2RGAA

Crystal structure of h-rasq61i-gppnhp
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGIEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oncoprotein
molecule keywords GTPase HRas
publication title Transformation Efficiency of RasQ61 Mutants Linked to Structural Features of the Switch Regions in the Presence of Raf.
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2007-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2rgaA00
2QT1A 1KI6B 2NIPA 5CM8B 3KL4A 1QBKC 1T8TA 1M7GA 3AVXA 1KO1A 3OEHD 4KODA 4TMKA 2WWYA 1G6OA 1MABB 3AV0B 4P0TA 4AY2A 2NPIA 1Z3IX 1XCMA 3SE0A 4C3ZA 1Z6XA 4PC6A 2CLDX 2NO1A 1AJEA 1JJ7A 4OI4A 3EZ2A 4BLPA 4PC7A 1G4AE 2XNDD 3EASA 3GQBA 5E7JA 3W34A 1JAHA 1U94A 4LCBA 2HXSA 3N2EA 2VP9A 4BASA 4IXMA 1S3GA 2IF2A 2SHKA 1UBFA 5FH9A 3NIBA 3QOFA 3EZ6A 4PX9A 3VR2A 3CRMA 1CR1A 2QMUA 4MGKR 3GEIA 5K8TA 1N5KA 4Q1BA 2DBYA 3LD9A 2WAXA 5G3ZA 2FV8A 2XJ9A 1GITA 2CEAA 5J40A 3SQWA 1XMIA 4CZ2A 2P2LA 2XTMA 3GP8A 4U00A 3MJRA 1GUAA 3IGFA 3OEEA 1VDZA 2RGDA 1T9HA 2Z43A 2FSFA 4BLSA 2O8DB 2JLXA 2V1UA 2YVUA 3OZXA 4PR0A 4ITRC 3VNVA 3WP0A 4B34A 1JAIA 1D5CA 2C5LA 5AUPB 2PZFA 3FGNA 1IXZA 2YOGA 1IOZA 3EPHA 1AZTA 1E9EA 2A7QA 2YV5A 1G7CA 1ZNZA 1CTQA 2H5EA 4CGZA 2J0UA 2HYDA 1RRCA 1NSFA 2OT3B 3FHCB 2ZSAA 1YR9A 2Q3FA 2RH5A 5FUXA 1DAEA 1KOFA 4G0NA 2OUKA 3GJ8A 4KFRA 2J46A 3IBYA 1E1QA 1IY2A 1S3SA 2BBTA 1SKYE 2HCBA 2F9MA 3SYNA 4IOKA 4MDFA 1DAIA 1DG3A 1PLLA 2FA9A 1YZLA 3IPXA 5F2EA 3TJZA 1E2EA 3UG6A 2O8CA 2J0VA 1E99A 3ADCA 3K70C 4LYHA 3HU1A 1F2TA 1UKEA 5BWMA 4HZIA 5KUTA 1ZD9A 5CJPA 3VFDA 5TY0A 2R6GA 4MGYR 4Q9IA 3CR8A 3EC1A 1R0WA 2F1JA 1NN1A 4C2TA 4A6XA 1TUIA 3BJIC 2ZJ2A 3KKPA 5HPYB 1P60A 1S9DA 4Z1MD 4E22A 5J4LA 5KOYA 3KX2A 2PMDA 2YYZA 3MJHA 5KPDA 3DOEA 2ZJ5A 2FSGA 2ZI3A 2JEOA 2R44A 3RSOA 1ZU5A 3OHMA 4NYMQ 1EFTA 2LCFA 3ASZA 3SZRA 1VHTA 4A8JC 4EPTA 2Q21A 4XIGS 2ODWA 1E1QD 4TLEA 4UXIA 5FTJA 3GLGA 1G5TA 3TSZA 1R4AA 5GJCA 2W0SA 1ZCBA 2GAOA 2GF9A 2GZAA 3LRPA 3AKCA 1U0LA 3BD9A 3OESA 3IILA 4GSYA 2V3CC 1E9AA 4JL5A 3TR0A 3HYTA 4K46A 3KJIA 1OT3A 2W00A 3R8CA 1Q3HA 1JR3A 1ZM9A 2ZM5A 2OV2A 4CEIB 4C2UA 2J3EA 1U0HC 4FMDB 2IBMA 3B1XA 4QL3A 3BIFA 3ZZUA 4W5HA 4KI0A 2C2HA 4DEXA 3B9PA 4W7SA 1EXMA 4PSVA 5LPNA 1ZM4A 1W4RA 3U5ZB 5EP1A 5JSZA 2UKDA 1T5IA 1EFRD 1ZC4A 4EPRA 1W49A 1RPZA 5H1YA 3QBVA 2VHTA 1FL9A 2DWQA 1NMYA 2OO7A 3EARA 2DFNA 4FMBB 4TT3A 8OHMA 2QA5A 5G53C 1Z6GA 2I1QA 1G21E 4JT4A 4XJXA 1PJRA 2WWXA 3H0KA 4JLDA 4KFTA 4ZCLA 4BFSA 4RY2A 2J1LA 5FUVA 4DZZA 4WW0A 3ND9A 4BECA 3BK7A 3DOFA 3I61A 1ZM2A 3BFXA 3NDPA 3I5YA 2ZYWX 2YWFA 1K8RA 3LA6A 4Q02A 3L43A 4MUBA 1R5NA 2Q0HA 2YWEA 4Q9LA 5D3QA 2W0MA 3BERA 2H57A 4I99A 3QXCA 1ELOA 1AKYA 4KV9A 3RLFA 4B35A 1TMKA 2IYTA 1X8JA 5L3QA 3DL0A 3BXZA 2GCOA 2QNRA 2GK6A 2XSZA 3SJZA 4K81B 4UNRA 1KZGB 4DCNA 1OXXK 2JCSA 5JJKA 3CWQA 1S2MA 5EE3A 1G7TA 3KFXA 3I8XA 4Q5IA 3NXSA 4EPVA 3Q5EA 5KSZA 1NLFA 2DFKB 5JZVA 1NN0A 1EWQA 4YXWA 5HZHA 3GCGA 4PPNA 1D9ZA 1FOEB 4LYAA 3U3OA 3NWJA 4LX0A 2X1VA 3WP1B 4B3CA 2F43A 3LLUA 2WPDA 2ZR9A 2Q3MA 2IS4A 1DAKA 1GSIA 4B2PA 1XRJA 2GJSA 2FFQA 1WCV1 1DTSA 4OQNA 4B74A 4EAQA 1CEEA 2GK7A 5B58C 5BYKA 4LHXA 4EQ6B 2IXGA 4JL8A 1M74A 1AQYA 4Q7JB 4US0R 3IBGA 3K8YA 5DGXA 3K0CC 4DXAA 2BDTA 4QNMA 2EQBA 4NYIQ 3ZGXA 1E69A 1KMHA 1W1WA 1OV4A 1G16A 1I4LD 1MKYA 1BYUA 4C0KA 2J0SA 2ZS7A 1TAGA 4ILEA 4DSNA 2XSZD 4Q1CA 3MG9A 4U02A 2ZR0A 721PA 1SVSA 2ANCA 2RGAA 5TDHA 1A2KC 3FKSA 1XD2B 2OG2A 1V43A 3DMNA 5FR1A 1NIJA 3HPRA 4B2IA 4E09A 5CB6A 2VHJA 1P9RA 2JLUA 1D8TA 1M1YE 2ZRBA 1YZUA 4MKHA 4OK5A 2VPPA 2WWWA 4OBEA 4BUJA 3QKUA 4YXWD 2F1HA 3P1JA 3MGCA 4GP6A 2PEYA 4OK6A 4PAMA 3RAPR 3RS4A 3RSLA 1NF3A 3I1FA 2QM8A 2N46A 1NBME 5CIQA 4DLRA 4OHWA 2WJYA 1UFQA 2ZE6A 4MRNA 2B8TA 1OH5A 3MLEA 1H8EA 2E1RA 4PO9A 2ECKA 2ODBA 1E2NA 4QM6A 1ZUNB 3D31A 2O52A 1W44A 4BFUA 4IOMA 4XSHA 5FTMA 4LC0A 3V9PA 3DHWC 4AYWA 1LS6A 4HUTA 1EGAA 2ZS9A 1G7SA 2OE2A 4TTPA 3AH8A 3IHWA 3TR5A 3FKSD 5TV2A 5AJZA 4PAOA 1N6OA 5SZKB 2ZI9A 2GJAA 4DKXA 2IL1A 3QPUA 3NC0C 5BXQC 3SQXA 2JAQA 2BM1A 1ZU4A 4L16A 4CW7A 1E9RA 3A1UA 1KDPA 4C4PA 4TYWA 2G77B 1MO4A 3EA5A 2W2VA 3TUIC 1LF5A 1W4AA 1D2MA 4IDHA 1GM5A 1FTSA 3QQ5A 3CRVA 4MRSA 1VCIA 1G291 3KUDA 4C0QC 1OB2A 2AWNA 2ORIA 1T8UA 3TNFA 3RS3A 5FL7D 4UKDA 3HWSA 2LKDA 2FFBA 4DDVA 2IEYA 3QKRA 2ZVQX 4TMXA 3Q72A 4IDQA 2VP5A 2D62A 4JBYA 1VG8A 1SVOA 2YNMA 1VG1A 2GWHA 4UNNA 3CRRA 1RJ9A 2QMEA 3KB2A 4JL6A 3NEYA 1TQ4A 1W4CA 5CM9C 3P26A 5E7MA 2JLYA 3AKYA 4HEJA 2AR7A 2GBLA 2ZRDA 5DLQC 3KKQA 3K0SA 4Q4HA 3GLIB 4FMCF 4A9AA 2FX3A 3SFVA 3DM9B 1KY2A 2GHIA 1ZM7A 4JVSB 4B2LA 1KI8A 3KQHA 1KJYA 1J70A 1KDOA 3QKSB 4I1VA 4HAXA 2AKYA 1LV7A 5JI2E 3QIAA 2C98A 1P61B 4G01B 4RFSB 3UK6A 1CJMA 2FZ4A 4M1TA 2IA5A 3QEJA 2IS2A 4L5BA 3I3SR 4RCYA 1YRBA 1N6HA 1ZAKA 1DAMA 3SS8A 5KNDA 1U9IC 4P4UA 2A30A 2FGKA 2C03A 1IM2A 1M7HA 2Z83A 4A0FA 3QNUA 821PA 2XXAA 1FP6A 4B3DA 1HTWA 2QTFA 2V54A 1E96A 3EZ7A 1FW6A 1G8PA 1CJTC 1AS3A 1E94E 4RZUA 5FOTA 2JJ1A 4IEEA 3THOA 4FWTA 2O8EB 2RMKA 1TNDA 1LB1B 2QN6A 4Q1DA 3FE2A 4L4UA 5EP3A 1GTVA 2GJKA 1EESA 4PO8A 2PT7A 1MRNA 2PX3A 1ZD1A 3DVLA 2I1VB 1U0JA 2J5XA 5LD2B 2CCKA 2QSZA 3QPVA 1IN7A 2FPKA 3AGQA 4IFEA 1OH7A 3WNBA 5KTYA 4FCVA 1P3JA 4OI0A 3NVAA 2VLIA 2KSQA 3ADBA 3HYRA 2AN9A 4JT2A 4AYTA 1AS0A 2YOFA 3EZ9A 3RANA 2EFGA 4NYJQ 1CIPA 2XNSA 3ZVRA 2K5UA 3TKLA 1WDTA 1G3MA 1XPRA 1HH4A 1SZPA 2ZRPA 4EPXA 4LJ7A 2CVFA 4EIWA 2VSFA 4F4IA 1R0YA 2A9KA 4TL8A 2V9PA 2P5SA 2CJWB 4H1VA 3UMSA 1T3LA 3FYHA 4QRHA 1R8QA 4P33A 221PA 2JJ1D 3EIQA 1QVAA 1UDWA 1AKEA 3UXMA 1W2HA 3WHLA 4LWZA 1CJVC 2GEDA 5AK0A 3W9YA 1J2JA 5J4HA 5HCNA 1HT1E 1XTRA 1GWNA 3KKNA 3NBXX 1ZNWA 5E3HA 2OCPA 3RC3A 3OIWA 4MQBA 1UEJA 4GMXA 1D6JA 2VP0A 2WHXA 5DN6D 2WZQA 5JWHA 4ZDKA 1SGWA 3LDAA 2HUPA 4ZDWA 4IHQA 3TVDA 2H7VA 4MRPA 3T06B 1E79D 3ZQ6A 1NN5A 3I4LA 1OKKA 3L0IB 2JASA 4H9GA 4AC9A 2D7CA 3MWJA 1N6LA 1DO0A 2QAJA 1CULC 2ZSEA 2GEVA 4DIDA 2KB0A 2O8FB 3AP3A 1A4RA 1NJGA 2TMKA 3CO5A 3CRQA 2JLVA 1TQDA 1DAGA 2QM7A 4URYR 5AUOB 1US8B 1KKMA 1XTJA 3Q3JB 4RD3A 1JB1A 2NOAA 1DE0A 4MRRA 4TZ6A 2VP6A 1SXJC 4NYMR 5FI1B 3C41J 4DUGA 5JFGA 1V5WA 3T1OA 2YWGA 4B48A 5JMTA 2FGJA 3CWZA 4B43A 2GESA 2D3WA 5TVKA 1GFIA 4UJ3A 2ZYVX 1ZD8A 2D2FA 2CK3A 2V1XA 1G41A 1E3MA 3AP1A 3UATA 3NBFA 3ADDA 1OKKD 3L0SA 3LLMA 4KHZA 3F0TA 4EFLA 2DR3A 2JGNA 3S1AB 1Q22A 3CRW1 2NO0A 1ZMXA 1R10A 1XTSA 1GL7A 3SEAA 2EW1A 1KO7A 5F3WB 2V6JA 1OIWA 3CPJB 4M2LA 2QEQA 1N6NA 4CT5A 2BBSA 1Z0JA 1DVRA 4G5RA 4IW3B 1UKVY 1W4BA 1XX6A 1XCGB 4GZMA 4NCHA 4Q03A 2WBLC 1COWA 3U4QB 1P7CA 3UWOA 1P2TA 2YZ2A 5DO9A 2F55A 2J59A 2O8FA 3T12A 1IXSB 2NGRA 4OQXA 4FN5A 1ZUHA 2J0QA 2D4HA 3AF3A 4ZIRB 2IWRA 4LJ8A 1KI2A 2BV3A 3GLIE 3O8BA 2BIFA 3C14C 1G8HA 3AVYA 4ZI3A 4Z54A 2W6IA 1KI1A 4LYJA 1DOAA 1TEXA 2ZJ8A 4JIMA 4R2IA 2CK3D 4O2LA 4TYPA 2QBYB 2JLWA 2QAGB 1ZUIA 4TLAA 1W0JA 3CNNA 3LW7A 5B57C 2W2TA 4PSKA 3THYB 2CNWD 2D06A 3CF2A 4RSGA 3QVVA 1IXRC 3VR1A 2JLQA 5GJWC 1AS2A 3BRWD 1FX0A 1NNEA 4NKRA 4LBZA 4M1MA 3ZIAA 2ZRHA 3IEUA 1YZKA 2GVZC 1U8AA 2OZEA 1HYQA 3OIYA 4IEIA 4UNQA 3WBJA 5ANRB 1WXQA 3ZLJA 2FPMA 1XFAA 4A0HA 3AB3A 4Q1AA 2EYUA 4TMWA 4QOSA 3FHTA 4WZAE 1KNXA 2NMVA 2RGNC 3OEHA 1JECA 2J45A 5D3MA 3A4NA 1FNMA 3RABA 521PA 4RKEA 4D4KA 2IHYA 1KHTA 3CONA 1U8YA 3PG5A 4L15A 3BGWA 2FFAA 1Z5ZA 3IHLA 1Z07A 2QTVB 4X8HA 5P21A 4JSYA 2XNDA 3WMGA 3T1QA 1NVXQ 4AG5A 4M22A 1CU1A 3AVPA 2MMGA 2Z4SA 1II8A 3H4MA 3K0FB 2W6ID 4EPYA 4N0DA 3N2IA 1VIAA 4CVNA 3THWA 4M9ZA 3MCAA 3IO3A 4QM7A 1OF1A 4LZZA 1W0JD 4QJ5A 4X8OA 1UEIA 4JYBA 4ARZA 2R6AA 2ZROA 2OSBA 4G5OA 2H16A 2ZR7A 4NYIR 4B71A 3BB3A 4PZZA 5EE1A 1Q0UA 4QBHA 1GZSA 3CNLA 1YKSA 2A5YB 4JLNA 4V0NA 5LBIA 4Z51A 1OPXA 1XCPA 3EWAA 3X2SA 4DCTA 1Z83A 1CP2A 2JA1A 2OBLA 1OHHA 3FFAA 3NG1A 5DI3B 1R0XA 1ZC3A 3GFPA 4M9SA 1P6XA 4WXRA 5DISB 5A0FA 1ANKA 1KK0A 4BFYA 1QHXA 3EPLA 5FL3A 1X3SA 2EWVA 1UDXA 3GJ7A 2EVWX 1IY0A 4M0LA 2PBRA 4Q4AA 4HAYA 3FKQA 4R9UC 2QORA 1VG0B 3RRNA 3U7EB 4WZBE 3H2YA 3LQQA 4FD2A 4PPGA 1KK2A 1SVMA 1XMVA 3KJEA 3N70A 4C7OA 2PCJA 4HB4A 4RJLA 4XTCS 1ZINA 4TQUS 4B44A 2JDID 1E6CA 2VQSA 4JLKA 5LB4A 3I92A 4H1UA 4FCWA 1NVUQ 4GRAA 1G19A 1GP2A 5HKKD 1T91A 5JHGB 2FG5A 421PA 2HYIC 2F1RA 3ASYA 3FB4A 1DELA 5JJLA 3NC1C 4HLQB 4HB0A 2HT1A 2RCNA 3BE4A 4C30A 1OHHD 2F9LA 1BS1A 4Q4JB 3KUCA 5FTNA 4S2EA 4ZKDA 4V02A 3ZVMA 1RRFA 2MSDB 4NCKA 4E5UA 2XAUA 3CBQA 2ERYA 3BB1A 3K70B 1KJZA 4P32A 4OI1A 4BRUA 2FOLA 1WRBA 2BM0A 4E03A 4URXR 4ZCMA 1KI6A 4Q18A 4JLMA 4Z1MA 3KKMA 1P2SA 1VECA 2NZJA 1QZXA 1E2GA 1X8KA 2QROA 2ZIAA 3Q85A 1MABA 3FTQA 3K9HA 4MYCA 4F7WA 4F92B 3Q7PA 1R6BX 2LWIA 1EFHA 4QHYA 4WIAA 2IYXA 2DY1A 3UANA 4DCUA 4PZLA 4ZCIA 2YKGA 4KXFB 1K5GA 3WBKA 4LY6A 2B6HA 2OXRA 3JVVA 5J4VA 4JLBA 4HDCA 1RKBA 3C5CA 3K9GA 3K9LA 2HDNB 3SC3A 3U6BA 4YDSA 4JJZA 4BFXA 2PMKA 3AKDA 1OIXA 4TL9A 5K8UA 3IEVA 1M2OB 3PVSA 3GEEA 3FMPB 2ZS8A 4XWAA 4GDFA 4C0JA 2GRJA 1RRPA 4XD7A 2YINC 3LBIA 4FXPA 4M21A 5CDFE 4KLZA 4AK9A 3UMFA 3AVTA 3IDQA 3NHAA 2BKEA 3A1TA 3B2EA 2NO6A 3P4YA 2GCNA 3LWNA 1HQCA 2PEZA 1SULA 1FP7A 2AK2A 4JMPA 4Y0AA 1KK1A 2O8DA 2WOOA 2VF8A 1Z28A 4PFSA 2ZU6A 1NKSA 1GRQA 3RRYA 4LUCA 1EFRA 2BMEA 4DWJA 5FUYA 1W5TA 3R7WB 1E2KA 3QY0A 2UVQA 1KO4A 4TTRA 2GVDC 2R9VA 1P72A 1W2GA 3TSWA 4EKDA 4UJ5A 2WIAA 2ZEJA 1FTNA 4HYYA 1PLKA 3BBPA 1B0UA 1U98A 4EJSB 3I32A 1SKQA 3A8TA 4W9MC 5JCPA 1SVLA 1J8MF 4JVNA 1T5LA 4XWKA 3VU9B 3J81k 3OAAA 3SN6A 5KNCA 1KDRA 2QP9X 4HZUB 5JLJA 2WKPA 1VG9B 1CLUA 5JS7A 1QG4A 4XD7D 3PQCA 4MKFA 4KU4A 3RS2A 5GJVC 2VA8A 4CEHB 1NBMA 1OE0A 1EX6A 2IYRA 2OLKA 2F3RA 1UBGA 5B2ZA 3U44B 2L0XA 2OESA 5CK4A 3RWOA 2I3BA 4N0EA 3TE6A 1E98A 2NO7A 4GT1A 3BORA 1QDEA 1IHUA 3PEUA 3VMFA 2GZDA 2V4ZA 3B1VA 4IRUB 2AFHE 3EA0A 2HT6A 5EUMA 3P20A 4TYNA 3K70D 1I4TD 4LBYA 3SDZA 1W36B 2QTHA 3OE7D 3A1VA 4NYJR 5CYOA 4NH0A 5SZJA 5BYJA 1IN5A 3CPEA 2ZI6A 1GG2A 2MMCA 3HDTA 4GL2A 2QL6A 1QRAA 2ZQ5A 1XMSA 1XTIA 2GA8A 1ESMA 3TW4A 4JLJA 4OL0A 3QG5A 4F93B 1G9XA 3T5GA 5G3YA 3B82A 2ZJAA 5BN3A 5FUWA 3OAAD 2ODEA 3N5CA 4AKGA 4POAA 3RWMB 2FWRA 4LHVA 1TTTA 1NN3A 3GJ0A 2V8OA 5EXPA 2XZLA 2A5FA 3IIMA 1P9WA 1G3IA 2VHUA 4ABYA 2X2EA 1H8HA 2ZI7A 3CW2A 2A3RA 3LY5A 4S35A 4RKFA 4A2QA 2QPTA 1NBMD 1N5IA 2IUTA 1VYVA 1A7JA 4F4CA 2BMFA 2WJJA 2X77A 4A15A 4UXJA 2CCGA 4YMVA 3KZ1E 4HZUA 2RB4A 1OYYA 2X8AA 2AXNA 3PENA 2QMHA 4L8GA 5K8LA 2WJVA 3IO5A 4PHTA 1KI3A 1ZJ6A 2A78A 4GFDA 4TSFD 5CYPA 4DCSA 1KAOA 1VIYA 2BWJA 3KXLA 2GF0A 3FOZA 3L82B 5KDLA 3BAFA 3H84A 4CEIA 4MKGA 1JBKA 3C5HA 1G64A 3T61A 2FZLA 3MUFA 4QNRA 4X8MA 4DIEA 3NHBA 2OCYC 1FQKA 3SJCA 4BFTA 2HJGA 3CLVA 3AUXA 4TMTA 3VR4A 1HE8B 2BBOA 3AF2A 2V7QA 2ZRAA 2C9OA 3IUYA 3UPUA 3RRZA 1T0JB 4DT1B 4BGDA 4C9BA 2XGJA 5IK2D 3FMFA 3K9NA 3NBZC 4OJQA 5FPYA 4JJKA 1E32A 2XTNA 3U7FB 1CR2A 1LVGA 2QU8A 4KFUA 5C4MA 1M6NA 4CF7A 3A36A 1PVOA 1GILA 3VX4A 1E9BA 1OFUX 1H8HD 4CT4B 4M1WA 3EPKA 1ODFA 1Q1EA 5IRCD 1YRAA 1X1SA 2RAPA 4HI0E 1CJUC 3GLHB 1Q20A 2GCPA 4LPKA 2ZXUA 1TX4B 4G5SA 1RC8A 2OEPA 4BRWA 1JR6A 1OXUA 1ZW6A 4NHOA 3KXIA 1YVDA 1NMZA 2YC2C 5DHAA 4EFMA 2NO9A 4HAZA 2IW3A 3A37A 6Q21A 2F3TA 3M1IA 4IVPA 3EPJA 5FR2A 3RVBA 1Q44A 1UBEA 5CLLA 5B64A 3CH4B 2VH5R 3EWSA 1S9HA 2DCUA 4HUQB 1K6MA 2O5VA 2V7QD 4HDQB 2YWHA 1W36D 3GEHA 3WNDA 5IT5A 1E2LA 5FOSA 4AD8A 3PUYA 4JYCA 3ZD7A 2BEJA 3QXHA 1KK3A 4OKSA 1T6NA 4HSEA 2GXUA 4G5QA 2HEIA 2JLRA 1AIPA 1JXMA 2H8KA 5J4KA 1KI4A 1R5BA 2WSSD 5FL7A 3AVQA 2ORWA 2FNAA 4ZDIA 4M1OA 1WE2A 4EQ6A 2ZSFA 2EYQA 3U61B 3DPUA 4R98A 1QHNA 5EP2A 1YE8A 4A92A 1NL3A 4D81A 1OFIA 2FEOA 4O25A 3KKOA 3NH6A 2CMKA 4GI7A 3KXKA 1XXHB 4V0ME 3PFIA 4B6FA 1DBSA 3BH7A 4Q4LA 3RS5A 1G20E 3TQCA 4JBXA 4B32A 3PEYA 1XD2A 3O8DA 4KLNA 3V4FA 1F5NA 4I4LA 3WRYC 4R71A 2IK8A 1EFUA 1RW4A 3EZFA 3SYKA 3TRFA 4QGAA 3KQUA 4XH9B 4URUR 4DEYA 3U60B 3SYLA 1E9DA 1G1MA 3VR6A 4HLDA 3ZYCA 1A2BA 4M9QA 4D0NA 5EJEA 3FFBA 4JLOA 4DLSA 3MWKA 3VTKA 4OHVA 1KMQA 2B7BA 2ZAMA 2ZAOA 1KSJA 3K1JA 3LX8A 3TLXA 4BEBA 3QXSA 1KJWA 1KTVA 5DHFA 2OBMA 2ASEA 3B1WA 2FF7A 1Z6AA 5L3VA 3K0AB 4TN1A 2ZSBA 2REXB 4PO1A 5FPTA 3V00A 1JQLB 2GBLC 2N42A 5E4FA 2GXSA 2OHFA 3X1WA 4BE7B 1HT2E 1E2HA 4HDOB 1YR7A 2I4IA 1WQ1R 2HF9A 3P4XA 3BFKA 3T35A 4YC7A 2G3YA 3G0HA 3GJ3A 4FMDF 4IDNA 4QJ4A 3HU2A 4HAWA 1WBBA 2AK3A 2QT0A 3MRSA 1PLJA 1BMFA 1E9CA 4BZQA 1Q1ZA 1E1RA 3D6TB 1GKUB 3UWKA 1W46A 4GP7A 3TUZC 3E70C 4CIDA 4Q19A 1QVRA 1YZQA 4TL7A 1BO6A 5FBQB 2IHBA 2XITA 4B3GA 1L4YA 2VTKA 1DAFA 4JKYA 2F1IA 4YMWA 3RS7A 3SHFA 4QGGA 1BOFA 1OH6A 2A5GA 3QJYA 4O0MA 2H92A 3B6EA 4OQLA 2XZPA 2V6IA 5HCIA 3GFOA 1UAAA 1OYWA 3AKEA 3L8ZA 3KTAB 4B76A 3ZD6A 1Q1QA 3B60A 2OXCA 4K8OA 4WAUA 3X1ZA 2FDCA 2BCJQ 2CLCX 2ZETA 2RGXA 2Q6TA 5EE5B 1JEDA 2R6DA 4Q1FA 4DDWA 2QGZA 5DN6A 1L8QA 2ZE8A 3A1SA 2F6RA 3PITA 3IQWA 5DE3A 5UKDA 2EFDB 1NVVQ 2OAQ1 3I8SA 1OW3B 2ZJOA 4C0HA 1E79A 1GVNB 1G3RA 5JBQA 1G7RA 3QUSA 3E5HA 3GLIA 2WWIA 5BN5A 4KO8A 4LBWA 2J7PA 5JWOA 1UM8A 1IQPA 2CDNA 3HR8A 5GJBA 5LB2A 1BMFD 3QXJA 2VP4A 1E1RD 4MA4A 5AUQA 1J90A 2LKCA 3QKSA 4NMMA 4BZPA 3UKDA 1E2QA 2ZI4A 1E2PA 2HLDD 3AVWA 3OFND 4RFSA 3TW8B 5AR1A 3GLHE 1VMAA 1N6KA 2WIBA 1Z0DA 4WA7A 3R9IA 1T4GA 3QF4B 3WMFA 4YLGA 4LSGA 2CL6X 2DFTA 4NZYA 3DO6A 4PHFA 3AEZA 3B13B 2IT1A 3WYGA 3LO5A 2WMOB 4DLVA 2O8EA 1EG7A 2FSIA 3P27A 3RS0A 1FMJA 1I4DD 2C95A 2QP3A 1X86B 3KTAA 2FJUA 3BB4A 2WTUA 1ESNA 3TGPA 1SXJB 4CEJB 3TAHA 3CF6R 3GLFB 4P3YA 2AXPA 2RKOA 3QEOA 4GPTA 2GAAA 1TQ6A 4OYHA 1A82A 3NH9A 1N25A 1G3QA 2J7PD 4M1SA 5C4GB 3B7GA 3REFA 2PH1A 3I62A 1IN6A 1W0KD 1ZCAA 4HLUA 3LAWA 3CM0A 2IXFA 2NZ8A 2B92A 2MSEB 4G3XA 3FPAA 3PIRA 3AM1A 1GAJA 2JIZA 2C96A 3GJXC 4BWYA 1IJEA 1P75A 5FPKA 2XOKD 4PQYA 1XZQA 2Q3HA 2W6JD 1DADA 1S1MA 3CIOA 1YR6A 1JJVA 3GJ5A 1XXHE 1L4UA 4BLTA 3D3QA 2CJWA 4II7A 2AL7A 3VR5A 3CZQA 3GJ6A 3ZVLA 2VL7A 1QG2A 2IYUA 1Z0IA 1P2UA 3MWYW 4RD4A 2WJHA 5G40A 1N6PA 3EG5A 1CRQA 1B23P 2J7KA 3TUJC 1OXTA 4MRVA 1WB9A 1KSGA 2WWGA 1HEIA 1OFHA 3LVQE 3B78A 4ZV4A 3L0PA 1XEXB 2A5DA 5KNBA 2CNWA 4KCGA 1MT0A 2KBEA 4I1OA 4KBGA 5HE9A 5KHOC 2JJ2D 1VHLA 3RC8A 1TU4A 3PUWA 4ON9A 3SR0A 5GADl 5L3SB 4HB2A 1KSFX 1KIMA 1GIAA 2HXYA 1HV8A 1Q12A 4C0AC 3BWDD 5G41A 3OIVA 1QF9A 1LW7A 4FCTA 4N1AA 1O87A 1YR8A 2JIZD 2QI9C 2XTZA 4MGZR 5JEEA 3RYTC 3ZS8A 4Q21A 2X19A 4BFVA 3SOPA 1TADA 4DLZA 2VSOA 3O8RA 3OIUA 1US8A 1TUEA 2P3SA 3BOSA 3QI2A 3BH6A 4OJKA 5AJVB 1M34E 2PCLA 3FWYA 2G83A 3EXAA 4XSGA 2FMXA 1LF0A 3B1ZA 4YONB 4D6PA 3MMPA 3NBYC 3W3AA 2IYSA 3DDCA 5JRJA 1RE0A 2B8WA 1MO5A 4OQFA 1IBRA 5J4YA 2ONKA 3PUZA 4AG6A 2ZRGA 2WKRA 2O8BB 2VSXA 3CX7A 1FFHA 1D9XA 4D82A 3L0OA 1OSNA 2Z4RA 3FDIA 2CE2X 4F4JA 1FUKA 2R62A 2VIIA 1SXJD 2C8VA 3C15C 3OF5A 3THXB 1XB2A 1GNRA 1F2UB 4EDHA 4GOKA 2WV9A 1N0WA 2YC4C 3CX8A 2VHQA 4L9WA 3K09A 3S1AA 1ZNYA 2REBA 3PUXA 4P4SB 4FWIB 4MKIA 4A0GA 2WKQA 1G5PA 1RIFA 2AWOA 3GFTA 5HZKA 3WY9A 4IOLA 4PTLA 1XF9A 1N0UA 1O3YA 3U3KA 3AQ4A 1GRNA 1CR0A 1G8FA 3QSYA 1PZNA 5CDFA 3U4QA 2PLRA 2C04A 5EUQB 2GZHA 4RVCA 4PC1A 4KAXA 1NG1A 2EFCB 2W58A 3AUYA 4ZIRA 1CXZA 2WWHA 5FTLA 1G6HA 2ERXA 2JDIA 4A6PA 2FEMA 5AUNB 2C9CA 5DIFA 2QSYA 1SVKA 1ONBA 3F8TA 4XTRA 2R6CA 4B3BA 5HKKA 4UQOA 1Y63A 2IS6A 4LV6A 5TXGA 1U81A 3G82C 1G4UR 2ZRNA 2QBYA 1E2DA 1PUJA 2QAGA 2G9NA 2DWPA 3GPLA 3CX6A 3TQFA 4A82A 1Z2AA 1TU3A 2RGEA 2N1BA 1XWIA 3THYA 3KJHA 3PEVA 3CF0A 4LHWA 2C99A 3TBKA 1NRJB 1VYTA 2JLSA 2GXQA 4ESHA 1QHGA 2VO1A 3ZVNA 4HLCA 4MDEA 4IVQA 2IS1A 4TMZA 2UZ3A 1D2NA 1VYUA 3BH0A 2JLZA 1T3HA 4MYUA 4ACBA 5KYKA 1EFCA 1Y3AA 1IN8A 3NTUA 4AI6A 4AKEA 3CKLA 4A0RA 1T0HB 1G18A 3B5JA 4DLUA 4ZPXA 1SXJE 3GLFE 4NCIA 2OCBA 3ECCA 1GKIA 4JVLA 4TL6A 2BEKA 2V55B 2XB2A 2J0UB 3KQLA 2XZOA 2DHRA 2JJ8A 2GTPA 4B33A 2ZUCA 2IYQA 2HCJB 4F38A 4D26A 3K0FA 5EZ5A 3I72A 4DLTA 1XPUA 4Q7MB 4V0LA 3LBHA 5DSZA 1BIFA 5AJWA 3M6AA 2EU8A 2Z6VA 4Q7LA 5H8WA 1Z0AA 5KPJA 1MH1A 3Q7QA 1YZGA 3T5DA 1PV4A 1D2EA 1MR3F 1VCNA 2O8CB 3U7GA 1A5TA 2KI5A 2G1JA 1XZPA 5DNYB 1GNQA 4IVRA 5JWRA 3MAAC 1F2TB 1K5DA 2IC5A 4OHZA 3VAAA 2DWOA 5DI3A 2QRZA 3U3RA 5JS8A 5FOWA 3WRXC 3MFYA 3PV0A 1GRRA 4M1YA 1AGRA 3SBEA 2X2FA 2OCAA 4LV8B 1MRSA 3TVTA 4PQFA 1YJ5A 4B3FX 4BQSA 3UIEA 2QPOA 2H1LA 1Q57A 5CB8A 2G88A 1X8LA 3GJ4A 3WNCA 5DH9A 2HJVA 4C0SA 3EIHA 5K8IA 1NJFA 2P6UA 3LXXA 5EP4A 1G5RA 3DZDA 3HR7A 1Z2CA 5EE0A 3HU3A 2CCJA 3JZAA 4CYMA 4E07A 4A8JB 1N3BA 2CHGA 2WWFA 4IDPA 3VHLB 3GLGB 1GKYA 3IQXA 1ZIPA 4AURA 4PANA 1Z6TA 3TK1A 3IKJA 5JRZA 2J9RA 4NDZA 5EXXA 5A4JA 1JXOA 5DYGA 3W8RA 2VYFA 1F60A 2PJZA 4DRZA 1XJCA 5B30A 4Q4JA 3KDSE 1SQ5A 1DG1G 1Q3TA 2ZRJA 1NY5A 3ETLA 3U7HB 2P67A 2BKUA 4CRWB 2PJRA 1C4OA 1XJ0A 1P62B 4ZDJA 2VBCA 3KFVA 4B6EA 3O8CA 3LNCA 3GMTA 4GNKA 3H1TA 4A1FA 3EW9A 3OE7A 3OEED 1EWRA 5FOUA 1S1CA 1UKYA 1SHZA 1E0JA 3EIEA 2O0JA 4DJTA 1HURA 2ZI5A 3FMOB 4LHYA 5HTKA 4KSBA 4URVR 3BFVA 5JSZB 4F91B 4DB2A 5FBVB 4RD0A 4Q66C 2ZSDA 3JVUA 1G8GA 1JALA 2GXAA 2ZJYA 4C0LA 4Q7KA 5CK5A 1G17A 4KYUA 4US2R 2MSCB 5BN4A 3EX7C 3X1YA 4URWR 2B21A 3SNHA 3SJBA 1AQUA 2ZU0C 4V0KA 5FTKA 1QHSA 1LNZA 4IJMA 5FPHA 3UMRA 1KZ7B 4D4MA 1ETUA 4NBSA 4GOXA 2VRWA 4NCJA 1LY1A 2W2XA 4A8JA 1UBCA 4RZ3A 2IYYA 4NCNA 3X1XA 3F5FA 4PHGA 3QE0A 4W5JA 1C1YA 2WM9B 4LDJA 1L2TA 4PAQA 4TSFA 3R8FA 1OH8A 3PUVA 5L3QB 4LJ9A 1NVVR 2GCOB 4MYTA 3AVVA 5HR5A 5JJIA 4QC2A 3ZDQA 1HUQA 4RZXA 4OHYA 1RYFA 2BMJA 3LVRE 2P65A 1Z0KA 1TL7C 2KJQA 4FMCB 4R7ZA 3PXGA 2RGGA 4QGHA 4LJ4A 3QG1A 1OFTA 4JKIA 2G0TA 4BZXA 4B75A 4BEJA 3ICEA 4FW9A 5E95A 2D74A 1KYIA 1XD9A 2IUSA 3W5JA 4V0MA 2H17A 1WF3A 1RRGA 4Q1EA 3R7WA 1E4VA 2BC9A 5IK2A 2F43B 5SZIA 1E9FA 2QQ0A 1AN0A 2P0EA 2ZTSA 4WXPA 5ELXA 3AF4A 3I73A 4GOJA 2BBWA 4LV5B 4EJSC 1DPFA 4O3MA 5BW8A 2QENA 4EJSA 2OILA 4PSAA 4NONA 1R0ZA 3VU9A 1SVIA 4Q48A 3KJGA 1FQJA 1S96A 1VPLA 2R8RA 5H70A 1DO2A 3TAUA 3I5XA 2IYWA 2GJ9A 5L3RA 2NTYC 1KMHB 1W7AA 3CZPA 4JBWA 3A1WA 4BLQA 1NG9A 4CEHA 4IXNA 3LW8A 5TARA 4GZLA 5F98A 3FMIA 3WXMA 3U44A 3VKHA 5GVSA 3KQNA 1WMSA 2BCGY 1JR3D 4US1R 4IFBA 4A2PA 3DM5A 1N6IA 5JECA 2YJTD 4BLOA 4D2IA 2BJVA 1W36C 1XEWY 3A4MA 1E0SA 3Q8XB 1KY3A 2OFXA 1W47A 1GDDA 2NQ2C 2Q9BA 4RZ2A 4O2RA 3P32A 1E2JA 3QPWA 1NY6A 1IONA 1NVWQ 2Z0MA 2WSSA 2ZYUX 2AD5A 4OQMA 3G5UA 1NI3A 2WOJA 1X1RA 4TYQA 3DMDA 1Z8FA 4TT3D 2WJIA 1YZTA 2AFIE 2H18A 3A4LA 1E2FA 5FOVA 4MGIR 4XVUA 5FOXA 5HE8A 5JEDA 5CITA 4BLRA 1EK0A 4D25A 2OAP1 2RHMA 2FSHA 2CL0X 4NE2A 1TF7A 2C9YA 4PPQA 4MUAA 4QXAA 3DKVA 1M7BA 5A5GA 2C77A 5FBWB 3K0CA 1NIPA 2QRNA 2QQEA 2WAYA 3CNOA 1R8SA 2IYLD 1FUUA 1C9KA 2XJ4A 4X8LA 4DC9A 2DFLA 3U3JA 2ANBA 4QFMA 1IN4A 5CIWA 2ZJBA 4KVGA 1YZNA 2GKSA 2QZ4A 2ZYTX 3B85A 3QXXA 3A58B 1OLOA 5DYIA 1LS1A 5M04A 1KI7A 1MV5A 3GLGE 1GOTA 1NLYA 1U90A 1KNQA 1IAQA 5AJXA 3SFZA 1X6VA 4MH0R 5IDVA 3WMEA 2CL7X 4HAVA 1SHKA 5L8VA 1Z08A 3HJNA 4KVAA 4M1KA 2QPAA 1F48A 3LH5A 5C46F 1XTQA 2ZPTX 2ATVA 1J99A 1II9A 4A36A 1P73A 2P5TB 4Z8YA 4DT1A 2YOHA 5JI3E 1NKTA 3TIFA 4AYXA 1MOZA 4PXAA 4AKHA 2WPDD 1KSHA 2VEDA 4M4SA 2C78A 3SU8A 1JR3E 2B7CA 4M9XA 1OIVA 1E9SA 2PL3A 2ZRFA 3AGPA 5KDDA 1OXSC 3QKRB 4ZKEA 4JLVA 5IF9A 3IPYA 2JATA 2KWIA 2ZUDA 3LBNA 3GLHA 2D7DA 5FBLB 3W6OA 4P31A 3SI7A 1F3OA 1HY3A 3VKWA 1RJ9B 3R9XA 1FZQA 4B47A 2WMNB 3M0EA 1XBTA 5AWFC 2WJGA 3NEJA 4L9SA 2ORVA 5C2JB 4LJYA 4TWZA 4KFSA 4Q4HB 4TQ9A 4TLBA 3QENA 5FFMA 4BPBA 2FPLA 1N6RA 1ZNXA 2J41A 3SBDA 4DCVA 2UZIR 2AD1A 4D0GA 3AP2A 2G6BA 2BVNA 3LX5A 4BFWA 2CBZA 3QVUA 3C4JA 4M8NE 5KSYA 2ZANA 2ZRCA 4TZ0A 1FMLA 3QF7A 3C7KA 3W8NA 3LV8A 5J47A 3ONWA 4HUQA 4URZR 4Q01A 121PA 4HAUA 4LGMA 3L2OB 1QHIA 1G8YA 2QG6A 2AX4A 2RGCA 4QBGB 4RD1A 1NMXA 5BQ5A 5F9HA 1ZBDA 1YU9A 1Z29A 4V03A 4Q9KA 5JHHB 3UG7A 2XXAB 1JI0A 4IKEA 1WBDA 3D8BA 3IIKA 2D2EA 1JPJA 4TTQA 3ND8A 4QBFA 1CKEA 3PCRB 4EUNA 2ONJA 4DSOA 1H8ED 4LJAA 1AK2A 2IEZA 1J7KA 3T34A 2QY9A 1JEEA 4NU0A 1DAHA 4W5WA 3SJAA 4D4JA 5E7IA 4DLYA 1UF9A 1XXHA 3RRMA 2VF7A 2ZRLA 5IHPA 1IY1A 1NLZA 5C18A 1XJQA 1HA3A 2P6NA 5TB5A 4B73A 1AZSC 2WICA 1N0VC 3RDPA 2ZE5A 3K0EA 4P4TA 1XEWX 2HLDA 4A4DA 4C0BA 4HATA 3OFNA 2BOVA 1M8PA 2FH5B 3TH5A 3B8HA 2IXEA 4D80A 1GL9B 3BC1A 2FE4A 4JVMA 1OJLA 2OFOA 1TPZA 2HF8A 4AKIA 1YHNA 1DS6A 1BH2A 2QE7A 1CBUA 4FI3C 1S0UA 2QGNA 4NP6A 2CE7A 4U5XA 3ZQJA 2CLSA 4A2WA 3U3MA 3ICQB 2P6RA 2E9SA 2ZITA 3C8UA 4TLDA 3JZMA 5TMPA 1Z22A 4XWOA 1XNJA 5KO2A 1WA5A 5KSOA 4R2HA 4ACAA 1U9IA 1XDBA 1U99A 3T1VA 3ZJYA 1J8YF 4PHHA 3K0AA 1CRPA 3PR1A 2NPFA 4YMSA 1TF5A 2HV8A 4M53A 2GNOA 1CR4A 4JLPA 1PUIA 4ESVA 1OB5A 3CH5A 4DDUA 1R2QA 2A2ZA 1VKJA 4DLXA 1BKDR 3W5IA 3B9QA 2NG1A 4DLWA 1N5LA 1WP9A 1TQ2A 5FPSA 1KO8A 3H86A 1W0KA 2R2AA 4ZO4A 1UKZA 4LBVA 3R20A 3T1TA 4FINA 1UJ2A 1VCMA 1ZP6A 3FVQA 3RHFA 4ASUA 4EFNA 1CF4A 4QG7A 3O47A 2IUUA 1ZVQA 1RFLA 3LFUA 1P4SA 1N2CE 2W83A 3AVOA 2EFHB 4GBMA 2XOKA 2A5JA 3NKVA 4WOPA 5CJ2A 3DZ8A 2W6JA 4D0LB 4KBFA 1LFDB 1W5SA 2QE7D 2YHSA 4YMTA 1Z63A 3AVUA 3ZH9B 3U6KA 1DARA 3ADKA 5AJYA 4Y0VA 3MD0A 5H68A 5KSPA 5KDOA 2OFWA 1JNYA 1E2MA 1P2VA 1GL6A 1XEFA 2EFEB 3LQRA 4DSUA 3A6PC 5EQTA 2QUZA 4AWXA 1LTQA 3KQKA 2J87A 2DPXA 3W6NA 4TLCA 2R65A 1Z0FA 4UXHA 5LD2C 4Q47A 4I1UA 1F6BA 2JJ2A 2XEXA 1RZ3A 4QKQA 5F9FA 4FIDA 5EXTA 2ZRKA 2GDJA 3MWLA 4HLUC 2FFHA 2WSMA 2WVJA 3VR3A 1I2DA 4QBIA 4XVQA 2ZUBA 4LJ5A 4KSCA 2Y8EA 4ASUD 1BYIA 1TF2A 1ZIOA 2DYKA 3HPQA 4CDGA 1XTKA 4MITA 1RVDA 4LC1A 4I1SA 3TMKA 1UPTA 1A1VA 3M4YA 5SZHB 3DEFA 4LPSA 2IWHA 3VX3A 3VNUA 4NL4H 3BS4A 4DVGA 4TYYA 1VTKA 4I81A 3E2IA 1DEKA 621PA 3SHWA 5EZ6B 1MO3A 4UNSA 3W3ZB 3IIJA 3RNLA 3PJRA 4V0OA 1KKLA 1AM4D 2GILA 2OM2A 1NSTA 3F3YA 3W90A 1E4YA 1MO6A 2CHQA 2G0NA 4YMUA 2Q9CA 1ZM3A 4N3NA 1HE1C 3ZZTA 2REOA 3QF4A 1R7RA 4MYHA 2Z5FA 2VP2A 3Q5DA 4U7DA 1Z06A 4LHZA 1E2IA 1VCOA 3MSXA 4EPWA 1KDTA 4PC3A 2KBFA 2O0HA 2O0KA 3DKPA 2PZEA 4RCZA 5J5CA 3EAQA 4WBSA 4PPFA 3T15A 4QHSA 4RD6A 5KU1A 1SXJA 2ATXA 2R6FA 4G1UC 3GLFA 4CEJA 1JPNA 1OXVA 1RYHA 2RHDA 3ZS9A 2AKAB 1NP6A 1FX0B 3CUEF 4OI2A 3LXRA 1HQYE 2FU5C 2OLJA 2ZJZA 4PQRA 1XU4A 2CHVA 1L7VC 3GD7A 1JQJC 1Q1BA 1KI9A 3C16C 3U2QA 4DSTA 4AIIA 4XOIA 3WYAA 1SKYB 4Q9JA 2ZRIA 2ZRMA 3VKGA 5D3MB 3AF1A 5FI0B 3WYFA 4XVRA 3WHKA 2BMDA 4BFZA 1II0A 2BHRA 1QHYA 4JZKA 2PX0A 4DB4A 2EWWA 2QP4A 1CS4C 1CJKC 1QHHB 1E0AA 4PZYA 3EC2A 1II8B 2G1KA 2BJWA 3VQTA 2PZGA 4JSTA 3NDBB 3THWB 4KJZA 1P5ZB 1U2RA 2PT5A 2XB4A 4JS0A 4LI0A 4DUGD 4J0QA 1FPMA 1E0KA 2OBNA 5FBRB 2IF0A 1R5OA 1XEXA 4ERNA 4DDTA 4GMDA 4NTZA 2F7SA 3K09C 4LK2A 3ZZ0A 4ARZB 4PC2A 2KE5A 1N5JA 4UNPA 2FN4A 3R9WA 1IJFA 5L3SA 2ZVPX 1UADA 2VHCA 3K53A 1P9NA 3QBTA 1KAGA 3V4RA 4TMVA 2IX3A 1AA9A 3AF0A 5LDDC 2ZE7A 1Q21A 4LRWA 1XMJA 3B1YA 2GJ8A 4KITB 2GETA 4B3XA 1EX7A 3FHOA 3VHXA 5JCZA 3KB1A 3HP1A 4YQFA 4QGFA 4JLAA 5GVRA 1Z47A 4KYIB 3REGA 4HB3A 4Q00A 1T3SA 3QKTA 1COWD 4Q4AB 3X1DA 1GNPA 1I2MA 2RGNA 1G3UA 5EE9A 3D7MA 5C1BA 1XPOA 2DB3A 5DI9A 3PEWA 4LOAA 3TSOA 2XX3A 2E87A 2PLFA 5EXSA 4QJ3A 2IYZA 1KO5A 2AHOA 1S8FA 1H65A 2CXXA 2RGBA 4LJ6A 4RFVA 2QAGC 4C7OB 3W6PA 1YQTA 4OK3A 2Q9AA 4G5GA 4LYFA 1QHHA 1XD8A 5CLQA 4WZ6A 1TEVA 3CR7A 4WVFA 3L8YA 2O8BA 4IOJA 4YDHB 1AGPA 1FNNA 4ZI2A 1Z6YA 2GEUA 4Z8XA 1XP8A 2ZREA 3E1SA 4TQAA 1SVWA 4IDOA 3THXA 1F2UA 1U8ZA 4NPHA 1ZRHA 2QMOA 1S4QA 4D4LA 3Q9LA 4DHEA 4P4SA 3ZIAD 4DBLC 2IYVA 1W48A 2CVHA 3CPHA 1KGDA 2ODNA 4OHXA 4QHTA 4RD2A 4Q9HA 1ZYUA 3CB4A
chains in the Genus database with same CATH superfamily
1KEZA 1GU0A 2QT1A 3DCYA 3FYSA 5CM8B 1L5GB 3QKIA 3P9CA 1EBFA 2IY7A 2HGZA 4TMKA 3TOZA 4P0TA 2B0JA 1NXSA 3RK1A 4AY2A 5EJFA 1Z3IX 2WF7A 1U6JA 2ADFA 1EYZA 4G1BA 1CUSA 1C9JA 1IIBA 2VRNA 3NDIA 5CH5A 4OI4A 4LZWA 3KDAA 4BLPA 1T2EA 4J9UE 4C7XA 3H05A 3F5SA 4PC7A 1G4AE 4WY8A 4BJ3A 2I65A 2XNDD 4MUFA 2YWRA 3EASA 3T5AA 2CFRA 4FC7A 1R0KA 2Z56A 1NUPA 1JNXX 1NMQA 1W9MA 1QIIA 3TLMA 1U94A 4EF6A 1O9GA 2VT3A 3GLSA 2HXSA 2Q1TA 3FCSB 4IXMA 3UW3A 1TIPA 2C5HA 4GD3Q 1HYGA 4B4WA 3TNJA 4IJ6A 2QD2A 5IH3A 1WWKA 1ULBA 1SUSA 1TRHA 2DPMA 5FH9A 4CT0A 3OHPA 4DPKA 4MW1A 3D64A 1Z35A 3CRMA 3BMOA 4YRQA 5HZGA 3GEIA 3HEMA 1DBPA 2WV7A 3TM4A 3NORA 1DX9A 4HH0A 2FV8A 2O1XA 2XJ9A 5G3ZA 1GITA 1WUYA 1NW8A 1T4MA 1CUAA 2CDBA 2A1UA 4ZHQB 1NBWB 5LBUA 2P2LA 4J75A 3GP8A 1JQAA 4PTZA 4J1SA 3H19A 3MJRA 5EIBC 3QTBA 2R68A 2VZ0A 2D00A 4AROA 5FDFA 2V98A 1YJQA 4H0CA 4NMLA 2I3ZA 2GT1A 1T9HA 2V6BA 2Z43A 3H1AA 3PDUA 4BLSA 1O4WA 5EQFA 3GB9A 3TZEA 4NZOA 3ZKAA 3FDJA 4CDMA 1LLCA 1WHTA 4BO4A 3R0IA 3OZXA 4CMHA 2V1UA 2YY6A 1CJCA 3DT6A 3FPBA 3S68A 4B34A 4OQQA 1XGKA 4PYOA 3MOGA 5AUPB 4NH4A 2O3RA 2OBFA 2I55A 4KWCA 3ZLBA 3D0RA 1MOPA 4PG4A 1E9EA 5MGBA 2Q5FA 3F5QA 3P9ZA 3EPHA 4O2AB 2H5EA 2J0UA 2CZQA 5FBHA 2O54A 2HYDA 4K3VA 3VNAA 3M6XA 1FQOA 2C8LA 5LQRA 2XCLA 2Q3FA 1Y9JA 2A1TR 1KYTA 4EJFA 2RH9B 1YB1A 4N4AA 1NXVA 1RE1A 3TRJA 4AO7A 4D57A 1L4HA 3FOFC 3KB6A 5AKKA 2FE1A 4PAWA 1S3SA 2BBTA 4MQFA 4EYGA 2PS3A 1Y8QB 3QLUA 5KWJA 3EGDB 4CG3A 3TJZA 1CV2A 4HNQA 4TKVB 2GS9A 1TCVA 4CLHA 4Q3OA 3ADCA 2HIMA 5JNTA 1PD1A 4FD3A 2WHYA 2XDQA 4NR0A 3LJKA 4UBNA 1E6LA 5AJUA 4M88A 4OHPA 4DV6B 2WW8A 3WL6A 1EGVB 1JI3A 1UKEA 1ZGHA 1JFVA 2G8NA 1K7FB 2ZJ3A 4IH9A 4F86A 1ZD9A 2FR8C 3MYYA 2X14A 1HE4A 5CLFA 1CHNA 1E3QA 3ZJTA 1TJ5A 1IZZA 1NP7A 1SXHA 4F6LA 3OIDA 1JEQB 3EAFA 4Z99A 3TPZA 4YUZA 1WHSA 4MGYR 1ZK4A 3CR8A 3I9V6 3FYCA 5HW0A 3DZIA 2F1JA 4CKEB 2QK4A 5DLEA 1C7IA 3D3KA 3OZCA 4BZZA 1LCIA 3M2PA 3KKPA 4IZHA 4W63A 3ITEA 3IEPA 1FNCA 1GQOA 2CNNA 1JRLA 3KX2A 1U2DC 3IBSA 2YYZA 3L4BA 5AVYA 1MAAA 1XRQA 2ZJ5A 4UAUA 2PYDA 3ORYA 3M33A 1STOA 2BUBA 3FUWA 1BD4A 3ASZA 1P2FA 3TLEA 2LNDA 1KXJA 3E84A 1D07A 1O6GA 1E1QD 1XNHA 1K75A 2ODWA 2VJAA 2ZIEA 4O33A 4UXIA 3VZRA 4WCVA 1R4AA 4RWZA 5GJCA 4DFDA 1O6CA 2V7VA 1WX1A 1IJKA 1UIMA 4A8PA 2M1ZA 2D5BA 3CRNA 1R6DA 3IMGA 2BTEA 1DKUA 2GZAA 4REQA 4I4TF 3LRPA 3AKCA 2IV7A 3LHSA 3L79A 1AUPA 5IDXA 2V3CC 3R5XA 1Z39A 4GR9A 4JL5A 4BBZA 5FKJA 1OT3A 4LNUB 2W00A 2EF1A 1RWBA 5BUZA 2H8GA 1JR3A 2YV3A 3K16A 2ZM5A 1JIIA 3NDRA 1WLSA 1FE8A 4MI6A 4X7RA 1IUPA 1PR2A 3B6ZA 1A95A 2YHAA 3B1XA 3R7AA 2G76A 3ZZUA 1U2GA 3DF7A 4ZYTA 2Q8PA 3SQLA 1P6UA 3BDAA 3E9QA 3P0JA 4PSVA 3WR5A 2D8MA 3GF4A 3ZXIA 5JT1A 4MO9A 2CLHB 3LVFO 4QRIA 1THTA 3ZK7A 4C29A 4CV3A 4YDQA 3K6SB 1K8ZB 5HWSA 1WF6A 3S6JA 3UNXA 3E9RA 3AW8A 4AZSA 1I9CA 4MRAA 5H1YA 3N2GA 4CKZA 1NMYA 2OO7A 3A7DA 3EARA 4NATA 4TT3A 5HA5A 5JY1A 2QA5A 5G53C 3VO1A 3OQPA 3ZU4A 2Z5GA 2YHUA 4JT4A 5FYQA 1JJFA 1KJQA 3DB1A 4KFTA 4XA8A 3WWZA 2VZ9A 4BFSA 2LCIA 4WW0A 3E1KA 2LCQA 3DOFA 1HZZC 2WF5A 3BFXA 4JUCA 4EOGA 2B61A 3SDBA 4ZREA 5D3QA 5INTA 2Q0HA 4ZYLA 5A6SA 3NXKA 4OMFG 3HUUA 1ELOA 3ETHA 2XA1A 3JD4A 3LZCA 1TMKA 2WHPB 3LHKA 1Q1NA 3AR2A 1GLGA 1XYYA 3NP7A 3PE3A 4GZ5A 3NRJA 4M1ZA 3WGTA 5K4HA 1QLWA 4LWPA 1AZWA 2IYNA 4GRIA 4PN7A 4GM4A 3AEUA 3PI6A 2JHFA 3EMBA 3R5FA 1VL2A 4HY3A 4QXQA 4X91A 2JRCA 3W7BA 5BOSA 5I5EA 2O7RA 1KZGB 1IH8A 8LDHA 2RHHA 2X8BA 3PC8A 1QO0D 2PAAA 3TEMA 2FEKA 1DKNA 1G7TA 2J5KA 3ECAA 3OZIA 1JL3A 4X90A 5EE3A 4YAKA 2C92A 3NXSA 3SVZA 4NZNA 2ZOSA 3L04A 5ENVA 1NLFA 5IJ0A 3VHRA 5TEWA 1NN0A 1U4OA 5LL6P 1N1EA 2PKYX 2YTZA 2V7EA 2GMWA 2FP3A 1YDFA 1QQBA 2PYIA 2Q3MA 4ZOLB 4GDMA 1JSLA 1CEEA 2GJSA 5AOVA 1DTSA 2D3TA 4OQNA 2V58A 1KOLA 2I7DA 4FZJA 4LHXA 2IXGA 2QM0A 2JIQA 2WF9A 1AQYA 3AB8A 3OU6A 1NF9A 1DTWB 5BP7A 5LVAA 1K8YB 3SEFA 2CMFA 2ZQYA 4DJDC 3ZCQA 5BORA 2VUUA 3FPKA 3K0CC 4DDKA 1GPAA 1ZG3A 2C0PA 1QH8A 2EQBA 4QNMA 1R16A 3DSRA 4RHEA 5TR9A 5KWIA 1HDZA 5FWAA 3AERB 3AUTA 3BXOA 2GPSA 2OCXA 4Q3EA 3NHYA 1OV4A 1OWPA 4YJ3F 1MKYA 4AY6A 2WYHA 5JD4A 4N12A 2C57A 3GUVA 3QE3A 4BMSA 4Z7NB 3MS2A 13PKA 2D1RA 3LI2A 4IYRA 1CUIA 3MLBA 1JHZA 1SVSA 2RGAA 3Q0IA 3RHSA 2B6NA 3FKSA 1XD2B 5FR1A 3U49A 1KEPA 1NIJA 4B2IA 3UJHA 3SKVA 4P98A 1CQPA 1T0BA 1TAQA 4A0SA 5C35A 7REQA 5KQRA 2R47A 2EDAA 3D2CA 1VB3A 3A7EA 3OCXA 1SEVA 4QUBA 2JLUA 1JA0A 1M1YE 3QVGA 1WKBA 4K6CA 2WWWA 4OBEA 4WOJA 5K3DA 4YXWD 1GQQA 4I5DA 2F1HA 2EJTA 4GP6A 1U2QA 1YRYE 1KJ9A 5A4FS 4L08A 3PLNA 1OI2A 3ULKA 2IXAA 3NI2A 1V16B 3DWEX 3O9ZA 3WLSA 3KAJA 1QM5A 1O95C 3SHOA 4KXWA 1CW2B 1NBME 1RHMA 5TC4A 4LVOA 1JEOA 2PKRA 1P4JA 1K3UB 2ORED 1BA2A 3C85A 3OQIB 1K3TA 1OH5A 1KAHA 1SQ0A 2PRIA 1NC1A 3MLEA 3K73O 1APBA 2ODBA 1LWOA 4B3RB 1YE3A 5FYDA 3KQMA 1FYWA 1Z3CA 1ZUNB 5AKEA 2JAUA 4KHPB 1ZBQA 3IAAA 4BFUA 3WO1A 3ZYZA 2C29D 3QELB 4X0EA 5AK4A 4LC0A 1R6TA 1Z16A 1U0BB 2MSNA 2XXJA 2Z8YA 3DHWC 3ZGOA 5A6VA 3SR0A 1MN6A 3C3PA 3C7DB 2QVXX 1PQPA 4Q7EA 4K6FA 5B1DA 1ISRA 4M9UA 4M36A 4C3OB 4JX8A 4PAOA 2DVMA 1N6OA 5G02A 5HEKA 4TQGA 2GJAA 4DKXA 3U7QB 2WIJA 2Q1XA 3QPUA 5G4KA 1AD2A 3MMSA 5CCEA 1ZU4A 4LF6B 3RJMA 2BR3A 4D9FA 1E9RA 5B3JC 4FBMA 3L01A 2FK7A 3AUUA 3W9SA 4LEIA 3DD1A 3IJ5A 1M6VA 4BB6A 5JXJA 2VJLA 1LF5A 1AQIA 5I7OA 3CXUA 3Q5GA 3WRYA 1W4AA 5EJ6A 1D2MA 2XUDA 1QK3A 1M2GA 1FTSA 3QQ5A 3CRVA 3TD6A 3IL2A 2JW5A 1IOVA 2Q62A 4OB6A 4BNTA 2ORIA 3P2YA 3M6VA 2Q7OE 4CF5A 4OQEA 3OEYA 3EH1A 4FNAA 3RS3A 1L5SA 4DYVA 2ZUEA 2FFBA 4DDVA 3EF3A 1QGZA 2IEYA 2PRKA 1WR8A 1FXUA 4IIYA 4TMXA 1E64A 3Q72A 4IDQA 5HFJA 2VUIB 4JB2A 1N2XA 4HKTA 2GN4A 1RJ9A 2FQ1A 3KB2A 4WXEA 3NEYA 5EGSA 2XODA 4B43A 3ZJ4A 1GR1A 5IN4A 3G7SA 1N4DA 4MQLA 5J63A 5L7YA 1FU7A 3RIMA 2BT4A 5JVDF 5DLQC 2VT7A 4L57A 5AH0A 3FGZA 5AW9A 3PC7A 1W9HA 4WL0A 4A9AA 1NPYA 3CC8A 3OZRA 4N8EA 1YRQA 5BQPA 4D4HA 3O3MB 3QPBA 3R40A 4B2LA 1N7JA 3KQHA 1T6ZA 3OQ6A 1J70A 2V7BA 3AM3A 4N5HX 2E5FA 5GGXA 4A5OA 1I80A 4I1VA 1PX2A 5JI2E 2ZWIA 1SZCA 2C98A 1CR6A 3EB9A 1RBMA 2V3WA 4JROA 3STTA 3LDHA 3JRNA 4ZT4A 2JAWA 3UK6A 3UUGA 5L6LB 1P18A 4RCYA 3BTSA 1DAMA 2DOKA 2H2GA 1U9IC 2H1VA 2II6A 4P4UA 3SS8A 2C03A 1QRTA 3BEDA 2Z83A 2Z8YM 4A0FA 4MEJA 1RI3A 3QNUA 4EYEA 1YC5A 5K0JA 1RM3A 3HL0A 3O8LA 2V54A 1E96A 3H9JA 5BURA 1ZUWA 4IGEA 3MUEA 1E94E 4RZUA 4L78A 2C83A 2JJ1A 3QWHA 2O8EB 1P4GA 5DBOA 1BCSB 2IDZA 2JLBA 1TNDA 1IEQA 4GI3A 2QN6A 4RBNA 1YMUA 3B6MA 2Q45A 3TTUA 3E3NA 2IP2A 3MBKA 3P9YA 5IF3A 2HD4A 2ORYA 1MAWA 4WN3A 4F5WA 2PX3A 5ICCA 2Y9MB 3AI2A 4OHOA 5D51S 4D6XA 4DMUB 1WTCA 3DUFB 2QIPA 5LD2B 3U81A 3KSMA 2TSYB 3QPVA 1FPQA 2FPKA 2NUAB 4N48A 1FYEA 3WNBA 4ARAA 5KTYA 3IMFA 4FCVA 1NW6A 5ALIA 3QMMA 4XI9A 2E4WA 2VLIA 1KHHA 2KSQA 3FRJA 1BFKA 1RCTE 4RVDA 1N3YA 2J3DA 2FTKE 2PANA 2LTAA 4HG2A 4N7BA 4AYTA 3FTCA 5JFTA 4Y0NA 3RANA 1V48A 1K68A 1S2DA 2R66A 3HCPA 1CIPA 4BNDB 4ZVOA 3KOMA 4KX3A 3WADA 4B9EA 2K5UA 3DTVB 3TKLA 5CVVA 2IE0A 1XROA 3BMQA 4NPCA 2GD0A 2CMHA 1EX1A 2YDXA 2XT9A 2XGSA 2W98A 2PKQO 2RARA 3PGJA 4WUTA 2CVFA 3FMVA 4Y6RA 5HGJA 3T7SA 4A10A 2VSFA 5LOVB 1R0YA 1B0AA 3H2ZA 3OPYB 4TL8A 2CJWB 3EF0A 1U1CA 4MR9A 4XW2A 4ITVA 1DG9A 3E81A 5HBRA 5AOAA 2W8ZA 4ZMSA 3HADA 5AIAA 1AKEA 2J9YB 3MINB 2PUJA 3P8ZA 5KYXA 3BKXA 2VA9A 3BZBA 2XUJA 2GEDA 4QUKA 1LPNA 3LRTA 4JC4A 5J2UF 3KKNA 4HS4A 5BVHB 2DTDA 1CUDA 5FLKA 1JHXA 1XZCA 2FX5A 1UEJA 3ITDA 3O4RA 4GMXA 4MQBA 4C22A 5IXSA 3GOHA 4GBJA 2BI7A 3NGLA 5DN6D 1JLMA 5JWHA 1BWPA 1T5BA 4ZDKA 4BKPA 3DBOB 3EW7A 1TQHA 5D00A 4RHCA 2FDRA 1SHUX 3T06B 4N5NA 3ZQ6A 4D96A 3P0FA 2VP3A 1F4LA 1NW3A 3COJA 2IY9A 5BWLA 2I2DA 4XM1A 1W96A 2ZTHA 1CD5A 1N6LA 3F6PA 3B9BA 3H7AA 2XNJA 1IRIA 1T2DA 1ZI8A 3NHJA 2ZSEA 4MVJG 3BUSA 2KB0A 1SKUA 4RY8A 2O8FB 4X24A 5FJJA 3ZDRA 1SQ6A 2FQQA 3KSDO 2BGLA 2HF7A 4UBIA 1S3IA 3UW1A 1HYBA 1LDNA 2GPWA 4JASB 1XQWA 4HS9A 4MVJH 4ZAGA 2B4TO 4JI5B 1BRMA 1JKJA 5JD6A 2BISA 4URYR 1US8B 2DT8A 1C1XA 1LVHA 1RLTA 2HHJA 2RHWA 3E9MA 3G68A 3OJFA 5JG7A 3V8NA 3TZBA 1RLUA 4MLCA 5EG5A 3IMKA 4WV3A 3Q3JB 5CA0B 2J3HA 1JB1A 1SU6A 2NOAA 1DE0A 2PX4A 3K5IA 4O6VA 4NYMR 2H1IA 5FI1B 4DUGA 2HRCA 3L3BA 1TT5B 5FORA 3PNMA 1JFRA 1V5WA 2UVDA 1I6MA 2YWGA 1CUWA 3AEQA 3ZVKA 1MT3A 5FNVB 5JOQA 2GESA 2ZIZA 2AX3A 4UJ3A 2CK3A 4XQCA 4BNZA 4BVAA 4CM4A 2B1JA 4XYLA 2QD5A 3OCWA 1LRJA 5K03A 4YJGA 3UATA 4B7UA 4EI2A 5BNZA 1QP8A 1J09A 2B30A 3IV9A 1OKKD 3SX4A 3EQZA 3ADDA 4V2UA 3O1LA 1LPAB 1Q95A 2Y0BA 1QZTA 1Q22A 2PUFA 2NO0A 1DDIA 1UOPA 2G4VA 1Y82A 4HHEA 5A7HA 1R10A 4AY3A 2AVDA 3KXPA 1GAWA 5ALLA 3RPEA 1PJZA 1QFJA 3MMZA 3SEAA 5C5EA 3L0DA 1N3LA 4M2LA 2G80A 4UM8B 1LKZA 1BE0A 2QEQA 4KGVA 1ML3A 3OE1A 2BBSA 4CT5A 1Z0JA 1DVRA 3HRKA 3DLIA 4G5RA 4IW3B 5AFSA 4HN9A 5CEFA 3RVRA 2UYOA 3U4QB 3H2KA 3DTVD 4U2KA 1F20A 5M7EA 3RK0A 4YCSA 3K5HA 4ZAFA 5ALUA 4EF4A 4EUSA 3ROKA 1S7GA 4GI5A 2CXNA 4FE4A 2Z5VA 1A5ZA 3WX0A 2B8NA 1BVUA 4BS9A 1HDGO 2JKYA 2WD7A 2PBFA 2Q6KA 4GW3A 3VYSB 4CKWA 1A69A 3MFQA 2XCQA 3E8XA 2BV3A 5E9WA 2H08A 2Q4TA 4L1KA 3O8BA 3OSZA 4Q82A 4QEDA 4PGFA 1ORRA 7YASA 1ZL0A 2DHCA 3FG9A 3C14C 2Q1YA 3AVYA 1WEHA 5H3HA 4HDMB 3LM8A 2W6IA 5FB3A 1UFKA 1P44A 1M2HA 3A6DA 2JLWA 1NUQA 1OLSA 1NPDA 3I6IA 3V8EA 1ZONA 1JV2B 4C6TA 2CNWD 4RSGA 4LFAB 1Y8RB 3QVVA 3VR1A 5A9SB 3RLIA 3VGJA 4G67A 4K9DA 4BCDA 4BWVA 1C7ZA 4FMPA 3FOCA 5DCUA 1I7PA 1N8SA 1U8AA 2GVZC 3F6CA 3G8DA 2XWJI 2ZW9A 5FBZA 4BKOA 5GM1A 4IEIA 4UNQA 2E5LB 1GCOA 1TGYA 2PT6A 1Y7LA 3BL5A 2PQMA 4I1PA 2H4JA 1AKVA 3OO0A 4RIHA 4TMWA 1QYDA 1VKRA 4IIJA 5YASA 1WDKA 4JI8B 1R4MB 4F1JA 1KFJB 3EC7A 5D3MA 3A4NA 4A16A 4LX8A 3NYRA 2XPCA 4RKEA 3Q7SA 4OTZA 4XIJA 4J49A 5LU8A 1KHTA 3PNSA 3L0ZA 3QZUA 4X93A 1U8YA 2OZLA 2FFAA 3L84A 4L8VA 4X8HA 5F7XA 3LF1A 4JSYA 2XNDA 4OIMA 1NVXQ 3ACBA 4M22A 5ILQA 2W6NA 2GRUA 1RAEA 3ENNA 4TM7A 2X6RA 1E8NA 3PYMA 2Z4SA 3TD9A 4BDSA 4DCGA 1L3BA 1NUTA 4B6QA 1NNLA 5H5JA 3PC4A 4FFLA 4B82A 3N2IA 1U7OA 1VIAA 4WACA 2HWXA 1J5PA 4E51A 3THWA 3JWEA 1CS0A 3V4ZA 1W0JD 1GA4A 1E4EA 2NV0A 2PGLA 4QJ5A 1OREA 3OX4A 3RVJA 3WL5A 1J39A 1QHEA 2QW8A 4HNGA 5DM1A 1PT5A 3T5CA 2ZROA 4FHZA 2H16A 3BB3A 1JDBC 1P0PA 3HXTA 1Q0UA 1E1CA 3OM1A 4FGUA 1GZSA 1S8NA 3ZH2A 4YRZA 2H29A 1YKSA 2A5YB 5ESXA 4Z51A 2QUKA 1XCPA 3ZXYA 2Z9CA 3Q9SA 1J8VA 3FVVA 2ZUSA 4IGFA 3HGTA 2R5FA 2OBLA 1YRWA 3G6WA 3NG1A 4GZ6A 4HNTA 1R12A 1QQTA 1ZGZA 3I1IA 4I0WB 2VHXA 1R0XA 1CY1A 1P29A 2CUTA 1NUAA 4OBWA 5A71A 2GLTA 2QDKA 4HGZA 1QCDA 1R27A 1KEEB 1KP3A 2F17A 2V7UA 1ANKA 2ODQA 4P4NA 4PLCA 1YCHA 4WJKB 2DPHA 5BVGB 1NSYA 1W2WB 3EPLA 1H6DA 1PR5A 4FONA 3VBCA 3GVPA 2P9JA 2EVWX 2X0NA 4HXEB 1QP0A 4BNVA 1IY0A 2PMEA 1LFAA 4TUYF 2ZQZA 3IIEA 4ALIA 1QPBA 3BMNA 4HBGA 3KTOA 4ND8A 1ZKMA 2X86A 3OP4A 3PD7A 3EUFA 3W77A 2VBGA 3K1AA 1SVMA 3ROPA 1T5TA 3K96A 2YL2A 3HN7A 2EJUA 1RMTA 2FEXA 2N0SA 3JQ7A 4HB4A 4MUYA 2ZIWB 4RJLA 4OFXA 4XFKA 5TVGA 2UXCB 3KYIB 2JDID 1IPHA 1E6CA 2WJ4A 3MT9A 1H2RS 1E63A 3EFEA 4FILA 4GWLA 4H1UA 4NFSA 1T13A 3IVRA 5KYWB 3CTMA 4GRAA 1TCBA 3L8HA 3G2HA 2OL4A 5JHGB 1JSRA 2FG5A 2PZBA 3I37X 3QGMA 2FFJA 3EH2A 3OX2A 5DOVA 3S40A 5TQ0B 1ZPDA 2GK3A 3FB4A 1DELA 3O95A 3MTIA 4HB0A 4HLQB 4JJ7A 1PTKA 1VE7A 4C3VA 1BS1A 4HQFA 4Q4JB 1G21A 2BKLA 3BBLA 1T4CB 5EESA 1JIKA 2MYNA 5LYYA 2NZVG 2IZZA 4BNJA 4JQZA 3H99A 3NU1A 3UFBA 4E5UA 2VPXA 3CBQA 3BB1A 1I7NA 2YWXA 4FEYA 3TQOA 1Z0SA 2BM0A 3GLIB 1XTTA 3EJWA 2AR9A 3OM8A 3MRTA 4RVFA 4EBFA 4V38A 2QI9F 4Q18A 4JLMA 5HIAA 3KKMA 4D99A 1YONA 2Q50A 2CJYA 4K6GA 1XYGA 4H6VA 4IBOA 2QROA 1E2GA 2ZIAA 4P4GA 2C4UA 2X3UA 4RV4A 2HCFA 2NXJA 1R15A 3KCQA 5SV2A 2IHZA 3ANMA 4WIAA 2A35A 5CH8A 4J2OA 4ZVQA 4UMDA 4PZLA 1I94B 4G4IA 5EI5A 1K5GA 4MYRA 5F73A 4R9VA 1M5TA 4KPEC 4HSGA 2VJKA 3ANTA 3QLUC 4RK6A 4AKTA 1QUEA 3DT8A 4HDCA 3QX3A 5BSHA 3PYXA 4HYTA 3ESAA 5F7JA 3FKJA 1DRJA 1NJ8A 4JEHA 3U62A 2GD6A 4RHXA 4Y2HA 3SXPA 1JLHA 2Y92A 3IEVA 1TCAA 3HGMA 3Q11A 5EQJB 4BRSA 4NOLA 1SUEA 3UC5A 2VDOB 1A27A 1M1NB 2YMQA 2ZS8A 3B9RA 2GRJA 3FMPB 4PM4A 2VEOA 4XD7A 5TT0A 3CKMA 4W5QA 5IVKA 2XVYA 4AK9A 3UMFA 2HGSA 5HUHA 4ZHQA 5IJXA 2Q27A 5ARCA 2XDWA 3VNSA 5I9IA 4RHYA 1ISIA 3NYWA 3QMPA 4MJ7A 1Y3DE 3GNTA 1XK6A 1XZEA 3LWNA 1J8DA 5FWYB 1ORIA 4GM0A 4OAOA 1FP7A 2R1UA 1T1JA 5LQSA 3JR3A 3IHTA 2DKOA 1Y7PA 3L4BC 4ZEXA 2OV3A 5L45A 4G0WA 1QYWA 2CZCA 2VF8A 3HV0A 3DDUA 3NRCA 1T1SA 4N9QA 4LHEA 1W5TA 3QY0A 2BFBB 1KO4A 3Q2KA 5IUKC 4EKDA 3TSWA 1W2GA 4DG8A 4H08A 1VQ1A 2JFNA 4IJKA 1FTNA 4O2AA 2ST1A 4MLPA 4QFDA 3TKYA 1YAHA 3A8TA 4UUOA 3U4GA 5JCPA 1VI6A 1XAGA 3N2ZB 1SVLA 4JVNA 5AXBA 1T5LA 3EISA 1I0IA 1K0FA 3T9CA 5ED4A 4DJEC 3T5MA 3ZE1B 2ZIFA 3OAAA 4XCXA 1EIWA 3DAYA 5JSQA 5HZMA 1AB5A 2LGJA 2OFFA 4JEUA 5F23A 4IQFA 1NI4B 1GUZA 1Y8QA 4WKGA 4EEXA 3EGDA 1J9EA 1YA8A 2AN5A 1JYEA 3RS2A 1IZ9A 3A9CA 4TKVA 2YWBA 10MHA 3MQFA 1PQWA 2BFNA 5EMLA 3ER9A 1EX6A 2IYRA 1X38A 2UUBB 2G9QA 2OLKA 4MHSA 2F3RA 1UPBA 3PGVA 4PS0A 3FBTA 4RXUA 2BZGA 2FSPA 3TFQA 1U2GC 5CK4A 5AVUA 6AT1A 3TE6A 2QVBA 5ALPA 1MLDA 4EYQA 5JLAA 1QO0A 3CUYA 4KDCA 4LGVA 2PQ0A 1JEQA 2NADA 4ZTUB 3GPCA 2V4ZA 3B1VA 3W04A 4TYNA 1YBFA 2QVCA 3JQDA 3K32A 2IRWA 3ESYA 1EHCA 2QT9A 3R4VA 1JG3A 1Q1AA 4CKEA 1ZSVA 2QTHA 3LKDA 2FSVA 4C6HA 2JCXA 3OE7D 4FLEA 2PUDA 1MP0A 3PD0A 1LUAA 5BQOA 4CE6A 1SAYA 5E0KB 1Y6JA 1GLNA 5BYJA 1AV6A 2AH5A 2ZI6A 3S7TA 4CIVA 5CBKA 4AUMA 3ZZNA 1GYPA 2QL6A 4N40A 2ZQ5A 3GGOA 3PXXA 3ZUPA 1P7PA 4N9WA 4PYQA 3TW4A 3DNMA 3IODA 5IKMA 5KOIA 1RYDA 2RHBA 4FZVA 3K92A 2O2XA 5AI6A 3DD5A 2QTTA 3B1FA 4AKGA 1S7CA 1DIRA 3B7WA 1NN3A 3GYGA 2NLOA 4RK0A 2K7ZA 1RYBA 2A5FA 2M6RA 1P9WA 2UVPA 2E6KA 2VHUA 4R69A 3ZD9A 3F7NA 2EGUA 3IT2A 1SPBS 3AF6A 2CHEA 3LY5A 4GUDA 4MA0A 2GBGA 4FU0A 2XUZA 1A7JA 4PYMA 2BMFA 2QUAA 2WJJA 3BRQA 4BMOB 1ZOLA 2DMRA 1LJUA 4PLWA 1ORVA 2LP4Y 2AXNA 4L8GA 3L7AA 5ARBA 5BSKA 2I34A 5K8LA 3PC8C 4DCSA 1HF3A 3QLVA 4LNUA 4TTIA 4EG1A 1KAOA 1VIYA 5KS2A 1MW9X 5FA6A 2GF0A 3FOZA 3DYBA 3QU9A 4D45A 4E0BA 3FFWA 1KZ1A 1E3IA 4H7JA 3WAKA 3O9MA 1I4OA 4DIEA 3PGXA 1MA0A 1XU7A 4ZMBA 3RYHB 1IG3A 4KGDA 5SYNA 2HN9A 8MHTA 4XX1A 1O97C 2QN2A 3AJDA 3K6SA 3CLVA 4V3BA 2ONZA 2VDNB 3CSUA 3ME5A 2GI4A 2E6UX 4P5EA 3UPUA 2DC1A 4Y1RB 2VDKB 4BGDA 1T0JB 3H6KA 4UD2A 4C9BA 5BY2A 3N86A 3FUUA 1V96A 1KZ6A 5DX1A 3H9BA 3K9NA 2QTMA 4UDXX 3LA8A 4OJQA 3WIOA 4RWEA 1ACLA 2WWVD 2WIFA 4D9CA 2QU8A 2Q4EA 4N03A 1V7ZA 5C1OA 1SUCA 3A36A 1GILA 5DDIP 1PN3A 1V45E 3CPSA 4GZ3A 1E9BA 1UBHS 4C4RA 5JMWA 4BE9A 1UFOA 4W82A 4EHDA 2RSLA 3EPKA 3MXTA 4PYLA 1IB0A 1N7IA 3VC2A 1FFBA 4HI0E 3GLHB 4KV7A 4LPKA 2X22A 4OATA 2ZXUA 2IPNA 1TX4B 1P9LA 1RC8A 4RMGA 2OEPA 2RBGA 4CUKA 4ZQBA 5ICSA 1XHEA 3IR7A 2A7XA 1OXUA 3D6UA 3QM1A 2CLOB 3F7OA 2CLIB 1QRUA 4EFMA 1NMZA 5DHAA 1BEUB 2CFOA 3U09A 4M0MA 3HQ4O 4A8TA 2IW3A 3IT1A 4JT9A 1YAJA 2P77A 1H6BA 2FR1A 3EPJA 2W8BB 4E5YA 1E5DA 2Q5IA 4F06A 2C2GA 3RVBA 1O0BA 1H05A 5B64A 1GNTA 2P9GA 3CH4B 3I58A 1ADCA 2AQKA 3WLAA 3KO8A 2VH2A 4ZVSA 5D1HA 1EB8A 1SCKA 4HDQB 5ALQA 3GAMA 4LF4B 4H7IA 3X1KA 1GCGA 4R1MA 5FOSA 4EW3A 3F8WA 1FDUA 5L4SA 3AILA 4JBHA 1KK3A 2HU5A 1T6NA 3RADC 2Q28A 4B3IA 4QDJA 2HEIA 1YS6A 3N8NA 1DJMA 2HXGA 1AIPA 1JXMA 1OJ7A 4P2GA 5DBEX 5LDGA 4ZOLA 2WSSD 1NW9B 2MSWA 3V6LA 4Y2SA 3M49A 4D9IA 4UASA 5FQNA 4BNGA 3U26A 4LF7B 1QU3A 1NA5A 1OVGA 1U7PA 3DPUA 1DTWA 3DXYA 3Q0EA 2A59A 5EP2A 4A92A 4QSHA 3NGXA 1NL3A 2OY0A 5C3MA 3IV7A 1OFIA 2FEOA 2ZJ6A 4FZ3A 1UINA 3KKOA 2JI8A 2OOSA 3ESQA 4Z9FA 2CMKA 1P91A 3AERA 3MWEB 3KEGA 1AGXA 5C8XA 2C2XA 2G28A 3PFIA 1ATZA 4FNGA 4GPD1 2AEMA 4MWEA 4RL6A 5JSYA 3TR6A 4ARUA 2GNAA 2YZ7A 4TV9A 2Q1UA 3ZDDA 4Q4LA 3RS5A 1K08A 4BYGA 1TA9A 2AG5A 2EL7A 1XMQB 3PEYA 3GVCA 1JU9A 1C8LA 1N92A 1XD2A 2XD4A 4UE6A 1D4FA 2I2BA 2JFXA 1VI5A 3DAGA 1FW8A 3AUJB 4LECA 3AESB 3WRYC 3ZNOA 3HJFA 1AHIA 1TM2A 3IR5A 4AN1A 1OYOA 1YBMA 2YMMA 3AEYA 1A71A 2Y99A 5LSAA 3KQUA 1TVCA 4XH9B 3DMGA 4URUR 1U8EA 2IYFA 2W37A 4J7AA 3WE7A 5J2TB 3SYLA 3ZYCA 3PXUA 3OIFA 4D0NA 1JHOA 1WUIS 5EJEA 3S81A 3OOWA 3FFBA 4E46A 3FNHA 1V16A 4KW7A 2HBYA 4DLSA 2JCGA 3MWKA 3VXKA 4KE9A 1M6EX 3C8HA 3M7IA 3DE2X 4GS5A 3A10A 3KQOA 3WDKA 4DR3B 2ZBGA 3ESXA 3HJRA 3TLXA 3OQIA 3PLAE 5BSGA 4HH4A 4R7GA 3QXSA 1ONNA 1KTVA 5DHFA 4P22A 2C2BA 2OBMA 1BOOA 3I0ZA 3PKIA 3EOZA 3LL7A 5KOJA 4QYSA 3CGWA 5L3VA 4TN1A 1HNZB 2JFYA 1V9CA 4FFPA 1ZUNA 4PO1A 2WIDA 3IMCA 3V00A 4PVDA 3UMJA 1JQLB 3I4FA 3KD3A 4PBRA 3QELA 5FWXB 4YV7A 3R77A 1JSCA 2EKDA 2FEWB 4FR0A 4QAQA 2GXSA 2I3DA 2ON6A 4AJKA 1E2HA 4CN8A 2I4IA 1EUQA 2HF9A 3BFKA 4LAFA 5HNKA 3T35A 1G63A 3ZI7A 2Q8NA 4YC7A 3V2IA 3ZHOA 2QNBA 1YO6A 3DP7A 3GJ3A 3VR5H 2V0GA 4FMDF 4WEOA 4XUEA 3U7QA 5GWXA 5DGIA 2VPQA 1FJXA 3FCOA 3DBHB 2AK3A 5TNXA 3KT6A 2BFAA 3BL8A 1QLHA 2MYPA 4KXXA 4L5CA 3OT4A 4JI4B 3R7BA 4BVEA 3TUZC 1VYHA 2WK1A 3FRIA 1JDVA 3VDNB 1QVRA 3C8ZA 5KNBH 1QVVA 3V1KA 3DDWA 1A9RA 1CNEA 3L93A 4Y1GA 1Z4PX 4GO1A 4P3PA 5TMDA 1OH6A 4L2IB 2XVZA 2A5GA 3QJYA 1QIKA 2H92A 2HI0A 2XZPA 3SF0A 2UDPA 2V6IA 4GX2A 3VU1A 2QYSA 4IL5A 5D87A 3E35A 4I50B 1GG5A 1OT5A 2WUGA 1GGKA 3B60A 2OXCA 3GEPA 2WD8A 4INAA 4WAUA 4L7VA 4H27A 1TTQB 4X84A 4DV5B 4NX2A 1XUOA 3REOA 2CLCX 3CU5A 4GX5A 4V0SA 3GIWA 5CA1A 3Q3IA 2QXUA 2JG3A 4YPOA 5DN6A 2ZE8A 4N49A 1A76A 2F6RA 4NG4A 4Q24A 5K99A 3LL4A 3WB9A 3U7RA 3LUKA 2ZUVA 1FFAA 1QVZA 3IHKA 2EFDB 1NVVQ 2LDXA 3I01M 3PK0A 3TTTA 4ZAWA 4UHJA 2QMYA 5DZSA 4O2BB 2H63A 1G7RA 3OQHA 3LBAA 3WLOA 4MS4B 4E1VA 5LDHA 2VPZA 1J5EB 3RQIA 5JWOA 1UM8A 3HR8A 4ZV9A 5BSRA 1JW9B 1JVNA 1BMFD 3BWXA 3LWBA 3W3AH 2VP4A 5GJBA 3MRVA 2B4RO 1W5AA 4DPMA 5TMBA 2LKCA 3KYCB 2GUGA 3PHGA 1E2QA 3N6RA 1XN4A 5A9TA 1E2PA 3OFND 3RYFB 1OX6A 1Z2OX 3HFRA 3K2QA 3AIIA 4LNAA 3KVNA 3QVJA 1VMAA 1XRSB 2R6ZA 4QASA 4Z53A 3VTAA 1A77A 3H9EO 3T7RA 4D3FA 1Z0DA 4NU8X 4DIFA 3MJTA 2QJFA 4N82A 4JMLA 4K6MA 3DBIA 3IKTA 2FHPA 4HRXA 4W9NA 2YVLA 5DWDA 4G23A 5EPEA 5TSDA 3AEZA 3LTEA 3WYGA 1GEEA 4OP3A 2J31A 4UDNA 2O8EA 1BCSA 1R3DA 3HLTA 4R2XA 2OQVA 1Y81A 3S2IA 3RS0A 1FMJA 4F85A 1MC5A 2PQ6A 5HKBA 2QP3A 4QXMA 5MN6A 1M0EA 3Q6IA 3RF6A 3UV6A 3I6QA 4CEJB 4INZA 1G8KA 3TAHA 2AXPA 4GPTA 3LGAA 5G0TA 4JELA 1AT1A 1MNAA 3DUFA 3P2MA 4TOIA 3T7AA 1U7HA 3RC2A 4OGLA 2I76A 4QYXA 5A04A 2NUAA 2YVKA 5AHRA 1Z6PA 2J08A 2YV2A 3REFA 1FFEA 2HSDA 4FKMA 4JI1B 2PH1A 2AJ8A 1IN6A 2HUNA