1DS6A

Crystal structure of a rac-rhogdi complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
181
structure length
181
Chain Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Rac-RhoGDI complex and the structural basis for the regulation of Rho proteins by RhoGDI.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 2
total genus 63
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2000-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ds6A00
3SNHA 2NO6A 2V1XA 5G53C 5SZHB 1WCV1 4C0BA 3I61A 2EFDB 2IYSA 2YOFA 2ZJZA 4NH0A 3A4MA 4B3BA 2OLKA 2OBMA 2O0KA 5BW8A 1GFIA 2C9CA 2HT1A 1N5LA 4QGAA 2QNRA 1SGWA 2HXYA 3OEEA 2W2VA 4DXAA 1HYQA 1P5ZB 4LJ7A 4RD1A 3BWDD 3QBTA 3F3YA 4IXNA 5G3ZA 3D6TB 3JZAA 2ZE7A 4A6XA 1XRJA 4TMKA 1KYIA 3K9NA 4ABYA 1OPXA 2AR7A 3GJ5A 3K0FA 3PIRA 3ZGXA 3BB3A 2G83A 4M1KA 1UKZA 1KNQA 1TAGA 1VMAA 2ZIAA 4KITB 2XSZA 5FBLB 4QOSA 1TQDA 5CLQA 4BE7B 1W4RA 3A58B 5AK0A 2ZJOA 3AVPA 4F4IA 1G18A 1U94A 1VDZA 3PUYA 1GSIA 2FEMA 1VCMA 4WOPA 1ZNYA 3ADDA 2GK7A 1QHXA 4D25A 4U7DA 4PX9A 5TMPA 1NY6A 1QHNA 4CF7A 1MKYA 3ASZA 2ZRMA 4ESHA 3KKQA 3GMTA 1XD2B 1KK1A 3A36A 1E2EA 3BBPA 4MKFA 1N25A 3CR7A 2R65A 1E6CA 1JNYA 3CWZA 3NKVA 4RZ3A 3I32A 1P2SA 1KJZA 1W1WA 3U4QA 4KYUA 1C9KA 5DE3A 3EZ9A 1DAIA 2OV2A 1L4YA 1V43A 4AKIA 1NJGA 3RS0A 3TW4A 1YR9A 2ZETA 4CRWB 2WWFA 5BXQC 3B8HA 1FQJA 4CEHB 3KDSE 3I73A 1NN5A 1XXHB 2QE7D 2YYZA 2Z4SA 2XGJA 3N2IA 3CRVA 4UNNA 5CLLA 1C1YA 3QOFA 5L3SA 2AKYA 4UXHA 1SXJA 1YQTA 4JLMA 5K8IA 5K8LA 2WSSD 1ZC3A 3W5JA 4F91B 4P3YA 3LXRA 4MDFA 1LS1A 4PR0A 3DZ8A 3LFUA 4EIWA 5KO2A 1E2MA 1N0WA 2FFQA 2WWIA 1E2HA 1KJWA 2BOVA 3KB1A 3MCAA 4B2PA 2NMVA 4QJ5A 3SYNA 1R0ZA 1ZUIA 1U9IA 1TQ2A 1G6OA 4NE2A 1CR0A 3THOA 2FH5B 1GKYA 2WOJA 5GVRA 3REGA 4Q1CA 4URWR 3GEHA 2IXGA 2J7PD 2WKPA 5BN4A 1WRBA 3AP3A 3REFA 4YLGA 1UF9A 2W6JA 3U7EB 4NL4H 3ECCA 2ERYA 2DYKA 2FJUA 4N0EA 5L8VA 1GNRA 4C9BA 4LYHA 1R6BX 1TF5A 2I1VB 5EXXA 1I2DA 1AN0A 1VG1A 4TQUS 4D4JA 1KI2A 1LY1A 4MKHA 4YDSA 2WMOB 1CIPA 4A92A 2CJWB 2YNMA 2R6AA 4UNQA 1Z6TA 2RGNC 4HLCA 4TMTA 5J4HA 4FCWA 3KKNA 4D4KA 3B78A 3UWKA 3G82C 1COWD 3PENA 3CNNA 2O8BA 3NDPA 2QN6A 5KOYA 4JLNA 3K1JA 2HYIC 2JLZA 2EWWA 3LVQE 2ZJYA 1JECA 5L3VA 1QVAA 1XMJA 4JLBA 4Q9JA 4B2LA 1CP2A 1ZCBA 2QE7A 1SXJE 2ZI7A 4TSFD 5JJLA 4KYIB 2OCYC 2Y8EA 3LNCA 5EXTA 4DT1B 3QXCA 3GJ3A 1FOEB 1T0HB 4RCYA 3K0CC 1E0AA 4G5GA 4LK2A 4PQYA 3CWQA 4PC1A 3X1DA 3OF5A 1RFLA 3C16C 5IT5A 4OHZA 2J7KA 4NYIQ 4W7SA 4KFSA 2IEZA 2VSOA 3U3OA 2GF0A 1XXHE 2G6BA 4XOIA 1L7VC 5DYGA 4PC3A 1AQYA 4ARZB 3GLGB 1UEJA 1XX6A 1E0KA 4GOXA 1DG3A 3SEAA 3AKCA 2VSXA 2V55B 3LBIA 1LW7A 1DPFA 3W90A 1YZUA 4BFWA 4FIDA 1FP6A 1P73A 3CM0A 2AHOA 1CR4A 2XEXA 4M9SA 5DSZA 5E95A 4M9ZA 4PFSA 1EFUA 3FKSA 4M1OA 5GJWC 4PO1A 1GG2A 2DWPA 4TTQA 4JT4A 2RAPA 1P3JA 3SJAA 1M74A 1IY0A 1M34E 5A5GA 3C5CA 4CGZA 3IGFA 4DLUA 5J4VA 3SJZA 4HB0A 3U7HB 2YZ2A 4DIDA 1R8QA 1G5RA 2YJTD 2IBMA 4Q1FA 4ZPXA 5KSYA 2G0TA 3UMRA 1O3YA 1PUIA 4BLOA 1Z3IX 3VNVA 2QM7A 4JL5A 4JVNA 2IHYA 3QBVA 3RAPR 1PLLA 1EGAA 2C99A 3BD9A 3GEIA 2QBYA 3MG9A 4X8HA 5BN3A 3A1TA 4DLXA 1M8PA 2VYFA 4LY6A 2WM9B 3TW8B 1WB9A 1ZJ6A 3U61B 4KSCA 1AGRA 5GADl 4C0JA 4DIEA 5FBQB 3SOPA 2W83A 3CH5A 4M1MA 2GJ9A 1G8FA 4PC2A 2ONJA 3AEZA 4OQMA 2B7BA 1OFIA 4E09A 2QQ0A 2EYQA 2VHJA 2O8BB 1BYUA 1RW4A 1HE1C 1Z08A 4KODA 3KJGA 4C4PA 3IEVA 4IDQA 2QPAA 1TNDA 2WJYA 1NG1A 1QG2A 5FUVA 1NVUQ 4P0TA 3IO3A 4O25A 1P62B 4UXIA 2GCPA 4FMDB 4J0QA 3B5JA 4NCJA 1N6RA 1Z6AA 4CW7A 1IJFA 4JL8A 2QROA 1UJ2A 4D82A 3RSOA 2OHFA 4URVR 1COWA 2E87A 3P4XA 4OHWA 3HU1A 2NIPA 4G1UC 4XWAA 4H9GA 4US2R 1RPZA 2FU5C 2ZE8A 1CJTC 2I1QA 3NH9A 1T3LA 2G3YA 3CRW1 1F2UB 2WSMA 3ZVLA 4TSFA 5JZVA 1XTQA 1X86B 2ZXUA 4PQFA 2P6NA 3C41J 4H1UA 3EA5A 5DHFA 5KYKA 3S1AB 4LOAA 2F1IA 5E7MA 4TL9A 3KQNA 1VTKA 1E4VA 5D3MA 3MJHA 2ODNA 4QXAA 1G8YA 4C0AC 1KI6A 2TMKA 3TQFA 1XTIA 1IBRA 2IC5A 3GJ4A 2ZSFA 4IKEA 1W7AA 3K9GA 2VLIA 4IVPA 1B23P 1TEXA 1E9SA 2XXAB 1XFAA 1E32A 2C98A 3KZ1E 3CRQA 4LV8B 4PO8A 5EE9A 5P21A 3T1VA 5CK5A 4BFXA 1W0JD 2RGGA 1W2HA 3ONWA 2ZEJA 4BLTA 1SHKA 4MUAA 1TQ4A 1UKEA 1Q3HA 4JKYA 3DKVA 2R62A 4GRAA 1WXQA 1FNMA 1X1SA 1XZQA 2JATA 4BLQA 2QRZA 3FTQA 3OEHD 1M7HA 4D4MA 1KK3A 2Z83A 4HLDA 2IYLD 4LCBA 4AI6A 2ZYWX 1LFDB 1T0JB 3HYTA 3UMFA 4A1FA 3L8ZA 4CEHA 1ZM9A 3CF0A 3GLIE 2BKEA 1AKYA 1V5WA 1IOZA 2AK2A 3A8TA 3NBZC 3KQLA 1KOFA 1BMFD 5FPKA 1LF5A 2ZRAA 3CX6A 2C04A 3L8YA 5B2ZA 2IYUA 4WZBE 4V02A 2H16A 2W2XA 2FPLA 3LV8A 3Q5EA 1D2EA 1NJFA 4HLUA 3EASA 1XD9A 4ITRC 4DEYA 4ZDKA 4QM7A 1NVWQ 2ANCA 4A0GA 2VTKA 3OZXA 1EFRA 2IW3A 1KDTA 1NN3A 5BN5A 2A5JA 4DB2A 3SHWA 3T12A 2XNSA 1TPZA 2XZPA 2Q3FA 3N70A 3KTAA 3BRWD 1Z0FA 2A9KA 1E2QA 3M1IA 5EP4A 3TUIC 4URUR 3K70C 521PA 1JALA 5KTYA 4MKIA 5FI1B 3WBKA 1E0JA 1IXSB 3NG1A 4F93B 3A1SA 5K8UA 5TXGA 4Q03A 4RKEA 4M1TA 4NBSA 1I4TD 1OHHD 5CJPA 4KI0A 3MJRA 3CF6R 3Q8XB 4ILEA 3TSZA 5D3MB 3L2OB 1KO1A 3CRMA 4NYJR 421PA 2H5EA 3NHBA 4LV5B 3OEED 3LO5A 3QY0A 4A2QA 1JQLB 2ECKA 1KIMA 2ZRIA 1KY2A 2Z4RA 1VG8A 2HCBA 1EX6A 1OFHA 1DAEA 2IYVA 3AVTA 4AG5A 3KJHA 3C8UA 3MSXA 1NG9A 4MQBA 3IILA 3TGPA 1RKBA 2GJ8A 1OXTA 3OIWA 4KO8A 4R2HA 1IN4A 2NG1A 2YVUA 3AF4A 5JBQA 3AUXA 1N6OA 2GK6A 2F43B 3P27A 1QVRA 3MWJA 4JSTA 4P4SA 3V00A 4G0NA 3R8CA 3QKUA 1F3OA 3ZYCA 2QQEA 2YV5A 3W5IA 2IX3A 3LX5A 3FKSD 4B3FX 3F0TA 3R20A 4R9UC 4TYYA 2O8EA 3EZFA 3IIMA 4HAWA 2RGNA 3DM5A 5C4GB 2QTFA 4OQNA 4NCIA 2ZR9A 1PLJA 4NCNA 2VHUA 3PEVA 3QF4A 2IF2A 2V9PA 3BC1A 3LD9A 1ZM7A 1G16A 5EXPA 1E69A 1Z63A 2OFXA 4XVRA 4HATA 1VYVA 1XBTA 3GD7A 4PZZA 2J0UB 2IEYA 2PZEA 2GWHA 4OI0A 5IRCD 1MO6A 2DBYA 2PLFA 3MMPA 4TL6A 5JSZB 4BZPA 3GJ0A 1E2IA 1UM8A 2AN9A 4EPVA 1QHSA 3ADBA 4MKGA 4EPWA 5FR1A 1D5CA 3VQTA 2DFLA 2IYQA 3CUEF 4M1SA 5EP3A 5AWFC 1L2TA 2CHVA 3EZ2A 1FNNA 1Q44A 4GOJA 3J81k 2IS4A 3I8SA 3OE7D 3QVUA 2Q21A 3O8RA 3QENA 3NH6A 2OO7A 3IIKA 1S1CA 1MRSA 2AD1A 4FW9A 4LJ6A 2J46A 2ZYUX 1ZYUA 1Q21A 3K9LA 4IDOA 3DHWC 5FOWA 2PT7A 3D7MA 5DYIA 2D74A 2F1RA 3UK6A 4DDTA 1QHHB 3QSYA 1Z2CA 2CNWA 4WBSA 5JS7A 4LDJA 4OQFA 1XZPA 2R6FA 2ZRCA 4U5XA 2J0QA 1AGPA 3EPJA 3AVXA 3T1QA 5DO9A 1VHTA 1T3HA 1E2NA 4NYMR 1E2LA 5JEEA 4PZLA 5AJXA 1Z8FA 1P9RA 2J7PA 2F9LA 3AF0A 1E2FA 1U2RA 5JFGA 4TYWA 2DR3A 3DKPA 4NYMQ 2B7CA 1D2MA 4NMMA 1T9HA 1JXMA 4B43A 1FX0A 3DMDA 4G5SA 1JQJC 3T1TA 1R8SA 1U90A 1CKEA 2PCJA 2CCJA 2PX0A 3RRZA 3TH5A 2IWHA 1G3MA 2VQSA 1SVSA 1HE8B 1P2UA 2BIFA 3LRPA 4HAZA 2RGAA 3VKWA 2D2EA 2GXQA 2YWFA 4X8MA 5DN6D 4UNSA 4ZI3A 621PA 3ZZTA 1BIFA 2FF7A 1ZVQA 2D06A 3HPRA 2GNOA 4Q9HA 3IEUA 3TMKA 2AXNA 1R5OA 1G8HA 2FZLA 3RLFA 2QBYB 4UNRA 3FFAA 1XMSA 3FMPB 2XAUA 1XCGB 4M9QA 3ZQ6A 1KK0A 4EPYA 4QM6A 4PPGA 2QTHA 4PHTA 2MMGA 1MO4A 1W36B 1X1RA 3FHCB 5KUTA 2ZREA 1G7TA 1DVRA 4B6EA 4YMUA 4QL3A 4AWXA 5JSZA 5KNDA 1W47A 2FPKA 2VSFA 1NKTA 2YWEA 4QC2A 2JJ1A 1NF3A 1NLFA 2P6RA 1R2QA 1U8ZA 2R9VA 4HLQB 5EE0A 2MSEB 1A2KC 3ND8A 4ZI2A 5FH9A 5J4KA 3PR1A 5EZ6B 1RYHA 3SYLA 2J0UA 3L0SA 4QBHA 2FFBA 2WIBA 2IUUA 1ESNA 2XITA 2JLSA 3QKSA 1OH7A 1OYYA 1NIPA 4A2WA 2OEPA 3B1YA 4WXRA 3SDZA 4GP6A 4AYXA 2PMDA 3H84A 1NSTA 1EFTA 4M1WA 1X6VA 3HU3A 1UFQA 4KVAA 4OKSA 4DSUA 2ZJBA 1U8YA 3UMSA 1ZU4A 3U2QA 4BEJA 1WDTA 1ZNXA 2J5XA 5LB4A 5C46F 3MRSA 3HPQA 1HQCA 4QHYA 3B9PA 5B64A 2XNDD 2QMEA 2REXB 3AQ4A 4PZYA 3EARA 1W4BA 1KI9A 2CXXA 1II0A 1W44A 2ZUDA 2R6GA 3CKLA 3P26A 3VKGA 2GVDC 2ZPTX 4Q4JA 1UBGA 2D7CA 1OB2A 1JBKA 4OHXA 3R7WB 4Z8YA 1KI6B 3TKLA 4PQRA 5DHAA 4BQSA 1LF0A 2A2ZA 4LHYA 4LYAA 3VHXA 4LX0A 1IN8A 3UANA 3B6EA 5FR2A 1NBME 1Y3AA 2HLDA 3DO6A 4KLZA 4Q9KA 1Z47A 4CZ2A 2F9MA 4YMWA 3KFVA 4LC1A 4DDWA 1VYTA 3DVLA 2G1KA 2IXFA 2ZRBA 1HUQA 1P60A 2GJAA 2VL7A 4AYTA 3EW9A 5H68A 5A0FA 3ZS8A 4JL6A 1XJQA 3KTAB 2C9YA 2W58A 2WKQA 1XD2A 4PC6A 4Y0VA 2GDJA 3THYA 1S3SA 2QM8A 1EESA 2QP9X 1OXXK 4LC0A 4M53A 1M2OB 2O8FA 5LD2B 2B8TA 2DWOA 2IUTA 4BUJA 1ETUA 5L3SB 3K09A 4D0NA 1DADA 1RIFA 4L5BA 1NVVQ 1P75A 1W49A 2O0HA 5DLQC 5BWMA 2OLJA 1XCPA 3RS4A 1O87A 4KFUA 3ZDQA 3K70D 1WE2A 1ZD8A 3HJNA 3PUWA 3I92A 4B73A 1OE0A 5CB6A 1MABA 5EE3A 5KDLA 1KDOA 1F60A 3RWOA 5DI3B 4YONB 4IVQA 5LPNA 1VCIA 3LQRA 3V9PA 3RC3A 1MO5A 3EPLA 5FPHA 2XOKA 1EG7A 3OEHA 2C03A 2GAAA 4FMCB 4JLAA 2MSCB 2BEJA 4Q02A 2F1HA 3A6PC 2JDIA 3VU9B 5B58C 1M6NA 2CDNA 2IWRA 1U98A 1P6XA 2ZYVX 2ZAMA 1CU1A 4R2IA 2ODWA 1E2GA 1OKKD 4Q1BA 2XJ4A 3LY5A 4K8OA 2PJRA 3CPHA 2CL7X 2Z6VA 2VP0A 4DCUA 2CE2X 1XTSA 1FX0B 3GQBA 1N6PA 1YZTA 5G41A 1VPLA 3GLHA 1E79D 1YVDA 2VA8A 1ZIPA 3L0IB 3VR2A 4JJZA 4LZZA 1DAMA 4IDPA 3WRYC 4DSNA 4TMZA 4DZZA 1KZGB 2VP4A 4B3DA 4AK9A 2RMKA 4LHZA 4JZKA 1E9BA 5CM9C 2G9NA 4IXMA 2ZUBA 4Q4HB 3SZRA 3GLGE 1CBUA 4EJSA 1ZMXA 4ZCIA 1U0LA 3K0SA 1XJCA 3U3MA 1YR7A 5TVKA 4BPBA 2CK3D 1HT2E 2FGJA 3QPVA 2GZHA 3B1ZA 2HLDD 3CIOA 1CTQA 1XCMA 2A30A 4Q47A 2CE7A 2CMKA 2P67A 2WBLC 3EIHA 1BKDR 4AG6A 1FW6A 2J41A 1G20E 4BFZA 1KI8A 3GEEA 4I99A 3BJIC 2B21A 3R8FA 3OE7A 1H8HD 1IN7A 1AA9A 3QG1A 2IF0A 4V0KA 5HPYB 1KAOA 2VP5A 1TU3A 1QHIA 1N6NA 2ZS7A 2WMNB 3B82A 4WW0A 4BRUA 2ZRGA 2EQBA 2FEOA 4ZCLA 2OFWA 1KKMA 3THYB 5CITA 4JBXA 1CEEA 5HE8A 4PHFA 2P0EA 3O8DA 4YXWD 4JLJA 4JLDA 2JIZA 4Q4LA 4BFTA 4LRWA 3W8NA 3MD0A 2ZI9A 4YXWA 1NVVR 1GP2A 3RVBA 1OV4A 1XEFA 2ZRDA 5L3QB 2E1RA 2P5TB 1G21E 1JAHA 1Q1QA 1DE0A 1T4GA 2R2AA 2ODEA 1J8YF 1GRNA 2WWWA 3M4YA 3QKRB 4Q4AA 3F5FA 3WNCA 1NSFA 1G8GA 2PZFA 2GETA 2ZS9A 3IO5A 1AJEA 4B76A 5GJVC 2GRJA 1RZ3A 4OYHA 5CM8B 1T3SA 1VKJA 5F9HA 1L4UA 3H86A 3Q85A 4TLEA 1OIVA 4JKIA 4D81A 3THWB 4HUQB 4MRPA 3TRFA 4DHEA 2IYZA 3LWNA 5HR5A 1OH5A 3UXMA 1AKEA 4FN5A 4BLPA 2WICA 1SKYE 1VIYA 3VX3A 2ZI5A 2ZSAA 5FBRB 1G17A 1NMYA 3Q9LA 2F43A 1G64A 4P4SB 4B3GA 1WBDA 5FTKA 4IOLA 1EWQA 1OIWA 4JYCA 2V54A 1Z29A 5E3HA 1DEKA 821PA 4AKEA 1MO3A 2GKSA 1UBFA 4P4UA 5JHGB 2JLRA 1SZPA 3AP1A 2GXUA 2QG6A 4DLZA 1X3SA 1GIAA 1QBKC 1OHHA 5EZ5A 1G7CA 2OAQ1 1G7SA 2GZDA 1SXJB 1PZNA 5L3RA 3KFXA 3TLXA 5FL3A 4Q4HA 3AKYA 3GFTA 1E9FA 1TL7C 3W3ZB 2ZI6A 5DGXA 4NDZA 1Q1BA 1Z6GA 4IFEA 2Q9AA 4AKHA 1D9XA 1IY2A 1J8MF 3FE2A 4L9WA 3WYAA 4EPTA 1T6NA 1FL9A 2W2TA 2WIAA 4H1VA 4QBGB 4A6PA 4DCVA 1I4LD 4LJ5A 1OLOA 4JLOA 5EE1A 1KMHB 3U60B 4NKRA 1T8TA 1Z07A 3AVQA 4FMDF 2PMKA 4RY2A 2XZLA 2WSSA 3ADCA 1SXJD 2QAGA 2QZ4A 2V4ZA 3EX7C 4DT1A 2EYUA 4M8NE 1XTRA 2J0SA 3VU9A 2ZVQX 3EZ6A 4CIDA 4FCVA 2NPFA 1OXVA 5H70A 2CJWA 3AP2A 3RWMB 1FMLA 2EFGA 3WP1B 3B13B 1DG1G 5KSPA 4ZCMA 4D6PA 2MMCA 1KK2A 3KXIA 1J7KA 1G19A 5CB8A 2R6DA 1XU4A 1GWNA 1IXRC 1TEVA 2X19A 4EPRA 1OFUX 3L0PA 3K0AA 5B30A 1UADA 2JLQA 3CNLA 3K09C 3TJZA 4LJYA 2VIIA 1KI4A 4YQFA 4OHVA 4RD0A 2P65A 1II8B 4NCKA 1XEXB 4B3XA 4D2IA 2W6JD 2QAJA 4FWIB 2GTPA 4XTRA 1E2JA 3GJ8A 5AUPB 2L0XA 1EXMA 1G3QA 1RRPA 3AUYA 2G88A 4K46A 4FMBB 1KSGA 1VCOA 2GXSA 3R9WA 2BJVA 3T5GA 3FMFA 2ONKA 4US1R 3KB2A 1FTSA 2HF8A 1R0XA 4B3CA 2ZSDA 3RHFA 1ZD9A 4U00A 3RDPA 3VKHA 4URYR 4LV6A 2NO0A 5JWHA 3H1TA 5FPYA 3EG5A 3WYGA 5CDFA 5J5CA 2BHRA 4A2PA 8OHMA 5F3WB 2Q3MA 2HXSA 1W46A 3PUXA 5FTJA 1U8AA 3IDQA 2D2FA 3VHLB 1K5DA 1E3MA 1DARA 1IJEA 1JR3A 2GESA 2KJQA 2VP6A 1KGDA 3LH5A 3M0EA 1ZM3A 2OAP1 1WF3A 2O52A 3U44B 3W8RA 1E2PA 4RCZA 1ZRHA 3EIQA 3I5YA 2X2FA 2O8DB 1OJLA 1DS6A 5EP1A 1GM5A 1AK2A 3Q5DA 3NHAA 1F48A 3QF4B 3QPUA 4RFSA 4C7OA 2NO7A 3VMFA 4E22A 1JJVA 2F1JA 2XTNA 4B71A 2H1LA 1OH8A 1IXZA 2QSZA 1BYIA 2QAGC 1PJRA 3A37A 3DL0A 4L9SA 3NXSA 4RJLA 1WA5A 1KMHA 2J59A 5C18A 2N46A 4C2TA 3SBDA 4NP6A 3K53A 2KE5A 4WA7A 2QENA 2A3RA 2IYYA 3H2YA 2BM0A 3QEOA 3I72A 2WOOA 1XTKA 4BRWA 5AUOB 1Q22A 2FDCA 2CLCX 1K8RA 4HSEA 1RRFA 1E9EA 2WJHA 3PV0A 5DI9A 4DUGA 3MGCA 4LJ8A 4LJ9A 1ZCAA 5KSOA 2A7QA 3QXXA 3OHMA 3WY9A 2ZJAA 1GKIA 3U5ZB 1MR3F 4EKDA 1CULC 1KO4A 1CLUA 4EJSB 1A82A 1M7BA 4OHYA 1N6HA 3H0KA 4JLVA 2BBTA 1HH4A 4MRVA 3OFND 4RKFA 5TY0A 4TYPA 4KAXA 5AR1A 1XEXA 4KV9A 4PSAA 1XEWY 3LDAA 3UKDA 3AF1A 2W0SA 2K5UA 3IIJA 3NEYA 3RABA 4HLUC 3SFZA 1S9DA 3ZZUA 1KNXA 2QEQA 1ONBA 2FN4A 2ZROA 4O2LA 4EAQA 4W5WA 3PEYA 1RRGA 1ZNZA 3BIFA 5J4YA 3PXGA 1UKVY 3AB3A 3HDTA 4G5RA 1ESMA 2EFHB 3B1XA 1YHNA 5FOVA 4D0LB 1JPJA 2WPDD 1Q1EA 4HAYA 4PC7A 2JJ2D 2ZSEA 3EIEA 4Q5IA 4WZAE 5UKDA 3CO5A 1KO5A 4GI7A 4IJMA 3EA0A 4IDNA 1HY3A 4EFLA 1YZGA 2J1LA 4KFTA 1KI1A 1ZD1A 1E79A 1YZNA 1Z0JA 3QG5A 4AIIA 1GZSA 2CEAA 2WKRA 5J40A 3X1XA 4IOJA 4TN1A 4XH9B 3U3KA 3QXHA 4C7OB 3EAQA 1OF1A 3GJ6A 4XVQA 4YMVA 3IQXA 3ZVMA 4XTCS 4LPSA 4XD7D 1OKKA 2VPPA 3B85A 1JEEA 5AUQA 3X1ZA 2QP4A 4Q1DA 3WHLA 2FSIA 4KVGA 5JI2E 3MFYA 4Q19A 3OAAD 5FBWB 3KL4A 2YC4C 3K0CA 3THXB 1P4SA 4UJ5A 2C9OA 4DB4A 2QMUA 2HEIA 2HUPA 4NZYA 3AVYA 1ZBDA 2X2EA 4B75A 1IM2A 1PLKA 2I3BA 2BWJA 2VHQA 4F7WA 1T5IA 4US0R 3C14C 2P3SA 4TZ0A 3X2SA 1VG9B 2NZJA 4A8JA 3V4RA 4HB2A 1K6MA 3FOZA 5H8WA 2WWXA 3I4LA 3KKMA 3NBXX 3QQ5A 4GMDA 2JEOA 4UXJA 1HQYE 2YWHA 1VECA 4LHXA 1H8ED 1W0JA 2QPTA 2DCUA 2VF8A 2ZYTX 4MITA 4Q66C 1S96A 2GCOB 1US8B 2JJ2A 2IYRA 4FMCF 2EFCB 4MRNA 2BC9A 3EPHA 1Q3TA 2CCGA 1Z2AA 4C0LA 2AX4A 1E9CA 3O8BA 3OFNA 4RFVA 2C5LA 1G41A 2V7QA 3OIUA 3LLMA 4JJKA 2AFIE 3A4LA 2PL3A 2HDNB 2G1JA 2JAQA 2J0VA 3FFBA 4W9MC 2YHSA 2CK3A 1ZM2A 2XNDA 2WVJA 4QBFA 2IHBA 3ZD7A 4Z1MD 1UDWA 2GBLA 1S1MA 4M9XA 1WMSA 4A15A 2O8DA 5KNCA 1PUJA 5DI3A 2N1BA 4PAOA 3A1VA 2AL7A 3AGPA 5CIQA 2NQ2C 1UBCA 3A1UA 4TWZA 1DOAA 1KO8A 2FZ4A 4LUCA 4MGYR 3AF3A 4NHOA 4PXAA 2GVZC 1G9XA 1XB2A 3P1JA 2FFHA 4HAXA 1JB1A 3B2EA 3QPWA 1KAGA 2E9SA 3CX7A 4LJ4A 3VX4A 3LVRE 1GL9B 4ERNA 4TLBA 2WJGA 2FWRA 2OXCA 1XF9A 3TR5A 4EFNA 2DWQA 4CEIA 4LBZA 4WVFA 4L16A 5JEDA 1P2TA 3N2EA 3FB4A 4B44A 4R98A 2ZJ8A 3QKTA 1AS3A 1G8PA 4P31A 1LTQA 1E9DA 1S4QA 5JECA 5F2EA 1NBMA 1H65A 2IA5A 1G3RA 1YR6A 2EWVA 2VEDA 4GOKA 1SVWA 1AQUA 2BCGY 2CHQA 3TVTA 3HYRA 3ZVRA 2C78A 1K5GA 2VP9A 4OQLA 3DMNA 4I4LA 4ZDJA 4CT5A 3TUJC 4U02A 2GBLC 1GOTA 4DVGA 2OCAA 4TYNA 4ZIRB 4LHWA 4JS0A 2BBSA 2NTYC 3ETLA 4JT2A 3NC1C 1DAHA 2V6JA 4MH0R 3BFXA 5TARA 4GNKA 2XJ9A 5IK2A 1TF2A 2ZUCA 5CYPA 1ZAKA 4N0DA 3UATA 3IPXA 2BMFA 4YC7A 2BBOA 5JCZA 3W6NA 1TU4A 2ATXA 1ZU5A 4PPFA 2DHRA 1F2TB 3U4QB 5HCIA 1NRJB 2ZI4A 3HR8A 3I3SR 4WIAA 2HJVA 3NEJA 5AJZA 2OUKA 3GCGA 4C0SA 2HJGA 2LKDA 1ODFA 1Z0IA 3SN6A 2F55A 3AVVA 2MSDB 3R9IA 4A9AA 3BH6A 3KJEA 1NIJA 3UPUA 3TK1A 4HB4A 4N3NA 3BB1A 5GJBA 1P61B 1T91A 4HEJA 3P4YA 4V0MA 3L82B 3O8CA 2GHIA 4HI0E 5FOUA 1XNJA 4G01B 3B9QA 5DIFA 1ELOA 1X8KA 4L15A 4IEEA 4Q18A 4DEXA 5HKKA 3R9XA 3SQXA 2DFNA 2GF9A 1KSHA 3EWSA 4P4TA 4N1AA 5FTMA 3PEUA 1YZLA 2XXAA 4QG7A 3NTUA 2WZQA 2ZRJA 1D9ZA 3T06B 2J45A 2AD5A 2GEUA 2RB4A 3QNUA 4NPHA 2QI9C 2ZITA 3RC8A 1F6BA 2WV9A 4MA4A 1GVNB 1TX4B 4HDQB 2FNAA 2C8VA 2YC2C 4Q7KA 3I8XA 5SZKB 1NMZA 2ZRNA 1RRCA 3ZIAA 2FOLA 3THWA 1E4YA 3RS5A 2DFTA 4TMVA 4Q7JB 2C2HA 4KFRA 4AC9A 3FMIA 3M6AA 4Q4JB 2QUZA 2F3RA 3OAAA 3L0OA 2QL6A 2OXRA 3FVQA 1TUEA 2VHTA 2UVQA 1U9IC 3RSLA 4OBEA 5JJKA 4BLRA 3GLFA 1W4CA 1KDRA 5FUYA 5DISB 3AVWA 2R8RA 2Z0MA 3D3QA 4GPTA 3NC0C 2AK3A 2ZAOA 2O0JA 2WHXA 2G77B 3VR5A 2JJ8A 2RGDA 4XVUA 5KNBA 3GLHE 1CS4C 2CNWD 1HV8A 3AKEA 1JEDA 3X1WA 4EPXA 1C4OA 1SKYB 1MH1A 1JXOA 2A5FA 4PPNA 4DLWA 3CH4B 4Q7LA 5DNYB 2C77A 3WMFA 3B1WA 1F2TA 1KI3A 2GEVA 2RGEA 2D62A 1QF9A 4Z54A 2XB4A 3E1SA 1OFTA 4BGDA 1Z28A 1SVOA 2AWOA 5EUQB 1AIPA 3QEJA 221PA 4CVNA 1HEIA 1XMVA 1MOZA 1HT1E 2PCLA 4DLVA 1A7JA 1Q1ZA 3KQUA 3MAAC 1R4AA 4WAUA 4URZR 1I2MA 1QZXA 3P20A 4QRHA 1VYUA 3WMEA 1Z0DA 5K8TA 2BMDA 3ZS9A 1IN5A 3KJIA 3MUFA 4Q7MB 2QGZA 2FSGA 3C5HA 3V4FA 1N3BA 4ON9A 2O8CA 1JR6A 3CPJB 4JVSB 2GEDA 1NBMD 2ZSBA 5AJWA 4EDHA 2BVNA 1XP8A 4Q4AB 3K0FB 3OIYA 2ATVA 3SE0A 3PCRB 4UNPA 1S9HA 4RZXA 1BS1A 4QNRA 4JVMA 1MT0A 4JVLA 4DKXA 1FMJA 2FX3A 3CRRA 4EQ6A 2BMJA 4S35A 1R5BA 1VHLA 2GILA 2CLSA 2H8KA 4Q01A 5B57C 1EFRD 2DB3A 4DWJA 4CEJB 1NLZA 3C15C 3CF2A 4IW3B 5EP2A 3PITA 2V8OA 1S0UA 2X1VA 3AVOA 3FHOA 1FZQA 2OM2A 1XPRA 4M22A 3B1VA 2Z5FA 1Q0UA 2A78A 2V6IA 4DSTA 3FKQA 2Z43A 5IHPA 4KU4A 5CDFE 3U6KA 2UKDA 1E1QD 2VF7A 4CYMA 2HF9A 4Z1MA 2V1UA 2BDTA 2A5DA 4DCSA 2CLDX 5FTLA 5IK2D 3WNBA 3CZPA 1H8EA 3K0EA 1ANKA 2ORVA 1TMKA 2QRNA 2XZOA 1QHYA 2WJJA 3RYTC 4NU0A 2IS1A 1E0SA 5H1YA 5FOTA 2EFEB 5FTNA 5HZHA 1UDXA 4TTRA 1OW3B 2LWIA 3T35A 1AS0A 3PG5A 1KO7A 5TV2A 3NBYC 2OFOA 2KBEA 3NBFA 4MRSA 2NOAA 4JLKA 2BEKA 4HUTA 5JWRA 2ZRHA 2ZS8A 1E1RD 1N6IA 1YE8A 2F6RA 2FMXA 4LI0A 4EFMA 3ASYA 5HCNA 4LHVA 3DOFA 4DLRA 3C7KA 1F2UA 4M4SA 3EC2A 1N0VC 4QGHA 3T34A 5JMTA 2CVHA 2ZE6A 4XJXA 1YZQA 4MYUA 1DBSA 2A5YB 3Q72A 4B34A 2Q9CA 4LBVA 5L3QA 2JIZD 3QJYA 1NN1A 2PX3A 4BFUA 2ZRFA 1N5KA 4Q1EA 5JRJA 4TL7A 4TLDA 1G5PA 4NYIR 3GLIA 4DJTA 4DDVA 4MDEA 1UKYA 3HU2A 4IOMA 4QFMA 3SC3A 2XB2A 3K0AB 2KSQA 4KXFB 1XJ0A 1EK0A 4CEIB 5CJ2A 3KQHA 4C0QC 1OB5A 2QORA 3DDCA 4F92B 2JLXA 3WBJA 3D31A 5DH9A 2RKOA 2ZRLA 3BB4A 2CL6X 5FUWA 2B92A 4BWYA 3CW2A 4O3MA 5EXSA 4A82A 5KPDA 5IF9A 3BXZA 2D3WA 1E9RA 1UBEA 3FMOB 3CPEA 2KI5A 2ORIA 3VNUA 1LB1B 3FGNA 3DEFA 1CRPA 3SJCA 3MWLA 2FGKA 2Q9BA 3C4JA 2ZRKA 2QU8A 2W00A 4Q00A 3TUZC 1FPMA 1S8FA 5FI0B 4ZDIA 2H17A 2AXPA 2CVFA 4RSGA 3KXLA 4G5OA 2XX3A 1XPUA 1A5TA 3U3RA 1OT3A 1FP7A 3BORA 4ASUA 3O47A 2EW1A 1E2DA 3I1FA 1WBBA 4IOKA 3SBEA 1E2KA 2BCJQ 4QHTA 1R7RA 5BYKA 2XOKD 1KTVA 4C0KA 4UKDA 2H57A 3E5HA 1BOFA 2OZEA 5M04A 4AKGA 4M2LA 2G0NA 4RD4A 4FXPA 2JLYA 2YOHA 2NO1A 4TZ6A 3QF7A 3FYHA 4BECA 1RVDA 3RRMA 3VAAA 3T61A 3ADKA 4BFSA 1GUAA 1GITA 1T8UA 4GP7A 2ASEA 1Z5ZA 4PTLA 2QMHA 3ZJYA 3ZQJA 1QRAA 4LYFA 3IKJA 5ELXA 2KB0A 1HA3A 4GL2A 4GZMA 4UQOA 1Z06A 2NPIA 1XD8A 3PQCA 4Z8XA 1KSFX 4HUQA 4K81B 2IYTA 3NIBA 5TDHA 3R7WA 1N5JA 4DCTA 1Z0AA 1KDPA 3UG6A 4TTPA 3TQCA 3GLFE 3B60A 2C95A 3A1WA 2ZQ5A 3SHFA 3P32A 4KJZA 1TF7A 1XEWX 3AVUA 4M1YA 4Y0AA 5JJIA 4AURA 4QHSA 2ZE5A 4V0OA 1W0KD 1IAQA 3LA6A 2YWGA 2UZIR 2NZ8A 4Q1AA 4EUNA 4L8GA 4HYYA 1PV4A 4MGZR 3GFPA 3IQWA 2I4IA 4HDCA 4F4CA 5AJVB 1R0YA 1JR3E 2W6IA 1CF4A 5BQ5A 4YMTA 4B47A 2IXEA 4FCTA 2VP2A 5AUNB 3BFKA 1SVIA 4A4DA 5HTKA 2V7QD 1L8QA 1W2GA 5FUXA 4TQ9A 1DAFA 1E1QA 1U81A 4OI2A 4HZIA 3LQQA 2IYWA 1J90A 1EX7A 2VHCA 3EPKA 1AS2A 4PO9A 3JVVA 4OK6A 3LX8A 3CZQA 4G3XA 4QJ4A 3RS2A 1CXZA 2Q3HA 4BFYA 5LD2C 1RJ9A 4ESVA 1UAAA 3RRNA 3T1OA 2BV3A 4GBMA 1QDEA 2PJZA 4DCNA 1XPOA 2REBA 1GNPA 2GA8A 1XXHA 3QI2A 4A8JB 3KUCA 2FFAA 1II8A 2HT6A 5FPTA 3LBNA 3K70B 3E70C 3AGQA 2A5GA 1KMQA 4FI3C 3GLHB 1LVGA 4EJSC 4JSYA 2HV8A 2PEYA 1SXJC 4P32A 4LPKA 3LBHA 3RS7A 1WP9A 3BAFA 4R7ZA 1NNEA 1TUIA 3H4MA 2IL1A 1G7RA 4MGKR 4QBIA 4XSGA 2WAXA 4GSYA 1W48A 4I1SA 1P9NA 5KHOC 4BZQA 3ZIAD 4EQ6B 2P6UA 3NDBB 3VR3A 4BASA 3GLFB 2PZGA 2IT1A 2VRWA 3HR7A 2KBFA 5SZIA 2OE2A 4TT3A 3ZD6A 1TQ6A 1E9AA 5ANRB 1KY3A 4A0HA 4QKQA 3TSOA 4O2RA 3L43A 3F8TA 1W36D 2OCBA 2CL0X 3Q7PA 4HZUB 1X8LA 4E03A 4M0LA 2WPDA 2HCJB 3VR6A 4CDGA 3U7GA 2FSHA 1GILA 4ACBA 4B35A 1UEIA 1QG4A 3Q7QA 1EFCA 2QSYA 2PLRA 1Q20A 2ZJ5A 3IUYA 4D80A 3U44A 1IHUA 1SKQA 1WQ1R 1Z0KA 5JLJA 4ACAA 3ZVNA 2JGNA 5HE9A 5SZJA 4ZKDA 3AV0B 1FUUA 1NY5A 2LCFA 5FL7A 1IQPA 1NKSA 2O8CB 4BLSA 1R5NA 5JCPA 1DAGA 1E1RA 3UWOA 5CK4A 1N0UA 3HP1A 5LDDC 2IS6A 4V03A 1KI7A 3SYKA 4I1VA 4C2UA 1GDDA 2OBNA 2GCNA 1HTWA 4OL0A 3VTKA 1DO2A 3LAWA 4C3ZA 3AM1A 5F9FA 3WP0A 5EJEA 1GTVA 4B33A 4PPQA 2PH1A 1RYFA 4OQXA 1D6JA 1Z6YA 3RNLA 1RJ9B 1P9WA 1IONA 1SHZA 4D4LA 1CJMA 4E07A 2J9RA 5E7JA 2W0MA 3QKSB 4GFDA 4O0MA 1ZINA 3QKRA 1AM4D 4XSHA 1ZIOA 1JI0A 1NLYA 5G3YA 3WHKA 3CB4A 3SI7A 3N5CA 2R44A 3NWJA 3GPLA 3PJRA 4Z51A 2RGBA 3TE6A 1N6KA 1GAJA 4BFVA 4MUBA 2ZVPX 1FTNA 4F4JA 2RH5A 1S2MA 2OG2A 2HYDA 2CHGA 1A4RA 4C0HA 3IPYA 4RVCA 4A8JC 4BEBA 3QVVA 5E7IA 4DLTA 4HAUA 2OESA 2YOGA 4B32A 1G4UR 3FWYA 1ZUNB 1KKLA 4TT3D 3MWYW 2WJIA 3BH7A 3BE4A 4HDOB 1S3GA 4HAVA 2QT1A 4GT1A 4P33A 1BMFA 1DO0A 1KHTA 3TAUA 4NONA 4TQAA 3GJ7A 1FFHA 4I81A 4XWKA 4QNMA 4V0NA 3ZH9B 1HURA 5KDDA 1M7GA 3UIEA 3THXA 1N2CE 3QXJA 3KX2A 4JIMA 3EXAA 3ND9A 1Q57A 2JLUA 2FA9A 3AH8A 5IDVA 1ZC4A 2QTVB 5A4JA 2V3CC 4GDFA 5DN6A 1H8HA 2R6CA 2EU8A 2ZRPA 4I1OA 1VCNA 4FWTA 3T15A 4PHHA 2EVWX 2X77A 4AYWA 2JLVA 2ZU0C 3FPAA 3GJXC 3LLUA 3BGWA 4GMXA 5LB2A 1G291 3WRXC 2ZR7A 3I62A 4MRRA 2ODBA 4PAQA 721PA 2WTUA 2IS2A 3BFVA 1ZUHA 4QGGA 3ZZ0A 4ARZA 1AZTA 3GLGA 2QAGB 1IN6A 4TLAA 3QIAA 5CYOA 5GJCA 3CR8A 5KDOA 1OXUA 3RANA 3VR1A 1R10A 2ZTSA 6Q21A 4JYBA 3LW7A 2WAYA 5GVSA 3IHWA 5C2JB 121PA 4DBLC 4LSGA 2PT5A 2QMOA 4KBFA 3CLVA 3JZMA 4S2EA 3WYFA 1U0HC 4R71A 1EWRA 2P5SA 1DTSA 1DAKA 4V0ME 4I1UA 5J4LA 1EFHA 3RRYA 2GJKA 1MRNA 2VBCA 1CJUC 1NVXQ 1Z83A 4LWZA 4OI4A 2XSZD 2F7SA 1Q12A 2KWIA 1KZ7B 4URXR 2FV8A 3BK7A 4LBYA 2GAOA 1F5NA 2N42A 2IYXA 1KSJA 4DDUA 1RE0A 5JI3E 1B0UA 4M21A 1SULA 1J70A 4NCHA 1IY1A 3OIVA 4V0LA 1I4DD 3TIFA 1MABB 2Q0HA 3TAHA 1G4AE 2NO9A 3IBGA 3ZLJA 1D8TA 4IHQA 4KHZA 4WXPA 1NP6A 1ZW6A 1T5LA 2BM1A 2P2LA 1SVLA 1QHHA 3A4NA 3DOEA 3BERA 3HWSA 4KCGA 5F98A 4XWOA 3E2IA 1RC8A 3SQWA 2ZANA 4JBYA 5EQTA 2ANBA 4BZXA 2QGNA 4PANA 3TR0A 2JA1A 2W6ID 4A0RA 2IK8A 4RZ2A 5AJYA 4ZO4A 4IRUB 2WJVA 2AWNA 5FBVB 1QHGA 3DPUA 1G3UA 3FDIA 2XTZA 1VIAA 5EE5B 4XD7A 2GZAA 4PSVA 4HB3A 4AY2A 4RFSB 2DY1A 1GRQA 4LGMA 2CCKA 4RD6A 1W0KA 1CR1A 3K9HA 2QA5A 3BS4A 3VR4A 3VFDA 2D7DA 1E94E 4LYJA 1U99A 2PEZA 2ZR0A 1GL6A 3UG7A 4MYHA 1U0JA 1YRAA 2OT3B 4IVRA 3ICEA 2FG5A 3QE0A 1Z22A 3DM9B 2REOA 1II9A 4TYQA 5FFMA 3KKOA 2D4HA 1D2NA 2JCSA 3D8BA 2OSBA 3K8YA 4ZIRA 4OK5A 4W5JA 3G5UA 3EZ7A 4DC9A 1SQ5A 3KXKA 5LBIA 3W34A 2F3TA 3TVDA 1X8JA 2YKGA 1P2VA 1ZNWA 3IBYA 5CIWA 4GZLA 1CJKC 1LV7A 5TB5A 4TLCA 3OESA 2RHDA 2GXAA 1AZSC 2VO1A 3PFIA 4KSBA 2WWHA 1J2JA 5EUMA 4ZV4A 4FD2A 2RHMA 4JLPA 4DSOA 2RCNA 3CBQA 3SFVA 4WZ6A 4OI1A 1YU9A 4Q9LA 3WMGA 5G40A 3EC1A 4G5QA 5FL7D 1FQKA 4MYCA 1JAIA 1A2BA 1YRBA 3ICQB 3RS3A 4PHGA 4HZUA 2ZU6A 1OSNA 3CNOA 4KLNA 1M1YE 3CX8A 3PEWA 4DUGD 1G1MA 5JRZA 1NMXA 2O5VA 2DPXA 3JVUA 1GL7A 4XIGS 3GP8A 1BH2A 4Q21A 2Q6TA 2BBWA 3W6PA 4NTZA 2NGRA 4ZKEA 4MYTA 4DLYA 1TTTA 4KBGA 2WWGA 2OCPA 3DZDA 1KJYA 1Y63A 2UZ3A 2J87A 4IFBA 4CEJA 3LXXA 4DRZA 1YR8A 4LJAA 4C30A 4QGFA 1J99A 1LNZA 1P72A 3U3JA 2BJWA 4RD2A 4E5UA 4X8LA 4UJ3A 1XTJA 3PUVA 2B6HA 2RGXA 3AF2A 1XMIA 3LW8A 1G5TA 3SS8A 1VG0B 4IDHA 4A0FA 4IEIA 2ZI3A 3QUSA 4TMXA 1PVOA 4AD8A 2C96A 3KKPA 2GJSA 1N6LA 1NI3A 3QXSA 3SJBA 4YMSA 2QY9A 2YINC 1CJVC 2WWYA 2OILA 3GFOA 1P7CA 4OK3A 3MLEA 4B48A 2H7VA 3I5XA 3WXMA 1W4AA 1NL3A 4X8OA 2FE4A 2JLWA 1BO6A 3NVAA 4ASUD 1FUKA 1R0WA 1E99A 2OBLA 3GLIB 2VH5R 4B74A 5FOSA 1G3IA 5KU1A 3MWKA 3W3AA 4MGIR 2J3EA 3BOSA 2FPMA 2IUSA 4LBWA 3IHLA 5KSZA 1XDBA 3SR0A 1JJ7A 4NYJQ 3PUZA 3W9YA 3X1YA 1YZKA 3S1AA 2ERXA 3G0HA 1JPNA 3TNFA 2AFHE 3U7FB 3U6BA 3CONA 4Q48A 5HZKA 2ZJ2A 4CT4B 2H18A 1GRRA 4B2IA 1OXSC 2JASA 2QT0A 2SHKA 1ZM4A 4POAA 4YDHB 4QJ3A 1OH6A 1US8A 2GCOA 3AKDA 1Z6XA 5FPSA 3BH0A 4FINA 5JWOA 3Q3JB 5JHHB 5JS8A 1YJ5A 3B7GA 5E4FA 2JDID 5C4MA 2BKUA 2ZM5A 4OJKA 4L4UA 1W36C 3TBKA 2PBRA 1NN0A 2QP3A 1OIXA 2CBZA 2O8FB 4RD3A 1YKSA 4ZDWA 3WNDA 2JJ1D 1MV5A 3FHTA 3EWAA 1E98A 5BYJA 4A36A 1GNQA 1DELA 3KQKA 3PVSA 1G6HA 2AKAB 4TL8A 4F38A 2X8AA 1N5IA 4W5HA 4PSKA 1SVMA 5FOXA 1OYWA 3KUDA 1JR3D 1E96A 4JMPA 4Q9IA 3T5DA 1CRQA 1TADA 4D26A 1SVKA 2QPOA 1UPTA 4II7A 1XWIA 2XTMA 4D0GA 5D3QA 3W6OA 2O8EB 1GKUB 2RGCA 4RZUA 5KPJA 4DLSA 2BMEA 1W5TA 2DFKB 1ZP6A 4B6FA 5J47A 2B8WA 4JBWA 3SU8A 1W5SA 2ORWA 4OJQA 5C1BA 2FSFA 4TMWA 5HKKD 1LS6A 4PAMA 2LKCA 1A1VA 2H92A 1CR2A 3TSWA
chains in the Genus database with same CATH superfamily
3SNHA 1XN1A 2WA2A 1GCUA 1OI7A 3K3PA 5K4AA 2COKA 2Z1DA 1WCV1 5CVCA 5I8ZA 1JVNA 1VCHA 4XB1A 1Z4OA 3ICOA 3A4MA 1W59A 2OGWA 1DHRA 2OBMA 2O0KA 1EFKA 2FRXA 5JASA 3OT1A 2C9CA 1N5LA 2KLBA 3OY7A 2I6QA 2IPMA 2N3ZA 3DT9A 2JGKA 4NX2A 1DX6A 1UMBA 4LJ7A 4FLFA 2HM7A 4FZ5A 5FBZA 3BF7A 3F3YA 5G3ZA 3D6TB 1NBOA 1DJPA 2KMLA 1MXHA 3GUHA 3PIRA 4JP5A 1UQTA 2POCA 3BB3A 5EUCA 4AXXA 4GBJA 1UKZA 2QYOA 4FS8A 2PWZA 3JATA 4G37A 3ILYA 1NC3A 4XUCA 2QRLA 5JYEA 3HGQA 2IHJA 4LDQA 4LVCA 5FBLB 1JFTA 1DC5A 4R7GA 2WINI 2HCTA 4IILA 1P81A 4BUCA 1H2HA 4E13A 1SXPA 3AVPA 1BDJA 3ZDXB 1T0IA 4IV0A 1C0KA 2FLVA 3FTPA 1VDZA 1WLSA 3G0BA 3PUYA 4ZVOA 1VKNA 5A4IS 1GSIA 4TKVA 1EGHA 4YJFB 1OA0A 1X7ZA 4X6UA 5EMMA 2GK7A 2C4TA 4D25A 1YA8A 2O23A 1LBEA 1ZY2A 4O4IA 3RLIA 4PX9A 4ARUA 1DKPA 1H42A 1QHNA 1KYVA 4CF7A 3ZW7A 3KKQA 1XD2B 4O2BF 2WFLB 2WIFA 5JVDB 1IJBA 5TR9A 4F9FA 3CR7A 5CB4F 3NKVA 4RZ3A 2Y66A 2PDAA 3I32A 2QZ9A 2L2QA 3IEMA 4DPLA 2JGLA 4KYUA 1C9KA 5DE3A 1HFKA 1DAIA 3PHGA 1L4YA 3WFIA 2PGLA 2X4DA 3O1HB 3UMJA 1YR9A 2ZETA 3LC1O 5KJFA 4PN3A 5BXQC 2XDWA 4MQ5A 1BE6A 4PZCA 1XXHB 2YYZA 4XGKA 3ZKWB 4DV6B 2BH2A 5I7SA 3P2IA 3OOJA 4LXTA 1RXEA 1Z16A 1C1YA 1PIWA 1GFSA 3F5QA 3RTBA 1KS2A 2AKYA 4UXHA 1SXJA 3QJ5A 3OFSA 4JLMA 5LC1A 2AXEA 3UW3A 3VYTB 2WABA 4ZJZA 5K8LA 5JZMA 5MFZA 3Q8KA 1DIAA 3BD8A 3PQ8A 4UE3S 4Z0PA 4MDFA 1GCAA 4CI0B 4PR0A 3DZ8A 2H11A 4MS3A 2CLMB 3RJTA 2NACA 4CTNA 1DXQA 4HDSA 4KUGA 1EP2B 4JB8A 1SELA 5KC9A 3SYNA 2DRIA 1PDOA 3D6FA 1WNTA 4B40A 5HRCA 1XZFA 5EZYA 1TQ2A 1BFUA 1YO6A 1GKYA 2FZVA 2WOJA 4TTSA 2EGGA 5IUJC 4YJ3B 2FUG6 1F0NA 4URWR 3DPSA 1JKFA 2E5WA 2QXYA 2HHHB 2F62A 3EC7A 3NNSA 4V2IA 1PNRA 3VZCA 8ATCA 5JADA 3EDCA 4XLLA 1U1DA 2ZWVA 3B36A 4CWAA 3D3KA 5B6PA 3VPFA 2QMZA 3CR3C 2I1VB 2Q99A 5F1YA 5KEIA 2Q8NA 1TTHA 1I2DA 2FN3A 1XMQB 3AEXA 4D4JA 3NETA 1KI2A 2AV6A 4EY7A 1U0GA 1CIPA 2CJWB 1NXWA 3AUUA 3OZDA 3KAJA 1K7XB 2G40A 2RGNC 3DDUA 4HLCA 2HQSA 4CCYB 4EGSA 4ZAFA 4CQJA 1NU8A 3KKNA 5A04A 4FB5A 4X90A 1J06A 3G82C 3CNNA 2Y1EA 4GSLA 5JXWA 4AY6A 3GMSA 3HSYA 2V03A 3W3AD 4NBNA 2JLZA 2V7UA 3ELWA 5IAJA 1RYEA 2C7GA 3QNWA 2NUPA 1E3QA 4NPCA 4BLWA 4K0KB 1QVAA 3CZ5A 5K51A 3M9WA 4TSFD 1GQSA 2QE7A 1H5QA 1SXJE 2AN1A 2YXDA 4M54A 1TD1A 4KYIB 3DLBA 5EGNA 1ZEMA 3J81A 4QYIB 3K94A 3VISA 1SOWA 3QXCA 2WQ6A 3GJ3A 3QWBA 1T0HB 3RD5A 4RCYA 4CHTA 1M8GA 3Q7IA 4G5GA 4YUZA 5IWAB 1L4NA 2P9FA 1JGTA 2G8LA 4DJ5X 4ZOLA 3M1AA 3E03A 5IT5A 4PYOA 2AMYA 4WCVA 4DJEC 3LY8A 3EY9A 2IEZA 1RHUA 3AU9A 4JWTA 5I9TA 2GF0A 3KHTA 5A71A 3U3OA 2OGTA 2G6BA 5IZ4A 3S28A 2H1OA 3L77A 5DYGA 3R5SA 4Z1OA 4MPJA 3O4VA 4PC3A 3I9V1 3UK1A 4F4HA 3GLGB 4XCQA 3O8LA 2AB0A 4YP5A 3VO9A 1OROA 2XKKA 3JD3A 4GAEA 3TLYA 3SEAA 1NG9A 3V6LA 2DECA 2A8YA 1R0CA 4HVTA 2C83A 3W79A 1DC7A 2FWBA 2JCBA 2V55B 3LBIA 4R2KA 1JDNA 5BWNA 4MV5A 5HIMA 2RHJA 4M9SA 1QZ3A 1W4ZA 3V8BA 2AZMA 4ZVRA 1VRWA 3GWZA 1AD2A 2J4DA 4M1OA 3T8YA 3B6JA 5TMDA 2DWPA 1SCNE 1XDZA 3ROTA 1V47A 5K09A 3BXFA 3H8WA 3PHIA 3WK7A 1LC0A 3E82A 3SJAA 1M74A 1ULUA 3ODPA 1QV7A 2G6TA 4ICIA 4ZZ0A 3GZTB 3LHIA 4DLUA 4UHEA 4PLZA 4F56A 1JFLA 1PGNA 1C29B 2XVYA 3BL5A 4TROA 3OQOA 4DIDA 1R8QA 1G5RA 3PT9A 2YJTD 3F74A 3KPJA 1WD5A 3VVLA 4ZPXA 1QUFA 1A8HA 2DUNA 2G0TA 3K0KA 1I3CA 2B3TA 3O31A 1Z3IX 4G5XA 1JZQA 3H2IA 5B1HA 3O6VA 1QK4A 1URPA 2C9MA 4JVNA 2IHYA 3DZIA 1EUCB 3LE8A 3H5AA 2QVYX 3WWOA 3EVDA 5EFOA 4MJLA 1N1EA 5DM2A 3KSMA 1Q0ZA 4YJGA 3UT5B 4RTMA 3TW8B 1CY2A 3OCVA 4MULA 2H2AA 1TM7E 4H3KB 3R6WA 3W77A 4C0JA 2VPXA 2YVLA 2P4UA 2VYVD 5CM2Z 4M1MA 3CH5A 2VH1A 1HG0A 5CNJA 5FT9A 1FFSA 2HK8A 1NI4B 3DBLB 1YVRA 1JKMA 3I9JA 4ZYUA 1OFIA 3VV2A 1RDFA 5PNTA 5IBCA 5EJFA 3KWFA 1BYUA 3PNLA 1Z08A 1U3DA 4ZXFA 5B37A 3IEVA 4IDQA 3BDIA 3U4HA 4FFBB 4OUDB 2WJYA 4EQZA 3B3QA 4TGLA 4KN9S 2LW7A 1ZN7A 5EWLB 1X7DA 1P62B 1YHZA 3GPDG 4O25A 1RBZA 2DU8A 2E82A 4FMDB 4OLFA 4UXIA 3PD1A 3WMRA 3MYRA 1GTMA 2XMZA 1H85A 3LWBA 5FWXA 5B3LA 5B7QA 1AQIA 1GD1O 5K0GA 1CK4A 3RSOA 5ENDA 3DTTA 3NQ41 1XF1A 3RRFA 3R40A 4HJXA 1ML4A 1L3CA 5K05A 2C7QA 2ZM6B 3OJXA 4QIHA 2NU8A 4KMMA 4LIPD 4OQQA 3DHYA 1Y37A 4UVHA 5HRAA 2GPWA 1T3LA 2PAAA 3U3XA 2G3YA 4KPUA 4BL5A 1ZISA 4HNRA 3O3MB 4TSFA 4FWBA 5JZVA 5KBYA 5I7WA 3E5RA 4PQFA 4OLHA 1BXRB 3AYXB 3WQSB 3EA5A 1Q14A 2QD1A 3GNQA 3PQDA 4FLEA 3CZ4A 4OFWA 5KYKA 2X86A 3D6VA 2OK7A 1EINA 3GFVA 4TL9A 5GZ6A 4A91A 3KQNA 3H4IA 4TS9A 4QXAA 3AM3A 2TMYA 4J16C 3VSCA 2W11A 3IH5A 5K0ZA 2YY6A 1N0HA 1VE3A 1XTIA 1M2OA 3IEPA 2BMVA 3CIFA 2D1RA 1EJ0A 2VLIA 1PZHA 5CW2A 3OLXA 1F51E 1TEXA 3N8NA 5DM4A 4NOLA 5EZQA 1XFAA 1E32A 5EE9A 3T1VA 1DLJA 1KEVA 3JRNA 1H9CA 1OR8A 4Y9TA 4M46A 4RWZA 3RUAA 3DHVA 5LOVA 1VBKA 2JPDA 2IHUA 1HNXB 4WNAB 4BLVA 2QUHA 3ONWA 2B35A 1ODKA 4RGYA 3RFCA 3HJTA 3H1AA 2C2GA 1UKEA 4UBOA 4J16A 2FW1A 4WL0A 2XD9A 5TF0A 1Q3HA 4LX8A 1S2NA 3BJEA 3QUAA 5KNBH 1Y8RA 2JATA 5BO5A 2QRZA 2W2LA 1ZQ9A 3FTQA 2R7KA 1MIHA 1RWQA 1L7AA 4M0PA 1KZ9A 1WMDA 4K86A 4D4MA 1N36B 3S70A 4MWDA 4B6GA 4P1ZA 4EUHA 3BXOA 3HYTA 2C5AA 3QHAA 4A1FA 1I6LA 1ZM9A 1JA0A 3U17A 2E4YA 3CF0A 1YS7A 3GLIE 1NQWA 3K2BA 2PGNA 1V5WA 4UFPA 1TM2A 4HBGA 3KVOA 3NBZC 3VUEA 4DOMA 2Q28A 1X1CA 2VQ6A 4F97A 3KQLA 1BMFD 4PLYA 3KDAA 4UC0A 1LF5A 2ZRAA 2IP4A 3DXZA 4WZBE 4V38A 2H16A 3DEYX 4MINA 3LV8A 2FPLA 5EWMB 3Q5EA 4M89A 3U3DA 3HCWA 1NJFA 1B1CA 2RHRA 4HLUA 4KWCA 5FV4A 2QT9A 3EASA 4YJ2A 3H1PA 4GPD1 4C06A 2G28A 2PXCA 2YN4A 4A0GA 2WE8A 4HD8A 4RQAA 1ILWA 1T9DA 4JC4A 1UC4B 2CJPA 2P4EA 3DZKA 3O1IC 3OZXA 1KDTA 4BV9A 1EQUA 2QX8A 4ZCTA 4DTCA 5C9ZA 3KYJB 4B80A 2PUDA 2AJLI 2FZEA 5JZOA 4QULA 2XNSA 1SUBA 1TPZA 2FEWB 1GY8A 2XZPA 3H8VA 4IX9A 1IPHA 4KMRA 3N70A 4NOKA 1FJXA 2A9KA 5EJGA 1E2QA 2XDYA 3IIEA 3M1IA 2CDAA 4URUR 521PA 2FW6A 5DLYA 5EQDA 3RYIA 5C8YB 3AJEA 3QVSA 3RF7A 3WBKA 1PJAA 1E0JA 1IXSB 2UV8A 1WPRA 4P83A 4R31A 5FBKA 3WYNA 4F93B 1T4MA 5AICA 2D2VA 4M1TA 3PZBA 3V4OA 1BOOA 2Z2IA 4J0IA 1MAVA 4R41A 3ELBA 3BIWA 1I1HA 1Y3IA 3MJRA 3Q8XB 2BFFA 4YMGA 4Q6WA 1LJLA 4YAIA 2AN4A 5K3AA 2H5EA 2IDZA 4I3HA 5IXSA 4LV5B 1C3OA 1JS1X 2HWXA 2Q7OE 1P6UA 2FB9A 1M2KA 2JI8A 3TX2A 4DA7A 4EFDA 7ADHA 1GZUA 3W1EA 3K6RA 1NWCA 2EZTA 2VQ3A 2EJBA 2Z4RA 1KPGA 2HCBA 1EX6A 2QE6A 2QTGA 2ZWOA 4HGPA 5LQSA 4AZ3A 4BVKA 2ZQYA 4KXYA 1GO2A 3V8RA 3V42A 1W8DA 5BYAA 2TSYB 1LBSA 4PHCA 1CUEA 1CP3A 3IILA 4CMHA 4B31A 3OIWA 1OXTA 4YDRA 1TZMA 1Q0SA 1BHQ1 2JCVA 4GC5A 4RV5A 5JBQA 2F00A 1YIOA 2ONZA 2GK6A 1QTRA 2F43B 4V24A 4BAGA 1RHKA 2QAIA 4HVLA 4G0NA 4GKVA 2QVBA 1SCAA 3ZYCA 3DTVA 4BNYA 3LF2A 2IX3A 3KQVA 1VBMA 5C32A 3KU4A 1WR8A 4RF2A 5TPZA 3E8XA 3UOWA 4TYYA 1F1JA 2ZB8A 4PGGA 3WWCA 3EZFA 4CTJA 4JR1A 4JUBA 4P7GA 1XQ1A 2QJWA 3IALA 4NCIA 4NCNA 4KDCA 4AZ0B 4BO7A 4ABTA 4Z3OA 2I91A 2PRIA 5KNBD 5LCXA 3N9IA 1FRZA 2PQ0A 3BC1A 1ZM7A 3LD9A 2FW7A 4ZOEA 5EXPA 3TLJA 1E4EB 1Z63A 4YY3B 5HEKA 1N2ZA 1VYVA 2RHTA 1XBTA 3Q9NA 3GD7A 4U7PB 2CV2A 2J5QA 1H0SA 1WAMA 1XKXA 4E32A 5JC8A 1RP1A 1GZVA 1UBHS 3HNRA 3HEBA 3GJ0A 3A27A 1ZJZA 4BZPA 4N41A 2X3YA 2RHHA 3I39X 4PCUA 2AUMA 5KYWA 2XUAA 4NMLA 4E11A 2Y4NA 3EIUA 4ZEWA 1Z8NA 4HS4A 2RI6A 3VQTA 1RWOA 1Z0UA 2IYQA 2EP8A 4IWYA 1SHLA 3ERCA 2AI1A 4FHZA 4GOJA 1CY7A 2PL5A 2WILA 1MJGA 2P2SA 3V1LA 3CCFA 3I8SA 3F4BA 3JD1A 3OE7D 4H3SA 1J20A 2JD1A 3O8RA 3K5IA 1ZX1A 2B1QA 3MF4A 1OGIA 4G4JA 2AD1A 4FW9A 4ZDWA 4LJ6A 4EHNA 4F2DA 1AU9A 1Q21A 1A72A 2Z6QA 1QLJA 2PT7A 1YDGA 4DDTA 2D74A 2F1RA 4Q4DA 4OY3A 1Z2CA 4IGIA 3S29A 4OQFA 3GV0A 3DEIA 1XZLA 1ENOA 5FA8A 3COJA 3NV7A 1MW9X 2ZRCA 4H7HA 4CM1A 3G2MA 3AVXA 1XVIA 3EPJA 5ECYA 4RTKA 3T1QA 1KL7A 1E2NA 2RC6A 2BI8A 5KAPA 4WCFC 4MARA 4Y67A 3II6X 2GN1A 2P90A 4JI0B 3TXAA 3Q9SA 2DPMA 1P2FA 3AF0A 3IC5A 1U2RA 4N6OA 4NOMA 5JFGA 1CC1S 2DR3A 3ZDDA 1P1KA 2AN5A 4ZAVA 5AXBA 4A0SA 5BMVF 1LSOA 1T9HA 1LLCA 2QG9A 5KYYA 1PZXA 1XTTA 3CYFA 3DMDA 4CIAA 1QJ4A 2CCJA 2PX0A 3LT5A 4E21A 2J09A 1GVHA 2HO4A 3C45A 5EKSA 3CJTA 4MTCA 2QD4A 3HWX1 2Z2KA 1RYDA 1X7HA 1QKJA 2ADOA 1G3MA 2VQSA 3G5TA 1P2UA 3QOWA 1KE1A 2IWHA 1XZIA 1HFEL 1Z25A 2ZJFA 2I6UA 4REQB 3VKWA 3VDNB 1Z5VA 3ZGNA 3KFLA 5AVOA 1HDEA 4OXYA 5C4IA 621PA 3G7SA 4PYKA 1MTOA 4ZEOA 1AUQA 2FF7A 4GOMD 4LY3A 1ZVQA 4PZPA 1MH9A 3HPRA 4QQRA 3KJFA 2BE7A 3TMKA 1FDTA 3PGXA 4JOQA 2BMWA 2ZWMA 3FUVA 3R7FA 5FQNA 4HAOA 5I3CA 5H9WA 3WAGA 4X6LA 4R05A 4RJJA 1E5DA 3FMPB 5GM1A 4ZT6A 1K9VF 3CJQA 5B7NA 1OAOC 3DMGA 1NOJA 3N3AC 4TKVB 1LWNA 2RBKA 5JQGA 2MMGA 3U19A 1MO4A 3QX3A 1HK7A 1I3LA 3NUZA 4YMUA 3IUMA 2WWVD 3U7RA 4AWXA 3UMMA 1X0XA 4ZAYA 1D1QA 1W47A 2RONA 4NBUA 1PFQA 1NF3A 1FS6A 4P98A 1TYBE 3W2IA 2ZCJA 1WTAA 2R9VA 3FN4A 4KQGA 4HLQB 4WN9B 5T5QA 2O3QA 2N9UA 5E2BA 3VYSB 4NBLA 2MSEB 1OWPA 1A2KC 3ABZA 4LJLA 4E5MA 6CHYA 5FH9A 2A7XA 6LDHA 4AMYA 1RYHA 4N8SA 3SYLA 5KREA 2J0UA 3D7KA 3L0SA 4H4EA 1P1IA 5H3CA 1UOOA 2XITA 5CLHA 3M49A 3WJ1A 1QGYA 5AKYA 5KTTA 3TMAA 2DQZA 2G80A 1STOA 1VLQA 2OEPA 2PD3A 2YMQA 3CSUA 4GF5A 1E60A 4Y18A 4KP7A 1ZAYA 3P2EA 2ZZMA 1UFQA 2E37A 3CWCA 4OKSA 1SBYA 3HCNA 2IGTA 3RIMA 2OPBA 4I9GA 3WHPA 2BEWA 4GI3A 3HPQA 4WJZA 4QHYA 4BIMA 3T9CA 4ND5A 1H3FA 2XNDD 3OPQA 4NATA 4XYGA 3SQDA 3QOXA 4F2PA 3R0IA 2CXXA 1I7PA 4GG1A 1QH1A 3GNLA 1W44A 2W8BA 2ZUDA 2F67A 2R6GA 4FT4A 5C1DA 5DRYA 5G0SA 4FMPA 1SOMA 2ZYAA 2ZPTX 5GAJA 1CQIB 2RGWA 3H9GA 1VKOA 1JBKA 1I2ZA 2EJCA 4GI5A 5F33A 2FPUA 1EFLA 4PIMA 4POOA 3S68A 4FD3A 4PQRA 4PCLA 1LF0A 2J3KA 3HKEB 1IN8A 2VJDA 2W6PA 3UANA 1JUDA 1Y7PA 3HJAA 4XIJA 1AQNA 2JCGA 1V3QE 4EYEA 1QPBA 1Z9BA 4MZXA 1QTQA 2X1HA 3BF8A 4L6CA 4R40A 5IAKA 5K0JA 4NG5A 4OV6B 3T5BA 2F9MA 3UTCA 3BJMA 1B7GO 4QDXA 3KSDO 4WFQA 2C88A 4NMHA 1VYTA 1OQAA 5EHQA 1C30A 1ULZA 3O8OB 5H3HA 1GG8A 2G1KA 4FYKA 3K8QA 2ZRBA 4E12A 2FSVC 3L8HA 5H68A 5A0FA 4UEOA 3OU6A 4ID3A 1C3LA 1J9ZA 2C9YA 4ZC1A 4W6ZA 4JB3A 1XD2A 4D3FA 3THYA 2GDJA 1S3SA 3KKKA 1RC1A 4M53A 1U1FA 3DV0A 5LD2B 1ZWLA 3BWYA 1BW9A 5I4CA 1NP7A 2FUEA 3USZA 5L3SB 4NWIA 4LZPA 4BBZA 1DADA 4D0NA 1JHRA 1W49A 5BWMA 4OBWA 2O0HA 1O77A 3NBAA 2XUGA 2WLTA 1ADFA 1WE2A 1JU4A 1U8TA 1KMCA 1MOPA 1UR5A 1ZD8A 4U1RA 4U0KA 5ETJA 4FDUA 4LYYA 1MX1A 2Y1FA 3NALA 1ABBA 1QXSA 4H08A 1VCIA 1ZSNA 4IVQA 3SZOA 5LPNA 3C6KA 4M0MA 1H6BA 1MO5A 2FVYA 3RC3A 1QANA 2PRZA 1EG7A 3RB8A 2EZ9A 5CDYA 2C03A 3OZVA 5JOQA 3DFKA 4DCTA 3NNDA 5JALA 5DRTA 4U39A 2CDNA 3AERB 3KZCA 3QPBA 3FYUA 2JG3A 5ECDA 1A88A 1EB9A 1AKQA 4I4IA 1IEWA 4E5KA 2ZAMA 1CU1A 1PN3A 1X8XA 4R2IA 2AH5A 4P0QB 4X94A 1E2GA 1FBNA 1PFVA 3K72B 2XIQA 1BFKA 3E3OA 3NDJA 5BSEA 5FOQA 1HTTA 1Y5NA 4PZAA 3GY0A 5IWCA 2VP0A 1N3YA 4PG6A 1MGOA 4WMLA 5BYBA 3N39C 1EUYA 1N6PA 4BNHA 3PXEA 4MP6A 3WGUA 3GLHA 1IUNA 1E79D 4ZVNA 2VA8A 1ZIPA 3L0IB 1G5FA 3ZHCA 1SU6A 2C2WA 3H13A 4BXOA 3CZ9A 5KVVA 1CUDA 4IDPA 5CEFA 3WGIA 1Q2XA 1V5GA 2PZBA 2ODPA 5CXQA 4KVZA 1JBQA 3GFRA 3D81A 3G2KA 1BD3A 3QSGA 4HN4B 2FG6C 2VP4A 4JQYA 3SKYA 3TTTA 2WT9A 3RVQA 1H5NA 4JZKA 1E9BA 5CM9C 1DC4A 3STUA 1PQWA 4Q4HB 4J2TA 3SZRA 1XZGA 2H4JA 1GPBA 2QN1A 1M6YA 4HFMA 3TIVA 3K0SA 1J07A 5TVKA 4BO3A 4MK4A 2UUCB 1M2NA 2CK3D 2VHEA 2V9CA 3GP5A 3IERA 4LSMA 4YRJA 2IEDA 4N3CA 5B3JA 5JIBA 3FYUC 5DYTA 4Y1RB 4CLOB 5HGXA 3G5LA 2AEFA 1H6CA 1M33A 4MQEB 2A9RA 1DWOA 4MR7A 1P0CA 3IQHX 4AG6A 3V1KA 1U65A 3DFUA 5HRUA 1JKJB 4BFZA 1TT5A 4I99A 3BJIC 2DHEA 3IT3A 2Q4OA 3OE7A 4HXYA 1EXDA 2H3EA 4F11A 5HPYB 5EPUA 1KAOA 2ZS7A 1IUPA 1N6NA 1QHIA 1R1DA 4QFCA 1N78A 3B12A 3PSHA 4ZCLA 1VL2A 4JBXA 3U1VA 2BONA 1HYHA 2W6OA 5DOZA 1GQFA 3I2YX 4ZT2A 4FDVA 4AT1A 4YXWD 5EIXA 3LCRA 3GEGA 2XE8A 4RADA 4G1MB 4Q4LA 4V0QA 1IL0A 4W99A 4BFTA 2XT6A 3W8NA 5IDQA 3PGLA 1G5IA 3D5TA 5ESWA 4W1QA 2AOUA 3L05A 4LVNA 4JU8A 3UGTA 2QRQA 3SE7A 3JV7A 1GA1A 1THZA 4F72A 4O8ZA 5DDIP 1NE2A 1T4GA 1C7JA 1QYVA 2R2AA 3QKRB 3WNCA 4GWKA 4AM8A 2FZGA 4RTOA 1CY6A 1YDEA 1G8GA 1R0BA 2ZS9A 3IO5A 1LPBB 3IE0A 3FZEA 1DQRA 4F4DA 1RZ3A 2WJPA 1MQ8B 3DL4A 1VKJA 2I3ZA 3WGZA 2Y1OA 3Q7EA 3O94A 4KBYA 3RT7A 5ADUS 2BGJA 5I9SA 3THWB 3B3AA 2EFJA 1DEHA 4Z4IA 1RM5A 3ZE9A 1NXXA 2IYZA 5HR5A 4RXTA 5H16A 4L0CA 4M87A 1AKEA 2AOTB 4FN5A 3X3HA 1RIIA 2UVPB 1VIYA 2DUWA 2Z4TA 3CURA 4JUFA 2GN2A 2ZZNA 5BQXA 2GBIA 3Q9LA 4UPDA 4P4SB 5K3DA 3U9TA 1WBDA 1JJBA 4NJEA 5D84A 5FTKA 1EM6A 1ESCA 1E20A 1OIWA 2V7GA 3K1YA 1V6CA 1Z29A 3JQRA 1KVUA 4R84A 4G81A 3HQ4O 4A5SA 4IIBA 5KOHB 3RAEC 4TXMA 2Y3IA 2IW1A 1SZPA 4LAFA 3AP1A 4PGMA 4AP6A 3TZBA 4AJLA 1U3GA 1Y1RA 1GZHB 1NA5A 2XCIA 4EOGA 1N9GB 3AT1A 4UVGA 3UJAA 1OAAA 5EUBA 4AZSA 1K06A 2WSIA 3EUEA 3LJKA 2F1OA 2F59A 1PZNA 4D9NA 2W6MA 5HF9A 4B7CA 1SKAA 1E9FA 3V4ZA 1TL7C 1I01A 5AK3A 3VPCA 1CQPA 1K7SN 3W04A 2ZI6A 1FBTA 1Q1BA 2II6A 2O05A 1K08A 4KLRA 3UGQA 3GPBA 2FUCA 2W2TA 2WIAA 1Y1LA 4A6PA 4BQFA 1E2BA 3OTOB 1I4LD 1XRLA 3L79A 3NUQA 4IMIB 5EA2A 1GGEA 3UAWA 1QUEA 3JRWA 3OTGA 1USIA 1N0IA 2GHTA 4CIBA 2XZLA 3S27A 2GM3A 3I9LA 2BELA 3ADCA 2QAGA 4MUKA 2D1FA 5B4VA 2BHNA 4OGKA 2YJ6A 3JQDA 2J0SA 3DH0A 4KPYA 2R96A 3AP2A 2EFGA 5K01A 4RK4A 1U28C 4IQ0A 1OYVA 4XASA 2EGHA 2OSVA 3R7DA 5JD6A 4CG3A 4MRAA 5KCZA 2IEBA 1G19A 5JBNA 5JFTA 1KVSA 4N47A 8AT1A 2Q46A 3IUBA 3CS3A 4QU9A 1N2OA 3TSYA 3WGKA 4DF3A 3GJYA 2PAFA 5KQRA 4G0WA 4P84A 5CB0A 5CIYA 1RQLA 4W1PA 4RQUA 4JDPA 5B30A 4IICA 2DM6A 3MJFA 4U9HS 3A4TA 1HZZA 1AGNA 1G9TA 3TINA 2O3TA 3TJZA 5HKLA 4CDNA 2TS1A 5ALTA 4LJYA 1C1XA 1KI4A 2WB2A 2XNCA 3E35A 3L1VA 4ZQBA 3NM6B 2OBYA 4Z9YA 4GPZA 4NCKA 4B3XA 5BURA 4D9EA 2HJ9A 4FWIB 4DRYA 3MXTA 1RCTE 4XTRA 2MSLA 3GJ8A 1Z7EA 5G1NA 4PEVA 1R4NA 3ORHA 4P7KA 1G3QA 5H7XA 3E22B 1RRPA 3OMLA 2QTAA 4FMBB 2XIJA 4QELA 1I1NA 2OV8A 3QEMB 1KSGA 2GXSA 3OQPA 5A7GA 1V7QA 2BJVA 1UQRA 4BMZA 5FHQA 3V46A 4C6SA 2Z08A 4LGVA 1NTRA 4FSHA 4DM7A 3EWIA 3FOAA 2UYCA 1OFVA 1R0XA 4RM2A 4FGWA 2VHXA 3JSAA 4B84A 3D8SA 3IR6A 1POWA 1S2LA 1Y33E 1KMMA 3FPJA 1N8TA 4G0MA 1VIVA 1Y3HA 2SNIE 4U00A 4R2LA 5BW6B 4X1IA 3NRJA 4BBJA 1M8JA 4PQEA 4YMHA 1F9AA 4LGYA 2W43A 3DYVA 5JWHA 2IV7A 4UVEA 4NEGA 1KEEA 1JT9A 1UPAA 3HA5A 3HRKA 3WYGA 3I05A 1FRNA 5CDFA 4A2PA 1I51A 1EVZA 2Q3MA 3O4HA 2WUFA 4X95A 2WB4A 4DYDA 5HF6A 1WQ3A 3N2YA 1C7ZA 3DV9A 3ZUGA 3UZUA 3E3MA 5E3JA 3EZNA 1DCFA 4OX9B 1DARA 1IJEA 1JR3A 2GESA 2KJQA 2VP6A 5JJ5A 3IE2A 3DTVB 3IRUA 2OAP1 3KEGA 3N2LA 1WF3A 2AVNA 3G79A 5AHOA 4DA4A 2JI7A 3U44B 4NU8X 1XLUA 4IUYA 1ZRHA 3EIQA 3MMNA 2R8XA 2X2FA 1MBZA 1NI4A 2HWYA 2VOJA 3DBLA 4NI5A 3RKRA 5AVSA 2O8DB 4HT3B 3Q5DA 2UDPA 3BRQA 3X1KA 3WDSA 3PQ3A 1E7RA 1JJVA 2F1JA 1FQWA 1GUYA 1Q7BA 1TVKB 1TK3A 1WZIA 1IXZA 4QUKA 4W9NC 4EHKA 4WI1A 3FUTA 2QAGC 1XNHA 2FPWA 3DL0A 3T3EA 4XIYA 5D6NA 1WA5A 2D0OB 1CY8A 3EG9B 1FDSA 1YB7A 2AFHB 3D3WB 3SBDA 5C18A 2ID4A 4F5DA 3UF0A 2IYYA 3KOZA 1J33A 3QEOA 5CA0F 1YL7A 3I72A 2FKNA 4OOFA 4FHFA 4JXXA 5JUWA 3OZTA 1XTKA 4L9RA 3RR2A 4BRWA 2P4HX 1JHPA 1KJ8A 2EBFX 1QIIA 4REOA 4UM9B 4PYQA 4V0RA 5AUOB 5K6AC 4DLAA 4EGAA 2WJHA 1RT9A 3JAMA 4DUGA 3ZE6A 4WT7A 3SF8A 1M8KA 1A69A 5KSOA 3HXOA 4JV5B 3A7EA 2A7QA 1DWUA 4RZSA 5B3JC 2ZJAA 4TWAA 2FVXA 1N7HA 3DQZA 4KRYA 2HC9A 4BATA 2XB8A 1GA6A 3NHYA 4BNZA 4EP1A 2EL9A 5EXEA 1CLUA 1A82A 2LRHA 3M8KA 4KDFA 4OHYA 1Q92A 2R2GA 1WIWA 5ALFA 2BBTA 3I9V6 3HCAA 4N5HX 1V6AA 3EH2A 3I5MA 2Y2VA 5ELMA 2JVKA 4KAXA 3A9VA 2Z8ZA 3I6BA 3RUEA 2AYZA 1YS9A 4PSAA 3WB0A 4PGFA 3FOCA 4RLFA 1XEWY 1R8XA 3H4VA 1R8YA 2P5UA 2Q3CA 3PDHA 5B6IA 2NU6A 3A2NA 5K0NA 3IIJA 2QN3A 1KNXA 3UXHA 1IHYA 1N92A 1ZMBA 3B7WA 4E3ZA 3V8NA 1DEOA 5ITZB 1QQBA 4O2LA 2ZROA 3FKJA 1IVNA 1XAJA 4YQEA 4W5WA 4BX8A 4CM9D 1Z5WA 3K5HA 3BIFA 1GZ6A 1UP7A 4K5QA 3PXCX 4BKRA 3V7WA 1PU2A 3PXGA 2XLCA 2YJGA 2NZWA 1CZUA 3HDTA 3R1IA 1QAOA 4G5RA 4JBNA 4Y1RA 4MPTA 1A5SB 5FOVA 4P36A 4EHDA 1OCEA 2FN7A 2WPDD 4RX1A 4HAYA 5JMWA 3EIEA 5B7GA 3OQMA 3IVMA 2MCFA 1UT8A 1N4DA 4GI7A 3L6OO 3OZIA 5EIOA 3DOHA 3TG2A 1KI1A 3UB3A 3K1AB 3F7OA 1MZPA 1GZSA 2CEAA 2WKRA 2JNWA 4QO7A 5J40A 5HZMA 2OBFA 3X1XA 3G5AA 2PGDA 4IOJA 5KKNB 3H6HA 3U3KA 1RS0A 1BEEA 3VZPA 3MT7A 1Y1SA 1WTCA 2C9BA 3CHYA 1X1BA 4KK4A 2R6R1 3SJ7A 1MTZA 3NO4A 3ZVMA 4LPSA 5GIPE 1J0AA 4LGCA 3Q2OA 4O4HF 3JXEA 5AUQA 3V3TA 1VL5A 1APBA 3PNPA 4MVWA 1HOTA 3ODGA 5DWQA 4BE9A 4C78A 5JXGA 4N48A 5ILQA 1KEWA 3L1KA 3EHDA 1OU4A 1O6FA 1M6HA 3DBVO 3IUQA 4UU7A 3MZ0A 2WU1A 4RPKA 3EEBA 2VQDA 2FXVA 1AKTA 1A9QA 3F7TA 4AXBA 5LDHA 3K6SB 4RTNA 3KD3A 3A05A 3ROPA 4EW6A 4EUSA 4ZREA 1T5IA 3EYAA 4WXMA 4F7WA 2HSWA 3LDUA 3DMPA 5ITSA 3AESA 3LI2A 2DR2A 1ZGAA 2HRCA 4ND4A 4G41A 4EL5A 1K6MA 5BNZA 4RKYA 3OCUA 3ANYB 3CUTA 3I4LA 3TX6A 1IMJA 4DUYB 3QQ5A 2UUBB 3T7SA 1VJCA 2GFQA 2JEOA 5A06A 4RHUA 5TQ2A 2DAPA 4R83A 1FCJA 2FOIA 1YAJA 1VECA 3NC4A 3GUCA 2XADA 3ITDA 3KJQA 3SHOA 1BHJA 1BJKA 1W0JA 2QPTA 4Q66C 4D1YA 4D0SA 2IYRA 3EPHA 2Q6LA 4FMCF 3IVGA 4ILKA 2VKTA 3OIGA 4I9FA 4JC0A 4XI9A 3UK0A 1X74A 1Z2AA 4KIGA 4KO4S 4RTPA 2AX4A 5CLQA 1E9CA 2QTWB 3L84A 3PWSA 3H9BA 1NRIA 2V7QA 3LK7A 3OIUA 2B94A 2UAGA 1K0FA 4GO1A 1VGRA 3A4LA 3MJSA 2PL3A 2HDNB 2QJRA 4BIIA 2RE8A 2JAQA 1CWUA 2G9ZA 2J0VA 4FFBA 5C51B 2IZ1A 3PX3A 3TR6A 2WIGA 1EXWA 1V41E 5C5DA 3EQ9A 4TTAA 2AYXA 2HMSA 4LYGA 2QX9A 1X9HA 2XNDA 2XUZA 4RLQA 2WVJA 4QPNA 3R44A 1WM1A 4MW9A 1AX9A 4QXPA 2JB9A 3A0UA 5ARCA 421PA 2GBLA 4UHJA 5DYYA 4BV3A 1A8IA 4PAOA 3TPZA 4GXRA 1L5YA 2AL7A 5A9SB 2NQ2C 3AC0A 4Q34A 3A1UA 5AK6A 1R88A 1G9SA 3IPCA 1A3CA 3BWEA 4RZIA 4LUCA 1LW6E 2BISA 4MGYR 4NHOA 5CH3A 2PN1A 1IVSA 2ZIXB 1XB2A 5KSWB 5EESA 1UMDB 2D1QA 3IAAA 4R6WA 5I5EA 3KVRA 2P9QA 1NR1A 4V2UA 3DMYA 2CEKA 3TOSA 2QSUA 1GG5A 1KAGA 1SKUA 2Q1XA 3MCZA 4LJ4A 5EKUA 2YHAA 4LOJA 3W5DA 1NVMB 2JZNA 2X8BA 4EFNA 3HN6A 4Y2SA 2CB0A 2XCSB 4LBZA 4FDMA 1PT5A 4J1TA 4U6SA 4RWEA 3BMCB 4B44A 1JHUA 3ZU4A 4CFSA 2ZJ8A 1SURA 1G8PA 4P31A 2D0PB 3U9SA 1S4QA 2VNHA 1B73A 3HKCA 3N8HA 3OI7A 1YZ3A 4G5YA 4RL6A 1NBMA 1H65A 4NPAA 5F3RA 1YR6A 4C05A 2AOTA 3TVTA 1S7CA 3VGPA 1H2XA 1MOSA 5JDCA 4QODA 2YIMA 2HSJA 4YX9A 2C78A 1K5GA 3ZNPA 4F71A 4UREA 2XKBA 4I4LA 3OSUA 5D87A 4CT5A 3TUJC 4ZDJA 3E5NA 2WZDA 4I4NA 2XMPA 4F9GA 4QOIA 1AH2A 3PFNA 4BY9E 1E58A 2GBCA 4LHWA 5JJLA 5EGSA 3KTFA 3FHLA 2R87A 1YCFA 3ETLA 3F5DA 4M1QA 2DY0A 5LLTA 5AHKA 1USUA 2V6JA 5TARA 3BFXA 1CF2O 5IK2A 2XJ9A 3GNTA 4WBNF 4OX9Y 5TMEA 1C0PA 3W7VA 5JLAA 3FOWA 3WVNA 1ZAKA 3UATA 5ITZA 2GSDA 4CQMA 4MP8A 2O7NA 3U26A 5JCZA 4I0WB 3D6UA 2LIPA 4GOOD 1ZU5A 3D8UA 1F8UA 4N7JA 4AJ9A 1K9SA 3QFFA 1CZLA