2FVXA

Clostridium beijerinckii flavodoxin mutant: g57t reduced (277k)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
138
structure length
138
Chain Sequence
MKIVYWSGTGNTEKMAELIAKGIIESGKDVNTINVSDVNIDELLNEDILILGCSAMTDEVLEESEFEPFIEEISTKISGKKVALFGSYGWGDGKWMRDFEERMNGYGCVVVETPLIVQNEPDEAEQDCIEFGKKIANI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Control of oxidation-reduction potentials in flavodoxin from Clostridium beijerinckii: the role of conformation changes.
pubmed doi rcsb
source organism Clostridium beijerinckii
molecule tags Electron transport
molecule keywords FLAVODOXIN
total genus 47
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 1996-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fvxA00
1BU5A 1OBOA 2X2OA 4GQIA 4ZVNA 1E5DA 3B6JA 4BMOB 3FVWA 5LMCA 2FCRA 1ZX1A 2M6SA 3EYWA 3K20A 2HPVA 1SG0A 1V4BA 2FZ5A 3NHJA 2QX8A 1AKWA 2D5IA 4N82A 1RLIA 4QODA 1AKRA 1AZLA 1CZLA 1TIKA 4U7GA 4C14A 4PTYA 5LLDA 1H69A 2FDXA 3G5MA 4H2DA 4CETA 1J9GA 1YCGA 3W7AA 3QFCA 1CZHA 1AMOA 1YRHA 3HLYA 5LJIA 4C0XA 1B1CA 3JSXA 3OX1A 1FLAA 1KBQA 2ARKA 3QFRA 4GR9A 3SVLA 3FJOA 1I1OA 4C76A 1WSBA 2Q9UA 3N3BC 3NHRA 4FX2A 3S2YA 1FX1A 3B6KA 1CZNA 1CZOA 4BMPB 1CZKA 4N9QA 2V9CA 1AG9A 4PU0A 3RPEA 6NULA 3EDOA 3GFRA 5EAIA 5FUQA 2QMZA 2QWXA 3NHPA 4YAUA 2QX4A 1DXOA 4FGKA 2BZSA 1TLLA 2OHIA 2QX9A 5NULA 4M0CA 5F4BA 4PTZA 2BMVA 1WSWA 2MTBA 3OWHA 2FX2A 1ZWKA 4YALA 1CZUA 3HA2A 4YAOA 2OHHA 1DX9A 2R97A 3GFQA 1VMEA 4N65A 1T5BA 4Y9RA 1J8QA 1H66A 1YCFA 2B3DA 3UXHA 4CF6A 1DXQA 2Z9DA 2R96A 4HEQA 4S24A 3TZBA 3GAMA 4ZVKA 3ESZA 1SQSA 3W77A 3KLBA 3D7NA 3TEMA 3U7IA 1OBVA 4LTNA 4Y7CA 2FLVA 4YQEA 2X2PA 4LTMA 1FVXA 4GI5A 4Y9UA 5EMNA 1BVYF 3L9WA 2HNBA 3FW1A 2KQUA 3NHLA 1JA1A 2M6RA 3NLLA 4NLLA 5TGZA 3TE7A 4NULA 2Z9CA 3FNIA 1JA0A 2F1OA 4QOIA 5LBTA 4DILA 5ULLA 5JROA 4R81A 1D04A 3ES9A 4HS4A 2XODA 4ICIA 2KLBA 1XYVA 3P0RA 4H6PA 2BN4A 1D4AA 3U7RA 3W79A 1F4PA 1XI2A 5EA2A 2AMJA 1CZRA 3B6IA 1FLDA 2Z98A 3NHWA 4YAWA 1YDGA 4ZVMA 3NHKA 1QBGA 3NHUA 3NHYA 3L9XA 2Q62A 3O73A 2OYSA 2FAXA 2FZVA 2QMYA 5LBUA 3ZHOA 2Z9BA 1NNI1 1FTGA 1XT6A 3N3AC 3OJWA 3OX3A 1RTTA 1T0IA 2ZKIA 3ESYA 4FGLA 2W5UA 2WC1A 4U7FA 2BF4A 1X77A 3O2NA 4XDHA 1J9EA 4U7HA 3NFRA 1QR2A 1XYYA 3OX2A 4YAFA 3W78A 1FLNA 2GSWA 3KEGA 1D03A 2MT9A 2V5VA 1AKVA 4OXXA 1KBOA 2RG1A 2A5LA 5LJLA 1FUEA 3OJXA 2V5UA 2HNAA 3FX2A 1YOBA 4ZVLA 5A4KA 3F6SA 4XDGA 3K1YA 1RCFA 4LA4A 4QOEA 2FOXA 3KAQA 3ESXA 1QRDA 1YCHA 1AKQA 2XOEA 5F51A 1AKUA 3HR4A 5NLLA 1AKTA 4DIKA 3N39C 2OHJA 2N1MA 4DY4A 5B3LA 3OVMA 5BUCA 5F12A 4D02A 1OFVA 5FA6A 4LTDA 3OWXA 2MWMA 2QR2A 3F90A 3B6MA 4QOJA 5FX2A 3NHSA 1RLJA 1C7EA 3NHFA 3KAPA 3LT5A 3QE2A 4FGJA 4QOGA 4ESEA 1QHEA 4C0WA 1AHNA 1J9ZA 3F2VA 3UXEA 4QOFA 4J8PA 4LAFA 3GFSA 1C7FA 1YKGA 5B3KA 2QX6A 1ZWLA 1FLVA 3LCMA 4F8YA 2MOKA 4QOHA 3R6WA 2FVXA 2BPOA 1GG5A 3F6RA 5LVAA
chains in the Genus database with same CATH superfamily
2DG2A 4INOA 4QE3A 2O9JA 1G4UR 4HY3A 4GOND 2OO5A 1TYBE 1XQYA 2FEAA 2YWXA 4JC5A 4O4LB 4TQUS 3QKIA 1IXYA 2QTNA 2HMTA 1P60A 1JDBC 1XU4A 3E22A 3PPWA 4PG6A 5AKJA 1CZLA 2UYYA 1W4AA 4OP3A 4MAMA 1V6SA 5A3VA 1LQTA 4E5UA 3D5QA 2BH9A 1P2GA 3E23A 3B9PA 1HE4A 3LLSA 1HH4A 1Z39A 2E4AA 3OX1A 2XCUA 2QD3A 4M49A 4RF3A 1YFJA 4UDOA 2ZP1A 1PT9A 5J63A 1IWPB 1EA7A 1WE2A 2FWBA 4HDMB 2P65A 4KIWA 2PL5A 4OQ4A 1JYFA 4XB2A 1VDMA 2ZBUA 1KDVA 3DBLB 3PJGA 1G21B 4RVUA 1AGNA 1YRYE 1HKUA 1V11B 2AJCA 4QO7A 3PP8A 5HBGA 3UXMA 5CG1A 2NV2B 2YW2A 4ZO6A 2DXIA 4QDXA 5SYAA 2CDRA 3IURA 3GZ4A 5DWDA 2QT9A 5LDDC 1F38A 1S3IA 1YQUA 5I7AA 3LXMA 4R54A 5LWQA 5BQ3A 1IN7A 3OQJA 1SJ9A 4PAGA 1GLGA 4YQFA 4H6VA 4X62B 1VE1A 2C07A 2O5VA 1R6BX 2RHOA 5EUQB 3MQ4A 2RAUA 5C37A 2HPHA 1E18A 3OOWA 2ALJA 2HDHA 1C8LA 1KC1A 2G9QA 3CX6A 3WIBA 2VJMB 4W1RA 2C42A 4O4JB 1Z33A 3G5LA 3OICA 1I4OA 1UJ2A 2WP0A 2C3UA 4N1AA 1EGVB 2JKZA 5ALFA 2GEDA 2XKBA 3EFBA 3REQA 3QP9A 5EZYB 4HVAA 3WWPA 1FNSA 4ND6A 4PQRA 1MQSA 2Y1EA 2P0YA 4IZIA 5JW6A 2WNHA 3SBOA 1RKUA 4WZBB 4H17A 4HNQA 1GU7A 1T29A 3AM1A 4OA5A 1RHQA 2B6NA 1H8HA 1XSEA 2X41A 4WKPA 4BTEA 2JH3A 2PS9A 3OX3A 2L82A 2Z4RA 3FSEA 5FOSA 2EW2A 4HJXA 1WXFA 3WOHA 4QJ5A 2VP6A 4M6WB 4PO8A 4RCVA 1X2EA 4Q18A 1WUTA 5TGTA 1QV6A 2XRZA 1P91A 4TXHA 5DLEA 3GUZA 2VP9A 3N0WA 1IZYA 3QKSB 5I4KA 4JB2A 3ILHA 3E35A 5CU7A 2VJAA 2BD0A 1N4AA 3TNYA 5LMNB 3QVSA 1NQWA 5CNJA 1EFPA 3MW8A 1XRPA 1ACJA 3RAJA 3K0BA 3VR6A 2OHGA 2ZWMA 1PVDA 2A0FA 5DTIA 3BGIA 3BIWA 3SEZA 1Z5OA 2YVKA 4XX1A 3AUYA 1WCXA 3A6ZA 4HF7A 4ITVA 1IBKB 2NO4A 1QIHA 3BDIA 4UZFA 2RJNA 2OD9A 3KXKA 1BGXT 4BVLA 1J8FA 4X3OA 4C0WA 3AY3A 3VJRA 2HQRA 5CEFA 2O5CA 4NJMB 4X6UA 4HDCA 3F5QA 2N75A 1EGHA 3GD5A 4HFNA 2NU8B 3WSTA 4BVEA 2QBYB 1L1QA 3OWOA 3SYTA 1S8AA 1T3GA 1ZN9A 4KE8A 4QOHA 1CUGA 4KXWA 4EG8A 2VPZA 4F4UA 1M3SA 3HUFA 3PGVA 3D8NA 2O5EA 1WZNA 1KI6B 1I4DD 3LWNA 5PGMA 5FI3A 2D54A 1ICIA 3G23A 1X1DA 1ZOSA 1US8A 2XE6A 4G0ZA 3P2KA 4FDUA 3PL5A 4U7GA 4CIXA 3GFTA 3OLWA 3ZTYA 1Z35A 5G1NA 3V8NA 3DZ8A 3PVCA 5C31A 1LCIA 3JARB 3LP5A 4KIUA 4I6GA 3EIUA 1N2GA 1YBVA 2OCPA 3F8SA 4LV8B 5FB3A 4CLOB 1CPYA 1CY2A 1GAEO 5J59A 1L7PA 5KU7A 1PX0A 4FSXA 4JLVA 4Y1RB 2WD9A 4KXLA 1YRQA 3E5MA 3GUVA 1W36C 3EQ7A 1KS2A 4DRZA 2TSYB 2WRZA 3LGXA 4UM7A 1DINA 4ZT7A 3ZLTA 4BMNA 3KKOA 3PXXA 1AKMA 3ME5A 2BF7A 1XNQB 1A0OA 1ZJZA 3WFIA 2I1QA 4MDFA 2PD6A 1VBFA 2HRQA 3F9RA 1TLLA 3UCFA 1ZD9A 4QXQA 2ZTMA 1T2UA 5EKSA 4NI5A 1WX1A 2PZEA 3FNQA 1NI4A 4MIYA 5CAEA 1VMEA 1Z28A 5AICA 1HG1A 4R1SA 4QG3A 3G89A 2Z9DA 3BIFA 3I45A 2W70A 1JXQA 2E7ZA 2IJGX 4DJDC 1OB2A 2BKUA 4B83A 3UKOA 4CDNA 5A0FA 2FZKA 4PGAA 1LK7A 4B5LA 1F8XA 3PCRB 4GI5A 4JUDX 4RACA 4L8FA 4YT8A 1IOWA 2TMGA 1MVOA 5ADHA 5JROA 5B12A 3SBEA 4AI6A 4GOOD 4ZCLA 2YJGA 2C4TA 1MC1A 3F74A 4DXDA 1TMKA 3GCXA 5BN1A 1HMPA 4J2OA 5LU8A 5ENDA 1VHWA 1ONBA 5EESA 1G3UA 4GP7A 3PQDA 2YYAA 3S6JA 2O7RA 1WTCA 3FGNA 4REMA 3HDQA 1T9HA 4UBIA 1K7EB 4C3VA 3U3JA 4HUTA 1DKUA 1C4KA 3JS5A 4FONA 1G5FA 3I01M 1J5PA 2NSJA 4NTZA 5AJXA 5FFNA 4YLYA 3K3PA 4QTYA 2PNFA 3OJWA 2I3AA 2FMFA 2TMKA 4OV6B 1RXUA 3HN6A 2A4MA 4TX1A 8LDHA 5CM2Z 5I3ZA 2VPIA 3CIOA 3JQCA 1KH2A 5CT5A 3OIVA 1BWQA 1JR4A 1ORTA 1HDGO 1IN6A 1IHUA 2DFLA 2VJDA 2WWXA 5I6DA 4LY0A 4BDSA 3RABA 3ZWXA 2ATEA 2YY7A 1Y48E 4GYKA 1V96A 2W2NA 4LSMA 2W8ZA 4IHJF 5H16A 3UHJA 4X9XA 3W8NA 5JRDS 5JU6A 1DGQA 4AQDA 4LJ7A 5P8WA 4YAGA 2LKDA 1IZ7A 2EU8A 2XD4A 3NC4A 4J0EA 3QPBA 2HQSA 7MDHA 1Y8ZA 1SXQA 3TKYA 5B6IA 3I52A 3OCYA 4JB8A 1VYVA 1AKNA 1YB1A 2G1KA 3F90A 5DI3A 3TFOA 3U19A 1RLJA 3LNTA 4ZHQA 2XKKA 5EWJA 1PQUA 1L5SA 5E7MA 2X9NA 1WU7A 1Z17A 3ICWA 5CLIA 1ES9A 4CT5A 5A04A 2XCSB 3KWLA 4NXMB 2QQEA 5E1OA 4R1LA 4EO9A 1BJKA 5GZ6A 4LYDA 4ZCTA 2VT2A 1UPTA 4RKFA 1NMEA 4XE5A 5LC1A 3BEDA 5JDIC 4IJQA 6ABPA 1E0SA 1BU5A 2YICA 2IYSA 5K4GA 5ALZA 1T1SA 4QULA 4CNBA 4RPLA 3HEMA 3MB5A 5CDYA 3SD7A 1YO6A 1ZUNB 5FHRA 1JWAB 1BRTA 2PPLA 5KOJA 5ILGA 3RUAA 2ZS7A 4B6EA 1QG6A 3UMRA 2AW5A 2G4CA 1BCRB 3BHMA 4ZRNA 4IFTA 1ADGA 2PR7A 4HWPA 4NNPA 1AMOA 2FNAA 1V48A 2LV8A 3RIYA 3GJTA 5CNKA 3TG2A 1RTKA 2W9XA 3DQQA 4GR9A 4HGRA 4JEHA 5E9JA 1RE1A 2XYHA 4WXRA 1L5LA 2Q9UA 4JJ4A 3ZX5A 3I5AA 3TD6A 5FO1A 2GZHA 4K6GA 3AF6A 4XQEA 4CKEA 5I7HA 2MSCB 4F60A 2QV0A 2OKCA 2ZSBA 2EIHA 4EFLA 2EQAA 4NZMA 3I3OA 4RYDA 2QTFA 2PRJA 5DEIA 1MB3A 2WVAA 5JS8A 2JJMA 1W44A 2NT4A 4W6ZA 1GZ5A 2PU7A 4MVJE 4BLWA 1JR2A 3PYXA 1P3Y1 3CT4A 4WBNF 3CVXA 2PJUA 3CRRA 3HQ4O 1M34B 3LQQA 5ED0A 3I0ZA 4C20A 1ECFA 3T7EA 2J32A 4UZEA 5LQAA 3HXMA 1EVLA 3AZQA 4NU6A 2O2XA 5FYDA 1CNFA 3G0CA 1L8XA 4IHJA 3CNHA 3F5SA 1OI4A 1NU6A 1FX0A 1T6ZA 4X3PA 2HEGA 2J9RA 4P86A 1I3OA 3L07A 2P4QA 4AMZA 3MJRA 4G23A 1N6LA 2FCAA 1IOVA 1AM4D 2C98A 2BM0A 1G2PA 1OWLA 3BRWD 4MEAA 4W9NC 5DYTA 2ZBRA 2AEFA 3L1VA 1DAGA 2FK8A 4PX3A 4WK2B 1QB7A 1KYYA 3W2HA 4Q82A 5FLEX 1W36B 3FF4A 3QLVA 1CJCA 2ZBEA 1Y5NA 3GVXA 4OIFA 4URUR 4EHFA 1RXIA 3T7TA 3VZRA 3JASA 1YACA 1YJ8A 4YAWA 1AUPA 2ZOSA 4M9RA 1HE1C 5HBRA 1UM9B 2AJLI 1UKBA 4GOMD 4HHEA 4KQIA 4L76A 4NPHA 4HMOA 3NONA 5GJBA 2H4HA 2IP4A 3RFTA 5TX7A 2PZBA 4DADA 1Y3HA 3AB3A 3NFYA 1T34A 3T8YA 3WLRA 4V39A 5JSHA 5TARA 1EDZA 5KYVA 3M2PA 3KHUA 2P2CA 1U8CB 1L5KA 1GPH1 4HQ0A 1K6MA 1T6XA 1QHXA 1TLFA 1KFBB 2MDTA 3SHFA 1POXA 3ETLA 1N2CA 1U8UA 4EP1A 1NVEA 1EVEA 1Q21A 5DYWA 4UAGA 5FUBA 4WKOA 1TQ8A 3DWEX 2VP5A 1WVMA 4NFSA 4CJXA 2GZ3A 1O0CA 4RV9A 4CCSA 4Q24A 1CY1A 4EUNA 3EOZA 5ITVA 4RK7A 4II3A 1NVAA 3A32A 4Y2UA 2ZRGA 2WQ6A 5DNDA 4FHCA 5LD2C 1V7PC 5IK2A 1GUAA 2CV0A 1TDJA 5BYJA 2D2IA 2MWMA 4CGYA 4DC0A 4DZZA 3D59A 1WZEA 4RVFA 3BD6A 3RSFA 2RGGA 1GTJ1 1V1MB 2DF8A 1NJ5A 4FOLA 5F76A 3WP1B 3M1AA 3RC9A 4K9DA 4BP8A 3LQ1A 4UBOA 5EP3A 3QF7A 1NN1A 1Q95A 2WAXA 3BMQB 3R5JA 2D6FA 3K2QA 5ALEA 1U3CA 1XZBA 1A50B 2PA0A 2RH9B 2ZT6A 3HO6A 2FH5B 4GO1A 2O8DA 2UAGA 1RMYA 2X3YA 2ORIA 3QLUA 3DDCA 3T94A 2AX4A 2BEUB 1RPNA 1KP3A 1T0PA 1WB5A 2FWRA 2QNRA 1VHJA 1IH8A 1CDEA 1V4BA 2R6ZA 4BBPA 3QJ5A 2AN9A 4HWTA 2BKEA 4BQSA 4LF8B 2X2EA 3CWQA 4H4CA 4AL4A 2R79A 2DPHA 4LXHA 4ZU3A 4ZKEA 3DBOB 4UMVA 1THMA 4JH0A 4YVFA 4MPJA 4TWIA 4UEWA 4FB4A 2VPPA 2I78A 1SZPA 4D9BA 3NHBA 4MQEA 2RGBA 3D3KA 3NYWA 3BMCA 2RHMA 3SNKA 2IUTA 2X0JA 3H1BA 1OXSC 4DKJA 3O2JA 1JDTA 3HM9A 2DH5A 3BMNB 3ELBA 3JXEA 1GU1A 2XLBA 4RE6A 1FDSA 1V2GA 2FSGA 5AUNB 4N4AA 1G8GA 1T8TA 3AV0B 3B5IA 4IQ4A 4BLPA 2I03A 1E5LA 4DE5A 4UW9A 4HVLA 1CZUA 3WB9A 1E62A 1NXOA 3MGBA 4CUJA 2RCNA 4D4HA 2AGVA 5M04A 2ROQA 2C97A 2F8SA 1ZXBA 3UWPA 4G0WA 1CLUA 2G9UA 1UBJS 2WNSA 3RW9A 4ZJYA 4R8LA 3V1KA 3KXLA 3G2QA 3WLHA 1KRXA 3AI2A 3B53X 4Y7CA 4LTMA 3YASA 2R8XA 1HEIA 1P0FA 2NAFA 4B6JA 2C7PA 1Z2DA 2RAVA 1I2DA 1GP2A 2Q3FA 3B2EA 3K5HA 5FPTA 3WMGA 1H85A 2QM7A 1NXTA 3MTQA 3K0AB 4M7OA 4RF4A 3DMPA 1LBEA 1RPJA 4A8PA 2CVFA 2GYWA 2VKTA 3COWA 1P9NA 3GZJA 5BUQA 2VDKB 3FHTA 4AJ9A 1S9DA 3LLVA 1W30A 2GVDC 1G3RA 2F8MA 5CA0A 1JEOA 2ECQA 3B60A 3C3YA 3MRVA 5EMKA 5F77A 2RAFA 1JDUA 4HEJA 3ILXA 1BW9B 1XDWA 3IEUA 4ND8A 4EFDA 4EQZA 1NGSA 3ZHOA 2IVZA 3LZ6A 4CLHA 3QPUA 3K9HA 3WA6A 5L53A 2QMHA 1H4SA 4DC9A 4U8HA 2H4JA 4J6EA 3VKFA 4F3NA 1C3OA 4RVSA 2D3TA 3BHNA 3OPVA 4EABA 4RTRA 1NX9A 3CIFA 2GPWA 3L2OB 2FQWA 1LLDA 1M0WA 1M1YB 4FXPA 4MP3A 4YI3A 1F5SA 1DC3A 1XF1A 4M1EA 1DWOA 4WDRA 4GKKB 2NTJA 4AFNA 1AGYA 1D2MA 2AMFA 4FYJA 3SZ3A 2AFHB 3BWYA 4HATA 2YXLA 3KYCB 2JL1A 3BERA 4L1KA 4WIAA 2QD4A 3L8ZA 1BXGA 3PUJA 2GASA 2VJKA 3OJFA 4WZBE 3A70A 5C18A 4DQ0A 3B8HA 3O9MA 1K88A 3V4VB 2BONA 4M0EA 2QTHA 4BWVA 3ROQA 3T4PA 4AZWA 3CF4A 4CQJA 3PI6A 3DC7A 2PA3A 3SEQA 3D7LA 1ZL2A 2V7WA 3KU4A 3MAJA 4AKIA 1EKXA 1H8ED 4HUQB 4JWKA 1Q22A 1JTVA 4IVQA 2Q8PA 1V6AA 2PD3A 4JFRA 2PYIA 3TDKA 3WMRA 4G1VA 1WVIA 2HSZA 1AGXA 3DDWA 2REXB 3V55A 1RD4A 3CZ4A 3NBFA 3THWB 2A94A 3MOIA 3CLUD 1DEKA 3O8OB 1E5DA 2W2QA 1P1HA 1T5SA 3EGDB 4H7KA 3TR0A 2GA9A 4JGGA 1SD2A 4YRBA 1E6UA 3O8QB 1NBIA 5KU1A 3TUZC 3WJAA 1BDMA 3TLCA 2VTDA 1U81A 3L8HA 4PRLA 1ZJWA 4DRXA 5JPDA 1N2XA 4NF2A 2Q4DA 4WERA 3HVKA 2ZDGA 1IM8A 3IMEA 1C80A 4BJ6A 1G41A 2NVBA 4D4LA 1KKLA 2AEJA 4J90A 3GFBA 4XOIA 3IELA 6LDHA 1HEYA 1T35A 3RREA 1QGUA 1HDYA 1V1RB 2GTHA 1KBQA 4LGVA 4OPMA 2QRLA 5G1PA 3W4IA 1L5FA 4UDYX 1KZ9A 1C3EA 2F59A 4P5EA 2VJYA 2PV7A 4QHSA 4B3DA 4CG0A 5AK4A 5IZCC 1QU3A 2WF8A 2GD0A 3UMMA 3DV9A 3K8QA 2XB6A 1GZ4A 2AJBA 2YR0A 5TQJA 3A3OA 4B2LA 1ZK4A 5KS2A 1FXWF 4IHAA 4LYJA 4MHOA 3UAXA 4WSOA 4G9BA 4EK9A 4BVAA 5HZHA 2O7SA 2F7SA 1YKSA 3ZE8A 3V4OA 2RGRA 4TTRA 3CMMA 1UPCA 4BAZA 3UKDA 5BOSB 1XMVA 4AIRA 1C8VB 1RWWA 3CKMA 2Q5EA 4EARA 1GQOA 1E20A 1EFCA 1L5QA 2JF0A 3I32A 3MGGA 4OFXA 4RHUA 3NTQA 1RSZA 3STWA 4AN0A 1H8HD 3FBGA 3OY7A 4GBMA 1VHQA 5DHAA 4DQDA 3BL6A 1F0YA 4L85A 3KQKA 3BH6A 1Q11A 4XD2A 1JVSA 5T4EA 4ACAA 1Y1LA 1Q7TA 2ZR9A 3R0XA 1OWOA 1TQDA 1QNLA 1ZCAA 1D2HA 2A7QA 4GFDA 4IIVA 4EBBA 4YUZA 4A1OA 4ZJUA 1AD2A 3Q40A 2GN2A 3BAFA 5KTYA 4YIHA 4OL0A 2XT9A 1UF9A 3OZXA 1JECA 2DHCA 1JG1A 2ZBDA 4NH4A 4ZI5A 5SZKB 4B44A 5E1MA 4GVLA 3G02A 1YDGA 1VL1A 3T41A 3VU9B 4UHFA 1B15A 4E6EA 3V7FA 3ZDBA 3N2GB 4EGSA 2JLZA 1EFVA 1DX4A 1XZMA 2D2EA 2PKYX 1Q5PA 1H22A 4O5AA 4KGVA 3U13A 1WR8A 5AOBA 4PBRA 4LPSA 1PEDA 3F3YA 4XD7D 4HQOA 4CQLB 4I81A 5TPWA 2ZJ0A 4ZQGA 3BRSA 1M9NA 4I8DA 4N0MA 1CB7A 3EWIA 1HTTA 2DLNA 4LV5B 1U2DA 4QYMA 2E55A 3GPBA 2BEVA 2FGKA 1EP3B 5KYKA 4GOLD 1ZKMA 4X91A 2QSJA 3X1ZA 2CKMA 5BRAA 3I2IA 4CKWA 3PE4A 3C39A 3R3HA 4DBVO 1NN5A 1PJ2A 3TW4A 1D2CA 1C3JA 3CINA 1X92A 4Q6WA 3U31A 2FPIB 2GPJA 4RAOA 4E5YA 1A4IA 1NF3A 4XGNA 3CBGA 1ZN2A 5JISA 1PO7A 1MNQA 3MSCA 3MRTA 5G0UA 4EITA 4D98A 2QZZA 3K5WA 3OM8A 3L8DA 2I2DA 4J16C 2HBRA 1WXXA 4JEMA 3OWXA 2V45A 3ZK7A 4DCSA 3B6MA 4MHTA 2Q5IA 2P68A 2PO7A 5EHNA 1OBCA 1HC7A 1DO0A 4C03A 1TUBB 3JQ8A 1BHO1 2FR0A 5LD2B 3C8HA 1ZKDA 2Q6KA 4MXDA 4OAOA 5F78A 4Y1GA 3BA6A 2G9ZA 1TVKB 3PC8C 2VSYA 4XTCS 1EFDN 4EATA 3UKJA 4LZLA 1JFTA 2JRLA 3O38A 3ZHUA 4XVCA 3NRJA 2IFTA 1WP9A 3VR4H 2OXEA 3K6RA 3N2YA 2NU6A 5G4KB 1L4MA 2EFEB 2P62A 4KYVA 3RKUA 2XVAA 2Q5CA 3A9VA 3W8DA 1VXOA 5C32A 3MD9A 2NM0A 4F9TA 4CKYA 4MKXA 3EUAA 3CRZA 1WCIB 1L5YA 1SMKA 2Q2QA 4P3KA 4UU1A 1H2HA 2I4LA 1T2CA 4RSGA 3EFOB 2PIDA 1GRRA 1U0SY 3BBPA 1I14A 3GBVA 3N0RA 4HXGA 3IBCA 3G0OA 4P4SB 4BVJA 1E5QA 1OD6A 4Y2VA 2CV1A 2NOAA 1JQKA 2IS6A 3C3JA 1I1OA 4ZCRA 1FP6A 4IIYA 5EXDA 3LPMA 4DNOA 3PHIA 2XUJA 4DARA 1U7DA 2Z09A 4CCYA 5T41A 2B37A 3DGFC 4YRFA 1DWUA 2G76A 2X5JO 3GEPA 1A88A 4JYBA 1N0UA 1A76A 4OHOA 1YCDA 3LDFA 4UVIA 5IFKA 3PHCA 5C8YF 1TLTA 3KOYA 4PC7A 4I3HA 5K0SA 3QW4B 2I8AA 3EASA 3AZOA 4ZQBA 5KTMA 3CX4A 3ZXSA 1FDIA 1V8FA 2H7VA 1V45E 3QUBA 1T5OA 4BO6A 1N5RA 1KZ1A 2WJJA 4ROTA 4N3CA 3D0RA 1S2OA 5AVKA 1BMTA 2BFFA 1O6GA 1J0CA 2CSUA 3PFNA 1CUBA 1X9GA 4RHXA 1RJ9A 1XO1A 3O0TA 2QZ9A 4Q19A 2JIRA 4ZYUA 1I7DA 3MZ0A 2DR2A 2Y1LA 1FNNA 3A3KA 3GP8A 1WBBA 2G88A 1Z8HA 3K9WA 3NR2A 1A9OA 2R86A 2RHBA 1XZKA 3IUJA 1JAIA 1U8YA 3PNMA 1MO4A 2GAOA 4UE3S 4X7BA 1T25A 3FOAA 1UBSB 3JD3A 4MR9A 3MTJA 1FB5A 2CJPA 3N05A 3N58A 4RD2A 2CCGA 3I1IA 2OB2A 2WMOB 2IIQA 3U7RA 3SFZA 2A6PA 4NBUA 3ZQJA 1X8LA 4INJA 4ZD6A 2XWQA 1I5OA 4OA8A 3TJRA 5L40A 2BZ1A 5JZMA 2CHEA 2JK1A 1XZLA 4HGZA 3C8DA 1Y89A 2O2EA 1O58A 2XOXA 3WNZA 4LJ5A 3ZIUA 3ZHYA 4OHMA 2HGZA 4RKEA 3CR3C 2GPNA 1RZRA 2R6GA 5TE9A 5C2JB 2PX4A 2XWPA 1T0IA 4UPEA 2PBLA 3FMIA 5EJMA 1X77A 1KYQA 3URMA 4OJMX 3WTBA 3E03A 4FD3A 2BDUA 3W6ZA 3WXMA 1X80A 3AT1A 3IJEB 3PS9A 3KU1A 4GYJA 2ODNA 1P3DA 3BBLA 5DHPA 5TS3A 3UAVA 1QC5A 4TS1A 4MI3A 5FUMA 5J4LA 2P3SA 3H17A 4LI0A 3V1UA 4YPOA 2FK7A 2JLBA 1V9CA 1N1GA 2A9VA 2WTBA 1ST2A 1TUIA 5DIZA 4ZANA 3LG2A 4UJ3A 1ILEA 1BN6A 3DAOA 1JNYA 3QUQA 4Z2YA 3U0BA 3W9SA 4GI3A 3R7LA 1QVAA 1F51E 1HQKA 3EDMA 1LEHA 4I36A 3E5HA 4OHPA 4UM9B 4D81A 2CXXA 2NYRA 1NL3A 2VDMB 2ZU0C 3ND9A 3R5KA 4G86A 3PHHA 3SJAA 1DFIA 3KYDA 2V3VA 2FUEA 4IXTA 2AFHE 3LA6A 1VJ1A 4YEDA 4DSZA 5KAPA 1WG8A 1EIWA 1FLVA 3K7EA 5EQFA 5CFLA 4FFLA 4HPJB 4QBFA 5DF1A 5FOWA 4BZPA 2Q3MA 3DVAB 4I5FA 2CHVA 3R6WA 1R0WA 4NCXA 2R0QC 1NC3A 2VXYA 3GBPA 3UJ6A 1LSUA 2VQSA 2LDBA 2H0QA 3GDOA 4E2WA 2E1RA 4UFPA 5JAIA 1NBHA 2IDJA 2QDXA 3EWAA 3FFXA 5ALLA 4PC6A 3U3XA 2ZTVA 2FZ5A 3TNJA 3NHZA 4HAWA 4JAVC 4XLTA 4EI2A 2XJ9A 5AI4A 1FYEA 3LO5A 3MB8A 3OAAD 4Q4JB 2CCKA 3P4UA 4XRGA 4ZK2A 1YIOA 1QLHA 2BMFA 3G17A 1X3SA 1GGHA 3FNFA 4JROA 1IY2A 4ZAZA 2O8BB 3C1TA 2RFLA 1RYZA 3E3NA 3L6EA 2WUVA 3I09A 3GVCA 3OPYA 1I7SB 3HO1A 2OV8A 5JZOA 3CB4A 4C76A 5JAMA 3FCCA 2YDYA 3AGQA 1MD9A 1XZNA 2DUJA 2X6TA 3DBVO 4H7IA 5FNZA 3EXIB 1FDUA 1UDBA 1Z0FA 3V80A 4FW8A 1V5GA 4N7MA 3AFHA 1P39A 1Z74A 2I1VB 3P9YA 4L2IA 4PVDA 1P61B 2MYTA 3W78A 2XTAA 3VVLA 2E5LB 2FZLA 2YUTA 3WQBA 2WFLA 4FGWA 4Q9HA 4BMXA 5FTKA 4A0QA 4E88A 1U5AA 2MYPA 5JJCA 1QX4A 3CEJA 4XM1A 1NNLA 1BHJA 3P9CA 3MRSA 4YQZA 3D2CA 4OTZA 3CLUC 4BBJA 2J6BA 1YQXA 2DLDA 2QYSA 1HYHA 3MEQA 4WNYA 1RQ2A 1SOUA 1X39A 2HO4A 2I3BA 3LC7O 4OSPA 3HKCB 2ZB7A 2HIAA 3D81A 3P2JA 1QHYA 3DLCA 2NSHA 3VPAA 5H80A 1PYOA 3VR0A 5C9ZA 4JVNA 3GT4A 1I9GA 4PZEA 3DPIA 1U9CA 4RMNA 4TWAA 1X1TA 3LUHA 1USVA 3GVIA 3RS7A 1YR6A 5A1JA 3ND7A 5EPOA 3RFCA 1QVVA 1VJDA 1ZW6A 3K9NA 2ZT7A 2VSNA 1LPSA 2GR9A 4FFSA 4PRKA 1EHIA 4X85A 1O6CA 1OFIA 2NUPB 3ZWYA 3OFND 2O7NA 3SZGA 4FC6A 4KU4A 3GNLA 3FR7A 1FRVA 2V6BA 4FDVA 2VTBB 1Y3IA 1NW7A 4QBHA 5E4JA 2POCA 2A5LA 5E6UB 4D6YA 4F2DA 5DBGA 3P9KA 3T15A 4KRGA 4XYMA 1RLOA 1RPTA 2QUJA 2RMKA 3IH5A 2QPAA 1SA0B 3T3MB 2AOTA 5JAHA 2AI2A 4C7JA 4JL5A 1JQAA 4EWLA 3HRHA 5THKA 4CVNA 2C8JA 3PU6A 4YROA 1GN9A 1OXBB 2QJOA 1KFJB 3BRWA 3C5VA 4O4HB 4X45A 5J40A 3SXUA 3WLQA 2GAFA 3RVSA 3GLFB 3ZDCA 1OROA 2HEIA 2OOKA 4M54A 2DT5A 1KEVA 1T5HX 1IOZA 4PZUA 1NXSA 2XCOA 3AY6A 3LQ2A 4YO8A 4B4OA 3UAGA 3R7SA 4X41A 4CKCA 4B82A 1UP4A 3PXDA 5G0TA 1UBUS 4EG1A 1U65A 3ZGXA 1VLJA 1QDEA 2QTWB 1QFMA 4KX3A 5KQRA 4Q01A 3G9XA 4FN4A 2GN0A 4ZAXA 4MA5A 3GNQA 1SCNE 1Z38A 4H0CA 3QTTA 2ZRMA 2QHXA 1EUCB 1GGFA 2VHVA 2ZRIA 4KXYA 3GLQA 5ELLA 1UBMS 3N5KA 4AZ3A 1A2KC 3NEPX 4IIJF 1VMIA 4CWAA 3GJ0A 2WFMA 3IO5A 2NZUG 4H1HA 4C7VA 3OQNA 1NVTA 5HFAA 2WA2A 4O29A 5G1OA 2XXAA 5DIFA 3GNTA 1PV1A 1C0IA 2YN2A 2Z0MA 4Q0MA 3AG6A 3HS3A 4JT9A 3G2PA 1KC3A 2QSUA 4YA6A 4F6RB 1YCGA 2QTBA 1YMVA 2ZITA 1GFWA 1N77A 1TXGA 4QM6A 5KWSA 3F73A 1KKMA 2M2IA 4DXHA 1GSAA 1U2DC 3GELA 1JIXA 2PRKA 2QEQA 1RR6A 1Z08A 2PUJA 5TJ9A 4EB6B 1Z3IX 4O25A 3FTFA 1QFXA 1YBAA 5DCYA 3WKCA 2XBUA 4EMUA 3GLGB 1JDSA 1OXXK 1S3SA 3F46A 1FE8A 4N9QA 3UGTA 1EJ6A 3UMFA 3D8BA 1I5EA 1P1FA 5BURA 4TYNA 1TTHA 1DCTA 5HIAA 1MMFB 4EPYA 4I14A 2LWIA 2KB0A 2XQFA 3RYIA 5CCEA 1GUYA 2B1GA 3NALA 3FCAA 3IR5A 3DBHA 2RBEA 5IHPA 3KJHA 5EJ7A 1S1CA 1BS2A 2I3ZA 1DC5A 3A9CA 3SY8A 2JGDB 3DE2X 2R7KA 3LW7A 2B61A 4GPTA 3H7IA 2PANA 1OBVA 6PFKA 3UUGA 3BC1A 2Y66A 2JEYA 3DHYA 1QOPB 4IIDA 5KJEA 3BJIC 1XN4A 3CHYA 4GYYA 5LOVF 1WXWA 4ALJA 2PS3A 2R7MA 2OV4A 4ND5A 3RUFA 5CHYA 1J42A 3FROA 4Q4AA 4JKOA 1U8FO 1HT3A 2V7UA 4M1MA 4DLWA 3RJ5A 3LDGA 5C8YA 1ELOA 5U4QA 1FFXA 2I6XA 1QK5A 2A5JA 1MOZA 4URWR 1FUUA 1DDIA 1X7DA 1PNQA 2Q62A 2HU5A 2XH8A 1R00A 2J09A 4U02A 1IUKA 4KQ2A 5LNK1 2IHNA 4OH7A 3ZCVA 3PRYA 1JXMA 1LC3A 4RXUA 3PUZA 3WWCA 1M33A 3I3SR 1U2GC 2GDZA 5EJ6A 1XEWX 3RJ9A 3H86A 3K6JA 2O19A 3ZIAA 2ONKA 5IS2A 2QE7A 2QRHA 1I4EB 1JLKA 4D42A 5F33A 1NLUA 1ULBA 1L7QA 4U6QA 1U63A 2GBIA 2ILTA 2O07A 4IHQA 1G38A 4IZHA 1X7XB 5CYFA 5FD8A 4R69A 2Y99A 1MF7A 3AL2A 2B35A 1S9HA 2PKXA 2JI7A 3FHJA 4GGPA 5AM5A 4NBRA 3A6GA 3DZGA 1YC2A 3NTRA 1ZMOA 1W48A 3H4MA 6REQA 1W1IA 1ZM2A 4CFZA 5JS7A 3IQXA 5E9AA 4B3XA 4FFBA 4S1VA 2LRHA 4WCFC 1RW4A 3F1LA 3FUXA 5DGIA 2YN4A 3L7LA 4PNPA 2X9GA 2WYUA 4MP6A 3W7VA 2XTZA 3FH0A 2O8FA 1RACA 2QX6A 4CMHA 3WDSA 2CK3D 3QVXA 3DV2A 5IM5A 2JLXA 3AHEA 2C8LA 1P44A 3C6ZA 4Q48A 5ILOA 4B6GA 1K3FA 1L5WA 1ZUWA 1HQDA 1U7TA 2RSLA 4JA2A 3V34A 4BV3A 3T9BA 4DPKA 1XXHA 4H4EA 3LIPA 4KV9A 1XDGA 2G70A 3AOEA 3UOWA 1SVSA 4II7A 1G20E 2QVLA 4TLCA 4BV2A 1ZJJA 2ADOA 4NAUA 3WGNA 2IH5A 4TQ9A 1KSGA 3UICA 3L49A 4E32A 3HSYA 3IHTA 4GI7A 1YHNA 2L0XA 1ZSYA 3JVEA 3O4RA 3T9DA 4UPVA 3TDNA 1QOZA 5FH9A 2PMDA 1FS5A 2IYLD 3PRHA 4O02B 2W2KA 3KTDA 4OSOA 4ZZIA 1WMBA 3SVLA 1GAXA 2NU7B 4ZT3A 5KDLA 2R85A 3LPNA 4L0CA 4CMEC 2GCOA 4QBIA 1W4CA 2NWQA 3O8CA 4EUKA 1R0KA 4OHBA 5AI5A 5EHZA 2Z5GA 3M6VA 3ZHQA 1YS6A 3F7NA 5ITZA 3O75A 4L3WA 3S2IA 2OHVA 3OX4A 1HFEL 3HU5A 5F4BA 1KO8A 1JKJA 2MTBA 3I2FA 1BQ4A 4WA8A 5LXTF 4AD8A 5HTKA 1U1IA 1DTWB 3ZWMA 4M87A 1OREA 4Q66C 3ILYA 1A9XA 3HHPA 3KEQA 2CL6X 2P9BA 4EFKA 3AILA 2B92A 4LF9B 3RS5A 2WFAA 5IDWA 2PUWA 1BKSB 1TAQA 3DMHA 3KJQA 2JAHA 5CFQA 3CEAA 4MWEA 1MEEA 5I8ZA 4A82A 2R6CA 5LA6A 5LOVB 4G24A 4MR8A 4MWBA 1NRXA 4RL4A 2CJWA 1E2BA 4QRHA 3X1MA 5L7YA 1N5OX 1A96A 2EKZA 1N5IA 4H1TA 4ESHA 4QKQA 5KNBA 1LZKA 1HYQA 2ZTUA 3PC7A 3K15A 4CMBA 3D6NB 1C2TA 3HDGA 4DV6B 4X7MA 4D5GA 1P75A 1T3SA 3H5VA 4J49A 1ZRNA 1IU9A 2GJSA 3TMAA 4AU1A 4HMQA 3K4HA 3MCZA 2BFPA 1HTWA 4ZC1A 1SC1A 1OI7A 2E87A 3D9QX 1RM4A 1TKBA 2YV2A 3LM8A 3QFHA 2E82A 3D5TA 4RLFA 2AFVA 1YZLA 3A2LA 4TLDA 2XZTA 4X84A 2ZB3A 1KVUA 3A05A 4XD7A 1HYBA 2J3IA 3B38A 5HE9A 3DDSA 3LWDA 5FI1B 2QB5A 4MRVA 5IANA 1Y7TA 3PDIA 4DC1A 1WZCA 2C4HA 1LPPA 2GLUA 3RODA 2WSSD 1K7SN 1XD8A 3KOWA 4CL0A 1H6DA 2HWXA 3N76A 2R11A 4WDQA 4WKNA 5IMBA 5CCDA 5HJ7A 1RHKA 4LMPA 1UT8A 1TPZA 4RMHA 3OPXA 1VL2A 4WJZA 1D2EA 3J81k 2PZJA 5B53A 3TLGB 4C6RA 1QWSA 4ZOBA 5EFZA 3ZBQA 2R65A 1PEAA 2QR2A 3T0GA 5BQOA 1Z18A 4J4HA 3RS2A 5AW0A 3WLSA 1D7OA 4E1AA 1RQGA 1SK8A 3WC4A 4KAFA 3ZH9B 5JTUA 2NVUA 3UANA 3GFSA 3QVLA 1DEOA 4B5KA 2DHQA 4F5EA 3GFPA 1XTBA 2VVTA 3TRJA 3CH6A 4MHSA 1E32A 4FGSA 1SHUX 1QFJA 2MSWA 3B51X 4ARSA 2CLMB 2VQDA 5B2ZA 4KMMA 4LJSA 5JRZA 2R5WA 1ZM3A 4WNAA 3P1JA 5FBZA 1NE7A 4QM7A 4QNMA 4ETIA 1XG5A 3AI3A 1C29B 4MWSA 2C2KA 5HIMA 4PN3A 1UKCA 2HGSA 1J06A 1NMQA 2Q4TA 4CHTA 3ANTA 2OKGA 4FLMA 4WZAB 7REQA 2E5FA 4HEA6 1IQ0A 4MUKA 2ODWA 4DMKA 4Z7NB 5E4FA 2P35A 3DUFA 3FI9A 3GCWA 3Q9LA 1XEFA 4HXEB 2BFBB 3EGXA 3FLEA 1XALA 4JLAA 4L3OA 4MB6A 4Y0NA 5I9BA 2Z5VA 3H9BA 3T9AA 5CBKA 4OMUA 2GPTA 4RVGA 1A9TA 4D9JA 4LNAA 2HA7A 5A5EA 3Q9UA 4P7JA 4WFQA 4CI9A 3E1KA 3IFSA 3VR6H 1ZD5A 4Y6SA 5EZQA 3FDJA 3MK31 2H8KA 2Q4RA 3DLTA 3TL2A 2PZGA 1C7QA 4B46A 4D6PA 4HNRA 4B35A 1XVTA 1CRWG 3CZ9A 3MILA 1L5GB 2C78A 3IAAA 4YP0A 3HUDA 3Q2IA 1EEXB 3ZVNA 4ZTUB 2CNBA 2GB4A 4PBTA 3GJYA 5FYQA 4WBNA 1NATA 1WEKA 3IVXA 3M5DA 3RIHA 2OHHA 3LSTA 3VOSA 2JFVA 3UV6A 3L84A 4G0VA 4D9IA 1KAEA 2FPPA 4OHFA 1P17A 3LHKA 4JR2A 4TWZA 2C9YA 4W8OA 3Q85A 1U8EA 1J8MF 1JPUA 1WBJB 2E37A 2PX3A 2IYRA 1CK4A 3C1OA 1H9AA 4FFWA 4GX5A 4K40A 3ORRA 3R5HA 4OFZA 3HCPA 3KLNA 5M3BA 4AG3A 1E64A 4HQLA 1ID1A 3LBNA 1SFRA 2P9EA 2P2NA 3QVUA 5CX4A 2QVYX 2ZJYA 1YZ3A 2CHUA 4B48A 3CEPB 1IMJA 2BISA 4L75A 4UPDA 3FWYA 1VG8A 4RJ2A 3O83A 4FOSA 1CQJA 1OASA 3SOZA 2V59A 4FX5A 1UPFA 4WV3A 3M6XA 3F7MA 2WM3A 5K0BA 1V16A 1SAYA 3E9NA 5AYVA 5TB5A 4KLZA 4LXYA 4XWYA 4BNLA 1EDDA 4RH1A 4N01A 2HLDA 1HLPA 1MRZA 2NW6A 2RGWA 3ET4A 1APBA 4EKEA 4YDSA 3QITA 1POWA 2HJVA 3W06A 3FTNA 1XT6A 2VRCD 3PT5A 2PVPA 1R5NA 2EGGA 5DWQA 2H16A 3V8VA 4TTIA 2ZI3A 1MX3A 3K53A 3OBBA 4JA0A 4K1LA 4EGFA 4JI2B 3LX8A 3O3MB 4TMKA 3P94A 1B6TA 3E2IA 2XXBA 3KPWA 5THQA 1YQTA 2Z6AA 5D3ZA 3MGAA 4D8UA 1VYUA 1Q0SA 2CXQA 2LTAA 2ZAGA 3QVKA 3O4FA 1Q17A 3G9TA 5FEUA 4WRRA 4D26A 4NY1A 2ORVA 5CLHA 3HR4A 3R3SA 3FDZA 2WBLC 1DKRA 2I6FA 3GLSA 3K0FB 4RGQA 5J1TB 3VR5D 5D3MA 1ABEA 1Q57A 5AVQA 4OATA 1G8YA 4KPFC 1ZZEA 1WM1A 1E63A 1T9BA 2C54A 3PQEA 2E3JA 4OO3A 3X1DA 1ND5A 3QMWA 2FHSA 2YCBA 3PGKA 2IWHA 2Y1XA 3E4DA 3ZCUA 1EB8A 1EPUA 5FULA 1W5FA 3Q6IA 4ZEXA 1NFFA 2EP5A 2G09A 1OYYA 3EGIA 4F5DA 1IEXA 4M0MA 3ROZA 1H42A 2OZKA 4BNWA 5HG0A 5KIAA 3F3KA 2QG4A 1WZ2A 1ZSNA 2DFPA 3UFBA 2OHXA 3QPVA 1WUIS 3QMPA 4ZU6X 5IWAB 1C1YA 3ORYA 1RFGE 4FDLA 3M2TA 4MICA 3F6EX 3KDSE 4EUHA 3FA2A 1EX9A 5AVJA 2BR5A 2W6IA 1KJ9A 1ZSVA 2Y9MB 1XDSA 4LECA 4MVJA 5HKOA 1C5KA 2XDQA 4YCAA 3A4IA 3H5OA 4MTLA 5D5PA 1DHRA 2PUDA 3N86A 3NAZA 4H7HA 4N8SA 3QOWA 2LR0A 5EQDA 1QTRA 1B8UA 4KR9A 3VPHA 3QVTA 1YU9A 1Z82A 3LV8A 1I01A 2OV3A 3ONFA 4Q3OA 2FEWB 5ELXA 4XW2A 4XLZA 3AKEA 3HY6A 1FJ2A 5JBNA 1T0BA 3FF1A 3L0BA 2P27A 4PV7A 2WAYA 1MA0A 1L4KA 1JZSA 2DFTA 3PICA 1T1GA 3ETEA 2JDIA 4JLSA 2FUKA 1I32A 1GGEA 1DRVA 2PUHA 3KDAA 1VPWA 3T38A 2A33A 2ZBQA 2AOUA 1QFSA 1GPAA 2F4VB 5DSZA 1MJGA 4F5ZA 3OMWA 4OU4A 1CD5A 1R6TA 4N5LA 4EG5A 2QLMA 2X5XA 1U9YA 5KPJA 3TZ6A 1WQ1R 3PR3A 4BPBA 3PG5A 4FYHA 1IWBB 3L0PA 3RASA 4CF4A 4UFNA 2ZAIA 1NPDA 2FG5A 2XD9A 1WSAA 1W6UA 3MFYA 4QBGB 1NVVQ 2OQIA 3KD3A 4CN9A 1OFUX 2GZDA 1N2CE 4H08A 2Q5QA 1W85B 2GX6A 1EGAA 2RKWA 2DPMA 1AZSC 1JG6A 3QSGA 5ECYA 2D00A 3DZJA 3LECA 3IMGA 1U2ZA 1Z45A 3CNOA 3DKRA 3THOA 1K3UB 2Z83A 1TNDA 3IPRA 3N8HA 1PFGA 4REQA 5AI6A 1Q0ZA 4PANA 5K3DA 1HE5A 2V03A 1SUCA 2QM0A 4HRYA 3FB1A 2DMRA 2NGRA 3MT0A 2ZJZA 5FV4A 4BWYA 5DM60 2Y4OA 2WINI 4I5IA 3U7QB 2MIIA 4GC5A 1HDZA 2DPLA 1RZVA 2X0DA 3ZU3A 5DHUA 3X1KA 1LF0A 3D4IA 3LBFA 3ETHA 2G36A 3N59A 1KVTA 3H6GA 4INPA 4C6TA 3JATB 2HPZA 1MENA 1I9CA 4IX1A 2AT1A 4GR5A 1PUIA 4AMBA 3QGMA 2OYRA 4RL6A 1HYGA 4XR9A 4DB4A 2PL3A 3KYJB 4PZ9A 4A27A 3R9XA 3DNFA 4HLQB 4QRDA 1L4LA 1Z2CA 3RSQA 3MJEA 4ZI7B 5K0TA 3BD9A 3Q8XB 3TGPA 5IT4A 1QNFA 1T9CA 1L4YA 3Q11A 1YHZA 3SYLA 2W8BB 3M83A 13PKA 2RHDA 4G63A 3R6TA 3T3EA 4Z4QA 3CBQA 4RD0A 3X1XA 1ZU4A 2GGSA 2J31A 1H4TA 2X22A 1USUA 4FOTA 3U3KA 2QW8A 1R2QA 1X1BA 4IDHA 5A0VA 3PVSA 3KUUA 1DC7A 1Z9BA 4PVCA 4TV8F 1E2UA 1N2SA 2Q6VA 2W6JA 2ZYDA 1MR3F 3QLVC 3QW2A 4K7JA 4KHPB 5CTJA 4ODIA 1ZGCA 2FEMA 2BBTA 3K35A 2QZSA 6Q21A 3G2IA 1R16A 5GADl 3TLYA 4KQFA 3BHIA 4H15A 5KEIA 1SHJA 4UBLA 5M29A 3E9EA 2XB2A 1KBZA 2NLOA 3PHGA 4RCZA 3OIWA 1OKKD 4OB8A 3EA0A 2VHQA 3GROA 3A1CA 3EZ9A 3N07A 1M2HA 2V96A 3WBKA 1YF3A 4JLKA 3PTAA 4TMZA 3GQBB 1XAJA 4U9IS 4X20A 4QU9A 1JWLA 1NBMA 1EGMB 1E0DA 2MINA 2ZUUA 4IH1A 2YXEA 4JU9A 4EW1A 3UZUA 4EOGA 4EYEA 3IKTA 1I6LA 1W88A 1CUHA 3X1JA 1Q1GA 1JIIA 3GXBA 3L6DA 2C4WA 5K45A 1HR0B 4N7RA 2PVSA 2BEWA 3O92A 1GZVA 3KJZA 5CX1A 1MT0A 5KTRA 4OHRA 3LBHA 3UYLA 4PU0A 1PGOA 3HR7A 3JWEA 3BGWA 4A9AA 1S7CA 2P6RA 4PHTA 5H7XA 3UOGA 3OOEA 2PGJA 1SBCA 3FOFC 1ESNA 1W6RA 1JQ5A 5I7EA 3H84A 2XMGA 3GA0A 4ZQIA 1FDTA 4ZOAA 4YNBA 3RG8A 4NFLA 4BL5A 2A58A 1U0OC 4EMTA 1QE0A 1WDMA 3G5TA 4CF6A 3O1LA 3Q8WA 3PRKE 1B7GO 1YI1A 2AYZA 3WKEA 5D7NA 2IZ7A 1ZNYA 2QK4A 2YVLA 1JGTA 1FYVA 1OFUA 4ZVKA 1R0LA 2YZKA 3AF0A 1FDWA 5DX8A 4W7SA 4KPUA 1NY6A 1Q0HA 1P1CA 4HSGA 1T36A 2VG8A 4L0QA 4OFWA 2GM5A 3RS0A 2WIAA 4HTFB 2R1VA 1NHWA 4C4TA 2YNMD 1Q3TA 3C3PA 3QXXA 5A9TA 3VR2A 5ULLA 1YB7A 3WAKA 4DT1A 4K9NA 2H9IA 2JANA 4Z7OB 1U7OA 1JA9A 3R5XA 4ESOA 3H2HA 1U3DA 1D4AA 4JIMA 3IPCA 1E9CA 3ELYA 3NT5A 4NAHA 4OXYA 1PZXA 5B4UA 5IJ9B 3I0NA 2Z2KA 2PCJA 3QYAA 4FEGA 1CUIA 4EA7A 4IO0A 1WF6A 3P2MA 3EPLA 3RVNA 1VCMA 3EAGA 3OE4A 4RGVA 1PDOA 4X24A 5SZHB 2WWHA 3GN2A 1KS9A 2JGEA 2Y1DA 1KTVA 1V0JA 2BGKA 4HDNA 4PHHA 4B3RB 3GUUA 1HURA 2P4SA 4G1EB 1K9SA 3NGLA 1G3IA 2NV0A 5HUQA 4Z49A 1TAGA 3VHQA 1JFLA 4YRMA 2A9KA 3TS1A 2FJPA 2UUOA 4MS3A 3NXSA 3I6QA 3O8DA 1XKQA 3TOVA 2IW3A 3HEAA 4W1QA 4DAEA 1P2BA 1Q3KA 3HFJA 5JFOA 5KSWB 2FRDA 2XCQA 1YCHA 2DWUA 5KSOA 2AHOA 5C34B 4GL4A 4KJZA 1ZYUA 1SH7A 2GXSA 1KDOA 3RYFB 1KHHA 3RVJA 1NY5A 2A59A 5TVKA 1UL1X 3NDIA 1RJDA 2VLBA 1Y9EA 2TS1A 3AFMA 3UAZA 1RBQA 1NOKA 1RQRA 4X8LA 2WLTA 4F85A 5JATA 1BX1A 2J30A 1LSSA 1KDRA 1DARA 1ML4A 1TIBA 3T3PB 3CTMA 3ICVA 3HZRA 2BZ0A 5TF4A 1GCAA 4J6FA 4LJ9A 2MOKA 5A5VA 3F5FA 1LBTA 4F3TA 2O7VA 5IJ0A 4KQ1A 1SBQA 1ODKA 3ZNQA 1LLUA 1VMDA 3FZEA 3HN7A 4GF5A 3ZH2A 4A03A 4DLYA 4YT5A 3SP1A 5LMCA 3CLTD 3GBSA 5DM70 2H1RA 3AUSA 2YIVX 3JWPA 2MSEB 1SHTX 2H17A 1UDXA 2ZK7A 3V7YA 2RK6A 4OGLA 5AI8A 5A1TA 4LJ6A 4MRSA 2FDXA 2O05A 5FWXA 5BQXA 4Z53A 2YV4A 3R7NA 1PJQA 3SKVA 4M22A 2IIVA 3WB1A 1WUYA 4Y2GA 2A1UB 4EO7A 1SPBS 1E2HA 3PQ7A 1SUIA 3DFZA 2X4DA 3L02A 1OI3A 1H6AA 1REQB 2GH1A 2P41A 3B78A 4MV7A 2V6MA 1CZKA 1FU7A 5CHEA 2QMQA 5CM8B 4Q7EA 2NO0A 3RSHA 5DLDA 3WQSB 2ABWA 1R5JA 4QQNA 3DVQX 5C1IA 5A6SA 2JLWA 1KP2A 4Z0HO 1WPGA 4Z86A 4YPFA 5AKXA 5BR1A 2WHXA 2GWRA 3LX5A 3MWEB 3DOJA 5CVTA 2FX5A 4FZ5A 4EF5A 4CTKA 4V03A 4QJBA 3CUTA 4ZU1X 1PG5A 3PE3A 3GDWA 4MVJG 4P0TA 3KLOA 2B3DA 2MYUA 1VPLA 3TPZA 3ZIAD 4B3FX 1A27A 3EEYA 1BCSB 1DQSA 3RTCA 4E4TA 1FMFA 2PAFA 1AC5A 2EF0A 4GC9A 1SKQA 3EJWA 1LD3A 3QI2A 3TK1A 1X0XA 1L4FA 1DTSA 4CYMA 5GJCA 2GCPA 2WTXA 3Q3VA 4D4KA 1QPZA 1PV2A 3LT0A 5EN4A 3PEYA 3BREA 1K3TA 4EG3A 3E3OA 4LJAA 3DTYA 2PSEA 3IR6A 4EENA 5B57C 4DILA 1XTIA 3MELA 3AGPA 5F5XA 4BNTA 4N3NA 5GZ1A 1H05A 1CY4A 2XDYA 2NNLD 3DOCA 4V38A 5FPHA 3DLHA 2DFDA 3L7OA 4M83A 1MTOA 2QRVA 3CF2A 4J1NA 3OZUA 1IVSA 1RWPA 2P78A 2CNKA 2EJWA 2UYGA 3SQNA 3Q5DA 3NHUA 5ADVA 4CV0A 4ZIRA 1T24A 1VJ5A 1HFJA 1GV0A 4YR7A 3ZZNA 4W5TA 2NT3A 3JYHA 1WDWB 1QF9A 2X0RA 5L3QB 2BF4A 1LRLA 1T6NA 5H1YA 1XCBA 3IUMA 4RMGA 3R9KA 1G6KA 3TCKA 2F2TA 3EXFA 3IUQA 4A15A 3MWDA 1MB9A 4KSCA 5GVSA 1X7HA 5K0EA 1DFHA 2ZRKA 3NYIA 4Q1AA 2V5UA 1OYWA 1M2FA 5EQJB 5FNVF 2FOXA 2QAIA 3NX4A 4PM4A 3ICPA 3K30A 4XVQA 1HE8B 2G6BA 1R0RE 1UZMA 1FZQA 2A9RA 1ZXLA 3C4JA 3UHAA 4YCMA 2Q27A 5KNBD 4I66A 2JASA 4KPGA 4N5MA 2EWWA 3GEMA 4N12A 5LQJA 3C3MA 5MN5A 1NI5A 3JQ6A 1BFKA 3K0EA 2WUEA 2CLLB 1JLLA 1PT8A 3HRIA 5ESXA 4YJ2A 2GM3A 3QQPA 4R84A 2CD9A 3FB4A 4HL6A 4L5IA 3K8ZA 5K4AA 3ZW9A 4C9BA 5A4MS 5KYYA 1GKUB 3U5ZB 4P4LA 2Q3DA 4YUXA 1O6BA 4H3VA 2ON6A 1KO7A 1N57A 3I8XA 1A5AB 1TI7A 4FYYA 2UXCB 4JGBA 3W2GA 1N0IA 1YR2A 3OTHA 3W90A 5KQMA 4JSYA 1D1PA 4LQ4A 1DQRA 1PD0A 3GDFA 4LRXA 1ISSA 3ZY3A 2IF2A 4ZI7F 1B3BA 1IHOA 2ONJA 1R8YA 1X7WA 3NDPA 4X1KB 3RVKA 3KTFA 3IHLA 1KAOA 2CMDA 2VUSA 4ZOLB 2O20A 4ARAA 4P33A 4DM4A 1H5QA 1PQPA 2QTZA 5CPFA 1M6VA 3B36A 4LY6A 5KYNA 4IY1A 2YWFA 3LA8A 3K4QA 4OJTA 4DJ5X 1DOZA 2V7VA 3NTOA 4IXNA 4JJ7A 4R8VA 3W6OA 1UXOA 5G3YA 3A11A 4FR2A 1YXMA 3PGJA 1EP2B 3FYUA 3AVYA 4F6LA 2JDID 5T8KA 2YN0A 4LCEA 4JHXA 5IT0A 2Q2NA 4ZT6A 4OP2A 1SIOA 1XAIA 4KO3S 1NBOA 4M1SA 4CM9A 5C5EA 4LOLA 1DKOA 2H0RA 2QR5A 5EIBD 3OM1A 4KO1S 3DOEA 1DXOA 4PXAA 1JALA 2B94A 3EIEA 4F86A 1NIJA 1GEEA 2CKDA 3WYGA 2VCYA 3TKLA 3E27A 3IJ5A 3HB0A 1QP7A 1BA2A 1MH9A 2ZYSA 4GSKA 1DNPA 5F4ZA 1YL6A 3G2NA 5D6OA 1M66A 3IT2A 3U40A 4RF5A 1SUPA 4HBZA 2GF2A 3A3NA 2AD5A 3FRJA 5DM4A 4OQFA 1W0JA 4EEKA 2PJDA 3CKYA 4OUKX 3K16A 3LNCA 3ORQA 2XDWA 4BE9A 4TZKA 2FDRA 3W5JA 1JSCA 5C80A 5LM3A 3AVQA 1O94D 1PWZA 4LCBA 5CXQA 3K0HA 1I0IA 5K2MA 3FYUB 3VPFA 1JA0A 2DM6A 4FKMA 1R6VA 3H16A 4MGZR 1ZNXA 4MKZA 3T3IA 4AY5A 1W35A 2EHDA 1V7CA 3HNOA 1FPQA 1NXVA 3L4BC 1PFQA 4AURA 3B1JA 1M6VB 1RAAA 4W8HA 5KWVA 1P2TA 4XYGA 4DBLE 3RHSA 2X9VA 1I3MA 4OB7A 4YRPA 4ZOLA 2BTEA 3R3UA 4JYPA 2HRRA 4QLOA 1PJBA 3BWMA 4I5GA 4D9MA 1SURA 2BV3A 4DNPA 1GITA 2ZWVA 1X7WB 3FUUA 4X1KA 3GJ8A 3RWBA 4DYHA 3HWX1 3QBDA 3RU2A 3V2IA 3W5UA 4BO2A 3OPYI 5JJKA 1NYTA 1MC4A 2AW3A 4UULA 3AYXB 3T1TA 4V0SA 3IDZA 1T1RA 3KAJA 2QP4A 1E2FA 1Y5RA 5D1NA 2GF9A 5KYYB 4F2GA 3Q0EA 1EK2A 2BMWA 1BJRE 2NACA 3KE9A 1JLLB 2ORWA 1SIWA 3B12A 4OYLA 4YJ2B 5E0KB 2HOQA 5CLQA 1R8XA 3MTDA 3IYLW 4J0CA 2AK2A 2IZ6A 2V7PA 1AKUA 2CCJA 4OQPA 3TWOA 5HRUA 1YAHA 2EZ4A 3FZQA 3ZLJA 1M2EA 2VWPA 2H54A 4YJDA 3DJYA 1QHIA 2Y93A 3GLUA 3UJBA 1EK5A 2I5PO 3GP5A 5LQMA 5F23A 4GWGA 3M5CA 1SEPA 3DMTA 5F1OA 2UUBB 1XTVA 1ZO8A 1AZWA 4XKJA 4DRYA 5IH7A 1T0HB 1BX0A 3D31A 1U6JA 3KJXA 3F7OA 1TZBA 1OAOA 1XDDA 1IRIA 2H2HA 4O2LA 1JKFA 1D8TA 2II6A 3O4GA 3MWDB 3PUXA 4BX3A 2PBZA 3EXFB 4DR5B 2VDRB 2IH4A 2JBHA 5I9IA 5C8XA 2XEXA 4F6CA 5L3QA 4PBSA 3U1TA 1OOEA 3JSAA 3LDUA 4OJKA 2F3QA 2GESA 2ZYAA 4RZXA 2BCJQ 1CJMA 3E82A 2DQZA 4ZIRB 1NXWA 1WDKA 1DDOA 2Q6OA 4KDEA 5CYGA 5M2QA 2H7XA 2QRVB 3DO8A 5CDSA 4LMAA 1D4FA 2MHCA 4KH0A 2FMIA 1FYXA 1ZA2A 1ZH8A 3JSXA 4KLAA 5AOCA 2OUKA 4CU5A 5CXUA 2PIAA 1KO4A 4Q9JA 3FVRA 2G7ZA 3JPWA 4CQNA 2Q1YA 1M6EX 1PHPA 4PX2A 1ZM4A 4BKRA 4HPXB 3RPEA 2V4UA 4KVZA 4LJRA 1VFPA 5FOXA 1X9IA 4MYHA 2O0LA 2Z5LA 1NHGA 1PHRA 1WV1A 1BCSA 1U31A 3OUTA 2ZREA 2XVZA 3GFQA 3R3ZA 1MG0A 2AZXA 2OVBA 4ASUA 2FFRA 1BQEA 2A5DA 3OFJA 1MZVA 4E2FA 3ZU5A 4LVCA 5LU9A 3MWEA 3U9SA 3P2YA 1Y1RA 2SBTA 4JYMA 1CS4C 3A04A 4IDCA 3UBTA 2XOKD 3DM9B 4J0QA 5A6SB 3W8EA 2PT9A 3LF2A 5D51S 1X1RA 3A28A 3Q10A 1FJHA 2IKQA 3G3EA 4L72A 1JA1A 2DBRA 2QNIA 1REQA 1PZHA 2DBZA 1LBHA 2O0KA 3W8FA 2BLLA 5IT5A 4RQAA 3DE0X 2ADFA 2EQ5A 2HI0A 2Q3EA 4IS3A 1NBAA 2HWKA 2IP1A 2A1UA 3BKXA 4DIOA 1U7ZA 2ZPTX 1UP6A 1VBNA 2Q50A 2QLTA 3EJ6A 1XZQA 2GK7A 5CLFA 4UXJA 2YXDA 3GJ3A 3IJPA 2FRDC 2QJFA 5DM1A 4D79A 5FWXB 4RTOA 3TPFA 3QQ5A 2PGNA 4BFTA 1EX1A 3O84A 1KRHA 1PJZA 4OGKA 3C5CA 2PNJA 2A2ZA 3H97A 2PSFA 5J4HA 5MF6A 2ZSUA 3T3OA 2IEYA 2YHUA 4U6NA 1P3JA 5ARCA 3PUKA 1J97A 2BMJA 2B21A 3EXAA 1IULA 1V1JA 1WU8A 3GRKA 4JI1B 4L27A 1TUEA 3HYSA 3QA3E 5ICEA 5IVHA 4C08A 2VLIA 3KYBA 3PUHA 5IJ0B 4AF8A 5F1KA 1PI3A 1ZM7A 4BNIA 4EB3A 5A0TA 1KIFA 2F55A 4AMYA 4JHLA 5I4CA 1R37A 5IAJA 2LE0A 1G3MA 5CYOA 4GP9A 5JCZA 1TK3A 4L3VA 4U7JA 3DA8A 3EUFA 1DG3A 1JSXA 1KR2A 3MHPA 4M37A 4M9SA 2I4IA 1E94E 3GQVA 2C2BA 3IB3A 1BD4A 1KI1A 4D25A 3RYFA 4LXGA 3NHFA 3QE2A 2IU0A 1MB4A 2ANCA 3NEYA 2UYCA 3SJBA 3EUEA 2PXCA 4RANA 5LP6C 1J9ZA 3D0QA 5ED4A 4N41A 3BFKA 3UB3A 2YUIA 2J59A 2HU2A 1EU1A 2IXTA 4G2NA 4GXRA 1GD1O 1EFRD 2PVCA 4MS3B 3AXSA 2SNIE 1LDGA 4GXTA 2FR8A 2G0AA 1VG1A 5I48A 1BS1A 4WH0A 1U9JA 5EVJA 3AG5A 3ZNPA 2WW8A 3DE3X 1BH6A 3MTBA 4PGMA 1N6PA 3OSZA 3LAWA 1YV9A 2DWOA 4HDNB 3ID6C 1QPBA 1AHIA 2HPVA 1AU9A 3WTCA 1IJEA 3RTBA 1SXIA 2ZSHA 4N82A 5KTNA 4FYKA 5FTMA 3FNBA 3CPEA 4E3ZA 5K05A 5G40A 621PA 2CZGA 2O8DB 4D44A 5IJ9A 3D4BA 5JC1A 4WOJA 3B1WA 2G5PA 3KZMA 3MJHA 4DT1B 1TO1E 1GZ7A 4MVXA 3F8TA 4R9UC 5C4IA 4YMLA 1IK4A 1NV9A 2QQFA 3UM9A 1GUDA 1HOXA 2HCFA 2R1VB 4HTFA 5EUBA 2ZYHA 1N2ZA 2LCQA 1II9A 1DO2A 1T36B 4X5OA 3BZWA 4KPUB 4YH1A 2V0CA 3P97A 4G1UC 1K8XB 3L8MA 5L7WA 4YP7A 3DO5A 4QG7A 4LJYA 3AV3A 3T1VA 4TLAA 4BLQA 5K0GA 1YB2A 1HEUA 3LUDA 1XHEA 1NLYA 2HHCA 2PKRA 4TWBA 2HTFA 1GRNA 3GYBA 3H83A 4GM1A 3RUCA 3OA0A 3I9FA 5AM1A 1E1QA 1CEQA 3GEEA 4R5MA 3KRTA 4C87A 1PG2A 4RPHA 4NNOA 1OXTA 3ANYB 3M6AA 3M1YA 3ABOB 4YCJA 4U63A 4KACA 1KDTA 2IEDA 3KL4A 2OCKA 4FK8A 4UARA 4BQPA 2CC2A 2FETA 4HLCA 2W6CX 4KB5A 1YB4A 3ZVKA 3I9NA 3LWBA 2BEWB 3NNSA 3HYRA 4RS3A 4XYBA 5AK0A 2D2FA 2R00A 3TIFA 3VDQA 1COZA 4J2TA 2IZZA 1W88B 1YA4A 2BN4A 3RVPA 3A36A 3PPXA 4YWJA 1G8JA 2YY5A 3BS4A 2MINB 4MVYA 4F84A 3W2EA 1GJRA 4RTLA 4PF1A 1RIIA 3QLTA 4X20B 4FIZA 4GMGA 5IKMA 1A9RA 2IHYA 2W2MA 2WJYA 3GQBA 1UDWA 3ZUGA 1BXZA 1CB0A 3ZWOA 3ADOA 2YJ5A 1W4RA 2DWQA 2Q5LA 4GE0A 4JBWA 4M1ZA 4RJIA 4OXQA 3WI7A 1M2GA 3CM0A 4M99A 4MQBA 1PUXA 3UUEA 2XUKA 4LDZA 1B74A 2R8PA 5EINA 3TE6A 3RB8A 2O2CA 2ES4A 1OHHA 2J07A 1OIVA 2G83A 2IZ0A 2UYOA 4QARA 2HLDD 2O2GA 5ETJA 1ISRA 2YRFA 3TBHA 4D9KA 2ZRBA 3OJ0A 1O54A 2YFQA 2A1TS 3FYDA 4HRAA 4JMPA 3SMQA 3E8MA 4BO9A 1MP0A 3L7NA 4FFMA 4OBEA 4CG1A 4IEEA 3H1EA 2BUBA 1XV5A 5H70A 5BW6B 4OHUA 1NR5A 2C2YA 1DAHA 1NSYA 1NVMB 2A7XA 1JJFA 1SXJC 2IQIA 1RYMA 2V3WA 2W8BA 1N6OA 2C9ZA 3LIIA 3REOA 4ZVTA 3UJDA 3GFFA 3H75A 1V3TA 3S0JA 3T95A 3A3PA 1FXWA 1V43A 1JG2A 3WGYA 1GCGA 1YAJA 1QHEA 3M0EA 4ZI7A 1ND6A 1RRKA 4L4RA 4AICA 3R9XB 3O26A 1SCBA 4ZAYA 2W0MA 4D3SA 4EEXA 2O2HA 2VAWA 3G0IA 3JATA 4C6TB 1NJ6A 1HFKA 3RD5A 3KVYA 4IJUA 3UQZA 3NVKI 5EIEA 2VP3A 2NVOA 3CNQS 3UPUA 2C04A 4WECA 2FQYA 4P3PA 4ALMA 2LP4Y 3IIJA 1MAVA 3U7QA 3DLPX 10MHA 3FD8A 1AV7A 4QPZA 3H9CA 3OY2A 4JY7A 5J47A 2FUCA 1R18A 4S3MA 3EN0A 5LZ9A 4REQB 4HNVA 1U3GA 4J0DA 1PU2A 2HXSA 4QZVA 5IJWA 1XNRB 1IN4A 2EFDB 1YGPA 1TK9A 2OWDA 4RDIA 5EXSA 3S29A 3VNBA 2D13A 4DANA 3DVRX 1AMUA 2VF7A 2PRSA 1W85A 2Q28A 4B7CA 2LDXA 3NWOA 1KJWA 4ARCA 3HA3A 2UUCB 1J1ZA 4NC9A 3RVQA 3IB6A 2CLFB 3Q72A 4I5DA 3U4DA 3K9QO 4G4IA 4RSRA 5CXSA 5H3CA 3JYOA 4B76A 4MV1A 1ULTA 2HFKA 1A7JA 2D0DA 1COWA 3GMIA 3QBEA 4NYIR 3WISA 3KOXA 4B7ZA 3M82A 1S8OA 4IPTA 1IBMB 1I1NA 4Z8YA 3TX6A 1CU1A 1ODFA 1WAMA 1SC3A 1XZAA 2Q1TA 4EEZA 3LHFA 4OK5A 1QHFA 3NBXX 4IIHA 1MJNA 3RVDA 3WGJA 2E18A 3KEFA 4DLAA 3KR1A 2AOUB 1I80A 2EW8A 3QG5A 1L5RA 1Z7BA 3FFBA 1EWQA 3A7EA 4R9VA 3U7IA 4AG6A 1IATA 2C31A 4MPTA 2Z08A 3B89A 3IDSA 2QUAA 5CFMA 5TLSA 3DHEA 1FJGB 4R1TA 2Z2YA 2IXAA 2I6SA 3ND5A 3NWEA 2XQKA 2C2WA 5HF8A 1E79A 2ZVQX 3IP3A 5IBRA 1WNTA 4KOAA 1N3LA 1SQFA 3ZWCA 4ZYLA 4C43A 5LIRA 3O91A 3UMSA 1QIGA 1SQ6A 1OA0A 4FJ1A 3COSA 1U3WA 2PLRA 2Y1OA 5JC8A 1MOQA 3HWSA 5KKAA 3T0FA 5EIBC 1XCPA 2CHGA 2XDQB 1CSEE 1E3QA 4LDJA 1UH5A 5AKZA 3ZDFA 1AQJA 5BSWA 4PZ0A 2IS4A 3JQEA 4HX2A 2ILVA 4PPGA 1IPHA 1GNVA 5DLYA 3V8QA 4BEBA 1IBLB 3HEBA 4HYEA 2WV9A 1H3NA 3WBJA 1SEVA 4PCUA 1N1EA 4S0XA 3NC1C 2YJNA 4OB6A 4AN1A 4CDMA 4GG1A 3VNSA 1KQFA 1EI9A 4IFBA 1B8PA 4KR0A 3IPYA 2ATXA 5CDFE 2W93A 1PJLA 1B23P 2VJQA 2ZRHA 4CIBA 3FTEA 2QTCA 2TECE 2QGZA 1T2EA 3I2HA 3TTUA 3DW1X 4PLWA 3V6MA 2GDJA 3ZJVA 2D4AA 5GONF 1Q92A 3HCFA 2JLQA 4DY4A 1GQYA 3GR6A 1JE1A 1P6XA 1QO9A 4Q16A 2P9QA 3MM4A 4MV4A 4R9SA 1EUZA 1Y6QA 1ZVMA 3EPRA 5D3MB 3NGMA 3K0FA 4U8GA 3TL6A 5DI9A 1KR5A 2PGAA 2XGOA 2HSEA 3FDZB 4RD6A 3T3HA 2PKCA 1DV1A 2VWGA 4TVOA 4XPZA 4QTZA 1QZ3A 5B37A 5H9VA 2JJ8A 2YMQA 4CG2A 2GAJA 3IVCA 3P9RA 4KBFA 3VKVA 2C92A 4GD3Q 3DR5A 1IQRA 5DNAA 1Q6ZA 2D3WA 3DOOA 3C14C 2ISSD 4HX5A 4ZMBA 1AXGA 2BFWA 4MLZA 2XWJI 1IXZA 3ORHA 5L95A 1RXEA 4MW0A 5HF5A 4KFRA 1QKIA 3L8YA 1Y1SA 3RQSA 4EY7A 2IDKA 2H06A 3ZY4A 2ZG6A 1FK8A 1OWNA 5LLDA 2AWNA 5TPZD 1GRCA 3VUFA 1E9RA 4YMUA 4JP5A 1SBNE 4DV1B 1PZFA 1V16B 5H82A 2OXFA 4BE4A 3F6BX 5KJCA 5LB4A 2XCIA 3SHTA 3QFRA 1TD9A 1CQJB 3PSHA 3B3AA 4HFJA 3OKCA 4KBYA 1KH3A 1T6YA 2PLNA 2QM8A 2R47A 2PGDA 2QUIA 2RJOA 1JQLB 1T2VA 1SUFA 3CXUA 3DHWC 3BQNB 2PMEA 3JD4A 2Z30A 1MEJA 1CEYA 1EFTA 4RZHA 4M8IA 4NCBA 2KS6A 2JFWA 4AJOA 1MQ8B 4C0SA 4N40A 5CX1B 4K81B 1E3IA 1JR3A 1LS6A 5DBFA 5L51A 4LXUA 5MN6A 2J3JA 2FPPB 3DOFA 5AJZA 1DB3A 2KBEA 4NX2A 2P9YA 3H8WA 4NYMR 4XJXA 5IVKA 4GP6A 5EGSA 3PQ8A 2ACKA 3DP7A 4GKVA 4MJLA 1SCIA 3SC3A 3F3SA 5C8VA 1E0KA 4WBNB 1SCDA 1E2EA 1GT6A 4NCAA 3DE1X 2WU8A 1G55A 3GVPA 1L8OA 2P8JA 1YKFA 2XHZA 1M54A 3M6FA 4RKYA 2DERA 3RQIA 5FCDA 2E89A 5AM3A 4L16A 1B0PA 1HYEA 3IIKA 2WMYA 3D7RA 3DCYA 3Q7PA 2YKGA 3A6FA 3KVNA 2ZAMA 3R23A 3BJZA 4JLMA 1T10A 5CH5A 1AH2A 4F21A 3TCXB 3GRAA 1E9EA 1N7HA 2QAJA 3VGJA 3R3YA 3BQMB 5J4YA 3EGXB 2BFBA 2X7JA 3NM5A 4GI1A 4EI9A 3DUFB 5J5AA 5JZBA 3T7RA 5CEJA 5JJBA 4GRIA 3L9XA 4QXRA 1EWKA 4WZAA 4NK5A 1CDOA 3HNPA 1J7JA 7REQB 4C4RA 2GN1A 1JE0A 1E9SA 3FYSA 2R00C 5H59A 5MFPA 4HYTA 5AHOA 3USZA 1DZIA 1G8PA 3GGSA 1ACLA 4FP9A 1WUKS 1JPVA 4WNAB 3M6IA 1Z15A 3HC7A 1J6UA 1EZ1A 4N76A 4XUGB 4CBVA 4RWEA 2RGCA 2A8YA 1XPRA 3H3XA 1KK1A 4OMFG 1RP7A 3W9BA 2FOIA 4X00A 2GEFA 3SLKA 8GPBA 5IXYA 4S0ZA 3OTOB 2YS7A 2NVUB 3CVWA 1KA9H 4YCCA 3ZVLA 4K9OA 5TRTA 5J4KA 1BN7A 3TVYA 4CG3A 3CVVA 3RC8A 2GFQA 1TPYA 2OFWA 4GKAA 4LVNA 4WD3A 4Q7QA 4F8EA 4RJLA 3X1WA 4MGIR 3PEFA 1L7BA 1E1RA 3HCOA 3I5UA 3MMSA 1S7GA 4AT1A 2IXGA 3TLGA 4J3NA 2GKSA 3NASA 3ROPA 1CIVA 3IKVA 3PPVA 3RU3A 2Q49A 4UCWA 2FGJA 3V2UA 3DEKA 5DJ5A 2VBCA 2J85A 4G8CA 4QX6A 1E1QD 1E61A 2P2DA 2CL5A 4LDRA 4H0NA 3WDKA 2OMEA 5F3WB 5ARDA 1D1QA 4YXFA 3PDIB 3FWPA 1TTQB 1C50A 4KQKA 1QVRA 4AS3A 5EIXA 4I46A 1VKJA 4DVJA 3I28A 2CEAA 1E79D 2JGAA 1PF7E 5ALYA 2FCRA 1FSPA 4FS8A 2EC5A 1SG0A 3EVGA 5JCPA 1BRMA 4QXOA 2IH2A 1X19A 3CRW1 4NZNA 1TIKA 3MWFA 2LBPA 3MPUA 1JNXX 1RAHA 3IV7A 3O94A 3OU2A 5EIFA 3B3QA 1JG7A 1KSJA 3S8YA 1GTMA 2I2AA 4LI3X 1TTTA 1FSSA 1K86A 2VT7A 5KPDA 1PR9A 4CN8A 3IE2A 3ABIA 3A1DA 4N5DA 5ALKA 2O4CA 2CJWB 4R7GA 1CZNA 3V1NA 4MR8B 5EIOA 3QBVA 5LA6B 2OZPA 3KSMA 4OF4A 5ER6A 5LOVA 1NAIA 3TGLA 4PCAA 4NE2A 3A9SA 1JMKC 4IBOA 1V39A 4OIMA 1XZJA 2CF5A 5FR2A 1GOTA 3I9JA 5F73A 5HGXA 4L9SA 2EKBA 1L4GA 1TYDE 3IPAA 2CN1A 5AW3A 3A2MA 1A1SA 3OE1A 1DTWA 4BNXA 3WYEA 3ED5A 1ARZA 3B9BA 4MNTA 4QGFA 4XVRA 4S24A 3ROXA 1JKJB 1Y9DA 2J7PD 2ZZMA 1TM4E 4TWJA 2B1RA 3CLTC 4X60A 4E1VA 2HU7A 2X0IA 1XE3A 1DDGA 4LWZA 1LQUA 3ODGA 4AM8A 3RF7A 2BE9A 2H1HA 5JECA 2XUAA 4RMIA 1KJYA 1G5RA 2GCOB 3F4LA 4XUCA 1W25A 4E08A 2NU7A 1C9YA 3AU9A 2W2KB 3CH5A 1S4MA 2C99A 3HJAA 1XMPA 3PQ4A 2DJIA 3JTMA 1GWNA 4TTJA 4A2PA 1KFCB 4A0FA 4IYRA 2KBFA 3MUNA 1HZJA 1FLDA 3DOIA 2C7BA 5AI9A 2AI1A 3D8UA 2Z1DA 3EE6A 5HW0A 2PUTA 1TYZA 3K9GA 2NXWA 4RKQA 1CUUA 1R7RA 2CWDA 4YDRA 3N3AC 3IUSA 3E0XA 3FY4A 4G4SO 2PUFA 3UA4A 1XXHB 4FWTA 2AK3A 2IV2X 3UPDA 2WM8A 1HY3A 4COOA 2JIMA 3OEWA 1J23A 4DR1B 1B43A 4P7FA 821PA 3I01A 2V8OA 4NPAA 3Q7EA 2ZSAA 3VR1A 1A77A 1F1BA 3K9BA 4ENQA 2VPQA 1JAHA 4Z4GA 2O8FB 2W4QA 5KJ1A 4X66B 1ZK3A 2H2WA 2NQ2C 2V1XA 4RDCA 4YAEA 4CW7A 3UWOA 1M2KA 3SYNA 4M0KA 4K9PA 2EEZA 3RJMA 1AX9A 1BZYA 3BE8A 2EYUA 4FFBB 4NCHA 4R6XA 3ZKAA 4DLSA 3LGSA 3A6JA 6REQB 4P54A 4QBTA 2RHJA 5EKDA 3M9XA 1E59A 1ZP6A 1NP6A 2HCTA 4F3CA 3VMMA 5J2UF 1X7XA 3RCBA 5JFGA 3RV4A 5BNIA 5BSKA 2X1LA 3PGMA 5DNWA 4Q1CA 5EJIA 3OKPA 3X44A 1CR2A 3EEOA 1FBTA 1ZK1A 2FR1A 3KVRA 4QFMA 5F7XA 1E2PA 1RC8A 4TXNA 4IRMA 1NOJA 2W2VA 1UJMA 2H2DA 1KZHA 2HT1A 1UBNA 2BI7A 2CJFA 5EGNA 1UT5A 4KRXA 1MW8X 3DOUA 3HMKA 3ZWBA 5IWCA 2QUBA 2RH5A 2W0SA 5MHTA 3H5RA 2ZRAA 4PQEA 3VSEA 2F48A 1YS4A 2Z4SA 3ZE6A 3QXSA 4CR8A 3EZYA 4ARUA 1K7XB 1L8LA 3GJSA 1ECCA 3KCQA 1FFXB 2VF4X 2I7TA 3H5IA 1YMUA 4LY3A 5C8YB 5H4GA 3F6PA 3LCCA 3A8TA 4Q37A 3KT8A 4POOA 4Q4AB 1B00A 2PX2A 2Q9CA 4FYMA 3AVPA 2B20A 4D8YA 3P9PA 5BQFA 4C0LA 2P75A 3PB3A 3FYHA 1Z4IA 1TZJA 5TGDA 1YK0A 2JCYA 4NL4H 3ZCXA 4NMHA 4WVLA 3TECE 2BL4A 5HKKA 2JGDA 1XQ9A 5ALWA 2EBUA 1IN1A 4YAOA 4GKJB 4DEYA 4EYQA 1QZTA 3DBHB 4NATA 4XWAA 5IP5A 2OC4A 5BSGA 1Y80A 4R2XA 2HIGA 3FDIA 3TZBA 3RYIB 3ZYCA 3KK0A 3MQ2A 1WMFA 3NHMA 4FN5A 4G3XA 1XROA 4DYVA 2ECKA 4K9LA 2B69A 3EQ9A 4P2GA 5EL0A 2H5LA 1O6FA 2NVWA 2QN9A 4BU0A 2GD2A 3PD1A 4EG0A 1FVXA 9GPBA 3HPQA 3P45A 1LJ8A 2W00A 4KGXA 4R2JA 2OE2A 1W46A 4DSTA 2ZIFA 2C2HA 1JJ7A 1GQRA 1R12A 1UIRA 3NUGA 4I1UA 4TN1A 3Q3GE 4XWGA 3GLGA 3MXTA 5JDCC 4N39A 2IUEA 4WXYB 5BQPA 4DMUB 1ATZA 4EB6A 4CM6A 3V4FA 4FKBA 2V3CC 1VGQA 4F9EA 1ZDMA 2C3OA 4NOLA 1GNPA 3QUCA 2Z98A 4F6RA 1MRNA 1UK7A 1GIAA 1SG9A 2PL1A 2WV7A 1R5OA 3WB0A 5CA1F 4QJIA 4R8RA 3SDBA 3DOHA 3PJEA 4B4WA 3PHJA 3WO0A 2HF8A 1ODSA 2W58A 2XXAB 4R8SA 3KZXA 4V02A 4LFCB 3SGLA 1MJHA 2ZYTX 4Q1DA 2N3ZA 4AZ3B 4DABA 3TB6A 2ODTX 2X8BA 1SC6A 2O8NA 1EUCA 3QVJA 2WOOA 4LHXA 1H9BA 4RUKA 4NHEA 5F2EA 3PQ6A 2BGNA 2CD7A 3KXDA 4YMWA 1GSIA 3PQFA 1OQAA 1JJIA 3OJXA 4JQCA 3AY0A 3W2FA 4BYGA 5LJLA 3AEYA 4QQ8A 1L6IA 1JH8A 4LRSB 4XUDA 3F98A 1F0PA 4J16A 2ZIGA 4HR7A 1X70A 2WZDA 3ED1A 1RHMA 3JQ9A 3QX9A 4NFYA 3OIGA 1MQ9A 2RCYA 5ALJA 3SR4A 5K6AA 1XWFA 2M32A 3GOQA 3CZ5A 2KW5A 3MPOA 2FUG6 1RS0A 3PNBA 4OBXA 2HQOA 3ZK9A 4ZP1A 1SCKA 3E61A 1ZD1A 2IZ5A 3CF0A 3SXUB 3GLFA 1TUGA 4O4HA 5ITZB 4X44A 1O03A 2C29D 2KM1A 5E4TA 5AKGA 3VTKA 1NJSA 2BCEA 2AOTB 3WRYA 1SA0A 2CLKB 1V5FA 3I30X 5KVQA 4O4HF 3WHLA