1DS6A

Crystal structure of a rac-rhogdi complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
181
structure length
181
Chain Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 2
publication title The Rac-RhoGDI complex and the structural basis for the regulation of Rho proteins by RhoGDI.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 63
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2000-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ds6A00
3IIMA 2OXCA 4JL6A 4BLTA 3DEFA 3RRYA 2FJUA 2ATVA 2AWOA 2JLZA 5FI1B 4PQFA 1ZNZA 3IEVA 3CONA 3B9QA 4X8OA 2FWRA 2GXSA 1WQ1R 3TQFA 4ZDJA 4XWKA 1LNZA 1R5NA 1Z08A 4AKEA 3JZAA 1CIPA 4Q9IA 2H5EA 3SJBA 2ZAOA 1KJWA 2QMOA 3I8SA 2A7QA 4M2LA 2ZVPX 4TMKA 4Q21A 5LD2B 2OE2A 3VU9A 5KPDA 2J7PA 2GTPA 2EWWA 4Q7LA 4QGHA 5EZ5A 2XSZD 3T34A 2WKPA 3UPUA 1TQ4A 1T3LA 4AK9A 3L8ZA 3FDIA 1HURA 2CK3A 1W4AA 2NQ2C 2ANCA 5H68A 4DDWA 3HPRA 2GBLC 2ERYA 2D3WA 1W1WA 1E2GA 2RGNA 1ZJ6A 4NP6A 4XD7A 3THOA 3K1JA 3O8BA 4V02A 2R44A 4QOSA 5CYOA 2KSQA 5G40A 2GZAA 2WJIA 3D8BA 2RB4A 5FUWA 1G64A 5H1YA 1KSFX 2F1HA 4Q4HB 3SC3A 1Y63A 4YONB 3FMOB 1VMAA 4URYR 4NYMR 1N6NA 2F3TA 2JLQA 1YZKA 4LJ6A 4B3DA 5FBLB 2D62A 4BLPA 4XVUA 1P61B 2EYUA 5DI9A 1NN0A 3EZ6A 5KSOA 2Q9CA 3NEYA 3SJAA 2LKCA 5KYKA 2P0EA 3KUDA 4HAXA 1P72A 1DAGA 2GAAA 1TU4A 4N0DA 4Q19A 1G8FA 1GFIA 1SQ5A 2O5VA 4EPWA 3QXJA 2C2HA 1E1QA 4AG6A 4TT3D 3K9HA 1XX6A 5A4JA 2R8RA 1GIAA 3AKDA 1WE2A 3OFND 1XD2A 2OG2A 1EX7A 1J99A 3X1ZA 2FX3A 2GJ9A 1EG7A 1A2KC 1RRGA 4EFNA 2OT3B 1MABB 1W47A 2XB2A 1F2UB 5DH9A 4B33A 1E2IA 1XCGB 3N2IA 3QBTA 4LUCA 4N1AA 1PV4A 3FHTA 5CITA 2IHBA 2DY1A 2RHDA 1UBEA 1SXJA 1T8UA 2ZYUX 2CL0X 4TL9A 4MRPA 3QKUA 4UJ3A 5TMPA 3KQUA 3QI2A 2F3RA 5K8TA 1XTIA 1XWIA 1XPUA 1QHYA 1P6XA 2VF8A 1KGDA 4Q4LA 4HUQB 2B92A 4RFSA 3FGNA 3K0AA 1ANKA 2NO0A 2R6FA 1XCMA 1GITA 1RZ3A 5CIQA 1G18A 1Q22A 1XJCA 3MG9A 3THXB 1XMVA 1Q1QA 1KDRA 2BMFA 2QSZA 1N6IA 2VQSA 4KBFA 1P2VA 2J0UB 4CEHA 2K5UA 4R2IA 1CEEA 4GP6A 1FTNA 3K8YA 4M0LA 5BN4A 1XPRA 3A1TA 5FL3A 4V0KA 2LWIA 3A8TA 3LLMA 1FQJA 2H57A 2GF0A 2PZFA 4DWJA 2XGJA 2EFEB 2I4IA 3BB3A 5KDLA 4CVNA 3TW4A 4PFSA 5JFGA 3U7GA 2V3CC 4CEIB 3WMFA 1LS6A 3GLIB 2G1JA 1E1RD 4BFYA 5IHPA 1SKYE 4AC9A 5CDFE 2ZROA 4KFTA 4MH0R 2QBYB 1NMXA 1QRAA 2C98A 3UWKA 1E4VA 3P4YA 4AYWA 5HPYB 2W83A 1G3RA 3MGCA 4DLZA 4AG5A 2OM2A 5HZHA 1A82A 2GJAA 5AJWA 3WMEA 2ORWA 3IIJA 2HF8A 2R6GA 2O52A 3W5JA 2Q9AA 3QNUA 1ZD1A 2NO1A 3U3KA 5JS7A 3NBYC 3B7GA 1NL3A 1HT1E 4TZ6A 4LV6A 3QJYA 2KWIA 2ATXA 2KE5A 1U81A 4UNSA 1C4OA 4QJ5A 1F48A 3WNBA 4DB4A 1MRSA 2FMXA 4A2PA 1KI6A 2N42A 2XZPA 2F1JA 1G5PA 1SHKA 2ZU6A 4QKQA 4FMCF 4PZYA 1SVSA 2REOA 1XD9A 1VG1A 2Q21A 3RS5A 2D7DA 1DAKA 4TYNA 4LJ5A 1FUKA 1P9RA 3IQXA 4EFLA 1M7GA 1GWNA 4LJYA 3FMIA 5FTNA 4QM7A 2VP5A 4JLAA 1DARA 1NLZA 1EFRA 2FH5B 3IBGA 4I81A 1Z07A 2VPPA 4K46A 2VO1A 3UATA 4A1FA 4GSYA 1M7HA 4QBFA 2DHRA 1GUAA 4EJSA 2ZI3A 1CS4C 5FTLA 5FPTA 1Z6TA 4RJLA 1UDXA 2WSSA 1US8A 4L4UA 4B3FX 3BK7A 4EKDA 2QRZA 1AZTA 4J0QA 1E2NA 3SU8A 3SQWA 2WOJA 4DBLC 3KTAB 4ACAA 3VKWA 1JPNA 1IN5A 1E9EA 1N5IA 3W6OA 2AKYA 2FU5C 3WHLA 2ZAMA 2ZITA 5L8VA 3BERA 4EPVA 4DUGD 4U5XA 2W0MA 5HR5A 1P62B 2C78A 5TVKA 2FSHA 4D4JA 3B1ZA 1JAIA 5EUMA 1OH8A 1ZM7A 5EXSA 3WRXC 1E79A 2NO9A 1GRNA 3GP8A 3SYNA 4TTPA 1E2MA 4JLJA 3RABA 1U9IC 4DLTA 5J4VA 5KO2A 4CF7A 1G4AE 2R62A 3KJHA 1Y3AA 1XEFA 2F9LA 3LVQE 3KJEA 3W8NA 1XXHA 1CJTC 1N3BA 1XF9A 1XP8A 5G3ZA 2ZETA 2J0QA 1N6RA 2A3RA 1M74A 2Z83A 4JJKA 2ZUBA 2JJ8A 3VHXA 4NU0A 1SHZA 4GNKA 5DE3A 4KFSA 4NKRA 2D2EA 1Z3IX 4RD3A 4XOIA 4FCWA 1Q12A 4JLPA 5JZVA 5G41A 1ZCBA 1KI8A 4IJMA 4BWYA 1XMSA 1N0UA 1YE8A 4EPXA 4LYHA 5H70A 3C15C 3T15A 1NNEA 4X8LA 4LX0A 1OXVA 4XJXA 1N6PA 2UVQA 1IN7A 3L0OA 4BFUA 3GFOA 3ZS8A 4DC9A 4FMBB 4JLBA 3SOPA 2QMHA 3THWA 3QEOA 4M9ZA 1EFCA 5KSYA 3KXIA 1SVKA 3E1SA 1YZUA 1G19A 3LQRA 3QE0A 3MSXA 4G5GA 3VMFA 1DAFA 4IFBA 1W7AA 4AY2A 1N6LA 1QG2A 2XNDD 3EA5A 2VP6A 4RY2A 3ADDA 3RNLA 4QJ4A 1N0WA 4EUNA 1CKEA 4EPRA 2BOVA 4A8JA 4ZV4A 3ZVMA 4JSYA 1GM5A 4IKEA 4FIDA 3QSYA 1NF3A 2V7QD 4BZQA 1DAEA 4YMSA 2WTUA 1IBRA 3DM5A 1HQYE 1Z0FA 3TH5A 2CHGA 4A15A 1GZSA 2QAGB 4B2IA 4CYMA 3HPQA 3SBDA 2DFTA 1PLJA 1B0UA 2IW3A 4DKXA 4W5HA 2YOFA 1ETUA 2VLIA 4YXWA 1UEJA 1PZNA 4M53A 3QPWA 1NRJB 1FMLA 3TUIC 1QHIA 1A2BA 4D0GA 2D74A 3F3YA 3BS4A 2QE7D 1GRQA 4F92B 3OIYA 3N5CA 3CM0A 1UM8A 5BYJA 1Z0JA 3THYA 2WMNB 3S1AA 1VG8A 2GNOA 2C8VA 3BORA 5FUXA 3QEJA 121PA 1OFHA 1IXRC 4NCNA 1AGPA 2ZYVX 2V6JA 1W0KD 2ZS7A 1AQUA 1P60A 4QBIA 3HU1A 1W46A 1Z0KA 4URWR 5B58C 4JVLA 1GNRA 2ZRDA 3ZIAD 2IS4A 1V43A 4TLBA 3BJIC 2NO6A 4NYIR 1U0LA 4Q7JB 4TMXA 1E9DA 2BMDA 3AKEA 1TF5A 3GLHE 3H4MA 3QXHA 2WWXA 3NH9A 1UBGA 2CL7X 2VSOA 1TUIA 2FA9A 3I73A 3KKQA 4UXJA 4C4PA 1LVGA 1N5LA 1XB2A 2GA8A 3QKRB 1VPLA 4BGDA 4JL8A 5JMTA 2EFCB 2AK3A 3FHCB 2B7BA 1TMKA 4ZI2A 1AZSC 3ADBA 2B8WA 4WZ6A 2VRWA 5BN3A 1E2KA 1T5LA 1OW3B 2YOGA 2JJ2D 5JI2E 4GMXA 4OQLA 2PMKA 4QGAA 3OAAD 3NC0C 4A0HA 2A5DA 4A0RA 4R71A 1NJFA 2YWGA 3BE4A 3U3MA 1G7SA 4OK3A 2QPOA 5KNDA 1G9XA 1E0KA 3LDAA 4B35A 3VNUA 3NC1C 2FSGA 2ZM5A 1X6VA 2FSIA 2IXFA 2ZE5A 2YC2C 5FOVA 5A0FA 3Q72A 3AF4A 3ZYCA 4MYHA 2FG5A 1XTRA 3RS2A 2O8EB 2AN9A 2ZRAA 3QVVA 1NIJA 3GFTA 4ZO4A 4Q1FA 1FX0B 1M7BA 2ZIAA 2XSZA 4AYTA 2BBTA 3PIRA 1ODFA 4IDPA 1NVWQ 3R8CA 1IXSB 2CNWD 1OXXK 3GLGA 1ZUIA 3K0FA 4EPYA 1E69A 4DVGA 4HATA 2IEZA 3NBXX 1DE0A 1J2JA 1NBMD 3UXMA 1KDOA 5D3MA 1U2RA 1N6HA 1XZPA 4BE7B 3B60A 1OH5A 4MUAA 2QEQA 3CZQA 1UDWA 5AJZA 2F43B 2G0NA 1FNMA 3UANA 5FPKA 2ZTSA 5KNBA 3ZZUA 1JBKA 4HUTA 4M9XA 3BAFA 2Z6VA 3LBIA 3PQCA 2JLRA 4LBZA 3MRSA 1OF1A 1IN8A 1W49A 2PJZA 2OBLA 4LYAA 1U8YA 4TLCA 4W5JA 1KSHA 2W6ID 3HWSA 4XH9B 2QAJA 3PEUA 1MV5A 3RDPA 2HT6A 4LBYA 5DYGA 3IUYA 2C9YA 4Q00A 1VHTA 5KTYA 1OB5A 3VNVA 2F7SA 1E0AA 5FTKA 2GJKA 2YHSA 5L3QB 2AK2A 3F0TA 1Q1ZA 4TT3A 5CJPA 2CJWA 3PXGA 1KOFA 1R2QA 4FWIB 3RSLA 1ZUNB 3RS7A 3UIEA 2R6CA 5DI3B 4URVR 2IF2A 3ZH9B 4DCVA 4LHZA 3OFNA 3O8CA 4PPFA 5HE9A 5BYKA 4BRUA 3GLFA 2IUUA 2VTKA 1DAIA 4TZ0A 4C0LA 3OESA 4IOJA 2OCBA 3A1SA 1PJRA 1NSFA 5L3SB 2WVJA 4JLDA 3T1VA 5J4YA 3SFZA 2VSXA 3UG6A 2BM0A 3AVVA 2YWFA 1R5BA 3U7EB 5DNYB 3EIQA 1Z63A 3ZD7A 1MO3A 4BEBA 2BCJQ 1NN5A 4QNMA 1R0XA 2Q3FA 4FCVA 5CIWA 1U0HC 1IY2A 1VG9B 3FWYA 3RLFA 1D5CA 3PENA 5CJ2A 1I4DD 4KFRA 4DEYA 3Q8XB 3LV8A 1N2CE 2P67A 4BZXA 1NKSA 1KMHA 3I5YA 3MWLA 4I1OA 3P27A 4JSTA 1WA5A 3GFPA 3R9WA 1MO5A 1BOFA 1KI4A 3TAHA 3AVPA 3B1WA 3CZPA 1IM2A 1AIPA 4BQSA 1U9IA 3H86A 4OQMA 3U7FB 1X8KA 2OFXA 2GK6A 5D3QA 4ZDWA 2UZIR 1KZ7B 5ELXA 4QHYA 3HP1A 2KBFA 1G5RA 1G8GA 2W0SA 3QPVA 1TF7A 4Q9HA 2JLXA 4ESHA 2CDNA 2Q3HA 4PO9A 5DIFA 2IYRA 2ZUCA 4YDHB 3BWDD 4LJ9A 3WP1B 2VHQA 1KO1A 2IYXA 5KNCA 3TKLA 5EE1A 1E9CA 2QA5A 2ZR0A 4KAXA 2J46A 3FOZA 2REBA 2YV5A 3TRFA 3OZXA 3T5GA 5JWRA 3QUSA 1E1RA 2X19A 1EGAA 2EU8A 4C0JA 5EP1A 1GSIA 2KBEA 2CHVA 3B13B 4RVCA 1G3UA 2QSYA 5C4GB 1J8MF 3B2EA 1P7CA 2XOKD 1WRBA 3LFUA 2ZJZA 3QF4B 4NONA 1HT2E 4RZUA 5BQ5A 1ZUHA 3WYFA 4DJTA 1II9A 2A5JA 2PLFA 1UJ2A 5JHHB 4F38A 1RJ9B 1G17A 1Z0DA 4GI7A 4TTQA 5CB6A 3IPYA 1G6OA 4HAVA 2JEOA 3I4LA 4P3YA 1YR6A 3CRVA 4TWZA 1QDEA 1TF2A 2ZRKA 5FBRB 3VR2A 1FP7A 3AVYA 5EXTA 2BV3A 1UADA 1XJ0A 1E3MA 1P75A 2Y8EA 1SZPA 4FN5A 3Q5EA 3EZ7A 3RC8A 1T0JB 4NE2A 5FPHA 3ZVRA 4YMUA 621PA 3Q7PA 3TUJC 2ZRJA 1MO6A 1XEXA 2CVHA 4HSEA 4QC2A 4JS0A 5JSZB 4FW9A 3T5DA 1KTVA 3T06B 4C0SA 5JRJA 1KO5A 1NP6A 4A82A 1Z47A 3SEAA 2J41A 4FD2A 4MGKR 3U4QA 2E9SA 3ZZ0A 1Z6XA 1NJGA 5FOUA 1PUJA 1CRPA 5HE8A 3VR4A 2CCGA 3B78A 4D25A 2VHJA 3MWJA 4DLXA 4IOMA 1OSNA 2P3SA 3R9IA 3CR7A 2QM7A 3VX4A 4M1SA 1XPOA 2GEUA 3EPHA 3W3AA 3ASYA 3VU9B 2IBMA 1OXUA 1II0A 1DEKA 1D2MA 4FMDF 2A9KA 4LBWA 4DCSA 4Q9LA 3AB3A 1QF9A 1DBSA 2XITA 4NYJQ 4M9SA 4W5WA 2XNSA 1IQPA 3CKLA 3OIVA 3NHBA 1JXMA 4HB2A 3PUWA 4GMDA 2QM8A 3DL0A 1GL7A 2J9RA 2P5TB 2AD5A 3BOSA 4HAYA 2ZI5A 4IXMA 3RWOA 4UQOA 2O8FA 1NMYA 5TXGA 5F9HA 4LBVA 1E2EA 1OHHD 3TVTA 3WP0A 1OT3A 1FW6A 3PUZA 4DUGA 4JIMA 3T1OA 3MD0A 4RD2A 4Q1BA 1VHLA 2C9OA 1L7VC 3OHMA 4BFTA 1KK0A 1TQ6A 4NTZA 1G41A 4Q66C 2IYLD 5TB5A 3AP1A 1CBUA 1ZC3A 4PAMA 5EJEA 1XMJA 4G1UC 3VTKA 4LZZA 1NG9A 3RS3A 1E2JA 4BEJA 4JBXA 4JVNA 2ZI4A 2XJ4A 4C2TA 4K81B 2YYZA 2V1UA 2NPFA 5FOWA 4TMTA 4BLOA 2W6JD 3CF2A 2AXPA 2IUTA 1CLUA 4C7OB 1N5KA 4RSGA 3N2EA 2GZHA 1KY2A 2BJWA 2C96A 2QMUA 3H84A 4JVMA 421PA 4A2QA 3C8UA 1XEWX 3QQ5A 1ZRHA 5KDDA 1QBKC 4ZDIA 2JLUA 4LCBA 1KI9A 2ZJ5A 4LC1A 1X1RA 2WWGA 3CR8A 4HYYA 4AURA 3QF7A 3KXLA 1LY1A 3V00A 1JR3E 4HZUB 2ZI6A 4Z51A 5DO9A 4URZR 3TIFA 4QFMA 1ZD8A 4AKGA 2ZREA 2PLRA 1T0HB 1I2MA 5FOTA 4D4LA 1E4YA 3X1XA 4DT1B 5CM9C 3HDTA 2WJVA 2EWVA 1LF5A 2I3BA 3C7KA 2O8CA 4Q18A 1TAGA 4ZKEA 1HH4A 1AKYA 1RRFA 4DSOA 4TLAA 4C0BA 4MRRA 4FINA 2CEAA 2RGXA 2IL1A 3CUEF 3BRWD 2WBLC 4RD6A 2R6AA 2XNDA 3L8YA 1M6NA 5FOSA 4KSBA 4B3CA 1CJMA 3U3OA 3IILA 3K0AB 2V54A 2FV8A 3BD9A 3B1VA 2V7QA 2IYQA 3BB1A 3R9XA 4L9WA 2O0JA 4UNRA 5DHAA 1AJEA 4CT5A 2IS2A 2JLWA 3I62A 5FPYA 3DPUA 1XFAA 2VHUA 3NKVA 2RGDA 4HLDA 1IY1A 3AV0B 3SQXA 3W6NA 3IKJA 2JJ1D 1X3SA 2ASEA 2YKGA 1MH1A 2OAQ1 3PEVA 4Q4HA 4BZPA 4Q4AB 2QE7A 1ZIOA 4HI0E 2IYSA 2ZJ2A 1G3QA 1B23P 2QAGC 4DRZA 2ZJ8A 1RRPA 3GCGA 3F8TA 4ERNA 4ZIRB 1W0KA 3ZD6A 1WP9A 1PLKA 4UXHA 1G3MA 3UWOA 1ZM2A 1XRJA 3TSWA 3AVWA 1YZGA 4D26A 3X1DA 4TLDA 3K09A 4PHGA 5B2ZA 2QGZA 2WICA 1YRBA 2HDNB 1LF0A 3GLHB 2XX3A 3KUCA 2O8BB 2XZOA 3IHWA 4BFVA 5GADl 2ZE7A 1D9XA 4ZDKA 4BPBA 3KB1A 2FOLA 3CNOA 3LD9A 1LS1A 4JLVA 5EP4A 4R9UC 4ESVA 2CCKA 1N6OA 2GCNA 5F3WB 4Q5IA 1G8YA 1FUUA 1T9HA 2NG1A 2G83A 2JJ2A 2KJQA 2IWHA 1QHSA 5CK5A 1CP2A 2BMJA 4E5UA 4MDEA 1MABA 1G1MA 3OAAA 2Z43A 5GJWC 3K70C 1MR3F 4G0NA 2GJSA 1QHXA 1LV7A 1OFUX 3ADCA 2ZVQX 4PC6A 4X8HA 3X1YA 5J4LA 4WAUA 1HTWA 1XU4A 3LXXA 3GJ3A 2HJGA 1NVVQ 2JLSA 1ZD9A 4HUQA 1O87A 2B21A 1R4AA 4JLMA 4OI0A 3E2IA 5SZKB 3KKNA 4FCTA 2AFHE 4B2LA 2QUZA 3NDPA 2ZRLA 5CM8B 3THXA 1N5JA 3PUYA 4MITA 1JQLB 4F7WA 1C9KA 5C46F 2C5LA 3OF5A 1XCPA 3TMKA 5DSZA 5AUOB 1ESMA 1G4UR 1T3SA 2ANBA 2CNWA 2J0UA 1I4LD 1RPZA 4UNNA 1E9FA 2GCOB 1H8ED 3A6PC 3B6EA 3TUZC 4R98A 3NBZC 2RCNA 5KOYA 1AS2A 1NBMA 3VAAA 2OHFA 3CLVA 4KYIB 4E07A 4CEIA 4H9GA 3M4YA 3B1XA 3LRPA 3I92A 1KNXA 4IOKA 3SN6A 2QU8A 3RRMA 4LDJA 3GLIA 2J59A 4IFEA 5HKKD 4D80A 2RKOA 3GQBA 3I3SR 1WDTA 4PC2A 1BIFA 4C0QC 4UNPA 1NY5A 4EAQA 4KODA 5G3YA 2QBYA 2OLKA 3VKHA 1BYUA 2G3YA 2VP4A 3HU2A 3QKSA 5GJVC 5C4MA 1E2FA 4TL7A 2AKAB 2ZRFA 4RKFA 3AUXA 4G5SA 1OLOA 4Y0VA 2FFHA 4D0NA 3G0HA 5B57C 3HU3A 3L43A 2OFWA 2W6IA 2C9CA 4Q03A 4LY6A 3QVUA 2O0KA 1CRQA 4B73A 2FF7A 4US1R 1L2TA 4M1YA 4NDZA 1KMQA 3OIWA 4PANA 1WBDA 2JGNA 1KKLA 2AX4A 4DLUA 4WBSA 1QHHB 1RYHA 2IYUA 4KO8A 1E0SA 1EFUA 4M9QA 1KK1A 3MLEA 3BH0A 2IYTA 1L4UA 1DELA 3KQNA 3RANA 4TSFD 3WYAA 1DG3A 4NCHA 3ZVNA 3GEIA 4NYMQ 5DISB 5JLJA 1Q0UA 1HE1C 2MMGA 3LWNA 3U60B 1FNNA 2YNMA 4V03A 4CT4B 2A30A 4XIGS 4G01B 5BN5A 3DZDA 3I72A 4KBGA 3FKQA 3Q9LA 3H2YA 5CLLA 2GDJA 3KB2A 3SZRA 5JCZA 2P5SA 2QNRA 3NVAA 4HDOB 3THWB 3SJCA 3I5XA 4PPNA 3RWMB 1M1YE 2H92A 5E7IA 3U3JA 4Q7MB 4ARZA 3R8FA 1G7TA 2ZPTX 1ZINA 2ZRNA 2HCBA 4LSGA 1G6HA 2GEDA 1W4BA 1ZM4A 4IDQA 1DOAA 3D3QA 4Q1AA 4XVQA 2ZRPA 5KSZA 4A36A 4I1VA 1ZW6A 2PZEA 1Z6YA 4TLEA 2QPAA 1CR0A 3WYGA 1OIVA 3RAPR 2ZEJA 1AKEA 1COWD 1Z0AA 4LI0A 3LX5A 3KTAA 4QM6A 3QXXA 2ZSBA 3BGWA 3P32A 4R7ZA 4XTCS 3TGPA 3GJ8A 3PG5A 4ASUD 1NN3A 3H1TA 2O8DB 3PUVA 1Q57A 4S2EA 2GBLA 4OQNA 2J3EA 4MRSA 4QHTA 5BXQC 3NDBB 4RFVA 4Q48A 1XD8A 1SXJE 4OI4A 4OQXA 4P4SB 2CL6X 2H18A 1T91A 1PVOA 3ZZTA 2G77B 3AP2A 2PT5A 4HB0A 4QBGB 1RE0A 2YVUA 2WWIA 3SR0A 2CLCX 4B3GA 3THYB 3CWQA 3S1AB 1KZGB 3LW7A 5SZJA 4C0AC 1HV8A 4RD1A 2BJVA 4CEJA 4PZLA 5KPJA 2XB4A 3H0KA 2XXAB 4QXAA 5J4KA 2XOKA 3KQLA 1S1MA 1DAHA 3CRRA 4F4CA 3O8RA 3DOFA 4A2WA 4RCZA 4JLOA 2FFAA 2RH5A 4FWTA 4D4MA 3UK6A 2CHQA 2P65A 2ZJOA 3FVQA 3CRW1 3AVOA 1TADA 3B9PA 2XTNA 1N0VC 1Z83A 4D2IA 4DLSA 1NVXQ 4LC0A 2W2VA 2YWEA 3KKOA 3ICEA 1VCOA 2EYQA 3AH8A 4U7DA 5E7JA 2OEPA 2DWPA 4NZYA 4LPKA 4MGZR 521PA 1IXZA 1DPFA 2AXNA 2O0HA 4LHYA 5IDVA 4E09A 2KB0A 4NMMA 1E98A 3VR3A 1YZQA 3IDQA 4K8OA 4BLSA 1S1CA 4KXFB 4O2LA 3NTUA 1TU3A 4YLGA 4P4TA 1A1VA 2PEZA 2PCJA 4D6PA 5H8WA 4OHWA 2JATA 3DVLA 3K70B 1KIMA 1OXTA 2B6HA 2IT1A 3IBYA 4TYQA 4KJZA 1P9NA 3WRYC 3PEYA 1ZP6A 1V5WA 3BH6A 4JZKA 1FL9A 5B64A 1OB2A 2I1QA 5AUNB 2R2AA 4QBHA 1ESNA 1II8B 1TQ2A 1DADA 4N0EA 2ZRCA 3ICQB 2FZ4A 2MMCA 2X1VA 2X2EA 3C14C 3K0FB 1YR8A 2CCJA 4LYJA 4I1UA 2WJYA 5EP2A 2Z4RA 2ZJYA 1M2OB 1P2TA 3ETLA 4NCJA 1EESA 1OHHA 2Z5FA 1OFTA 3CRMA 4URUR 4UXIA 5J40A 2FEMA 2BVNA 1WF3A 3ZS9A 4XWOA 2IS6A 4O25A 2QL6A 3SI7A 3A1UA 3KJIA 5LBIA 3MFYA 4TQAA 1CU1A 1E9AA 1W2HA 1JI0A 4I1SA 3A1VA 2VHCA 1W48A 4ZCLA 1E32A 5P21A 2WZQA 2ZRIA 4Q4JB 1HUQA 1CR1A 2VP9A 1GAJA 4YMTA 1VECA 1XTJA 3KJGA 1IONA 2RGNC 2RMKA 2PJRA 1ZM9A 3F5FA 4YC7A 1JJ7A 1KSJA 3NIBA 1YZTA 1Z2AA 3QKRA 3K9LA 2OFOA 721PA 4OJKA 3FYHA 4WIAA 2W6JA 1E2QA 1VYUA 4QG7A 2IS1A 1KHTA 4GRAA 2ZI9A 3CIOA 5EE3A 2JAQA 3QBVA 2CVFA 4I4LA 2ZYWX 1X8LA 5FTMA 1NSTA 1GTVA 3N70A 4EQ6B 3RRZA 4L8GA 2UKDA 3P1JA 4GFDA 3U44B 1RIFA 2ZI7A 3KFVA 5FOXA 1S3SA 5HTKA 2BCGY 4E22A 1G7RA 4XSGA 3REGA 2PZGA 2XTZA 4OK6A 2J0SA 1U0JA 3AQ4A 5LB2A 4L9SA 4W7SA 1E9SA 4Q47A 4M8NE 1F2TB 1GL6A 4B3XA 4Q1EA 4TMZA 3WXMA 5GJBA 3CX6A 2O8EA 3EAQA 1XXHE 4BRWA 1VIAA 5AWFC 2ZE6A 1G3IA 1P73A 2ZSAA 1VYTA 3EZ9A 1FX0A 1Q1BA 4US0R 4DCNA 3QY0A 1AGRA 2GZDA 2FE4A 1M8PA 2FEOA 3L2OB 4RD0A 1OH7A 4M1MA 2J0VA 1G8PA 2QTHA 4BFSA 2BBSA 2V4ZA 3ZVLA 1WCV1 4DSUA 1VIYA 1KJZA 1SXJC 3A4MA 2A5GA 1GG2A 2R65A 3X1WA 1N25A 1F3OA 1BMFD 1OPXA 4V0OA 4B71A 4LK2A 4OL0A 2GJ8A 2JJ1A 1Z6GA 2F43A 1AQYA 4AWXA 2X2FA 4UNQA 3GPLA 4N3NA 2EFGA 1RKBA 1S96A 4FXPA 1NLYA 4V0LA 1U90A 2ODEA 4EPTA 2ZSEA 2W2TA 3TW8B 3DMDA 4A6XA 2WWWA 3K0CC 4PPQA 3KXKA 1JAHA 1GDDA 2I1VB 5EXPA 5FR1A 2AFIE 2ZR9A 5JJLA 2PMDA 4PAQA 2H17A 3OEED 2OXRA 2G1KA 3KFXA 4GZLA 4PHTA 5DLQC 4X8MA 5EP3A 2NMVA 3O8DA 1QG4A 1MOZA 3KDSE 2ORVA 2HJVA 2FDCA 3OEHD 3EC1A 5HCIA 1I2DA 5AJVB 2ZR7A 2PX3A 4B75A 4NH0A 4DSTA 5L3QA 5KSPA 1VCNA 4JYCA 4JBWA 4OBEA 4KSCA 3R7WA 5DI3A 3I32A 2VF7A 3EIHA 1KYIA 1GNQA 3TLXA 4IDNA 5AJYA 3LLUA 1JPJA 3DOEA 2JDID 1OIXA 2QQ0A 2HXYA 2V1XA 5IK2D 5JECA 1KO7A 3B1YA 3KL4A 3IGFA 4CIDA 3CX8A 5CB8A 5L3SA 4GBMA 2FNAA 2HYIC 4MYUA 4OYHA 1KDTA 4WA7A 4TYPA 1SKYB 3BB4A 4NCIA 3TR0A 3WBKA 4M4SA 4EIWA 1ZU5A 5F9FA 3TR5A 3LQQA 1D2EA 1SVLA 1KNQA 4B76A 2WPDD 4NYIQ 3K9GA 5E4FA 1HA3A 1EFHA 1OKKD 5JJIA 2GKSA 2ZRBA 2NOAA 1IAQA 1HYQA 1R0YA 4AYXA 2OZEA 3BFXA 4CW7A 2G6BA 2YWHA 2C04A 4HEJA 4GPTA 3C41J 1K6MA 4PX9A 2GK7A 1YRAA 1Z28A 3PR1A 2GVZC 3TE6A 4AD8A 1PLLA 4YDSA 4DDTA 1YHNA 3QPUA 4LHXA 4PHFA 2Z0MA 5M04A 4KYUA 1ZNXA 2A5YB 1JEEA 1GP2A 1VYVA 4O0MA 1R6BX 5J5CA 1BO6A 1CJVC 4HAUA 2WKQA 2SHKA 2NPIA 1H8EA 1ZM3A 2OBMA 1DS6A 3PUXA 1ZMXA 2GRJA 1WBBA 1W36B 1ZCAA 4MKIA 2NZ8A 4DXAA 3U61B 1CR2A 1MRNA 2AD1A 4M21A 4MGYR 5JWOA 4MRVA 4LWZA 1F60A 2IYYA 4LOAA 1ZU4A 5HKKA 5TDHA 4HB3A 3SHWA 4EJSC 2XEXA 3AUYA 1KJYA 1ZC4A 1Q44A 4HAZA 5F2EA 3VR5A 5CK4A 4Z1MD 1RRCA 1VKJA 4B74A 1OH6A 2HYDA 3QF4A 4CRWB 1GVNB 4TTRA 1VDZA 1Z29A 2WOOA 4JKIA 3X2SA 2VEDA 3LH5A 3CF0A 4WZBE 1NY6A 1UFQA 2H8KA 1YJ5A 2QI9C 3MMPA 4L5BA 4AKHA 3TVDA 4DLRA 3GLGE 2ODBA 2Q9BA 1RJ9A 1U94A 1FQKA 1JEDA 5AJXA 3SFVA 1OE0A 3P20A 1T5IA 3ND8A 2GCPA 2JIZD 3T1QA 3CBQA 1G20E 2VP2A 4OHZA 2IWRA 3UG7A 1KK2A 4GP7A 3IHLA 5FH9A 4Q7KA 4PXAA 3U3RA 4WXRA 3W6PA 4M22A 1T6NA 2FSFA 4UJ5A 2BEKA 2Q6TA 3CWZA 2MSDB 4JT2A 1CR4A 5LB4A 3AVUA 4TSFA 4WVFA 1NG1A 2QQEA 1EWQA 1A5TA 2GXUA 2RGBA 4HLUC 4W9MC 3C5CA 1OJLA 1SKQA 2WJGA 5JSZA 2QT0A 4Z8XA 1X8JA 5ANRB 1SVWA 3CX7A 4V0NA 4DIEA 4PQRA 1VCIA 3MJHA 1S2MA 3IEUA 2JLYA 2YZ2A 4B34A 2PEYA 4S35A 3K70D 4PTLA 4AI6A 5TARA 5JWHA 1KSGA 5J47A 2BWJA 2KI5A 2ZYTX 5AK0A 1TUEA 2JASA 4XTRA 3TSOA 2QTVB 3SYLA 3AF2A 5EE9A 4O2RA 2O8CB 3U7HB 3IQWA 2VL7A 3P4XA 3JVVA 3DDCA 4KVGA 4OK5A 2RGCA 1W4RA 1H8HD 1XEWY 4A92A 3QG5A 1XMIA 3G5UA 1YQTA 2DFNA 3MAAC 4MKFA 5JI3E 3EW9A 4MQBA 1XD2B 2CE2X 3FB4A 3EWAA 4EDHA 4KI0A 4D4KA 1J7KA 4HB4A 2X77A 1COWA 3GLFE 2DWQA 4D0LB 2VSFA 2WV9A 3A4NA 1FOEB 2N46A 1KAOA 3FMFA 4ASUA 2FGJA 3ECCA 4Y0AA 4OHYA 1VTKA 1Z6AA 4FI3C 4U02A 1S4QA 4E03A 5DN6D 1E99A 1W5TA 1D2NA 2F1IA 1HQCA 3SS8A 3TK1A 5GVRA 3FHOA 4GL2A 3TSZA 4JMPA 2DR3A 1SXJB 2FZLA 4HLQB 1NLFA 1G8HA 4A8JC 3GJXC 2QENA 2P2LA 2ZU0C 2A5FA 5UKDA 1RC8A 4C9BA 4NHOA 4GZMA 5FUVA 4RFSB 2NO7A 2WJHA 2DPXA 3W9YA 2YC4C 3FKSD 3GD7A 2J7KA 2CLSA 2E87A 1X1SA 1ZYUA 1AK2A 3GJ6A 3ZJYA 3UMSA 5KHOC 4CZ2A 4C7OA 3B85A 1E2DA 2DWOA 2NIPA 1RYFA 3JZMA 2BBWA 1CJUC 4CEHB 3LBHA 4POAA 3IIKA 5C18A 4IEIA 1YZLA 2VBCA 4YMVA 4XSHA 2A2ZA 4NL4H 3E70C 2BMEA 1KI7A 4MGIR 1CULC 1SVOA 2JLVA 1EX6A 2V8OA 3TJZA 3CNLA 2LCFA 2JA1A 1N6KA 3KQHA 3MJRA 1BH2A 1JR3D 3GJ0A 1UF9A 4HZUA 2IK8A 1ZIPA 3WHKA 1IN4A 1BS1A 2MSCB 4JLKA 4B44A 1J90A 4DT1A 3HYRA 2PH1A 1ZBDA 2IUSA 1G21E 1XTQA 4QJ3A 2FPLA 4A0GA 1MO4A 2J1LA 3ZIAA 4ACBA 4H1UA 2AHOA 2HLDD 3BBPA 5FBQB 1K5GA 4ITRC 3AF1A 3DHWC 2YOHA 2IYVA 2BDTA 2OCYC 1UKYA 1J8YF 3PVSA 3U6KA 2CE7A 5K8UA 3NWJA 5BWMA 2P6NA 4DIDA 1QHNA 1SGWA 2RGAA 2OCAA 3K0CA 1A7JA 2F6RA 4NCKA 5F98A 3W8RA 3EZ2A 4IOLA 3PITA 1H65A 2X8AA 1SVIA 3TBKA 1F2UA 3K9NA 3KQKA 2BC9A 4KCGA 1GKUB 3V9PA 3QXCA 2PCLA 4QHSA 4IVQA 1IN6A 2J87A 1KI6B 5SZHB 2E1RA 3HR8A 3SJZA 3AKCA 1LW7A 4PSAA 3SHFA 4URXR 1VCMA 1IJFA 2OESA 3MWKA 4Q4AA 4ZPXA 3EWSA 4YMWA 4TQUS 4KV9A 4A0FA 3OE7D 5DYIA 2H1LA 2VP0A 4KU4A 5E7MA 2PL3A 1XTSA 4P33A 4KHZA 5TY0A 4ZIRA 4B43A 5E3HA 3WNCA 1FMJA 4ZCMA 3GEEA 2XZLA 1TNDA 5FL7D 4JLNA 4IDOA 3QKSB 3UMRA 5IF9A 3RVBA 4EJSB 4C2UA 5LDDC 4DHEA 5K8LA 4H1VA 4A9AA 4A6PA 2HV8A 3GLHA 3LY5A 2YINC 3CRQA 2O8BA 3CNNA 1US8B 1BKDR 2G0TA 3EC2A 3EIEA 2AR7A 4WXPA 1OXSC 3M0EA 1W0JD 1D9ZA 3QXSA 2BKUA 4FMCB 3ZDQA 2WAYA 2GXQA 3MUFA 2WHXA 4Z8YA 1XBTA 4DDVA 3LA6A 3AVXA 1AS3A 1EK0A 1Z22A 1XNJA 4MYTA 4WW0A 5G53C 3RRNA 4C0KA 1R7RA 3VQTA 5GJCA 1SULA 4DCUA 3QENA 4JVSB 3L82B 4B3BA 4LV5B 2ZXUA 3I61A 3MCAA 2J45A 1XDBA 3K53A 2FPMA 5EE5B 1JNYA 2A78A 1AA9A 3I1FA 4TMWA 3IPXA 3KKMA 4ON9A 1TTTA 5FPSA 2GILA 4HDCA 3D6TB 4OQFA 4YQFA 3J81k 4MRNA 1XXHB 2HEIA 4RCYA 2IEYA 2C95A 2OBNA 2VHTA 4QNRA 4US2R 4OHXA 4ARZB 4F91B 821PA 2MSEB 1NMZA 4BECA 2B7CA 1Z8FA 4D81A 2XJ9A 3M6AA 3AEZA 4PSVA 4BUJA 2QTFA 5JHGB 5JS8A 2GCOA 1S3GA 2WKRA 4A4DA 4CDGA 2R9VA 4Q9KA 4BFWA 1U8ZA 1UKZA 4B47A 1W36D 1RVDA 1DO0A 4TMVA 5K8IA 3AP3A 221PA 3ND9A 5CLQA 1BMFA 1J70A 4LJ8A 3U5ZB 3GJ5A 4TL8A 3DO6A 3Q3JB 2VA8A 5KDOA 5EQTA 4MYCA 1FZQA 4IVRA 3Q85A 1S0UA 3O47A 3BFVA 3ONWA 4G5RA 1DTSA 2J7PD 3GMTA 2OSBA 3MWYW 2N1BA 2BM1A 2ZQ5A 2HF9A 1PUIA 5J4HA 4PR0A 1YU9A 4PO8A 2BBOA 2UZ3A 3FFBA 2Q0HA 3OEEA 2WM9B 4HLUA 1CJKC 4A8JB 2CK3D 2ZSDA 3AGPA 4JKYA 4C0HA 4TYWA 4CEJB 4IVPA 2CLDX 2CXXA 1E96A 5LPNA 3OEHA 4RKEA 1UPTA 1S9HA 3DKVA 1QHHA 2QP3A 2NZJA 3NHAA 4II7A 4R2HA 1KY3A 3LAWA 2IXEA 3NXSA 1E2HA 4G5QA 4XD7D 5JCPA 4BASA 2J5XA 3PCRB 2XAUA 3NEJA 2OLJA 2G9NA 4LYFA 2F1RA 4B6EA 3AKYA 2LKDA 2IA5A 4B32A 1JQJC 3EZFA 1QVAA 1T3HA 2JDIA 4CGZA 4M1TA 3EPLA 3DMNA 5IK2A 1HE8B 3OIUA 4LHVA 1G7CA 3VR1A 3K0SA 1OFIA 3CH5A 4PHHA 1P9WA 2L0XA 3TQCA 3U6BA 5B30A 2XTMA 3AF3A 4GOXA 2WJJA 3AVTA 5FI0B 4DLWA 2QN6A 1LTQA 1L4YA 3K0EA 5JRZA 5EZ6B 4QL3A 2IYWA 2WPDA 3LVRE 1S8FA 2W00A 3FMPB 5HZKA 1E1QD 4MKHA 1EXMA 1OKKA 4IRUB 2ONJA 1NVUQ 3E5HA 3FE2A 4QGGA 5SZIA 3V4FA 1QVRA 5C2JB 4I99A 2JCSA 3WBJA 3PV0A 3T61A 3FFAA 1OIWA 2V55B 2ODWA 4XWAA 1NKTA 3CPHA 3GJ7A 2HXSA 3ADKA 1GKIA 1NIPA 4AKIA 3CF6R 1GNPA 2DYKA 1VG0B 3DKPA 1P4SA 1UKVY 3NBFA 4GT1A 3ZGXA 1R0WA 3T12A 4Q01A 3HR7A 2O8DA 5BW8A 1ZNYA 2IHYA 3QG1A 1ZNWA 3W34A 4P32A 4JJZA 1W44A 3IO5A 4HLCA 1SXJD 3UKDA 4P4SA 3VKGA 3Q5DA 3CO5A 4LGMA 2ZRGA 2EQBA 1IOZA 1JR6A 2AWNA 1ZAKA 4Q1CA 2W58A 4JT4A 5KUTA 5EUQB 2ZRHA 3U2QA 3A4LA 3BFKA 1P2SA 2QY9A 2F9MA 5C1BA 4V0MA 2PBRA 3D7MA 2B8TA 1KK3A 2ZS9A 3PEWA 1JJVA 5L3VA 1GOTA 1R5OA 2NGRA 3EASA 1D6JA 4Z1MA 1KDPA 3AM1A 2XXAA 3ZQJA 1KI2A 1E9BA 1GKYA 2QAGA 1AM4D 1RFLA 3SE0A 5FTJA 1W36C 1YZNA 2YJTD 3HYTA 4LPSA 2RGGA 1EWRA 3TAUA 3GLGB 1R8QA 3SDZA 5GVSA 3Q7QA 1YR9A 4LRWA 4B48A 4P0TA 4XVRA 2JIZA 3NH6A 2QROA 1NBME 1Q3TA 1IY0A 1A4RA 5D3MB 1K5DA 4KLZA 1JECA 1K8RA 3ZQ6A 4LV8B 3CPJB 3M1IA 1U98A 2WMOB 3EG5A 4JYBA 3GLIE 2PT7A 8OHMA 3ZLJA 2GHIA 1Z2CA 2D4HA 2ZUDA 4HAWA 4Z54A 4OI2A 3LNCA 1E9RA 3C16C 1UKEA 5AUQA 2WWFA 2BEJA 2ZE8A 4P31A 3QKTA 2WIBA 4KLNA 4UKDA 2BKEA 5AUPB 2FFBA 5IRCD 3EX7C 1YKSA 2EFDB 2D2FA 4PAOA 5KU1A 2Z4SA 4QGFA 1FTSA 4D82A 1ONBA 4L15A 2OCPA 3IO3A 4MDFA 1F5NA 1GL9B 1I4TD 4B2PA 3SBEA 3REFA 2RAPA 4JL5A 1T4GA 2H7VA 1UAAA 1CF4A 1II8A 2PX0A 4F4JA 2BIFA 1H8HA 3L0SA 1HEIA 2CJWB 3DM9B 4EFMA 1TEXA 2QP4A 4C30A 2P6UA 4LHWA 3RS0A 4ZI3A 4PC1A 1MT0A 2ZJAA 4WOPA 1G5TA 2P6RA 1KO4A 4BLRA 1JALA 4IW3B 4NYJR 2V6IA 3GLFB 3L0PA 2GETA 4BFZA 2D06A 2QORA 1F6BA 3RS4A 5LD2C 3RSOA 1P2UA 5DN6A 1UBFA 4HDQB 4KITB 1IJEA 2WWHA 2OO7A 1DAMA 1OYWA 3DZ8A 3KX2A 4DCTA 1Q21A 2TMKA 3PFIA 4PO1A 3FTQA 1E6CA 1GILA 1EFRD 4WZAE 5JEEA 1TL7C 1DG1G 5JBQA 3A37A 3AF0A 4Q4JA 4RZXA 4DB2A 4ZKDA 1AS0A 1XTKA 3A36A 2Q3MA 1KAGA 3GJ4A 4TL6A 5FBWB 2QPTA 2WSSD 1W4CA 3FKSA 1UEIA 1KMHB 1QHGA 2VYFA 4BFXA 1FFHA 1RW4A 3CW2A 3C5HA 3B5JA 4G3XA 4GOKA 3GEHA 4MKGA 4RZ2A 5EE0A 1MKYA 1NN1A 3BIFA 3LXRA 4LJ4A 2QP9X 1FP6A 3BXZA 3D31A 4KFUA 2QZ4A 1XJQA 4M1OA 4PSKA 2EVWX 4IHQA 5DGXA 4U00A 4GOJA 1LB1B 1TPZA 2DBYA 2QG6A 4F93B 3R7WB 3VFDA 4EQ6A 4MUBA 2FGKA 3V4RA 2EFHB 1E0JA 3U44A 3A58B 4F4IA 2IYZA 2HT1A 1JR3A 1DVRA 1E79D 3LW8A 2FPKA 2WSMA 3QIAA 2ZANA 2H16A 4DEXA 2ERXA 1OYYA 2DFLA 4Q1DA 4ABYA 3LO5A 3K09C 5FBVB 5JJKA 2DCUA 3W3ZB 2QT1A 4IXNA 1U8AA 3RC3A 1F2TA 2ZJBA 4DDUA 1P3JA 3CPEA 4TN1A 3KZ1E 3EPJA 2CMKA 1KI3A 1UBCA 3QOFA 3SNHA 3SYKA 2HLDA 3EA0A 3G82C 5L3RA 2QGNA 1ELOA 3CH4B 4C3ZA 1OV4A 1SVMA 3LBNA 2G88A 3WY9A 1C1YA 4O3MA 3W90A 2WIAA 2FN4A 3RYTC 3TNFA 2F55A 2W2XA 2AL7A 3VHLB 3WNDA 2QMEA 5CYPA 5FFMA 3BH7A 5IT5A 4HZIA 3T35A 1Q20A 4DSNA 4IDHA 1YR7A 3C4JA 2V9PA 3EPKA 2C77A 4OJQA 1HY3A 1KKMA 2IF0A 3ASZA 1TX4B 3VX3A 4JBYA 1S9DA 1CXZA 1FPMA 2FFQA 2EW1A 2IXGA 2GEVA 2R6DA 1JB1A 2ZSFA 4OKSA 4GDFA 1Z0IA 4Q9JA 3B8HA 2OUKA 1CTQA 1Q1EA 1XEXB 2GWHA 2OV2A 3W5IA 2IX3A 1E2LA 2C03A 4G5OA 4NPHA 2HUPA 5DHFA 3JVUA 1L8QA 5FUYA 2ECKA 4L16A 4AIIA 3KKPA 3OE7A 2GESA 1WMSA 3U4QB 3I8XA 3UMFA 4OI1A 2ODNA 2REXB 2RGEA 3PJRA 2RHMA 1BYIA 1R10A 4V0ME 1YVDA 1E2PA 1KO8A 1R8SA 3CB4A 4MA4A 4DLVA 5FR2A 3WMGA 1NI3A 3AGQA 4PC3A 4B6FA 1LFDB 5FL7A 1W2GA 1Z06A 1R0ZA 2OILA 4TYYA 5JEDA 2VH5R 1M34E 4PC7A 3R20A 2ZS8A 1IHUA 1WXQA 2C99A 4KVAA 4Q02A 1DO2A 1E94E 1TEVA 2QRNA 1W0JA 4YXWD 3L0IB 1Z5ZA 3BC1A 1G16A 3NG1A 2DFKB 2IC5A 2NTYC 1P5ZB 4LJAA 2ORIA 4DZZA 4ILEA 3AVQA 1WB9A 2GVDC 2O8FB 1TQDA 4IEEA 1T8TA 5TV2A 4P4UA 6Q21A 1X86B 1KI1A 5CDFA 4M1WA 1QZXA 2OAP1 4LJ7A 3P26A 5E95A 4QRHA 5AR1A 3VR6A 5EXXA 2HCJB 4RD4A 4FMDB 3LX8A 5HCNA 1G291 1ZVQA 1W5SA 2BHRA 3A1WA 4BLQA 2GXAA 3EARA 4RZ3A 3RHFA 1O3YA 5A5GA 1GRRA 4DLYA 2WWYA 2ONKA 3EXAA 1JXOA 3FPAA 1NVVR 4M1KA 4PQYA 4PZZA 3HJNA 1XZQA 2WAXA 2DB3A 4TQ9A 4PPGA 2CBZA 3B82A 1Q3HA 2GAOA 4NBSA 4ZCIA 3T1TA 1U99A 1AN0A 1D8TA 4OHVA 2GF9A 2D7CA 2VIIA 1EFTA 2ZRMA
chains in the Genus database with same CATH superfamily
1BX3A 3KSRA 1FQWA 4CKWA 2OBFA 4NXNB 4MMYB 3FBTA 1FTGA 3AOGA 4W7IA 3UAGA 2H1OA 2RJ3A 4ZMBA 2X0RA 5AIBA 5IUJC 1PE0A 2JLZA 4Y9TA 5CX1A 3EDCA 1YR1A 2XTAA 3B2NA 1N2ZA 2GXSA 4UZSA 1ICEA 1QE0A 1LNZA 1N4DA 3S6JA 1RM3A 1SCAA 2HO4A 2Y93A 3JZAA 2RHCA 3ZNPA 4Q9IA 2H5EA 2KMLA 3FSEA 3GNSA 3ZBQA 4E2XA 2A7QA 4YLEA 2Z56A 2RHHA 1P7WA 2P2CA 5F1KA 4NENB 1V37A 2ZWMA 3CC8A 3KU1A 2CGEA 3BTOA 3VU9A 4BN4A 4DV0B 1LDBA 3STUA 4C1NA 3GARA 5E6RB 1K86A 4J0EA 4N18A 2OORA 3DEIA 3N0WA 3UPUA 4J9UE 1JG7A 1T3LA 2JARA 1JEYA 2ZBFA 2AUNA 1O03A 1XLUA 2MU1A 3L8ZA 1K4MA 3VZDA 1DIRA 3B6KA 3EGXA 3S68A 1VFNA 2ANCA 5CCEA 1NBIA 2GBLC 2JFYA 4C6RA 1H4VB 1ZMTA 2ECQA 2ZTMA 3CZ9A 3N8IA 4N5HX 3R9XB 2D3WA 4DQXA 1WCYA 2RGNA 2X5KO 2XRYA 5A5VA 4CM1A 4XD7A 3JQBA 3THOA 4C07A 1PF7E 1E3SA 4AZ3A 3OQJA 1RDFA 4O4JB 4P4LA 4EG8A 4PINA 4YCSA 1RI4A 2KSQA 2WTAA 3G2MA 3HRIA 2WJIA 3QIVA 5TPWB 1F1BA 5K3DA 2I1WA 3O90A 1SU8A 4HS9A 1G64A 2V98A 4K6FA 4WOKA 2WIFA 5AKGA 2CLOB 1PEDA 2FRVA 4YRTA 4DLRA 1N6NA 4I19A 2W71A 2D62A 3OPYI 1ZUD1 1ICIA 4ZT2A 4BLPA 3K15A 4XVUA 3W8DA 2YV1A 1NN0A 2HN9A 1GXSA 4B4DA 4Y6SA 3BZBA 3QWBA 1ND6A 4QOJA 3SYMA 1SHJA 3W5CA 1UWKA 1PJ8A 1I0IA 2DQKA 3VRHA 2FQXA 3SF0A 1TU4A 2X7XA 1G8FA 1GFIA 2B34A 2JK1A 2P0YA 1M1YA 2K4MA 2O5VA 4QWMA 4K6GA 3QXJA 2C2HA 1CY0A 1E1QA 4BWVA 4JVOA 3ZIDA 4RZIA 4P7FA 3LZDA 4O1MA 3DS8A 5ERYA 5IH3A 4YYEA 1FJHA 1Z7GA 3AOEC 1DJMA 1W34A 2GFIA 1YA8A 1I1NA 3R0QA 4RVFA 4M7OA 3SDBA 1DTWB 5K0ZA 2V6BA 3SQNA 3L8FA 4DAOA 2Z98A 4RANA 4R05A 1WDWB 1XL0A 2OT3B 2C57A 4GIBA 1DUVG 5BWCA 1NURA 3F98A 1NW5A 5FDFA 2XB2A 1DJOA 2R4UA 4B33A 3PT5A 1QF6A 3FHTA 3IVMA 1J97A 2HLNA 3TYXA 4AJPA 4TL9A 4QARA 3NHZA 2DHQA 3TD6A 4Y9UA 3CVVA 1MV8A 4CQLA 2BUBA 1SQSA 3G9UA 4ISCA 4MWBA 4XDHA 5K8TA 1Z4NA 4PZUA 4HWSA 2IS6A 1HDCA 2GA9A 1P6XA 2VT2A 3EE6A 5LQKA 2PMBA 1G6Q1 4TTAA 2B92A 4M0EA 4RFSA 3PVCA 3MJCA 1EEXB 2I65A 4MIKA 1L5LA 3B8EA 1BFUA 2R6FA 1HRKA 3RVDA 4AJHA 3IXLA 1G2OA 1GITA 2YRFA 1HK7A 1XJCA 2IZOA 5H16A 5CFRA 1XMVA 2YBDA 3TQSA 3EQZA 1Q1QA 3BRQA 4L5YA 3CUYA 2D5BA 4G4SO 2EW2A 2GNPA 4J0JA 2EBHX 1VIVA 4F3RA 2J30A 4XPIB 2OLEA 2GH1A 3FVTA 2Y67A 3E9RA 5FL3A 5BN4A 2H2DA 4S2UA 2FG6C 2BI7A 1J1IA 1B6TA 3A8TA 2H6EA 2QY6A 1O96A 2H57A 3B6MA 3BHNA 1Y1QA 3E8MA 3GNLA 3LHDA 4IRXA 4ZAGA 5KDLA 1JA1A 3TW4A 2CMFA 3UZUA 1A9PA 4AU1A 5JFGA 3D6AA 3NAZA 3WMFA 3IULA 1H3FA 5ED4A 3GLIB 2M1XA 2JHAA 2K7ZA 2HBRA 4Z9YA 3CE6A 2I3GA 3BE6A 1MGOA 1VSTA 4P36A 3A0UA 2X8JB 4AC9A 1NP3A 5JNWA 1QR6A 4R9RA 3TLZA 1FFXA 4O63O 1I51A 1MP0A 5IDYA 5CDFE 2Z5LA 1CVRA 1RAHA 3AUFA 1BCRA 1QORA 2HWWA 3TLBA 4RH0A 5IUNC 1E4VA 3HO6A 2BF4A 4HDRB 2C3MA 4H17A 3KUUA 3LK7A 3FIUA 2P30A 4GPZA 4LWPA 5AI5A 3V2IA 4AF8A 4EI8A 2CSUA 1U02A 2CB9A 2WHQA 4EB8A 2HGSA 1QAOA 3BL6A 4GWGA 5ICMA 2ALJA 2HF8A 2YHBA 2NU9B 3SCZA 4RK5A 5EZSA 3W5JA 3Q40A 1J8FA 4LXIA 2FW7A 3QNUA 4LQ4A 1ZD1A 1FP4B 4QUIA 4LSWA 3L8CA 2O1SA 3U3KA 3ASUA 3R0JA 3VR2D 3PDHA 5CEFA 4U6QA 4UHFA 5JS7A 1HT1E 1HETA 4GLFA 1RTTA 3WYCA 2KWIA 4BO0A 2ATXA 2KE5A 3OCJA 2GCIA 2VPWA 1U81A 2FPPB 3PWKA 3PRJA 3GFQA 3ESYA 3VNQA 1CQZA 3FGOA 7AT1A 5AVYA 4DB4A 2ZK7A 3EWIA 2GN9A 3M9WA 1ESEA 4S3MA 2G1AA 2N42A 1T2DA 3D43A 3KTFA 4CTMA 2XZPA 2OO5A 3UAXA 4REMA 2R60A 1SHKA 3A4VA 4TT8A 4PN3A 3R5TA 4AY6A 2IGTA 4W6QA 4PZYA 4BMSA 2V6GA 3TB4A 1RWQA 1SVSA 2OY0A 3NHRA 1XD9A 1VG1A 4IH1A 5D3ZA 3W5BA 1DAKA 2VRBA 4Y3UA 3RFCA 4QATA 1OWPA 5BN5B 4TYNA 4EFLA 4P92A 1X13A 1M7GA 3AEYA 1P1CA 2W11A 3O9VA 4LJYA 5HDBB 1WG8A 2VPXA 3USES 4QM7A 4AJ4A 1ZWLA 3BWCA 2FZEA 2VJLA 4UNIA 3DUWA 3HKCB 2XECA 1EJBA 2NYVA 4MR8B 2AF4C 1JHUA 5I7VA 1OI4A 2KYRA 2VPPA 1FS6A 4K46A 3AONB 3ZKAA 4A1FA 4Z9BA 3PFKA 4EJSA 2JAPA 1TMGE 1CS4C 2QJWA 1UPBA 5FPTA 4OQ4A 1WPQA 2G1UA 2LE0A 4QXPA 3A31A 1UDXA 3DE7X 4PBSA 2V7EA 1AZTA 3VTAA 3DUFB 1HL7A 1JKXA 1GR0A 1TYCA 2X0KA 1E2NA 2QAIA 2Y4NA 3SU8A 1MA0A 2P0AA 5F76A 1SRQA 4RIGA 4PWYA 1JXAA 1W8DA 5T67A 3D6JA 2FPWA 3NKLA 4RIIA 5LQJA 1OLSB 3A6ZA 4QVKA 4W5RA 3A2KA 3BERA 4CNQA 1O94D 4DUGD 3KYDB 1VE6A 3WLKX 1WUTA 3DQPA 2SICE 4N3AA 2G7ZA 3B1ZA 3E5MA 5FPPA 4Q3LA 5ALLA 1KIAA 5A4FS 1ZM7A 3KE8A 1H2BA 5ALHA 1ZCJA 1RQ2A 3CMMA 1CIVA 4FYYA 2NO9A 2J4DA 2R0QC 3PNOA 4YRFA 5F7ZA 5JZMA 1V1RB 2W2OA 3WLEA 5I7FA 3CVOA 4AO7A 1E2MA 4JLJA 3B6JA 3FDXA 4WLFA 5DSTA 3ZDEA 1G4AE 2YS7A 1EGVB 1NWHA 1AUVA 2RI6A 2ZUWA 3EMVA 1AK9A 2AC2A 3FSGA 3CUWA 4JQYA 1XXHA 2J9GA 1SD5A 1N0IA 3CJRA 1XF9A 1L5QA 1OWLA 2X86A 1LVUA 2WILA 3NDIA 1XMQB 1Q17A 1U11A 2HMSA 2R97A 4KE7A 2A3RA 5BRAA 1WZIA 4XYMA 1WPGA 5C0OE 4M86A 1EGMB 3VHXA 4A10A 4NU0A 3QY9A 2YY6A 3KPWA 3QTTA 4PG4A 5DSXA 5DXAA 4NRDA 1EAYA 1MORA 5NLLA 4XOIA 4RD3A 4FCWA 4XWWA 4D97A 4JLPA 1CERA 4MR9B 3AI7A 1RHMA 3DLIA 1KI8A 4PRLA 1HFEL 2B5WA 1F0YA 1XMSA 2H06A 1YI8A 2QRGA 3T7JA 3UUWA 4EPXA 3T15A 3FZNA 2C7QA 1NNEA 4X8LA 1DUSA 2YN0A 3I9JA 4LX0A 5HFJA 4RDXA 4RENA 3L0OA 4WSOA 1E6MA 1L8OA 2OP0A 3GFOA 4TS9A 3DLBA 2G17A 2QMHA 3KCQA 4YJHA 3SMQA 4X66B 3OZWA 1CCWA 4J3JA 1B6GA 3CF4G 3DVRX 1IZ7A 3D3WA 1ID8A 3OJOA 1KOJA 3OT5A 3CH6A 2FZGA 2Z2IA 3R7SA 3HUFA 3UWDA 1MPTA 3PIIA 1PNVA 3SLGA 1IDOA 1Z33A 3LQRA 4Q39A 2OOSA 3LUCA 3MQFA 4D8XA 4DM7A 4K88A 1RHQA 2J8ZA 4IFBA 4KGZA 4WCVA 3IDAA 4F56A 1N2CA 1QG2A 2AFIA 1T5BA 2VP6A 5FUBA 2I7CA 4AJOA 3ADDA 3TRKA 4DMUB 1N0WA 4XUGB 4EPRA 4A8JA 5HIJA 5LZ7A 4DA6A 3R6DA 4IKEA 1YU6A 4LWOA 2WU8A 4H7DA 4LNHA 3DPIA 4YMSA 1K27A 2XGGA 1HQYE 3MPUA 2XY4A 3B51X 1GZSA 5I01A 4CYMA 1AU9A 1NX9A 2DFTA 1WPRA 1J0EA 3LC7O 4ZU6X 5IVHA 1YIAA 4X97A 2B1JA 4AZSA 5D85A 4P3XA 3LHFA 4YCDA 2IW3A 4C4ZA 4CUZA 2NU8A 5M34A 3KSDO 1UEJA 4UD6A 4A26A 2VDPB 4MW9A 1TD9A 3PI7A 3QPWA 5TS2A 4CLRA 3GEDA 5IDXA 1Z16A 1A5BB 1Z74A 4F92B 1GRQA 2FVXA 3CM0A 1UM8A 2GNAA 4U39A 5LU9A 3S1AA 1VG8A 2PGJA 3OM8A 1C7ZA 1M72A 1IXRC 3B89A 1X7HA 1T36A 2O05A 4RL4A 4W6ZA 6ABPA 3JSAA 2QNBA 1YTLA 2E18A 2ZS7A 1L1FA 1IVYA 4EGFA 4QDXA 3TTUA 1X92A 1GKKA 1Z0KA 2QX9A 3LUFA 4OAOA 1VLVA 5B58C 3KTOA 2C07A 1ECJA 4N7MA 3HCEA 2LBPA 1MB4A 3HB7A 2I4LA 5JVDF 1CQIB 1B26A 3BJIC 1U0LA 4Q7JB 4TMXA 1E9DA 1UK6A 4BL5A 1MB3A 1DV2A 2WWXA 4LRUA 2CL7X 2VSOA 4UXJA 1EDDA 2FA9A 4C4PA 1LVGA 4ZU1X 2GA8A 3R6LA 4IIBA 1D3AA 1T2AA 1VPLA 1M6VA 1YQ9A 3KR2A 4D3ZA 2AK3A 4DXHA 4KXUA 4MS4A 2AHRA 3SD7A 3CG4A 4F9GA 2B8WA 2GKOA 4WZ6A 3LYAA 4Q9NA 5BN3A 1E2KA 1L5ZA 2JGLA 3K94A 1XC7A 3L02A 2B2CA 4TOIA 5KTSA 2R00A 3SHOA 2DBVO 1JDVA 1E8NA 2I2BA 2P9HA 2PMKA 3CZAA 3JASA 1H5UA 1NYLA 3M4NA 1OCEA 3OAAD 4L51A 1FFEA 5DX8A 4E4TA 4UE6A 4LJSA 1NJFA 4EY6A 4D3FA 4IAOA 5H82A 5LQRA 1C5KA 1XIVA 2L19A 3IKMB 4BGUA 1VIMA 2NNLD 1JKJA 1E5LA 4BB0A 1RXSA 5KVSA 5A04A 5JVDA 4BQPA 4B35A 4GX1A 1FSGA 1UBKS 5DLDA 3WGYA 4F5ZA 2ZM5A 4M8LA 5BUSA 1X6VA 2JLAA 2PGIA 2IXFA 2VHEA 4FR0A 5BWNA 5K7SA 1VC2A 5AM1A 4FS8A 5EMHA 1YMUA 2RGWA 4HWRA 5LP1A 2XW6A 5LLDA 1FF9A 2GYVA 1OY1A 4MYHA 2FG5A 3RS2A 1IM5A 4MS1A 3QVVA 1QH0A 5REQB 4DY6A 1NIJA 4MVJI 4ZO4A 3AUTA 1FX0B 3E2MA 4AYTA 4TV9F 4TS3A 3PIRA 3NNNA 5EJ8A 2ZIEA 1PR6A 3G9TA 3R8CA 4CHGA 2EP5A 3DWFA 4RTQA 2PT9A 4QOIA 3WS7A 3EZXA 1E69A 3BTSA 4KR9A 2PX5A 4HATA 3RQSA 4DVGA 1JHYA 1IEVA 1THGA 5JARA 1BEEA 3HFRA 3A9WA 4KN8A 3QMMA 3C3BA 5C5CA 3UXMA 4Z4EA 2C4NA 3NJ8A 2OECA 1ORIA 4BE7B 3B60A 4MUAA 2QEQA 5EQFA 4RHUA 1UDWA 4WKNA 5AFSA 1XZDA 1W85B 2EBUA 3H3JA 3K35A 2CJFA 5AJZA 3UANA 4ADSG 5KNBA 4IUDS 3H4TA 4YP1A 4RHXA 4FSDA 4TV9A 1Z37A 1OLUA 2JLRA 1OF1A 4NBWA 3VO8A 4RHFA 4BNTA 4YUAA 4I9GA 2PJZA 4ARVA 1A9OA 1J49A 2CB0A 4D42A 1QIMA 3FPHA 2MYTA 3G7SA 3OIFA 1CWUA 1KSHA 4XH9B 4ZXPA 2ZAGA 3Q9UA 2HHHB 3BD6A 3PA8A 4M55A 4EG0A 3RDPA 4N39A 4LBYA 1HZZC 2JEZA 2XVAA 3QMWA 4Q00A 5KTYA 3VNVA 3K5HA 4DFDA 2F7SA 3OHPA 1UPFA 1XZFA 2NVBA 2AN1A 4GQIA 3S99A 3VZCA 4ZOQI 1H3EA 1E0AA 3EPRA 1EP9A 2NX2A 4BAUA 4RF4A 5DW0A 5L3QB 2AK2A 2CMGA 1S3IA 2WPNA 5CJPA 3QLJA 3Q12A 4IP0A 3PXGA 2Q8NA 5LIPA 2W7TA 1D2AA 4H6XA 1U1IA 2V97A 3R5KA 2IF2A 3ZH9B 4M36A 4EW2A 2YZKA 5CGQB 1Y1RA 3EC7A 2DT5A 1OX6A 3DTVA 4K9NA 1ZHFA 1NW7A 1PJ3A 3FM9A 3NTXA 4J49A 2R2GA 3T0GA 4U9HS 3UH0A 1PFUA 4TZ0A 2DFDA 2VTKA 3FUUA 3D6FA 3H1BA 2O2SA 3KS9A 4IOJA 2PZMA 5EJGA 2FMFA 4K2AA 4BVGA 3ICOA 1NSFA 4KLAA 4P5DA 2P69A 2WVJA 4GMFA 4BXOA 4JLSA 2W8ZA 2BUCA 3PUJA 2HKIA 4CWAA 3OF3A 4D41A 4X65B 3F9RA 2XWBF 3AVVA 1TC1A 2YWFA 4RJJA 5DYNA 2BFMA 2EKPA 3LI2A 5J2UB 3S8EA 4O3FA 1T4DA 5DNYB 4OU5A 3R0IA 4ZO6A 2C2KA 4I9UA 3EXHB 2JLCA 3GA7A 4G0XA 4KK4A 2LGJA 1J5XA 1WXEA 2BKAA 4FCVA 4LYYA 4QNMA 5FWDA 5HS6A 1IU9A 5B6IA 3B53X 1E7RA 3WO0A 5C5IA 3LQ1A 1ADFA 1LI7A 2WNHA 4DEYA 3TRDA 1N2CE 4QEZA 1C0EA 2O14A 3F9CA 4UAJA 2ZJ6A 1NKSA 3FPLA 3I5YA 2I29A 3MWLA 2CVZA 3HFGA 3P27A 4HN9A 4JSTA 1GNLA 5AQEA 4G07A 1BOFA 3FA2A 4R2WA 2OV4A 2BGRA 3OZFA 3GN2A 1AIPA 1SZDA 4I08A 1PNOA 5ALTA 4DPKA 3LQ2A 4NG4A 5AW4A 2CV0A 2BHSA 1LX6A 1KZ7B 1T43A 4QHYA 5ELXA 4XCXA 2W0SA 1G8GA 5B12A 1O77A 4E7OA 2AXQA 3DP9A 4NX2A 1BGVA 1JIXA 2P9EA 2CDNA 4WD3A 2DLNA 4PO9A 4DA9A 4M83A 1FDUA 1YBFA 4OYYA 3E7WA 3BWDD 2IXBA 2VHQA 4KO1S 5LMUB 2HBYA 2QA5A 2ZR0A 5F4ZA 1MDBA 2J46A 2REBA 2YV5A 4YN3A 4DWWA 3RJ9A 1E1RA 2X19A 2EU8A 5A4AA 2EWMA 3ZHRA 1GSIA 2KBEA 3SM9A 2F48A 4QTZA 3F67A 4FYXA 2J67A 4JNCA 1OX5A 1EG2A 5C4GB 1SUWA 1P7CA 3CX3A 5KI6A 1YH3A 2B3DA 2IV2X 2PKEA 2VSNA 1C7QA 3I2IA 4FJ1A 3WGHA 4CKEA 2ISCA 4DJTA 5JXJA 1CUYA 1YVUA 1IBLB 1V2HE 2A5JA 3P19A 4GPD1 1UJ2A 5HQJA 2QN8A 1Z7WA 3W8EA 5CDHA 10MHA 4GGMX 4TTQA 5J63A 1SR8A 2IY8A 3IPYA 1YR6A 2B20A 3D0RA 2PZ8A 4TWZA 1OX4A 5LXTF 3IE1A 4IDCA 4U2BA 3P9SA 2H9AA 4KIFA 1NASA 1XJ0A 4TKMA 2E7ZA 1ZL2A 4CCWA 5HKLA 2CFTA 4FN5A 1IB6A 2GOYA 2PBFA 4XFJA 5TEWA 4NE2A 4WCFC 3ZVRA 1W9HA 1IXYA 1Q1NA 4MWEA 4PRKA 3TUJC 4BCBA 4F2PA 2DPMA 5TVGA 1DI0A 4IBOA 4ENQA 1VSQA 3HBJA 1XEXA 4LQDA 4QC2A 4JS0A 3H42B 4O59O 4LFCB 3OOJA 3ECSA 1PU2A 4FW9A 3RIEA 3T06B 3T5DA 1KO5A 1NP6A 2G28A 3GRYA 2JHPA 4MGKR 1U1EA 4FD2A 4YJ3F 2E9SA 4EW1A 5IXYA 3U4QA 3O95A 3MILA 2FCAA 4G8JA 2CJYA 4JYPA 1PUJA 1UPCA 5JXWA 1JQ5A 2CCGA 3MAGA 5JH7F 4KE9A 2VHJA 3MWJA 1OSNA 1Q0SA 1AKNA 4NDAA 3R9IA 1MEEA 2QM7A 5FA5A 1XPOA 4KXMA 4RHTA 3LQYA 2ZVDA 4R3NA 4QQRA 3R40A 2GEUA 1K9SA 4M0UA 4MLDA 1H5NA 1LRJA 1F4LA 5EKXA 5FORA 4FEEA 3EPHA 3EQ2A 3VU9B 4EHLA 1QP8A 4WESB 4RTSA 5TLSA 1Y42X 5IKPA 1D2MA 4FMDF 3HE3A 2A9KA 1H2XA 1DBSA 2JLBA 3DKIA 3PF9A 3TQIA 4KUGA 4Y67A 2G04A 4EVSA 4BNGA 4LFAB 1YS4A 2J4FA 3EGXB 1JXMA 3EZGA 3OJEA 4GMDA 4YJ3A 1GL7A 2ZT6A 4LA4A 3W1VA 3VZSA 1PTJA 2DY0A 3CLSC 1K92A 1PS0A 3DBLB 3ND6A 1F12A 2IIPA 5JSUA 3MUEA 2I2AA 1KORA 2O8FA 3AESB 5HIIA 2OO3A 1OHHD 2H00A 3TVTA 1VZ3A 5E7QA 5AW5A 3WP0A 5JH7A 3M5DA 3T1OA 2C54A 4C4YA 2CEKA 2XQIA 4GQBA 3WQHA 3F7TA 3FJ1A 3SQMA 4YUWA 1VHLA 2GRAA 3ACCA 4NR0A 3I04A 4B6RA 5FT9A 2ZUEA 4DE5A 2IZ0A 1HDYA 2DULA 2W9XA 1G41A 1B7GO 1SCBA 5EEGA 4FB4A 1EM8B 2DECA 2XPCA 4GDMA 1SRRA 1SQFA 2BEVA 2IIBA 1VQ1A 3AP1A 5A5FA 2HK6A 1ZJ4A 2I22A 1QNFA 2JGEA 3K4PA 4II3A 4G1UC 3CCCA 4K7JA 3LPNA 4LZZA 2YWJA 3L01A 1QZUA 1E2JA 2OL4A 3VTZA 3GGOA 4BEJA 4E5MA 2EKDA 2A9RA 2XJ4A 3NVKI 4K81B 1XCJA 5C7YA 2YYZA 4MUIA 1HQDA 3E22A 1BX1A 1DC3A 2W6JD 3IUQA 5J3JA 1HYBA 1D2CA 5C53B 1QQAA 2BFOA 5AKZA 4AT1A 4LGCA 3DLHA 4C7OB 1UBTS 3CUUA 1WZUA 2V65A 3N2EA 4WFJA 2QMUA 3WB2A 3H84A 3HZZA 2QZJA 5KC9A 1EFAA 4H59A 1T0BA 1ZH4A 2IP2A 2N47A 3BRSA 3HI6A 3BVPA 3AU8A 2AC4A 3PDJA 1SPXA 3QQ5A 2WIGA 4LCBA 2JI6A 4KQFA 1Q11A 2AEEA 3O2QB 4JP3A 3KL2A 4BEVA 4D3DA 4F5YA 3H11B 3QF7A 1UOEA 4FFRA 4UPDA 2CC2A 1JR3E 3K8ZA 4UBIA 4URZR 5DO9A 4BQQA 2G4VA 2RDMA 3EIUA 2HHCA 1JFLA 5A0TA 3IBFA 4MV6A 1PGQA 3ZWQA 4OFZA 3JRWA 5FOTA 5IN5A 1EE1A 1EUQA 3JWHA 3HDTA 2PQ0A 1I9GA 1DPGA 1NQWA 2FW9A 3L6OO 2HD4A 1XHEA 5BMVB 2O8CA 1P0MA 4Q18A 1TCAA 5ELLA 1TAGA 3G9ZA 4ZKEA 4EZEA 1AKYA 4JI3B 4DSOA 3OFSA 4L72A 1LPOA 2HPAA 3RT7A 2GBCA 1LUAA 2RGXA 2YN4A 3CUEF 3W2TA 3TM5A 1N0HA 1WDKA 1XF1A 5T4BA 2R6AA 5LZ4A 1WZCA 1CETA 2IUEA 3DP7A 3DZBA 3E84A 2EXXA 5E6SA 3IOBA 3TQRA 3UYKA 5DT9A 2GBGA 3GR6A 3F78A 4FLMA 2AQ8A 4EG4A 3FUCA 4BE4A 1ISJA 1FSSA 1ZXXA 4DCOA 1J0BA 4IQ0A 4CM8A 4UEWA 4UNRA 5BNWA 5DHAA 3F73A 3WJ1A 1QOZA 1CF2O 1X1DA 3NHKA 4O4HF 5FPYA 3ZJ5A 5LSAA 1QPZA 3I62A 3DEAA 5JLAA 4P08A 5BN4B 1M0WA 4TKVA 2ASEA 4CMJA 5KX5B 2P5UA 2HMAA 4KQHA 2QRVA 4GR4A 1VBFA 5JISA 5HTOA 2VTBB 3PEVA 1ZPDA 4OB6A 2I9KA 4Q4AB 1X7DA 3HJAA 4HI0E 1E3TA 4KE6A 4KWIA 4WKBA 2IYSA 4RULA 1NYRA 1QWOA 4HPXB 1BC5A 3QLVC 4X24A 1W0KA 3H16A 3NGXA 3ZD6A 3WZLA 4P7KA 3QVXA 1XRJA 1HEUA 1A5AB 2V3VA 3EODA 4D26A 4M1EA 3X1DA 3QPBA 1M0EA 2G5PA 3LDUA 4TLDA 1P3Y1 1CE8B 4G8BA 4KFCA 4O4HA 2H5JA 4F2HA 5B2ZA 3KQQA 3OOEA 1YRBA 1P4AA 2HDNB 3NWEA 4OMDA 2O8BB 1UDRA 1CNFA 3DW3X 4CM5A 2XZOA 1RYZA 4BPBA 2B9VA 2UXCB 1MT3A 1U0OC 3KB1A 3BFJA 4UMDA 4CM9D 3V2GA 1ZISA 4C7MA 3ZCTA 4CMEC 3M6WA 2F9FA 1DJLA 1J9GA 3GPDG 4JROA 1FUUA 3QVWA 4CL3A 2G83A 1D09A 1H4SA 1CP2A 5J58A 4G0OA 521PA 4MDEA 1G1MA 5EGNA 4AJJA 2Z43A 1UBNA 2Q2OA 3D7LA 1J0CA 5F9MA 5A4KA 1K89A 2GN4A 2JZCA 1X9HA 2G76A 4R1LA 3E0XA 5HBRA 1P5JA 1MR3F 3T3PB 3K70C 3QEAZ 2HU2A 3HM2A 4TGLA 3L05A 1CIJA 1MC1A 1GSAA 1PHRA 3HEAA 3PGA1 4G1CA 3URMA 2O2DA 4OYRA 1ZI8A 2ZVQX 4CFSA 3V80A 4PC6A 2GWRA 3Q3GE 1Y6GA 3RYFB 2J3MA 1H6AA 4WCFB 4YJGB 3W3AH 1JEJA 4OQPA 1TM1E 4EY7A 1XU4A 3LXXA 3GJ3A 2R6HA 1H1LA 2COEA 2JLSA 2MINA 3PFNA 4R83A 1QP0A 4EP1A 5SZKB 2H2HA 1EJ2A 2AFHE 2H5IA 2ZRLA 2GAJA 2QZ9A 4LMAA 2XDAA 3LK6A 2ECPA 4B3SB 3PUYA 2C5SA 2DF8A 2ZYDA 3EXEB 4HDAA 4EMTA 4F7WA 1GQFA 1XCPA 1FY2A 1QGYA 1U9CA 3NB0A 1G4UR 4IWNA 4E6EA 2ANBA 3IOCA 2WT8A 4EDFA 2OCKA 2HA3A 4HEQA 1E1NA 3ABSB 1OA1A 4P34A 3LBYA 3TL2A 3ZXIA 1U28C 4Z4FA 1C0IA 2IP4A 1ZWKA 3B6EA 3TECE 1KL7A 1K5HA 3ZDCA 2NWQA 3KLMX 3NBZC 3PS9A 5GZ3A 1AS2A 1CZUA 1NBMA 4ND3A 5HMLA 5LZ8A 1VL5A 2BGTA 3E27A 4E07A 3ZDDA 1KQNA 3B1XA 1JAXA 3PU6A 2W4MA 3I92A 1I3MA 5CAEB 3VVCA 1NUTA 4U3JB 1KP3A 1RAGA 1Y8RB 2C83A 4IFEA 4KKVA 2RKOA 1QIKA 1YS6A 2YV2A 1RLIA 4DIBA 3HM9A 3I3SR 1WDTA 1YFZA 3VPDA 1BIFA 4C0QC 4EATA 4UNPA 4BO6A 1NY5A 4EAQA 1QYVA 4QT0A 3QMVA 1Z26A 3OECA 3QKSA 4Y0NA 4JODA 3S29A 3W2HA 1G42A 4NFYA 4K87A 4QEKA 3RIMA 3G0HA 5EC8A 1WUHS 1WDLA 4IS3A 5JPCA 1TOAA 4EG3A 4LY6A 4C5AA 3R3YA 5AW0A 3UAYA 5AKJA 3R3VA 4US1R 1K4KA 1X9IA 4LW8A 4NDZA 1DWQA 4PANA 1DSSG 4RKWA 2PUCA 2H54A 4JYMA 1QTRA 1RYHA 4X7MA 5E4YA 2ID8A 5LA6B 1INLA 4M9QA 4E5YA 4JB8A 1CZKA 1O5TA 5IF3A 3T95A 1D6SA 1Q0ZA 2HA5A 2IYTA 4L2IB 1DELA 3KQNA 1BSVA 4NZPA 4RETA 4X84A 4AIRA 3AU9A 4CHTA 5AVKA 1MOSA 5K2MA 5KWVA 4B09A 3L07A 5C32A 1Q0UA 3T5TA 2QTAA 3P94A 1HE1C 2MMGA 4Q6BA 4K2HA 2YNMA 3VSEA 2XUKA 2AR9A 4V03A 4C08A 2XIJA 1BXZA 2WA1A 3Q2KA 5CT6A 1HL3A 4PRZA 1RXUA 1Y7TA 1VGQA 3WRWA 1BHJA 1Z17A 3Q3VA 5CLLA 5JCZA 2VDJA 4I14A 3HO8A 3ZGZA 3NVAA 4FHGA 4EX6A 1ZGAA 2XUZA 1HLDA 3OTQA 2C0PA 2O5EA 3RWMB 4RSHA 5ESRA 4L3OA 5E7IA 2GN0A 4FCCA 4Q7MB 3T7CA 1IUOA 2RG1A 2HUNA 3W04A 1WTCA 4EBFA 3EH2A 4HEA6 4M89A 1ZM4A 1DOAA 3OTHA 4Q1AA 1XZAA 4IJUA 4A36A 3IVAA 3RC2A 2QLMA 2SECE 3KOUA 3MD9A 5A9TA 3OQMA 3WYGA 3IXMA 4D9BA 2J5KA 3QPDA 1Q7TA 1AKEA 1Z0AA 1RPNA 3LX5A 1U2ZA 1V5GA 2XB6A 4G37A 4BX8A 4XYLA 3TGPA 2PL1A 2XB9A 3PG5A 4ASUD 4OLBA 2DU8A 1T5OA 3UK0A 5AM3A 1TVKB 1NUQA 1Q57A 3LA8A 1JU3A 2A88A 5FFNA 1CUVA 1MC5A 5G0VA 1ZD2P 5BXQC 4DARA 3GEMA 2GM3A 5F64A 1ZIYA 4I8IA 4NVRA 3JD1A 4OI4A 3RBXA 4FX5A 1XZNA 2FCRA 3F6BX 3U40A 5ILQA 3AFMA 2G77B 1M5RA 3K9QO 1WX1A 4RXTA 1YZFA 2YVUA 3SR0A 1KEUA 1G5FA 5AOCA 3S1AB 5JZOA 3LW7A 3I42A 1NF2A 1RBYA 1Y9ZA 5D5QA 5L53A 3S8MA 2R48A 2EEPA 2WYIA 2BJVA 3E5NA 3MWFA 4S1OA 2I6GA 3ROMA 2XB4A 4JI1B 3EGDB 4K1XA 1PWHA 4FOPA 2XCSB 2WHPB 3ICPA 3HNOA 2XOKA 5ERGB 5T3UA 1ZHHA 3BMXA 3O8RA 4A2WA 2FFJA 3ET4A 2VNJA 1D0VA 2OV1A 2FFAA 2RH5A 3HSYA 4FWTA 2W2KB 4D4MA 2Q5EA 1A50B 5HYVA 5A0VA 3D0KA 3FW1A 2P65A 3GYBA 3AVOA 5D84A 4PV7A 5KTKA 1N0VC 3MTQA 1YCFA 2AN4A 1Z83A 4FEYA 2ILTA 2WZBA 1RQ7A 1NVXQ 1UMDA 3NBAA 1M0SA 4LC0A 4MS4B 3T7KA 4G67A 1RVV1 1VCOA 3OQIA 4YWJA 5E7JA 4ZAXA 5JAZA 1F2VA 2HQSA 1PJZA 5HXAA 1VLMA 1IXZA 3DBIA 2O0HA 4LHYA 1NLUA 4J7XA 4C7JA 4NMMA 3UT0A 3IDQA 1HOXA 1QYRA 1H6CA 4FDMA 4K8OA 4BLSA 1QGUB 2J33A 3DAHA 3NTUA 2Z1DA 5EMMA 4P4TA 1GPYA 4INZA 4OHOA 3AJ9A 1JNXX 3NVDA 4XB6B 4JYZA 3RU9A 3K70B 4OA5A 1KIMA 1KPIA 1UKBA 2M6SA 3O4VA 4ZVUA 4QT4A 3SQXA 3KPUA 3QWHA 4QUHA 3GAMA 4KJZA 1P9NA 1JA0A 5IAEA 1ENYA 4JZKA 4CV3A 4PXSA 4JBIA 4A23A 2R2AA 2PGLA 4R8MA 1ESNA 1II8B 4U6SA 1TQ2A 2BFPA 2XYRA 3AZOA 2VT6A 4X62B 1OH6A 3HK2A 2XUIA 1QMGA 4N0EA 4XUEA 4E4YA 1WHTA 3WL6A 4MEJA 4D92A 1P0IA 2CDAA 3ICQB 1BN7A 3BQ9A 1GTMA 3SK0A 2KPOA 2JIDA 3RUAA 1KJQA 1WV0A 5EP2A 4HMQA 2ZJYA 6ADHA 4IEFB 4F4UA 4QUDA 1N1DA 1FFCA 1EPUA 2WF5A 1FYEA 2I7DA 4ER7A 1XZHA 4KVZA 1XHFA 2ORYA 3OCXA 4NCJA 3IMCA 1R37A 2AB0A 2ZIWB 2ZQYA 4X5OA 5KCMA 4F71A 4Y2YA 1YOVA 2LV8A 1IULA 1U7PA 2FEMA 3JQFA 3ZK7A 1RS0A 4C4SA 4F12A 5EUBA 3C3KA 3A1UA 1PJQA 3WQBA 1HPLA 1WXDA 3HVHA 2XGOA 3M8KA 3JYPA 1A7KA 1L5YA 1W48A 3I6YA 3KO8A 3X1JA 1PT6A 2FSSA 1E32A 3EH1A 1OI7A 4NJEA 1X1BA 4WZBA 3TS1A 2ZRIA 3AEUA 3L1JA 3X1MA 1CR1A 1UDBA 1H6DA 1JH8A 1DRWA 4MP8A 3AUUA 3OFKA 1IONA 3IYLW 3U9SA 1ZM9A 2JVJA 3F5FA 4HS4A 4YC7A 4IO0A 4AMUA 5K01A 3EDOA 3IT3A 3OPYA 3T3OA 3G02A 4ZAZA 3K9LA 2OFOA 4MW4A 2HU5A 4EB6B 4M88A 721PA 4WIAA 3N59A 5JCOC 3K4HA 4HPWA 3OLCX 5AW8A 5I51A 1KHTA 4GRAA 2ZI9A 4X71A 1YL5A 3I4CA 5EE3A 4JC5A 4Z2YA 2JAQA 1Y9EA 3BX1A 5KYWB 3A05A 5BURA 1JZQA 3N2NA 2VOJA 2FAXA 4L8GA 3O84A 2NZWA 4DRXB 1V8BA 4H4CA 4I4TB 5LDHA 4GFDA 1NKVA 4W8GA 2O5CA 2HC9A 3DFKA 2FMHA 2OHXA 1J2YA 2OCLA 2XRFA 4JX8A 3KJNA 2FQWA 4X90A 2PWBA 2EDCA 4OK6A 4LOKA 1U0JA 5DZSA 1NF9A 4PAWA 1E1CB 1E9SA 4Q47A 4M8NE 1U04A 1UBLS 3GYGA 4CF6A 5AXDA 2RHJA 5PGMA 5GJBA 3CX6A 2GO1A 4K9MA 2VK1A 4MW2A 1C80A 5I9SA 3RVJA 1NVMB 4IJQA 4U7HA 3BRWA 2PN1A 5HF8A 2GZDA 1U3GA 4HTFB 5A7GA 2FEOA 1YK0A 2BYTA 4WI1A 2PTHA 4D45A 4JT8A 1ZONA 5JY6A 1B8UA 3SXUA 2B4TO 3QX8A 2ZTLA 3N6RA 4MUGA 3INYA 3HYNA 4M1QA 3T4UA 5CPBA 1Y6QA 5B3AA 3ZVLA 2Q5CA 1IJKA 1JLHA 4C4OA 3RCBA 1GG2A 4IVNA 1AC5A 1A95A 3BJZA 3SQOA 3UUFA 3PGKA 1BMFD 4V0OA 4BCCA 1B1CA 3ITEA 4AO8A 2GJ8A 5LBTA 4NMLA 5EWMA 1AQYA 1P3DA 4PZPA 4AWXA 3O0TA 1RKBA 1ZFNA 1K66A 3E3MA 4HGQA 3EFEA 2W2TA 3WAJA 3DMDA 1N2IA 2WWWA 3K0CC 4FGUA 2UUBB 2HDWA 2QYTA 3KXKA