA 3TPFA 4FYHA 4P2GA 1N0UA 1P2BA 4W5HA 3S3TA 2WP8J 4WECA 4JROA 4K81B 4NCNA 821PA 2P0EA 2VAPA 3RC7A 1DPFA 3LQKA 4EAAA 2BMWA 4PM4A 4ZVOA 3GUYA 3TB4A 2FOXA 4HG2A 5KSYA 3M3PA 3BICA 2VC2B 1G98A 3GXOA 2O52A 4B31A 2QTBA 1IYZA 3Q3EA 3TTVA 2VAWA 2JIZA 4R7TA 3QJGA 2HW8A 1I2AA 4OSOA 1HYBA 3LXMA 3L0DA 4J0KA 4RY2A 4AJIA 2JBWA 5C8YF 4CKCB 5KOHB 1FLDA 4GS5A 2Z57A 3ZE7A 4F9TA 2Z2XA 3OPNA 4ZYLA 2GBCA 3AIMA 4Q4AA 1RYEA 1L4NA 4EA8A 5CB6A 2ANBA 4F56A 5EQTA 1S01A 2F9LA 1EX1A 5H16A 5GJBA 3DE0X 2A78A 1DIOB 3IAEA 3JD4A 2CXHA 4U0JA 4ARAA 1UC9A 3KJIA 4XCXA 5DMHA 6GPBA 1NQTA 3KFXA 3THOA 1Z56C 3PJGA 2G28A 4TROA 5HG0A 4JJIA 3SOPA 3TIIA 3BZWA 1JVNA 2A0KA 3L0CA 3P0FA 4G1VA 4IICA 4YQEA 3VKGA 1VLVA 2RHCA 4G24A 2G4CA 4RHFA 3QX9A 4ZGBA 4P93A 1IN1A 1XAIA 3TD2A 1ISJA 1GGHA 1LWOA 3ELYA 3K72B 4PZ0A 3D3QA 2H0QA 2JGDB 2VRCA 2H1FA 2XT0A 3FRJA 5CDSA 2PXCA 1UDWA 2X23A 1PV1A 4YMIA 4QHTA 4JP1A 4E21A 1EWYA 4BP9A 4S35A 2YVUA 5NLLA 1WMFA 3BRWA 4GPBA 2COEA 1QIIA 2VT2A 4JT2A 2R62A 4UUNA 2WJGA 3O0TA 5DGTA 1IEVA 2EQBA 3HWWA 4Q0MA 1IM2A 1FTGA 4Z9FA 4WCFC 5ICEA 4B2PA 1QQAA 2XITA 3STWA 3WISA 4GH5A 4NU5A 2IYEA 1DX4A 1M7HA 1S89A 3AESA 3F7NA 3PEVA 4QTUB 5JAHA 5K8JB 2P65A 3LX6A 1J07A 1Z62A 4FYPA 4JLSA 4L85A 4UHKA 4DDHA 3GJXC 5HZHA 3LT4A 4RTMA 5CB0A 1E3LA 3K70C 4YMUA 1X7HA 4WVFA 2R79A 1GRNA 4RU1A 2EFCB 4RTRA 4PLGA 2VPXA 3DFFA 4HZIA 4RABA 3I12A 3LHKA 1F4LA 1A8PA 3BDAA 1MT3A 4KUGA 4O2LA 5E9JA 3GH1A 3GLSA 3JPWA 3L7DA 4O4HA 2G4LA 5C8VA 5HJ5A 1X7ZB 1N8NA 4EFDA 5K03A 3R6LA 5K4HA 1Z0KA 1Q3KA 4N1AA 3DOOA 5CJPA 3IHTA 3CE6A 1MXHA 5AVRA 2CJFA 4D56A 4AYXA 3ASUA 2EKDA 3UH0A 5KPJA 2DPYA 2A30A 1Z7EA 2D1QA 1LA2A 1KC3A 1WDMA 3REGA 5AQ1A 1GPJA 1SVLA 3AUSA 4BMNA 4EFKA 1K3FA 4BO0A 1TCUA 3G17A 5HA5A 2VI5A 3AU8A 2NU9B 1V0JA 5DGDA 4CV3A 5CLFA 3AKYA 1ZC3A 2ZAYA 3GPDG 5LNK6 1XK6A 4MV9A 4ZOLB 3RVLA 4FCTA 4MYUA 1UR5A 2W22A 1NHWA 1SBQA 1UBGA 2V7QA 4Y2HA 2GJ4A 3ESZA 5HZKA 1EE9A 3V5NA 4WOJA 1KI6B