1DS6A

Crystal structure of a rac-rhogdi complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
181
structure length
181
Chain Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Rac-RhoGDI complex and the structural basis for the regulation of Rho proteins by RhoGDI.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 2
total genus 63
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2000-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ds6A00
4JLPA 4Q7LA 1JAIA 4DBLC 4MRNA 3EIHA 2EYQA 1ZP6A 4IDQA 3E2IA 4ABYA 5KSYA 2WKPA 1E2JA 5JS7A 3LQQA 1N2CE 4JS0A 5FPHA 2ZXUA 3EAQA 3AKEA 1P72A 1E9FA 2J0QA 4FMCF 3GJ4A 3NVAA 3CRVA 1XPRA 2V8OA 1MKYA 5BQ5A 2VH5R 2ZI5A 3N70A 821PA 5KSZA 3DDCA 4C9BA 1R5BA 3CKLA 5BW8A 3QEOA 2O5VA 5CM9C 5JJIA 3TSZA 3WRXC 1EK0A 3T5DA 1XB2A 4TZ0A 2HLDD 3W3AA 3ZS8A 1NRJB 5CIQA 1NY5A 2FSFA 2VP2A 4GMXA 3NEYA 1VG1A 2FH5B 4RCYA 4ARZA 1G3RA 3FYHA 2JLSA 2QQ0A 2XOKD 3CX8A 4YDHB 1NMXA 4URXR 5AWFC 2ZS8A 1YHNA 1Z6XA 2AKYA 4S2EA 5EP2A 4IOLA 2AX4A 2QEQA 3WNCA 2RHDA 4HUTA 2RGCA 3LX5A 1FQKA 1JEEA 1Z5ZA 2FFAA 1XMVA 4DSNA 4B3DA 3JVUA 2JJ8A 3VR4A 1Q12A 2RGNC 3PUYA 4ZKDA 1XTJA 2ZE6A 5SZIA 2D62A 2VP9A 5DIFA 2H5EA 4HUQB 1WXQA 2JCSA 2FPKA 4AIIA 3L82B 3EC1A 3GLFB 5AJWA 3ZJYA 1E2PA 4NP6A 4G5OA 1DADA 1U0HC 2KWIA 4Q4HB 2WPDD 3IBGA 1HE8B 3OZXA 4FIDA 2EWVA 3OEHA 1JJVA 1GVNB 1SXJD 4HB3A 4KVAA 1U0JA 4I1VA 3GLIB 5HE9A 3U3RA 1BMFD 3UATA 5JI3E 2YYZA 2JASA 1E2GA 4URWR 3B9QA 1U8AA 4BFUA 2CL7X 4JLNA 3AF1A 1U90A 3R7WB 3CF6R 3AV0B 4D0GA 2DWPA 5C4MA 4DCUA 2V9PA 3KDSE 2JJ2D 2W00A 4EQ6A 4GDFA 4LCBA 1VECA 4IHQA 1Z0JA 2YC2C 4D4LA 4DLWA 1JR3E 1ZU5A 3PXGA 1IOZA 1ZBDA 4RSGA 4D81A 3Q3JB 3UWKA 1KDTA 2BM1A 1CRQA 2QE7A 1NN0A 3KJHA 1S9DA 4DDVA 3CLVA 1KMHB 4PPFA 3U7GA 1E1QA 4JLVA 4U5XA 1E0SA 2HDNB 4QBIA 5LB2A 5JHGB 4CEJB 3U5ZB 2J46A 5GJWC 3RS2A 2OXCA 4BLPA 2BC9A 4Q9KA 5FOTA 3H84A 1GAJA 2HJGA 1I2DA 1OIWA 3VFDA 1GSIA 2Z4SA 1UEJA 1P2VA 4PANA 3IDQA 2C77A 4B75A 2P6UA 1KGDA 1IY2A 4R9UC 4C4PA 1Z29A 1EESA 2GRJA 1RC8A 2DFKB 1KJYA 1MO4A 3HDTA 2GA8A 1DBSA 3C8UA 1DAGA 3CNOA 5FBVB 3OHMA 4WXRA 1SKYB 2WMNB 3UXMA 2OZEA 3P26A 4F4JA 2F3TA 4E03A 4V0LA 2GDJA 5H70A 3TSOA 2Q21A 5JWOA 3EX7C 1AQUA 1V43A 2XJ9A 2D3WA 2Q9CA 2ZI4A 1AGPA 1QDEA 5KDDA 1FNMA 1E1RA 1W0JA 2AXNA 2QPTA 4NH0A 2O8BA 1HH4A 4CIDA 5FBQB 3ND9A 1SQ5A 1IN8A 2VHJA 1W5TA 4M0LA 2DB3A 1T3LA 2QRZA 2VHCA 3TNFA 1TMKA 4ACAA 1R6BX 3T15A 3NDBB 2GCOB 1Z06A 5K8UA 2YOHA 1I4DD 1T9HA 5GJBA 4MITA 3TUIC 2C95A 4QG7A 2F1JA 4LUCA 4M4SA 3SU8A 1M74A 5KNDA 1N6PA 5SZJA 1G18A 3E5HA 5EUMA 2QAGC 1X6VA 1EXMA 1T91A 1W5SA 1S96A 1DAFA 2QY9A 3OF5A 3BORA 3U4QA 3VNUA 1DAEA 1G5RA 4GBMA 1K5GA 3NC0C 4AY2A 1R2QA 1ZCAA 3I1FA 4TTPA 3KQLA 1ZC4A 1T0HB 4ZCLA 3FWYA 3BFXA 5D3MB 3UKDA 2WBLC 4EPYA 3H1TA 4EFNA 1Q1BA 1NBMA 1YRAA 2FZLA 4AWXA 1EX7A 2P5TB 3K9HA 4BASA 1G8GA 1Q1QA 2BVNA 5KU1A 4LJ5A 4EFLA 1GNRA 3HU3A 4LYAA 1YZUA 3BS4A 1D9XA 1E94E 2BKUA 4EIWA 2AFHE 2R8RA 1KO1A 3LXXA 1E2NA 2EYUA 1XF9A 3QBVA 2QENA 4W5WA 3KQHA 5C46F 3F8TA 4OI2A 2RGNA 3SQWA 1KTVA 2W6JA 4AKIA 4MYUA 4C3ZA 3L8YA 3HR8A 4TT3A 4X8MA 2ZRBA 2GJKA 3CF0A 3WYGA 1I4TD 3D31A 2UVQA 4PO9A 1XNJA 2NPFA 3PITA 1QVAA 5B57C 1YZQA 1HT1E 2B21A 4I99A 4RZXA 3TW4A 2XZLA 3VR6A 1R8QA 3FVQA 1N25A 2PEZA 5LB4A 2QTHA 4P4SA 4YMSA 3LLMA 3FOZA 1GILA 2VHQA 3A8TA 1A2KC 3ZD7A 1LF5A 1VTKA 2Q3MA 3AUXA 3ZVNA 2ERXA 2AK3A 3T1VA 3SFVA 2A9KA 2OCAA 5LD2C 1L4YA 1Z6TA 3NXSA 3Q7PA 3KUCA 4RCZA 4Q19A 3U3KA 3CR8A 2C99A 2YKGA 1W49A 2P5SA 4WZBE 3QXCA 3IPYA 2HCBA 5FBLB 2RKOA 3LBNA 3W90A 5FUYA 1DAHA 3B5JA 3EZ7A 3CIOA 4ZO4A 2PL3A 3HPRA 5C4GB 1YZLA 5A5GA 3NG1A 4MRPA 3NC1C 4M9ZA 4AKHA 4OJQA 4QJ5A 3BH6A 1XPOA 1PLKA 1OV4A 5FUVA 4LHVA 4OQMA 1BS1A 2O8EB 1F2TB 2FA9A 4DIEA 2J59A 1Q3HA 1GL6A 3EWSA 3ZVRA 4G5SA 2P6RA 4JLAA 2HV8A 3B2EA 1R0YA 3GQBA 2C78A 2IWRA 4V02A 4XSHA 1KK1A 4RKEA 1MO5A 4HI0E 3EIQA 2EFCB 1L7VC 2BJWA 3ND8A 4C30A 1S1CA 3THOA 4YXWD 1K8RA 5M04A 2FGJA 2WJJA 4L9SA 5D3QA 3R8CA 4TYQA 3I72A 1QHYA 4Q4AA 5EXTA 1N6KA 3EZ9A 4MUAA 3SBDA 3OIYA 4BEJA 1KI1A 1GNQA 3K09C 2ATXA 2NOAA 3UIEA 1XEFA 3QPVA 4GP6A 4Q21A 2J9RA 3K53A 1XZQA 3GLGE 1ZM9A 2ZROA 2QM7A 4XH9B 4C0HA 1CKEA 1NVVR 3D7MA 4GZMA 3HYRA 2F7SA 1CJKC 3RNLA 2FX3A 2P67A 3RSLA 1EFUA 5FUXA 3LO5A 3W8NA 4LI0A 4NL4H 2V7QD 4XJXA 4GI7A 3GJ0A 5DI3A 5KYKA 5CJ2A 2JGNA 4CEIA 4AYXA 2J0SA 4HAYA 4DLSA 4DDUA 2V6IA 4M2LA 5FR2A 4Q7KA 2F3RA 4B33A 3BRWD 3THWA 1S0UA 1KI4A 1TF2A 1TPZA 5AK0A 4DLRA 3EPJA 1OIVA 2PEYA 2REOA 2OESA 3P20A 5JS8A 1ZINA 3PEWA 4RFSB 3P32A 5JRJA 1FL9A 4TQUS 1KI8A 2ZJYA 1F48A 3DL0A 4IKEA 1OPXA 1IJEA 3ZH9B 3QPWA 4HZIA 4BFXA 5JECA 3CWZA 3K70D 3X2SA 2G88A 3J81k 1XTSA 2QPOA 4Q7JB 2ORIA 3CX7A 2CXXA 1KNQA 2AXPA 1HE1C 2CNWD 3QY0A 3R9WA 1OFIA 4YMTA 5E3HA 4IEIA 4FCVA 4NYJR 2E1RA 3LQRA 3IEVA 4PTLA 4YC7A 3QUSA 1U9IC 3UANA 1E69A 2IUTA 5KOYA 3CNLA 4P4SB 2CK3D 3AGQA 5EP4A 2ZUBA 4CRWB 2C04A 5CDFE 3DZ8A 4P0TA 1E0JA 5EXPA 2A5JA 3SI7A 1LNZA 5FPYA 4QBHA 1CR4A 2D06A 2UZIR 2OE2A 1UM8A 1N5LA 1QHHA 2QP9X 2R44A 4C0SA 1OHHA 4PO1A 1OFTA 3TMKA 4P3YA 1W47A 4DLUA 2J87A 1CU1A 5K8LA 1P4SA 2CLDX 4C0QC 3THWB 3THYB 2IYVA 2ZR0A 2HXYA 2WKQA 3JZAA 1SVOA 2BM0A 2XTNA 4Z1MA 4Q4AB 1CIPA 4KSBA 4DCNA 4EJSB 2IXFA 1CJUC 4LOAA 4PR0A 4LHWA 4BPBA 2B8WA 2C5LA 2VSXA 3MMPA 3KQUA 2QG6A 1EGAA 4NCNA 4V0ME 5L3QA 2WWGA 3AF4A 3CRMA 3WRYC 4AC9A 3NBYC 1W44A 3CUEF 1S8FA 4Q9JA 3RS4A 4DB4A 4PZYA 1KIMA 2WIAA 5FOUA 1E2MA 1YZTA 3OFND 3FKSA 2AL7A 2GNOA 4AYWA 1R5OA 4ESHA 4KU4A 2F55A 1IN5A 4CEHA 4TLCA 2Z5FA 3MWLA 3SJCA 4XWOA 3VU9A 4U00A 1DO0A 2N1BA 3QKRB 1ZM2A 1Z0AA 4EAQA 2EW1A 1KAGA 2WKRA 4W5JA 1KKMA 3K09A 1LFDB 3FGNA 1NNEA 3TAUA 2KE5A 1VKJA 2KB0A 2CEAA 4M1YA 3Q9LA 3PEVA 1KI3A 1G291 5F2EA 3AVXA 1ZNWA 4JL6A 1GRNA 2FPMA 1N5IA 1F6BA 2WWFA 4JLOA 4WOPA 1AQYA 2J7PA 2OFXA 4G5QA 1QG2A 3TVDA 1G3UA 2O8EA 1G16A 5CB8A 4LBZA 1X8LA 1O87A 5DI3B 3B60A 5DHFA 3IHWA 4JVSB 1O3YA 1UADA 4MYCA 1FX0B 3Q72A 1E6CA 3U6BA 2WOOA 1OXXK 2NO9A 3ADDA 1W1WA 3MJRA 4LGMA 1JB1A 4TQAA 1MO6A 1YR7A 1IBRA 2PBRA 5J5CA 2XZPA 3FHOA 1VG0B 4M1KA 4Q7MB 4BGDA 3I3SR 4FXPA 2VP4A 1T5LA 2GJ9A 3AP1A 1G1MA 1TU3A 1JI0A 1FPMA 1RE0A 4YMVA 3VKGA 1WA5A 3PENA 4JKYA 1W7AA 2JDID 2C98A 1XEWY 2NO6A 2QORA 2W2TA 1Z0KA 1H8EA 2XITA 2IA5A 5GADl 2GF9A 1CS4C 2FSIA 4B2PA 3L8ZA 2QSYA 3EC2A 1FZQA 1KI6B 2CVFA 5HZHA 1W36B 2Q3HA 4JSTA 2GESA 4LJ8A 3H4MA 3PUWA 4JLJA 1AZTA 1QHSA 1SXJC 2IYSA 2LWIA 3FDIA 3KB1A 1CJVC 3W34A 4Q9LA 4Z8YA 5EE1A 2CK3A 2F9LA 3QXSA 1WF3A 4CVNA 1XEXA 2YWEA 3V00A 1P9WA 1T5IA 3SR0A 3CZPA 2BEKA 3FMFA 4MA4A 3U6KA 2O8FA 1V5WA 4F92B 4K8OA 4LJ9A 4DSUA 3L0PA 5LPNA 2QMHA 1P2UA 2GCNA 4E07A 2YV5A 2BIFA 3W3ZB 5BN4A 3GMTA 3U44A 1D2EA 1MABA 2X2FA 2ZJZA 3WNDA 4TMKA 4LJYA 3LWNA 5F3WB 2IYZA 3ASYA 4BE7B 1Z0IA 2I1QA 3EIEA 4HB4A 1Z0FA 1Z63A 1NIPA 4A9AA 4EPWA 4OK6A 4OK3A 1SVSA 2ORWA 1W0KD 2V1XA 4XVUA 2EQBA 5J4KA 2ZSBA 3B1WA 5FBRB 1JBKA 4M9SA 3B9PA 2JATA 1JECA 4LYHA 4MKHA 4TL9A 3KL4A 1XFAA 2ZR7A 3CR7A 1LS6A 3IQXA 4LPKA 4N0EA 4TMTA 4D2IA 3LRPA 3B1XA 4FMDB 2PCLA 2WPDA 1II8A 2PJRA 3MWJA 4TLEA 3R9XA 1U2RA 2D4HA 3DEFA 3IPXA 5KDLA 2OBLA 3AUYA 3BFKA 1NL3A 1FMJA 1WE2A 1QHHB 3DM9B 5G40A 1RRCA 2XNDA 1BO6A 1KHTA 4C7OA 2VF7A 4TMWA 1SKQA 1TQ4A 1GRRA 1E9EA 5H68A 3X1WA 4V03A 2FSGA 4HLUA 4JSYA 4PFSA 2P0EA 4BZQA 4Q1BA 3HU2A 1W4BA 2GZAA 4HAXA 4O25A 4OHXA 3OAAA 4N0DA 1NSFA 1Q57A 2H1LA 3AH8A 3KTAB 1QVRA 4Q5IA 1RYFA 3VR1A 3VR3A 421PA 4QKQA 4G1UC 4HB0A 2HF8A 4UKDA 3U60B 1AS3A 4LBWA 2A5FA 3VR5A 3AKCA 4ZDKA 4A36A 1AJEA 3RYTC 2GEDA 3QKSB 5EE0A 3QKUA 2WAXA 4HUQA 1NLZA 2XX3A 4KFTA 4ILEA 2ZUDA 2JDIA 4IJMA 4KJZA 1KO8A 4FW9A 4NYIR 3O8RA 1PUJA 3PV0A 4XIGS 5JBQA 2J45A 4CYMA 1GZSA 2FNAA 1N6NA 1E98A 3IUYA 1ZUHA 2XJ4A 2ZSDA 4DCVA 2OT3B 2A7QA 2OUKA 2R6FA 2QBYA 4TYWA 1KSFX 3H86A 3RABA 4ZDIA 2IUUA 2A78A 3OE7A 4D80A 4GT1A 4ASUA 4A82A 4RD6A 1P6XA 1DEKA 3FB4A 5E4FA 4KBGA 3FTQA 2MSEB 2ZS7A 3KKMA 5KSPA 1J8YF 4O2RA 4HZUB 1P75A 1G7RA 2Z83A 4YDSA 2MSDB 1DVRA 1CTQA 3KXLA 1DAKA 4PSVA 4PZLA 2WWYA 1IAQA 3WXMA 1G3QA 1OW3B 2OEPA 3GP8A 2F43A 2PH1A 3VQTA 2Q9BA 5CLQA 3W6NA 2C2HA 4LK2A 2DY1A 1NJFA 4DDTA 2ODNA 3CO5A 4DUGD 5KUTA 5HKKA 1KSGA 3RWMB 2ONKA 3SYKA 5JHHB 4TLBA 3W6OA 3NH9A 4L5BA 1G5TA 1YR6A 2DR3A 1UEIA 2EFEB 2OILA 2SHKA 2WWXA 2IW3A 4Q4JB 3EASA 1G3IA 2AD5A 4YMWA 2X77A 3AVPA 4OK5A 3NH6A 1Z2CA 5KNCA 1WB9A 1R0ZA 1A4RA 3IILA 5FL7A 1KO7A 3NHAA 4C0AC 5FOXA 2QSZA 2G77B 3UG7A 1J2JA 2DCUA 3TBKA 4LZZA 1VDZA 4M21A 1GIAA 1P2SA 4Q66C 4Q1AA 3U7EB 4JL5A 4OQLA 4B34A 4AYTA 3U3JA 2WWWA 2IEZA 1XTQA 2DWQA 4UXJA 2B6HA 3U3MA 1S9HA 4U02A 1EFCA 2WJIA 1N5KA 3LVQE 1D9ZA 4BZPA 1N6OA 1L4UA 2RCNA 3BJIC 4HATA 3BK7A 2EWWA 1JR3D 3B1VA 2LKDA 4LRWA 1P61B 4HEJA 2A30A 3C4JA 1XEWX 2W83A 4B71A 4PXAA 3CH5A 1IQPA 3NBZC 2IYXA 2WSSA 2YJTD 1ZIOA 4AI6A 2GXAA 5JCZA 4QM6A 2OAQ1 3SDZA 1RRGA 2VP6A 4UNRA 3VTKA 1E99A 4MQBA 1SXJB 2Q9AA 3PIRA 1MH1A 2JIZA 1BYUA 1XMJA 3S1AA 4EKDA 1IN6A 3W5IA 4Z51A 4LHXA 4JVLA 1RRFA 2N42A 2YWGA 4NYJQ 1W36D 4DSOA 4Q4HA 3B13B 3RAPR 3W9YA 1J90A 1TX4B 2NPIA 4ARZB 4B47A 1OH5A 3C5CA 3C14C 2WZQA 4MGZR 4UNSA 3A37A 1UDXA 2CNWA 2ZITA 3CM0A 3ECCA 3ZVLA 4B3XA 2IBMA 5EE3A 4HAUA 5AUPB 1PUIA 3SN6A 3MAAC 5G3ZA 4FMCB 1JQJC 1G4UR 4Q1EA 3VMFA 5E7JA 3WMEA 3KXIA 721PA 3TQCA 1CRPA 1OIXA 3OE7D 3QXJA 4ON9A 1DPFA 1NN3A 2ATVA 2WWIA 5SZHB 1N0UA 1US8B 2R6CA 3FMPB 4XSGA 4MH0R 1G19A 4IOMA 2IYRA 4QOSA 5JJKA 1TADA 4Y0VA 5E7IA 2JA1A 1WMSA 3ZD6A 3SJAA 2CL6X 2ZYVX 1CXZA 1E1RD 2PLRA 1XJ0A 2VPPA 4Q9HA 4OQFA 4K81B 1TL7C 4EPXA 3LAWA 4YMUA 2P65A 2O8CB 2ODWA 5EQTA 1R8SA 1LS1A 4F7WA 4O3MA 3VKHA 1KSHA 4NHOA 3OEED 3TAHA 1QHIA 3U7HB 3TVTA 2QP4A 4JL8A 5IDVA 3SJZA 3QJYA 1FMLA 5FOSA 4GNKA 3ADCA 3E1SA 2VQSA 2E9SA 2ZI7A 4BLTA 2MMGA 2GVDC 2ZAMA 3CH4B 4G5RA 3X1DA 1M1YE 4O2LA 4MGIR 3QENA 1CR2A 5J4YA 1M2OB 3VU9B 1YVDA 3L0SA 3HPQA 1TTTA 1KJWA 2OCBA 1IN4A 2ZRIA 4B74A 2GJSA 2FFQA 4DT1B 1NBMD 5C18A 3B7GA 1F2TA 1FFHA 1H65A 3AF2A 4NPHA 2WICA 5DYGA 5LD2B 1T4GA 4EJSC 2HF9A 1TUIA 4PC1A 3QI2A 3RLFA 5FBWB 5BYKA 4WZ6A 3HWSA 2XXAA 4KVGA 1VHLA 3QG5A 3REFA 4E22A 4GZLA 2A5YB 1F2UB 1HEIA 3T35A 2ZQ5A 3EG5A 4U7DA 1LB1B 2QN6A 1Q0UA 3MSXA 3MUFA 1MR3F 4LYFA 4CDGA 5IRCD 2WHXA 1AKYA 4ZIRB 2IYLD 1CLUA 1UKEA 2W6IA 1J99A 4JLDA 3NHBA 5HCIA 2RAPA 4KV9A 4P4TA 3OIWA 1G7SA 4PHGA 1E2QA 2YC4C 4US1R 2XXAB 1NN5A 2Q3FA 1DG3A 2VO1A 4MRSA 1OF1A 4QJ4A 2ZRLA 4XWAA 2ONJA 4DHEA 4E5UA 4R2HA 3N2IA 4DWJA 2Q0HA 5JWHA 1G8HA 2O8DA 1PJRA 2VBCA 4KCGA 2XB4A 3K9LA 3VKWA 5H8WA 3WYAA 121PA 1ZMXA 2AFIE 1R5NA 1E2FA 4IVRA 1TNDA 1CJTC 2OLKA 1IXRC 5EUQB 5FI1B 1KOFA 5IT5A 3QEJA 1YZGA 4GL2A 4JYBA 3RC3A 1IXZA 4BQSA 4US0R 3B8HA 3DOFA 4L15A 1Z3IX 3WMGA 4A15A 3TUZC 3A4MA 3IIMA 4BLOA 1VMAA 2ASEA 4B3FX 1BKDR 2XNSA 2G6BA 4DCTA 1SVMA 3VX4A 4NCKA 3QNUA 4WA7A 3WYFA 1J8MF 1ZAKA 1IJFA 3BFVA 3FMIA 4PSKA 2RGXA 1D8TA 1N3BA 1T6NA 1EFTA 1XX6A 2PMDA 3AVUA 4EPVA 2QAGB 4G5GA 1E9DA 4QRHA 2BWJA 2BBOA 4JIMA 4WW0A 1DELA 4NE2A 2WJHA 1X1RA 3KUDA 221PA 2C9OA 5DE3A 1N6IA 3U61B 1XTKA 3AVWA 3FE2A 5JJLA 4OYHA 4US2R 5G3YA 4RD1A 5BN5A 2HJVA 5B30A 3BGWA 2C03A 2HUPA 3P1JA 4LJAA 4TMXA 1RPZA 2OG2A 4I1UA 4KI0A 4QBFA 1G6HA 4YXWA 1ZM7A 5CK4A 3NKVA 4LJ7A 4A1FA 3GLFA 1M7BA 1Q3TA 1JALA 3UMSA 4O0MA 1NBME 1W4RA 2ZAOA 1OH8A 3GJ6A 3ZQJA 1XDBA 3QSYA 2BMDA 1KY2A 1GG2A 1AKEA 1Z6GA 4DVGA 3EPKA 3B85A 1E0KA 1FTSA 4DSTA 4MDEA 4TYPA 2D7DA 2JJ1A 3WBJA 4CZ2A 2QZ4A 2RGBA 1GKUB 2W2XA 2R9VA 5JI2E 2VP0A 3KX2A 1S3SA 4GSYA 4B3BA 1J7KA 4DLYA 5AJXA 2QBYB 5BXQC 2GEVA 3GFTA 2NO0A 4OI0A 3UMFA 1KO5A 2O8DB 1BMFA 1BH2A 4PC2A 1JPJA 4TQ9A 3F0TA 1JJ7A 2FV8A 2OFWA 2J0VA 3K8YA 1T0JB 3DZDA 1Y63A 4IDOA 3NEJA 3GLHA 2R6GA 4HAZA 4WBSA 1GKIA 2ZI9A 2W6ID 4KHZA 1TAGA 1VCOA 2ZRMA 1NN1A 3JVVA 4TT3D 3BB3A 2QGZA 1E4YA 1ZW6A 3SC3A 3L0IB 4A6PA 3GCGA 4MDFA 5TB5A 4A8JB 1R7RA 3L43A 4OHYA 4ITRC 2NG1A 5F9HA 3LW8A 1Z0DA 1G9XA 4NCHA 5HPYB 1KMQA 2VTKA 2NMVA 2CHQA 4CEHB 2QGNA 1XXHB 2ZR9A 4QHYA 1RYHA 2AK2A 3V4RA 3MFYA 4TWZA 2OXRA 3BBPA 2IXEA 2B8TA 4XOIA 3AP2A 3NDPA 4RD3A 3LA6A 3GJ5A 4DLVA 3RRZA 1YZNA 3WBKA 1NY6A 4XVRA 1U0LA 2IUSA 3AGPA 3CPJB 4A2WA 3GJ8A 4CGZA 3E70C 2BMFA 5GJVC 1E9BA 2G3YA 2LCFA 4HLUC 1OXVA 1E79A 1M6NA 2YNMA 3GLHB 4LDJA 3EA0A 3M1IA 1KZGB 3OEEA 2ECKA 4FMDF 2CLSA 2AN9A 3R8FA 3QPUA 5CK5A 3TUJC 3SYNA 2QNRA 2BMJA 1D2NA 3BIFA 3GJ7A 3RVBA 3P27A 1UKVY 4RFVA 4Z1MD 1W36C 1KK2A 5UKDA 2BDTA 2CMKA 3HR7A 4A8JA 5HTKA 2J0UB 5B58C 3ZZTA 3OESA 4V0NA 5HR5A 2QPAA 3LBHA 3RSOA 2BCJQ 4KFUA 3PUXA 4V0MA 1A5TA 4I4LA 5FUWA 1OH6A 1ESMA 1RVDA 4QXAA 4KITB 4JT2A 5SZKB 3GLGA 1KNXA 4S35A 5TDHA 4NONA 5EP3A 3A58B 3R9IA 2Z4RA 1E96A 4IDNA 2CE2X 2NZ8A 4A4DA 1W2HA 3GJXC 3N2EA 3X1ZA 4C0LA 2IYWA 4PO8A 2WV9A 4BRWA 1UAAA 2ZJAA 3N5CA 4R7ZA 2ZJ2A 1XJCA 4GP7A 1OFHA 3CRQA 3SE0A 3SOPA 4ERNA 1OKKD 1ZUNB 4DRZA 4CF7A 4KYIB 3KQKA 2IK8A 4TL6A 2BBSA 1KK3A 1KKLA 1W46A 3BD9A 3FKSD 3K9NA 4Q1CA 2XSZD 4BLSA 4PC3A 4DLXA 1HYQA 1KAOA 4LBVA 1GFIA 2FF7A 1CEEA 2C9YA 4EPTA 2YINC 2FU5C 4MKGA 5CYOA 3K9GA 4PAMA 4YLGA 2RHMA 4URYR 1TF7A 4PPGA 4ZV4A 4DLTA 2FEOA 1RJ9A 3LNCA 4IXMA 4M1OA 1CP2A 1OT3A 2VHTA 5BN3A 1JR6A 2X1VA 2HT6A 4Q47A 3AB3A 2ZPTX 1W2GA 3KKOA 2VP5A 3KKPA 5L3SA 1GUAA 5EXSA 1Q1EA 3A1VA 3GEHA 1NVXQ 3CB4A 4HAVA 3QG1A 4KO8A 1E9SA 1TQDA 1Z07A 4BFZA 4QGHA 2NQ2C 4Q1FA 4V0KA 4BECA 2IXGA 1U9IA 3QKSA 1W4CA 3W5JA 1D6JA 1MOZA 2GJ8A 2HYDA 4K46A 3WNBA 2YZ2A 4BFYA 2PX3A 5FTKA 1J70A 4JJZA 1BYIA 1P2TA 4LJ4A 2GAOA 3IO3A 2HXSA 3R7WA 2IWHA 5FOWA 5CITA 4W5HA 4I1OA 4PC6A 3MCAA 5JEDA 5CLLA 4DZZA 5C1BA 4FMBB 1S4QA 3CONA 1KI9A 1NKSA 2VA8A 2X8AA 1VIYA 1Z8FA 1NVWQ 4PC7A 1G8FA 5CM8B 1FUUA 3SFZA 1G64A 1OFUX 1ZJ6A 2I4IA 4X8LA 4C2UA 1E9AA 2JEOA 1EWQA 2ODBA 2OSBA 3K0CA 2B7CA 3CWQA 1P9NA 1R10A 4D82A 4B6EA 1KZ7B 4Z8XA 4IXNA 4UNPA 5CB6A 3F3YA 3GEIA 4OQXA 4GOKA 1G8PA 3BE4A 1W0KA 3QF7A 4I81A 2EVWX 4GRAA 1EFHA 4KSCA 4UNQA 2EFDB 2WWHA 5G53C 2XTZA 1ELOA 5K8TA 1YE8A 2QUZA 4TYYA 2ZSAA 3A1UA 1JNYA 2BHRA 2ORVA 2PT7A 1F60A 3Q85A 3AM1A 2JJ1D 2VIIA 2PZEA 1DTSA 2XSZA 5EJEA 1II9A 2PX0A 2AD1A 3PUZA 4F93B 1K5DA 4AKEA 1I2MA 2ZRCA 1GP2A 4D4MA 2CCKA 3Q8XB 3SBEA 2O52A 3TW8B 1JQLB 4TL8A 3SHWA 2V4ZA 3T1OA 1DOAA 4YQFA 2JLYA 5CYPA 1RRPA 3GLIA 2XB2A 3LW7A 3LX8A 4PHFA 2IHBA 3WHLA 3X1XA 3OEHD 4FCWA 4IOKA 4DXAA 3TKLA 4UXHA 4H1VA 3RHFA 1RKBA 1W4AA 2FWRA 4NYIQ 3AP3A 1XTIA 4M9XA 3KJIA 3O47A 1MABB 2ZS9A 4A0FA 4WVFA 1VIAA 4B6FA 3HYTA 2F1IA 3RS7A 3I5YA 3PUVA 1OSNA 4ZI2A 1G6OA 3K0FB 2AKAB 2GHIA 3Q5DA 3RWOA 3VR2A 3QIAA 1UBCA 3ZYCA 5KTYA 3I73A 2J7KA 1R4AA 1T8UA 2NIPA 3TR0A 2WJVA 3KFVA 4PPNA 5AR1A 4QFMA 2R6DA 3AQ4A 1EX6A 4JLBA 3WY9A 5JRZA 4IOJA 3TGPA 2REBA 4TL7A 3EA5A 2OCYC 1UDWA 5L3RA 2QI9C 5BYJA 3GLFE 3AVQA 4HZUA 4FD2A 1AGRA 1UBFA 6Q21A 3GFPA 2OBNA 4F91B 1Y3AA 5KPDA 2I1VB 4TLDA 4CEIB 1WBBA 3X1YA 4M22A 1Q44A 2GK6A 1EFRD 3CRW1 3I8SA 2VSFA 4TLAA 1E2KA 3LD9A 1E2DA 5FFMA 3H0KA 1ZIPA 4URUR 4E09A 4EFMA 4RVCA 1ODFA 2G0TA 3T61A 1GL9B 2EFGA 2G83A 4JT4A 4GFDA 4URZR 2F1HA 4BFSA 1R0XA 4BRUA 4TZ6A 3T1TA 1NMZA 4AURA 4D4JA 2GZHA 3AVOA 3A6PC 3QE0A 4A0GA 2ZIAA 1ZD1A 1KDRA 1LVGA 3TSWA 5C2JB 1M8PA 1NJGA 1XMSA 5HKKD 2KSQA 1HTWA 2P2LA 5DN6D 3EPLA 4P32A 3T06B 4DIDA 1E9RA 4HB2A 4LSGA 4W9MC 2IHYA 2ZANA 2W58A 4C0KA 4TTRA 4D6PA 5FPKA 1U81A 4MYHA 4M1MA 2UKDA 2ERYA 1G20E 2YHSA 2FDCA 3WMFA 4IFBA 1X8KA 3KZ1E 2QTFA 3U2QA 3ZLJA 2O0JA 1E0AA 1NF3A 4B48A 1W0JD 4FWIB 3SEAA 4PHTA 1OJLA 1VYUA 5JSZA 3G0HA 2VSOA 4ZI3A 1KK0A 1ZC3A 1XMIA 1JAHA 2D74A 5GVSA 1FUKA 3QQ5A 2VRWA 1OXUA 4A8JC 4KLZA 1XTRA 1WQ1R 2KJQA 3F5FA 4JJKA 4B44A 1XCGB 1G41A 4WAUA 3V4FA 4FWTA 1HT2E 2Y8EA 1ONBA 5JCPA 5HE8A 1VCIA 3MJHA 4HYYA 1DE0A 2O0HA 1SXJA 2YOFA 5GVRA 3ZS9A 3D8BA 3M6AA 1KMHA 1FQJA 2GZDA 1P62B 1TUEA 1LY1A 1WRBA 2ZU6A 1COWA 4XTCS 5IK2A 3FPAA 1PZNA 1QHNA 1TQ2A 2R65A 1ZU4A 4EPRA 5JMTA 4ESVA 2WSSD 1GITA 3ASZA 3PVSA 1ESNA 4II7A 3RS5A 3NBXX 2L0XA 2NZJA 1P60A 2CHVA 1E1QD 1SULA 2QMEA 2G1JA 1Q21A 3DMNA 4IEEA 4POAA 3EWAA 4ACBA 3RC8A 4B35A 1VG9B 1YQTA 1UKYA 2C8VA 4XTRA 4B3CA 4IW3B 4A0RA 3MGCA 4C0JA 3BH0A 5E7MA 3EXAA 3EARA 4KFSA 1Q22A 1DAMA 4NMMA 4AG5A 1OLOA 1F5NA 1NVUQ 2V7QA 1YZKA 4BFVA 3K0FA 2IYUA 3MWKA 5HZKA 1SVIA 2N46A 3AF0A 2RGDA 1PLLA 2JLQA 4JBYA 2GK7A 1NMYA 1UKZA 4Q1DA 5ANRB 2W6JD 4RZ2A 2OCPA 4CT5A 3RS0A 2WTUA 2H8KA 1NLFA 1YJ5A 1U8YA 1B23P 2GTPA 3A4LA 1NP6A 1TEXA 1KI6A 3FKQA 4Q4JA 4UJ5A 1MT0A 1N0WA 1RFLA 4DC9A 2WMOB 1C4OA 1PVOA 3PQCA 4QHTA 2GF0A 2ZJBA 2FN4A 2VEDA 4LWZA 5TXGA 2GBLA 2GETA 1IONA 3A1SA 2IYTA 4C2TA 3BAFA 5L3SB 1GOTA 3RRYA 1BOFA 3ZIAA 2AWOA 1LW7A 3A36A 2ZI6A 5DI9A 3U4QB 1NVVQ 3V9PA 5L3QB 3LDAA 3QXHA 2MSCB 2B92A 2OHFA 4HSEA 1HY3A 2H17A 5AJYA 2B7BA 3DO6A 2PT5A 3PEYA 1ZM4A 2BCGY 4MUBA 3TR5A 1X8JA 5DN6A 2HYIC 2JLUA 4TMVA 4EUNA 4KFRA 3MWYW 2IF0A 3KFXA 521PA 5P21A 5LDDC 1YKSA 4DEYA 3B78A 4DUGA 4A6XA 3W6PA 1K6MA 4UXIA 1HA3A 1ZCBA 4A92A 2IS1A 2A5DA 3K0CC 3ZZUA 1XCMA 2BV3A 3KQNA 4BWYA 1XZPA 4HDQB 4MKIA 1ZD9A 5EE5B 4QGGA 2FJUA 3SYLA 2HCJB 3ZDQA 5AUOB 5JSZB 4LV8B 1C9KA 4X8OA 4NZYA 2J41A 3DPUA 4DLZA 4ZCIA 4IDHA 1B0UA 1HQYE 3PR1A 4LV6A 4XVQA 4DT1A 1WBDA 2FMXA 1VPLA 4OJKA 1H8HD 3TRFA 3CPEA 3UK6A 4Q03A 4JMPA 1G17A 4I1SA 5TARA 5J4LA 2A5GA 5KHOC 4F4CA 1ZNYA 2BOVA 4N1AA 1P9RA 1ZYUA 2QA5A 1RW4A 2IS6A 1Q1ZA 1PLJA 3ZQ6A 3WP0A 1XP8A 4R71A 3TE6A 2DFNA 1XD2A 4H1UA 3THXA 2ZSEA 2ZVQX 1IN7A 1XD8A 2PLFA 2FSHA 1LF0A 2RH5A 4M1SA 4Y0AA 2F43B 4FI3C 3IHLA 1YR8A 3C15C 1CR0A 2A2ZA 4BUJA 4M8NE 4CEJA 1HV8A 4QGFA 4A2PA 2ZRKA 1VG8A 4MKFA 1IY1A 3DMDA 3B82A 4FN5A 1VYVA 2GVZC 3VHXA 2J0UA 4ASUD 2VL7A 3CBQA 2EU8A 2PCJA 2CJWA 5J4VA 1UJ2A 1N6HA 3LBIA 5FL3A 4B2LA 1MRNA 2CCGA 4X8HA 2WJGA 1RZ3A 4QBGB 1MRSA 4AD8A 2OO7A 2OM2A 2CE7A 1Z08A 3LXRA 3GD7A 1QBKC 3IO5A 2FEMA 3IBYA 1QZXA 4GPTA 4A2QA 1VHTA 4MRRA 4OI1A 1XPUA 1TF5A 2ZUCA 4Q00A 2IX3A 2PMKA 3ZIAD 4Q01A 5J47A 1ANKA 3Q7QA 1QF9A 1QHXA 2RGAA 3PJRA 2OBMA 3BB1A 1OYYA 2H7VA 4B43A 2JLXA 3LV8A 4KLNA 4WIAA 2G1KA 3AVYA 4L8GA 1AZSC 2HT1A 1NSTA 4GMDA 4D4KA 1E79D 3H2YA 3UG6A 5EXXA 5D3MA 2F1RA 2ANBA 1MO3A 1N0VC 4GOXA 4PX9A 1GRQA 2GWHA 5FL7D 2RMKA 3DHWC 2V55B 1PV4A 3DKVA 2VLIA 2IL1A 3G82C 2FOLA 4DJTA 2ZRDA 3CF2A 2ZE5A 4OKSA 4KAXA 3UWOA 2JLRA 2DBYA 2CHGA 3EW9A 2KBEA 4PPQA 3TJZA 5KPJA 1ZNZA 2NTYC 2DYKA 2KBFA 1VCNA 1RIFA 3BC1A 1FP6A 2AHOA 3NWJA 4HDCA 5J4HA 4DB2A 2G0NA 1Z83A 5ELXA 2GAAA 1M7HA 4R98A 1UF9A 1OXTA 4BLRA 2Q6TA 2FG5A 2JLWA 5FPTA 3CW2A 2FGKA 2CDNA 2ZRFA 3TQFA 3DVLA 2ZI3A 2R6AA 1G21E 4NDZA 1OB2A 5B2ZA 1Z22A 2O0KA 1HQCA 3IKJA 2AWNA 1COWD 1VCMA 4W7SA 5IK2D 2Z0MA 1Z47A 2VYFA 2WM9B 3QKRA 4OHWA 2XEXA 5G41A 3VAAA 1H8HA 3NBFA 4JVNA 4PQRA 1I4LD 4RD4A 2WOJA 1JXOA 3GLHE 1ZD8A 2GJAA 1JR3A 3BOSA 5FR1A 1X1SA 2OLJA 4UQOA 4DEXA 3UPUA 2IS4A 2GEUA 4OHVA 1FP7A 1SZPA 1N5JA 5AUQA 5DLQC 4ZCMA 3QVVA 3FMOB 4PAOA 5TVKA 3R20A 5FH9A 2P6NA 3MRSA 4IVPA 3K0AA 1L2TA 3JZMA 4MGYR 2ZRHA 3TK1A 4N3NA 1F2UA 3M4YA 2J3EA 2CBZA 1TU4A 1HUQA 1FX0A 4OL0A 4HLCA 1QRAA 4KYUA 3K70C 4D0NA 2UZ3A 3I8XA 1AIPA 3EZFA 4FINA 2CJWB 4EJSA 3ADKA 2X19A 1IXSB 2LKCA 2ODEA 2ZETA 4NBSA 3SNHA 4D26A 1P5ZB 5H1YA 5TV2A 3KJGA 2QMOA 2YOGA 4M1WA 3T12A 3QVUA 2KI5A 3AKDA 8OHMA 1D2MA 1FNNA 4KBFA 1M7GA 1SVKA 1SXJE 2AR7A 4FCTA 1XD2B 3THXB 1R0WA 2GXSA 1X3SA 4LBYA 3D6TB 1SGWA 3VNVA 2BMEA 3U7FB 4H9GA 2QL6A 5DNYB 5TMPA 2TMKA 1LV7A 1GL7A 2ZRGA 3CRRA 3PFIA 4MGKR 4B73A 2XOKA 4D0LB 1XEXB 3ZVMA 4JBXA 4UNNA 1X86B 4Q02A 2NGRA 1DARA 2XGJA 4JVMA 3RDPA 3A4NA 1E2IA 3QBTA 2F9MA 5JEEA 3QF4A 1ETUA 2R62A 4ZKEA 5F9FA 2PZFA 2V3CC 1SHZA 1CF4A 4PHHA 1OYWA 3P4XA 3ZGXA 3K1JA 4IVQA 4QHSA 5CJPA 621PA 3SQXA 4DDWA 1UBEA 5KSOA 2EFHB 2CL0X 3IIJA 4CW7A 1XRJA 4NTZA 1G8YA 2ZVPX 2ZE7A 3REGA 3A1WA 3GLGB 4PQFA 3GFOA 3OIVA 1XU4A 3AF3A 3AVVA 3KTAA 2GCPA 3SS8A 1FW6A 1SVLA 2QROA 3LVRE 3PG5A 1AN0A 3I32A 4BFTA 4QNRA 4EDHA 3U3OA 1FOEB 2WSMA 3EZ6A 2IT1A 5F98A 1IM2A 1MV5A 1N6LA 2IF2A 4URVR 5KDOA 3WP1B 3KKQA 1E2LA 5FTLA 5AUNB 3NTUA 2QU8A 4OQNA 3C16C 4QJ3A 5DGXA 1CJMA 5K8IA 1OKKA 2ZRJA 1QG4A 5AJVB 2DFLA 4M9QA 1A1VA 2GXUA 3QKTA 4JKIA 4EQ6B 4HLQB 2V6JA 2XNDD 3O8BA 4P4UA 1BIFA 1WP9A 2D2FA 2I3BA 3BB4A 1E2HA 4KODA 1CULC 5IF9A 2J1LA 3KB2A 1AK2A 4NCIA 2BKEA 2WAYA 4RZ3A 4TSFD 1C1YA 4ZPXA 3IGFA 5FTMA 5DISB 3HP1A 2VF8A 3BERA 1IHUA 1US8A 5FI0B 1F3OA 2A3RA 4MYTA 1G5PA 4PAQA 3ICEA 5GJCA 1NLYA 3KJEA 1KDOA 1E3MA 2J5XA 1KY3A 2VHUA 3PEUA 1CBUA 3S1AB 3HU1A 3M0EA 2V1UA 4RD0A 1S2MA 4D25A 3B1ZA 1YR9A 4V0OA 2BBTA 4HLDA 1Z6AA 1JEDA 1UFQA 5DO9A 4DCSA 4LY6A 4TMZA 2QM8A 2XAUA 2QRNA 2ZYWX 4RFSA 3QF4B 2ZJ8A 3DKPA 1ZRHA 2ZYUX 4R2IA 1HURA 3L2OB 2RGEA 3UMRA 1T8TA 3K0EA 4B76A 4BFWA 2C9CA 2CCJA 3THYA 5JFGA 2DPXA 2ZRPA 4AK9A 1U98A 4MRVA 4P31A 5FTNA 3FHTA 3ADBA 1S3GA 4OBEA 3D3QA 1S1MA 4QNMA 4RY2A 4B3GA 1D5CA 2ZEJA 2ZSFA 1KJZA 3GPLA 3TIFA 3LH5A 3T1QA 5L8VA 2ZE8A 4JZKA 5HCNA 4C7OB 5LBIA 4TN1A 4LC0A 1DAIA 3BH7A 3MD0A 2FPLA 3IQWA 2ZRAA 4P33A 5KNBA 4J0QA 3T5GA 4LJ6A 3WHKA 2ZREA 1G7TA 4LX0A 2O8CA 3I4LA 2BEJA 1XD9A 3AKYA 2XTMA 1FTNA 3IIKA 2RGGA 3PCRB 2IYQA 4G01B 2JLZA 1NG9A 3QOFA 2X2EA 2XZOA 1OH7A 2QAJA 5A0FA 4AG6A 3I92A 3FFAA 5L3VA 1SHKA 3EPHA 4F4IA 4TYNA 2GXQA 5CIWA 4DKXA 1GWNA 3AVTA 3ICQB 3B6EA 2QQEA 3LFUA 2C96A 1XJQA 2JJ2A 4ZIRA 3W8RA 3C5HA 2IEYA 2ZYTX 1XXHA 2DWOA 2GBLC 1XCPA 4GOJA 2NO7A 4IFEA 3OAAD 5KO2A 4QGAA 3L0OA 4XD7A 3O8CA 1T3HA 2HEIA 2O8BB 1Z2AA 2QE7D 4XD7D 1AM4D 4QL3A 4KXFB 3DOEA 4G0NA 2RB4A 3RS3A 3K0SA 1Z6YA 1GTVA 2IS2A 3MLEA 4Q48A 4BZXA 2DHRA 2OFOA 2E87A 4IDPA 3B1YA 2QMUA 4TSFA 5JZVA 2QAGA 1CR1A 2ZJ5A 2JIZD 3CPHA 3DM5A 3LY5A 2WVJA 4JLMA 4NU0A 5EP1A 1E4VA 2ZU0C 4JLKA 2JLVA 1AS2A 3RANA 4XWKA 4ZDJA 1II8B 4LHZA 2F6RA 4OI4A 3T34A 4WZAE 3I62A 3I5XA 2QT1A 1JPNA 4NKRA 1KI7A 3VX3A 3I61A 1P73A 1E2EA 4NYMQ 1EFRA 3ONWA 1YRBA 4C0BA 1E32A 1W48A 1E9CA 4CT4B 1AS0A 2REXB 4JBWA 5DHAA 2FFBA 3OIUA 2V54A 3GEEA 4YONB 2H92A 1M34E 2WJYA 4L16A 4LPSA 4G3XA 2MMCA 3VHLB 4TTQA 5FTJA 1A2BA 1KO4A 1KDPA 3NIBA 2Z6VA 4A0HA 4F38A 3GLIE 5A4JA 5EZ6B 1SKYE 1XXHE 2D2EA 3LLUA 2ANCA 1NI3A 5EZ5A 5FPSA 4BEBA 5DYIA 4L4UA 1H8ED 2ZTSA 3CZQA 3C7KA 2D7CA 4PQYA 1OB5A 3EZ2A 3BXZA 1UBGA 3FHCB 1II0A 4NCJA 4WXPA 2BJVA 3SJBA 2BBWA 2YVUA 3SZRA 5IHPA 3ZZ0A 4QC2A 2O8FB 2H16A 3Q5EA 1DO2A 5AJZA 3K0AB 4B2IA 1TEVA 1L8QA 3KKNA 4Z54A 3CNNA 4LC1A 3O8DA 1TQ6A 1U99A 5JLJA 5TY0A 1DS6A 1G4AE 2HLDA 2P3SA 3FFBA 1GKYA 4M1TA 2QT0A 1QHGA 2IC5A 2W0SA 1OXSC 2NO1A 2DFTA 5BWMA 1ZUIA 4M53A 1EWRA 5B64A 4BLQA 1DG1G 5J40A 5EE9A 1LTQA 1N6RA 3K70B 1OHHD 5JWRA 2W0MA 1JXMA 2ZRNA 2ZM5A 3OFNA 1G3MA 1VYTA 2YWFA 3G5UA 3TLXA 1UPTA 2GILA 1WCV1 2K5UA 1NG1A 3TH5A 1GM5A 4B32A 1XBTA 1Z28A 4HAWA 2JAQA 3U44B 2ZJOA 2CLCX 2FZ4A 4HDOB 4QM7A 2H57A 2W2VA 4NYMR 1T3SA 4Q18A 1ZNXA 4LHYA 4LYJA 5FOVA 4IRUB 3RRMA 2G9NA 1OE0A 3CX6A 1KI2A 5E95A 1GNPA 3A1TA 3QXXA 1AA9A 4JYCA 1A82A 3HJNA 3IEUA 4Q4LA 4ZDWA 1IY0A 2FE4A 2OV2A 2R2AA 3BWDD 5CDFA 2GCOA 1NIJA 2PJZA 1KSJA 2QTVB 1RJ9B 3ETLA 4L9WA 1WDTA 2WIBA 4RD2A 4RKFA 4LV5B 4PZZA 2GKSA 1U94A 1NKTA 2FFHA 2H18A 3AEZA 4OHZA 1ZM3A 3RRNA 2OAP1 3C41J 1XWIA 2QP3A 4PSAA 2IYYA 3P4YA 3MG9A 4AKGA 3GJ3A 5DH9A 1U8ZA 1A7JA 1G7CA 3SHFA 5DSZA 1GDDA 4RZUA 4Q9IA 1SVWA 1EG7A 1P3JA 1ZVQA 2CVHA 1YU9A 3KXKA 4UJ3A 2J7PD 2YWHA 1Q20A 1P7CA 4RJLA 2PZGA 2Z43A 1KYIA
chains in the Genus database with same CATH superfamily
4O4IB 1X7DA 2ZSJA 2BGUA 2YTZA 4XUDA 5C35A 3EIHA 3MUNA 2CUZA 3E2IA 5DGDA 1J22A 3HQ4O 5D85A 5JS7A 2Y4OA 1N2CE 4JS0A 2PGOA 2ZXUA 2ZIFA 3ULKA 1E9FA 3C4VA 4YAFA 2J0QA 1NP3A 2W71A 4V3BA 1F4VA 1XPRA 3DQQA 1BE1A 1MKYA 4OFZA 3T54A 2ZI5A 4DMGA 5LYJB 1IZZA 3DTNA 4MHSA 3QEOA 3UT6A 5DBEX 5ISMA 3O0DA 2O5VA 2P8SA 1N5OX 1PEDA 2R8EA 4JUAA 5FA5A 2FSVC 2H31A 4F2WA 1L3CA 2EATA 4H7JA 3T5DA 2R3SA 4QPPA 3FR7A 2XVAA 3QYAA 4MJLA 1NRJB 4S1WA 3KAKA 3F5SA 4BNLA 4KUEA 1E1MA 1NY5A 2HSEA 2VP2A 3DOOA 1WXDA 4RHFA 4D8XA 3FPEA 4YUZA 3NEYA 2R1VA 1REQB 4ARZA 4AI6A 4EBBA 1G3RA 1XTBA 3WYEA 1Z7BA 2XOKD 3CX8A 1HDYA 2DTXA 3JYLA 4URXR 1XAGA 4CLDA 1Z6XA 4FNGA 4IOLA 1M6YA 4LECA 4NNOA 4RESA 3PYMA 3M5DA 3R3YA 1V8DA 2JBAA 2P11A 2IUFA 1EI9A 2BGJA 1U0SY 2V7XA 1V39A 4DSNA 3V3TA 4Z4GA 5IBRA 1BD4A 3VR4A 1Q12A 1X7XA 2P4EA 1XTJA 3T4PA 2ZE6A 4Z3OA 4J7XA 3KIPA 1QK3A 1U9CA 1YC5A 3ZWMA 4IF4A 4W5TA 1TDJA 4DTIA 1CUCA 5MGNA 3EC1A 2WVAA 1Q74A 1E2PA 4WOBA 1U0HC 4R5HA 5TPZA 5C1OA 1LU9A 1AUOA 3IBGA 5CXQA 1EP9A 2B0CA 5T67A 4G4JA 2GZMA 2H0RA 4HB3A 4KVAA 1GSAA 4F4HA 4GEKA 1U02A 3A11A 1OOEA 1E3QA 3GLIB 1BMFD 1XKXA 2QD1A 4JU8A 3NPMA 1BTOA 2HIAA 1U8AA 3STXA 5I6DA 1EU1A 1U5AA 1ATZA 4LRYA 3AF1A 1IBKB 1YQEA 3ABZA 5CB4A 5KX5B 1U90A 2VJMB 4D0GA 1JA9A 3IAM6 3ZDYB 3UAOA 2JJ2D 1P17A 1R18A 1A5BB 3RPEA 4BKQA 4RQBA 4GDFA 2FP4B 4AQDA 4FFMA 4K6GA 3WVNA 3N7AA 4IHQA 1SBIA 1V1RA 5C5DA 1JR3E 3STYA 3LTNC 1CNEA 1M2OA 1RAAA 2OR3A 2H7CA 3KOUA 1MA0A 4RSGA 3RG2A 3MELA 4D81A 1Y6ZA 5PNTA 3ZE6A 1VJCA 3MN1A 4HJRA 4NICA 2CMGA 1A2QA 3HJGA 1JW9B 3OO0A 5GQSA 3VJKA 4RH3A 1Z4JA 2AZ4A 1ZI8A 1D09A 2ZIVB 3R0JA 5E6RB 5FJJA 5G1NA 2HDNB 4QBIA 1YR2A 5JHGB 3DL7A 2QX4A 4IG9A 3U5ZB 2J46A 1B3BA 1FTWA 4BLPA 1ZESA 4OIFA 4IV8A 1GAJA 1Z2NX 1I2DA 1WX1A 1BS2A 3VFDA 3NR2A 4NQRA 1P2VA 1CUFA 2PMWB 3NASA 2AQKA 2C77A 1KDZA 4Y6QA 5ALDA 2P6UA 1KGDA 1IY2A 4C4PA 5A6SA 1Z29A 1EESA 1RKQA 3MGAA 2VDUE 4JCCA 3VZQA 4XZ3A 1Y4UA 3MTDA 1Y42X 1X9IA 2PR2A 3DBOB 5A3JA 5ALUA 5MGBA 2BGGA 2C2GA 3JARA 1XRRA 1SKYB 1IBCA 4KQEA 5TS3A 3M3DA 3P26A 1OLSA 4J0FA 4X6LA 3UXMA 3WGZA 1UPFA 1ST3A 2BELA 4Z2AA 2FDRA 2R97A 3ZBPA 8ABPA 3BMNA 5H70A 3TSOA 3ZV7A 3EX7C 1Y9DA 4U2KA 3LUPA 4RNDB 1IB0A 4V1CI 5CVVA 1U9YA 2H2WA 1VPVA 4BVHA 5AVOA 4BMXA 3AI7A 4Z49A 1OI3A 1FNMA 5KDDA 4LJRA 1H3EA 3LMKA 3QV2A 3L7CA 3LVBA 1LJUA 3ST7A 2R1VB 2AXNA 2QPTA 2O8BA 1GPLA 2YIMA 1X1CA 3EVAA 2HTEA 2W98A 1Q7BA 1C2TA 5M5BA 3AF5A 3JQ6A 1Z06A 5COBA 5K8UA 1I4DD 1N0HA 1W34A 2A59A 2Y1KA 4Z6KA 2ZTUA 3O4HA 5D86A 3VYVA 1NQUA 4LUCA 3C87A 4C4SA 2R87A 4M4SA 3A6JA 3M6LA 2E4UA 1SR8A 2PUJA 1HSOA 2GKGA 3ISTA 4OFWA 5B7QA 1G60A 4IDCA 4RVHA 4DS3A 4B6GA 4CGYA 3E5HA 5DBIA 1IJKA 4HTFA 3SHQA 3A6LA 3N2ZB 4GPEA 2QAGC 1XQWA 3B8EA 5D1NA 3WGJA 1EXMA 1T91A 1T34A 1W5SA 3FFXA 3K92A 4BNXA 5LZ2A 3DDWA 4RPLA 3WNZA 4DR2B 4N3AA 2XUAA 3PTZA 1K5GA 3HCBA 4AG3A 1MA3A 3NC0C 1ZCZA 3WV4A 1V5FA 2UZ1A 4FP9A 5K0GA 4U2DA 5BNTA 2DUWA 1OLXB 2OHVA 3F5MA 1P8AA 3RAEC 4O4LA 2B6NA 4WQMA 3CZ9A 3KUKA 4RM2A 1KIAA 5D3MB 5DLDA 1DBVO 1H9BA 3H1TA 2CNLA 4K5QA 1YDEA 2H7YA 2FZLA 2P5TB 3K9HA 1GT91 2BVNA 1J2RA 5LQAA 2JI6A 4ALMA 5AVSA 5BSMA 1JP7A 3W8FA 3V48A 2EYUA 3D8TA 3FDZA 5HSGA 1UOOA 2HHJA 3DLPX 1UQUA 2LR0A 3LF1A 5KREA 4W5WA 3KQHA 3JD4A 5C46F 3F8TA 3IC5A 3AEKB 3IIIA 3EZYA 2AVDA 3N2GB 4DMLA 3HSKA 3UCXA 4C3ZA 2BFCB 3X1JA 3K8ZA 4MVJD 4GU5A 3VOBA 1H0HA 3HWRA 2ZW9A 4CM4A 4MV1A 1HZZC 1RM3A 1A4XA 1YHZA 2B4YA 2PA0A 2W2OA 3D31A 3DEYX 4XM1A 4PO9A 4X63A 4EJ2A 2W6NA 2BEUA 1XNJA 5M3BA 2NPFA 3QKIA 4ETIA 1YZQA 3EPPA 1Z8NA 5AYVA 2B21A 4C0XA 3NETA 2PSFA 3T7DA 1P3DA 1R8QA 2JCVA 1N25A 2B78A 4G8JA 4D7AA 1P2DA 3BTVA 3CMMA 4RDIA 1Y8ZA 1SBZA 3EK2A 2UZ0A 3LLMA 5FRDA 1UDCA 2I2AA 2VHQA 2M1ZA 3A8TA 3F71A 1A2KC 2YICA 1LF5A 1L7OA 3FPCA 3O3NB 3H2JA 1TVCA 2IIPA 2FR0A 3IDZA 3ZVNA 2ZCJA 3ZDZB 1W4ZA 4PNPA 4ZI7F 4OHOA 1YAJA 5BN1A 4PIPA 4AJEA 1X7HA 4ZAXA 3F7MA 4PSCA 5CLGA 3HGTA 4GC5A 2YVLA 4HFRA 5BORA 2H2IA 1Y7IA 3LGAA 5A9RA 3BG5A 3VVLA 3D81A 3A9VA 1XA4A 2JJYA 3QXCA 3L7AA 4IX9A 1Y34E 2XE6A 4UBMA 3RM3A 3SIPA 1XQ6A 2ZAIA 4BRSA 2GQ0A 5A3SA 4PFQA 4ZO4A 2XQJA 4EG4A 1RXIA 2PL3A 5T8KA 4F6RA 1YZLA 3OZAA 3IMGA 5M2QA 1MUUA 4BO8A 5AVYA 2ZWIA 4M9ZA 1VLVA 2LD4A 3AI3A 5H4HA 3ZI0A 5BR4A 4NBKA 1VKRA 3BF7A 1EUZA 3JS5A 4BXOA 2QUBA 1G6Q1 1J97A 3PHJA 4P7FA 4G8CA 3ZDFA 1HETA 2FQWA 3ETHA 1PLKA 4EYKA 2H4ZA 1XPOA 5K0ZA 5TEVA 4OXNA 4LHVA 3FLEA 1MGPA 2EKQA 4DIEA 3BSYA 5LQNA 2J59A 3EWSA 1QGDA 3HN6A 5LOVF 3A6DA 4JGBA 4WKPA 2IPOA 4I9NA 4YWHA 2EW2A 1KK1A 1D5WA 1G4HA 2C58A 1DBRA 2XCQA 4NZZA 3EIQA 4FUTA 3UBMA 4XJSA 4RL6A 3GCXA 3P9XA 4CMCA 1H05A 4L7QA 1K8RA 1ZISA 4AZVA 4YX9A 4MR9B 1SAYA 2WJJA 3CO0S 3JQRA 2E5FA 3NTQA 4P38A 2AN1A 3HB0A 2NZXA 4Q4AA 2YIDA 5EXTA 5JDCC 1N6KA 3KKKA 1UMBA 3OIYA 4M7WA 3TX6A 3KOXA 2NOAA 3HL4A 1MX5A 1L5NA 1IHPA 2KM1A 2V5VA 2J9RA 4P82A 1XZQA 2O48X 1B4DA 1U7XA 4PZ0A 3ZE9A 3GLGE 4ZTUB 1ZM9A 3ELWA 4EJ6A 2RE8A 4C0HA 1GU0A 5B1EA 3ZUPA 1DMRA 3RNLA 3VPFA 3V55A 5DXAA 1MTZA 1M1ZA 1ULAA 3LUCA 4IDAA 4X90A 2HOQA 1RD4A 2V7QD 4LI0A 1UFKA 2YV4A 4XJXA 4AJJA 1K86A 2WYUA 2I6TA 3FWKA 3QV1A 2VPZA 5KYKA 1M5RA 3BK1A 3EZXA 4UW9A 2XRMA 4MQFA 2AXEA 1XAHA 5DTEA 4DDUA 3V8VA 1JHDA 1JQKA 3V4LA 3PL5A 5FR2A 3R5KA 2O2GA 2VEOA 3EJ6A 1ZXXA 1QNLA 3BRWD 4B33A 5CFMA 1KI4A 3WRXA 4DLRA 3THWA 2IGBA 4WNYA 3RRFA 3B2QA 1OIVA 1ORWA 4CCSA 4PG5A 4OUKX 1I80A 1ODTC 1QQAA 1M73E 2ZB3A 3I0NA 3ZH9B 3L4KA 5JECA 2F3PA 2X4GA 3DWIA 4F9GA 5EWLA 4Z3DA 4JHXA 2GD0A 3FM9A 4H4CA 1X7XB 2ORIA 1N3YA 4PVDA 4CDRA 3RSCA 5THQA 4F46A 1NUQA 5IANA 2PUWA 3E9MA 2YWCA 4X1KB 3ZY2A 3QUSA 1U9IC 3UANA 1GRVA 1THZA 3AGQA 2DLCX 5KVQA 4EHKA 4P0TA 3AOGA 5CFQA 3TTXA 2CWDA 5EUBA 1BDMA 2E1PA 2P77A 3GJZA 3PFCA 2R8BA 3U3XA 4DBVO 3K35A 1ECJA 3PD7A 2VAVA 4IRXA 4QBHA 1ZOSA 4QQRA 2JGAA 2B8NA 2WK1A 3AJEA 5GIPE 3AC0A 4D9FA 3KYDA 1IUNA 1N5LA 3VGJA 3WSTA 3BFPA 4YR7A 5FAKA 2R44A 2Q1SA 4PO1A 4W4TA 3TRHA 5LA6A 1W47A 3CUYA 1EJBA 5K8LA 2BISA 4TVSA 1BJKA 1ZITA 4B8WA 4EUEA 3JQPA 2ZR0A 3I04A 1WMFA 4FU0A 5HM6A 3B89A 2HXYA 3USCS 1SVOA 3KYIB 3SPXA 1KU0A 3TGWA 4MTLA 4DCNA 3DDNA 3WFJA 4EJSB 1DINA 3DXZA 3SGLA 1ZJZA 2PHZA 4TWBA 2C0QA 1HEUA 4PNZA 2C5LA 2VSXA 2D1SA 3EDYA 5JQWA 3WB1A 1NX6A 1EGAA 1L5FA 4LIPD 4J3JA 1CZLA 4NCNA 4PWYA 1XMOB 3HRHA 3CSSA 4E3WA 3NBYC 4KGXA 3GMIA 1S8FA 3L8MA 1CY8A 4RK7A 1KIMA 1PFGA 2WIAA 1E2MA 3I01M 3KZMA 3NYIA 3G0IA 1RWXA 1R5OA 5KC9A 2VYNA 3ETCA 2HA7A 2Y05A 2JFYA 1Q91A 2JAUA 1IN5A 1PTKA 2Q7DA 4CN8A 3CLUD 3WQHA 4O2AB 5GONA 2F55A 1YIAA 3M9WA 4EHBA 3I6QA 2C2BA 2N1BA 3QKRB 1J2YA 4YBZA 5ETJA 1ZM2A 1K68A 3ZC3A 3P9IA 4ZI7B 3AU8A 3F4KA 1KKMA 1IDOA 1LFDB 3DFMA 3K09A 3RK1A 5EKSA 3N6XA 5B1SA 3ZCSA 4AY6A 2OAGA 1M2NA 3A9SA 1OLUB 4Z4QA 1ZVVA 4IO0A 5CDUA 5IM4F 4DR4B 4RS4A 4IQ4A 1KI3A 4WBNA 4C7VA 3D5TA 3ZDBA 3T95A 2D2VA 3MMNA 3O1LA 2PKCA 1J8FA 1ENPA 2A0KA 4FS8A 3H75A 4WOPA 1N5DA 1OA0A 1AQYA 3MYRA 1MBZA 1SU4A 2DH5A 3OKCA 3TW4A 1DQNA 1TA4A 1NXVA 1G16A 1TM3E 3V8PA 3OM9A 5B7NA 2B1GA 3D7SA 1X8LA 2FAXA 4BKRA 3D6AA 1O87A 2J6HA 4FILA 2H2GA 3B60A 5DHFA 3IHWA 4NF2A 4Q4DA 4R68A 4M99A 3JATA 4BO6A 1K7YA 2Y68A 3IOCA 4MYCA 1NF8A 2G9ZA 1WDKA 3ZZMA 3UT5B 4WK6A 1E6CA 2WOOA 1OXXK 3ADDA 2Z30A 1OYVA 4ETMA 3OPYB 3ZLUA 2XZPA 3H0CA 3LT4A 2QI9F 2HRRA 2Y3IA 4QYIB 5DCLA 5FO0A 4UM9B 1T5LA 1H4VB 1B8PA 3WV5A 1G1MA 3QBJA 3R0IA 3VKGA 4FUQA 1OMOA 1T9BA 1ZGAA 2AW3A 3C74A 5DYWA 1PNVA 2HZ7A 1NU8A 4JKYA 1M8GA 4F3NA 4X92A 2ZUFA 1H8EA 4IF6A 3EWNA 4OQ4A 2ZYDA 4CIXA 2GF9A 3H13A 5FI3A 4MWSA 3TFWA 4B2PA 1EUDA 3X2FA 4BV9A 3EC2A 4CKWB 1FUYB 1THGA 2FW8A 4CNBA 1PBNA 2Q3HA 3QVJA 5H3CA 4X66B 1QONA 3PUWA 5JADA 3RK0A 4DBLE 1AZTA 1SXJC 2IYSA 4LK3A 4ZHQF 1CJVC 3KVYA 3JSXA 8AT1A 5EE1A 1SOVA 2CK3A 2WG1A 3FHLA 4NABA 1XZBA 2NV6A 1MJNA 2OM6A 4DJAA 1WF3A 1EINA 3WWOA 1ACJA 2VFAA 1IUOA 1UZUA 2YWEA 1P9WA 1T5IA 5FWAA 1EFVA 1QTNA 3CZPA 3PUHA 2AH5A 2GFQA 3CEMA 4MA4A 4UFNA 1V5WA 4YROA 3VRHA 5T64A 2Z1MA 4H08A 5I47A 3L0PA 2C84A 3O4VA 1GUBA 5FTWA 5LPNA 2QMHA 1P2UA 5AVJA 4E07A 2YV5A 3PT5A 3VVBA 3GMTA 1A8SA 1D2EA 1QH8A 5FBZA 1PJAA 4G4SO 3OOSA 4GOLD 1JILA 4HH3C 5BSKA 4RWEA 4LJYA 4PBRA 3DV0B 4QEZA 4I1PA 3RARA 3ASYA 3G0OA 2GEJA 4CV1A 3FNEA 1XCBA 1T8YA 3PQ2A 1R4NA 2C5BA 3H1EA 4DJDC 1MEJA 3BRQA 4OK3A 4L08A 4MR8B 1QXSA 1NC1A 5F7ZA 5GONF 2ZSBA 2O2SA 4J1NA 2LGJA 2AT1A 4ARUA 3FPGA 1RYZA 4EGAA 3HU5A 4LYHA 4OXQA 4TL9A 4XR4A 1XFAA 1VFNA 3GVCA 3VZDA 1LS6A 4D3DA 4TMTA 3C1OA 3OZEA 2J3QA 3A6GA 1G6KA 3LRPA 4HCJA 1V3QE 2WPDA 2X14A 4OY3A 4DSAA 2PZBA 1PGJA 2CXPA 4TLEA 1U2RA 5A9SB 3IPXA 3OE4A 3R23A 1G8JA 5KDLA 2Q7OE 5JJCA 1FQOA 4JEMA 4G84A 1K88A 4Z7QB 1YJAA 1AUPA 1EZZA 2BHNA 1KERA 1W93A 3DM9B 4GYWA 5AK5A 3RJMA 4CM5A 4EA8A 1KHTA 2QF7A 4TMWA 4L28A 1TQ4A 1DKRA 2V97A 3AL3A 1GRRA 4MV0A 2VR1A 3FOCA 4QLAA 5BVGA 5H68A 3GGOA 3X1WA 4OXRA 2NSJA 3NLLA 3T1YB 1SZDA 3DE3X 3PNLA 4NPAA 1CY2A 5JZ9A 5C53B 4YLEA 2Z9CA 3A3NA 3HU2A 4MWGA 1IZYA 1RXUA 2I76A 2Y1EA 4CWAA 3PXAA 1R0SA 4N0DA 4Q5IA 3KTAB 1Q57A 5EI5A 3ED1A 3VR1A 2P69A 3UXEA 2VDWB 3N87A 4HB0A 1GNVA 3PDWA 3QOWA 4ZDKA 3FTPA 1SZCA 5LBUA 4A36A 3RYTC 3BXHA 1N36B 1R9MA 5EE0A 4PLCA 4M8SA 5ARCA 1DJMA 1E7YA 2B2CA 3ITKA 2XX3A 3Q5GA 1OU4A 4JVOA 2C4WA 2JDIA 2PL5A 3M5PA 4KC0A 3SCZA 1X42A 4KJZA 1AU9A 3PRKE 4NYIR 1KJ9A 2XT6A 4FW9A 5AK6A 3U7IA 3O8RA 4CYMA 2E5WA 3VHXB 1GO2A 2FNAA 1VLLA 1E98A 1M2JA 2QL5A 3O2QB 2PPLA 2WIGA 2XJ4A 1KP3A 2Z5LA 5F2KA 4DCVA 4QUIA 5A4MS 2ZUEA 2R6FA 5ER9A 2FQ1A 4HH4A 2Q99A 2VATA 4IGIA 1NZDA 2X2OA 2OGZA 1NATA 1GXSB 4D80A 2BFMA 3AIOA 1JMYA 3GAZA 1JQBA 1P6XA 3AR4A 2GBPA 3FB4A 3E82A 3GCWA 1X14A 1ZD3A 3MT7A 4PLTA 5E4FA 1UBRS 1KBOA 2YH2A 5AI0A 1ULBA 2FR8C 1UXIA 4KBGA 2FUEA 4MVJP 3AERB 1L5SA 2MSEB 4LJSA 2RK3A 1T5SA 3RSFA 4Y1RA 1J8YF 4KOEC 5HZGA 3AXSA 3UXHA 1DVRA 3KXLA 2YIVX 1IYZA 2LE0A 3L7MA 5WRFA 3ESYA 3WXMA 4DIBA 1XALA 2WNHA 4UARA 4E5KA 5M7EA 1OW3B 4P93A 5LXTA 2PH1A 3L7YA 4NE9A 3HCOA 5REQA 3VR4D 3K71B 2Y1XA 5CLQA 5EPUA 4HRVA 1MQ9A 1OZGA 2DY1A 2C20A 2XDWA 3CO5A 3GZNB 3JWPA 1KSGA 2ONKA 4ZOLF 3UUEA 1WHTA 3B70A 5TGZA 3W7VA 4KDRA 1YR6A 3JYPA 5HQJA 3E4CA 5IFLA 1T9GR 2DR3A 1D2GA 3O5AA 4CMJA 1QFJA 2WWXA 3IDSA 1KAEA 2IV3A 2H4XA 4ZARA 5JFOA 3IKMB 1Z16A 1B74A 3O8OA 4OK5A 1R0ZA 1RLUA 3ZNOA 2HKIA 1KO7A 5FL7A 5KKNB 3NHAA 4DW8A 5L7YA 2JB9A 2QSJA 4RMHA 3STUA 1J2JA 5SICE 5H83A 4M21A 3ME5A 3DB2A 4R3UC 3ICCA 3ACDA 3QWIA 3MS2A 4KVFA 1XA0A 3BEDA 3ESXA 1YNSA 4B34A 4AYTA 4BWFB 1IG3A 2IQ5A 4JJIA 4NQZA 4WGGA 4EMTA 1PR3A 4P22A 3G9UA 5EFZA 2B6HA 1QKJA 4BC0A 4R1UA 5HBRA 2JLAA 3WDLA 4BNHA 2I6SA 3JZIA 4KTTE 2OQRA 1QZUA 5BV8A 4EMSA 4ED9A 3HM9A 1U2QA 1PSWA 1H42A 3GUYA 4CQNA 4IQGA 3ZBUA 3PR2B 4LZOA 3VO1A 1E5XA 1UR5A 1X1AA 4QUAA 1DIAA 1Z7WA 3C4JA 4ZCPA 3NAMA 4U8GA 3UOWA 4D9GA 1HXHA 3DWGA 3QU5A 5ED0A 1LI4A 1GZ4A 4PXAA 5HK8A 3ETDA 1K27A 5HZMA 5H7XA 2GXAA 2RJ3A 2WG0A 4QM6A 2OAQ1 1LK0A 2E4WA 3OOYA 4EO9A 1RRGA 1AQ6A 2PWBA 4P5PA 2XDQA 2I0FA 3VTKA 4HS9A 2CBXA 1NM5A 1NTOA 2JIZA 2WU1A 3BJRA 5T4FA 1XMJA 4WFJA 7ABPA 3G7NA 3H05A 2H00A 1JJIA 2FY8A 4Z51A 4LHXA 5TJ9A 5IAAA 3V34A 4X91A 2H65A 4YRFA 3USES 5K9ZA 3OBBA 3BZWA 1H22A 3HADA 4J6EA 3A1FA 2KQUA 3LPNA 4YV2A 3BHIA 3OCXA 4F1WA 4LF6B 4J94A 1PT6A 4IIHA 1FDOA 2NXCA 2PBZA 4OXXA 4I1IA 4Q34A 5ALGA 1Y4SA 4U6SA 5JJBA 3UJ8A 3TBHA 3EBOA 3A37A 2V7TA 1T2UA 3NAGA 2ZITA 3CM0A 1XZNA 2X1MA 2IBMA 1SUIA 2JFXA 4HAUA 1AHNA 1PUIA 3ZNNA 3MAAC 3LUHA 4FMCB 2LP4Y 4EZBA 1WUJS 2FZCA 1XZJA 721PA 5DW0A 1IUKA 1I32A 3HP7A 5K05A 5JXJA 3QXJA 1O6CA 3EGIA 1M1UA 4E5PA 4U0JA 3DE1X 3QLVC 3RQIA 2R6CA 3B20A 3FMPB 3VDMA 4C7MA 3MJ4A 3OJLA 3EXG2 4J0IA 2IYRA 3LIIA 5EIXA 4AMGA 2D6FA 1YONA 4MV7A 1I14A 2I4MA 3SJAA 5HQ3B 3S28A 4HG2A 3ZD9A 2VPPA 3TLMA 3F7OA 4OQFA 5CNJA 3V4OA 4XUGB 5ENVA 4YMUA 1TL7C 1P8JA 1JHMA 1M2EA 2E0IA 1YKFA 2JD2A 2ODWA 3W1WA 3WLRA 3HR4A 2OZLA 4QTYA 2OWDA 3U7HB 1TIPA 1ADBA 3VZSA 3CLSD 2O2JA 3U39A 4JL8A 5IDVA 1TAUA 3QJYA 4KMMA 4NENB 5SY4A 4MMXB 2AG6A 1V96A 4QXRA 3JD1A 4NFYA 1GA1A 4LAFA 4TXLA 2JVIA 2RJOA 5EHQA 1C7RA 1YAHA 2VQSA 2XB9A 2DKFA 2WE7A 4LOLA 1FLVA 3ZHXA 3CH4B 1H6AA 3ILHA 1M1YE 2JAHA 1CVRA 4MGIR 2Q5CA 3QENA 1CR2A 1LNQA 4K2HA 5KVVA 2RH9B 3K6KA 1W5AA 3VJLA 3IP9A 3VU9B 2MYTA 4MLDA 2QMZA 4ZICA 3W9UA 4QZVA 1AKWA 1BQ3A 3BSFA 1Z4IA 4IM7A 3B3FA 3ADOA 2YN4A 3AR5A 1UPAA 1RVV1 3PEFA 4G5YA 4G0ZA 3VVCA 5C18A 1WV1A 1FFHA 2WA2A 3AF2A 4NPHA 4KYVA 2IYFA 5JMOA 3A7DA 2Z8YA 4PC1A 1A9SA 3QI2A 1RP1A 3C3XA 5FBWB 1T36A 2B3TA 4NU8X 4G2TA 4NJMB 3RU3A 1HI9A 3GN1A 2Q4EA 1ADGA 5ICFA 3ZHYA 3KJNA 5LLTA 3C24A 1F2UB 1PEKE 1T1RA 1LB1B 2MSWA 2O4UX 1LVHA 2QN6A 3MSXA 3MUFA 3T4EA 1ZRSA 1TQHA 2J9ZB 4LYFA 4BYMA 2WHXA 2RARA 4ZIRB 2IYLD 1CLUA 1U28C 3NV9A 3QWAA 1QE3A 1R4ZA 1M0EA 1J99A 4EY5A 2PXHA 3P9ZA 3MOIA 5HCIA 4KV9A 4P4TA 3N9IA 3OIWA 4PHGA 1YBHA 2ILTA 2Y1FA 3KJQA 3ORHA 4MRSA 2Q3FA 2ONJA 5I8PA 4DHEA 1ZXBA 4WCVA 1VQ1A 1XVUA 4E5UA 1MN6A 2I2WA 4NESA 4UOQA 5ITZB 5JCJD 3N2IA 2VNIA 4N3CA 3I23A 4QQFA 3DTTA 5AI5A 4RULA 2G17A 1G8HA 1OBHA 1SPXA 2Z4TA 1DBWA 4HP8A 5FB3A 3DDSA 1P0FA 2Q4TA 1HTTA 2Q07A 3AY7A 3MTIA 2XB4A 1TD9A 3ESQA 3AEUA 3NOQA 3OETA 3R5TA 1L5KA 3SZGA 3I1IA 121PA 3WYAA 2B1JA 1KFJB 2QLMA 1XTVA 5JBNA 3OPMA 4FSHA 1WOMA 4Z4EA 4QTUB 3HA7A 1CJTC 2G09A 1CUYA 2OLKA 4EABA 4EMBA 5IT5A 3BIOA 1YZGA 3MCTA 3C43A 2CVZA 1O96A 3I04M 4JR1A 4EEZA 1IXZA 2IHJA 1L1QA 4Y0NA 2JCXA 5HJ2A 5J2UF 1XT6A 5DBFA 3U13A 2I80A 4PCLA 3VZPA 2FQYA 1DFGA 1DRVA 1ORIA 1Y3IA 2ETXA 4RKRA 2C4UA 4BLOA 2XXBA 4KNWA 1QPZA 2ZPAA 4QFBA 1QP8A 2QX7A 1ZFNA 3N2KA 4HXFB 1JJFA 4RA9B 2XKBA 4OQDA 1FY2A 5MDHA 1J8MF 2VYQA 4LXIA 4RYLA 1IJFA 2CNBA 3Q7TA 4GX2A 4J49A 4PSKA 3G2PA 4LYYA 3W5VA 3QUQA 2JGJA 3AT1A 1EFTA 5JD4A 1XZDA 1XX6A 3BEOA 4P9NA 1JX6A 3GI1A 4DZTA 4A8HA 3AILA 1DELA 3K20A 5KQGA 5JTUA 1GUYA 3FOWA 2FRDC 3EOBI 2IU6A 2B20A 2EKDA 1VRVA 1CVLA 4KDEA 3U7FB 3EHEA 3AHIA 4LGYA 4EL5A 3CJRA 4BX8A 5LMCA 3IOYA 5AMXA 5DE3A 3U61B 3U4AA 3M6IA 2D5BA 5CDHA 3JX9A 1RBMA 2QR5A 5IT0A 2PKRA 1J1ZA 4GQBA 2PUEA 5G3YA 5JS2A 4RD1A 5BN5A 2HJVA 5DLYA 5B30A 3B3AA 2B4QA 2VUIB 3OQVA 1VJ0A 2DWCA 1N57A 2NV2B 3KQSA 4QBFA 4XE5A 4YXWA 4RKQA 5CK4A 3RJTA 2XQKA 1M7BA 4K3UA 1U6JA 1UPCA 3LDUA 3FSEA 1JMVA 2Z3ZA 4KEAA 5AM1A 1OH8A 2JJQA 2PO7A 3HCNA 4ZREA 2C3PA 4P1ZA 2GSDA 3QSYA 2DEUA 2NP7A 1GPAA 1KY2A 1AKEA 2PRYA 4OYLA 3B85A 1E0KA 2ZJ0A 3EFOB 1O54A 2O2YA 3HXOA 1BC5A 1HT0A 4TV9B 4MZXA 4I4IA 3U4DA 1P7ZA 5IABA 2D7DA 4CZ2A 4INJA 2IDJA 3PPXA 1H5QA 4LDZA 4DHWA 4HV4A 3EF0A 5BV1A 1UDBA 1S3SA 2FQXA 4GSYA 2Q1XA 4B6JA 5AW7A 1R37A 3S2EA 2GEVA 1MAHA 1WD7A 1YGYA 2NO0A 4MV6A 4BGEA 3AY6A 1KO5A 3UMFA 3I5AA 4FHEA 5DPMA 4EATA 5EJFA 2P4QA 1F12A 4O4HF 5C8XA 2C4TA 1EGHA 1JKIA 3EPRA 1DI0A 1JJ7A 3EB9A 4OSPA 3GF4A 1UT5A 1IC6A 3VJMA 1XL0A 1YUNA 4O2BB 3KOMA 3NEJA 2XWPA 2R8YA 2NXNA 1NQ5A 2R6GA 3FUCA 4CG3A 2Q2QA 1UQRA 4O4JA 2XUDA 3G88A 2OD9A 1QANA 4ENVA 3Q7RA 1ZUNA 4MS1B 4RQTA 3JVVA 3BB3A 1I3CA 1ZL2A 4HGPA 1A9RA 3VPSA 1E4YA 3C8HA 4MMZB 4R05A 5JZMA 1N7HA 3MWEA 1H4SA 1YBVA 4A6PA 1KOLA 1BEEA 5FLKA 4DQKA 4A8JB 1IK6A 4WV3A 1L5GB 3RYHA 1K0UA 3ONDA 4LRUA 3UVEA 3L4BA 2YNMC 5F9HA 4QUHA 1G9XA 3CF4A 4NCHA 5HRAA 1KMQA 5IFKA 1JWLA 5A6SB 4ZTZB 1PWEA 2CHQA 3OUUA 4ZMSA 2PQ0A 3OE1A 1KE1A 4RTRA 4V0SA 4FE7A 2G82A 2CMDA 3Q6MA 2Q8NA 3ZCQA 2AK2A 3FCYA 3OOJA 1QKKA 4TLLB 4TWZA 4RV9A 2IXEA 1E3DA 2OORC 2COKA 4X5OA 3ZEIA 2RBKA 4XOIA 3NDPA 3NEAA 5DEOA 1V16A 2W6ZA 3E18A 3GJ5A 2YXDA 3LA6A 3UAVA 1RAFA 1ZPDA 1NVAA 1SD1A 3AW8A 3ZWOA 3WKEA 1U0LA 2IUSA 3HUDA 4A2WA 5DCUA 4O5OA 3ZHZA 1FJHA 2BMFA 4IDFA 3C3JA 1B1CA 1RI1A 3EF3A 3R5HA 4MPTA 1WUKS 1A0OA 3UN1A 1T4DA 4KFCA 1VMEA 2JVKA 2ZDHA 1RWKA 4FOSA 4HR7A 5C32A 4WOJA 1AY0A 3UC9A 4B6OA 2P9BA 2WIJA 3QPUA 5IXYA 1RZRD 3VSCA 3SYNA 2QD5A 3UUWA 2WLSA 3BIFA 1PFVA 3QNWA 1F9EA 4M1EA 2YV1A 1PT7A 3R3XA 3WK8A 1A8IA 7MDHA 1OX6A 1W36C 3JZFA 4HNVA 1FDTA 3UHAA 3G0DA 4N5NA 5HTKA 5M34A 1YVPA 3RR2A 2X4DA 3H18A 3Q7IA 3W06A 2QK4A 4V0NA 5HR5A 1G2IA 1AB5A 4ZCIA 5KI6A 1EE1A 4KFUA 1RWQA 1SCDA 4I4LA 2IXAA 4R1OA 1YO6A 1ZY2A 4IKOA 2RI0A 3PIDA 4JT2A 5SZKB 1KNXA 5LM3A 1KP2A 4S35A 1QGED 2NZYA 2P5YA 4HVCA 4WJKB 1HOTA 4DCPA 2Z4RA 4FQ5A 4IDNA 3IUJA 3LOPA 3CEAA 3V42A 3N2EA 1ILWA 1WD5A 1I3OA 2ZIWB 4RAOA 2CFIA 4GD3Q 4WVLA 2ZJAA 3N5CA 4R7ZA 2R4UA 4XWTA 4D9KA 4F96A 1FS6A 5BP7A 1B93A 1JAZA 4JD5A 3CRQA 1DRUA 4ONEA 3LL7A 1OKKD 3O7MA 1EEHA 4KYIB 5C8DA 4I4TF 4TL6A 3HV2A 3K9NA 3BD9A 3MTEA 4C21A 4D8VA 4K40A 2I3DA 2WYHA 2C29D 4WMLA 2VYND 5ALPA 3ZLBA 4B4OA 2VDJA 4DLXA 4B3MB 3E5RA 1KAOA 1I6WA 1QJCA 1RKXA 3CLKA 2FF7A 5DM60 1CEEA 3WL7A 3WYBA 3ZGLA 2PUGA 3TVYA 2XZTA 3IMKA 5IJXA 1T8WA 2YINC 1XZEA 2FETA 3GPBA 4MKGA 3SYTA 2VDPB 2RHMA 5AKGA 3H99A 5ALVA 5ALWA 1TF7A 4FJ0A 2BTEA 4ZV4A 4X6UA 4H4EA 2Y0CA 4UEWA 1RJ9A 2H54A 5BN3A 2HJHA 1JR6A 2CMFA 1BX0A 3MJFA 3UQZA 16PKA 2GPJA 2WM8A 5DOVA 2DPMA 1C3JA 2HQSA 3WSVA 3JYNA 3AG5A 3GRPA 1GUAA 5EXSA 2MR6A 1Q1EA 3NANA 2X5OA 3SKVA 2HF2A 3A1VA 3QG1A 4KO8A 1HMPA 1N5MA 4JC4A 4OAQA 3DLIA 1OT5A 4JJ7A 4ZA2A 5LNK1 1B6SA 5C31A 1MAUA 3BGSA 4TPKA 3QBEA 2VTEA 1PL6A 4BFZA 3JRXA 4QPCA 2Y6VA 3AR7A 5DNAA 2NQ2C 1EFVB 3RTAA 2E21A 2WFLB 2QUHA 1R0CA 3A28A 1PAUA 5BO5A 4C1NA 3WX0A 2HYDA 2XIQA 3WNBA 4R1PA 1J70A 4G1MB 8ATCA 3CPSA 4IUYA 2P3QA 2Q0QA 2GAOA 2I9KA 1DO8A 2LIPA 5CR9A 3T7KA 1JHRA 4ZEOA 3EVCA 3GPCA 4I1OA 1LBEA 4W5HA 1ZOOA 3EULA 4MW1A 5C1BA 1A98A 3VR0A 3DBRB 5JSFA 1M1YA 4ZVSA 3CONA 1PR6A 1KI9A 4R1TA 1QPGA 3U80A 1ONSA 1M2VA 4ITVA 4CMIA 3E3OA 3C3KA 4TKMA 4FNOA 1S3FA 1SMKA 2X9VA 4QDUA 1JQEA 3BMOA 1ZJ6A 4RDXA 3GFQA 4EEXA 4R9VA 5KWJA 4RK5A 4C2UA 1E9AA 2JEOA 3SMVA 2OSBA 4FPXA 4FSDA 2Y66A 4DMFA 1P9NA 4HNUA 1R10A 3TSCA 4B6EA 1O6FA 4IXNA 2PH5A 3F3YA 3GEIA 2VRCA 4XFJA 1RR6A 4F85A 2BGRA 1EM6A 3G2LA 3PPYA 3D6FA 4NZNA 4CM1A 4DPMA 3D8UA 5JY6A 3I3OA 2PE5A 2BD0A 5GINE 4R2LA 1PVDA 3DAGA 4GRAA 3O4RA 1EFHA 3RU2A 4BP3A 2Z3WA 3P9SA 1YE8A 1GGVA 1C7QA 2FZGA 3E9DA 3ROXA 1RXWA 1PIWA 3IESA 1MNQA 3MAJA 4B5KA 2PR7A 4Z86A 1R3DA 1SXQA 2AFVA 2C4KA 3H9EO 1X1QA 4KQHA 3WXBA 1UPXA 4DIOA 2CDCA 2XSZA 2ZUSA 3E9QA 3KAPA 3CW9A 4AKEA 2FWNA 3IA2A 2BH2A 3GEDA 2FWIA 4IG4A 3IJPA 3Q8XB 5DX1A 5K0JA 2F1KA 3IQFA 4ZZIA 5AVWA 5JU6A 2BSQA 1J21A