4R98A

Chimera of the n-terminal domain of e. coli feob
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
263
structure length
256
Chain Sequence
KKLTIGLIGNPNSGKTTLFNQLTGSRQRVGNWAERKEGQFSTTDHQVTLVDLPGTYSLTTQTSLDEQIACHYILSGDADLLINVVDASNLERNLYLTLQLLELGIPCIVALNMLDIAEKQNIRIEIDALSARLGCPVIPLVATDTKNVQFVLKLAIDRYKANENVELVHYAQPLLNEADSLAKVMPSDIPLKQRRWLGLQMLEGDIYSRAYAGEASQHLDAALARLRNEMDDPALHIADARYQCIAAICDVVSNTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A GTPase Chimera Illustrates an Uncoupled Nucleotide Affinity and Release Rate, Providing Insight into the Activation Mechanism.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal transport
molecule keywords Ferrous iron transport protein B
total genus 85
structure length 256
sequence length 263
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
A PF17910 FeoB_Cyto FeoB cytosolic helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4r98A01
4DEYA 1L7VC 4GZLA 1XTRA 4LHXA 2NO1A 1VCOA 2WV9A 5HR5A 4LK2A 5CLQA 1NN0A 3ADCA 2EWVA 3EIQA 1L2TA 2WPDA 4LHYA 1T0HB 1JBKA 4DJTA 3EPKA 1G6HA 3A6PC 3I8SA 1N2CE 2QP3A 2F55A 2O8CB 1XEWX 3QIAA 1TX4B 4DEXA 2ZR9A 2WKRA 1P2UA 1X1RA 2FPLA 1RYHA 3FYHA 1KNXA 1M2OB 2N46A 3GJXC 2H1LA 4OHXA 4QM7A 1HE8B 4KBFA 4A8JB 1LV7A 1V43A 4M8NE 4R71A 5DNYB 4BFYA 1ZCBA 2PEZA 1KI6B 4TMWA 2VP6A 4GZMA 1CU1A 5JWHA 1ZD1A 1DARA 1JR3D 2IYZA 5HTKA 3ZZUA 2I3BA 1ZM3A 2W00A 4D81A 1DAFA 4DIEA 4JBXA 1WA5A 2PBRA 1MH1A 3GJ0A 2WBLC 5IHPA 3WP1B 1Q0UA 1NVUQ 3UWKA 1Q12A 1VIAA 1SULA 2ZSEA 1G3MA 3T1VA 2GF9A 4QNRA 4G5GA 1AA9A 1ZW6A 1MT0A 2D06A 2EFCB 1CR0A 1E2FA 1ESNA 1E2NA 3P4YA 4A8JC 4JKYA 1TADA 1GSIA 1XEXB 5EXXA 1MABA 1T6NA 2OLKA 2WOOA 3NH9A 4WVFA 4A0FA 1QVAA 4BQSA 4C0AC 2DB3A 2WVJA 4RFSB 1VPLA 2C04A 3ND8A 2JLZA 1D2NA 1OFUX 3PV0A 4HUQB 4LJ8A 1G7RA 1YRBA 4M1WA 5C46F 3LD9A 3WY9A 1N6HA 2CK3A 1FMJA 4F7WA 1FMLA 1WQ1R 2HJVA 5E4FA 4TQUS 3QEOA 3OIVA 2J0UA 4FINA 4OHWA 4WAUA 1NMZA 4GBMA 1N0VC 2D2FA 4ESVA 2C9YA 1EFUA 4RKEA 2A2ZA 3HDTA 3KQLA 3KXIA 4CRWB 1Q1BA 4Q01A 1JECA 2P5TB 3FHCB 4ERNA 4MYUA 1UKEA 1R0WA 2O0KA 2WWWA 1T3HA 1UKVY 1I2DA 2AKYA 5DHFA 3KJIA 2N42A 3JVUA 4LYHA 5C18A 4DSUA 4G5OA 1OXTA 2X77A 4EQ6A 1R8QA 3CIOA 2IX3A 1A1VA 1HT1E 2Q9AA 4U02A 3LV8A 5KSOA 4R9UC 4NMMA 621PA 1KO4A 3FWYA 1XX6A 3FKSD 1OHHD 2XNDA 4LZZA 4ASUD 4BZXA 2RMKA 2FA9A 1JB1A 2REXB 1KAGA 2G88A 4BRUA 2IS1A 3KL4A 1F2UB 1P73A 2Z83A 4ABYA 2XITA 2DY1A 4NPHA 4B76A 1K5DA 1KY3A 3AF1A 2BCJQ 3RC3A 1X1SA 3IQXA 1AKEA 3W6NA 2ZSAA 1BKDR 1KK3A 3JZMA 3TMKA 1N6NA 4LC0A 3BFVA 3IHLA 4PO9A 5L3VA 5A0FA 2FMXA 1Z3IX 1D9XA 1M7BA 2WJJA 1U99A 1VHTA 3ZVRA 1OKKA 1DADA 3SI7A 3BH6A 1E2EA 2J46A 1ZC4A 3AVYA 1UM8A 4PZYA 4V02A 1YR6A 1NG9A 4WIAA 3WMGA 2IL1A 4C0QC 5M04A 3I4LA 1US8B 4PPFA 4TMTA 3RRZA 1W4BA 1SVMA 2E87A 4HUTA 2I4IA 4AY2A 3GP8A 3T1QA 4LCBA 1G19A 2J5XA 3O8CA 1KKLA 3H1TA 2OUKA 3PUZA 1YU9A 4XWAA 1KO5A 2BBTA 5J4LA 3C5CA 4TYPA 5LBIA 4WW0A 4XD7A 4GOXA 2IS2A 1SVWA 3B1XA 5CYOA 1N6KA 1JEEA 1MABB 3AGPA 4LSGA 1BMFA 3FHTA 3UKDA 4MUAA 4QBGB 3T1OA 4EJSB 4LPKA 1FTNA 1Z6AA 2QAGB 4BASA 2ZTSA 1U81A 4B32A 1XXHE 2GXUA 3NBXX 3AM1A 2GETA 2V54A 1W4RA 2DPXA 1G7CA 4Z8YA 1JI0A 2PLFA 1DTSA 3RWOA 3GEEA 4HI0E 2IXEA 1X8JA 5HCIA 2OILA 3RS3A 2C78A 3A37A 3Q72A 5BN4A 2BWJA 3REGA 3RNLA 4NONA 2JJ2D 1MOZA 3GEIA 1BIFA 1ESMA 4FMCF 1Z0KA 5DN6D 1U0JA 2Y8EA 3CRRA 2QTVB 2QORA 4HLQB 3VR6A 4ZDIA 3CRMA 1E4VA 1U2RA 2JIZD 4B3BA 5HKKD 4TLDA 1NBMD 2C77A 4HEJA 4ASUA 4DT1B 2IYVA 3SR0A 3KFVA 2NQ2C 3EZ2A 5CM9C 2RGNA 2ZS8A 2OCAA 3EA0A 4Q9KA 5DISB 5KUTA 4QBFA 4BRWA 4LJ6A 2ORIA 1ZVQA 3QG5A 3CX8A 3MG9A 4FI3C 1D9ZA 1NI3A 4Q1DA 1SZPA 5LB2A 1JQJC 4JL8A 2O5VA 2D2EA 2ODWA 1KK0A 4PZZA 2AXNA 1GAJA 4RJLA 1SVIA 2J0QA 3CBQA 1AZSC 1M74A 1OSNA 2ZYWX 4EDHA 4U5XA 2FFAA 2IYWA 4TTQA 5D3MA 2MMCA 2QA5A 1E6CA 2RGDA 2C95A 1YRAA 4TL8A 3TIFA 4Q19A 4DLTA 1XD9A 2DR3A 1DAEA 4DWJA 3V4FA 5BN3A 3EZ6A 4GOKA 2CBZA 4OK3A 3WYFA 2CCGA 4KCGA 3QEJA 3GJ8A 1BMFD 4OQLA 1RPZA 3ZGXA 4KFTA 4PAMA 1M7HA 1OIVA 1F2TB 3EZFA 2VHTA 5K8LA 3QPVA 1US8A 4WOPA 4F91B 1Q1ZA 3EAQA 4NYIR 2DFTA 2GKSA 2W58A 3TQFA 5B30A 1KSFX 2HCBA 2R65A 2DFKB 3QKRB 1CS4C 3CF2A 1G3UA 1FTSA 2ZSDA 3OIUA 4WZAE 4ZV4A 3BOSA 3MUFA 4YMUA 5IT5A 4LUCA 2F3RA 4A36A 4HYYA 4KO8A 5H8WA 1PLKA 1J8MF 2Q9CA 2FPMA 2FX3A 2YC2C 4G5SA 1SXJE 2GNOA 1YJ5A 3K0FA 1W46A 3EIHA 2R6FA 4PSAA 4KSBA 3OEHA 5G40A 1KSHA 4TMVA 3WHKA 2CEAA 1QHSA 1CXZA 1YZQA 3OE7D 2VP0A 4KXFB 3BH7A 4TL6A 1WBBA 3M1IA 3Q8XB 1IXSB 4ILEA 3N2IA 1DVRA 3MRSA 2BBWA 1T8TA 2HDNB 3IIMA 4V0OA 1Q44A 1N6IA 2ZJ5A 2ZRIA 4AG5A 1AS3A 3HR7A 5JCZA 1G16A 3GJ4A 4BZPA 4DDTA 3GLGE 4MYTA 5FOUA 5JZVA 4G3XA 2ZVQX 4E22A 2D62A 1SVLA 4UXHA 3U2QA 4OI0A 1JR3A 4P32A 3TUIC 1A82A 4BFVA 2OSBA 3B7GA 2NZJA 2G3YA 2CXXA 3BB3A 5SZKB 5DHAA 1U9IC 4XVQA 2AWNA 3ZS8A 1S9DA 5AR1A 4JS0A 3U6KA 4AURA 4EFMA 4Q1BA 1KO8A 3PFIA 2YVUA 1SVKA 5AJZA 1E1QA 1VHLA 2QQ0A 4A0RA 4EKDA 2V8OA 4NTZA 2I1VB 2FH5B 5E7JA 4QBIA 5BYJA 1TQ2A 1W2HA 3EZ7A 4DKXA 2J9RA 2JGNA 4LYJA 3VKGA 1S8FA 2QU8A 3CNLA 5KSZA 3K0SA 4MKHA 4B2PA 1EX6A 4GOJA 3LAWA 2AD5A 3CONA 3BB1A 4TMXA 4KFSA 2CHQA 3AF4A 4MGIR 4FW9A 5L3QA 1UAAA 1OPXA 1SKYB 1YR9A 2EWWA 4U00A 4TLEA 4PSVA 1ZBDA 3ZIAA 3SBDA 1R5BA 5JCPA 5KPJA 1G5TA 2AL7A 2QPTA 1HEIA 5BQ5A 4DC9A 1E0AA 2AKAB 3UANA 1Z47A 1IHUA 3NTUA 3ZVMA 5EP1A 3TVDA 3A1WA 2QE7A 2WAXA 3RS7A 4PC1A 2F1JA 1AQYA 5CK4A 5JECA 2IC5A 2OXRA 4RY2A 5FL7D 3SJCA 1W36B 1EESA 1ZUIA 1G3RA 2MSDB 3T06B 2J0UB 2FFBA 5FBRB 4CF7A 1NMXA 1QHYA 3U7GA 2FWRA 4Q03A 2AWOA 1TL7C 2QPAA 1VG0B 4GNKA 2IK8A 4NZYA 4PC6A 3C14C 4B33A 3G5UA 2Z43A 2WWIA 3FDIA 3M6AA 2B7BA 3FFAA 4E03A 3KJGA 1G5PA 3P27A 4LJAA 3A8TA 4CGZA 1G7SA 1SXJD 1GOTA 2H7VA 2OHFA 2ZU0C 1E9EA 4YMTA 2OV2A 1XMJA 3IQWA 4LWZA 3RYTC 1KO7A 2HEIA 3L0SA 1TEVA 3TLXA 4URZR 3QPUA 3RSOA 3LBIA 5F9HA 3ASZA 4B3FX 1WCV1 1XMIA 2FF7A 1IJEA 2W0MA 3W3ZB 3ZZTA 2FV8A 4BFTA 4ZCIA 2KBEA 3AKDA 4MKIA 2EU8A 1XCGB 1E0SA 3B9QA 2XX3A 1J7KA 3LLMA 1W49A 2D7CA 3BK7A 2ZYTX 2EFGA 2YINC 1GM5A 4KODA 1G21E 3I3SR 4IDQA 5E7MA 2D4HA 5IRCD 3ZD6A 1FL9A 1Z0AA 3P26A 1NN3A 2VLIA 3CF0A 4AC9A 1XJQA 4GT1A 1W7AA 1JEDA 3WXMA 2ATXA 1YZTA 1Z6YA 1XEWY 5FPKA 2EYUA 4OHYA 4HAUA 1IY0A 2WMNB 4YQFA 3IEVA 5LPNA 4MRNA 3FKQA 3GEHA 3KJEA 1GILA 4UNSA 4N3NA 1S0UA 1VYVA 4W7SA 3T34A 1OH8A 3AVVA 2ZRGA 3RWMB 3HPRA 1W0KA 2IBMA 3LQQA 4QHYA 1UDXA 1VKJA 4PTLA 2KB0A 2GJSA 3SOPA 1ZIPA 1W36D 1VCMA 5DH9A 2GJKA 4M1KA 2GDJA 3QG1A 1TQ4A 4TZ0A 5FBLB 2YOFA 1IN4A 2ZI5A 3B9PA 2V7QA 3X2SA 4ZDJA 4GRAA 3K53A 4PQYA 2JDID 1R0YA 2FJUA 3QUSA 3B2EA 2H16A 2Z0MA 1NN5A 1E69A 3N70A 3H2YA 1G291 1N6PA 1CIPA 1RRPA 2RB4A 1E79D 3BIFA 4ZO4A 4B35A 4QGFA 3UG7A 3AF3A 3A58B 1KI4A 3PEWA 3ZQJA 5LD2B 1L4YA 1TQ6A 4QJ4A 5DI9A 2C98A 4M22A 3BE4A 3LA6A 1T0JB 2OCBA 2CL6X 4TWZA 5GJWC 1C9KA 3RS0A 4I1UA 4QXAA 2CLCX 1GRRA 2ZRJA 2VSOA 4HB3A 2NG1A 1UBFA 2CL7X 3B1YA 1T91A 4H1VA 3NIBA 2BIFA 3KQUA 1KI3A 4K8OA 5CM8B 1OIWA 3AVUA 3BS4A 4PSKA 4CW7A 4URYR 5IDVA 5FOWA 4GP6A 5L3RA 4MDEA 4BFSA 2AR7A 3CR7A 3SEAA 4WZ6A 3ZJYA 1NP6A 5TV2A 3FGNA 4G5RA 1E2GA 2A7QA 2IXFA 1G8YA 3ZVLA 4A82A 2P0EA 2QI9C 2A9KA 3MWLA 1EWQA 2QT0A 1X3SA 2CNWA 1KJYA 4P4SB 2C8VA 4Q4JA 4DLZA 1KNQA 2ZREA 3PUXA 4JSYA 1ZM7A 2ZI4A 4L9SA 3QSYA 2WZQA 1LW7A 3BRWD 1Q57A 2ZROA 4G01B 3EA5A 3LNCA 1II0A 3K0EA 2HJGA 3DKVA 1HV8A 5CIWA 2CE7A 4ESHA 1FNMA 1NMYA 1QBKC 2X19A 3GD7A 2OLJA 3P20A 4C0KA 1S1MA 1F2TA 1KI7A 1QG2A 2BMFA 1CP2A 2GWHA 3AGQA 4FMDF 4M1OA 4HLCA 1RRGA 4RZXA 4XJXA 3IGFA 1W2GA 2GCOA 3EXAA 4TT3D 3T5DA 3TUJC 3TGPA 3U4QA 1CRQA 2GXQA 4B3DA 5EUQB 2VP9A 2J3EA 4NCNA 1R0XA 2R2AA 3BWDD 3DEFA 3NHAA 4IDPA 3MJRA 1CJVC 1UKZA 1KSGA 1KAOA 3OEHD 1KIMA 4LX0A 5JEEA 2BV3A 4F4CA 2PL3A 1UBGA 3FMOB 2O8DB 5CB8A 3SFZA 2WAYA 4Q9JA 1G18A 2XTNA 4OQFA 3CH4B 1IN5A 4KLZA 4ZDWA 5J4HA 5HCNA 2FOLA 5DE3A 2SHKA 4TLCA 1AKYA 5EE9A 1SVSA 4N0EA 2ZR7A 4E09A 1JPNA 3K0FB 4BLTA 4LV8B 1XZQA 1XU4A 4JSTA 5CLLA 1PUJA 2ZQ5A 1S1CA 2CJWB 1R0ZA 5KNCA 3CKLA 3GJ6A 3TH5A 3HYTA 4PFSA 1JAHA 3KTAB 721PA 3K70B 2R62A 2ZJZA 3R20A 2C5LA 2ZRMA 2QY9A 4O25A 1ZM9A 3ZH9B 4DB4A 1FPMA 3K9NA 5HZKA 2FFHA 2H5EA 1G64A 2G77B 2IYYA 5FPTA 1E2KA 2CVHA 1SHZA 2J41A 1J2JA 3QKSB 1B0UA 3GMTA 1KDPA 2VRWA 3EPHA 4R98A 2NOAA 3L2OB 4URWR 4B34A 2QM7A 3EG5A 2TMKA 1ZUNB 2D3WA 5CJ2A 1KYIA 1E4YA 1KKMA 3THWA 4HZIA 4M0LA 3DOFA 2X2FA 3IPXA 3LXRA 5FPSA 4DLVA 1Z06A 3SNHA 3TAHA 5J4YA 4N1AA 3B5JA 1NLYA 1QHGA 4P4SA 4Q4JB 1N25A 3LW7A 3BB4A 4P0TA 4C3ZA 4JVSB 2ZVPX 1LB1B 1CR4A 3ECCA 4Q9LA 5KDOA 2ZAOA 2PZEA 2PX3A 3X1ZA 4RCYA 4Q48A 3DZDA 3EW9A 3TW4A 4ARZA 4O0MA 5BN5A 1M1YE 3SN6A 1Z0FA 1SXJB 2O52A 4OQXA 1E2QA 1E2IA 3NC0C 1N0UA 1X6VA 3HU3A 2JLXA 3R8FA 3D7MA 4EJSA 4EQ6B 4OJKA 4DSTA 4B73A 5FTLA 4KHZA 2F1RA 3QJYA 4RZ3A 4TL7A 3GLHA 3PITA 1A2KC 5TDHA 3TSZA 1OYYA 3VAAA 4KJZA 3TR0A 1JR3E 2ZRBA 3GFPA 3NXSA 1D2EA 4QRHA 3ICEA 2JLYA 4B43A 3OZXA 4LRWA 4TQAA 2BKEA 3I1FA 2ZRAA 4EPYA 4F38A 1Y63A 1G7TA 4MRSA 1N5JA 2DCUA 3MJHA 3K0CC 1UBCA 3C7KA 4MGZR 4FMCB 1UFQA 3BORA 4JT2A 2V55B 1EG7A 4WBSA 2ASEA 5JI3E 1G17A 1RJ9B 1XJCA 2ERYA 1U8YA 2REOA 2PCJA 4IJMA 1XPRA 1Z8FA 3KXLA 3EPLA 2VHCA 3WNCA 1IJFA 5BW8A 2CJWA 5CDFA 3OAAD 4HAXA 4PHTA 1Z07A 4RD4A 1U8ZA 4ZIRA 2O8EB 3T12A 4IHQA 3PEVA 2HXYA 2BEJA 3WRYC 4PR0A 1RYFA 5LDDC 2H18A 4HDOB 4OL0A 4V0MA 1M7GA 2ZUBA 4AG6A 3IBGA 3V4RA 1C4OA 5FTKA 4OI4A 2C9OA 3I92A 2QNRA 3QKSA 1XTSA 1IXZA 4ACAA 5EJEA 2F7SA 1FZQA 3TSWA 4ZI2A 3D31A 3CF6R 1KI9A 2FSGA 2OAQ1 4AKEA 3WMFA 4PZLA 4MA4A 4EPTA 1EWRA 5TY0A 5AUOB 2R6AA 1NF3A 1NKTA 2GJ9A 3QVVA 4UNRA 4C2TA 5DIFA 3KDSE 3VR2A 2IT1A 4JLAA 5EUMA 3NH6A 3VR1A 4B2IA 3I61A 2RGNC 3JVVA 3WYAA 4C7OB 3DO6A 4FCTA 1HTWA 5C4GB 3EPJA 1KDTA 4Q4HB 1TQDA 2V7QD 2AN9A 3IPYA 2BM0A 3FVQA 4URVR 1RIFA 3P1JA 1X8KA 1K8RA 4KVAA 1JXOA 2QM8A 4R2HA 5EP3A 2PMDA 4G0NA 3UG6A 1ZJ6A 2DWPA 1RFLA 2AK2A 3BBPA 1JALA 2UKDA 4ZPXA 2JLQA 4FIDA 5BYKA 3ADKA 1W5TA 4HLDA 1XP8A 3NBFA 3K1JA 2AX4A 2A5JA 3AP1A 1BYUA 2BMJA 2GZAA 1OFTA 4IDHA 1BH2A 1E9DA 3S1AA 3O47A 4ZDKA 5JHGB 4TYYA 1FX0A 1XRJA 4RFVA 2ZJAA 3N5CA 1VG1A 4NCJA 2RGXA 4DSNA 4OI1A 4C30A 1B23P 3AQ4A 4LV6A 3A1SA 3CO5A 2IYUA 2P6UA 5KNDA 3TR5A 5C4MA 5JRZA 2WJGA 3UXMA 3KFXA 3A1UA 1XD2B 2O0JA 2XZOA 2HCJB 5AJVB 1Z29A 2ZR0A 2VH5R 3B60A 5FTMA 2FEOA 3H84A 3UPUA 3BFKA 2QBYB 1NIPA 2RHMA 2FDCA 5FOSA 4D4KA 5E7IA 3QXXA 4KVGA 4A6XA 2QGNA 1OFIA 4F4IA 2D74A 2F6RA 4BE7B 4CEIA 4DHEA 1F60A 1ODFA 4BLQA 5JEDA 4HDQB 3DM5A 2F1IA 2XZLA 1YHNA 4E5UA 2EYQA 4LHVA 2YNMA 4KU4A 1ONBA 1KK2A 3E1SA 1KGDA 4Y0VA 1CKEA 5JLJA 3C5HA 5EZ5A 1GNRA 4Z1MD 1JJVA 2W6ID 3J81k 5GADl 3MWYW 2JLRA 1DBSA 4NYJR 5AUQA 4NCKA 1VCIA 3ASYA 4YMVA 5LD2C 2IYRA 4DUGD 1ZD8A 2ECKA 1G8GA 5FUXA 4M1SA 5L8VA 4MKFA 4AKIA 3NHBA 2P5SA 4Q02A 4NDZA 1NNEA 5BWMA 2FE4A 1TMKA 1EGAA 2KJQA 1COWA 2ZS9A 2A5DA 3QPWA 1HQYE 4CZ2A 1N3BA 4Q47A 1N6RA 5FFMA 5L3QB 3QF7A 4JMPA 4JYCA 4PPGA 4GMXA 2GRJA 4K81B 2ONJA 4FWTA 4M21A 2J0SA 3C8UA 1MKYA 1LFDB 5IK2A 1OB5A 5EE5B 2AHOA 2WPDD 2L0XA 1CTQA 4NCHA 4NYIQ 4B3CA 3B85A 4TMZA 1AM4D 2X2EA 1XJ0A 2ZYUX 2OZEA 5EP4A 3IEUA 4M9QA 1MO5A 4DLXA 2BCGY 1ZYUA 1Z28A 1I4LD 3AUXA 3FMFA 3THXA 4IOJA 4FWIB 3FPAA 2JA1A 4D25A 4JBWA 1GDDA 4MITA 3W5JA 3U3JA 1OH5A 2YWGA 2VBCA 3QXCA 4QGHA 2J7KA 3I32A 1SKYE 4NYMQ 2CHVA 1IY2A 1QVRA 1XXHB 2JLVA 1P6XA 4XIGS 3V9PA 4KYIB 4A8JA 1TNDA 1ZNYA 3U44A 3WNDA 4EFNA 4D26A 2RGCA 1IN7A 1E79A 1UEJA 3HU2A 1TTTA 1Y3AA 4EJSC 1OYWA 3AF0A 4CYMA 3TAUA 4PC7A 4JJZA 2XB4A 3QQ5A 3U7HB 4C2UA 2G0NA 1F48A 2CCKA 5CDFE 3CB4A 2IYXA 4I4LA 4I1OA 3EWSA 3BC1A 1G8FA 3CX6A 5F2EA 1E2LA 1HYQA 2G0TA 2NO7A 3PG5A 4JLJA 3REFA 3U6BA 3DVLA 3LVQE 1OH7A 2VHQA 3CPJB 3OF5A 4TT3A 4YDHB 2O8BB 4B47A 2IEZA 1IN8A 2WSMA 3A4MA 1EFRD 3QXJA 1Z0JA 1AIPA 4XTCS 2WKQA 2GBLC 5DN6A 4RFSA 1Q21A 2ZE7A 3FOZA 1VTKA 1KZGB 5E95A 2VO1A 3DOEA 3U3KA 4UNNA 4AKHA 3ICQB 1W5SA 4MQBA 1MO3A 3AP2A 2X1VA 2JAQA 2XNSA 3H86A 2I1QA 3B1ZA 4YLGA 3TKLA 2ZSFA 4B48A 2G1KA 3NKVA 4L8GA 5UKDA 1OH6A 4XD7D 2WMOB 3RRYA 2Q3FA 5FUVA 3KUCA 4NU0A 1E3MA 2H92A 4B75A 2ZJOA 3CNOA 2Q9BA 3FMPB 4XWOA 2GJ8A 2GK7A 3B1WA 3SYNA 2DFLA 2LKDA 5JJKA 2F1HA 1E0JA 1SGWA 1XZPA 3R7WA 4D0GA 4DCTA 2KWIA 3I5XA 4GSYA 5SZHB 2ZE8A 4ARZB 3HWSA 2H57A 2VEDA 2DBYA 1PJRA 2F3TA 5FBWB 2PJZA 2NPIA 3ADDA 4XSHA 3R9XA 4NE2A 3NDBB 4AYXA 1TU4A 2ZAMA 3QKTA 4GI7A 3A36A 1P9NA 4KYUA 5HE9A 2DWOA 4IOLA 4W5HA 3GLHB 2ZI9A 1RZ3A 1DAMA 1K5GA 2OBNA 3B13B 1UKYA 1UJ2A 1HQCA 3EASA 1C1YA 2PH1A 2PZGA 4II7A 4JLVA 3TJZA 2RKOA 4JJKA 2PX0A 2OAP1 2UVQA 1YZGA 2O8BA 1HURA 1DELA 3K9HA 1WF3A 3QE0A 2RCNA 2IHYA 1W44A 1GL9B 4TLAA 3MGCA 3SDZA 3T35A 1SHKA 2FPKA 4PQRA 3T5GA 1HY3A 2QAGC 1Z63A 1Q3HA 2W2VA 2AFIE 4HSEA 2MMGA 4NCIA 3VNUA 3R9IA 4C7OA 2FZ4A 2QSYA 4Z51A 1UDWA 3NEJA 3W9YA 1N5LA 3O8DA 2ODEA 1AN0A 2CE2X 1NY5A 3KKQA 1HH4A 2ZRHA 2GAAA 3U3RA 1XCPA 2Z6VA 3CWQA 4PANA 4JLNA 1G8PA 1XFAA 2ZRCA 4JLKA 4X8OA 4M2LA 4TL9A 3C15C 1CR2A 2VPPA 5GJBA 2JJ1D 4XTRA 5FL3A 4EUNA 2H17A 4KSCA 3R7WB 2E1RA 4Q4AA 4Q18A 3RANA 2P3SA 4PAQA 5J4KA 1XB2A 1DG3A 2HYDA 2PT7A 2AK3A 3I73A 5AK0A 2R44A 3Q5EA 5JSZA 2ZJ8A 1GVNB 2EFHB 1OW3B 2VF8A 1II9A 3KKMA 3Q7PA 4IXMA 1Q20A 1RVDA 2ZUCA 4PC3A 2ZM5A 1E2PA 1GIAA 3GQBA 4XSGA 4YMSA 1O87A 1N5KA 4KLNA 2QZ4A 2Z4SA 4HAVA 4P33A 1DG1G 1Z08A 4BFZA 4I99A 1WB9A 2JIZA 5HKKA 2YC4C 1PLLA 2P2LA 2QMEA 4MRRA 1N0WA 4R7ZA 3X1WA 4UKDA 4BLSA 2J7PA 2V4ZA 2R8RA 4EAQA 1CEEA 1OLOA 2A5YB 4N0DA 3TW8B 2WWHA 2EFDB 2JCSA 3L8YA 4P4TA 2QEQA 3K70C 2XZPA 2ZANA 5CJPA 2VF7A 4GPTA 2OCPA 3PJRA 3DDCA 1UF9A 2YOGA 4TMKA 1P60A 4MYCA 1U90A 3Q5DA 4F93B 4QHTA 3I8XA 2AD1A 3KX2A 2OBLA 4JL6A 4JLPA 4RKFA 3ZLJA 4QG7A 1WE2A 1ZUHA 2QN6A 2VSFA 3KB2A 1S2MA 2FNAA 2ZU6A 3MMPA 3G82C 4A92A 3AVPA 3H4MA 2HT6A 1FOEB 5DI3A 1V5WA 2BDTA 1OE0A 1KO1A 1ZNWA 5CB6A 3EARA 2PLRA 2IWRA 4JZKA 4EFLA 4Q7MB 5TVKA 2QUZA 4ZCLA 4RZUA 1U98A 2WSSD 3K09C 4JL5A 4PC2A 2GHIA 1T3SA 5TARA 2ONKA 2A30A 2W2TA 1UBEA 3CZQA 1VECA 5JI2E 1KMHA 2VA8A 5KNBA 4P3YA 1E32A 2QP4A 4FCVA 2FFQA 2ZJ2A 2X8AA 2B7CA 2QRNA 4DUGA 4A1FA 1TF5A 4CEJA 4IOMA 1ZM4A 1KDRA 2VL7A 2WTUA 1RRCA 2HF8A 3JZAA 3EX7C 5F9FA 2CMKA 4B2LA 2GBLA 1QHNA 4OBEA 2LKCA 1LTQA 3MSXA 2DYKA 1U0LA 4BUJA 3THXB 2WWYA 3PUWA 4G1UC 4KFRA 4YXWA 3LY5A 1W48A 3OIWA 2OG2A 4DZZA 2XSZD 5IK2D 4ON9A 4P4UA 2QPOA 4KITB 1OT3A 1PZNA 4MYHA 3PR1A 1GTVA 4TSFD 4Q1FA 421PA 4DCNA 4IFEA 1WXQA 2ZE5A 1FP7A 2BMDA 1SXJA 221PA 3CUEF 3QBTA 5F98A 4OHZA 4GFDA 2GAOA 5DO9A 3CRVA 5FL7A 1YZUA 3TK1A 3T1TA 1XWIA 4JT4A 4NKRA 4BWYA 5GVSA 4LDJA 5JRJA 3SS8A 4UXIA 1FNNA 4Q1CA 3E70C 3LX8A 5KPDA 3L43A 1R7RA 2WIBA 4C9BA 4M1YA 1GWNA 2WIAA 4HUQA 4Q9IA 4GP7A 4C4PA 3EZ9A 1U8AA 4FMDB 3VX4A 3LLUA 3PCRB 3WMEA 5JMTA 1RKBA 2ZI3A 3DHWC 4HLUA 1LS6A 4BFWA 1E9SA 2YWEA 4IEIA 2J59A 2Q3HA 4DBLC 3O8BA 4BEJA 1O3YA 3MD0A 4HAZA 4Q1EA 1W4CA 4LBVA 4QJ3A 8OHMA 2GF0A 4HAYA 4Z1MA 1S3SA 3U60B 1KI8A 2P6NA 2YWFA 4LJ4A 1KMHB 1Z6XA 4Q9HA 3X1YA 4EPVA 1P7CA 4PO1A 5IF9A 2NMVA 1W0KD 2DWQA 3DM9B 3AKYA 3SHFA 4GMDA 4Q5IA 2ANCA 2HUPA 1NVVR 2KI5A 3AEZA 4Q7KA 4O2LA 4OK6A 3U7EB 4BFXA 3I72A 2WWGA 2W6JD 3RRNA 1II8A 1P2TA 4V03A 2GXSA 2FN4A 2ORWA 5SZIA 3GLIE 1EFRA 2RGBA 5D3QA 3OEED 5FPYA 5GVRA 1R4AA 2FSHA 2V9PA 2VQSA 1GL7A 4UQOA 2GCNA 2GESA 3QENA 1ZAKA 3UMSA 4RD6A 3VTKA 3KQNA 3TBKA 2IW3A 4TLBA 4GL2A 3U5ZB 1E9CA 4M9ZA 5EXPA 1FFHA 3BERA 3MCAA 1AGRA 2JJ8A 2HV8A 2ZETA 2Q0HA 5CYPA 1GRQA 5EE1A 2ZRPA 4DDUA 4YXWD 2ZSBA 3QY0A 4XVRA 4KFUA 4L15A 1WRBA 1YZLA 1E2HA 2KBFA 1U94A 3OFNA 1PVOA 1T3LA 2BMEA 4DXAA 1KTVA 1Z6GA 1OHHA 2XNDD 1E2DA 1TU3A 2QROA 5JWOA 3D6TB 2IS4A 4QJ5A 2OEPA 2ZI7A 1DO0A 3U4QB 2RGEA 3THOA 4DDVA 2G6BA 1IM2A 2B92A 3TVTA 3GLFB 4WXPA 2ZXUA 1A5TA 3B1VA 2ZITA 5KDDA 3BFXA 5FI0B 1QG4A 4L16A 3BXZA 3QBVA 3WHLA 3RSLA 1KHTA 3IDQA 3CZPA 1ZIOA 4OK5A 3IO5A 4PHGA 2AFHE 5FPHA 4FCWA 4AWXA 3SU8A 1YR8A 4NBSA 3B82A 4RVCA 2JLWA 1YVDA 2RGGA 3QNUA 1R5NA 4HZUA 3TNFA 2B6HA 3A4NA 1OKKD 4CDGA 4D0LB 4JLBA 3LXXA 5GJCA 2IS6A 4CIDA 3WYGA 2O8FB 1R5OA 4A2WA 1AS0A 4B44A 4D4LA 5G3ZA 1SKQA 4ITRC 1NKSA 1EXMA 3DMNA 4AYWA 4PAOA 3VR3A 1DS6A 5SZJA 3K9GA 1BYIA 3AB3A 4NP6A 1KI2A 1KI1A 3AVOA 2QTFA 3M4YA 3UMFA 4PXAA 3S1AB 1FX0B 1IAQA 5EQTA 3LQRA 3HYRA 2QP9X 3GFTA 1NVXQ 3GPLA 1GP2A 1DAHA 2CLDX 3NEYA 1E0KA 3OIYA 3EWAA 2IUSA 1P61B 3FTQA 1NL3A 5HZHA 3AVQA 1F3OA 4CT5A 2AXPA 3OEEA 4EPRA 3LO5A 1SVOA 1VDZA 5C2JB 3ZQ6A 1IY1A 4TYNA 5P21A 1J8YF 1EX7A 4BLPA 1NSFA 3LDAA 5CITA 5FR1A 2WICA 1P62B 2REBA 2ZPTX 4HB2A 1W1WA 4IRUB 1WP9A 1JQLB 3WBJA 3K9LA 4QL3A 4A15A 1QDEA 4US0R 5JS7A 3AUYA 5H70A 4Q21A 2O8CA 4DB2A 1II8B 1UPTA 5DYIA 2YV5A 2C9CA 2EVWX 1LF5A 1CJKC 2A5GA 3CLVA 1DAIA 5KO2A 4Q4LA 1GNQA 3W3AA 3LBHA 1M8PA 4M1TA 1UADA 5JHHB 3ZS9A 3IBYA 521PA 3TRFA 2XJ9A 1ZU5A 3A4LA 4P31A 2BEKA 1L4UA 3HU1A 2QGZA 1P3JA 4JVMA 3SYLA 1D8TA 3U3OA 1G3IA 4PQFA 2BOVA 1N6LA 3T15A 4A6PA 1OXXK 2RAPA 1ZM2A 3SE0A 2BKUA 3SC3A 4LJ7A 1OF1A 2JEOA 4JIMA 1A2BA 2IF2A 1KDOA 1EFHA 2GCPA 2IYQA 3IHWA 5AJYA 3ETLA 3DZ8A 3AVTA 1OB2A 2WJHA 1VYUA 3Q7QA 4D80A 5K8UA 4JVLA 2OESA 2XB2A 2C96A 4PHFA 4AKGA 5DI3B 2XTMA 1NJGA 3LW8A 1KSJA 2XXAB 1E1RA 5KSPA 5FOVA 1ZMXA 1CJUC 1JJ7A 4LV5B 2QQEA 5FUYA 5DGXA 1FW6A 2D7DA 3P4XA 1QHXA 1MRNA 4TYWA 5FOXA 4IXNA 5JS8A 4Q1AA 3WP0A 4TYQA 1G1MA 3SQWA 2ATVA 3W8NA 1E2MA 2FZLA 1ZNXA 2W83A 4D0NA 2O8FA 1S9HA 3W8RA 3LBNA 2HLDA 1RJ9A 4OYHA 1LY1A 1Z22A 1D5CA 3CW2A 2GXAA 3K0CA 2GEVA 3RHFA 3LRPA 3BGWA 2CNWD 3U44B 4DLSA 1GZSA 2JJ2A 1JXMA 1CULC 1S96A 3RS2A 3AF2A 1SXJC 4CVNA 3KKNA 1IQPA 1DEKA 1R10A 2HF9A 4BECA 2R6GA 3VQTA 4F92B 2CL0X 1TPZA 3NC1C 4JKIA 4RCZA 4URUR 2LCFA 4MUBA 2NO0A 1JPJA 3L82B 3RVBA 4DDWA 1OIXA 2PJRA 3QF4B 1GKYA 1XF9A 1AS2A 3RLFA 3GCGA 3RC8A 4BEBA 2IUTA 3K8YA 3R8CA 2XGJA 3IIJA 4B3GA 2BM1A 3SJAA 2R6CA 1PLJA 2YZ2A 3WNBA 3ADBA 2XSZA 1LF0A 2IXGA 5FTJA 4B6FA 3A1VA 1F5NA 2DHRA 2OBMA 1TF7A 4PHHA 4M4SA 4ZCMA 1K6MA 4TSFA 3ZVNA 2GVZC 3A1TA 4RSGA 1HT2E 1ZCAA 3UWOA 3Q9LA 4DCSA 1N6OA 4JBYA 1EK0A 4Q4HA 1FUUA 4HB0A 2XAUA 5KYKA 1AJEA 1T5IA 1P2VA 2WJVA 3OAAA 4DLUA 3H0KA 5J4VA 2CDNA 1YZKA 2B21A 3MLEA 1GL6A 3HPQA 3IIKA 1VG9B 5FH9A 5J5CA 5G41A 4PPNA 1MO6A 2UZ3A 2UZIR 3BD9A 2XTZA 1KZ7B 2NTYC 4DIDA 1CJTC 4BGDA 5A4JA 4TN1A 1E1QD 4QGAA 4NL4H 4MH0R 2VTKA 1KY2A 1YKSA 4MGKR 4L9WA 4US1R 3GJ3A 3PUVA 4ZKEA 5J40A 1RRFA 4DLYA 3FMIA 2FSIA 3AKEA 1L8QA 2ODNA 2YJTD 2XOKD 2F9MA 4OJQA 2J87A 3PEYA 3CH5A 4MDFA 2DFNA 4G5QA 2JLSA 2NZ8A 2N1BA 5TMPA 2A3RA 2CLSA 3K0AA 4YMWA 2QG6A 2VHJA 1XDBA 1XD2A 2G9NA 1JAIA 1H65A 3SHWA 4R2IA 3NWJA 2WWFA 2QBYA 2OFWA 5FI1B 4WA7A 2GTPA 3U3MA 5LB4A 1DOAA 4FXPA 4OHVA 4QNMA 1Z2CA 2P67A 4L5BA 4MRPA 2XJ4A 1NN1A 4AYTA 3UATA 3VNVA 2Z5FA 3AVWA 2NGRA 1Q22A 5HE8A 3HJNA 3GLGB 2KSQA 4A2PA 4D4JA 1G4AE 1A7JA 4DSOA 3KJHA 1HE1C 2BVNA 3QXSA 2F43A 3VU9A 5FBVB 1G8HA 1KI6A 5A5GA 1E99A 1G9XA 2HYIC 3OFND 4LYFA 1IONA 1P5ZB 2IYTA 1Z0IA 1LVGA 2RHDA 5H1YA 3L8ZA 4DLRA 4EIWA 2IEYA 4JVNA 3F5FA 5CIQA 1NLFA 5J47A 3ZD7A 1XD8A 1XTQA 2ZRLA 2ODBA 1R6BX 2B8WA 4HZUB 3KKPA 4US2R 4AI6A 4NH0A 3CX7A 1IOZA 3CNNA 4Q4AB 4EPXA 3DL0A 2H8KA 2IUUA 1W0JD 2ORVA 2QAJA 4I81A 1AK2A 3EIEA 4IKEA 1NBME 3SZRA 4Z8XA 1CJMA 4EPWA 3GFOA 1T8UA 5TB5A 3GLFA 3GLIB 1P72A 2EFEB 1ANKA 5GJVC 5KTYA 1Q3TA 4TQ9A 3NVAA 4I1SA 1NSTA 5EXTA 3UK6A 4A2QA 1GNPA 2E9SA 2QMUA 2IWHA 1E9BA 3F3YA 4C0JA 3KZ1E 1ETUA 1GG2A 4QOSA 1MRSA 1G41A 1P75A 1XCMA 3K0AB 4LHZA 5AJXA 4LBWA 1W36C 1HUQA 2V1XA 4BLRA 1OXSC 3D3QA 3VKWA 3ZIAD 1RE0A 1NJFA 1BOFA 1VIYA 1RW4A 5JWRA 2OFOA 5FOTA 2KE5A 1NY6A 2ZJYA 1IBRA 1OFHA 1XXHA 3RDPA 2J45A 5B57C 4D6PA 4QFMA 3HR8A 1E9AA 1F6BA 1I4TD 3PXGA 5B64A 5JJIA 1QZXA 4V0KA 5K8TA 2W0SA 1YR7A 4ZIRB 4H9GA 3B8HA 1PV4A 4QBHA 3W90A 3UIEA 3VU9B 1EFCA 3VR5A 4C0BA 4D4MA 1Z83A 1FQJA 1ELOA 1I2MA 5DYGA 1QRAA 1UEIA 1LNZA 1FQKA 4TZ6A 1SQ5A 4DCUA 1G6OA 4M9XA 4X8HA 2QTHA 1COWD 1E94E 1XMVA 4A0GA 2PT5A 2NO6A 4LY6A 1ZU4A 2Q6TA 2V6JA 3VHLB 4ZI3A 1H8EA 4K46A 4U7DA 2QT1A 2ZRFA 1T4GA 1E9RA 3OESA 3B78A 2FU5C 3BJIC 3CWZA 3FHOA 2ZYVX 2IA5A 4CEHA 3PUYA 2ZE6A 1DE0A 3K09A 1KJWA 2QE7D 4LPSA 3KUDA 4FMBB 2F43B 2GEDA 1P4SA 4PO8A 3VR4A 1ZC3A 1ZINA 5FBQB 4AK9A 4Q7LA 5DSZA 4GDFA 4QKQA 1CF4A 1M6NA 3WRXC 3QI2A 3MFYA 4MKGA 4Q7JB 1N5IA 2QL6A 4AIIA 1XTJA 3ND9A 2QMOA 4PX9A 1GITA 3FFBA 2ZS7A 2WWXA 1HA3A 2F9LA 1MV5A 3QXHA 2G1JA 3KXKA 2OCYC 4B71A 5HPYB 2IHBA 3MWKA 3VMFA 2B8TA 4HDCA 4XH9B 4FD2A 4Q00A 5C1BA 1KJZA 5B2ZA 2BHRA 4TTPA 1BS1A 4JYBA 3PEUA 4B3XA 4UJ3A 1T5LA 2Q3MA 1D2MA 2VP2A 3C16C 2CCJA 2HT1A 1Z6TA 2XXAA 1LS1A 2NO9A 4C0LA 1Z5ZA 3RAPR 1I4DD 2IF0A 3U61B 2WM9B 1E98A 2HLDD 1VG8A 2EQBA 5K8IA 4NYMR 3IO3A 1QF9A 4Q66C 4A0HA 1E2JA 2FEMA 1QHHB 1X8LA 2PZFA 2VIIA 4M53A 1FP6A 1NVWQ 2CK3D 3M0EA 2QSZA 3NBYC 1J90A 4LYAA 2RH5A 1P2SA 2VYFA 2OFXA 2O8DA 3SJBA 4V0NA 2YKGA 4V0ME 2A78A 1H8ED 4CEHB 3HP1A 5L3SA 3KKOA 4LJ5A 2NIPA 1ZD9A 1Q1EA 5KSYA 4QC2A 5FUWA 2FG5A 2GJAA 4B74A 1GUAA 3PVSA 1G20E 4BZQA 1GKUB 5H68A 3CRQA 2Z4RA 2VHUA 3QF4A 1OV4A 1XTIA 2QRZA 1NG1A 2R9VA 4IDOA 2WJYA 2YOHA 1S3GA 3KTAA 5ELXA 3ZDQA 4F4JA 4XVUA 4CT4B 4A4DA 1VMAA 2GZDA 2G83A 4O3MA 4IFBA 3K70D 1S4QA 2PEYA 5JSZB 3LX5A 2JDIA 3RS5A 2ERXA 4KI0A 2OE2A 1KMQA 1E9FA 4JLDA 5EE3A 1QHIA 3FKSA 3NDPA 4HATA 4ACBA 3DPUA 4I1VA 4MGYR 5G53C 4IVQA 1NLZA 1XEXA 2PMKA 4IVRA 3V00A 4JLMA 1XPUA 3VFDA 3SFVA 4OQNA 3B6EA 4MRVA 4W9MC 3FB4A 3SJZA 4W5JA 4WXRA 1TUIA 1DPFA 4LI0A 3Q85A 3NBZC 1Z2AA 1IXRC 2R6DA 4C0HA 5KU1A 1WBDA 4BPBA 3R9WA 4RD2A 2K5UA 3QKRA 2ZJBA 1G3QA 1Z0DA 1QHHA 5B58C 3AV0B 3UMRA 1P9WA 3GJ5A 4L4UA 5JJLA 2WKPA 4S35A 1VCNA 4WZBE 4LGMA 3ZZ0A 3IKJA 4JLOA 1M34E 1X86B 3G0HA 3CPHA 1ZNZA 3MWJA 5L3SB 2C2HA 3W6OA 1RC8A 1U9IA 4UJ5A 2ZI6A 1CBUA 5AWFC 2FSFA 4XWKA 1NIJA 3NG1A 1E1RD 2QENA 4KBGA 4M1MA 1W47A 1AQUA 3IUYA 2JJ1A 4POAA 4DRZA 3VX3A 1TEXA 1DAGA 1MO4A 1XPOA 2BJVA 1F2UA 2ZEJA 3F8TA 1BO6A 4X8LA 5CK5A 3LWNA 2J7PD 3ZYCA 3TE6A 1ZRHA 3CM0A 3GJ7A 4LJ9A 2VSXA 2ZRKA 4XOIA 4LOAA 4DVGA 3QVUA 2GEUA 3GLGA 3DMDA 2JLUA 2QMHA 5EE0A 1JNYA 1FUKA 3L0PA 3SQXA 2V3CC 4IOKA 4CEJB 3PENA 3QKUA 3GLFE 2O0HA 1D6JA 4IEEA 2VP5A 4C0SA 3KQKA 1JR6A 1XNJA 3AH8A 1NVVQ 2VP4A 3PIRA 1GFIA 1MR3F 1W0JA 3TQCA 6Q21A 2C99A 1KK1A 2YWHA 4RD3A 2O8EA 2WJIA 3T61A 3THYA 2NPFA 2ZRDA 4IVPA 4UXJA 5JFGA 2CHGA 3AKCA 3RABA 5KOYA 5KHOC 1IN6A 5BXQC 3Q3JB 3GLIA 1YZNA 2QAGA 3SBEA 4LBZA 1R2QA 5FTNA 4J0QA 2V1UA 2P65A 2HXSA 2OO7A 1EFTA 121PA 3L0OA 4RD1A 5AUNB 4LBYA 3LH5A 1ZP6A 2GA8A 3MAAC 2LWIA 2GCOB 4H1UA 4OQMA 5FR2A 5F3WB 1VYTA 1T9HA 1Q1QA 2IYLD 1CLUA 2GZHA 4HLUC 2V6IA 1AZTA 4NHOA 2ZUDA 2BJWA 4O2RA 3E2IA 3EC1A 3PQCA 4LHWA 3AVXA 2IYSA 3SYKA 2P6RA 5G3YA 1H8HA 4UNQA 1P9RA 4PPQA 3IILA 3W6PA 4ZKDA 1WMSA 4YC7A 4URXR 4M9SA 3I62A 2XOKA 3LVRE 5EZ6B 1CRPA 3C41J 3WBKA 3AP3A 2C03A 4DT1A 4S2EA 2ZRNA 2MSCB 3F0TA 3TUZC 4NYJQ 4IW3B 2GILA 3VHXA 1E96A 1GRNA 1G5RA 2MSEB 3RRMA 1YQTA 2YYZA 1J70A 1NBMA 2RGAA 2YHSA 1XBTA 2J1LA 2PCLA 1DO2A 3P32A 4DLWA 2W2XA 1KOFA 4DCVA 2OM2A 2OXCA 1XMSA 4HB4A 5EP2A 3THYB 3N2EA 3C4JA 1OXVA 1TUEA 3FE2A 2GVDC 4E07A 3OE7A 4QGGA 3X1XA 1GKIA 3CR8A 5EXSA 3CRW1 4W5WA 1YE8A 4OI2A 4BLOA 5AUPB 4QHSA 4Z54A 5E3HA 2JASA 2FGJA 4YONB 3L0IB 2WHXA 4V0LA 2BC9A 1AGPA 1J99A 2BBOA 3D8BA 2OT3B 4KV9A 5KDLA 3GLHE 3E5HA 1W4AA 4IDNA 4RD0A 5JBQA 4CEIB 1A4RA 1G4UR 1NRJB 4OKSA 2ZIAA 4HAWA 3OHMA 4A9AA 5TXGA 2GK6A 3W5IA 3THWB 3BH0A 3DKPA 3QOFA 2W6JA 4TTRA 3KB1A 3TSOA 3CPEA 821PA 4LC1A 4YDSA 3O8RA 1TF2A 3KQHA 1TAGA 1PUIA 2ANBA 5DLQC 2J0VA 1OJLA 3U7FB 3LFUA 1CR1A 1U0HC 5AJWA 2FGKA 2W6IA 4BFUA 3EC2A 4D82A 5D3MB 1WDTA 2JATA 3W34A 3BAFA 4KAXA 1DAKA 1H8HD 2WOJA 3ONWA 4RZ2A 4B6EA 3I5YA 2A5FA 1OXUA 3X1DA 1XTKA 2EW1A 2BBSA 4D2IA 4Y0AA 5ANRB 1R8SA 3VKHA 4X8MA 2WSSA 1XEFA 2CVFA 4UNPA 2XEXA 4QM6A 4FN5A 4AD8A 4LJYA 2Q21A 3RS4A
chains in the Genus database with same CATH superfamily
4GZLA 2J9YB 1RKVA 2XHZA 2LBPA 4LHXA 3EOBI 4M6WA 3QI7A 1LDEA 1XIVA 4LK2A 3P0JA 3HB7A 5HR5A 5KREA 2EWVA 4XFDA 3IOCA 3PJGA 5ALTA 2IZ1A 1D5WA 2FY8A 3EN0A 4ZT5A 3S55A 1IDOA 4ZO9A 4DJTA 2OCXA 3CKMA 3P9QA 4PPYA 3EPKA 1T2DA 5GQSA 5C8XA 4HRAA 2R6JA 5REQB 1H6BA 1N2CE 2XZTA 2WM8A 1XEWX 1DG9A 1WDLA 3OQHA 4DYVA 2QSUA 3AVYA 4UTZA 2B0JA 2CLKB 1Z45A 4ZAGA 4LN1A 4M8SA 1WZEA 3F47A 3BWMA 5FCDA 1KNXA 1M2OB 1YI0A 1P7YA 3WLPA 1IMJA 2CF5A 1T9BA 4HNUA 1F12A 2IW1A 3SZUA 4DUYB 4D46A 2GZRA 3TLJA 2WYHA 1WQ4A 1LV7A 1V43A 4R3UC 4EHFA 4QOFA 3UTDA 5CBPA 1ZCBA 2RK3A 3EEFA 3JQ9C 3O93A 2VP6A 2HIMA 3EZLA 4GZMA 2QLBA 4WHMA 4MV7A 1JR3D 4RHUA 2I3BA 5EJFA 1ZM3A 4PCVA 4DIEA 1C1XA 2HD4A 3WQBA 2PXCA 3U7QB 3WAGA 1TECE 5IHPA 5E9QA 2WW8A 5TE9A 3INYA 3KKZA 2JBWA 1E9VA 1SULA 2ZSEA 1Y5IA 1NMEA 2HGSA 2PBLA 3GGOA 3T1VA 4F2DA 2ZVJA 2EFCB 2VDWB 1CR0A 1A8HA 4JITA 4RA9A 2B2CA 1MABA 1T6NA 1KEUA 1B3BA 1G8MA 2OLKA 3N0VA 3NH9A 4O4LB 3SZGA 4J3FA 4N5LA 3T7JA 1ST2A 2C04A 4W8HA 2HL6A 5ITVA 1TVCA 4LJRA 4X85A 3TECE 3COVA 1N6HA 2OBBA 1FMJA 4RLSA 2H2DA 2I0FA 2JI6A 1WQ1R 4K05A 2CSXA 2HJVA 3QFTA 5T6MA 4KDCA 1BJTA 2GASA 4BNHA 3ENWA 4OHWA 4WAUA 4WEOA 5AI4A 1NMZA 4GBMA 1N0VC 3FUUA 3MRTA 4WADA 1M2NA 2A2ZA 3K9CA 4O6VA 4UBMA 3SX2A 3LDGA 4AS1A 3MJ4A 2AN3A 3KXIA 1REQA 3WLOA 2VHEA 3CC8A 1QGDA 1RWBA 3GB9A 3KWFA 4Q01A 3DDHA 3E53A 3DFMA 2ZXEA 1IIBA 1P0FA 2YASA 4G67A 2FSPA 3TLYA 2HM7A 4ZGBA 1OWMA 3KV1A 3OCVA 2UYYA 1I13A 3U62A 1BE8A 1I2DA 2QRLA 3NIWA 5FA6A 2GBCA 3AG5A 5L53A 3ZK8A 3H5RA 1CUGA 4TMYA 4L85A 4CQLB 1OXTA 1KL7A 3PX2A 4RIHA 5U4QA 3I34X 2IX3A 1THMA 3G89A 1WUIS 3IDZA 4FOTA 3HVKA 4DA8A 5EIXA 1JRLA 1NXVA 2Q9AA 2OM6A 4U02A 4FYPA 1UBOS 3FLBA 4ZZ2A 3MUEA 5CA0A 2FYTA 1NXOA 2X0JA 1DKOA 4DFDA 1CUZA 3QMMA 4B7AA 4KUEA 3GK3A 1PFWA 4ZC1A 3H9GA 4L8VA 1W93A 3AFMA 4M6WB 5HTOA 1XX6A 2HRZA 1OHHD 4XPIA 3VU0A 4MPJA 4ASUD 5EMMA 4D9HA 2FA9A 2V9CA 4GR5A 1JB1A 3C2QA 4P38A 1BRMA 1KAGA 1UC9A 2G88A 3QTTA 4E5NA 4DV6B 1P33A 3TXXA 4ABYA 1UFOA 2XITA 1KHHA 1MW9X 3HJRA 3NX4A 4D42A 5IABA 3VHQA 4UHBA 4UVGA 4JBIA 1UIMA 1ZSVA 2CMFA 3AERB 1GZHB 1ICIA 3TAXA 3PFKA 2X14A 3UMBA 3I0NA 3RC3A 5JASA 3E6AA 3D7SA 1BDBA 4AMUA 1BFDA 1EVLA 5B7QA 1EE1A 2VTVA 1BKDR 1EWKA 3TMKA 4QATA 5LJIA 3GGPA 4IJ6A 1ODSA 3A1FA 3BFVA 1HQKA 1RQLA 3IAAA 1GD1O 2WIJA 1Z3IX 4O08A 1L7RA 4KAAA 4WLEA 2WJJA 2Y1OA 1U99A 3NKLA 2V7EA 3ZVRA 4JN6B 1CLEA 2J46A 5FLYA 2X1MA 1UM8A 1U0FA 5I01A 1CZOA 1NG9A 2HZBA 5KCMA 3K0KA 3WMGA 3X43A 5M04A 3I4LA 1US8B 3HCBA 3RRZA 4DMUB 3R7SA 2AZTA 3TO5A 1YONA 1SVMA 3L6UA 4MA0A 4HUTA 3GP8A 2POCA 1DRVA 1IBCA 2IELA 1G19A 2R60A 3T1QA 1V71A 2OUKA 1DCFA 3B70A 3PRJA 4HDSB 1YU9A 3IUEA 3QMWA 1EK2A 2RCYA 3ET4A 1KO5A 1F3LA 2BBTA 3HNRA 4O1IA 5LBIA 4WW0A 3SQDA 1VSVA 1ZG3A 2Z2XA 4GOXA 5CYOA 1WDKA 1MABB 3FHTA 4PQGA 1Y8RB 3N1UA 3UKDA 3G2LA 3UUWA 2PK3A 4MW4A 4QBGB 4UCQA 3MNFA 1GTSA 5JD3A 4JJ6A 1J21A 5IZ4A 5L4NA 2LCQA 1LFAA 2V54A 5EWLA 1T6ZA 4DANA 1LJUA 1RLJA 5DPMA 1DTSA 3QGMA 5B3JA 4HI0E 2CFCA 1X8JA 4QDUA 5HCIA 3RS3A 4C89A 3Q72A 1NR1A 5BN4A 1XK6A 1YK0A 3IUJA 1YTUA 2ZM6B 1MOZA 1XRRA 2VBGA 2UUOA 1GXSA 4KC0A 4V0QA 2ZUVA 2QTVB 2TMYA 3VR6A 2C1XA 4WASA 2GHQA 4WNYA 1TZCA 2QF7A 1V95A 1KPGA 4C6SA 2AF3C 1ONSA 1HXHA 3OCWA 3EZ2A 1JB9A 2IEAA 3BWYA 1Y4DE 2FWPA 3A10A 3G49A 3OMWA 2C5FA 1M34B 4YALA 5J59A 3WI7A 2ORIA 4BRWA 4MB0A 4KQJA 1WPGA 4FZ3A 1ZVQA 3WYNA 1K6IA 3DCIA 3MG9A 4V3BA 4FI3C 1D9ZA 1GUDA 4J0FA 2WU4A 3PFHA 3R6DA 5F21A 2VJMA 5JAHA 1RVV1 3RKSA 4Y1GA 1KK0A 2RG7A 4A27A 3WNZA 1OLSB 1AKRA 3W5VA 3LPNA 1N7HA 4D9BA 2HXGA 1BRTA 1PK7A 1M74A 2Q0QA 2ZWVA 3CZAA 4D3XA 4EDHA 1T35A 1JFSA 4IFTA 1MX3A 1PVDA 1RHMA 3DPSA 3IV7A 1IC6A 4ZHQF 3AERA 1BD4A 2JIRA 3NAZA 2J3KA 1NP3A 3PFGA 3Q4GA 3GPIA 1RZVA 5E0KB 1YRAA 3TIFA 3T9EA 1V1JA 2HO5A 1APBA 1DAEA 4GOKA 4IIVA 1H2RS 2CCGA 1V1MB 4KXVA 4PLTA 2RB5A 3E5NA 5BR1A 1OAOA 2H7CA 3QJ5A 1RPZA 4QFBA 4PAMA 5COBA 1OIVA 4KWTA 5TQ0A 1QP7A 1F2TB 2PIDA 4ITUA 3RF6A 4UD2A 2ZSHA 3HFGA 1H4SA 2SBTA 4LXTA 1Q1ZA 3SYRA 3TLGA 4NYIR 4M0MA 1FS6A 1U7PA 4MKRA 5KVAA 2GKSA 1ESCA 3AHEA 4QYSA 3TQFA 4DABA 5B30A 2R65A 1EUZA 1DX6A 1CS4C 1G3UA 2IGTA 3KYDB 3G2KA 3IQIX 1RT9A 2F3RA 1CZKA 2QTAA 2O1WA 3EDCA 4JLSA 4HYYA 4KX5A 4P8RA 1Z0ZA 1NXTA 5BWCA 3FMGA 5H8WA 1J8MF 3V1YA 4YMIA 2Z98A 3P2MA 1Y7HA 2H2AA 3K8QA 4G5SA 1V3VA 1JHPA 4JWTA 4D8VA 3VC3A 1YJ5A 1W46A 2VWPA 4HEA6 2V6MA 4PLGA 4DC0A 2OOKA 1BCSA 1BOOA 1NXQA 5J2TF 2AUMA 4BIMA 1O6GA 3EBOA 4TWIA 1E5DA 3AFIA 5TQ2A 3BZBA 1WBBA 1M83A 3ELWA 1M1NB 1WW8A 3H16A 1IXSB 1JEAA 2OZKA 2HJRA 3FN4A 2BZSA 3N2IA 3QX9A 3ITKA 4G8CA 2D1SA 4NE7A 3A4TA 3U4CA 3NVMB 2Q4TA 1A72A 4MX8A 3R5XA 4AY3A 1Q44A 4OGGA 4AG5A 3ADPA 1TA0A 4L4ZA 5EWMA 1SHTX 3S0JA 5JCZA 1MQ9A 1U2DC 2R8PA 4DDTA 1XGKA 4ZQFA 4BZWA 4MYTA 5FOUA 5JZVA 2AFIB 4BLUA 4G3XA 2ZVQX 3E27A 4LYDA 1C7RA 4I5GA 4C2AA 4R5HA 1TA4A 3U2QA 4OI0A 5LMNB 4N5HX 3R77A 1JR3A 2G9RA 4L8LA 5T8KA 1GGMA 1SB9A 4LXIA 4P32A 4XE5A 4BFVA 2W6ZA 3A0RB 1Y8ZA 3B7GA 3M4ZA 4EGFA 1KZ1A 2CXXA 1SXPA 1NZDA 4K86A 4M3NA 4YIKA 3UFXB 2Q6LA 1S9DA 3KB8A 3L84A 5AR1A 1JFTA 4EFMA 2WSBA 4BCDA 4RTPA 1SVKA 5AJZA 1Y0BA 3INRA 2ZBQA 2PVSA 4DYHA 4NTZA 2CT8A 4XR4A 1EZZA 4EMSA 2PT6A 4R8MA 5E7JA 2BMWA 4EMUA 2Y1GA 2ISCA 1AQIA 5BV1A 3NDJA 3K72B 4DMRA 2ZDGA 4IDEA 2JGNA 4LYJA 4DHEA 4DKXA 1SXHA 1CY6A 3CNLA 3HJUA 2VDWA 4P7FA 5SY9A 3K0SA 5G1OA 1P2FA 3I58A 3LAWA 4AS3A 2GFHA 4M0FA 1C80A 1K08A 1JYSA 2OENG 2OCDA 4KFSA 4N8EA 5EZYB 4G0WA 3OT1B 5ERGB 2HH9A 2CHQA 2A6PA 1QKKA 2RGUA 4FW9A 2O14A 1OPXA 1YR9A 4MGIR 4MAAA 3EEIA 4BWFB 2TMGA 2I6QA 4WFKA 1X1AA 1PJQA 3N58A 4TLEA 2V3VA 5IJZA 3KT0A 3GJZA 2AL7A 3VBCA 5JCOC 4HNQA 1HDIA 2F1OA 4TXJA 4U6QA 2QG4A 4KE7A 2QV7A 3HBJA 5AKXA 2E1PA 3ZVMA 2WNHA 3A1WA 3K0BA 5GONB 2GLUA 1AKWA 4RPLA 5TS3A 3TVDA 3U5TA 5KYXB 5JECA 4BKQA 4LQLA 4C5BA 1TKRA 4UVHA 3SJCA 3PTZA 4F3RA 1G3RA 1X70A 3QVTA 4JYZA 3RTBA 2FP4A 1IUNA 4IIUA 5FBRB 1QHYA 1ZRSA 2I2WA 2R87A 2HLHA 1JG1A 1XQVA 4B9EA 3OPYI 3ER9A 1OTYA 4YP1A 4DF3A 4Z9XA 4NZYA 5LU8A 2GN1A 1EE2A 3A2KA 4EL0A 1Q19A 2Z43A 4PYJA 1D2RA 3FDIA 1WUTA 2XRFA 1UP7A 3C3CA 5HUJA 2B7BA 1ISJA 1AB5A 4FC7A 1GZ5A 3FFAA 5EJIA 3KJGA 3TR6A 3UFXA 1RE1A 4F3KA 4CGZA 1BXGB 1SXJD 4R6XA 1GOTA 3VNRA 3HRIA 4J16C 2OV2A 1XMJA 3IQWA 4PX5A 1OZ0A 3NU1A 4I46A 1GU7A 3L0SA 3RYTC 3TXYA 3TLXA 2Y67A 3QPUA 4RTQA 3MJVA 5EKDA 4B4KA 2YL2A 4MV6A 5F9HA 2E21A 3ASZA 4GBED 4B3FX 1OPRA 1W1IA 2FF7A 1Z34A 3DUFA 3O1LA 1UAGA 1WZUA 5C8YB 2KBEA 3OLWA 2X7HA 1KIFA 2JPDA 3PNVA 1O58A 4N54A 5EWMB 3VR0A 1NW7A 2J9GA 5IT0A 2R85A 1IQUA 2DFPA 3U4IA 1BHSA 3D4LA 1CCWA 4H17A 5AO9A 1J7KA 2H07A 3MFQA 4RA6B 3F97A 1WUYA 1DU4A 3L6CA 2R86A 2Q3EA 4WACA 1WKVA 5HW0A 3KSBC 2ZUSA 1DL5A 4IKOA 1ISPA 2VTDA 2ZBFA 1DP4A 3PD1A 4YRKA 3IP9A 2FJ0A 2YINC 1OTXA 2JFFA 2I33A 2WRZA 1YI8A 2PS9A 2Q1SA 2R66A 3BJZA 1PV1A 3HKCA 3KBOA 2Q5IA 2X4LA 4N7MA 1UMDB 5E7MA 4JWKA 5K2MA 2AZ4A 2VLIA 2W6MA 3A3OA 4DJ5X 1CB0A 1Z38A 1U28C 4AC9A 5C3MA 2G1PA 4G0UA 1WP4A 1B6SA 1JEDA 4EKYA 3BD8A 4EHAA 1R74A 1TAUA 4ENWA 3CY6A 1Z6YA 1XEWY 3PDIB 4OHYA 2G9ZA 1RYDA 3LKZA 4BP8A 3IEVA 3DFIA 1SC6A 2H85A 4N3NA 4H08A 1BW9B 1NNUA 1VYVA 4LY3A 1D6NA 1GCAA 4W7SA 1DX4A 1Y34E 1QV9A 3OHSX 5JOQA 1JEYB 2IBMA 4QHYA 1XVUA 2QX4A 2ASVA 3FWHA 1TMYA 1ES9A 1VCMA 2NNLD 3ENZA 3I05A 3L4BA 3OVMA 3SSOA 2GDJA 3WLEA 4HDKA 1TQ4A 5FBLB 5FNZA 2YOFA 1JT9A 2FN9A 3RVKA 4R5MA 1IN4A 1L1FA 3G17A 5JVDB 3CSUA 4ZREA 3L4SO 4ZDJA 2IE0A 2UYOA 3H4VA 1E7QA 3K53A 5HIMA 3WLAA 2XUZA 2H1OA 4PTYA 2V4MA 2V3WA 3COWA 3DB2A 1LPAB 2A4KA 3V7NA 4H1TA 1JH9A 1GPYA 1CIPA 1H0KA 1JHMA 1N6PA 4K03A 1JKJA 3LCRA 3NHPA 4BU0A 3V4ZA 2HWYA 3R3JA 4P83A 1SK8A 2G80A 4K9RA 4Z6KA 3PEWA 1SK9A 2WJ6A 2Y76A 1V16B 4M22A 4AMVA 1L1QA 5IUNC 4YYZA 3RJTA 2OCBA 2CL6X 2P9QA 1BMTA 1CUXA 1LSJA 1ZMTA 2R48A 4TWZA 5GJWC 3Q15C 1A5BB 1MCZA 1YQ9A 2C82A 2CLCX 2ZRJA 5LL6P 4HB3A 2NG1A 1UBFA 2CL7X 3LSYA 3B1YA 1SKUA 2W9XA 4F7DA 3ZWPA 3KQUA 3HBNA 4I9FA 1OIWA 3PUKA 2WUDA 3AVUA 1CQIA 4PV7A 4WJKB 2X86A 1O57A 3FYTA 3X2FA 3I1JA 2DMRA 2BFBB 1TCUA 3OBBA 4WZ6A 2MR6A 4MV9A 1RU3A 6CHYA 2JG3A 4FKZA 2FQWA 1EK6A 4KGVA 1E2GA 2HJ9A 4B7ZA 4RHTA 5BW4A 2VFAA 1Q7BA 3R24A 4IIHA 4EGQA 2QI9C 2I34A 2WB2A 4ZOLF 5H16A 4RY9A 5KKCA 1SBYA 1F14A 2ZIZA 1X3SA 3CZCA 3VC7A 1Y3CE 4HL6A 4DLZA 1DEXA 3OQBA 3L7CA 2BL4A 3M6UA 4CUZA 4RA6A 1JEYA 3C3WA 4JI1B 4YUWA 1ZM7A 2IOFA 4L9SA 1VBFA 1H3FA 4YJFB 1GO2A 1Y5LA 4G01B 2ZROA 1R4MA 5JNLA 1CDZA 3K0EA 4BC1A 2HJGA 4I1IA 2HHHB 2NPOA 3LDUA 4MMYB 4P7BA 3DE6X 1LX6A 4S0XA 3GD7A 2OLJA 3CF4A 2LCIA 4BNUA 1L5VA 4L0QA 4M55A 2RKBA 1VA4A 4IYJA 1BH6A 1QG2A 3AGQA 4M89A 1PEAA 4FMDF 4OMFG 4R1UA 4EQ6A 3IGFA 4TXMA 3TUJC 5MFPA 1PZHA 3H3FA 2P9CA 3HO6A 4B3DA 2D0OB 5EUQB 4ARAA 1Q50A 1FNSA 2Q2WA 1R0XA 3L4EA 3PS9A 4G37A 3NHAA 4MHOA 1SCNE 3U31A 4AWBA 4M7PA 1YL7A 4QULA 2X9VA 1KSGA 3AR6A 3UBMA 1V16A 4LX0A 4RVOA 5LLSA 1TAQA 1UOQA 2ZB2A 3ANTA 1TO2E 3EFOA 5DNWA 1FU4A 1REQB 1WUHS 4F5WA 3SFZA 4H27A 2WAYA 3NONA 1XTUA 2L69A 2W42A 2NTNA 3I2HA 3ONNA 1G18A 2XTNA 4RE5A 2GFQA 5EVJA 3LWBA 1B41A 1QH1A 1KMIY 1YDWA 4LXUA 5I9TA 3F6YA 3PCTA 4KLZA 5J4HA 1GV1A 2Q1TA 4DQ0A 4FX2A 5DE3A 2JK1A 4TLCA 2C3OA 1UMCA 5IMBA 1EK5A 1INLA 2C58A 2XIQA 4J1NA 3ANXA 5KX5A 1B8VA 1MB3A 2PX8A 3WGTA 2XEDA 4JSTA 1FTWA 1QORA 2ZQ5A 1ISFA 1J56A 1KKUA 1R0ZA 4UM9D 3CKLA 1ZXXA 5F73A 4EO7A 2B8NA 3I04A 3HO1A 1TDJA 1PG5A 3M9XA 4MW5A 3IEIA 1GGVA 1P1RA 721PA 1XPJA 2R62A 3R0JA 5BRJA 2C5LA 2PWPA 2WR8A 1U7DA 4R1NA 1EXNA 2BI8A 2OMEA 1GTMA 1UJ5A 1MB0A 2F8TA 4U9UA 3WWEA 3K9NA 4EVQA 3GFSA 4MV5A 5JLAA 1SHLA 5HZKA 4CLRA 1BXRB 3V4PB 1S2IA 1TMOA 1E2KA 4XYBA 2IYOA 4DAEA 1B0UA 2Z3ZA 1K75A 4JEHA 2XUAA 1KDPA 2HRBA 2V59A 1J9GA 3NTVA 4UBLA 4URWR 4H35A 1MTZA 2WUGA 2PKQP 3TD9A 3ZQKA 2ADOA 2H0QA 3A05A 2QX6A 1RZRD 2I62A 1DXOA 2EGGA 4KZKA 5BSVA 2OK8A 5CJ2A 3RASA 3VDRA 2BFDA 4F21A 1E4YA 4LF4B 3L8CA 1RABA 1NE2A 1FU8A 1AT1A 3K6KA 5BYAA 4X91A 1UT6A 2IPNA 3SNHA 4DPLA 5HGXA 1TE2A 1Z5GA 5J4YA 4JGIA 3B5JA 2BYTA 4G26A 3VAAA 4Z5XA 3JQFC 1E8MA 1XA3A 4LRUA 3HP7A 2CJFA 1L7AA 4GUAA 4JVSB 1DIBA 2P30A 2XCQA 3ECCA 3LY7A 3N8NA 2O8NA 4W1RA 4ARZA 4L8FA 1LLCA 2JD2A 1NTOA 4Y2JA 3NV9A 4C3OB 1M1YE 1P81A 2B1JA 2ODAA 3SN6A 2YIJA 2WE7A 2YFKA 2FJPA 3NEPX 4OQXA 3P9XA 2PMWB 1FRQA 2BTQB 2WTNA 5I9MA 5FUMA 5CH8A 5HG0A 3R0QA 5K03A 1SIBE 1UQRA 5HP4A 4PGFA 3FPJA 1Y3IA 4C7JA 3D9QX 1YUMA 2P6MA 3QJYA 4RZ3A 2UU9B 3E23A 3CZRA 3HUDA 1F4VA 3IMEA 3EVAA 3L4BC 4AO7A 4NXNB 3SX4A 3HHEA 3U56A 3M70A 1RWOA 2WT9A 1A50B 3TR0A 3V97A 3RYCB 3UGJA 3G6KA 1D2EA 2VNSA 5A2QA 3AR4A 3ICEA 1FW8A 3OZFA 4ZICA 4TQAA 1MJNA 2BKEA 4RKQA 4F38A 2X8JA 1DJQA 1OZHA 2JGRA 3LX4A 2C2BA 1T3GA 3UH0A 3DFFA 8ABPA 3Q88A 3JAMA 3HEAA 3ITEA 3VPSA 3K0CC 4YP7A 3VJKA 4BTEA 1UC5B 4GQAA 3WJ7A 3N2KB 2V55B 1EG7A 3RK4A 4D0RA 1P5HA 1YZFA 1MA0A 5AVTA 4ERXA 1XJCA 3GWGA 1N1EA 1U8YA 1Y5RA 2REOA 4KB5A 4KR9A 4DNQA 1XPRA 5C4MA 1UZLA 4REOA 2VYNA 1OWLA 1NONA 1IJFA 2D0DA 2FZ5A 5I9NA 3B51X 2QXYA 5CDFA 1M1XB 3WGIA 1WCIA 4OXXA 3UKJA 2I3AA 1Z07A 2ZYIA 1U8XX 1N2ZA 4PXSA 1MC5A 3IV6A 2G4LA 3VAYA 2NVUA 1YB4A 3RV4A 3TLZA 2GD2A 2HXYA 4KO2S 4PR0A 1RYFA 2NTJA 1CUBA 1K0FA 2H18A 2QN2A 3TNJA 2YXLA 4MZXA 2BFCA 5LZ5A 4D8TA 3OJ0A 3O8OB 1KZYC 2QUIA 4GP9A 4H15A 3IBGA 5AW7A 5JZ9A 3V4RA 4GPEA 4B8WA 3CCFA 5BYBA 3I92A 1QCCA 4W8OA 3L5OA 1NLMA 1XTSA 5C4IA 1VJDA 1T0IA 1YB1A 2F7SA 1FZQA 2ID7A 2MCFA 4ZI2A 1KI9A 4GKBA 5KAMA 4MCHA 1IHDA 2OV4A 3WIEA 1N1MA 2HLPA 4BZZA 3P0RA 1A7AA 4GQBA 1JG4A 1OGIA 4AKEA 1ZUNA 4WLFA 1T9GS 5IM4A 1Y6FA 1V6SA 1EWRA 1RWNA 3H3JA 3JQGA 5TY0A 3N6RA 2RE8A 3ML1A 5AT1A 2YR0A 4E14A 2GJ9A 4J0KA 2JKVA 1BKSB 4UNRA 5DIFA 1OBOA 3KDSE 4MCIA 3PLAE 2IT1A 1MDBA 3NH6A 2EJCA 5FFNA 4AB1A 5LMCA 2RGNC 1ODKA 1D09A 1ZCZA 3DO6A 1DJLA 4FCTA 5C4GB 3EPJA 1KDTA 3JAKA 4I4TF 3GUZA 2JIQA 3GGGA 2Z9CA 1O9GA 2O4UX 4N0PA 5CVVA 1U5CA 1RIFA 4FR5A 1X8KA 5IVHA 2PMDA 4CT0A 4EAAA 5TX7A 1JQDA 2P69A 1XZGA 4H7IA 2V96A 2DWPA 2AK2A 2AMLA 1JALA 4OJTA 1VSBA 1WKCA 2G67A 1CIJA 1KR2A 3DMFA 4L3OA 1JU3A 4D8XA 2H51A 5CDYA 1W75A 4TV9B 1W5TA 2I80A 3IALA 3H42B 4HRXA 4OL9A 3KYCB 2V9ZA 3NBFA 1NJ5A 2A5JA 3WRVA 1QNLA 3AP1A 4MLPA 2BMJA 1OFTA 2CXNA 2P78A 2J3LA 4RACA 1PZMA 4TYYA 4RFVA 5GONF 4ZVVA 3G59A 4X3CA 3SIPA 4PY2A 4BQEA 1NM5C 1VG1A 2Q07A 4NCJA 4K6GA 2XDYA 4XPIB 4QTZA 4DSNA 4OI1A 4C30A 1XCJA 1IWPB 3G2JA 1VC2A 3CO5A 3REQB 3WJ1A 3X44A 5HXAA 2NT4A 4N5IX 1H9BA 1L5NA 4UU7A 3TPZA 3KFXA 3N39C 1H2BA 1SC4A 1Z29A 2XNCA 3B60A 2M1XA 5FTMA 5IM4F 3BFKA 13PKA 3UN1A 1NIPA 4B46A 4D4KA 2ZP1A 4NV1A 3UBTA 3WE7A 4A6XA 2V58A 1TGYA 3FVTA 3IDFA 2QTLA 1JJAA 2F6RA 2FOXA 3PGJA 4MB2A 1F60A 5CX4A 5I47A 5KHLB 5KQMA 1ODFA 1MQAA 2HWKA 3E9ZA 1S2OA 5JEDA 2ZUEA 1Y9JA 4IRXA 2UZ0A 3T3NA 1DINA 3HM2A 3QU2A 4HXGA 3PDCA 4EP1A 5CDGA 3PQ6A 3A31A 2NTEA 4KE6A 5HWSA 4Z1MD 1QCYA 1X7ZA 3JWHA 2EL7A 2ZDQA 3M5PA 5AUQA 4D9EA 3SZLA 4RJKA 4ROSA 3HM9A 2ZWAA 4EB0A 3ASYA 4BB5A 4AO8A 1Y6GA 4BP3A 3DXZA 3M4JA 2VPXA 4JJGA 2GBPA 4MQLA 1ZD8A 2ECKA 4QVGA 5IEBA 2BF7A 2Q3DA 3H2JA 4OHFA 2AEMA 1OXMA 4HDSA 1ZD2P 4MKFA 3RIXA 4DMKA 1L5HB 3I6YA 1UM9B 4AKIA 1UMBB 3DONA 2P5SA 2JS7A 2FE4A 3HJFA 4QBKA 4XJSA 1COWA 4WESB 3L7OA 3ZHYA 4ZMRA 1HLGA 2NP6A 1PQPA 4TKZA 1N6RA 2IODA 4RMGA 5L3QB 4JYCA 4JMPA 4D6XA 4CKBA 2ZQYA 4GMXA 3QIVA 1CB7A 3KLNA 3L93A 4K81B 4LZJA 2XQIA 2ONJA 4EELA 3F74A 2WEKA 2J0SA 3D2BA 3EGOA 1MEEA 2XMDA 3O1HB 2B9VA 2DQ4A 3A1DA 2FVXA 3NCTA 3EBLA 5DTEA 4RDXA 2AUNA 3U81A 3UJ8A 5IULC 5IJ0A 5KTRA 4NYIQ 2BF4A 4IUBS 3WAJA 1K68A 1SUCA 3DAHA 4H77A 4QDOA 1UPXA 4QOEA 3LOQA 4B3CA 4DLKA 3B85A 4Q7QA 1ARZA 3MWGA 1Z68A 3VR6H 1AM4D 2X9LA 4PN7A 3D8UA 4M9QA 1MO5A 3FHLA 4DLXA 1LWOA 5A9SB 2BCGY 3V1UA 5HIKA 2FPSA 1XZJA 1Z28A 1GXSB 1EP1B 2Z5LA 1F1BA 5BWBA 4FWIB 3C3DA 2JA1A 4B85A 2ZULA 1HFEL 3EUFA 4JBWA 1GDDA 5DASA 3ZY3A 3W5JA 5BQOA 1OH5A 2QPLA 4QGHA 3JWPA 2PQMA 1ZQ1A 3GLQA 2CHVA 5KJ1A 1QVRA 1XXHB 3MJCA 4W5QA 4F8YA 2DG2A 1MORA 5DGCA 1ZGZA 1TNDA 4UTVA 4EVSA 4HDRB 1GCGA 1J1IA 4EFNA 1BWRA 1UEJA 2RGCA 4MYDA 4Z4HA 1M73E 2HQSA 2ZLBA 1QK5A 1RYNA 2VTBB 3ZE8A 1GPUA 4G6ZA 4EKGA 1N2HA 4J9VA 1KJJA 3VPHA 1KRWA 4OO3A 2CCKA 4M54A 4AP9A 2QD2A 1YJAA 2XDAA 3PC4A 3CB4A 3QOWA 1KZHA 3OQIA 2ZB8A 4JEIA 1GKLA 3DHNA 2Y1EA 2O07A 3CX6A 2WAOA 3HDYA 3MTBA 4J2OA 4MS4A 1Q0QA 5F2EA 4D79A 1PDWA 5BXYA 3PG5A 5KWVA 3SGLA 1EFAA 3LVQE 3WWYA 4Y2HA 2D0IA 4X93A 1AUVA 2ZK7A 3UICA 1XKQA 1MFPA 3GT3A 5A05A 5ITZB 5KYYB 3QXJA 4L78A 2CUTA 1SIWA 2VWGA 4XTCS 2WKQA 5DN6A 4RFSA 5CLJA 1Q21A 4JU9A 4AXXA 1UJ6A 4H4EA 4DV2B 1KZGB 5E95A 5BSTA 1T9ZA 3RFVA 3U3KA 3E8SA 1I2AA 2P1DA 1MO3A 3AP2A 3O75A 1B74A 5LQCA 2IZ0A 1O5TA 4H2DA 2FPPA 4YLGA 1YSCA 3O1JC 4DN6A 5KIAA 3ZV7A 4HWRA 2YWDA 3U40A 4DQVA 4L8GA 3M3PA 2EAUA 3TFOA 1OH6A 2X1LA 2ZIXB 2PS3A 3RRYA 1TYZA 2WMYA 1WF6A 3F9RA 1GV0A 5FUVA 2H2HA 4NU0A 2H92A 4B75A 3CNOA 5D51S 1KTIA 3TW0A 4BXOB 1PJLA 1U3DA 1IMOA 4WVLA 2XKBA 2GK7A 2RFLA 3SKYA 4YRBA 1NPYA 1W9MA 2RIRA 3QEMB 5LQKA 1SUBA 3LYUA 4RZQA 4D0GA 5B7GA 2KWIA 4E5MA 2KM1A 2CXRA 2DCMA 3A04A 3AR9A 1NTRA 1YXMA 3PGA1 4OKIA 2RAFA 5SZHB 1PX2A 3TZKA 4ARZB 3HWSA 1I4WA 3ZOKA 4R01A 1F38A 3HUTA 4CV3A 3KS9A 3M1LA 4TWBA 3PXUA 4I8XA 4JOBA 2H7YA 2R8ZA 3KR1A 2I7DA 3ADDA 1Y3BE 3HDJA 3LP8A 4NATA 4WN9A 4XSHA 2VJOA 5B53A 1TFUA 2EBWA 3GQBB 2H65A 3KEFA 2Y77A 4OTZA 1CY7A 3ZWVA 3ZK9A 3NDBB 1UFKA 3IDSA 5BV0A 1ZEMA 3FDZB 2O48X 4X1KA 5FBHA 1Y98A 3A36A 3JRWA 1P9NA 4N40A 1M2KA 4TVBA 4C7MA 1DKPA 3F1LA 3OUTA 2GD0A 5HE9A 4BAUA 1E59A 2OLEA 5T5QA 1HK7A 1X13A 4RGQA 2J3HA 5IAJA 5BQ3A 4K9MA 4P7GA 2Q4DA 4NEGA 1DWUA 3TJZA 4N7JA 2F64A 2YN0A 2QDKA 4OUKX 1U2GA 5E6UA 3O94A 1FFWA 2OAP1 2VXCA 4FDMA 1MXHA 4QRDA 1HURA 2AG5A 4G1CA 4YHBA 2ZAIA 4UTPA 3QE0A 4E70A 1YH3A 3A1NA 2CNKA 1L5SA 3MGCA 4JA0A 1H6DA 4O5OA 1HYHA 4TXNA 4XB1A 3SDZA 3ZWOA 3U9LA 1LW6E 2FPKA 1LLFA 2YHAA 1JIUA 1J0AA 2R1TA 1Q3HA 2W2VA 1CPYA 3CHYA 3MRXA 3D1LA 3E9MA 5ULLA 5EGSA 4MW0A 5FQOA 4G1BA 1HE5A 5K99A 1ZMBA 4EY8A 2Q9UA 5H3LA 4TZTA 1X1CA 5A3JA 5HZGA 1WXIA 2F00A 1FSSA 3BKWA 4OIMA 1E1YA 4MIYA 1AN0A 4REQB 3R0VA 1DRKA 3VHXB 4RJ2A 3BRSA 3I53A 1CT9A 1U2PA 4HJXA 2Z6VA 2R3SA 2ZRCA 3K4QA 3NFRA 4FQ7A 4JLKA 4OEHA 1QB7A 4REMA 5J58A 4CM9D 2BEWB 4TL9A 3C15C 1VL0A 4NJEB 3GLRA 1QQBA 5ALUA 3S6JA 2NVOA 4N6NA 5L7YA 3AJAA 3R7WB 4CQJA 4OUDB 3OLXA 3AR3A 3RANA 2P3SA 2HK6A 4PAQA 4TV8F 3C3XA 4RS3A 4G24A 1PZFA 3QWAA 3Q5EA 2JFPA 2IPLA 1Z5WA 1GVNB 1Z35A 1XJWA 3OP1A 4WN9B 4ZCRA 4R69A 3KKMA 3Q7PA 4D6YA 2FZGA 4IQ8A 4PC3A 3L7IA 4YMSA 3HVIA 3GMDA 2XUGA 1N5KA 1I5EA 4QO8A 1K88A 2Z4SA 2RSLA 3OWOA 1TCAA 1QK4A 4MO9A 5DW3A 3VR6D 3ZY6A 2AEFA 4GI1A 1ODTC 1U2GC 4I99A 1C4XA 3LOPA 2I4TA 1JXQA 3KVVA 1ZOIA 1UDBA 1D03A 3IS3A 3WGJA 4I4IA 3X1WA 1QFMA 4UKDA 5DX1A 2JH8A 4CJXA 2BKLA 2R8RA 3VJMA 2PFSA 3PL5A 1DRUA 4OGKA 2BGGA 2WJPA 1OLOA 1U7ZA 3AI1A 3TW8B 3L8YA 2EFDB 3PPIA 4P4TA 2PE5A 2QEQA 1E64A 3OJCA 4AZ3B 1Q7CA 5E38A 3OPQA 4AKTA 1FTQA 4H59A 1IBSA 1J24A 2VF7A 3AXTA 1JG3A 3KHKA 4UU1A 5BT9A 2Z2KA 3C85A 1P18A 1ZA1A 2BLNA 2CVPA 3DDCA 1UF9A 2YOGA 1KMNA 4IGKA 1VP9A 4UE3S 1O2DA 2J4FA 3HYSA 2GDZA 5T3YA 2XMBA 3Q5DA 3QY9A 5GAJA 4DSAA 3EXG1 4M1QA 2ZPUA 2J09A 2AD1A 2D13A 2XYQA 5AHKA 4JL6A 1QB8A 4TKVA 2MYUA 3A9TA 4K3UA 3ZLJA 4N5MA 3MCUA 1WE2A 4GVLA 4Y6SA 1ZUHA 3SDBA 5I5EA 1ZWLA 3IMCA 2H8GA 4OHOA 1S2MA 3F90A 3DP7A 4IIBA 3AEKB 4A92A 5JNTA 3AFOA 2FW7A 4U3JB 1JLRA 1K6JA 3EGDB 3MELA 5EXDA 3H4MA 3STVA 2HT6A 3E0QA 3PDUA 1Q95A 4HD8A 4M7OA 3USES 1YDGA 1V5WA 2AJ8A 5DF1A 4RQAA 2OZVA 2IIQA 2WILA 3A6KA 4AJ1A 2G40A 4RJIA 2JEZA 4LECA 4Q7MB 4C87A 4TUYB 4OUDA 4D96A 4PC2A 3ZDBA 2DPYA 2GHIA 3W2GA 3WGUA 1FB5A 1V4VA 1QIMA 4MS1B 3EZGA 3HA3A 3FZQA 3OCCA 4OLHA 1I5OA 2A30A 1CIVA 2W2TA 3CZQA 4Y6LA 1CQJB 5CGQB 5AK4A 5DM2A 1CWUA 5K51A 4P3YA 5KNBA 3P2IA 3TTVA 1IULA 4QGSA 5LIRA 3VM6A 2X8AA 4PVDA 4YAGA 3IAEA 3NR2A 2RBKA 2V7GA 4G0XA 4MCAA 1P2BA 5HOQA 3DA8A 4DHWA 3JZAA 3QVWA 3VH3A 3SXJA 2X5JO 1B42A 3MK31 1A8UA 3R5SA 4ZQBA 1IG3A 2H5IA 3EX7C 3N0XA 1QHNA 4OBEA 2HRRA 3MSXA 4O1MA 1V7ZA 4KK4A 4BUJA 3G2MA 2WHYA 4WDRA 4BJ3A 5I7VA 3VBEA 3M5CA 1YCGA 3MT9A 1KEEA 3K1TA 2D5IA 2XSZD 1UC4B 2ZWIA 4OYYA 4ON9A 3NIDB 3PXBA 3J81A 4MYHA