3ROEA

Crystal structure of mouse apolipoprotein a-i binding protein in complex with thymidine
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
233
structure length
233
Chain Sequence
AVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSKSPPTVLVICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQKMDIPFLGEMPPEPMMVDELYELVVDAIFGFSFKGDVREPFHSILSVLSGLTVPIASIDIPSGWDVEKGNPSGIQPDLLISLTAPKKSATHFTGRYHYLGGRFVPPALEKKYQLNLPSYPDTECVYRLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apolipoprotein A-I-binding protein
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 75
structure length 233
sequence length 233
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.1.99.6: NAD(P)H-hydrate epimerase.
pdb deposition date 2011-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3roeA00
3RU2A 3ROXA 3D3JA 2AX3A 3ROZA 3RSQA 3RTCA 3RO7A 3K5WA 3RT9A 3RSGA 3RNOA 3RTDA 2DG2A 3RRBA 3ROEA 3RTAA 3ROGA 3RREA 3RTGA 2O8NA 3RRFA 1JZTA 3RS9A 3RTEA 3RSSA 3RU3A 3RT7A 3RSFA 3D3KA 3RRJA 3RTBA 3RS8A
chains in the Genus database with same CATH superfamily
1JLLB 4PZYA 1DHTA 1PGJA 3UM9A 4CFYA 1TM7E 8AT1A 1ZOIA 5IAEA 4L73A 3U4GA 1Z36A 2XQJA 1UK7A 3QGMA 4KK3A 3U4HA 3O92A 5ELMA 5BUSA 1NBMD 3TG8A 2C03A 3WZMA 4CQMB 1T9AA 1G20E 1NJSA 4C3OB 4M9SA 3ZQUA 3ROFA 1OFUA 7ABPA 3COZA 1CUHA 1YS9A 4WLFA 1MGOA 1IHPA 2H07A 3RYCA 4UULA 3CUWA 3ZZUA 3RJZA 3T34A 2OAQ1 3IXMA 5A2QA 4RYDA 5CA0A 1TKRA 5BV2P 4TLEA 2A5LA 4WK0B 3VDQA 2YV2A 5JAPA 1U8TA 3C5EA 4NMMA 4WNIA 3BN3A 1R8JA 5F2NA 1TCBA 3DMDA 3OLZA 3I23A 2BDEA 2A0WA 1ULHA 3QWAA 1P8AA 1L8LA 2W2VA 1R8SA 2JBWA 2WJAA 2CY0A 1JECA 3E18A 3AI1A 2BFEB 5KYGA 3OOHA 1YTLA 5B12A 3UWMA 3MM4A 3CHYA 4LF6B 1NQUA 1Y9DA 2COUA 2ORIA 5IC6A 3BMNB 3E7WA 3RFXA 3VRHA 3KVNA 1ZDMA 3S2ZA 5ITZA 2M6KA 4KTTE 4A03A 5KMGA 2ZT5A 1I94B 3JZAA 1DLJA 3GROA 3NHBA 3FPFA 4M7OA 3PPYA 2C99A 1DRVA 4RKYA 4TMYA 1GTZA 1H5NA 1WEKA 4KN9S 4QASA 5LXTB 3D6NB 1AUVA 5JSYA 2FZ5A 2DBVO 1PZMA 5HGJA 1MB2A 4CEJB 1NURA 3LVFO 4EYKA 2J0EA 4QEKA 2JDIA 3SXJA 4NBNA 4ER6A 1S4QA 4TLLB 4RH0A 2WVGA 3PF9A 4YCDA 1FRVA 4F3TA 1SCIA 2JH3A 3PR1A 2H4XA 1DCKA 1RW4A 1YOBA 4FCTA 2VPWA 3MJCA 4O0MA 1CE8A 3KE8A 3DULA 3JTEA 3WRYC 2BCJQ 4AJNA 5DCYA 2H6EA 1Q1AA 3BHIA 1G8KA 2FKAA 3W3ZB 2Y93A 1GCAA 1MABB 1C1XA 1DDOA 1YBMA 3KKKA 3PQFA 5BORA 2AZXA 4ZT6A 4N8EA 1A8SA 2GAIA 3MJTA 5F7ZA 1DAPA 2QX9A 4YK7A 1YV9A 3CM0A 1L0BA 3JD0A 3BRSA 4RMJA 2I8LA 4WKNA 2O2EA 5AHRA 4RNCA 1TO1E 3SHOA 4HAVA 3TRDA 2ZBGA 4EUFA 5JEEA 7MHTA 2B6NA 5IBCA 1VKHA 2P4QA 3DV2A 1EP9A 3TQFA 3LBNA 4HDKA 2RMKA 1O7JA 2G5GX 3BT7A 2IITA 2IXFA 2ZYRA 4MRSA 4OKSA 2A7XA 2D5BA 1RRMA 1N36B 2LUOA 5L3VA 3CVXA 3CGGA 1A5BB 1ID1A 3JVIA 3PHJA 1LPBB 5DT9A 3IP6A 2ZYGA 1X8LA 3R24A 4MV5A 4OUDA 5BSFA 1TUIA 1TTTA 3HDVA 2G0NA 4AMBA 3GYBA 3VHXA 1ZIDA 4DLUA 1XZ8A 1K0FA 1DPFA 2H59A 2ODTX 3EUAA 4RKQA 5FTMA 1Q95A 1UKCA 1NDHA 1HI9A 1XTQA 3GCGA 4JLJA 4DADA 3L4SO 2AFHA 3IKJA 3A6FA 2WDZA 3RSZA 3HR4A 5CT5A 4Q7MB 4ZRMA 5HZHA 3L4JA 1AV7A 1FNCA 1OZHA 1ADBA 2A0YA 2ZRCA 3PA8A 5JRJA 1W36B 1ZG3A 4P3XA 4WY2A 3FXAA 2IT1A 3PYXA 3UENA 4D46A 4EJSB 2HBRA 1YA4A 1BXRA 1C1DA 3KKOA 3QV1A 2IW1A 1Q0QA 2WI8A 2MT9A 1T4CA 3BKWA 3MPUA 5CVCA 1WWKA 5D3KA 2D1FA 1UKEA 2CHFA 3AJDA 3OPMA 2ZYIA 4DA7A 1V4NA 4BLSA 2ZVPX 2H1LA 1F8UA 4RDCA 3NJRA 2UXBB 2BUBA 1X7XB 4TS1A 2EFCB 1BEZA 1O96A 5HK8A 5A9SB 3VTZA 1BEUB 4KQMA 2DR0A 3WDMA 4DYDA 2HSGA 2NNLD 3IVAA 5DFAA 5HBRA 4DABA 2OLJA 3B1KA 4F45A 4PCLA 1JQKA 1HQDA 3H9GA 3KL2A 5BN1A 3WFIA 5ALIA 1XFDA 1NQ5A 3A2NA 4J7AA 4QWWA 2Q5FA 4D2IA 3A1CA 1XHFA 1JR6A 3KTAA 3LQKA 2WUDA 3ANXA 3CZPA 4D44A 4MUXA 2WG2A 1HE8B 2F43B 1B15A 4MLDA 3NDRA 4DCGA 2FAXA 3DAFA 4M49A 3LHDA 1MO2A 5K3DA 4DGSA 1HORA 4K9RA 4DZTA 3D6UA 5HGXA 1V6SA 3T3GA 3QF7A 2G5TA 5JBNA 2XZPA 5E4JA 2QB5A 2CXQA 2ZJ2A 3G3EA 4JSRA 3WWOA 2ZRFA 3JRWA 1E2DA 2DHCA 2H8GA 3BH0A 5BN4B 4W5NA 1TYAE 4QBFA 3Q7QA 3Q3EA 4AQYB 2C5SA 1NTRA 4GOOD 2I54A 2VJQA 4MKFA 1HE4A 1P77A 1UBEA 4ZYZA 1VJTA 2HA2A 1EUYA 4XWTA 5CPFA 5FUXA 4I3GA 4B83A 2ZIXB 1TEZA 1F1BA 3YASA 3FCEA 4Q1DA 4D96A 2FVYA 3NC1C 3NTQA 4HDSB 3KJEA 4I4TB 4RK4A 1GQSA 5JH7A 4G37A 3ZQ4A 4R1PA 1EYZA 4UNSA 3IQZA 4RHEA 4EO4A 1HA3A 3NTUA 3LK6A 4H7FA 3NBMA 1WKCA 4NABA 4EA7A 3OJOA 4KGDA 5DNDA 3GN2A 1VMIA 2QR5A 1G6Q1 2W2LA 3GUCA 3WZ2A 2VZ9A 3MOGA 3LQ2A 5BWNA 3RRYA 3A1DA 2IHKA 4H6WA 1XZQA 3R6TA 2YWFA 4UHDA 4YRTA 2QL9A 3K05A 4H16A 4GBMA 5LBIA 1SOUA 1O58A 2IY8A 2QTVB 5E3IA 4IEIA 2I3AA 3RTEA 4EY8A 5KHLB 1K2VN 1TRKA 2XYGA 5T4BA 2Z4SA 1SXJC 2WIGA 4NL4H 1II8B 2C5GA 3JQDA 2XBMA 4YQEA 1O3YA 2C4TA 1RXYA 4QOFA 1KEKA 1MDBA 3H9UA 4F3KA 5BR7A 5C1BA 3I5YA 3BUSA 1K6EA 1A9TA 1L7EA 1HL7A 1WLYA 2VCYA 1EA7A 2Y2VA 4KXMA 1QE5A 4PRLA 5AMXA 2BMJA 1BCRA 1EWRA 1KFJB 4YEDA 1TL7C 4MQEB 4JCOA 3U6KA 4CU5A 1C5KA 5D85A 2RIRA 4F6RA 4A0FA 2RC5A 3VR4H 4XM1A 2E3JA 4WZBB 3L0YA 1MRNA 1EWTA 1CY4A 2H54A 3LQQA 5HJ7A 2TSYB 2XDWA 1Y1RA 4INZA 1D1PA 1YGPA 2WF9A 2WU4A 2Y6VA 2WYOA 3DBOB 3DDHA 3UCEA 3ZZTA 1J8MF 1F12A 1THZA 4IJ5A 1F6DA 2J4DA 3IC5A 4KR7A 4ZOLB 2Q9CA 1UDRA 4NEGA 2ZREA 3MYYA 4Y18A 4B2YA 3UGQA 3I0ZA 5CK5A 5D87A 5DTQA 3U2QA 4QTTB 4X64B 2Y92A 5C35A 4YREA 5LZ8A 3J81A 2JFWA 3VR4A 1T9GR 3OESA 2UU9B 1DEXA 4V0QA 4P83A 5ALPA 3K16A 4EPYA 3PFWO 1ZD5A 2KW5A 4QXQA 4FONA 4UDXX 5EQTA 5K3CA 1FTSA 4CJXA 2PT5A 1QHYA 2F3TA 2VYVA 4NMXB 4C0BA 1C7JA 3KT8A 3U3MA 3KX2A 2RGEA 4WKBA 2IYQA 5DIFA 1NMSA 7GPBA 1GZ6A 1WY7A 3T7IA 3DDWA 4OY3A 2XB6A 4EENA 1WABA 1EFUA 4HVCA 4HTFB 1OE0A 1KO4A 3AL3A 3UAWA 4NFHA 5F7OA 1WO8A 1ARZA 3RS8A 1A69A 3K9HA 4KMSA 1I6WA 4O4HB 5DM70 2VL7A 4RD4A 5HOEA 3RD5A 2RJNA 2Q2WA 3BTUA 3H9QA 1P1IA 1VGQA 3IELA 5FTKA 4LZAA 3SVLA 3TE7A 4NZOA 1EK0A 5IM4A 1IBRA 1Y6RA 3G8DA 3TLKA 4C0JA 4CKCB 1JJBA 4K9OA 4PYNA 3ZOKA 1K97A 3RFUA 2PK3A 2I34A 2XUKA 4OX9Y 4AQ7A 2QPTA 1QH1A 1JP7A 3KOWA 3O91A 1M1YB 1O97C 4FDLA 4M38A 2EDAA 4MI6A 1VCOA 3HP1A 2B94A 2BGLA 2C3OA 3BL5A 1JVSA 1HEUA 2HXYA 2JFQA 2XWBF 2PMBA 3O4VA 1FP4A 1KFBB 2PO5A 4PM4A 1ULTA 2CE2X 2B4TO 1O9BA 1WDTA 2C4VA 4I1PA 5LNK1 1QQTA 2OOKA 1E4EB 1VCHA 2PMKA 1PT6A 4L74A 3HXLA 4P4SB 2FX5A 2FETA 3VO1A 4AY5A 3OJ0A 3PC4A 3R20A 2HWYA 2QF7A 3I12A 1E62A 3LXUX 4I9GA 3IPAA 3DOFA 5CW1A 2YN2A 2AW5A 2GAAA 3AFHA 4DXHA 4A0HA 2IUFA 4MPPA 4BMXA 5ADWA 4YRBA 1QVRA 4WGGA 3FZEA 1UWLA 1CJBA 4KFSA 4E1AA 1I7LA 2HLPA 1H2RS 1LX6A 1XRQA 2P6PA 2W7TA 3L05A 2MSCB 5ALUA 4I1RA 5GAJA 3IXQA 5L51A 2JFGA 1KQGA 4LGMA 4NBVA 5BSUA 3E7DA 3CLHA 5HKAA 4A0GA 3I6ZA 3AHHA 4Q1BA 3L6DA 3R76A 2HSWA 1VL2A 4MVJH 1RBYA 2IXGA 2R60A 2IK8A 2QSZA 1H1LB 4K6CA 1UANA 3F9CA 4ZHQF 4XFDA 1MUUA 1Q6YA 1PJCA 3AUFA 2FOXA 3QTTA 1Y3CE 3ES9A 1YO6A 5EHQA 2BDTA 3GLSA 1WCXA 4JC4A 4R1TA 2FZEA 1CUAA 1IULA 1D6NA 1YU9A 3U49A 1X1RA 4YJ3F 4Q9HA 2WP8J 2DETA 1AKQA 1EKXA 2GM4A 4LGCA 2HIAA 4C5AA 3HLKA 1C2YA 1MFZA 3D7LA 2AZMA 1YR1A 5CVTA 2DP4E 2WT9A 3D81A 1X7HA 2I67A 4CZ2A 3OEHD 4F4JA 4KXVA 4EJMA 1EJ6A 1UEJA 1K98A 3ZV6A 5K0ZA 1GPUA 5A02A 1E6KA 5K1ZA 3TVTA 1N5KA 1I32A 1FSSA 1KO8A 1Z29A 1UKYA 2WM8A 3C15C 3X1JA 2CDRA 1XNHA 2H0RA 2JBHA 3KWMA 3OQ1A 4FGUA 1BW9A 1TMKA 1WPXA 2DPGA 2UYGA 3CONA 4S2UA 3TZHA 4L6AA 5H7XA 5DM4A 1E1DA 1YXMA 5IT4A 1SVWA 4HGZA 2B4YA 1TDJA 2QP9X 4H0NA 3JAWA 4R16A 5CYOA 4ZCRA 3MWLA 5HW0A 2EHJA 3EYWA 3TLGB 2A9PA 3D8BA 4B71A 2QW0X 5AXAA 5CXUA 1D6SA 1YHNA 2GD1O 3HB7A 3DO5A 4RF2A 1Q16A 4S0XA 3U80A 3UF0A 1U7TA 5AUOB 5JO0A 1IZ0A 4IMRA 1U2RA 5TGZA 3OVMA 2QU7A 1NI5A 1NI4A 3KWFA 1XZNA 4UNIA 3PRKE 1DKUA 1U6JA 1C9JA 5E4YA 4ZOQI 3RYCB 3AY6A 3EC7A 4RD1A 4WH0A 3QQ5A 3OH8A 2P11A 5B3AA 4XX0A 1JA1A 1HOTA 2QJFA 1QRSA 4I50F 1Q1BA 2X76A 5K8IA 3PXXA 1E89A 4D8WA 1EEHA 521PA 4DQUA 2Y68A 1Q0RA 4UTPA 3GLHA 3LMKA 3PDHA 1HC7A 1K9SA 3SD7A 1Z47A 3E0QA 3A6DA 3TRHA 5DGXA 3W2TA 1PD0A 2G36A 4IS2A 4EKNB 3ZHUA 2H7XA 3WXMA 2QTHA 5GONA 3S2EA 3VSEA 1Q7TA 4B4KA 2PX5A 3BMXA 4F1KA 5FWYA 3HRHA 5IFKA 2DBYA 3OIDA 5NLLA 3HYCA 3ABZA 5AVOA 2NVOA 5BSVA 4KB5A 4E7OA 2YZNA 4YQYA 4BNXA 1R64A 1T4GA 4D8XA 1GGEA 3OPQA 5KMGB 1A2BA 3DMTA 4Y2QA 1P4JA 3T61A 1MB3A 2GBIA 3KQTA 2GARA 4NCXA 4RTMA 1KDVA 4E5PA 1P5ZB 4JBLA 5KKCA 2P4UA 4FYPA 3MWDA 2W71A 3HLTA 1G3QA 3G5MA 4UCFA 2QW8A 2OO3A 2WTBA 1O94D 2IYAA 1TW2A 3FCXA 1X0VA 4UCQA 4LE0A 5D01A 5K9ZA 3QF4A 2DLCX 4D4GA 1FFXA 2WLSA 4PSUA 4K7JA 5J4HA 3HCCA 1RAIA 5TT0A 3FSEA 3HCAA 1MO6A 2ACVA 4BBZA 3TOVA 5JD5A 2ZSAA 2GCOB 3FNBA 3SNHA 4EPXA 1KRXA 1T35A 1YMVA 1GPYA 2ZJ4A 3PQ8A 4LBYA 5E95A 2RGCA 5HUQA 4RKFA 4EX7A 4FU0A 1KZ6A 4D4MA 1N6KA 2GEKA 4XLLA 1N9GA 1ZN7A 3F6EX 4AK9A 1N6LA 1DWUA 4Q03A 1MD9A 1RQRA 3LZ6A 4CM3A 4R8MA 3TBKA 2ZCJA 3WMEA 1GARA 1O9HA 2AI3A 3D54D 5DLPA 5LM3A 4IV0A 5DCLA 1U0BB 1HTTA 3SWWA 5JXHA 2W6MA 3L8EA 2HLDA 5JVDB 3CPSA 1F2DA 1TMYA 4IJWA 1ZONA 3LY9A 3GEIA 2H31A 2W0MA 1K6XA 1SEVA 3CA8A 3EQ6A 4MCJA 1X6VA 4OUDB 4B3DA 1MQ9A 3C7CB 2OFWA 2YV3A 3D1VA 5I51A 1JEOA 4H0CA 2HF8A 1CRPA 2HV9A 1XP8A 2P0YA 3ZI0A 2IH5A 4JV5B 1ORVA 3AU8A 2PYIA 3GA0A 3HPQA 4KNVA 4KRGA 4OLHA 3GUHA 4TTQA 2KBFA 3UB3A 2PRKA 1X42A 5AW6A 2IHUA 1PJBA 3GQBA 3PENA 4N40A 5K0CA 1KVUA 4UREA 1ST3A 2WKSA 4ZQBA 3LF1A 3CPEA 1XPJA 2QMOA 4D9GA 2FP3A 1LGYA 2YJ3A 3EEFA 3M9LA 4E5UA 5KC8A 5KS2A 3RVQA 3NG1A 2OUIA 2BFFA 1EDOA 1BXRB 4JVNA 4X20A 1SCKA 4Y0VA 1KSFX 4UOEA 3U1VA 2AD1A 1QBGA 2YMMA 4NECA 1KOLA 1GNSA 3K8ZA 3VX3A 1U0FA 2CB0A 4WY5A 4ZYYA 2ZWVA 5B3KA 1AH2A 1FDIA 3L7MA 3VTKA 2ZI6A 3FPLA 2PEYA 3GNQA 2H4HA 1M1UA 2Q1UA 4LNHA 4BAGA 1N8SA 3FHLA 4IIJF 4NZ9A 4YR9A 4LJYA 1PZNA 1G0NA 1O96B 3MUFA 2V58A 3OOYA 2GERA 1J49A 1AY0A 1BS2A 2JFNA 2IP2A 3HMKA 1FMLA 5AKXA 4YMWA 1RJ9A 1MB0A 4CKXA 2GN0A 4OI4A 4C4XA 2GEBA 3RVRA 2QVLA 5FRDA 5J1TB 1Z37A 5LOVA 4DIBA 1AV6A 2EQ5A 1Q15A 4JX9A 2EJWA 3GVIA 3TJMA 1YMUA 5FX2A 5B57C 3SNKA 4QVKA 3KK0A 4IOMA 4DCVA 4JI0B 1NX6A 3ZKAA 2AUMA 2X8JA 2BEJA 3AF5A 1E2EA 2P27A 3C85A 4QYIA 3O8NA 3U5TA 4Q3NA 3R9XA 1EH5A 3KHUA 2XTJA 2ZVDA 3NKLA 3O95A 4Q02A 4HXYA 3W7BA 3H4TA 3G7SA 1MQSA 2RHRA 4E5KA 3TMAA 3LS2A 3KOOA 3ZBPA 4WLOA 5A3QA 3ND6A 1WXXA 4C0WA 3BXGA 3MT8A 4E70A 1ZUWA 2BH2A 2J0UA 4KI7A 4N1AA 5TMPA 3F73A 1E2JA 2Y99A 1OI4A 2R65A 1ADGA 2AN3A 2FWRA 1QAOA 4FJ0A 4IHAA 2IELA 1XFAA 1N3BA 1NLYA 4U2KA 1FDOA 1K08A 2GFQA 4U00A 3PI7A 4N12A 2X8AA 3SIRA 3AHCA 3AW8A 2Q3JA 1WNFA 1BSVA 3JV7A 3IV6A 4F71A 5GINE 1M34E 3E61A 1SELA 4DIDA 2HQRA 4B40A 3NHSA 2VLBA 3SS8A 3K6RA 3F6SA 5EPOA 4G4JA 2XX3A 1J0AA 1TVMA 2HU8A 3HFRA 3O82A 7REQA 2QVGA 2PMFA 3AHEA 1DXOA 3AKZA 2NG1A 1I4EB 1FDWA 2OMKA 4RVFA 1TF2A 4YUYA 1TTHA 3DE7X 2VSOA 3OZTA 2PLRA 2DSNA 1QR2A 2XLBA 5AVSA 1XA3A 1KMHA 3B53X 3ACDA 3P9RA 5JD6A 2Q3LA 3JR3A 3RHSA 8MHTA 3V8VA 4IUYA 2OV4A 2E6KA 1ONOA 1V3UA 4B45A 2XRFA 4P31A 2FZVA 4AJ4A 4AECA 3PX3A 3KZOA 1R0WA 1HLGA 3WGYA 2YY7A 3RVPA 2JFOA 1WUTA 4DCTA 1WBJB 5DBOA 2O2YA 4JOSA 2QT0A 4Y2HA 4KWEA 1BCRB 1U3CA 1ZLYA 2I2CA 1FMJA 3DEKA 4LJRA 1KL7A 5IJAA 2FEAA 2XT9A 1F8FA 1SGWA 1TTQB 5LA6A 1VHWA 3S8MA 5HKKD 3P71T 2J6HA 2OORC 5D1NA 2QD1A 5C7IO 3OI7A 4NRDA 1DBWA 3R7BA 4FX2A 4TUYA 4GXNA 2AF3C 4QBHA 3OFND 1NMEA 2VJCA 3W6PA 4ODIA 3MCZA 4QTXA 1E2HA 4GVLA 4A2CA 4TWBA 3AV0B 3FUXA 2R79A 3KOUA 4K28A 4NCNA 2DULA 3AETA 5AJUA 2XUIA 4G5FA 1T2VA 3LG2A 2YH2A 4ZVMA 3AYXB 5CT4A 4E4YA 1SD1A 1Q0LA 2ZKLA 1X9GA 4M3NA 1G16A 4UKDA 5CM9C 3TL2A 2NXWA 1L4YA 3L0DA 4NAVA 5DNVA 1FXUA 2LCQA 5GVSA 2IC5A 1OH6A 2VATA 4J2OA 2OE2A 4UAVA 1A95A 2NZ2A 3A6HA 1RYHA 4MKGA 3RC7A 5DYTA 3RG8A 3IODA 3UJ7A 2GGSA 2V6FA 3B3QA 4ESHA 4GOMD 4F7WA 2A9FA 3U31A 4RF3A 2NXJA 1A5ZA 3IHLA 5FPYA 5HFJA 3CVYA 3MGKA 3M6MD 2ZQ5A 3BWMA 4JT8A 1CULC 1UXIA 3BX1A 4MJ7A 4CLRB 3OQNA 1SBHA 1UDXA 4L5BA 2ZDQA 4JI3B 4EHLA 5JU6A 5AHOA 2ERXA 2R00C 1N2XA 1PDVA 3GEPA 2I6UA 1KF0A 5DASA 3SI7A 2W42A 2P1RA 4A36A 3NNNA 4C06A 2XB2A 5EIFA 2Q8PA 5G40A 3M4NA 4CMKA 1JRLA 5A05A 3N07A 3ZXSA 4A8PA 1OBCA 1QH1B 3GQVA 2PKQP 3NEAA 3STUA 1RWXA 3OQIA 1UP6A 3B6IA 4YT8A 2JFHA 4WK4B 1Y82A 3GBSA 4DLWA 1CNFA 4EJ0A 1FP4B 3B3GA 5HJEA 4R2XA 1TMOA 2OFXA 3G2JA 4P5PA 5D5PA 4QE3A 4CDGA 5TT1A 2BCGY 2MOKA 4QC2A 2CK3D 5DCUA 1KYXA 1X38A 3OHSX 3WS7A 4NBRA 2P5SA 4B7AA 5A4IS 1FX1A 1GL3A 4FYMA 4EK9A 3UK0A 1RWNA 2QD4A 1T8SA 4Q82A 3BORA 4PLTA 2VDLB 3WXBA 1JDSA 1XYVA 3C98A 3W06A 4F93B 1U5BB 2VSQA 1LPMA 1ZNZA 2AE1A 4HDCA 3EVEA 5IASA 4PNPA 1XNJA 3HN7A 4W9RA 1J2JA 4DG8A 4LRXA 5BQ5A 3HU5A 1QLWA 3FHOA 1FNBA 4GDMA 4OSOA 4A2QA 3L6RA 3PP8A 3R23A 2JLXA 3IIKA 4LEIA 3OCYA 4BMCA 4UXHA 5K8TA 2HK8A 5KVCA 2JPDA 2FWJA 1RLMA 1Z2PX 1FRQA 1KOFA 2FUKA 2VHYA 3U9TA 2PT9A 4PBSA 2PXHA 2OXCA 1SC6A 5AXCA 3X1XA 1N2SA 4BP9A 2A3RA 5JPIA 5JZOA 3DM9B 5CB8A 1JLSA 5F77A 1G19A 5B2FA 5C7LO 1NG1A 2CL7X 4H7JA 4ZAFA 4CVNA 1NE7A 3AFGA 4KDRA 1A8HA 1B6GA 1FFAA 2NYAA 3CZ4A 3N2IA 1SQSA 4EY4A 4D99A 4GOJA 1X15A 3T0FA 1PBNA 3Q15C 3EUFA 4Y9SA 4AIIA 2ZTVA 3G1WA 3G0IA 3CZRA 4JP8A 5DXFA 3RYFA 1Q0SA 4N5NA 2UKDA 4AJIA 4OBXA 4GS5A 1NU8A 3B7WA 3O83A 3D8HA 4O1MA 2OCIA 4KLRA 4RF4A 5LQSA 3WJ1A 1PJSA 1PG2A 4S05A 3DNPA 1BW9B 2NUPB 1UAAA 3DLIA 3KHKA 3MAGA 4BC1A 1KY2A 1VSQA 4J29A 4D42A 4EKGA 3NU1A 1RYDA 2OCGA 1TVEA 4ZHSA 1XVUA 2EDCA 5E9JA 2P6RA 1GZ5A 3LGXA 2Y1WA 5IWAB 2YJTD 3UJAA 4CDRA 4ESOA 3NHWA 2VBGA 2C3UA 1BVYF 4CM7A 1Y6QA 2F55A 1SCUB 4IY1A 4MXDA 3W8RA 1ZK4A 2Y0BA 4J6FA 1QGOA 3NAMA 1NI4B 2XVXA 1DC4A 5FUVA 1KK2A 1KAMA 5KJ6A 3C3PA 4XVUA 5EEGA 821PA 4M7RA 4D79A 4BGDA 2FW9A 1G38A 4XX0B 2J3LA 3RVNA 3GDGA 4ZYVA 5DK6A 2Z0MA 4KE7A 4GBGA 3KOMA 4I55A 3AL2A 3E9EA 4NYIQ 4DNXA 4GO1A 1X2EA 3M34A 3EDYA 4LZWA 5KTRA 3QTLA 3AX6A 1L5QA 3R44A 3WHIA 2DWQA 1GXSA 2CL6X 4MICA 3KJZA 3NHPA 3GPDG 5GONB 2RHWA 1Y9ZA 4KOEC 1E3WA 4KXNA 3E9MA 3ISVA 1GEEA 4G24A 1HT1E 1UC5B 1UBMS 3U4DA 5KX5A 1ZMTA 2G04A 2QAGC 2DQ4A 5DTJA 1DTEA 3ZDFA 5J4KA 3ME5A 4IWXA 1DEOA 2QZPA 3RUFA 1IUOA 1P7PA 2G28A 1BWQA 4K1XA 1LZLA 3D0RA 1OLOA 5FFNA 1DX6A 3VH3A 4B76A 3HR7A 3E9QA 1PKXA 3OKCA 4UBNA 4X60A 1W76A 3MWDB 4HB3A 2PCLA 4BZQA 4CDNA 3TIGA 2E4ZA 4E31A 2NXNA 4G97A 4O63O 4QO8A 1IBKB 4OJKA 2QQ0A 1B8PA 4I7EA 4P0PB 1FSZA 1RWKA 4MW1A 1XIVA 4XIIA 4UPEA 4Q3CA 3HO1A 3B6KA 4KQEA 3ZLBA 5U9CA 1BWPA 2GF2A 3THSA 1PZEA 3QVXA 5F23A 4TMFA 3UY4A 1C1HA 1N9GB 2G77B 4EF6A 3H11B 1U1CA 3HVUA 4I5GA 1VE1A 1COZA 3WISA 3BMQB 1YJ5A 1JHPA 1PTKA 1H6DA 1XVLA 1Z2AA 3HABA 4KQIA 3PIRA 4MUMA 1CR6A 1LPPA 3AYZB 5AUQA 1ZHFA 1V25A 4EVQA 4YB8A 5D3ZA 2EQAA 4YRDA 4K26A 2H2AA 4GZ6A 5CYFA 3M5WA 2ZE6A 2WAAA 3E03A 4KV9A 3N8IA 1YZYA 4OHYA 2DB3A 2YX1A 2PX4A 1L4EA 4Q9LA 4TMKA 1RCUA 2Z2XA 1TO6A 2ATEA 1AHNA 2Q3BA 4V1CA 3IERA 3DLHA 1FU8A 3PQ7A 1KEUA 1H1DA 3SM9A 1G3UA 4WT7A 1W48A 2JLWA 1YF3A 3OLWA 5AWFC 3J7TA 3QKUA 1MXHA 3LWBA 4PC1A 5C0OE 4QTYA 3AMVA 3LE8A 1B0ZA 2GEFA 3CUVA 1CKEA 1E6WA 1N25A 4HJRA 2M6SA 1C3VA 4MMZB 5DHSA 1NUHA 2LKCA 2HU7A 1XLTA 3KRTA 3GQBB 5E7QA 1W9HA 1V5GA 4RJJA 3WIUA 1XN4A 4GWLA 5HQTA 5JV5A 2X9GA 4CQNA 4MEAA 1BX0A 1SU8A 2WSSD 4JKIA 1Z0JA 3JVEA 3V1YA 4HYTA 1ZFNA 3KKEA 1JAXA 2GZSA 4G1MB 4OPMA 1II9A 4IIFA 4X20B 5FWAA 4YUZA 4X6YA 4FGJA 1PEDA 3RUIA 5LP6B 1WUYA 1A4IA 1P1BA 1T4BA 2ZI3A 3OEWA 4IJUA 4PTLA 2QTZA 3GG2A 4KYTA 4QUBA 4JXKA 3OHPA 1W88A 3R9IA 5F4ZA 3OECA 1ILWA 1JDUA 1R0ZA 2IHJA 3F6RA 2RAPA 2N9UA 1E63A 3ABOB 1Z9BA 3UJ3X 1RJ9B 2GI4A 1NNSA 1IHXA 2OB2A 3EFEA 2HIGA 1JG3A 4MGYR 2FN7A 1DUSA 2O0HA 2XLCA 3K9LA 4JSYA 4OQ4A 4RGYA 3SC2A 5LOVB 3TAXA 4YUVA 4OHOA 4B8ZA 2I7TA 3WSVA 1ZM9A 1PU2A 4BZWA 5D86A 5K7SA 1GUBA 4PZPA 3ZNOA 1TYDE 1CV2A 3LBHA 2X8JB 1OAOA 4QU5A 3I72A 3QBVA 4QUDA 3F7NA 3H99A 1CZHA 1IY9A 2B1IA 2OBNA 1UADA 4PAGA 5DJ5A 3U7QA 4DQDA 3H9EO 4MIYA 3D2BA 5A2GA 4I5IA 3TQIA 3FX2A 4QNRA 1SBTA 4BNLA 2D1QA 4TT3A 3ZEAA 1Z3IX 4H3VA 3CT6A 5HE9A 4ZP1A 4M87A 1PFVA 3W6OA 1YZLA 1NN3A 1SCDA 1T2DA 4FYKA 2DR2A 3M6FA 3IQEA 2ANBA 3H4VA 3VNQA 5AW4A 2J0UB 4MKXA 1GKKA 1O89A 1VLMA 5F7XA 1L7DA 3UBTA 2CFSA 2YQZA 2AX3A 3IHKA 3IP7A 5JBQA 2H5IA 3FKSA 3FPGA 3MK31 5EERA 1SVMA 3W1VA 3QE3A 2UZ3A 3D4IA 1P31A 4QJIA 5ELLA 5GJWC 1DOAA 1TC1A 3PGXA 4JMPA 3W2GA 4F3RA 4LQCA 2QMUA 2YN0A 1YIAA 1XDUA 4TKMA 5J9FA 2ZFUA 3LGSA 3VR3A 4J0HA 4P34A 2PUHA 4BGEA 5KNLA 4R81A 3ZS9A 4HGYA 3PT9A 3S4YA 1XZMA 2MWMA 2G80A 5KNCH 3LX8A 4RZSA 4GVXA 2RGBA 5KYVA 3DDZX 3AR8A 2FN3A 2W6JA 2Z9CA 3Q6IA 1Z68A 4F85A 1YE3A 3KZXA 3PQCA 1SZPA 1TGVA 4RQBA 1CIJA 4UHBA 1QAMA 1KK1A 3Q3IA 1Y3FE 5KYNA 4OXIA 4PHGA 4YDSA 5TC4A 3GJRA 2VJPA 2Q7OE 2XYVA 4HQNA 1YJAA 4RV9A 1I1NA 3N86A 1I0ZA 1T2UA 4CEIA 2H9AA 3SBXA 3V8MA 3QOFA 2ROQA 1FFEA 4B17A 3TGPA 2IIQA 3KR9A 3B20A 5K3AA 1YQ9A 2VDWA 1EWYA 2ID4A 2KMLA 3VU8A 4BYGA 1I5RA 3LYUA 4TVOA 4W6QA 1Z88A 1E1RD 1XAIA 2W4QA 2C2BA 1KS9A 1P7VA 1MJGM 2G07A 4F1WA 3EFBA 4TUYB 1ESNA 1N8KA 2R7NA 2XV1A 4ZCMA 1F2TA 1X1EA 1VE5A 4FKMA 2DERA 4H15A 2G1JA 4RACA 3W7VA 1ULZA 1F06A 3CEPB 2C5AA 3BIJA 3AETB 4J2TA 1GGJA 4LZZA 1WE2A 3HB5X 4YRCA 4BIMA 2PYZA 4AJKA 1L7XA 2HF2A 2O3SA 5HTOA 2NU7A 3VKHA 1B8VA 1E32A 4W7HA 5MHTA 2HYDA 3LPLA 3QELA 4NYIR 2B4KA 1O8CA 2PX2A 3A9SA 3AZOA 1J0EA 3UFXA 4RTLA 1NV9A 4B3TB 1GKYA 1P4GA 3P0RA 4DA0A 1Z5OA 5A6VA 2RCNA 3B1XA 1NPYA 1BVHA 2FMXA 2PJRA 3F9IA 1J9ZA 3NOOA 1MF7A 3QU7A 4ENWA 1Y9AA 2XB9A 1G3IA 3QKIA 1YFKA 5AYVA 1M10A 1DI0A 1E4OA 3VVBA 4LJAA 4QKQA 4R1NA 4FBGA 4FFLA 2HMUA 5T4EA 1HZJA 4U2GA 1AK2A 2DX7A 2FE4A 2DY0A 3G79A 1D8TA 3VV3A 1HYBA 1YS1X 5JNUA 1T36A 4G09A 2HT1A 4IDAA 1GFIA 3RIHA 1KZHA 4ZMBA 2ZATA 4JQZA 3DXZA 3DEFA 1Z73A 3I1YA 3V1UA 1PDOA 1UR5A 3PE6A 4X85A 4BMVA 4NIMA 4LFBB 4D0RA 4DHWA 1P9RA 2GSDA 1IN4A 2VPTA 4FGLA 5L9AA 3WQRA 1IQRA 3QUQA 4G5HA 5BYBA 1G0OA 3F90A 3RJTA 4YJKA 5GM1A 2ESRA 1IPFA 1ISMA 4HUJA 4OHRA 4RLQA 3D5TA 4YMSA 3EAQA 5ALMA 2B5WA 1F9EA 3A32A 3ANLA 1JSXA 1Q14A 2E4YA 4A9AA 3VUEA 1NW6A 1W85A 3NP7A 4G1VA 3TVDA 2PH1A 3K4PA 3B6JA 1QFZA 2PUJA 3NDBB 4OHFA 1YDGA 4D9IA 3CX6A 3OBIA 1PWEA 1W0JA 3ILHA 3IS3A 4FFVA 4G8CA 4NJOA 4UHCA 3QOWA 4DUGA 2BP7A 4BO0A 3TDKA 5CFMA 3HUDA 3MMPA 3GNLA 4AZVA 1P2GA 3WDLA 2IVZA 3T4XA 5HIAA 3OQMA 1XCLA 1EZ4A 1MKYA 1YFZA 1X7GA 4MYDA 4OVKA 4CV2A 2AJTA 4IQ8A 1E5VA 1EP1B 4KLAA 3MWJA 4Q4CA 3IURA 4P3YA 1SCQA 3DONA 3KVRA 4HDMA 3TNFA 4XXHA 1QCZA 3HKCB 4HAIA 4EPVA 3K15A 1ZMRA 1M1ZA 4FM9A 3LSTA 3KQMA 2Q4BA 3QLUA 4UBLA 2CDCA 3GD7A 5G1OA 4FYWA 5LMNB 5A5FA 3V7FA 1W47A 3FNEA 2YV4A 2YS6A 1W1UA 2G83A 4UM9D 2TYSB 3FR8A 4G0NA 4JFAA 3TTUA 4BLUA 3WTCA 3GOHA 4P33A 1X1BA 2X9QA 4BV2A 1LBHA 1NXPA 2P35A 3QXSA 1HLFA 1R6DA 2FW8A 2W48A 3R6DA 1VPLA 4K6MA 3LW8A 2GPSA 5FJIA 2W43A 2VUHB 3IUPA 2O3QA 2NU8A 3C3DA 5FL3A 2YN4A 3QJ5A 4L51A 3THWA 2XITA 4BMPB 1GGMA 4E5NA 4PR0A 1VDMA 1TKAA 2XNSA 3GLUA 5K4AA 3RYFB 5MN6A 4U2FA 3DTVA 1JV2B 2R8ZA 1G64A 2LW7A 4IDOA 4PQGA 3PXDA 1CQZA 2A5DA 4HAWA 2IEBA 4BJ6A 4ETIA 2PIAA 5L3QA 3PNVA 3KAPA 4UARA 5COBA 5C1IA 4NCHA 4S04A 1E3DA 2D06A 3H1BA 4MAFA 3FUWA 4QICA 4E1VA 1XZAA 4RZUA 2BSXA 2BGGA 3BDVA 2WIBA 1MAVA 1NQWA 2V7GA 2NP6A 4OMCA 3BVPA 4TLCA 4JP5A 2QU8A 2H4YA 2GKGA 3KYCA 2EF1A 1RPJA 3LYLA 1E98A 3N1UA 4X54A 3SSAA 4RZ2A 3V8NA 4B87A 5G0TA 4RJLA 2WJJA 3ZU5A 1O5OA 4TL8A 1E2NA 4J8PA 4DDHA 4PQFA 3NDIA 3FCAA 5JC1A 1XA4A 4MUKA 2IW3A 3KEQA 3WL6A 1DAFA 1XJQA 4JGGA 4ENRA 3E7PA 2WM3A 4O8CA 1DO8A 2IY7A 1HE5A 1PR3A 1WDMA 4HVTA 4TS4A 1KVRA 4XQ0A 1FBNA 4L7QA 4RXUA 2OD7A 2AIRA 1DAHA 2WPDD 4IJVA 4HGRA 4N3NA 3FCYA 3EEQA 3FVQA 4HZIA 1BKSB 3SZMA 1U3GA 4LDNA 4WIAA 1IBSA 1KY5A 3RQIA 3C3KA 1FK8A 3O8DA 4OTZA 5E7JA 2X4GA 3R3JA 4YWHA 5DEOA 1AB6A 4R68A 4JLNA 3I8SA 2GZ3A 2LDBA 1CQWA 3O38A 3PNOA 4I99A 5EIBC 1RQXA 1L7OA 3CNQS 3OLVA 4YRPA 1KTVA 3IUMA 4A3SA 3IVGA 2GZDA 3GJ8A 4B9AA 5JZMA 4C6HA 2CLIB 2Z2JA 3N3BC 2I6QA 1U98A 3OETA 1VZ2A 2GPAA 4KI0A 3ITEA 4P92A 2QTTA 1PSDA 1IVYA 1FYWA 1GRCA 4EF4A 4MRVA 3DEAA 4TLDA 5IDVA 2VP6A 2FJUA 3ESXA 2IV7A 1JU3A 1T91A 1OLSA 3SJCA 2IBMA 4G1BA 5AUNB 3DMHA 2YR0A 4ACAA 1LRJA 2J4FA 5F98A 3K6JA 3G0HA 4KWIA 4C30A 2PXXA 1JPUA 1TLTA 4JQYA 4O2BF 2X0DA 5JISA 5EWJB 2O0LA 1O95C 5EJ7A 2ZI7A 1S2DA 3DCIA 1ZOOA 1WZEA 4PO1A 3NLLA 4GI1A 1MN6A 3DLAA 2A7QA 3WHLA 3HM9A 1Y1SA 3HKBA 3THYA 3RUAA 4D0SA 1SKYE 3C7DB 4JT2A 2Q3FA 1UIMA 2H0AA 2PSFA 3HE3A 1W73A 1H2ZA 1NATA 4JJ6A 4GSYA 4B4UA 4J4HA 3D2LA 5MF6A 5BUCA 3DE0X 4AXXA 2FPGA 1M2OA 3T1YB 1V2GA 2BN4A 2FZLA 2IEAA 5ICCA 3ITNA 1MJ5A 4K0RA 3RJ5A 1HEYA 1XJWA 5CB4A 5IFLA 1RNLA 5TQ2B 2O7QA 4F5ZA 4EJ6A 1UOQA 4RJIA 1RBQA 4W5JA 3NTOA 1K68A 2UVDA 5SICE 4V1CB 3EGXA 3NT5A 5JCOC 2G6TA 3GT4A 3ILSA 1BGVA 1G1MA 1XKTA 3OP1A 1IWPB 4NLLA 1VG8A 1Z2EA 3KJIA 1KETA 1WCYA 3SLRA 2VNAA 4XDYA 4MX8A 4JT9A 3QKWA 4JC0A 2FSFA 3NKVA 1PX2A 3CFYA 1V7QA 3FG9A 3IV7A 3P4UA 2W2PA 2ZSHA 3LO5A 3TBFA 1A9QA 3TSZA 1GTG1 1CY0A 1DG3A 1PUXA 2ZETA 3KZCA 4FIDA 4YJHA 5FLEX 3O7MA 1KGSA 1LW7A 2AEFA 4X44A 5AO9A 2HUNA 2C5LA 2G40A 4C3VA 2G8NA 3GFTA 3FJOA 3CKYA 4YCBA 1LTHR 5HRUA 2HBZA 1F2UB 5GV7A 4IHJA 5EJ9A 5T7BA 2D74A 4U3JA 1O94C 4DQXA 4IM7A 2CHVA 3E9ZA 1FX0B 1RBMA 3TL6A 2V7VA 1U3UA 1EK1A 3DZCA 4J7XA 4LMRA 4UVGA 5F7JA 3KPJA 1N2EA 2LIVA 5DYYA 1YR9A 2VF7A 3H0KA 3RSCA 3WKEA 1B73A 2G67A 2P6OA 5JATA 2XB4A 4UTOA 3HRKA 1Z56C 2W2LD 1P2BA 1I5OA 1AQLA 1XWFA 2AI2A 1ISJA 1TUGA 3N53A 2YXEA 4G9GA 4D0NA 5EKXA 4WXEA 2A9JA 1ZM2A 4NOKA 2C2OA 1W4LA 4QBKA 5AI9A 1K1EA 3KLBA 4UAUA 2IHVA 2UYQA 3GBVA 1XL1A 3TTTA 1JJFA 1I0LA 3OX4A 2XIJA 4WZZA 1O2DA 3PC8C 4YFYA 2PKWA 2FEMA 2YUIA 4WKGA 5FQOA 3GIWA 1ZC4A 1ZU4A 3IFSA 1C0KA 1XCBA 3ZYCA 4C1BA 5I8ZA 2KPOA 2AC2A 2G4CA 7MDHA 4UPDA 2DTXA 2VRCA 4O5AA 2VQDA 1JZTA 4UJ5A 3WHKA 4G0PA 5HIKA 2WTAA 2HQSA 4GX1A 4M98A 3QXCA 1B0UA 5JDIA 4CXMA 1HT3A 3F46A 5KTYA 3WQBA 1KI4A 4CR6A 1Y4ZA 3IOEA 5FLXA 3L1VA 5B4UA 4YGYA 3HJGA 3GRYA 4Y9RA 4DDWA 1TUBA 4FSHA 4ZDKA 4XWYA 2HU5A 1XD2A 3O93A 3GNTA 3BFXA 1MTZA 1NW5A 2VVTA 3NHJA 5KTSA 4KNYA 4H7HA 2I6GA 4YECA 2OM6A 3WYNA 2IOFA 3ZUGA 4DEXA 2FN8A 1H2WA 4GHWA 5E6SA 4RA6A 1ZPDA 4A0SA 3BF7A 5SYNA 4JZKA 2O5CA 2VTVA 3C43A 4E6EA 3RIGA 3OKPA 4A5OA 3NPAA 3VR4D 2CNKA 2X41A 4ARCA 2NTNA 2POCA 2ZSFA 4PG7A 1YRYE 1H6CA 4OEHA 5KHAA 4BTLA 3RUDA 1UBRS 1Z6XA 4LHZA 2FZCA 1T8RA 1C3EA 1WDKA 4TN1A 4JDPA 1ZJJA 3SXUA 4BC0A 4KAXA 5IXJA 3R3SA 4OUKX 2VYVD 4B3XA 1CXZA 3EIQA 1OVMA 4EVRA 5BNIA 2B5OA 1XCPA 2FU5C 5FAXA 1RWMA 1B16A 2AN5A 3LWZA 1J5EB 1PTJC 2PZBA 3NUQA 1W34A 1GU7A 3W6UA 4CEIB 1V1JA 1XZLA 2PPLA 3HVJA 1S2IA 1T3HA 4MP3A 4QFBA 3TLEA 1DJMA 4D0LB 2XBUA 2FN9A 2VDWB 4NF2A 4GVPA 2H7YA 2VDNB 1GAJA 3O4JA 4DIUA 3G2MA 4TLMB 1ULAA 2V7QA 2Q1YA 1ZGGA 3VISA 1PIWA 2P68A 4J43A 1VMDA 3CF4A 4HDAA 2OILA 2ID9A 1FP7A 3JRXA 4NNJA 2C7BA 3AB7A 1H0RA 3ED5A 4NZPA 3W5IA 3ZE0B 1U0HC 4FGZA 4OCZA 1RQPA 5AJWA 5C51B 2VHEA 3PQ3A 3ZIAD 2XRZA 4FYYA 5CURA 4BTEA 2GFHA 1SPXA 1JEEA 2OFOA 3ORRA 2VHZA 3ONFA 3PQEA 1T2NA 4D8VA 5LQJA 5FHRA 3QELB 4BFCA 3I92A 1KSHA 4Z0TA 1A4RA 2NZUG 2R7AA 2YVKA 3B9BA 1YU6A 5CTJA 3EK2A 3GXOA 2NSHA 3TMKA 2RHOA 3UFXB 4B46A 1B8OA 4P84A 5HJ2A 2GBCA 3LQ4A 2ZWAA 3C3CA 3V2IA 2NPIA 3CIOA 2R8EA 4DG9A 3GFGA 4REQA 1L1RA 1R2QA 1REQA 5B55A 1C3OA 1G7TA 2QN3A 5ENZA 3SSMA 1MX5A 3UJDA 2MSWA 5IULC 2CBGA 2F1HA 3E8SA 1JFFB 3ILYA 4IOKA 1QTRA 1GSHA 1T29A 3JALA 4PEVA 4P3OA 5FPSA 4DJAA 4YRNA 1FIUA 1ML3A 1SOWA 2BFWA 2B8EA 5CK4A 3SIPA 1E2FA 1GNTA 1IY8A 3GH3A 1Z6PA 3GDWA 4FDAA 2BONA 4R9SA 3KFVA 4LOJA 4FZRA 2NGRA 1NBME 4BFXA 2CDNA 4QRHA 3W5UA 3N59A 4PFJA 4EYOA 4ENTA 3DL2A 2JLZA 3EXAA 2QI9F 1GG5A 2ZB3A 1EE1A 1EVLA 4ND4A 3W1EA 4AO8A 1R8YA 3UKOA 2Q4OA 3IVXA 3R4VA 4HNGA 1V95A 4WEOA 3DMNA 1L8QA 1XNGA 3KV3O 1QGUA 5A6SA 5LWHA 3VO8A 1P2SA 3QX7A 3AY0A 3M81A 1N1MA 3PR2B 3PNQA 2GPTA 4IV5A 4W5WA 1G66A 2VPIA 5I7UA 3E22B 4QT0A 3QNUA 4KP7A 3FTEA 1D04A 4D9KA 5JI2E 1ZZGA 2QRGA 1J21A 2WJGA 4X94A 5D7NA 5KZMB 4ZGGA 4MVJD 1R9MA 1C81A 1U3DA 1RAGA 3TZ6A 1YBFA 2ZE8A 3GEGA 4C05A 3BL6A 3G17A 3PBKA 2CWDA 2ZYVX 3PFFA 3C8MA 1V1MA 1G18A 2BP7B 4IO1A 2G17A 4BE7B 1PT5A 1H2FA 4ZCTA 4AKIA 1OX5A 1RI2A 2IYWA 2OG2A 1UC8A 2PX6A 4RXMA 4D57A 1P1HA 3IUSA 2ZZNA 1XTPA 1GWNA 3BC1A 4X97A 2CJXA 4NOMA 2VRNA 3LCCA 2V7TA 4JYBA 3QE0A 4ZEWA 3TRFA 2DWUA 3T4PA 1XF9A 3N6VA 1LPSA 4HDMB 3R0VA 3FSGA 4PCAA 4QFCA 4L22A 2O52A 4TM7A 5DHQA 3S44A 1DAKA 3A9WA 4Q1EA 3C0KA 4QSHA 1XU9A 2FWMX 3EQ9A 1N2CE 3P9CA 4UDYX 3B1JA 1VSVA 1AKTA 3BMCA 2IGTA 2XEDA 3ZR4B 1QZXA 4Z49A 2QBYA 3EDCA 2P2DA 4UW9A 3HNRA 1ZEJA 1D0IA 3ESYA 3ZNQA 4PPQA 4D7AA 2ZUFA 1EBFA 1E2BA 3F4BA 5KYKA 1TJ4A 1SUSA 2GNPA 5ARCA 1MH1A 1UBKS 1Y8RA 2BM8A 2NV0A 2ORWA 5FUYA 3UXMA 5GMOA 3PYLA 1SB8A 1QFYA 2GZ2A 2Z9DA 1A97A 2REOA 3VJMA 2C9ZA 1YR2A 4JYAB 3HDJA 1X70A 3AF1A 2KLHA 3PVSA 4YP0A 5HIIA 4HLCA 2QQ5A 2RHTA 2O9JA 2NPOA 4FFDA 1H8HD 3THWB 1VB3A 1XK7A 1RYZA 4HDRA 3NDPA 3NWPA 3DTVB 4FE4A 4WBSA 4KAJA 4Q00A 2X40A 5HZGA 4V1CI 2BPOA 1N7HA 1WXFA 2PKCA 2W0SA 4E09A 3QUAA 5L3QB 2OCDA 1OU4A 3X1MA 1ECLA 1JIIA 5ALRA 4HO1X 3ESDA 3E84A 5EE3A 5FBVB 1N6PA 2OBYA 4ICIA 4ZEOA 1K7CA 1YUMA 2EFGA 4Y98A 2I4MA 3WRYA 3PCXA 3OZAA 3SX2A 3UCFA 2HMAA 2Y0PA 4B6FA 1UT8A 2EKLA 2NZYA 1CUEA 3KUKA 3CUYA 4DWOA 4GKKB 2TMGA 3VR6A 4COOA 4XTCS 4C0SA 1RMTA 4X7BA 1FZQA 2VK4A 2G09A 3BJMA 3C1OA 3R3VA 4Q9JA 4I0WB 3TX6A 1MJNA 3GFQA 2FKNA 2I1VB 2AQHA 1H6BA 2QUIA 3C6ZA 3I9OA 1XX6A 3DAHA 4HGPA 1H3NA 1IHYA 1E9RA 4TQGA 1HDGO 2QVBA 1UWVA 3CNLA 4NY1A 2P5UA 4XSHA 1LS6A 4CLDA 5I3ZA 2N42A 3F6PA 1JLMA 4RE5A 3S28A 5A3JA 1GZUA 3IAM1 3W78A 4B6PA 1RXSA 1N7IA 1T2CA 4W1RA 2CJWA 2AOVA 1AZLA 3DKVA 4RLSA 3FE2A 1J20A 2QVZX 4S0ZA 4Q9IA 3NASA 5FO0A 4CFZA 3MCTA 1C9DB 2GJAA 5IZCC 3L43A 2DRIA 1P33A 2EP7A 2YBEA 3ADOA 3H6HA 1HDOA 3O3MB 4GOKA 3VV2A 4E4TA 3NHKA 2DEUA 2JCYA 4A73A 2WFLA 3F3SA 4CTNA 3CLUC 1FQWA 4IJKA 3PNPA 3HDGA 5H3HA 3QU2A 3SIWA 2FDRA 1B7GO 1NVGA 1LXCA 1T9GS 2C9CA 2RD2A 4V0KA 3S1SA 3QEKA 2JLSA 1SRRA 1F14A 3PFHA 5EJEA 4G84A 1IOZA 1WRBA 4IF6A 2FXVA 4KBFA 4RABA 3VDMA 1M6HA 1LA2A 1QIIA 3CS3A 4BEBA 3B6MA 1U5AA 1SZJG 1Z45A 3M2PA 4JJFA 4L9AA 3NTVA 4TVBA 3KD2A 5IANA 1XJ0A 1OLSB 3K1JA 5JXWA 1ZXBA 5TGDA 4BRWA 2X4IA 3H9BA 4Q4JA 3EF1A 3F1KA 1UPFA 4LK2A 4M22A 4RORA 3V34A 1GDTA 1QG0A 2OV1A 1CVLA 4N01A 3UK2A 1GR1A 4M7PA 2ZE5A 1AS2A 1YI0A 1PFYA 2FWPA 1OC2A 3DWIA 3K96A 2VAMA 3LOUA 4O4LF 4AT1A 4F3CA 3W5BA 3ER8A 3GRFA 3BSSA 4PC7A 2VHWA 4EHJA 2WTUA 3THYB 1RJGA 1RE1A 4WBNF 3R7FA 3FHJA 3C6XA 1L1EA 4Q39A 3ZWKA 3GP5A 1K7XB 3JD1A 2ILVA 2P40A 5ECWA 3PUYA 3RS4A 3N6RA 4JDUA 2EL9A 5MN4A 1EUZA 2B36A 4RL4A 2XQIA 2OG1A 1DV2A 2FPGB 1I7NA 1M2OB 3CX4A 3F7OA 3MIIA 2AYYA 2AT1A 3SS7X 4CODB 4YAGA 1CUYA 3QRWA 2EIXA 3IESA 4G01B 1A04A 2PJDA 5CB4B 1PR0A 4YPFA 2ZUDA 5DGDA 4GMKA 5C8YF 2CHQA 4IO0A 5ALWA 5K8VA 2HCRA 3EGXB 5LUAA 2XD4A 1O77A 2VT2A 3QSGA 1VBKA 2IV2X 3U3JA 3VPDA 2HMWA 4PRYA 3SR4A 3V1MA 2D62A 1MX3A 1JVBA 1IIBA 4XQEA 5LUBA 4LRWA 1RHUA 2YWEA 1VGRA 3QVOA 3KFXA 3LHSA 4X24A 5JSQA 4H08A 2QI9C 3TZBA 2BE7A 4B2IA 3T7RA 5FKJA 4XGNA 1LD3A 2G6BA 4LJ4A 5FL7D 3RAEC 3CUUA 1EGHA 1FFYA 3H2ZA 3AOEC 1DWQA 1EHCA 1NAIA 2WINI 4B3MB 1VXOA 4UUNA 5AVQA 4FGSA 3KYJB 1GPKA 3OC0A 4TRMA 4IHJB 3KEOA 3TW4A 4U3JB 4K3UA 4AFNA 2GBPA 3Q9SA 3AVXA 3ZE6A 3ZHXA 1U7OA 4Y7CA 2QTAA 4BMDA 2HJGA 3OQJA 3TI9A 3F5FA 4MARA 2OM2A 1Z0KA 3LDFA 5DYGA 1T5IA 1W87A 3S2SA 4WWHA 5B7PA 2FPRA 4RIGA 4AKGA 5IJXA 1LJLA 1L8AA 2WV9A 3L6UA 4YGXB 5HK9A 3CRRA 2PY6A 2VHTA 4O2AF 1XMOB 2XPCA 1OWPA 4R6WA 4TZ6A 2PGDA 3O1HB 3DPIA 1E96A 2XOXA 2HU2A 2JANA 3BKXA 3DVLA 2CBZA 3K6KA 4KIJA 5JXIA 5GIOE 3B70A 1RKBA 3IQHX 1NBIA 2J67A 2WZQA 3CCCA 4JUIA 2I87A 4B6QA 4FHZA 5JT1A 2G1UA 1BC5A 4RSHA 4WJLA 3QEAZ 3F96A 3C4VA 4F2HA 6LDHA 1F3LA 4LXXA 3FOAA 1IRIA 3I9V1 3CVJA 2IS6A 1UBUS 3PEYA 1CY8A 5TQJA 3J81k 2A30A 1W30A 1GTL1 1RPTA 1UMKA 2P4HX 4PFQA 1DX9A 2JGKA 2R5NA 4LXYA 1ZISA 2YXLA 2WMNB 2ONKA 2Q5HA 4LYEA 1VL5A 1VL1A 4LHSA 4MYTA 4MW7A 2I0FA 4Q3OA 1KH3A 4IQ0A 3T4UA 2XYQA 4Y6RA 4Z0HO 3U3XA 2I2DA 2LR0A 1P3JA 4NDAA 1IK4A 1CUZA 1TUBB 2PZMA 2YW9A 1LRLA 1RXEA 1XD2B 3NHMA 3ONNA 3QLVC 4LNAA 4EABA 2IU6A 1DTSA 1PO7A 2J0SA 3IB6A 4GPBA 3ZK8A 4N7JA 4ID9A 4IYJA 2IUTA 5BUZA 1VMAA 1DXHA 3A3OA 5LMUB 1D2GA 4TZ0A 3CISA 3TLMA 3RSHA 5E9AA 2DLNA 4OQMA 1QGDA 3TZCA 4NBLA 4J9UE 3TZLA 4I8XA 3FJYA 2F17A 3GGGA 1SCAA 3DKRA 2QTGA 3JQFC 1NWCA 2C2KA 3A04A 1KJQA 4WZAA 5EMKA 2NU9B 3AIMA 4HLNA 2A78A 3ESRA 3JWJA 4DAEA 4ZDIA 1JR3A 3A7DA 5F33A 4M9ZA 3G23A 1BE0A 1KZ4A 4MQLA 3GBPA 3K92A 4BZPA 2QE7A 4J3JA 3SXUB 2GJ9A 1YQWA 3OZVA 3KDAA 5LQKA 1DKRA 2VZ0A 3CLTD 2YIJA 3GHHA 4NMHA 2H29A 2J9GA 3LYHA 3VFDA 1XELA 2NVWA 4CMBA 5KPDA 5G1NA 3CW8X 4O29A 3T5DA 4D4LA 3EGOA 3MXOA 1HLDA 2GD2A 3Q3CA 4ANFA 5BWBA 4S2EA 1DQZA 1W49A 3PFCA 5KYWA 4A16A 3TQSA 3OQPA 3EIWA 3WOVA 3MLEA 4LSWA 4KFRA 2Z4TA 3WLJA 4KDFA 5B2ZA 3G9ZA 2HSJA 1OHHD 4HPWA 1LI4A 1GQQA 1OU0A 3KVYA 3LPDA 3LDGA 1Q3KA 3OUTA 4F8JA 1QOPB 3A10A 2P6NA 1Q7RA 4FW9A 1KEEA 1XYYA 1H8EA 2AZDA 4P5DA 3R77A 5DHTA 4CCYB 3BEOA 1K8XB 1H66A 2QTNA 3E58A 1XVAA 5ESDA 3FCSB 4RIEA 4EHAA 3B78A 1Q1NA 2HJHA 3KB2A 5H02A 1CLEA 1QDEA 1C9EA 2C83A 3I64A 3Q10A 2XDQA 3ZC3A 1RQGA 2KBEA 4BVKA 3L8FA 4A7PA 3ADCA 1VE6A 1TD1A 2R9VA 3L46A 3OO1A 3RVMA 4M1TA 4ARZA 4BBJA 2QT1A 4YPOA 6CHYA 1PS9A 5IW8A 3EN0A 2WA2A 4GFDA 4N76A 1VJ5A 4QWMA 2WC1A 3Q11A 3QLTA 4I8IA 1XRLA 5DI3A 1EXVA 2IVFA 1QQAA 1FUEA 4DSAA 2Q28A 1QOQB 4REQB 2ZRJA 4ZC8A 2WJYA 1REQB 4G0VA 1C3OB 1RXUA 1W5AA 2NTYC 4LC9A 2O20A 5GPBA 2WM2A 3VC3A 5JMTA 2OLKA 1XTUA 5A0TA 4AYWA 2ZRGA 4KXLA 4L3OA 1XDWA 3IULA 1H93A 4OH1A 5C1PA 1USWA 3HA2A 2XRMA 4MDYA 2H2WA 4B85A 3Q0TA 4AJOA 1XTSA 1ZICA 2O3TA 3EVFA 5JMWA 1KSJA 3C5HA 3ORQA 1XKLA 2BVNA 4JP3A 2CXHA 1IZ9A 3UK6A 1AF4A 4RW0A 2FSHA 4LE1A 3SEAA 5K8CA 3ZHTA 3NB0A 1XQVA 4AZ0A 1NVDA 4BVLA 2QV7A 1I2AA 3LKVA 3I9KA 4G1CA 5A6SB 4X90A 3I1IA 4CMJA 4FN4A 4DCCA 1P3Y1 3RU3A 1ESDA 4OGGA 3ELBA 5JASA 2P6UA 2XKBA 2IYYA 3C3XA 2NZXA 3K72B 3T9DA 3LPCA 3ZHCA 3ZVKA 3NOVA 2JI6A 3OEYA 3R3YA 4OKNA 3Q8KA 1EBUA 2PUDA 2ZBFA 3BCSA 4LX0A 2BM0A 3Q1KA 5BYJA 1NUUA 2X8BA 4U7GA 1Z5VA 3JS5A 5JSUA 4A23A 1LF0A 3JU3A 1IRXA 5A62A 1X3LA 4YLYA 3C3EA 1V1MB 1TT5A 2OBMA 4N6GA 4DLKA 4DIEA 3PDIA 4MUAA 3STVA 1IOWA 3IR5A 2BKUA 2COKA 4L8GA 3TQCA 4UEOA 5ES4B 2VTEA 2VSXA 4M76B 3NM6B 3VKGA 3PEEA 1FTQA 4TTTS 3W8FA 4RUKA 1R6VA 5IKPA 2JS7A 3W3AA 5T57A 3PEWA 2CV0A 3CF2A 1HFJA 3D8NA 2FMTA 5C8ZA 1MVLA 5IWCA 1ZK0A 3MCVA 2AE2A 4NPHA 1Y6FA 1W6RA 2BUCA 1IPHA 1U8ZA 3DL7A 4EGQA 1XU4A 2CSUA 1ZH4A 3T1HB 1LPOA 2D0PB 5AI6A 1DEKA 2W2MA 2QG6A 3H13A 4YN3A 1FJHA 2AR7A 1F4VA 2P3OA 3CURA 3I2KA 3Q12A 4X45A 3RS3A 1THGA 1ZH6A 3MLBA 4BGUA 4OHWA 4PZLA 2OVBA 2JCBA 1FNMA 1UPUA 3ETCA 2PZLA 3IP3A 3UPDA 2C0PA 4O4JF 4ZYTA 1QF7A 2JEOA 1M0TA 2VN8A 5I9MA 4PCUA 3CZCA 4EUSA 2OGSA 4JBIA 1QWOA 1EGAA 2H51A 3BCRA 2GSWA 2OCPA 5CG2A 1ZEMA 4K9KA 1Y8RB 2FLVA 3D6JA 3E9RA 1ZMBA 3KIPA 3RRMA 4KL8S 1NMYA 2I6TA 2O8NA 1SKUA 1E79D 3PIIA 4RFVA 5KO2A 3UEOA 4HPXB 1IY2A 3HDHA 2PNJA 3KSRA 4FC7A 1XP5A 4ZA2A 3TQQA 3RBAA 2WSLA 5LR6A 1L7PA 1PL6A 3GPIA 5CFRA 3LSYA 4P7BA 3ZHRA 4EFKA 1FNDA 2H5EA 5K0EA 1RCFA 3L7OA 1KPIA 2PGAA 3FD8A 4FFOA 4A6PA 3C5CA 3O94A 5TEVA 3LHFA 3S7ZA 3RRZA 3ZY6A 1L4GA 5KVQA 3KJHA 3PQ4A 4ZU3A 1F51E 2AXNA 2OY0A 3G9UA 3UXEA 4RTQA 1HNXB 4MYRA 1O08A 1TM3E 1YAHA 2C7QA 3IBCA 4HXEB 3UOAB 1J25A 1PVDA 1WIWA 1GZ7A 1J0CA 2WAMA 3AR7A 3H7AA 5FNZA 2RB5A 3IPCA 3MNFA 3AK4A 4NS4A 1C30A 4YXWA 4B35A 1G59A 2FPLA 1TU4A 4KAAA 3IT3A 3ETGA 5FT9A 1UZMA 3OT4A 1HETA 4GSLA 4MHSA 1GKIA 2ZRMA 1IVNA 3EIXA 1V16A 4J4TA 1S3SA 3CRVA 4YMIA 3UK7A 2GNOA 4I1SA 4M88A 2EBHX 3CG0A 2YJ4A 3P9NA 1PJQA 1V11B 3ESBA 4EW3A 4TVKA 4AULA 2RAFA 4J2HA 4JEMA 4MROA 4O3FA 3MGAA 2HXGA 3KBBA 4QHSA 3K1TA 4ZMSA 2FPKA 4XWWA 2PUGA 3KYBA 5E6UA 3TFOA 1M73E 1MB9A 2IE8A 3FI0A 3EW7A 1NJ2A 1U4SA 4TS9A 2F62A 3GPBA 4CCSA 2A9QA 5CB6A 2GD6A 1AMUA 1URPA 3T7CA 2C7OA 3TAUA 4JBYA 1I30A 2RH4A 2PUBA 2PVPA 4AZWA 4XM2A 2Q99A 3CH6A 4PAWA 4S1VA 2CMGA 4NESA 3HN2A 2V7PA 4B3JA 1RLIA 4S1NA 4NEQA 4LSMA 5TDHA 4UXIA 1NASA 1S8AA 2GNAA 3W77A 2GO1A 2Y6UA 5A5EA 1WXEA 2DPMA 3I62A 2WFLB 4UU7A 3ZHBA 2PUAA 3ET5A 3ER6A 1MG5A 3HVRA 1VMEA 1MOSA 3A3NA 2OQVA 4IWNA 4DJEC 2F8TA 1SHKA 1QK4A 4XVRA 3WB9A 2ARKA 5IJ0A 1KXJA 1UBCA 1RYYA 3P20A 2BBWA 1BDMA 1LLUA 3W2IA 4R5HA 1GGKA 1K88A 3HK2A 3ZHZA 1L5OA 2RBGA 1QO0A 4PU0A 3ANNA 2FQXA 1NDQA 2EFJA 4Q4JB 3WK8A 4DZZA 3ZY3A 4E32A 5IVPA 1H0SA 1E7YA 3MAAC 2ZRHA 3N2GA 4BUJA 1UMBA 1RKVA 3FZQA 4HN2A 1WU7A 2BUAA 5CBPA 1TJ5A 1HEIA 1CP2A 1JTEA 3H5IA 4KH0A 5CEJA 3SP1A 4Q4AA 2CJFA 4JHLA 1U1EA 3ZZ1A 5HOQA 4MI1A 4LDPA 4UZSA 2ID7A 3RG2A 3L7IA 1Y63A 4JYMA 1NC1A 3S3TA 4S12A 3P96A 1E8NA 3ZY2A 2Z6QA 4AI6A 2VZLA 1SXIA 3CRZA 1LWOA 2PD3A 2X0JA 4U7FA 3K2QA 4XCXA 3DFFA 2ZGVA 4PONA 4FD2A 4OLFA 3MINA 1CY7A 3GR6A 2IZOA 4ZHQA 1XEWY 1MP0A 2TMDA 4DCUA 3F6BX 5EZSA 4MA4A 5CYGA 1T8WA 1TJNA 1W6UA 3FPCA 1JMYA 1LWNA 2HF9A 4JELA 1E9FA 4NAUA 4WW0A 3Q40A 4YJ3A 4C5BA 2PRJA 2O2GA 5K0SA 3BHMA 2CVOA 2RJOA 3PCTA 2QK4A 3QKSA 1ZGAA 2CW5A 1A50B 3KZ1E 2BJVA 4C08A 4IUCS 4TYNA 2Z56A 3BTOA 3OZXA 4CMEC 4HMOA 3T99A 3T8YA 2DH5A 4Q6BA 1C8BA 1BMDA 5WRFA 3KKPA 4JLUA 1U3TA 3PITA 1RM4A 3WHPA 4DQVA 2BBOA 4BE4A 3A9TA 3HG7A 4ZXFA 1EX9A 3BZWA 3DAPA 4KFTA 5K3BA 3JQPA 4M9XA 1R6XA 1VPTA 2QHXA 1NUPA 5J5VA 5JJCA 3V7NA 5JYCA 5KYXA 3WO0A 3GW8A 3D31A 3HP4A 2XDYA 2J09A 3RREA 5BQXA 2J9FA 1KYYA 2VRBA 2NQ8A 2AHOA 4PBRA 1E5TA 1T8YA 4MHTA 2XTMA 2ZSDA 4PIVA 1CUIA 3WWPA 2O48X 4XUGB 1YRHA 1PL7A 1OXUA 1Y34E 3KDSE 3KQPA 2JJYA 3L1JA 3FWZA 4MMXB 3KSZO 2IX3A 4DUZB 2ZIAA 4GPAA 4EFLA 2VYCA 2WKRA 2HN9A 4XYGA 4R2MA 3B82A 3EXFA 4W63A 5JPCA 1N77A 4G5GA 1HMPA 3SG0A 2E5WA 2VS1A 4JLMA 3AF4A 2I4LA 1W2GA 3QSYA 3IAAA 1Q91A 2DG2A 2XZTA 4MR9B 5LCXA 3WAKA 4BB6A 3MWEA 4F9TA 4XOUA 1KWKA 1ZM7A 1GYQA 2EX0A 4JEUA 3MWKA 3PEFA 4Y1EA 5IBPA 4IYRA 2LGJA 2OORA 4TPKA 5TLSA 1H2XA 3HKEA 4LGVA 3EW9A 5KNCD 3FUTA 3SDBA 3MHTA 1FFBA 1VHDA 4IL5A 1JT2A 3TCKA 1G3RA 1L5GB 4DCNA 3E81A 1E5LA 2DWCA 4MVJF 3WNCA 4PX5A 4BKUA 1ZBQA 3ROMA 1GPAA 1SWWA 3FAZA 3KB6A 5HIJA 4TROA 1AURA 1FF9A 3ADPA 3LT5A 3TQTA 2AX4A 1YZQA 1U7DA 1A9SA 1Z8FA 2L69A 1AQYA 3EVCA 2F8LA 1Y6JA 1ZUHA 3GDFA 3IJPA 4KODA 3AC0A 2Q27A 1UT6A 4B81A 4HQ6A 2FMHA 2Y71A 3EH2A 3H2BA 1GAWA 1ZCJA 4UFOA 2C5FA 3OUUA 1T4DA 3KAQA 3QPCA 3P2YA 2JGDA 3UMBA 1CQIA 1HUQA 2L42A 3ZWWA 5I3CA 2P4EA 4CN8A 2GEVA 4WZAB 4M8NE 1NVFA 2ZR7A 3IDZA 3VKVA 5KB3A 4Z3KA 1JT9A 5FDFA 1UBOS 1U3WA 2C84A 3DHYA 3WX0A 1DAOA 1HWYA 2NVUA 4M46A 3ESAA 3ROPA 1ZJ5A 3BD9A 3T1VA 3SZUA 3OF3A 1CUJA 4BQOA 5JQWA 2HDOA 2P78A 2XSZA 2JJMA 3QA9A 1L1FA 3UXYA 3ZK9A 1LQUA 2BSQA 2ODQA 2XMRA 3OOEA 4LGYA 3OAAA 4U1RA 2EZTA 2FF5A 2JGNA 3RT9A 5T6BA 4C4PA 1JR4A 2R00A 5KYWB 1KAEA 1M2FA 4W7IA 5JW6A 4KR6A 1MOQA 2CDBA 4AAYA 1P73A 4MWDA 5KQMA 1OREA 2UUBB 3CBGA 4IPTA 3C6MA 4GSKA 1YJCA 1ZH8A 2D00A 5F3RA 3L1KA 5DOVA 2Z8XA 3IBYA 4RQTA 3AINA 4PX3A 4RMNA 4RTOA 2C8JA 2B30A 1OH5A 3CLVA 3MSCA 3WGJA 1FP6A 4FT4A 4KGVA 4EELA 3IE2A 3VTAA 4AUNA 2VDKB 3K2IA 3L6BA 5I4BA 2GZMA 4K6KA 2CC2A 2SKEA 4P4NA 4PYMA 1QTQA 5DK4A 1EEXB 1QH9A 5JNWA 1NJ5A 1A9XB 3RHZA 2JI7A 3TUZC 1ZNYA 4XEHA 4YROA 5ALLA 2UUPA 2OAP1 4ARZB 3QV2A 3V4PB 1GNRA 4IIEA 1PHPA 2WUFA 4X3OA 2B9VA 4MS1B 4DUGD 3GLQA 2DQZA 5CUQA 3TYXA 4UE2A 1Z7EA 2UUOA 4OJYA 4GZLA 4EB8A 2O0JA 2XYHA 2ZSJA 3LH5A 4TWZA 4C0XA 1Q12A 1YAJA 1YBAA 1XEFA 1ZLXA 4QOJA 3T7JA 2AA3A 2KI5A 2CCJA 2JLQA 2ZR0A 5G0SA 4MVXA 4IIJA 5G2OA 3AXTA 3SHQA 4BFZA 5I7WA 2BGWA 1U7PA 2DWPA 3H5WA 1FFDA 3DOHA 1P7CA 2HMVA 2IEYA 5EP2A 5KOYA 1FB5A 4BO8A 2Z5FA 1XK6A 3PFNA 4GLFA 1N1GA 2UAGA 3ZXYA 5GIPE 4JS0A 4YI5A 1D6MA 4PIPA 5B30A 3ZY5A 1JJIA 2JEZA 4R9NA 3SKXA 1S2MA 1ZSNA 2R6DA 3U16A 2C4KA 3AILA 1SUBA 4MVJM 1ADCA 1WW3A 4AZ0B 4R8SA 3UPTA 4RTPA 1JEDA 3HWSA 4ZVKA 3X1DA 4OHCA 1B8NA 2PMCA 2JAQA 3NVKI 5HRAA 2GCGA 2CXOA 4RJKA 1RHQA 3AGQA 3DZGA 3LKDA 1VBNA 5F3DA 2JFYA 2VZEA 4A8HA 4ACBA 4DT1A 2JIMA 2YWJA 4WBXC 1BNCA 2XOKD 4U02A 7YASA 3MQ2A 2TECE 3T9CA 4C2UA 1XL0A 1TT5B 3EF3A 4P4LA 2EKPA 4J1SA 2XAAA 1YVUA 2ZEJA 1NA5A 5EZYF 5EMJA 2Y4OA 3LVRE 3BSYA 2GN6A 4NV3A 3UJHA 1XZDA 1SVUA 2JJQA 4PN3A 4ABYA 2E7ZA 3SJUA 3V4RA 2QEQA 1I24A 1FUUA 2IL1A 5I4CA 1ADFA 3E0XA 3BGVA 5DX8A 3FOEC 4MDFA 1XXLA 2V3WA 4K5QA 4Q6WA 1M76A 3O0DA 3ESQA 2WJHA 4OLAA 2BL4A 4KIWA 4MV4A 2C57A 4XASA 1O03A 1USUA 3WP1B 2NO1A 1A7KA 3SJBA 3I2JA 3C7KA 4P2BA 1AOXA 4MZXA 2A6PA 2CLSA 4NBUA 3R74A 2GK4A 2E1PA 5F2KA 4BQQA 1NYQA 3MMSA 5IVHA 3QK7A 1SAYA 1Z63A 2EFEB 2YNMD 2GB4A 3R5SA 4GYKA 3ZH2A 4RHYA 2HPVA 2YFYA 2QAGA 1CYDA 1J1ZA 1KH1A 2DM6A 1MV5A 5FTWA 1VJGA 2PS3A 4NJEA 4AC9A 3M89A 4U7HA 4BP1A 1WOYA 2BGMA 1M2JA 8ATCA 1QCDA 3HBFA 1L5HA 3BD6A 2WIKA 3S27A 4ZWNA 1L8XA 1E3JA 1QHNA 4WNAA 1XCGB 2HNBA 3T5BA 3IEMA 4AJ9A 3T94A 3KQNA 2WVJA 4OJTA 3FLEA 1C0EA 4RY9A 1KK0A 1NZJA 1CP3A 3GWZA 5M04A 4ATNA 4PG6A 1LJ8A 2ZS9A 3WYDA 5CDHA 4AG3A 1YVPA 4JASB 2GLXA 4EHNA 3FRHA 3PT5A 5CGQB 3ADDA 5KSPA 3TX2A 2H17A 3AQIA 1JKFA 1P6XA 1PKEA 3IA7A 4LZLA 2E0IA 1C30B 1D2RA 4W6ZA 4D3SA 6NULA 3DQPA 1EWKA 1CB7A 3DD5A 3L0SA 1TJYA 1Q17A 4R84A 3DE3X 4X1OA 5ARBA 3NQ41 4ZT7A 1M1NA 5BWOA 5BO5A 1QHIA 5M3BA 3TUIC 5LN1A 3IHWA 3LZCA 4KV7A 5FO1A 1F4PA 3LC7O 1APBA 3AUSA 4JU9A 3AJ9A 1LBIA 2VF8A 5EE9A 3OTQA 3IPXA 3MCUA 4EY5A 2IZ5A 1K06A 5H8WA 3U3RA 1WZIA 2QA5A 2ODEA 2VXYA 3MJDA 1QIFA 2Z5LA 5DVZA 1PQPA 2QMEA 4DBLE 2DAPA 3PCRB 4QXPA 3EZFA 3KTFA 4KIFA 5H9VA 4NYJR 3HS3A 3WDSA 1WHTB 1D0VA 1CDOA 3QUCA 1DC7A 2WR8A 2YWHA 4YRJA 5IN5A 2OHVA 1OFHA 3P2KA 3BXHA 4J16C 1DIAA 4KFUA 1TTPB 3VAAA 3K6SA 4DR6B 3AIIA 2Q8NA 2I8AA 4MULA 4IBOA 1XCOA 3I73A 3T3NA 3T3HA 1K86A 3IUNA 1E9CA 2DUMA 3LCRA 3ZVRA 4YA6A 4EFDA 5EXPA 1WP9A 4GP9A 1LV8A 1WXGA 4G2NA 2DMRA 2PT7A 2EBWA 1ZGZA 2ZIGA 6REQA 1WUHS 1X8KA 3MB8A 5IJ0B 3M49A 1FC0A 3N3AC 4GYWA 1ZVVA 1LC3A 4YNBA 3HCBA 4PYOA 4B2LA 3C8ZA 4ER5A 2BD0A 1XB2A 1F6BA 3ZLJA 4JLOA 2C3PA 4HADA 1D7OA 4G8JA 4HNVA 3ODGA 3ZQKA 1ZUNA 1RQNA 1IDN1 1SRQA 1WQ1R 2VIIA 4L5JA 4P22A 3GJQA 3MMXA 4B44A 3I8XA 3AUYA 5C8XA 2V6BA 4KNWA 3G6WA 2GH1A 1N2GA 4FDMA 3EFHA 4TSFD 4HDOB 3WMFA 3WQSB 4F5DA 1UMBB 4WCFA 3X3HA 1HFWA 1ZCAA 4NE9A 4MO9A 3U48A 4JVLA 1C7ZA 1CJMA 1DAGA 1SO8A 1V8BA 3HCPA 3Q9UA 5B1HA 3HM2A 4WLNA 2AF4C 4Q4AB 3Q3GE 4PVCA 2X9VA 5BNTA 1UP7A 2Z30A 4RDIA 2Z5GA 4G63A 2ZUEA 1PT8A 1Y1LA 2JVJA 4NR0A 3SN6A 1XZGA 5LMCA 2V96A 2IPAB 4WZBE 2H3HA 3SGLA 3IAFA 3OFKA 4MIKA 5AVXA 4YBRA 5ECYA 2WAOA 1LVGA 1NVKA 5LQMA 1YD7A 1CFZA 4DYVA 1KJIA 3ASZA 3JATA 3L8HA 3V1KA 3EZ2A 1JAIA 1OFIA 3T7TA 1QRAA 2XE8A 5BV0A 4POAA 1JQLB 1G63A 1QNFA 1SBNE 3MILA 2ZCVA 3P1JA 4UM5A 2A92A 1XDDA 2N3ZA 4JLAA 4LYGA 3IIMA 1EWVA 4TKLA 1KARA 1VHTA 3A4IA 3LV8A 4M9CA 4N8SA 4F5WA 2D54A 1B2LA 4I6EA 4XZ3A 3C45A 3P97A 4C43A 2XCLA 4F72A 3ICEA 3VH1A 1KMMA 3RSSA 2VT6A 4U7JA 4XQGA 4HUQA 4YJ3B 3BTVA 3JZMA 4YMTA 3C87A 2AYXA 3H84A 5LQUA 2BM9A 2EVWX 1G8PA 1N9ZA 2F48A 1R0XA 5DWDA 4AKSA 1KMQA 2Q41A 3AG6A 3QKSB 1DAIA 1G5IA 2PMDA 3ACBA 5A5DA 4B3FX 1AKRA 2FPOA 5JNTA 5KVSA 1Q5PA 1SVIA 4HB0A 3RWMB 1X39A 1IY1A 1U8UA 2D1SA 3U26A 3V8PA 3KZMA 4O1IA 3W2FA 4D26A 2VKQA 3OFJA 5JHGB 4HAYA 4UC0A 2QPOA 3FWYA 8ABPA 1TZMA 1K4YA 3CB2A 2YRWA 3ACCA 3PC6A 1VJRA 2WHRA 1P4RA 3QNMA 4K6FA 2JIQA 3V4LA 2IH4A 1LDYA 1UJ4A 5KYXB 3LYAA 4KQKA 2I8CA 4B73A 3H0EA 3MJHA 4HKTA 4XE5A 5FWXA 4P32A 2J9FB 1XC7A 1NXTA 4FKBA 4LRQA 3NRBA 1OLUA 2ZIVB 1GTJ1 3MW8A 3ZIDA 1EFKA 4MW0A 3TMYA 4MS3A 2AOXA 3VOTA 4CR8A 3G89A 3VKFA 3RC9A 1ZL2A 4PXAA 2SCUA 4URHA 1PJAA 2YCBA 4JB2A 2VXBA 3RU7A 1X7YA 1V71A 1HXHA 1M1YE 3G02A 2HSZA 3PKZA 3QG1A 2V03A 2W2KA 2JGLA 3FPKA 5AM0A 5FJJA 3W5SA 2IS1A 1DIBA 1UXHA 2ZPTX 5AVJA 3OF2A 1CJSA 1IMJA 1QH8A 1WU8A 2REQA 2C9OA 3I8OA 1UJMA 1WZCA 4H0FA 1RWPA 4EUEA 2I7XA 1FZTA 1NFRA 4G8BA 1JHQA 3H1PA 1E4YA 2XAUA 1WVGA 3MWEB 5LYJB 4D9EA 2MCFA 1JLHA 1AQUA 4YQFA 4GGOA 3M6WA 1I33A 1DWPA 2OO5A 1A9RA 5EUCA 4YMVA 3HKEB 2B5VA 4N82A 1HKUA 5JCZA 2RHBA 4F12A 3UN1A 3E35A 4U6SA 4INJA 4PG5A 3BQMB 4UUOA 3DT8A 3SQWA 4XGIA 4N47A 2A0FA 1EUCB 5HG0A 3C3BA 1QIGA 4I66A 3X1YA 4FTWA 5AUPB 1SXQA 2ZYDA 3WADA 3AVOA 1W2WB 1Z5UA 4NNPA 3IPRA 1E9BA 3U7QB 3V46A 2ZUUA 4FYXA 4B3IA 4R2HA 1W1WA 1Z8DA 1TQ8A 2Q07A 1HNWB 5D00A 4CNQA 3ENKA 2QR3A 4CN9A 5TXGA 5HQ3A 1HT0A 4YTEA 3UMJA 1AHHA 1HMYA 2ZSKA 4X3PA 2C7VA 2JGDB 3LC1O 1CQIB 3HEMA 3HJRA 4ARSA 2REXB 2DFNA 3WSWA 2AL7A 1VLQA 1BD4A 3GA7A 5DTIA 3ZGLA 5MFPA 4YT2A 5G53C 1RIFA 4JBNA 3FYUA 1GRRA 2MSEB 3ZE7A 1UXGA 3QEMA 4CKBA 3GCZA 3U81A 4Q3DA 1RRGA 3VZDA 2FQYA 3KXIA 2ECOA 2PTGA 1I4LD 1R5OA 4IS3A 1H9AA 3IBFA 4LC0A 1RAEA 2VCHA 2ZSUA 3K5IA 1RYFA 1AKNA 2PV0A 2DKNA 2Y0CA 1BG6A 3B2EA 3OOJA 3ABIA 4X7MA 4XQ9A 1JDBC 1GO2A 1EB8A 4Q3KA 1Y37A 1DOHA 1JIUA 2OENG 2W98A 5T3YA 5I9LA 4TLBA 2XUOA 4MCHA 4EG7A 2OBBA 1GJRA 2ZIFA 2BRUC 3THRA 2UXCB 3OO0A 1P7YA 1FRNA 2IQ5A 5B1EA 2CVPA 4RHXA 5H83A 2KSQA 3VKUA 4GUDA 2GS9A 2ZKIA 1UZNA 2X8WA 4V39A 1ACMA 3PV0A 5I9TA 2HA4A 2NSLA 3KUUA 2IZ7A 3HJNA 2DGDA 3NC4A 1G8MA 3HV0A 2VK8A 2CYCA 3NEJA 3QVKA 4GD3Q 4GE0A 3M6UA 3I9LA 3PX2A 4WUVA 4IGKA 4FOTA 1TA0A 3AZQA 2H8KA 2I99A 5ICFA 2Z83A 3A3KA 4ND6A 1CYEA 3UAOA 2DQSA 2D3WA 1QYDA 2YJNA 1ZXXA 2R6FA 4NG4A 1N3YA 1MJGA 4C76A 4PO3X 3WL7A 1O0SA 2OZVA 1E4VA 4UCXA 2R0QC 4GP6A 3EY9A 5C4GB 1R0YA 1CNMA 4FDVA 4IIJB 3N7AA 2YXPX 4EOGA 1X77A 5HSGA 3FSGD 4B80A 3F5MA 1K8ZB 4HH3C 3LBFA 3AESA 5BR4A 5IUJC 2A0UA 5ECGC 3TO5A 5EGSA 4ZC1A 5IDXA 2IEGA 3D3QA 1MOZA 5DB4A 3CLTC 1HTBA 1YCDA 3ZCRA 1VYUA 3BYZA 4ASUD 4BAZA 1ZKMA 1YB7A 4NXMB 2BHLA 3M1YA 3OM9A 1CC1S 1S4MA 4FFBB 4B1FA 3QMVA 1W5SA 1C29B 2ZJ1A 1ZYUA 3FYHA 3X0DA 4DN6A 3BA6A 1P8JA 3OJFA 5KSZA 1RJEA 2CXSA 1I3MA 3GAMA 1ZA1A 2DF8A 4M8SA 4YP6A 4U6QA 4UOZA 4PYIA 2FMKA 3UJNA 4DT1B 1NHWA 5T8KA 4GZMA 2VEOA 3GWGA 3VAYA 1LV7A 1NDUA 2PRZA 2HA0A 1TUEA 4DA8A 1I7DA 3I09A 3CMMA 3SCZA 5JFGA 1UC4B 2B8TA 4DJ5X 4DV0B 5DZSA 1A8IA 1PEAA 3OX2A 3C8UA 3PNSA 1J5XA 3ISTA 4HAUA 4P7KA 1G8AA 1QQ5A 1RLUA 4XWKA 2MSDB 2VHJA 4NK4A 3WK9A 3LBAA 2W00A 3FMVA 2PM8A 4D9FA 3DHVA 2GPYA 1JAZA 3U5ZB 3HFJA 2R7KA 1HFKA 1G6OA 1W5FA 3ZBTA 5D1HA 2BAGA 3SICE 3VQTA 1D2EA 1V96A 4AJPA 3AO0B 1J06A 3KKNA 2E9SA 3FZNA 2DYKA 3IO3A 1KJZA 4U7WA 3BK2A 4TQAA