2FVXA

Clostridium beijerinckii flavodoxin mutant: g57t reduced (277k)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
138
structure length
138
Chain Sequence
b'MKIVYWSGTGNTEKMAELIAKGIIESGKDVNTINVSDVNIDELLNEDILILGCSAMTDEVLEESEFEPFIEEISTKISGKKVALFGSYGWGDGKWMRDFEERMNGYGCVVVETPLIVQNEPDEAEQDCIEFGKKIANI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
publication title Control of oxidation-reduction potentials in flavodoxin from Clostridium beijerinckii: the role of conformation changes.
pubmed doi rcsb
source organism Clostridium beijerinckii
molecule tags Electron transport
total genus 47
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 1996-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fvxA00
1RLJA 3G5MA 3F90A 2HNBA 4XDGA 6NULA 4H6PA 4U7HA 2FAXA 1SQSA 2FX2A 4YAWA 2QR2A 4C0WA 4XDHA 1CZLA 1D04A 1CZRA 4YAFA 5EMNA 3SVLA 4ZVMA 5BUCA 2A5LA 1AHNA 4N82A 3EDOA 5LLDA 3B6JA 3B6IA 4LTNA 2R96A 2BPOA 1JA1A 1KBOA 3TE7A 1T5BA 2QMZA 3KAQA 5FUQA 4S24A 4DY4A 1J9ZA 1TIKA 3TEMA 4HEQA 4H2DA 4PTYA 1YCGA 2XOEA 5NULA 1FVXA 3UXHA 4NULA 1F4PA 2KLBA 2WC1A 4FGKA 4Y9RA 3S2YA 3KLBA 1SG0A 3FNIA 5F4BA 3QFRA 4J8PA 3KEGA 4F8YA 2AMJA 2X2OA 4ZVNA 5JROA 2OHIA 1FLNA 1AKWA 1X77A 4GQIA 4D02A 2MTBA 2QWXA 1OBOA 1QBGA 4FGLA 2FZVA 1C7EA 2FLVA 1D03A 3FX2A 1OBVA 3L9XA 4CETA 2BF4A 3LT5A 3ESYA 4M0CA 1AKUA 3OX3A 1YOBA 1DXOA 1XI2A 5NLLA 3UXEA 3U7RA 3NHRA 2MT9A 1CZHA 2Q62A 3W78A 4ZVLA 1GG5A 1KBQA 2BN4A 2XODA 4U7FA 1AKTA 3ESXA 3EYWA 4FX2A 1JA0A 2QMYA 5EAIA 4NLLA 3TZBA 5LVAA 3K1YA 3JSXA 3W7AA 1AKQA 2FOXA 5F51A 5A4KA 1I1OA 3NHLA 2R97A 1CZNA 2Z9DA 3NHWA 1XYYA 1FLAA 1RCFA 1H66A 4QOIA 3R6WA 2FZ5A 2X2PA 4N9QA 3W77A 3ES9A 2B3DA 3FJOA 2FVXA 3ZHOA 1YDGA 2MWMA 1FLDA 2MOKA 1AZLA 4LTMA 4ICIA 4YAUA 1YCHA 3ESZA 2Q9UA 1C7FA 5EA2A 1WSWA 4YALA 1BVYF 1E5DA 1J9GA 4QOJA 3RPEA 4PTZA 4GR9A 1AKVA 3NHSA 1J8QA 5ULLA 3O2NA 1FX1A 3NHYA 2FCRA 3NHJA 2ARKA 4BMPB 1ZWKA 3N3BC 4HS4A 5TGZA 2D5IA 4GI5A 1DX9A 4YAOA 1ZX1A 1B1CA 1FUEA 3B6MA 3QE2A 2OHJA 2QX8A 1YCFA 3OX1A 2N1MA 2ZKIA 1XYVA 4C0XA 2V5UA 2M6SA 1T0IA 1AKRA 1WSBA 3GFSA 1ZWLA 4ZVKA 5LJLA 3OVMA 1VMEA 3NHPA 4DILA 2OYSA 4N65A 4QODA 4U7GA 1J9EA 2FDXA 4Y9UA 4QOHA 3GAMA 4FGJA 1QHEA 1RTTA 3GFRA 5FX2A 4ESEA 3N39C 2KQUA 1CZKA 4C14A 1D4AA 4OXXA 3F2VA 3NHKA 2OHHA 1OFVA 1FLVA 3FVWA 1CZOA 2V9CA 1TLLA 3O73A 2QX9A 1RLIA 3HR4A 4LTDA 5LBUA 1QRDA 3OWHA 3D7NA 4QOFA 4CF6A 4LAFA 2HNAA 2HPVA 5B3LA 3OWXA 3FW1A 3LCMA 3GFQA 3NLLA 4Y7CA 2BMVA 3K20A 2V5VA 2Z9BA 1BU5A 4QOEA 2RG1A 3W79A 1H69A 1NNI1 3F6SA 1FTGA 3U7IA 3L9WA 2QX4A 3B6KA 1QR2A 1YRHA 3NHFA 2M6RA 5LMCA 4LA4A 1XT6A 5B3KA 1DXQA 2BZSA 2F1OA 2QX6A 3P0RA 1V4BA 5FA6A 2Z98A 5LJIA 3HLYA 1AG9A 2W5UA 3NHUA 1CZUA 4YQEA 4BMOB 3NFRA 4DIKA 3N3AC 3KAPA 4PU0A 3F6RA 3OX2A 3QFCA 5LBTA 5F12A 1AMOA 4R81A 3OJXA 2GSWA 4QOGA 3HA2A 4C76A 3OJWA 1YKGA 2Z9CA
chains in the Genus database with same CATH superfamily
2IKQA 3VDQA 2X9GA 2FHSA 9ATCA 2C31A 2FA9A 2PBFA 4GU5A 3UKOA 4B33A 4ER5A 4JSYA 4MUXA 3KQLA 4R7ZA 4ZYWA 1A5BB 4Q02A 3FMVA 4FPXA 5AKGA 4B40A 2XZDA 2CEAA 3E7PA 3R6TA 1NYTA 5GJBA 3JR3A 4RETA 5KDOA 1CULC 1C2YA 1K08A 2FZWA 3LTNC 5K3CA 4N5MA 3WHLA 1BXZA 1YS9A 1RWBA 1SUDA 3F5MA 1YBHA 4V0ME 2MDTA 1UINA 2LKDA 3Q9UA 4GVXA 3T0FA 4ADSG 3OT1B 2H1IA 4Q00A 2RGNA 1O89A 4Q1BA 5HM6A 3FROA 3RGGA 5IM4A 1E5TA 2YW9A 3DT6A 4MYRA 4N82A 3EDOA 1YZNA 2J9FB 2HT6A 1HSOA 2Q5CA 3B6JA 5KVCA 3W2GA 1JQDA 3OF3A 3EGIA 3N8DA 4FEEA 2AOUA 3RTEA 1G8HA 2WSIA 1XHEA 5HIKA 1B0PA 3C43A 1MH1A 1N5JA 1WZCA 3BMNB 4AURA 1TW3A 5FNZA 1C9YA 3GEIA 2AC7A 1GGFA 1J21A 3OHMA 1JFRA 2ILVA 1JPNA 2PRSA 2A8YA 2WD7A 3KTDA 4MGYR 4UMVA 2QG6A 5K03A 2GN1A 2BGKA 2HIHA 3DFUA 1CKEA 4K9OA 2NUAB 4WZAB 3TWOA 1CR4A 3UGQA 1L4GA 4OM7A 3HEAA 5B64A 1NBME 1Z0ZA 2IXFA 1SKUA 2FN8A 2H9YA 3UXHA 5L3QB 1T36B 1E5QA 3QI2A 5K51A 3FZYA 4A82A 4QU5A 4Q1EA 3C4JA 3U4MA 3OOEA 3ABIA 1ZGHA 3BGWA 1FYXA 1R8SA 4IXNA 2JBAB 1T13A 1X1BA 2G0AA 2PBRA 2WAMA 4L6CA 4R8KA 1G8SA 3QBTA 2AR7A 1N0VC 3CRZA 4IQ4A 4J76A 5BWBA 3S8MA 3ZWCA 1MB2A 1R9NA 2GK7A 2QG9A 4IM7A 1LV7A 1ZYUA 1I5OA 3A1TA 3ZNOA 3V8MA 3A9VA 3VR3D 1UZLA 1CEEA 5BN3B 5FJJA 3HKEA 2CE7A 2VDVE 2NPFA 1FOEB 3E5RA 1T5OA 1YBVA 2CUKA 5M04A 3DD1A 1PUJA 4Q18A 1RJWA 2WP8J 4X8MA 4UMFA 2ZROA 1DKRA 3H18A 3OEYA 4Y6QA 3T5BA 2J6BA 2UDPA 4V1CA 2WM3A 4QARA 4OP3A 5TMEA 3BWDD 4OHPA 1I3OA 5FPQA 1ZM3A 3UJ8A 1GGNA 2OVBA 1ZR4A 3UAZA 2P4EA 5AJTA 5G02A 4IHJA 4HVLA 1KO7A 4F72A 2VZ0A 4RC9A 4N8EA 3LE8A 1OBHA 4D98A 1FDWA 1U2SA 1T3TA 4MPPA 1MRSA 2F67A 4JKIA 4IOMA 5HSGA 1YZTA 2ZS9A 3E9YA 2BTQB 1AUVA 1UJMA 5HUQA 3NOXA 4XUEA 3R5XA 2YWGA 4N01A 4BVLA 5KJ6A 2JLXA 2AEMA 2LPMA 3B1FA 1TYEB 1UPBA 3ETEA 4RF2A 2J46A 1I10A 2SKDA 4GW3A 4QRIA 1K1EA 3P9CA 3DC7A 3USZA 1DC7A 4R5HA 3U44B 1ZD2P 1YR8A 1A9ZA 3GEBA 4LGYA 5J2TB 3D4NA 4N6GA 4QGFA 1QOPB 2JANA 1RWPA 4V3CA 4YLGA 1R00A 3NR2A 4ARUA 4P82A 4IIJB 3Q9SA 2J0EA 4K9LA 4MV8A 4XGNA 1LBTA 3KVOA 3A4IA 2QQ5A 2PA3A 1G0NA 3B1ZA 4PPQA 2O8VA 4HWSA 4JDUA 3O7WA 2DQSA 3RBXA 3W8NA 3KJZA 3WXBA 4TUYA 2QJWA 1A4UA 4ZDWA 2YMQA 1YOVA 1KK1A 3P71T 4A8JC 1SC9A 3HWX1 3MTEA 1KDVA 4QAJA 1IG3A 3CFYA 3QXXA 5AIAA 1FIUA 1STOA 3AGPA 1QHYA 2ZR9A 1W7AA 4RL6A 1XVAA 1AHPA 3KQQA 2EVWX 4MV1A 4HAOA 2UYQA 1BDBA 1TQDA 2ODPA 3DAYA 5EIBD 1XQVA 5F64A 1NL3A 2WT9A 2HQ1A 3O8QB 4MS4A 2W00A 3RSCA 1NF3A 3QKRA 3ME5A 4WLUA 3C8UA 4IBOA 5L95A 3A32A 4G1BA 2N3ZA 3ESYA 1NVMB 1D2RA 4NYJR 1YULA 3H2YA 4KEAA 3C24A 2IW1A 5A4MS 2JFZA 2VTBB 5JRJA 4PRLA 3HJNA 3DUWA 5EQTA 1P9NA 4TQGA 1RTKA 1R2QA 2PZEA 1P19A 3QV1A 4YRSA 3T35A 5BVHA 1FBTA 3FI0A 2A59A 3D0KA 1K2WA 3L8CA 2BN4A 4HDQB 3MMZA 4IIUA 2CF5A 3KHTA 4K87A 2ODQA 1FYFA 4LMRA 4OJMX 4UNRA 5K8JB 1K4MA 1BFUA 3ESXA 4FI3C 4QJ3A 1YNOA 1QFYA 3P9YA 3O2JA 1SVOA 4U5QA 1WCIA 3WWDA 4BVKA 1TM1E 3WAGA 2VP9A 3G1TA 4CMGA 2D2XA 3I2FA 1FSGA 4LUCA 2X58A 2QMQA 1IDN1 1HPLA 4DLSA 1CQPA 4MIEA 5LXTA 1DTWA 3FYUA 2CVOA 3ZJVA 2X1MA 3R76A 1UDWA 3C74A 4DA0A 3AEUA 4UNSA 5FTJA 1DU4A 1FNNA 1FUUA 3BKXA 2Q3JA 4HCJA 1ID8A 3U7FB 3W7AA 1CQJB 4ZYUA 5KUTA 1Y4DE 1BCRB 3NB0A 2HSEA 4I5IA 1G5RA 3PJRA 3EG9A 2HXYA 3NEJA 2WZQA 1Q7GA 3H5RA 4AC9A 4BRSA 4PHCA 1ZD8A 2QMUA 1P1FA 2VPWA 5KYYB 2BFMA 2VUIB 2AFIE 5F51A 2X0KA 4BYMA 2GEDA 2ZGVA 3WGOA 2J32A 4NOMA 3V8VA 4DIMA 3TIXB 2YIMA 1QCYA 4O4JF 2VLBA 1F20A 1LCIA 4WDQA 1G20E 1P77A 1ZMBA 4X7RA 3NHWA 3IB6A 4HXEB 4IXDA 4N9QA 3KLNA 3R3VA 2VS1A 3IP5A 4CDGA 4XWGA 3BB1A 5DX1A 1Q1GA 1UMDA 4UNQA 1PG0A 3HV0A 3TD6A 1FDOA 1T4MA 4Z0NA 2BKVA 1L7BA 3AR3A 2QU8A 2D2IA 5AI0A 5KWSA 3D64A 1A9YA 2I4TA 3HVHA 4U1RA 4W5WA 2YCBA 2JC3A 5BV1A 3DEAA 3DEJA 5C81A 3QKIA 3RHSA 2OBYA 1K8QA 3MIZA 4GZ5A 1T24A 2LIVA 2IHTA 3F3MA 1O6GA 1UZUA 4OK6A 2PJUA 5FCDA 4DV2B 4DYVA 4PY2A 1WUKS 2B4TO 2J0QA 3FJYA 4OHMA 3FPGA 1UQTA 4KC0A 5G1OA 4JEUA 4MKHA 3ROGA 4MNTA 1TFUA 3DL0A 3KPVA 4OSOA 2PZFA 2FPKA 2XA9A 3CH6A 4LPSA 1QH0A 4XWKA 4RQUA 5DBIA 2XCOA 3F7MA 3K0AA 3SPXA 3QLTA 2ZYIA 3AHCA 2XNHA 3DEHA 4YALA 4PC2A 3QU7A 1PI3A 3W9UA 4PCLA 4CCYA 5JS8A 4CIWA 2GUGA 1WMSA 2FEOA 3A0UA 1HLFA 2QLNA 3RUHA 3W3AA 3QUSA 2AXEA 2PQ6A 3BYZA 4G23A 1Z7YA 1IM5A 1I8TA 2EBUA 4CMJA 4KXLA 4RJIA 1AKVA 2EGGA 4WK4B 2OXIA 4E6PA 2Z8XA 3WP0A 1J8QA 4JLPA 3ENKA 4TMVA 3V32A 2HLDA 2WU4A 3B6ZA 4BQOA 3O83A 4MGZR 1TVEA 3BHNA 3I0MA 1B8VA 1KI2A 2BJVA 4E51A 1LBEA 1Q16A 4IQ8A 2ZUSA 1E9SA 3QFFA 4WEOA 1V5EA 3DDOA 1GRRA 1XVIA 2IH2A 2I29A 4OHYA 4UARA 1HYBA 3PE4A 4QSHA 3RD5A 3NOVA 4EL5A 1CY7A 4CM4A 4UJ5A 1KR2A 3O4IA 4CQMB 1J56A 1OYVA 1JHAA 4KI7A 4AM8A 4AS3A 5H0IA 4IRUB 4Y30A 4HJRA 5DXFA 5JASA 1V5FA 3NJRA 1XDBA 2HZ7A 4JJ4A 3WB0A 1DQRA 1WY7A 2YXPX 3H9UA 4CKYA 2QTRA 4G8JA 4LOAA 2O1XA 4K05A 2FKAA 2V65A 3Q3JB 4MX8A 1AA6A 1EAYA 2VR1A 1T8YA 2HA3A 1R1DA 2O5VA 3K7EA 4JXJA 5JO9A 3UMVA 4C3ZA 4COOA 3R8FA 2W7TA 1IB0A 2FPWA 4RVGA 1KVUA 2IOQA 2NZ8A 3Q0TA 1AKRA 1FUYB 1V4NA 3TI9A 1V5WA 1WSBA 1VHQA 1Z5VA 1QFMA 4GLBA 4QPCA 1L7RA 1USWA 5KTPA 3ZWMA 4Q34A 1AKEA 2GD2A 3L3BA 1G16A 2CZGA 2PZLA 1ZS9A 4P5EA 3VU3A 5TQ0A 4P33A 5PGMA 1JI0A 5ITVA 1I24A 1MV8A 3HYCA 2IITA 3CVOA 2IPLA 2Y93A 2CDAA 2P30A 1TQ2A 3R3XA 3N74A 4BNNA 1P1BA 4KSYA 4PPGA 4FEAA 1Z38A 4R05A 3NHBA 4Z6KA 5EEGA 1CUCA 3SAJA 4EMSA 1G59A 1MENA 2JPDA 4P98A 4UEKA 1DZIA 3SE0A 3UTCA 2OCKA 4AJ2A 5KNCH 5M29A 4PZLA 3R7DA 3R23A 5CB4B 3O92A 1ZISA 4HUQB 4ML3A 3N2ZB 2Q99A 3TPCA 1VXRA 3AUSA 3GNLA 4HDMB 4Y9SA 5CX1B 1MKYA 1B8NA 2VP6A 1QH1A 3DSRA 4LE1A 4P5PA 3SFVA 5GVSA 4EGCB 2GEFA 1Y0BA 4YJDA 3MXTA 1GD1O 1QR6A 2AJBA 1M1NA 2HWWA 4LI3X 2IHYA 4PYQA 3TE6A 4DKXA 2ISQA 4TLMB 1DAKA 3CSDA 2FVYA 2ZRGA 3FVWA 3NTQA 1L1RA 3PE3A 1VSUA 2RAVA 4IHKA 5CHEA 1N5OX 1QK3A 1CK4A 2OV4A 2AG6A 3T7IA 3DXYA 4E88A 5SY6A 1N78A 9LDTA 4OB7A 3GMIA 1EUQA 4CL8A 3ZYCA 4CLDA 3SJ7A 4G89A 3NWJA 3H7IA 4KN5A 3TQCA 4BWVA 1USKA 1RRCA 4WXMA 1YB1A 2A9FA 3HWRA 4QTUB 1WCWA 4MGIR 1C9MA 2P3OA 1R4MA 3K8QA 3K1JA 3U0VA 4CR6A 4KAAA 2PGDA 3HP7A 5JNRA 2BGLA 4DSUA 3GEEA 1EDDA 2BFBB 2IE0A 2PH5A 5D2CA 4PGGA 2HMSA 3CLVA 1RR6A 4X45A 3WYFA 3LBYA 2FW7A 5B1DA 4FDAA 4C0HA 3MYYA 2VYVA 1ZRNA 1K92A 3OP1A 3U4CA 4KQ9A 3THXB 3QSGA 4LCEA 3HU1A 1OIWA 5TGTA 3BRCA 3K20A 3QWHA 4GNKA 4O25A 3OO0A 3VBCA 5KMGA 1WQ1R 1SVMA 1Z3IX 3EZ9A 3ONWA 4G26A 3R41A 1E69A 2VKTA 4G37A 4MJ3A 4RXMA 3DOIA 4HFMA 3F5DA 5IKXA 1SZPA 2OB2A 2ADMA 3V8NA 3DKPA 1Y89A 1B6TA 3EA4A 3Q15C 3BL8A 3SK0A 3ZVKA 1ZXXA 4MUJA 1PW7A 2W6OA 2BFCA 3L1HA 2ZWOA 3B6KA 3FCOA 2RHOA 4JNKA 1HK7A 3BRSA 3PQ2A 4OFZA 2D1YA 1QIIA 3CT6A 1U9YA 3F47A 3O1LA 4TN1A 3J80A 1RRKA 1N6HA 2V59A 4R2WA 4V0OA 1WCXA 2MSCB 3HY3A 4ZT2A 5H8WA 3T0IA 2CB0A 1M2KA 5ALUA 1IWPB 2W2XA 3A6DA 4R8SA 1K7FB 4NX2A 1HT1E 4PM4A 2ZWIA 3NYRA 1E2NA 1RLMA 1U3CA 4OGKA 2VP5A 3MB5A 2R6FA 3LDAA 4MVJP 3UJPA 2NO7A 2CVPA 3HZOA 1T25A 2G40A 1Y48E 3GB9A 5IM5A 2R86A 1XTJA 5K0GA 5B36A 1V4BA 1SHUX 2XOXA 1LW7A 1ZSNA 1Q7EA 3DZFA 5IC6A 5T41A 2X0DA 1UDCA 3SC6A 3EWNA 3WTCA 4MDHA 2JFBA 4UW9A 4D9JA 3O90A 5K8TA 1ZW1A 2HQSA 4LYHA 3H8JA 5IAOA 3OZAA 2ZJOA 5AI4A 2NW6A 1CS4C 2R8RA 3P2KA 5SYNA 4E5YA 4Z7QB 1CCWA 1HL3A 4OO3A 1PKEA 2GASA 1MAVA 4MZDA 4MJXA 1DSSG 2PMFA 5ESRA 5EJ4A 3DOHA 1U2DA 3VHLB 4XSGA 5J3JA 1WV0A 1NI5A 4QQKA 4FCVA 4BGEA 3EPPA 5IYZF 4F86A 1BDMA 4KOAA 5D86A 4D26A 1K4KA 1TTTA 3CPJB 3BHIA 2NYAA 3JQFC 2VF4X 4R2MA 1Z63A 1I4DD 4RMIA 1N2JA 1I7DA 2D8AA 4CF3A 1OZHA 5AKXA 3DE1X 2XBMA 3REFA 3DL2A 3QBDA 4ILKA 1NTOA 4ENPA 4MVJD 5IS2A 4EVRA 1QYDA 1NG1A 2FR1A 2GYUA 2UVPB 4JKOA 2BZGA 3FPAA 4I46A 5EWMB 2PO5A 4FFBA 1KRWA 3CBGA 4NHEA 4XGKA 5CVEA 4M54A 4MCAA 5JYDA 1G8KA 3FPCA 1TU0A 4OYLA 3AYZB 5LC1A 3NQ41 3WJ1A 1H2AS 4QGGA 1NIPA 2QK4A 3P9ZA 3VKWA 2TS1A 2C99A 3FZEA 1PTJC 4O6VA 4QULA 3PRHA 4TV9A 4XD7D 4OU4A 4C03A 1Y3AA 3F6YA 2VJKA 1X7WA 4I50B 3ZHUA 4DM7A 1CZLA 3UOGA 3MRVA 1A88A 1D04A 2D1SA 4L8YA 1F51E 3A7EA 2VZLA 4DG5A 3BF8A 1VB5A 3GLFB 2RG7A 1A7KA 3EZLA 3GAAA 3WGQA 1GT6A 3BMOA 1ND5A 5BUCA 4I6GA 2IRWA 2N46A 1JX6A 5I4BA 4NBKA 1KOFA 1EFTA 1PQ4A 1I32A 3GRZA 1CRQA 2GAJA 2NXCA 3CE6A 1DRWA 2PL1A 3QIAA 2TMKA 3K9LA 4KPUB 3Q7PA 1OGJA 4Y0VA 3N70A 4ZO6A 1XE3A 1IM8A 3MIIA 5I9LA 3UV6A 4BV2A 2R751 3IAS6 4DPLA 2QMZA 1O0SA 1IN5A 3I73A 1N25A 3N6VA 5IUKC 4P32A 3IEUA 1KC1A 1QIGA 2W8BA 3K0KA 4HNQA 4HG2A 4PPNA 3PS9A 4RFLA 1FFGA 3A4LA 3RTCA 1LQUA 4KXVA 3AJDA 1U0OC 2OCIA 4XDYA 4YDRA 1QRAA 4H2DA 1EJ0A 3FNEA 3THOA 2G9QA 2QGFA 1CETA 4AJIA 4J6EA 3ND6A 2XNDA 3KQUA 2EFDB 3BHMA 4J0FA 3MTQA 3DPSA 4M0FA 5JQWA 4NULA 1ZZEA 5JWHA 1U9JA 2C3PA 3AI3A 2OTCA 3G0OA 4D97A 5HM8A 4L95C 3JQGA 4MA4A 4CI9A 3WYEA 4KQHA 1FFAA 3K70C 4NZPA 1VPDA 3OMWA 4PCVA 5JANA 3PNYA 4EI7A 2G63A 3FPFA 4I2VA 3H11B 2ZE7A 1NVFA 4AZ0A 3UO8B 3CZ4A 1ZBDA 2DFPA 3L1JA 4I7EA 3U1BA 4G0WA 3LPAA 2ZITA 5C32A 3KOMA 5CFQA 3WZLA 2EYUA 1O95A 3O9MA 3WWOA 2B5WA 1F0YA 2HX1A 1RCUA 3FNIA 3OM1A 2Z2KA 5F4BA 3VYRB 3A6GA 1XL0A 3GUYA 1RAEA 1WIWA 3URKA 3W4JA 4JSRA 4PQYA 1WB6A 2RC5A 4XFJA 2DH5A 2ST1A 3OZTA 4ZO8A 3PCRB 4HPJB 2FK8A 2C2OA 3PEVA 3IAUA 5C1IA 4F8YA 5BQ5A 1NMXA 5LD2C 3VI4B 1A9TA 1VPVA 3P9XA 4ZQEA 5CD9A 1J22A 1QDLB 1V7ZA 5DF1A 5B7GA 1ZI8A 4BNYA 2GF2A 1YS2X 1G8JA 4G84A 1VQ1A 4FIDA 4LYGA 4PYOA 2IU4A 1J0CA 1Z5WA 3B53X 3FR8A 1A7UA 1JEQB 3GRYA 2DPXA 4PNHA 1BMFA 1M1ZA 4Z2AA 3FNQA 3AV3A 1EM8A 4NEGA 4G67A 5B58C 3CZQA 1RXVA 4R1MA 2QD3A 3NEPX 3PNOA 4B3GA 1A0OA 5CFOA 3F6EX 1M34E 2OL4A 3B1YA 1FFWA 4LKOA 3RS2A 4AJPA 5TT0A 1AKWA 5IDYA 4FJ0A 1X77A 1VCOA 3KPUA 1ZNWA 4DQDA 3Q7EA 4X1IA 5T6BA 2VQ6A 3CJQA 3EH1A 2EOAA 3OFSA 4QYMA 1H6DA 4JB8A 5F77A 1MU0A 4EDHA 4YP1A 4OHKA 3RUCA 4JEMA 3FYSA 2RDMA 3KQHA 2G3YA 2X19A 2ZBEA 1FC0A 4HQRA 4Q66C 5HQJA 2G0NA 2VEDA 1H3NA 3NZEA 3QWBA 2IUFA 5SICE 4EB6A 1S4QA 3OTGA 2P40A 4FKZA 4L78A 3H86A 1ZUIA 3NT2A 4KUEA 4CFYA 1YF3A 3EMBA 1TF5A 1LBQA 4LRTB 1PGQA 3D7RA 4RFSA 4RMNA 1YZLA 1PKXA 1LA2A 1QGUB 2VPQA 4M88A 4XM2A 2WAOA 2R79A 3B3JA 3G82C 5JZSA 1G9TA 3EIWA 2FPMA 4OFXA 2Z2YA 521PA 4WGFA 1D03A 1BEEA 1Q1ZA 1LFDB 4ZOLF 4RTJA 3VNBA 1VJTA 2Q2QA 2R85A 1GKIA 3L9XA 1RQPA 2JIDA 3M70A 3PVCA 2G6BA 3VR4H 3TFOA 1I80A 5A1TA 2I4NA 3HDHA 4I5GA 4QFCA 3DF9A 4MI3A 1AKUA 1K7XB 3D4BA 3OLXA 3PPYA 3UT5A 4DV7B 3M5DA 1DXOA 3NBMA 4WLNA 5JXJA 2XR1A 1JKMA 1QH8A 1XK7A 2C4VA 3DDZX 3EODA 4K88A 1II0A 1IHPA 2XITA 3AI1A 2GXAA 1RWQA 2GVZC 2PCJA 4O4HA 3ECSA 5K0EA 4N1AA 1MJGM 1KBQA 1FNDA 2ZSAA 3DJYA 4MQBA 4W1RA 2JIQA 1VBKA 4HNAB 3WZ2A 3O8DA 4PQEA 1AKTA 3EPKA 4F06A 2Y27A 1SVLA 3EYWA 1KARA 4ROTA 2OWEA 3OZIA 2DECA 1VKRA 4N7JA 1C50A 2JVIA 2OCXA 3ZTTA 1DRUA 3OZDA 3QKSA 5CCXA 3DTVD 1ZUNA 2I6SA 1X7GA 2PKWA 2RHRA 2OO5C 3EGOA 4KMMA 5BSMA 2XMQA 2ZKLA 5FA8A 5J58A 1B42A 4FI3F 2XDYA 5BQ3A 2XUHA 4XPIA 3IMCA 2HY7A 5IKEA 2P0EA 3QA9A 1I13A 2PWYA 3VOAA 1X1DA 1PU2A 3L8YA 5BXQC 3HKDA 4PWYA 3K16A 5DGXA 2IYUA 3EDCA 4CCSA 4Q05A 2R60A 2WIKA 2LTAA 4KFTA 3ZCUA 3SBXA 3KUKA 1T4GA 3KWJA 2IUEA 1G5PA 1OTYA 3R0VA 1H2RS 2XUIA 3ULKA 4ZQBA 1RI1A 2PTHA 3FIJA 4HDKB 1WW8A 1OU0A 4V03A 2ORIA 2Q3CA 3ZDBA 1UDRA 1JHRA 2GSDA 2OBXA 4UFNA 3KQNA 2P6RA 3KC2A 3X1DA 1KJ9A 2XTMA 4DA9A 4JX8A 2AH5A 3NNNA 2WRZA 1H66A 3HJCA 4AN0A 2HRBA 2X2PA 1U80A 3NRBA 3RUFA 5CNKA 2AW5A 4TLDA 1C3EA 1AZSC 1GFSA 3TNFA 1L4FA 1SCAA 5CHYA 3FOEC 1YQWA 3OOJA 3RC3A 1UUFA 1YR2A 1Z8HA 2QW1A 2QM0A 4CG1A 3ZGLA 2B98A 4KRXA 1QUFA 2A57A 2ODNA 3BG5A 4JXKA 2E21A 2DFDA 1J0BA 1CQWA 3CW8X 3CZRA 4G9GA 4C07A 5DTJA 3KB8A 4QL3A 3DCJA 3UHFA 5K8UA 2WSBA 4BQQA 3K9FC 3S0JA 2WP0A 2HQRA 3LT4A 3G68A 3O2QB 1EH5A 4E4YA 1SXJB 1AZLA 2XXAB 3HFRA 2VPZA 3H4TA 2CJXA 4ER6A 3TQTA 5HIIA 1WXDA 2H2FA 4DIBA 1OI2A 2MHCA 4M0PA 4HH3C 1ZITA 2BM1A 5GGYA 2Q2NA 3GYBA 5LU8A 4FS3A 3WGUA 2PG3A 4QGHA 1VB3A 5TQ2B 1G2PA 2ERXA 1QQBA 4J91A 2V0NA 2V54A 4NPCA 4ZVOA 3RYFA 2OCPA 1KYIA 2H1WA 4K6MA 4YJGA 2IBTA 4PYRA 5JG7A 4TQAA 1LI5A 3ZE1B 4MQFA 1AQ6A 1MT3A 4N5IX 2VJMB 3BCRA 5CVJA 5LU9A 1HT3A 5I4IA 4EFLA 4FK8A 1CBUA 1KY4A 1T29A 1XPUA 3QFTA 3GDWA 1NW8A 1L4HA 5EQDA 1UBFA 3HDQA 4HN2A 1YS6A 1G1MA 1P5FA 5E0OA 3TD9A 2QTCA 1UC5B 2YIDA 1R0YA 4P4UA 3U61B 3MOSA 4PO1A 2C88A 3IOEA 1WHSB 3G5TA 3O1JC 5TX7A 2DHQA 3VVBA 4CM8B 5C5DA 1IIRA 5KJ1A 2FMFA 2A1TR 1K68A 1Y9ZA 2O3UA 1KU0A 1C29B 3I5MA 1B43A 3PGVA 4IVPA 1E3TA 4RSMA 2Q1WA 4ZYYA 2IZZA 4UHHA 3TW0A 4BTLA 3KFLA 5TGZA 3OQIA 3LRTA 4OKNA 3PA6A 2E4ZA 2VAPA 1Z29A 3I83A 2H7YA 3DA8A 2A35A 3C3WA 2I2BA 3ODGA 4AIIA 1J39A 4R8RA 3JAKB 4XJVA 1HRKA 5DSZA 2HCTA 2N75A 2FFBA 2F3QA 3VR5D 2HW8A 3LUJA 2W6IA 2GESA 4ZVRA 2C8KA 2QI9C 3VC1A 4B75A 1D2EA 1Y3IA 4TTQA 5LA6F 2AW3A 2AHRA 5BYKA 3QMPA 3KVRA 3ILVA 5I9MA 4B3TB 4Q9AA 3HCFA 4R1SA 3CR8A 3FNHA 3FHJA 4NXMB 5TY0A 4FHDA 1E2IA 4WACA 5ARCA 1T0IA 4QQ8A 4YRGA 1ZL2A 3BMQB 2C7VA 4P7KA 5HK8A 5DYWA 4PSAA 3EQZA 3NWPA 16PKA 3QLJA 2FMTA 2HA0A 3RLIA 1N7GA 4NL4H 1KS9A 1WZIA 4A4DA 5ALWA 1KDPA 3BT7A 1UK9A 4MR9A 1XX6A 1DOZA 2V6BA 2XOKA 2O8DB 1QQ7A 2VSXA 3E5NA 3OEED 2J3LA 5LP6B 3G23A 4O0LA 4EYOA 5HJEA 1VMAA 1U8TA 2YXNA 1U5BB 3AVTA 1YJ8A 2QZPA 2WWVD 4EKYA 3T7KA 4S05A 2V6IA 4AN1A 3MRSA 3QW4B 4H08A 4K9QA 2VUTA 2E85A 2I5PO 3IPXA 4DXHA 4UZSA 1COZA 4GM0A 4EJMA 4TKUA 3AR6A 2ZG6A 3D4IA 1T9KA 1XCPA 2ATIA 3BXGA 2ZJ0A 1KOGA 2QTNA 4HAZA 1PHPA 4C14A 4CCWA 1GSOA 4GHWA 5KHOC 3F2VA 4LDJA 3F3SA 4KNVA 4IVNA 4J94A 3RQSA 1YU9A 3OZ7A 1B00A 4DNXA 1W8DA 4B4DA 3OKPA 4AYTA 4PW0A 1Z2CA 1ZD1A 1JTVA 3MRTA 1C9DB 2IXDA 3L0ZA 3SX0A 1P0IA 3CUYA 1O7JA 3KYCB 3O73A 4A3SA 1HDZA 3AEQB 3ZDYB 4D9BA 1TJ5A 3K0BA 4DQKA 4ZAYA 1XJ5A 4ZGWA 5TIIA 5AHOA 2XYVA 4ZV4A 2BGNA 1JWBB 1W0KD 4Y2QA 3DPUA 4EA9A 2R6JA 3DC2A 3IUQA 3KR2A 3OT1A 1RXCA 3LVFO 1PJCA 3QHPA 4NZYA 1E9DA 4Y6GB 1XRRA 3C41J 4H18A 5JAOA 4DMUB 3R3HA 1N8TA 3UMCA 3EZGA 4R6WA 4Z3DA 1E0DA 4XOUA 4WN9B 3ANYB 2EG9A 3PGLA 1XZDA 2ZJFA 3LA8A 5DYYA 1EXMA 3WRVA 3LBAA 3SYLA 4FN5A 1BIFA 2W6ZA 3E4DA 1GGHA 4YRTA 5BMVF 4JK3A 3GJYA 3RYHB 3STVA 1QU3A 2UVDA 3W8FA 7MDHA 3NTRA 1FMJA 1FXWF 1G3IA 1IPFA 2BLNA 1KJ8A 3PDIB 5B6JA 2PYIA 2Q4TA 2GPTA 1LB1B 1MUUA 4JENA 1MP0A 2QSUA 2V5VA 4FLEA 1JSLA 2UZIR 2ZJ4A 1HYEA 2NUAA 1XNQB 4HWRA 1WLSA 4WZAA 1ZKMA 1T9AA 3A37A 4Z1MD 1ZKDA 2J9GA 2Q8PA 5A0FA 4NS4A 5L3QA 5JAHA 1NZFA 2XMBA 1T36A 1ZUWA 3H3FA 1GZ6A 3EEQA 3GN1A 3HEMA 3M2PA 3GJ4A 1IONA 4QLOA 1W88B 4QZVA 2VWHA 4YUWA 1K6IA 1X9HA 2BF7A 1G6HA 1L8AA 2BC9A 4KFRA 2QX7A 3SIWA 2W6JA 4ZOCA 1VFNA 1PWXA 4EOGA 4O33A 1YJXA 5DYGA 1AN0A 3B1XA 3SYNA 4YRNA 4RTOA 1IBKB 3MG9A 3HMKA 1DIRA 3K96A 3IXMA 3DM5A 2K5UA 1LF0A 3TSCA 4QASA 3EPHA 5BN3A 4HRAA 1PT5A 1OI4A 1YVDA 2PSEA 4QDKA 4Y6LA 3VYSB 1J1IA 1ZK3A 2Q4DA 3EASA 2X4DA 4NNPA 4YONB 3DQZA 1UJNA 3E18A 3ZZTA 2NMVA 4Q01A 1IZ8A 1I4WA 2ZVDA 3KKPA 4UNNA 4D4MA 3DVLA 3OBBA 4MXDA 1O8CA 1V2HE 1CUGA 4B6FA 1QRTA 2WJPA 3IMGA 2WZBA 2QU7A 3FUCA 5LJIA 2OGTA 4E5MA 2VNJA 2CN1A 2NYUA 4J1TC 4P3NA 5AW3A 4UUAA 4C6HA 3PNQA 4X66B 2QXTA 3DVAB 3QOWA 2CKDA 3EH2A 5AK3A 4Z9FA 3RUEA 2O2IA 3T9EA 3USCS 4EX6A 3EVNA 4RKEA 4BX3A 3CURA 3T06B 3CQ9A 1X3SA 5I9SA 4D8WA 3TDKA 3ZD9A 1XDGA 1G17A 1FS4A 2VSYA 1O08A 5A03A 2I9KA 3KNZA 2V9ZA 2A94A 2RGCA 5TJ9A 3I76A 2P5TB 3LXXA 3TIFA 1NZJA 1PR2A 2HJ9A 3F5QA 5LBTA 3ZV4A 5F7ZA 1YWGO 1OXSC 4IEFB 3QELA 1DAGA 4ER7A 1JDVA 3O93A 3UQZA 4BAUA 4DC0A 1GXSB 3U44A 4OJYA 3ZVMA 5HRAA 4PFSA 3IIEA 1E7MA 1YC2A 1DUSA 1X7YB 2H1LA 1C7IA 1OKKD 4IIJA 2GN0A 2A9VA 2JGLA 4LC9A 3JVVA 3L49A 4ND6A 3EHEA 2P11A 4EG6A 1Z6XA 5BN4B 3L0DA 4IFEA 2X0JA 1TVKA 5DTMA 3L5KA 1ESDA 3NYWA 2P35A 3BIXA 2VP2A 2EW8A 4JA2A 2WIBA 3NASA 1MAHA 2ZRLA 2VH2A 3VKHA 5PNTA 5KKAA 1NKSA 3TIIA 1AUQA 1GTMA 4HFNA 2H2GA 2R68A 1Q91A 2X76A 3DE2X 4W9NC 4XDHA 2RJNA 3TMKA 5C46F 1EFPB 1QX3A 1WABA 2VNIA 4FFSA 2V74B 4I08A 3KELA 2AK2A 3ASZA 2FYTA 3Q4GA 4Q6BA 3NIGB 2C5BA 3O8QA 2ZUBA 4B76A 1NE7A 1PQWA 1Q1EA 3JYLA 1LPBB 5CW2A 5DN6A 3V1TC 3OTHA 5D51S 1VL5A 3EWAA 5DP2A 5G40A 1I51A 1OFGA 4WXPA 3K9NA 1UC8A 2QLBA 5IJ0A 2MYUA 3KZ1E 4CQLB 3ILYA 4BN4A 4N0DA 4ZAWA 1HG0A 2ZAMA 5AI5A 4E09A 3BWYA 2H4JA 3H2IA 2X5KO 2HFJA 3O3NB 4DPMA 3TDMA 1B2RA 3L0BA 1ZU5A 1JHVA 1PO7A 3ABZA 3LDGA 2IEZA 3DAOA 4EY7A 1HDRA 2R4QA 4KREA 4DY4A 2JZNA 3SR0A 4JUDX 3S2IA 2XV1A 2HC9A 2I22A 2WFAA 4HEQA 4WCVA 5CLIA 3ND5A 5EHIA 5HCIA 2OLKA 1DVRA 5HGXA 2QL9A 4I99A 5DE3A 2QUBA 3W0LB 1NWCA 3C39A 2FJ0A 4PZEA 3GG9A 2Z0MA 3NV7A 1KFKB 2F6RA 1LPNA 1WW2A 2BBTA 3RV4A 4BC1A 4ZEVA 2DPHA 2HJWA 1AH2A 1EFAA 2PKQO 3MJRA 4LISA 5BSUA 4CMCA 5J4VA 1ZL0A 5IN4A 1NFQA 2Z30A 2X9NA 1LDNA 4FFDA 4P4SB 2WF6A 2WZDA 4Q7LA 3RBZA 1SBNE 3U26A 4EF5A 4IYRA 5ES3A 4NCHA 3R7WB 4B7ZA 1Z5UA 4HYTA 3WKBA 3LFUA 3AKCA 3ZD7A 4YASA 1CQJA 2IXTA 2POQX 2H9IA 3DNMA 4BLSA 1II8A 3NYQA 1QPGA 4UHJA 4ZO9A 1B4DA 3C3BA 4NZNA 3EVAA 2YHIB 2RAUA 4TVKA 2OECA 2X6QA 4CG0A 5KTRA 2ZE5A 1KYTA 1NRIA 2R2AA 5E3IA 1DFIA 2RGDA 3JYHA 4KRFA 4HEJA 4JQOA 3GHYA 3KQWA 3WO0A 4X1YB 2XCRB 1XRNA 3NAQA 1NV8A 3QFRA 4KE7A 5AI9A 1NU6A 4TZ0A 4Z7NB 1IG0A 1IWBB 1XD8A 4J8PA 4DJTA 2JG3A 4TTTS 3IQXA 1ZA1A 3LHIA 5I7SA 1G5IA 2QT0A 3RAGA 2CHVA 3BTOA 1EVYA 2QSJA 3RVRA 1B0ZA 2MJLA 4Q4AB 2NYVA 4RY0A 4DLXA 1IRIA 2QJTA 1G8MA 4LE0A 4CTMA 3EUWA 3NT5A 1P1HA 4QD3A 2A1UB 2GEVA 3PXEA 1ADBA 4H0FA 2H8GA 2IPOA 3KAKA 4GLOA 3R3JA 4RIEA 2R25B 4LRXA 2J3IA 2ZSJA 5HF6A 1YD7A 3NGLA 1ZNYA 5FQOA 1DRJA 4DLKA 3AJEA 3LPMA 1QBKC 3U2QA 4YCDA 2HJGA 1FLNA 3CX7A 1C0LA 4MGHA 2BEVB 4MWCA 4IGIA 4PNEA 3SSNA 4ZARA 4YV0A 2NSJA 1KJWA 4M0LA 4L4ZA 5E1OA 4CWAA 4YV1A 4A27A 2XB6A 1V3TA 1DWUA 1BOOA 5DBEX 1VSBA 4LSMA 1TAQA 3THWB 3HJRA 2ZJ7A 4OAQA 3SJCA 3C5CA 3OJLA 3L6CA 4HDRB 3IOCA 1YASA 3ST7A 1KQFA 2Q0QA 1SHJA 2QRGA 3KJGA 4CIYA 4NJEB 1T1EA 3I0NA 1Y1TA 3BBLA 5C5CA 4B71A 2W83A 3U3DA 1NQ5A 4EZIA 3KKKA 2IX9A 3LYUA 2AR9A 1GEGA 2PRIA 2JHCA 3Q2KA 1I2CA 2VHQA 2DPGA 2W2NA 2JLWA 2P4HX 4WBSA 1YI1A 2ECOA 4NMWA 4QATA 1JB9A 1J23A 4ITVA 3WGJA 1KO8A 2J07A 3HHEA 2FV8A 1T91A 1F7VA 1ZG3A 4G9BA 3T1NA 2REOA 4JBYA 3D0QA 4EJFA 3GJ7A 2CHFA 1PR6A 2EWMA 1KTVA 3DZJA 3JYNA 3RC1A 5CB6A 3PUXA 2H1RA 4JLNA 4LVUA 4J0JA 1F2VA 3D6NB 1XBTA 5A0VA 4PTLA 3DFIA 2ZEJA 3AETB 5KHAA 3OTQA 4PC3A 1ECFA 5BSVA 2Q5HA 1NXQA 2QNIA 5AKZA 3CHYA 2J31A 1AZWA 4KX5A 3VPGA 3R9XA 3C6BA 4XLTA 4XPZA 5SY9A 1G8AA 5EJ5A 3H7AA 4KYIB 3GRRA 3RRBA 3M9LA 3NEYA 1AKYA 3M3HA 3RRZA 3WHKA 1M2OA 5HRCA 2Q21A 3Q9LA 4GRAA 4ISBA 1KDOA 3FOWA 4YBZA 1EVLA 1E1DA 1F6WA 3DW3X 3G0DA 2WWWA 4F11A 2I6QA 2D0OB 2ZJAA 2YYSA 2QGZA 4ZEMA 1JA0A 3KB2A 1LLUA 1B1AA 4LYEA 4F3YA 1X94A 2E7ZA 1XSEA 1UMBB 4I4IA 1FS6A 4G25A 2VWPA 4BTVA 3WMRA 4UFOA 5COBA 5FR1A 1P9OA 1WV1A 3HWSA 4ZI3A 2E55A 2IE8A 4KVAA 4MH0R 4ZVQA 5JPIA 2FDCA 1IVNA 2OC4A 4R8MA 1H2ZA 2PYZA 5G0TA 3AK4A 5B53A 2ORED 3K4PA 4BNMA 3GJZA 4ZKDA 4P83A 1EWQA 4GEGA 1Y1LA 2YXBA 2FF5A 1QGED 4GRDA 4XQGA 2IV3A 3R5JA 2VJLA 3C2QA 3KKNA 3ZIAD 2I8AA 2YQZA 3MCVA 3OHPA 1RXEA 4G41A 4BLUA 3VXKA 1JR3A 4TT3D 4BVFA 6GPBA 2YUIA 3NTXA 2OV6A 4TSFA 4F4HA 4F6CA 4UBLA 5FI5A 3TRHA 3BIFA 3M4JA 4DJAA 4BLTA 2FWJA 5CB4A 2ZI7A 5LPNA 1JH9A 1R8JA 1FQJA 1Q7CA 1UDBA 2GCGA 2QQGA 1KEWA 1W2HA 2D7JA 2DLDA 4HUQA 4P8RA 5GV8A 2VUSA 8AT1A 2WQ7A 1K88A 3T3MB 1SOUA 1R9MA 1ULZA 4L7QA 5CX1A 1BQ4A 1RCFA 1GG2A 3ZX5A 1D0VA 2V98A 4UAGA 2P90A 4IDBA 2AK3A 1I3KA 4GT1A 1UP7A 1ZVMA 3UT0A 1XK6A 4FKBA 4IUCS 1JEOA 1JF8A 4KITB 3DMPA 1SH7A 4WOJA 3LFHA 3KLPX 4Y6SA 3EE6A 4H60A 5I9IA 4WX2B 1L4LA 3V8BA 3RFTA 2FVXA 3I2JA 2WB2A 4QU0A 4W8OA 4EEKA 5JFTA 1RCTE 1LPMA 2QN2A 3AUKA 1FSPA 1YZ3A 1MT0A 3OQ6A 2JLZA 1S96A 3X1MA 4IO0A 5EE3A 2WR8A 4EVSA 2F90A 1O5TA 4M9ZA 4ZMRA 1XPJA 1SKYE 4QBGB 4WE3A 5IKPA 4RKFA 4J9VA 4TSRA 3PDCA 1YQGA 4PX2A 4Z8XA 1PFQA 1EK2A 2I9PA 4LWQA 4P53A 5AXBA 4LJLA 3ESZA 4M1OA 5KYVA 2QSZA 4LXIA 2L82A 2ODTX 6PFKA 2AOTA 1YQQA 1B6GA 3I30X 4Z2YA 4WJLA 4M3NA 1IHDA 1H2XA 3FKJA 2PPVA 1B6SA 4IOLA 4OXQA 2CHUA 3THXA 1RZ3A 1NURA 3DAHA 3W05A 4C1NA 4GSYA 5FBKA 1GYPA 4EB8A 3AUTA 4LHEA 1EM6A 1D9XA 1E6KA 4MCIA 2WI8A 2CXQA 2DHDA 5BNFA 1ZIDA 5KNCA 3BE8A 4INZA 4BBAA 1RWWA 3B5JA 3DZGA 4G4GA 1LEHA 4HX9A 3NDPA 3RAEC 2WPNA 4J2OA 4JT8A 3DCYA 3PG5A 1O8BA 1V48A 1YT5A 3DFMA 3IDFA 3OIGA 5DX8A 4YV2A 2HK6A 3EIEA 3QVOA 5C8ZA 3HXOA 1NN1A 3CZ5A 2NV2B 3L82B 4OOFA 2NACA 3F9IA 1U94A 1P8AA 4ZT4A 4FD3A 3PGMA 1IE3A 4UNIA 4A10A 1EUYA 5P21A 1WWKA 4DG8A 1E4OA 5FBVB 1M8JA 3AXSA 5BQPA 3OU6A 3WK7A 3M6LA 4JC0A 3B6MA 3WL4A 4F2WA 4PGHA 2NLOA 1VIYA 1XDDA 4KFUA 4N5LA 4GOJA 2A5FA 4RYLA 3T15A 4D3XA 1N9GB 3OTIA 4N3AA 1QO0D 3MN1A 2LCQA 2PNJA 1O9BA 3PUIA 2BR5A 3MWDA 1ES9A 1YRAA 1IZ7A 1U9IA 3PR2B 2FRDC 3UN1A 1EKXA 3OUZA 1Z07A 1RM4A 3HU2A 3PHIA 1GZ7A 4C0XA 4DLYA 4JP5A 2PFGA 4EAQA 3RSSA 1X1AA 5HVNA 3VO8A 3MWKA 1NJSA 3FRHA 3BD6A 2K4MA 2QI9F 3TKYA 4YAGA 5AVTA 1KAOA 3ITEA 1V71A 2OV1A 2R66A 3UC9A 2V6MA 3BJZA 3OX4A 1RIIA 4QYSA 4IIGA 4HH1A 2KM1A 1SU6A 1F5NA 3BMCB 1QU2A 5AI8A 1CJUC 1BWRA 3GBVA 5IDVA 3OSUA 3ROXA 1F0PA 3MJ4A 5KSZA 3ZG6A 4YGYA 1FW6A 5B4UA 2C0CA 2W71A 4KO2S 4P4TA 2IEIA 5AOAA 2G4LA 1HQYE 2OT3B 2DETA 2AZXA 1E1NA 1I3MA 3VSEA 4KYUA 1KEEB 1QMGA 4L3WA 1XXHB 2AZMA 1CZKA 3QJ5A 4LYDA 5B1HA 1FRFS 3SMVA 2PVSA 2PUEA 5IANA 3S27A 1HGXA 3NIFB 4JWTA 4U2GA 4HPXB 1G21A 1XP5A 3QHAA 3JYPA 5EFOA 1HRDA 2POCA 3OP4A 1P6UA 4EUSA 3EUFA 4YR7A 4YPVA 3T3PB 3E23A 4QTXA 5EIWA 5CK5A 1NUUA 3DOFA 4JI1B 2J3QA 3UKDA 2WYHA 2XYRA 1ZJWA 5EGNA 2VHTA 5F5NA 3E5MA 3M1IA 3V46A 3ZNQA 4PRZA 4YT4A 5C34B 5JD4A 3F78A 4RPLA 3GLFA 4A0GA 3O21A 1DIHA 3ZU2A 3CLUD 3HR4A 2FMKA 4LTDA 4D8YA 2QN7A 3OWHA 1ICEA 5IF3A 4YYEA 4AKHA 4IG4A 4D4JA 1V8DA 1D8TA 4J0CA 4LX0A 3TR5A 3O4GA 1Z22A 2B7BA 4LAFA 4H1VA 3NIBA 2JZCA 3M83A 1G8PA 1GFIA 4IGEA 4KPUA 2G6TA 4JJZA 3RR2A 1KZ7B 1LPAB 2Q0HA 3EGVA 4RHYA 1IHYA 5CA1B 5JAQA 3UIEA 2IEBA 4EVIA 1V45E 1KDZA 2EFHB 4Y7CA 2QPOA 2V6JA 5A62A 1AV7A 4O8ZA 2FY8A 1CUFA 1E6WA 1VG0B 3GV0A 3K09A 1NFRA 4MTCA 4OFBA 4RJLA 5FOSA 3I2KA 2ZRCA 3HVIA 3IMFA 4B3FX 4UVHA 3MHPA 4JA0A 3T41A 4BKOA 1HORA 5BPFA 3ETNA 4PO8A 1F2UA 1PNQA 2YFHA 4QGSA 4GL4A 1JBEA 5BUSA 1OYOA 4C4XA 4UASA 5BNTA 3PC2A 3LX4A 5JNVA 2IIPA 2PLFA 1LPPA 3K2EA 3PUZA 5ALXA 5FPTA 2C1EA 4XX0B 2YR0A 4O63O 2QPTA 3A9CA 3MAAC 2OM6A 3IR7A 4E7PA 1YAHA 3DOCA 3RREA 5KNBH 3AR7A 3MMPA 1G3QA 4F56A 5AM3A 4Z99A 4EHLA 3KOOA 5B3KA 3T1YB 4QNMA 3NBZC 1R6AA 1L7PA 2ETVA 1E9BA 4BFXA 3TCKA 2PT9A 2ZT7A 4M8IA 5J2UB 1R27A 4EPTA 4CL0A 2VNHA 4Q4HB 1DO0A 3ADPA 3OOYA 5JCJA 2PCLA 3DNFA 1CV2A 2XQIA 3E48A 4FQ7A 3EK2A 3KSRA 3ORYA 3SXJA 1QIFA 4MB6A 3FOCA 5JJBA 4E12A 3E22B 3JS5A 3K6JA 4NTZA 3DHYA 1LDMA 3DTNA 3PDHA 4I1IA 3VJMA 4CHGA 4D9EA 2VHCA 3RFFA 3RKUA 1H0RA 2QRKA 1ZI6A 2HTEA 2FWIA 5LMUB 3GLIB 3HUEA 5K3EA 1IOZA 3JTEA 4XVCA 1Z8FA 1CRZA 2V7BA 1KMNA 1KXZA 1A7AA 4LJKA 1XTUA 1EFDN 2NVBA 4JX9A 1Q15A 2VF5X 4NU5A 4TPKA 1JEQA 2HUNA 3OX2A 4HGPA 4HTFB 5F78A 3CEPB 1BN6A 4YJ3B 4NQZA 3HA3A 3COYA 4RCVA 4UATA 1SVNA 4I3GA 2J8ZA 1U5AA 3AI2A 1T6NA 2HEGA 2O3TA 3AL3A 3CF6R 1L2TA 2KJQA 3FHCB 3LW8A 2YN0A 3VZPA 3WLOA 3MJFA 4KP7A 1U98A 2RMKA 3HABA 1MQAA 1Z2AA 4JEHA 1JEDA 2CXXA 4C4YA 4AUMA 5C52B 1L7DA 1O58A 4MTLA 5MDHA 4CW7A 3WBBA 2ZZMA 2P2NA 2D5BA 2OZEA 1RMTA 3GRAA 3C6YA 2GZSA 1VHJA 3OAAA 1ZCJA 4RPCA 4DDMA 1X1RA 1HLDA 2SECE 4S3MA 5A3QA 3RE1A 1FTYA 2RC6A 3QVSA 5F1YA 1NW4A 1X1CA 3DGFC 1NVBA 3MJHA 4YAWA 4HZGA 1X2EA 4B6GA 2JRLA 4FDVA 2ZJ1A 3IHTA 1WUYA 3RC2A 8ABPA 3BE6A 1NM5C 3G9TA 1ZM9A 5DWDA 1KPHA 4UHFA 4JOQA 1CZRA 2ZWVA 3E7FA 2VJNA 3PYMA 4UHDA 3LPNA 1J2JA 2ZI3A 2XI4A 2JD2A 2I1VB 1LDEA 1MQ8B 4OHXA 2XGGA 4BMZA 1VJ1A 2QYHA 1L4NA 1L6RA 1N6PA 1GILA 3RHZA 1EGVB 1Q3HA 4WNYA 1T6YA 1P2VA 4RKWA 2OP1A 2H4WA 4CM1A 3U0BA 1LKZA 1ZI9A 4FMPA 4YCMA 4KX3A 4W6ZA 1KBOA 1A95A 1L3CA 2PIDA 2C61A 3EHDA 2JFUA 2I6GA 2P2GA 1HFWA 2JFWA 2PXHA 3LC2O 3GELA 4G1VA 5HJ7A 1GNLA 5EIOA 4N76A 1GTZA 2ZT6A 2FXIA 3GBPA 3UXYA 1WKVA 2NIPA 2Z8YA 4LS3A 4ZXPA 1SBZA 3PE6A 5DVZA 4HNAA 4X20B 3ZI7A 1J97A 2GPNA 4A6XA 4DLTA 2ZRQA 1ZHOA 3MCZA 2H52A 4Z4HA 1VLQA 3GI1A 3K9WA 4W7IA 5NULA 1ID1A 1PK9A 3K30A 1ZMTA 3R3YA 3AWIA 1RZUA 2JJ2A 4KV7A 3EDQA 3WKAA 2ENWA 4CUKA 4GX5A 4RHXA 5D85A 1L7OA 2EF0A 2WIGA 2CJPA 4H0CA 4Y9RA 1V3UA 5LYJF 5G3ZA 2CV1A 4V0SA 1YJBA 3ENQA 3TX6A 3E5HA 4Q1DA 2QXYA 4GPIB 1M5UA 3IBSA 1D2NA 2NAPA 4OIMA 5HKKD 4BGDA 4MV0A 1NJ1A 1V4VA 2DOKA 2EZ9A 2PGXA 3DT9A 4QECA 2FUKA 4JJEA 5KSWB 5KCZA 2CLEB 1TD1A 3M3DA 4DDKA 1SEPA 1P2BA 1CR6A 1T2CA 4HDKA 2AR0A 1NC3A 2I3GA 3I6MA 3N0RA 3ESBA 2ZRBA 5J40A 1MFPA 3OOSA 1GU1A 1GCOA 4XKJA 4ZIRB 1ZVQA 2OHOA 2UZ3A 4GPD1 4EMTA 3LGSA 2F43A 3NXKA 4UXJA 4RVOA 3KEGA 4W5NA 1JLRA 3BA1A 1K98A 3OD5A 5L6MB 4G56A 2BYTA 1QQ5A 2WUGA 3KETA 3EXG2 1BS9A 3ANSA 3A26A 3DJFA 5CPFA 2FPIB 3U4HA 4WBNF 3MJVA 4QICA 3DR5A 3G79A 5CURA 5JROA 1BS2A 3MWYW 5DBOA 2XY4A 3WICA 2IP2A 3DNPA 4RMHA 3BIWA 5KJEA 3AZQA 5DCYA 5KNCD 3AT1A 4IH1A 1W6RA 3QLUA 1OXXK 4FSDA 4CIDA 1GOTA 4DLUA 5COQA 1T2DA 3A6PC 1CFZA 2NPOA 1ECJA 3GFGA 4JBNA 4JYPA 4A2QA 4PGMA 3RLFA 3SX2A 2BSAA 4PSDA 4DUGA 2XXAA 4I55F 4J0DA 4P93A 3UAVA 3BREA 4EHFA 5C1DA 5KWIA 4CXMA 5J5AA 3Q5DA 3BICA 4ILEA 3L18A 1NFFA 4HF7A 1NOIA 5DB4A 5AVOA 2VRCD 2O3RA 1HYQA 3DZCA 4CNQA 1J6UA 2IS1A 1F8GA 4QFDA 4XSVA 1RWVA 3QXCA 5TQ2A 5BR7A 4UCXA 1YGPA 3I9NA 5B6PA 1EB9A 3DAGA 3EFBA 1MC1A 1Y3DE 2VYQA 2HIGA 3D54D 4PLFA 5LMZA 2NTJA 2O48X 3E05A 1M7GA 3CXUA 1TGYA 4L16A 2DG2A 1XLWA 2VJMA 2X0IA 2E5LB 3LK6A 3UBMA 4FQ8A 4Z1OA 1GR1A 3CNBA 5JVDB 2ID9A 4UZFA 3D2AA 3EXFA 4ZVSA 3OETA 1ZN8A 1SK9A 1MOZA 4K5QA 2OFWA 4WI1A 3J81A 2VATA 1D1TA 1WBBA 1M7BA 2QL5A 4RQAA 4OHWA 3ND8A 2BFAA 4C7JA 4F97A 4CM8A 4OXRA 5HS6A 1QHNA 2JJ1D 4V2IA 1IN7A 2P77A 1DT5A 4ESHA 3AB7A 5ARBA 1BRTA 2VDWA 1XQ1A 1KL7A 5T4HA 1WPGA 3LBNA 2ASVA 2FZ4A 3EGWA 1O6BA 1QIDA 4UD2A 4C0SA 3IPYA 2IOHA 4IH4A 2P9EA 3JD3A 1XRMA 2OGUA 3FIUA 3OH8A 4BNZA 3MWFA 2E5WA 5H59A 2PMEA 3ZW8A 4PS1A 3WRYA 2MT9A 1AQLA 3JAKA 1F0KA 4X54A 1KJJA 1Y5IA 2ZRIA 4UVIA 4UOEA 3S99A 4NKRA 3P19A 1I2MA 4O4JB 1SUEA 2C7BA 1JIUA 2WNSA 3L1UA 3MQ2A 4HN4B 1Q19A 2WKPA 4RA6B 2W2LD 2V7QD 1JU9A 5K0JA 4AQ7A 1ZCZA 4H6VA 3K1AB 4FX2A 3RFVA 5KKCA 3HXMA 3KD2A 2DSNA 3DO5A 3NHAA 1KMQA 3GD5A 3LZDA 2NNWB 3EGXB 1I2ZA 3AUYA 3IBFA 4GPEA 1RYDA 2Q49A 1JDTA 2OSBA 4MQ6A 1PZNA 3TQHA 4DM3A 4PN7A 1ZJ4A 1YS1X 2P9GA 1E2GA 3LRPA 4X94A 1XHFA 5DBFA 3DTVB 3DEZA 3V2IA 4CKBB 4C4TA 2HCBA 2RHHA 4RM2A 1R5OA 3MVEA 4DNFA 3W5UA 5ELXA 1D6JA 1WZNA 2RJ3A 3MFQA 4BV9A 1U1FA 2FPSA 3WK4A 3RW9A 2O8DA 4NSNA 4D8VA 1U1GA 2E5FA 4IEIA 3UVEA 4LBYA 3N2KB 5IVKA 3IHLA 3PD1A 4L1KA 4EX7A 1U5BA 2DPMA 2F64A 1Q3TA 2G9ZA 3KKOA 4OQYA 1E0SA 3TK1A 1X74A 3UJ3X 1DRKA 4MEJA 4RADA 2V4UA 5A4KA 4QGBA 4RTMA 4V02A 4CR8A 3F97A 1IUNA 1HY3A 1KK3A 2RHCA 3COSA 4UU8A 4B6QA 4DXAA 1EA7A 4EMBA 3DM9B 1XMJA 1JW9B 4XR9A 1OMOA 2I2CA 1IL0A 3ZY2A 1EBBA 4B7XA 1E9RA 4MDFA 2C9YA 3O4FA 3UAXA 3G2IA 2HHCA 3TNLA 1VE6A 3DLCA 3R3UA 2J4CA 4HJXA 3A11A 4RVHA 2HMWA 2P69A 4D3FA 2HHLA 3KYCA 1P1RA 3T3IA 1Y6QA 3D8TA 4UDOA 4WASA 4AY2A 4AROA 3P52A 1DKOA 2ZU6A 4DUZB 2YVUA 3CH5A 3DG9A 1SU4A 2PMBA 4FMDB 4MDYA 5T5QA 3FLBA 2XQKA 4YJHB 3C70A 2ZJYA 1N5MA 3IA2A 4G24A 2ZUWA 3A0RB 5TT1A 4QBKA 4B5KA 3CNLA 3IKTA 3R9WA 2FSVC 5ECDA 1JJ7A 4PZ0A 4HUJA 2XMRA 2K87A 1DTEA 3H4IA 4YLYA 2Q3BA 3PKJA 1VL1A 1FNSA 1FDUA 2BGWA 1B15A 2QR3A 3ABOB 4R9NA 1SULA 2ENUA 2R11A 2VHWA 3HCDA 3WV4A 2OBNA 4KR3A 1NUPA 5BYAA 4FZVA 3JSAA 3X3HA 1Y3BE 2G1AA 3IULA 4BV8A 3DHWC 2YYYA 4NJOA 4D82A 1U7PA 4QDTA 2FFHA 3OIVA 4WLFA 3DMNA 3WZMA 4RIIA 1DAIA 1SUCA 3EXEB 5G3YA 9MHTA 4KQGA 2QRVA 2ZJBA 1QYIA 3AW9A 4D9IA 1P1JA 4UUNA 4REMA 3IPLA 4MUHA 2OQIA 1L5MA 1QYRA 2ACEA 3P0IA 3ISVA 2QZZA 2ID8A 5ENDA 4ACAA 4JGIA 5TPZD 1H23A 3TTUA 1B0UA 1UBGA 3UPUA 3G5LA 1Y37A 2OOSA 4QXQA 1GIAA 1J2TA 2A6PA 2BTOA 2VJAA 1U4OA 1F48A 2BGTA 3B5IA 3DOOA 2J4DA 3E9DA 1WVIA 2D5IA 3C7TA 3L7JA 1ODCA 1Q95A 1OLXB 2PYDA 3FNRA 3PUHA 4ZAXA 5JE8A 4BB5A 1N2EA 2AZDA 4JYMA 1B1CA 3MD9A 1JJFA 4M9UA 1NQOA 3WWYA 4MS3A 4L73A 1M76A 5JH7A 4TMTA 4CKEA 2CGEA 3H0CA 2GM5A 3CN7A 3MWGA 1EEHA 1NW7A 1B93A 2MSLA 4XRGA 3AUXA 4R6XA 5T57A 1B8OA 1DC5A 2JCBA 3N8KA 1G66A 3GEGA 4EDFA 5LA6A 4RV4A 3FDFA 2BCJQ 5MHTA 2H07A 1QOQB 1IH8A 3DMRA 1VYTA 3AIMA 2OUIA 2V5UA 4MUFA 2BH2A 4US0R 3DMYA 5CJ2A 3ZX4A 1D0IA 3BCSA 2R0QC 4LYJA 4PYMA 2OQVA 1UBHS 4NDAA 2C8VA 5ETJA 3AY6A 3FETA 3FMOB 2VPXA 1KXJA 1NRXA 2AEJA 1VMEA 2ZANA 2WD9A 1QKKA 3S7TA 1H3FA 2P0AA 4XB6B 1U3GA 2CVQA 2FDXA 2HZBA 4KSCA 1K8YB 3WYAA 5DTIA 4Y9UA 2BFEB 5COAA 2RGNC 1GZVA 2OZKA 3GGDA 3MLBA 3RVBA 5HBRA 2ZPTX 1VA4A 2XJ4A 4OKIA 2N9UA 5GONB 1X7YA 4NU0A 4ZVUA 1BEUB 1JQBA 2ISSD 4R1NA 4UQPA 4E32A 4ESEA 1N34B 3WIOA 2QYSA 4RH0A 1WD5A 5CVDA 5KC9A 1KQGA 1Y3CE 2CK3D 3OA2A 5CH3A 5EC8A 1EGQA 4MW6A 2QUIA 2IV2X 2VWGA 3LA6A 1XMPA 4IWNA 1L5YA 3D3KA 3FG9A 3OESA 1LH0A 4N03A 4KBGA 2FGJA 3OPYA 3UJDA 2P9FA 5C8YB 3LAWA 5E4FA 3OY2A 1W93A 3VQTA 1EFPA 2H1CA 4OF4A 3F1LA 2ZB3A 4WK0B 2W2OA 4RE6A 1SMKA 2C5FA 2FX5A 1FJ2A 3OQMA 1U2GA 2DBZA 4M9CA 4FVTA 5DNUA 4ZANA 3AX6A 4NE2A 5KYWB 1CDZA 4HQNA 1NP3A 5C0OE 3H0KA 2AXNA 2GO1A 4MUKA 1Z4PX 3T52A 5B7NA 3HBLA 3TN7A 2CFSA 1XTKA 2WJHA 4UD6A 5F21A 2FPPB 4MAMA 3G2NA 2DHRA 3PQ7A 4G0VA 2NO6A 4NZOA 1JNYA 4JAVC 2BONA 3GAZA 2P6OA 4N0QA 4EW1A 2ZE6A 2ONZA 4XIYA 1Y6JA 4WWHA 3LF2A 4DMLA 2LDXA 4MYUA 1JTEA 2X86A 1VSVA 1P31A 1G42A 3ET5A 3NAMA 1OIVA 2WF8A 2Z3ZA 1HSZA 4WZAE 5K4GA 4GPZA 1UKEA 4EI9A 1QKIA 2H63A 4TL7A 5DPMA 3Q8LA 1NBEA 1T5TA 3VR4D 1WCYA 1E1RA 2WKWA 5I01A 1O3YA 2JGDB 4FZJA 1CQIA 1QWSA 2YJ6A 1PT9A 1WZEA 2Q8NA 4J0EA 4UM8B 2NXEA 4B74A 5JWOA 4E03A 2DX7A 1KPIA 2H2DA 2K2QB 2ONYA 2OPBA 1VLLA 3GK3A 3EMVA 3OECA 1SA0B 2MINB 4RD6A 3I39X 2BKLA 3DEIA 3Q88A 4BNTA 5IYZB 3NHFA 4P4SA 3HK2A 3UG7A 3SY8A 2FRXA 1SXQA 2EZUA 1W1UA 3OURA 3R7WA 1R4NA 1TCUA 2EHDA 3PFKA 4Q0MA 3KHKA 4Y2TA 1N2IA 3T9DA 2BZSA 3P26A 2TYSB 3I1FA 3IO5A 1C7RA 2YH2A 5FORA 3R2JA 3WS7A 3TLCA 1A97A 2WUWE 2X5XA 2YHIA 3QUAA 4DLWA 2PSSA 2DCUA 2O2YA 3ETDA 4CM9D 3HCWA 4AJ4A 4NAHA 3AUUA 1BD3A 3PDJA 3VR3A 4LE2A 4L5IA 1DG3A 2ZTVA 4GMDA 3V2GA 1SUSA 4ZEXA 4FMCF 3P0RA 1R0XA 3T5MA 3UMMA 2ZYUX 2BE9A 3RTGA 3ON5A 4MGKR 3TZLA 4QBFA 4X93A 3WDMA 3C7CB 1AG9A 2R6HA 5LOVB 5E0KB 2XNSA 4JUAA 4Q4AA 1DOHA 3RWMB 4FUTA 2FZGA 2AYXA 4GYWA 3RARA 1GAWA 2Z43A 3N8IA 3OT5A 2ERYA 4N7BA 1WDLA 3GMSA 3N2YA 2AEEA 3QPUA 1YRWA 1XVTA 4PLWA 2YY6A 1RJFA 2DM6A 3P4XA 4ND1A 3D3QA 1LRJA 2CFCA 1JHOA 2NZVG 2DQ4A 3I58A 3KEFA 4ARBA 5EHQA 3QMVA 2EZ4A 4UU1A 1YR1A 2Y2UA 4PBSA 3RHTA 1U1IA 2BEVA 1Z6GA 4ITUA 4D4LA 5M2QA 4B4WA 3DV0A 2XBUA 2GSWA 4GKBA 4FWBA 5IXJA 1TJNA 3HA2A 2I55A 3THWA 2JI9A 2P68A 4P80A 4DNPA 1UPCA 4H15A 5ALZA 1PZEA 4JHXA 1C8KA 1ZH2A 4ALIA 1J07A 1DIBA 3G2QA 3U5TA 1HNNA 1FK8A 1TTPB 3M9WA 4HDRA 2R1VB 3LKZA 4EHBA 1XU9A 4NJEA 3RIHA 6NULA 4M7PA 3P2JA 4XZ3A 1BWQA 2YOHA 1C80A 1GADO 2B34A 2R3SA 4YCSA 5T7BA 3OQNA 4DR6B 1AOXA 3PFCA 3B51X 3WLMA 2VOEA 3FYTA 3HJAA 5K3DA 4M38A 4L15A 1LW6E 1NRJB 4Y2JA 1EJ2A 2RGWA 3CZAA 1ATIA 3F6PA 5FLXA 1F9AA 2VUHB 1VCMA 4GOOD 2HXSA 3W6ZA 5JAUA 3EVFA 1TT5B 4TRJA 3T7EA 4ZVMA 4CKCB 1MOQA 3Q72A 5C4MA 2ZZNA 3L0PA 3BN3A 1ODKA 3FYUC 4GMXA 3ZVLA 5AQ1A 4ZOQI 3PHGA 2DKFA 3B3QA 4B2YA 1BCSB 2WYVA 1TZCA 1QJCA 3KCQA 5CK4A 2GOYA 3SR4A 1N2ZA 2AD5A 3EZYA 3IQWA 1IOVA 2WSMA 3AETA 4LRQA 4I8IA 5AVRA 3VNRA 3HCAA 3IKVA 4B4OA 5LLTA 1YB5A 2OMKA 5SYMA 1VTKA 1NJ2A 4M89A 2C9ZA 1JIIA 3ZKWB 2WTXA 4CCAA 2I4LA 5TVGA 1E2QA 1FU4A 5DMXA 4CZ2A 3IE1A 3AV0B 5IVDA 4DDUA 2RJOA 3B12A 5BW4A 4URZR 3UMSA 1I6LA 1GL3A 2UKDA 4PCAA 4RJ2A 1E3EA 1EGHA 1X7ZB 2NT4A 3LUGA 3F2IA 4CMHA 1T2EA 2Q9CA 4Q4JB 4UPEA 1T43A 1VLJA 2GKSA 3NW9A 1JILA 3RUPA 2O1EA 2B83A 3IUJA 4ZFNA 2WWTA 3A28A 3CISA 3KJNA 1AA9A 2IUUA 4A36A 1KEZA 1Z2OX 2BIFA 1BEZA 1CEYA 4QBTA 1JHUA 1VM6A 1OWLA 2PT7A 4B5LA 1UMBA 1NY6A 1OUMA 4BNXA 4HHEA 4KQKA 2DWUA 2PS1A 3DDUA 2WSLA 1FDIA 4EHNA 2XAUA 3E2PA 3WNVA 5GV7A 1XKLA 2EW2A 3BXHA 1JIKA 1N8SA 1J8MF 1EVEA 2OZVA 3ANTA 2Y3IA 4HNGA 3TZEA 1VFPA 3OLZA 4MJLA 1E7YA 2J7PD 4ZU6X 2H9AA 5FOXA 4JOSA 3Q3IA 3YASA 5C7OO 4ZHQB 1QRSA 3O8NA 1GUDA 2REXB 3ZCTA 3MPOA 1ZO8A 1GNQA 3PQCA 4QNRA 1MGPA 3OZVA 1WXGA 4DEYA 5JYEA 4ZWNA 3FCCA 2PKQP 1Z82A 2PZAA 4MGEA 5IJZA 3WL5A 2H7VA 4TTVA 4AS1A 3GXOA 4WLEA 4M36A 4E15A 4UCWA 1ORRA 5DM2A 2F3RA 2WQZA 3TOCA 3K0HA 4ZCRA 4QO8A 3MAJA 2O8EB 2Z83A 1VCIA 2XCIA 1AU9A 2YZNA 1L5ZA 3GCDA 2X40A 3WRXA 3W04A 2EERA 4DA8A 5BRAA 1VPEA 1VRWA 4WKPA 3VDNB 3WAJA 5EKXA 2ZP1A 1V2GA 2FEAA 3SC2B 2IHUA 4NCXA 3PI7A 3L8HA 5G53C 5HNKA 4MQ5A 2ZBQA 2OHIA 3BXEA 4OV6B 2BMWA 3L04A 3AVXA 4BJ3A 3PR3A 4OQLA 1ZNZA 3ZDRA 4A0RA 3IT2A 2X8WA 3CIOA 1BX0A 3GNQA 1UC9A 3V8QA 1YQUA 3NRCA 2FX3A 1CQXA 4AMZA 1YZHA 5DLQC 1SUFA 4TRRA 3DXFA 3F6CA 4LF5B 3ZK8A 2R6GA 1CNFA 5GWXA 2XWPA 1XTIA 3EVDA 1PGOA 1MD9A 2GEUA 3V7WA 1U8AA 2JGMA 4BNIA 1RS0A 4AQDA 2K6GA 3M33A 3HADA 3QOFA 1PTKA 3SSAA 1GP2A 2P7HA 4QIHA 3TX2A 2QN6A 4F21A 4LFAB 1LK0A 1EXDA 2B5VA 2ZUEA 4LVNA 3KTFA 4D56A 3FVVA 1UOPA 3K92A 5BQOA 3BWVA 3B13B 4RO0A 4ZREA 5IKMA 3OZCA 5CYGA 1UXKA 2WWIA 2X7HA 3GNTA 5E1BA 1SG6A 4FZ5A 3I8XA 1QVWA 1VMKA 3X1JA 1SGWA 4DR1B 3UK2A 1KAEA 1VI5A 1XC7A 1BXRA 1Z88A 2DP4E 2MSDB 3K9CA 1R88A 3NGXA 2GEJA 4U63A 5DASA 5GOZA 1L0BA 3CO0S 3DLAA 4OCZA 1BGXT 2VSQA 2GBGA 4GVLA 2DLNA 2QE7A 4AMVA 2YRFA 3OE7D 5IPFA 1L7AA 1Z39A 2P75A 1X38A 1DUVG 2P4SA 3CW9A 3FX2A 1NVAA 3IUSA 2FW9A 1HTTA 5KDLA 5TSDA 2C2BA 3U3JA 2GB4A 1N3IA 2YASA 2CZQA 2OFPA 4L28A 4TZKA 4E4TA 2K7FA 3N53A 3E1SA 1EG7A 5F23A 3FLEA 3KYJB 3WFJA 1I4TD 1KK0A 5ALKA 3B3FA 2DY0A 2J4FA 4Q1CA 3W9SA 4Z54A 1WB9A 1UBTS 2V7XA 3B7WA 3B9RA 2GZHA 1VMDA 2PSFA 4AKTA 3E9CA 4PAWA 3IAXA 3DBLB 4HRVA 2G9NA 3ZNNA 1Q0LA 3IP3A 1VGRA 4LJAA 3V6LA 2J67A 4ALJA 4AKSA 5IAAA 1ADYA 2X9LA 4MV4A 1B2LA 4B3SB 3OJ0A 4ZPXA 2ZU0C 1K7CA 2SHKA 4RELA 3DHVA 1X9IA 2DRIA 1NQTA 2DR3A 3DDNA 5EYPB 4PRKA 4CT5A 4E22A 4ZJZA 3U4QA 3QKTA 2H7CA 4XJXA 4I3HA 3RU7A 1DINA 2HCRA 1Z4JA 1EFHA 4PLTA 3A2MA 2MR5A 4XH9B 3TBFA 1W4LA 4QQRA 1K6MA 3N2EA 1REQA 3KOXA 4HN9A 4FFRA 2QMEA 2W11A 3EA5A 4P7GA 3Q6NA 3TFWA 4RY9A 1K75A 1PRYA 3NH9A 1TW2A 4DC1A 1W19A 5E1DA 3LBFA 2DR0A 2VTDA 4IUBS 3HZRA 3TECE 1QPZA 4HB2A 1KI9A 4ZAZA 4U0JA 3BMCA 2IY9A 5U9CA 4DDWA 4BFLA 3KJQA 2W6PA 4D0SA 1JR3E 1KOJA 5TARA 1S3GA 4PCUA 3ITKA 4KK4A 4Q3CA 1W47A 2BHTA 4G5GA 1JSZA 4QC2A 3MBIA 2ZSUA 3BL5A 3CX6A 4AICA 4H4DA 2E0IA 5FWXB 1S6YA 4YP7A 4LJ6A 4WK6A 4LRSB 1OWMA 4QDXA 1Z0SA 4R0NA 4YP6A 4KXQA 4R54A 2H18A 2GZDA 1KEEA 3A6FA 1Q7RA 2VDPB 4K9PA 4ZK2A 4HZUB 2PEZA 3SNHA 4UEQA 1XCMA 3N07A 3PJGA 1HDXA 2PGNA 2AG1A 1ZU4A 2O2GA 3TCNA 2D2VA 3W77A 421PA 1NUHA 5HIAA 1W96A 1DADA 1UMCA 2YTZA 1BHO1 1VC2A 5EJ2A 1QNFA 5ESXA 3BULA 5C37A 2XT0A 5CM2Z 1YHZA 1S3SA 3ZZMA 5CDSA 1DDGA 1EB8A 4AX8A 3BGSA 2J6CA 3D3NA 5DYNA 4TV8B 4F5WA 4G81A 1SG9A 1Z83A 3FNGA 2CHEA 4RK5A 3C85A 3L4EA 3MTGA 3NBUA 3U48A 3D6TB 3QY0A 4JP8A 3EFEA 3M89A 3B36A 4RABA 4WJZA 1Z7WA 1FP7A 2MMCA 3GPDG 3O8BA 1LPOA 4HX2A 3IKJA 1NHWA 4UTNA 3MTIA 4GOXA 3UEOA 3TRFA 1LNQA 1NQWA 1QUEA 3LWBA 4P81A 3PFGA 3BH7A 2QY9A 1FTNA 3DFKA 3AHHA 3KE9A 1GGMA 4IILA 3PB3A 3ONEA 4MEAA 5CA1A 2FPOA 1HM5A 4I4TF 3EZXA 5EA2A 3WGYA 5HP4A 1VJGA 3S1AA 3IVCA 1DXHA 4WY5A 4YB8A 3TZ6A 2AJTA 2VI5A 1DMSA 5EHGA 3T8YA 3ZHVA 2DWCA 4JJGA 3ZW9A 2X14A 4IQFA 1PNRA 3RPEA 4JR2A 4UPDA 3QVGB 5ALLA 1P81A 1GTG1 2O0LA 4X6LA 4B4VA 1HF3A 1M6WA 1SD5A 2JIZA 5A9SB 1PEKE 4EI8A 2WWFA 2A88A 2Z5VA 3GGJA 4MOWA 3ZY5A 3QSYA 1RBQA 3PWZA 4F2GA 3VZQA 1TCVA 3L2OB 1Q0UA 4B2LA 5E6SB 5KJFA 2AG5A 2WHXA 5IAGA 2XUGA 3K9GA 1U2DC 4PHHA 3E7DA 2CHQA 4H1TA 3GGSA 2B2XA 2Q6LA 3ZDDA 1G60A 1DEAA 3ZJUA 2NAFA 1X19A 1YE5A 5HZMA 3KZKA 5AKYA 3ZBUA 5EERA 1N4AA 1CFJA 1WDMA 1NN5A 4FN4A 4LRYA 4M1ZA 5FPHA 2KW5A 4GP7A 4AVYA 4BFTA 4ABTA 4Q4HA 4DRXB 3VKGA 2CLSA 3X1ZA 1LWNA 1XMQB 4EGQA 1H4SA 4KODA 2PVCA 4ABYA 3HFGA 3K9BA 1Q12A 1P74A 2WVAA 3FBGA 3GUCA 3F49S 4MW9A 5AJVB 7MHTA 1RNLA 1TKAA 5JPDA 5EIEA 3KS9A 5E3JA 1MF7A 2GM3A 3RGWS 2NYRA 1NOJA 4CQJA 3PLNA 4YRPA 5LQUA 2LBPA 4F93B 2VPIA 2C59A 1P18A 1XEAA 3A10A 4UXHA 4A2WA 2AUNA 3C3CA 3BS4A 3C6XA 4IICA 4MW4A 5FNVF 1KO4A 4H4EA 1OX6A 5SZHB 3AEKB 2GAIA 5CG2A 4HTFA 2VHEA 4JYZA 4UOZA 1E8NA 1XTZA 3C3JA 4YCLA 4YJ3A 3FKSD 4F2HA 1T5HX 4RS3A 4A2PA 1M6VB 1Y7LA 4X7BA 3DLHA 1NYQA 1AHHA 4PPFA 4XWTA 1Z7GA 4IDAA 3JD1A 1PK8A 4I1VA 2X42A 4H7JA 4MW2A 2PUTA 4GO1A 3SSMA 4PINA 3V2UA 1TEZA 2O8FB 4DLPA 3PXGA 4FGJA 1V41E 2BBSA 2G67A 1DDIA 1G55A 2QAGB 4M21A 1EQAA 4O4IA 5CM9C 5TJHA 4MRPA 3AUJB 3IEMA 1NKVA 1M8FA 1KFEB 4Y2YA 3VV2A 4HXFB 3VH3A 2WA2A 4ZAVA 5JRZA 4M6WB 2FZKA 4MVJA 1ECLA 2RK6A 1VL2A 4G1UC 1G21E 5IM4F 5FUVA 4P6VF 2QRMA 2G72A 2IA5A 3NHKA 2I03A 2I7XA 1JLHA 4JBLA 1DEOA 2XSZD 3MPUA 4OSEA 1KVSA 4WINA 1RAGA 5EIAA 3M6FA 4ZI7B 2IYQA 5DT2A 3G2PA 1PD1A 3HY6A 4D5GA 2QUAA 1X9GA 1CUYA 1S4MA 2CL5A 3CLSC 3JWIA 3RVLA 3DEFA 3ZCQA 3GLFE 1GV0A 4OQFA 1WQ4A 2Q1TA 3IBYA 2YDXA 5EJGA 1H0SA 1GPWB 2UAGA 1T4CA 4MW1A 3AF5A 4Y2UA 4JZYA 1FFSA 3VTFA 4CF6A 2R7KA 2Y67A 3V7NA 4KO8A 3LDUA 4LFBB 2LP4Y 1DE0A 1QTQA 1U2ZA 4Q21A 4KZPA 5DCWA 3I5XA 3TI7A 1DJNA 2HDWA 1N77A 4CV3A 3F5FA 3SLGA 4Q3NA 2WIFA 1YUMA 3FVQA 3SS7X 1LZLA 1NVVQ 2CMGA 2OVFA 3MWJA 4PV7A 1O95C 4UEOA 4XVUA 5B30A 4X62B 1Y82A 3JD0A 4NOJA 1WO8A 1P9LA 5KB3A 4L8GA 1VJDA 3BFVA 4PG4A 3CLRD 3D0OA 4X20A 1XTBA 1M2JA 2W6NA 4YRCA 5FUXA 3U9TA 4HZIA 4MRMA 1N2SA 5BV0A 2VH5R 5TMPA 3ZIDA 4TSKA 1PVDA 4S35A 4WCDA 3TL2A 2FWBA 5AIBA 2J0UA 1RAAA 3H8VA 2WKSA 5JTTA 1JE1A 2ZVPX 2ZYWX 3G0CA 2W42A 4FM9A 1HDOA 2WHRA 4WZZA 3LYHA 4B3CA 3FTDA 3RUIA 1N6RA 2QX4A 4N5DA 2E87A 4DLBA 3U56A 3WLNA 1YZGA 2ZCUA 3C14C 2NZJA 1COWD 2Y4NA 5E8RA 3BCHA 1SBYA 2GN4A 1SXIA 3BK1A 1SJ9A 3X1WA 3AFOA 3LQ2A 4E11A 1Z33A 1DXQA 3E9NA 3IVGA 1Q0RA 1TM5E 2ZIXB 3MA0A 1K5GA 3EOZA 3L92A 3NOOA 1QANA 3Q6MA 3QXSA 4GECA 5DHAA 3ZC3A 4FE7A 4O1HA 1MLDA 3FR7A 4IHJF 2WSSA 1OVMA 3E9EA 3WK6A 2YWRA 1JHPA 1YE3A 3ETJA 4UQOA 3R5HA 1GU0A 5EXSA 2X7XA 3BZBA 5GZ3A 2FPRA 1J42A 4KPFC 2PX4A 4LSGA 2BMEA 3HE3A 1ORWA 4NVRA 2YHAA 4IRMA 1JDBC 1TZBA 5F1PA 4WESB 5FA6A 4ZIRA 5IDQA 1Z5GA 1H0HA 4MHSA 2WTUA 2H00A 2BOVA 3CXRA 3PPXA 1XU7A 4WERA 3S44A 2WUFA 2GILA 3FTFA 1C7JA 3CN9A 1XRLA 2RD2A 2FPIA 4J29A 1A5AB 1RE0A 2GLTA 3II6X 2CXPA 3HRIA 2VEOA 3HH8A 1G8GA 1S2NA 5JNWA 3M6AA 2XF2A 1R6TA 2VHUA 1NR5A 2W90A 4GBGA 3L4JA 3F6RA 4NZZA 4Z51A 4GLJA 1E5LA 3IOMA 2I4IA 4AYWA 2XYPA 2BZ0A 4CM5A 3QEAZ 1F7UA 4JLSA 1SQGA 1GPMA 2EARA 2R8ZA 3QA3E 1XEWX 4TUYF 2VYNA 3JARB 4RD2A 1HFEL 2Y6VA 3VSDA 2WJ3A 2I99A 4N39A 2X0RA 1SWWA 2AQKA 2YX1A 4FBGA 1SZDA 3ZDZB 4BPRA 3NV9A 4H3VA 1EE2A 1EP1B 1RWOA 3FLAA 5DLEA 2VOJA 1HDCA 4ACBA 4R2XA 2DBQA 4QYWA 2EU8A 4CKXA 1YO6A 2UZ0A 4OI1A 1K7YA 3F9CA 3G6KA 2QD2A 2AX4A 4U7HA 2YCLA 1K27A 3GNSA 1I7LA 4D1YA 3ZWVA 1CUAA 2BI8A 2JIPA 3CV3A 3WAKA 1GITA 3RASA 2ICAA 3MWEA 5JVDA 4EKEA 2G7ZA 4PSCA 4PR0A 2C5LA 2JDID 2ZW9A 5K2MA 4LQLA 5HF5A 4Z4QA 3C3XA 4QPNA 3SVLA 1VIAA 2O6LA 4HYEA 1KI7A 4K9NA 2QLFA 4B6OA 5CVCA 2HADA 1OX4B 2I7DA 3HN7A 3PQ3A 3SBDA 1SVIA 3PXAA 1NVWQ 2FWAA 3SNKA 1I9GA 2PAAA 3CINA 1UC4B 2BGMA 1G2IA 1ZXLA 2NXNA 3ZPXA 1Z4KA 2D7DA