4R98A

Chimera of the n-terminal domain of e. coli feob
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
263
structure length
256
Chain Sequence
KKLTIGLIGNPNSGKTTLFNQLTGSRQRVGNWAERKEGQFSTTDHQVTLVDLPGTYSLTTQTSLDEQIACHYILSGDADLLINVVDASNLERNLYLTLQLLELGIPCIVALNMLDIAEKQNIRIEIDALSARLGCPVIPLVATDTKNVQFVLKLAIDRYKANENVELVHYAQPLLNEADSLAKVMPSDIPLKQRRWLGLQMLEGDIYSRAYAGEASQHLDAALARLRNEMDDPALHIADARYQCIAAICDVVSNTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrous iron transport protein B
publication title A GTPase Chimera Illustrates an Uncoupled Nucleotide Affinity and Release Rate, Providing Insight into the Activation Mechanism.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal transport
total genus 85
structure length 256
sequence length 263
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
A PF17910 FeoB_Cyto FeoB cytosolic helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4r98A01
3QVUA 2ONKA 4Q7MB 4YXWA 2ZJAA 3GMTA 3L8YA 4TMWA 3EW9A 1V5WA 3GLIB 4DLRA 2GZHA 1U2RA 4V0LA 3NVAA 4DDTA 4OHVA 2CLSA 3AF3A 2BJVA 2WPDA 3H84A 3KKMA 3KKQA 3M1IA 3WBKA 4A4DA 2NTYC 5FL7A 2R2AA 3KKPA 2GF0A 2C9OA 2IC5A 3AVTA 3CRMA 2GCOA 1FZQA 3QBTA 2REBA 1HT1E 2QTVB 1BYUA 2NO6A 4I99A 2CNWA 4C30A 4XWAA 1JR3A 4G3XA 5K8TA 3FYHA 2ZJOA 3F8TA 3PQCA 4Q19A 4B35A 1S1MA 1G8HA 4AKEA 1N5JA 1P2SA 2FDCA 3ADDA 1FNMA 4M9ZA 4PAMA 4Q9KA 4YMSA 2NO0A 3RABA 2RMKA 2W2XA 1LS6A 1XNJA 1XTRA 4Q4HB 2HYIC 2W83A 4XSHA 4MYCA 4AURA 5JLJA 4V0NA 1G3QA 2I1VB 3A1WA 4Q1DA 2ANBA 2H8KA 4RKEA 4PO9A 2FZ4A 2N42A 2CL0X 1IHUA 4C0JA 4FMCF 4C0KA 2JJ8A 1P9RA 4ASUA 4Q4AB 2O8FA 4RKFA 3PEUA 1YZQA 4V0ME 2QQ0A 2KE5A 2ZJ5A 2V7QA 2BMDA 3THWA 1GL6A 4QJ3A 4C0LA 4UKDA 3CM0A 3SHFA 4NCNA 1ODFA 4I1OA 1TNDA 1NBMD 3CRQA 4FWTA 4H1UA 3KB2A 2PZEA 5GJWC 1KTVA 3KJGA 3QQ5A 1UKVY 3PEVA 1S9HA 1EFUA 2O8EA 1U90A 4WXRA 3HPQA 5P21A 1XTIA 2A5YB 1ZU4A 1E96A 4QGAA 3QIAA 3RSOA 2GA8A 2C98A 1OXTA 1AN0A 2JASA 1US8B 4MGZR 1GP2A 5AJZA 1EX6A 4IW3B 4LJ8A 3B1VA 2E9SA 3ZDQA 2ZRPA 4TQUS 1EFCA 4KBGA 3RC3A 3QOFA 4KFRA 3EXAA 4D6PA 4U02A 2V6IA 3TUIC 3I1FA 4TYQA 1TQ6A 3THXB 3NDBB 1XXHA 1JB1A 2REOA 5TV2A 3GJ4A 1S2MA 5A0FA 4PPQA 1DADA 4YC7A 1P2UA 4HB2A 1XJ0A 1KSJA 2WVJA 4EPXA 3AVUA 3BOSA 4UNQA 5KSOA 3FHTA 1AA9A 2IT1A 1DAEA 2X1VA 3AQ4A 3QXJA 4QHTA 4BLRA 5KPDA 3CW2A 1N6LA 4WA7A 1G4AE 5KU1A 5DHAA 4A8JC 4F7WA 2IEYA 1U8ZA 2J5XA 1MABA 1UBFA 1UBGA 1KYIA 4PSVA 1DBSA 2CVFA 3I62A 2F55A 4O2LA 2ZE6A 3K0SA 4B48A 3MGCA 1QHHB 1IM2A 1GITA 4C0BA 3K0CC 4TQAA 5FL3A 3GLIA 4DZZA 4JLMA 1KJWA 5FOWA 3ZVNA 3EC1A 2QP3A 5AJYA 2W00A 1XEFA 3R8CA 2F1IA 2O5VA 4LJ5A 3B1YA 1YZTA 1UBEA 3RC8A 2ECKA 4Q47A 4UJ3A 1S3GA 1X86B 5BYKA 3QXXA 1NBMA 4P4SB 2IYXA 3GLFB 1KK2A 2VA8A 2AR7A 1OPXA 2OFOA 3NG1A 2P65A 5CYPA 2ZR0A 2N1BA 1C4OA 3PV0A 3SJBA 4DDUA 3H4MA 2GVZC 1RKBA 2FU5C 1DAIA 1W4BA 4IOLA 1Q57A 4BZPA 1RRPA 3P1JA 2ZSAA 3BS4A 1W0KD 1HUQA 3SI7A 1Z0JA 4KJZA 4WW0A 1Q21A 5CITA 2GJSA 1RVDA 5C4GB 2JJ1D 2A7QA 3GJ6A 4PAQA 3VMFA 3C5HA 4KITB 2VHQA 4Q4HA 1KO5A 4EAQA 4QM6A 4TYWA 1NVWQ 2VP9A 2WJGA 4LJ7A 5JZVA 1U8YA 3BJIC 3ETLA 1CR4A 4LJ4A 4PQRA 3CF0A 1MH1A 3N2EA 4LRWA 4QHYA 1PZNA 4PZYA 4Q1CA 3TR5A 4F38A 3GP8A 2RHDA 2VP4A 1G8FA 1S8FA 2R6CA 3QG5A 1T3SA 3LNCA 1GKYA 5H8WA 1CR2A 2AKAB 1G7CA 3IGFA 5FUWA 2R9VA 2DWQA 2ERXA 1QHYA 2IYZA 3LFUA 4LYAA 2ZQ5A 4Q4AA 1QHNA 3A36A 3AGPA 4GP7A 4R9UC 5TDHA 4D4MA 4XOIA 3A1SA 4MA4A 1EX7A 2R6FA 3CBQA 1N6OA 1H8HA 3B82A 5C46F 4DSOA 4CIDA 1NY6A 5J47A 4ABYA 1NN5A 4A1FA 2WWFA 1DAFA 3OIYA 4GPTA 2ZE8A 4HUTA 5K8IA 2GKSA 1ZUIA 3DMDA 4FW9A 4Q9IA 5FPHA 4BEJA 2BBSA 2W6ID 1XJCA 3MCAA 3RWOA 3AVQA 1ZM3A 3GLHE 1DELA 2CHVA 2YJTD 4A92A 1AGPA 2GK6A 1E69A 2VH5R 2QPOA 3LWNA 1N0UA 4WIAA 2WBLC 2ZE7A 1US8A 3WNCA 1RYFA 1R8QA 4QBFA 2ZM5A 1Z6GA 3TAUA 1SXJC 1NL3A 3AVYA 1SVLA 1IY0A 2F3RA 4A6PA 3AF1A 4HAZA 4ACAA 1OV4A 1NJFA 4DLVA 3THXA 4DJTA 2PMKA 4JJZA 1KJYA 1ZVQA 4P32A 4BZXA 1NF3A 1P60A 2FEMA 2EQBA 1BKDR 1W0KA 5EJEA 3PG5A 1T0HB 2PX0A 2IS2A 4NDZA 2IK8A 2JJ1A 1EESA 4B6FA 3QXSA 4KLZA 2EFHB 1R7RA 4M9SA 4LYHA 1NY5A 2W58A 5KNDA 3RRMA 2ORWA 3U44B 3R9IA 3AUXA 3RVBA 1OH5A 2G1KA 2QSYA 4N0DA 5DGXA 5ANRB 3KKOA 3QPWA 1KDPA 3WBJA 5L3VA 2ZJYA 2Q9AA 4Z8XA 5FTMA 5KDOA 4OI0A 1AJEA 4C0SA 1GM5A 2R6DA 4LBZA 4W5HA 2BIFA 1YZLA 4R71A 4US1R 4DT1B 1OF1A 3D8BA 5CB6A 1A1VA 1Q1EA 3PCRB 1G9XA 2XZLA 4U00A 3ZD7A 3IILA 4JBYA 4NCIA 3OFNA 3AVXA 4RD1A 1G5PA 3GLFA 1Q20A 1A7JA 1Z47A 4YLGA 3SFVA 3LAWA 4Q5IA 1VDZA 2W6IA 1GAJA 1N2CE 4GFDA 1KKLA 3IDQA 4LJ6A 1E6CA 1FOEB 1D2EA 4LOAA 4GRAA 2OXRA 1V43A 5FTKA 3SOPA 3CPEA 2PX3A 1Z6TA 2BJWA 2OFWA 4M1KA 2GRJA 2YWFA 3QKRB 4OI1A 5FTLA 4DWJA 1SVOA 3UXMA 1ZMXA 1NIJA 4M2LA 5CLQA 5G41A 2BWJA 1ZUHA 3F5FA 3VR4A 1VMAA 5EE1A 2Z4SA 4M9XA 1E2JA 4A0GA 2XX3A 1CEEA 3VNUA 2IHBA 2WMOB 3I8SA 3NKVA 1J99A 1XCPA 3SU8A 2D74A 4B2IA 4B3CA 2IXGA 4DCNA 2WWYA 5AUOB 1N6HA 3A4NA 3UPUA 2GHIA 4O3MA 3AKCA 4PXAA 4LHXA 1PJRA 3SBDA 3W90A 3DM5A 1HE1C 1OIVA 3RSLA 4AC9A 3DVLA 1S1CA 4H1VA 2BV3A 5DE3A 2HCJB 2HV8A 2GXQA 2ZI9A 2JIZD 4HB0A 3SC3A 1O87A 5EXPA 1ONBA 3EIEA 3AM1A 1M2OB 3BE4A 3EZ7A 5KSZA 4LK2A 4GOJA 4OHYA 1Y63A 1ZD8A 1EFRD 2EU8A 4B74A 2B7CA 2IXEA 1E1QD 2LKCA 3DDCA 3U4QB 2FFBA 1UEJA 3LRPA 4JLVA 4TMXA 1ELOA 1GOTA 1XEXB 3EIQA 2IS6A 2OESA 2ZYVX 5HKKD 2HXSA 4JLPA 1W48A 4MYHA 3ND9A 2OCBA 3L0IB 5FR2A 1XMSA 1QDEA 1SXJB 5EP1A 1ANKA 1RJ9B 2CK3D 2FA9A 3RRYA 1FPMA 4BZQA 3M0EA 5ELXA 3BK7A 1NVXQ 4TL6A 2XJ9A 3IBGA 1UKZA 2GJ8A 5JWHA 1UDXA 4UXIA 5L3RA 4YMUA 2ZVPX 1BYIA 2WWXA 1DEKA 1E9BA 1DO2A 3MUFA 4JBXA 2QU8A 4C7OB 1E2QA 3J81k 2P6NA 3GLGE 4V0KA 4CRWB 4JL5A 2Q3MA 3ZIAD 1GFIA 1MO4A 4JMPA 4ZDWA 3EPJA 3U44A 1LB1B 2A5DA 4A8JA 3DO6A 5CDFE 4ZCMA 1NVVQ 3Q85A 1MV5A 2P5SA 1AKEA 3ZJYA 2OUKA 1Z6YA 4FD2A 5L3QB 2ANCA 2QENA 3I4LA 4QNRA 1RW4A 4XTRA 1G5RA 4MYUA 3K0CA 4KBFA 3NIBA 5SZIA 4DT1A 1XTSA 4FCVA 4JVLA 4KVGA 1CTQA 1LW7A 3QF7A 2KI5A 3B85A 2F1JA 2DFTA 3K9NA 1P72A 4IXNA 1SXJD 1KGDA 5IF9A 2F1RA 2ZXUA 2O8BB 1S3SA 2QG6A 3GJXC 3L43A 4IRUB 4NZYA 1AS0A 3A8TA 4JIMA 4MDFA 3SBEA 2JIZA 1S0UA 4RD0A 3T12A 2Q3FA 1KO4A 4ZO4A 1YRBA 3KQUA 4HEJA 4IFBA 2V55B 1FW6A 1NVVR 1EFRA 2VF7A 1W36C 1JR6A 2IW3A 2PH1A 1E1QA 3QKRA 4JT2A 4EUNA 3MWYW 2XTMA 4DLWA 2AL7A 3L0PA 1M8PA 3VHXA 5DI3B 1SKYE 2BBWA 3EA5A 2GK7A 1KI9A 4Q4LA 1JAHA 3LX5A 1Q1ZA 1W5TA 2X2FA 5SZKB 5HKKA 1R5BA 4A6XA 2W2TA 1KI8A 1XB2A 2ZS7A 3BC1A 3GJ8A 4HYYA 3L0OA 2ZAOA 4MKGA 3RS5A 1KNQA 4HI0E 1QG2A 2CK3A 2QNRA 4MRRA 4NONA 3U60B 2JATA 4GDFA 2QM7A 3P4XA 4B3GA 5GJVC 4FWIB 2IBMA 3EZFA 1G18A 1P2VA 1PVOA 1AS3A 4PPNA 4QG7A 4D25A 1EK0A 4KFTA 1SVKA 3B7GA 4MUBA 1CXZA 4MRPA 2V9PA 1Z29A 4EPRA 4MGYR 2QPAA 4OK3A 3SYLA 2ZJZA 1OYYA 4DXAA 1TQDA 1N6RA 2X2EA 3TW8B 2VPPA 4DKXA 4IVPA 3NC1C 1IN6A 1XTQA 4V02A 3B5JA 4I1SA 3ZZUA 2YOFA 3U2QA 1NN1A 1ETUA 3HDTA 3EPKA 2H7VA 1R8SA 2ZJBA 4Q7KA 2I1QA 2J0UA 4BFTA 2GEDA 1ZC4A 3TK1A 3ZZTA 4DUGD 3WMGA 4CGZA 4IVQA 2VLIA 4NU0A 3TIFA 2A2ZA 3IHWA 1IY1A 1XEXA 4PZLA 1J70A 4Q00A 4JVSB 1M34E 4IEEA 3QPVA 2XJ4A 1ZNWA 2OM2A 4OHZA 5B30A 4DIDA 1Z0IA 2NPIA 4G1UC 2GXUA 4DRZA 2JLWA 4A0FA 1L2TA 4ZCIA 1J8MF 1FUKA 1HE8B 4Z1MD 1SXJA 2ZSDA 4BLTA 3ND8A 1Q12A 1RJ9A 2ZYUX 1W47A 4JL6A 2WJVA 5JMTA 2ERYA 2IYUA 3BGWA 1S96A 1RRFA 4QXAA 2ZSEA 3U7FB 2C9CA 4I1VA 2DY1A 1RRCA 3CRW1 3CH4B 5F9HA 2X8AA 1N0VC 1W49A 1T0JB 2GEUA 4W5JA 1E98A 1E2MA 2V1XA 4LX0A 2BDTA 4GOXA 3MSXA 4C7OA 1XTJA 1G291 1JXMA 2KBEA 3WYFA 4PHHA 3BERA 3TQFA 4JLNA 2OLKA 5FOVA 1OFTA 1D2MA 4WZAE 1G8YA 2PZGA 2Z83A 4S2EA 4TMTA 2IWRA 3U3RA 3O47A 4B43A 3AVVA 5FR1A 1TF5A 2L0XA 4TYNA 3AGQA 4KU4A 2QAGC 4L5BA 3RRNA 2V54A 4K46A 5EE3A 1K8RA 4DCTA 1Q3TA 1YHNA 1Z6XA 2VRWA 3IQXA 4IEIA 3B6EA 4OYHA 5FOUA 3CO5A 3FMFA 2C8VA 2JEOA 1CJVC 1I2DA 2RGXA 3A1TA 2OBMA 3I8XA 4PHFA 5GVSA 2WHXA 1NKTA 4E5UA 3R9WA 4BE7B 4LY6A 2AWNA 2REXB 4HLUC 2O8BA 1ZC3A 1MKYA 3TH5A 2FFHA 3RLFA 2CCGA 1IN5A 1IAQA 2D3WA 3AKDA 4JKYA 2W0SA 4D81A 4HSEA 4GL2A 1T3HA 1VCNA 4ZDIA 3IPXA 1G3MA 3OHMA 3RS3A 4JSTA 4DB2A 5FI1B 1G5TA 5FUYA 1KK3A 1SVSA 3DZDA 2O0JA 2ZSFA 4V0MA 1MRSA 1TADA 3W9YA 1W36B 4NH0A 1D8TA 5JI2E 2EYUA 1E9FA 1E2DA 4N3NA 4BLSA 1XRJA 2WWIA 5B57C 2Z4RA 4EPYA 1LY1A 1HT2E 5SZJA 3CZPA 2AK3A 4PC1A 5UKDA 1SXJE 2G0NA 2CLCX 2G6BA 4HLQB 1KY2A 4PO1A 3H2YA 1W2HA 3CB4A 4QC2A 1E0JA 3GLHB 1R5NA 2W2VA 1RFLA 5FOXA 4XD7D 2HEIA 3VR3A 2Q9BA 1MO6A 3RANA 3K9LA 1QVAA 3LV8A 1U94A 1KY3A 3NBXX 3OEED 5F98A 1KK0A 1GRNA 1ZBDA 2FGJA 1GKIA 3NBFA 2YC4C 2BCGY 2ZRNA 1G6HA 3TMKA 2ZAMA 2BM0A 4QNMA 5CIQA 5EE9A 2P0EA 2AFIE 3FKSD 1ZIPA 1G21E 2ZANA 3IIKA 3K1JA 4OQMA 3M4YA 2PT5A 1OFIA 5C1BA 1W44A 2G88A 2KB0A 2WM9B 1TEXA 1I4DD 4LSGA 1GL7A 5KNCA 4C2TA 5L8VA 4LBVA 4X8LA 3SN6A 1L8QA 4M4SA 5HR5A 3SQWA 1ZCAA 1WXQA 2GF9A 1W36D 2A5FA 3FMPB 2HDNB 3QXHA 5BN4A 1RIFA 2R6AA 4BQSA 4B73A 2FE4A 2CJWB 3KJIA 3HYTA 1KI6B 1YR8A 4TLBA 2B8TA 3VX3A 3CH5A 3N2IA 3N70A 5DNYB 3GEHA 1UEIA 2V3CC 3SQXA 1TQ4A 1A5TA 3EPHA 1ESMA 2C2HA 3LQRA 3KB1A 4MDEA 1E4YA 2AN9A 1QHIA 3QF4B 1Z07A 3FFAA 2JDIA 5EZ5A 1BO6A 2ZU6A 2WMNB 3QY0A 2A5GA 3VKWA 1XD8A 2DCUA 2OEPA 3QEOA 4PO8A 1D9ZA 4HLCA 3T1QA 2Q9CA 4KVAA 4D82A 1ZM9A 5FPSA 3THYB 3T35A 1TF2A 1ZRHA 2RCNA 1EFHA 4QKQA 1FQJA 4C4PA 2QTFA 1GZSA 3T1VA 5J4YA 4MKIA 5HCIA 4MKHA 4PX9A 5G40A 4DCVA 3A37A 5E7JA 1F3OA 3MWKA 5JRJA 3BIFA 5DHFA 1AZSC 5CM8B 3W6PA 3VAAA 2QAGB 1KKMA 3TRFA 4XWKA 2WAYA 1CRQA 4TN1A 4XD7A 3PVSA 3PJRA 4DLXA 3EWSA 3Q7QA 2JAQA 4OI2A 4BECA 3OEEA 2F6RA 1SHZA 1H8ED 2J46A 3QEJA 1J2JA 2ZYTX 2QRZA 4CEIB 3BB4A 1KDOA 2FN4A 3JVVA 5LBIA 2UZIR 4KFSA 4O2RA 4IHQA 2ZI5A 2OCPA 4AWXA 3HWSA 1N6PA 1RYHA 2FPLA 3DPUA 3EWAA 3PUXA 3AF2A 5JWOA 5G53C 1T8TA 2NZJA 1XEWY 3FKSA 4G0NA 1XMIA 4WZ6A 2AX4A 1RPZA 1E2PA 1Q44A 2CE2X 2ZJ2A 3LQQA 4QRHA 5KYKA 3QUSA 4N1AA 1IN7A 2WSSD 2C03A 2R65A 3CX8A 3K53A 4HUQA 3C4JA 3P20A 1G17A 3TSOA 4EJSC 4DLUA 2KWIA 2WAXA 3FHCB 1CS4C 3QPUA 1W7AA 4JL8A 1XP8A 2GDJA 2HLDD 3KTAB 1F2TB 1E2KA 4LCBA 1E9DA 4M53A 2IWHA 2WTUA 3MLEA 4M1OA 3WYGA 1OIXA 3DOFA 5FOTA 3LX8A 1Q1QA 1QRAA 3H86A 5GVRA 1Q22A 4US0R 4ON9A 5EP4A 4PQYA 4URVR 4D4JA 4X8OA 3T1TA 3K70D 1XTKA 2CDNA 4PR0A 5JECA 3GLHA 3B60A 1CR1A 4LYFA 1NSTA 2ZRKA 4N0EA 2A5JA 2XB4A 4NYIQ 4MUAA 2ZSBA 1KI3A 2ZE5A 4UXHA 1UKYA 1Z63A 2ZYWX 4BLOA 4AIIA 5CK4A 4TMVA 5GJCA 1BS1A 2ODBA 1XPOA 4FXPA 4JBWA 5FFMA 4NYJR 2PLRA 1R0YA 4G01B 2FNAA 1U0JA 4PC2A 621PA 5JEEA 2YOGA 2GILA 3AP3A 4P3YA 4KFUA 3WRXC 2C99A 2JLYA 4RZUA 5J4KA 1AQUA 1N3BA 2VYFA 2WJIA 4IVRA 1OE0A 2W6JD 3WP1B 8OHMA 1XBTA 1DARA 1YQTA 4TTPA 2J41A 4P31A 3TUJC 4NCKA 5JCZA 2CJWA 3QKSB 3X1DA 2H5EA 1KI6A 3BH0A 3NWJA 5C2JB 1HY3A 3GLGB 5KSPA 4NYIR 1NLFA 4POAA 2WJHA 3GPLA 3EASA 2QMHA 3CNOA 2PCJA 3GJ7A 3DM9B 1D6JA 1XD2B 4UJ5A 2QMUA 1TUIA 2C9YA 2QBYB 2PLFA 3QF4A 3AH8A 1EGAA 3LBIA 3X1ZA 1FUUA 3SNHA 1BMFD 1TPZA 1EFTA 3B13B 4DDVA 2VHCA 5KDLA 2JJ2D 3THYA 3QKUA 4LZZA 1EWQA 1NRJB 2ODNA 1YR6A 3LLUA 2J0QA 2HLDA 2O8DB 1G7RA 5KOYA 4HDOB 5FH9A 3KJHA 1KOFA 2ZRHA 4RVCA 3UMRA 5JSZB 2GWHA 2AXPA 2NO9A 4L8GA 4LBWA 4PSAA 1UAAA 4M1MA 2J3EA 5KPJA 5E4FA 1F5NA 3GJ3A 2QAGA 5JI3E 2AHOA 1E1RD 1BH2A 3CNNA 4TSFD 3GEEA 1JJVA 3WNBA 5BYJA 1GIAA 4P0TA 4KAXA 1E0AA 2CE7A 1KK1A 3BORA 4PAOA 4CEIA 2GXAA 3CF6R 1YZKA 1IBRA 1SKYB 2DHRA 4QGFA 1TUEA 3ICQB 4A0RA 4TL9A 1W1WA 4HAUA 3VR6A 4A2PA 1OLOA 2IYRA 4C2UA 4BLPA 4HLUA 2IS4A 1AQYA 3N5CA 1XZPA 4PC6A 3I5YA 1X8LA 2FJUA 3CX6A 3V9PA 1DO0A 3TSWA 5BXQC 3LVRE 5CJPA 3CRRA 2CL6X 4D26A 5JBQA 1W4AA 4OQLA 2ZIAA 1E9EA 5JRZA 5FBLB 1MR3F 3BBPA 2P3SA 2W6JA 3IHLA 4CF7A 1R0XA 1ZNXA 2WKPA 2KJQA 1W4CA 2V8OA 3IIJA 3KTAA 3DZ8A 1G3IA 1F2TA 1XX6A 2VIIA 4IOJA 4EJSB 1G3RA 1R6BX 1X1RA 4TLDA 2RGDA 1P75A 3EX7C 2ASEA 4GZLA 1JI0A 1A2KC 1CJMA 3DKVA 2IXFA 5EQTA 4A8JB 1PV4A 5SZHB 4JS0A 4G5QA 3FE2A 1IXRC 2CL7X 2JCSA 3K0AB 5CYOA 2OHFA 4AKGA 2Q21A 2QMOA 1ZM7A 1FMJA 4I81A 1QBKC 4FMBB 2RGEA 1WF3A 2GAAA 3IIMA 2WSMA 2RGGA 2A9KA 4G5SA 1EG7A 1WE2A 2JJ2A 2V4ZA 4KV9A 4B71A 1IN8A 4AI6A 4ACBA 3RHFA 3U6BA 1KSHA 2XOKD 2WJJA 3LD9A 4ZIRA 5KHOC 3KQLA 1E9AA 2WWGA 2RKOA 2ZRCA 5EXXA 1I4LD 1MOZA 3PUYA 4HATA 2FG5A 3W8RA 3SYNA 2J0VA 3B1ZA 3LH5A 2Q0HA 4LHVA 4TSFA 4RFSB 3KUDA 1H65A 4EFLA 3ICEA 2J7PD 2ATXA 4RD4A 3QKSA 2XXAB 1VYVA 3OIUA 3E5HA 2OBLA 2RB4A 1FMLA 3MG9A 2GJ9A 2YKGA 4IJMA 3KQNA 3GLGA 1II8B 1L4UA 1G41A 1Z0KA 1IXSB 4BRWA 4DCSA 1YZNA 4FCTA 5CDFA 1N25A 2EFCB 3ADKA 2QTHA 1WBBA 4AY2A 1E79D 1X3SA 1XD2A 3AVPA 3OZXA 4W9MC 2GVDC 3VFDA 1Z06A 2QBYA 2QP9X 2V1UA 4GP6A 1XF9A 1OB2A 5LD2C 2Q3HA 3FOZA 3ECCA 2OE2A 3U3MA 2NO7A 2JLVA 1Z22A 3JVUA 4LJ9A 5BQ5A 3CR8A 3BB3A 3KFVA 4JSYA 3QNUA 1P4SA 2O8DA 2BCJQ 1M6NA 2MSEB 2HJGA 4NHOA 5TY0A 5JSZA 1GL9B 1Z0FA 3GFOA 1JEDA 2A30A 4V03A 4B47A 2AKYA 5LB4A 2VP6A 3T61A 2OXCA 4JLDA 3CIOA 2QUZA 4HB4A 4F4JA 1GKUB 3FTQA 1FTNA 4TLAA 3ZQJA 4DLTA 1DVRA 5JHGB 4CT5A 2AFHE 1E4VA 1UADA 2HF9A 2J0UB 2E1RA 2HCBA 3ASZA 5AUQA 5IT5A 4QOSA 5CLLA 3FWYA 1LNZA 3C7KA 4IDQA 3SJAA 4NKRA 4B75A 1OKKD 4JVNA 3R7WB 5TARA 3I92A 2B6HA 1YRAA 4UNRA 2XOKA 2A3RA 2QI9C 1P3JA 3T5GA 2VQSA 5IHPA 1QHXA 4LHYA 2F9MA 2ZRIA 3Q8XB 1IY2A 1Q3HA 2OT3B 1DTSA 2FMXA 4LV5B 3V00A 1DG1G 2P5TB 4JYCA 1N5LA 2X77A 1HTWA 2J7KA 1KNXA 2ZRGA 4JT4A 1UDWA 5D3QA 2PJRA 1CJUC 1OFUX 5AR1A 3JZMA 1JEEA 4AK9A 2QT0A 2ZRFA 4GMXA 4DEYA 5F9FA 2J7PA 1U99A 1OXXK 4EJSA 3HJNA 4PANA 1YZUA 4TWZA 3IO3A 1WCV1 4I1UA 1WA5A 4PQFA 1W46A 3GQBA 4Z54A 2VO1A 5FPTA 3IEUA 2EFDB 1COWD 3SJZA 1E32A 2D7DA 3SJCA 3FDIA 4PTLA 1NG9A 3K0AA 3KJEA 1JALA 4CT4B 2CMKA 3QXCA 4C0QC 5DI9A 3OAAD 4DHEA 4E09A 4F4CA 4UNSA 1QZXA 2G77B 4Q1FA 2PBRA 2GZDA 1FP7A 1KO1A 2DBYA 3GJ5A 4OJKA 1LF0A 1LV7A 2J45A 4KI0A 3UMSA 2BC9A 2EYQA 5E95A 3LA6A 1KO7A 2XNSA 3WRYC 1JQJC 1R0WA 4CZ2A 3CPJB 4IDHA 3ZD6A 2JLSA 2Y8EA 1ZNYA 2A78A 3VR1A 2ZTSA 3BFXA 2WKQA 1KHTA 2NG1A 3DOEA 4RFSA 2H18A 4FINA 4LBYA 3X1WA 2DFKB 1E9CA 2I4IA 1NP6A 4CYMA 2F3TA 2DWOA 2XXAA 3PITA 4C9BA 4P33A 2ZRJA 4MRSA 4EDHA 4ZI2A 1Z28A 3RRZA 1II8A 1G3UA 1GRQA 3LBNA 1UKEA 3H0KA 1U8AA 3ZZ0A 3Q72A 1C1YA 1X6VA 1CKEA 1UFQA 3MAAC 4B44A 4BFZA 3P32A 2V6JA 1YE8A 4AYWA 4Q18A 2IYQA 3VKHA 1R2QA 5D3MB 2OG2A 4PFSA 3X2SA 1KI1A 4QJ4A 4Q4JB 721PA 2GJKA 1U9IC 2D2EA 2B21A 5BN3A 5EUMA 3P26A 1Y3AA 2NPFA 3LW7A 3VR2A 1KSFX 1G64A 4BFWA 4NYMQ 4ZI3A 5LD2B 2IS1A 3OEHD 5KSYA 2IF0A 2MMCA 3AVOA 4JLAA 3BH6A 3UWOA 4M1WA 4RSGA 4IDNA 1GTVA 4XVUA 1VG9B 4PSKA 1N6NA 3MJHA 3UG7A 2D62A 1CF4A 4RZ3A 3EZ9A 2G83A 4TMZA 2XB2A 3T15A 3U61B 3ZIAA 1COWA 5IK2D 1JPNA 5HCNA 3TVTA 2ZRAA 3WXMA 5KDDA 2OLJA 2OZEA 3SS8A 3VHLB 2IYTA 1W0JD 2FFAA 1MRNA 2QROA 3OAAA 4LC1A 4B3FX 3U5ZB 5JFGA 3K9GA 2LCFA 1Z5ZA 2CXXA 2O0KA 4HLDA 1PLJA 4M8NE 2CVHA 3V4FA 2O52A 3PXGA 2NZ8A 2IHYA 2OBNA 2QAJA 3R7WA 3NHAA 2EVWX 4FI3C 2QORA 2VP5A 1E2FA 4DLYA 2BEJA 2OCAA 3R9XA 4ITRC 1B0UA 1UM8A 4EQ6B 4NYMR 2R6GA 3O8BA 5DYGA 3SHWA 4JLKA 2NO1A 1ZAKA 1Z08A 2JLRA 3D3QA 2I3BA 2Z5FA 4U5XA 2EWVA 1KAGA 121PA 5FPKA 4CEJB 1M7HA 1SGWA 3BXZA 4Q9HA 1I2MA 1LF5A 1FX0B 3PFIA 2ORIA 3W5JA 3PENA 2BMFA 1QF9A 1Q0UA 1VG1A 3WYAA 3O8DA 2F7SA 3KFXA 3ONWA 4NP6A 1OW3B 1T5IA 3GFTA 3VKGA 2BMEA 1OIWA 4M22A 4P4TA 4ARZA 3IO5A 4RZXA 4EKDA 1E99A 2OSBA 2MSCB 3I72A 1WMSA 2O0HA 2H1LA 4ZCLA 4RD3A 3DKPA 3K70C 3WNDA 2ZU0C 2H92A 4HAYA 3CLVA 3E1SA 4DSUA 4M1SA 5CIWA 2C04A 1KAOA 2AD5A 4Z8YA 1VTKA 3EG5A 4AG6A 3AUYA 2NGRA 1IQPA 3A1UA 3OEHA 1LS1A 3K8YA 3LY5A 3NH9A 2G1JA 1M7GA 4DEXA 5FUXA 4W5WA 1AKYA 1G16A 2XAUA 4MGKR 1FNNA 4LGMA 1T4GA 4IDOA 3NDPA 5K8LA 3ZGXA 4PC3A 1NIPA 4S35A 3PEWA 2GETA 3GD7A 1OYWA 1GVNB 2QGZA 4R2IA 3U7GA 1JQLB 5EP2A 5IK2A 3OE7D 5AWFC 1G20E 4CW7A 3TUZC 4GZMA 2W0MA 4BFVA 1OT3A 3HU2A 4HAXA 4OK6A 2ZS9A 4Q02A 4ZKDA 4KYIB 5HTKA 1TTTA 2QMEA 4Y0VA 5AUPB 2J9RA 4DUGA 1R4AA 3NC0C 2IEZA 4TT3D 4HUQB 4F91B 2GCPA 4HZUA 3KZ1E 4TLEA 3LDAA 5FUVA 3NH6A 4Q9JA 2QN6A 4KXFB 4CVNA 5BWMA 2B8WA 1N6IA 4M0LA 1CR0A 3C5CA 3FHOA 3B9PA 5D3MA 3OF5A 2ZI3A 4Z1MA 3D7MA 2XEXA 2ZRDA 2ZR7A 4Q4JA 2FFQA 2CBZA 4URZR 1KIMA 3C15C 2DFLA 2JLQA 2VHTA 2IYLD 4ZKEA 5LPNA 1AS2A 4KHZA 3ADCA 4NL4H 4D2IA 3W3AA 1Z0DA 1T9HA 2E87A 2FSGA 1RC8A 1A4RA 3SZRA 1PLKA 1IXZA 2ZUCA 3REFA 1M1YE 4NCJA 2LKDA 2HYDA 4K81B 2FSFA 3BH7A 4D4KA 4DIEA 3ADBA 4Z51A 1CBUA 2QY9A 1E9RA 1F48A 1HURA 4IOKA 1GNPA 4V0OA 2QGNA 1NKSA 2YZ2A 3A4MA 4KYUA 5TXGA 2DYKA 1WDTA 4TMKA 1T91A 3R8FA 1QVRA 1DPFA 2B92A 2NOAA 4YMWA 3WY9A 1Q1BA 3THOA 1E3MA 4NMMA 2GNOA 2QRNA 3WHLA 2ATVA 5F3WB 3PIRA 2B7BA 1MO3A 4RD2A 4HAWA 3U3KA 4LJAA 4AYTA 821PA 1L7VC 4KO8A 4KODA 4D0GA 4XWOA 1JPJA 1OJLA 4EQ6A 1VG8A 1F2UB 1ZD9A 4X8HA 3ZVLA 3KQKA 1E0KA 1P5ZB 3HYRA 4Q21A 1P2TA 3I5XA 2CCKA 3OE7A 1CRPA 2PEYA 4CEJA 4NCHA 5DH9A 1S4QA 4FCWA 2BM1A 3UK6A 1SVWA 1FX0A 3NEJA 3RDPA 4YDHB 3TVDA 1NN3A 3V4RA 4RCYA 4C0AC 4D80A 1FQKA 3S1AB 3G0HA 2GBLC 4TT3A 5DSZA 3DHWC 1GG2A 3TAHA 4UQOA 3A58B 5H70A 5A4JA 4Q1EA 2WV9A 4QBIA 3X1YA 1R10A 3CWQA 3B1WA 2FX3A 5J40A 4OQNA 2D4HA 4ESVA 4KLNA 4BFUA 4LV8B 4M1TA 3TBKA 1WQ1R 1Z83A 3VU9B 2HT6A 2ZRLA 4YMTA 3K70B 5DLQC 4R7ZA 1RRGA 1XPRA 3IBYA 3PUVA 1AM4D 1IJEA 2WWWA 3FKQA 3CONA 1AZTA 4ZV4A 2ZVQX 2BHRA 3I3SR 3K09C 1XMVA 4TTQA 1CJTC 4WAUA 4QFMA 4DDWA 1CP2A 1W2GA 1ZM4A 1ZM2A 1DE0A 2IF2A 5M04A 1KI4A 3EAQA 3NEYA 4QHSA 1X8JA 2F43B 2IYYA 3BB1A 1OXSC 2PEZA 1QHSA 4B2PA 5A5GA 3OIVA 2BKUA 3F0TA 1X8KA 1LTQA 2IUSA 2QA5A 5F2EA 4YONB 1T8UA 5JWRA 4NYJQ 1D5CA 1S9DA 4QM7A 2FH5B 2DR3A 4IXMA 3KUCA 1N6KA 4BASA 1YVDA 2WWHA 5KUTA 2YV5A 2P2LA 1W4RA 5TVKA 1VKJA 4A82A 221PA 2RHMA 4URUR 2UVQA 3KKNA 3MFYA 2PJZA 3KXKA 5FOSA 2EWWA 4HDCA 5B64A 1R5OA 1VCOA 5LDDC 3LXRA 2AWOA 5FTJA 3KXIA 5DYIA 2DPXA 3ZYCA 5KTYA 2GXSA 4OJQA 3HR8A 4DC9A 1M7BA 1GNQA 3MWLA 2HUPA 4LHZA 1TAGA 1SHKA 1U9IA 3P4YA 2OAP1 1ESNA 2YVUA 4DCUA 2DWPA 1G7SA 4M21A 1JR3E 5CK5A 2ZR9A 4ERNA 1C9KA 1H8HD 4XTCS 1XDBA 5E3HA 1TU3A 3TJZA 4BEBA 1G19A 3FGNA 1CLUA 4D4LA 4ZIRB 3HU1A 3A4LA 2XZPA 5DIFA 5J4VA 2CHQA 5GADl 1TL7C 3CX7A 1RZ3A 1WB9A 3CNLA 3AVWA 1K5GA 2ZI4A 4OK5A 1ZUNB 1AGRA 1VCMA 2G3YA 4C3ZA 3VQTA 1SZPA 2BMJA 1WRBA 1F6BA 2JLXA 1E2EA 2ZI7A 5E7MA 1JXOA 2RGBA 1E9SA 1H8EA 1NLYA 3NBYC 1F2UA 2P6RA 2ZETA 4A2QA 3B78A 2YOHA 5EP3A 1KSGA 2GZAA 4KSBA 3HP1A 4Q7JB 1D2NA 1HQYE 2FSIA 3T5DA 4B33A 2GAOA 2QT1A 4PPFA 3MD0A 3EC2A 4TL8A 1OHHD 4G5GA 4XJXA 2DB3A 3I61A 3JZAA 3ZQ6A 4D0NA 4DB4A 3AF0A 1Z8FA 2AD1A 3LO5A 5AUNB 2WSSA 3CRVA 3ZS8A 3S1AA 3ZVMA 3BRWD 4GBMA 4L9SA 3TW4A 2ZITA 4B6EA 3FFBA 4F4IA 4ZDJA 4QL3A 1II9A 1E0SA 3B2EA 4FIDA 1Z0AA 3TR0A 1KJZA 2QE7D 1GDDA 2XZOA 5CJ2A 2IUUA 3EPLA 3WP0A 2J1LA 5CB8A 2XITA 4MRVA 1BIFA 3VU9A 2C5LA 2ZUBA 4A36A 2FOLA 1NVUQ 4LUCA 1D9XA 1XXHE 3B9QA 4DLSA 3A1VA 2ZROA 4IFEA 1LFDB 4Q48A 4DSNA 1HV8A 2RGCA 3C14C 4O25A 1U0LA 3AB3A 1Z2CA 4QGGA 1VHTA 4TL7A 2P67A 4EFNA 2WIBA 4BGDA 2WZQA 1TMKA 1NNEA 3OFND 1N5KA 2F43A 5BN5A 3OESA 2C95A 1II0A 1SKQA 2NIPA 1PLLA 4JVMA 5EZ6B 3TE6A 1ZJ6A 4U7DA 1IOZA 4QGHA 1HA3A 3Q3JB 3KX2A 3Q5DA 2ODEA 3MRSA 3LBHA 1QG4A 1XMJA 1IONA 4II7A 3HR7A 4K8OA 2UZ3A 1OSNA 4XIGS 3AF4A 2PZFA 5J4LA 1N5IA 3RS2A 2J0SA 4NE2A 1VIAA 3SR0A 3GLIE 2Q6TA 1ZYUA 1JNYA 3AEZA 2R44A 4J0QA 5L3SB 1XZQA 5HZHA 1NG1A 2PT7A 2QP4A 1IN4A 3FPAA 1VPLA 3FMIA 4H9GA 4Q9LA 5IDVA 4W7SA 1DOAA 1TQ2A 1M74A 4UXJA 2VP0A 1XJQA 2XSZD 1U98A 2RGNC 2WKRA 3NXSA 2JGNA 4RCZA 1OHHA 3T1OA 1P62B 2H57A 1NBME 3LLMA 3QI2A 4JLOA 4XH9B 5JS7A 3BAFA 3QBVA 1VCIA 1GNRA 4EFMA 2DFNA 3NHBA 1BMFA 2YINC 3EIHA 3PUZA 4URXR 2SHKA 1TU4A 3QVVA 2N46A 4OL0A 3BD9A 3IPYA 4G5RA 3Q7PA 2YWHA 421PA 4WBSA 4OHWA 1YZGA 4URYR 1QHGA 3CF2A 4PPGA 2OV2A 4A2WA 1VYUA 1XFAA 5AJXA 3W6OA 2QE7A 4F92B 2BVNA 2D2FA 1VYTA 1G7TA 1ZD1A 3DL0A 4A9AA 1T5LA 3NTUA 1P73A 1QHHA 4LWZA 1UBCA 2QZ4A 2HXYA 4XVRA 1E1RA 1DAMA 4LPKA 1YR7A 4JLJA 1SVMA 1GRRA 4EIWA 1GWNA 1AK2A 2TMKA 2FF7A 2XTZA 4GSYA 1L4YA 3QG1A 2FV8A 2QQEA 5FBVB 1W5SA 1Z6AA 1AIPA 5DISB 2VTKA 2GTPA 3D6TB 4WXPA 2IYVA 3TSZA 2RAPA 4P4SA 4C0HA 1DG3A 1RE0A 3EZ6A 4BFYA 3C16C 3UWKA 2XTNA 2IA5A 3K0FB 3T06B 5H68A 1E2HA 1ZCBA 4HB3A 3K9HA 5BW8A 3KQHA 4BWYA 2ODWA 3U7HB 1ZP6A 2WOJA 2X19A 3GCGA 4E22A 3GJ0A 4DBLC 4P4UA 4TZ0A 3ZH9B 2J59A 3ZS9A 2VSOA 4O0MA 3W8NA 2GEVA 2HJVA 4KCGA 3WMEA 1KDRA 5JJKA 4WVFA 1KI2A 4FN5A 5AK0A 2FPKA 2GBLA 1F60A 1SQ5A 4TTRA 4UNPA 3SDZA 3MWJA 2BBOA 2NMVA 4EPTA 4TYPA 3UIEA 1OXVA 5KO2A 3KDSE 5G3YA 2O8CB 2VHUA 4E07A 4LJYA 4M9QA 2GJAA 5DO9A 3VTKA 2AXNA 2XSZA 1G6OA 1OH6A 5EXTA 1PUJA 5C4MA 2ZRMA 4AG5A 1ZW6A 1ZU5A 2J87A 2NQ2C 4B3DA 1XPUA 5KNBA 5JJLA 2MMGA 1KMHB 1JBKA 1NMXA 2MSDB 4EPWA 3CZQA 4TQ9A 3HPRA 4ZDKA 1G8GA 1I4TD 4TYYA 1NSFA 3K09A 4LI0A 2FEOA 2ZI6A 1TF7A 3I32A 3B1XA 4GI7A 1U81A 4GMDA 4OHXA 3W3ZB 3RS7A 2ORVA 5DN6D 1E2NA 2PMDA 4X8MA 2HT1A 4MH0R 4RZ2A 4DVGA 4L16A 5E7IA 3QE0A 3ZVRA 4RY2A 4LC0A 2JLUA 3G5UA 1JECA 2ZREA 4ESHA 2UKDA 1DAGA 2FSHA 1E94E 4L15A 4B3BA 1P6XA 2Z0MA 1OH8A 4AYXA 2CLDX 3HU3A 2BEKA 2H17A 2H16A 2WOOA 5EE0A 4TLCA 4BFSA 5B58C 3PR1A 4D0LB 3SEAA 3SFZA 1T6NA 2F9LA 4XVQA 5L3SA 5JJIA 3TLXA 1B23P 4L4UA 2VSXA 5EXSA 4DLZA 1TX4B 5FTNA 1O3YA 4ARZB 3WMFA 3U7EB 2D06A 3CUEF 3PUWA 3SYKA 3L2OB 3L0SA 5FBWB 1E79A 4BFXA 2ONJA 4GNKA 3L82B 2VEDA 3GLFE 3BFVA 3K0EA 4XSGA 3A6PC 1G1MA 1T3LA 2VSFA 3AKYA 4Q7LA 1WP9A 2F1HA 3E70C 4NPHA 5K8UA 1VECA 4BLQA 3UG6A 3MJRA 4OBEA 2QM8A 4HZIA 1K6MA 1IJFA 1XEWX 4HAVA 1KZGB 5HZKA 2CHGA 5H1YA 4R98A 4CEHB 2OILA 5EUQB 1KO8A 5FPYA 1N0WA 2VL7A 2R8RA 2YWEA 4ILEA 1GILA 4LYJA 4AD8A 3KXLA 3NBZC 2IYWA 2EW1A 5JHHB 1JJ7A 3IQWA 3T34A 1MT0A 2G9NA 3QENA 2HF8A 1HYQA 1XD9A 2IYSA 4MQBA 2GESA 2AK2A 2Z6VA 3BFKA 1OKKA 3CPHA 4JJKA 3O8CA 2LWIA 4HZUB 2QEQA 1GUAA 1Z2AA 3CKLA 2OFXA 1R0ZA 3AP2A 2IX3A 3TQCA 5DN6A 3K0FA 4PZZA 2YC2C 2ZPTX 3GEIA 4QBGB 4URWR 4GOKA 4NBSA 1P7CA 3VR5A 4B2LA 4ZPXA 3D31A 2FWRA 4RD6A 2IUTA 2C77A 4MRNA 2YYZA 3RS4A 5JS8A 1G8PA 3AP1A 4A15A 3QSYA 4PHTA 2P6UA 4FMDB 4IDPA 3SE0A 1EXMA 1OFHA 1FTSA 2RH5A 3UMFA 1EWRA 3WHKA 5IRCD 5JEDA 1DAKA 4NTZA 2O8CA 3ASYA 4DSTA 5EE5B 1Z3IX 4MYTA 5FI0B 1P9WA 1HEIA 1TEVA 2FZLA 3B8HA 3TKLA 3UKDA 3Q5EA 1HH4A 2EFGA 2WJYA 2VF8A 4OI4A 3LW8A 4QJ5A 3EARA 2ZRBA 2G0TA 3REGA 4JKIA 1KMHA 4LV6A 5TMPA 3CR7A 1BOFA 5J5CA 2JA1A 4MITA 4YQFA 3RAPR 2FPMA 2RGAA 1FP6A 3O8RA 2ZEJA 3FB4A 3KL4A 4LHWA 3C41J 1XCGB 3U3JA 1VG0B 2GCNA 2R62A 3CWZA 1ZNZA 4Q1BA 4GT1A 1VIYA 3U3OA 3Q9LA 2VHJA 4E03A 5TB5A 2VP2A 4B76A 2GCOB 5AJWA 3F3YA 1LVGA 1CU1A 5JCPA 3G82C 3W34A 3U4QA 2VBCA 1X1SA 3IEVA 4Q1AA 1J8YF 3FVQA 2ZJ8A 4OQFA 4FMCB 2WIAA 4US2R 2QSZA 4B32A 1YJ5A 1UPTA 3RYTC 1UF9A 2XNDD 4HDQB 4EPVA 1VHLA 3I73A 1DS6A 3VNVA 1P9NA 4Q03A 4YDSA 3H1TA 3RS0A 3DMNA 3UANA 1U0HC 3VX4A 2RGNA 3AV0B 3TGPA 1SVIA 1KDTA 2BOVA 2YWGA 1FL9A 1GSIA 5FBRB 4KSCA 1JAIA 4YXWD 4AKHA 1HQCA 1ZINA 5CM9C 2QPTA 1PUIA 1E2IA 1K5DA 3MMPA 4JYBA 2OAQ1 4B34A 5C18A 521PA 1E2LA 5AJVB 4PC7A 2O8FB 5FBQB 3X1XA 2WPDD 2PCLA 4WOPA 1J7KA 4BRUA 1P61B 1A2BA 1XWIA 4OQXA 4TZ6A 4Q01A 2XGJA 5FL7D 4CEHA 4CDGA 2YNMA 3DEFA 3LXXA 3THWB 1NMZA 3C8UA 3FMOB 3U6KA 1YKSA 3E2IA 2PL3A 2ZS8A 4UNNA 1NLZA 3UATA 3R20A 3IUYA 5L3QA 2YHSA 1MO5A 1A82A 2FGKA 4B3XA 4WZBE 1W0JA 4G5OA 5GJBA 2CNWD 3W6NA 1JR3D 1WBDA 2BKEA 2K5UA 2QL6A 4IOMA 5B2ZA 2O8EB 4F93B 4M1YA 2Z43A 2WICA 4RFVA 4BUJA 1KI7A 4JLBA 2JLZA 1XU4A 1NJGA 4QBHA 3L8ZA 4BPBA 4LDJA 3EA0A 1OH7A 3IKJA 4L9WA 1OXUA 3LVQE 1KZ7B 2KSQA 2OO7A 3BWDD 5HE8A 2CEAA 6Q21A 1XCMA 3TNFA 5J4HA 2OCYC 3ZLJA 2BBTA 2JDID 1J90A 1XXHB 4MKFA 1ZIOA 3W5IA 1CIPA 4R2HA 1NMYA 2ZUDA 1DAHA 2IL1A 1NI3A 1YR9A 3EZ2A 3P27A 4ASUD 5DI3A 4AKIA 1G4UR 4LPSA 1OB5A 4PHGA 4YMVA 4Y0AA 5LB2A 4A0HA 5HPYB 4RJLA 2EFEB 2V7QD 3RNLA 2XNDA 2C78A 2KBFA 4IKEA 1CULC 3QKTA 1E2GA 2C96A 4OKSA 1CJKC 1SULA 3AKEA 1MABB 1FFHA 4Q66C 1NN0A 3OIWA 1KMQA 4MGIR 3RWMB 4I4LA 5G3ZA 1YU9A 3PEYA 1UJ2A 2CCJA 2D7CA 5HE9A 3GFPA 3QJYA 3M6AA 4JZKA 4FMDF
chains in the Genus database with same CATH superfamily
4DXAA 5CXUA 1RRKA 4YXWA 4L0MA 3H11B 3GMTA 2Q50A 3WGOA 5F5NA 2I8CA 3K0BA 2BE7A 3IOYA 2GZHA 1BQEA 2MSKA 3ESDA 4DLRA 2N47A 5HS4A 1HF3A 4J49A 5CR9A 3BKWA 3NVAA 2NP7A 1W30A 5EYPA 4N5DA 3V2UA 2CLSA 4X1YB 2M32A 3SJ7A 3DZKA 4TROA 1Y6FA 1IEWA 4AZ3B 1FBTA 1IZZA 4DEVA 1ECPA 4GS5A 2X5XA 3G85A 4PONA 4QPPA 2O2JA 1L9KA 3I09A 1E5DA 1XQ6A 3CRMA 1USKA 3L0ZA 2GCOA 3TTYA 3H8SA 1SY7A 1UCFA 1EEHA 2VYNA 1C7ZA 3HWRA 2REBA 2Z3WA 3CEPB 3L7BA 3KS9A 4OATA 1OLSA 3AEQA 3T9AA 4DCMA 4X91A 4YAKA 1TLTA 3F67A 4C30A 4FS8A 4XWAA 3P97A 5K8TA 4HYTA 1U0NA 4FHEA 2Y99A 2GN9A 1UBKS 4K6MA 3TYXA 5H81A 3CCCA 1G8HA 1QE5A 3AEKB 3WAGA 5F12A 1COZA 3ADDA 2PFGA 5CPFA 3WGIA 2D54A 2NO0A 3RABA 5PGMA 3SVTA 1LS6A 1DBQA 4NLLA 4UTVA 4UHCA 5FULA 3ZY3A 1I2AA 1QK3A 3VZPA 4ZQGA 4AURA 4MYCA 3ZJTA 1P1RA 4FEEA 4QUKA 5JLJA 2Q0XA 2FTKE 3QLUA 3ANXA 3DOHA 2QJWA 4Q1DA 5A4KA 5JNWA 3KLNA 2EQ5A 4TTIA 3LSYA 1TTQB 3EVFA 2H0QA 1HI9A 3B12A 2CL0X 3WGGA 3CJRA 5H0IA 1IHUA 3CF4G 5I9SA 4EEKA 4C0KA 1JLLB 2A57A 4BNZA 3DAOA 1BCRB 1DFHA 1XHLA 2H1SA 4F5WA 4RKFA 4V0ME 3R41A 3CX3A 3LF2A 3ZKWB 5TLSA 4JYAB 3FI9A 2KE5A 2ZJ5A 4FGSA 2Z08A 4E6EA 4D0RA 1F4PA 4UKDA 4XEUA 1GZ7A 1AKVA 2D59A 4Z4EA 2W4MA 1LSUA 4O2BA 4MX8A 4RGQA 1TNDA 1LRJA 2NZYA 3CUWA 4PZEA 4AY6A 3KB2A 1VCHA 2Q4RA 5CRIA 3V8BA 1L5SA 3NRJA 3O74A 2CFCA 5G4LA 1JIJA 1C9YA 4RF3A 4LYYA 5LYJA 4FIZA 2HCFA 1PNTA 3D81A 3DA8A 3DWEX 3OEWA 5P21A 2IUEA 2ZPUA 1E6UA 1XMPA 2A5YB 1E96A 4RY0A 3RSOA 1MW8X 1RI1A 2C3OA 2GA8A 3ZE6A 4YRPA 1AN0A 3DDUA 1GP2A 1RQ2A 1EX6A 3VOAA 3K4PA 4XB6B 2DM6A 1U3VA 2VF2A 4F97A 3SDBA 3KEGA 1XTUA 3NWBA 3RC3A 4KQ6A 3UCEA 3NIDB 4O8CA 4PNZA 1FDUA 1QX4A 1U6KA 1QIJA 3D64A 3EXAA 2V6IA 3NFYA 3SF8A 4C7MA 3N0XA 4ZEVA 1PSZA 3OCJA 4KXLA 4Z9YA 3GJ4A 5TV2A 2E3JA 3STHA 4WXHA 2QS9A 5LQJA 3GFGA 1YL7A 1DADA 4YC7A 1LLFA 3IUBA 2OHGA 4CQJA 1QHEA 4LSWA 1ACLA 1DV2A 1OILA 4N3AA 3LG2A 4HDRA 3OPMA 1ZK3A 4E4TA 2IZ0A 1ISPA 3OQ6A 4K9NA 3OT5A 5DBIA 3FHTA 3I1JA 4BLRA 3ZU5A 3P2EA 2B4AA 2NUPA 1JFFB 4WA7A 2Y0BA 5LFAA 2NADA 2IEYA 2ZULA 2XHEA 2GFIA 2J5XA 3L6DA 3OX3A 2NXNA 3Q2OA 4XCQA 4Y1GA 4ADSG 5EJ9A 1BMQA 1KYIA 4WADA 1N9GA 1RC1A 5FPQA 2CVFA 4R05A 2I6GA 2IPNA 3MTDA 3CUKA 3IUSA 2ZE6A 3PC6A 4R0VA 4B48A 2PUFA 5DM60 2J67A 2VJKA 1QAMA 5A7HA 1Y34E 4B4OA 1GITA 3H11A 3P0FA 3PQ8A 5AHXA 3HXPA 4C0BA 4F3TA 3T7KA 4TQAA 5FL3A 5JY1A 1AT1A 2WR8A 2VJQA 3K30A 3EAFA 4N3GA 5E8JA 2Z9DA 3VU3A 4ENTA 2YN2A 2QZJA 3I9FA 4X1YA 2EP7A 1MVLA 5K09A 1HE5A 3R8CA 4PX5A 3IDAA 3R0VA 5BV2P 4AZ3A 1WLSA 3T3PB 4LJ5A 3VR6D 3NB0A 4HADA 4FSHA 1X86B 4G5XA 3ZDZB 3PI7A 1GUBA 5BYKA 1OCEA 3P9QA 3ZWQA 3QXXA 3OC0A 2IYXA 4KIUA 2VA8A 1NBWB 1OPXA 2AR7A 2HMTA 3GJYA 3NG1A 5KI6A 3WDKA 1CIVA 4NEHB 4C3OB 3O4JA 4G4SP 4KUGA 1NW9B 1UBUS 1RKBA 1YJXA 1JG4A 5IWCA 1I6LA 3HBFA 1LDNA 1WXGA 3P1JA 3WR5A 1QH0A 1W0KD 1CC1S 2C3PA 3AEKA 3WLTA 3SI7A 1QV9A 3ABOB 4WW0A 1Q21A 3ZI4A 1RVDA 3C3YA 2I54A 2CNDA 5L6LB 1M3SA 3GJ6A 3VMFA 4KITB 3RB8A 2VHQA 4QM6A 1KO5A 5HHTA 4HGYA 1NVWQ 2VP9A 1Y7IA 2WJGA 2DJ5A 1YL5A 1DG9A 3BJIC 2J9FB 2G72A 5KNDD 1H1LB 3N2EA 3O03A 3KDPA 4P3NA 1PZNA 3TR5A 4UTZA 1O5TA 1JWBB 2OGTA 2QD1A 1QFYA 4XYBA 4XX0B 1PL8A 2YW9A 1UBNA 4RSHA 3MMNA 2ZSHA 1H9BA 1RAFA 3UT0A 4AJLA 1CR2A 3R5HA 2AKAB 2OP0A 4CKZA 1G7CA 4WLVA 2EXXA 1WZCA 2GZ2A 3PFNA 4AX8A 1HKUA 1JLLA 1XK6A 1QIEA 1F8FA 1S7GA 2ZQ5A 4L8FA 2JCBA 3NZEA 5B4TA 3N8GA 4GGMX 4GP7A 4R9UC 2VNHA 3ZKWA 1SWWA 4MA4A 2HEGA 4EUKA 1NOKA 4PBTA 4PGFA 2H6EA 2WT4A 3B82A 5C46F 4K1LA 1NY6A 5DW0A 1UOPA 4ZCSA 3A4TA 2Q3JA 5E3JA 2Z98A 5J47A 3FUTA 3EY4A 2IU3A 3JYQA 3U48A 4AS2A 4LXUA 3N59A 3DMDA 4FW9A 5FPHA 3K9WA 3K4HA 1X8XA 3SZ3A 4EHDA 3GB9A 4NWIA 1KFBB 1XJCA 1U3FA 3GLHE 3VPFA 3LKBA 5B7QA 4LVOA 1AOXA 3MMXA 3GJSA 1U3TA 1SBIA 4OVKA 1U2QA 2QL5A 1WOYA 1YKFA 4GQAA 2QPOA 2JGLA 2IX9A 1A8SA 2ZE7A 1XKTA 2GBGA 3BDVA 4RMHA 5JFTA 2A1UB 1B6SA 4ALNA 3G6KA 3CKYA 1Z6GA 3K1TA 3EWIA 3IE0A 4UE3S 3TAUA 1E3QA 4BMCA 4OQEA 1E5TA 1LBSA 3OLYA 3T7DA 4BCDA 2H2IA 3GH3A 4JT8A 2Q5LA 4H3KB 1SVLA 1IY0A 4HAZA 4ACAA 1OWNA 1OV4A 1NJFA 4LZAA 4HEA1 3L1UA 4MRAA 1SIWA 2GN1A 1QYVA 2H1VA 1T4CB 4ZREA 1CQXA 4C6TB 3ZQ4A 3H2JA 5ER9A 2P11A 1VKHA 1KXZA 2Q6OA 3AI3A 3U7JA 4R1SA 2YQ4A 1W1UA 2CMFA 1FFGA 1KEVA 2MT9A 1ZD3A 1LLCA 1RXEA 1T0HB 2GERA 1PJ4A 3CY6A 4NDZA 2UYHA 3MGKA 2IK8A 1JFFA 2BSXA 2OPHA 3EXIB 4MMYB 4DG5A 3CLRD 1AO3A 5JBIA 1EESA 1ULAA 3W06A 4AUNA 1N2OA 1F4LA 4M9SA 1B14A 2ZWIA 4BBPA 5JAIA 4EKNB 1M2JA 2IITA 3CKKA 3E48A 2H52A 3TZQA 4ZCRA 4ETWA 2HA4A 3RVBA 2G1KA 4XQ0A 4FYMA 4Z9AA 2YXNA 2EERA 3VPXA 1XUOA 3E9DA 4KTTE 4H16A 2GD1O 4MO9A 4BB9A 3GT4A 4CKWB 4ND8B 2IHNA 2Q9AA 4IUDS 1ACJA 5IVDA 4DQ0A 4OI0A 3F47A 3IAHA 2Y93A 3NAZA 1WCIB 3EFBA 2R6DA 2OA0A 4LBZA 1TDJA 3AY3A 3LY9A 4LZPA 4R71A 3OF2A 3LBYA 1OF1A 4FFBB 4DR3B 4R2XA 2CGEA 4ODIA 4RMIA 3NNDA 4BP9A 4JBYA 4WLEA 1YBHA 3COZA 3OQPA 3OFNA 4NCIA 2JHCA 3RSFA 3IOCA 1RPJA 4RD1A 2X0RA 1VZ2A 1K63A 1M75A 1VSBA 2V3VA 2PGOA 1EWYA 3A3YA 1TYAE 3SFVA 2HADA 1YMUA 4S1TA 3TTWA 3ZWYA 1POXA 2A8YA 3WC4A 2IPAB 2W6IA 4B81A 4FDTA 1EVKA 2H31A 4MKXA 4P08A 4BKRA 5LU8A 2YH2A 1E6CA 2PHZA 2PUVA 3SK0A 5SY6A 4GRAA 3A2NA 3PDUA 7ABPA 5LKAA 3G2OA 1JG6A 4J0KA 4CE6A 4OUDB 4OHCA 1KS9A 3CPEA 4F45A 2OFWA 2PZMA 3F9IA 3K9QO 1JHVA 2H65A 1C2YA 3QKRB 4FTWA 5FTLA 8ADHA 1SVOA 2A7XA 3QI7A 4HNQA 3RVJA 1ZMXA 5BNIA 5HSGA 1QVVA 5LBUA 2J9FA 1R27A 4MNTA 1H1LA 4KREA 2O1WA 4IIGA 1VMAA 4YAOA 2Z4SA 1E2JA 3HMQA 3U19A 1CEEA 4XX0A 1L5WA 4CODB 4FUTA 1N75A 2G63A 2NPOA 3EGIA 4DWOA 3I8SA 2BGRA 2ADOA 1G8KA 1IHYA 4KO4S 1XCPA 3PC4A 4WNCA 1FUIA 4WZBB 1WPRA 4MP6A 2RHHA 4F5YA 3M5DA 2VZ9A 4AB1A 4AMBA 5KJ6A 2VJLA 3IQEA 4HQ6A 1N6HA 1TEHA 3RG2A 5DM0A 1AY0A 3WGYA 4HWTA 3D6NB 1QCYA 2O0LA 4TXJA 4LHXA 2EHDA 3CEJA 4MV4A 3W90A 1JB9A 2C3UA 3E7XA 2Z09A 3L8EA 1X80B 5ALYA 1DBRA 3RSLA 3ESQA 3DL4A 5JJCA 2I6UA 3HWX1 4IDBA 4AMVA 3ONVA 4OMDA 5DE3A 5LP1A 4E2FA 4I5IA 1UMBB 2HCJB 2HV8A 5AQEA 3W5UA 4KV7A 5BSUA 1O87A 1DCKA 1O95D 2WU1A 3AM1A 2YVQA 3EZ7A 1EUZA 2EKPA 4MQLA 1PGJA 2GBPA 1WPQA 1Z16A 1Y63A 4NBVA 4NZOA 2C0PA 1ZD8A 3RTGA 1Y7LA 2VK1A 4PG5A 3QRWA 3TEFA 2QN3A 5FA5A 2LKCA 1OQAA 1YS2X 5EAIA 3ET5A 2FFBA 1UEJA 2A1UA 4S12A 3RAFC 2JFGA 3LRPA 1ORRA 2CUZA 3C24A 4JT9A 1GOTA 2IS6A 3OWHA 2OESA 1VKRA 4F1WA 1C4WA 1EBFA 2HXSA 3EGVA 4PBSA 2VXBA 4UVHA 3ND9A 2OCBA 2CZCA 3L0IB 5FR2A 2ACEA 5BQXA 1XMSA 1QDEA 2A1TS 1EGVB 1KZ6A 2VJAA 2VAWA 2Z1DA 3FPGA 3OPYB 3TQQA 4CKBA 5HQTA 3NOQA 5REQB 1ANKA 4C5BA 1QCDA 4BGEA 3JQRA 4ECAA 4C6TA 5BP7A 5GAJA 3A2KA 4KQIA 3M0EA 4HRXA 1W5BA 2P4HX 4BMDA 2O8DB 1P0FA 1NF9A 4ZOQI 3IBGA 1UKZA 2WLSA 1DRJA 5JWHA 1LLDA 1Z7EA 4EARA 4UTNA 3PT9A 1APBA 2X9GA 3TZLA 1JVNA 3ZY6A 5DXAA 1AHNA 2YVKA 2WFAA 3EXIA 1NNUA 1F1BA 2AMYA 3NHSA 3D5EA 4L07A 1M54A 3GLGE 3MHTA 3KVYA 1SXHA 2AG1A 2Q3MA 3K8ZA 1GPKA 3NYIA 3WGLA 4C1BA 4DQKA 3Q15C 3EPJA 1N36B 3BGDA 4FSDA 4ZCMA 1NVVQ 5CDFE 4EVQA 1HORA 3KR9A 3JSXA 1KC1A 3RIGA 4CKWA 3L3BA 4CTKA 1SU7A 3ZJYA 1BU5A 4ND8A 5BRJA 3DTNA 2W8BB 1VP9A 1Y8CA 4FD2A 4JXXA 4CMBA 5C32A 2VPWA 5L3QB 5LQRA 3I4LA 4J9UE 4TTTS 4UOEA 1WCIA 4CMAA 2QTCA 4UMEA 5F7JA 1JVSA 3RJZA 3LY7A 1DBIA 2QQFA 2XUOA 3T7EA 4JVLA 4Q0MA 4FFBA 1CY4A 5CVCA 3GELA 1NGSA 2RK3A 3ZWOA 5F2KA 2KI5A 2PYDA 4I2VA 1P8JA 3CBGA 3ANNA 3K9NA 1P72A 4IXNA 1M73E 5HK8A 2VNIA 5EJ8A 1SXJD 5IF9A 2F1RA 1S3IA 1MJ5A 3VYUB 3AEUB 3LYAA 2QG6A 1Z62A 1W4ZA 4M1ZA 2OCKA 2QUAA 3A8TA 5DWVA 2ZIEA 4WTOA 1R4NB 2JIZA 1S0UA 3K94A 1E8MA 3GG2A 1R00A 3MT7A 4KNWA 4M8IA 4V1CI 5ECYA 1F0YA 2FUCA 1SQGA 4HAOA 1KO4A 2XQFA 1FTQA 4IFBA 2V55B 1B1CA 2VF7A 4U2GA 4UU0A 1JR6A 4MZDA 2IW3A 1RMQA 2PH1A 3QKRA 3VOTA 1M2KA 1NXOA 4LYDA 4YRTA 4DLWA 4LF5B 5DI3B 3OO1A 2BBWA 4GMFA 1QNLA 2C7PA 4BY9E 1U31A 4Q4LA 3DLAA 3KWLA 3AB8A 5HKKA 1NC1A 4A6XA 4A10A 1PZGA 3QBJA 4MGHA 4Y2VA 3ZHXA 5ITSA 2XMDA 4RVGA 4HDAA 3UMMA 2Q46A 4OIMA 1MNQA 3RS5A 2WUGA 4NV1A 4N12A 2QNRA 1PAUA 1TLLA 3DR5A 3KZVA 3DQQA 4LDPA 4LRXA 4MRRA 1HRKA 2JATA 4WZBA 4ZU1X 3HNPA 4B3GA 4TWJA 4ND1A 4BMOB 1U7PA 2IBMA 1P2VA 4EENA 4QG7A 3M2PA 3PRJA 2HSDA 5HOQA 1RLIA 1ZN8A 4KFTA 4MQMA 1CXZA 3OOEA 1ZH8A 2NU6B 4I7EA 3NGMA 4MGYR 1X80A 2F62A 4F4HA 1ZISA 4F3CA 5LWHA 1RR6A 3MYRA 2Q4EA 2QLNA 4KE6A 4RSMA 3NC1C 3W5CA 2CNKA 4N3BA 1IN6A 3KALA 2BMWA 4I9UA 4I1SA 4V02A 3VO2A 3L46A 4D79A 2YOFA 4U6NA 2EBUA 1MHPA 1Q7CA 2IP1A 3V1MA 3EPKA 4Q7KA 2ZJBA 5DASA 4FNOA 4BFTA 1DWQA 1XZKA 3KV1A 3RSQA 3ZV6A 1RQPA 4MW4A 3RU2A 1Q2XA 4N5HX 4CGZA 3QKIA 3KHUA 4NU0A 2A2ZA 3H1AA 2DRIA 2VQ6A 3IUPA 4M3NA 1RMTA 2J9YB 2C8JA 3RAJA 3Q9SA 1FLNA 2IGTA 1ZNWA 4B09A 3X44A 3AQIA 4G1UC 3L0YA 1JQKA 1RQRA 3OPYA 1J8MF 4Z1MD 4EI7A 1EIZA 3G5MA 4D4IA 3ND8A 3M4JA 5REQA 2ZYUX 3VH2A 3LM8A 4B40A 2DH5A 1LBEA 5D01A 3NEAA 2CV1A 4QOEA 3FUUA 2PZAA 3U7FB 4B3IA 1SFRA 3ADOA 1T5SA 1QTQA 1BEZA 3TD2A 4EA8A 2GM4A 1N0VC 1I5EA 1T0JB 1C1DB 1ZGZA 4W5JA 1RWMA 1E98A 1RXUA 3QELB 4NPAA 2BDTA 3HBLA 3G0GA 1INLA 5HZMA 5I9LA 3JAMA 1CDDA 3WYFA 4P0PB 3BERA 3P94A 2H2WA 4H1WA 2DPHA 2ZXFA 3PEFA 5JAQA 2Q8PA 5AKYA 2K4MA 3N8DA 3PFCA 3ZV4A 3GPDG 5J1SB 4TMTA 4S2EA 3W2TA 3AVVA 3U3RA 4NDAA 5FR1A 1CQZA 1TF5A 3AERB 3ZLVA 4TYNA 1O03A 1R4ZA 3BGIA 3ITKA 4KU4A 4DPKA 1HLFA 1GGKA 1MGPA 1RPNA 2QAGC 2W8BA 2VDPB 2VBFA 3OWOA 3L8MA 4K46A 3RRNA 1K8RA 4I8XA 1Q3TA 2HDOA 5AVJA 5ITVA 5H82A 2O2XA 2NSYA 4OYHA 3AILA 3VU8A 4OXNA 1YFJA 3FMFA 4MPDA 3R5JA 3QEBZ 1QAQA 1PEDA 1NOJA 3BTVA 1I2DA 1A9RA 3ZGOA 1H3EA 3Q7EA 2VDRB 4PRZA 1DIAA 3AB7A 3I8XA 4PHFA 3N7TA 1GYRA 3PFBA 2X4LA 4GSLA 1GGMA 3T5CA 2WHXA 2I3GA 1NKTA 4KQCA 3WLIA 1FNBA 2YZKA 4OLAA 4GXQA 1RJFA 3DFKA 3ZU2A 4ENQA 4EHHA 1P77A 3H5VA 2Q1XA 2XA9A 1M33A 4CHTA 2WNIA 4FJ2A 3N2YA 3TH5A 2FFHA 2NZXA 1ZGBA 2IU4A 3KOOA 5DWDA 3VHRA 1NVAA 3CE6A 4MUYA 4UHEA 4JKYA 2W0SA 5DCLA 4J76A 3SR3A 2OECA 4GL2A 2QGFA 1T3HA 5ECGC 2H5LA 3IPXA 1J42A 1G3MA 5CT5A 4A3SA 2O3QA 2WTAA 3M34A 3EBPA 2OGZA 1TCVA 1K92A 1BX0A 2HMSA 2NUTB 3NHUA 3VNAA 1TADA 4KRXA 4JQYA 1UQRA 5CVUA 4B6PA 5JH7A 4B4KA 3I5AA 4TTSA 2QW1A 5FIUA 5F3RA 1GNVA 1O4VA 4BLSA 1SU6A 2RAUA 5HF9A 5EIFA 2X2OA 5UKDA 2OYRA 2R8EA 3TSCA 1W9MA 4S0ZA 5ALFA 3QA3E 2R4UA 3QLVA 4HLQB 4WKOA 1XZDA 4PO1A 2GCIA 3HCDA 3CB4A 1E4OA 3ZK8A 1L5RA 2YVAA 3MWDB 1R5NA 2FRDC 2W2VA 1RFLA 3ZBTA 4JI3B 3TZBA 1KH3A 2C4HA 1VLVA 1NYRA 3DO5A 2PSJA 1QVAA 1YXMA 1GU1A 2GUWA 2NU6A 2VCEA 1GRNA 3TQRA 4RZHA 3STTA 2DHEA 3NBFA 1K0FA 2ZGVA 1BFUA 2ZRNA 3OD5A 3K0HA 4AZ0B 4LHEA 4U2DA 4LQDA 3BGSA 1D2CA 3TMKA 1LPAB 2ZAMA 3E8SA 4LX8A 4WNIA 5CIQA 2P0EA 1VL8A 1ZIPA 2ZANA 3IIKA 2Q6KA 4HFNA 3IYLW 2H1OA 1NI5A 3ESBA 3K1JA 2H0AA 4OQMA 2PT5A 4XLTA 2Q1WA 1W44A 2CFSA 5A9RA 3KCNA 4EW6A 1BS9A 1M5RA 2WM9B 1EUYA 4YPFA 4LSGA 6GPBA 5KNCA 4GZ6A 3VYWA 2A86A 2FPSA 5L8VA 1U2GC 4OREX 1L8QA 3D0OA 4M4SA 4DCPA 4I9GA 2RBEA 3FXAA 1WXQA 3DGEC 5TS3A 1W36D 1SC9A 2HDNB 4NI5A 1ZRSA 3QXHA 2FK8A 4BQSA 7YASA 5CH8A 1XVVA 4MPRA 1C7EA 4I1RA 5K6AA 2E4UA 5ALHA 3U49A 3E23A 4TLBA 2B8TA 4UHJA 1IG3A 3IT0A 4RMJA 3GEHA 1MLDA 5EG5A 1HTBA 3UA4A 1WU7A 4MINA 5B3JA 1TQ4A 1A5TA 1RYZA 4RHXA 4D4HA 1E8DA 2Q1SA 1SKMA 3LQRA 4MDEA 5JFOA 1BWQA 1HNXB 1ZIYA 4NULA 4J0FA 2JDIA 4FDAA 1XZCA 4IJVA 1SZDA 2A5GA 1L1FA 3L6BA 2OEPA 3O93A 3O6VA 1DJLA 3FDJA 4PO8A 2QRJA 2OV6A 1C1DA 3QELA 2QUJA 5AYVA 3N8KA 2YICA 3N86A 1YS7A 3HCOA 4CU2A 4D82A 1H2WA 1SB8A 4FJ1A 4FS3A 2IXBA 1WDKA 2Q5HA 1TF2A 1ZRHA 2RCNA 3E1GA 3NTVA 4OHOA 4X0EA 4XIIA 3T35A 1B6GA 3O31A 2HZBA 4L7QA 4MJXA 1PFKA 2YZ7A 5GONF 2NV0A 3HU5A 1J2RA 5E7JA 3M9LA 3RTEA 3A9SA 2F3UA 3AERA 2RAFA 3EPPA 4RLQA 1PSWA 4G07A 2X0FA 5DHFA 4CBVA 1FUEA 2R66A 4Z4QA 3GRCA 4TRMA 4L73A 5KYUB 1NQOA 3HJHA 4D57A 3MW8A 2H2GA 3EF3A 1RKUA 1DC5A 3W8FA 1K2VN 4XD7A 4JUDX 1YFZA 3FVWA 1A27A 2CVZA 2Q4TA 1GGHA 3IAEA 1ZMBA 1H8ED 2XVMA 1RWKA 4F21A 1J2JA 1NATA 4GLLA 1JDJA 4HY3A 1KMNA 2QRZA 3M3DA 5JNSA 4NBWA 2DJIA 1G5QA 2GH1A 4MVYA 2HSWA 2ZRQA 4HN9A 1CQIA 4AQYB 2ZI5A 1WG8A 4MCIA 3HRIA 1N6PA 1RYHA 3F9RA 4WA8A 1RCUA 3AF2A 1QLHA 1T8TA 3EDOA 5DNVA 2M1XA 1P0PA 3FIUA 3FKSA 2VQFB 1IU9A 1CEXA 1SC4A 2C7GA 2F1KA 2HFKA 1XMIA 2P2SA 1RHRA 3PFFA 2AX4A 3UB3A 5CH3A 1E2PA 2ZJ2A 3AR7A 1PQWA 1THGA 3QUSA 3S2UA 4MLZA 1IN7A 1FFXB 3T3HA 1Q50A 2G4LA 2HJRA 3RADC 1DZ3A 2Y2UA 1XYGA 3IBCA 4DLUA 2NUTA 4EJSC 2WAXA 4X65B 2W90A 3FHCB 3MT9A 1CV2A 1XZLA 4FC7A 2RI0A 1JJBA 4RPKA 4AO8A 3IVRA 1K4KA 3TLZA 2HLDD 5DVZA 3B3QA 1HOTA 1Z74A 2HLPA 3BHNA 3UN1A 5KKNB 5JD5A 1VLHA 2YV3A 4X61A 2D2VA 2Y4NA 1H9AA 4X97A 3DOFA 5FOTA 3LX8A 1QRAA 1TXGA 3H86A 1Q22A 1JIUA 2YDYA 3I5MA 4G65A 4IMJB 3ER9A 1B8UA 2FPGB 2FZVA 4ON9A 4DABA 3BZBA 5EP4A 1FTYA 4FFRA 4L8LA 4D4JA 1X1TA 3T1TA 3ITEA 1YVEI 4KMMA 5JECA 1RZRA 3MWDA 4R68A 4JNCA 5ALLA 1CR1A 2QMQA 2V0NA 4MUXA 2P4EA 3RUFA 5JXGA 2JL1A 1ZOLA 4NYIQ 4KIGA 4MUAA 3RHZA 1PDVA 2ZSBA 3QHAA 2I8AA 5EFOA 4KQEA 1UXJA 2QTGA 5H9WA 2ZYWX 2PLNA 4BLOA 4ZYXA 2DFVA 4Y9RA 3K2BA 4TMVA 3UA3A 1CP3A 2R1VB 2VPYA 2ODBA 3DXFA 1U7HA 4AZ0A 5E0KB 4DWVA 3FPEA 4W9RA 2G08A 4BTEA 2W2LD 2HA5A 1H66A 1WXDA 2HDWA 4O5OA 4RA6B 4RHYA 3TTSA 621PA 1ECFA 1SZJG 1BROA 2GILA 2OBYA 1O0SA 2Y1OA 2XUPA 1A5AB 1Y1SA 2XGSA 3QKWA 2BD0A 2D1RA 2A59A 1FDTA 2ZYRA 3GUYA 3BMXA 3QK7A 3WRXC 3F6CA 2JLYA 1EP3B 5E7QA 4L4YA 3GDFA 4IVRA 4E46A 4QPCA 4LZNA 2H1FA 3F3KA 2HX1A 4JP2A 4GRIA 5EJGA 3HABA 2VXCA 1DARA 2K6GA 2PM8A 3ZPXA 1QZTA 1NA5A 2HH9A 2X8WA 3VAYA 3LUPA 5D5HA 3ZYZA 1O6BA 3LUBA 3BH0A 2I9KA 4OTZA 4IH9A 1G1AA 3IQIX 1KQGA 1Y9AA 2PPLA 8AT1A 3WLSA 3EASA 5ENZA 3GPLA 1EU1A 4P36A 4JYZA 3AIMA 3RC7A 3KUKA 4OMFG 5JJ5A 1TUIA 4YQYA 1JEQB 1GQRA 1RT9A 3AH8A 3E18A 1EGAA 3EDYA 4MCJA 4O6VA 3W5VA 4M1QA 3LXUX 4KPEC 4O2AB 2H7XA 4NDNE 3SNHA 1ZRNA 2BM8A 4F8YA 2Y0CA 1OY1A 3G49A 2YWXA 4BVFA 3TDNA 1A97A 2VHCA 4LEIA 3THYA 3KM0A 3SEZA 3BWEA 4JJIA 1YR6A 1V8ZA 1K86A 1L4KA 3GNQA 4HMOA 4TRNA 4YRSA 5JDCA 2XB9A 1GU7A 3KTOA 2W43A 5FH9A 2D8AA 1O5IA 3WBBA 5IN4A 1V25A 4LBWA 3ILSA 5DZSA 1PV2A 1TZKA 5ARDA 1UAAA 2K7ZA 1KEWA 1Q19A 1UJCA 2BCEA 1F5NA 4W1PA 1ZXXA 2JGMA 3H6KA 3GJ3A 5E4FA 4GC5A 2XOEA 3KHKA 4QXRA 3SHQA 1T2CA 1YE3A 4TSFD 5BYJA 2Z2KA 2IZ6A 2B0JA 1GIAA 3D6HA 1LQ2A 1QTIA 2PMCA 4KAXA 4ZYWA 1E0AA 2CE7A 2O23A 1KK1A 4FW8A 4K8RB 3LHIA 5F5XA 2IV7A 3VVMA 4NH4A 2GEBA 2PKYX 4HXGA 2CN1A 2GXAA 3B1FA 3MT8A 4F2PA 4XUDA 1SKYB 4QUBA 2DHRA 1JG3A 2EF0A 4O4LF 1GCAA 1TUEA 2DUWA 3O3NB 3ICQB 1W1WA 4PR3A 3ELUA 4E5SA 4E08A 4HLUA 5EQJB 1AQYA 3N5CA 2JPDA 3HB7A 3S44A 3I5YA 1R0KA 4HJXA 4HQOA 1FMCA 2EGUA 3JYNA 1DO0A 1SQ6A 2Y2VA 3UHJA 2JIOA 3LPMA 4Z3OA 1BMTA 1WXHA 4FYVA 1CY7A 2CUNA 1F5SA 2B2NA 2P62A 3AL2A 5K51A 5JBQA 3S3TA 1MDFA 4C4XA 5CEFA 2ZIAA 3T0IA 1D4AA 2BRUC 1VBMA 4U7WA 1MR3F 3BBPA 2P3SA 3ZLTA 1R0XA 4AXXA 5ICFA 4D3YA 4EF5A 1W4CA 3FDZA 4TTJA 1NW3A 5C34B 5A1TA 5K0JA 2J4FA 2I87A 5AHRA 4KXVA 2ZBGA 2JLCA 1F14A 1PNRA 5ALZA 2RGDA 3D8TA 3O91A 1OBCA 2XVYA 3JU3A 2AGVA 3RS8A 2ASEA 1RQNA 2FPGA 2QL9A 1A0OA 2WW8A 4NAHA 3HP7A 5AJHA 2ZBPA 1JHYA 1P45A 4LDRA 3AWIA 4G9BA 5EQTA 4JS0A 1R5JA 4AKGA 5INTA 1FJ2A 2QMOA 2QAIA 4M38A 2W5UA 3WX0A 5B55A 1HFWA 1HQDA 2NO4A 2OOSA 1PHRA 1GRCA 4I81A 4XWGA 2FEWB 4N65A 1TKCA 1YDWA 3RUAA 1RQ7A 2IRWA 2RGEA 3ENVA 4LF7B 2GAAA 3IIMA 5IM5A 1PG2A 4G5SA 4HFJA 2V4ZA 3H5AA 4H7PA 2GZSA 3L40A 1M34B 5FEUA 5SY9A 1C50A 1Z8NA 1VMIA 2UVDA 4JASB 1AK1A 3COYA 1KR5A 3RHFA 2BFOA 3LD9A 2I80A 4RA6A 3L7CA 1RQXA 4ZIRA 2XW6A 4HGRA 5KHOC 1E9AA 2RH4A 1U4OA 2PNFA 1KQPA 1ITZA 1NR7A 2Q1UA 4G1EB 4L4XA 3W8RA 3KQSA 1XNHA 4JIGA 1CERA 4KPUB 3JD4A 3RKRA 3SM9A 3ZGYA 4ND2A 2GN4A 3LH5A 3ZV3A 5BOVA 4AJ2A 4EELA 4RVOA 3N53A 4XGNA 3SR4A 5DNUA 4YCCA 3OTWA 1WZEA 3L7YA 4R8KA 2C2KA 2H9IA 1QPBA 3D6VA 3GHYA 4HWGA 4RDCA 2XE7A 4FE4A 4IXDA 4XCVA 3ITDA 3UUEA 3VYSB 5C1PA 1REQB 5K0TA 3AJRA 3FNIA 3AM4A 2XXAB 2FFJA 2FMFA 4Z7JA 4YV0A 1EEXB 2OBLA 1FMLA 2DY0A 4KNVA 4RIGA 3H4TA 3WLJA 2FWJA 4OJMX 4F96A 4F9TA 4MVJI 3D6AA 2YY5A 1NW8A 4RVNA 1IXSB 4JP5A 3RREA 3UT5B 4EEZA 5H59A 1HR0B 4AJKA 4MIYA 5CDGA 2WSLA 3OZXA 5IZCA 1MOSA 4W9MC 2GVDC 3KG2A 3G2KA 2V1UA 3V7UA 3L7KA 2C42A 3E3OA 3KUXA 4O2AA 3W5SA 2FUG6 4IV5A 4OKIA 1FPQA 2PA3A 2RIRA 1JG1A 1H4SA 5AESA 1WXWA 1X7HA 1X1AA 5IVHA 5BN3B 5AT1A 3T1YB 3ECCA 4YLEA 2PR2A 2ZB4A 4M0DA 1DQZA 4GPZA 2JLVA 4NY1A 3RF7A 3DBRB 2AF3C 1QM5A 2CYBA 3KFVA 4JSYA 2O8DA 1P4SA 2XMBA 4OYYA 2G09A 4OAQA 1M6NA 4OHMA 1K68A 2MSEB 4QXPA 2PX4A 4AM8A 3BWYA 3WGUA 2Z2ZA 2CLOB 4IFTA 4ZVTA 3K5HA 3LFHA 3TIVA 5JXWA 4DQVA 3AIKA 3IULA 2RI1A 4FYJA 3ZI7A 5LA6B 1ES9A 5LB4A 2OHOA 3EGOA 3T61A 2P8SA 3KB6A 2UV8A 2MTBA 1GKKA 2XYGA 4EZBA 3DP7A 4TLAA 4KZPA 2VDMB 3NWPA 4DLTA 4RBNA 3SEFA 1GA4A 5L4SA 3UVEA 1UADA 1YE5A 2HCBA 4D6XA 3L8CA 2YFYA 3CUSA 4O1MA 2BI4A 4QOSA 2NTJA 3BE6A 4J6FA 4IDQA 4X45A 3MHPA 3VZSA 1M6HA 1QDLB 2V3WA 3GRRA 5F1KA 4MULA 4QT4A 3O38A 2WFMA 4UNRA 1IYZA 3E2PA 1EM8B 5LCXA 2AQIA 4AQ7A 1P3JA 3R9XB 4O59O 3E5NA 1NT2A 4LHYA 2F9MA 5IVIA 5G4KB 5KMGB 1QZUA 4W4TA 2D6FA 2Q7XA 1TJNA 2G0AA 2PS0A 4M0EA 5CB0A 3QUBA 4F56A 4JYCA 1N5LA 2V7EA 2X77A 4N5NA 2JD1A 2QDKA 2R25B 2ZRGA 2A1TR 3LECA 3OCVA 4MA0A 4LGVA 5D3QA 4HS9A 5FEMA 3MOGA 1J8QA 2XDAA 2PJRA 5AR1A 1JEEA 4RV4A 4DEYA 1XL0A 2MWMA 1ZITA 2DERA 2J7PA 4BJ5A 1Q0SA 1OXXK 2B1RA 4ER7A 2FX2A 1SMKA 2JI9A 2JIMA 2XTJA 5HNKA 2J4CA 4CIWA 4PANA 4TWZA 4LECA 4K6CA 2XUZA 4KUHA 1XOIA 1WA5A 3KPUA 4PQFA 4ENPA 4C21A 5HMLA 4BU0A 3R0QA 5IXSA 4KE7A 7MDHA 4DQUA 2W11A 1E32A 3EXG1 3SJCA 3P0HA 4NMWA 4PTLA 4QVGA 2UXBB 4DBVO 1Q11A 5TX7A 3PNKA 1Q5PA 2QIOA 1JALA 4LMBA 1Z4KA 4CT4B 2ADMA 5DI9A 3OAAD 2B1JA 4F4CA 1DBWA 3QWIA 1OWPA 2AJDA 4UNSA 1DC4A 2GWRA 3INGA 2PBRA 3SZMA 3T7AA 3S1SA 3PC8A 4MKZA 2DBYA 3URKA 1XNRB 1EXNA 1IJKA 4JCCA 1LV7A 2ODPA 1M34A 2BC9A 4N5LA 2YJ6A 3LA6A 4M76B 1HSZA 2XVAA 1X3LA 2XNSA 3IAUA 4IIEA 1HPLA 4Y3UA 3WRYC 1R0WA 1Y4AE 4CZ2A 1HM5A 4EATA 4UAJA 1ZN9A 1WDMA 3ZD6A 5IFLA 1QRRA 3CU5A 1ZNYA 4GU5A 3VR1A 3E5RA 2G9QA 1BN6A 2YY7A 3PQDA 4KPUA 5EL0A 2P4QA 4A8HA 1GDHA 5I9MA 2HB6A 4EO4A 5HTOA 4PLTA 3Q3IA 2ASVA 2H18A 3FNFA 3O9MA 4O4JF 4NJOA 5D1HA 4CYMA 1RJWA 4LXXA 1JZQA 2XXAA 1K3FA 1U63A 3RSZA 3FZEA 3DOJA 1Z28A 3RRZA 1UKEA 2M2IA 3H0KA 3ZZ0A 3UT5A 1BVRA 1KBZA 1RLTA 4BEVA 3Q72A 2IY8A 4TLMB 1VXOA 3VZBA 1SEVA 5IULC 3A06A 4YT5A 3RRBA 4YACA 1W75A 3W4IA 1RPAA