4R98A

Chimera of the n-terminal domain of e. coli feob
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
263
structure length
256
Chain Sequence
KKLTIGLIGNPNSGKTTLFNQLTGSRQRVGNWAERKEGQFSTTDHQVTLVDLPGTYSLTTQTSLDEQIACHYILSGDADLLINVVDASNLERNLYLTLQLLELGIPCIVALNMLDIAEKQNIRIEIDALSARLGCPVIPLVATDTKNVQFVLKLAIDRYKANENVELVHYAQPLLNEADSLAKVMPSDIPLKQRRWLGLQMLEGDIYSRAYAGEASQHLDAALARLRNEMDDPALHIADARYQCIAAICDVVSNTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrous iron transport protein B
publication title A GTPase Chimera Illustrates an Uncoupled Nucleotide Affinity and Release Rate, Providing Insight into the Activation Mechanism.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal transport
total genus 85
structure length 256
sequence length 263
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
A PF17910 FeoB_Cyto FeoB cytosolic helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4r98A01
3SOPA 4Q4HB 1NLZA 2PBRA 5JWHA 5EE3A 3GLFE 1EX6A 3N70A 3EA0A 3BB1A 4V0OA 1FL9A 3I5XA 2IS6A 3I8SA 1AZTA 1I2DA 1ZCAA 2O8DA 1H8HA 2WICA 1QHYA 3OZXA 5C4MA 3QNUA 3KUDA 3HPRA 3SYLA 1KZ7B 4BFXA 5KDOA 1G4AE 2ZETA 3DEFA 3KXLA 3KJHA 4LV6A 1Z0AA 4KXFB 4AYXA 1YZLA 4FW9A 1E9RA 2G0TA 1G17A 4WW0A 1T4GA 2ORVA 3EA5A 4HAZA 1X3SA 4XH9B 5F98A 4B32A 4POAA 1M6NA 1FUUA 3ZQJA 2D2FA 4OHXA 4S35A 3L0PA 4NCJA 2ZRKA 4NYMR 2IYRA 1OT3A 1XEXA 3W34A 1LVGA 2GF0A 2C9OA 3DHWC 2FH5B 2O0JA 2PMKA 3ZIAD 3TVTA 4RFVA 1JECA 1OV4A 3PJRA 1SVSA 5HE9A 2ZI9A 1G20E 4TT3D 5EP4A 1ZAKA 1OYYA 1Z63A 1HV8A 3F8TA 5J40A 3VHLB 5FOXA 3TK1A 2QE7A 3RSOA 1A7JA 1L4YA 2AD5A 3TRFA 4NCHA 1BYIA 2XAUA 3KXKA 3O47A 3QI2A 3VR6A 3SJBA 4Q9IA 1W46A 2F9MA 4QOSA 4B3CA 3EIEA 421PA 1R5NA 1KYIA 1T0HB 4QNMA 3Q7PA 1NKTA 4PTLA 5C2JB 1AZSC 3CH5A 1W4RA 2ZI6A 2QGZA 2BC9A 4OQLA 2YINC 1IY2A 2WZQA 3L43A 3FTQA 4L9SA 2PCLA 1AK2A 4ZI2A 4CRWB 3RLFA 4PC3A 4Z1MA 4P4SA 2R6DA 1KHTA 4KVAA 3UMRA 2DFLA 3ZVRA 1X1SA 1JNYA 2GEDA 2VP0A 4JLAA 4LJ8A 4QNRA 2VHCA 2WWYA 3I32A 2B92A 4P3YA 1X8JA 4PHTA 3A1SA 1KTVA 2ZTSA 3L0IB 3WMFA 4JIMA 4U5XA 4B2IA 2W6JA 4TZ0A 2V55B 5HR5A 2ZS8A 2GNOA 3ND8A 4HSEA 4G5RA 4U02A 4XVUA 3BK7A 4PANA 5EUQB 5KPJA 1S4QA 3KQNA 3AVWA 3BC1A 2J7PD 3FHOA 4QJ5A 3FYHA 2FFAA 1WBBA 4EFMA 2JJ8A 1DE0A 4TQAA 4YMVA 1YZQA 1QVAA 2R8RA 2NIPA 2GVDC 4A2QA 3A1UA 3FFBA 4LI0A 3UANA 3LLMA 2F1RA 2BEJA 5C46F 4DBLC 2CNWA 5DSZA 5KDDA 1G9XA 4DDUA 2V7QD 4WZ6A 4X8MA 2IYTA 4LBVA 3NG1A 4JLKA 4AC9A 1NVXQ 1Z07A 3WMEA 4EKDA 1MV5A 1XEFA 1RVDA 4MUBA 1GTVA 4Q01A 3PVSA 3RRNA 4UNQA 3PEWA 121PA 2A30A 2ZRMA 4JKYA 5EZ5A 3LBNA 2UVQA 3EC2A 2XZOA 2QSYA 3TE6A 2VTKA 1FX0B 2GILA 4QGFA 4L15A 4MRNA 2IC5A 3VR5A 3U44A 2WJIA 2P5TB 3FHCB 4UNPA 3P4XA 2F3RA 1RE0A 5FL7A 3ADDA 3RS5A 3OAAD 2NG1A 1VTKA 4BFVA 5M04A 1FNMA 1CU1A 2FFBA 2R6GA 2XXAA 2FZ4A 2ZE7A 4I1UA 3B13B 4BWYA 3VR4A 2CVFA 6Q21A 1E2KA 2GETA 1JQJC 4EJSA 5TXGA 4MQBA 1AA9A 4V0MA 4ASUA 5E7MA 2NPFA 3SHFA 4BUJA 2KI5A 2LCFA 4DJTA 3PUWA 3VX4A 3PEVA 5BYKA 1O87A 5KDLA 2MSEB 2XOKA 5CB8A 1AN0A 2B8WA 4UKDA 4HLUC 1VCOA 3SE0A 5FBQB 3B8HA 5FBVB 5AUPB 4RSGA 1KO4A 3QUSA 3LO5A 2O8BA 3P26A 1MOZA 1Q21A 3U3RA 4TWZA 3W90A 2G83A 4B75A 4M9XA 2WSSA 2WVJA 4DLXA 1WP9A 3FVQA 3W5IA 3RS7A 4D25A 2C9CA 2CCJA 2WAXA 3EZ6A 1DAKA 2H7VA 4Q47A 3RHFA 1OE0A 1US8A 3RDPA 3RS3A 4KHZA 2G88A 2RGNC 3LFUA 4HDCA 1P2VA 4F4JA 3GLIA 4GZLA 1Q22A 5GJVC 2AKAB 1JR3D 2X77A 5JBQA 1FTSA 2IYUA 1E2EA 3K0CA 2GVZC 1GILA 4JT4A 3CWQA 4PPGA 3NIBA 1FW6A 4LK2A 1MO5A 4PX9A 1VPLA 4URVR 1NBMA 1W4CA 2E87A 4IDNA 1M34E 5FBWB 1MO4A 2YZ2A 3AUXA 4DDWA 4EPVA 4DB2A 2GESA 1Z08A 1SVOA 4M1YA 1SVIA 4MYTA 3GQBA 2OCBA 3CNLA 1W47A 4D81A 3OIVA 3FMIA 4DRZA 1E0SA 1SVKA 4ZIRA 5AWFC 2PX0A 4KBGA 2ZJYA 2ODEA 2ZRIA 3WP0A 1TU4A 4RZXA 4ZDKA 2QUZA 5B58C 221PA 4A15A 1CBUA 2ZRPA 3RC3A 2FN4A 1T0JB 4BLSA 1ZUIA 1ZVQA 4FCTA 4DUGD 3FOZA 1U94A 1R7RA 1TPZA 2CHGA 1XTQA 3OIYA 5DHAA 2HEIA 1ZIPA 5FUVA 4AWXA 4Q1FA 821PA 5IT5A 1XTJA 4XD7A 2XX3A 1ZUNB 2AL7A 4TMWA 4R71A 1BH2A 1I2MA 1P75A 1KKLA 3EX7C 5SZIA 3RAPR 2IYSA 3K9GA 5IHPA 1U9IA 4W7SA 4DZZA 5A5GA 2Y8EA 5E4FA 2IS2A 3WNDA 2MMGA 1MT0A 3I73A 2GHIA 3QG1A 2RHMA 2A2ZA 4KCGA 3Q3JB 2C99A 2QTFA 2ZRDA 1QHNA 2ZI5A 3KFXA 4QGAA 2K5UA 3GJXC 2J3EA 1ESMA 3SFZA 1W5SA 1U0HC 4EIWA 2JIZD 3LWNA 1Z6TA 4B35A 4LJ5A 1EFRA 2VP2A 3BFVA 3LNCA 1NJFA 2N42A 3FMFA 2X19A 4YMUA 3DDCA 5H8WA 1IBRA 4C0HA 2C98A 4IEEA 4DCSA 5IK2A 1F2UB 3GLFA 4ACBA 3KQKA 4M9ZA 4A6XA 4C2TA 2X2EA 2XSZA 3QF7A 3L8ZA 4I81A 4IXNA 5E7JA 1RW4A 4ZV4A 2QTHA 3ZD6A 2ERYA 2XNDA 4RFSB 2V9PA 1OH7A 5CDFA 1FTNA 1KY3A 4QFMA 1XCGB 4D26A 3H1TA 5EXSA 5FI0B 2QEQA 1JR3E 1Z6AA 4MYUA 4OQXA 3B1WA 2OV2A 3E5HA 2QP3A 1W4BA 2GJSA 4TMXA 2D3WA 4CEJA 2F3TA 1KGDA 4M8NE 4QBFA 3HYRA 4B73A 4PC2A 3K0FA 3WHLA 4US0R 3UPUA 2KBEA 1JXMA 4A6PA 1NN5A 3RABA 3B1ZA 4D0LB 2FX3A 3IO3A 3QXJA 3T1OA 2A9KA 1TX4B 3FMOB 4Q02A 1DTSA 2F9LA 3CBQA 3Q5DA 5SZJA 5FPYA 1E9CA 3B1XA 2JJ1A 1SZPA 2H5EA 1KSGA 5JEDA 1RRCA 2AKYA 1OHHA 2GK7A 3PUVA 2I1QA 5BN3A 2IBMA 4US2R 5FTJA 3D6TB 3GD7A 2Q3MA 4MH0R 2GA8A 1KZGB 4XWAA 4D2IA 1DAEA 4U7DA 5JI2E 4Q1DA 1UPTA 2JLYA 3FKQA 1HYQA 5J4LA 3B6EA 4Y0AA 3RS2A 3UIEA 5KPDA 2AK3A 5DYIA 3BAFA 4W5WA 4C9BA 1TF5A 4ZO4A 2IHYA 1GFIA 3HYTA 3C41J 1TADA 3W3AA 3HR7A 4W9MC 1QF9A 3VNVA 2P67A 2IUTA 1UADA 2Z0MA 1I4TD 2B21A 3CR8A 1GUAA 4KVGA 1GRQA 1YR7A 2IS1A 1M7GA 1VCIA 4DEYA 1PUJA 2IF2A 2A5JA 3I3SR 3MD0A 3O8DA 2J87A 4LRWA 2G1KA 4WOPA 2KSQA 4DSUA 1S3GA 1ZM4A 2H57A 2C04A 1BMFD 1C1YA 1XPUA 3KQUA 4Q19A 4YMWA 2DFTA 2QPTA 1J99A 1E2FA 2WMNB 3PITA 2OFXA 2Q9AA 5E95A 2FNAA 3IHLA 3VNUA 4IDHA 2GTPA 1AKEA 4ZPXA 1N0VC 1DG1G 3W3ZB 1S2MA 5EUMA 5IRCD 4V0LA 1XZPA 2XTZA 3KL4A 3VQTA 5AUQA 5EP3A 4C7OA 3QEOA 3T06B 5CM9C 3D31A 4MGKR 4OI4A 4EJSC 1UEJA 2V4ZA 3PV0A 3T35A 4JLBA 3CW2A 3QOFA 2OFWA 5G3YA 1J70A 3SQWA 2HJGA 1IONA 2V3CC 2P5SA 4BLTA 3SJAA 1RPZA 2AFHE 4JLDA 4ZCLA 3FPAA 1X86B 1JEDA 1PZNA 4AD8A 1CXZA 5KSZA 3H4MA 4C0SA 4PAMA 3H2YA 1QZXA 4ARZA 4M22A 1SHKA 2GF9A 4GOJA 4JYBA 4XTRA 5TARA 3ETLA 3QY0A 2PZGA 2AFIE 1E4VA 4DCTA 1OIVA 2FGJA 4HAYA 3Q8XB 1NSFA 1I4LD 2AWOA 3PCRB 4TT3A 1G3RA 3C4JA 4O3MA 1XD2A 5FR1A 2VL7A 3AKYA 2Z5FA 1CRPA 2Z6VA 3QSYA 3U3OA 3V4RA 1CR2A 4TLDA 5F9HA 2O8CA 2ZYUX 2XZLA 3VR2A 3GJ0A 3OHMA 4Q18A 2VHTA 5TV2A 5EE1A 5CIWA 1KDRA 1W2GA 3ZD7A 1G8PA 1MABB 2IUSA 2XTNA 4PO1A 3LBHA 4TL6A 3QKRA 4PPQA 5KO2A 2RKOA 1S96A 3AGPA 4D6PA 1E32A 4LV8B 4NCNA 2YC4C 1KI2A 1E2PA 4QJ3A 5P21A 1AS3A 3NXSA 4GFDA 4JLVA 4BPBA 1HA3A 1ZC4A 5D3MB 2BWJA 2DHRA 4ZCMA 1JQLB 3A37A 1P62B 2ZITA 1DAHA 1ZCBA 1X1RA 4AYWA 5CJ2A 5CITA 5HE8A 3ICQB 1IJFA 4JBWA 4M1SA 1JPJA 2PEZA 4EAQA 5KSOA 1CS4C 2VIIA 4E22A 3EZ7A 3KB2A 4LBYA 3TNFA 1GRRA 3NKVA 4DCVA 1P9RA 2QTVB 3AVXA 3B9QA 2JCSA 2ZR7A 5JHHB 1J8YF 3QPWA 1N3BA 2DPXA 4URYR 2IUUA 1KK1A 4URXR 1VDZA 2N1BA 4GBMA 3W8NA 3NVAA 3U7HB 4X8OA 5FPKA 1U99A 2ODWA 3QXSA 3AKCA 1PLJA 1GVNB 1HEIA 2FSGA 3FWYA 4QBHA 3RSLA 1MKYA 4MRSA 3KKQA 1EFRD 1JAIA 4JLPA 3OIWA 4HYYA 2ZSAA 2JJ2D 2ZEJA 4GP7A 3VKHA 2ZU0C 3ZH9B 5KSYA 3CZQA 1IHUA 4BLRA 3UWOA 2V7QA 5IK2D 2REOA 4XSHA 1EFCA 3VKWA 3QVUA 3O8CA 1IJEA 1XMIA 1COWD 3R7WB 1Z29A 4AG5A 1NVVQ 1XTIA 3OFND 4MGZR 1OFUX 3HU1A 2QG6A 4PHFA 1D5CA 1VHLA 3GLIE 4UJ5A 1NVWQ 4Q4JB 3JVUA 1KAGA 4XWKA 2GCNA 1GIAA 4QHYA 5DHFA 2WBLC 5KUTA 3A4LA 4HAWA 4NDZA 3QKSA 5KNCA 3VMFA 4V0NA 1YR8A 4FIDA 5EXPA 1S1MA 2FPLA 3H86A 1XJCA 1TNDA 2Z43A 1G7SA 1U8YA 2RGXA 5FTKA 5HZKA 3OAAA 2FSIA 2RGCA 4Q7KA 4B48A 1W0KA 2FFQA 5TDHA 5F9FA 2O0KA 3MUFA 5FTMA 4KFSA 1SKYE 4C30A 2GZDA 2JLQA 1KAOA 2QSZA 5GVRA 2D2EA 3MFYA 1P9NA 2R65A 2XNSA 3KJGA 2XZPA 1ZD8A 3NEJA 1C4OA 4IJMA 2WWHA 3OF5A 1NLYA 2FMXA 3S1AB 4UNSA 1E2HA 5L3VA 5AJWA 3THXB 2WSMA 3BS4A 4DDVA 2ZS7A 1RRPA 1D8TA 4B2LA 4QM7A 1OHHD 3WYGA 1A2BA 2CJWB 2RGNA 1NNEA 5GJCA 3KJIA 3SC3A 5KYKA 1DEKA 1EFUA 4TSFD 1N5LA 1GM5A 2YWHA 2E9SA 4TL8A 2R9VA 3QQ5A 3AEZA 2BM0A 2HDNB 5LB2A 4CDGA 2CLDX 2KBFA 2UZ3A 4A36A 2R6FA 1XPOA 3T5DA 4BFUA 3SJCA 1GITA 1E94E 3KTAA 3UXMA 2ZXUA 2P3SA 3A1TA 2JATA 4TLEA 4G5OA 5JWOA 2YJTD 3K0AA 2GJ8A 3GLHE 3LVQE 4PC7A 4R2HA 3THWB 2GRJA 3ZLJA 1I4DD 4NTZA 4TMKA 3L2OB 4NE2A 1UBEA 1QHHB 1XBTA 2CLSA 3CRMA 2D4HA 1GKYA 4LPSA 3HDTA 4HDOB 4Z54A 3PQCA 1QVRA 4WXPA 2GCOA 1M1YE 5FOTA 1P4SA 4KAXA 1S9DA 1CIPA 1Q1BA 1YZKA 2HT6A 2IYQA 3LQQA 1XTKA 1Y63A 3AGQA 1KO5A 2GEVA 2MMCA 1YU9A 4DIDA 2ZJOA 3EWAA 4S2EA 5FOVA 3ZVLA 4DCUA 4KFTA 3QJYA 4LOAA 4JT2A 1G8GA 3BWDD 4M9QA 1JALA 5CDFE 4LHYA 2V6JA 2GXQA 2EYUA 4HAVA 3D7MA 3RS0A 4UNRA 3WYFA 4DCNA 1MH1A 3EPLA 2G9NA 4LHZA 2GJKA 2IEYA 4LWZA 4UXHA 2J7KA 3MSXA 1Q3TA 1Z47A 4M4SA 1DAIA 1R0YA 4XTCS 3TKLA 5L3QA 3KUCA 1G291 4EPWA 2W6IA 2QT0A 3AP2A 4UQOA 4DUGA 3DOEA 3GEIA 3U4QA 1F60A 1KK3A 3ZVNA 1T6NA 3EW9A 3ZGXA 3T1VA 1G16A 3GEEA 1Q57A 4XIGS 3TAHA 3VU9B 2GZHA 5GJBA 3R9WA 2GWHA 4N3NA 2J59A 1XTRA 4BLQA 4GT1A 4MRPA 1XXHE 5DN6A 1Z0KA 1VG1A 2PZEA 4JVNA 5DISB 3BJIC 4Q4AA 3ZS9A 1W1WA 5K8IA 2NO0A 2A5GA 1XX6A 2WJVA 3SFVA 2EQBA 3GPLA 4AKIA 2BMDA 1TAGA 2W2TA 1WQ1R 2ORWA 1H65A 1OLOA 3H0KA 4BE7B 2DY1A 1KI7A 2JIZA 2WKRA 3R9XA 1IOZA 2EFGA 2IXGA 2RGAA 3A1VA 2R6AA 1IN7A 3QBVA 3SS8A 1OH8A 1K5DA 3X1XA 4AYTA 1Q44A 2QA5A 1YZGA 3A4NA 1OXUA 4J0QA 2ECKA 4D82A 4Z51A 5DLQC 4ZI3A 3CUEF 2QU8A 3RC8A 1XFAA 1R0ZA 2EFCB 4DHEA 3EC1A 3OIUA 4Q1EA 3SJZA 2IK8A 4GNKA 1Q1ZA 3W8RA 2YC2C 1K8RA 1W48A 4UJ3A 1T8TA 2BOVA 5BQ5A 3OESA 1TF2A 4LC1A 4OK5A 4JL5A 4BFYA 2W2XA 4E03A 4NKRA 3KKOA 4ESVA 2G6BA 4HZUB 2CCKA 4EFLA 5DI3A 1P61B 3MLEA 5B2ZA 3GLGA 1Z3IX 2J46A 3UATA 2QENA 4FMCB 1W5TA 4F4IA 1LFDB 4MGIR 1N6IA 1VECA 4HB2A 3CLVA 3ASYA 1P2UA 3HPQA 2ZANA 3A8TA 2PT5A 3BERA 5A0FA 1WF3A 1CKEA 1UAAA 1KMHA 3EPJA 1G3UA 4OJQA 3X1DA 1FOEB 3DZ8A 4H1VA 2ZR0A 4PPNA 1NIJA 3ZZ0A 2PZFA 4YC7A 621PA 4BRWA 3E70C 4LX0A 2F43B 4RZ3A 2ZI3A 3THYB 1DBSA 1EFHA 1ZYUA 4LBZA 4D4LA 1DARA 2RCNA 4I4LA 2JAQA 8OHMA 2VHJA 4C2UA 3U6BA 4NYJQ 2XJ4A 4DXAA 2V1UA 2HCJB 3KB1A 2F1HA 1ZP6A 5JCPA 5KOYA 2RHDA 1IN4A 2RMKA 4NH0A 2JASA 1G1MA 4RD3A 2NGRA 2OM2A 1NL3A 2CDNA 1GOTA 2REBA 4BFWA 2QAGB 3U3MA 4TL7A 3VKGA 5KNBA 2KJQA 2ZI7A 5EP2A 1E2DA 4MRVA 2JLZA 2G0NA 4BRUA 2XB2A 2JLUA 4EPTA 1W0KD 2HCBA 4IVQA 2JLXA 4G1UC 1W44A 2ZRGA 2CMKA 1DS6A 4XVQA 1E2MA 1N0UA 4PC1A 1E96A 3WNCA 2ZJ8A 1E9FA 2ONJA 2WIBA 1J8MF 5DYGA 1EXMA 4YONB 3U3KA 1SXJB 2EWWA 2P0EA 3NH9A 1F2TB 2Z4SA 1FP7A 1N6HA 1BMFA 2AN9A 4BZPA 1CJVC 1G5RA 3V00A 1IY0A 1YRBA 2XGJA 4DT1A 3Q85A 3I62A 5G41A 1ZIOA 5FFMA 3PEYA 1G8FA 1OIWA 4CEIB 3F3YA 1ANKA 4LBWA 5JHGB 4CEHA 1ETUA 3BB4A 3CF0A 4LZZA 3NEYA 1P2TA 1M2OB 1QHSA 3C15C 4M53A 4JLJA 5K8TA 2ZI4A 1LV7A 4TMTA 3TR5A 1P72A 4YLGA 4C0JA 2WM9B 4HAUA 2C03A 4UNNA 1E79D 4UXIA 5CLLA 2O8DB 2D74A 2O8FA 3DOFA 1GWNA 3LAWA 4YDSA 3T61A 5D3QA 1XD8A 1GRNA 1Z0FA 4RD2A 2QI9C 3DM9B 1XMVA 3FB4A 4PSVA 5EXXA 4D80A 1FMJA 3CRW1 3EIHA 3WY9A 4TYPA 1ZNZA 1TQDA 1WA5A 2FU5C 2QROA 1F48A 4GOXA 5JJLA 4D0NA 2ORIA 5A4JA 3EPHA 4M1MA 3PXGA 4KFUA 3M4YA 1CJMA 2IYYA 3K9NA 3BH0A 3W9YA 4F92B 1BKDR 2OT3B 1YKSA 1KK0A 3CF6R 1GG2A 5HTKA 3UK6A 4LGMA 2WV9A 1XEXB 4PZZA 2W00A 1LF0A 4NHOA 2WTUA 4A0HA 5TMPA 1CP2A 1TL7C 3ZZTA 2QM8A 5E7IA 3WNBA 1XU4A 3TSWA 1W4AA 2OUKA 2ZJ2A 1WBDA 1FQKA 3RYTC 2F55A 3RWOA 1G7TA 1U0LA 3KXIA 1E2QA 1FPMA 1GL6A 3IGFA 3LY5A 1NY6A 1VIYA 2BIFA 2NPIA 1CR1A 1JB1A 2ZJZA 3IPXA 1VCMA 3OE7D 1XF9A 2HLDD 2W6ID 4NYIR 3LV8A 2QNRA 4I1SA 3B5JA 2PEYA 1E1QD 3O8BA 1EG7A 2MSDB 4Q1BA 1W36B 2OAQ1 1ZM3A 2ZAMA 2ZYVX 4LJYA 4EPYA 2BMEA 1OXTA 1XEWY 2ZPTX 4GRAA 4MDFA 2W2VA 4CT4B 3U7FB 3NHBA 2FDCA 1R8QA 5C4GB 4JVMA 5AK0A 5IF9A 3U7EB 2HXSA 3TW8B 4A82A 5DN6D 3A1WA 4G01B 2DR3A 1FZQA 3BE4A 1RKBA 1QRAA 4NONA 2FA9A 2HT1A 5J4KA 2NQ2C 2A5FA 3ZJYA 5J4YA 1KI1A 4NBSA 4RZ2A 1OYWA 1VCNA 2IYWA 2W0SA 3AF0A 4P4SB 4KFRA 4Q1AA 5JFGA 3A4MA 3HR8A 3NC0C 3GLHA 4M1TA 1TQ4A 2D7DA 1R4AA 2GXUA 3NDBB 3B9PA 1UKVY 3LLUA 2QN6A 5JRJA 4ZDJA 2QY9A 3C5HA 1MRNA 2BJVA 3VR3A 2DBYA 3UKDA 2JDIA 1QHXA 4HUQA 4PSAA 3QF4A 5JJIA 2EFHB 1KO1A 1GDDA 1ONBA 2FG5A 2JJ2A 1J2JA 2QRNA 3B1VA 1OSNA 4FN5A 4BFZA 3AM1A 2O8EA 2JGNA 2ASEA 1R8SA 2QM7A 5DI9A 2DWQA 1ZUHA 4TTQA 1MO6A 1N6RA 1YZTA 1COWA 4QGGA 1QBKC 1VHTA 3OFNA 4AY2A 5TB5A 4BLPA 3JZMA 1JI0A 2NMVA 2ZRCA 3LX5A 2X1VA 1G3QA 2FSFA 2DCUA 4MKIA 1OKKD 1T9HA 2FV8A 3QKUA 4ON9A 3CRQA 3I72A 4AK9A 4HZIA 3AKEA 4RD4A 4WAUA 4KV9A 4D4JA 2WJYA 3CB4A 1OFTA 3CRRA 5UKDA 1G7RA 2C77A 1Z06A 2VBCA 3LA6A 3P27A 4JJKA 2VSFA 1KI6A 2ZRLA 4JS0A 2BMJA 2J5XA 2O5VA 3U44B 2QBYA 5K8UA 3A6PC 1ZU4A 2ZUDA 3FKSD 1Z2CA 3OEED 1DVRA 1RJ9A 4FINA 2CVHA 3SR0A 4JVLA 3IIMA 4HLCA 3LXXA 4AKHA 2BDTA 2QPOA 4OQNA 3SDZA 2B7CA 2V6IA 4EQ6A 2EW1A 1XXHA 2D7CA 2O0HA 2VP9A 3Q5EA 4GMDA 1RC8A 2XXAB 3GFTA 4B3BA 2OCAA 4PO8A 4TLAA 1E2IA 4LCBA 2REXB 1P7CA 4IKEA 1X8LA 4EJSB 3G0HA 1KO7A 3QXCA 5CJPA 2OLKA 3U7GA 4TSFA 2C9YA 1L7VC 2PJRA 3K70B 5L3SA 1IXRC 1OFHA 1L2TA 1OH5A 2GJAA 2GK6A 2FWRA 1XCPA 4OQFA 3EASA 521PA 4OL0A 3ECCA 3GJ6A 1D2MA 2CL6X 3X2SA 3IPYA 2ZJBA 2FF7A 4E5UA 2ODBA 1II8A 1FP6A 3Q9LA 2YHSA 2O8BB 2NZ8A 3I4LA 5JSZA 4F4CA 3CRVA 2IF0A 1G21E 3IBGA 4LYHA 4US1R 4D4MA 2ZE6A 3K0EA 4ZDIA 4ZKEA 3PUYA 1R5BA 4NU0A 1XCMA 2PLFA 5BWMA 2RH5A 1AGPA 1SGWA 3ICEA 3TLXA 1US8B 5AJYA 3LX8A 3NTUA 3LDAA 5H70A 3GLIB 3AUYA 4LJ4A 3SYKA 2ANCA 4MA4A 3QG5A 3I61A 1N6KA 1RRGA 3BGWA 3SN6A 4LDJA 2BV3A 2VP4A 1J7KA 2BMFA 4Q7LA 2NOAA 1RYHA 2ZRNA 4Q7MB 3WRXC 3O8RA 3CF2A 3AP3A 4LYJA 3GLGE 3ZQ6A 4I1VA 4HEJA 2C5LA 1EGAA 2P2LA 1G5TA 1XZQA 3C14C 2ERXA 4LHXA 1SKYB 2FEOA 1G64A 3EAQA 1GNPA 2ZVPX 4PAQA 2CLCX 2GXAA 5CM8B 1QHIA 1NN0A 3DKPA 4ZIRB 1HUQA 3TSZA 1W0JA 2PCJA 4IFEA 4JJZA 3BH6A 3IIKA 2J0UA 2QMHA 1EX7A 4NPHA 4PHGA 3T34A 3TR0A 2AX4A 1LY1A 1MRSA 5FL3A 4JBYA 4B44A 1DAMA 1X8KA 4GDFA 1V5WA 1HQYE 5CLQA 4Q5IA 4A8JC 2RB4A 2DWOA 3QPUA 3PFIA 2QP9X 3PR1A 3IBYA 5F2EA 1G7CA 1E69A 1TTTA 1NLFA 4TLCA 3K70D 4JL8A 4FCVA 1ZMXA 2HYIC 2ZYTX 1RIFA 1ZM2A 3CPHA 3GJ3A 4Q4HA 2AWNA 3ZYCA 2PJZA 1NG9A 2AD1A 1GL9B 5EE5B 2V54A 1DO0A 3WBJA 3DPUA 1NVVR 2IYXA 3KX2A 4OQMA 1R6BX 1T3LA 4OK6A 3GJ8A 2WJGA 4LYAA 2IWRA 4AKEA 2HF8A 3KKMA 3X1WA 4R98A 4AKGA 1F6BA 1GNRA 2JLRA 1SKQA 2BKUA 2R2AA 2ZR9A 5LD2C 2Q21A 2R6CA 4NCIA 1OXSC 1EWRA 4OK3A 5FOSA 2ZSFA 3K70C 3QEJA 4L5BA 3RWMB 1SVLA 1IAQA 2EYQA 4P33A 4PQRA 2QORA 4MYHA 4L16A 4B6EA 5DH9A 4JKIA 3NBZC 5FTLA 3C5CA 3PENA 4PQYA 3GLFB 2YVUA 3T15A 4M0LA 4CZ2A 1A2KC 2BJWA 1ZW6A 4IOJA 4MKHA 3KQLA 2WWXA 1Z0DA 1UM8A 3TIFA 3AF2A 4LSGA 2YNMA 2WAYA 3AQ4A 2MSCB 5FBRB 1UDWA 1T91A 3I8XA 2GEUA 3AVTA 4DLUA 1KIMA 3BOSA 4B2PA 4PC6A 3UMSA 4C0LA 2OBLA 2IX3A 1G6HA 2H17A 3GMTA 4CEJB 2L0XA 2JDID 4MYCA 5KSPA 4QHSA 1EESA 1Q3HA 3TMKA 1G3MA 3K0FB 3C16C 4BZQA 2WOOA 3D8BA 3OEHD 3L0SA 1TEXA 1GKIA 2OLJA 2WWGA 1OJLA 5DGXA 3W6OA 2BVNA 4Y0VA 1LW7A 3T1QA 4ILEA 3KJEA 2YWFA 2ZU6A 1IN6A 2WOJA 4OBEA 2OBNA 4ZDWA 2F1JA 2CHVA 4IOLA 4NCKA 3F0TA 1UKYA 2GCPA 3KKPA 5CIQA 4TMZA 1P2SA 3SNHA 1D9ZA 4TYYA 3EIQA 1TUEA 1XJQA 3K8YA 4B76A 3J81k 3U2QA 2XITA 4IOKA 1OB5A 2PT7A 5GVSA 4OI2A 3TGPA 2XB4A 3B78A 5FH9A 4YXWD 2B8TA 4XSGA 2FPMA 4V03A 2OSBA 1CLUA 2WMOB 3VAAA 1OW3B 1UBFA 2H18A 3B82A 4B33A 4JBXA 2ZM5A 1D2NA 2ZYWX 4OYHA 3VFDA 5FOWA 1DELA 4CW7A 5H1YA 2ZJ5A 2EU8A 3IO5A 4JLMA 1N5KA 1E9SA 2CEAA 4ERNA 5AUOB 2P6RA 5HKKD 3NC1C 5JEEA 1DG3A 4LJ7A 4R9UC 1GSIA 1KDTA 3K09C 4JMPA 3WMGA 3SBDA 4A0RA 3CPJB 5SZHB 5EZ6B 1GL7A 2JLSA 2W58A 4M21A 3QE0A 4UXJA 4DLVA 1T5IA 2GBLC 3ZS8A 3AP1A 2WJHA 1JXOA 1KJWA 1ZM9A 4Q9JA 2YKGA 4NL4H 1L4UA 2IYVA 3AVVA 3CNNA 4FWIB 4IRUB 1MR3F 1E79A 1FX0A 3MWYW 4MKFA 1E2JA 4DIEA 4C7OB 1WRBA 4FMCF 5AJZA 2RGBA 1Q1QA 1P73A 1JPNA 1N2CE 3HWSA 2NZJA 2FSHA 5AJXA 3UG7A 3SEAA 1ZINA 1J90A 3EG5A 4FMDB 2OXRA 4OI1A 3V9PA 4NP6A 4KITB 4KYUA 1Q12A 1IQPA 1NJGA 3G82C 2WKPA 3RRYA 4RD1A 5L8VA 3CIOA 4DLYA 3M0EA 4XOIA 5TVKA 2FZLA 1A1VA 2DWPA 5CYPA 4A9AA 2FJUA 4LYFA 1GP2A 3R8FA 1LB1B 4O2RA 4ARZB 1G18A 5BN5A 5KHOC 2C8VA 2EVWX 1YVDA 2BEKA 4IDOA 2BHRA 4B74A 4GOKA 2FEMA 3X1YA 3P32A 2QQ0A 5BXQC 2YOFA 2QQEA 1AIPA 1XD2B 3TH5A 1AS0A 4B3FX 2Q6TA 1XWIA 2C95A 3OE7A 2VH5R 2HLDA 2O8CB 3UMFA 2BCGY 1AKYA 1KDPA 4LHVA 1E1QA 2IL1A 4KJZA 1W0JD 3GJ5A 4WVFA 3T1TA 5JS7A 2BBTA 5FR2A 1KOFA 1IXZA 3K0SA 1TQ2A 3GJ4A 2ZVQX 3QKRB 1OFIA 1WCV1 2QMEA 2ZSBA 2F6RA 2D62A 2ZRFA 4Q48A 5EE9A 3SI7A 2I1VB 3CX8A 3T5GA 3REGA 3QENA 1XMJA 1NN3A 3AF1A 5L3RA 5HPYB 5FTNA 3EZFA 3K1JA 4WIAA 2AR7A 3DL0A 1R0WA 1N5IA 2C2HA 1UKEA 4TL9A 4DLWA 1Z22A 4IOMA 3B60A 4I99A 4AG6A 2QAJA 3B85A 4DLRA 4EPRA 1DOAA 4IHQA 5BYJA 2ONKA 1ZD9A 1YJ5A 4B47A 2VPPA 4NYJR 4Z8XA 2WWFA 3C8UA 1KSJA 1Z0JA 3K53A 5G53C 3SHWA 1T8UA 4KODA 4BASA 3W6PA 2VYFA 3CX7A 4G3XA 4DVGA 1JJVA 1QG2A 4PR0A 3L82B 4HATA 1B23P 2GKSA 3P4YA 4QXAA 4FD2A 2BBOA 2W83A 4CYMA 1KJYA 1KNQA 4KLNA 2RGDA 2Q3FA 1CR0A 4GSYA 3GP8A 2Z4RA 3P20A 5JS8A 3BH7A 1X6VA 1H8EA 1OKKA 2D06A 3CX6A 4QJ4A 4MRRA 2CL0X 1KDOA 3TUIC 1CJUC 1E9DA 4QBGB 1VYTA 2OCPA 3B1YA 2LKCA 1E99A 1DPFA 3HU3A 4QBIA 5F3WB 4Q00A 2CK3A 4O0MA 4URUR 4DDTA 3AVQA 2DFKB 2VSXA 2ZQ5A 1XTSA 3EWSA 3QKSB 5ANRB 2QZ4A 3FKSA 5HZHA 3OEEA 1PV4A 2V8OA 2OG2A 3MWJA 2QPAA 4YMTA 5FUWA 1XJ0A 2RGEA 1XRJA 2QT1A 4KLZA 4EUNA 2PH1A 1E1RD 3AKDA 3DVLA 2HYDA 4FMBB 3TUJC 1Q0UA 3A36A 2WPDD 1NF3A 2J41A 4NYMQ 3CM0A 2YWGA 1PUIA 1LF5A 2H92A 2HV8A 4M1OA 1VG8A 2PLRA 4DSOA 1OH6A 1YQTA 2OXCA 4PSKA 1F2UA 1R2QA 3N5CA 5JMTA 2ZUCA 1ELOA 3MWKA 3QKTA 4IEIA 1U81A 1W2HA 1KNXA 2BBWA 2GDJA 1JJ7A 4RFSA 3RANA 4OHVA 5LDDC 4R7ZA 4A0GA 3W5JA 1KMQA 2ZROA 1Z2AA 3B2EA 2GJ9A 4ESHA 1S8FA 1NN1A 4WA7A 1VYVA 3FDIA 1HY3A 1P9WA 3I5YA 5BW8A 1V43A 2XJ9A 4LJAA 2CCGA 4WXRA 4CF7A 4MDEA 5GADl 4XJXA 3CZPA 3KTAB 1YHNA 2DFNA 3U61B 3C7KA 4HI0E 5FPHA 1ZNXA 3TQFA 1Z8FA 5K8LA 4HUTA 3L0OA 1TF7A 1N0WA 3K0AB 2AK2A 1IN5A 4M9SA 4ZKDA 4MKGA 5EP1A 4Q9LA 4Q4LA 1L8QA 4H1UA 1RZ3A 4LHWA 1GNQA 3Q7QA 2KWIA 5JJKA 1KSFX 4CT5A 1XD9A 3ONWA 1OPXA 4TYNA 1XNJA 3UWKA 4O2LA 3MJRA 2GCOB 2I4IA 1N6OA 3MMPA 1N25A 2WKQA 3X1ZA 4F91B 2AXPA 1PLKA 2H1LA 1ODFA 3WBKA 1E2GA 3AVOA 2H8KA 1N6PA 2ZAOA 4L9WA 1UJ2A 4A8JA 1AM4D 3R20A 5CB6A 5H68A 4DWJA 5AR1A 1NIPA 4TYQA 3IEUA 1VG9B 3G5UA 2OILA 2W0MA 5CK4A 4QKQA 2ZRBA 1YE8A 2YYZA 2ZRHA 2ZSEA 1ZD1A 4WZBE 1E6CA 5J4VA 2GAAA 4RVCA 1YR6A 4HAXA 2BBSA 2VO1A 2IHBA 3SQXA 1VG0B 1XB2A 3TVDA 1ZC3A 5L3QB 1D2EA 1E0JA 3U4QB 4FI3C 1JR6A 1A82A 3HP1A 3QXXA 1NY5A 2C78A 2Q0HA 2KE5A 3FMPB 3RVBA 1R0XA 4M1WA 1NP6A 1SXJD 1S0UA 2AXNA 2LKDA 3W6NA 4G5GA 4DSTA 1UF9A 1Q20A 1Z28A 2QAGC 1YZNA 1IXSB 1ESNA 2VP5A 1JBKA 1E9AA 3KZ1E 4TQ9A 2CBZA 1HE1C 2RGGA 2OESA 1LNZA 1W7AA 4Q4AB 1Z6XA 1E3MA 1CULC 4D4KA 2DYKA 3MAAC 4LY6A 4B3XA 3K9LA 1R10A 2VEDA 4AURA 3DMNA 5JI3E 4CVNA 3BXZA 2NO9A 2ANBA 4EDHA 1RFLA 1QDEA 1SVMA 4TYWA 4FCWA 3BB3A 1G8HA 2I3BA 4W5JA 2PL3A 2WIAA 1T3SA 3NBFA 2HUPA 5KU1A 4L8GA 1XDBA 1BS1A 1SXJC 4YDHB 4R2IA 3HJNA 1TMKA 4PHHA 2X2FA 1SULA 4QL3A 1H8HD 3PUZA 2V1XA 4OHWA 3VTKA 4BFTA 1P60A 1P5ZB 4MGYR 4PPFA 3JZAA 1Z6GA 2GZAA 2IT1A 4TN1A 2NO6A 4DSNA 5EQTA 2BM1A 4RD6A 1OB2A 3ZVMA 1FUKA 1N6LA 1RRFA 1Z5ZA 4C0BA 3MJHA 1JEEA 2YV5A 1FQJA 1II0A 2QMOA 2RAPA 3WP1B 5DI3B 5HCNA 4TQUS 1SQ5A 4NMMA 3GLGB 4B3GA 4BEJA 4DLZA 2QP4A 4KI0A 4XWOA 1T5LA 3BFKA 4F38A 5JRZA 2AHOA 4JL6A 5IDVA 1BYUA 5G40A 2J0SA 4QC2A 2QRZA 4A2PA 4C3ZA 5C18A 1WB9A 2FPKA 4P4TA 3KFVA 1IY1A 1YR9A 3OEHA 4RKFA 5CYOA 2WJJA 1EK0A 4AIIA 1KMHB 3AF4A 1FMLA 5DE3A 1E98A 4G0NA 4X8LA 3AVUA 1E0KA 1MABA 1NMXA 4LPKA 3SBEA 3BFXA 2IYLD 2YOHA 3CH4B 5JCZA 2QE7D 4TTPA 1U98A 2Q9CA 5JLJA 1EWQA 1II9A 3WYAA 4PZLA 3U3JA 1HT1E 2JEOA 1UBGA 1S1CA 1H8ED 1HT2E 1W36D 2IW3A 3TW4A 2WHXA 3K09A 4QGHA 1G6OA 5D3MA 4BQSA 1CR4A 3LVRE 1EFTA 3DO6A 3NWJA 4C0AC 1ZU5A 2FGKA 5J4HA 3AH8A 5AUNB 3R8CA 2A5DA 3WHKA 4B3DA 3IEVA 1A4RA 1SXJE 1BOFA 1HH4A 4YXWA 2CK3D 1DO2A 1ZJ6A 2EWVA 2GBLA 2P65A 3EXAA 3N2EA 4HB0A 3IDQA 4K8OA 1S3SA 4HB4A 4ACAA 4P31A 4Z1MD 2GXSA 2X8AA 3TAUA 4E09A 4JSYA 2UKDA 4O25A 5C1BA 1KI8A 4NYIQ 3TQCA 3ADCA 5HKKA 1ZRHA 3DKVA 1M8PA 2NTYC 2W6JD 3A58B 4HDQB 1W36C 1SVWA 4DEXA 3N2IA 1KI3A 1LS6A 2CE2X 3M6AA 1XP8A 2ZE8A 4OHYA 4JVSB 4LJ9A 4PFSA 1DADA 3ZDQA 1C9KA 1E4YA 3GJ7A 4Q9KA 4PQFA 5ELXA 3CONA 5G3ZA 4PZYA 4A2WA 3BORA 2VLIA 5JECA 1VMAA 2VQSA 1CEEA 4N1AA 4GI7A 3ZZUA 3R7WA 1G5PA 2IYZA 4DT1B 2J9RA 1W49A 2CNWD 2IEZA 5FPSA 4CEHB 4Q4JA 4URWR 1Z6YA 4X8HA 5EJEA 2ZRJA 1YRAA 4FXPA 1N6NA 4JSTA 2FE4A 1QG4A 4RKEA 3R9IA 2G77B 1HE8B 1GKUB 1JAHA 3LW8A 4BZXA 4F93B 1AJEA 4YMSA 1Z83A 5AJVB 2G1JA 4RZUA 5FBLB 3SU8A 4A8JB 2WWIA 3KKNA 1UDXA 1U8AA 4TTRA 2ZE5A 5FUYA 3PG5A 3VHXA 4CIDA 3F5FA 3NH6A 2OBMA 1T3HA 4KO8A 5FPTA 4ZCIA 2ZJAA 5DO9A 2O8FB 3I92A 4TLBA 1PLLA 3TBKA 1CJKC 1UKZA 2IWHA 4A92A 2NO1A 1HURA 4F7WA 5FL7D 2NO7A 2UZIR 1PJRA 3BIFA 4GPTA 1KJZA 2Q3HA 2ATXA 3S1AA 1ZNYA 1CTQA 4RJLA 4BECA 3THXA 1E2NA 1NKSA 2YOGA 3VX3A 2A7QA 2A3RA 2QMUA 4DB4A 4Q03A 2CJWA 3REFA 3CNOA 4B71A 3PEUA 4ASUD 1NG1A 5KNDA 1RYFA 4P4UA 2JA1A 3CO5A 3IUYA 3QIAA 2HJVA 5LD2B 1MO3A 4KU4A 4D0GA 4RCYA 3ADBA 3Q72A 2VF8A 2HXYA 5JZVA 1U2RA 2CXXA 3GCGA 5FI1B 4KSBA 4BFSA 2XOKD 2SHKA 3LRPA 2EFDB 4LC0A 1E9EA 2F1IA 4DLTA 4JLOA 4Z8YA 1DAGA 2R44A 1NMYA 3NHAA 1HTWA 5EE0A 4II7A 1G19A 4L4UA 2OAP1 5B64A 3RRMA 3THWA 4IXMA 3UG6A 2VRWA 2QBYB 3CR7A 3L8YA 3LD9A 2DB3A 3MRSA 4YQFA 4BGDA 1E2LA 5E3HA 1QHHA 1BIFA 2WSSD 1TQ6A 4IVPA 4QRHA 1NMZA 2ZS9A 1P6XA 2JLWA 1IM2A 1R5OA 2ZSDA 3FE2A 4K81B 4WZAE 3AVPA 1FNNA 4WBSA 2J45A 4A4DA 3BRWD 4PXAA 4A1FA 2TMKA 2Z83A 3GFPA 1AGRA 1VIAA 4Q9HA 3MG9A 4LJ6A 3TUZC 3E2IA 3GLHB 2IXFA 3H84A 3CKLA 1AQUA 3ZIAA 4RD0A 2OO7A 3IQWA 4M1KA 2ZRAA 5LPNA 1NBMD 4PO9A 3CWZA 5B57C 2PMDA 4G5QA 4LUCA 3LW7A 4HLDA 1YZUA 4HUQB 3QF4B 4KBFA 2Q9BA 4IFBA 4NZYA 4RY2A 2A5YB 3HU2A 5FOUA 2OZEA 2ZREA 3DM5A 3IILA 3MGCA 2EFEB 3TSOA 2O8EB 1NVUQ 3ADKA 1F3OA 4URZR 4PAOA 1KY2A 4BEBA 2QL6A 4B43A 1UFQA 3K0CC 3VU9A 4M2LA 2XEXA 2IA5A 4Q66C 4I1OA 2FFHA 4FMDF 1XEWX 2IXEA 2OHFA 4IVRA 1XPRA 1TU3A 2A78A 3IHWA 1TEVA 3QVVA 4OJKA 4AI6A 4A0FA 2VHQA 1Y3AA 1ZM7A 4IDQA 4U00A 4XD7D 4OI0A 5SZKB 2C96A 4V0ME 3FGNA 1LS1A 4HB3A 3AV0B 1A5TA 3ND9A 1N5JA 2CL7X 4P0TA 4Q7JB 5J5CA 3DZDA 1KI6B 1OIXA 3KDSE 3SZRA 4DLSA 1M7BA 1E1RA 2YWEA 1GAJA 3VR1A 1O3YA 2WPDA 1NSTA 1S9HA 2ZIAA 3D3QA 1RJ9B 5FUXA 3E1SA 5CK5A 2J7PA 3T12A 2VP6A 3FHTA 4EQ6B 1XXHB 5J47A 1CRQA 2VSOA 3DMDA 3NDPA 4C0KA 4KYIB 3EZ2A 4Q1CA 3LBIA 1NRJB 5EXTA 2P6NA 2O52A 2QGNA 3EZ9A 3QPVA 3IQXA 4GL2A 4QG7A 4DKXA 3P1JA 4GP6A 4HZUA 3IIJA 4G5SA 1AQYA 1VYUA 2VA8A 3CPEA 2J0VA 3PIRA 3PUXA 3QBTA 5TY0A 4JZKA 5L3SB 2VHUA 1KI9A 1U9IC 2OCYC 1KSHA 1ZBDA 2N46A 2XSZD 4GZMA 3WRYC 3AVYA 1K5GA 4OKSA 3LQRA 2J0QA 2E1RA 2XNDD 2XTMA 3EARA 1VKJA 2B7BA 1KK2A 4N0EA 1G3IA 3V4FA 4DC9A 2IS4A 1G8YA 721PA 4H9GA 1FFHA 1OXXK 1GZSA 5B30A 4QHTA 3NBXX 4LV5B 1II8B 2G3YA 1WXQA 1CF4A 3EPKA 1TUIA 5JSZB 3BBPA 1NBME 1M74A 2WWWA 1G4UR 2OFOA 1G41A 1WE2A 4HLUA 4N0DA 4B34A 2ODNA 3ASZA 4FWTA 2F43A 3MCAA 3THYA 4P32A 1SHZA 3GEHA 5BN4A 4C4PA 1KKMA 4TMVA 5JWRA 1D9XA 4V0KA 3U5ZB 1OF1A 1QHGA 1KO8A 1F5NA 2JLVA 3MWLA 1XMSA 3SYNA 1U0JA 4MITA 1BO6A 1CJTC 1DAFA 2ATVA 4TZ6A 4OHZA 1ZNWA 1KI4A 2JJ1D 3AB3A 1E9BA 1U90A 4XVRA 3LH5A 4ITRC 5LB4A 4CGZA 2QAGA 2B6HA 5GJWC 1OXVA 4Q21A 2BKEA 3U60B 1PVOA 2KB0A 3IKJA 4K46A 4KSCA 2OEPA 4IW3B 2VF7A 3WXMA 4RCZA 3BD9A 1Z0IA 3JVVA 2FOLA 1M7HA 3K9HA 2OE2A 4GMXA 3THOA 4EFNA 3KQHA 1E0AA 2R62A 4JLNA 1WDTA 2HF9A 1U8ZA 3U6KA 1HQCA 2BCJQ 1P3JA 4W5HA 5LBIA 2J0UB 5DNYB 1SXJA 4MUAA 2J1LA 1F2TA 1B0UA 2ZUBA 1UBCA 3I1FA 3QXHA 3TJZA 3LXRA 1NI3A 3B7GA 3RRZA 4B6FA 1IN8A 1WMSA 2CHQA 5HCIA 4BLOA 4IDPA 1AS2A 1K6MA 4C0QC 2P6UA 1LTQA 4JYCA 3RNLA 2GAOA 5DIFA 1Q1EA 4E07A 1JR3A 4CEIA 4QM6A 1UEIA 3NBYC 5KTYA 4ABYA 2PX3A 4V02A 4HLQB 3RS4A 1D6JA 2H16A 3GFOA 3M1IA 2LWIA 2CE7A 4EPXA 3FFAA 2F7SA 3AF3A
chains in the Genus database with same CATH superfamily
3SOPA 4Q4HB 8MHTA 1NLZA 3L0CA 5JWHA 3GLFE 3VDXA 1EX6A 3MVEA 3EXEB 3EA0A 4PBTA 1BCSB 3ZR4B 5L6MB 2B1JA 4V0OA 2YIMA 3KYDB 1VJ5A 1SCUB 2O8DA 1Z4QA 2O5RA 1K3UB 1QHYA 3WNZA 1M33A 1N5OX 3G2HA 4MVJE 3QNUA 4E31A 1KMCA 2PH3A 3KSZO 3HPRA 3IVMA 1LDYA 4E5YA 4NV3A 4YLYA 1Y6GA 3PI7A 1FP1D 3H97A 3PWSA 4BFXA 3DEFA 4AYXA 1RACA 4ZZ0A 1Z0AA 4ZO7A 3OT5A 1WBJB 4LY3A 4AROA 4IUCS 4JK3A 4DMKA 1YZLA 1W93A 4F3KA 4M6WA 2GSWA 2PWPA 2X42A 4ZT3A 1BMQA 3QEAZ 3UAZA 2ORVA 1NVMB 4GE3A 5BRNA 5A4AA 2FUCA 5T5QA 1OLSB 1NFRA 1ODJA 4B32A 4INJA 2QTRA 3UGTA 3ZG6A 3FPFA 1YS7A 1B8UA 2ACKA 4M55A 1L5FA 4LF7B 3FUVA 1CUUA 3KE9A 2ZTUA 5K3FB 4IIDA 2GF0A 4O4IB 2C9OA 2YY5A 4EI2A 4TKZA 2C5EA 2O0JA 2Y1GA 3DEKA 3IVRA 4KXUA 4PVDA 1XNRB 1YXMA 2F64A 1XKTA 3F9CA 2J9GA 3O95A 4WZBB 3A6LA 4OH1A 3VO9A 1SVSA 2I3AA 4QFDA 3CINA 1W85B 3GI1A 5EP4A 5AOCA 1OYYA 1Z63A 5K1ZA 2HJ9A 1A95A 4ECAA 2YRWA 4IGFA 3WIEA 4MO9A 1AD2A 3W9BA 5KQMA 4YT5A 4EGCB 1VMDA 3QU2A 2QE7A 2ZBQA 1A7JA 2GPSA 2AD5A 2HZ7A 1SC6A 1FFEA 2C0QA 4PFKA 3QI2A 1CUBA 1AF7A 3VR6A 2CV0A 1U4NA 1W46A 1TK3A 5I9TA 3WAJA 1ODIA 1FBNA 4P38A 5D01A 3HO6A 1T0HB 4CG3A 1VBMA 2DX7A 2EW8A 3IQGX 2FPIA 3L7LA 3NWEA 3EJ6A 4Q3OA 1C3EA 2RHWA 4NFLA 2IHVA 5AXCA 2WUVA 3H19A 4ZYYA 1IG0A 5ED0A 2ZWPA 1U1DA 2BC9A 3KQTA 3L43A 3FYDA 3MILA 4I6JA 1T1EA 5BSUA 3ZQ4A 3QHAA 3H4TA 1OAAA 2V9CA 1TCCA 2ZUVA 1UC8A 3IRUA 3ENZA 2R6DA 1KHTA 4JI1B 3UMRA 2DFLA 2B5VA 2HMYB 2GEDA 2VP0A 1YL7A 4JLAA 1JFSA 2H1HA 3VXKA 2AEMA 2H07A 2WWYA 1X8JA 4PHTA 1ACMA 1Z68A 3A1SA 4D9NA 2ZTSA 4N18A 4RIEA 4JIMA 5AI8A 4B83A 5I4BA 4LZOA 4B2IA 2Z6AA 2A8YA 1OOEA 1CY8A 2WSYB 3ND8A 4PNHA 1VCHA 1UM9A 2O05A 4U02A 3TQOA 3LLVA 4NPCA 4KVZA 1PK9A 4EB0A 3G2NA 3KQNA 2REQA 5D8DA 3BC1A 3FNQA 4GLJA 1BN7A 3FHOA 4LVCA 5IJ9B 3F98A 4HQ6A 1DKRA 1LV8A 3A9RA 2XUAA 2VCHA 4BAUA 2FSSA 2H7CA 3BTVA 4TQAA 5ULLA 3WYCA 4RANA 4BMCA 4YMVA 1CUDA 2GD1O 4BX9A 1NMSA 1CVRA 3HBFA 5LMZA 4OX9Y 3FFBA 3CN7A 4LI0A 3UANA 4IM7A 5A05A 2I03A 3K94A 1Y33E 3P45A 3VUFA 1FC0A 1RHRA 4WJZA 4PN3A 3ROXA 1N2HA 1E1LA 1I2CA 3EDYA 4TTJA 4XCVA 2O8VA 5IAJA 3CSUA 2P5UA 2YZ7A 4L5CA 2XZTA 3CRZA 4GQIA 4BTVA 3WMEA 1QQ5A 3BMCA 1RVDA 4MUBA 4ZOLA 3PVSA 4G1MB 3P2OA 2Q9UA 5JZSA 2CUNA 121PA 2A30A 2B4RO 1V8OA 3CZ9A 3GCDA 4FYHA 3LBNA 1QBGA 3I01M 1EJ0A 1QZZA 3GUHA 2I7XA 3OZCA 2IC5A 1I3MA 4TTSA 3RAJA 5B3LA 2E2WA 2WJIA 1JU9A 2BONA 5B1IA 2E55A 4CM4B 3OLCX 3K0HA 3BE8A 2HN9A 1J9EA 2AC2A 1RE0A 4IIUA 4PEVA 3RUEA 3P0FA 2NG1A 4RGBA 2H4WA 1FDIA 5JD3A 1VTKA 5M04A 1VL8A 1JLLB 2X86A 2FFBA 1CU1A 2R6GA 3SC2B 3PFWO 6REQB 2EF0A 1EHYA 2ZBVA 4P80A 3AUAA 1P0PA 4BWYA 3B1FA 3TCKA 2G4CA 2IZOA 1PWXA 1A4UA 5JCOA 1NXXA 1C3LA 1U2GC 3WS7A 1E2KA 4TROA 3ZWKA 4YTEA 6Q21A 3CVYA 2FSPA 4YX9A 1RVV1 3UW1A 1Z5WA 3I9V1 1EFVA 4CQMB 1AXRA 2R1TA 3ER8A 1T36B 4YRZA 1L5HB 3HY3A 5AM1A 5KYNA 5LQAA 3AEKA 2XYPA 3PUWA 5BYKA 4HS9A 1QC5A 1JEQA 1YC5A 5KDLA 2MSEB 4CJXA 5BWNA 2XVAA 3IRVA 3UPDA 1JQAA 4BQEA 1PEDA 1CUZA 3N3AC 1B00A 3AIMA 3KJNA 4RXMA 3O38A 4HLUC 3S3TA 2FFRA 3SE0A 3UEOA 1PBTA 3VVCA 2C2YA 3VNBA 2VDNB 3HA7A 1KEWA 1QX3A 2VWHA 3ILXA 2RBKA 3JYOA 3UK7A 5BV8A 4G25A 3KVVA 2QRUA 3MOGA 3QUSA 3LO5A 1DRVA 2BT4A 1MOZA 3HYNA 3MCZA 4LNAA 1T1RA 4DSZA 2DBZA 4IS2A 2HRBA 2ASVA 3U3RA 1YB2A 4TWZA 1QKJA 3ZWVA 4CN8A 1A72A 3I6QA 1KVQA 4O2BB 2EG5A 5D87A 3RUAA 1SA0B 3MINB 2WVJA 4DLXA 1WP9A 3TMYA 3U13A 2BGUA 2I4OA 3FVQA 5T3UA 5SY4A 3ZDYB 1RM0A 4UHEA 1DAKA 3HNOA 1N8KA 3BXFA 2YZKA 3CT4A 4P53A 2EZ4A 2F8SA 2MSWA 2X0JA 2W93A 2VJYA 2I2AA 3DB1A 1A69A 1PQPA 2ZFUA 3U3DA 1RMYA 5AT1A 3WKBA 4ER7A 2FZWA 5JBQA 2DGDA 1KJJA 1XRSB 3MBKA 3DVSX 5CGZA 5D6OA 1XTBA 4XJSA 3C3DA 4YB8A 3NIBA 1FW6A 2B69A 3GOHA 3U7QA 4PX9A 4QUDA 2DH5A 1VPLA 4D46A 1QJCA 2C2GA 4NBNA 3D7RA 3Q2OA 1NBMA 1ITZA 1C29B 1PFVA 1WOMA 2E87A 3CLRC 3DGEC 3FI0A 3IVGA 1GPKA 3BSWA 4KZPA 2H5IA 3ZDCA 5TF0A 1QYCA 2YZ2A 1I3NA 5TQ0B 1CUWA 3F6PA 3JYHA 4QSHA 4DB2A 4CLHA 3STWA 1Y8QB 1SVOA 1YA8A 5K8VA 1X1DA 3AZQA 3OD1A 2WU1A 1I3CA 1VPVA 2XMPA 4OJTA 1E0SA 4FGSA 3E81A 5IUKC 2IPLA 1EUDA 1WXDA 2PX0A 2PXCA 4KBGA 2DFDA 1CZRA 1SUBA 1U7DA 1BW9B 2W6QA 4OB7A 4OM8A 2ZRIA 4ZC1A 1CHNA 1ZIDA 3ABIA 1TU4A 3CKKA 1IHOA 1H2RS 4DMHA 4CTKA 221PA 3K30A 3HY4A 2ZRPA 4YRKA 3DEZA 1KYTA 3KYIB 2WIJA 1AHIA 1ZUIA 4HNGA 2W6ZA 1ZXLA 2C1ZA 1U8EA 1U94A 4WCFC 1R7RA 2XHEA 4XZ3A 4WXMA 1BGVA 4E12A 1ZIPA 4R9NA 2CDAA 4AWXA 1A8HA 2D0OB 4Q1FA 3RBAA 4FJ1A 821PA 5KKAA 5IT5A 1HT3A 1F7VA 1XTJA 3H1EA 3H99A 2JFGA 1RBQA 3U19A 3BCSA 1BH2A 4INZA 4PSUA 1KKLA 2OP1A 4KACA 1W35A 4D5GA 1J2UA 3EX7C 3V8VA 3OM1A 1TM5E 3K9GA 1I2AA 4DILA 1U9IA 4HGQA 3LCRA 4N7BA 3WRYA 1NFQA 4DZZA 1B6RA 2Y8EA 4PIVA 1OY1A 4WXYB 3WL8A 1JHMA 2WQ6A 5IDQA 3I73A 2B6NA 1E3WA 2GHIA 2RHMA 3MJTA 4JDPA 2O2IA 2C99A 1R16A 2QTFA 3Q3JB 2ZI5A 3H2ZA 3KFXA 2H4FA 1D4AA 1OLUA 1WDWB 4WTOA 4F6LA 3GLQA 4R51A 1RM4A 1Q16A 1ESMA 3VR0A 5F33A 5KQGA 1Z56C 4YV7A 4MAFA 1RADA 4EKNB 1E63A 2V97A 3R6LA 3KDPA 3T1HB 1Y8RB 3D6AA 2VT7A 4B9EA 2UVDA 3VPXA 1ECGA 1UMCA 1BDIA 2BFCB 5AIBA 1RJDA 2FW0A 3LNCA 4U0KA 4YMUA 2B9VA 4RY8A 4MV7A 1X7HA 3HXQA 1IBRA 4MB6A 4NDNE 2E4WA 4Z49A 3TLJA 5KQLA 1TMYA 2OQRA 3BYZA 1JHYA 3ED1A 5KYYB 3BK1A 2HF2A 7ABPA 4A6XA 1NR7A 2QN2A 3KQKA 2WLTA 3P19A 1LLCA 3P2MA 3E82A 3ZD6A 4ZV4A 2QTHA 2XNDA 1ABBA 1CK4A 1BE1A 3DTVA 4PNZA 2PUEA 2XDWA 2DCMA 3MIZA 2WDZA 2YDYA 1XCGB 2ZUTA 3TOSA 4C08A 5LZ2A 1T15A 2VH1A 4D26A 5CEFA 1Z6AA 5EL0A 4LQ4A 4UTVA 2PGAA 3FCUB 3O4IA 1E3LA 3S70A 5DRYA 4CLRB 2B1QA 4AJOA 1UZAA 4Y7DA 2GJSA 1PZMA 3HYLA 2JD1A 3M9WA 2Y0CA 3HYRA 4OG2A 5ECDA 4B73A 3TECE 2PIDA 1NX9A 3HCFA 1NNSA 2IPOA 3FX2A 5JXWA 2B3TA 2D13A 5FBKA 4UULA 5D3KA 3RABA 3B1ZA 2V7WA 1F5SA 4D0LB 2QR5A 2J07A 3FH0A 4E33A 1VRCA 2VQFB 4MWCA 4UE6A 2XCRB 3FMOB 4Q02A 1X1EA 1OTYA 1JR4A 1J42A 1RKXA 3CBQA 3ZV4A 4KQGA 1MX1A 1YNOA 1F4VA 5SZJA 3CCBA 3PWZA 4Q7EA 3C3WA 1E6WA 4O4LB 1IWBB 1SZPA 3JQCA 5AVYA 1RPNA 1KSGA 4YAUA 2N1MA 5JEDA 3UB3A 4UBMA 4R40A 1I7SB 1JA1A 4ME6A 2ZGVA 4CMEC 1GU1A 3G17A 3S27A 1ONSA 2IBMA 3F8SA 5BN3A 5FTJA 4US2R 4EX7A 1EFVB 3HDJA 1P1CA 1EDOA 4JA0A 2GA8A 3AEKB 3LZDA 1QRRA 3ENQA 1FLDA 1OXBB 2GEKA 3CVWA 4Q1DA 3U26A 2SCUA 2LCIA 1HR0B 5C8YA 3K1AB 4HQLA 1W19A 4ZI5A 3UIEA 5HUHA 3O21A 5KNBD 4TRNA 5DYIA 3DUFB 4AZ3A 1C1DB 4AU1A 2QMZA 1ILEA 1D6SA 3OZTA 1TF5A 5CT4A 4C0XA 4QTYA 2AVDA 3L9WA 4PYJA 2Z5LA 3W3AA 4Z0PA 4HY3A 1QO7A 2P67A 3H9JA 1PEYA 1RXYA 4IIFA 1T35A 3Q0EA 2Z0MA 5EPUA 5KZMB 1JG4A 3CR8A 4BNLA 1ISRA 5EN4A 4KVGA 1GRQA 3VR4D 3FZEA 4KIWA 2Q5LA 3ESCA 1TIBA 3LKBA 3O8DA 5BUZA 5ILOA 3L6BA 4BTLA 2G1KA 2P75A 1L8AA 4DCOA 1FF9A 1S3GA 1Z0ZA 2UYOA 2LBPA 3A05A 4RWEA 4ALKA 1NOJA 1BMFD 1C1YA 4MUYA 5C9ZA 1X19A 1J99A 1E2FA 2EIXA 5T6BA 4EG6A 2CVPA 4I6EA 4KUEA 1EDBA 2FNAA 2R1UA 2CD9A 3OD5A 1JMYA 4KXYA 2VT3A 4OU5A 3PYMA 1N0VC 3DLHA 2AYXA 1I6MA 3LUGA 2E48A 3JARB 1S2MA 1OD6A 2GN4A 3BIJA 3L6UA 1JNXX 1ISGA 4P1ZA 5HDQA 5IBRA 5BVGB 3VQTA 3LK6A 3P9KA 1P91A 2Q1UA 5AUQA 4G97A 2B78A 5EP3A 2FWAA 1YFJA 2EKLA 1YAHA 4EJSC 4G0PA 2OFWA 4AQ7A 2BR3A 5HVNA 5TGTA 2HJGA 2GKGA 1J0BA 5AFSA 1VMIA 2FMTA 4XQGA 4BO8A 1M1XB 1PVVA 1RPZA 2VSNA 4D4GA 4BNIA 1T2UA 1E77A 3R5SA 1IQRA 3H13A 2Q3BA 1CXZA 3PGA1 4C22A 3HVRA 1KA9H 3PGVA 3OTIA 5C7LO 1HM5A 3VZDA 4MS4B 4QUJA 1DCKA 1QZXA 3AONB 3F6YA 3RS3A 1ZK3A 4AJKA 1F4LA 4K6HA 4CLXA 3ETLA 4OOEA 3QY0A 2XQJA 2PZGA 3PXXA 4MUXA 2BGRA 4L6CA 1VI6A 4LNUA 4DRXB 3RYHA 1TU0A 1NSFA 1SBNE 3PCRB 3UAWA 1WZ2A 1SCQA 4O3MA 1GRCA 4JQOA 1DCTA 2BFBB 1U3TA 3X44A 3U3OA 1CR2A 2O8CA 5EGNA 3D7NA 3M33A 4C6HA 5CBPB 3IKLA 4H6PA 2YVKA 5HQ3B 2PGNA 3P9CA 3PRYA 2VHTA 4UE3S 5EE1A 5TV2A 3EB9A 3ICOA 1FNBA 3GROA 4BV8A 3INNA 3ZD7A 1G8PA 2IUSA 1NV8A 2ACEA 3P5SA 3E3OA 1GPMA 4OOFA 3G1WA 2RKOA 3AGPA 1D03A 2Q2WA 4OPMA 4D6PA 2QMQA 3B9BA 3PTZA 1MZPA 1KI2A 3RG2A 5DF1A 4QJ3A 4C7XA 3L7KA 4L8FA 1E66A 3NXSA 4BNDA 1N1GA 4HBGA 1JIUA 1VLLA 5TGDA 2QLBA 4ZC8A 4YRMA 2Q8PA 2PMCA 1PQYA 2C4HA 1J5XA 4PYQA 1NTOA 1P62B 2I7VA 1YCGA 1DAHA 3O2NA 1X1RA 2HSGA 3E3MA 3OJFA 5KQRA 3SD7A 5CITA 1IJFA 4B5LA 2VZLA 3RQIA 4E22A 2C4WA 4E1AA 3TNFA 5IKOA 1EGMB 3QXGA 4BY9E 1TZCA 1P9RA 2QTVB 1K0FA 4G2NA 4UQLA 3MT8A 1YD7A 3PFBA 4N65A 4YALA 2ZZKA 5JHHB 1K98A 1AE1A 1ZIXA 3FMGA 4V24A 3F7TA 4URYR 5CD9A 2VHWA 1SRRA 4BKUA 4URXR 5JNTA 4UUBA 1VDZA 2N1BA 2P90A 4GBMA 2UVPA 4MS3B 3FUWA 4HLNA 4MR9A 4X8OA 5EZYB 5K3OA 4L8WB 4QBHA 3FWYA 4A8TA 1EWKA 1DOZA 4IIBA 1EFRD 2VDOB 3G0DA 5CT9A 4JLPA 3OIWA 2BSQA 2ZSAA 1L8XA 2BKXA 2Z3ZA 2FZKA 1MPTA 2ZEJA 2G7ZA 4GP7A 3RUPA 3U7RA 3VTAA 4W5TA 4F12A 3Q8KA 2EATA 5K6AC 4OLHA 3U9LA 4YJHB 4XSHA 3VKWA 3QVUA 2PKXA 3LCVB 4YV1A 4GGPA 1BE0A 1HT0A 1P39A 1U2GA 1XTIA 2IJGX 1TKBA 2XTJA 4KQIA 4OHRA 5AOVA 3T8YA 5LQDA 1EINA 1CJCA 2FX2A 4BJ5A 5K20A 1L7PA 1VHLA 1EH5A 1JWAB 4Y2UA 5C3MA 4I4IA 2GCNA 3DFKA 4RQUA 3UUGA 1Z39A 4BIIA 5KUTA 3A4LA 5A6SB 1K7CA 4HAWA 4MUGA 5LQCA 1EYZA 5HM8A 5KNCA 1O54A 4FIDA 5EXPA 3Q88A 5EJ5A 1DKOA 4Q16A 3CTMA 1CY4A 1TNDA 2Z43A 1UZLA 5ALWA 2RGXA 3HJHA 5FT9A 4BXOA 4L57A 3OAAA 3K1ZA 4RXTA 2FSIA 3CX3A 4OTZA 3AUSA 2SCUB 3LHIA 2HWWA 4I14A 4B48A 3VVBA 3E7PA 4I66A 5F9FA 5FADA 5FTMA 1K6JA 1UQTA 1SKYE 2G40A 4KFSA 2IOQA 4U2EA 2EARA 2V7BA 2JGFA 3FGZA 3IAHA 1KAOA 4A7PA 1P0QA 2O0LA 3ROGA 3QIVA 1QB8A 3FNGA 5IANA 2NSDA 5BR1A 1C4OA 3ZXSA 4CI9A 1JVNA 1NLYA 1WHTA 2ZT7A 1DP4A 4BJ3A 3CZMA 3EVTA 1CNMA 1VFPA 2FMXA 4UNSA 3ZHXA 1TYDE 1E2HA 2CLHB 6NULA 5A5FA 5JXHA 2CV1A 3IAM6 4IICA 3OE5A 2WSMA 5AJWA 5ILGA 3TQSA 5H3CA 4C7VA 4WLOA 2XDAA 4DDVA 3EC7A 3T0GA 3WYGA 4TKMA 3O75A 3DQQA 2CJWB 2VAPA 4L27A 5JCJD 2R47A 1GQYA 3CEJA 4L95C 1KPIA 1N5LA 3R3ZA 4CLEA 1TVEA 1U2EA 3PXEA 4WK0B 3AEZA 3DEAA 2FQYA 3GY0A 3C1OA 3PKZA 4A36A 1F51E 2R6FA 1ATIA 3T5DA 3GHHA 1GITA 1R0BA 1E94E 3KTAA 1SZCA 1PJCA 3LWDA 4FZJA 4Q05A 2P2CA 3FPEA 1XHFA 3KOWA 3FZGA 5HILA 3QV1A 1WDLA 2HPZA 3SEQA 3TXYA 1ADCA 4OB8A 3UWMA 4BX8A 2HI0A 3C87A 5SY6A 2M6LA 3DYVA 3I9FA 1QE3A 1JFLA 2WE7A 4IKOA 4JB8A 5TJHA 4A2CA 3G9XA 2OFPA 2NYAA 2QVLA 2GK3A 3BFJA 4NE2A 4OM7A 1XKXA 4WKNA 5F1KA 1QHHB 5A7HA 3TJRA 1NXTA 2VZ0A 4L78A 2GA9A 2D4HA 2GBIA 2DHQA 3HDTA 3QVTA 3IE2A 4LPSA 3MCWA 2FMKA 4Q3DA 4UATA 3UGQA 5IDXA 1M1YE 1WUKS 3NTXA 4N03A 4DIMA 1XRPA 3HDQA 3WICA 2Q5EA 1E6LA 2GZ1A 5AOBA 2HT6A 4AJHA 2GVNA 3V4ZA 1XTKA 3AGQA 1FNCA 4HMPA 4Z4CA 1RP1A 2O7RA 4J9UE 4WCFA 2W4QA 1NDUA 1NHGA 1USGA 1IXKA 2QD5A 1IBSA 2LXNA 2QI9F 3Q8WA 4LOAA 4YP1A 3Q6MA 3S0JA 1G8GA 3L41A 3R5TA 1UBHS 1JALA 2VNSA 4E94A 5CDFE 2O2XA 2PXHA 3PD0A 1E89A 2FEWB 4JUAA 4DR4B 5EIXA 3L7DA 3TIXB 3GXBA 1MH1A 1Y80A 4YRCA 2WU8A 3JU3A 1LEHA 1PR6A 2GJKA 3ON5A 4LHZA 3MSXA 4UXHA 1RQRA 5L7YA 4KAFA 4XI9A 3UAYA 2PGIA 4M4SA 3PLAE 2VSYA 3GDWA 2WHQA 4Q3KA 4ZXFA 2ZYDA 3W5BA 3HJUA 1G291 2AF3C 4GQBA 4EPWA 1NPTO 3PC8C 3T99A 4DUGA 5GV8A 1E3IA 1KFEB 5JXJA 4NV1A 3E1GA 3KLOA 5GWXA 2XA2A 1AKVA 3R23A 1RQXA 3R3VA 5B37A 4YREA 3GEEA 3OJXA 4D92A 5K3DA 5K0NA 1R8JA 1PD0A 5ISMA 4Z4GA 3D0QA 2J59A 3QWIA 4ZV9A 3SG0A 1MQ8B 3OZIA 4GT1A 1J2RA 1KYQA 3JQFC 5H9VA 3IV7A 4YPVA 2PZEA 5DISB 3ESAA 3BJIC 4Q4AA 2WHEA 2NO0A 2A5GA 1T8YA 1HMPA 1MC5A 2WJVA 1IH8A 1X7DA 3CO0S 3JWEA 3QP9A 4AJ9A 2BMDA 3MJVA 4K6CA 5K2OA 5B3JC 3OQIB 2Z9DA 4W1PA 3K0KA 3KCQA 2X4DA 2PTGA 1FTWA 6PFKA 3RYFA 2JIZA 5FBVB 3VDQA 1FS4A 2RGAA 1GZDA 1DWPA 5LOVF 4R41A 4YMGA 3QBVA 1P81A 2BFEA 5DN9A 4FTWA 1OH8A 3COJA 1XJ5A 5ENVA 3EY4A 3QKWA 3IOCA 4D82A 4N3CA 3IE0A 3DONA 1H0RA 3ZOZA 3L77A 1JSZA 2EFCB 3PC7A 1BWSA 2PQ0A 3BXXA 3IDFA 4FS8A 1VXRA 3GDOA 1C9EA 3I9JA 5HJEA 1UXJA 3HZRA 3S2FA 3WGOA 1AY0A 4UJ3A 4ENRA 2BOVA 1KJQA 4BFYA 3GGGA 2BTQB 6ADHA 4NKRA 4ENWA 5IF3A 2OHVA 1BDJA 4G84A 3JATB 3M1AA 4U9IS 1P61B 1TYEB 1WIWA 1J0CA 1UFRA 2V7EA 1RYZA 3QLUC 1IC6A 1LFDB 1N6IA 2UUPA 1SG6A 4NZOA 3HP7A 3R09A 1P2UA 5EMNA 4FYPA 5ENZA 3HPQA 5ELLA 4OXIA 2YNMD 1MGPA 3FSEA 3A8TA 1WTAA 1N9ZA 3H8SA 1Y4DE 3ZE8A 3U17A 2X0NA 1IEQA 3BM5A 4Q3BA 5A0FA 5IFLA 3IQFA 5CTAA 1KVTA 3C6MA 1NHWA 1CKEA 4XQCA 1UAAA 3Q1KA 3EPJA 1D2RA 2GN1A 4OJQA 3V97A 4B0PA 3DZ8A 3OE1A 2ZR0A 2CXQA 3LYHA 621PA 1E3TA 1JLKA 1Z7YA 2QTBA 2Z9BA 3FCEA 3THYB 1XUOA 3W0LB 2BCEA 5AW7A 4WKCA 1BA2A 3PD7A 4XIIA 1C7JA 1EE2A 1P2BA 4D4LA 1KEUA 5IAAA 4EITA 2O2EA 3OQNA 4C2UA 3U6BA 2XQFA 3MS2A 3HMKA 1Z17A 1CNFA 2HCJB 2XYQA 3U80A 3D1JA 3I39X 5F73A 2PUFA 4NH0A 5AVKA 2JASA 2BEUA 1HPLA 2P9JA 2ZPAA 3VPSA 1XN4A 3Q8LA 3ROQA 4QX6A 4BP9A 3EYWA 3TM4A 2ORYA 3NZEA 4CLOB 5DGIA 1ZJZA 3DHYA 3IT0A 1N5MA 2CNKA 2GF2A 2ROQA 2P2GA 3OFVA 2QUBA 4TL7A 3VKGA 1IBLB 2KJQA 3MMSA 5HJ2A 3WGNA 3ILYA 1E2DA 4F5EA 2JLZA 2G0NA 4MWEA 3F73A 3GRAA 1E1YA 4DWWA 3FWZA 4L0MA 1L4NA 3ZZMA 2XB2A 5HDBB 4EPTA 1FU7A 1W0KD 2HCBA 2PPLA 3HI6A 4IVQA 5E1MA 1XYGA 5IYZF 1NX6A 5I7RA 1MDBA 1DS6A 1N0UA 2ZJ8A 2G6TA 3LCMA 4WADA 3N8IA 4EZEA 4DM4A 5IZ4A 3OQHA 2J33A 4YONB 3ELYA 4JJGA 3U3KA 1BDMA 4C6SA 5B55A 1JH9A 4WDRA 1GQQA 3VAYA 2P0EA 2II6A 3VMMA 3CGGA 2Z4SA 1AQIA 1LSSA 2WYHA 4J76A 3E4DA 4JP2A 4KTTE 4RDXA 2PKWA 3GLKA 3KWJA 3KZNA 4PZUA 3K8ZA 2L18A 5F7OA 1IY0A 2FQ1A 2YIDA 3KUXA 3Q1LA 4PR3A 4AJIA 4DT1A 4JZYA 4WVFA 5DYNA 2XNKA 5G41A 3ZBPA 3I62A 3CNQS 4I1RA 4GBGA 5I3ZA 4YRNA 3E22B 1ANKA 3ELBA 1XZ8A 2AS0A 4LBWA 3WHIA 4CEHA 1EJ2A 1QRSA 1R37A 2OHGA 4KMOA 1QHSA 3SLRA 4JLJA 2H1OA 2XCUA 5YASA 4ND5A 1JSLA 3MCTA 3WQQA 5A9SA 3UMYA 1GQ2A 3KPVA 3TR5A 3S2YA 4HAUA 1R18A 3C3XA 3L49A 4L28A 4UNNA 4DLLA 5CLLA 2D74A 2OCIA 2H2IA 4RCVA 1STOA 1IUKA 5AVWA 5D3QA 2H59A 3N0RA 4ZOBA 1Z0FA 2FW9A 1GTG1 1E3SA 1CF2O 2QI9C 4FYWA 1GUFA 4DNPA 3NCTA 1BG6A 1GYRA 4PGGA 2PL9A 4IQ0A 3ZHBA 1Y98A 4KNVA 1E5XA 3S2UA 3I4CA 3PD1A 2DXIA 4RX1A 3H1GA 1TQDA 3ONFA 3A9SA 2O23A 3UT5B 1WA5A 4YN3A 2VT6A 2WM3A 2Q8NA 3GAZA 3HB4X 5COBA 2ORIA 5A4JA 3EPHA 2Q1WA 1O57A 1VBNA 4OFXA 2C4KA 3KC2A 4G1BA 2PH7A 1KQOA 1UBKS 2CVZA 2ZJ1A 1KK0A 1N57A 3CF6R 3IAS1 4M0FA 4QELA 4CQMD 5I8ZA 1A9ZA 2WV9A 1DIHA 1XEXB 4AJEA 4RS3A 1FS6A 4FE4A 1UT6A 1NF8A 1QYXA 1Y3BE 2OC4A 1XLWA 1YQWA 3UH1A 3TW0A 4C5BA 4ZK6A 3WLQA 4Y1GA 2JAXA 1GHTA 4PYKA 4I5EA 3TSWA 2G28A 5EHQA 7GPBA 3LP8A 3MAGA 5IN5A 3CLKA 3RYTC 1HFKA 3PQ8A 1AUQA 1MIOB 2RH9B 4WDQA 4PLVA 1E2QA 1TLTA 3UF0A 1ST3A 1G5FA 1VKNA 3IGFA 4FLFA 1H2EA 1JSXA 1TJNA 3QTLA 2WJ6A 2BIFA 3BAZA 5CLQA 1EHIA 1XF9A 2RCYA 4Z86A 3LV8A 1ZIYA 3L7JA 4EA7A 4XYMA 1P17A 3FWKA 2MSDB 1W36B 4Q1BA 2OAQ1 1ZM3A 2ZYVX 4N6GA 2BFNA 1CWUA 2OV1A 4FQ8A 4W1QA 3SGLA 4DR5B 3GR6A 5H4HA 2FQQA 3G7NA 1T34A 4GRAA 4MDFA 1D07A 4CIWA 1E3JA 2OV8A 5C4GB 5DRTA 3T3PB 3HHPA 3U7EB 3TW8B 3WNQA 3R4CA 5DN6D 3RR2A 2V98A 1XZMA 1DQSA 4NONA 1QRAA 3H9UA 2FA9A 4HWPA 2RI6A 3ZJYA 1MJNA 5A0TA 1VPEA 3OTHA 1QUEA 3GNLA 1OYWA 4RZ2A 4UBKA 3RVOA 4P4SB 2P2DA 4R7TA 2E6UX 4DZRA 5EJ6A 5KTKA 2XRZA 2JBHA 1EZ4A 3NC0C 4UW9A 4M1TA 4ZD6A 4C88A 2O2SA 2LGJA 2D0DA 1FXUA 2J48A 3D02A 4II3A 5AK5A 5HW0A 5JNWA 3OJOA 2QN6A 3HBLA 5JRJA 2QY9A 2XGSA 2BJVA 1M2JA 1KJ8A 4FR5A 2IY9A 1QHXA 2JBAB 4MPDA 5A1TA 4GKJB 1DC3A 5GTDA 4PSAA 3QF4A 3GK3A 2ZAGA 5HF9A 4LF6B 3EGVA 4NFHA 3V8RA 1J2JA 3B1VA 2WT8A 3NJ4A 3HJGA 2C0PA 4I9HA 3AM1A 2JGNA 3LIIA 2DWQA 3H1PA 4OLFA 4F9TA 5CFOA 1U2ZA 1W30A 3BWEA 4M89A 1SELA 2HPHA 1MO6A 1F7UA 2H2FA 2E4XA 5IDWA 2I80A 4AY2A 5TB5A 4IINA 3BJRA 5CLHA 1JI0A 4Z5XA 4ER5A 2NMVA 3PHCA 2PN1A 2X1VA 2FSFA 4GKVA 4MKIA 3GLTA 3EIOA 3U7JA 4AJ4A 2OHJA 5BV1A 2MCFA 2HWKA 4ZYUA 3DDWA 3H1BA 3I72A 3IFSA 1LPBB 3A6KA 3NO4A 4HZIA 4Z3DA 4DADA 2ETXA 3BGVA 4NOKA 4ZVSA 3VH2A 4D4JA 2PO5A 2DG2A 5DCWA 5AVTA 3CCCA 5UKDA 4FYMA 1L5YA 2C77A 3HKBB 2X9GA 4JJKA 1Y5LA 2VSFA 3SEZA 1KI6A 2J67A 2ZRLA 3DDSA 5ESWA 2O2GA 4A26A 3U44B 1PJTA 1J9ZA 2OB1A 2CDBA 3IUSA 4CNQA 1CDEA 4EKIA 5JS1A 3I9MA 4FFSA 4Z9YA 5EWJB 4JI5B 4EM6A 3DFIA 3GFFA 4KQMA 4ND6A 3C39A 3RVMA 2BDTA 4DTCA 4MPPA 3SDZA 5BMVF 5M34A 3OIFA 2NP6A 1U28C 2JGAA 4OX9B 3W04A 3SR4A 3BKXA 3M7IA 2W6MA 2RHGB 4GPD1 5GM2A 2RIPA 3VZPA 1RZRD 3UHFA 4TLAA 1AHHA 2QXUA 2G5TA 4BUZA 1P7CA 4ENTA 1O4WA 4IKEA 4EJSB 3G0HA 1FFBA 2EIHA 4MVJM 1KO7A 4RF2A 1H5NA 5D6NA 5BVHA 3NBUA 5CA0F 2OLKA 2ZIVB 3EGDA 1O9BA 4J1SA 2C9YA 2ZOSA 4TSFA 5FV7A 5EEGA 5A5EA 3ESQA 3ICPA 1OFHA 3ROKA 4K0KB 1ZH4A 1QSGA 1OH5A 1BEUB 3CZ4A 2C00A 4LFAB 2GJAA 4Y6GB 1DMSA 1XCPA 2FWRA 4OQFA 4Z7JA 5CYGA 3G85A 3ECCA 3RIXA 1AQJA 1W88B 4N5NA 2FUNB 2V96A 4W1RA 3V48A 5C4IA 4OUDB 2VF2A 4XFDA 3IPYA 1IM5A 4DF3A 2IBTA 1CEQA 4IHJA 5TQ2B 3RUHA 3UYKA 5CJJA 2F3SA 3WMXA 4E5UA 3QVSA 2NP7A 5BSRA 2O8BB 5K2MA 3M4XA 4GS5A 4MPRA 5ITZB 3H5TA 1KFBB 1PO7A 2X2PA 4LIPD 4KXLA 2IF0A 2IOFA 1GPWB 3IBGA 4US1R 1BU5A 1UP4A 3MWEA 4G41A 2WHRA 2ZE6A 3E35A 4IXTA 3TVYA 1QK3A 3DOJA 1PW7A 2RH5A 4R8KA 1SGWA 2X5NA 3O2QB 5JQGB 1NLMA 1RXUA 1JHRA 2Q2OA 2TMDA 2H8GA 3PC8A 1UC5B 3LDFA 3NTUA 4R3NA 5EKDA 1O0CA 3Q5GA 4DN6A 1AH2A 3RD5A 1V41E 5H70A 3ADPA 2X8WA 2R25B 3AUYA 3LCUA 1EEHA 3DVQX 4C5AA 5EKXA 3HRIA 4MW5A 1XTZA 3FF1A 3UT0A 3BGWA 3LPCA 2JIQA 3X3HA 1CERA 3AJ9A 4M37A 9LDBA 4URHA 5I6DA 5I9LA 3FCCA 1J7KA 2BMFA 4DNXA 2NOAA 4DW8A 4JU8A 4Q7MB 2QW0X 1VL1A 2BE9A 1SUIA 2DULA 3H9CA 3JQFA 2WJ4A 4LYJA 4KO2S 4NBWA 1TKCA 3FVTA 5KAMA 3GLGE 4KHPB 1KJNA 4HEJA 2A9VA 3K71B 3KLNA 4L72A 1O7JA 1F9AA 5TMBA 3C14C 2XT0A 3OPYA 3FPHA 3ZHQA 3PQDA 5B3JA 3GQBB 2I6SA 5AK6A 5ALGA 3DKPA 4DPKA 4YPOA 3A6DA 4HJXA 4JITA 5KYVA 3OLQA 1IJBA 4JJZA 2ZB4A 2VZ9A 5BRAA 1H6AA 4IMPA 1UR5A 4NK5A 3TPFA 1Q14A 3GVIA 3TR0A 5C32A 4D8VA 5FL3A 1DIAA 3JRWA 1JZSA 3BXPA 4YRIA 5CLJA 2IIPA 5FEUA 2OO5A 1AXGA 3W5HA 4AF6A 1SU6A 3U4MA 4HADA 3V4OA 4TKVA 1VFNA 5KS2A 16PKA 1JMVA 1XO1A 2DUNA 1P2GA 1NLFA 1YRLA 2RDMA 5KHLB 1QU3A 2BMWA 3NRJA 3VPGA 1ZSVA 4IHKA 2AGVA 3CPHA 3GJ3A 2ESRA 2G4LA 3GT0A 2V54A 3PZRA 3QLUA 1Z7EA 2HBQA 1ZI9A 1BQ3A 1X7ZA 2PUTA 1I3LA 3EDOA 3OCZA 2VJAA 4JT9A 3OX2A 3T7KA 1ZEMA 3WBJA 4C7MA 3LL4A 4BMVA 3KX2A 1A9SA 1F9EA 1SK9A 2BLNA 4R1SA 2HF8A 1JQ5A 1QR6A 1ULAA 3ABSB 3FLEA 1LBQA 3GFGA 4ZJPA 5CDHA 5A0VA 3KKMA 4LI3X 4XD2A 3DHVA 2B61A 2DWCA 4MP6A 4AKGA 5EERA 4EEKA 2ZR9A 2WNSA 4IDDA 1PE0A 2O1WA 1XZBA 4KX3A 4MVCA 1OXSC 3RI3A 4CCAA 4Z2AA 2VNIA 3C8DA 2BGGA 3TTSA 4DBVO 2ZSFA 3K70C 1D0SA 2Q29A 3QEJA 1DI0A 1SVLA 3V4PB 5KYWB 4P33A 4PQRA 2QORA 3SYTA 5DH9A 2AR9A 1MUUA 3D5EA 4PQYA 3PENA 3ZV3A 4DVJA 4NAUA 4Z0TA 3VPFA 1A2KC 4TS3A 1A9XB 1BFUA