1DS6A

Crystal structure of a rac-rhogdi complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
181
structure length
181
Chain Sequence
b'MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 2
publication title The Rac-RhoGDI complex and the structural basis for the regulation of Rho proteins by RhoGDI.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 63
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2000-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ds6A00
1A2BA 2G1KA 3QY0A 1OKKD 1RW4A 1TAGA 2OCYC 3A8TA 2QPTA 2J3EA 4JSYA 4ARZA 3KXLA 2B92A 4LC1A 4ZCIA 3ZQJA 2LWIA 1U81A 1R0WA 2JIZA 5J4VA 1EFHA 3IO5A 2GAAA 3EA5A 4DCSA 2N1BA 2HXYA 1KGDA 1P2UA 4NH0A 4QOSA 4PC1A 1MO5A 3VAAA 1N6PA 2MSCB 2Z5FA 3OE7A 4JL5A 3NBXX 2BEJA 4OYHA 3THYB 4F92B 5DISB 1ZNYA 1S9HA 4QRHA 3LBHA 3SJAA 3FFAA 1J99A 4US0R 2YOHA 4P3YA 4US1R 3L0SA 2P6RA 3ZD7A 1DAKA 3VR6A 2B8WA 2O0JA 2V7QD 4KFUA 1GM5A 4A8JA 1E9BA 2ZANA 1SVKA 3Q8XB 1OXUA 4MA4A 1NMXA 4KLZA 4W5WA 4MGKR 1E0SA 3R7WA 1NMYA 1YZUA 1QHYA 3PEUA 5L3QA 5CDFE 1IQPA 5CM8B 5EE5B 4BLQA 4YQFA 2QENA 4Q5IA 1T5IA 421PA 5KDOA 1KI2A 1X86B 4M1MA 1GKUB 4DIEA 1SVIA 4X8MA 5DI3B 4C0KA 4PZZA 2IXEA 2QMEA 1CLUA 1CEEA 2PJZA 3BWDD 3QJYA 5A4JA 2WJVA 2NZ8A 4C0QC 3LAWA 3EW9A 2RCNA 1SKQA 4UQOA 1AZSC 1Z0FA 4LJ8A 4Q21A 2EQBA 4Z1MD 1XRJA 2AN9A 1DELA 1UDXA 1OXVA 2GXAA 1ZINA 4HDOB 3W8RA 2QP3A 5H1YA 1X8JA 4I1OA 1DARA 1SHKA 1MO4A 3NEJA 5FBQB 1DAFA 4MKFA 5GJCA 4PHHA 5EE9A 1DEKA 2V54A 5IDVA 2ZJBA 3DL0A 5D3QA 1YVDA 4IRUB 1PVOA 1NVWQ 1JBKA 4MRNA 1WQ1R 1Q1BA 1TX4B 1Z2CA 2DWOA 5LB4A 3FOZA 1EK0A 4RD1A 2PJRA 5JJLA 4FMBB 3U7FB 1W1WA 3CWQA 2ZU0C 1AM4D 1UJ2A 2ATVA 3LA6A 4OK6A 1GTVA 4PPFA 4V0LA 1HT1E 3L8ZA 4LV8B 3N70A 1KK3A 2DR3A 3K70D 4AYXA 2IF2A 4O3MA 4JIMA 2VLIA 1C1YA 4A4DA 4CIDA 2O8DA 2OBLA 4A9AA 2XZOA 1YZKA 4I4LA 1W4RA 1SGWA 2PBRA 4M9SA 4B3DA 2GTPA 5IK2A 2MSDB 3K0AA 3WHKA 4C2TA 1VG0B 3D6TB 1GDDA 1GNRA 1HYQA 1DAGA 1XB2A 1XMIA 3GJ6A 3GJ5A 3AVPA 1P2SA 4B2PA 4QL3A 5JCPA 3QEOA 1ODFA 1B0UA 3B1VA 2ZRPA 2V9PA 4KJZA 5CYPA 4LI0A 2GXQA 1IJFA 4QBIA 3K09C 4KLNA 2ZSDA 3W90A 3RAPR 3ZIAA 4JLDA 1XNJA 4LYHA 2X8AA 1XCGB 1FP7A 2F9LA 4D4JA 1KTVA 1BIFA 1NJGA 2C99A 2QT0A 1G8HA 3UMSA 1G9XA 1F2UA 3GLGA 2OCAA 4D26A 1FTNA 1XXHE 4NYJR 3KUDA 4TMTA 4TYPA 1EX6A 4JJKA 4OQLA 1YKSA 5TXGA 5EP1A 4DLYA 1NIPA 3UKDA 1QHXA 2QY9A 2W6JA 4NKRA 3OF5A 3U3JA 2WAXA 2QAGA 4C0AC 4ILEA 2ONKA 2QRNA 3RVBA 4QHYA 4Q7LA 4M4SA 4DUGD 1E2FA 1Z22A 1AS0A 1O87A 1YR8A 2OG2A 1XXHB 5FL7D 1SXJD 2Z0MA 4TYYA 1OYYA 4P0TA 3B1WA 1XEXB 1M34E 1XMJA 5CLLA 3ZQ6A 2D7CA 4TYWA 4Q18A 1KYIA 2OESA 1EX7A 3K0EA 3KQKA 3UWKA 4JLBA 2Z83A 4PAMA 1MABA 2VQSA 2QA5A 2IHYA 3K70C 2QMUA 1OJLA 3QOFA 4TL8A 5JMTA 4TMVA 4LGMA 2GK6A 3O8CA 1K5DA 3E1SA 4CT5A 1E2HA 4HB0A 1KI6B 2V6IA 3J81k 4W5JA 1FTSA 1Z6GA 2EWVA 2R6CA 2ZVQX 2GJ9A 4JVMA 3NHBA 2BBTA 5DI9A 1OXTA 2PMDA 5LB2A 1AS3A 3PUYA 4PQFA 4HUTA 4QM7A 1WBDA 5JJIA 4EDHA 1U99A 2QGNA 2RGXA 3EAQA 3FE2A 4GSYA 2FSIA 5AJVB 3SYKA 3X1YA 4YMVA 1F6BA 2OSBA 3QKUA 2RGEA 1W49A 4GFDA 4OK3A 1W2GA 3IBGA 2J0UA 3RSLA 4QBHA 2RGGA 2Z4RA 4BECA 2VP4A 5AJXA 3KB1A 4AD8A 3LBIA 1E96A 1PZNA 4KV9A 4TN1A 4DLZA 2YWFA 3BK7A 1E2EA 3T5DA 3AUXA 4M1KA 2NMVA 2P2LA 8OHMA 2QGZA 4C7OB 4X8OA 1ZJ6A 2Q9BA 3DEFA 1Z28A 1G8GA 1KSHA 4K8OA 3UG7A 3I8XA 4BE7B 4Z51A 4RKFA 1DO0A 1X1SA 4B34A 1BYIA 2ZE7A 5JBQA 4TLAA 4G5RA 3P1JA 2A2ZA 2E87A 1NN3A 1P75A 2ZRIA 5EUMA 3U3KA 3NIBA 1UBCA 1M8PA 1V5WA 3NBYC 1UBEA 3K09A 3AVUA 3WHLA 3WRXC 3WMFA 1SXJB 2NPFA 2H5EA 2J9RA 2IK8A 2WOOA 4IJMA 4B6EA 4G5GA 2BHRA 5EE1A 3U44B 4JVSB 1W48A 2GDJA 4FWTA 2DFLA 2IYRA 1P4SA 3RNLA 2CJWB 3QQ5A 3I73A 3LO5A 1N5JA 4ZV4A 2OFOA 2AWNA 5FOUA 1P62B 1ZVQA 2GCOB 4Z1MA 1KSGA 4RZXA 4XWOA 3LBNA 1N2CE 1S3SA 1SQ5A 2G0NA 3PG5A 4BFUA 2QN6A 3SFZA 4EFMA 4DDVA 4TMKA 1GKYA 1P2VA 1SKYE 2AWOA 2QTFA 3GEHA 3P26A 1KNXA 4G1UC 3KX2A 2HXSA 1R2QA 4B47A 4D4MA 3WBKA 3CONA 2CL7X 1N25A 3AP2A 1QHIA 1ZUHA 3W3AA 2FV8A 3EG5A 4URYR 2H16A 2YWEA 4TZ0A 1WCV1 4OI0A 4AIIA 4YLGA 4KBGA 4TYQA 2VP0A 3TE6A 1SKYB 4DDUA 1J90A 2CL6X 3FVQA 4RY2A 4Z8XA 2HJGA 4YMTA 2RKOA 2BVNA 2CXXA 3FMFA 4MGIR 1N5KA 4RZ3A 3PCRB 4WXPA 4AKIA 4E09A 3AM1A 2BEKA 2EFDB 2BKUA 4EPXA 1XWIA 3QI2A 3TSWA 4BZPA 2W6IA 3ASZA 2V6JA 2GVZC 3GEIA 5CK4A 1Y63A 2GRJA 2XTMA 2ZYTX 1TU3A 4GI7A 3QBVA 5DLQC 3WNCA 2OAP1 4HAXA 1D2NA 3MAAC 2OCPA 1BO6A 1KI8A 3ADDA 1IY0A 3C4JA 1Z08A 5FBWB 4Q1BA 2NG1A 1HV8A 3M6AA 4OHWA 1ANKA 3ETLA 2O8FA 3KDSE 3U7GA 1EWRA 2WV9A 4NONA 3U61B 1CKEA 4IDPA 5GADl 1UEJA 5FTKA 4BEJA 5HPYB 1RYFA 4WA7A 2WM9B 2AX4A 2GJAA 3W9YA 4TYNA 2ZM5A 2YC2C 3SHWA 5JRJA 3VR5A 1TADA 5TY0A 3KB2A 1JI0A 1NVUQ 2Q6TA 2VIIA 1R10A 2ZJ8A 2ZI7A 1W0KA 3X1WA 2FZLA 2SHKA 3LDAA 2IUTA 1G7TA 1AKEA 1U98A 4UNNA 5K8IA 4P4SA 1GKIA 1CP2A 5GVSA 5KO2A 5LPNA 1DOAA 1S8FA 4AYWA 1X8KA 4DUGA 3OIVA 2PT5A 3AKDA 2OO7A 4F4JA 1XPUA 4DEXA 2A78A 4AKEA 3FHOA 3EIEA 1W47A 5GVRA 1G8PA 1OPXA 3OIWA 3UMRA 1XFAA 1E9DA 2R6FA 5KNCA 4Q48A 5SZHB 1ZUIA 2BCJQ 3C15C 3JVVA 2YC4C 3ZLJA 5HZKA 3KTAB 2F43A 5KSYA 4A0HA 1G7SA 3Q5EA 1OYWA 3CRVA 1TU4A 2ZI9A 1ZCBA 3RS3A 2IS2A 4QGFA 3VTKA 2GNOA 2J7PD 2WWYA 3HU1A 4URWR 1E0JA 1IBRA 4B2LA 2WJIA 2WPDA 3G82C 2GF0A 4AG5A 1G6HA 2GCNA 1K8RA 1FFHA 3NC1C 4B3XA 3U4QB 1KJYA 2EYUA 1E99A 1GG2A 2IWHA 3GJ8A 4D0LB 4ZDIA 2QQEA 4R98A 1XP8A 2XGJA 2XZLA 5EQTA 2CHQA 4CGZA 3LY5A 1ELOA 1QBKC 4PXAA 1ZM3A 3TSZA 2ZROA 1MR3F 2JLSA 3A1VA 3Q9LA 2OBMA 2ZE6A 3QG5A 3RS5A 3REGA 3RWMB 1JEEA 2AFIE 3RS0A 5JS7A 5J47A 4RJLA 1UKYA 3A6PC 4Q4LA 5BW8A 1E79D 4PSAA 4JLKA 3GJ7A 5HR5A 1FP6A 5CIWA 1COWD 2B7BA 3D7MA 3S1AA 2JJ1A 3LLMA 3A1WA 3BH7A 2JDID 1Z63A 3P27A 2ZJAA 3QEJA 2ZJZA 4ITRC 3REFA 1Z0JA 4A6XA 4LSGA 1A82A 1QVAA 1R0YA 2XAUA 2NTYC 1QRAA 1BKDR 1G3MA 2IS1A 2AXPA 2J87A 2KB0A 4OQFA 3B6EA 5G53C 3HPRA 4FD2A 2ZAOA 2ZRNA 3TNFA 2TMKA 3SQWA 2C04A 1M1YE 3ZZUA 2C03A 2CHGA 4LJYA 3M0EA 4MUBA 5LBIA 5KSZA 1Q1QA 1HE1C 2XEXA 3MRSA 2HCBA 4NP6A 3VNUA 1RJ9A 4B3GA 1T3LA 3V4RA 1BMFD 4MKGA 3AF3A 4PAQA 2PZFA 5B58C 3CRW1 2H18A 1NL3A 1VCMA 1ZM7A 5G41A 3AVTA 1FOEB 2DY1A 3KJEA 3MJRA 5EZ6B 3GLFB 3SFVA 1HQCA 2KE5A 3AP1A 5E7MA 1KY3A 3CM0A 3MG9A 1NN5A 3K0FA 5K8LA 3AKCA 1N0UA 4Q9LA 3WNBA 1SHZA 4B71A 4BEBA 2VEDA 4EUNA 4DLSA 4BPBA 1E2DA 1P73A 2DFTA 2DB3A 2ZPTX 3LQRA 4U02A 4XD7A 3PUXA 1FQJA 1W4AA 2WKRA 4LZZA 1XCPA 1IOZA 3FDIA 3OE7D 3NHAA 1E9AA 1GIAA 4B3FX 2D3WA 5TARA 4YXWD 4Q4HA 5KPJA 1KSFX 1R5BA 4JT2A 5DHFA 2IS6A 3LXRA 1NBMA 2G83A 4MITA 1UAAA 4XJXA 3QNUA 3MGCA 4FMDB 5HE8A 3TUIC 1YR6A 3IIKA 3GMTA 3QKRA 2IEYA 1P60A 2BJWA 3FYHA 4LV6A 4F38A 3KXKA 1XBTA 1W7AA 2PT7A 4MYTA 3G5UA 1AN0A 3Q72A 4B44A 1VIAA 3FHTA 3Q5DA 2QE7D 1UBFA 4Q7JB 4TSFD 5TB5A 3TSOA 3R9WA 4RD3A 2ZE8A 2H1LA 4FMCF 2GILA 2BBOA 4D0GA 2VPPA 4IOKA 4JVLA 1HT2E 4A0FA 5JWOA 2XB4A 5FOSA 3W5IA 4AG6A 5H70A 2O5VA 1NMZA 5A0FA 3T1QA 5JRZA 4TLBA 3RSOA 3EXAA 2YV5A 2P65A 3H4MA 4GL2A 5KUTA 1Q1ZA 2ZUCA 4OHZA 3DVLA 1RRGA 5A5GA 1PLJA 4TQ9A 5UKDA 2IA5A 3SI7A 4ARZB 4C9BA 2EVWX 1FUKA 2P5TB 1IN4A 1LFDB 1E1RD 1CU1A 1XDBA 2FOLA 2EFGA 4PHFA 3UG6A 5DYIA 1NY6A 4CYMA 3QXHA 1BYUA 2ANCA 2IYLD 1A4RA 3CNNA 4OHXA 5F98A 2CBZA 3HU2A 3Q3JB 3WMGA 5EUQB 3SYNA 4B3BA 2J7KA 4LBYA 4QBGB 5JS8A 2L0XA 4QNMA 5SZJA 2F9MA 1YE8A 4LY6A 3L82B 4HZUA 5FFMA 4Q9JA 3OIUA 1IN8A 4XVRA 1G5RA 3TQCA 1P3JA 4A8JC 3R7WB 1N6RA 2PH1A 2J7PA 2FF7A 2ZSBA 1IXZA 3VMFA 1X1RA 2CCJA 4M0LA 5L3QB 1T3HA 2HCJB 1S1MA 2GAOA 4PQRA 1FZQA 5FTNA 4UXJA 3GJ3A 4KYIB 3R9IA 1Y3AA 2FFQA 3BGWA 3GLHA 1NN0A 2AK3A 2VHTA 1BOFA 4BFXA 1U0LA 2O8EA 2FNAA 2IX3A 3ZIAD 3IEVA 1WP9A 1SZPA 4MYHA 1T0HB 2JAQA 3CRQA 1E79A 1NRJB 1D5CA 2RH5A 2OFXA 2WZQA 2JLWA 2HT1A 2O8CA 1KI4A 3QF7A 4Q19A 3SJZA 3K8YA 4V0NA 1US8A 2H92A 2R6GA 3T1TA 3EZ2A 2QBYA 2W6JD 1KO7A 3U7HB 2QPOA 1R0ZA 1OH7A 2HDNB 2WSSA 5AUPB 1CJKC 4FXPA 1AS2A 3B85A 3N5CA 4HUQA 5HKKA 2D7DA 4V03A 2QMHA 1KAGA 1VDZA 5BN4A 5LD2B 2FSGA 1OH8A 1ZUNB 4GZMA 3EC1A 5KSOA 4AKGA 1YZTA 4TQAA 4KI0A 5FH9A 5JWHA 1E2LA 1E32A 4MYCA 2OZEA 1TL7C 4WVFA 4B2IA 3O47A 2GXSA 3I72A 3KKNA 4NCIA 1ZIPA 3AP3A 1NLYA 2YJTD 3ND9A 1PLLA 3W8NA 1BMFA 1W4CA 3GFTA 1UM8A 3WYAA 2K5UA 4P31A 4V02A 2AHOA 2VP5A 5DGXA 1VCOA 5EZ5A 5FOXA 3SE0A 5KOYA 4GOXA 3EASA 5FBVB 2IWRA 3KQUA 1E2PA 1ZNXA 4ZCLA 3OFND 2QI9C 3JZAA 2JASA 3GLGE 3C14C 1V43A 4JLMA 2FFHA 1GP2A 2ZYUX 4LCBA 4POAA 5KNBA 2IC5A 1Z8FA 1NKTA 3SQXA 5DH9A 2ZYVX 1LF0A 1VIYA 2GK7A 2FEMA 1GVNB 2KSQA 2P6UA 4ACAA 2PZGA 4PO1A 3NH9A 5EXXA 1E9CA 1W2HA 4YXWA 4HI0E 1OV4A 2NO6A 1F2UB 1R0XA 2GEDA 3GLGB 1NVVQ 3AKEA 2JA1A 1UKEA 2VL7A 4DSNA 5DNYB 1OB2A 3LV8A 4D25A 4S2EA 5SZKB 3QXXA 3I5YA 5FL3A 1NNEA 3NDBB 2CHVA 4OQXA 4QHTA 2VRWA 3CZPA 4YMWA 4E03A 4KFSA 1ZD1A 2ORIA 1FMJA 4E5UA 1RVDA 2Q9AA 2FPKA 4NYIR 3ZVMA 4C0JA 4Q9HA 4DB4A 2WBLC 2QAGC 5E7JA 1ZU4A 2NO1A 2QE7A 3QXCA 4TSFA 1KDRA 4WBSA 1QHSA 1Z0IA 1G3IA 1CR2A 1E9SA 4NZYA 4LPSA 4R2HA 3X1DA 1KDPA 3F8TA 4G01B 1E2JA 3BFKA 1P2TA 4DT1A 2C9CA 4B43A 1Q20A 5J4YA 5F9HA 2W58A 5KSPA 4I99A 4ESHA 4II7A 1JR3A 1XU4A 3BOSA 1MABB 2B21A 4NYIQ 4X8LA 3SS8A 1RRCA 4BLPA 1L4YA 1Z0AA 4HAWA 5AJYA 1FX0B 2IYZA 2NOAA 2W0MA 1G3QA 2CVFA 2ODEA 1LNZA 2X2EA 3IGFA 1OFHA 4GRAA 4LC0A 4A82A 1KIMA 1II8B 2WSMA 1YR9A 2ZUDA 1Z6YA 3TGPA 3CPHA 3BH6A 3HU3A 3IUYA 1E1RA 5C46F 2ZSFA 2R65A 5JJKA 2C8VA 1HY3A 3L0PA 2PZEA 3U7EB 1NI3A 1GRNA 4LHWA 1SVWA 5L8VA 1WBBA 2N46A 4JLVA 4E07A 2PEZA 4XIGS 2J0UB 2JLUA 2ZS7A 2G88A 2ZS8A 4M2LA 3G0HA 3DZDA 3H1TA 4WOPA 4PX9A 1TF2A 2ATXA 721PA 3ADBA 3QKSA 2A5YB 1AQUA 2QM7A 4LRWA 5CJPA 1Q0UA 4QBFA 4CEHA 2YYZA 1CJMA 3C8UA 4FWIB 4H1UA 4AK9A 4B3CA 4ERNA 1U2RA 2JGNA 2GEVA 1OFIA 1XZQA 2QRZA 4BZQA 1CR1A 2W6ID 3SBDA 3KQHA 3GJXC 1G18A 4MRRA 3H84A 1HTWA 4PC2A 3TUJC 1E69A 4A0GA 3EZ6A 4CF7A 1DAHA 2O0KA 1YHNA 4M9ZA 2OT3B 2ZRKA 4Q1AA 4Q01A 5AUOB 5FBRB 2X77A 3THOA 2OFWA 1LF5A 4Q00A 3MCAA 5EE3A 3NDPA 4PPGA 1TPZA 2CLSA 2QG6A 1NP6A 1G3UA 4KODA 2XITA 4JSTA 3CWZA 5L3RA 3T06B 3PJRA 3TAHA 2ZR7A 4LUCA 1TMKA 3LH5A 5HTKA 1YJ5A 2P6NA 3GFPA 3L8YA 4FCTA 3FFBA 2JLZA 1W0KD 4IDHA 2Y8EA 3M4YA 3DKVA 2I1VB 3N2IA 4PSVA 3FMOB 5HCNA 2PX3A 3EZFA 2QNRA 3QENA 1NF3A 1JXMA 4DIDA 3ASYA 5FUVA 4NYMR 4F4IA 5GJWC 1KHTA 2GCPA 5AWFC 1DVRA 2QROA 2IYQA 3D3QA 4B33A 5J4LA 1YZGA 3AGQA 1ZMXA 4MKIA 3GP8A 5AJZA 1RKBA 1TF5A 3A1TA 1LS6A 4LHVA 4YC7A 1S9DA 2JLXA 3K70B 4GNKA 3AEZA 3ONWA 2OV2A 3PQCA 2ZI4A 3CX6A 3Q85A 1N3BA 1T9HA 3L0IB 4HLCA 4DLWA 1WB9A 1ZIOA 4RCZA 1E4VA 4NE2A 1RIFA 4W5HA 1PUIA 4NYMQ 4M22A 1F2TA 4N0EA 5EXSA 5L3SA 3GLIA 4FCVA 1XD8A 4LWZA 4MYUA 5K8TA 5DI3A 4CEJA 2Z43A 2GXUA 2VO1A 2WPDD 3CW2A 1EGAA 4P32A 3IILA 1Q3TA 1RRPA 3B9QA 3CRRA 1Z47A 4CVNA 5FPHA 1IN6A 3OFNA 5JECA 2O0HA 2ZETA 3WP1B 4C3ZA 4W9MC 1XMSA 3TW8B 121PA 4IXMA 4LBVA 4LHXA 4QFMA 2MMGA 5CDFA 4BQSA 1Z6AA 1WMSA 2FA9A 1M74A 3EPLA 4RD6A 3SOPA 5KHOC 2O8FB 1VHTA 1IM2A 1Z5ZA 2ZRHA 3WXMA 5JEEA 3ADCA 2BMFA 2IYVA 1KI1A 3K1JA 1BS1A 4DEYA 1SXJE 2V8OA 4QGGA 5BYKA 1M2OB 2YNMA 5JSZA 2JJ1D 1Z6TA 4QJ4A 4IXNA 1T6NA 1OIWA 4P4SB 1XJ0A 3GFOA 3KKMA 1WXQA 1BH2A 2ZQ5A 1XTIA 2XXAA 5JEDA 1ZM4A 2YVUA 2BJVA 1QF9A 4UXHA 4TT3D 4DLRA 4HDCA 1JNYA 2BWJA 4A0RA 2RGBA 4JLAA 4OBEA 2VYFA 4GBMA 4V0ME 3CO5A 3OZXA 1W0JD 3MD0A 2RMKA 2RGCA 2E1RA 4UNSA 5DO9A 3T35A 2F43B 3I1FA 2ERXA 3LW7A 2UZIR 5JWRA 3SBEA 2EFEB 3GQBA 2ZRMA 4XWAA 2KBEA 5KDLA 3BS4A 4KSCA 4HAZA 3LVRE 2WKQA 2GHIA 5HE9A 3O8BA 4OJKA 6Q21A 3SC3A 5EJEA 3UK6A 2C9OA 4GZLA 3D31A 1DAEA 1ZAKA 1G17A 2GA8A 4Q1FA 2IYXA 2F1JA 1WE2A 5BXQC 3F3YA 1NY5A 2FPLA 4AY2A 1XTRA 4XD7D 1K6MA 2FFBA 3VX3A 4OKSA 1N6IA 1RFLA 1N0VC 3R20A 3U3OA 3CPEA 4AWXA 2C2HA 3TR0A 4A2PA 5FPTA 2WIAA 1NBMD 3P4XA 4ZO4A 1VG1A 1KZGB 2ZSEA 4HLQB 1U9IC 1T91A 4ZI3A 3S1AB 2EW1A 1ZBDA 2VP6A 2IYYA 1D2EA 4DHEA 2D62A 4DCVA 1Q12A 3IBYA 3K0CC 4LJ4A 4LJ9A 1JB1A 4DLVA 2O8BA 2ZJ5A 1Z07A 4JKIA 2GBLA 4URZR 3FB4A 4PR0A 3DOFA 2ZREA 3K9HA 3B1YA 4S35A 5FOWA 2IL1A 1Z0KA 2KWIA 2WJHA 1XTSA 1R5OA 4A2QA 1H8HA 1YRBA 2ZRJA 2AK2A 1RJ9B 4IEEA 2E9SA 1QG4A 1GRQA 1S96A 1KI7A 1ZCAA 4TL9A 3U6KA 3PUZA 5DN6D 2UKDA 4DSTA 2ZI5A 1ZRHA 2NQ2C 2IXGA 5CIQA 3SHFA 621PA 2IHBA 5H8WA 4CW7A 3O8RA 3THWA 3I32A 3M1IA 1AK2A 1XCMA 4BLTA 3CF0A 5FBLB 4A6PA 4NDZA 1N6NA 3K0FB 2WJYA 4B76A 1OFUX 2Q3MA 3IHWA 5FR2A 1T3SA 3MJHA 3P20A 4G5OA 2NGRA 1XD9A 3H2YA 3RS7A 1SVSA 3AVYA 4M1OA 4ZI2A 5ELXA 1A1VA 1W4BA 2OILA 1R7RA 4JLPA 5C4MA 4QGHA 3KQNA 3CIOA 2A9KA 1AQYA 1AZTA 3B7GA 4PHGA 4LX0A 1H8EA 4EJSC 1XTQA 1II0A 2GKSA 2OHFA 1F48A 2QL6A 4CRWB 3A4MA 4OI4A 1XEFA 1OXSC 1IN7A 3QKRB 5AK0A 1U8ZA 4ZDKA 2B8TA 4JBYA 4TTPA 5J40A 1JJ7A 4D4LA 1AIPA 1C4OA 2LKDA 1NSFA 3QPUA 4QJ5A 4GMDA 3SU8A 2VSFA 2X2FA 3KKPA 4PHTA 3ZS9A 1E9EA 2WVJA 1HURA 1IY1A 4LHZA 2J0VA 2YOGA 1U90A 2J0QA 2JJ8A 2IT1A 2PEYA 3IIMA 4L8GA 3LD9A 4WXRA 2HV8A 5SZIA 3E70C 1M7HA 4DLUA 2BBWA 1E2IA 1G20E 1SULA 2O52A 3GD7A 2FN4A 1U9IA 2QEQA 3K9GA 2CDNA 2F1HA 2FDCA 1KI9A 4DDWA 3K0CA 1E9RA 2OBNA 2WJJA 2A3RA 3FPAA 5C2JB 3W6PA 3ZDQA 3JVUA 1VMAA 3VHLB 2WSSD 5E3HA 2V1XA 3KFXA 2ZUBA 4Q7KA 5HKKD 3RC8A 1E94E 4I1VA 2Q9CA 2XJ9A 3BFXA 1EFRA 4IOJA 4JYBA 4M1SA 3IQWA 4LYJA 1E4YA 1P5ZB 1GL9B 3OESA 3IEUA 1KOFA 4TT3A 2GVDC 1KK2A 3VHXA 4URVR 3GLFE 4Z54A 4TTRA 3TMKA 2QUZA 4DSUA 1W0JA 2FFAA 5JZVA 3THYA 4L16A 1FQKA 2C95A 1FL9A 5EXPA 4E22A 5HZHA 3FKQA 2CK3D 3CNLA 4PZYA 3SYLA 2BC9A 1JR6A 2Q3HA 1Q57A 3QE0A 3RC3A 4HZUB 1JQLB 2OEPA 4PAOA 1NIJA 2OE2A 5KDDA 3K53A 1U8AA 4DJTA 4LK2A 2WJGA 1OXXK 1ESNA 1G1MA 1U94A 4LDJA 1G4AE 1J8YF 3FTQA 3SEAA 1D2MA 3QG1A 3NKVA 1GUAA 2V4ZA 3I61A 1T0JB 3UATA 3TQFA 5L3VA 2AD1A 1ONBA 2FH5B 3PENA 3GLHB 3AF1A 2I3BA 2BMDA 3HYTA 1U0HC 4IFBA 2O8EB 2YINC 3WYFA 2W2XA 4GDFA 3QF4A 3ZD6A 5F9FA 5C1BA 2D2FA 1MRSA 2H57A 2QQ0A 1FMLA 5D3MA 4EJSA 1T4GA 2ZRFA 2BBSA 1ZP6A 2O8CB 3AF0A 1FNNA 1US8B 2VH5R 2XSZA 4B6FA 3UPUA 4DLTA 3MWKA 2REXB 1G16A 3H86A 1QHHA 1Z29A 4QG7A 2IEZA 1ETUA 4NCKA 4HUQB 2GF9A 4QM6A 4ACBA 1W36D 3U3RA 1J7KA 1X6VA 3QKTA 3QUSA 3R9XA 1O3YA 3EZ9A 4IDOA 4N0DA 3H0KA 3PXGA 2JEOA 4KFTA 4HATA 3RLFA 1YU9A 3ZVLA 3BRWD 4PSKA 4C0SA 1DO2A 4OHYA 2CE2X 2HUPA 2EWWA 1RC8A 1CF4A 3QIAA 4D0NA 1PJRA 3ZZ0A 1P6XA 1LY1A 2AXNA 3C5HA 3L43A 2P3SA 4PPNA 1XTKA 1S2MA 1JR3D 1ZD9A 1AJEA 3C41J 2Q3FA 1NKSA 3UIEA 5DN6A 821PA 1JAHA 4JT4A 4B48A 1A5TA 2ZJOA 3EZ7A 3PUWA 4JZKA 4DVGA 3W6NA 4Q4AA 3V00A 4OQMA 2GWHA 4ZCMA 4JLNA 1DG3A 2W2TA 2J46A 2DFKB 4IDNA 5B30A 2R62A 5B64A 2ZS9A 4EPWA 2XOKA 3KKOA 2C96A 4O2RA 3BAFA 4XVUA 2MMCA 4FMCB 5KPDA 4M1YA 1KZ7B 1E1QA 1UPTA 3PEVA 2FJUA 2RGDA 3KJIA 3VFDA 4A1FA 2ZAMA 1TF7A 4EPTA 2RB4A 2C9YA 5E4FA 1D9XA 3SDZA 3U3MA 3ZZTA 1OW3B 2DHRA 3I3SR 1G41A 1CTQA 4QHSA 4D4KA 1XD2A 2IF0A 4R2IA 5FOVA 4CEIA 1KAOA 4A8JB 2ZJ2A 4G3XA 4DCTA 2FSHA 3X1ZA 1IONA 3GCGA 2ZRGA 1NN1A 3NBFA 2CL0X 1HE8B 3QSYA 2GZDA 1GOTA 3EPJA 4ZIRA 5K8UA 3KJHA 1VYUA 4KAXA 3GPLA 2R6DA 1JQJC 1NG1A 1R6BX 2W83A 3LWNA 4LJ7A 4IW3B 1Q22A 4EQ6A 2XNDD 2W2VA 3WP0A 1KMHA 2ASEA 1WF3A 1A7JA 1YQTA 4Q9KA 1W36C 4YONB 3OEED 5CB8A 4F4CA 3OEHA 3TRFA 1ESMA 1E2NA 1PLKA 4PPQA 3PFIA 4AURA 2QU8A 5IT5A 2EU8A 1I2DA 3HPQA 3EIQA 2WICA 4MGYR 3P32A 1K5GA 1Z0DA 2DCUA 2RHDA 4GOKA 3VR1A 2GJ8A 2EFHB 3B13B 4XSGA 3PIRA 2FG5A 4L4UA 4N1AA 3EARA 3U60B 4WZ6A 1W5TA 4HYYA 2G77B 1E6CA 2IUSA 4ZKEA 1KJWA 1NSTA 1CJVC 4RZ2A 4DKXA 1QVRA 3KZ1E 4OI1A 3SJCA 1SVMA 1KKLA 2D4HA 2RGNC 4BLOA 2OAQ1 3UXMA 1G8YA 1KKMA 1I4TD 3VU9A 4RFSA 5DE3A 5TDHA 4JBXA 3MWYW 1X3SA 4BFVA 1AGRA 1L7VC 1G8FA 4LV5B 3PR1A 4Q1EA 1WA5A 1VECA 4Q4JA 4C4PA 3LX5A 2CNWD 3EC2A 1E98A 4PC3A 3X2SA 5B57C 4UNRA 2ZXUA 1F60A 1OHHA 4UJ5A 2CK3A 3QKSB 4RD0A 2WHXA 4XWKA 4UXIA 2RHMA 2O8DB 4EAQA 4MDFA 3A4NA 2FMXA 1ZU5A 2J1LA 2QSYA 3LX8A 4R71A 1N6KA 2P0EA 4IVPA 2QSZA 4DXAA 3K0AB 5LDDC 1II9A 4HDQB 1GAJA 2ZI6A 2VA8A 4K46A 4TMXA 3RABA 2JATA 3E5HA 4YMSA 2F6RA 2FEOA 3BB4A 2QTVB 4MQBA 2AL7A 5ANRB 2HYIC 2F1RA 4A15A 3PEYA 1LTQA 1DS6A 1NVVR 3T12A 4FIDA 2VP9A 1N5IA 2X19A 3WNDA 2VTKA 1KJZA 1ZD8A 1TQ6A 2LKCA 4JMPA 5FPSA 2NZJA 5EXTA 2IYUA 3QXJA 2WWGA 4NCJA 2D2EA 4PO9A 1EFTA 2ODBA 4KVAA 4C0HA 4M1TA 2VSOA 2J0SA 1DAMA 2C78A 2ORVA 2D06A 2ZI3A 2A7QA 1MT0A 1N6HA 1S4QA 3LLUA 4AKHA 3LNCA 3TW4A 1Q3HA 4GPTA 3CNOA 1UFQA 2CMKA 3EWAA 3NH6A 3C7KA 5FUWA 2H8KA 2A30A 4IKEA 4JBWA 4PFSA 2QAGB 2NPIA 1XPRA 4TLEA 2ZTSA 3B1XA 1UF9A 5IRCD 1G5TA 4Q9IA 4ZDWA 3AF4A 3GLIE 2IYSA 5C4GB 1UADA 3T1VA 4LHYA 4IVQA 4KFRA 2CLCX 4AI6A 1R8QA 3RRYA 3OAAA 4G5QA 1HQYE 2JLRA 1KK1A 1XJCA 5KYKA 3QXSA 5FI0B 2F1IA 4GMXA 4BUJA 3THXA 4B74A 1F2TB 5L3SB 1G7CA 3Q7QA 1KDOA 3GLIB 2RGNA 4A92A 3ND8A 3KJGA 4IFEA 5F2EA 2G1JA 2ZRLA 2BDTA 4CEJB 3NEYA 2XZPA 3BXZA 1DTSA 1E0KA 3B1ZA 4TL6A 3SR0A 1E9FA 1VG9B 2XTZA 1KY2A 4LYFA 3VR3A 4C0BA 4TQUS 1GL6A 2FX3A 3CF6R 4FCWA 4Y0VA 4H9GA 4TMWA 2Z4SA 4OJQA 1LV7A 4U00A 5B2ZA 4C30A 4BWYA 3BD9A 4KVGA 2WWIA 4KU4A 1W46A 3RANA 3WRYC 4YMUA 1XZPA 4HZIA 1KSJA 4LBZA 2QPAA 2NIPA 1OIXA 5GJVC 2N42A 1GNQA 4BFSA 5DYGA 3TIFA 3WBJA 1YZLA 3NTUA 2RAPA 2VHJA 521PA 4Q47A 4HLUC 2DWQA 3CB4A 5JSZB 5M04A 1E2KA 2J5XA 2FU5C 2WAYA 3SZRA 3RRMA 2C77A 4RKEA 2QORA 4JS0A 4JYCA 1N6OA 2KBFA 4YDSA 2WOJA 5BYJA 2GZHA 4HEJA 3EPHA 2HEIA 2A5DA 5H68A 4LJAA 4GT1A 2LCFA 1HA3A 2XNDA 2XXAB 1LW7A 2IBMA 2C98A 1CIPA 1IY2A 3OEEA 4DZZA 5JCZA 2Q21A 1GITA 1ZC3A 3BJIC 1H8HD 2YZ2A 4ZKDA 3PEWA 3CPJB 4XTCS 1OLOA 4NL4H 4HAUA 5BN5A 3TVTA 3RDPA 5GJBA 4KITB 1NVXQ 1ZM9A 2OLJA 4EPRA 4C2UA 2ZRBA 1RPZA 5FTLA 2BOVA 3AVXA 1L2TA 3DMNA 3C16C 4KCGA 4QJ3A 4KO8A 4TZ6A 1I2MA 2IUUA 2HLDA 4RD2A 5G40A 2W00A 4IHQA 1SVOA 3TJZA 3DM9B 3RRZA 4ON9A 1Z3IX 2A5JA 3ECCA 2DWPA 3CZQA 1IAQA 3BERA 4ZPXA 2HYDA 4P4UA 4U7DA 3QBTA 2QTHA 1G5PA 1EXMA 4WZAE 4X8HA 4FINA 1D6JA 2X1VA 1T8TA 5FTMA 1E2QA 3B82A 5JI3E 2CNWA 4UNQA 3CR8A 3ZVRA 1EFCA 3F0TA 3AF2A 3CH4B 3I8SA 2BMEA 1XPOA 3HR7A 2FGJA 3CR7A 4JVNA 1XTJA 1H8ED 3TLXA 1Z6XA 3NBZC 1CRQA 1ZW6A 3AVWA 4BRWA 4NCNA 3CRMA 1MRNA 3B5JA 3CX8A 4QNRA 2JLVA 3IIJA 3K9LA 4G5SA 3BORA 1DAIA 4RFVA 1NG9A 2ZSAA 4ESVA 2A5FA 5F3WB 3I92A 3FKSA 1J8MF 4NYJQ 3T34A 2HF9A 3X1XA 4US2R 3PVSA 4I1SA 3U5ZB 2O8BB 1IJEA 1OB5A 1FNMA 1GSIA 1XEWY 3EIHA 1UDWA 3NVAA 4QXAA 3DZ8A 3IO3A 1TTTA 3VX4A 3WYGA 3MLEA 1G19A 2GBLC 1RE0A 3CKLA 2PMKA 3NWJA 3UMFA 3MWLA 4MH0R 2WMNB 4L9SA 4BLSA 1FX0A 2WWXA 2DFNA 2XB2A 1OKKA 4LJ6A 1W44A 5DHAA 2Z6VA 4UJ3A 1II8A 3UWOA 4HLUA 1JALA 3F5FA 1UEIA 1ZNWA 1TEVA 4O0MA 2HT6A 1TQ2A 5BQ5A 4BZXA 3KUCA 1N5LA 3E2IA 4MRSA 3THWB 2KJQA 4LYAA 2BIFA 4P4TA 3RHFA 1QZXA 4UNPA 3BB1A 1EFRD 4MDEA 1MV5A 3AB3A 3TR5A 3VNVA 1OSNA 2QP4A 4O25A 3QVVA 2V7QA 3BC1A 4NTZA 1MOZA 3MFYA 3N2EA 1XJQA 1JPNA 1L4UA 3NXSA 2V55B 2G3YA 3BBPA 4K81B 4FW9A 3KFVA 4Q7MB 1JEDA 2MSEB 1GRRA 1GNPA 2ZYWX 2BM0A 4Y0AA 2ERYA 2YKGA 1M7BA 2ZITA 4LPKA 5P21A 1FW6A 1E2MA 1F5NA 3UANA 3LFUA 3K9NA 1I4LD 1Q44A 1XMVA 4KBFA 2ZRAA 4DWJA 4A2WA 3TAUA 5TMPA 1KI3A 1OH5A 3RS2A 4I81A 1SXJC 5FUYA 4DLXA 1LVGA 4W7SA 2IXFA 5TV2A 5JHHB 5KNDA 3HWSA 4D2IA 3O8DA 2XJ4A 4TLCA 1N6LA 1ZC4A 221PA 5EP4A 4XSHA 4G0NA 1J2JA 3AKYA 1LS1A 2PX0A 2VP2A 2ZU6A 1JECA 3AVOA 1EESA 1UKZA 1M7GA 1NJFA 1VKJA 4M21A 1CR4A 2AR7A 1M6NA 1XF9A 3TK1A 3HYRA 5BN3A 4BGDA 4Z8YA 3FWYA 2BMJA 2BKEA 5E95A 2XSZD 4BFZA 1CBUA 2OM2A 3CUEF 1P9RA 4Q03A 5IHPA 4D6PA 2JLYA 1XXHA 5AUQA 3I5XA 1MO3A 4LJ5A 2WKPA 1CJUC 1W5SA 4XOIA 2BV3A 3BB3A 4KHZA 4OHVA 4PO8A 1DBSA 1XEXA 4DDTA 3DMDA 3DKPA 1CULC 5FI1B 1YZNA 4NPHA 1PUJA 2CE7A 4NU0A 3U6BA 1C9KA 4B35A 5HCIA 4OQNA 2PLFA 2WTUA 5CITA 5AR1A 3IPXA 2EYQA 2BM1A 4HSEA 4C0LA 1WDTA 2HJVA 2ZRCA 2I4IA 2VHUA 2DYKA 4N3NA 4EIWA 3IKJA 1KI6A 1T8UA 4TL7A 5J5CA 5JLJA 3W6OA 2AKYA 1ZM2A 3JZMA 4YDHB 1RYHA 4O2LA 5BWMA 5FR1A 3FHCB 4TLDA 2YHSA 1WRBA 4CDGA 3GJ0A 4U5XA 1YR7A 3HJNA 4JLJA 1VPLA 4PANA 4TMZA 1VCIA 4ASUD 5J4KA 2FWRA 2AD5A 1NBME 3ZH9B 2XOKD 4IEIA 1G64A 1S1CA 4NBSA 1G4UR 3DOEA 3KXIA 4R7ZA 1E1QD 3B9PA 3OIYA 2PLRA 4WZBE 3TVDA 5JI2E 1U8YA 2CVHA 4EFLA 3PUVA 2ZE5A 4BASA 1P72A 1IXRC 3EA0A 3QF4B 4C7OA 1HEIA 2OXCA 4Q4HB 2IS4A 5D3MB 4EJSB 3Q7PA 1F3OA 4HAYA 4DCUA 2WWWA 3DDCA 4L5BA 1OFTA 1P9NA 1OIVA 3A4LA 3VR4A 2DPXA 4QC2A 2VSXA 1OH6A 3EPKA 2GESA 4Q1CA 4XVQA 1QHHB 4F93B 5FL7A 1SXJA 3AH8A 3QPWA 1GILA 4MRPA 4UKDA 1IXSB 4PC7A 4GP7A 3U44A 5CB6A 4BRUA 1Q1EA 1Z2AA 3MMPA 4JLOA 3W3ZB 2R6AA 1FPMA 3DPUA 2CJWA 2G0TA 3OEHD 2RGAA 2F3TA 2F3RA 3FGNA 1G3RA 2FSFA 2GCOA 1RRFA 1KO4A 2R8RA 4GP6A 1VCNA 1IHUA 2F55A 4IOLA 1AA9A 4BFTA 3VKWA 1VYTA 3L0OA 5CK5A 1GL7A 1R8SA 1YRAA 1UKVY 4PQYA 1P7CA 4EPVA 4A36A 4V0MA 4HLDA 1H65A 1TNDA 5FUXA 1QHGA 3R8FA 1FUUA 2FZ4A 1RZ3A 3CLVA 2QM8A 4NMMA 4Q66C 2B7CA 3LRPA 3ZS8A 2V3CC 2UVQA 3NC0C 2XNSA 1A2KC 1VG8A 2ZR0A 1MO6A 5KU1A 3C5CA 5AJWA 4Q4AB 1S0UA 4R9UC 1I4DD 2ONJA 3A37A 4L9WA 2JLQA 2OXRA 1CR0A 3ICEA 3MWJA 2GZAA 3A58B 1Z83A 4M9XA 1OE0A 3B2EA 1PV4A 2P5SA 3SNHA 3IQXA 5G3YA 3AV0B 3KKQA 3SN6A 2JJ2D 4GOJA 4PC6A 4MUAA 4XTRA 1QDEA 1ZYUA 2CEAA 3TUZC 3FMIA 1OHHD 2H7VA 1DE0A 4J0QA 1XD2B 4CEIB 2PCJA 3IPYA 2ECKA 3GLHE 1G291 2QT1A 4URUR 1JXOA 1LB1B 4F7WA 4DCNA 3A1UA 4Q1DA 5EP3A 1MH1A 2PL3A 4HB3A 3IHLA 1Z06A 3MUFA 4ZIRB 5IF9A 2C5LA 3B78A 3TBKA 4DB2A 4WAUA 4EQ6B 2ODWA 4LBWA 2GEUA 4HB2A 4B73A 3PITA 1G21E 1KMHB 4RZUA 2WMOB 4FI3C 3T61A 3I4LA 3W34A 4B32A 4KSBA 2B6HA 2QMOA 4OI2A 3TKLA 1B23P 4IOMA 1GFIA 4P33A 2CCKA 4DRZA 2V1UA 3DM5A 2ORWA 1DADA 4FMDF 2IW3A 1OF1A 1T5LA 4L15A 4PZLA 2GJKA 2JIZD 4CT4B 4DBLC 2AFHE 2H17A 2J45A 3ZYCA 4MRVA 5FPYA 2BCGY 3RRNA 1U0JA 3A1SA 2QBYB 2ZVPX 1KK0A 3PV0A 4KXFB 1EG7A 1CXZA 2ZEJA 2R44A 2A5GA 2GETA 3MSXA 4I1UA 1GZSA 2R2AA 5E7IA 3ZJYA 2REBA 3WY9A 2W0SA 3VU9B 4RFSB 3V9PA 3V4FA 3U2QA 2G9NA 3AVQA 5CYOA 4B75A 2UZ3A 2ANBA 3KQLA 3VKHA 3B8HA 3KTAA 3D8BA 1TUEA 2J59A 4Q4JB 1AKYA 1SVLA 1X8LA 3LW8A 3CBQA 3OAAD 3ADKA 1CJTC 1AGPA 1D9ZA 3T15A 2QP9X 1P61B 4D82A 4QKQA 5JFGA 2G6BA 3AUYA 1IN5A 1OT3A 4OL0A 4F91B 3U4QA 4WW0A 1QHNA 5CJ2A 5KTYA 1EFUA 2I1QA 4ZDJA 2FPMA 1R4AA 1VHLA 4V0KA 1Q21A 4ASUA 2R9VA 5TVKA 4PTLA 2J41A 3B60A 3TH5A 1DPFA 3LQQA 2CLDX 3HR8A 1D8TA 3EWSA 1JAIA 3K0SA 4M53A 2OUKA 2ZR9A 4H1VA 2YWHA 4IDQA 4DC9A 2PCLA 2ZJYA 2NO0A 4EFNA 3FMPB 4JJZA 5FOTA 4TTQA 2XTNA 2P67A 4JL8A 1R5NA 4KYUA 5EP2A 3NG1A 3L2OB 3IDQA 3BIFA 1E2GA 4AYTA 1P9WA 4LOAA 3RYTC 2VBCA 2VF7A 4MKHA 1KO1A 1TQ4A 1JJVA 1HH4A 2ODNA 4QGAA 2VHCA 2ZRDA 2FGKA 4XH9B 1JR3E 1W36B 1XEWX 3CF2A 2NO9A 5J4HA 4CZ2A 3ZVNA 1TQDA 4Q02A 1GWNA 1E3MA 2QZ4A 4NHOA 1KO8A 3GJ4A 2WIBA 3VKGA 2YOFA 4WIAA 4AC9A 2VF8A 4M1WA 1HUQA 2OCBA 4DT1B 1CS4C 1G6OA 4D81A 3EX7C 1KMQA 1CRPA 5IK2D 5JHGB 3QVUA 5AUNB 5EE0A 1G7RA 4HB4A 3GLFA 1MKYA 2QAJA 4D80A 4URXR 3THXB 1JPJA 1NLFA 3AQ4A 4RCYA 1EWQA 4EPYA 3WMEA 2HF8A 5DIFA 4TWZA 3LVQE 2IYTA 1E0AA 2F7SA 2HLDD 1YZQA 4EKDA 3T1OA 3AVVA 1ZNZA 4JL6A 3RS4A 3DO6A 2NO7A 1VYVA 2WWHA 4RD4A 1NLZA 3A36A 3RWOA 1TEXA 4RSGA 3T5GA 3BE4A 4JKYA 4HAVA 5CM9C 4M8NE 1KO5A 2CCGA 3OHMA 4IVRA 2JJ2A 3CH5A 1L8QA 1COWA 3AGPA 3I62A 1J70A 5DSZA 2D74A 3BH0A 4V0OA 3KL4A 2JDIA 4M9QA 3ZGXA 3ICQB 3R8CA 3LXXA 1DG1G 2JCSA 2EFCB 2DBYA 2KI5A 2VHQA 3GEEA 1QG2A 3DHWC 4FN5A 3VR2A 1S3GA 3QPVA 4NCHA 4CEHB 1KDTA 5C18A 1TUIA 2REOA 3HDTA 5LD2C 3FKSD 2WWFA 2YWGA 4BFWA 5CLQA 1XX6A 2OLKA 2XX3A 3VQTA 3SJBA 2FE4A 1N0WA 3HP1A 4DSOA 5FPKA 2AKAB 2IYWA 4RVCA 5FTJA 4OK5A 5G3ZA 3W5JA 2Q0HA 1KNQA 2GJSA 4BFYA 4BLRA 4ABYA 1VTKA 1UBGA 3CX7A 3BFVA 3P4YA 2ZIAA 4MGZR
chains in the Genus database with same CATH superfamily
3BF7A 5FPQA 3QY0A 2OCYC 4UTZA 4B6RA 3JQFA 3PRJA 2FSUA 5BN5B 4UDOA 5WRFA 3TOSA 4COKA 4YLYA 4M6WB 4CKCA 1U81A 2UXCB 1R88A 3AX6A 1R0WA 3CUVA 4D3YA 4ECAA 3IO5A 1OZHA 3LBFA 4OKNA 4DCSA 1GGNA 2WIDA 2XTAA 5JYDA 3Q3CA 1P18A 4PW0A 2XCQA 2QJOA 1PT8A 3KEQA 4NH0A 4PC1A 4RHFA 4YP7A 4UM5A 2AF3C 3NWPA 1Z9BA 1Y0BA 2BLNA 3G9UA 4JL5A 1P5JA 5B1DA 3SJUA 4BGIA 3FTFA 4RV9A 1ST2A 4F92B 5COQA 2X9VA 1NW5A 5HUQA 3FFAA 1LZLA 4LQ4A 3V3TA 4LXYA 2RIPA 1IPHA 2YOHA 2QUHA 4HP8A 2ZIXB 4V24A 4LY3A 5HTOA 3KOYA 2B8WA 4KQFA 4TTSA 3MWFA 2UVPB 3JYQA 4A8JA 5DI9A 2EZ8A 4RH1A 1XRMA 4PFQA 3P5BA 4MA4A 1R9GA 4FFPA 1QHYA 4RL6A 5SICE 5LYJF 1BXGB 1DJOA 3OP1A 3BN3A 1SEPA 3UHJA 5L3QA 3WKCA 2WF5A 1C9EA 2HEGA 3DCJA 3DH0A 5EE5B 3WKBA 2ZJ0A 4Q5IA 4RLSA 2QN2A 1T5IA 1FFXA 4LMBA 421PA 3I6IA 5KDOA 1C8BA 4D42A 5JARA 4DIEA 3BQMB 2ODQA 4ZJPA 5FJIA 2M2IA 1W94A 2IXEA 2YJZA 5ITSA 4ZT5A 3SMVA 4YACA 1L5MA 1AK9A 1RRKA 3ACCA 3BWDD 3IAS6 2GBFA 4PQEA 5CB4B 5CBPA 5DGHA 4K7JA 4NBLA 5A4JA 2NZ8A 1B4DA 4P0QB 4Z7JA 1KEEA 1N3YA 5CX1A 2FRDA 3PGMA 3OE4A 2X1MA 4UQOA 2GVNA 1LLUA 4HX5A 1FW8A 1KYQA 3STTA 3LL7A 4Z1MD 4GVLA 5REQA 1DELA 3IMKA 1QRUA 4YAGA 2O0MA 4MUFA 1Y1LA 2GZRA 5DLPA 4JI5B 3C8MA 3OM9A 2DM6A 2FOXA 2XT0A 3QPAA 4MTLA 2X0JA 1BVYF 1SHKA 5IDVA 3QLUC 1DAFA 4H08A 5GJCA 4PHHA 5KOIA 5TMEA 5JZMA 2YXEA 3DL0A 3TLGA 1DKMA 1YVDA 2G8NA 4HY3A 4IRUB 3SXJA 5KVSA 4YNBA 4GI1A 3BWYA 1PX2A 1JBKA 2DWOA 4XIFA 3SK0A 1ABFA 2X6RA 3NKLA 4RD1A 2Y1EA 5D7BA 3M3PA 2PJRA 3NVMB 3K9WA 1JKFA 3QNWA 1BROA 2GARA 1W1WA 1SUAA 3CWQA 3LMKA 3HBAA 3LA6A 4ALMA 4JX8A 4V0LA 4DR3B 1JEQB 4PCLA 1KK3A 2DR3A 2ZLBA 3WL3A 4C14A 4AYXA 3KR9A 2UYHA 4IICA 4LTDA 2Y76A 1V35A 2VLIA 3PXDA 3EFOA 4JIMA 4B3MB 3OZGA 2Q62A 4CIDA 5B3JC 5JBNA 3IB6A 4QPPA 3RBVA 2HIAA 3BMNB 1VKRA 1W4RA 2PKWA 4X71A 5EPOA 2PBRA 4M9SA 1SN7A 3PJFA 2FVYA 2Z8ZA 3PPYA 1XQ6A 2GTPA 4LDAA 2O1EA 5IK2A 2VR1A 3ONNA 5F51A 3D6TB 3MQFA 2UYCA 3RUIA 1GDDA 1YRHA 1E77A 3TBHA 1I6WA 1Z5GA 3AVPA 1P2SA 3PF8A 4JUCA 1UWCA 3WLOA 5KJFA 5DLDA 3VVCA 4EG5A 5AOCA 3WKAA 4D4HA 1QO0D 4LKRA 3ZK8A 1NVMB 1X39A 2MHCA 2YDYA 4LI0A 2FUG1 2G76A 3AU8A 3RTGA 3K09C 3UGKA 3W90A 1I3MA 3RAPR 3ZIAA 1Q1GA 4JQYA 2X8AA 3D3JA 1XCGB 2V7BA 1FP7A 3Q6NA 2F9LA 2OHVA 3VU1A 5DXJA 4PX3A 3U1BA 5CXXA 4AO8A 2QR2A 3PHCA 4J16C 5DCWA 3JQBC 2O2HA 4XB2A 4ZYTA 2FSPA 5B55A 5DV9A 1VBFA 1FTNA 3RVDA 4KSYA 2J5QA 1RQ7A 4EG0A 4TYPA 3GUYA 5B6PA 4G9GA 5EP1A 1EG2A 3V80A 4PV7A 1QHXA 2DULA 5HW0A 1CQJB 3UHAA 4NKRA 1SCUA 3K9BA 4DV7B 2PKXA 1F7VA 2P75A 2WAXA 4FOTA 4UTNA 1Y4DE 2TECE 4C0AC 2ONKA 4NATA 4Q05A 4R54A 2WQZA 5K3DA 4J90A 1GXSB 3SC2A 3O90A 4M4SA 1VJDA 3FCSB 1QE3A 1Q19A 3EOZA 1E66A 1IFXA 4CKBA 2OP1A 3BREA 4MEAA 4REQA 1W6RA 2OG2A 3DLHA 1XXHB 3K2IA 1KZ4A 4O5OA 4QYIA 2I22A 4YA6A 1REQB 3PYXA 3ZXUB 5A4AA 1GCIA 3V7WA 2BGNA 3A3NA 2JFGA 1XEXB 4ARUA 2Y05A 2GFQA 2D7CA 3IR5A 4B3TB 1KYIA 1Z62A 1TE2A 1RHJA 4CF3A 4AUNA 3FN4A 3KVVA 4F3RA 1SRQA 2Z83A 1O77A 1ID1A 4OQDA 1XCBA 3U39A 2C9BA 1C14A 5JNLA 3QOFA 1HEYA 3FLAA 3IE0A 4Y1FA 3B3AA 3UV6A 8GPBA 1JFVA 2QSJA 2W6CX 4UHFA 4DIOA 2EEPA 1K5DA 2DTXA 3E1SA 3FPFA 3H4TA 4AB1A 2ZJ1A 4HB0A 2CJXA 5L6MB 5HYVA 3H3JA 4W5JA 1FTSA 1Z6GA 4OBWA 3O8QB 4GQAA 4I7EA 4JVMA 4K3UA 1OFVA 2WTBA 4MB0A 2BFDA 2HK9A 1AS3A 3PUYA 4IFTA 4OMCA 4PQFA 3U31A 3UB4A 4JLSA 4D96A 4ZVMA 4GSYA 4D9IA 2WM8A 1PQYA 1ECFA 1OYOA 3L4BA 4MV3A 3SZOA 3WGMA 3X1YA 4AMGA 2UYYA 2FFRA 1DOHA 1F6BA 2OSBA 1RE1A 3SFTA 1W49A 1N9GA 2PKYX 5IMBA 1FTYA 3OM1A 4X94A 4X85A 3OJLA 4MVJH 3AUJB 4X1YB 5AJXA 5DU2A 5SYMA 1L4NA 1M2FA 3V4OA 2JA2A 5ELMA 3GHHA 1JTVA 2ZIVB 3KZKA 4M1KA 3NCTA 2DQSA 3HKEB 1X7ZB 1YIAA 4NZZA 4UDXX 8OHMA 4M8IA 4WZZA 4ZZIA 1VBMA 1U3UA 2P11A 4X8OA 2Q9BA 2HPVA 4KQIA 2YQZA 1QRRA 3UG7A 1KSHA 3GFQA 1MJNA 2C20A 4HRXA 4K8OA 4FM9A 4ZO8A 3PE4A 4DJDC 4FCCA 4NULA 4Z51A 1DO0A 2QLJA 3N76A 4TV8A 1IK6A 4DA7A 4YX9A 4V38A 3EG9A 4YO7A 4CI9A 4RL4A 3TXXA 3WK8A 4BP8A 1CY1A 5EUMA 3BIOA 3NIBA 1G2QA 4G07A 1UBCA 1GNTA 1P33A 3OG9A 3WGJA 3N0TA 4QBKA 4EG6A 4CLOB 2I54A 3H1FA 2NAFA 5JFTA 1LNQA 4IJMA 1SBTA 1X7YB 4N12A 3X44A 4ZT2A 1ZOPA 3RKSA 4KWHA 4JVSB 3U44B 1VL1A 4H7FA 2QMQA 2DFLA 4FDLA 3ZHRA 1IXYA 2HO5A 1MOQA 3RNLA 2Q8NA 5JYEA 2OFOA 3ZJTA 3F6YA 3L92A 1Y6ZA 4WFJA 4Z1MA 1P62B 2FDRA 2D8AA 4WCFC 4RZXA 1XNRB 1JU3A 1GPAA 3LOPA 1T2DA 3T4PA 4DDVA 3F7NA 3EAGA 2QX4A 3L06A 1EFKA 2O3JA 3PG5A 3QBEA 4JXKA 4W4TA 1U0GA 4H1WA 3D4LA 2IPNA 1QDLB 1GKYA 3NATA 3AI1A 4H7PA 2A9JA 1SKYE 4Y9TA 1Z26A 2OKCA 1GSOA 1O97D 4JY7A 1P31A 1Z75A 4M7WA 3K72B 3MJCA 3OOWA 4B47A 4D4MA 4LA4A 1DKQA 3AP2A 2OV8A 5B7NA 4PX5A 4URYR 5L40A 1WUTA 4EGSA 2JGJA 3VKVA 1WCV1 1SH7A 3D6JA 5ALOA 3X2EA 4CQNA 4OQZA 2ZG6A 1KZYC 1OY1A 2R5NA 4Z4GA 4KBGA 2HA0A 1NNSA 1CZHA 2CL6X 3FVQA 2P35A 4Z8XA 1Y5RA 2RKOA 1MVLA 4HOYA 3RJMA 2CXXA 1LQTA 3CXRA 2X3YA 3KHUA 3OPYB 1DRVA 4K6HA 1LLCA 5CT9A 4IMPA 3IP3A 4NCBA 1JIIA 1RAEA 2NVBA 4N6OA 4A0QA 1R4NA 3N7AA 1IUPA 5BYBA 5GIOE 2DPMA 4G09A 4K26A 4B5LA 1U2GA 4AKIA 2EFDB 2BKUA 4IV0A 4EPXA 3TSWA 4BZPA 1H6CA 3THYA 3ASZA 2V6JA 3GEIA 4N3AA 5CK4A 4GI7A 3SIRA 4BTVA 3QBVA 1T9KA 3HVIA 3G0CA 5K0NA 1C1HA 3D2LA 4WOKA 4BVBA 1B26A 3NFYA 2UUPA 1RLMA 1HOXA 4L4RA 4MYSA 4N0PA 2HMVA 1VKHA 1RWKA 1GNLA 4D57A 3V55A 4BAZA 4YV1A 1L7DA 3U7GA 3ND7A 3EZYA 3CG4A 1ZR2A 4V2UA 1POXA 1N36B 3R3WA 3DLBA 4PQGA 5BNTA 1YK1A 1XZFA 1UEJA 2I80A 1Y8QA 1O58A 3OX1A 5FTKA 5HPYB 4WA7A 5LP1A 4Z3OA 1HDOA 2AX4A 2GJAA 2ORED 2VK1A 3OJXA 2IHKA 2P78A 2ZIFA 4QUIA 2NU7A 2CZGA 1WWKA 1QH1A 3OZDA 5AK6A 1IG0A 1R10A 2JVIA 4JITA 2FZLA 3PRHA 3LDAA 3PSHA 2AZMA 2TRSB 1AKEA 4X6XA 5K8IA 4F5ZA 2H5IA 5KOHA 2BYTA 3M2PA 4GW3A 1N2EA 4L5CA 2XV1A 4Q6BA 5LPNA 4F85A 1S8FA 3EULA 4RDIA 3TQTA 3H5RA 4X00A 1NE7A 1C41A 4PONA 4XGIA 2BE7A 5LQNA 2BGGA 2HF7A 3UJ7A 3EIEA 3JQAD 4BYGA 5KMGB 2YBEA 1V39A 2C9DA 1G8PA 3EXFB 3OIWA 3VJKA 1XFAA 4JI2B 4L9RA 4AG3A 1I13A 4OHOA 4BTLA 5KNCA 5SZHB 1VXOA 2DTEA 3R0XA 4EJ6A 4L85A 2C4WA 2ZWVA 5AVZA 1NJ2A 3AHDA 2PTGA 5IM4F 5ADHA 3EY4A 1BE8A 3Q5EA 3RFVA 3CRVA 4XUDA 1G63A 3F9IA 5CB0A 1ZCBA 2PD4A 4OREX 2BI8A 4LXTA 1WOMA 4MV7A 2GNOA 3GMIA 2CNOA 3DZJA 3IJRA 5JPCA 2H3EA 4IP0A 1IBRA 2WFAA 3BILA 4KV7A 3OU2A 3DEKA 4QOJA 5FJJA 2XCTB 5FX2A 2B8JA 5C32A 3FYCA 1CQIA 2Y6UA 4B6GA 2QT9A 4LHEA 4UHEA 2CLHB 1V4VA 4ZDIA 5L51A 2QQEA 4N65A 1KBOA 3VC2A 1EGVB 1T2VA 2AOWA 3LY5A 1XYVA 1ELOA 2IE8A 1RI2A 2A9RA 2NNWB 4Z1OA 5I8PA 4MR8A 1WXFA 3A1VA 2OBMA 2VJPA 2EG5A 4MI9A 3SM9A 2Y68A 1K3TA 3BGDA 3QG5A 3UC5A 4IQFA 5C5CA 1U7UA 2M6RA 2V4MA 1KE1A 3RS0A 1JFFB 3A6PC 3C7CB 3LHDA 1WZ2A 3GJ7A 3V4LA 2QLLA 2WJWA 4EHIA 5ICFA 3F71A 3S1AA 4YIHA 5K51A 3KQOA 3UJAA 2G36A 3RUAA 3BH7A 1RMQA 3KWMA 4YVFA 3QEJA 4FHFA 3REFA 3L7DA 3MD9A 5FULA 3FOWA 4HNSA 1JG4A 1GUFA 3U13A 3L7NA 4QJBA 2NTYC 3F2IA 3USES 1T3TA 2QB5A 5CP8A 1QRAA 1BKDR 1G3MA 4ZVPA 1ZK3A 2IS1A 5EJ6A 1D1QA 4F12A 2J87A 2J5RA 2DU8A 3B6EA 4JDUA 4Q37A 1RWPA 3IUMA 5LCXA 2OYCA 1IK4A 2TMKA 1MAWA 3CLSC 3G8AA 2W2LA 3B38A 2C04A 2Y1WA 3P94A 1M1YE 2CXSA 2UYQA 2Z3ZA 4FKZA 2C03A 4JJGA 3R3HA 1KRWA 4MUBA 1H2AS 1K66A 3OFSA 1Q1QA 1HE1C 4OXQA 3H65A 4BIIA 4CFSA 2ZTLA 5G1OA 3NYWA 4AUKA 5DBEX 5FIUA 3DBIA 5ITZA 1PQUA 3CUYA 5EWMA 3PGKA 1GYQA 1ESZA 1VCMA 1XZBA 2CWWA 2PDAA 1MLDA 4R0VA 1UPAA 1TEHA 3R76A 1QAMA 2JAHA 4YHHB 3O9ZA 3X3HA 2DX7A 3AP1A 3CM0A 2XNHA 3K0FA 1G5FA 1ADBA 4G4IA 4ZCSA 1H6DA 1SHZA 1H2WA 2VEDA 4L3OA 4DLSA 2BCEA 3VOTA 1IHPA 3Q0IA 4B83A 2EIHA 2ZPTX 5EXEA 5F1YA 4AY5A 2GPWA 4CTMA 4QVIA 4GGPA 1R37A 2O07A 3JX9A 4YUWA 3CKKA 1TZCA 1SU7A 1YMUA 2WKRA 1KH3A 4RNDB 3K6SB 3IRVA 1NVGA 3OE7D 4UAGA 2IPAB 2QNBA 2EX0A 2D3WA 3SOZA 2AN1A 2LTAA 2ZDGA 3FVTA 1YFJA 2E4UA 2FEAA 3GEDA 3VOAA 1KSFX 4X5OA 2NXNA 1MCZA 1NBMA 3KPJA 4BL5A 4XJXA 1N5MA 4YUYA 4ISBA 4CV0A 3V7YA 4FGZA 4F11A 3QHPA 4J0HA 3U3XA 5FV4A 1WLYA 3EISA 3TUIC 1FSFA 4BLVA 3O0DA 1QOQB 4OU5A 1IZ9A 3LPDA 9LDBA 4KACA 1CR6A 5HILA 3NUZA 1WXXA 3UK0A 1UZMA 2JHPA 4PIVA 4ZVKA 2AJDA 3G5UA 5FYQA 1OAKA 5KJEA 3WLTA 5CA0B 1LPAB 2ICAA 3GT3A 1C2YA 1VIAA 2MOKA 3I2HA 2RKWA 2QE7D 1Q0SA 3PQ4A 1Y1TA 4I4TF 4N8DA 3FPGA 3CNQS 3GPBA 4RD3A 2ZE8A 1VHQA 2H1LA 3MHTA 2GILA 4JEMA 4GKAA 2CHUA 4JVLA 4A0FA 2ZVJA 5JWOA 5FOSA 3W5IA 4AG6A 5H70A 2O5VA 1NMZA 5A0FA 1KF0A 4TLBA 3RSOA 1QU3A 1RBZA 1WXDA 3OPYI 1MG5A 5AVWA 2P65A 2QJRA 1KS9A 1WCIB 4DJAA 2HQOA 5EIOA 5KKNB 5KUTA 1BDMA 1Q1ZA 4TVBA 4INAA 1XJ5A 3C98A 1LFAA 3CTPA 1EINA 1RRGA 3DVLA 5B53A 3S68A 4DV3B 1DSSG 4TQ9A 2YV2A 4FDAA 3SI7A 4ARAA 3EVAA 3KVOA 1U0RA 3W1WA 1FUKA 2IQIA 2C00A 5EIBC 4CUKA 5T4BA 1Z7BA 3WA6A 3HY4A 3D7NA 4DV6B 2XVAA 2VRCD 1NYQA 2ILTA 3G9ZA 3O93A 4P3NA 4C76A 1J39A 1U3TA 3JQAA 2XVZA 5DYIA 4CYMA 5JUWA 4KC0A 2YHIB 1VSQA 3L8CA 3LNTA 3QWIA 3I04M 5C8YB 1VE1A 2IYLD 4JWKA 1VLJA 1D2GA 2HMWA 2VYCA 2CBZA 4I3HA 2E7ZA 1JDBC 2DUMA 3D4OA 3FWPA 4BGEA 4N48A 2NTEA 2GM3A 5BO5A 3ONFA 3L5OA 5A05A 2J7KA 4LBYA 5BNIA 2HHLA 4M1ZA 1FIUA 5KAPA 2B1JA 2LR0A 2Q0QA 1U7TA 3JYLA 3L82B 6NULA 1Z74A 1JG1A 2BLLA 3OIUA 2GHQA 4Q9JA 1G5RA 3TQCA 1BHJA 1EX9A 1G8AA 1P3JA 3S7TA 3ZV7A 4EVIA 5KYUA 3F5QA 2BR4A 3PT5A 1WKVA 1U3DA 2ZSBA 1IXZA 4KLRA 5DT9A 2ZYAA 1T3HA 4R1MA 2O0LA 2EF1A 3DEZA 4H18A 1XIVA 2QHXA 4NC9A 4QUJA 3ZWAA 4F45A 4UXJA 5SY9A 4UQLA 3H0CA 5I8ZA 1XQWA 4ZEXA 5AK5A 3R9IA 3CN7A 1PGJA 1Y1PA 4FR5A 1R5JA 1N8TA 5L4LA 1U3GA 1XZHA 4II2A 4EKNB 4LY0A 1XV5A 2JLAA 2P6PA 3UTDA 4BFXA 4EUEA 1U0LA 2P7HA 4XOUA 2O8EA 5E4TA 1ZITA 4L76A 2ZWIA 3H83A 1T0HB 2RI0A 4FBGA 2XYVA 2OFFA 3S1LA 1LVUA 3WHPA 3ZTWA 1MC1A 1RLTA 4XJTA 5BQFA 3RNOA 3T3OA 4B7XA 1JHAA 5C8DA 2WZQA 5K1ZA 2F8MA 1KJJA 5K0FA 1VRWA 3Q9UA 3QF7A 4ZPJA 2EKZA 3K8YA 3PVZA 3VI4B 4HH4A 5F7ZA 4DXHA 5HIKA 4LRXA 1KH1A 3T9FA 1HG0A 2W6JD 1HFWA 1SUPA 2HA4A 3FNRA 1YDGA 4JMLA 3IEXA 3MBIA 5AUPB 1OH7A 2WHQA 1KP9A 1NUAA 2QAIA 1UXJA 2Z3WA 3B85A 3IQDB 4HUQA 4P22A 4AJIA 4AZVA 1KAGA 2WWTA 2FSGA 1ZUNB 2Z9DA 4QGSA 4WERA 1A9ZA 4UHHA 4TQAA 3T7TA 5GZ6A 4N3CA 3U4CA 4AXXA 2Y92A 2AFHA 3PKIA 4OB6A 1E32A 4MYCA 3EJWA 4M98A 5SYNA 3JQRA 3BK1A 1S2DA 2D1RA 1JLHA 4O8CA 2A94A 4WVFA 3O47A 3KUKA 4DLBA 2E55A 2FPIA 3AP3A 2H1FA 3D9QX 4FQ8A 4RCVA 5T41A 3ND9A 1XVUA 3NMUF 1HETA 1D4AA 4MUKA 4RACA 4CKEB 1SKMA 2GT1A 1VPTA 1GQSA 2R97A 3AIOA 4GOMD 3ICOA 2FETA 1RNLA 3Q4GA 2NVUA 4J2HA 4OHPA 4LFCB 3VJMA 2Q5QA 2H7CA 3NV9A 1JG2A 3IDFA 4WWHA 4Z9BA 5TS3A 4BNLA 1DRJA 3HKCB 3W06A 1CVIA 3DMTC 3S2EA 1V11A 2JKZA 1BWSA 2O2SA 1E2PA 4KIFA 1Z8HA 2XCLA 1MB2A 2QI9C 3K1AA 2JASA 1IBCA 3W04A 3C14C 3DYIA 2G8LA 4JLMA 3DC7A 3EN0A 1YS6A 2CWDA 1GP2A 1YHZA 2ZYUX 4OM7A 2Z6AA 1QQ7A 1HDIA 2OZLA 4ZAFA 1IJBA 2IC5A 2HWXA 3IUNA 1YJXA 1SY7A 3D3WB 5DH9A 2PV0A 3GNSA 3N8IA 1ZGHA 2R8ZA 1IDN1 2KSQA 3EEYA 4LIPD 2PZGA 1IM5A 2ID9A 4G0OA 3M83A 2IUYA 3WRVA 5BVGB 5DYNA 1W2HA 4L6IA 3MIIA 3ENKA 1W59A 1Y5MA 2G72A 4IHAA 5M2QA 3CLRC 4QUGA 5J5VA 2JNWA 1X42A 3H3XA 4PYIA 4GKJB 3AKEA 4XGQA 2VL7A 2W90A 4Z9AA 2R8BA 3N8GA 1LTKA 3LV8A 3OZUA 4MRMB 1UODA 2XBMA 4UTXA 2YV1A 4CQLB 4AZ3A 3I5YA 2ENUA 1ECBA 2WHPB 4CTNA 4OHKA 3EE6A 3G17A 1NNEA 4DEVA 1DT3A 2DUNA 1MEJA 2G70A 4ZVLA 3F96A 4OG2A 5HTKA 4JP2A 3ET4A 3KVYA 4NYIR 4CIYA 2PXAA 4NDAA 4Q9HA 2ZIGA 3HQ4O 1H5QA 2YJ5A 1SHUX 2QE7A 4ZQGA 3CE6A 4NZYA 1G3IA 1CR2A 3ZVKA 1T10A 4DLAA 4R2HA 1YFZA 1KDPA 2I3DA 1W87A 1XKLA 2RSLA 1TZKA 1N1GA 3BFKA 4YJ3A 4R69A 3F90A 2C9CA 4F9FA 4YUAA 3ESRA 3QU4A 4EABA 3A9UA 4O4HB 2W58A 3F5MA 2FEWB 1XL0A 1DKLA 1P1JA 2FEKA 5LLTA 4EO4A 5KTNA 1MIOA 4X8LA 5U9CA 2PL5A 1H1TA 3GEGA 4HAWA 3J80A 5AJYA 1FX0B 3QX3A 2NOAA 1JDUA 1G3QA 2RHWA 2X2EA 1UMKA 4M0UA 2WG2A 3MXTA 4P5DA 1KIMA 1R16A 2WSMA 3MTJA 3IAHA 2ZUDA 2WM2A 4DAOA 1ORIA 2ISCA 2R1VB 2O06A 3H1AA 3T9DA 3TEMA 5EJ9A 2GYYA 3TGPA 2C4MA 1U5CA 4NNOA 4R6WA 2ZSFA 2R65A 5JJKA 4BQRA 3SZGA 2WU3A 1SC1A 2I4MA 1D4OA 1V1RA 4ZGWA 1VBNA 1TKCA 2NTVA 1DJNA 1WBBA 5JCJA 2FW7A 1HEUA 1ULHA 2J0UB 2NUBA 2C3MA 5THKA 4FOPA 1WEKA 5ISMA 2H9YA 2FSSA 2G88A 3DE7X 4PYQA 1EUDA 4L0MA 4M2LA 3ERCA 3CUKA 3DZDA 3WG9A 2D1FA 4XI9A 1B0PA 5ILOA 1O4WA 3BA1A 1HKUA 2GBGA 4IG9A 1ZY2A 4YO8A 2PMBA 3O4JA 5DULA 5FLEX 3EOBI 2X8WA 2YV3A 2VVTA 5HS6A 5KTTA 4S05A 2MT9A 1A5BB 1NBAA 4HYQA 3R7BA 4AK9A 3TLEA 4A0SA 4KH0A 3V2UA 3LBAA 1J49A 2NQTA 2GEVA 2WHYA 4L4ZA 4XWWA 3CCBA 2QRZA 4KQWA 3C3EA 3WBBA 2W7TA 3SBDA 1Z4KA 3AEXA 3CR3C 3ILVA 4AW9A 5IU6A 3Q1LA 3WGHA 5KYNA 4RBNA 3H84A 4JC8A 4AO6A 5AVJA 3TUJC 1E69A 4WKPA 4JUAA 5DT2A 1SOMA 4YXFA 2HJWA 5AW7A 1RMTA 4Q1AA 1DMRA 3ONDA 4I50A 2HZ7A 4RK4A 2FP3A 3LYAA 5HNKA 3DVSX 2FPPB 3MCAA 4P84A 2PN1A 3SXPA 1P8AA 3A70A 4BJ5A 4RE5A 4E5NA 5M34A 1RCUA 4LCEA 2IE0A 1SUDA 5D51S 1SM4A 2NU8A 4ZVUA 1TVMA 4FEGA 2VRNA 3PDIA 4LSWA 1U5BB 3CWZA 3EIUA 5L3RA 3SHQA 1FLAA 2ZR7A 3AI3A 4PYLA 4JXZA 1ISHA 1TMKA 1A04A 2PPVA 1YJ5A 1M1NA 4QT4A 3N7TA 3ILXA 4O4JB 1KIAA 2HADA 2CJFA 1NZJA 4A03A 5AVOA 2WFLB 5HCNA 3FMOB 2QTRA 2QNRA 5ADWA 3F1KA 3A2LA 1JXMA 3L0BA 4DIDA 3D1LA 1P4HA 2Y3IA 1KEVA 4DYHA 3TNDA 4ER3A 4ARBA 3AUSA 3OU6A 4YECA 3TQOA 1U9JA 3FH0A 5AO9A 4J0CA 2IYQA 4FYMA 3T0FA 3ZDYB 3AGQA 2FG7C 3IS3A 3NETA 3CFYA 5DSTA 5ERYA 5HGXA 3FHJA 5IXYA 3F6CA 3C7DB 1LS6A 5JMPA 5HRAA 4DR2B 2JLXA 2PUHA 3K70B 3AEZA 2BH9A 3Q85A 4YCSA 2BRUC 1ZCJA 4OGFA 1WB9A 3L0IB 1ZIOA 4XB1A 3X1KA 1YHYA 3B6IA 5DX8A 1I10A 3GV0A 4Y2XA 3DZHA 4C4OA 1LD3A 4QEDA 4HDSB 4M22A 4N0EA 3L4KA 1DRWA 2I9KA 2FN9A 3WK4A 1PFUA 3SKXA 2B3DA 4MYUA 3ZQKA 1XQXA 5DI3A 3ROFA 1JR4A 2Z43A 2GXUA 2OO5A 1XZJA 3ORRA 5IAEA 3KAJA 1EGAA 1U6KA 3LY7A 4L7QA 1RRPA 1PV2A 4CVNA 3LUPA 5JECA 1KFCB 3BGSA 3KT6A 4C3ZA 1Z45A 4XCVA 5KWIA 4ZXFA 4KXXA 4Y1RA 4IXMA 1JSXA 4LBVA 2P7IA 3A9WA 1A7KA 1AC5A 5EWJB 5CDFA 4BRZA 2UYGA 3S28A 4EB8A 1DAPA 3D0OA 4IIGA 4HVLA 1AF4A 3GZTB 4KXQA 3EPLA 1NJ6A 4NBRA 5KHOC 4K2HA 2BKXA 2QR5A 3PD1A 5LMUB 2O8FB 2WG1A 1IM2A 2NADA 2ZRHA 3WXMA 1RMYA 5J59A 3O3MB 4BV8A 4RQUA 2QLMA 3GH1A 1VSVA 1XZAA 4ZYWA 5JEEA 5K0GA 3N5KA 4LGVA 5E4JA 2J3DA 2BMFA 2RHHA 3L9XA 4QFBA 3E7FA 1NF9A 3DD5A 4DEYA 2V8OA 1R0RE 4XLTA 3LYUA 1ZGBA 5BYKA 5JSZA 2JJ1D 4G24A 2W5UA 2X13A 1VHJA 4C7MA 2PYIA 2QRVA 4YCDA 3ADDA 2YHBA 5HK8A 1CFZA 1UWKA 3CPSA 3LKBA 4OSEA 5DWQA 3UJ3X 1CDDA 3T3MB 4ZHQA 2VJMB 5DBOA 1XJ0A 5C52B 2V65A 3LZ6A 3EF1A 2W2MA 2PGIA 4LXQA 1RADA 3AUKA 3KKMA 4QAQA 3Q88A 4ZU6X 4OHUA 3PU6A 1XTIA 1M8GA 1ZM4A 2ZZKA 5BMVF 1QQBA 3ESDA 1KY4A 3UMYA 4TT3D 3CLKA 3ZQ4A 1B8UA 4H0CA 3ZXIA 1JNYA 4B40A 1CF4A 4KYVA 1LSJA 4A0RA 2RGBA 1YQ9A 4DIMA 2XE7A 2R7AA 4MARA 1W0JD 4V0ME 3M1AA 1YBFA 3MD0A 4LXIA 4DQVA 2DHDA 4UNSA 3T35A 3D8SA 1XRQA 4YJDA 2F43B 3QPCA 1SG9A 3I1FA 1LSOA 3LW7A 3FNBA 3EH1A 3BMQA 2UZIR 3P2OA 3TS1A 4BKOA 4B4KA 8ADHA 1J24A 5AW0A 1NG9A 4XWAA 4LJKA 3V9AA 1L7BA 3GLQA 4HGPA 3SXUB 4F4HA 1SQFA 1CDOA 5DXAA 4KRYA 2GHIA 2IITA 4OJKA 6Q21A 3H9GA 3CLTD 2P6MA 3D31A 4OUDB 1ZAKA 3UWMA 5BPHA 4Q1FA 2QTZA 3AI2A 4TGLA 3HI6A 5FWDA 1OXMA 1RAGA 4OUKX 1Z39A 5BXQC 4AY2A 3ZE9A 4XD7D 3IB3A 2DBRA 4KDFA 1MVOA 1YDHA 1D2RA 2JIPA 2GRUA 1D6MA 3AFGA 1N6IA 4OKSA 4PN7A 4UTPA 2ST1A 1JG7A 4YDQA 4TKMA 5CH8A 3VR5H 1Z5VA 4AWXA 3PE3A 4A2PA 2YN4A 3ZHZA 3EXHB 2JI7A 4DJFC 1MOSA 1CT9A 3N2GA 3HCEA 1KZGB 1PR0A 2ZSEA 4J76A 4ZTBA 4HLQB 1U9IC 3QEAZ 4UATA 1VPWA 1L5FA 2XCIA 5FD8A 2VP6A 3DONA 1EE2A 4FILA 4CMGA 3C1UA 4GMHA 1PNQA 1YA6A 3EDMA 4DRXA 2PWAA 3IDZA 3OLVA 3PNVA 4J3FA 4LJ4A 3LYHA 4LJ9A 2G17A 4NEGA 2QRMA 1D8AA 3PX7A 2WNHA 1PL7A 1TT5A 4KXYA 4ZT3A 2O8BA 4LRTB 2BSXA 1RWXA 4JKIA 2R3SA 4KZKA 4BEWA 3RB8A 3FB4A 3FZQA 3HUUA 1VJ5A 4UEJA 5JW6A 4ZO7A 1MB4A 4KOEC 2A35A 2V0GA 4FWBA 3M34A 4O63O 2KWIA 3PDJA 1XTSA 1Z0ZA 4P80A 4A2QA 3FDXA 1EYZA 5IAKA 1H2EA 2GAIA 4IEEA 4ZQHA 1QG4A 3EEOA 1M34A 1XL1A 1KI7A 3R3YA 1ZCAA 3G23A 4ATNA 4AROA 3U6KA 5CT8A 2XDQB 3OICA 2GERA 2UKDA 1JHPA 1NYTA 5DN6D 3T3NA 2A33A 3H9CA 3SQOA 4E5KA 2VPWA 3PTAA 1R9JA 2IHBA 3IT0A 1VL2A 3O8RA 3GBVA 1BC5A 5JH7F 1NBHA 2QTCA 3I32A 1AK2A 4BLTA 4ZVNA 1XK6A 1W9MA 5FBLB 4A6PA 2YXBA 1FJXA 5KOJB 3RK1A 2ODPA 4QUAA 5EKDA 1OFUX 2Q3MA 3QU5A 5ICEA 4HMQA 1WHSB 3QU2A 3ZBQA 3VZPA 2Z2JA 2CZCA 3P20A 3IV6A 5EJ5A 3O74A 3QFHA 4ZVVA 5C37A 4Z4IA 2JAOA 3H2YA 3AVYA 1I6KA 2R7KA 2J9FB 4ZI2A 2C9MA 3KJZA 3D2CA 2CLLB 4MWBA 4U7PB 4ZO9A 5AK3A 3K1ZA 3LDGA 3PX2A 5LP6C 2JGKA 1JHYA 3GRPA 3SF8B 4BU1A 1T9BA 4WOCA 4KAFA 4AF7A 1IBKB 4DR4B 4JUIA 1MUUA 4FBMA 4WN3A 1KL7A 2I4OA 2IPXA 1CNFA 2OPBA 4MVJI 4EJSC 5JCOC 3GARA 2OMKA 5CT5A 3VAZA 4QTYA 2GKSA 1F6DA 3FPSA 4W1PA 1Z25A 4OI4A 1ZCFA 5ALTA 5FWYA 1DBVO 1U8ZA 1RIIA 2X9QA 3E5MA 2B8TA 3FBGA 2Q1XA 3OZCA 4KLCA 4ENRA 4ZDKA 4WLFA 5J40A 4ZTUB 5ARBA 1GADO 2PWZA 4N6NA 5HJ2A 3SU8A 3KKPA 1BAPA 1E1KA 1E9EA 4AZSA 3PNPA 3GVXA 5KYTA 3F49S 3PD0A 5J63A 1D2CA 1HURA 3EQ6A 2VWGA 2OV6A 1J0DA 1DG9A 4NIMA 2J0QA 1U90A 3QVKA 2QTTA 2ZKLA 2JFQA 2DFVA 2FWMX 3JWEA 3LD9A 4IY1A 4O4IA 2BFPA 2EKLA 4ZVQA 4YJFB 1M7HA 3L5KA 2BBWA 1E2IA 1XRNA 1G20E 1SULA 2BDEA 2O52A 3DPIA 2QEQA 3OOEA 4KTTE 4X1KA 1X1DA 5AHXA 5JS2A 2V58A 3K9GA 5F77A 3ODGA 4IMIB 4P3XA 1P6QA 4XASA 4EI8A 4D8WA 2CFIA 1J7JA 3D64A 3WK9A 1JZTA 3K0CA 2WJJA 5IYZB 2CJYA 4MVXA 5C2JB 3W6PA 1O7JA 3VHLB 1VMAA 5AHKA 6PFKA 3GLTA 3E3MA 3HYSA 5HBRA 2WSSD 1DTWA 2V1XA 1OI2A 2DF8A 1PWYE 2ZUBA 3PX3A 3U80A 1WXGA 3I3OA 4OQQA 3HP7A 1L7PA 3S6JA 2Q9CA 1K9SA 5G0SA 1NPTO 1TYZA 2JGIA 2P4HX 4L8LA 4LRUA 1V9SA 1FY2A 1BS9A 3OESA 1DLIA 4TKUB 4DV2B 4TT3A 4UHCA 2I8LA 4FKMA 3UFXA 4IGEA 3GLFE 4E51A 4Z54A 3N8HA 3OWXA 3TMKA 2QUZA 1W0JA 2FFAA 2P2GA 3K94A 4L16A 1FQKA 4LVOA 5HZHA 2B1RA 4J7UA 3S3TA 1MB9A 2AC4A 4PZYA 2JARA 3TIGA 1Q57A 3IHKA 3VNSA 3OU7A 2OK7A 3GNLA 4JQSA 1GZ4A 1UIRA 3AWIA 2EOAA 1X15A 1UWLA 2I03A 1DC4A 2FUNB 2IYFA 2ZYDA 1U8AA 5FHRA 4BWGA 3H3FA 4CL0A 5J2TF 1ESNA 1G1MA 5D5HA 1QFYA 1S4MA 1G4AE 2R1TA 5AXAA 3KO8A 1D2MA 1JRLA 3HBFA 5C1DA 4W7IA 4JASB 3NKVA 2V4ZA 1KDYA 5TT0A 1EI9A 2PKQO 1T0JB 4GL4A 4OOEA 3HI4A 3R9KA 3T9CA 5L3VA 1BDHA 2AD1A 1ONBA 2FH5B 3GLHB 1U8TA 1ZK2A 2C3UA 2YL2A 2I3BA 2VDUE 3AF1A 3N7UA 4EITA 4IFBA 2CY0A 1WL8A 5HM8A 3FF4A 1AKUA 4IJ5A 4MO2A 4RUKA 3WYFA 5AHRA 3I76A 3IOEA 4YCBA 4ZQCB 4GC9A 4HNQA 4D1YA 3I2YX 4GDFA 3BGOS 4KQEA 4FQ7A 3IIIA 3JTEA 3SYMA 1DC7A 2D2FA 5C1BA 2V7GA 3ZGZA 1SD5A 1TKBA 2EIXA 2HWYA 4F6CA 3UOAB 4HQOA 2BBSA 2WG0A 1ZP6A 2ZWOA 4QLBA 4FFNA 1I1OA 1JKIA 1X80A 3DT6A 4WESA 2YX1A 4YDRA