3ROEA

Crystal structure of mouse apolipoprotein a-i binding protein in complex with thymidine
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
233
structure length
233
Chain Sequence
AVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSKSPPTVLVICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQKMDIPFLGEMPPEPMMVDELYELVVDAIFGFSFKGDVREPFHSILSVLSGLTVPIASIDIPSGWDVEKGNPSGIQPDLLISLTAPKKSATHFTGRYHYLGGRFVPPALEKKYQLNLPSYPDTECVYRLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Apolipoprotein A-I-binding protein
total genus 75
structure length 233
sequence length 233
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.1.99.6: NAD(P)H-hydrate epimerase.
pdb deposition date 2011-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3roeA00
3RSFA 3RREA 3ROZA 3RS9A 3ROXA 2AX3A 3RTBA 3RU2A 3ROEA 3RRBA 3RRFA 3RT9A 3RTAA 3RTEA 3RNOA 2DG2A 3RRJA 3K5WA 3RSGA 3RU3A 3RO7A 3RS8A 3D3JA 3D3KA 3RSSA 3RSQA 3RTDA 3ROGA 1JZTA 3RT7A 3RTGA 3RTCA 2O8NA
chains in the Genus database with same CATH superfamily
4TX1A 2AJCA 1D6NA 1E96A 4V0MA 1A9ZA 2YVAA 3GJ6A 4KRYA 4XVQA 5A4FS 2IITA 3EVEA 4FYJA 1XA4A 4IWYA 2ZUEA 4TVOA 3EEBA 5JSUA 2CLOB 3VJRA 4NNOA 1H2XA 4PEVA 3NM4A 3URKA 3W6NA 3FGPA 3G79A 2Y8EA 1MU0A 1NVVQ 2IZ5A 1XP8A 1X2EA 2QM7A 4JBGA 3AERA 5E0OA 2XZDA 2I3GA 1TTQB 5AW3A 4QBTA 2GFQA 1R88A 1MQ9A 2AF3C 3JARB 3MXOA 1T2AA 3I6IA 3AIOA 5EKDA 3CX7A 2PKWA 4GC5A 3A6EA 4ICIA 4HNTA 1G5QA 2PQ2A 2JFYA 1NT2A 1TUGA 3QELB 5GZ6A 4W5RA 2O8DB 4AMUA 3O92A 3PF9A 2INGX 3A9VA 3O82A 3P9PA 1P7CA 3NEYA 4QTXA 2B9EA 3HXQA 3ASUA 3BQ9A 3GLRA 3SF8B 2P9ZA 2PRYA 2EBHX 3NVKI 3NHJA 4KNYA 1XRJA 1U8CB 5C31A 1SHUX 4BVKA 2EFDB 3BRSA 6AT1A 4CEJB 1FYXA 3H1EA 3RC9A 5EJ7A 3CF2A 3F6EX 3VVMA 3OEHA 1G291 3N86A 3QVTA 2R6R1 4MW6A 5JLJA 4GOND 2XB4A 3EULA 2PZEA 1WCWA 1JA0A 2GM5A 3K4HA 5C1IA 3ZWNA 1ZINA 2A14A 4BNTA 3CPSA 4HYYA 4Y67A 3FR7A 3IQGX 2BE7A 4QELA 1Q1GA 4HLCA 3FKSA 3ITNA 1TT7A 2XXAA 1B00A 2PWZA 3E03A 2YNMC 3FG9A 4IVPA 1O96A 5IZ4A 2O06A 3P4XA 4FE3A 2J6CA 2OUKA 2PZKA 3O94A 3NOVA 2OCLA 1XRNA 4GZ5A 5JVDF 3ODGA 2VZEA 5CB4B 1AK2A 4HDMB 3F5QA 4Y3UA 3OZTA 3T4UA 1RABA 1K66A 2QGNA 2ZRQA 3O26A 3OEED 4JC8A 4WZZA 1M7GA 2WHPA 5LUAA 1YFJA 1GY8A 3UKJA 4ZVQA 4PZYA 3NBKA 3PCRB 1E1CA 1XJQA 1EX9A 1ZK0A 2JH9A 2NVOA 4HQRA 2ZPUA 3RG8A 1C29B 3PXBA 1E8DA 1MB4A 1NPYA 1PW5A 2KS6A 3M89A 4CN9A 3RSOA 4FWBA 1TVKB 1DAGA 3IT0A 1AC5A 4C4RA 3K9WA 4MKFA 4LA4A 1VHWA 5IXJA 2D7DA 4Q9AA 1LSOA 1SUAA 5JY1A 1K6XA 4LX0A 1PJCA 2PWBA 2YR0A 3L7IA 2J41A 1M2OA 3RO7A 4EYEA 4Q1FA 5J4LA 4G0UA 3EH2A 4FFMA 1G6HA 1WXEA 1LDYA 5AMXA 2FWRA 2RGNC 4JROA 3ZXIA 3CLSC 3AVUA 1V6CA 2DOKA 2ZIFA 1Z4JA 4PGHA 4V24A 4CWAA 3UZUA 2D2IA 3H8SA 1TO6A 4XB2A 3ZTWA 3CR8A 4X97A 2H7CA 4MJ3A 1DTWA 2OV2A 4R3WA 5CU7A 3CBGA 3D8TA 3EZGA 4QXRA 2R5NA 3TL2A 1SELA 1QU3A 2PH3A 3K0EA 4OQ4A 4C01A 4MV4A 5K3EA 2I2BA 3C5WP 3QKRA 5SY4A 2R1TB 4XOIA 5KNCD 1RP7A 1Q7RA 4P0PB 3R77A 1YK0A 5GQSA 1VFNA 4K28A 1P1CA 1QK3A 1V4NA 4GAEA 2FMFA 4O4LA 1Y9AA 1B23P 1W7AA 2F6RA 3BK1A 4MIEA 2NZWA 5LQKA 3FMFA 3NWOA 4E2ZA 1KE2A 2OLEA 3UAVA 1K7EB 4X5OA 1YHZA 3CTPA 5BMVB 3LXRA 4RPIA 5KWSA 5J1TB 5C53B 3EIHA 1CQPA 3D7NA 4PZPA 4BKOA 4W8GA 4E13A 2ZULA 3H1BA 5GWXA 5DGCA 3ORSA 1PYGA 4OO3A 1H1DA 3D7MA 2R68A 2BAGA 4Y0NA 1H8ED 2D1QA 4RJTA 4LOIA 2F2TA 4RKEA 4LDAA 4CM9A 5KNCH 1I3CA 1YQQA 2V54A 2CVHA 3KAPA 5FA6A 3UJCA 3V7YA 4XZ3A 1BE6A 1IATA 1T35A 3MT8A 3O1JC 3G2OA 2WAYA 1ECLA 5G1OA 5E6SB 1YFZA 1ZM2A 2QAIA 3GK3A 3MXTA 4IEIA 3S40A 1D1TA 2CXSA 3PUXA 3CWQA 1VCHA 4YO8A 2PGNA 3U0BA 1UM9A 3F9RA 5JZVA 2WWFA 3CW9A 4RPJA 1P5RA 3RJTA 2PN1A 2FW0A 1MUUA 3OOHA 4PG8A 3QJGA 3ADDA 3TTXA 4AJOA 4EEKA 4BP9A 1FFCA 1GZHB 1V2GA 2XIQA 2BZGA 1QVRA 3C6MA 2JK1A 3N3AC 4FEGA 4B2YA 1YE5A 3GBSA 2IUFA 4RHFA 1QZXA 2PRKA 4IIVA 4K6OA 5LP6B 5KNBA 5DH9A 2MIIA 1RKBA 2ZZNA 3K8OE 3QLEA 1O87A 4Y2YA 2BKLA 3A1FA 3Q72A 2BTQA 1DC8A 4U6SA 3WHKA 5LYJB 4NDNE 5G0UA 3KPUA 4J7UA 1XYGA 1WNFA 4MGIR 1E2BA 4CLDA 1YQ9A 3T5CA 1PRYA 1OU0A 4WY8A 4OHYA 2Y9MB 1W76A 3RG2A 2HBZA 2QVLA 4K9OA 4UEOA 3UPDA 3OCCA 2JGLA 3OCXA 3RDPA 2HA4A 3OJFA 3QX9A 4Q19A 4B3BA 1XWFA 4WKPA 3UW1A 2IE0A 3EGDB 3G49A 1AGXA 3SZRA 4N9WA 4WUVA 2JASA 5K45A 2ARKA 3PQ6A 4H7FA 3TG8A 1DO0A 2QE6A 3A37A 3FCYA 4GRDA 5EMNA 3KJGA 1S2GA 5HK9A 1BHQ1 1XO1A 3A6KA 4CETA 1XXLA 4DJEC 1GRRA 1ZEMA 3RC3A 1EUCB 4DMRA 5DNCA 8OHMA 2ZUVA 2ZANA 5L4SA 1PVOA 1CUAA 1H23A 4FNOA 3RCBA 2M32A 4C08A 1EFAA 4IJKA 4J0EA 4A36A 2DBZA 3RQSA 1JMYA 3Q7RA 3VZQA 5ITSA 1AS3A 4U2GA 2V55B 2WF5A 3BBPA 5KIAA 2DHEA 1NXXA 1CUSA 2AG0A 2DFLA 5HHTA 1F9AA 3C3XA 2HUNA 4US1R 3L04A 5GONF 3UB3A 4WJLA 4AYWA 2FZEA 1BOFA 1O6FA 1VLZA 3CZPA 8LDHA 1RXSA 4O4JF 1SXGA 2WEKA 3PF8A 5LMUB 4S1VA 2Z4RA 1F14A 2OP1A 4YASA 2JK0A 1JFVA 4Z3DA 2HGZA 4KIGA 1AF7A 4LFCB 4E2WA 4OX9Y 1VCMA 3HJFA 1TCAA 1N7HA 4IOLA 1HKUA 1Z0ZA 2IPXA 3AM3A 4O59O 1E9FA 3P5SA 2JLBA 1KMCA 3O90A 5IM4F 4G8BA 5AVRA 4M0EA 2RSLA 2CL5A 3QVMA 4ZHQF 3BFPA 3O4GA 3SYMA 1D9XA 2D0IA 5J4HA 3ZW7A 5IT0A 1RXUA 1HLGA 5EWJB 5JAZA 5HCUA 3I8SA 2QJRA 4TVBA 2Q1UA 2JLQA 5ERYA 2GUGA 3REOA 4NIMA 1ZITA 2DVMA 1R0KA 3HCCA 2BCJQ 2RAPA 3NV9A 3AR5A 3ZK8A 3HB7A 1C4WA 1T0HB 2G72A 4RIHA 2X5JO 3ZDXB 1YT5A 5LOVA 4EEXA 1NMYA 3IUMA 3FNHA 2DKNA 4L57A 3ROMA 4J4TA 4MH0R 5HUHA 2L82A 1KDTA 2PKCA 2QI9C 2XITA 5AKYA 1D9ZA 2OFXA 3IV7A 3A14A 3KELA 1DFHA 1ECBA 1VLMA 3M70A 4OH1A 5FOSA 4TRNA 1ZI8A 5L95A 4POOA 4LVCA 4NSNA 1T5HX 3TLZA 4LXXA 3AR2A 2E7ZA 5CYGA 5EJFA 2BGNA 2H2IA 2WZDA 3WRYC 1EVYA 5BYAA 2VUIB 3SMQA 1QHXA 3SZOA 4HXGA 4BB9A 1M5RA 2YWRA 3CJQA 2VXBA 4K87A 2FCAA 2N1BA 1ZHHA 2Q3LA 2BEWA 4WECA 2ZJZA 1WLSA 1FBTA 1K27A 2AOTA 3DVAB 4WLUA 2AYXA 2G4LA 3AVPA 3OT4A 4K6CA 1EA5A 1T5OA 3RVKA 4PGMA 5JSQA 1DAKA 2ZT7A 3FBWA 1QPZA 1Y8QB 2XMBA 1YJAA 1E2MA 3TLXA 3ROXA 3TINA 3ZH9B 2C58A 5KX5B 3ZWPA 3A1TA 5EIOA 1H8HD 4RSGA 1PHPA 2F43B 2BFCA 1OH7A 9GPBA 1M1NB 3IAM6 3COPA 4II2A 2G9UA 1QIIA 4KDRA 1VKOA 1OGYA 2XV1A 5B64A 3ZJ4A 5ITWA 5H1YA 2VBCA 1DKQA 4MMXB 4EMSA 2I55A 4UNSA 5J5CA 1FUYB 4LK3A 2NV6A 4ZYXA 4LF8B 3LBIA 2R48A 1E58A 3VC3A 2Y9PB 1SPXA 4JVLA 4W5HA 3UCFA 5K4HA 1NSTA 2ZJ5A 3CLTC 1KFCB 1HDRA 4AJHA 5HUJA 3SR3A 1ML3A 4F4UA 1M6HA 2GD2A 5F98A 5JAPA 3RYFA 3GLIA 1CJKC 1XNJA 5FPPA 1QIEA 3O73A 1JYEA 2VF8A 1XQ6A 3HG7A 2F3SA 3VPGA 4C20A 1K8XB 2JCYA 1UT5A 3IAEA 2P2SA 4WEQA 5LXTA 3W2EA 4HH3C 4WAUA 3D4IA 3AF1A 3GGJA 1E9AA 2CXPA 3I34X 3O1IC 1R10A 1Z5GA 1JFFA 1II8B 1TFUA 2PD6A 2WTAA 4OQEA 3CRNA 3DFZA 4UM5A 1Z7WA 3HB9A 4RVSA 8ADHA 1TEZA 2PLWA 3SFZA 4FUQA 4DLTA 3LS2A 2IL1A 1A5AB 1NV8A 3L05A 2XOEA 4NESA 3WLRA 4F4DA 1ZD5A 2CHVA 3LVRE 2HYIC 4RUKA 3W6UA 1N2HA 3SXUA 1XD9A 1ZXLA 4YR7A 4XX1A 1X7GA 3HPRA 1E8NA 1RWBA 1W5EA 2HT6A 3PGKA 2EKLA 1R37A 4DCUA 4RU1A 1VHDA 5AHOA 1CQJB 3C41J 3U56A 621PA 1E69A 1XTSA 2V7PA 2QGZA 3QUAA 1Y81A 3HHEA 1MVOA 2XVAA 3LDUA 5BSEA 2FUG1 3EFEA 1OOEA 3AEUB 1QRRA 1N2CE 3B1YA 3CMCO 1TLFA 4R01A 3RJZA 1N5JA 1RXIA 3MCVA 4X6UA 3QU7A 4XRRA 4YYZA 5LOVB 1BXRB 3C3WA 2IK8A 3UA3A 3VH2A 4TTAA 4B09A 4C2UA 2G1JA 4HI0E 3OPYI 3RARA 1N5OX 1JXOA 1WW8A 4OHCA 1R16A 5ECYA 2HKIA 4EI8A 1F60A 1K2WA 1GPLA 1BS1A 1OXKB 4PLVA 2ZXEA 1TW2A 2CNBA 2GMWA 1FCJA 1S96A 2ODAA 3NHZA 4FT4A 2CNNA 4NBTA 4PR3A 3WK5A 4ZVMA 5KU7A 1SIUA 4BO6A 3Q12A 2VHTA 3CURA 4N5NA 3TSWA 3ABZA 4BJ1A 2P5TB 2QD1A 2Z8ZA 2XUAA 1M0TA 1IUOA 4PQEA 1RCUA 3M6IA 5T3YA 2C3PA 3HFGA 2R5FA 1N33B 1QHGA 5JS8A 3AHIA 1ZUHA 1G3MA 2Q8QA 5T8KC 1UWVA 2AKYA 3DDUA 3FWPA 3T3PB 4CDNA 4DLYA 3NHYA 3RSSA 5CVUA 5AI4A 4FHEA 2JD1A 4GLBA 3G8YA 1DKMA 4TYQA 4DBZA 1N36B 3LT2A 1Y4DE 1YCHA 4PSVA 1YRHA 4ZWNA 1J8FA 4DRYA 1IN5A 1H0HA 2GHRA 4AQDA 4X66B 2ZQ5A 1X1TA 3PS9A 4P1ZA 1FQOA 2HU5A 1JFLA 1EJ0A 1RHUA 2XRFA 2AZMA 4D5EA 1DCMA 1PJBA 4C14A 1T8TA 1PF7E 2ENUA 4NICA 4AZ3A 5JDCA 4YV2A 1KJ8A 4BNGA 2ZS9A 5BN4B 5E38A 1WUJS 4RE5A 1VB3A 1NNI1 2VAPA 6LDHA 4P7JA 1M2HA 1MRSA 3N2EA 2D6FA 1V96A 4MUMA 5IZCA 3OZXA 4FONA 1T15A 2GHIA 4IKEA 3EX7C 3H5RA 4B1FA 4EPTA 4DDTA 4B31A 4I6GA 4OI1A 1VIMA 1EINA 1VM6A 4I2VA 1XYYA 4O1HA 1WB4A 5EQDA 4B79A 1KFBB 3KQMA 3TQIA 3LLMA 2X14A 4MIKA 3E9YA 1YHYA 3TW8A 1R9MA 2UVPA 2WICA 3FROA 1JKIA 1ORVA 2OGWA 2QN3A 1MGPA 4TMFA 5F1YA 4CMJA 3EWNA 1WB6A 1I6LA 4HS4A 1I7PA 1W2GA 3TQQA 4XQ0A 4F2GA 1TF7A 5MN4A 3DE5X 5HS6A 3F1LA 4KPUB 3WV4A 2VIIA 4BKRA 1V1RB 4RY8A 2NZXA 4O3MA 1TX4B 2QKYA 2RHWA 1CQWA 4RC9A 5KWVA 3GD7A 4BX2A 4FJ1A 2C92A 1EFVA 3DD5A 3QF4B 2HIMA 3JQGB 4TTVA 4Z0PA 2BSQA 1QPGA 1UMBB 2XI4A 5DI9A 4ZCSA 4D96A 1OMOA 2YYYA 3ZCQA 3THWB 1NJ8A 1TJNA 2YQ4A 2Y4NA 5FFMA 4ND2A 3BDAA 4AKHA 4YUZA 4G0MA 1N5LA 4L76A 1TOAA 4YJFB 3NOOA 1ZJYA 2H1FA 3VKFA 5C3MA 5GIPE 4KWIA 4D8TA 2BHRA 1OA1A 1Z0FA 2JFNA 2ZE5A 5DZSA 3HVKA 1USVA 3N2IA 1I0LA 2GTIA 2UUOA 2OC4A 3SP1A 5I5EA 3P9RA 1PN3A 2YINC 3SHVA 4HDSA 1AURA 4HNAA 1CDOA 1Q0LA 1UH5A 3GB9A 1TAGA 3LLVA 3P27A 3U4GA 2P5YA 4F97A 3W4KA 2ZXUA 1X86B 2SICE 5AOAA 1JPJA 3CV3A 2BONA 1SD1A 3GDWA 3QEOA 2YJNA 2B34A 4JR1A 2GZHA 3ZIAA 5BRJA 2ZOSA 5HE8A 1UDBA 5D5QA 1DAFA 1GUDA 1W4RA 1C3EA 3C6ZA 3QMVA 4KB5A 2VEDA 5ECGC 4REQB 4Z2AA 3KKQA 3PFHA 4PTLA 3L7BA 2EWMA 3U44B 2REQB 2ZETA 3H5NA 3LYHA 3SE7A 3VX4A 3Q3HA 1DDOA 1MQSA 3UMRA 3PDHA 1F0PA 2DM6A 2VAWA 2XD9A 2RHTA 2YYZA 3LWBA 4P32A 4BQFA 4E88A 1PFQA 5LOVF 3DT8A 1QHYA 1TAQA 1YIDA 2CN1A 4TTRA 3IILA 3N6VA 3HYTA 2RGXA 1HE5A 3ND9A 1SKQA 3PC3A 4MPDA 4RDCA 1EUYA 1NHGA 1E4EA 2JFFA 3L7OA 4M1YA 5FI1B 1EP1B 3DEJA 3ULKA 4CQMB 4PZ0A 1SKYB 2ATXA 2HA6A 5CYFA 2ESRA 1RW4A 3I5MA 5DBIA 1E1QA 4MLCA 4OA8A 4W6ZA 5JV5A 3ECSA 1BDJA 2D5LA 2NT3A 4NMLA 2FG5A 3NC1C 1ZSYA 3N9IA 1LFDB 3AYZB 2QW8A 5FNVA 5HF9A 5I3CA 2Y77A 4KVFA 4Q9DA 4X7PA 3GIWA 4AWBA 2H1SA 2UYHA 1KO1A 4YJ3B 3TTSA 5CB6A 3L7LA 4TLEA 5F9FA 2V6GA 2NU9A 4WOBA 2GD6A 4RS4A 1QGDA 1EH5A 1P74A 2A0YA 5EP3A 5EJ5A 1OREA 1E4EB 1BS2A 2GO1A 4MKIA 5DCWA 2O9JA 3S2SA 5SICE 2BGTA 4MRRA 1ESEA 3ZY5A 4G0QA 4YV1A 1OXBB 3MF4A 2ZIXA 3WIDA 3JD1A 3THOA 4BV2A 1RMYA 2ERYA 4JK3A 4B3HA 3R3YA 1ZVVA 5BOSB 1B15A 1GJRA 3MWDA 2P67A 1OWPA 4IH4A 2GVZC 1OKKD 4HC4A 1WEHA 2FI1A 5J4KA 1E2FA 3GLGE 2R4UA 2QV0A 2DQSA 4N40A 4PICA 1NN0A 1RU3A 2GN6A 3N8GA 4IMRA 1EAMA 1JTVA 2QRKA 3FMGA 3D6VA 4B3IA 1HSZA 1EVEA 2I1VB 5JCJD 3H65A 4XD7A 1W6RA 3KKPA 4G89A 1U6KA 1DLIA 1AX9A 2R7MA 2E3JA 2RH9B 3LFUA 5EMLA 3SCZA 2Y0PA 1W88A 2YV1A 4D7AA 4GLJA 2JHFA 1I2ZA 1E2HA 1N6HA 4LYYA 3CH5A 4M9QA 3RRJA 2XXBA 2VHCA 4TT3D 2FPRA 4IXMA 3WGZA 2O4UX 3MWLA 4LPKA 4NCJA 4BL5A 2WD8A 4E08A 5FUQA 4EKNB 1E63A 1PHRA 5TMPA 1F5SA 1FFSA 1T6BY 3MUEA 4CU2A 5K99A 2QMOA 1U0RA 3WRYA 2OK7A 3PUVA 2C3UA 4JOBA 3LZDA 1LF5A 1NTOA 2H4WA 1WS6A 4G24A 2GBLA 3FHOA 3IKJA 2ONKA 3T7CA 1YACA 4C6SA 3O0DA 4WHMA 3WHLA 7REQA 1KJNA 1MT3A 3ROTA 2LR0A 3OQIB 2J0UB 2G0AA 5HM6A 2QR3A 4WZ6A 4Y1RA 1I7DA 5FR2A 1MOPA 2Z4TA 2HDWA 2RH4A 2WG2A 2RIRA 2WV9A 2C1XA 2ZUDA 3CF0A 3G0IA 5AYVA 4KLAA 1YQTA 4TYPA 5P8WA 4BU0A 4L1KA 2BGRA 3EZFA 5ES3A 3TZLA 3MSXA 1FVOA 3SSOA 1JRLA 4AN0A 1PX2A 1NU6A 1IJBA 4REQA 1TZBA 4HWTA 2ONJA 4DABA 4Q16A 3E48A 2I4IA 3NNDA 2JGDA 1LH0A 2GEBA 1U8ZA 1SCBA 4QDKA 1G5HA 5AUOB 1YBVA 4L7QA 3T7AA 3HA7A 4NL4H 1C50A 2QL5A 3DE4X 3KYBA 4CEIA 2PZMA 3BCHA 3G02A 3I12A 4MS3A 5ERGB 1ADJA 3GFSA 4NQRA 4AF7A 3K6RA 3HGTA 4OHXA 4ZT3A 1C7IA 2ZRIA 4MR8A 1GSIA 2TMKA 4W5WA 1KO7A 3C16C 1HL3A 1QAQA 4KXFB 4HK4A 3WOHA 4CQMD 4EYQA 1VI6A 2BI4A 1M2OB 2F62A 4IDFA 5TXGA 3RS8A 3GP3A 4TL8A 4K2HA 4KQCA 2D2FA 4PO1A 1LKZA 4BS9A 1GFSA 4XGNA 3RT7A 3AQ4A 3HGMA 4Q3LA 1D7OA 4XUCA 4EGQA 2VCHA 4I9NA 1VOTA 1XRSB 4B6PA 1L5GB 4LGVA 4Y6GB 1EJ2A 2OMEA 3DTNA 2PQMA 2PUVA 4G85A 4PYKA 2C31A 1I0IA 5IKXA 4MV7A 4O4JB 1PAUA 3A0RB 4IVNA 2P1DA 3RD5A 1GA6A 3N39C 4Q82A 5DF1A 3QQ5A 4D80A 4QSHA 3U3JA 3E2PA 1VBMA 1QHIA 5A06A 1ONSA 2ZRMA 1IZYA 4K3VA 1M3SA 1UBTS 2IH4A 1ZESA 3B85A 3TFOA 1ZIYA 4LZNA 1E1DA 3AOGA 3IQZA 3M5WA 1H5UA 5L3SB 2QY6A 2LKCA 1YULA 4V3CA 2CB9A 2VHEA 2BFNA 5A0TA 4GPZA 1Y4SA 1EGHA 2XZOA 3NKLA 2G5CA 2YJ6A 1R5NA 2P2ZA 1UPXA 1HT1E 2VDJA 3PR1A 4IXTA 3MTEA 1BJKA 5AQEA 3RRZA 2BPOA 3EAGA 1YB2A 4LC0A 4OMCA 4N8DA 3WB0A 3BEDA 2Q6IA 1A9XA 4QHSA 3KOXA 2H1RA 2OKCA 2AR7A 4IIBA 3DJFA 1JHAA 2NQ8A 1M54A 4KDFA 5K8IA 1SD2A 3NHUA 3X1JA 3OFND 2FDXA 2E4WA 2JJ8A 4A8TA 5ALDA 2VCYA 2R6FA 4KFSA 1ZH6A 1TM7E 4D8XA 5JXGA 1A71A 4RD6A 4ZAZA 5LU8A 1GZ3A 2XT0A 2B2CA 4FEEA 1TKRA 2EL9A 4PSAA 1VDZA 4HLQB 3WZ2A 3ABOB 4DLZA 1UJBA 1PR0A 1ZNZA 2IE8A 3U61B 5HIJA 5DTIA 1SVWA 3PZBA 3IVAA 5EVCA 3WZLA 4UMVA 4OP1A 4MPJA 5BN1A 4IDHA 5BR4A 2QTRA 1TB4A 2ZBVA 1LW6E 2FV8A 2CFRA 3DEZA 4WD3A 3A1VA 3RRNA 1FS6A 2IXEA 1F38A 3CN9A 5CFOA 5I7SA 2NO0A 5L3VA 3LDAA 3QEJA 1AMNA 2FAXA 1K75A 3IBTA 3IJEB 3IPYA 1ODLA 5EWJA 2W2NA 1VHTA 2SCUA 1P7WA 3MHPA 3TQSA 2MSWA 3GJ8A 2M9MA 4RD0A 2P90A 5PNTA 4XM0A 4JGIA 5BSMA 2E1PA 4XJTA 5JQGA 3L9WA 4R1QA 5EXSA 5D5HA 4NABA 2YY6A 4PFKA 3TR5A 2AN3A 3PFBA 5CHEA 1W1UA 3K16A 4MR7B 4CGYA 4N0PA 1M1YB 4X7RA 2AF4C 3RKUA 1P0IA 3QFRA 4EITA 1QFJA 4O25A 1ZL0A 2IYTA 4O2BF 1E5DA 4I1IA 3JD0A 1ESCA 2XMQA 4QEZA 3QX8A 4FGUA 2F3RA 1OJLA 4PO8A 3ZD9A 3KXKA 1SHTX 1VG9B 3DL7A 3BCUA 3CEHA 3QMMA 4RSMA 3ZK9A 2R8EA 1SC6A 5TPZD 4XD2A 3ZV3A 1TIBA 4BX8A 2ZBUA 3J7TA 4KQIA 1B6TA 2ZVPX 1CRLA 4UNPA 2QIPA 1W5TA 3OX3A 4YQFA 4OQXA 3HR7A 3WY9A 4JSTA 5C1DA 5B57C 4N41A 2QE7D 2WHQA 3DDNA 2WJPA 5HFJA 4LDJA 5CVEA 1IJKA 1E1YA 1WUTA 3GH3A 2Z3WA 3OOYA 3I23A 4CMKA 2W2PA 1SC1A 4E4YA 4FMBB 1Z45A 2WIFA 3EIFA 1G8SA 4MQUA 4OIFA 1YAJA 1D0IA 4HWRA 2HO4A 1EFUA 1C9YA 1GA4A 1DTEA 2YMPA 3BRWD 1WWKA 3MGCA 4IFTA 1VPTA 4DLRA 3TXAA 3JQQA 1NUTA 4BNLA 2WYWA 4NBRA 1LI4A 4L4ZA 4MLPA 4FFRA 4U7JA 2BM1A 3LF2A 3RAFC 1I6MA 3V8QA 3DHEA 1O95A 2VAXA 2OV6A 2ROQA 1CZUA 5IBRA 2FUCA 4AN1A 5JSHA 1C7EA 2ATIA 2ZR8A 4EWLA 3O83A 4CF7A 3MYYA 4MYUA 4YP6A 3BFJA 2BFEB 3QY0A 5IH3A 3YASA 1J20A 3NT2A 3QFFA 4FOLA 1TCBA 1TJ5A 4JBIA 3OHPA 1MPTA 3O7MA 5FF9A 4L22A 2OLKA 4BVLA 2X0JA 4JI6B 1MQ8B 3RS9A 1Y3DE 1GA1A 2RGBA 4A5OA 1L3CA 1O8BA 4NC9A 5JCPA 1CR0A 4LXQA 1EK2A 2P68A 3OKCA 3C5VA 4QXMA 1ISFA 1NIJA 1YRAA 1XEXA 4S0XA 3HK2A 1GG8A 1SXJA 1L7DA 3VDXA 1HX7A 5AW8A 3LDFA 5DMXA 1ZC3A 3PUYA 4ALKA 3DAYA 5C81A 4G0VA 1RRPA 1PK8A 2AR9A 3DCIA 4HBZA 1L5ZA 3SC6A 4YECA 2A9VA 2X0DA 2TSYB 4TM7A 2E2WA 2BFMA 2CXUA 1NDUA 2ZUUA 4YLEA 3WE7A 3JASA 3WAKA 2XY4A 2W6CX 5ALNA 4NS1A 1L5NA 1YZLA 2YFQA 4B17A 1H4SA 2LV8A 5LWQA 2NW6A 1B8UA 3TS1A 1G4HA 3H7AA 4C78A 4RTRA 2BFFA 4HF7A 3GLGA 4QC2A 3R24A 4LWPA 1PGNA 4IP0A 5LZ2A 3LBFA 1JHDA 3ZCRA 2VYQA 1E64A 3AFOA 2OKGA 4W5JA 1V37A 4WK4B 4X6LA 1XTJA 1RLOA 1DWPA 1HURA 5ALXA 4I9HA 4CR7A 3WNQA 1N5MA 3SGLA 1JYFA 3AR4A 3CLUD 3LK7A 4Q18A 4Y30A 4QVKA 1MNQA 4C4OA 4CMGA 4UTVA 1RWKA 4DUYB 1WOMA 3U7FB 1HZZA 4EVSA 1HKHA 3Q0EA 3F67A 1EK1A 2O2YA 4M49A 1TDJA 2CC2A 5SV2A 2PU7A 4J07A 4JJZA 1N2BA 5EHIA 3SI7A 3WX0A 3Q5EA 3ZNQA 2GN2A 1Y9DA 3ZS8A 3ABIA 5JCZA 1DUVG 4GSKA 4GYKA 5PGMA 5JDCC 1Y33E 4DSAA 5JEEA 1N2EA 4R16A 1E9BA 3W78A 2YXNA 3BE5A 1SVUA 4LV6A 4M53A 4NPAA 4ZCRA 4AJ2A 3LIPA 1QZTA 5BNFA 1SZJG 1QP7A 3MWYW 1KY5A 1E32A 4QUJA 1RFGE 2AN9A 1JF8A 5AICA 4WY2A 4TZ6A 4JUCA 2JEYA 5I6DA 3TD9A 3KQYA 3PG5A 1G5FA 2BGLA 1FFWA 4UHBA 3RANA 3FNEA 5ALFA 1P2TA 3HP4A 4J1QA 1EUDB 1Q57A 1NX9A 1P73A 1EB9A 5AM0A 1AT1A 1PGOA 1XC7A 2C5HA 2J48A 3BB4A 2MHCA 4W82A 4A26A 2JJ1D 1B6SA 3G2QA 3MG9A 5FOTA 1EE9A 2VUTA 3WL6A 1PUIA 4LZWA 4URXR 3S28A 1G9XA 5HWSA 2GYVA 4BRWA 1G55A 2O0HA 2XE6A 4KX3A 1XTQA 4QGFA 1FJGB 2BH2A 1ZA2A 4QBIA 1MO5A 1KS2A 1SMKA 2G4VA 2XUDA 1JXMA 3LG2A 5H3HA 5AW4A 3QA9A 2IOHA 1MORA 1OV4A 4DC0A 4YV7A 5AK6A 5KQMA 4BE9A 4D3XA 3MT7A 4G67A 4U7TB 5CLGA 3K8ZA 4MICA 1PJ3A 1KF0A 2C5GA 4KREA 5C8ZA 2CKMA 1F12A 3GJ0A 1U7WA 3FYSA 4RK5A 3STVA 2O3SA 1ISIA 4FDTA 1MO6A 3ZQKA 3C87A 1PEAA 1IB6A 2R44A 2IY9A 5CT4A 3PC8A 2J9XB 2V7QA 4YQZA 2H00A 1CRPA 5CIWA 1MX9A 2JBWA 2FWNA 3W4JA 1NBAA 1TCUA 2A9JA 3RIEA 1ZA1A 3K0AB 4OFZA 3VNQA 1H2AS 1RYYA 1TPZA 4WRRA 4IDQA 2A6PA 3VMFA 5JRJA 2IQIA 3P45A 1L4LA 3ROGA 2PGLA 2FQWA 2YC4C 1G8KA 2J4DA 4FIDA 5FB3A 3KZVA 5B1EA 2IT1A 2B0CA 4JMPA 1PJ2A 1N6OA 3OLQA 4OD0A 4RS3A 4TOIA 4XTCS 3TD6A 4DR2B 2IDJA 3BXPA 2P2YA 1SKBA 3Q8XB 4M88A 3UG6A 4JV5B 3AF6A 5GZ1A 4TZTA 5E2BA 1E79A 1ZKMA 3OD5A 2P2LA 4ALLA 1YDGA 3L8EA 2AD5A 2G70A 4EJSB 3TL6A 1DBWA 3N87A 1IOVA 2ZYRA 3AETB 5JADA 3NEAA 1P39A 4U00A 5BO5A 4ND3A 3QOFA 2XNDA 3B20A 4G4IA 2X5KO 4I50A 4BJ5A 2NVWA 1QYXA 1V3VA 2CXRA 2IGTA 3KHSA 3O1HB 5TMDA 5I4CA 2OXCA 2C2WA 3ZD8A 4X8LA 3BJIC 2G1UA 4E0BA 3LSTA 1XD2A 3PB3A 4N0QA 4JCOA 3SHOA 5H4HA 3ON5A 4Y9UA 2HJRA 1NXVA 4URHA 1Z0JA 5IHPA 1JJ7A 2BDUA 2WJYA 2H1VA 4C4SA 2IYLD 1P4SA 1GFWA 4IF4A 1TQ6A 5EPOA 1ZNXA 3UT0A 1J5EB 2AKAB 1T2NA 3E53A 3PD1A 2VJDA 3TIIA 3OPVA 2VTBA 4H2DA 3TNYA 1P4RA 3GVPA 1BN6A 1ZWLA 3ZHOA 5M29A 2R7LA 4X6YA 4LJ5A 3P9XA 4TUYF 5CX1B 4D56A 4PIPA 1HLDA 2E49A 1NXPA 3F5FA 4LKRA 2WKQA 4U63A 5JDIA 1XPOA 3K94A 3NIFB 2BDTA 2GD1O 1Z06A 3C1TA 2H9IA 2OG1A 3CNNA 4EHKA 3W7VA 1SK9A 3QX3A 5C4GB 1U0TA 1ZAKA 4O4IF 2VUHB 4QXOA 1JIIA 1GZDA 2C2YA 4N5DA 1QK4A 3ZLJA 4US2R 1CW2B 2J0UA 2YBEA 1D3AA 2YWBA 4BZWA 1F7UA 1P0FA 1U3CA 1UDAA 5DHAA 3IL2A 3IUBA 3NHSA 1GGKA 5HPYB 2ETXA 2JAPA 4KV9A 1KO8A 2M1XA 3IB3A 3MMNA 1SXJD 1L5WA 1ODJA 5JSFA 2FJPA 1PJSA 1J24A 1XAIA 4Y9SA 3W8RA 4KGDA 1RZ3A 3OU2A 2A4MA 5DHRA 3TZEA 2R11A 3VPCA 4R8KA 4K81B 2IPAB 3D8UA 4KQXA 4D26A 2X8BA 2G6BA 4I8IA 4JP2A 4V0SA 5FOVA 1J49A 1P1HA 4TXNA 1BWQA 1V16B 2ZS8A 4GOOD 3GCWA 4HJRA 4P36A 2A0WA 4RSHA 4DNFA 2ZUCA 3EPPA 5EIFA 3CEJA 3A70A 1VIDA 4UU8A 1AKNA 2GJKA 3V1KA 4DLUA 1VKJA 4GUDA 2WI8A 3WLAA 2QL7A 3H1PA 1L0BA 3AKZA 4BY9E 3C3AA 2F8MA 2BMEA 4F6CA 2I4TA 3RUPA 5EWLB 3LWNA 3N2KB 3D8SA 2FR8A 2QX4A 4ZDKA 1BVHA 5DHFA 3AF5A 4JYPA 1SUPA 2ZI3A 4R2LA 2YYAA 3W8DA 1X92A 3DV0B 1OE0A 1NVBA 1Q7BA 1XQVA 3IAS1 3MWDB 4UMEA 1UEJA 4CKCA 4QG3A 1M10A 1HPLA 1GRVA 4GRAA 3RW9A 1VPVA 1IN8A 3IUJA 1IVNA 3FTDA 1JXQA 4JZKA 2EQAA 2HF2A 4MO2A 4ZT7A 5I4KA 4AJ9A 3HRKA 4AAYA 5E2IA 3DNMA 3LCUA 1NP7A 2JIPA 2KI5A 5EKTA 4X20B 5HJEA 3SBEA 1QQ5A 1DELA 1OZFA 2V4UA 3OTGA 3WLOA 5ALEA 1M6YA 1HNWB 1GKUB 1ZRHA 3UJ3X 1QGYA 2OCYC 3U81A 4EG5A 1ANKA 3T1NA 3ZBQA 1OASA 2VT3A 2PDAA 2WJIA 4J2HA 3UFBA 1U3WA 3LPMA 1AO3A 3SHFA 3OIUA 5L3QA 3FVWA 4WZAB 2V58A 1W30A 5J4YA 2X5XA 3L1KA 4O1MA 1O58A 1TGYA 4II7A 5TQ0A 1ORWA 3CZQA 2JJ2D 1PJZA 5DPMA 2XKJE 4GLOA 3GJ3A 4MVJH 4WNIA 2WWVD 3QGMA 1AZWA 2HMSA 4E94A 1JR6A 2O3QA 1DV1A 3REQA 2VDOB 1O4WA 5I45A 1EE1A 7MDHA 4QU9A 1ZIPA 1M2VB 3FOCA 1DJNA 4DYVA 1C0LA 8MHTA 3W2TA 2J9YB 2RG1A 5J4VA 3N8IA 2AFHB 1BHO1 4GX1A 3OWOA 4RHCA 1WSDA 1NA5A 4AJIA 3BWEA 4DN6A 1G7TA 2IGBA 1QIGA 3MWKA 4EPVA 1GAXA 1JR4A 2HLPA 3HLTA 4NARA 3AY3A 2WSYB 2VQ3A 1E5TA 4PM4A 1S2LA 2YVLA 1F17A 1VCNA 1RHJA 1IQRA 3C48A 4L0QA 5EE5B 4C7OA 4HXYA 4YX9A 1K6IA 1TNDA 4M9XA 4TLAA 4PC1A 3SX0A 3TDNA 7ABPA 1R6TA 2XT9A 3WIOA 4IVRA 3NBXX 4MB2A 3ZQ6A 1DBVO 5F5NA 4X95A 4GNKA 4D1YA 2BHTA 3M82A 5BSRA 1T2UA 3B1VA 1T3ZA 2A4KA 5LDHA 3ZNOA 2MR6A 4V0ME 1HSOA 1WVMA 4D74A 3OQNA 3OWXA 1ZU4A 3HCWA 4JUFA 3MAAC 5H70A 4N6OA 3UAWA 4NEGA 1N4DA 3R6DA 3UQYS 1OTXA 1AQYA 3ONWA 2EZ4A 3EFOA 1T0PA 3T4XA 2Z5FA 4QAJA 2Q5HA 1JAXA 3CEPB 5J2TF 2Y0BA 5JYBA 2OV3A 4ITUA 3KM0A 4ASUD 1EWKA 2PT7A 2WZBA 2Z0MA 4BWVA 4IRUB 1TA0A 1XUOA 4M0KA 1BX3A 4KSCA 1RYEA 1S4MA 1I32A 2GN9A 1NNLA 1ZPDA 1FL9A 2FOIA 1P80A 1DC3A 2FMXA 3LLUA 3NIWA 4WGFA 4HN4B 2YV2A 3VKUA 1CY0A 1XCGB 1N2CB 4TWZA 2X0EA 2P6PA 3AGQA 5DBOA 4YT5A 1MV8A 3TRJA 4GIBA 1NKVA 1O97D 1TYDE 4R4JA 2BEVA 5JXHA 3LXXA 4PLFA 4EG8A 2JAUA 1ZDMA 3AEXA 1EHCA 2GKGA 1DCFA 3KVNA 3RHSA 3UHJA 1JG6A 4F8YA 2JVJA 1UKVY 3K96A 4V39A 5E1BA 2EDAA 3C0KA 2C5SA 4FDAA 4A27A 2FN8A 4B85A 4YAIA 3GJ4A 3QBVA 2IELA 2R8BA 4KPFC 1I5RA 1MEEA 4WN3A 3TVTA 5C18A 1SWWA 4KVAA 4I6EA 3ZU4A 4C2TA 2NGRA 3N0WA 4NMHA 3WICA 3NHFA 1U81A 3K1AA 4GR9A 3DULA 1QWSA 3WS7A 3FMOB 4WNAA 2F1JA 2A86A 4JBLA 3L8HA 2EW2A 1PG0A 1A7UA 2QRPA 4DCNA 2OG2A 3U1BA 4I1RA 4CMIA 2MSDB 2OB1A 1E1QD 3IIEA 4E3ZA 3E4DA 1D2CA 3M4YA 1RZVA 4EG1A 3JQPA 4WERA 3CIOA 4GYWA 4ZO7A 3E9RA 3V8MA 1ZRMA 3WQQA 2CJWA 5LN1A 1BVUA 1Y4AE 1ZAYA 4OYHA 1M66A 4LY6A 3SY8A 4FYVA 5C1PA 4F3CA 4HB2A 1NQVA 1AIPA 4ZZ3A 5I7AA 1G8YA 4ND7A 3TI9A 5BXQC 2WHYA 2WU0A 2Z30A 3AR8A 4HAIA 1R5OA 3C7DB 1NXQA 1WHSA 4ENPA 5JD6A 4I4NA 3I5AA 2KM1A 2ZIZA 2FPSA 3FAKA 3TLAA 3W05A 4PF1A 5U4QA 4B7AA 1M2GA 3QU4A 1WSWA 5AVSA 3HDTA 2CD9A 5J23A 1M6VB 1PS9A 1QOQB 1ABEA 4J0DA 4K1LA 2DWPA 4KH0A 2EP7A 4HN2A 4ZJPA 5A9SA 1M1NA 3QQPA 3RTEA 5KYUB 1H22A 2PA0A 2V0GA 3ZI7A 3EF0A 3Q3IA 4R8MA 4WLNA 3NVMB 3TSOA 2AYZA 3TECE 3JASB 3DBHA 4D0GA 2HWYA 2EP5A 4YCSA 5EJ8A 1XHLA 3MINA 4E32A 5KYNA 4CF5A 2LUOA 2PS3A 4B3GA 2NU7A 2RGRA 3GELA 3FPLA 4HQ0A 1JB1A 1YSCA 2YWFA 1THMA 5LZ7A 3WL4A 3ZW9A 3QVKA 4EIWA 4EVRA 2IUTA 3HCBA 4KZKA 2PT9A 1DIRA 4RY2A 2HRDA 1N6LA 1UZLA 4KC0A 3QI2A 4B6OA 1ZRNA 3MPUA 4OBWA 4ENUA 2JLVA 3N59A 1PUXA 2VJMA 3AHDA 4FEYA 4NYIR 3D6HA 4LYHA 2H5JA 5IF9A 1RHKA 1JR3A 2Q49A 2ZREA 1B2RA 3IP3A 4JLVA 3WGYA 3PJEA 4RHTA 1R0RE 4GBGA 4NJEB 1RJDA 3HABA 3LFTA 4KE8A 2JI8A 1W46A 1VHLA 4PAQA 4G5QA 4ZHQB 1U94A 2OGTA 3EIOA 2W58A 2IZ7A 1CNMA 2A9PA 4ZVLA 3H8VA 1N2JA 1DFIA 5CXXA 3NU1A 1PT5A 4G0YA 4YCNA 3U4HA 1XKXA 1FX0B 3JR3A 4Q3EA 3SJCA 2P5UA 4E4RA 4EY4A 2PM8A 2B82A 4L5AA 4N3NA 3PX3A 2FRDC 2BLLA 1NSYA 4KO4S 5AK4A 2C95A 5FPKA 1NU8A 1SUEA 1Z6PA 1Q5PA 3HH8A 4I0WB 4HX5A 2RB4A 2Y1KA 5BXYA 4KODA 3B6JA 3WP1B 1GGJA 2XECA 3M6MD 4TVSA 5D7NA 2GAAA 4KSYA 3RVJA 5FV4A 2WP0A 2RK3A 1CUGA 4MQLA 3ZBUA 4RK0A 3BH6A 1IOLA 3C3MA 4I1SA 3SHTA 1QJ4A 4BB6A 4GMFA 3PGVA 1Y8CA 3ZWXA 1UMCB 2I8CA 2WIKA 3TE6A 1WMDA 3SVLA 3IO3A 5CXQA 3G3EA 1Y6RA 4MAMA 4MVXA 5F51A 2BFDB 3THYB 2IZ6A 3JQ7A 3ICWA 3V2UA 4LF7B 4O2BA 1X1DA 4LUCA 1I30A 4MO9A 2NUTB 1RCTE 2H29A 3EASA 2BV3A 2XEXA 1E4VA 1NN3A 4JJAA 4H18A 1J9ZA 1ECJA 1IZ8A 1EX7A 2BP7A 4RMJA 3WO1A 1NPTO 3JRXA 1VG1A 2IUUA 4DCOA 1YWGO 5A3VA 3PGLA 3GUUA 4OAOA 1MAUA 1V95A 2QXTA 3FJ1A 3I83A 3N7UA 3DQQA 1F9EA 3SX4A 1SBTA 3LT0A 4KEAA 1P81A 4BFTA 3P4YA 5CD9A 4ND8B 5IKEA 3VSDA 1Y48E 4FHFA 1YS1X 2XNJA 3NAMA 4LXHA 4XIFA 2QORA 4U5QA 4DCVA 2OHVA 2R97A 2IC5A 3BBLA 3BFXA 5BYJA 5FA5A 2YYSA 2H4FA 3IOYA 4NOKA 1PYDA 4B74A 1TA9A 4HLNA 3A6DA 2IVZA 3A3YA 1A5TA 1OXTA 2VP9A 3TOCA 4OUDB 4G5GA 2A0XA 1NVDA 1ZGAA 2Y92A 3ZUGA 2QR2A 1UOQA 4E1VA 2HJ9A 3A6LA 3MTQA 3KSZO 1WPQA 4O2RA 4CL8A 1L7BA 1UDWA 3F4KA 5DOZA 3COJA 3RWOA 5IJWA 3TN7A 1ABBA 4BLUA 2FDRA 3MMSA 4EPXA 1PJ4A 3DBIA 1C9JA 4F5WA 3ZHBA 4CLEA 4E11A 4PLHA 4MARA 4L75A 5GM1A 2OVFA 1B8VA 1X3SA 1L5HB 2NXCA 1C4XA 2Q7DA 2CSUA 2O2SA 3CGGA 4WACA 2UV8A 3MBIA 4Q9KA 4E5KA 3A0UA 1Z73A 5FOQA 2HMAA 4GEKA 4INAA 3EDYA 3I05A 2Q5LA 3DA8A 3KQQA 1QKJA 4J0JA 1XT6A 4OGLA 4JT2A 2WNHA 1SRRA 3LVBA 3NYQA 2V7BA 1T9HA 2HCJB 2E6UX 4KR2A 3EC1A 4O1IA 3UWMA 3C7CB 3K20A 1QGAA 3GT0A 1CDZA 4U1RA 2EJCA 5DJ5A 3ROKA 2F43A 5B4TA 2AFHE 2ZRLA 3EVZA 5GVRA 4FHGA 2ZBGA 5AFSA 2CJYA 2UYOA 1AKUA 1A95A 2ZIWB 1KR5A 1QDEA 4TUYA 1A72A 1G18A 2OC9A 2XUKA 4GQBA 5IDVA 2D00A 1JFRA 3K6KA 3ZDZB 1EGQA 4QT4A 3UUFA 5KNCA 3IXLA 1H0KA 1ZOSA 5F23A 3U6KA 1G98A 1EBBA 3VUFA 1Z25A 3C5HA 4HXEB 1KMIY 2ANBA 1DDGA 1V6SA 2G4CA 3FM9A 5AT1A 3IH5A 3W8EA 3GLGB 3EIWA 4HEA1 3REFA 2Z6UA 2BD0A 3K53A 3A9SA 4KYUA 2UZ1A 3W5BA 1QP4A 1SVLA 1ZNQO 3OCWA 2Q6OA 5DCUA 3DOEA 2DEUA 1W5SA 5DNWA 1KSJA 3VO8A 3CVUA 4KQGA 3DLHA 3HYSA 3E0QA 5TC4A 2VT2A 4LX8A 3H5IA 3OPXA 1BGVA 1L4KA 5F7XA 1C3LA 1NUAA 2FP3A 2I34A 3WK8A 1KZ4A 1Q22A 3P0JA 1PZNA 4CTNA 1GL7A 3CLRD 4CM9D 2C7GA 1KRHA 1MX3A 3BE4A 5DMHA 4FZ3A 4EOGA 2AT1A 3G9XA 1C8VB 2NSHA 3B70A 1NW8A 1MB2A 3K1TA 4Z9XA 3VH1A 1PL8A 2HI0A 2ZIEA 4DA8A 2Q0QA 4K9DA 2NAPA 3ABQB 4LYJA 3VR5D 4DNPA 1PEKE 1E3WB 1Q0SA 1OAOA 1LPOA 1F8YA 5BQFA 3DHYA 1IHPA 2F17A 4TRRA 1YRYE 3RT1A 2PEZA 3FTQA 2LW7A 2YL2A 1FP2A 1I3OA 5DW3A 2ZQYA 1LBTA 4RCYA 4DF3A 2VPIA 4H1TA 4PQFA 3R9WA 5KHOC 1U90A 1OGIA 1SOMA 4OFBA 3VAAA 1IEQA 2R66A 1BS9A 3VR2A 1PZXA 1SBCA 4BNUA 2O3JA 4F8EA 4KQWA 1T2EA 1J99A 1I4EB 1D7AA 4FLMA 3KFVA 3IVMA 2C94A 3O38A 3RTDA 4IILA 2DPXA 4X93A 5IF3A 1FA9A 1PGQA 1PX0A 4ZRMA 3ZGYA 2V3VA 2QG4A 4IDOA 1SHZA 3VR5H 2OSBA 4CM5A 2TECE 5CFNA 2WG0A 3IVXA 5LKRA 1H4QA 2I4NA 2ORED 2JFXA 2ZWPA 5H83A 4C0QC 4CL3A 3DWEX 2IEAA 2NYAA 4QQFA 4ENRA 2WDPA 4ESHA 3TRHA 4RFSA 5B2FA 4XPIB 1UIRA 3FTNA 4MV3A 3K4PA 4XYBA 3M2TA 4G1EB 2BIFA 1MV5A 3MJVA 1T1GA 1W73A 1HMPA 1ODFA 3L4BC 2X6TA 4JQCA 3HEBA 5TB5A 3WGUA 1OBHA 3IIJA 4LJLA 4OK3A 4XB1A 4F8JA 4J75A 4DIFA 4LV5B 1L5RA 4XWOA 1WE2A 1A8QA 5KNDH 2OHXA 1MX1A 2GEJA 2R65A 4IHKA 5B3AA 1EDOA 2Q3BA 3ZGVA 4RTKA 1GTRA 4J0FA 6PFKA 3R6GA 3LF1A 2FEPA 3OT5A 1DL5A 2RG7A 3FYCA 5J58A 2OFPA 1N6RA 2DUUA 1GQQA 1L8LA 1FP6A 1YR7A 2H11A 4JFAA 4TZKA 2PJUA 1SUSA 1I36A 3VR2D 1JQAA 1U1CA 3FRJA 2V98A 3PLNA 3GC6A 2QMQA 2J3IA 1KPGA 3NJ8A 4F1KA 2VNJA 1U31A 2Y0DA 4HNQA 4KVZA 4XDZA 4R2HA 2VDUE 3IBSA 1ZR4A 3ZDAA 3GLVA 1HEIA 3ZIAD 2OCXA 1KZ1A 1W88B 2ODBA 1X8LA 4LC1A 4J49A 4HH4A 1R0SA 4ZVOA 3UANA 4CTJA 4UOZA 3OIWA 2J4CA 5MGNA 2XWSA 1QFXA 5FBRB 3BORA 2RBEA 4RV9A 4AZ0B 4CUZA 2Q7OE 4UAVA 4V03A 1EXMA 2XCSB 2ZU0C 4C04A 1SQSA 3MYRA 1M1UA 3RFFA 4MCAA 4QTYA 3DW1X 5CVJA 2VRBA 1GU7A 2BVNA 3S68A 4RO0A 2PUJA 4ZANA 2CBGA 4TT8A 1O0CA 1CEEA 3MJHA 4DY6A 2V97A 4CG2A 4DA6A 3RWBA 5TS3A 4JD5A 4GL2A 3PGMA 4UUOA 2I22A 4JB2A 3TX6A 3U9LA 5ES4B 1NLYA 4GHWA 5IK2D 1ZH8A 3O3OB 1DEXA 2FSVA 2ECKA 1LV7A 2M6SA 2JRCA 1B0ZA 4HWOA 1N5RA 3P20A 3A3PA 2D4HA 2WJHA 1XK7A 3QI7A 1NNUA 1BVRA 1ZGCA 3AEZA 1GLVA 2A5LA 1CY7A 1H3NA 4LY3A 4R9VA 5LUBA 4B35A 5KREA 3QF4A 1W85B 2JKVA 2W42A 5MN5A 4RZXA 2WTMA 5BRAA 3UN1A 1VRVA 1VIVA 3EZNA 1USIA 5CUQA 1D1QA 5L3QB 4JU8A 5HX7A 1PEYA 3G0CA 3UJDA 1UKCA 1E9RA 4NYIQ 3BXOA 2ODEA 4YJGA 1J2JA 3GGSA 1JI3A 1AKYA 2QD4A 3JPYA 4JUBA 4BVAA 2OENG 5T67A 3L8FA 2HXSA 1NM5A 4U2CA 1M2JA 1K6JA 5AVTA 3KJIA 3T4EA 5M34A 1S3FA 3OZDA 3C8UA 2YRFA 3A06A 3AVWA 3B6MA 2XGOA 1J90A 3S3TA 4KAJA 3I9JA 2Q4EA 4MUKA 5TGTA 1VKHA 1KI4A 1O96B 2Q2VA 2W0SA 4LRUA 1E6UA 2AK3A 4MXDA 4TLDA 5JD3A 2WWXA 3PIDA 4YC7A 3CHYA 1WXGA 3N3BC 2AOUA 2OL4A 4HNGA 1ZJZA 4YBRA 1F1JA 2J45A 4NH4A 5HNKA 2FYTA 3L18A 3MWGA 2OQIA 2WIGA 4FGKA 1U99A 1N8TA 1L4FA 1RQXA 2WDZA 4YPFA 5DYYA 9ATCA 1OH8A 4JEIA 3HBMA 4L0MA 1Y80A 4IDEA 3OQVA 1E3JA 2HD4A 3COYA 4OXQA 4LJ9A 1TIPA 1H6BA 1XXHB 5JSZA 4IKOA 4N65A 2IXDA 2OVBA 4M1SA 5HRAA 5JY6A 1NPDA 2G9ZA 3I3OA 2CLEB 4QFBA 3DS8A 4RLQA 1EK0A 2Q27A 3OPMA 1TVKA 4BNIA 4UE6A 3M3DA 2ILTA 2ZYGA 2ZWMA 1U0OC 4WJZA 3BVPA 4RF2A 4DUZB 3PDWA 2PBFA 2VDRB 1CZRA 3ANNA 1L7AA 4JLKA 2ONZA 5E9WA 3T12A 4MTLA 2ZI7A 2PKQO 1FNBA 3TR6A 1QMPA 4D6YA 1CWUA 4W9NC 4DBVO 1HNZB 1ZGJA 3GAMA 1Y8RA 3QYAA 5JTTA 3H9QA 1N2ZA 2HQSA 4ZMBA 2JJQA 3ZJ5A 1KORA 2F1KA 3A31A 3DL0A 3O84A 4MVJF 1ELOA 2NAFA 3RRYA 5CK4A 5AQ1A 3AUSA 3H3JA 4ABTA 4YUVA 3NWPA 3OMWA 5IYZF 4R71A 3G1TA 3UK0A 1H3FA 4Z54A 4LBYA 1D04A 3O8BA 3UIEA 2HZBA 1G6Q1 1UAGA 3D3NA 2WD7A 2HBRA 1EM8B 4QFDA 4U5XA 5FYQA 4A03A 2SNIE 2YY7A 5EUMA 4AO8A 3JRWA 4G36A 4CLXA 4LNUB 5B3LA 2AE2A 2XQVA 3H0EA 1FU7A 4R2IA 1T9AA 4QWWA 1W96A 3USZA 1L1FA 4B43A 3VBEA 1JFSA 1JBQA 4R7GA 3VQTA 5FWXA 2DLDA 1DMRA 1R8SA 3NGXA 5D1NA 1NVFA 3IHWA 3NTQA 4U2DA 4F4JA 2IXBA 3LT1A 4C43A 2V6FA 5A1JA 4M9ZA 2FPWA 3LZ6A 4JSRA 2X6QA 1JKJB 2BDEA 3AKYA 3PDIB 4YRPA 2EF0A 4Q1AA 4F9TA 2ICAA 1X87A 4BNDB 2WQ7A 2DY0A 4MWCA 2C59A 1QS0A 3CF6R 1G3QA 3BHNA 3EGWA 3HACA 1H5NA 3SC2A 4I4TA 2VLIA 2EWVA 3BG5A 2GCIA 1U4OA 4GXQA 3NIBA 3P0FA 4GVLA 1F06A 1AB6A 3B1JA 4YMHA 1FLDA 3H2ZA 3B6EA 2RGYA 1JH9A 4IVQA 3OCUA 5BQXA 1UFQA 4GWKA 4KQKA 4OJKA 4ETWA 2MYPA 4ZA2A 3VR6A 1MRZA 5I9IA 2EOAA 1CF4A 1QNLA 5BSHA 2J9FB 2YH2A 2FF7A 1PFWA 3K0FA 4FFWA 1XAHA 4OQYA 3ZCXA 5JNRA 4NONA 4JKIA 3EQ8A 4M9UA 4MV0A 1PL7A 1IY1A 4C0SA 1MPXA 4DMLA 1RAFA 4EYKA 3DLBA 2YHIB 3D7SA 1A97A 5A4JA 1SA0A 2PMFA 2HA0A 4UBKA 5J5AA 2JCXA 3VH4A 3LGXA 4EFLA 4EQ6B 1TD1A 5C7YA 4COOA 2JFPA 1J2RA 3PKZA 1P2GA 1QVAA 1YMVA 3DXFA 2WOJA 3BSWA 4CV1A 4INZA 5CA0A 3ESBA 1Q91A 1GPDG 4MSUA 1XIVA 3GYGA 5ALPA 4XYLA 1AXRA 4ZDJA 1KI2A 5BR7A 3A27A 3GG2A 4TRJA 3HWX1 4LZPA 4IM7A 4IIFA 1QCDA 1LCIA 5J2UF 5BWLA 3DLIA 4BFXA 3QTBA 5EZYF 1T9KA 3CPHA 3VYSB 4FT2A 4B83A 1KA9H 3T3IA 4F93B 2FPPA 2VDWA 1L9XA 3DZGA 1V5IA 1Q3KA 5JNSA 3IYLW 3KQPA 5JBIA 5F73A 4P6VF 4JVNA 4XLLA 4EA9A 5LIPA 1ACJA 2CMFA 3D43A 5IJ0B 3E8XA 4H7JA 4GBED 4MV9A 1Z33A 1QTNA 2G7ZA 5E2AA 4FK8A 1NRJB 5AXBA 1ETHA 3EZ2A 3PCXA 5E9QA 4EY5A 4TMTA 5B5SA 5BSVA 3QH4A 2C3MA 3IEUA 3B2EA 3HB0A 5HKKA 1A1VA 1GKYA 3E6AA 1EFRD 3T7IA 3QNMA 3LQ1A 4TWJA 1SQFA 2WUDA 2GF2A 4JLAA 2P6MA 4CKBA 3LCRA 4LQLA 3KJEA 3G0OA 4EDHA 2YS7A 3E3OA 5K7SA 3T1OA 2EP8A 1WULS 3ECCA 3S8MA 1PE0A 3KIPA 3PFGA 4IIJF 1G3UA 1DKNA 1JEQA 2JZCA 3DJYA 4MPPA 5T57A 4K2AA 2JLUA 3WG9A 3KX2A 4GQIA 5AKIA 3GRRA 1XDWA 4Q01A 3AFNA 1YBMA 1GG2A 4ETIA 5I7VA 2HL6A 4Q1VA 4EAAA 2EAUA 4UHEA 2G07A 2HNAA 3GPLA 2BBWA 2H51A 3EGXA 1G41A 1JU3A 3ZGLA 1KVTA 1TMYA 3U4QB 1VJ1A 1UBJS 1L7QA 3CF4G 1EJ6A 4FGLA 5C1BA 4DR1B 5CNJA 4KXNA 3VNUA 3I01M 2D06A 1C1XA 1Y5IA 2Y27A 2OY0A 2JGMA 2P9YA 4BNNA 2QE7A 3IGFA 1SKUA 3BJRA 3D3WA 3VKHA 1MVNA 2YFHA 3KEQA 3ESXA 3WI7A 4AUNA 1LY1A 1MFPA 5KQLA 3ZD6A 2Y6VA 5EYPA 4YPVA 4KPEC 4BXOB 2CHGA 2ZT5A 3CLVA 4GF5A 4EB8A 5K03A 2EFGA 2H5IA 2ZJ6A 3OPNA 4K0KB 3V4ZA 2ORWA 5EPEA 2FLKA 4EHBA 4UTNA 2WK1A 1BE0A 3QA3E 1XKQA 3KXLA 3UJ7A 4FR0A 4AJEA 1R0XA 2E21A 2F1HA 2HM7A 2IBMA 3KTFA 5AVKA 2QMZA 4JI8B 3D0QA 4TLBA 5A9TA 4D3DA 3Q7IA 3T9BA 1T4DA 4KITB 3HZRA 1UQRA 1L4MA 2HQOA 4G4SP 3UM9A 4ACAA 3HHPA 3V4SA 3WLLA 2P1RA 3ZU2A 4OGWA 4BP8A 1V9CA 4RACA 5IAOA 4I3GA 1XLTA 4PHFA 3AUXA 4NFHA 4C6TA 1Q83A 4HN9A 1XVUA 2GF9A 4TRMA 4ZEXA 3TNDA 1TMKA 4RZIA 3UAZA 3OZIA 1N0IA 3CH7A 1URPA 4TL7A 5BQ5A 5KSPA 4C4AA 3H18A 4R0NA 1MF7A 4INJA 3W1EA 2LZ0A 2YDXA 5LD2B 3KDAA 1Z0DA 1M8KA 3HV0A 3THYA 2B8JA 2RGWA 2XYVA 2P9HA 4J6EA 3FWZA 4RHEA 1GGFA 1PR1A 1K63A 1YJCA 2VQFB 3QVUA 4AY2A 2ZTLA 3ZR4B 4Z6KA 2H85A 2AEMA 1RQRA 3M1LA 4AMZA 4IJ5A 3EODA 1FIUA 1KIAA 4F38A 3DB2A 4Z9BA 2C2GA 2WIDA 1WXFA 3CNOA 4Z9FA 3U3XA 3SDBA 3IUNA 5K51A 1S1CA 2ZWOA 2R8PA 2WWYA 3IOMA 5D85A 5AM3A 4J16A 1Q0UA 1S2IA 3ZWBA 1F4PA 2FPPB 4RTQA 4HGRA 1RC1A 3B9BA 1H2YA 1JW9B 3QG1A 3C7TA 4PNHA 1NXTA 3V2IA 4CKYA 1N4AA 3C6YA 4XIJA 4BMNA 1FFGA 1U4NA 2W8BA 1YUNA 3LOQA 4FKBA 4KQMA 3V8VA 3EE6A 2RAFA 5K0ZA 1VA4A 2GTHA 1JMKC 2OAQ1 1LJUA 3GD5A 2ATVA 4LBVA 5MF6A 1RLIA 2O3TA 2MSNA 3RR2A 1ZLXA 2X1VA 1E1RA 3GUVA 4RF4A 2I2FA 3WGKA 2CGEA 1UFRA 3L02A 5L45A 1QC5A 4ZAGA 3FVQA 4BFUA 1T1RA 2D54A 4OV6B 1D1PA 4H4EA 4R2KA 3RYHA 4KRFA 3NUGA 4BLRA 1US8A 1NMZA 5DP2A 4BNVA 5SZJA 1U7XA 1ULZA 2ZT6A 2FHPA 2C83A 2H7XA 3DV2A 4WW0A 4XDGA 2C2ZA 3NANA 4WLOA 3S29A 4M0CA 1ULHA 3DF7A 5DK4A 4FOSA 3O4VA 4DJTA 2AI1A 1LV8A 2I3DA 1H1TA 1AGRA 2VZ8A 4V2UA 3NONA 3W6ZA 4O6VA 5IEBA 4B6GA 4IEFB 4QYMA 1L1QA 1N8NA 4YAOA 3HUFA 5DLEA 5HCIA 1USGA 1IN1A 4YIKA 3Q15C 1JA1A 4UARA 2OYSA 4PV7A 2HRCA 1J9EA 1RHQA 3CR3C 1K6MA 2BFAA 4WN9B 3OSUA 4ZOEA 4ZI7B 2FH5B 3CUUA 1MJGM 1R18A 4C30A 4BVHA 3J80A 4MGKR 1Z56C 1EKXA 1DNPA 3V2GA 3FJOA 3SQOA 5JPCA 5KTRA 3NWJA 2B0JA 1P3Y1 3RVBA 4ZEOA 2PMCA 1QIHA 2XZPA 3AESA 4ZO4A 5D7BA 4V3BA 4PXSA 3GJXC 3PBKA 1MMFB 2J5RA 3UJPA 1ZJJA 4H31A 4H7DA 3KQTA 5BNIA 1L4EA 4N0DA 2FG6C 3CUVA 4IHJB 4NV1A 4D0LB 2GJ9A 1FQJA 3D4NA 3AHCA 4F46A 2C8LA 1ICIA 2XW6A 1L8AA 2DCMA 4KTVE 3KTAB 2KWIA 3PWSA 3GEEA 1VBNA 2EFYA 1T36A 3L0YA 1C8BA 3FE2A 3NNSA 2O8DA 1KMQA 2P77A 1NE2A 2HJHA 5K6TA 1EWRA 1OPRA 1UFKA 1Z0KA 1MC4A 1DDIA 5JNVA 3NRCA 2CXXA 3GEGA 2CHEA 1WHTA 3WKBA 4ENSA 3A9CA 1VLQA 3RVLA 3DZIA 5TIIA 1MO2A 4HUQA 2A59A 5K05A 3EPKA 3TFQA 1Y7PA 4PGGA 3RHTA 3ETEA 3OJEA 2XMCA 2QSZA 4C89A 1XZHA 5ALWA 2C4VA 5EJEA 5HK8A 1JJIA 2YZ2A 1BA2A 5AKEA 4GGPA 5H0IA 2RIPA 4ZCQA 1NBHA 3RBVA 2DJ5A 2QTZA 1JIXA 1CZOA 1RACA 3NGMA 4XWYA 4YWHA 2NUAB 4FZVA 4G07A 3WWZA 1WY5A 1KMHB 3BB3A 1B7GO 3PU6A 3GARA 1IHOA 1JLKA 1U0JA 5E7MA 1HY3A 3PX7A 3BQNB 1FZQA 3IPAA 3OPYA 4FGSA 3DT9A 1VP9A 3OIGA 4BJ6A 5GY7A 4JLPA 5ALVA 1IMJA 3SIWA 1U8XX 1V7QA 4DRZA 3DOUA 1B6RA 5KVAA 1HM5A 3O4JA 3Q7EA 3ZE0B 3HVUA 1KBZA 2P30A 2PGAA 4HLUC 3ONDA 4BLPA 2B98A 4OJNA 2QW1A 4BQPA 3FDFA 4DRXA 1T1SA 4RPGA 1B0AA 3OX4A 3K09C 4IIJA 2WA1A 4WOJA 4Y2JA 3U9SA 4PVCA 1Z7EA 3KEOA 3CQ9A 1OUMA 1SGWA 3IA2A 1ZIOA 1W9HA 2H52A 4UQPA 4WFQA 1TF2A 4LSWA 1Z8FA 4UEWA 5AR1A 3TCNA 5AOBA 1UKBA 4BQOA 1YO6A 2J0SA 4P31A 2JAQA 2XCOA 4DZTA 5CM8B 4ZVUA 1DG3A 2C82A 5C32A 1GV0A 1O1YA 2H2WA 2JANA 3GHHA 3QOXA 4YXFA 1TE2A 3PRHA 3COWA 4M1QA 2FN3A 4P86A 1ZLYA 4D2IA 5E6UA 2Q1YA 3LH5A 4OXRA 4Z7QB 4ZQHA 3A1WA 5J3JA 1LF0A 5F7ZA 2FEMA 3ROEA 4OLJA 1ODKA 2AC2A 1A50B 3LGSA 1F2UB 3ITKA 4LE1A 3VSAA 4CQLB 4O08A 1I7NA 1ATZA 3DB1A 2JKYA 1NG1A 3I9V6 1ZJ5A 2QMHA 1EESA 4WLVA 3QVSA 4C5CA 3D8NA 2J3MA 3I9KA 5DYIA 5JJ5A 3B6KA 1HA3A 3EXG2 4OSOA 2C99A 3J81A 3VPSA 2WE7A 4G5YA 1SOUA 3QXGA 4X63A 4D46A 2H2FA 4QZVA 4XSGA 3WKEA 4GI7A 1IN6A 3LQ4A 3T5DA 1XLWA 3OY7A 2Z98A 1R12A 3IR7A 4Y98A 5DASA 3SHWA 1BU5A 5E4JA 4GO1A 7GPBA 1I3KA 1Z2CA 2J67A 3FZNA 2C2MA 4K9QA 1N3YA 1WOYA 1L7RA 1WY7A 3F8TA 3P32A 2FZ5A 3DP7A 2VRCA 3GMDA 2MT9A 4ALJA 1IYZA 3S2EA 3G2HA 5JPDA 2GJ8A 4GYYA 3PFWO 2D0OB 5K2MA 4UBNA 2WHPB 3GGCA 3GLKA 3NT4A 4CEHB 1AUVA 2HPVA 3ZC3A 5E3IA 3E82A 3ENVA 5C5IA 5U1PA 3EPLA 2H59A 1FZTA 1J25A 3IAXA 4WBNA 5IASA 1OGJA 2ID7A 4DQUA 5CFZA 2FPIB 1M6EX 4GKVA 4BJHB 2FKNA 5CG1A 3JZMA 4B44A 2QQFA 1JEOA 4XD7D 1U5CA 4EMTA 4D3ZA 4BBAA 2RAVA 1JG1A 1FLVA 4CKCB 1E1LA 2RI1A 5ENDA 3BH0A 1H4VB 4BO2A 3GPBA 2G9QA 3JX9A 3UV7A 2AFIA 2HLHA 1UEIA 4L8YA 3X44A 4E5YA 7ADHA 1O0BA 2FLWA 1D1SA 1P1KA 3BGVA 1LS1A 3G68A 2FFBA 1QR6A 3A36A 3GXOA 3IBCA 4L0DA 3G7UA 1FSGA 4OGGA 2Y1DA 4PQRA 3NRBA 4LDPA 4OYLA 5CHYA 5CEFA 4R3NA 5EIWA 3O8OB 4C3OB 3STUA 4X1YB 4MK4A 1B8OA 4NP6A 3TW4A 1W2WB 4IR7A 5ELMA 3KJNA 1I51A 4QUBA 4QSMA 2X9LA 3A4YA 4Q7QA 3C1AA 3CFYA 1N5DA 3H5OA 3SF8A 4OAPA 2DP4E 4MUJA 3U3RA 4BVFA 3G1UA 3SQLA 5TQ2A 3WRWA 1GO2A 2IHBA 5I7EA 3CR7A 5GINE 1YVPA 5AVQA 3K05A 4U7GA 3WAJA 4FDMA 3T7RA 3P9ZA 5GV8A 2J3KA 1CUJA 2MTBA 3G59A 3DZ8A 3HCEA 2P78A 2YIMA 4MKHA 1YI8A 1OT3A 5I9NA 1NVTA 1KY4A 3GFTA 4JVOA 1I7SB 1KTIA 2C5AA 4OLBA 4E51A 1XE3A 4B84A 5KJFA 2XVXA 2J1LA 3BSFA 1QFSA 4HJXA 4R1SA 3R8FA 4F56A 2PMBA 3ZCSA 3O5AA 4GOXA 2OB2A 3B8HA 3E5HA 1QIKA 4YRAA 4MVJE 3PPVA 3DYVA 1L4NA 3O8OA 1C7RA 4UHFA 2XYRA 5BVGB 5LWHA 3FCAA 3KAKA 4H7HA 3TDKA 1Z37A 2MYTA 2PA3A 1M67A 1VA5A 1OZHA 4TSRA 3LUJA 4G0PA 1MA3A 1O5IA 3QPVA 1DO2A 2I9KA 3FDXA 5DDIP 1EXDA 1Q1BA 5IAGA 3EQZA 5CB4A 2N47A 2DQZA 1IBCA 2HMUA 1INLA 2QLNA 4CCSA 5KOJA 2NSLA 3JAMA 4RV4A 4OXIA 4WI1A 1LW7A 2NX2A 3VR4A 3PQ8A 2VJNA 2A1IA 1P5HA 1JJVA 3NHKA 3Q5GA 3R6LA 5CX4A 5MN6A 2DQKA 2GS9A 4ZQGA 4N3CA 2FSSA 3IJPA 5CVVA 5HG0A 4BLQA 1Z2EA 4B3JA 3C3JA 1V2HE 1IY2A 3HNPA 1ESMA 4AJKA 2R00C 2RFLA 4JBNA 3DVQX 2IW3A 5C35A 1SOVA 2ZTUA 3ETHA 5D3MB 2WJ4A 5IAKA 1UFOA 5DGDA 3U3ZA 4DT1B 3HGQA 4IUDS 3GLIB 3DWIA 3V1LA 4J0CA 2B99A 3JQFA 1XMQB 5AHXA 3IDAA 3COVA 1YB5A 2GRUA 3TGPA 3L8DA 3TLCA 3WK9A 1Y9EA 8ATCA 3AP2A 3F6CA 3DO5A 4KR0A 2M6LA 2H07A 3LUBA 3HR8A 5ICGA 1PV2A 4H1VA 3UPUA 3BGDA 3SMVA 1YUMA 2YOGA 5AI9A 1V8DA 3FVVA 4FKMA 5ICMA 3I6YA 3Q8KA 5BV8A 4ITVA 1Q0QA 4Z9YA 4LS3A 3Q3JB 1BZYA 3HJNA 5CXSA 1JT9A 5T5QA 2WJWA 4YMSA 3LNTA 4HQLA 2FN4A 1V7CA 1N25A 3G0GA 2H16A 3GGGA 5A71A 3F96A 5J40A 4ZYTA 3PXDA 4ZK6A 5FHQA 4S2EA 4ZPXA 4NNPA 4UULA 5G02A 3VPAA 3D3QA 2HPZA 4MQMA 2PTGA 3T61A 3KE9A 1NI5A 3M4XA 3QV1A 5CG2A 4JT8A 3NCHA 5CTJA 4CQJA 4PSCA 3DO8A 2XE4A 3CXUA 3WMWA 2QRLA 1NQUA 1IY9A 3DKPA 5CEEA 5FQOA 1WPGA 4QVGA 3VFDA 3VTKA 2HJVA 2PNJA 4TYNA 1WNTA 4YRFA 3LTNC 4GMDA 4EARA 4UTPA 1T5IA 2ZBFA 4U2KA 2RKBA 1SR8A 4MRAA 1QCZA 3A58B 2G36A 2OTCA 2IIBA 5T6BA 1X1SA 2ISQA 3PD0A 4R2WA 1U3TA 3FF4A 3M3PA 5J5VA 2OWDA 4V38A 3PWKA 1ZP6A 3GAFA 1CUVA 5GONB 2NP7A 4DNOA 5JAIA 1SM4A 1BGXT 4XCVA 5GADl 2A9KA 4HX2A 5FI3A 1QQBA 4ID3A 1SUBA 5KHAA 1KZ6A 4IKPA 1BEZA 1VL6A 4M60A 1JHQA 4OB6A 2P9CA 4X9XA 3R7DA 3UHAA 2GZ2A 1UT8A 2AYYA 3IUPA 1ZIXA 4LPSA 1G19A 1U80A 2V3WA 4IMPA 1A8HA 3ENKA 5JMWA 5K2OA 1O94D 4P4LA 1KAHA 1AB5A 4KPGA 4ZVNA 3TKLA 2GCGA 1J8MF 2QLTA 1YC2A 4RY9A 1VKZA 4PQYA 1Q15A 2LRHA 2M1ZA 3MLBA 4XJSA 4EHNA 2AN5A 3Q7TA 1IPFA 2P3QA 2AOXA 1PV4A 3IIMA 4WJKB 2PYIA 3H83A 3AU9A 3FLAA 1PQWA 4P8RA 2OBYA 4I19A 3LMKA 2DLCX 3FPGA 4UZFA 4Z8XA 4YRIA 5KAPA 1D6JA 1TF5A 2B7CA 5KTOA 1CUIA 4MGHA 1OFUA 4Q9IA 2JB9A 3MCUA 5JC1A 2AG5A 1A2QA 1GRNA 4EYGA 1RFLA 4KBYA 5JD5A 3N58A 5H80A 5EYPB 3W7BA 3K0FB 4I4IA 1HG1A 2AG8A 3PYMA 2BJVA 3KWJA 4J3FA 1K5GA 1E1RD 3EY9A 4KWCA 2E4VA 1GUAA 3AUFA 3ZU5A 2BM0A 1K6EA 1PDOA 1PL0A 3KU4A 4IHJF 1OWNA 5SZKB 4C4ZA 1XDGA 3Q88A 4DCPA 5C5DA 3VDNB 1O9GA 2PR2A 4XJVA 3ILXA 2UYYA 2CV0A 2I6SA 3T8YA 1E3SA 3BIXA 4CCWA 1D5WA 1A4UA 3VKVA 4TKVA 1GTG1 3DEFA 1JXAA 1OXSC 3WGIA 1A9SA 2Y4OA 4KPUA 3ND5A 4UBOA 2BFCB 4WY5A 1MZVA 3LFHA 4DLXA 4F4FA 5C0OE 5HBGA 4HT3B 1UJ2A 2GZSA 2A2ZA 4B7ZA 1WDMA 3OZGA 2XMZA 1FDWA 4IO0A 3D6AA 2A35A 5LU9A 1AO0A 4PC2A 4MROA 3L07A 4QYXA 1EVIA 4GR4A 2R25B 1AD2A 2GAFA 1VSQA 4X94A 3T1QA 4X62B 1HYGA 2IH5A 1IWBB 2OBFA 3OJWA 5BT8A 4U7DA 4X45A 1O8CA 3PGJA 4YCJA 1LC3A 5DM4A 3IQIX 4PS1A 1TEHA 3N2ZB 2QYOA 4YMUA 4XGIA 2RKWA 1CS0B 1RXEA 2P7HA 2ZRHA 1ZCZA 2PBLA 3AT1A 3ONFA 4O2AA 1F8XA 5AUNB 2YOFA 4DEXA 4Y2UA 1P6XA 2NUPA 4WBNF 3ISJA 1IXZA 1F2TA 3I8XA 4DZRA 2IYWA 2X9VA 4DV1B 2XSZA 1I1NA 3BHJA 5DEOA 3KSBC 4TN1A 3RUHA 3JQAD 4FZ5A 1JNYA 3P0HA 3R23A 5G2OA 2FPOA 4X91A 1N77A 3TD2A 1SVKA 5LKAA 3M1AA 1T0IA 1TCVA 2CDAA 2WILA 2XGMA 3ZHZA 4RTOA 5LQDA 3B5IA 5IM4A 3LC7O 4LCJA 1XAJA 4RIEA 2C0CA 2YJ4A 3KKNA 4DLWA 2AB0A 1XZGA 2IYSA 5JALA 5JH7B 1QWOA 1RPJA 1FRFS 3CS3A 4G41A 4MGZR 1JQDA 4DNQA 4M98A 4Q24A 2XH8A 4HVLA 5HVNA 4QJBA 3ZJUA 4IUCS 1EDDA 1EFPA 1S8FA 3T9FA 3IP1A 3OETA 3RIXA 3TJZA 2J7PD 2ADMA 5JSYA 1T4CA 1RM3A 4N0EA 2HGSA 2PSHA 1DIHA 3FIUA 1MIHA 3L7NA 2YW2A 1PK7A 3KSAC 3D8RA 5FOXA 1AG9A 3SC3A 2BHSA 3ADCA 2PMWB 4ZODA 2OM6A 4E1BA 5JFGA 1RVDA 2J0EA 2WSIA 1DRJA 1KXJA 1WCIB 1E6MA 2MU1A 2Y1FA 2RHJA 3R6WA 3TLGA 4EF6A 2DUNA 4Q4AB 2GNOA 1V8FA 1SZPA 1VQ1A 2AX3A 2H4XA 2NP6A 3E35A 3HKBA 3UPTA 2H1CA 2GBPA 2PLAA 3CCFA 3FX2A 3R5KA 5FTWA 5K4GA 1RI1A 3A1EA 3QU5A 2QUBA 1G9TA 2YKGA 2NXJA 3AOEC 4HGNA 4BQIA 5KKCA 4FP9A 4G9EA 4WV3A 2X5NA 4M37A 3P2KA 4IHQA 1ZOPA 4LQCA 1T9DA 3AY6A 4F9GA 5JRDS 3OCYA 2ZTMA 2DBQA 2JAXA 4KO3S 4NMXB 5TY0A 1IMOA 1HTBA 3MWEA 3MJFA 4QODA 2GAJA 4GLLA 3A1NA 3TRFA 1KJ9A 4Y1FA 3L0SA 4ZCLA 4FSXA 3RU2A 1J7JA 2PUDA 3FFBA 3TLGB 1A9XB 4L27A 2R1UA 2QF7A 2GLUA 5G40A 4AG6A 4B3FX 2HSDA 2IV3A 5KYXB 2DBRA 3L6CA 3ZLVA 4B2LA 2IHKA 5L9AA 2VNKA 5C4IA 2O19A 1AKRA 4N48A 4EG6A 3B1KA 1ZIDA 3OC0A 3HCAA 3RH0A 2I6FA 4FD3A 4M8SA 3L6EA 1C1DB 3FWYA 2XYHA 3GT4A 4OXXA 3OFVA 3G7SA 1WBJB 3NYWA 3IXQA 1XZLA 2G88A 2PLNA 3BMQB 3K2QA 3QYFA 1LWNA 3FPFA 4C6RA 4IZHA 3H3FA 4P98A 4I3HA 1XZMA 2F55A 3JWHA 1QH8A 4NVRA 1TADA 5EHQA 1NQOA 1Y5RA 3P71T 3E7DA 4I81A 4XQEA 2DB3A 1T1JA 3T52A 3ZNPA 1ZGZA 4EPRA 4HDNB 1J2TA 4XM1A 5BWCA 4MW5A 1RS0A 4KFRA 3TB4A 2NUPB 5JJLA 4O4IB 2Z2IA 1UXHA 1NF8A 1L7NA 3GGOA 4Y1RB 1PR9A 1GG5A 1UWCA 1V3TA 1FJHA 1OW3B 1Z13A 2D1RA 3R44A 4KNVA 2V6JA 5LQCA 3RM3A 2ZR9A 3CVXA 4CIYA 2IKQA 2YHUA 2ZYTX 4YFYA 1I5OA 3ESAA 3RYCA 2VR1A 1TM2A 3DEYX 2J3JA 2BISA 3B1XA 2AOWA 2WVAA 1UKYA 3GCDA 3NTVA 5IDYA 3NIGB 3CG0A 3T41A 3DP9A 1A9QA 1J42A 3PUKA 1AN9A 2JIZA 5TJ9A 4N0MA 721PA 1SUIA 5HEKA 1Y1PA 2QIOA 1LX7A 2FEWB 1PNVA 3H11B 2PZ8A 1YVDA 3ESQA 2LVBA 3E3NA 4P2BA 3BXFA 3QKRB 4TL9A 1IPHA 1RQPA 1V1MA 5HTKA 3IESA 1JHVA 3WKCA 2FW1A 3ZY4A 1JALA 4JIMA 3MAJA 5E1MA 3KQNA 2CK3A 1UCFA 2XVYA 2UZ3A 3U4CA 2JAWA 1CUEA 4RABA 2ZIUB 4PLZA 3KKEA 5DTJA 5ESXA 1VCIA 2WC1A 1HYEA 5AK5A 5IJ9B 7MHTA 4CIDA 4Q9LA 4QEDA 1U8FO 5ALKA 4OXYA 2IS4A 1B16A 1Z0IA 4MW9A 5I9TA 2I2AA 1WRBA 4RW0A 2IOYA 5CDTA 2FPLA 3SBXA 3VPDA 4HMOA 2PO7A 4RCZA 1TM4E 3GNLA 2O57A 5JASA 2G6TA 1IN7A 2FXVA 4Y9RA 1SQGA 1XQXA 5FL3A 1A96A 2R7NA 1MOQA 1ITZA 4O63O 5ADHA 1P9RA 1Q84A 1Q0PA 2C2OA 3EEQA 3FH0A 4H3KB 4KAFA 4KWHA 5TQ2B 4F21A 5HS4A 2JJ2A 1L2TA 4JCCA 2V7EA 4JJIA 4OHFA 1IAVA 3CRMA 1A4XA 1T9CA 2DHCA 1G5TA 4HNHA 5BSWA 1ES9A 3OUUA 3LHFA 1HTWA 3P0EA 2MINB 3G8CA 4IL5A 4EGJA 5KC9A 2WM9B 3JQ9A 1TEVA 2E4AA 3NB0A 3L6BA 4B75A 1XTRA 4DB4A 4L72A 1RC0A 3G9ZA 1YQGA 2GKSA 3I9MA 1Z4OA 2PX4A 4YBZA 5HP4A 3FYUC 1P29A 5BN3A 1IHDA 1KSHA 1KKLA 1Z28A 1T9GS 3KT8A 4RXTA 2P4EA 2QPAA 3MTBA 1NYTA 1VXRA 4IOJA 3Q9SA 1QGUA 3R41A 4JBWA 4UE2A 4CL0A 3R3SA 1BCSB 4NNJA 3T5MA 1WSBA 5JWOA 2AR0A 3FZYA 4EFMA 5ARCA 1UMBA 3FCCA 3MMPA 1UINA 5HJ5A 2AV6A 4E46A 3BK2A 8AT1A 2WUFA 3MHTA 3PQ3A 3OKFA 4WCFC 4ZZIA 3EVBA 4LAFA 4DV4B 2RARA 1YZHA 2I8LA 1I0ZA 3V9AA 2O8FB 5BMVA 2MINA 2P35A 1GCOA 4JLNA 5CVTA 1GTVA 1N9ZA 3JTMA 4JKYA 4R8LA 5IDXA 2JATA 4P0TA 4TMYA 3V7NA 2D5BA 4XPZA 2A30A 3WISA 1FFHA 4NJOA 3DDOA 4IFEA 2AN1A 2VEOA 4PSUA 1Z3CA 4Q3NA 3ED5A 5FLKA 3GUYA 3NALA 1GSHA 3P9NA 3BHMA 2RGCA 2HA3A 2VK1A 4MMZB 3DZHA 4JAVC 4JL5A 2ZYVX 4DPLA 1ZRSA 2FMIA 2E87A 2RHMA 3EUWA 4RPKA 3RC7A 1CY1A 2B7BA 5IULC 4IQ0A 4OJTA 1GQSA 1HQKA 4LYEA 3FYUB 1E5VA 2ODTX 4QU0A 4HDAA 3T06B 4BFYA 1VG0B 1WZ2A 4EKDA 2JFOA 4F91B 1JAYA 2OGZA 4F5ZA 2GBLC 5EHNA 1JLHA 3FDIA 3LO5A 1SFRA 4BFWA 5E8RA 2HQRA 2D1TA 5AH0A 2VG8A 1M5TA 4U2BA 5THQA 1NYQA 5A1TA 1JLLB 4YP5A 5CM9C 5EUCA 1AS2A 2I54A 1XEWY 5FWXB 3L7JA 1D4ZA 4AVYA 3R2JA 1RRCA 2EGGA 1YZNA 1H0RA 2A1TR 4F7DA 1DKLA 5HE9A 1LNZA 4F4HA 5CDFA 2QTBA 4ECAA 1QRTA 5E6RB 3RFCA 1W19A 1CUZA 2VHZA 2WM3A 1TTPB 1GPKA 3GWZA 3LCJA 2G80A 3DF9A 4I8XA 1XU9A 1CQIB 1KDRA 3HLYA 5DCYA 3E5MA 1NN1A 4QJ3A 4UATA 3CU5A 4U9UA 4MS4B 4F3YA 3HBJA 4DQ0A 3E1SA 2J33A 3RUEA 2FPUA 4B4UA 1MB0A 4UVGA 5CGZA 1LC0A 2C4WA 1V3QE 3M6LA 5TQJA 1DXHA 5JARA 4IRMA 2R60A 2V5AA 3R5JA 2X0IA 1G8FA 1Q0HA 2W2LA 3KWLA 4R8RA