1DS6A

Crystal structure of a rac-rhogdi complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
181
structure length
181
Chain Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 2
publication title The Rac-RhoGDI complex and the structural basis for the regulation of Rho proteins by RhoGDI.
pubmed doi rcsb
source organism Homo sapiens
total genus 63
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2000-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ds6A00
1IM2A 1VG8A 3U44B 3A1TA 3B1WA 2F9LA 5KDDA 3O8CA 3KUDA 5FOTA 3T5GA 4JKIA 3RYTC 1TF7A 1TUIA 1FQKA 2H57A 3FMOB 2JCSA 2ZRPA 2OBLA 2WJHA 1SQ5A 4RD6A 3QXSA 3Q3JB 4RSGA 1WB9A 2BBTA 1Z2CA 3PUXA 1NLFA 4QBFA 1D2EA 2E87A 4D0LB 3CR7A 2W83A 4LPSA 5DE3A 3QVVA 4GP6A 3S1AB 1NG1A 1US8B 3GJ5A 4MRPA 1KGDA 1W49A 5H68A 1KK1A 4TLDA 3ONWA 3GJ6A 1NKTA 4BWYA 4EQ6A 2ANBA 4N1AA 1N6LA 1DO2A 2WPDD 1KMHB 4B3DA 2VP4A 1IXZA 4JSTA 4J0QA 1YZQA 2FF7A 4YXWD 2IYXA 1QHIA 3KJGA 4HDCA 4UJ3A 3UWKA 2WIAA 1G7TA 3L82B 1R0ZA 1EG7A 4WW0A 4Q4HA 1NMXA 1HV8A 4LRWA 2IYLD 4QGHA 1CR2A 4QFMA 2GXAA 1I4LD 1JEEA 1XJQA 3PR1A 3HDTA 2Q9BA 4LBVA 3M1IA 2OEPA 1T8TA 1NMZA 2GHIA 4Q19A 4R7ZA 1QG2A 3SFZA 1W4BA 4N3NA 1A7JA 1WE2A 4URXR 4KV9A 1E2GA 1EFUA 1LF5A 3EWSA 2BKEA 5B2ZA 1W36D 3SBEA 5GJWC 5AUPB 3I8SA 5DHAA 2QY9A 3EIEA 3THYB 1E98A 3F0TA 4FCVA 4B44A 4MRSA 3B13B 3UMFA 1TL7C 2HJVA 3GEHA 3OEHD 1BH2A 4C2TA 1Z29A 4KFSA 1JAHA 2ZRBA 5JSZA 1GRNA 4KFTA 5FBQB 1S1CA 1KHTA 3BB4A 4Z8YA 1P3JA 1XDBA 5FOXA 2YINC 3R9IA 3DKPA 4AYTA 4PAMA 2O8FA 5JI3E 5GADl 2WM9B 4TLEA 1L8QA 5EP2A 3R9XA 1CR4A 5L3SA 1XF9A 1W4RA 4F93B 1R8SA 1XTJA 1ZC4A 2IC5A 2OUKA 4JJKA 3AM1A 4DDUA 1OB2A 2O5VA 1W7AA 1BO6A 2QI9C 1KI4A 3I3SR 4FMCB 4HLUA 4OQFA 2ZRFA 3TQFA 2ODEA 1M7GA 1G3IA 2DWOA 3BGWA 4QHTA 4TL9A 2QTFA 1XX6A 2FEMA 2ZYWX 2B21A 3NBZC 1N5KA 4OHWA 1SKYB 1NJFA 4ZIRA 1BMFA 3DHWC 1J7KA 2W6ID 3RC3A 3RS5A 1ZC3A 2ZUCA 5C4MA 3PEWA 2ZJOA 2RH5A 2PLFA 2XSZD 1J70A 4GOKA 2GJ8A 4M0LA 1CBUA 1VYTA 2Z5FA 2E1RA 2QRNA 3NXSA 4M1WA 1X8LA 2ZE5A 1ZU5A 1ZNZA 2GCOB 2GWHA 2IEYA 2XJ9A 5JCZA 5KTYA 4ESVA 3TAHA 2WSMA 1XEXA 5AWFC 3NDBB 1E9RA 2QPTA 5EZ6B 3GCGA 3H2YA 1G5RA 4G5RA 3MGCA 3VR6A 1T6NA 1C9KA 4GFDA 3DM5A 1TF5A 4EJSB 4ESHA 1JR3E 1KOFA 2OV2A 3I62A 2QEQA 4EDHA 1NI3A 5DYGA 5TB5A 1HQYE 1CTQA 1YVDA 2XJ4A 3LW7A 1XCPA 1XTSA 3K0SA 4MKHA 1K5GA 4Z1MD 1G3QA 1PJRA 3GLIA 3O8DA 2E9SA 4C9BA 2VP5A 3HR7A 4WIAA 3A4MA 2ZJ2A 1G5PA 3D31A 5JEDA 2XXAB 1GKIA 1S0UA 1VMAA 2PBRA 4YDSA 1AS3A 1A5TA 2IYWA 4BLPA 4TSFD 3UXMA 4B3BA 2ZRKA 5KDLA 4AYXA 4MA4A 4TYYA 1E3MA 3QBVA 4PC7A 1CR1A 3FFAA 1QVAA 1ZCAA 4NONA 5EXXA 1G8PA 3EZ9A 1MO6A 3U60B 3IO3A 3P20A 1SULA 2QZ4A 3LRPA 4D81A 3KZ1E 3OIUA 3G82C 5KSZA 1DAEA 4JLBA 1G7SA 1GWNA 3GLGB 4YC7A 4HAUA 3TIFA 1D9ZA 1DG1G 1ZUHA 1IY0A 4Q1BA 1R2QA 3RNLA 2WZQA 3ZYCA 1U99A 2ZYUX 1SKYE 2FGKA 4D0GA 2JLVA 4JLDA 2IF2A 4BZQA 1KI9A 1VG9B 1LW7A 2GZAA 1XMJA 4D6PA 3IKJA 1N2CE 3T5DA 4HZUA 2GEUA 3WNDA 2A30A 1R0YA 1P6XA 4EPXA 1TF2A 1ZM9A 3W9YA 1Z6TA 2VL7A 4A82A 2OO7A 2C96A 2CVFA 2RGGA 1S9DA 1KKMA 1AKYA 2VP9A 3A4LA 4HB0A 2I3BA 4ZKDA 1GG2A 4BPBA 2OBNA 1DADA 3Q72A 2JJ2D 5A4JA 1TEVA 2VEDA 1F2TA 2ZS7A 3CRRA 2DWQA 4NZYA 5FI0B 3RS3A 4CF7A 2VBCA 4LBYA 2AXPA 4TL7A 4RY2A 4JIMA 2F1IA 5FBVB 2ZE6A 3CO5A 4MRNA 4JJZA 4DDWA 3SS8A 2PX3A 3K0AA 6Q21A 1NIPA 4MYTA 3WP1B 4QGAA 4HLCA 2LKCA 1QHNA 4BZXA 3Q5DA 2HLDD 1OIVA 1MO3A 2QAGB 1W1WA 2ZTSA 3E70C 4LJ4A 2F3TA 2AL7A 1FL9A 2RGNC 3KFXA 4Y0VA 5LPNA 1ZD9A 4WZAE 2B6HA 5EUMA 1OH6A 3TBKA 4TT3D 1Q1QA 2ZSDA 4BLTA 3EC2A 2GEVA 1XFAA 3LWNA 2WIBA 2Z0MA 2FMXA 2V54A 2ZAMA 2JIZA 1P2UA 1K5DA 3CNOA 2QORA 3SJBA 4GSYA 4FD2A 4ASUD 1E2KA 3SOPA 1VHLA 3IPYA 4DKXA 2ZRGA 1G291 5L3VA 4PAOA 2GBLC 3T1VA 4DSTA 4TZ6A 1W46A 1OXTA 3L0PA 4EUNA 3GLGE 1DARA 2NGRA 4EQ6B 3EX7C 1P9NA 1WMSA 1T0HB 3IIKA 3OEEA 2YNMA 2C95A 3AH8A 2Q9AA 4PZZA 4RZUA 5E95A 3U2QA 5EE9A 2IK8A 2ZI9A 3M0EA 1P9WA 2OFWA 4IOMA 3KTAA 4Q4HB 4BFXA 3EPKA 1SVKA 3KQHA 1VYUA 3X1YA 2ZM5A 1KSJA 4KO8A 721PA 4MRVA 3BB1A 3EAQA 1GOTA 1AGPA 2AK3A 2JDID 2YKGA 4Z54A 1G17A 3AVPA 1UEJA 1P60A 2NO9A 3BB3A 2KB0A 4KBFA 1OXUA 3TUZC 1E79D 4LHVA 3GJXC 1T3HA 4U5XA 4RKEA 3KB1A 1R7RA 1ZM2A 4ZDKA 1XWIA 4DDTA 4LC1A 3A8TA 1Z3IX 3M4YA 2FFQA 4A92A 4CZ2A 2VP6A 4CEHA 1OYYA 4AC9A 3FDIA 1IN8A 1AM4D 3PUYA 3LVQE 4Z51A 5JSZB 5IF9A 1XD9A 2BEKA 2IBMA 1G8YA 3IO5A 3VX3A 4M9ZA 3X2SA 2A5GA 4F91B 2O8FB 3PVSA 4IDPA 2VHJA 4U00A 2KSQA 3HU3A 2YHSA 2FOLA 5L3SB 2XOKD 5DLQC 3QPUA 5J4VA 1FUUA 1E2PA 3EASA 4U7DA 2GDJA 4IXMA 4C7OA 2ZRNA 1UBGA 2WWXA 4M1KA 2C99A 4IHQA 3ZQJA 1DS6A 2DFLA 4O25A 2JAQA 2GCPA 2ZI3A 5KNDA 2CK3A 4FWTA 1L4YA 1OFUX 1FTNA 3ZVNA 4DCVA 1HE1C 1BYUA 2VRWA 1R5NA 4MDFA 3DZDA 4ZIRB 5FR1A 4R2HA 3WP0A 5EE1A 4Q02A 1XD8A 2P6NA 1WDTA 4QBHA 3NH6A 4RZ2A 3SQXA 4KU4A 2WJGA 2BDTA 4LUCA 4OHXA 3LQQA 5ELXA 3RVBA 2UVQA 1ZD1A 3I92A 3Q85A 5FOUA 4DXAA 4B75A 2I1VB 3EPJA 2D7CA 3OIWA 3GFPA 4EKDA 5C4GB 4WXPA 1G64A 2WSSA 1LFDB 4H1UA 1XEXB 1VYVA 2CE7A 1CS4C 2YOHA 3OHMA 3QPVA 4PQRA 1KO7A 1QHHA 1EWRA 2IT1A 3MCAA 1FMJA 4NE2A 2BM0A 3AEZA 1B0UA 4Q1AA 2NPFA 3KQUA 2RHDA 3KXIA 1D2NA 2ZRCA 1XPUA 2EFCB 3QKUA 2B8WA 2ZE7A 3A1VA 2BCGY 1W0JD 2B92A 1E32A 3NDPA 1KSGA 1GKUB 5HTKA 3TSOA 4Q1EA 3LFUA 1XBTA 1Z0JA 3QOFA 3TMKA 3GLIB 1U98A 4M2LA 4QJ5A 3TUIC 2R9VA 2PEYA 3KQNA 4JT2A 2C77A 4PFSA 4XTRA 3RANA 2YJTD 5IK2A 1WBDA 1COWD 2IYSA 5CITA 1VKJA 1JAIA 3KXLA 2JLXA 2YVUA 3BFVA 1OLOA 1QDEA 4NPHA 2P3SA 3CONA 5CLQA 1IN6A 1NBMA 3UATA 4C0HA 1OW3B 3PJRA 1ZAKA 2YV5A 2HJGA 3OAAD 3FKSD 3FPAA 3O8BA 1SGWA 3ZZ0A 3EZ6A 3E1SA 3AGQA 2XZLA 2GVDC 1ETUA 3BRWD 4M9SA 5LBIA 1G6HA 3IHLA 1NN1A 4LJ6A 5AK0A 4KLNA 4M1MA 2GXUA 1N25A 5AJWA 4XIGS 1IBRA 4V0OA 5FUXA 5GVSA 4AY2A 3MLEA 4AG5A 4XWAA 2A5JA 2KJQA 2WOJA 3W6NA 3D6TB 1QHYA 5J4YA 2PJRA 2GBLA 3PXGA 4B35A 4IVRA 1NSFA 2A7QA 3AVWA 3RSLA 2NG1A 4WAUA 1G3MA 3QXHA 4BFWA 4GL2A 1OF1A 1OKKD 4DUGA 2QMUA 5CDFE 1JR6A 2J7KA 1FW6A 3IDQA 3AF0A 1MRNA 3AP3A 4HZUB 1H65A 1I2MA 2FZLA 4B6FA 1T8UA 4Q7MB 2W0MA 1EXMA 2ZIAA 2BBWA 3WMEA 4MGIR 5TMPA 3P26A 3D8BA 1NNEA 4PPQA 2FPMA 5LD2C 3RS0A 2PH1A 1AK2A 5FH9A 4D26A 2F7SA 1AQYA 1D8TA 4GZLA 4PQYA 3W5IA 1N5LA 4MDEA 3GJ8A 1W0KD 4YDHB 3MWLA 2IWHA 3CWQA 5BYKA 1Z6AA 1F2TB 4TMWA 4QXAA 5FPSA 2R6AA 1XEFA 2X1VA 2YC4C 5TV2A 4JLVA 2BVNA 3GLIE 3K0AB 4LK2A 3WNCA 4NCHA 1YU9A 2YWGA 5F98A 1OPXA 2ZPTX 3DMNA 3SE0A 4MGZR 5A0FA 2IYRA 4A0HA 3TW4A 1JPJA 2Q3FA 1EFRD 1HURA 1AS0A 3VHXA 1E9FA 5DN6A 4P4TA 3CNLA 4NBSA 4MKIA 4FXPA 5DSZA 3KDSE 1GRQA 5BQ5A 4C30A 1R0WA 2ZSFA 2BHRA 3B1XA 3NVAA 3P32A 4AWXA 1KY3A 2V7QD 4HDOB 5FL7D 1JQLB 2WWHA 1U2RA 2DBYA 4URZR 3T1TA 1NP6A 2WHXA 3FE2A 4E07A 3HU1A 1TTTA 5DI9A 1KDOA 3KJIA 3RS2A 1PLLA 2REBA 3E2IA 1R5OA 4MRRA 4Q01A 3EA5A 1KSHA 1T9HA 3A1UA 5HKKA 3LXXA 4R71A 2ZS8A 4KJZA 1DELA 4DLTA 4TQ9A 4EFMA 1XEWX 3K9HA 1YE8A 4JL6A 4TTRA 3THWA 5JMTA 2ONJA 4DT1A 3BH0A 4ZDJA 5JBQA 3C4JA 2ZUDA 5FUWA 4TYNA 2ECKA 2OM2A 3AUYA 1KYIA 3KTAB 2OLKA 1R8QA 1VG0B 4QM6A 1NJGA 4L9SA 2HT6A 3IIJA 3TW8B 3L43A 4WA7A 1KI8A 3QE0A 3EPLA 1OXSC 3QXXA 1NF3A 3BOSA 1QRAA 1E9SA 4IW3B 3RS4A 5EP3A 1P61B 3VFDA 2XAUA 2OCYC 2CNWA 1OHHD 3DM9B 4W5JA 2G1KA 4XD7A 4I81A 3G5UA 1FP7A 1GUAA 1AIPA 3EC1A 1HT1E 4DLWA 4KI0A 4TYQA 1DE0A 3EIQA 4CEHB 4NL4H 5CYPA 2AFHE 3W90A 3ZD6A 2C8VA 4R2IA 4Q5IA 2AN9A 1NLZA 1V5WA 4DDVA 1W47A 4ZO4A 4CDGA 1ZINA 2G83A 1HYQA 1R6BX 1IXRC 5IRCD 1TPZA 1E2EA 1OJLA 4Q4JA 5B57C 2P5TB 4LJ5A 4JBXA 2J3EA 1YHNA 3WYFA 2ZJAA 2WKPA 3HPRA 3I8XA 1E1RD 2D2FA 5J4KA 2PX0A 3L0IB 1OIWA 1H8HD 1Z83A 1CJUC 4IDNA 4C7OB 2C9OA 4Q9JA 2RGXA 3N5CA 4O3MA 2HV8A 4KAXA 1Z06A 2ZI7A 4EPVA 4FI3C 2BC9A 3OFNA 3K1JA 4GI7A 5F3WB 2IX3A 1YR7A 4CGZA 1NY5A 1P2VA 1YZKA 1HQCA 3AQ4A 4PSKA 4Z8XA 3W8NA 2HEIA 2LCFA 2HCJB 1EWQA 2FFHA 4UXHA 2IUTA 2D3WA 4HLQB 4HLDA 3MRSA 1W2HA 3KJEA 1U81A 3WY9A 3LLMA 2R2AA 3BIFA 5FOVA 4ZV4A 5CM8B 1S8FA 3MFYA 4I1UA 4UNNA 3VKGA 3P1JA 3SBDA 3IEUA 2EYQA 3VKHA 1QHHB 2A78A 2OBMA 4XJXA 1Y63A 2P6UA 3CH5A 4WZBE 2ORVA 1E0AA 1M7BA 2IF0A 3IILA 4HAXA 5DH9A 1X86B 5AJVB 4BFZA 1Z6GA 2K5UA 2R6FA 4UJ5A 2ATVA 4OK5A 4AYWA 3NEYA 1RE0A 3BFKA 4PC1A 4OHYA 3D7MA 4BQSA 3SQWA 3DZ8A 5EJEA 2EU8A 4V02A 1SVLA 3T1OA 3PEVA 1G4UR 3ZJYA 3ADBA 4RD1A 2MSEB 5FTKA 4OYHA 421PA 2W2VA 3W5JA 2JATA 4MYUA 5JECA 3EG5A 1KI7A 3C16C 3NC1C 2G6BA 2DCUA 1JJ7A 3DMDA 5EP4A 4GDFA 3EA0A 1XJ0A 1X3SA 4KBGA 4OQMA 1B23P 3BERA 4CEIA 4LJ7A 2ZRAA 1DAGA 2G0NA 5BN4A 2DFKB 2IHBA 4X8HA 4D4LA 2PJZA 1UDXA 1ZM4A 2J7PA 2GZDA 4MITA 4M1YA 4LOAA 1AQUA 2ZRDA 2JA1A 2CVHA 1HH4A 2FU5C 4BLSA 2V6JA 4GP7A 4QGGA 1PVOA 1FZQA 1E2DA 4Q4LA 2CLCX 1KO4A 2JLRA 4GBMA 1U94A 2GZHA 5KNCA 1WCV1 2FPKA 1DTSA 4MGYR 5E7IA 1NN5A 2IS2A 4A8JC 2FSIA 3AP1A 3GEEA 2AWNA 1G8HA 1H8EA 4N0EA 3U3KA 1UADA 1T5LA 3AB3A 1SHZA 5JLJA 5FTNA 2IXFA 3B78A 3MJRA 5DNYB 2AK2A 4TN1A 1HY3A 2B7BA 1D5CA 5DIFA 5JWOA 4F4CA 2PMKA 3QEJA 3TUJC 5JJLA 4I1SA 4KVAA 1OT3A 4NCNA 2GA8A 1DAMA 4C3ZA 4LJ8A 4NCKA 3IPXA 1CULC 1ESMA 1GL9B 1MOZA 4A15A 1NVVR 4Q7LA 1N0UA 3TH5A 3CX7A 1JPNA 1T3LA 2QTHA 4JBYA 1RKBA 3C41J 5EXSA 2ZR9A 2EFHB 1N6OA 2DWPA 1RPZA 3NBYC 3QPWA 3F5FA 4P4UA 3CRMA 2J0QA 2D74A 4BFYA 4Q1FA 4ZKEA 3QKRA 1GL6A 4KCGA 2QN6A 3MWJA 5HZKA 1O3YA 4LHXA 2QE7A 1ZRHA 5C1BA 5J4HA 4JLAA 1NBME 4JVLA 2VLIA 1N6RA 2WOOA 1M1YE 1X1RA 3QKSA 3V9PA 1MH1A 1Q1BA 4BEBA 2O8DA 2IYVA 4RJLA 5KSYA 4OJQA 3OESA 2Q3MA 4HAVA 1XPOA 3HYRA 1PUJA 2XZPA 4DJTA 3LBHA 2A5DA 4GRAA 5JCPA 5BN5A 3PQCA 2IL1A 3QENA 5FOSA 3VMFA 3EW9A 2JJ1A 1MRSA 4IEEA 4DCTA 4JS0A 3H84A 5KSOA 2W2XA 4R98A 2WKQA 3BH6A 2GJAA 2VF8A 2R6DA 5BYJA 1X1SA 4WZ6A 2OT3B 4RD3A 1AS2A 2GJKA 2HLDA 3THWB 1L7VC 4DT1B 3NTUA 1E4YA 1M74A 3REGA 2ORIA 2CE2X 2G9NA 1W44A 3TRFA 221PA 2CHGA 4P0TA 2RKOA 4PAQA 5CIQA 2QMEA 3AF4A 3MAAC 5DHFA 1DPFA 1E9BA 4LCBA 4RCZA 5FBWB 3ICEA 2WV9A 3U61B 3FGNA 1RZ3A 4L4UA 3MG9A 2P6RA 2GXQA 4FCTA 2YWHA 3KL4A 1W2GA 2ODWA 3NC0C 2A5YB 1D9XA 3BE4A 2DFNA 2Y8EA 4PXAA 1TX4B 5FUYA 4OL0A 4W5HA 2QSZA 2ZRLA 4URVR 5JHHB 3ZVRA 5TXGA 5G41A 5FPKA 4O2LA 3LW8A 1ESNA 4Q18A 1ZW6A 4HB4A 5FPHA 3SZRA 1VHTA 2XNDA 2AKYA 1UKVY 4M4SA 3K70B 2XNSA 1N6NA 2PLRA 2X77A 2JLYA 2PZEA 3GLHA 2ZE8A 2FJUA 2V8OA 4IXNA 5K8LA 2VA8A 3GQBA 1SXJC 4KSBA 5JS8A 1P4SA 4RD2A 1YQTA 3QIAA 2FDCA 1DAIA 2G77B 2OILA 2BWJA 4QHSA 4Q4JB 3SNHA 1I2DA 3H0KA 4RFSA 1BMFD 1Z0KA 4V0NA 1KI6A 4DEXA 2J5XA 4V0ME 2IXEA 1RRGA 2H1LA 4MKFA 5ANRB 2SHKA 4A2WA 1UBFA 2EYUA 3TE6A 4BECA 4GZMA 2P0EA 3ASZA 5G53C 1MO4A 3C15C 4OI2A 5E4FA 4ZCMA 2BCJQ 2UZIR 1CJMA 1N5IA 2YZ2A 3R7WA 2XB4A 2F3RA 2C04A 4TQUS 1WBBA 4KLZA 3AUXA 1KI1A 3L0SA 3DDCA 2ZQ5A 4FMDF 1W5TA 4HZIA 1KNXA 2BMDA 3LX5A 2HF8A 3U6KA 1Q0UA 1VCOA 1G7CA 3LA6A 4H9GA 1T5IA 2VPPA 1CJTC 3K09C 4JLJA 4A8JA 3NH9A 4I1VA 4PHTA 2GTPA 2CL6X 2AKAB 2RGDA 2C78A 2W6JA 3OZXA 4C0KA 5HCNA 4AKIA 4QNMA 3NIBA 1S96A 2W58A 2RGCA 2X8AA 2ZI6A 4DIDA 2QTVB 3Q7QA 1CF4A 2F1HA 4PSVA 1XMSA 4LHYA 5DGXA 2BBOA 4JZKA 2FGJA 2O0HA 4DLVA 2GKSA 1DG3A 4B76A 2F55A 4DLSA 2VTKA 4TLAA 3GLFA 1LY1A 2ORWA 1F2UA 4CT5A 4AIIA 2WTUA 4OI1A 1E2NA 4UNPA 4KYIB 4MQBA 3FHCB 3LVRE 1HUQA 4NYJQ 2V55B 2R6GA 1IAQA 2BJWA 4LJYA 4BASA 3ETLA 2J1LA 4OHVA 3TKLA 621PA 1S1MA 1FNNA 2UZ3A 1SVWA 1AN0A 2H92A 2FWRA 1ZM7A 2FZ4A 3ZVLA 3VU9A 4CEIB 1ODFA 1IONA 4PO9A 3QF4A 2AD1A 4GOXA 2BBSA 5JI2E 4C0AC 3IUYA 4Q9KA 3VAAA 5J40A 1W0JA 1K6MA 1KO8A 1NVWQ 3JZAA 3WHKA 4QHYA 2IUUA 4G1UC 1UPTA 4XOIA 4A6XA 3U4QA 2JLQA 2F6RA 5JS7A 2QNRA 2ASEA 3P4XA 3AVYA 2QP9X 1KTVA 4LC0A 4JLPA 1ZUIA 4Q4AA 3SN6A 3K9GA 4B34A 5EUQB 2J9RA 2ZJ8A 2PCJA 5F9HA 1QBKC 3B85A 2REOA 2Z83A 1KK2A 3QI2A 2LKDA 1GL7A 2AXNA 4PZYA 3C8UA 1E1QA 4YONB 1A2KC 4OQLA 3L8YA 1YZGA 4A4DA 1GNPA 5CIWA 1CLUA 1Q3TA 1NLYA 1RVDA 4B3FX 2D06A 3CPHA 3PCRB 4D4MA 2HT1A 3CBQA 3W3ZB 3WBKA 1EFTA 5AJZA 1GNQA 1DVRA 1SKQA 1GSIA 2ERYA 1NVUQ 2FEOA 2QP4A 4OHZA 2W2TA 4OI4A 4D0NA 3THXB 2GK7A 2V6IA 3A37A 1Q3HA 3Q8XB 3U3RA 3WRYC 3WYAA 4YQFA 5GJBA 1OE0A 3QQ5A 2EVWX 3T61A 2OFOA 3CF2A 3QVUA 3A1WA 4A0FA 4D80A 1XD2A 1KK3A 2WWIA 5CLLA 1UDWA 4V0KA 3ZQ6A 4P33A 2WAYA 1OH8A 4JKYA 3NWJA 4M53A 1Z08A 4EJSC 2BEJA 1U0HC 3QBTA 3BC1A 3BD9A 3CKLA 5KUTA 3EPHA 3AV0B 2JIZD 1S4QA 1II8A 2PEZA 3SYLA 3ZH9B 1BIFA 1EK0A 3B1YA 3QKRB 3BXZA 3FMFA 3ZDQA 1DAFA 1GM5A 2AWOA 1P5ZB 2GNOA 3AVUA 1SXJA 3F3YA 4MYCA 5CM9C 4Q7KA 1Z0FA 2JEOA 3MUFA 4PHGA 5JJKA 1CP2A 3VX4A 4C0SA 2QT0A 3ADCA 1EESA 4FMCF 2GJ9A 3FKQA 3DOEA 3QKSB 4IOKA 3RRMA 2O0KA 1ZBDA 3OEED 1PUIA 4RCYA 1TQ2A 2O8DB 3DO6A 1LVGA 3THOA 3OIYA 2WMOB 4Q9LA 2HXYA 2C98A 4DCSA 1XU4A 1UAAA 1YJ5A 1QHXA 4W5WA 2IYQA 2ZU6A 3EZ2A 4NKRA 3OE7A 2ZJ5A 4RFVA 2XB2A 3E5HA 4KODA 4MUBA 3K0FA 2V1XA 2DHRA 4FMBB 2QUZA 4KITB 1DBSA 4OQNA 4II7A 1VIAA 1RW4A 4BFUA 2V1UA 2QP3A 1CXZA 4AURA 2ZRHA 1G5TA 3AVOA 3RRNA 1KAGA 1N6KA 2RGNA 2G0TA 2NIPA 1LF0A 1F3OA 3WNBA 4P3YA 1L4UA 3PUVA 2AHOA 2L0XA 3K09A 5HE9A 4URYR 1Z6XA 3FOZA 1MR3F 4E09A 5E7JA 5JFGA 1CIPA 2FA9A 4BLQA 1DEKA 2WMNB 3TLXA 2ZU0C 2GRJA 1W36C 2FE4A 3DKVA 5JRJA 2OXCA 4G0NA 1J90A 2VHUA 4M9XA 2GCNA 5L3RA 4YXWA 5AUOB 4UXJA 1JXOA 1VTKA 4KYUA 1D2MA 1SHKA 2V4ZA 3N70A 2WVJA 3ASYA 3GPLA 4XTCS 1Z6YA 2ZRMA 3VR5A 1FFHA 1S9HA 4M21A 2GEDA 4AG6A 3I5XA 2OE2A 4WOPA 2QRZA 2OCBA 4V03A 1JR3A 2EFDB 4LZZA 2RCNA 5F9FA 3IQWA 2N1BA 3GLHB 4NHOA 3MD0A 4LY6A 5JRZA 2FV8A 2P2LA 2QGNA 1LTQA 2CK3D 3KX2A 1KSFX 4V0LA 2IHYA 4M1SA 5FTMA 5J4LA 4MGKR 4N0DA 4F4IA 3TSWA 5DISB 2G88A 4RFSB 3SHWA 2WWYA 1KI6B 4EPRA 3ICQB 2H5EA 4RKFA 2CMKA 2R44A 1FMLA 3ZIAA 5FTLA 2PT5A 4D25A 3KKMA 3ND9A 2PZFA 1G3UA 4PC6A 3UMSA 4L16A 5EE0A 4GPTA 5J5CA 3T35A 4RVCA 2OG2A 5SZKB 3R7WB 2Q6TA 3KQLA 2WSSD 3B7GA 1F48A 1AGRA 1K8RA 3C5HA 2B8TA 2QMHA 2JLWA 2IA5A 5H70A 3R9WA 3T1QA 5H1YA 1U8YA 1YZTA 5KSPA 1VCIA 3KFVA 3N2IA 3NG1A 2YC2C 2VO1A 3ND8A 4A8JB 3HR8A 3IBGA 4A36A 1KJWA 1QF9A 1OB5A 2VP2A 3ADDA 4ITRC 1M2OB 1XP8A 2PCLA 3WHLA 4I1OA 4EPTA 2VH5R 1W4CA 2QSYA 2H16A 3WXMA 3RS7A 4LBZA 5FBRB 1RFLA 1KI2A 3B9QA 5CB8A 1A2BA 5IK2D 1W5SA 1QZXA 4B3GA 2WAXA 3QG5A 4LV8B 1SVMA 4XH9B 4C0LA 1XTRA 3SC3A 3CF0A 1Z0AA 4NTZA 2ZS9A 5GVRA 3RRYA 1NBMD 3TK1A 4B3XA 3WRXC 4DLZA 5CYOA 3RABA 3GLFB 3QSYA 2D62A 1F2UB 1A1VA 1FTSA 1II0A 1OFIA 3B60A 1RIFA 1TQ6A 2FN4A 3SEAA 4YMUA 2R62A 4LWZA 3QG1A 4AK9A 5L3QA 1ZU4A 1CRPA 3GLHE 1AZSC 1WF3A 3IIMA 4IKEA 4IEIA 4US2R 5A5GA 4US0R 2FX3A 3B6EA 3EZFA 2FFAA 4PZLA 1E2QA 3IHWA 4CRWB 1ONBA 3K0EA 3GD7A 5TVKA 3VU9B 2EQBA 4ZCLA 4QBIA 1KZGB 3QF4B 4DUGD 3AF1A 3CX8A 4ON9A 1IOZA 1YZUA 3QKTA 3CRQA 4C0JA 2DB3A 4URWR 1UFQA 2PL3A 3U4QB 5SZIA 4LYJA 4G3XA 3WMGA 1VECA 1Z28A 1LB1B 2WPDA 1G19A 4LSGA 2AD5A 2O52A 1V43A 3O47A 1CJVC 4JVSB 4Q4AB 2RGAA 2RB4A 2ZSEA 121PA 1FNMA 1JALA 4OK3A 1E9EA 4G5GA 4TMKA 4HLUC 1QG4A 2OSBA 4WVFA 2I4IA 4P4SA 3CUEF 2DY1A 5EP1A 2Q21A 4HDQB 1N6IA 1VG1A 4PC3A 3RWMB 2XTZA 4C2UA 3EWAA 2VSFA 4FCWA 4ARZA 1EX6A 3VR4A 1KNQA 3IEVA 1E2JA 1HT2E 1U9IC 1RC8A 4NU0A 3KKOA 5KU1A 1IN4A 1U90A 3NHAA 3EIHA 1YR6A 1NVXQ 1OXXK 4LHWA 3PG5A 1GILA 1ZNWA 4JL5A 1FUKA 1XCGB 1XXHA 2KWIA 4ERNA 2KBEA 1E6CA 2EW1A 2QG6A 3KKQA 3W34A 5DN6D 4M1TA 1XD2B 1UBEA 3OEHA 2REXB 3AVVA 3GLFE 4A1FA 1KO5A 4JYCA 8OHMA 3UG6A 4F7WA 1II8B 1E96A 1S3GA 2H8KA 3ZD7A 1DAHA 1RJ9A 1F60A 4RD4A 2DFTA 1OFHA 2HCBA 3H86A 5JWHA 3W6OA 2ZANA 1KJYA 4PSAA 3A58B 1SXJB 2J0VA 3SU8A 4B48A 3LX8A 1GVNB 5HKKD 3L2OB 3FYHA 2VHCA 5GJVC 4L15A 1KAOA 4TTQA 5J47A 4ZI2A 3OIVA 3GFTA 3X1ZA 2ZRJA 1IY2A 2VQSA 5CB6A 5KYKA 1DOAA 4GNKA 1E9AA 4QJ4A 1GITA 2OZEA 4Q9IA 5CJPA 2MMCA 4AI6A 3H1TA 3HU2A 4Q21A 1XB2A 3ZGXA 3JVUA 3P4YA 1E2LA 4DSUA 1XMVA 2W6IA 3K0FB 3L8ZA 1KO1A 3AVXA 4JBWA 2J46A 1U0LA 1TU3A 1NKSA 1C4OA 2ZR7A 4A2PA 5K8UA 4W9MC 1LV7A 2JJ8A 2ZITA 4TLCA 1MV5A 1ZIPA 2R6CA 2RGEA 2XSZA 4F4JA 2AR7A 1Z5ZA 4BUJA 4PO8A 2CNWD 1G18A 1PLJA 3GFOA 2FNAA 2XX3A 4XD7D 2IXGA 3LD9A 2NO1A 5CK5A 5KHOC 4HEJA 2IS4A 3K0CC 1EX7A 3ZS8A 4K81B 2C5LA 4YMTA 2D4HA 3KKNA 2WWWA 3DL0A 2C2HA 2IYYA 3U6BA 4LBWA 1JJVA 5FPYA 3K70D 4X8OA 1NRJB 3B5JA 1EGAA 2J59A 2CXXA 4PO1A 1O87A 1RRFA 1N6HA 1U8AA 1JBKA 2BKUA 1II9A 3H4MA 1TUEA 2NTYC 1VCMA 3SJAA 3SYNA 2VYFA 4XVRA 5D3MA 3PENA 3X1WA 2YYZA 4MYHA 2IYUA 1XJCA 5HE8A 4Z1MA 1XTQA 4Q03A 1JB1A 2GXSA 1J99A 4KHZA 5G3YA 3R20A 3RWOA 4DLXA 3LBIA 2G1JA 4LJ9A 1FQJA 3RC8A 1X8JA 5IT5A 3BS4A 5JEEA 4B3CA 2A3RA 3UPUA 3PV0A 4LX0A 2AFIE 3CNNA 4TSFA 3I72A 1UJ2A 4I4LA 1G4AE 1Q20A 2GAOA 1MKYA 4DIEA 1N5JA 2MSCB 2OFXA 2C9CA 1SXJE 2CLDX 4S35A 4PR0A 3U3OA 1T4GA 2QAJA 4ZCIA 3OFND 1G8FA 4IFEA 4A0RA 3FHOA 1TQ4A 2V9PA 4OI0A 3BFXA 3AKCA 3TR5A 3THXA 4AKGA 1X6VA 4A6PA 3PITA 4UXIA 3NKVA 1T3SA 1GTVA 2NPIA 3TVTA 4BFSA 1BYIA 5LB4A 2CHVA 2YOFA 3LAWA 2YWEA 4M22A 4D4JA 1G6OA 2ZJYA 3TQCA 2PMDA 2BV3A 4HAWA 4QC2A 1QVRA 3R8FA 1ZUNB 4IRUB 2GK6A 2J41A 3UANA 2ONKA 4IFBA 5K8IA 2OLJA 1JI0A 1TMKA 1VIYA 3BBPA 3BORA 1M6NA 2HF9A 2ZR0A 2XZOA 5AUNB 4QOSA 5AR1A 4EIWA 4CEJA 1PV4A 5CJ2A 2R65A 4KFUA 4L8GA 1P73A 1A82A 1J8MF 3KKPA 4B2IA 1Q1EA 2PT7A 1WXQA 4LGMA 4O0MA 5EQTA 3DEFA 4Q7JB 5CDFA 1Q1ZA 2F9MA 4MUAA 2H7VA 2JJ2A 1U9IA 5HR5A 2WJIA 1S2MA 3A1SA 4B6EA 1GDDA 1OYWA 4JLKA 2HDNB 3UWOA 1SVIA 1XTIA 3VR3A 2PZGA 3C7KA 3LLUA 4DB4A 2Z6VA 1D6JA 2BMEA 1UF9A 2CHQA 3BJIC 4I99A 4OQXA 1EFCA 2CCGA 2CDNA 3CB4A 2QU8A 4PQFA 2JGNA 4EPWA 4Q47A 1ZP6A 1GKYA 2QT1A 821PA 1CKEA 1Q12A 3QXCA 1YRBA 1YR8A 2H18A 2J7PD 3PIRA 1J8YF 1MABA 4YMSA 5L3QB 2X2EA 2O8BA 2ZVQX 1AJEA 4G5SA 2QMOA 2XTNA 3T15A 4TT3A 5FOWA 1OFTA 3V4RA 3MMPA 2OHFA 2ZI4A 3NEJA 2FSFA 3AF3A 5SZJA 2F1RA 3VNUA 1Z47A 1XRJA 1IY1A 4S2EA 4M9QA 5F2EA 4D2IA 1UKYA 2N42A 2Q9CA 4ASUA 4QBGB 4EFNA 4QGFA 4ACBA 1Z0DA 1LNZA 2FSGA 2F43A 1G3RA 4B2LA 4BRUA 1H8ED 1WP9A 4UQOA 2O8EA 1WQ1R 2EWVA 3SFVA 2DR3A 4C4PA 3CRVA 4EFLA 4UNSA 1PZNA 4R9UC 3CPJB 3KQKA 2CL0X 3AF2A 2QPAA 2QROA 3Q5EA 3GP8A 3G0HA 4TMXA 4PPNA 3CPEA 2CEAA 3W6PA 1HE8B 4Q66C 4DWJA 4NYIR 4LYHA 2JLZA 4P4SB 1VPLA 2IYTA 4TMZA 4A2QA 3X1XA 1E99A 2R8RA 2UKDA 4LV6A 4B43A 2WJVA 3I5YA 3T34A 2JDIA 4B73A 4ARZB 4HYYA 4X8MA 3K0CA 1MO5A 1KDPA 5FFMA 1CJKC 1TNDA 4PTLA 4HB3A 2BOVA 1E79A 4G5QA 1W36B 3NBFA 2G3YA 4POAA 4YMVA 5CK4A 1XXHB 3W3AA 1CU1A 5G40A 3ADKA 1C1YA 2QE7D 3KUCA 2IS6A 4BE7B 1UM8A 1WRBA 2ZYVX 1ELOA 3LY5A 2CJWA 3HWSA 3U5ZB 1P9RA 3I1FA 1TEXA 3WBJA 1KJZA 2FSHA 1N0WA 1YR9A 1FX0A 3FMPB 2HYDA 3UIEA 3FWYA 2NZ8A 4PPFA 4UKDA 4XVQA 1G7RA 1RJ9B 3U7GA 1VCNA 4KVGA 4JYBA 3HJNA 5FR2A 2VIIA 3CRW1 3GEIA 1G20E 3QUSA 4QKQA 4URUR 4Q00A 3UG7A 1MT0A 4MH0R 4CW7A 2NOAA 2QBYA 3FVQA 1QHGA 1P62B 1XEWY 3LBNA 3AKYA 4AKEA 1DO0A 1CEEA 4RZXA 2DPXA 4ZPXA 2JJ1D 2XOKA 4DSNA 5G3ZA 3BK7A 1QHSA 3MWKA 3VTKA 5E7MA 3LNCA 4DCNA 5LD2B 4Q1CA 4GT1A 4B32A 4ACAA 3VNVA 1LS6A 2RMKA 1ZNYA 3BAFA 3KB2A 4OKSA 5JWRA 1XZQA 5KNBA 3K9LA 2WWFA 4W7SA 3TGPA 1OSNA 4DLYA 4NYMR 5SZHB 1IXSB 2NO6A 2A5FA 3PUWA 5IHPA 3R8CA 1E2MA 4AD8A 3CR8A 1Z07A 4HUTA 2WBLC 1OXVA 4PPGA 1GNRA 2HXSA 4PC2A 4QM7A 4Y0AA 3K9NA 1OH5A 1ZVQA 3EZ7A 3U7FB 4EAQA 3ZZUA 4NP6A 1M7HA 4XWOA 5HPYB 4FN5A 4BEJA 2J0UA 2X19A 3DOFA 2O8CA 2V3CC 3HPQA 4IVPA 2RGBA 4BGDA 3A4NA 4B2PA 1BKDR 1CR0A 1SVOA 5EXPA 2XEXA 3AGPA 4E03A 3C5CA 1I4TD 2WJYA 3VKWA 2J45A 2D2EA 3K53A 2IS1A 4TMTA 1G8GA 1P2SA 2XNDD 3A6PC 4BZPA 2JLSA 1DAKA 4FW9A 3VR2A 3LQRA 2ANCA 4ZDIA 3SR0A 4F92B 3ZZTA 2ZSBA 3CF6R 5DO9A 1AZTA 2J0SA 3VHLB 4CYMA 2IWRA 3B82A 2ZSAA 3CW2A 3TJZA 1XXHE 3JZMA 5D3MB 3MWYW 3TVDA 3NBXX 2ZJZA 1IQPA 3F8TA 4G5OA 1I4DD 1BS1A 3SYKA 1G1MA 1JXMA 3JVVA 4RD0A 3U3JA 5TY0A 2GVZC 1E94E 1FP6A 2ZYTX 4FINA 3LO5A 4AKHA 1COWA 4X8LA 3QXJA 1KDTA 4TQAA 3ECCA 2ATXA 2BM1A 4EPYA 3IBYA 3CZQA 2B7CA 5FBLB 1Z22A 1KZ7B 2QENA 3Q9LA 4P32A 4D82A 1S3SA 1ZMXA 1PLKA 2A2ZA 4MKGA 3OAAA 4JT4A 1E2HA 3FKSA 3TNFA 3WMFA 2JLUA 1UBCA 3IGFA 4DRZA 4TYWA 2OAP1 4G01B 2W0SA 5M04A 5C18A 4O2RA 4DHEA 3FB4A 1E9CA 2P65A 4A0GA 5LDDC 5DYIA 1FPMA 3KXKA 3AVTA 1E2FA 4KFRA 1GIAA 1HEIA 1KY2A 1G21E 1RYHA 5B64A 1IJEA 5DI3A 3K8YA 1F6BA 4IVQA 3B9PA 3QEOA 3MJHA 2WICA 4LDJA 1M8PA 4JSYA 2HUPA 3KJHA 4HAZA 2W6JD 4YLGA 5HZHA 1E9DA 1N3BA 1OKKA 4B47A 2A9KA 2OCAA 4Q48A 1RRCA 5FTJA 2W00A 3ZLJA 2NZJA 2FG5A 4ZI3A 5EZ5A 3HP1A 4DC9A 3SDZA 4CVNA 4CEJB 4NDZA 5FPTA 1R5BA 5LB2A 2ZUBA 4CIDA 1P75A 2CCKA 2WWGA 4H1VA 4OK6A 1KDRA 1L2TA 4DZZA 4HUQA 4TLBA 1N0VC 1WA5A 2OXRA 3V4FA 4DCUA 1T0JB 4LV5B 4B33A 4TWZA 3EXAA 1Z0IA 4JLMA 1W0KA 4DLUA 3MSXA 1X8KA 4RZ3A 3CX6A 3PFIA 3AKDA 2QM8A 1F5NA 2CLSA 3U44A 2NO0A 2NQ2C 2ZI5A 2WKRA 1NL3A 3B2EA 3RHFA 1RRPA 4HATA 4XWKA 1TQDA 2AX4A 2XITA 5UKDA 2XGJA 2ERXA 3QY0A 2RAPA 3LXRA 3AP2A 2GILA 4P31A 5H8WA 1XPRA 1Q21A 4QRHA 1GZSA 4UNQA 4WBSA 1ANKA 3OF5A 1JQJC 4BFTA 2ZJBA 3I61A 4GOJA 1SVSA 1XCMA 1E69A 2QA5A 4LYAA 5KDOA 3REFA 1GP2A 3GJ0A 4A9AA 1E0JA 3T06B 1R10A 1AKEA 4IDHA 1G16A 1ZD8A 4IDQA 3S1AA 2O8BB 1MABB 1US8A 1ZNXA 4JLOA 4DSOA 1EFRA 4HB2A 3CZPA 1GFIA 3NHBA 3GJ4A 1IN5A 4LPKA 2XTMA 1YZLA 4XVUA 3K70C 4E5UA 5E3HA 3GJ7A 5JJIA 5K8TA 3J81k 1KMHA 3O8RA 4XSHA 2YOGA 1NN3A 2N46A 3RRZA 1NN0A 1M34E 1LS1A 2V7QA 2ZROA 5FL7A 3HYTA 1NVVQ 1SZPA 1UKZA 1NIJA 5EXTA 2IEZA 1IJFA 2F43B 1E1QD 5KPJA 4JVMA 3PUZA 2O8EB 1UKEA 1Y3AA 3FHTA 5EE3A 4YMWA 2KI5A 2WJJA 2QQ0A 3SJCA 1E0KA 1Q44A 3FTQA 4Q9HA 4QNRA 1U0JA 4US1R 5C46F 1TU4A 2GJSA 2ZXUA 2KBFA 3IQXA 4XSGA 1W4AA 3THYA 3I73A 2CCJA 2RHMA 4DBLC 2Q0HA 4NMMA 2BJVA 4IOJA 1KI3A 1TAGA 1KMQA 1ZJ6A 2FFBA 1Z2AA 4K8OA 1CRQA 2BIFA 4FWIB 1ZCBA 2QAGC 2QL6A 4HI0E 4JVNA 4BLOA 4JMPA 4QJ3A 3SI7A 1RYFA 1U8ZA 1OHHA 3UK6A 2GESA 2P67A 4KXFB 4LHZA 3U7EB 1T91A 2GAAA 3T12A 4PX9A 3A36A 2VHTA 4L5BA 1SXJD 3PEYA 1P2TA 2QPOA 5KPDA 1ZM3A 2EFGA 4C0BA 2QM7A 1OIXA 4F38A 1W48A 4M1OA 2CJWB 2F1JA 2Z43A 3BH7A 4ZDWA 4LYFA 5BWMA 2OCPA 2KE5A 5B30A 4IDOA 1FX0B 4QG7A 2VHQA 4FIDA 3Q7PA 4Q1DA 4E22A 3B1ZA 4JL8A 3U3MA 3PEUA 1G9XA 3QF7A 1R0XA 2QQEA 5AUQA 3VR1A 2VSOA 5EE5B 3UMRA 4GMDA 4B74A 3OE7D 1Q22A 4KSCA 1NMYA 4CT4B 2QBYB 4DB2A 2IUSA 4LJAA 5KOYA 2OESA 2ZVPX 3LDAA 1YRAA 3X1DA 1XNJA 1E1RA 1P7CA 2ZAOA 2P5SA 4L9WA 4OJKA 5IDVA 1H8HA 3TAUA 4PHFA 2BMFA 3WYGA 1R4AA 1AA9A 1NSTA 4ABYA 4B71A 1JECA 4LI0A 3AVQA 4C0QC 4BLRA 3EARA 1XMIA 2GCOA 1YZNA 4DEYA 1OH7A 1KK0A 3ZVMA 3UKDA 4V0MA 5JHGB 5FI1B 4BRWA 3SJZA 1KIMA 1OV4A 4EJSA 5BXQC 4NYIQ 5JZVA 4BFVA 1E0SA 2IW3A 3B1VA 3D3QA 2J0UB 2O8CB 2H17A 3ZS9A 2DYKA 3CWZA 5TARA 1Z8FA 2C9YA 1XTKA 3DPUA 3V00A 1E4VA 5P21A 2I1QA 2BMJA 5KO2A 5GJCA 4PHHA 521PA 1IHUA 2Q3HA 5HCIA 3SHFA 1JR3D 2XXAA 1BOFA 1EFHA 4HAYA 4ILEA 5D3QA 5C2JB 5L8VA 3CM0A 2Z4RA 4PANA 3TSZA 3LH5A 1N6PA 2O0JA 4M8NE 5BN3A 2FPLA 3FFBA 3N2EA 3RDPA 2LWIA 2MMGA 3RLFA 2NMVA 4IOLA 5AJXA 1P72A 2NO7A 3CIOA 3ZIAD 1ZYUA 2J87A 3LV8A 3TR0A 3GMTA 4TL8A 1G41A 4TTPA 1Z63A 5BW8A 2EWWA 2ODBA 4TYPA 4K46A 4WXRA 3GLGA 4HSEA 1J2JA 2CL7X 2CBZA 3U7HB 2ZEJA 3BWDD 4NH0A 1UEIA 2VSXA 4TL6A 5FUVA 1FOEB 2OAQ1 1KKLA 4GMXA 2IYZA 3DVLA 2VF7A 3RSOA 2FH5B 1E2IA 2X2FA 3B8HA 3CH4B 4UNRA 4FMDB 4NYMQ 4IJMA 2GF9A 2D7DA 1GRRA 3AKEA 4NYJR 5DI3B 1ZIOA 4QL3A 4TMVA 2ZETA 3I32A 5AJYA 4DVGA 3L0OA 4NCIA 2EFEB 3M6AA 4DLRA 2TMKA 4TZ0A 4U02A 3RAPR 2ZRIA 4OBEA 1NG9A 2ODNA 3VQTA 5FL3A 3QNUA 2GF0A 3QJYA 1YKSA 4NCJA 3CLVA 5B58C 1XZPA 1JEDA 3W8RA 3I4LA 1GAJA 2ZREA 2JASA 2QGZA 1IN7A 3FMIA 1HTWA 2GETA 2C03A 2YWFA 4D4KA 4HUQB 1JNYA 1NY6A 2HYIC 1A4RA 2Z4SA 1Q57A 5TDHA 1TADA 3GJ3A 1VDZA 4JLNA 3C14C 1HA3A 2QAGA 2MSDB 3P27A 2VP0A
chains in the Genus database with same CATH superfamily
3AUTA 5T64A 3ZHCA 1VG8A 3U44B 2UUPA 3B36A 5TQ2B 2M6SA 4CL3A 1TCVA 5FOTA 3T5GA 5FI5A 3ZNOA 1FQKA 1GCIA 2JCSA 3AF5A 4RSGA 4EQZA 1ZD2P 4L8VA 4WCFC 4WLVA 3SSAA 5A5EA 2B30A 2JIRA 1WU7A 1M0WA 2IZ5A 3HBMA 2C20A 3PUXA 4IH4A 1NLFA 5COAA 2DKFA 4CR7A 1EA5A 1ZSNA 1QP8A 2PXXA 3UJ9A 3LUKA 4MVJE 2DHEA 3CR7A 4Y2YA 2ORYA 1M33A 3QVVA 3FR7A 3S1AB 3L5KA 2G5GX 4A7PA 1US8B 3RFUA 2AG1A 2I67A 4CQLA 1BFUA 4TLDA 5KYXB 3O6VA 3FBTA 4UM8B 1FFAA 2Y93A 3OJEA 5DYYA 4BWYA 4EQ6A 2GBCA 2J5BA 4PNEA 2ANBA 4ZT7A 3A6KA 1DO2A 1BFKA 1KMHB 1ZMRA 2HMYB 3AB8A 2YV1A 4J8PA 4HAOA 2ZIZA 3AB7A 4JSTA 4EI8A 1G8KA 3KJGA 1K75A 1PTKA 1SUSA 4X41A 3ZDXB 3UWKA 3RU9A 3KSDO 2POCA 3ZHOA 3BMQA 3L82B 3HJGA 1R0ZA 1WETA 2PGOA 4M0EA 2AI2A 3DYVA 3NT2A 4HMQA 4JYPA 3HHPA 5CA0A 4NJMB 1OAOA 2I0FA 1XJQA 3UF0A 4XWOA 4YRIA 5GZ3A 2Q9BA 4MVJG 4V3BA 3ZWXA 1CT9A 1WW8A 3PKIA 4LBVA 1JW9B 2ZIFA 1X80A 1M1NB 1F14A 1AX9A 3SVZA 3EEYA 4PU0A 2QQGA 1V37A 1WKBA 3GGSA 4ML3A 3GCDA 1RXCA 1GY8A 4EG3A 4ZRDA 5JC8A 3H87A 3RH0A 3VKUA 3I8SA 3THYB 2CFRA 4RHUA 4R9VA 1E98A 2WIGA 2XQJA 1DCKA 1FU8A 3CN9A 3PJGA 2FSSA 4D1YA 2XWSA 4YCMA 4FR2A 4FE7A 2ATEA 4DGQA 4CF3A 3F6PA 2A33A 3TCKA 2ZAGA 2JI9A 3KJNA 3F73A 1YUNA 4QUHA 4C2TA 5ESDA 3I04A 1LU9A 3RK1A 1B6RA 4O08A 2IXBA 2Q5FA 4AZ3B 5EJ5A 1MJ5A 1HZZC 1UDRA 4E4YA 1N2EA 4ZVLA 5JSZA 2NTJA 4Y2QA 3DEIA 3KXDA 2VXCA 4KFTA 2FUNB 1GEEA 4NCXA 3THSA 4EHAA 4DR6B 4KH0A 1OC4A 1AO3A 1EMDA 4XJSA 1FDOA 1A9QA 1EBBA 1XDBA 1S3IA 3SK0A 5LWHA 4KUGA 3TFQA 1H9AA 5LQSA 1N2SA 3RUFA 1T2EA 2OK8A 3GC6A 3Q3HA 3LLCA 4FK8A 1XF9A 5GV7A 1N33B 4F93B 1XTJA 1Z5GA 2EG9A 4QELA 4E33A 2WINI 3W7VA 3ZHTA 3Q5GA 2X7XA 1BO6A 1G8SA 1KI4A 2QI9C 3I3SR 1V3TA 4KR9A 4X65B 3QTLA 1OBOA 2ODEA 1G3IA 5BSMA 4TL9A 2AFVA 2FUEA 2QTFA 2DH6A 4PG4A 4JD5A 1FP1D 2BTQB 3IPAA 4EHLA 1N5KA 2OAEA 2Y0DA 5FAKA 4ZIRA 1IC6A 4RIHA 1HRDA 1J7KA 2N0SA 4K8RB 1KZYC 2E18A 3CF4G 3TRIA 1WHTA 1C7ZA 1N1MA 1KBZA 1T4MA 2JZOA 3BSFA 4WRRA 3PEWA 2PLFA 2TMYA 2EZTA 4YO7A 4M0LA 5FLEX 1CBUA 1VYTA 2Z5FA 3B6JA 1V11B 1YQ9A 3KIPA 3ZTYA 3A9RA 4M1WA 1I7LA 4A2CA 1K9SA 2J8ZA 4MUFA 1FS5A 1ZU5A 5L7TA 2C4HA 5JCZA 3QW2A 3PRHA 4WVLA 1OGYA 3RYCA 2AVNA 3MHPA 4AJJA 5CVTA 1EVQA 4UTZA 5KMGB 2FWPA 1SCQA 2IYFA 1B76A 2X1MA 2XF2A 4G5RA 2EJVA 5C31A 2ZZNA 3DM5A 4EHDA 1TF5A 2A94A 4MS3A 3STUA 2C5AA 4DUGA 2NUPB 3Q98A 1XIVA 4XLLA 5DYGA 5TB5A 1U2TA 2MJLA 4ZANA 1CTQA 1VRWA 3LW7A 5EIOA 2UUBB 4MYSA 1T9ZA 1ZJJA 2I2XB 2W6CX 1K5GA 4HEHA 4Z1MD 1CF2O 3RSHA 4AUNA 3FSEA 4BWGA 5HUHA 1KRXA 2X0KA 4WIAA 2YFKA 4BNFA 1O6GA 3B3QA 1A9XB 1LPSA 3DAPA 1D1QA 1JQDA 1RAGA 1VMAA 1W6UA 1WABA 1LPBB 3WLAA 3PC2A 3AUJB 1G5QA 1ZK4A 1T6ZA 1A5TA 2VDPB 3F7MA 3QX7A 3GEBA 4K2HA 2IY9A 4TSFD 4WINA 8ATCA 1I4WA 4ZK2A 4MA4A 1E3MA 3QBVA 2R1TA 3ONVA 5AOVA 4WNAB 5JT1A 1P18A 1WPRA 1CR1A 2ZXEA 1T36A 1C7IA 5H3CA 1QVAA 2O1WA 2GN9A 3OA0A 3DWGA 5EXXA 2HGZA 4XYEA 3WK6A 5BV1A 1MOQA 3EZLA 3FZNA 4YNBA 4WOJA 4ZT5A 4GHWA 4D81A 1EYZA 1Z88A 4NLLA 3CVYA 5THQA 3OIUA 3EF1A 4CTKA 4FGLA 1T8YA 4GWGA 5J1TB 4MEBA 3ROPA 1G7SA 3BL5A 1DXOA 2NPOA 1U0OC 3GLGB 2H9YA 3TIFA 3FD8A 1D9ZA 1ZUHA 3PHIA 4BB5A 4EG4A 1R2QA 1N4AA 1GUFA 4ER6A 3KSMA 1AUVA 1U99A 4B7UA 4E11A 3QLEA 4ETMA 1DQRA 2HIHA 2ZYUX 1SKYE 4D0GA 4UTPA 4ZYLA 1WSBA 3H9QA 2GZAA 3A9TA 1E8MA 1P0QA 5E9QA 4YPFA 4K9LA 4D6PA 4F5YA 1UP4A 4FHGA 3T5DA 3JAMA 2UAGA 1P6XA 3KEOA 5AHRA 3TTYA 1TF2A 3HSKA 3OCWA 3K6KA 4MVJF 2O2SA 1GDHA 5D8DA 4HPWA 3RIXA 5AVQA 1AKNA 2CVFA 4FD3A 4QNNA 1NTOA 4W5RA 4AO8A 4DUZB 1S9DA 1KKMA 1VLMA 4FFRA 3RV3A 1T5OA 3BXOA 4HB0A 1T3TA 2O50A 1BOOA 4C05A 7GPBA 3UWSA 1ECBA 4UFPA 2ISSD 2JJ2D 4ZGWA 3Q6MA 2XHZA 4MWGA 2PH7A 5A4JA 4IIFA 4YRRA 3COVA 2VEDA 1F2TA 1KBQA 2XDWA 2ZS7A 3I6QA 5HMLA 1H2HA 3U3DA 3VR3D 3ZOKA 3FFTA 2XADA 4CF7A 4PLHA 1XG5A 4NK4A 5FOQA 4D8VA 3K70B 3DTNA 3GDFA 2ZE6A 3IV6A 2AFHA 4AZWA 1DC5A 1K7EB 2B8JA 1AF7A 2PR7A 3SS8A 3KTOA 5HM8A 3FETA 5CEFA 1NIPA 4MYTA 1MB3A 2OBXA 5I4IA 5ITSA 2LKCA 2X13A 1YQGA 4IV8A 2XXJA 4KN9S 1OIVA 4EI2A 3HZRA 1UWVA 1W1WA 2Q9UA 2ZTSA 4LJ4A 4S0XA 2UYGA 3IOYA 3F9CA 3RVOA 1YXMA 4MIOA 2ZSDA 5I7FA 3S8EA 2FX5A 3KR0A 4X6LA 3JD4A 3GW8A 1XZAA 1UK9A 4YLYA 5CG1A 2FKNA 2FMXA 1XQXA 4W6ZA 5BO5A 2ZAMA 2PKQO 1GGMA 1NMQA 3BN3A 3HCAA 4MW7A 4RDCA 4GSYA 1WKCA 3H1GA 1JEJA 3DZCA 1VHLA 3IPYA 3MMZA 4KQXA 1WULS 4NWIA 3GH3A 3VOBA 5K0JA 3NNSA 1H23A 2AQKA 4CQLB 1TCBA 2GD1O 2IZOA 5L3VA 2E4UA 2GBLC 3T1VA 1OXTA 1QFJA 1GPKA 3EWIA 5BNZA 1Y3FE 2NGRA 4EQ6B 3ZK7A 2LV8A 2PSDA 2FVXA 3HU5A 1Q0RA 1NUTA 2Y27A 2ZGVA 3GT0A 3BZUA 3T3EA 3ONEA 2XAAA 4PZZA 1P19A 3KO8A 3T7DA 1MOSA 4BB9A 2ZI9A 1EINA 2I4NA 3BMQB 3GRUA 1P9WA 1PWZA 1BMTA 1TYZA 2VZEA 3PTZA 4CU5A 4BFXA 3EPKA 1SB8A 1RAEA 1UBKS 1K4YA 2X5OA 3Q7EA 4X54A 5CA0B 2DPMA 4UD6A 3P2IA 3BB1A 1Y7PA 3DJFA 4OX9B 3REOA 4NXNB 1X80B 1QDUA 3AMVA 2YKGA 2HMTA 3AFOA 4Y2HA 1TJPB 1KQGA 2BKXA 1K0UA 2BKVA 1OXUA 3V34A 3TUZC 2NWQA 4L4ZA 5BRAA 1E79D 1BHJA 3KB1A 2OTCA 3NYWA 4YCJA 2DHCA 4MV7A 2E85A 1ZM2A 3QKIA 1QCYA 1UM9A 5ALWA 4EGQA 1XWIA 1FUIA 1OCEA 3EQ6A 3RFCA 5LJIA 4A92A 1H4SA 3IUMA 2A0YA 3DHEA 2VP6A 1T4CA 5A3VA 4CZ2A 4Q39A 4QXPA 5D86A 2Q1YA 3OZVA 2H9IA 3FCOA 2FJ0A 3FDXA 5JSZB 1APBA 4Y6RA 2IBMA 3H19A 1PG0A 4ZYTA 3IO5A 3ND6A 1C8KA 3QMPA 5CD1A 4M9ZA 1SWVA 3L8CA 2I3DA 4BAGA 4DG9A 4AJ2A 2FSUA 3QV2A 1V26A 4FKMA 5CW1A 1G2IA 4U00A 1X19A 3W1VA 4OFZA 2YHSA 1KU6A 4RJTA 1KP9A 3H9EO 3RUPA 5ICFA 3D2BA 1E2PA 3EASA 2HNBA 1WD7A 2GDJA 3O3MB 1N2XA 3AW9A 4IXMA 1RAAA 2ZRNA 4G5FA 1QIKA 4M1KA 3RVKA 4IHQA 4CI0B 5K20A 2QM0A 1HTTA 3LY7A 5CFQA 2JAQA 2GCPA 3G8CA 2R8EA 3LHKA 3QFTA 5TPZD 1L4YA 3ZVNA 1FTNA 2VSYA 2W2NA 3AETA 3VZPA 2DRIA 4X62B 1R4NA 4MDFA 3DZDA 2RJNA 4ZIRB 4TSRA 3COZA 3QBEA 4G9BA 4CQJA 4ND7A 3H6HA 1WDTA 2P35A 3BHMA 3NH6A 4LOLA 3F3SA 4AZVA 1XRQA 1VLQA 1WHTB 1Q19A 1T1JA 3OFVA 2GN8A 4LUCA 4OHXA 3L3BA 4W8OA 5ELXA 1Z0ZA 3RVBA 2HSDA 3HADA 4DXAA 1DBPA 2I1VB 4B75A 4EYOA 4HGPA 5K6TA 3OU6A 3GFPA 4PLYA 1HNXB 1C1XA 3VVBA 5AMXA 1MDFA 4YUYA 4I9GA 1XVLA 2CE7A 1C41A 1RKUA 1PHPA 3RYCB 3ZGZA 4IQGA 4EA8A 3U40A 5JSKA 2Y1GA 2PD3A 3HNPA 1QU2A 1FMJA 1SC1A 3AWIA 3Q8WA 3WKBA 3K31A 1B0UA 1HEYA 4UHJA 5IVIA 4MS3B 2RHDA 3GUCA 4ZOAA 3DQZA 3QLUA 4CETA 4I5FA 1KERA 3R2JA 4NQZA 1RE1A 4CCYA 4ZMSA 1JH9A 1WNFA 3ROTA 2A0FA 3L4EA 1GKUB 2YWBA 4I6GA 4ARVA 1J4AA 4YCLA 1PKXA 4G24A 5HRAA 3PNVA 2JGFA 4KLAA 3WO0A 5JUWA 1Y5RA 1Q0QA 1Z0JA 2B6NA 1U2QA 1U98A 3QOFA 3HFRA 3EULA 4ND4A 4NZOA 3BJMA 4W8HA 4RK5A 3VSAA 1CZUA 4RM2A 2R9VA 5DX8A 3UMJA 3TRDA 1SOMA 6NULA 1COWD 1X8XA 4IH1A 4MS1A 1PL7A 1OLOA 2DBQA 1P2BA 3RIMA 1QDEA 1BU5A 1Z4LA 5CLQA 4B3JA 3ZYZA 4C0HA 5JE8A 2R1TB 1M1YA 3AILA 3L9WA 3PJRA 5F3RA 2YV5A 4CV2A 1LTHR 1T36B 2UYOA 3KD3A 3S2ZA 1G2QA 1IUOA 3FPAA 4EZIA 2I65A 2BFWA 3FLEA 3INRA 1HQKA 4Z0TA 3I45A 1PS0A 1DIBA 3TF5A 3E1SA 4GWLA 4QQ8A 3SD7A 4XA8A 4UFOA 2Z8YA 2IHTA 4CM8A 3IHLA 1VL5A 3A9WA 4FYXA 4KLNA 4EYKA 1JQKA 1R6AA 1XDUA 4BMPB 1L8LA 1N25A 2YN2A 4RLFA 5AJWA 3V8QA 4BVAA 4WJZA 1IBRA 5FUXA 5DYWA 3MLEA 3OP1A 4XWAA 4AG5A 2C3PA 2VJBA 2WOJA 3HEBA 2AOUA 3W6NA 3VSCA 3E3AA 4YBZA 1KEPA 4G1BA 3WGOA 5J4YA 3WGGA 1NSFA 4XQEA 2A1UA 3AVWA 5A0VA 4FXOA 5CDTA 3VH3A 2NG1A 3IVXA 1VMKA 1J20A 1OF1A 1OKKD 1Q3KA 2ZJ3A 4OG2A 2XA2A 4Y9TA 4GBJA 1K0FA 3OMWA 4BGEA 4BUCA 1DKMA 1WUJS 4DNPA 1R15A 2XQIA 3CSDA 3UWDA 5M2QA 2YWCA 2ZB7A 5CXUA 5JISA 5MN6A 3BWBA 5IM4A 1FXWF 4BJ6A 3ZWBA 1QH8A 4XFDA 2FZLA 1D1TA 1PBNA 3V7FA 5JPCA 2FMFA 4Q7MB 1Y42X 2W0MA 2ZIAA 5KZMB 4RLQA 3FOWA 3BHNA 1Y3HA 3PK0A 5TMPA 3PD7A 5TVGA 1SK8A 2WSBA 3AIOA 3PFGA 1WMAA 2H2HA 1R88A 3H8SA 3EEQA 3HI4A 3M83A 2WG0A 3T3MB 3AXSA 2H00A 4IQ8A 4D26A 2F7SA 1RC1A 4PQYA 1RFGE 3VTAA 4TWJA 4F5EA 3GJ8A 2CLOB 3EA4A 3H5TA 1DUSA 3EG9A 3OY7A 4WLUA 4XYMA 5J2TF 2IWHA 2IZZA 3GR6A 3CWQA 3RM3A 1RS0A 3SIWA 3TOSA 1F2TB 3I83A 4IEFB 3FRHA 1JS1X 3L8DA 1EU1A 1ZS9A 2R6AA 2EEZA 4QU8A 1O6CA 1X7DA 2PKCA 3C6ZA 2AFHB 1JZTA 3QITA 4JLVA 1QYWA 2HQOA 2YUIA 3GLIE 1WOYA 4NCHA 4OL9A 1SUBA 1TUBA 1OPXA 2AOXA 3E9MA 3KVNA 3NBUA 4KXWA 4MGZR 5EJAA 3SE0A 4C1NA 5AW3A 2Q5HA 4A0HA 3E9CA 5DN9A 3OOJA 3TW4A 3DOOA 4P35A 1HURA 1AS0A 1NVGA 1YBFA 2VDJA 2WUGA 3VOSA 4G56A 1L8AA 3BF7A 4NBSA 1GN9A 2O1EA 4ED9A 4E2YA 4RZHA 4FXPA 5DSZA 1MB4A 3BMCA 1GRQA 4PFKA 5BQ5A 2ECOA 3UC5A 1R0WA 1Q0ZA 2ZSFA 3AL2A 4WUTA 2Q1SA 3NTLA 1C4XA 4LZJA 4ZOBA 3B1XA 4MWBA 3C3EA 1QGZA 4HDOB 1HETA 1KARA 3DD5A 3GOQA 4PG6A 4O8CA 5FL7D 4YIHA 3VR0A 1SRRA 3PT9A 4FZVA 3HYNA 3T1TA 5DM60 1NP6A 2C1ZA 2WHXA 3PNBA 1IPHA 5DYNA 5K3SA 4FJ0A 1CYDA 1KDOA 1UK8A 5GINE 1YQQA 3JW8A 4R9RA 2REBA 1N8KA 3E2IA 4PZ0A 4UVHA 5HKKA 1UWCA 3LXXA 4FGWA 4KJZA 5JXIA 5TX7A 1U7OA 4EFMA 2X0JA 2PGIA 4RE5A 1F38A 1FFSA 1HKHA 1NW5A 2M32A 5B5SA 4M0KA 3RTAA 1R0BA 2B3DA 3THWA 1BKYA 4IR7A 1NHGA 5A4IS 4DT1A 1DRVA 1LLCA 3K2QA 2CVQA 3OH8A 3WL8A 4G0XA 3BVPA 1MC5A 3ICPA 3IQIX 1PG2A 3DV2A 4IUCS 4KRGA 4YRGA 1R8QA 2P3OA 3QLVA 5KTPA 4L9SA 3DKRA 2QZSA 1GYQA 4WA7A 3TYXA 2QTCA 3EPLA 1A2OA 4UBNA 2Q5JA 4RM3A 1V8ZA 1NF3A 5IVHA 4CMCA 2RK6A 4HRXA 3I6ZA 3RS4A 5EP3A 4QIHA 1OWMA 2J3DA 3CX3A 5CFNA 1OHHD 1PK7A 3LYHA 6PFKA 1P8AA 3J7TA 3R5KA 2X8BA 4WNIA 3A1DA 3GRCA 5JVDA 1UM9B 1AIPA 3EC1A 4KTTE 4RQBA 3O1LA 1QQ6A 3OE4A 2JBAA 3QVSA 3T4PA 4UDNA 3B3AA 1T4CB 1LK5A 2OECA 3ZCUA 4TMFA 3W90A 3OBIA 2VLBA 5AIAA 3AIKA 2JI7A 4Q5IA 2AN9A 1PNRA 3I37X 1V5WA 2EDCA 2J6CA 3N0TA 4LZNA 4ZO4A 4ZEXA 2QN8A 3BMNA 1ZINA 5AVZA 2G83A 1HYQA 2P9EA 3TG8A 1QQAA 1TPZA 1OJLA 4Q4JA 4QUKA 5LQNA 2ROQA 4KX3A 2GBPA 4FJ2A 2P5TB 4PZUA 3QPAA 4ARAA 2R6JA 1HX7A 4JBXA 2J3EA 5AM1A 1YHNA 3O91A 2ZJAA 4LJRA 5HHTA 4TXLA 3JZFA 2R47A 1RAHA 4HJXA 3FPFA 1H8HD 1Y7TA 4LFCB 1DJLA 2GM9A 2AN4A 1NJ1A 2PKYX 1F4LA 4MPTA 1JGTA 1JWLA 1OZAA 3PB3A 4RL4A 5ECWA 1G60A 3AETB 3KHKA 3SYMA 2FEPA 1D4FA 1AXGA 4QQFA 1SEPA 1R4NB 3QVGA 2WT9A 5CMLA 3HC7A 2NADA 3TZCA 2CHEA 4ETNA 3FYDA 3OFNA 2EAUA 3K1JA 4G89A 4GI7A 4BQPA 1VE9A 5F3WB 2WWTA 1KY5A 2P2GA 2Q2NA 2XNJA 1DC4A 2Z04A 4BNZA 1LA2A 4DADA 1NY5A 2FSPA 3W8NA 1HQCA 2HEIA 1PE0A 1NF9A 2XQKA 2HCJB 2CF5A 3A27A 1MQ9A 3L1UA 2D3WA 1EJBA 2HY7A 3TLEA 3AERA 1YBMA 1XUOA 4HH4A 2NU8A 3KDPA 4RMHA 2R2AA 1C1XB 1DFHA 4M86A 4E0BA 2FOIA 2HLHA 3V8RA 3SBDA 3PYMA 3ER9A 2I54A 1PG5A 1SAYA 3CEPB 3D3KA 4J29A 4L2IA 1TAUA 2BPOA 2DMRA 4Z3KA 2P6UA 2VKTA 1B8NA 2ORVA 4I9FA 2AT1A 3V1LA 2IF0A 3IILA 4QA9A 5BSHA 2PUFA 3PFHA 1I7PA 5C1DA 4CCYB 4BFZA 2K5UA 1ISRA 2XUDA 4L78A 1NJ8A 3SZMA 4PYNA 3HXMA 1OTXA 3THWB 3HH8A 3AT1A 4YT5A 3NEYA 3VPDA 4CJXA 4NJOA 1MV8A 5DGTA 3D7MA 5BRJA 4BEVA 3JX9A 3LP5A 4RULA 3CTMA 3SVTA 3T0FA 2WABA 4V02A 1SVLA 3LHIA 3ADBA 4EITA 1YD7A 1GG5A 5FTKA 3BULA 3KT3A 4G1CA 421PA 2LIVA 4YLEA 2JATA 2PN1A 3ZH2A 2HBQA 4XWYA 4OF4A 1DEOA 3OJXA 1UPXA 2DFDA 4Y2JA 5CVVA 1U11A 2BUAA 3DVQX 2E0IA 3RVRA 1BDJA 4GIBA 4F3NA 1JDBB 1M1YB 2OWEA 1YBAA 2WR8A 3KYDA 3ADOA 2G5PA 4HP8A 4KBGA 1F17A 2CY0A 4CEIA 3D64A 4QTUB 4YP0A 3ROXA 1CG6A 1NONA 1NJ5A 1NTRA 2DFKB 2IHBA 1IU9A 1TRKA 1YAJA 3NHUA 4Q3KA 2HRCA 2C7BA 3B6ZA 3H1EA 1SQGA 4O8ZA 4C7JA 4CM8B 4MITA 3DEZA 3E53A 5CU7A 4LOAA 1AQUA 3TX6A 2ZBPA 4RZSA 5P8WA 2X0DA 4O5OA 3EGXA 2Y76A 4EBFA 3KR1A 1WDLA 4I4TF 2ZIVB 4KNWA 4N39A 1E3TA 1E2DA 1FDVA 1I4EB 2AOUB 3JQCA 3LZCA 2QVXX 4MPDA 2CLCX 1KO4A 1MVOA 4Q4LA 2A1UB 3KJXA 3BILA 1U94A 4GBMA 5BXYA 1MLDA 2O3TA 3FTFA 4YJ3F 1JB9A 1I3MA 1TVMA 3CNBA 1DTSA 1K4KA 4JQSA 4HPJB 2QVCA 4A8JC 4QJIA 3OQBA 5KQSA 3P7MA 1G8HA 4MW6A 4BYMA 1R37A 4K9SA 1QH8B 4DY6A 3EEOA 3U3KA 1T6BY 4KMMA 1T5LA 3QWFA 2VDOB 3RGGA 2WE7A 5DNYB 4BX2A 4R1OA 5CCDA 1R9MA 2X42A 3DE7X 5EIBC 4RY8A 4PYMA 4C6RA 4JV5B 4H77A 1JLKA 2ZYRA 2BGTA 2B1JA 2ZT8A 5DIFA 3M6MD 4NPCA 4F4CA 2PMKA 3IELA 5IKOA 4JU8A 5JWOA 4GBGA 1ZR4A 4BOYA 4K87A 4NBKA 1HYEA 1CF9A 2DM6A 3GO4A 3NANA 2ACVA 3EG9B 1GL9B 3LPNA 1MOZA 2I29A 2A9VA 3A7DA 3TZEA 1PVVA 5JY1A 1H2BA 1NVVR 1ISFA 1N0UA 2GH1A 3KLMX 4Q7LA 3TH5A 3R5TA 4FILA 2WZBA 4QDUA 3TDNA 3C41J 3PA6A 4CBVA 2P41A 3PVZA 3D4IA 5EA2A 1FUYB 1N6OA 4YI3A 4G0MA 1RPZA 4NI5A 1GAEO 4YH1A 1I33A 3F5FA 9ATCA 4PCUA 2J0QA 1YT5A 2NZXA 1TUBB 2AMFA 1T2CA 5B1IA 4GGOA 4KCGA 4RSRA 1H6AA 1LPAB 2I7VA 1JJIA 3HO1A 3N2LA 4W1RA 1OVMA 3MWJA 2LCQA 2QE7A 4W5OA 5C1BA 3ZW9A 1NDUA 3P2MA 4JLAA 4B6QA 1JAYA 3BMCB 1N6RA 4PYOA 1HZJA 4K9QA 3T3GA 3L18A 1FDWA 2RHLA 2J9XB 5FPPA 5K0CA 2IYVA 1WEKA 5BWNA 3DMFA 5KSYA 4OJQA 3SX4A 5JZSA 3ASUA 1XPOA 3BCRA 3RV4A 1PUJA 1VMIA 3L06A 3PPWA 1W93A 3RS9A 5A5FA 3NAQA 4LDRA 2UXCB 2MSLA 4DJTA 3LKBA 2ADOA 4GRAA 2CDCA 3UT0A 2D1RA 5BN5A 4M1QA 3N05A 4K88A 5FULA 1PJQA 3WI7A 1KXJA 2ZT7A 3PHLA 4DCTA 1GQ2A 1NULA 2GLXA 3KZOA 2JH9A 3PYLA 2FZCA 2WKQA 4HNSA 2GJAA 5BYJA 2R6DA 4E1VA 4YRBA 2HLDA 4CTJA 1CY2A 1Y4DE 2BE7A 3K2EA 3WWCA 1E4YA 1M74A 4DT1B 2CE2X 1K7SN 5IT4A 1JDNA 2X5NA 4R1LA 1G55A 3SZGA 5K3FA 3TRFA 3MYRA 4ZPJA 4TM7A 5FBWB 1E9BA 2PLWA 4U2KA 4KNYA 5F76A 3UJCA 5HUJA 1GYRA 1RZ3A 2VJLA 2WQ7A 3W8DA 1QDLB 2I6UA 4WCFA 3F7NA 2G36A 1L3CA 3PQ3A 4NXMB 4FCTA 1B4DA 3RKUA 1W2GA 3EBOA 3N7TA 1IB6A 1L5GB 4R83A 2FZGA 3UHJA 4CWAA 4DUPA 1QIDA 5IFKA 2VPZA 2QSZA 2ZRLA 1U1IA 3KB8A 5JHHB 5JVDB 3ZVRA 4EG8A 2AV6A 2NVUA 3KOYA 5FPKA 4O2LA 1KYVA 1ESNA 5LQKA 1R9JA 1QP4A 2JBAB 1ZW6A 4AIRA 2R0QC 3SZRA 1PYOA 1WKVA 3IE2A 1QWOA 1VE5A 5AXAA 5HFNA 4X66B 4V2UA 3Q3EA 3RFFA 5CP8A 2PZEA 1LW6E 1LJUA 1QV7A 2AS0A 2FJUA 2V8OA 3ME5A 3GQBA 1CQJA 1SXJC 1UQUA 2YVLA 2O7QA 5EHXA 1K2WA 3BMNB 3HVKA 3OOEA 4J75A 4KSBA 4R1MA 3ZQ4A 3EVCA 5JFOA 5JS8A 3QIAA 5IXJA 2QX7A 4RWZA 3UMYA 1T1SA 2BWJA 4Q4JB 1GTRA 1F0YA 1W6RA 3K1YA 4L22A 4YMGA 1A76A 4IWNA 1YDHA 1F2VA 3DFKA 3E22A 4TKMA 2IX9A 4V0NA 1KI6A 4AP9A 1W73A 1RRGA 1FUEA 4JP3A 1H2XA 1I4OA 4KWTA 2SHKA 3VH4A 4A2WA 1MJHA 1RI3A 1QHEA 1JAXA 3DWEX 1WSAA 5MGBA 1G42A 3LKZA 4ID9A 1J8FA 1MO4A 4JVOA 3DB2A 4OI2A 3W6ZA 1UBJS 4ZCMA 4QDXA 1L7NA 4RZIA 1WXHA 1ZJZA 3LYAA 5HDQA 4XDHA 2XB4A 4V24A 2F55A 3C74A 3QVGB 3L0SA 4YXFA 2ZQ5A 3NDJA 3G5LA 1O95D 4IF6A 2ZDQA 3LX5A 4HNHA 3DAGA 1JQ5A 1WVGA 1H5UA 4FLEA 3SAJA 2OV8A 2BCEA 1HZZA 1VCOA 3E18A 1G7CA 2YXBA 5JXGA 1UBTS 3T41A 3MERA 4WY5A 4QREA 1UKAA 3AERB 4M8KA 3MJDA 2YJ4A 2HWKA 4D41A 3NH9A 1FSZA 2NU8B 1QRUA 5LQCA 2ETVA 1DX9A 2XPCA 4OBWA 4PHTA 4MLCA 5EESA 5I9NA 4QRIA 3I2YX 4QGGA 3UJPA 4FGZA 2RGDA 2C78A 3OZXA 2W90A 4MW5A 5HCNA 1S96A 4L2IB 4WOKA 1E5LA 1L9KA 3PTLA 3FMVA 4Q7EA 1EHCA 1CY8A 3C6QA 1GJRA 5A4FS 3H5VA 3VZRA 5A3RA 3MIIA 1XMXA 1DG3A 2Y68A 2PXHA 1RDFA 1QLWA 3L7JA 1GPJA 2XKAA 3D0KA 1Z7BA 4WH0A 1DTEA 4CM9D 3GLFA 3H0EA 1OROA 3LT0A 3V1TC 3DKKA 1IZZA 2WF8A 3WHPA 3OOSA 2JGEA 4OI1A 1ONSA 1KC1A 3N8NA 3WOHA 4KYIB 2BEVA 3LFHA 4EEXA 4Q1VA 3FHCB 3LVRE 1HUQA 4Z9BA 1P6QA 2V55B 3DS8A 3DUFA 2BJWA 3WSWA 1IATA 3BWVA 2HDOA 4MVJH 2IPMA 3WIOA 2IYNA 3Q1LA 3QTTA 4RABA 3TKLA 621PA 1R9GA 2AEJA 3DT6A 3G13A 1AN0A 3NQ41 3KYDB 2YBDA 2FWRA 1ZM7A 4IQFA 4PWZA 2HHAA 3RK4A 3ZCTA 4QFDA 2OHHA 4CEIB 1RLJA 4K9KA 1K1EA 1ODFA 3NP7A 1SXHA 3WP1B 1EGHA 4HYQA 4Y2SA 4B4WA 2BBSA 5ENZA 4P0PB 2C0QA 2IV3A 4OYRA 2YQ5A 1ICIA 1N0HA 4O02B 1W0JA 3JZAA 1NVWQ 2YHAA 1KAEA 3F5MA 4QHYA 5K51A 4G1UC 2GNPA 4XOIA 5AESA 1CHDA 2JLQA 3EGXB 4DTIA 4CM4A 1HDZA 3RASA 1SKAA 2C2OA 1CFZA 5ARBA 4P5PA 4OAPA 5LLTA 3DC2A 3OIDA 1BWPA 2QP9X 1EX9A 1O6ZA 1GSOA 2AW3A 4JLPA 1ZUIA 3I28A 4JC8A 1B73A 1LRJA 3PHGA 4RGBA 1RWVA 2PCJA 4F7DA 1N5OX 4M38A 5CNMA 4TXNA 4D8YA 2P9GA 2Z83A 2O7RA 1TZJA 4PZYA 5EWLA 4UAUA 4OQDA 2FWIA 3WWZA 1THGA 1A2KC 2N1MA 4L76A 3USCS 1V7PC 4OQLA 2I03A 4P58A 4NV1A 3LU1A 4PSDA 2IP1A 2VWQA 5D00A 1Q3TA 4MS4A 4B3FX 3R3JA 2D06A 3IUQA 3D2CA 3CBQA 4ZQFA 5BP7A 1EFTA 2R84A 4QLAA 4KXYA 4IGIA 1YUMA 2ERYA 1NVUQ 2QP4A 2J4CA 3K92A 4OHZA 1G8JA 1YA4A 5FJJA 2DQZA 3G7NA 4J7XA 5AKLA 3D7LA 3HY3A 1I3OA 3ZEIA 4YQFA 5GJBA 3A9VA 1XMQB 1TT5A 4MB2A 3T61A 2OFOA 1MENA 2CB9A 3ETNA 4A03A 4OVKA 4L3VA 4S24A 2E4VA 3BIOA 2L2QA 4FGUA 3TIIA 1H6CA 9MHTA 1UDWA 4Q9AA 4V0KA 3ZQ6A 4B46A 2CSUA 4HNVA 5BPFA 1YR1A 4OHPA 1ZMTA 2BEJA 3QBTA 3BC1A 3CKLA 2LE0A 1T9GS 1GU1A 5EMHA 3SYLA 3SYRA 3BQNB 1EK0A 1L7RA 3QELA 3V55A 3VJRA 1NA5A 2GKOA 4RTQA 2AWOA 4I5DA 4L08A 3AVUA 4RK1A 2H0QA 2IRWA 3F3YA 4DRXA 4DCMA 4GQBA 3OFKA 4KXVA 4ZZIA 1L5WA 4ZCRA 3FTEA 2GPNA 1ODIA 4C0SA 2QT0A 4FMCF 3K9CA 2GJ9A 2XIJA 4B45A 4PQEA 3FKQA 3QPDA 3DOEA 5AXDA 3ZD9A 5KJCA 4FOSA 1DT5A 5I9SA 1ZBDA 2ZK7A 3ETEA 2GYUA 2X3YA 3DO6A 3UGTA 3FCAA 2OO3A 1M10A 3G0IA 3OIYA 3WGMA 5AW2A 1JDVA 1ZIDA 5KTOA 3KTDA 3PXAA 2ZWMA 2C98A 2XWPA 3IOMA 1ZGBA 1UAAA 1BD4A 1YJ5A 1QHXA 1EUCA 4R1UA 3T1NA 6AT1A 3CGGA 4F2DA 5D6NA 4CM6A 2IZ7A 3NHFA 4R84A 3SSOA 1ZESA 3L7BA 4MUBA 3OVMA 5BN5B 1TEZA 4KXMA 3EXG2 2DHRA 4FMBB 2WMDA 4XJTA 1UOOA 1QZTA 1DBSA 1U0SY 2HB6A 2Q4OA 4II7A 4ZAZA 5K3AA 1VBMA 2B2XA 4P2GA 4AJKA 1OGIA 3GCZA 1ZOIA 3U4MA 1DQSA 2PGDA 3KPUA 3LDUA 3RRNA 3NM5A 1KAGA 3U26A 4MRMA 2G0TA 5K3FB 4KWIA 1F3OA 1F6WA 1GUZA 3WNBA 3UWMA 5FV4A 5HDBB 2L0XA 5EXDA 3K09A 5E9JA 1I1QB 1QH0A 4HT3B 4FFOA 4Y6OA 1VBKA 3I6IA 3O1JC 4WCFB 4PX2A 1W36C 5MHTA 4YT4A 2G9RA 5L3RA 1E77A 5AUOB 3PGLA 5G1PA 1EUQA 2QX9A 3ZWWA 2H1CA 3STXA 2OLEA 4P4GA 1NBOA 1F4VA 1SHKA 2BRUC 2GM3A 3A1CA 4Y30A 1K97A 5A04A 1FMFA 3FCXA 1F5SA 3ASYA 2YZMA 3E15A 2NVUB 1BE8A 1H1LA 1PGOA 3KZNA 3WIDA 2Q8QA 3GJTA 2WTAA 3I5XA 4WOPA 2QRZA 3GLQA 4V03A 2RCNA 5T4FA 4A6EA 3O2NA 4IIJA 2ZWOA 2JRLA 4LKRA 1E3DA 4WOCA 3GQBB 1CQJB 4ANFA 2GLUA 3VUEA 5DTIA 1QK5A 2QIOA 2EGGA 1LTQA 4MV8A 4N5MA 3LCVB 3IUPA 5HRCA 4V0LA 2IHYA 1YL6A 1JHYA 5FTMA 4UATA 4MGKR 2DQ4A 4Q3NA 3TQQA 5E6UA 1GTZA 4F4IA 5K99A 1JUDA 3W1EA 2G88A 1XCJA 3SHWA 2QR5A 3E22B 2R3SA 3KSUA 5MN4A 1KI6B 4WCDA 5FNVA 5TMDA 4FM9A 3UICA 1MTZA 3KZKA 1PFVA 5J63A 4MIYA 1I1HA 4GC9A 6ABPA 5FTLA 1TAQA 3WZMA 5CDSA 1T5DX 3KKMA 2PZFA 3NGXA 1A9SA 4ZTBA 3WA6A 1RI4A 4DNXA 5IWAB 4LF9B 4YT8A 4ZJZA 1Q7CA 1XQ9A 4RVCA 3PI7A 3CGWA 1ODJA 4UULA 2DT5A 2VF5X 4BO3A 3D6MA 2ACWA 4OXQA 3TI9A 2HA6A 3A3KA 4YP7A 1ZRSA 1QV6A 3F5DA 3WV4A 1QE0A 2WG2A 4GKJB 1LDYA 5D3ZA 2GCEA 1LDMA 3C5HA 1TGVA 4N6OA 5EIXA 1GZUA 2VHYA 1XO1A 1NX6A 3A6FA 3WKEA 5H70A 1UBSB 4GSKA 2D0PB 4E5NA 3GNQA 1JHMA 3KT0A 2PZMA 1U6KA 3UK7A 5JC1A 1VCIA 2BR4A 2X2PA 1O0SA 3KFVA 3NG1A 3P4UA 5F2NA 3PEEA 1KJWA 2QD3A 4K6HA 3W78A 4E46A 4AS2A 3DOUA 5GONA 2PGNA 3GVPA 4JIGA 3UAVA 4EPTA 3K5PA 1NMEA 2HA2A 4O2AA 3RS7A 3I2GA