4R98A

Chimera of the n-terminal domain of e. coli feob
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
263
structure length
256
Chain Sequence
KKLTIGLIGNPNSGKTTLFNQLTGSRQRVGNWAERKEGQFSTTDHQVTLVDLPGTYSLTTQTSLDEQIACHYILSGDADLLINVVDASNLERNLYLTLQLLELGIPCIVALNMLDIAEKQNIRIEIDALSARLGCPVIPLVATDTKNVQFVLKLAIDRYKANENVELVHYAQPLLNEADSLAKVMPSDIPLKQRRWLGLQMLEGDIYSRAYAGEASQHLDAALARLRNEMDDPALHIADARYQCIAAICDVVSNTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Ferrous iron transport protein B
publication title A GTPase Chimera Illustrates an Uncoupled Nucleotide Affinity and Release Rate, Providing Insight into the Activation Mechanism.
pubmed doi rcsb
source organism Escherichia coli
total genus 85
structure length 256
sequence length 263
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
A PF17910 FeoB_Cyto FeoB cytosolic helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4r98A01
2VHQA 3TSWA 3FHCB 4DEYA 5GVSA 3KKOA 3MRSA 4Q00A 4Y0VA 1AK2A 3ONWA 5CK5A 2PJZA 1WF3A 4LWZA 1DAGA 2DB3A 4BRUA 4DSOA 4BFXA 4HB3A 4B3DA 1F60A 4NCHA 4JVSB 2FFBA 2R8RA 3P20A 4WOPA 2ZI3A 4DB4A 2Q0HA 2OHFA 2CLDX 4D25A 1XF9A 4YDSA 1TF2A 5EE3A 1OYYA 1KSGA 4Q9LA 3PR1A 1BO6A 1DARA 1N0UA 2FF7A 4IDPA 3U3MA 4QJ5A 2ZUCA 2X19A 3QG5A 5GJCA 4E22A 4CEJA 1G8FA 4IFBA 3QEJA 1I2DA 1R8QA 2QL6A 5HKKD 2OFXA 1XMVA 1U2RA 2QGNA 5JCZA 5F3WB 2VSFA 3AP3A 1FNNA 5CITA 1E79A 2B92A 5EUQB 3I32A 3BERA 3LVRE 4JBXA 1P60A 2EW1A 4A92A 4DHEA 4MGZR 4GNKA 3RLFA 3RS4A 3C4JA 2YOGA 3GLFE 4A0FA 4B34A 4BEJA 1KDOA 3I4LA 5KYKA 4L9SA 1RRPA 3WRYC 5E4FA 3T35A 1TQ6A 1ZC3A 1MV5A 1E9RA 2R6CA 4G0NA 2ECKA 1KY3A 1B23P 3KDSE 1WB9A 1MKYA 1XFAA 1XD2B 1G5PA 1D2NA 2QBYA 5BN5A 1W46A 1XEWY 1NI3A 1SXJD 2Q3HA 5EJEA 3TUIC 1DPFA 4B71A 1DE0A 3OFNA 2D74A 2RGDA 4L4UA 4C7OB 1J8MF 2A9KA 1ZC4A 4LSGA 2NO7A 3R20A 3O8RA 1E3MA 3G82C 3QXCA 1LY1A 4ZPXA 2RGGA 4HB2A 5TMPA 1DS6A 3RAPR 3U7FB 1OH6A 2G9NA 5KNCA 2D2FA 4EAQA 2C95A 2F9MA 2HEIA 2GKSA 2CHGA 3UG7A 2ZRJA 2WAYA 3DHWC 5TARA 4W5WA 2VHJA 4WXRA 4XIGS 2W2XA 3QKSA 5TVKA 3VFDA 4HLCA 2OBLA 1UEJA 5A0FA 3BH0A 3PV0A 3THYA 4JT2A 3I92A 5EXSA 4URXR 5HR5A 1OXVA 4B3XA 4UXJA 1G5TA 3OE7A 4YMWA 1IHUA 2FH5B 1OH8A 4B76A 1CRQA 1T3HA 1UBEA 2ZYUX 3OHMA 4RZXA 4XSGA 5JJLA 1JQLB 1LVGA 1PVOA 2H7VA 1UBGA 1XP8A 1L2TA 1RJ9B 2PX0A 2OT3B 1Z0AA 4KJZA 5LD2C 1YU9A 4BZPA 1D8TA 3MCAA 3EASA 1RVDA 2QY9A 2LCFA 1D2EA 1RPZA 4MA4A 3BJIC 3KUDA 3V9PA 2NO0A 5FOVA 1Q1EA 1YZGA 5EP3A 2CEAA 4WBSA 1EFRA 2AK3A 3ETLA 3Q8XB 2QENA 4PC7A 4B2PA 4NE2A 3BH7A 3VQTA 2YZ2A 4B3BA 5EUMA 1UBFA 2P5TB 1I4TD 4CZ2A 2HDNB 1GTVA 2ZRBA 1YZTA 1J2JA 1P9NA 3GD7A 4OL0A 1GOTA 4X8MA 3W6OA 4JL8A 4TLCA 4D80A 2ZTSA 4HI0E 4HB4A 3RNLA 1V5WA 1PV4A 4AY2A 1JR3D 4Q5IA 4BASA 4KHZA 1DO2A 2REXB 4Q4HB 1AGRA 3AF4A 2PLRA 2VPPA 3HPQA 3I5XA 1UKYA 3TQFA 2QTFA 1G18A 2G1KA 1ZM7A 1U8YA 3B1XA 4IDOA 3I3SR 2CNWD 3BWDD 4P4UA 1UM8A 2EYQA 821PA 1MABB 3GLIE 4UKDA 2IF0A 3FDIA 4QGAA 4A2PA 3TRFA 1II8B 4RD1A 5KPDA 4A8JA 1JEDA 2QE7D 3I8XA 3NTUA 1TUEA 2V6JA 3FPAA 4C0KA 1RKBA 5TDHA 4RKEA 2CHQA 4M1WA 5SZKB 5LDDC 1GIAA 1KJZA 3TVTA 1GG2A 1MR3F 2XGJA 1W36D 5DI9A 3SBDA 1PUJA 4UXIA 1I2MA 3LV8A 1A82A 4OQFA 3SHWA 2QQ0A 1BS1A 3LRPA 2Y8EA 2ZRLA 1OFHA 521PA 4MKIA 1E9DA 4I1OA 1RFLA 1OH5A 1UEIA 4TLEA 1QG4A 5JHHB 3VKHA 5CYOA 5FL7A 3K0EA 1L4UA 2QAGB 1HT2E 2KB0A 4A15A 1W36B 1WE2A 2P3SA 4QRHA 3A37A 3PCRB 1AZSC 2GBLC 4DEXA 1ODFA 4HLUA 1BIFA 5FBQB 1W48A 4BECA 4DB2A 1Q12A 4I81A 2RHMA 5KSPA 1E2FA 3FGNA 2BJVA 1E98A 1YRAA 3LY5A 4MDFA 1FOEB 1AGPA 5A5GA 3W8RA 1U0JA 4MYUA 4DRZA 2ZUDA 5J4KA 4HLDA 4HAXA 2F3RA 2EFGA 2PCJA 1NY6A 2JLRA 4BLSA 3WYFA 1QVRA 1XTKA 4LBYA 4MRPA 2O52A 3CWQA 5DE3A 4YONB 4M1MA 4Q9JA 3TGPA 1S9DA 4Q9KA 4QHSA 4ARZA 5CDFE 5J4YA 1G64A 1NJGA 3BFXA 2XJ9A 1OIWA 2WIBA 4IVPA 3X1XA 2PX3A 3X1YA 1X86B 3CRQA 1G7CA 2ONKA 1TQ2A 4YDHB 3CRVA 1F48A 5J47A 5FR2A 2ZS9A 4EDHA 3GEIA 2AFHE 4TZ6A 2VYFA 2BMJA 2ODEA 2X8AA 3NG1A 2VP6A 3OFND 3ZJYA 4EPXA 1IBRA 1E9BA 1TX4B 3BOSA 4XWAA 4D2IA 4DCUA 1K8RA 1ZW6A 1VPLA 2J3EA 3LW8A 2OSBA 3OF5A 5JI3E 2OCYC 1ZD8A 4D81A 2P65A 4K46A 4A2QA 2QBYB 4EIWA 2VHUA 3CB4A 4URZR 3IIMA 2OM2A 3TH5A 5B30A 4C0JA 5P21A 2QN6A 2F43A 3ZS9A 4E03A 4LOAA 5D3MA 5FPSA 2GHIA 4NPHA 5FUXA 3QNUA 2Q9AA 1ZUHA 3PVSA 4POAA 3FMFA 4R2IA 3R9XA 1XZQA 2YV5A 3A58B 3B8HA 2NPIA 4Z8YA 4G5GA 4Z51A 4NZYA 2GVZC 4UJ3A 5K8LA 4DCNA 5M04A 1OXSC 1YRBA 3OE7D 1Q0UA 4NYJR 1GUAA 4DDVA 4XVRA 3QKSB 1XTJA 3ZIAA 4YMVA 1HA3A 4XVQA 4PO9A 1Q3TA 1D9XA 1Z3IX 2FSHA 2UKDA 4Q19A 3THYB 3ZVMA 1S2MA 2GF9A 1CF4A 2FPLA 3F3YA 1U0LA 2DFTA 2C96A 3NXSA 1ZNXA 2AHOA 4QBFA 1YQTA 2IUSA 3DDCA 3ADBA 3ADCA 1P73A 2HXSA 3VR6A 4URYR 1AS0A 2DY1A 1FW6A 4S2EA 1KMHA 2NMVA 2P6RA 5LPNA 4DXAA 1EFRD 3H1TA 1KDRA 1C4OA 1JAIA 3W90A 1Q20A 4FINA 4CF7A 2D62A 5EQTA 5GJBA 1E9EA 2IXFA 1E0AA 1QHIA 3LBNA 3EZFA 4LBVA 1A5TA 2PCLA 4NP6A 2ZRHA 1Z08A 3E5HA 3MLEA 4RD2A 2BC9A 3EG5A 4O2RA 3VX4A 1IJFA 4TMTA 4WA7A 4QFMA 4PTLA 3QKRB 3TSZA 4NDZA 1OFTA 2P2LA 3HYRA 4GDFA 4RJLA 2ATXA 2CDNA 3AVOA 5F9FA 2J0UA 5BYKA 2IA5A 4NONA 1JAHA 4MDEA 1Q1QA 3K0CA 3C16C 1O3YA 4M8NE 4EFLA 3WMFA 2A5FA 1KO8A 1E9CA 1JALA 2F1JA 5BYJA 4XVUA 3JZAA 1FQJA 3IQWA 4WVFA 2HF8A 1YZNA 3C15C 4TYQA 1XMIA 5AK0A 5JEEA 2OEPA 4BLOA 3GLFB 1HQCA 4MGKR 4DDUA 2AKYA 2OESA 3MAAC 3GEHA 3RANA 3TKLA 1ZBDA 2K5UA 3K9LA 4ZDWA 4DT1A 4Z1MD 2C2HA 2ZRIA 2PEYA 4PQFA 3QENA 3QI2A 1N5LA 4C2TA 2XTZA 4A8JB 3QXXA 2UZ3A 4DDWA 1GL7A 1SXJE 1UDXA 4CGZA 1N3BA 2HCBA 3Q9LA 2FSIA 4B48A 1RW4A 2JLXA 1X3SA 4HDOB 4D4MA 1NIJA 2BV3A 5FL7D 5CLLA 5FTLA 2GDJA 3ADDA 1FTSA 3H2YA 5LB4A 3BIFA 4LC1A 4WZAE 2JCSA 2NGRA 3EIQA 5F2EA 3PUXA 4L5BA 4MUBA 3R9WA 5FBWB 2BBTA 4WZBE 2VP9A 2VP0A 1DAFA 4M22A 1PLKA 3OZXA 3GLGA 2IYUA 1AM4D 2D4HA 1EX7A 1T0JB 5AJZA 2V8OA 4DCTA 1B0UA 3AH8A 4EPWA 1ZCBA 4GOJA 2W6IA 3B5JA 3IPXA 2OFWA 5E7JA 2QORA 4R9UC 3KXLA 3SYLA 3VR5A 2ZSEA 2JATA 5G3YA 2BM1A 4B6FA 1XB2A 3TQCA 1N5IA 2OBNA 2ZR9A 1IXZA 4PHFA 3KQUA 2Z5FA 1P5ZB 4NYIR 4MUAA 2BVNA 4D82A 3WNCA 4KFSA 1OJLA 1E2QA 1N5KA 2FJUA 3GMTA 3AKEA 3PUVA 3C8UA 2V54A 1YR9A 4HZIA 3O8DA 1ZD1A 1NN5A 2NOAA 1ZIOA 1TQDA 4XD7A 1Q57A 4V0NA 2ZXUA 4PQRA 1V43A 2QSYA 1GFIA 1VKJA 1KAGA 4LBWA 5EE1A 1MO3A 4MGYR 2WKQA 3TUJC 4YMSA 3B60A 1ZVQA 4YLGA 2QAGC 1FMLA 5FL3A 5KUTA 1W36C 5LB2A 3HU1A 4KV9A 4NTZA 2BEKA 3UKDA 1VCOA 4CT4B 1G7RA 4M9SA 2GJSA 3CR7A 3U7GA 4TWZA 3AKDA 4Q4LA 4FMCB 4LDJA 1TMKA 3SFZA 1JR3E 3A4NA 3B13B 3IILA 4B75A 2QMUA 1KKMA 4TMKA 5H1YA 2EWWA 3SC3A 2BJWA 1A1VA 2QM8A 4BQSA 3WRXC 2GJ9A 1CJTC 5EXXA 4IOKA 3AVXA 2GZHA 4D4JA 1TTTA 1LW7A 3D6TB 4JKIA 4V0ME 4M2LA 2CCGA 2OZEA 3LFUA 1U90A 2WZQA 4KFTA 1OT3A 2WSMA 3CPEA 3CRRA 4OI0A 3EC1A 3AF0A 5D3MB 1NN0A 3EXAA 1NMXA 2OXRA 1CJVC 2C77A 2ANBA 3W34A 1Z0DA 2DFLA 3ZIAD 1GM5A 3ZD6A 4IOJA 3R9IA 5L3QA 2IEYA 4TYPA 2IHYA 3K53A 5CIWA 4JIMA 1XEWX 4F4CA 5L3RA 3VR1A 1OHHA 3KUCA 3CF2A 3P26A 4KLNA 4BE7B 3K9GA 1GP2A 3T12A 1CEEA 1DAIA 4TN1A 2CE2X 2JASA 1JECA 1Y3AA 3NH6A 4IDNA 3EPJA 3D31A 4ZCIA 2DHRA 3PEYA 2ODNA 3MJRA 4OQNA 4UXHA 3FMOB 1X8LA 5CM8B 1QHYA 2AXNA 2XTMA 4HATA 2WJIA 1QHSA 4TZ0A 2WWGA 5K8TA 2R44A 1K6MA 4HAZA 4LV6A 5D3QA 4Q03A 2J5XA 2ZUBA 3TAUA 4DLVA 3A1TA 5H8WA 3KB2A 1QHHA 1N6LA 4QGHA 3BORA 4L9WA 3SN6A 2C04A 4F91B 5G53C 4C4PA 1G41A 3D7MA 3K8YA 1Z2AA 1T5IA 3GEEA 1MRNA 1W2GA 4AWXA 2CCJA 2GESA 2MMCA 4LHVA 4O0MA 1UADA 1US8A 1OFIA 2QP4A 4BUJA 1E32A 1EXMA 5CYPA 4QG7A 2RH5A 3U7EB 3A1UA 1UKZA 2WWHA 4NH0A 3FKSA 4PSAA 4Q4AB 4PZYA 1GKYA 2ZRAA 1KZ7B 1IN7A 4RFVA 3RS5A 3KB1A 4QM7A 2J0UB 1K5GA 1WQ1R 2HUPA 3FHOA 1RRFA 3K0FA 2A30A 4P4SA 1FX0A 1UBCA 4CT5A 3MG9A 2ORWA 3GJ8A 2P6NA 3T1OA 4A36A 3WBKA 2W2VA 1GAJA 4ACBA 4LV8B 2C03A 1OLOA 2JDIA 3A4LA 3KX2A 1E0JA 1N6PA 4QGFA 2BCJQ 1KZGB 1XJ0A 1VIAA 5DYGA 1P6XA 1G1MA 2F6RA 2RGCA 4KFRA 1KJWA 4IW3B 2WBLC 4DDTA 3OAAA 2G88A 5C2JB 1G7SA 4US0R 4GI7A 1SVMA 1EFCA 1E2EA 3EPLA 2FG5A 1JJVA 4L15A 3P32A 1NN1A 1YZUA 3A1VA 1KI7A 1QHGA 4ZDKA 3IDQA 4UQOA 3R8FA 1TU3A 1MO5A 2VF8A 4G5QA 1A4RA 3QSYA 3LLUA 2IEZA 1U9IC 2ZAOA 3QPWA 2OLKA 3PFIA 4GPTA 3UWOA 5KDDA 3OEEA 5KHOC 1NNEA 2NG1A 1AJEA 4AIIA 1ZNZA 4ACAA 2W00A 1VG8A 3NWJA 4GOKA 4IRUB 4PC1A 2ZJAA 3BH6A 3Q72A 1N0WA 2W6ID 2ZETA 1M7HA 5FTMA 2XSZA 1OIXA 4OK5A 3RS7A 3O8CA 4JZKA 4LYAA 1AQYA 4ITRC 2A5DA 2CMKA 4Q47A 4YC7A 2QPTA 1QDEA 1E1RA 4D26A 4G5SA 3CH5A 4HDCA 2O8FB 4NBSA 3U44A 4EQ6A 3U61B 1CBUA 3FE2A 3QF7A 5AJVB 3L0PA 5TV2A 2C9YA 4Q1BA 3H86A 4YMUA 5JSZA 2CL6X 4XD7D 1G20E 1ZAKA 3UK6A 2E9SA 1XEFA 2WIAA 1ELOA 4ILEA 4AKHA 2RGNA 3I73A 5B58C 2XX3A 2HT1A 1JI0A 4BFSA 5EE9A 1YR7A 1UAAA 2H57A 4ZCLA 1ETUA 3T34A 2JLUA 1TEXA 3T15A 1Z07A 2O8CA 1FZQA 1XTIA 1JEEA 4A4DA 1GRQA 1NSTA 3Q7QA 4WW0A 3RWMB 2ZRFA 1PLJA 2BMEA 4CRWB 4FN5A 4LPKA 4GMXA 3LXRA 3QY0A 4F92B 4QL3A 2QZ4A 1HEIA 1T8TA 2HYDA 1N6RA 1Z6AA 5E7IA 3HYTA 1G6OA 4R98A 5ANRB 1RIFA 3L0IB 3WMEA 4LJ9A 3AVPA 3UXMA 2QT0A 4BFYA 2JJ2A 4KO8A 3GFPA 4B35A 4I4LA 1OHHD 2B7CA 1CLUA 3K09C 2D7CA 3I5YA 1J8YF 2WKRA 2VP2A 2CBZA 3B82A 3AVTA 2IYYA 2ZYWX 4HZUA 1AS3A 2O8DB 2YC2C 1OE0A 1ZU5A 4C0BA 5L3QB 3VNUA 1OV4A 4HSEA 1R7RA 3DZDA 1EGAA 4RD6A 2CE7A 1J70A 4BFUA 3KJHA 2CK3D 1QHNA 3ASYA 4PSVA 1SXJB 5FPTA 2R6FA 3WY9A 1E0KA 1PUIA 2ZANA 4X8OA 3KKNA 4CIDA 1SVOA 4A0RA 5KO2A 2NPFA 3FTQA 4TL8A 2AL7A 4DLZA 1NIPA 4HLQB 1CXZA 3NHAA 2ONJA 1S96A 4Q7KA 4IKEA 2C9CA 2F9LA 5BQ5A 1Z29A 3RYTC 3IEVA 4YMTA 1IY1A 2Z83A 5KNBA 1DTSA 5JI2E 4E09A 1NVVR 1X6VA 4D0LB 2YKGA 1RRGA 1WP9A 5DO9A 1ZMXA 1Z5ZA 2ZE5A 3OEHD 4CDGA 4D4LA 3ZYCA 2FA9A 2N46A 1VG1A 3DOEA 3FKSD 5FOSA 2E87A 4JBYA 5DHFA 2G0NA 4O2LA 1US8B 4BEBA 3U6BA 3O47A 1S0UA 3KJIA 1NSFA 2FFAA 4JLVA 3HU3A 4B6EA 3PEUA 3AB3A 3EWAA 3TLXA 3TR0A 4DCVA 3O8BA 2O8EA 4CVNA 1SQ5A 4C0LA 2J41A 2JDID 2I1VB 3QPUA 3SI7A 3EA0A 1W4AA 4GMDA 1F2UA 5JEDA 3REGA 4QM6A 3Q5DA 5K8IA 4C3ZA 1SVKA 1P62B 1P7CA 2RGXA 3OIVA 3K0FB 3K0AA 2GXUA 4D6PA 2CXXA 2DYKA 2JJ8A 1F2TB 4P4SB 5JECA 4LYFA 2OXCA 2VQSA 1YE8A 2EYUA 3OAAD 1W1WA 2C98A 2EFDB 1ZUNB 3W5IA 2QPAA 4TMXA 1WMSA 3ECCA 4CEIA 3A6PC 2GZDA 4F38A 3E70C 3VHXA 4URVR 2QA5A 3THOA 3UG6A 1BYIA 1ZM3A 4FMCF 1FTNA 4AKGA 1G5RA 1R5NA 4K8OA 2OAP1 4TMZA 4URWR 4Q1DA 3OEED 3W5JA 1KSFX 2IYQA 5UKDA 3I62A 2YOFA 2ZI9A 2G6BA 3KJEA 3PUYA 4OQXA 5HPYB 3CZPA 4GP7A 1VECA 5GVRA 4PPGA 1WCV1 4R7ZA 1T9HA 3PIRA 1J99A 2XSZD 2D7DA 5AUPB 2ASEA 4WXPA 4RKFA 2KE5A 4OK3A 3DM5A 1E2MA 4AURA 3SS8A 3HDTA 1DAEA 2BDTA 4RZ2A 3NBZC 4V0LA 2V1UA 3FHTA 1SVWA 2VSOA 2ERXA 3N5CA 5J40A 1KGDA 2BMFA 4ZIRA 1E1RD 3THXA 1ZNWA 1UFQA 3K1JA 1N2CE 4BWYA 2ZSAA 1II0A 3KFVA 1CKEA 4AD8A 1CP2A 1OKKA 2LWIA 4LJ5A 2ZJZA 3B1ZA 2HV8A 3JZMA 4EFNA 3OIWA 1AKEA 1XWIA 3GCGA 3TK1A 4MRNA 3U44B 4FIDA 4EQ6B 1ZINA 1ZM9A 1S3SA 1Z6TA 2JJ1A 2RKOA 3IO3A 3NC0C 1GL6A 2GCOA 4RD4A 2DWPA 1GNQA 5KPJA 1GL9B 2DR3A 2D2EA 1Z0JA 1T8UA 2PT5A 3EPKA 3N2IA 1YKSA 4G3XA 2C9OA 3ZVNA 4DUGA 4A0HA 3SJCA 2CLCX 1KIMA 3BD9A 4B3GA 3KTAA 2OG2A 4QC2A 1AA9A 4V02A 2BBWA 5FR1A 4H9GA 3SHFA 3VAAA 1E79D 5AUNB 1KI6A 2VSXA 2O8CB 4DSTA 1W4RA 5HE9A 5H68A 3U2QA 4CEJB 1XMSA 3B85A 3CW2A 2VA8A 3Q85A 3EPHA 2IYZA 4YQFA 4ON9A 1IAQA 4NCNA 3UPUA 1OW3B 4NYJQ 3QF4A 2QU8A 4PXAA 3ZH9B 4IOLA 2ZSDA 2JJ2D 2NZJA 3KQLA 4RD3A 3CLVA 2GTPA 2YVUA 5L8VA 1R0WA 2GK6A 3QOFA 4JT4A 4BZQA 4NKRA 3UANA 2QMHA 4QBIA 1CS4C 5JJIA 2AXPA 1KOFA 1VHTA 3QKUA 2OBMA 2OCPA 1Z83A 1T6NA 2ZE7A 3W8NA 1QG2A 2PT7A 2CCKA 1TADA 2PLFA 3U60B 1BH2A 1DELA 4QBHA 5FUYA 5IT5A 2JLZA 2ZS7A 4HZUB 4XOIA 3PQCA 4TQAA 4EPVA 3T5DA 5FUVA 2QRNA 2BWJA 2W58A 3KKPA 4HB0A 2FFQA 221PA 1WXQA 5IHPA 4A6PA 5EZ6B 1FMJA 4QGGA 4KLZA 2R9VA 5DNYB 4TL7A 5FOXA 4US2R 4U02A 4KU4A 1BOFA 1HT1E 3GLGE 2ZAMA 1YR6A 2F7SA 3B6EA 3RS3A 3PG5A 4S35A 3CKLA 4B44A 4PC2A 2WMOB 2ZREA 4EFMA 1M6NA 2ZJ5A 1SKQA 3AV0B 4RZ3A 2R2AA 2CL0X 3RWOA 2WJYA 2YWEA 3DOFA 3LO5A 4XWOA 1G7TA 1SZPA 3U3JA 3D8BA 1E4YA 4PC6A 4RFSA 2ZJ2A 3PXGA 2AWOA 3ZDQA 4DSNA 1CIPA 3L0SA 2FSFA 2QQEA 1QZXA 2KWIA 4Q66C 1RYFA 2ZU6A 4B33A 2ZI4A 1FFHA 2WVJA 4NHOA 1U98A 3UMSA 4TTQA 3RVBA 3ZZUA 1T0HB 3GFOA 4M9XA 3LBIA 4TTRA 4Q01A 3ZLJA 4IDHA 2V55B 3GPLA 2H8KA 2JLVA 1E94E 2QUZA 4Z8XA 3CO5A 3H84A 1SXJC 1UKVY 2X77A 5F98A 1W0KA 3GFTA 3X2SA 4M1SA 4AK9A 1F2UB 3CNNA 3LH5A 3QE0A 1P75A 1G8GA 1OXUA 3BBPA 4JL6A 3W9YA 3CPHA 1G291 1NRJB 2XOKA 4PANA 4M4SA 4MYCA 5AUOB 4WAUA 5DLQC 5HCIA 1T3LA 3KQHA 1TF5A 1KNQA 5JJKA 2A5GA 4C2UA 4CEIB 2ZRPA 4C30A 3CNOA 3HU2A 5KSOA 3C14C 3IQXA 4JS0A 1Z28A 3VMFA 1OH7A 4ESVA 2GXQA 2ZROA 1S3GA 3EZ2A 4QNRA 3ZS8A 2ZYVX 1N6KA 1HY3A 2RB4A 3SQWA 4CEHA 4RCZA 4B2IA 3CPJB 2V3CC 1Q44A 5FUWA 5EP4A 1AN0A 2GILA 5FPKA 1GKIA 1JPJA 1KMQA 2V6IA 4FMBB 4P0TA 1TAGA 4NYIQ 3GLHA 2FMXA 4XH9B 4LCBA 2IYSA 4AKEA 2OCBA 1OKKD 3ASZA 2IL1A 1NLZA 4V0OA 3QJYA 1JQJC 1NVXQ 5TY0A 4ZIRB 2ZRGA 1QBKC 4QHTA 1ANKA 3LQRA 4B2LA 1CJMA 2PZFA 2AX4A 3QXHA 1ZYUA 3SR0A 2GWHA 1HUQA 4LRWA 4OI2A 3NKVA 4CYMA 2QI9C 5GJVC 3WXMA 4Q9HA 2JJ1D 1F5NA 2VHTA 3HP1A 3VU9A 2OAQ1 3DMNA 1C9KA 1Z0FA 3LAWA 2LKCA 1T91A 4PPQA 4BLTA 4HAWA 4W5HA 2IUTA 2B8TA 4DUGD 1M74A 3AF3A 5AR1A 5EXTA 4N1AA 3P4YA 3QQ5A 2GCOB 2FDCA 2J87A 4HAVA 4TTPA 1XEXA 4OJQA 5FFMA 1GILA 1P2VA 2AR7A 1IN4A 1KI2A 3BB3A 2FPMA 3H4MA 5JWHA 3T61A 4LJ7A 2QGZA 1S9HA 5KSZA 4LHZA 1IN5A 2OUKA 1G8YA 4DCSA 1ZUIA 3RSOA 4B3FX 5JRJA 3B1YA 1VG0B 4C0AC 1MOZA 3AM1A 2KJQA 2GCNA 4QOSA 3IO5A 1XCMA 5EP1A 2RAPA 2C99A 2VLIA 3A36A 1CR4A 1KI6B 3CR8A 3QBVA 5KNDA 2WJJA 4UJ5A 5TB5A 3TJZA 1HE8B 3IEUA 4M53A 1LF5A 3VR3A 1G21E 3WHKA 2ZPTX 4ARZB 1XD8A 3GJ6A 4NYMR 1CU1A 2XTNA 3QF4B 4EJSA 4PHTA 1HTWA 2QT1A 2CLSA 5FTJA 2BBOA 2IYXA 2I4IA 2G0TA 2ZEJA 3IUYA 4V03A 1W5TA 1VCNA 3K9HA 3W6NA 2O8BA 2YWFA 2TMKA 1JR6A 1TNDA 3VTKA 2JAQA 3WP0A 5FTKA 3DZ8A 4WIAA 2XZPA 1BMFA 1M8PA 2MMGA 2C78A 3NIBA 4LC0A 4KVGA 4KXFB 1YHNA 2IS6A 4Q1FA 3H0KA 1RRCA 2MSCB 3FMIA 4H1VA 4PFSA 2ZVQX 2F43B 5L3VA 4GZMA 3PUWA 2X2EA 1X8JA 3KFXA 1P2SA 2Q3FA 4RD0A 1NJFA 3F8TA 4JLPA 3F0TA 4UNSA 1UF9A 3CM0A 3M0EA 4U5XA 4LJYA 2QEQA 4MITA 4K81B 3QBTA 2ZRNA 1NLYA 1N6IA 1NKTA 2ZJBA 4KCGA 2VP4A 2FZ4A 5JBQA 2A5YB 4Q9IA 1KTVA 1ESNA 3MWKA 1SVIA 2Z0MA 2BM0A 2Z43A 4JJKA 4PQYA 1KI8A 1A2KC 1U81A 1P3JA 3EIHA 5FBRB 1P9RA 2H1LA 3KL4A 3AF1A 2ZM5A 3FKQA 3CUEF 3RS2A 2DFKB 2ZVPX 3PJRA 5E3HA 2HYIC 3MD0A 3BRWD 5HE8A 3TIFA 1KMHB 4JVMA 1YZKA 3TUZC 1W0KD 3ZZTA 3KZ1E 1OXTA 1ZU4A 5SZHB 1VYVA 3WYGA 5B2ZA 1WBDA 1DO0A 3ND8A 2XZLA 3ZVLA 2OE2A 2EVWX 2XEXA 4JYCA 2XOKD 3WBJA 3X1WA 1D6JA 1XCPA 1EESA 1C1YA 4Q02A 1Z22A 2DBYA 2WOOA 4I99A 2IYLD 4TMVA 4OHWA 1MRSA 4LK2A 2NZ8A 3CWZA 2IYWA 2O0KA 3U4QA 1EWQA 2WJHA 2JLYA 1R0YA 4QJ3A 4PZLA 2NO6A 2YWHA 3R7WA 3SU8A 2RHDA 3WHLA 2VIIA 5DSZA 2IYTA 2QMEA 5G3ZA 2Q3MA 2KBEA 2WSSA 3GJXC 4EUNA 2I1QA 1MO6A 1G8HA 1M7GA 1SHKA 5JLJA 3LD9A 4C0HA 4PO8A 2X2FA 3L0OA 4HDQB 5EXPA 3RHFA 4BZXA 1TEVA 2GEUA 3ADKA 4GL2A 1GRRA 4TYYA 2GA8A 4JLJA 5CK4A 4GT1A 1KK2A 3U3OA 3LXXA 4CEHB 2GEVA 2YNMA 1TUIA 2C5LA 3M4YA 1NN3A 3C5HA 3BB1A 1I4DD 3AKYA 1D2MA 4DT1B 4RZUA 3WMGA 2R6GA 5FH9A 5AJYA 3AUXA 1NVWQ 5BN3A 4F7WA 1FP7A 1R0ZA 1E4VA 2AD1A 3VNVA 1LB1B 4YXWA 3AGQA 4EKDA 1S1CA 1XJQA 2ZR0A 4XTRA 2QRZA 3NBXX 1ONBA 2ZRDA 5C4GB 4DIDA 1SULA 2RGEA 4CW7A 4FW9A 1E2HA 6Q21A 1F3OA 1E2PA 3ND9A 2UZIR 2P5SA 4GP6A 4Q1AA 1TPZA 2CVFA 5HTKA 4Q4HA 4DBLC 4BGDA 4X8HA 2D3WA 4A1FA 1G3RA 3EIEA 2YC4C 4BLPA 2GCPA 3B78A 1IOZA 5K8UA 4KBGA 2PL3A 2BOVA 1KO5A 2F1HA 2ZI6A 3GLGB 2BCGY 1S8FA 2HF9A 4HUQA 2XAUA 3PENA 4TYWA 1MABA 1GWNA 4NU0A 3R8CA 1YVDA 4LX0A 3JVUA 1G3MA 2OLJA 2QG6A 2IHBA 1E96A 1KY2A 1XEXB 4F4IA 3WNDA 5JZVA 5J5CA 4BLRA 4MRSA 2FGKA 5KTYA 1E2GA 4KI0A 2GVDC 2F55A 1G19A 1YJ5A 2QMOA 5F9HA 2WWIA 4JL5A 1XBTA 2YHSA 5AWFC 4A8JC 1VIYA 1NBMA 4ESHA 2XB2A 3V00A 1R6BX 4OK6A 5JS7A 2FOLA 2QE7A 1I4LD 3GP8A 2NQ2C 3A1SA 1DADA 2YWGA 2YOHA 1R10A 4JLBA 4DC9A 2WWYA 1R4AA 1NLFA 3NVAA 2J46A 4BFZA 1E2NA 3RABA 1IM2A 3HR8A 1ZP6A 1DAKA 2QAGA 1Q22A 1AIPA 1VYTA 3I72A 1CTQA 1P2TA 1ZCAA 3LW7A 4EJSB 4B32A 2BIFA 3FVQA 2N42A 1BMFD 4AC9A 4DZZA 3AVWA 4FCVA 3RC8A 3P4XA 3SEAA 3RS0A 4JBWA 4MH0R 1Z06A 4HLUC 3TMKA 2O8BB 4ASUA 2J0SA 1HV8A 1OIVA 1VMAA 1WDTA 5C46F 1IJEA 3L82B 5FTNA 4TSFA 1Q1BA 5FBVB 4G01B 3TAHA 3BFKA 3E1SA 3LQQA 2NO9A 2EFEB 2DWOA 4FXPA 2G77B 3IHLA 2VP5A 1OB5A 2Q9BA 1NVVQ 2WWWA 4LUCA 1Z63A 1NVUQ 3BB4A 3K9NA 3QUSA 4OI1A 1JJ7A 4LHWA 4HAUA 2J7KA 3T1QA 2DCUA 1W0JA 2IF2A 4QBGB 1GDDA 3LDAA 5BWMA 5FOUA 2FSGA 2ZQ5A 3MFYA 4LY6A 2EFHB 3EZ6A 4A82A 1NF3A 2HXYA 4NCJA 5BXQC 5JWRA 2J1LA 1X8KA 1XXHE 4ZV4A 1XMJA 1P4SA 4LPSA 2WICA 3EW9A 3N70A 5KDOA 1HYQA 4I1UA 4AKIA 4OJKA 1XZPA 3W3AA 4B74A 4P32A 3CONA 1NKSA 3HR7A 1LFDB 5FPYA 3G0HA 2R62A 3LX5A 1SGWA 2I3BA 3FYHA 2YINC 3LX8A 4MKHA 4RSGA 3C7KA 2WM9B 2IYRA 4ZI3A 2HJVA 5G40A 2QP3A 1IXRC 4U00A 3AP2A 3J81k 2J7PA 5JMTA 4TL6A 2WJVA 2AK2A 2JA1A 2KBFA 1RZ3A 2R6DA 1U99A 1EFHA 2PMDA 3OIYA 1Z2CA 4PAOA 1KI1A 4UNRA 1QHHB 3SE0A 1HE1C 2HLDA 2GNOA 3DM9B 3LVQE 1UJ2A 1XTSA 4BRWA 1IY0A 3QKTA 3RSLA 2JIZA 1NG9A 1Z0KA 5LBIA 2QROA 5FOTA 4PHHA 3BS4A 4UNNA 5IDVA 3ZQJA 2QAJA 3RRMA 2QSZA 4HEJA 1XU4A 5DISB 4KYIB 2WSSD 2ORVA 4DLUA 4JVNA 2ZI7A 4HYYA 4TT3A 2ZI5A 4JLAA 3U4QB 2REBA 2J0QA 2J59A 2LKDA 4RY2A 3R7WB 1JNYA 5JWOA 2ZRKA 1L7VC 1Z6GA 3KXIA 4FCTA 4Q1EA 2ZSFA 2A2ZA 4Q18A 2XB4A 4RCYA 4U7DA 3AEZA 121PA 1W49A 2ZR7A 1P72A 2V9PA 1FX0B 1D5CA 2BKUA 5TXGA 2RCNA 4Q4JA 4M9ZA 3HJNA 2WPDA 4M1KA 4N0EA 1ZD9A 2VH5R 2PMKA 2PH1A 5C1BA 1Q21A 2W6JA 3AQ4A 1N0VC 1RYHA 3VHLB 3T1VA 4FCWA 3PUZA 1KO1A 5KDLA 3CF0A 1EK0A 1LS6A 2B8WA 3BE4A 5DGXA 4YXWD 5IF9A 2IS4A 3FB4A 4M9QA 4N0DA 4ZI2A 1A2BA 2P0EA 5L3SA 4NCIA 2JGNA 1W5SA 2AFIE 4IEEA 1U9IA 3QKRA 1AS2A 1E2DA 4KAXA 5DN6A 4QJ4A 4ZKEA 1N6OA 1Z8FA 1KDPA 1KO7A 2X1VA 4LV5B 4TL9A 1P2UA 4LZZA 1HQYE 1VTKA 2ZRMA 1FNMA 1EFTA 3SYNA 2W0SA 2YJTD 3DMDA 2IWRA 4IEIA 4IXMA 4M21A 3NHBA 3ICQB 1W4BA 2IK8A 4US1R 1PZNA 3ZQ6A 1XX6A 3IBGA 2BMDA 2Z6VA 3RC3A 4JYBA 1F6BA 2GJAA 1FPMA 3IIJA 5B57C 1W44A 4EPYA 3W3ZB 2Z4SA 3K0CC 1MH1A 5CIQA 4HUTA 5FI1B 5H70A 1G3QA 1IN8A 3A1WA 3GLFA 2SHKA 4HUQB 2GK7A 4OHVA 2WOJA 1XXHA 3AF2A 1M2OB 8OHMA 2A7QA 4LBZA 3RRYA 2A78A 5C18A 3THWA 1NBMD 4PSKA 3B1WA 3K70D 2XNDA 2F3TA 2WTUA 4KITB 4G5RA 2FX3A 2WMNB 3IHWA 4KBFA 1G4AE 4LGMA 1GRNA 2F1RA 4P31A 3LLMA 4LJ8A 3I1FA 4Z1MA 2PEZA 5JSZB 1H8HA 5E7MA 1N5JA 1E1QA 2F1IA 5AUQA 3GQBA 5SZIA 3VKWA 1XJCA 4XWKA 3K70B 1SKYB 4KVAA 3VR4A 1FQKA 2XNSA 3EC2A 4TYNA 2ZSBA 2A3RA 1XRJA 3NDPA 2CVHA 4LHYA 4PO1A 3I61A 4W5JA 2PZEA 4MYHA 3CX7A 4QNMA 1E9AA 4QXAA 1GKUB 3TW4A 2AWNA 4ASUD 3B9QA 3UIEA 4NL4H 1IN6A 1CULC 4TSFD 3KKQA 3C41J 1R5OA 2GF0A 2P67A 2VEDA 3C5CA 1DBSA 1E0SA 2HJGA 1KAOA 1CJUC 4XJXA 1U8ZA 5AJXA 1EG7A 2QTVB 5KSYA 1OYWA 4BFTA 1XPUA 4MKFA 5C4MA 3TR5A 4QKQA 1QF9A 4EPTA 3S1AA 3AUYA 5BN4A 1E2LA 1W0JD 1KI4A 3F5FA 2FU5C 4JVLA 3V4RA 1N25A 1QRAA 2H18A 4DLYA 4GZLA 4Q7JB 2EWVA 1M34E 1SVLA 3K09A 3TBKA 1G6HA 3DPUA 4DLTA 1R0XA 1K5DA 2CHVA 2O5VA 2H92A 3BXZA 3GLHE 4TMWA 2AN9A 4IOMA 2H5EA 4JLKA 2G3YA 2WAXA 2IX3A 4GBMA 3OESA 1KK3A 4RVCA 4I1VA 5HCNA 3RRZA 2FEOA 4FD2A 1X1RA 4N3NA 1R8SA 1SHZA 4IVQA 3LWNA 4D0GA 3FMPB 1XPOA 2ZJOA 1Z0IA 2P6UA 5GJWC 4MKGA 1W4CA 3BAFA 4GOXA 3M1IA 4EJSC 2OCAA 2ZRCA 4OKSA 2A5JA 2FV8A 4I1SA 4PAQA 2J7PD 2NO1A 3SQXA 1G9XA 2VL7A 1VDZA 1DG3A 3MJHA 3EX7C 4PX9A 4FI3C 4ERNA 2B6HA 3U7HB 5HZHA 3GJ4A 3UWKA 5IRCD 1NMZA 1CR1A 2HLDD 2W2TA 1GVNB 3IPYA 4R71A 1WRBA 4FMDB 1ESMA 2JIZD 1M1YE 2ANCA 1IY2A 3CRMA 3DKPA 2J45A 1X1SA 5DH9A 4DWJA 4DLRA 1D9ZA 1TU4A 2GETA 4P33A 3LNCA 3W6PA 4MQBA 2V7QA 5CLQA 721PA 4C0SA 5JCPA 3GLIA 1S1MA 2FEMA 4DVGA 4PR0A 4TT3D 2WWXA 1ZNYA 3MMPA 2ERYA 1JBKA 2Q9CA 5HZKA 1FUUA 3NH9A 1WA5A 3RRNA 1S4QA 1LTQA 1COWA 2ODBA 1W2HA 3WNBA 1TL7C 3PITA 2J0VA 1LF0A 4XTCS 5DYIA 1ZIPA 1AKYA 2DPXA 2QPOA 4JKYA 1ZRHA 2WPDD 2KSQA 3NBFA 2EFCB 3G5UA 1E2JA 3B7GA 3SJZA 5B64A 2O8EB 3TVDA 1JPNA 5DI3A 3L43A 2W6JD 2ORIA 3GJ3A 1P9WA 2QP9X 4IHQA 3TE6A 1Z6XA 4AI6A 2ZJ8A 1KO4A 3K0AB 2ZITA 3ZGXA 4URUR 4G5OA 3KQNA 4ZKDA 4L16A 4Q4JB 1DVRA 2ZIAA 1XCGB 2QTHA 3IGFA 5JRZA 1EWRA 3Q3JB 3ZD7A 1J90A 2JLWA 4JLNA 1WBBA 5DN6D 4QHYA 1CR2A 5J4HA 3CX8A 2IXGA 2ZE6A 5G41A 1E2IA 1ZJ6A 2HT6A 1AZTA 3EZ9A 1TF7A 4NMMA 4KSCA 4ZDJA 3L8YA 4LYJA 2FGJA 1KNXA 5FOWA 3CBQA 3VR2A 3CNLA 5L3SB 4DKXA 1N6NA 1QVAA 1UPTA 3MWLA 2GEDA 3IIKA 2IWHA 1G3UA 4Q4AA 5FBLB 1U94A 1GNPA 2VTKA 3Q7PA 1BKDR 5CJ2A 2QM7A 1O87A 3NDBB 1IXSB 3QVUA 3B1VA 2D06A 2VO1A 1CR0A 1MO4A 2XJ4A 5CDFA 3SYKA 2YYZA 2CJWA 1UDWA 3SOPA 1KK0A 4LI0A 1A7JA 3SZRA 3THXB 2V4ZA 1G16A 4NCKA 2FFHA 3PEWA 2XNDD 4PC3A 2G83A 4IXNA 4P3YA 4UNPA 2IYVA 3LBHA 4NYMQ 5DIFA 2FPKA 3KKMA 4JSTA 4X8LA 2PBRA 1XXHB 2OV2A 2ZJYA 3L2OB 5IK2A 1KI9A 1LS1A 3T1TA 1H8HD 1U0HC 2BEJA 1EFUA 2FNAA 2GBLA 3AVYA 4BFVA 4Z54A 3THWB 1E1QD 2N1BA 3WP1B 3AVVA 1YZQA 2XXAA 3UATA 4FWIB 4OHZA 1OB2A 2BKEA 4TLDA 4P4TA 3B9PA 4DIEA 3M6AA 4MGIR 3X1DA 4H1UA 4LJ6A 2PZGA 3DL0A 2J9RA 3AGPA 2NIPA 2WV9A 4ABYA 4B3CA 2GJKA 4JLDA 1Z47A 4GSYA 3U5ZB 5AJWA 1JXMA 3RDPA 1UKEA 3QXJA 3MSXA 4B47A 3BK7A 1EX6A 4KFUA 1JB1A 2ODWA 3KTAB 2AKAB 5JS8A 3TW8B 4BPBA 1GSIA 4Q7MB 1AQUA 4B73A 1G8PA 4F4JA 1E6CA 4LJAA 2FN4A 2GAAA 1KHTA 1QHXA 3ZZ0A 2EQBA 3NEYA 1E9FA 1T3SA 2IT1A 2B21A 2NTYC 2O8FA 1LV7A 4JLMA 4E5UA 3MGCA 2XZOA 4DLSA 1DEKA 1NP6A 2Z4RA 1H8EA 2W83A 4OQLA 3QXSA 4WZ6A 3EWSA 3MUFA 3SJAA 1W47A 1RC8A 3Q5EA 4UNQA 3ZVRA 4V0KA 5EE5B 3S1AB 1LNZA 1G4UR 2GAOA 4A2WA 3V4FA 4DLWA 2AD5A 2GXSA 1OFUX 3EZ7A 4PZZA 3MWYW 4IJMA 4D0NA 1NMYA 3SDZA 3N2EA 1N6HA 2WHXA 2RGNC 1VG9B 5CB8A 3GJ5A 2ZE8A 5JHGB 3K70C 4LYHA 3E2IA 2VRWA 2CL7X 3FFBA 4E07A 1J7KA 2JLQA 4OHXA 1L4YA 621PA 1OF1A 1XPRA 3AKCA 5JFGA 5KOYA 4JJZA 3VX3A 1W7AA 4W7SA 1RE0A 3IKJA 2O0JA 3B2EA 4MYTA 5GADl 4KODA 1KK1A 5J4VA 2JLSA 1DG1G 1IONA 3CX6A 5EP2A 5FPHA 2MSEB 2E1RA 4OHYA 4O3MA 3REFA 4EPRA 4BFWA 4OBEA 3TNFA 3BGWA 3T06B 4PHGA 1FUKA 5HKKA 2FZLA 4G1UC 4KSBA 3QVVA 3EARA 2GJ8A 2V7QD 4B43A 1BYUA 2H17A 3QEOA 2R65A 2V1XA 1GITA 1PLLA 3P27A 3JVVA 3U3KA 2B7BA 5CM9C 1P61B 2OO7A 1VCMA 1XD2A 4O25A 5FI0B 2KI5A 2BHRA 4DJTA 1XDBA 1L8QA 2Q21A 4RFSB 4JLOA 3HPRA 1COWD 1ZM2A 1HURA 2GZAA 4IVRA 4KYUA 4LHXA 4TQUS 2ZS8A 1NBME 5CJPA 4C7OA 4M1OA 2O8DA 2QNRA 5LD2B 3GLIB 2IUUA 1SKYE 1KKLA 2IBMA 3FFAA 3KXKA 2OILA 4HAYA 1T4GA 3EAQA 4F93B 2IC5A 2VBCA 4XSHA 2R6AA 2RGAA 1SXJA 1FP6A 2IXEA 1G3IA 1DAHA 1JXOA 1OSNA 2HCJB 2RGBA 3SJBA 1KYIA 4ZO4A 4AG5A 4LJ4A 4AYWA 1DAMA 1T5LA 4R2HA 4II7A 3A4MA 4M0LA 1KDTA 3BFVA 5BW8A 1E69A 4OYHA 2CK3A 2PJRA 3NC1C 5DI3B 3A8TA 1E99A 4A6XA 3KQKA 3DKVA 3SBEA 1E9SA 3AVQA 1OPXA 2OFOA 4L8GA 4TQ9A 3VKGA 1XD9A 3KJGA 3QIAA 4MRRA 4OQMA 1U8AA 4Y0AA 4GRAA 3X1ZA 4A9AA 4A0GA 4C0QC 2GXAA 1E2KA 2JEOA 2VHCA 4IDQA 1H65A 4Q7LA 4D4KA 3CF6R 2Q6TA 4Q48A 1Q1ZA 4M1YA 1RJ9A 1GZSA 4PPFA 4PPNA 4TLAA 4AYTA 1MT0A 3FOZA 4DSUA 1KSJA 3CRW1 2FE4A 3IBYA 3GJ7A 5E95A 3ICEA 1VCIA 5CB6A 2REOA 3D3QA 2FWRA 3EA5A 3UMFA 3OEHA 4DLXA 4MRVA 3HWSA 1KJYA 1NG1A 3CZQA 3DVLA 5SZJA 2MSDB 4OI4A 3NEJA 5A4JA 2GRJA 5EE0A 1R5BA 4C9BA 2UVQA 3PEVA 4J0QA 4M1TA 1HH4A 1PJRA 3GLHB 4IFEA 4Q21A 4PAMA 1Q3HA 4AYXA 3LA6A 1F2TA 3SNHA 3GJ0A 3UMRA 2ATVA 3CH4B 1GNRA 5IK2D 3DO6A 1ZM4A 2CJWB 2WKPA 2ZYTX 3AP1A 3QG1A 2ZU0C 2BBSA 3SFVA 4AG6A 5KU1A 1II9A 1Y63A 1NY5A 3FWYA 2EU8A 1DOAA 2L0XA 2IS1A 2DWQA 1VHLA 3OIUA 5ELXA 1OXXK 1TQ4A 4JSYA 2O0HA 3VU9B 4JMPA 2IW3A 2W0MA 1YR8A 4BLQA 3QPVA 2WWFA 3DEFA 4ZDIA 1R2QA 1JR3A 3I8SA 2RMKA 2XXAB 1CJKC 5EZ5A 3U6KA 1VYUA 2XITA 1XNJA 1M7BA 1FL9A 4FMDF 5J4LA 3BC1A 1KI3A 1Z6YA 2DFNA 1II8A 4V0MA 1G17A 2G1JA 1IQPA 1CRPA 2C8VA 4GFDA 2CNWA 2VF7A 3P1JA 5DHAA 4ZCMA 4Q1CA 1NL3A 3U3RA 1XTQA 3WYAA 2IS2A 2H16A 3CIOA 3L8ZA 4TLBA 4W9MC 1YZLA 421PA 2WJGA 1KSHA 3MWJA 3K0SA 1H8ED 4FWTA 1XTRA 3T5GA 3AVUA 3TSOA 1SVSA 3NBYC
chains in the Genus database with same CATH superfamily
2R3SA 1XT6A 5ERYA 2DLDA 1D1TA 3DE2X 1ZAYA 4DEYA 1TZKA 3A1DA 1JEJA 1AK2A 2EZUA 4LZLA 1H0RA 4JI0B 4RTNA 1WF3A 3PGMA 4LWZA 2ZIUB 2XT0A 5IABA 4HB3A 2M6LA 1P19A 1F60A 1R1DA 4PLHA 4BKRA 5M2QA 3R6DA 4JUIA 5BXYA 2Q28A 2FFBA 2PUAA 2VBIA 4DJAA 3KKKA 4DB4A 2X0EA 2XRZA 3R40A 2CLDX 3JWIA 4D25A 1NWCA 2R47A 4G07A 4TXMA 1Y1SA 1TF2A 4YDSA 5EE3A 1OYYA 3VAZA 3AEXA 4E14A 3HCPA 2FEPA 1LLDA 4IS3A 1KHHA 2IHJA 2RC5A 1CG6A 1T6BY 3C87A 3U3ZA 1V35A 1ZRNA 2QN9A 2VATA 2ZYRA 2ZUCA 4QJ5A 5HIMA 1L5SA 4BQOA 1Z25A 1H9AA 2VHZA 1JEQB 1ZUD1 3C4VA 3IAEA 4CEJA 1I2DA 3CMMA 3VR6H 3C3XA 4OGKA 4IXDA 1HFEL 2D1FA 3B1KA 4IG9A 5F3WB 4PWYA 2I33A 3TZBA 2IYAA 2VNAA 2C4TA 2C88A 2O48X 3Q3VA 4X6UA 3NHSA 4C6TB 1GFSA 3X44A 4A92A 4JBXA 1C3VA 4DHEA 2Z5LA 3LC2O 2WK1A 5JJBA 3B36A 2PYIA 2O59A 2JLCA 2P9CA 2PUCA 3MTEA 4A0FA 2E4YA 5FA6A 5I8ZA 1KDOA 4YROA 4C07A 1NQVA 4J7XA 1ZGAA 5KYKA 2HWXA 1MCZA 1RRPA 1DIRA 5D85A 3LQYA 5L4LA 5AIAA 1ZC3A 4UZSA 5DHQA 5DN9A 4D1YA 4CQMB 4KRGA 1DDGA 1KY3A 2CEKA 3QMWA 3BWEA 1ABEA 4GX2A 4UU0A 1XD2B 4MI6A 3BXEA 3T7KA 4JUDX 1D2NA 1HRDA 3KD3A 4YV7A 5BN5A 2JJQA 3EQ9A 1OH5A 2QBYA 4ID3A 1E7WA 2H1FA 3HKCB 3ME5A 1R8YA 4L3VA 3BD7A 4KMOA 3O8OB 5M29A 3OZTA 4JDPA 4C7OB 2A9KA 4AJIA 5J43A 1T5BA 3R20A 3AY7A 1M33A 1E3MA 4R54A 4ZP1A 4WLFA 2J30A 4ZPXA 3TZLA 4MS4B 5CVVA 2CLFB 3RAPR 4BMOB 1ZXXA 2JZNA 4BS9A 5AESA 5IG2A 1EUDA 1NW8A 2C95A 2FUKA 2HEIA 3H3JA 1QP0A 3LDGA 3RSSA 2BJHA 1L7BA 4E94A 1NVGA 5TARA 5KTPA 3VNSA 3ONFA 2JGRA 2SKEA 1IWPB 1DXHA 3GRZA 3AY6A 4BHTA 1Y48E 2ASVA 5TVKA 4DLBA 4AJ2A 2X0IA 3ZOZA 3MOGA 4ANFA 3TRJA 1Y89A 3E35A 3BHNA 5IAKA 5DK6A 3H1PA 3CCBA 4NS1A 2OZVA 3BH0A 4CTJA 5CDYA 4JT2A 4HCJA 5EXSA 5J2UB 2GZRA 1C9EA 3LTEA 3DPSA 4JD5A 3OE7A 4P6VF 1WJGA 2NUPA 3KQSA 3VU8A 1UBEA 3S5UA 2YVAA 4A6DA 5BYBA 2DTEA 2ZK7A 3KOZA 4OQEA 3SFTA 3ZZ1A 5KYNA 1J1ZA 2Y1LA 1LVGA 4RHYA 4AVYA 4U2BA 1CUVA 3I9FA 2H7VA 1Q0RA 1UBGA 1LPOA 3BMXA 3LCCA 4N7BA 3K94A 3RYCB 2QYHA 4KJZA 1KPGA 4U2CA 3W4KA 1H4QA 1YU9A 2ZWAA 4BZPA 1D8TA 4L8WB 3EASA 3V8VA 1B6TA 2LCFA 4RK1A 2FPOA 4L5YA 2QNBA 1D4FA 4MA4A 3L8CA 1IATA 3KJNA 4BO0A 3LKZA 3RUCA 2UVPB 1IJBA 2OV8A 3WKBA 5KJ1A 4YT2A 4D02A 5GZ1A 5F5LA 2WIKA 4RTQA 3HWX1 2BFOA 4OHOA 4OEHA 3I9LA 1W581 1DIBA 3BH7A 1MLDA 1WZUA 1K63A 3PQFA 4OHBA 3SOZA 3IT1A 2FRDC 5JQGF 2XYQA 4Q7QA 1IVSA 2N47A 2VR1A 1AGNA 1XSEA 2D1YA 1DLJA 3GD7A 1XQ1A 1KFKB 3ILSA 3OF3A 1GOTA 4R3NA 4YHBA 5EHIA 4TLCA 3T41A 2WI8A 1G59A 1N4DA 1HEUA 3M6IA 4JQYA 1N57A 3I53A 1X74A 5CFRA 1PAUA 5CPBA 1H2BA 1J20A 4BASA 3DUWA 1FDSA 4TGLA 4ED9A 3L7MA 4TVOA 4J0EA 2JHFA 5LQDA 4NJMB 2AG5A 3AM3A 2C9MA 3AF4A 3EFOB 3WLHA 1A7UA 5KWSA 4QULA 4YRRA 3I5XA 3GZTB 4EARA 1GKLA 3C3CA 2H29A 1G18A 1GQFA 1GZ4A 1NNUA 1FS5A 1U8YA 2G1KA 4MVJI 4ZT3A 3AY0A 3HLKA 4I1IA 5FNVA 4ZCRA 4IIJF 5TPWA 4CIYA 1MABB 2C5FA 3E9MA 3HMKA 3DWFA 5LBTA 5COAA 3AM4A 3FDIA 4QGAA 1GU1A 4M55A 1SZDA 3DOCA 1FUIA 1D5WA 1II8B 3KHUA 2X3FA 3L7CA 1F4LA 3FPSA 4JLUA 3HDYA 3V8PA 1GZ6A 2VSYA 1P4JA 3A9TA 2BUCA 3EBPA 3LHFA 3NPAA 3RF7A 3TGLA 3R9KA 1RKBA 5TDHA 4RKEA 4M60A 1TOAA 3MWEB 1KJZA 4WOBA 3IBFA 5F7OA 4KQ1A 3MYYA 1MR3F 3FPJA 4RKQA 2QRMA 2VWHA 4ZJPA 2ZWVA 1RXUA 4Y0NA 4DWOA 5LKAA 3EMBA 1I7QB 4UXIA 1VKHA 4PE5B 3ZWMA 1J21A 4PXSA 3SHWA 3FG9A 3FOFC 2ZQYA 4L5IA 2BGIA 1TMGE 2ZRLA 3I01M 5BV2P 4Q93A 4I1OA 4YRAA 3IC5A 1VL8A 3OU2A 3JSXA 4ZAVA 1QE3A 3WLQA 2QD5A 5CYOA 2R0QC 4P0QB 5EZSA 1XNRB 4A15A 5G02A 2P3SA 3A37A 3WGMA 3KVRA 3Q1KA 1YC2A 2N1MA 4HLUA 1BIFA 4OHCA 3IURA 2CLHB 1XA4A 2EEPA 3JQAB 2FW0A 2FZEA 4WK4B 1EEHA 3FGNA 1QKKA 3V7NA 1Z4QA 1YRAA 3LY5A 1GCUA 2I66A 1HLGA 3K9FC 4FGJA 4K8RB 4R8KA 3IODA 1ZHHA 3I9V6 3QNWA 1M2WA 4TMFA 3OOEA 5JCXA 1YZHA 2P4QA 4LZNA 2ILVA 2GASA 5KOHA 1ONSA 3WWDA 3W5VA 4U7JA 1ZVKA 2AN5A 5CYFA 3AL3A 3PT5A 1ABFA 2PCJA 4OFXA 5LMZA 1RYZA 3HVJA 1Y82A 5D5PA 3WYFA 3KR0A 4X3OA 3ZK8A 4MPRA 1JDSA 2XKAA 4BO9A 3GCDA 3ROFA 3KEMA 5LP6C 3CWQA 4M1MA 5MGNA 1UZNA 2JFYA 4WCFA 2HD4A 1MJ5A 4ESOA 2VK1A 5HQJA 1P1JA 1QGUA 1G64A 1DRVA 2Y77A 3GPBA 3O4GA 2P9ZA 2XJ9A 1O9HA 5E4JA 3RTBA 1SHJA 2V4MA 2G71A 1GKKA 2WIBA 1W4LA 3OH8A 4IVPA 3UT0A 4IDCA 1NTOA 1Z4OA 2ONKA 3GUZA 2BUAA 1TQ2A 4YDHB 1KP3A 1BDHA 2NYRA 1RIIA 4UULA 2QSUA 1F48A 3EF0A 5FR2A 4EG1A 4UMDA 3QW2A 2H2GA 5TE9A 3OWOA 4EDHA 1DMSA 1M72A 4G9BA 2BZGA 4EPXA 4X6YA 1IBRA 1TX4B 1ZH6A 2OHGA 3D6UA 1K8RA 4OLFA 4UUMA 1PJ3A 2J3EA 3LW8A 1E64A 3CS3A 4CLOA 2ZIWB 1SXPA 4M9RA 3LLVA 3F4LA 3IP6A 4O4IA 2ZSKA 2QBYB 1J97A 2FUCA 3BCRA 4L51A 5BN5B 5KNCD 3IIMA 3MWDA 2G67A 2O7QA 4ZZ0A 2EIXA 3QFFA 3VSAA 1R0KA 5JY6A 2P27A 3PK0A 2C92A 1B8UA 1NMEA 1UBJS 1VE9A 2P30A 2VNJA 1S8AA 4MICA 3GFSA 1JR2A 4WWHA 1PW7A 3G2MA 5FUXA 5FUBA 1N1GA 4L28A 1JSXA 4HNVA 3DH0A 1Q50A 3OM1A 2HK8A 1OQAA 3FUVA 4KPUA 2YV5A 3A58B 3B8HA 4Z51A 3AZOA 4G5GA 2R5WA 2DX7A 5K8LA 4BNFA 1J5XA 2HO5A 4IGKA 4YJFA 4CF5A 1N1DA 1OXSC 4CKZA 2XD4A 1CP3A 1GUAA 4Y9TA 1Z5NA 1L4NA 4XVRA 3N3AC 5B5SA 4Z86A 4YMVA 1DX6A 3SG0A 3AXTA 1HA3A 2QRHA 2XUDA 4MB0A 5TMDA 3WB1A 1D9XA 4BUZA 1SCUB 2B99A 1S2MA 3OG9A 3I76A 3W6ZA 4W9RA 4X62B 4XASA 1LSOA 4A03A 1U0LA 2DFTA 1CIJA 1KEWA 2AHOA 2NUPB 3DV0A 4QBFA 2VPZA 3MN1A 3ADBA 1W36D 3HZOA 2HXSA 4LXGA 1RXYA 3VR6A 3PKJA 5IBCA 3ILVA 3OOYA 4MJ7A 3BQ9A 4S2EA 1XR3A 2IU6A 4HGYA 3WDMA 1VRVA 3MW8A 1EFRD 2I6QA 4DQ0A 4INZA 1Q20A 1ZK0A 5CG2A 3HCRA 4ZWNA 4GW3A 1MB0A 3KG2A 3AKZA 5GJBA 2P40A 3QFRA 1GEGA 1TYDE 2GN2A 2FF5A 3H7IA 4NEHB 3SM3A 2PCLA 3AEUA 4LF6B 3A9SA 2V96A 4JR0A 1F7VA 2XB8A 1CNMA 1Z6ZA 2V0NA 4BNVA 3I52A 1JG3A 3OFVA 2IEBA 1F51E 1RXIA 3GDFA 1ADCA 2X8JA 3C6YA 2YJNA 3EG5A 4O2RA 5DOZA 3VX4A 1Z4NA 1P5HA 4ATNA 2BLNA 3PWTA 1RAGA 1KY4A 1TAUA 4EITA 3FSJX 1RD4A 3NI2A 3QKRB 3VOTA 2PWAA 3ZWXA 2V7GA 5GV8A 4LISA 4GDFA 1Y9AA 3BTOA 1IHXA 3W8FA 2J0UA 3RIYA 4HVLA 5BYKA 3EJWA 4NONA 1JAHA 3LSTA 4HGOA 3K0CA 3C16C 1O3YA 4X91A 1K86A 5ARDA 4ZT6A 2WWVD 3M1AA 4J4BA 4MDHA 4EFLA 7AT1A 3AIKA 3HCOA 3KOWA 1KO8A 1E9CA 1J22A 2F1JA 2Y1DA 3BKXA 4Y1FA 4OJMX 4YRKA 4UBMA 2ZDQA 2HMAA 4YRDA 3IQWA 3KVOA 2HF8A 5AK0A 3C15C 1QU2A 4PG6A 4A6EA 5FNVB 2JB9A 4MGKR 5TPWB 4BGVA 3GEHA 5J4HA 3RANA 4G4SP 4Z1MD 3OSUA 1EVKA 4YAIA 2ON6A 1JE0A 2WJ4A 4U9UA 4C2TA 5GIOE 3RC1A 3JYHA 3O9MA 2AOVA 3L9WA 1SXJE 3ED5A 3PQDA 4CCAA 1N3BA 2HCBA 1QYWA 3Q9LA 1KZ1A 4OP2A 3LU1A 3H5RA 4GBED 1EWTA 4FQ7A 3H1AA 5BQPA 1XN1A 5I9MA 4DSZA 5CLLA 4RJTA 2GDJA 1P1CA 2WP0A 1U0OC 3H2YA 3BIFA 5LB4A 1ZRMA 2VT6A 3ZDYB 4L5BA 4EY4A 3R9WA 3T7DA 3WJ1A 5IAJA 2XCRB 2O20A 1I9GA 2QT9A 3R7BA 2E5FA 3OQ6A 1HKUA 4UOEA 2PXHA 3MAGA 2G82A 1ZOSA 1PLKA 3NTLA 3GLGA 3WLJA 3TCXB 2IOQA 2V8OA 4II3A 4JB8A 1WMEA 4MWOA 5K2OA 4DCTA 1PZHA 2HA3A 2HI0A 1ZCBA 2G80A 2SKCA 4PGGA 4A8PA 2W6IA 1FDOA 1E3TA 3B5JA 3B51X 2JANA 5DW3A 3UOGA 2ID7A 2QORA 4CWAA 1IBCA 1NNLA 3CVOA 3OOWA 3PD0A 2JATA 1OGIA 1VMDA 1LPPA 3DMTC 3ZJ4A 3W1VA 1XB2A 3TQCA 1G8KA 2H48A 2ZR9A 4LYDA 5TMBA 3KQUA 5KOHB 2P5YA 3E3OA 1FE8A 4MI1A 2GPTA 2BVNA 3ENVA 3FYDA 1E92A 4QXQA 5F1YA 3SQDA 3WNCA 4BKUA 5CM2Z 4E4TA 2CJPA 1CUJA 2FJUA 3B38A 3UGQA 2V54A 2I2FA 1X70A 1YR9A 1J2TA 3QVKA 4QJIA 4ZCTA 3SC2A 4HWTA 4EYKA 1H2EA 2NOAA 3P9XA 1XDSA 3I39X 1TQDA 3ORFA 2WY2D 1EA5A 1Y4ZA 3DFFA 4WCFB 3RW9A 1Q57A 3NHUA 5KMGA 1QGUB 1SMKA 4PQRA 2BI8A 5WRFA 1GFIA 1VKJA 2C8JA 2Q4OA 3SVLA 2CY0A 5EE1A 2B4YA 5BV1A 2RKWA 1VJ0A 2WKQA 1UWLA 3P9SA 2PL5A 3E7XA 3FTNA 4LSZA 3TUJC 3V8MA 1Y9DA 1W36C 1FCJA 3DZFA 4P81A 5LB2A 4E0BA 4R6XA 2NU8A 1K8XB 2BEKA 4ZVQA 1VCOA 2A0KA 1EJ6A 2IE0A 1G7RA 2GJSA 1CE8A 2AUTA 1UAGA 2IP2A 2VHEA 3CA8A 4FMCB 4Q4LA 1GQOA 1V5GA 3HDJA 4TS4A 3B13B 2B1JA 4RVOA 5LXTA 3K9QO 2FPRA 4CLOB 3RBVA 5DYTA 2K87A 4U4AA 2Q2NA 5I3CA 5EXXA 4EHNA 2GZHA 5D00A 4JKIA 1YCHA 3M5PA 4V0ME 2ZCJA 4Y9RA 3ETDA 4XE5A 1BJKA 1OT3A 2AHRA 3IXLA 5F4BA 4ENWA 1CVLA 2FKAA 5AVKA 1A5ZA 2R1TB 3HB7A 5BR8B 3EXAA 5L53A 5AVSA 2OXRA 1CJVC 2ZJ7A 3ZWKA 1YCGA 1P8JA 1Z0DA 2D59A 2DFLA 5A5FA 3ZD6A 2YV1A 4HG2A 3R9IA 2CFOA 2VNSA 1JI3A 5FRDA 2C3PA 5AP9A 4KPUB 4ENPA 3K53A 1HRKA 5CIWA 1XEWX 3BREA 3QUAA 2M98A 4IQGA 1QOQB 3LYLA 3AOEA 1OHHA 3VR1A 4RK4A 4YJFB 1W5AA 2GUGA 1XC7A 3CF2A 3EVGA 2FSVA 5KU7A 5KSWB 2X13A 1H6DA 3IP5A 4N6OA 5BVGA 2FR1A 4L7QA 5KYGA 2W8BA 3T12A 3N9IA 2HU8A 2CE2X 2PRZA 1JECA 1K75A 3B1FA 2Z30A 3AI7A 3HS3A 2HK9A 3IPLA 4IDNA 4MYDA 1ZVVA 2D54A 5C5CA 4FYYA 3LMKA 4MQFB 4RA9A 1PEKE 3DWGA 4N5LA 3U48A 5I9IA 5ALUA 2WT9A 5JYDA 3FMOB 1SC3A 3TW6A 3O7WA 3WB0A 4MV0A 3BGOS 1WCIB 1IPFA 2VSQA 2P79A 3IOBA 4KYTA 5DX0A 5JZSA 4I5DA 2BM8A 2XTMA 3DV0B 3EG9B 3Q3HA 4PYKA 3VC1A 1QHSA 1POXA 1LBEA 4ZI5A 1LBTA 2AF3C 3AIMA 2IEDA 1HFKA 1KQGA 4R9VA 4DLVA 1YMVA 1A8HA 4M0CA 3UMGA 3A1TA 3I04M 2Z9BA 3L8FA 3KB2A 5D84A 3RVQA 1N6LA 1T43A 2O3QA 4QGHA 1L5KA 3BORA 3G0BA 3VSDA 1ZJJA 3D7MA 3QLVA 1VPWA 2FHSA 2KS6A 4BX8A 4RF2A 2XCUA 1LWOA 5B12A 1UK9A 3JQBC 1W2GA 4AWXA 3TL2A 4CM5A 2CCJA 4HO1X 3TPCA 5FDFA 3ETHA 4GM0A 1NZFA 4F84A 1US8A 3AYZB 1PFQA 4E7PA 5AJHA 1EXMA 1YQQA 5CYPA 4JUAA 2X8JB 4ZTBA 1S5PA 3VTFA 2RH5A 3LIIA 4CUJA 4F71A 3W77A 3NCTA 2GQ0A 5AXCA 1S3FA 3MRVA 1IM8A 2NNLD 2XUGA 1JA1A 3FKSA 4PSAA 4RELA 1ZCFA 1ORRA 4UBJA 2GEKA 2ZRAA 4PZYA 4OQZA 1EWKA 1KZ7B 3TPFA 3E3LA 4GVPA 1KJNA 4HPXB 4MINA 1FC0A 3MPOA 2J0UB 1N8KA 2AN1A 4O59O 4P08A 2X8LA 2PR7A 2QJFA 1S7GA 1FX0A 4X65B 1G21A 3ZOKA 1HC7A 1NX9A 2AN3A 3BGVA 2P6NA 3GJ8A 4PLZA 5D5QA 4HDAA 4RSHA 3RYHA 4LV8B 2C57A 2IFTA 4L8FA 3BDAA 2JDIA 2OSVA 2VCHA 3A4LA 1YB7A 5CD9A 1E0JA 1N6PA 3GN2A 5SY9A 1GV0A 2OZKA 2RK3A 1SEPA 4LDNA 2DSNA 1A5AB 2QZZA 2X6RA 1P6XA 4XARA 4O2BF 4EJ2A 4J0KA 5AOBA 5EPUA 2CUNA 4BU1A 4GR5A 2HA6A 4TWJA 1Y5LA 2O4CA 2AKEA 2XMCA 5EHNA 1IBKB 1JJVA 1L4MA 2J4FA 4L15A 2A3NA 1YZUA 1WDMA 1EUZA 1UFKA 3GUCA 3I9MA 3AJAA 4GX0A 4Q9NA 5A7GA 4ZDKA 4WACA 2UXCB 2VP3A 2GXAA 4REQB 2VF8A 3DULA 4GKAA 1ADFA 1YQWA 2WB4A 4AN4A 2IZOA 3G9ZA 5TVGA 2RIPA 3LLUA 2IEZA 4OL9A 2HT1A 2OLKA 1A69A 3GIDA 4YI5A 1NNEA 1R6TA 3AHHA 1ZNZA 3PICA 3KUXA 2J5QA 1VG8A 3NWJA 3FBWA 4L2IA 4ZQCB 4IRUB 3RBAA 1LJUA 3BH6A 1C7JA 1N0WA 1R27A 2GN0A 3BMOA 1M7HA 3MMZA 5DTMA 2D4AA 3PSHA 2ZJ4A 3IDOA 2L82A 5LNK1 3RS7A 4S1OA 3EJ6A 1YI1A 4EP1A 5CXQA 3O8CA 1Y1PA 3ITDA 3AIOA 4ITRC 3U19A 4YC7A 4RVDA 3K35A 4AICA 3OMXA 2WQ7A 4UU8A 2JGAA 3H5VA 3MGBA 5CH8A 3VJRA 3E5RA 2O8FB 4BEWA 2IPLA 1V5FA 4NBSA 3D1JA 1WDLA 3L8HA 3V1YA 4EQ6A 1N2GA 3U61B 1CBUA 2XMQA 3PP8A 5ITZA 1DKUA 1JIVA 2YZNA 1CUHA 3K05A 1ZLXA 3H86A 3JWJA 2EJBA 5K3BA 3CIFA 2B1GA 3GVXA 3ZDRA 4CMEA 3UJ3X 5EHZA 1U7OA 5C51B 4XD7D 1E3WA 4LMPA 1W87A 4N0PA 4ZVKA 3AG5A 2AT1A 2O2ZA 4NATA 2GWRA 1T0BA 1I5EA 1T2CA 5FXMA 1OU4A 1YR7A 2O2CA 4GRDA 4I5IA 1JWAB 1QYVA 2CNOA 1O54A 5H3HA 2GARA 3FZQA 4ZCLA 4DIUA 5EXDA 4QLBA 4M8IA 1L3CA 3T34A 3TOSA 4EG5A 3CVJA 3GRCA 3GNSA 4FJ0A 4AZ0A 3HGTA 5KMGB 1Z07A 4KPFC 2O8CA 5FI3A 1UR5A 3A6KA 4J1TC 2C29D 2GVNA 4YUWA 4W9NA 1JEEA 1SBQA 3RV3A 2PZ8A 2VPQA 3U26A 2W42A 3PGKA 4QUIA 1NJ6A 3KQMA 5LQJA 4GC9A 1O6FA 2FZVA 3LXRA 2I76A 2QTVA 1V8OA 4MAMA 3A70A 2CVQA 5DM1A 4DPKA 3T3PB 2XY4A 5D1HA 2HYDA 3KPWA 4HDRB 4RGYA 4QG3A 2HQOA 4ND6A 4K86A 3HYTA 5E7IA 3MWGA 3LG2A 3WGHA 4R98A 4U7HA 1MEEA 1Z2OX 1YONA 2DSTA 3QWFA 3L0IB 5CDUA 4IIGA 1BKYA 4H7HA 1D7OA 3DTTA 2A7XA 3UXMA 1EWYA 4IJUA 3T3EA 8ADHA 4MMZB 1IHYA 3L8MA 4KO8A 4LJLA 1ECPA 4ZMRA 4EUHA 2WNSA 5LZ9A 4DV1B 4QTZA 2I4OA 4I4LA 4MUGA 4U7WA 3RKSA 3W2TA 3K09C 4WASA 5KX5B 2D7CA 3T4EA 1J8YF 1CDZA 2VP2A 4KR9A 3VO8A 3WLPA 1B8VA 2IYYA 2PS3A 1GFWA 3KZXA 1UQRA 1AS3A 2EKBA 3FI9A 5D1NA 2X8WA 9GPBA 4C0BA 3F6RA 3VNUA 3ELUA 2X1LA 1USKA 1R7RA 2I7DA 1TCAA 2FQXA 2UAGA 4HSEA 2CUTA 2JVIA 4DIKA 1QZZA 4QQNA 2FWJA 4DV2B 4X41A 1QHNA 3HRKA 4O2BA 1PD1A 2PZBA 2W8BB 4O4JA 2R6FA 5FPTA 4R68A 3WWEA 1MMFB 2DE0X 4CIDA 3PXUA 3MS4A 3FTQA 5C8YF 1FS4A 5JOQA 2WHPA 2AL7A 2XMDA 2QG4A 1XVTA 1DC3A 4BVKA 3G13A 4HNSA 1VL0A 2IV2X 4EY6A 1H9CA 1FJXA 1GYQA 5IH3A 5T4HA 4WY8A 2C9CA 3E7DA 3K3PA 3D8SA 4WZBB 1TFUA 2A59A 4PZPA 5ENZA 1Q2XA 1C7EA 1QGDA 3LK6A 1H9BA 3W5HA 1OGYA 5KQGA 1ICIA 2AUNA 4M8KA 4ZOQI 2XR1A 1NVVR 4EYEA 1U7WA 5NLLA 4ALKA 2ATEA 2YKGA 3FVRA 4LDPA 1Z5ZA 3O91A 1JZQA 1JQAA 2HAEA 3AUFA 3VNBA 2XCIA 2E87A 1RWBA 1F4VA 2LPMA 1VQ1A 1Z8DA 2AH5A 1US8B 2LD4A 3LZ6A 3NP7A 3ZBTA 2GEJA 1MC1A 1S0UA 2FQ1A 2I62A 3K20A 2COUA 4PAWA 5FWYA 4GZ6A 1YK0A 4B6EA 1BAPA 3O8BA 4D8YA 4PLFA 4XCQA 1FVXA 1UEXC 3H7AA 2I1VB 3L3BA 4FFBA 2IU3A 3SI7A 3EA0A 1BSVA 1NPDA 4GMDA 3M6WA 4BNDA 3HR4A 3HXKA 3Q5DA 3HUEA 4M99A 1SVKA 4A16A 4C3ZA 4M46A 4R8RA 1F2TB 1OILA 1GXSA 3MMXA 2VQSA 1QP4A 3V4VB 3PHGA 3RYHB 1XEAA 3DB1A 3K9CA 2MHCA 1T3GA 4PYLA 4NXNB 1ORHA 1VBFA 3JQFC 3E61A 3A6FA 1UPBA 2OZLA 1U5BA 2CN1A 4AU1A 9ABPA 2DKFA 3E70C 4LYYA 3AJRA 1MNAA 2H1SA 4MZDA 5HF9A 5KTRA 3D3NA 3UG6A 1FTNA 1Z45A 2PU7A 1R5NA 1RI1A 2JCYA 2OAP1 1I0ZA 2HRRA 3MD9A 3PB3A 4AZ3A 4Q1DA 3N7TA 1KSFX 2RIRA 2YOFA 1WAMA 2MOKA 2VYVD 1JQDA 3K5HA 1T0PA 1IDN1 5IVDA 1QSGA 2YDXA 1YS2X 1ZCJA 1AKRA 3KJEA 4OBXA 4RH1A 5E9WA 4S24A 3UQYS 3F6BX 4PPGA 2G1UA 1T5DX 1WCV1 3IKMB 1T9HA 4FGUA 1NYLA 1U7ZA 3FXAA 4GQBA 4R7ZA 5DM60 1DFIA 2ASEA 2G9RA 3AM5A 1NLUA 3AHGA 2Z98A 4RKFA 1TTQB 3RHSA 3DM5A 4AURA 1OFGA 1R88A 4KACA 4LK3A 3NFYA 3SS8A 4EMSA 3E9RA 1MHTA 1WD5A 1EWVA 1Z16A 3WIUA 2VSOA 5CD1A 3SAJA 1XCJA 3N5CA 2BMFA 2DWUA 4MWGA 1E1RD 5J40A 3BMOB 3WL3A 4ZIRA 3O9ZA 5EQDA 3VUFA 1F14A 3HA7A 4YO8A 3MS2A 2RJOA 3KEOA 2EP7A 2W6MA 4H3HB 3KFVA 5EHGA 4B4KA 1CKEA 4II2A 2PIAA 4H7JA 4ZI7F 2A88A 1C7RA 3OLWA 2ZIXA 1OKKA 4G4SO 2DFVA 3DV2A 2OOSA 4CLEA 4LJ5A 4LGVA 4YUXA 2HV8A 3UTDA 1VJDA 3JZMA 4F5DA 4D45A 3OIWA 4J8PA 4EFNA 1UWKA 2YIVX 4NV3A 4UASA 1A3CA 2O3UA 1XWIA 3GCGA 5IC5A 3CBGA 1SD5A 1QV6A 3BGSA 3LUGA 4FIDA 1SHLA 4AF6A 1NT2A 3TZEA 1NUQA 3K9BA 5ITZB 3ERCA 2G08A 3EY4A 3OJ0A 2RKOA 3DE7X 3IO3A 2WD9A 1ENYA 3FNGA 4CM6A 3IVXA 4NV0A 1XMOB 2UV8A 1E3WB 1FIUA 1EH5A 2OV1A 2FZWA 4MW0A 4F8JA 1SAYA 3EPKA 4J0HA 2RI0A 5JR3A 3WR5A 4BNTA 2X1HA 1ZOPA 1ORWA 4HFMA 1CF2O 1IWBB 3N0WA 1MAUA 3H8WA 5LMCA 2DQKA 4I2NA 3GO4A 3CURA 4C29A 5JVDF 1RBQA 2JFZA 5HJ5A 1YBHA 1AA9A 3M7IA 4A8HA 1JMKC 2Q1TA 2QW1A 4DDHA 2FWPA 1TZ2A 4EHKA 2ZPAA 1GUDA 2OQRA 2O8CB 1L5HA 4DSTA 4YMLA 3F7MA 4W7IA 3PHHA 3OCUA 1XMSA 4RH3A 4DM4A 2QRVA 3AWDA 3MC1A 4MWSA 3KYIB 4KQ9A 4YJ2F 1IEQA 1DRUA 4WK2B 1IAQA 2K4MA 3Q6MA 2WYWA 3CVUA 1GZDA 3NBQA 1GGEA 3QF4A 5ENVA 2O5CA 3GRUA 4IOLA 1P6QA 5JSHA 1T36A 3NPMA 2NZJA 3HUDA 1BCSA 3CLVA 2I99A 2GTPA 3Q3EA 5JDIC 5L8VA 3WISA 2YWJA 4WBNB 1XA0A 3QOFA 3EDCA 1A96A 4NKRA 3UANA 4DC0A 2QMHA 3L4EA 1XUOA 4QBIA 1QRSA 2R48A 1VL2A 2AXPA 1KOFA 1RHQA 2CF5A 2NXCA 1VHTA 2Y1GA 3QKUA 4D9EA 1UQUA 2I34A 2OCPA 4MQEA 1PN3A 3IFSA 2CCKA 3D6NB 3WGJA 2GPNA 3RU2A 4OO3A 1V5EA 4CQNA 2HBQA 1DELA 2JK1A 3A6DA 3ANLA 4YQZA 1OBFO 4XGQA 1T3ZA 2ZS7A 3F47A 4QYXA 4XOIA 4TQAA 4PBRA 1BQ4A 4AJEA 5EJ8A 1AKUA 3F9IA 3JD1A 5B1YA 3KKPA 4UEKA 4HB0A 2ACKA 3NVMB 3JQ9C 4XYBA 3WQSB 4ADSG 1KBZA 3BWXA 5HQ3B 3ZDAA 4A6PA 1M73E 3ER8A 1S4MA 1FMJA 4G4JA 3PD7A 4KLZA 2BSAA 9MHTA 5A4DA 1PO7A 3TG2A 4FEEA 3GLKA 3HFGA 3HB5X 3HEAA 4HKTA 4B0PA 3EF1A 4HDKA 5KVQA 5E9JA 4US2R 4OV6B 5C34B 2ZAMA 2WPNA 3RTCA 4MUFA 3CVXA 1OOEA 3MGAA 4P5PA 3PG5A 3FYSA 3NGXA 3TOXA 4G4GA 1T9GS 3DL7A 3EOAI 2WMOB 4CXMA 2WHPB 1GTSA 3ED1A 4X0EA 5F4ZA 4OUDA 4EFMA 5KNBD 4N0QA 2ODQA 3HABA 2MIIA 1S02A 1SKQA 3GT7A 4YAGA 4WECA 1A0OA 3KJZA 1TVMA 4X3PA 3RWOA 4JCOA 2C4UA 5LP6F 3DT6A 3KS9A 3W7VA 3SHVA 3O6VA 3V32A 4DDMA 1LDNA 4KXXA 3ZDEA 3M9LA 4PC6A 1YDGA 3NYIA 1Q1AA 4IIEA 4BXOB 3OKFA 4HR7A 2AQIA 4QARA 1N2JA 1W1UA 1D4OA 5HMLA 3ZJ5A 3WG9A 2Q7OE 3RTAA 1RYFA 5LQCA 1CC1S 3HBMA 4TVSA 4PWZA 4ZI7A 3INYA 2COEA 1CUGA 3ZZUA 4WOCA 3SCZA 5K0SA 4PSDA 5IEJA 4IDHA 1TW3A 2JLVA 4DNOA 1O77A 1E94E 3ESQA 4DR2B 1L7AA 4MW7A 3UUWA 5EEHA 1G20B 2FRDA 3HKDA 3GVIA 1APBA 3KPJA 1HDOA 4KNWA 5F98A 2V7EA 3IE0A 2Z3VA 3IS3A 4ZD6A 4BNDB 1Q15A 3JZIA 1J0AA 1VCHA 3VPAA 3WIBA 1OXUA 2X9NA 3B20A 2N0SA 2VXBA 3BBPA 3W9YA 3KR2A 4BJ3A 2FR8C 2XOKA 4M4SA 3SIRA 4E5KA 1P9LA 1OBHA 1GXSB 3O8NA 4MYCA 3S55A 1Z5GA 5C1IA 2O50A 3K6RA 3MTJA 5HCIA 1ULHA 3RGGA 1UPXA 3JPWA 3LOQA 5ICEA 3KQHA 2M2IA 1CY1A 1NUAA 4ALMA 2EDAA 2J3QA 3P2YA 1M5TA 4YUYA 1P8AA 2W2NA 2OZLB 1BDIA 3DTYA 4C30A 1I36A 3EA4A 4GBJA 3C14C 5FAXA 3DFUA 4JS0A 1ATIA 2QYSA 3VMFA 2F8MA 4ESVA 1MO2A 5CFNA 1DOHA 1JB9A 3ZS8A 2IGTA 3T9DA 2HSDA 3FZEA 4AZ3B 5F1OA 3OO0A 4NESA 4U8GA 2D0DA 3SQWA 3GELA 4RCZA 4UFOA 2R97A 5EP4A 1NI4A 2GILA 1JP7A 3IAFA 4I50F 5EGSA 1M34A 1GKIA 4FMBB 1KMQA 2L2QA 2V6IA 4QO7A 3X1JA 2HSEA 3NALA 4JYZA 3HJTA 1TAGA 1WZIA 4WI1A 3F8SA 3FNRA 3RH0A 3JU3A 1VLMA 1YNOA 1T5TA 1YB2A 2GYYA 4WK6A 3RK0A 2Y68A 5TY0A 4ZIRB 2RC6A 5G1PA 2PZFA 3QXHA 5BMOA 3HVRA 5EKDA 3MYRA 4LRWA 3PL5A 4OI2A 2POCA 4ZC1A 2WYUA 3DVRX 3CX3A 1DUVG 3BSYA 1CNEA 2BEVA 2ZIXB 1NXWA 4V38A 2VHTA 4Q9HA 1DFHA 1O03A 3A6JA 3VU9A 2ZYSA 5HP4A 2OAQ1 3DMNA 3C1UA 4YP1A 2GHRA 3MRTA 4J94A 3BQNB 5EMMA 4E5YA 5BW5A 5A4KA 5JBIA 3OTGA 4RC9A 3PBKA 1WD7A 1ZQ9A 4D3SA 1KORA 3PRKE 1E4EA 1M74A 1W9HA 3RTEA 1D1PA 1GD1O 3LBFA 5AR1A 5BSEA 4WCDA 3P4YA 1CEYA 1ZEJA 3QQ5A 1RXWA 1RLTA 2J87A 3ESYA 3M4NA 5EIHA 2PL9A 4KK4A 4P7FA 4KDRA 4IDFA 3DE3X 1GILA 3EW7A 2AR7A 4ROSA 4ZOBA 3LXMA 4BDSA 2PZAA 1IN4A 2AMYA 5HIKA 3HVHA 4DV5B 3BB3A 3H4IA 1FPQA 4CR6A 2C1EA 4LJ7A 5KSZA 2PTHA 1IN5A 4LHZA 4FW8A 2A35A 4FYXA 5BOSA 1PFUA 5TGZA 3QTTA 5LP6A 4C0AC 3AM1A 1MJNA 2XMZA 4ZVSA 4PM4A 3NHLA 2CLLB 2VLIA 3NHFA 1CYEA 4FDTA 3U80A 1CR4A 3D4IA 1L5HB 2WJJA 3T3OA 1U9YA 4K6MA 2PXAA 3F96A 2QRVB 4FWBA 4Q0MA 3T3MB 3W5AA 2FSPA 4M53A 1LF5A 3UA3A 2O2DA 4ARZB 1T10A 2HEGA 4MRAA 5EJ2A 2SCUA 1CU1A 4E33A 1CF9A 3QF4B 4WINA 1UPFA 3IDZA 1HTWA 5HFNA 1P4RA 5HEKA 4YAFA 4EGAA 3DVSX 1XKTA 3EVDA 4GYWA 3J81A 2BBOA 3TZKA 3IUYA 1PQYA 2VUSA 1W5TA 1VCNA 3ZHRA 4R69A 5D01A 3BEOA 3W6NA 3AEKA 1BMTA 4M0FA 1HFJA 2C0PA 4EGCB 2YMLA 1TYZA 5FTKA 4ZYUA 3DDWA 3OT1A 4MB2A 5AFSA 4HRYA 4BBAA 2RAUA 3SSMA 3GAAA 4IIHA 4ENSA 1QVWA 3R4CA 5EKTA 2B5VA 4G1CA 4ZALA 1BZYA 2MR5A 3NIBA 4FLFA 2ZJ0A 1JDBC 4GMFA 3VH4A 5IHXA 1YHNA 2Z2JA 2FAXA 3DBRA 3K2EA 2IS6A 3H0KA 3FMIA 1S2GA 2J3MA 2VPXA 4G1EB 1B00A 2A0UA 2HLPA 2PHZA 1YRHA 2X4DA 3E3NA 4NOMA 4XI9A 3U1VA 5JNWA 2NV0A 1BMQA 5L3VA 1XZJA 5HOEA 2C59A 2OC9A 3A3KA 4PLWA