1DS6A

Crystal structure of a rac-rhogdi complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
181
structure length
181
Chain Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 2
publication title The Rac-RhoGDI complex and the structural basis for the regulation of Rho proteins by RhoGDI.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 63
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2000-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ds6A00
3RYTC 3LVRE 1FX0A 1YZLA 4QFMA 3U3RA 1D2NA 2REBA 5JJLA 4DHEA 2OHFA 1E2QA 4LJ8A 3WNBA 4BRUA 1R0ZA 4URWR 1KZ7B 2RGXA 2QI9C 4WIAA 4JSYA 2IYSA 5CM8B 3OFNA 2DYKA 2GRJA 2YNMA 5ANRB 3DMNA 5EXTA 1RC8A 2C04A 5BWMA 1UEIA 4AWXA 5KU1A 1A82A 1S0UA 3U60B 1FMLA 4AKHA 1KK3A 5E3HA 3EX7C 5L3RA 1CJUC 3IILA 1P4SA 3BD9A 4V0KA 5DLQC 3SYKA 4DLRA 1DAIA 1Q57A 1H65A 4JLOA 4PC7A 4AD8A 5FI1B 3RNLA 1IM2A 2EWVA 2PCJA 4CEHB 1WQ1R 3QSYA 2XGJA 2HLDA 3AV0B 1KDRA 2PJZA 2CLCX 2PEZA 3QY0A 1A1VA 3C4JA 1CBUA 3D7MA 3OESA 1N6IA 2IWHA 3I8XA 4HI0E 5F98A 3HR8A 3G5UA 5BW8A 3N70A 1E2NA 1Y63A 1Q22A 2IYXA 3H86A 1RYHA 3EPKA 5JRJA 2RGNC 4URZR 3NBXX 2A5GA 2RMKA 1YRBA 3IEVA 4A6PA 4DDVA 2WSMA 1E2MA 3GJ7A 1XEXA 2NTYC 2O8CB 1E2GA 3TSWA 4ITRC 5DI9A 2Q3FA 4IDNA 4IXMA 1R7RA 5C18A 4IDPA 2IBMA 2QMHA 4KFTA 4S35A 1DS6A 2W2TA 2GVDC 2GJ8A 4Q48A 5FUVA 1W36C 3F3YA 1PV4A 1GRRA 3D3QA 1KMQA 4N3NA 5LBIA 3KDSE 3LDAA 2HJGA 3RANA 1IBRA 1CRQA 5CB8A 1WB9A 4URYR 3RRYA 3QOFA 4JKIA 1K6MA 4PHTA 3WYGA 2P3SA 4TL7A 1KZGB 3BXZA 3KB2A 3U6KA 4YONB 4AKEA 2P0EA 1Z0AA 1FUKA 1ZD1A 5G40A 1JPJA 3MG9A 2IX3A 2CK3D 4F38A 1VYUA 3QENA 1Z0JA 4HZUB 4ABYA 1P2VA 2VTKA 5KSZA 2ZETA 2PT5A 3KQHA 1GL6A 3C15C 1UKEA 1YZUA 4IKEA 1GFIA 1XCPA 2FN4A 1VG8A 2QZ4A 3IGFA 2VF8A 4FD2A 3THXB 4XOIA 1DARA 3DPUA 4MGZR 3GPLA 4TT3A 5EE3A 3RHFA 4EQ6A 2FFQA 1G3UA 4HB4A 2C8VA 1UDWA 3B1VA 4PR0A 5KHOC 1Q3TA 2RCNA 4EJSB 3GJ6A 4OQFA 4GP6A 4LPSA 4QM6A 2ZYVX 2F1JA 4LY6A 5GJVC 4BFTA 1W0KA 4P4TA 2VH5R 3LWNA 4XVRA 3GLFB 1G7SA 2ZRNA 3AKDA 1M7BA 1N5IA 3R8FA 3QNUA 4XWKA 3B9PA 4P4UA 3W9YA 2BEJA 2FH5B 3AP2A 3K0FA 4PC3A 3OIYA 4XWAA 1Q44A 3P26A 2BJWA 3EW9A 1XBTA 3CUEF 4OJKA 4LJ6A 1SULA 5E7MA 3AF1A 2OFOA 2J1LA 3P27A 4UNQA 4B3BA 1T0HB 5FL3A 3Q72A 2RGAA 4JKYA 1LF0A 3CWZA 4CEIB 1O87A 2L0XA 2AWNA 4CT5A 1XCGB 2RGCA 2P6RA 4OL0A 4BECA 4ZDJA 3N2IA 2BMJA 2NOAA 3A36A 1JEEA 2QP3A 1N6RA 4O2LA 4CEJA 4KBGA 1E9RA 4BASA 2GJ9A 2GTPA 2A3RA 3P4XA 5H1YA 2ZRKA 1GKIA 1W2HA 2OBNA 5JEEA 1U81A 2J0UB 1G4UR 5J40A 4JJZA 4AK9A 2IHBA 2IS1A 4BZQA 1Z28A 3QI2A 2Z6VA 3CPJB 3AM1A 1I4TD 1U99A 5DSZA 3A58B 1IJEA 1GL7A 5KPJA 5B58C 3KTAB 4UXJA 1KKLA 3Q7QA 2GETA 5HZHA 3DZDA 5TMPA 3AGPA 2GCOA 3AH8A 4MUBA 3QG1A 4NYJQ 3BK7A 2IF2A 4G5QA 1MABB 3BBPA 3AKCA 3VKWA 1BMFD 4TSFD 2C99A 3RAPR 2QBYA 4JL8A 2RGDA 3TLXA 5CK4A 3D6TB 1KSJA 3SC3A 3EPHA 4NYJR 4M8NE 1XZPA 1EWRA 2WIBA 4QBIA 4Q9IA 2JATA 3M4YA 4DLVA 4ZDIA 1WF3A 4QM7A 2B6HA 4LYAA 4IFBA 2ZRCA 4M9XA 2R6GA 5EP2A 1Q0UA 2BBOA 3DKVA 3LBIA 3ZVRA 4A36A 3LY5A 1KK2A 3A1SA 1PUIA 4YC7A 3UIEA 4I4LA 3ZS8A 1KO8A 5AJYA 4UNPA 4Q7LA 1IN6A 4II7A 1FNMA 4M1SA 3K70D 1CR4A 4QJ3A 1O3YA 4HDOB 4QOSA 4IDQA 1B23P 4OHWA 1W4RA 1KI1A 4QJ4A 3SBDA 3S1AA 2TMKA 4DCSA 1NLZA 1HE8B 2QENA 4IOLA 5FTJA 2AX4A 3SEAA 2JLYA 3KXIA 2F3TA 3SQXA 4GMDA 2VP5A 4HB0A 2ODBA 2R44A 3WNDA 4FMCF 1QVAA 1NY6A 1JNYA 3AKYA 4P4SB 2YV5A 3QXXA 4MKGA 4LHXA 4H1VA 1TQ2A 5TV2A 3CIOA 1X3SA 4O3MA 5F3WB 3VR1A 1JR3A 2CJWA 3J81k 2GCPA 1WBDA 4KODA 5FBLB 2ZSAA 3KXLA 1COWD 5J4LA 3ETLA 3JVUA 4ZI2A 3GEEA 2XXAA 1UKVY 4PQRA 2WICA 2J0QA 3SE0A 1YZKA 2GEDA 3VTKA 4U7DA 1GILA 1EG7A 1E0AA 3EAQA 2XOKD 2ZRIA 3TVTA 4HAUA 3M0EA 2NO7A 3FE2A 2WWWA 1T6NA 4YMUA 5K8UA 3FHCB 1E1QD 4KYUA 1SHKA 2XSZA 5KUTA 1SKQA 1C1YA 4OQLA 3QKRA 3NDBB 5DN6A 1PJRA 3U7HB 2ZVQX 1GWNA 4OBEA 1E1RA 2QTFA 1MO5A 2R65A 4DWJA 4QRHA 3WMGA 1NKSA 3CLVA 3ZD7A 2MSEB 2C5LA 2CL7X 3AVXA 1F48A 2J45A 4EJSC 3Q3JB 3QF4B 2RB4A 4BLSA 4IJMA 4Q47A 3SQWA 1ELOA 2PEYA 5FH9A 3K70B 4QGFA 4HSEA 3KQNA 2UZIR 1E0SA 1TAGA 4PANA 1X8JA 1GTVA 1YVDA 1P73A 3RVBA 1AS2A 4OK6A 3SJZA 2NO1A 3ZGXA 3BB4A 1SHZA 1NG1A 3RLFA 3FHOA 4W9MC 2DFKB 1AM4D 3GJ5A 1E96A 3OEED 3W8RA 5CDFE 5SZIA 2FG5A 4EPRA 2NZ8A 1P72A 2WIAA 1DAHA 1KJZA 3VU9A 4EPYA 3AF3A 2Q9BA 2YOFA 4B2IA 1CU1A 1UDXA 4UJ5A 1GAJA 4B71A 2WAYA 4UJ3A 4ERNA 3OFND 2GILA 2ZU0C 1XJCA 4DT1B 2HF9A 5KTYA 1F3OA 1X6VA 2ODWA 3MSXA 1G19A 3X2SA 2ODNA 2E87A 4TYPA 3ZYCA 5FBWB 3TIFA 1GM5A 3T1QA 1NN0A 2CCKA 3Q7PA 4LBVA 5JHGB 3WMFA 3ZLJA 3ICQB 1NLFA 1RVDA 2F1HA 3FB4A 3DKPA 3W6NA 2HLDD 1EFRA 3A1UA 1MO3A 3U3JA 1ONBA 4QL3A 1QHHA 2GDJA 5AUNB 2QG6A 3V9PA 3EARA 2IS6A 3QPWA 3OIVA 1ZNZA 2Z43A 2ZVPX 4LV5B 4DCNA 3ZQJA 3THWB 4R7ZA 3AKEA 2G88A 1XXHA 1Z47A 4WVFA 2FJUA 1KMHB 2BOVA 2C9YA 4MYUA 4C0KA 4HZIA 3PR1A 3BOSA 1W5TA 2A5JA 2ZI6A 4BLTA 3HU2A 4JT4A 2G1JA 3KUDA 3NWJA 5EXPA 3KQUA 2IUSA 2HJVA 4TL8A 2BWJA 5JS7A 4LBWA 1D2EA 2OM2A 2FPKA 4F91B 1Q21A 3VR3A 1P9RA 4UQOA 4ESHA 1HTWA 4Z54A 5F2EA 2CK3A 1E2DA 1R0YA 3T34A 1VCIA 2CNWA 4ZDWA 2FSIA 4JBXA 4YLGA 2Y8EA 1XD2B 3VAAA 1W4AA 3NEYA 4D26A 4C2TA 1QHNA 4LX0A 2FSHA 1US8A 4QC2A 5KDLA 1OW3B 1GRNA 5GADl 1AZTA 1X1SA 1S1CA 2IUTA 2QL6A 5AWFC 5FTMA 4C0BA 3RRMA 1IAQA 1FX0B 5FPKA 2GCNA 1U0LA 3Q9LA 4ZIRA 4MA4A 3N2EA 2ZRHA 4GL2A 1IONA 3IHLA 4FMDF 1E9CA 1Z6YA 2GAAA 2H8KA 2AL7A 2J46A 3QUSA 4TYQA 4B3XA 4I1UA 4MUAA 4LJ4A 1E2LA 2JJ8A 2EYUA 2OCYC 5HCNA 1R5OA 4Q4HA 3RRZA 1OH7A 1D2MA 4RKEA 1R2QA 1AKYA 1Z29A 2ORVA 4P0TA 5DHAA 2QORA 3TJZA 4EFNA 1YR6A 3OF5A 1KI2A 5H70A 4N0DA 3SU8A 3TNFA 1TTTA 1OH5A 4K81B 1DG1G 4W5WA 5L3QA 3U7FB 4DSTA 1IXSB 4TT3D 1BS1A 2VRWA 4A2QA 2C9OA 1G41A 4NBSA 1U9IA 2V3CC 3TW4A 3AF0A 4PTLA 2QM7A 4YDHB 1QF9A 1RRCA 1KOFA 2CE2X 2BM0A 1E79A 1L7VC 1Z0DA 4P3YA 4OQNA 2D7DA 4TN1A 2GZHA 4JLAA 2JLWA 2ZREA 4DVGA 1KI7A 3DO6A 1TF7A 1XEXB 3QXHA 1FZQA 1I2MA 4JLVA 4I99A 4NP6A 3C14C 3KKPA 3SI7A 5HKKA 1XJQA 4CZ2A 2WTUA 3U44A 4EPTA 1WBBA 4W5HA 1YZTA 2IYLD 3NBFA 5SZJA 2ZE5A 2UZ3A 3TRFA 2GF9A 4U00A 5FOUA 4A9AA 3GFPA 1ESMA 1WE2A 2ZI7A 1KHTA 3ICEA 4PQYA 5JECA 4DBLC 3NKVA 4F4IA 1AZSC 3R9XA 1C9KA 3LBHA 5F9HA 3CF0A 2BCGY 3SYNA 4JVLA 4NYIQ 5KO2A 1FQJA 3VNVA 2VL7A 1DO0A 2G9NA 2D4HA 1KGDA 1Z8FA 2JJ2A 2YWGA 4FCVA 2DR3A 2GESA 1XEWX 4M4SA 5DISB 3K70C 4C3ZA 3SS8A 1FFHA 3HJNA 4WZBE 4URVR 2JLVA 4Q66C 4OKSA 2VQSA 1CJTC 3GJ3A 3LRPA 3PEUA 4DCVA 2Q21A 1F2TA 1S4QA 5C46F 1W1WA 3CNOA 2H92A 5BN3A 1KIMA 4US0R 3KUCA 1RZ3A 2RKOA 3B6EA 1TL7C 2SHKA 2VP2A 1YR7A 3I4LA 4WZ6A 1G16A 4ZCMA 1VG1A 4GRAA 1MRSA 1ZNXA 3K1JA 3ZS9A 2ZR7A 3ASZA 4EQ6B 6Q21A 3ZVLA 4G3XA 5FBVB 1CLUA 3HYRA 4TL9A 1RE0A 3LX5A 5DGXA 4A82A 1MT0A 4HYYA 1II8A 5DNYB 4M53A 4M1OA 2GXQA 3GFTA 4QHYA 1F5NA 5C4GB 4HAZA 2B8TA 2J87A 4DLWA 4YXWA 3MMPA 3MWKA 3RC8A 4KFRA 4Y0VA 1E9BA 3NBYC 3U3MA 2XJ9A 1Y3AA 4B34A 4DB2A 3UMRA 2J0SA 1P5ZB 3K0FB 3L8YA 3THYB 4B3GA 2DFTA 3AVVA 2IYZA 1EFUA 2RAPA 3CW2A 3K0CA 3PVSA 4DLSA 4PZLA 1CP2A 3BGWA 1NN5A 4TMXA 4NCHA 3PEWA 1GVNB 1TQ4A 1D5CA 1ZD9A 2FOLA 3OZXA 1SQ5A 1AQYA 3BAFA 1L4YA 3K9GA 3I61A 4DLXA 1R0WA 1ZNWA 2EQBA 4MGIR 5FL7A 4RCYA 2HYIC 2RGEA 2GXUA 3I92A 4F92B 1KK0A 1ODFA 2WM9B 2X2FA 4LV6A 2J7PA 3CO5A 5IK2A 4BFUA 1J8MF 2ZS7A 4XD7A 4CEJB 1OFIA 2CDNA 1NJFA 4FMCB 1E4VA 3MLEA 4OYHA 4B3DA 1LV7A 2ZE7A 1VHTA 5JWRA 5JFGA 3IDQA 2OCAA 2VP9A 5JRZA 1G3MA 4DDTA 4H1UA 1SZPA 1UBEA 4DLZA 1N6NA 2ZI3A 1DG3A 1ZP6A 2WZQA 4KITB 1JJVA 2ZUDA 1ZCAA 3DZ8A 3EC1A 1QZXA 3K9HA 3QKSA 4GPTA 2GHIA 4Q7MB 2VP6A 1CR0A 3NC1C 5DH9A 5EP1A 4EPXA 4XTRA 1UJ2A 2D7CA 2BHRA 4MDFA 1QG2A 3LFUA 2GCOB 5JJIA 2QMEA 3QEOA 1JJ7A 4NYMQ 1UADA 2XSZD 1JECA 1T5LA 3B85A 4OHXA 3W90A 2QBYB 2G77B 2IXFA 2ORIA 4DSOA 5DIFA 1MR3F 3NXSA 4NYMR 1E1RD 4DXAA 2Q9CA 2AK3A 3K8YA 2C9CA 3KZ1E 1SXJE 5ELXA 4L15A 3KFVA 3BRWD 2GZAA 3W5IA 3F8TA 2KSQA 2JASA 4FMBB 3QXCA 2C78A 1G1MA 2I3BA 1II9A 3ADKA 3L0IB 4IDHA 4Q7JB 2EYQA 2F7SA 5BYKA 4RJLA 3PEYA 3TR0A 4DCUA 2BBTA 5J4HA 1J8YF 1GIAA 4TZ6A 1OKKA 3P4YA 1Q1BA 4Q1FA 5IRCD 4K8OA 2RGBA 2HF8A 1ZC4A 5B2ZA 1XEFA 2HCJB 5JZVA 1OXVA 1W2GA 3GLIE 5J47A 1VMAA 3QXSA 3W3AA 1ESNA 2FV8A 4L8GA 3S1AB 2PLRA 4F4JA 3EPLA 1FQKA 4WXRA 1LNZA 4XSHA 1M6NA 2ONJA 1ZW6A 1U94A 4D4MA 3C7KA 4KFUA 4PAOA 1JQLB 4LI0A 4Q03A 221PA 2BJVA 4FCTA 1OLOA 2CLSA 2BEKA 2YKGA 1XX6A 4I81A 2P2LA 4LCBA 5FOTA 5BN5A 3BH0A 4GDFA 1IJFA 4M1WA 2CJWB 2FFAA 5FPSA 4PFSA 4BFWA 2WV9A 5AK0A 5IHPA 1LB1B 2XXAB 3BFXA 5LDDC 5L3VA 1XMVA 2OAQ1 3HU1A 1P2SA 4LOAA 2CCGA 1J7KA 1G20E 1WMSA 2IT1A 4K46A 3HYTA 4NMMA 1T9HA 3QIAA 4DDUA 1UAAA 3NBZC 1IN4A 2VHUA 5AJZA 3UKDA 2YWFA 1EESA 4LYHA 1NBMA 1EFRD 2V7QA 1OSNA 3CPHA 3QKRB 5CLLA 1GRQA 2IS2A 4LDJA 2EU8A 3FFAA 3EASA 5DE3A 3TAHA 1JI0A 3HWSA 4IOKA 1U0HC 3I73A 2KB0A 3B1YA 3MGCA 4XIGS 1JAIA 2BMEA 2C03A 3CRMA 3VX4A 1NF3A 2PX0A 3SFVA 4BRWA 1HUQA 3BWDD 1E9DA 2REOA 1P2UA 1WCV1 3NTUA 1M74A 2F1RA 4AYWA 2W6JD 2WWHA 2WPDA 5HZKA 5LPNA 5JS8A 1IOZA 4KAXA 3TH5A 1R8SA 4E03A 3CBQA 1UBFA 3T12A 4ZI3A 3GQBA 4TQUS 5JJKA 3C16C 3LNCA 3FVQA 4JL6A 2CNWD 4AIIA 3LXXA 3KJIA 3QE0A 1VG9B 5KOYA 3AGQA 2ZJBA 1ZRHA 2IYRA 1JAHA 4LJ7A 4Q18A 2JIZA 1CRPA 1A4RA 3SN6A 4QGAA 1GITA 2GK6A 4M1YA 3SYLA 3T06B 1FW6A 1W47A 2OBLA 2YYZA 1E2JA 1VHLA 1FNNA 4B3CA 2AD1A 4FIDA 3OAAA 3VU9B 4ACBA 4I1OA 3QKUA 4IRUB 2J59A 2WVJA 3ND9A 2IUUA 2QEQA 4FMDB 5E95A 2XTNA 1KSGA 1BIFA 2ZRFA 1YE8A 2IHYA 3NC0C 3DL0A 1YJ5A 4D0LB 4GOKA 2IF0A 4P31A 1DAFA 4UKDA 2GK7A 1Z6XA 4TMTA 1KAGA 2P6UA 2WJIA 3E2IA 4HAYA 3CM0A 4PHGA 4JLNA 4MYCA 4A0FA 1QHSA 2ZSDA 1BOFA 2ANBA 4IVQA 1FTNA 1NMYA 2P5TB 2C77A 2QMOA 2WMOB 4IEIA 3SHWA 4CRWB 5GJWC 2I1QA 4DLTA 1SVIA 1D9ZA 1S9HA 3UWOA 4XSGA 1QHHB 2WJHA 3QQ5A 3PIRA 1E79D 4Q1EA 2WBLC 1RJ9A 4BPBA 4DUGA 5DI3A 1LW7A 1X8KA 3NHAA 1BH2A 1ZM7A 3WYFA 4AG5A 1XXHB 3ZH9B 3EWSA 4Z51A 1Z07A 3CONA 1RPZA 2P5SA 721PA 2W0MA 3P32A 4TMVA 3IKJA 3IO3A 4B2PA 1V43A 1YRAA 5JCZA 4US1R 1K5DA 1NLYA 5CDFA 2FEOA 4E07A 5HKKD 1X1RA 3Q5EA 1II0A 2B7CA 1QHIA 5JBQA 3TSOA 5DO9A 3ADDA 2Q0HA 4NCJA 3ADBA 3KQKA 3ZD6A 4AKIA 1G8HA 4KXFB 5J5CA 3OHMA 1IHUA 5TVKA 3VKHA 1HE1C 4JSTA 2A5FA 1ZYUA 3B82A 4M21A 3UWKA 1OFHA 2FGKA 4LJYA 4TQAA 2OLKA 4DRZA 1QHYA 2XTZA 1US8B 4HUQA 4Q00A 3G0HA 4Q1AA 2ONKA 5BXQC 2JJ2D 1QG4A 4ZIRB 2PZFA 3QJYA 4YMVA 4FN5A 1C4OA 4Y0AA 4G5RA 2ZI9A 3LW7A 4JJKA 2D2EA 4RZ3A 4YMSA 3EZ7A 4JVMA 3L82B 4MGKR 4J0QA 4M22A 2FX3A 2HXYA 1JBKA 3CNNA 2W2XA 4Q4HB 4RVCA 4MRVA 1P62B 1DAMA 5JSZA 1EK0A 3BJIC 3GJ4A 5JI3E 4O25A 2JA1A 1EX7A 3OIWA 3A4LA 4NU0A 2JEOA 3AUXA 3RS0A 5L3QB 2BKUA 3KKMA 4DCTA 1G7RA 1P9NA 1VECA 3W6OA 2NO9A 1KO7A 2JLSA 2QMUA 3Q85A 4QBGB 4C7OA 4A2WA 5A4JA 4BFVA 1OIVA 1M1YE 1SVKA 1NBME 1G5TA 1DVRA 4QXAA 4D80A 3V4RA 4OJQA 2IEZA 4NE2A 3C41J 2O0JA 4YQFA 4JLBA 4QNRA 3MFYA 3HPQA 4A4DA 2JLRA 3VKGA 3WMEA 3B1ZA 4URXR 2DFNA 4B47A 4YXWD 2XB2A 2KE5A 3BS4A 3RABA 4W5JA 4M9ZA 2FNAA 1UF9A 2HT6A 4LHWA 1ZM3A 1HQYE 1N5JA 1TUEA 3LD9A 3LV8A 1JALA 5EE0A 1L4UA 2EVWX 2ZQ5A 3FMPB 3U3KA 3O8CA 3U44B 3RSOA 4EUNA 1IN7A 4HLUA 2FE4A 2NPIA 4E09A 1OIXA 4W7SA 1L2TA 4TLEA 2NO6A 5D3MA 1XD8A 821PA 5FL7D 1W44A 3FTQA 4B44A 3I5YA 1FUUA 5TB5A 4C0LA 2YOGA 2PZEA 3AVQA 2BMDA 1LY1A 2J7PD 2H18A 4TYNA 1ZM4A 5GJCA 2XNDA 2YC2C 3SOPA 5IK2D 4IOMA 4YMWA 4XD7D 1JXMA 2OZEA 4KHZA 4Q02A 2NZJA 4PPNA 2O0HA 4A8JA 3EZ9A 3DOEA 3EZ6A 4C0HA 3VHLB 4PPQA 1MH1A 3PENA 4Q19A 2P67A 1F2TB 1TF5A 2YVUA 4WW0A 2R9VA 3Q8XB 2ZXUA 1E9FA 1ZINA 3GCGA 2PLFA 4M0LA 4Z8XA 2O8EA 1ZJ6A 1G18A 4MDEA 4P33A 1Z0FA 4X8HA 4QBHA 4L5BA 2X1VA 1NMXA 2QN6A 4IVRA 2D74A 2CVFA 4LC1A 3TQFA 3LQRA 1PLJA 5GVSA 1W48A 4EPWA 2VIIA 1RKBA 2ERYA 1OT3A 4S2EA 1E2EA 1T3HA 5J4VA 2ERXA 1II8B 3OIUA 4IVPA 4ZKEA 1MOZA 1R5BA 2X19A 4RKFA 1KI9A 2JJ1A 2MMGA 3U7EB 2FMXA 4NZYA 1IQPA 4TYYA 1CXZA 1U8YA 1G6OA 1SKYE 2ZANA 2YJTD 1G3QA 3GLGE 2FWRA 2A30A 3DM9B 4KSCA 1ZAKA 5AJWA 3SDZA 4BGDA 2W00A 3EZFA 1XD9A 2Z83A 1KI6A 3TQCA 5L3SA 5FUXA 1TPZA 1OKKD 3U2QA 2ZRBA 2YZ2A 3X1XA 4JZKA 2XB4A 2PMKA 4PX9A 121PA 5FBQB 4OK5A 4QBFA 1Q12A 4N1AA 4X8LA 2WKQA 1S3GA 1ETUA 3W34A 1E99A 4Q21A 1AKEA 3U4QA 1MRNA 1RW4A 2VPPA 1XJ0A 5EXXA 3ZDQA 3PQCA 2XX3A 1OHHA 3UANA 2IXEA 3T5GA 3EWAA 2YWHA 1K5GA 4X8OA 1Z6AA 2H1LA 2D2FA 4IOJA 3R20A 1Z5ZA 4XH9B 5D3QA 2VHJA 5JEDA 2JCSA 4BZXA 1VKJA 1S1MA 1E32A 2F55A 3V00A 1Z0KA 2R62A 4FWTA 1G4AE 3QKSB 5JWOA 4JVNA 2ZU6A 2ZRPA 2ZRJA 4D2IA 2J0VA 4EKDA 3TR5A 3FHTA 2YINC 2GEUA 5EQTA 3FMIA 2FPLA 1FP6A 2GVZC 2C95A 2X2EA 3ZIAA 2IWRA 5CIWA 3BFKA 1Z06A 1KKMA 3PUVA 2W6JA 3T1VA 1NBMD 2V7QD 3OE7A 4CGZA 3FMFA 5SZKB 3AF2A 1RFLA 5FOWA 4D0NA 1X8LA 2GWHA 2R6AA 3M1IA 3LQQA 2GBLA 3EIQA 5EXSA 1FTSA 1N5KA 1XZQA 4PC2A 4XJXA 1KNQA 3IUYA 5DYIA 2AKAB 5AUOB 4GOXA 5EE1A 4M1TA 1U9IC 1B0UA 1WP9A 3I1FA 4KSBA 4Z1MA 2ZJZA 5IF9A 4JL5A 2D06A 3WBJA 4KBFA 3C8UA 3WHKA 2IYWA 4MYTA 4LK2A 3TUZC 2WPDD 3FGNA 2I4IA 3TKLA 5C2JB 2OUKA 3TGPA 1W5SA 1KDTA 4MYHA 1GG2A 1Z83A 1E2IA 2GKSA 2IA5A 2QPOA 2ZYTX 4TL6A 4ZO4A 2NIPA 4GT1A 3REFA 2IS4A 5FOXA 4KCGA 4BQSA 5B57C 2A7QA 1U8AA 1P7CA 4FWIB 1XCMA 3A37A 2H17A 5HCIA 4KYIB 3K0EA 4UNSA 1Z08A 2JIZD 4FI3C 4Q1BA 3NH9A 1N6KA 2JDIA 5JLJA 3RWMB 3U3OA 1ZD8A 1VYTA 1AGRA 1NVVQ 1W4CA 3ONWA 4OK3A 3OAAD 4C0JA 5EJEA 5J4YA 2H57A 4QG7A 3EPJA 3VR4A 2OXRA 4DJTA 3QVUA 1F60A 1NVVR 1XFAA 2A5YB 1NN1A 1XP8A 3OEHA 4LBZA 4AI6A 4R2HA 3IO5A 4V0ME 4E22A 2F1IA 4IHQA 1DTSA 4B48A 2V54A 1CULC 3IPXA 4L9WA 1SXJA 3CRQA 4NCNA 4F93B 4JLJA 1AIPA 5AUQA 4DC9A 1YQTA 2WWXA 2G3YA 4NPHA 1AA9A 1NG9A 2VP0A 2BVNA 3AP3A 1N0UA 1UBGA 4D82A 4MKHA 1VTKA 3CRRA 4GP7A 5H68A 3PITA 3F0TA 1N5LA 2OE2A 1PLKA 3K09A 3FYHA 4PHFA 5FPHA 5BYJA 4BZPA 4DUGD 4OI0A 4BWYA 4KLZA 4LYJA 2AK2A 2VHTA 4CYMA 4DB4A 1SVMA 4GMXA 4ILEA 3GLIA 1VCMA 2FSGA 3H2YA 1R4AA 3LBNA 3LW8A 3BC1A 3QBTA 4Q01A 1Q1EA 1N6PA 5CM9C 4XVUA 4PO1A 4PSVA 3B2EA 2KBEA 2B7BA 4RFSA 2CHQA 3SR0A 4I1SA 1EFCA 2ZUBA 1CR1A 2XEXA 2HCBA 1Z2AA 4ON9A 2ZRAA 2Q3MA 4QGGA 4NCKA 1KYIA 3TK1A 3ADCA 4NYIR 3CZPA 1W4BA 4DEXA 2OFWA 1WDTA 3EC2A 3IIMA 2C98A 5E4FA 2ZYWX 1HYQA 3ECCA 3K0CC 4ESVA 4Z8YA 1XDBA 3AQ4A 3JZAA 4YDSA 2HT1A 3PUZA 4D4LA 2V6IA 4GOJA 1N25A 1VIYA 4ZCLA 5H8WA 1NSFA 3KQLA 2G6BA 2N42A 2ORWA 4V0OA 3DMDA 1GL9B 2RH5A 4PZZA 4EAQA 4AYTA 3PFIA 3RRNA 2IYVA 3BFVA 1G7TA 1Z6TA 1KSHA 4TLAA 1LFDB 5EP4A 2HDNB 2P65A 3L8ZA 2DFLA 5K8LA 5SZHB 3RS2A 2QAGA 2O8DA 1F2UA 1P61B 2ZJ5A 3C5CA 2QA5A 5BQ5A 1JEDA 1YZQA 4ZPXA 3W3ZB 4CVNA 2QPAA 1DELA 3CKLA 2IK8A 3SJAA 2JLZA 2QPTA 1KJYA 1KO4A 1FOEB 2QTHA 1RJ9B 3B9QA 3I62A 1HT2E 1JXOA 4D0GA 5DI3B 4XTCS 4DSNA 1Z63A 2VLIA 4QJ5A 4XVQA 4B3FX 2H5EA 2JLXA 3WNCA 4Q1DA 3SJBA 3P20A 1SGWA 2VEDA 5L8VA 4ACAA 4C2UA 1OPXA 2DCUA 4M1MA 2O8BA 4L16A 1S96A 4JIMA 2BMFA 3CF6R 1OXUA 1UM8A 4URUR 3GEHA 5J4KA 5F9FA 4IW3B 2ZJAA 3H84A 3VMFA 2V9PA 3GLGA 3RDPA 2QT0A 4M9QA 2AFHE 1AJEA 1CJKC 2CE7A 2PL3A 2NQ2C 3L43A 4B6FA 4Q1CA 3V4FA 3PJRA 3D31A 1W46A 4B32A 4CF7A 3TBKA 4HUQB 4LJ9A 2B8WA 4LV8B 1E2PA 1HQCA 2KI5A 1NSTA 2R8RA 1E98A 1KSFX 2Z5FA 3MWJA 2XNDD 2ZI5A 4HLCA 4NL4H 4QGHA 4C30A 3NHBA 3FWYA 1R5NA 2J9RA 1DAKA 5BN4A 4C0AC 3GD7A 5FOSA 2IYYA 3K9LA 4B43A 4HAWA 5EUQB 3I3SR 2C2HA 1H8HA 3O8DA 1ZUNB 2J3EA 3BH7A 4DLYA 2BV3A 1QHGA 3REGA 2WMNB 1ANKA 2O0KA 4C0SA 2H7VA 1ZUHA 1GSIA 3IQXA 3U5ZB 3A4MA 2OG2A 2B92A 2HXSA 1IN5A 5HE8A 5JSZB 1Z0IA 4G5GA 2BDTA 2GJKA 4A0RA 4NH0A 2ASEA 4D25A 1JPNA 1S2MA 2R6DA 3AEZA 1R8QA 1PZNA 2JLQA 4KU4A 5G3YA 5B64A 2N46A 1G8GA 4PAQA 1OYYA 1GKYA 2ZE8A 1E3MA 4HAXA 1GNQA 5DHFA 1AK2A 2XITA 3EA0A 4Q4JA 4C7OB 2WHXA 1ZM2A 4G01B 1XTKA 1CEEA 1NVWQ 5EUMA 5K8IA 3BE4A 1P6XA 3WY9A 3GJXC 1E2KA 2JJ1D 3CH5A 3AP1A 2OEPA 4GFDA 2CBZA 1HEIA 4U5XA 3B13B 3U61B 1D9XA 2A9KA 4BE7B 3SFZA 4HB2A 4GZMA 4EIWA 3QPUA 2WKPA 2LKDA 2JGNA 3T35A 1GNRA 1T0JB 2PJRA 3GEIA 1F6BA 2WWYA 3DHWC 1XMSA 3ZVMA 2QSYA 1QBKC 2EWWA 5G3ZA 3R9IA 5KDOA 5FPTA 3DOFA 4ZDKA 4KVGA 5KSOA 4HB3A 1P75A 5D3MB 1LS1A 4DSUA 3F5FA 4LRWA 3R7WA 1G8FA 1OXSC 2W6IA 2XTMA 3CR7A 4CT4B 5KSPA 5TDHA 4PHHA 4UXHA 1CJVC 2FDCA 1E0KA 1Q1QA 1D8TA 1J90A 3R8CA 2G0NA 1U2RA 1SVOA 1E4YA 4NKRA 1V5WA 4EPVA 4HLDA 1UKYA 3P1JA 4KJZA 3H4MA 2A2ZA 4A8JB 3PCRB 4R71A 3A1TA 1G64A 1OHHD 4NCIA 1MKYA 4G0NA 3EG5A 1NVUQ 3HP1A 4LJAA 2O52A 4LWZA 2QGZA 2ZAMA 1T4GA 3NDPA 3WYAA 3FPAA 1HURA 1K8RA 2QSZA 3TW8B 1OH6A 1P9WA 4WXPA 2O8EB 4A0GA 3TSZA 3LLUA 1DPFA 4BFXA 1ZMXA 1G8PA 3MJHA 3KKNA 1G3IA 2IEYA 4HDCA 1RRGA 2QAJA 3QBVA 4UNNA 2OO7A 2A5DA 3ZIAD 1DAEA 2ZUCA 4PPFA 1N6LA 4FXPA 4M9SA 3OE7D 4ASUD 1Z2CA 1JB1A 1CTQA 2DY1A 3PV0A 5LD2B 5E7JA 1M2OB 3CWQA 3DVLA 4CW7A 2UVQA 1DAGA 4B35A 4JMPA 1N6HA 4NONA 5CJ2A 2ZM5A 1KTVA 4MRSA 2BM1A 1JQJC 3UPUA 3ZZTA 4FW9A 4BLQA 3NVAA 3FOZA 4B33A 4Z1MD 4IDOA 2GXSA 5EZ6B 1KO1A 1R10A 2A78A 3QVVA 1KI6B 1XB2A 4MQBA 5M04A 5L3SB 2YC4C 2CL6X 3AF4A 2ATXA 3QPVA 2CEAA 2QE7D 1CKEA 2ZPTX 1OFUX 4TTRA 3CR8A 1ZM9A 2REXB 1CR2A 4Q9LA 5CITA 2QUZA 2CHGA 1E9SA 2PX3A 1FL9A 4AG6A 1P2TA 3AUYA 3RWOA 2ZRDA 4RFVA 2HUPA 2RGNA 2O8FA 2P6NA 2FFHA 2QTVB 2CL0X 2DWPA 5JI2E 2XJ4A 4Q9KA 2JDID 4B6EA 2AHOA 2GEVA 5CYPA 4HLQB 1XEWY 1OJLA 1L8QA 3RS7A 3U4QB 2VP4A 3PEVA 3HR7A 2QROA 1W0JA 1E2HA 1XRJA 1NKTA 1DE0A 1RYFA 3PXGA 1XTSA 3EIHA 3OEHD 2ODEA 4LPKA 4L4UA 2OSBA 4EDHA 5EP3A 2MSCB 1TEVA 4M2LA 2F43A 2G83A 3MD0A 4LHZA 1IY0A 1EGAA 3EA5A 3CX6A 1SXJD 4NDZA 1GZSA 1S3SA 1FMJA 3FKSA 3SJCA 1ZU4A 2Q3HA 3O8BA 3RC3A 2OT3B 1TNDA 3K0AA 2EFCB 1XPOA 1NI3A 1YU9A 1T3SA 2QGNA 1E9AA 4KV9A 4LZZA 3VHXA 3THYA 4DDWA 1CJMA 1SVWA 1NIPA 3TVDA 5CLQA 5DYGA 3VX3A 1W49A 2ECKA 3AB3A 3LAWA 4DZZA 4OQXA 2IW3A 1LS6A 1H8EA 1AN0A 2YHSA 3UG7A 2HYDA 5KDDA 1G291 3DEFA 2XZOA 3AVWA 3VR2A 1Z22A 2N1BA 2GA8A 3L0OA 4A6XA 1OV4A 3AVTA 3W6PA 3I32A 3QKTA 1BYUA 3ZJYA 2OCBA 5P21A 3B60A 4TMWA 4A92A 4RD4A 5FTKA 3CZQA 4FCWA 4CIDA 1YZNA 2KBFA 1GOTA 4KI0A 2FF7A 4ZCIA 2QQ0A 4X8MA 4R9UC 1RIFA 2WWIA 3DM5A 1KJWA 3A8TA 3Q5DA 1T3LA 4HLUC 3EZ2A 4BFZA 4D4KA 5TARA 3NH6A 3WRYC 2ZTSA 2CVHA 2VO1A 1XTIA 3CX8A 3IPYA 4MKFA 4LSGA 4Q4AA 1NIJA 2GZDA 3FMOB 2E1RA 5FOVA 5LB2A 1KY2A 2VSOA 3L0SA 2F3RA 5KNBA 2EFDB 1HV8A 5KNCA 1T91A 3IEUA 2DBYA 2Z0MA 4LJ5A 1KO5A 3LA6A 1T8UA 2OCPA 4UXIA 2RHMA 4R98A 1MO4A 1SVSA 1S8FA 3QXJA 2MSDB 3E5HA 2LKCA 3I8SA 2KJQA 1SXJB 2VSFA 4A8JC 3GLHA 1N2CE 2MMCA 4JBWA 5JCPA 1A2KC 2FFBA 2OAP1 4QHTA 2I1VB 3QEJA 3AVYA 1TU3A 8OHMA 3GJ0A 4ARZA 1UBCA 4TLDA 4B75A 1BO6A 5AJVB 4OHYA 4NHOA 3TMKA 3B78A 2WWGA 3L2OB 3PUXA 3UMSA 2WAXA 4OHVA 3DDCA 2WOJA 2ZS9A 3EXAA 1NVXQ 3BB3A 4M1KA 3O47A 2XZLA 3GLIB 4O2RA 4TLCA 1PLLA 2OLJA 3UK6A 2ZS8A 2ZSFA 5FPYA 1M34E 1TEXA 4Q9HA 4AKGA 2OILA 4RFSB 4EFLA 3WP1B 2AFIE 2FEMA 1AQUA 5LD2C 1U8ZA 3HU3A 4Q9JA 1VYVA 1OH8A 1P3JA 5EZ5A 4ZV4A 4LUCA 2IL1A 4PO8A 1KAOA 2AR7A 2QP9X 2QNRA 3H0KA 5FFMA 2WSSD 3JZMA 4V0MA 1HA3A 2ZSBA 3EIEA 5FTNA 4CEHA 521PA 5B30A 2W2VA 1R0XA 1MO6A 4Q4LA 3A6PC 1LF5A 2K5UA 4AY2A 1KNXA 2AD5A 4V03A 1XPUA 1E6CA 4OI1A 1QHXA 3G82C 3HDTA 3E70C 3KB1A 2FZLA 1VCNA 4QKQA 1NMZA 2WWFA 3SBEA 3TUIC 1H8HD 1CS4C 4H9GA 1OB5A 2IYTA 3T1TA 4RD1A 2GF0A 1OF1A 4ZKDA 1R6BX 2O8CA 2VSXA 4KLNA 2BKEA 3MUFA 4TQ9A 2Z4RA 4F7WA 1BKDR 3WP0A 3IBYA 1KDPA 1WRBA 1G3RA 4JVSB 2ZI4A 2ZITA 4E5UA 2QAGB 4RSGA 4OQMA 3PUYA 2O8DB 1GUAA 1F2UB 3IHWA 1U0JA 1TF2A 4NTZA 3I5XA 3D8BA 4AURA 4RD2A 621PA 2H16A 3KFXA 1IXZA 4D81A 3SHFA 1OFTA 4FINA 2VHCA 2FA9A 3CPEA 1A7JA 3IIKA 2ZR0A 2PT7A 2QRZA 3VFDA 1D6JA 4GNKA 4DIDA 5JMTA 2ZJOA 4JS0A 1GKUB 4XWOA 5AUPB 1VDZA 4C4PA 5KYKA 4PC1A 1ZIOA 4HZUA 4DEYA 1ZC3A 2AXPA 2C96A 2R6FA 2EFHB 3T1OA 1G8YA 2O8BB 2X8AA 1AGPA 2GAOA 4B2LA 2RHDA 5A5GA 1VG0B 2ANCA 2GBLC 3GLGB 1FP7A 1XTQA 2NGRA 1WXQA 4PPGA 3K0SA 1JR6A 2F6RA 4DLUA 1NY5A 2OXCA 2AN9A 5CYOA 3W8NA 1ZUIA 4TLBA 2WJGA 1M7HA 2V55B 2W6ID 4BLRA 3CRW1 3ZZ0A 3THXA 2WOOA 4N0EA 3IIJA 4HEJA 1YKSA 4HUTA 2J5XA 3CNLA 1ZVQA 1OXXK 2EFEB 4JLPA 2QQEA 1OE0A 4EJSA 1TQ6A 2Q9AA 1XU4A 3K53A 1U90A 2VA8A 3A1VA 3NEJA 4OI4A 3B1WA 4BEJA 1KI3A 4JLKA 2WJYA 3WRXC 2ZSEA 3TUJC 4EFMA 2HV8A 1YR9A 1E69A 3GLFA 4TYWA 3N5CA 1CIPA 1GNPA 1XMJA 3AVPA 4KVAA 4LHVA 4QNMA 3MCAA 1A2BA 4WA7A 2PZGA 2LCFA 3UG6A 4ASUA 3I72A 5HE9A 1QVRA 3UMFA 4LBYA 3B7GA 2R2AA 1ZNYA 2PH1A 4YMTA 1NL3A 2ZJ8A 1XTJA 1N0WA 5FUWA 2ZAOA 1Q20A 3MRSA 5G41A 2FU5C 3GLHE 1EX6A 2PMDA 421PA 3ND8A 2D62A 4Q4JB 2YWEA 1NN3A 1SVLA 2WJJA 3BH6A 5UKDA 4F4CA 4HATA 4JYCA 3KX2A 3GP8A 4CEIA 3T61A 2ZRGA 5CB6A 2B21A 3WXMA 3MWLA 5EE5B 1SXJC 2Z4SA 2BBWA 2QE7A 2ZJYA 5GJBA 1IY1A 2BC9A 2VF7A 1TUIA 1M8PA 4V0NA 1UEJA 4DIEA 4PAMA 1X86B 2GXAA 5AR1A 4B74A 3KJHA 3W5JA 4BUJA 2J0UA 3WHLA 1J70A 3CRVA 2QY9A 2ZIAA 3ZVNA 5HPYB 5A0FA 1DADA 2CXXA 1G6HA 3K09C 4MRNA 3B5JA 4G5SA 1G17A 1KK1A 4WZAE 2QT1A 2AWOA 3LVQE 1AS0A 1YZGA 3H1TA 4GSYA 3R7WB 1DBSA 1ZCBA 3LO5A 3KKOA 5FUYA 2QU8A 3KTAA 4PC6A 1I4DD 3VQTA 3L0PA 4A1FA 4GI7A 1EFTA 1MABA 2IXGA 4HDQB 5CJPA 1JR3E 3IBGA 2R6CA 1Q3HA 1TU4A 3FKQA 1W0JD 3U6BA 5HR5A 3RSLA 4RD6A 1W36D 4PO9A 1EXMA 4TWZA 4A2PA 4C0QC 2ZE6A 3NIBA 3MAAC 3TE6A 2NO0A 4JT2A 1TMKA 1ZIPA 2BBSA 3KJGA 4LYFA 4TZ0A 3BB1A 4RZUA 4I1VA 4Q7KA 3HPRA 2VYFA 1NJGA 4D6PA 1KI4A 2UKDA 1N0VC 1W0KD 1Z3IX 3FKSD 4TTQA 2RGGA 3T5DA 1XPRA 1I4LD 2E9SA 3GJ8A 5JHHB 5GVRA 5FTLA 4G5OA 4B73A 3FFBA 4RZXA 2CHVA 5HTKA 1WA5A 2GJSA 2X77A 1N6OA 2BCJQ 1UPTA 4OI2A 4B76A 5C1BA 4MRPA 1VPLA 2DHRA 2QAGC 1XTRA 3FDIA 1ZU5A 1YHNA 1E94E 5KPDA 3R9WA 3KXKA 5CIQA 1DEKA 3CX7A 1H8ED 3KL4A 2DWOA 3U7GA 3CH4B 1T5IA 1GP2A 3IQWA 4P4SA 5TY0A 1I2DA 2XAUA 1DO2A 2V4ZA 2ZYUX 4JYBA 4RCZA 3ZZUA 4RZ2A 3RS4A 3LX8A 1OB2A 1OIWA 3MWYW 5KSYA 2EFGA 2Q6TA 2QM8A 3SNHA 4GZLA 1S9DA 2OFXA 1KDOA 1NRJB 1XMIA 3E1SA 1G5RA 1Z6GA 3GFOA 2O8FB 1N3BA 5IDVA 1DOAA 3X1DA 1KI8A 3BORA 1HY3A 4MGYR 1UFQA 3KJEA 4LGMA 4WAUA 2V8OA 2HEIA 2NG1A 1E0JA 3C5HA 1BMFA 3QG5A 4TSFA 2NMVA 1W7AA 3A1WA 2CCJA 1IXRC 4TMZA 3VR6A 1FPMA 3RS3A 1TADA 2YOHA 1XNJA 1W36B 2O5VA 4LC0A 3VR5A 2DPXA 2W83A 1G7CA 4OHZA 3GLFE 1OYWA 3X1YA 2G1KA 3UXMA 2GJAA 2FSFA 3UATA 1QRAA 2F43B 2LWIA 4KO8A 1NNEA 1PUJA 2ZJ2A 1NP6A 1YR8A 3QF4A 2EW1A 4US2R 3AVUA 2AXNA 3BERA 2ATVA 4L9SA 1Q1ZA 2V1XA 2ZR9A 3SZRA 1J99A 1SKYB 2WJVA 2W0SA 4BLPA 2VBCA 4Q5IA 2ZROA 4PSKA 2J7KA 4GBMA 2W58A 4POAA 2NPFA 4JLDA 3K0AB 1XXHE 2AKYA 4BLOA 4D4JA 3X1WA 3CB4A 1VIAA 2F9MA 4V0LA 1M7GA 4PSAA 1J2JA 3THOA 1XWIA 3NG1A 4MKIA 1RRPA 4RD0A 2V1UA 4DKXA 2DB3A 4JBYA 3RS5A 2F9LA 5K8TA 1PVOA 3B1XA 2WSSA 2QP4A 4BFSA 2WKRA 2OBMA 5CK5A 4AYXA 4G1UC 3LH5A 1RRFA 3GMTA 3T15A 2ZEJA 4UNRA 5G53C 5IT5A 4PZYA 4C9BA 4DT1A 1CF4A 1E9EA 3PUWA 1IN8A 4TMKA 2JAQA 4PXAA 1COWA 5FR1A 1G5PA 2GNOA 3MJRA 5C4MA 4V02A 4PQFA 2BIFA 2ZRMA 2VHQA 5JWHA 5TXGA 2XOKA 1T8TA 1GDDA 4QHSA 2OV2A 2D3WA 4O0MA 1UKZA 3M6AA 1EWQA 5FI0B 2IC5A 2CMKA 1E1QA 1KY3A 1G21E 1JR3D 4BFYA 3B8HA 1EFHA 1IY2A 1LTQA 4Q4AB 2PCLA 2QRNA 2DWQA 3KKQA 1U98A 2J41A 3ASYA 5KNDA 3TAUA 3QF7A 2IYQA 2ZRLA 1AS3A 3PG5A 3BIFA 5AJXA 2FPMA 5EE9A 2CLDX 3WBKA 3THWA 1OXTA 2V6JA 5FR2A 1KMHA 4KFSA 4IEEA 3LXRA 4MH0R 1HH4A 2KWIA 4LHYA 4R2IA 4JLMA 5FBRB 1HT1E 4TTPA 1LVGA 1G9XA 1BYIA 3K9NA 4P32A 4RY2A 2IYUA 5DN6D 3X1ZA 2JLUA 1MV5A 4RD3A 1QDEA 3A4NA 3GLHB 4AC9A 2FGJA 5E7IA 1A5TA 3O8RA 2XZPA 1E2FA 4MRRA 5LB4A 3JVVA 3VNUA 4CDGA 2PBRA 4ARZB 3LLMA 1XD2A 1XF9A 4IXNA 3ZQ6A 4U02A 4MITA 4A0HA 4A15A 1P60A 4HAVA 2OESA 1ZBDA 4IFEA 1VCOA 1TQDA 4WOPA 3CF2A 3OEEA 2XNSA 2FZ4A 1TX4B 2G0TA 3AVOA 4BEBA 4WBSA
chains in the Genus database with same CATH superfamily
3JQAA 3A6ZA 5B7GA 4WKGA 1SXHA 1L5WA 4EO4A 4HSGA 4URWR 1KZ7B 1P7VA 3RBAA 4WIAA 4JSYA 3HLKA 4Q82A 2CFTA 2WG2A 5JTUA 1YRHA 3G5TA 3INYA 3WQSB 4EHNA 2GRJA 3IESA 4IJ6A 4LMPA 1B0AA 8AT1A 5KU1A 1WO8A 1C3OA 4AWXA 4YT4A 1SG6A 4A5OA 5DLEA 1EUZA 1XE3A 3PDHA 5KSWB 3H2IA 1GPBA 1PZMA 3ENWA 4JLUA 4XFJA 1OAOA 4C20A 1BDIA 3Q2KA 1CJUC 3IILA 1IDOA 3AY0A 2HSJA 1Z2NX 3BD9A 5BR1A 1QIDA 1H65A 1E9VA 1VB5A 2QLNA 4JLOA 4PC7A 2A5LA 5AM0A 1DDGA 4MJ7A 3NHPA 4B0PA 1JHAA 1WQ1R 1E1CA 3K6KA 2XGJA 3WA7A 1XKLA 2PJZA 2PEZA 4IWNA 3VISA 4BX9A 2OZVA 1CY8A 1N6IA 3D1JA 1PG5A 3MZ0A 1WHTA 2IWHA 4MVJH 3IAHA 4HI0E 3B12A 2WQ6A 4EBBA 2O23A 5FV4A 4RJIA 1XAIA 3H1GA 3N70A 3PHHA 2IYXA 2JKZA 4AQYB 4OIMA 5JRJA 3KKKA 5JE8A 4R1LA 3NETA 3NBXX 4URZR 1YRBA 3IEVA 2XUPA 3NW9A 3QYFA 4EG4A 9MHTA 1FK8A 2ZJ0A 1RM3A 5EHIA 3TSWA 1JA1A 2BRUC 4DS3A 3AL3A 4IDNA 3PGXA 2XUJA 1F8UA 3IVMA 4IXMA 4Z7JA 4KAAA 1Y1QA 5JH7A 4AECA 3K2EA 5FRDA 2OENG 2B1JA 2Z1MA 3CBGA 1G8JA 3OZSA 1DI0A 4JOBA 2QMHA 3KUKA 4S35A 1D1PA 1NYTA 4Q48A 1W36C 3Q3IA 1JU4A 2QSJA 4IGKA 3GJZA 3C3BA 1SVNA 3LDAA 3R0IA 1WB9A 3RANA 1Y7LA 3UYKA 4FBMA 4L51A 2VBIA 4L8VA 2QZJA 1GPJA 2EJTA 2B2CA 4TKUA 1QOQB 4MQFA 3RRYA 4PHTA 2F00A 3WYGA 1UQTA 4MV5A 1YC2A 2P3SA 2BGLA 2ZKIA 4TL7A 4X61A 4E5SA 1L7PA 1WJGA 3KB2A 5IX8A 5F5LA 4YONB 4AKEA 2P0EA 4U2GA 4YUYA 1NUQA 2V7UA 3G2NA 3FF4A 2AFRA 3AR9A 4KH0A 3TW0A 5JMOA 3V1MA 2IX3A 2ZLBA 4IJQA 1VYUA 2J9FA 2QM0A 1Z0JA 5A3VA 4BOYA 3D2CA 3RQSA 4LNAA 3W1VA 1FA9A 1P2VA 1Y33E 2BDUA 2LIVA 2YDYA 2I55A 3ANXA 3GG9A 1GPKA 3C15C 1E5QA 3Q4GA 1RXIA 4OHKA 1U9YA 2OWEA 1UDCA 1Z4PX 5ELLA 3MPOA 2A94A 2VQFB 1AKRA 4FGLA 6REQB 4OJNA 1Z33A 3HDJA 3IGFA 2VF8A 4RTJA 3TYXA 1F12A 4K03A 1V4VA 1DARA 4XOIA 4AIRA 3THXB 5I9NA 3GPLA 5FCDA 1DIHA 1TZ2A 4X92A 3S2GA 4YRDA 3RHFA 2Q50A 1G3UA 2CXNA 2DMRA 2O05A 2RCNA 4MW6A 4NNOA 3T3DA 4EL5A 3LHSA 2WD8A 3BWVA 5ALTA 1VL8A 2FUG6 1DXYA 4DM3A 3GAAA 1XG5A 4HMOA 2F1JA 1BHQ1 1QLJA 2W6MA 1HDYA 2W8ZA 5GJVC 4P4TA 4N3CA 1G55A 1T35A 3IE1A 3C0KA 3LWNA 1TAUA 4MV0A 3UB2A 3S55A 4DLAA 2ZRNA 1M7BA 1WDMA 2AI2A 2F3UA 3HEAA 1RBMA 1MDBA 4IIUA 4UFNA 4XWKA 3R8FA 2C1EA 1E1DA 3O4RA 4ZMBA 4UVEA 2BEJA 1CUWA 1W5EA 3AP2A 3HVKA 4XWAA 1Q44A 1C9MA 3KPYA 3UHFA 2EJBA 4L3VA 1K4YA 1TZKA 2H08A 4G09A 4KLRA 3P9YA 4IL5A 7ABPA 2R1VB 4FBGA 4YRTA 3ID6C 3NM4A 3K2BA 5FL3A 5G4KA 1LLQA 4EW2A 4PYJA 3HSYA 1TIPA 2ZBRA 3DOUA 2C2WA 3F6PA 3PPIA 1N7HA 2XQJA 1LF0A 3HI6A 1VBKA 1PJAA 1GLVA 2Q4DA 3HY3A 2BFDB 3LI2A 1JS1X 2IZOA 2J3JA 4N9WA 4CEIB 4U63A 1KPIA 2AWNA 3ESDA 3ICPA 3IMFA 2UYCA 5D1NA 2XI4A 3IPLA 3AXSA 5FO0A 4OL0A 2LE0A 3BE5A 3IUSA 4MAAA 2P2NA 1QPGA 3O84A 3RRJA 2DWCA 2O2JA 3A36A 3QKIA 1JEEA 10MHA 1N6RA 3UJHA 1ISMA 3HV0A 1TK9A 4ZN6A 2H1RA 2ZSUA 1JEOA 5MFZA 2F4NA 5KQRA 2ZRKA 5EJ8A 1GKIA 5ALGA 4TZTA 1PK8A 2ZT7A 3D6MA 2OBNA 1RQ7A 3B5IA 2J0UB 5J40A 3NONA 4IS2A 4ARSA 3MB5A 1LZLA 1JF8A 5EJ9A 2NAPA 3CF4G 4Z9XA 4F2GA 3HY6A 3TPCA 5HKAA 4BX2A 1YGYA 3L92A 2WNSA 3FYSA 3AJ9A 3GDOA 5F5NA 1EUCB 1UMCA 1XTVA 5DSZA 3G2OA 1WUJS 4QWWA 3GH1A 1SBIA 1Q0HA 2CFSA 4EZIA 1Z0UA 4OH1A 4NBTA 1NI4A 4NNJA 4DIOA 3K05A 4Z4QA 4CKCB 4I55A 3H2BA 1ODCA 2GCOA 3AH8A 4C0QC 1ML3A 3BK7A 4Q39A 4C4RA 4O1MA 4XAQA 2QUAA 2PZBA 3CLRC 1I6WA 3T99A 4CCAA 4CKBA 4UTRA 3SD7A 3EY4A 2FN8A 3H13A 1EE1A 3E9DA 4BQNA 3D6TB 2H0AA 3GWZA 1EVJA 3G2KA 3HHPA 4J0HA 1JE1A 1EFLA 4M8NE 2BY4A 1P1JA 5AM1A 1XC7A 4MEBA 4F9GA 5IAOA 1EWRA 2AUTA 1C8VB 3VC2A 1P5JA 3EXEB 3M4YA 1WF3A 2B6HA 2G1AA 2VZEA 4MA5A 1ZHOA 4IFBA 1UWCA 2HU5A 1NC1A 1LTHR 4K9NA 3DKVA 5EP2A 5GY7A 1VRWA 5KQPA 3EE6A 1NNI1 1EFAA 5A5VA 4GNRA 1KAMA 2BLNA 4EB3A 2FR8C 5EINA 1YDWA 4A36A 3A1SA 1WB5A 5FEUA 5K1ZA 5C8YA 4JZYA 2OP1A 4XLTA 4OGKA 4IIJA 5ELMA 2EGHA 3EAFA 5JCOA 5AI9A 3LOUA 2C3MA 2OWDA 1UFRA 1NXSA 1FNMA 4E3ZA 2Q1XA 1O3YA 3QV2A 4IDQA 4OHWA 2NSDA 4D8VA 4DCCA 1KI1A 1ZRNA 4UZSA 3SBDA 5T6BA 4EMTA 2BZ1A 3LHIA 3RIYA 1HE8B 4IOLA 1NW3A 4QAJA 3SEAA 2JLYA 3SQXA 1OT5A 3K15A 3HA5A 4GMDA 4M0MA 4W8HA 4HV4A 2FSUA 4UM8B 4MGHA 3A6LA 4GI1A 3TMAA 4RIIA 3WQBA 3OZIA 3WNDA 4IYRA 4FMCF 2Z6QA 4RIGA 5HKLA 4ALKA 3S28A 1A9YA 1JNYA 3LSYA 2Q5HA 4LDZA 5F1KA 1T9GR 2M9MA 2VNIA 1YQXA 3IQGX 2YV5A 3NR2A 3O8OB 4RHTA 4LHXA 2WU8A 2HKIA 5TV2A 4HWKA 1ZN9A 1JR3A 4GI3A 3I9OA 4NAHA 4YRRA 5IN4A 3TF5A 3J81k 1DCKA 2CSUA 4PG8A 5BWLA 4ZO7A 4GPIB 3JVUA 4RS3A 2XXAA 2HQSA 1IBLB 1T4DA 2WICA 3URKA 2J0QA 4LXHA 2I3ZA 4RORA 1YZKA 3VTKA 4U7DA 1X7WA 4B8WA 2NNWB 1CJBA 2XOKD 3T5AA 4FNMA 5CU7A 4ZT5A 4BBAA 3NBQA 4RSRA 2CZQA 4FW8A 1ZOPA 2M6RA 4RK5A 2XLBA 4AB1A 3FHCB 4DRXB 4MV4A 2XSZA 2WM8A 2F8TA 4B0OA 5LP6C 1PJRA 4K05A 5J23A 4JJGA 2ZB3A 3SAJA 3ZHOA 2R6JA 3PC2A 1E1RA 2FMTA 1NUSA 2CJXA 4TS3A 1CUIA 2UZAA 2XQIA 4PX3A 2DG2A 1Z7YA 1KEZA 3WMGA 1EJ6A 3OC6A 4JR1A 3H5LA 3CH7A 4GKKB 1UINA 1SQ0A 4LTNA 2CL7X 5IVKA 1G8SA 3I2KA 3AVXA 1E6KA 2PL1A 3TVYA 4D74A 1KH3A 1R0SA 3EFBA 3F2IA 2ZIWB 4P08A 4TVKA 5IEBA 5I4CA 3I9KA 3MMXA 1E5DA 1KA9H 1TGVA 1SUBA 2P2CA 1X7ZB 1YKGA 4FR0A 5LYYA 4RK0A 4QGFA 1L5KA 3U9TA 4UFOA 1H5UA 4HSEA 3ZHYA 1BE1A 2XCIA 3E7WA 4YJFB 4OJMX 1X8JA 3JQ9C 3TSYA 2BPOA 3VDNB 1GTVA 1YVDA 5EZYF 1N8NA 4C4TA 2XCSB 4OK6A 2HZ7A 3AU9A 5JD4A 4BXOB 5KMGA 1OX4B 1NG1A 1OUMA 1NW4A 2Q4TA 3LPAA 4LMRA 3EMVA 4OMCA 2DFKB 1JE0A 5AD1A 5SZIA 1O89A 3ZWYA 3C3KA 2GEKA 5H83A 2IHNA 1GQYA 4EPYA 3PIDA 3RU3A 3LPLA 4KFCA 3VBEA 2F1OA 2C9DA 3EC7A 5LYJF 2JKVA 4FFSA 2AG6A 2C61A 5JFTA 2E4VA 3I4FA 4K6GA 4E14A 4UJ3A 1TTPB 3ANYB 3FVRA 3OFND 3WLQA 5U1PA 1XJCA 4DT1B 4F3NA 4EGAA 5K4GA 4JH0A 3DQPA 5FWYA 3PR3A 3GW8A 1J42A 2ODNA 3D8RA 3I09A 3BSWA 4BV9A 3IFSA 2E87A 4QUAA 2B0JA 3K5PA 2C4VA 1GR1A 5ALMA 4ADSG 3BGOS 3DMYA 3MYYA 1Q2XA 5F4BA 3TQQA 1TJ3A 3B8EA 3UM9A 4DLBA 2WTBA 3IP5A 4RYLA 3WL6A 5LZ2A 2R5WA 4ZQEA 5C52B 1XLWA 1Z35A 3ZLJA 1NLFA 3COZA 3DHNA 5AJTA 5CFOA 3QIVA 2YCBA 3T3HA 1XHLA 1QUFA 1N5DA 2X8LA 3B36A 3GAZA 2FQYA 1HX7A 4GOND 3UJDA 1ONBA 1YFZA 1QHHA 3A0UA 4CCYB 5AUNB 2PJDA 1GYPA 4WOKA 1WZUA 2YYAA 3OIVA 5I9BA 2F3PA 1ZNZA 1FYEA 2FWBA 2Z43A 2ZVPX 4LV5B 3ZQJA 2FCRA 4N5HX 2G88A 4XB1A 2FPXA 2DERA 2FJUA 3L8FA 2BOVA 4KQHA 3RUCA 4ER7A 1RI5A 3G0BA 3BOSA 2Q3JA 4B3SB 3ZS8A 4BLTA 3N07A 4IKOA 2PT9A 4JT4A 3KUDA 2OFFA 3T7SA 3IAM1 4KWHA 5CA1A 2BWJA 5JS7A 1A9SA 1A9TA 1P9RA 4A2CA 4ESHA 4Z54A 3EIWA 4HNTA 5IARA 1R0YA 2DQYA 2O2HA 3CRNA 1VCIA 2WSLA 5LXTF 5EKXA 4B84A 1Y3IA 3AESB 3NEYA 4RTLA 4B6PA 4D26A 3HA3A 5TNXA 1SQGA 3RC7A 1O57A 2FSHA 3DLTA 4I7EA 5KDLA 1EDEA 3DNPA 1GRNA 1AZTA 2IUTA 1Q7EA 1SCJA 1SIUA 5EXEA 3KBBA 1GGFA 5FTMA 1RAAA 2ZYRA 3N76A 1U0LA 1S8NA 3Q9LA 1BW9B 2ZRHA 5EMNA 2G1PA 1J0BA 3MT8A 4FFPA 1WW2A 4FMDF 4KC0A 1E9CA 3DNMA 3EUWA 2A4KA 2NUAA 4RDIA 2GAAA 5DWQA 5JAPA 2H8KA 3GCDA 1CFZA 2AL7A 1VMEA 2DUWA 3QUSA 4RU1A 3HCPA 5CP8A 5TGDA 3SF8A 3SVLA 3P2IA 1G21A 4WEOA 1VLJA 4WNCA 5GMOA 4F97A 3FCYA 3RRZA 2BFFA 1NAIA 1R5OA 2OCYC 3O95A 2BW0A 1MJGM 3F5MA 5ALYA 5H3LA 4NQRA 1ESDA 4RKEA 1Z29A 2PY6A 3QUQA 1F4LA 2XVXA 1JQBA 2DULA 2VA9A 4XCXA 3P96A 5ALPA 4KIFA 2VHEA 4N0DA 2VHVA 4HQNA 5IVPA 1TTTA 3BZBA 3DDNA 3UHJA 3P97A 4LZAA 5ARCA 3PCXA 1DKRA 3Q2OA 2Z56A 3FUVA 4NBSA 3KOXA 3GUYA 1K4MA 4PTLA 2NXEA 4YDHB 3S68A 3TKYA 1QF9A 2V0GA 1IQRA 9ABPA 2NNLD 2QGFA 2BM0A 1CUHA 2C82A 3KFLA 1E79A 2QTBA 5DSXA 4P7KA 1L7VC 4UAUA 4JK3A 2AB0A 4FFRA 4OQNA 4AZWA 2IXAA 2GZHA 3PHGA 4TRNA 2JLWA 4YRPA 1LX7A 3DO6A 1CUDA 4CLHA 3ZWKA 3PF9A 1F38A 1JLLB 1PO7A 4DIMA 3FNEA 3Q1KA 1EDBA 1CZLA 1XJQA 4N40A 4ZOEA 3DSRA 4CZ2A 5AVTA 5SZJA 1YZTA 3NBFA 3JYPA 3QLTA 4DR2B 1RPNA 1BD3A 5EERA 1E62A 4BVFA 4QT0A 2FRDA 1P4AA 1UPAA 2PGDA 2ZI7A 1KHTA 5HVNA 1V47A 4FYKA 1QC5B 2AVDA 1BMQA 1T8RA 4PQYA 3SDBA 4ATNA 4DANA 4FB5A 5JDIA 1U7ZA 5HMMA 1YIDA 4AP5A 1C9KA 1NRXA 1L4GA 1U3UA 2BCGY 3RYCB 1U3VA 4JVLA 3ETCA 3TD2A 4NYIQ 3VNVA 1FRFS 1EINA 4DV3B 1DO0A 4KE6A 3GNLA 4HAIA 1E3EA 3AFMA 3G0CA 3TQOA 3PFKA 2QL5A 2YWGA 4FCVA 3QEKA 1FUYB 3DHEA 3I9FA 5IF3A 2GLUA 1PK9A 4EKNB 5DYYA 2OC4A 5JC8A 1R3DA 1PJCA 3QEMB 4ZTBA 4D4JA 2JHAA 4OXRA 4KWIA 4PQEA 1F2TA 3RKUA 3FZEA 2NAFA 3CNOA 1KQGA 1SRQA 4QNNA 5JQGA 4JB8A 4US0R 1GCOA 2VQ6A 4G1MB 3KUCA 1RZ3A 5JDCA 1G20A 1ZOSA 2VP2A 1Z4IA 2IODA 4WZ6A 5DHTA 1QAQA 5AW9A 3QLEA 3VO9A 1O0BA 8MHTA 1GADO 3MWEA 4GRAA 1WDWB 3H2JA 5B4TA 1ND5A 2VJNA 3K1JA 1TLTA 3ASZA 1N1EA 3A0RB 4K2AA 4EQ6B 1ZS9A 1TIBA 5FBVB 3W5DA 1WKVA 5A6SB 2AJCA 1BCRA 3OTIA 2D2XA 1ZCZA 2DFPA 4O2AA 4RVFA 4F8JA 1P5HA 2OO3A 2II6A 1II8A 1FMFA 4W6ZA 8LDHA 2R8PA 1NTRA 1TYZA 1HKHA 1N4DA 2JVJA 2W6NA 3JARA 2IYNA 1DMSA 1T8SA 2J87A 4HAZA 1CUCA 3MWKA 4H4DA 5K3BA 5A7GA 2QJRA 3TQSA 4C7VA 3E03A 4DNQA 1Y3AA 3TL6A 2NVUA 4DB2A 1GY8A 2HFJA 1P5ZB 4FI3F 3KXPA 2DFTA 3ZOKA 3AVVA 4CFZA 3CW2A 3PVSA 1CP2A 2W8BB 4JHLA 4NCHA 1UBMS 3SYRA 2VQEB 3GXBA 1EWYA 1GVNB 3KLBA 2YIDA 5FBKA 1D5CA 5D86A 3AR2A 3SZOA 4D25A 3DAPA 1AQYA 3K9GA 4Z9BA 1UXOA 2GFIA 3HUDA 3RHTA 5KQMA 2Q28A 2X7HA 2EQBA 2LDXA 2BFCB 2VK2A 3C3EA 3GFQA 4MGIR 3JYLA 4QFCA 1E7YA 2GXUA 4LXGA 1U9JA 1SQSA 1KK0A 3GO4A 1ODFA 5REQB 4D92A 2WM9B 2X2FA 4LV6A 4N12A 3ELDA 1W88B 3JYHA 4O4IA 4UARA 5F12A 5ERGB 3WGOA 4JWTA 1HWYA 4IWYA 5IK2A 4BFUA 5DN9A 4QVIA 2DLDA 1LU9A 2FVXA 3VPAA 3Q3GE 2A7XA 3DS8A 4FMCB 4YYZA 3WOVA 1WM1A 1CQZA 1X94A 4M1EA 4OLJA 4AY4A 4OYHA 1XRNA 3FN4A 3N5KA 4FYWA 4M87A 2ZE7A 3ESAA 5JZOA 5JTTA 1IXYA 1NDUA 1Q0TA 1G3MA 4PV7A 1U2DA 4LEIA 1GEGA 5LZ9A 1DC7A 4WPGA 2QR2A 3ZWPA 4DLZA 4RHUA 4OTZA 1N6NA 5BP7A 1ZP6A 2Y4OA 2LNDA 3EA4A 4GX2A 2XDQB 2ZUDA 1ZCAA 4GVPA 4D4IA 3K9HA 3QKSA 4Q7MB 2GHIA 1XYYA 5EP1A 4DJJA 1UBLS 1UBKS 3HBMA 3MMZA 4H0FA 2P75A 4DR6B 4Q3AA 5ESRA 3ZE7A 3LFUA 3NEPX 3R6GA 2QMEA 4ZT3A 5HBGA 1JJ7A 4NYMQ 2O2YA 4ARCA 1H4SA 1UM9B 3ZKWB 4TXNA 1JECA 3DAOA 3FROA 5FFNA 3NIWA 1AK1A 3TLAA 4BKQA 3ED5A 1K6JA 1MXFA 2G77B 2GEFA 1J5PA 2ORIA 5TEWA 4RTKA 4QXPA 3RUIA 4I6EA 4DXAA 1OFUA 3K8YA 4R2LA 1NVFA 4LSMA 1SB8A 4Q37A 3BRWD 2PKEA 4MUHA 5J2UF 2XWBF 1WULS 4QPDA 3D0OA 3DOHA 3LKDA 1UOOA 3AR7A 4FHZA 4NZNA 4J0KA 4RGBA 2JASA 3STYA 3ZWOA 8ADHA 2Z3WA 4RMJA 4CM9A 1Z5VA 2I3BA 2JF0A 3OX1A 3OTHA 1ISSA 1AB5A 1I6MA 4RJLA 3PEYA 1MW9X 4MVYA 4BWGA 5EJ5A 2XCRB 4ECEA 3ZX5A 2WPNA 3P4YA 3O82A 1KJ9A 2HF8A 3SP1A 4EHBA 4AS3A 1XEFA 2QLLA 3W8DA 1Y4ZA 2IHZA 2J09A 5JZVA 1W2GA 3U62A 5J47A 3W3AA 4KPUB 1TFUA 2FV8A 5EZYB 3S1AB 1NWHA 1QGUB 3EPLA 4WXRA 1LNZA 3I6BA 3LCRA 2ONJA 3ZCSA 1QHFA 2V6GA 2OGZA 5LOVA 1A69A 3WQQA 3MVEA 4D4MA 3NUQA 1H3EA 3C7KA 4KFUA 2V4MA 4TVBA 3J81A 3FYDA 1JQLB 4IXDA 4BIMA 1C9YA 4KTTE 1DC4A 1KJ8A 1ATIA 1OLOA 1YTLA 2CLSA 1PS0A 3I53A 2B4YA 3LA8A 4JITA 3F4LA 3PLNA 2WUEA 1X7YB 5LYJB 1RZVA 3AEKA 5TQ2A 4ARIA 3HVJA 5FOTA 4R54A 2C42A 1IJFA 2QYSA 3LIPA 3WGGA 1X80A 4W4TA 5DZSA 4UUNA 2I0FA 5AK0A 5I7OA 4QVKA 5M29A 2W98A 4L7VA 4NJOA 2AN4A 3WJ7A 5LDDC 2PU7A 4BP1A 5I01A 1ZI8A 3KHUA 4D98A 5LQMA 1T2UA 1G5QA 2A0WA 2IIBA 1P2SA 2R8ZA 2CCGA 2PGIA 1U0GA 5K51A 5JAQA 1Y5NA 4DV4B 1T8PA 3QIAA 2ZBPA 1Y6GA 5KYXA 2WHQA 3IT1A 3ZHZA 3L0ZA 2HHLA 3JQGA 3NBZC 3P0HA 2Y67A 3UKDA 3L4KA 2RE8A 1UAAA 5KAPA 5HNKA 3FPKA 1JEQA 3JTMA 3OX3A 5BV8A 3CLUD 3QKRB 3C85A 3TE7A 5AOBA 4ZI7F 3IP7A 2DPLA 2IS2A 1WZCA 3NDIA 3EASA 4DG5A 2RB5A 2GD6A 3OZTA 4FFBA 4QEKA 4IOKA 4YP1A 3BD7A 3I73A 4B87A 3EEYA 5A9SB 1X19A 2QY6A 4MYRA 3CRMA 1Y8CA 3VX4A 1NF3A 4EX6A 3SFVA 3A32A 1V7QA 2REOA 2X58A 1NI5A 1YUMA 2W6JD 2WWHA 4NDNE 3HEMA 1WOYA 2WJ3A 2J67A 3F4KA 1UBFA 1V2GA 3T12A 3OC0A 1V1MB 3UA4A 5JJKA 3SXJA 5I48A 4FGWA 1HOXA 4XGRA 3EVAA 1E1MA 2BM9A 5KX5A 3NHLA 4FFOA 4MS3A 3HSKA 4LSZA 1Q6YA 2ZJ7A 4WA8A 2CNWD 3LXXA 1ISJA 1VG9B 1AQIA 2COKA 2A88A 2ZJBA 1DDOA 4BQRA 3MT0A 6YASA 4NWIA 4PS1A 4RVOA 1B2LA 3U9SA 7REQB 4QGAA 4J29A 3F71A 5F2OA 3T06B 3T0GA 1P6QA 4LYGA 2OBLA 2Y0PA 4S1NA 3MWDA 4UUBA 4U8HA 4B3CA 4HWRA 3OAAA 2P3QA 3GDHA 4PCVA 2GT1A 3T95A 3VU9B 5L40A 1JAXA 2WKSA 2H9IA 1GZ7A 4IRUB 3TAXA 1IHPA 3L8DA 5TSDA 3ANNA 2QEQA 4FMDB 3KD3A 1KSGA 2QVZX 5HWSA 4EB0A 4Q3NA 4YP5A 1FNDA 4XYMA 3WFZA 1XRMA 1HOTA 2IHYA 3FPBA 4CLOB 1HFWA 1YJ5A 2WYVA 4C78A 2IF0A 4P31A 4D0LB 7AT1A 3RG8A 5LUAA 4HXYA 4OAPA 1ZGBA 5GM1A 1H9AA 2GK7A 4KDEA 3D5TA 3SQMA 4TMTA 4XQEA 3TB6A 2P6UA 2WY2D 3ZY4A 4TSRA 1Y4DE 3CM0A 2VZ9A 2A14A 4MYCA 3A11A 5BVHA 4B3JA 2FTKE 5JNSA 5CVCA 2H5JA 1BOFA 2GASA 2PLWA 4G9EA 3VR4D 1FTNA 2P5TB 3SHWA 3Q8MA 1C9NA 4IEIA 3GRAA 4II3A 2E18A 3BJZA 3C74A 3WKDA 1M9NA 1GD1O 2IZ7A 3H3XA 5A0TA 1E3SA 4XSGA 1R9NA 1PDVA 2AMYA 4DQLA 5BSVA 4HYQA 3AI2A 2O06A 1MIOB 4Q1EA 4RXMA 1YT5A 3PZBA 4KW7A 4XJVA 3UK1A 4DUGA 2V0NA 1X8KA 3E4CA 3AIIA 4BNMA 4N54A 3WYFA 1G2OA 4JQOA 1QFSA 4PGGA 3H1EA 2FZVA 3NDRA 4R1OA 5CA0A 1NDQA 1Z07A 2BR3A 3AW9A 4L50A 5CT5A 4TMVA 3IKJA 3OM0A 4RF4A 4U2DA 2PE5A 1P1BA 1OI2A 2WUVA 1K5DA 1NLYA 4E07A 4QJIA 3SC4A 3TM4A 5HKKD 2OZKA 5BUCA 5LQUA 1Y9AA 5J9FA 4XFKA 1GV1A 2Q0HA 2DCMA 3ZD6A 1WPQA 5DCLA 4AKIA 2FW6A 1NF2A 4KXFB 3L0DA 5J5CA 1LJUA 4CM5A 2PU5A 5BSUA 3W06A 4XCVA 2H3HA 2AN1A 4M21A 3UWKA 1TKCA 4Z5XA 4TQAA 3HDHA 1PR1A 3QVLA 2ZIZA 5G0VA 1QHYA 5K3FB 4C06A 1SWVA 3DEHA 2PMWB 4Q1AA 1IEWA 2JI6A 1EVYA 2XNHA 3NHWA 2MSLA 1U2ZA 1A77A 2AT1A 3OZBA 4G25A 3I01A 1B74A 1U3CA 4CKXA 4CUZA 4Y0AA 5JXGA 4I08A 4H7IA 1QONA 3DEKA 4DBVO 3QMVA 2FK7A 3ROTA 1V11B 1F6DA 1MO2A 3LL4A 3PD0A 1ZUNA 4L2IB 4UAJA 5DP2A 2D2EA 4YUWA 3EZGA 3NWOA 4I4NA 3RASA 3L82B 4M22A 4ALLA 2FX3A 2HXYA 1GTJ1 3AEUA 1QNLA 4Q4HB 3ZIUA 1OVMA 2JRLA 4U7PB 2C7GA 1P62B 3FB1A 4WFKA 5JSZA 4NOLA 1F0KA 3BJIC 2V7GA 3GWGA 2H1FA 1B42A 2EGUA 3A4LA 3IL2A 3UAVA 2Y0DA 4REQA 4EUHA 1BROA 5L3QB 1AF4A 5BR4A 1ESZA 3DHVA 3NJ4A 1G7RA 1IQ0A 2YY5A 5DYWA 3W6OA 1Y82A 4OGGA 4R6WA 2XRYA 1HGXA 4A2WA 3D8SA 5ILGA 5HIAA 1N0HA 4B4KA 2DRIA 2ZSJA 2I4NA 5HZMA 3Q3HA 3ZE2B 3U7IA 1GO2A 2O0JA 4L02A 3UKOA 3V46A 5IJ9B 1YTUA 3H5IA 5HRCA 3O4HA 3BHIA 1BEEA 3COSA 4U2KA 3T3GA 1H2BA 2QU7A 4URXR 3IMEA 1TZBA 4B47A 5FORA 4WJLA 4YXWD 3B6JA 3N2NA 3G2QA 2ZAIA 1ADBA 3G6KA 4QU5A 4D7AA 4M9ZA 5EHZA 1LQTA 1XRPA 2W71A 4LHWA 1V5IA 4LI3X 4LOIA 5E2AA 4ALIA 2BGTA 2ZBFA 5EPUA 1N5JA 3F7NA 4QDOA 4TKMA 5EE0A 1BTOA 1JALA 4YQEA 2IWRA 3FMPB 3VH2A 1O77A 4ZHQA 1DOHA 4PG4A 3RSOA 3ILSA 1ILEA 1SKAA 2FE4A 2YHIB 4NENA 1LA2A 4PY2A 5FX2A 1L2TA 4TLEA 2NO6A 1IUPA 2PSHA 3OZVA 3JQ8A 3DOCA 1NQVA 1Y3FE 3CE6A 4N0PA 3TZQA 5BOSA 3I5YA 1Q50A 3FTQA 2OQIA 1FUUA 5TB5A 2YOGA 2HN9A 2PZEA 1H6DA 2BMDA 3AVQA 1LY1A 5AT1A 1PT5A 2C9BA 5JYCA 4Y98A 2C5FA 4C7JA 1EVLA 3L9XA 3G9TA 3EGIA 4XD7D 4H3SA 1A9RA 4Q02A 4C2AA 2NZJA 4PPNA 1RHUA 4ZYZA 1XV5A 3I34X 1QV9A 5B37A 4ZA2A 2VPYA 3WZMA 1MHPA 1LRLA 4V3BA 2B4AA 2VPWA 5K3AA 4EF4A 2PNJA 1N75A 2OBXA 1DFGA 1PSZA 1N2EA 4L0QA 4NX2A 4RVGA 3Q8XB 3QMMA 2BMVA 3GVHA 3TX2A 3L7BA 4ANFA 3GCGA 4LY3A 5JVDB 2APJA 3ZXXA 1ZJ6A 3DT8A 1NTOA 4X8HA 1WBJB 1ZJZA 4P4NA 2MWMA 1NMXA 2IU4A 2X1VA 2I54A 3JAWA 4FSHA 3G8BA 4G37A 3TQFA 3HVIA 3FOFC 3K9QO 2AJLI 4HKTA 2VJDA 2L82A 3SX4A 3TMYA 5C7LO 3LQ1A 3ORHA 3ISTA 4D0RA 4IZHA 1S2LA 1I1OA 2NM0A 4MV7A 3RJ5A 5BQ3A 2O20A 4F06A 5GVSA 3P94A 4KQXA 3IT2A 3OZCA 1OTHA 3KCQA 1E2EA 1T3HA 3GARA 2ERXA 1CG6A 1L5MA 2XTJA 4IVPA 4ZKEA 1PX2A 3PNPA 3ZDZB 5LFAA 4R1PA 4RKFA 2J6IA 1SELA 1W76A 1DG9A 1NW6A 4PLYA 4Z7OB 4YROA 3IKMB 5JW6A 2VF2A 1CXZA 3N74A 2A35A 1U8YA 1ECJA 2I9PA 3OI7A 4HRAA 2W2NA 3LC0A 1N4AA 3WKEA 5KEIA 5J2UB 3LU1A 2A30A 5P8WA 3GLGE 1ZAKA 3CLUC 5AJWA 3SDZA 3UW3A 1O8CA 2W00A 4I36A 3G85A 2FMUA 1AZWA 3X43A 2IEBA 4TWIA 2Z83A 5FQOA 3TQCA 1JA0A 1W94A 2CVOA 1NJ5A 2N75A 3Q0EA 5L3SA 3EULA 1ZZGA 1GGKA 3HKDB 1HG1A 2XKBA 2G9UA 4RPGA 2MINB 1Z7BA 3PYLA 1PJ8A 4U7FA 1PJ3A 4PX9A 4ZXFA 3VPBA 121PA 2ENUA 1XQ9A 5FBQB 4E6EA 1I3OA 4OK5A 4YA6A 3T7IA 1H2EA 1PU2A 3OQPA 4X8LA 5A02A 4JB0A 2I8LA 1ZEJA 1S3GA 5ALSA 5AW7A 4YX9A 4LWPA 4Q21A 1AA6A 2D6FA 1VXOA 2VPPA 3CURA 5I7VA 3LMKA 5LP6A 3BL5A 3ZV3A 4YEDA 3PQCA 1JEAA 2XX3A 4LNHA 3QELB 1PR2A 1MAVA 3UANA 3AIMA 2RGYA 4ZO9A 1VHDA 2YWHA 3EEFA 2JVKA 3G7SA 4IOJA 4DR4B 3R20A 1Z5ZA 4OGLA 3PFHA 2VK4A 3TTXA 1BMDA 1ORTA 1LBEA 1VZ3A 1S1MA 5LJLA 3D7LA 1DEHA 3TRIA 1VKOA 4YCSA 2ZZNA 4QFDA 4BP3A 3GLTA 5BRJA 1KJJA 3TO5A 2ZRJA 4R5MA 1PWXA 4COOA 1TOAA 1OTXA 3TR5A 1OA0A 1RWQA 3PUJA 3R0VA 4JD5A 1BFDA 1MX1A 2X2OA 4HQFA 2GVZC 2C95A 4PF1A 1MG0A 2X2EA 3U1BA 2X14A 1EM8B 2B20A 3H9JA 4JU8A 5C51B 1WG8A 4TWAA 5B1DA 1KKMA 2G7ZA 3A10A 3PUVA 3H1BA 3HYCA 4AX8A 2OHJA 3FMFA 5SZKB 4X71A 1QR2A 2QTAA 4MINA 1I2CA 4ZI7B 1O0SA 2GWHA 2R6AA 2Y1LA 3BYZA 2V7BA 3BMXA 2B61A 1A96A 3GGGA 3BQ9A 3ETGA 5ADVA 5EG5A 1J5EB 2GBLA 1CCWA 1FTSA 1XZQA 3EXHB 4QTZA 2R79A 3NQ41 4XJXA 1M1NB 2A0UA 3R3YA 4GOLD 2HSZA 1LSJA 3IUYA 5DYIA 3KAPA 5AUOB 3RCBA 1B0UA 1HQDA 1J06A 4PXYA 3AL0C 3P2EA 4LVOA 2AH5A 3DE2X 1SD5A 3PD1A 3F98A 4YRLA 1P1HA 2VK1A 1ZICA 1UANA 4KI7A 1W5SA 4QE3A 1ZWKA 2P2SA 3K9CA 1QVVA 3VBCA 4DJ5X 3C8HA 1DUVG 2X1HA 4TL6A 4WJZA 3UJPA 1KFKB 1A98A 1CVIA 3JASA 3TFOA 4UBMA 3HCDA 4KMRA 4WLFA 2AYYA 5B57C 4AQ7A 3MXOA 1P7CA 3A7EA 1KETA 4FWIB 4E21A 3A37A 3HYLA 4FE4A 4HDKB 2QT9A 1T2AA 5A7HA 4DQ0A 4FI3C 4MUNA 1KYWA 2CLOB 1U3TA 4M86A 4N49A 1E2UA 1QH9A 2CDRA 2WE7A 1ZD8A 1W4CA 1EIWA 2IYEA 2VYVD 1THMA 2FG7C 4TT8A 4F1KA 4HN9A 3QU5A 1LBTA 5DCYA 3FXAA 2WINI 4HRYA 4QG7A 4ZOCA 1ES9A 1F60A 1L3BA 3C8MA 4GPZA 4DXDA 1U0RA 1XFAA 1N5RA 2A5YB 2I6UA 1XP8A 5K3DA 1M8FA 3U4MA 1ULHA 3KVOA 4LGVA 4R2HA 1T1GA 1WKBA 4KO4S 1Q7RA 3AFGA 4L74A 2ZVJA 4N4AA 4J0CA 3FH0A 3V2IA 1L8AA 3RVSA 1DTSA 2PS3A 1A50B 2X8WA 1CULC 1D4FA 4O5OA 3IPXA 2HRCA 4LCJA 3BWBA 5L95A 3CRQA 1CEQA 1YDFA 3JQFC 3MM4A 2QVBA 4CJXA 4F93B 2MIIA 1Z5GA 3NALA 4DC9A 3QA9A 1LZKA 5HFNA 3UBMA 1YQTA 5CYFA 3CNEA 2G9ZA 2ON6A 3AG6A 4Y9RA 4NPHA 3CIFA 4FJ1A 3ZWCA 5CG1A 4EWLA 1NG9A 1CY2A 2VT7A 4CKWB 4YUZA 1CEYA 4CV0A 1TYCA 3JATA 3I6MA 1W6RA 3BRSA 1VTKA 3CRRA 4GP7A 4HRVA 2NXCA 4KO3S 3A25A 3AEXA 5ICMA 3F0TA 4E5NA 3BWYA 1PLKA 1M2VB 1SUPA 4TXJA 5BYJA 3A6FA 4L08A 5HMLA 3UTDA 4BZPA 2J30A 2I66A 3W1WA 1AQLA 4KLZA 5TPZA 4DB4A 4PN7A 2X40A 3U37A 2OXIA 4IIXA 4Q01A 3LW8A 5T4HA 1BE6A 1CQXA 3AZPA 5JCJA 1NU8A 2B4QA 2G5GX 2XE6A 3B2EA 4PYQA 1ORDA 2KBEA 1C1HA 1XVAA 4M8KA 1Q1GA 3OQIB 2GB4A 2FPGB 3MGGA 3QRWA 5B2EA 1XRQA 2OB2A 3BXHA 4KX5A 3ZWMA 3PC4A 1FP4B 5BSRA 2VH1A 4KN9S 1NXQA 2IX9A 2VDOB 3IEKA 3KDPA 4ZCRA 2Q3MA 4QGGA 5JV5A 2ZUFA 4NCKA 1KYIA 1Z7WA 3TK1A 1OLXB 2QN8A 3J80A 3ADCA