1NBWB

Glycerol dehydratase reactivase
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
113
structure length
113
Chain Sequence
PPGVRLFYDPRGHHAGAINELCWGLEEQGVPCQTITYDGGGDAAALGALAARSSPLRVGIGLSASGEIALTHAQLPADAPLATGHVTDSDDQLRTLGANAGQLVKVLPLSERN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GLYCEROL DEHYDRATASE REACTIVASE ALPHA SUBUNIT
publication title Structure of glycerol dehydratase reactivase: A new type of molecular chaperone
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 31
structure length 113
sequence length 113
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02288 Dehydratase_MU Dehydratase medium subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 1nbwB00
5D5QA 3WB2A 1EEXB 1IWPB 3WB0A 3BRCA 2D0OB 3AUJB 1EGMB 1NBWB 3WB1A 1IWBB 1UC5B 5D5PA 1MMFB 2D0PB 1DIOB 1UC4B 1EGVB
chains in the Genus database with same CATH superfamily
3KPUA 1H9CA 4GPEA 3H0KA 3R6LA 1AHHA 4IEEA 4DIFA 1Z6XA 4JL5A 3R23A 2D06A 4L4XA 1IQRA 2OCBA 3MEQA 2R66A 3EA5A 3S68A 3M5WA 5TT0A 3RK4A 1NQVA 1U3GA 2XNSA 4N7MA 3H5TA 4PFJA 4YRQA 1X1SA 2Q1WA 1Z18A 1I6WA 5KVQA 5THXA 3VPGA 3WXBA 4Q1CA 4MVJP 5EZYF 2NU6A 1L4BA 1SIOA 1L4LA 2XVZA 1FW8A 3E9EA 3HKEB 1H2WA 4J07A 2D54A 2WPNA 4FHCA 4JFAA 4P5PA 1PS0A 1E7WA 3PWSA 1JALA 2YMPA 4AWAA 3DV0A 2DUJA 2PS3A 3ZWKA 1SXIA 4GM1A 2E3JA 2GTIA 2VPQA 3VX3A 4CM3A 4DSAA 1TT7A 1ZRNA 2X4DA 4HXYA 3ET4A 3WK6A 3U3MA 1QCDA 1OH8A 4D4MA 1VL6A 2G70A 1Y1TA 2HBQA 4B1FA 2LCQA 5BNZA 5ED0A 1LVHA 4F8YA 3IQDB 1BHO1 2EGHA 2PXHA 2ZYVX 5CNKA 3I6BA 3NTUA 4KQWA 1QLHA 5C4GB 3U3KA 4A36A 5EJIA 3H9UA 2OXTA 1ZK0A 2C2GA 3D02A 1HQYE 2PPVA 1L4GA 3OOWA 5EIWA 4YT2A 1WW2A 1XZQA 5LKAA 1EVKA 2G6BA 5TDHA 3JQ9C 3P0FA 1CFZA 2ZJ4A 3F2VA 2FMIA 3JQEA 4MEAA 1UDWA 5FF9A 4H08A 1BKYA 1BDBA 1VPVA 3AU8A 4BNVA 1WQ4A 1IOWA 1LPSA 4TROA 5BQXA 5E2IA 2HBRA 4ZCIA 5LXTB 2YDYA 4B40A 1XYGA 3U4QA 4QELA 3PP8A 3GU3A 4ALKA 1PJQA 8ATCA 1JFFB 3D8UA 1Z6TA 1AQUA 1ML3A 1M74A 4CBVA 3KZCA 4FHFA 2Q41A 1O9HA 4P36A 2D1TA 3IAFA 5CM8B 5ENVA 1DBIA 3LH5A 2NUPA 3RC9A 3AUAA 1WUIS 2ORIA 3GLFA 1BWRA 3ZLTA 3MMNA 4XGNA 1M2GA 1A9ZA 4ZOBA 3W2HA 3RF6A 1XXHB 2QAIA 2C2ZA 4MB0A 4WNYA 5CYPA 3ZW9A 4OP3A 2R5NA 3PHHA 3BSFA 5TARA 5LFAA 1L4KA 1ORIA 4N5DA 4Z2AA 1ZVVA 5BWMA 4BQFA 2P68A 1VPTA 5BV0A 5TY0A 1N3LA 1NW5A 1HYEA 1JQLB 4E08A 5K3BA 3OKAA 4JMLA 2RHCA 5DDIP 2WPDA 3HSYA 2WU1A 3ME5A 4B2IA 4COKA 2OZPA 1PX2A 1Z2EA 4EBFA 1Z63A 5EPEA 2HSEA 3OT5A 3QPVA 3CPEA 1P33A 1U1GA 4EWLA 3S1AA 1DKPA 4OBBA 2GCIA 5EWJB 1O96A 2R8EA 2PXAA 3RHTA 3FF1A 2UZAA 4UBOA 3S1LA 3A1TA 4MULA 3ZGLA 3G6WA 3RS8A 4GRAA 4O0MA 1QDUA 3UAVA 4BE7B 1E66A 4GEKA 1YRAA 3S1SA 1YKFA 1CZRA 3CLVA 3OICA 1L7OA 3HCOA 2E5WA 4HH4A 2OYRA 5E8JA 3WLJA 2YWXA 4ZRMA 4ZYXA 5BQFA 3B3QA 1SXJD 3PA6A 1LS1A 4I2NA 4D4JA 4NTZA 4P4UA 1VZ2A 3DW1X 4L4YA 4RJIA 1FTSA 3TSZA 4ESVA 3WIOA 3BGOS 2JI6A 2CXSA 1CQJB 4AJ2A 3TB6A 4DMUB 2HRZA 4RQAA 1BX3A 1L7DA 5DGHA 4RCZA 2EBWA 3MUEA 3S0JA 2O5EA 4KRGA 2VQ3A 5JADA 3W90A 5LP6F 3R9KA 2PV0A 1GRRA 4GHWA 2V6FA 4L4UA 3TIXB 3GLGE 1NQWA 4WY2A 3T3OA 4AIIA 4M0CA 1MB0A 1KPHA 1FFHA 2BUBA 2YHIA 4RIIA 4QG3A 1W2WB 3L46A 2RJ3A 1Q7EA 1RWNA 3GLHE 2H1VA 2IH2A 3WGNA 1PFKA 1C0EA 1HSOA 3AHEA 5ESRA 3RYIA 1XROA 2V03A 2O8EB 3BK7A 3CH4B 1R4MB 2C3PA 1F2DA 1TLFA 4XVHA 1ENOA 1ZNWA 2PLFA 3IIEA 1GRQA 1O5TA 3ILXA 4GXRA 4IDOA 1EUCB 4KTVE 3EBLA 3IJRA 1VGQA 5DMXA 1GPWB 4JVOA 3W5AA 2PUEA 5F64A 3ACDA 1UMCB 4AS3A 3C3XA 3H7AA 3AB7A 3NOQA 3UHPA 1YDFA 1G9TA 1M6YA 3CSDA 3CZRA 4YJFA 3UXYA 2W83A 3JQBA 4CGZA 5CDFE 5D7BA 2ACKA 4DV5B 3ETGA 1II0A 4DIBA 2XKBA 4Q9KA 3PNSA 3PX7A 1C0LA 3K35A 3CBGA 1FZTA 1A7UA 1EGMB 2Y1GA 2YZ7A 3JQAB 3KQWA 3SEZA 4B6SA 4B3TB 1UPCA 7MDHA 1UM9B 3GFRA 1NC3A 4KDRA 2P6NA 3LBHA 3P9CA 4LF8B 3L40A 3HJRA 2HPAA 1ZCZA 1D7AA 4HNRA 3QV1A 2VDMB 3NBFA 3GEGA 3OBIA 3C98A 3G9UA 1Y1LA 1TUIA 2N3ZA 2WYWA 3VZRA 5HOEA 1NOJA 2P1RA 3KYIB 1L4HA 3K9CA 1WNFA 3UH0A 4NFLA 6YASA 1GA6A 3JAWA 3VR3D 1CB7A 1L8AA 1QWOA 1Y7IA 2EQAA 3DE6X 4NEHB 1WAMA 5K0FA 2QLJA 3KM0A 3EULA 3HCBA 4B75A 5FQNA 2QR2A 1W2HA 1U6KA 5KTPA 4ITVA 3Q2OA 4NLLA 1NUPA 1WDMA 1XU7A 4WGGA 1Y37A 1PFVA 2PANA 4B71A 3ONWA 1N25A 1BVHA 3EFOB 2EHJA 2BGGA 3NPAA 1DXOA 1K75A 4I8DA 1AA6A 4ZAVA 3IQXA 1CD5A 2ZBVA 3OOJA 3HM2A 1P0FA 2OZKA 3DJYA 2F48A 3S7ZA 2BKLA 4YACA 3EFEA 2HU2A 3JW8A 3OZTA 4MO9A 4UHJA 3JRWA 4GECA 5I4CA 1WUKS 2ZSBA 2MHCA 3IQZA 4J0FA 3RAJA 4QUKA 2IEZA 2C2KA 3IP3A 3TMKA 3I32A 4FGJA 1JKIA 1OI2A 3ZQKA 5BNIA 3TX2A 5DYNA 1PP4A 5KYNA 4V1CB 3O94A 1BG6A 1RFLA 4MGZR 4HZUB 3CE9A 5IVHA 3OZXA 1ID8A 2BZGA 3HVIA 4PC1A 2AC4A 4IJ5A 2IU6A 3GFTA 2H63A 2A92A 3UXHA 4NYMQ 1MHTA 1G8KA 1Y8RB 4QEKA 5FJIA 3TPFA 3HA7A 3T4EA 1XTBA 4RV5A 4ADSG 4ZK6A 1FQWA 2ORED 3K0AA 4MWOA 1W1WA 2QMQA 4YIKA 4F91B 5E9JA 4A0RA 1YCFA 2BEUB 1FDIA 4HQOA 4W7SA 3QWAA 4C29A 3PSHA 5I45A 1H6BA 1X9GA 3IAXA 4R9SA 2VS1A 3DKKA 3VTZA 1Q44A 3UT5A 3ER6A 4C0KA 4F6LA 2G63A 2J5RA 1P2TA 3R7WB 4N3BA 1EM6A 2LVBA 4QOSA 1NPTO 3C0KA 1QYVA 1L6IA 1GCOA 3IEMA 2W00A 3DV2A 3CVVA 3GVCA 4L0QA 2D00A 3SC3A 2QVZX 2HJGA 3JD2A 2ZANA 2WU8A 3IUPA 1PU2A 3EIQA 1M1YB 1MNQA 5G1OA 6REQB 4BJ6A 2DFLA 1UEIA 4PAMA 4UASA 2DJ5A 2HQRA 4QUBA 3OOHA 4P22A 4LHZA 1XVTA 4DLWA 1JE1A 5H70A 4QYIA 4PYLA 2GZSA 5I7RA 3QLUA 3SLGA 1UM8A 1ADYA 3UANA 4CL0A 4RE5A 1X7YB 3FZYA 4G24A 4PWZA 2CNWD 1XX6A 3DBHA 4II7A 2PL1A 2W8ZA 2WVAA 4P92A 1JIKA 4Y30A 4F04A 4U2FA 3AMVA 1JDSA 1GWNA 1VFNA 2JH9A 1ABBA 4O0LA 2AA3A 4Y18A 3LQ2A 3I6ZA 5J59A 4C3VA 2IXEA 3CUKA 4K6FA 4LTDA 1UL1X 1IQUA 1J09A 3G1TA 5EJ2A 1OAAA 3SIWA 1AC5A 2VNIA 3H1PA 5JCOC 5K09A 2LKDA 3CKYA 2JFZA 2PSSA 4LCJA 3SHOA 2WMDA 3WBKA 2BDEA 1TZKA 4Z1OA 3A9VA 5D3ZA 1U9ZA 2XYGA 4CXMA 1ZNZA 2C94A 9ATCA 1KDPA 1Z0ZA 4JEHA 3ZWOA 4AY5A 5HW0A 1RHJA 5KTKA 2HC9A 1PSDA 4GX0A 2QKYA 5G02A 3I45A 5C3MA 3HP7A 4RQUA 5ALZA 1W73A 5BT8A 4Q34A 4XWOA 5H0IA 4GWLA 3N5KA 2IZOA 2PWYA 4QUAA 2HXGA 4KRXA 2XGJA 4FGUA 7YASA 4BV8A 3NOVA 3PNQA 3GBSA 2RAPA 4W5JA 2QTVB 3HFGA 3MERA 1Z0KA 2XNKA 5TXGA 5DNAA 4L6AA 1BEEA 1E6CA 2CZCA 1JFVA 3PPWA 1ZH2A 1IJFA 1T8UA 4I46A 1POWA 5AM4A 5HSGA 4BMYA 1KEKA 1R5NA 5DV9A 4MO2A 1TJ3A 3RVSA 2E9SA 3OFNA 2G1PA 1LLFA 1ZW1A 3MAGA 1OVMA 4N3GA 5IYZB 5C7YA 1ESZA 3QF4B 2CVOA 2ZGVA 4BNDB 2ODNA 2G5GX 2B4KA 4UD2A 3MXTA 4QHYA 1NVMB 1WSWA 3TQOA 3EARA 3EDYA 2RK6A 3L77A 2MTBA 4XLZA 3L0OA 4B17A 2NZWA 3GC6A 3F3SA 5ICSA 1LBIA 3QEKA 5ENDA 3V1NA 1RACA 4D42A 4EFNA 4FYMA 4MKZA 5F7XA 3ZZ0A 2PQ6A 5CITA 5B58C 4NI5A 3MUNA 3PQDA 1J8FA 1Z17A 1R9NA 2B4AA 1XDGA 3SZLA 1F2TB 1QH8A 3LYHA 1DAGA 4P8RA 4CIXA 2M1ZA 1W0KD 3PZBA 1KY5A 5LYJF 2E49A 4E12A 4LFAB 3FPLA 4Y1GA 3ZOZA 4MHOA 1MIHA 1N7JA 1VHWA 4U7PB 1BGWA 1B42A 2PK3A 4XJVA 2PKRA 2XUDA 4XLLA 2M6SA 3U7QB 3ZYZA 1UBGA 5KYUA 2PVCA 3NU1A 3KZXA 4EJSC 4JVSB 5ARBA 1M34A 2XCQA 3PD1A 4OU5A 1PZXA 4NBUA 1N2CE 4JVLA 3CFYA 4ZCLA 4YJ2F 2B83A 3QSGA 1OZ0A 4R2XA 3KJNA 4DHWA 4LJ7A 1W44A 2X41A 1P60A 4QDOA 2NXCA 5K3EA 1FQKA 1Q0QA 4B73A 2YVLA 4Q66C 5KTNA 2VNKA 4HRYA 3T7EA 3PTZA 2J7PD 2ZQ5A 2D4HA 4LSMA 2F9FA 4ZV7A 3T38A 5AVVA 3M4JA 5TMEA 4IH1A 4B44A 1O8BA 2AGVA 2GK3A 4X8MA 3TGPA 3JS5A 1WG8A 1DDIA 2GEJA 1SG0A 2QQ0A 2YHSA 2XA9A 3EIHA 1KYZA 3H3XA 4FS3A 4DXDA 1C4KA 3D8SA 3NHMA 1Y3CE 4ZO7A 5D84A 5F78A 3VMMA 2Q28A 3ZY5A 2AKYA 2RH4A 3PDCA 4B7AA 2W4QA 4OA5A 3H8SA 1JQ3A 4HB3A 4PHCA 5A2QA 2PBLA 3P5SA 2JGMA 2Y0PA 3MJSA 2ZWPA 4ZVVA 1LVUA 1JDVA 2B5WA 1QRRA 1Q16A 1XD2B 3AHGA 4JVNA 5IARA 1AQJA 4RD6A 2QNRA 1C0KA 1Q3HA 3L4BA 1EFPB 4NBWA 1JIUA 4W5OA 4EITA 1KYWA 2BZSA 2VYND 4J0QA 1TUBA 3RUPA 1DQZA 4X91A 2R7NA 5C8ZA 2BFEB 4EIWA 1R6AA 4PGFA 2NYVA 2OBBA 2ZJ5A 4YRDA 3VSEA 1KZ1A 2SECE 2OB1A 4Y6PA 3RU2A 2ZT7A 4Z7NB 3I39X 5JVDB 1RLTA 3OCJA 3WFIA 4J4TA 1RM5A 3FKSD 1B73A 3FHOA 3GAMA 1ELOA 3F1KA 3LOQA 3FETA 4Q01A 3R7DA 3ZNOA 1OX4B 1E1QD 1ZUHA 3WGVA 1RT9A 3LP8A 5CMLA 4OXRA 2E21A 4Y2YA 5BWBA 3CLRC 4MUIA 2X0IA 1Y42X 2ZUSA 2H4ZA 4A0FA 2XCSB 2XKAA 4R1NA 4TTAA 1GN9A 2B8NA 5AJWA 4P83A 4PZLA 2C83A 4D4LA 2H4HA 3PGMA 2WD7B 4RDCA 4G5XA 5GIPE 2P90A 1HBJA 5FOWA 1IEQA 2FZ5A 2G9ZA 5DKFA 2HWKA 3DC2A 5G3ZA 5TVKA 1V26A 3F78A 3SF0A 3HJGA 4ACBA 2FGKA 3KT0A 1E92A 2P3SA 4CM4A 1JJAA 1G8JA 2H59A 3G5TA 5IFKA 4YX9A 5NULA 2ZRFA 3ZJVA 2AFIA 1XRRA 2B7BA 1EXWA 1SHLA 3DCYA 4NBRA 2F64A 4ZVOA 3Q9LA 2PX0A 3OZAA 4ZA2A 4EB0A 3PE3A 4CQMD 2JGIA 4CKBA 3U2QA 3A1WA 5BN3A 2C7RA 3ZBQA 1VLHA 3OCWA 3T5TA 4FFOA 3S29A 3TPZA 4MUJA 4P33A 4QYTA 4RTKA 2BBOA 3JD3A 1I4EB 1JYEA 1Z36A 1KI7A 3W4IA 3P9NA 4R84A 2ZRLA 4R16A 4KV9A 1GITA 1MJHA 3A3PA 4MS3B 4RXTA 4RH3A 5F76A 4P98A 4BQOA 5J4VA 4U7DA 1U1DA 4YMGA 2O50A 1G20A 2ZJBA 2PS1A 4IF6A 3F98A 4K9DA 4E2XA 3T3IA 1DWPA 1EE9A 2OPHA 1F12A 1NPDA 1SKYE 3JRXA 4C5AA 3GB9A 2XJ4A 3EA0A 1JKMA 3PQ8A 2ZR0A 2PWPA 4DS3A 2VHWA 2ZKLA 3L6OO 1Z8FA 2VT3A 4MVJH 2WSBA 1QPZA 3CPSA 2C78A 2XIJA 2AN9A 2AWNA 2YXEA 3GNTA 5AWFC 2K5UA 3AG6A 4AJJA 3FFTA 1NRXA 5EXPA 4QOIA 1TYCA 1LGYA 4DDKA 5BY2A 3Q7QA 2O1WA 2D7CA 1ZRMA 3ECSA 2HA5A 3K3PA 4HYTA 4IZ6A 5DPMA 4IOMA 1XMPA 5K51A 2WMOB 3MC1A 4LUCA 3WLHA 1H93A 4Y2JA 2VDRB 4PLCA 2J9FB 3HE3A 1U0OC 3I62A 5COBA 5A3JA 3DXZA 1BGVA 1KBOA 3UJBA 3WNBA 1G1AA 3HXPA 2KE5A 4XJSA 3S55A 2WU3A 3HMKA 3OMXA 1ND6A 5CD1A 2MSCB 3TNJA 5FPPA 2Y9MB 2FWRA 3N8GA 3TRHA 3N2ZB 2XDQB 1OLXA 3LHSA 3WYDA 3KFXA 1J7JA 3LQYA 3LUAA 2GNPA 4GGMX 1SXQA 3K1AB 1LA2A 3PGA1 4RPJA 1U80A 4KR9A 2RHLA 3E7WA 1NRIA 2K2QB 1VKNA 4D0RA 2VZ0A 1S2LA 3FZQA 2XT9A 3TO5A 1GV1A 1E7QA 2ZSIA 3WYNA 1HYHA 4RGYA 5GV8A 4U6SA 1XEAA 3PRHA 3ZK9A 3MWYW 4RQBA 2FW0A 4IW3B 1Y5NA 2XUOA 5E7IA 1VLQA 2Q9CA 3NUGA 1U63A 1Y33E 4QU0A 1RRKA 1VJ1A 3B2QA 4J1TC 221PA 2H5IA 4WZ6A 4GFDA 4AF6A 2Y1KA 2C3UA 2JJ2A 2I6XA 3V9AA 1KK1A 3S8EA 5DH9A 5HVNA 3GLFE 3GNSA 3VI3B 1B14A 1KAOA 2YY6A 3OM9A 4NBVA 3LVRE 2BUCA 4FCVA 3GEPA 2JFFA 2PYZA 1WD5A 4M1QA 4KVGA 1XZBA 5DI3A 5EJFA 2FDXA 2B2CA 1ST3A 4GMKA 2DPHA 5FNVF 3C3YA 3F6SA 5T8KC 1MZPA 3TRJA 4XGKA 4AS1A 4CKYA 1XKQA 3KUXA 2HQSA 3FPHA 3W4KA 2IXGA 1NAIA 2R11A 3C6MA 4JEMA 4LBWA 1QC5A 4DMGA 2UYHA 1U7PA 1UOEA 4ZODA 2BE9A 5HJEA 3DKIA 1V45E 3NX4A 3FJOA 5AUQA 1G5FA 5JZOA 5AVOA 3R3VA 1B26A 1P61B 2D2EA 3DZDA 3IEVA 3M5PA 4ZT5A 1CK4A 2QAGB 1U4OA 1LTHR 2Y68A 3HR4A 3RU3A 4A26A 2GBFA 2L2QA 1R0KA 4JEUA 4X64B 2V3WA 4F9GA 2EKZA 1EEHA 4JOCA 3JQ6A 5TPZD 1N2IA 2VJOA 3IAEA 1YWGO 4MRMA 5EP4A 2QN7A 1KDZA 3KU4A 5CXSA 4LXUA 1NP7A 1EFHA 4MDYA 3U4AA 5KWIA 2H1HA 3RS2A 2R7KA 4RAQA 3VGPA 2FQYA 1EWTA 1COWA 3X1ZA 3E9YA 2ASEA 2C4WA 2NU9A 4CM5A 5H68A 4C7MA 1RPJA 3CYFA 1VDZA 4FHGA 3A9WA 1Z8HA 4ICIA 3I5YA 1E5VA 1CS4C 3A7EA 4ZMRA 1VRVA 4JLNA 2QU7A 4BVKA 1XTKA 5KNBA 1G21B 1MP0A 1SU6A 1LSSA 3IVGA 3Q15C 1H69A 4AU1A 1QGYA 2N1MA 2PNJA 1YB4A 5KTTA 4KXVA 3PFIA 1P9LA 4FIDA 3RS0A 1VM6A 3F6RA 3HU1A 3U16A 4D26A 2O8CB 1VL2A 2YW2A 4XA8A 3I37X 4KXQA 2XA2A 4WN9A 3ZG6A 4G2TA 2R6R1 1GEGA 2D6FA 2ZRHA 4J0EA 5IKXA 3CLRD 3TW8B 2HDWA 3SM3A 4DRYA 3RGWS 5FBWB 4MS4B 1W30A 3KUUA 1EFAA 2OY0A 2Y0DA 4RZQA 3ZHTA 4MVJG 1QJ4A 4GP7A 3B78A 1ZKMA 2GPBA 4LX0A 2ATCA 2PMKA 3OA0A 2XZPA 1GRVA 3IT3A 4HSGA 3T99A 3BWBA 3DHNA 5HDBB 1K68A 5JLJA 1J9GA 1XVLA 3VKFA 1NLMA 3JYPA 2Z2JA 5TQVA 5LA6A 4OPMA 4C4OA 1P4SA 4OQQA 1AO0A 3MCWA 4H7IA 1PR4A 5TB5A 1QZZA 4DWVA 1SQSA 4WBXC 1EH5A 3R8XA 1OI4A 3CBQA 3CH7A 2GD6A 2JLRA 1RJFA 3SLRA 4O08A 2XTJA 1ST2A 4TOIA 1IN6A 1NVVQ 1DX9A 4RH1A 5YASA 4U2GA 1WP4A 4M76B 3L5KA 4GXQA 3F9IA 4RDXA 4KO3S 5CJ2A 4BV3A 3ANLA 5EJEA 1HFEL 2GXUA 3IHKA 3TIGA 3TZCA 1JDUA 1K27A 3BGVA 4UAVA 5EKXA 2V74B 4M0EA 4GOJA 5JNVA 1YJXA 1NJSA 5JFOA 1YRQA 4TLEA 3LX6A 4ND7A 3Q8XB 1MB2A 1RMQA 1DVRA 4Y2TA 5B2FA 3U26A 3W05A 2V0CA 1P44A 2AG0A 2HT6A 2F8LA 3RW9A 3NVKI 3QHPA 3P9PA 4I5DA 2O3JA 4FSHA 1Q14A 5IZCA 1KDRA 4IWYA 4NE9A 3QQPA 4GM4A 2AHOA 3U1VA 4DM7A 3PGKA 1WQ1R 4YFYA 3N0VA 1WCXA 3OO0A 4FLMA 4QU9A 5L9AA 1EUZA 4Z4HA 3ZNPA 3B7PA 4U2DA 4DLKA 2ZREA 3ORQA 2IOQA 4JOBA 4D97A 1YCHA 1JAIA 1JL3A 1UFQA 1HOXA 2GAAA 2WNHA 4KN8A 1PKXA 1Y3BE 1P7WA 1TJ5A 2CLCX 2VNJA 1FVFA 1UKCA 4MWBA 1QGOA 4CKCB 3H9GA 3NVDA 1V8OA 5J5CA 1OIWA 4QE3A 2QG4A 4P53A 2QI9C 3FF4A 2ZYGA 1XZFA 3K92A 2J9GA 1UJNA 3Q7PA 3T5CA 4AY3A 4WACA 1F0NA 4LF7B 3IMCA 3VTFA 4H6XA 3AVXA 4IS2A 1R4NB 3IS3A 5JNSA 3IVRA 4OD0A 5LQKA 1JQDA 1YDEA 4FIZA 4Q4JA 3TPCA 2ZUWA 3K71B 4O2BA 5JSHA 2VPZA 1DBPA 5E6UA 3MCUA 2EG5A 3GLIB 2ID9A 4HZIA 4XD7D 3PKZA 3ROEA 4MKHA 2QX4A 4BN0A 1UZAA 1XN4A 4MMZB 2HIMA 3ZS9A 4C4SA 1IWOA 5K0ZA 3MN1A 1NF3A 4LHXA 4OJMX 4M1YA 1Y8ZA 2OFFA 1Z6QA 4NFHA 1E89A 4US0R 1MQ8B 2QXYA 3N07A 5FBHA 2CD9A 3G0CA 1YZ3A 1V8FA 3EMDA 3RC8A 2CJPA 3VPFA 1P0CA 2CVHA 1NG9A 1SUPA 2FPOA 2P77A 1UJ4A 2VC2B 3LP6A 4QOFA 5CW1A 5KYWA 1DL5A 3VDNB 1QIJA 2GFIA 4IVRA 4R01A 3OZUA 3SHWA 5CA1F 2AD5A 5AW2A 2ZM5A 2RH5A 3TJZA 3GMSA 2BYTA 4LIPD 4G5HA 5LJIA 3I5MA 4YPVA 1V11A 4IJVA 4DKJA 4G5SA 3E5HA 2XA1A 5B36A 3ITNA 3CZCA 4HG2A 4CCYB 1A7KA 4P4TA 1KDVA 3NTXA 3DMGA 3EODA 3EOAI 5IRCD 3C70A 4K9MA 3P19A 1TJNA 4NZMA 4MW4A 1HDGO 3KT8A 3ABIA 1U8YA 1AMOA 2OZLB 5REQA 1QVZA 2X3UA 4TKUA 1IIBA 2HNBA 3KQVA 3WNVA 1KZGB 2ZYWX 3WLEA 1TRKA 1X80B 4XWWA 3RK0A 1UMBB 3QX3A 2JLWA 3MINB 4F4IA 4G25A 1TK3A 3RUHA 3C74A 2ZATA 4S2EA 2ODTX 2GPAA 1KMCA 2NUAA 3K5HA 3PK0A 4KNVA 3TWOA 2XYRA 3GVIA 4PLVA 2VSFA 4KMMA 2XVMA 2W43A 2ZWVA 4R8RA 2GHTA 1P6XA 2E4AA 3W5JA 1E2JA 2CNNA 2EW2A 4G09A 3TM4A 2R1VA 5AI8A 4JLUA 4YI3A 2WU4A 1E9RA 1JA9A 2Q6KA 1LWOA 3AEXA 4BZZA 5KQRA 3UFXA 3PNKA 3GDHA 4CEHA 1NW4A 3N1UA 2ZIUB 3DBIA 3EZ9A 1O6FA 1P1JA 1YL7A 2O5CA 1R27A 3KRTA 3A70A 3OHSX 3FMIA 3HBMA 3ZDBA 3WX0A 2JF0A 2QB5A 2RHRA 4BEBA 4ZEOA 1TEZA 1MTZA 2QRJA 2DVMA 2F90A 2XEDA 4PHGA 3HB4X 1SUSA 2C3OA 1DOAA 4H6PA 4CCSA 3WJ1A 1S2MA 3EXG2 4FZVA 4DMMA 2VHQA 5FNZA 3EUFA 3VPSA 2R6GA 3IH5A 3VKWA 1XTPA 1PZGA 3LDFA 4FOOA 3RANA 5ALDA 4XYLA 1ZN7A 3MXOA 4IDDA 1KVSA 1RYFA 4I55B 4HGPA 1KEVA 1DT3A 1G6HA 1IXRC 3W9UA 2X0KA 4C3UA 3WAKA 3RKUA 2YWRA 1FRZA 5K01A 1U5BB 2D4AA 4R1PA 4E88A 3JQCA 3OX3A 4ARUA 4EHAA 3N75A 1IUNA 4XPIA 3NM6B 3E48A 5IAKA 1P2DA 3BMQB 4D81A 4MWDA 3NBUA 3D6JA 2VBGA 3P2IA 4LDJA 5KYVA 5DX8A 2XZOA 1XN1A 1PZNA 1Y6JA 2QL9A 3I2IA 4LYGA 5THKA 4F7WA 1AN9A 4DUYB 2DY0A 3MUOA 1JYSA 4TWIA 2ICAA 4WMLA 2A1UA 4NJEA 3NV9A 1B3BA 3SZRA 4OGFA 4WKPA 1NNLA 3FWYA 2AZ4A 3QBTA 1GCUA 4HAOA 3TQQA 4AAYA 5ICCA 1DWOA 2JARA 3KQHA 1RXWA 3J81A 1QG6A 3A9TA 4EO9A 2GCEA 5GOTA 2JCSA 3V8RA 3FUUA 5T3YA 4DJAA 1IXZA 1SXJB 1EK1A 3T5DA 5L3QB 1F8YA 4Q4HB 5KVVA 1ORRA 2ANCA 2G77B 5KSOA 2XUKA 1ONNA 3JCZA 5LDGA 1Q0TA 1NF9A 5LOVA 3BAZA 2X3YA 4MHSA 1CQZA 5SY6A 4FQ8A 4P86A 2CVFA 5HUJA 2XY4A 3PLNA 2ETVA 1Z5OA 2BGJA 2FPWA 2IUTA 3Q40A 5JQGF 3WLIA 1SMKA 1ISHA 3HN6A 4G2NA 5ITZA 2HDHA 2VVTA 2Y9PB 4ZYZA 1IJBA 2HDOA 5L95A 3FYTA 3PXAA 1TC2A 4QPNA 1FCJA 3DAPA 3T9EA 3CNOA 2VSXA 1GNVA 2B94A 2YINC 3FKJA 5TT1A 4G4SO 3OY7A 1FFYA 4BO1A 4R2LA 1V2HE 2OV6A 2NSJA 4GD3Q 4UVGA 4C43A 2QZZA 3G17A 2DF8A 2P67A 5KC9A 4RHUA 3FSGA 1GARA 1P5JA 4NDAA 5CAEB 3JQGA 1ONSA 4TRRA 4D8UA 4YRZA 1EK6A 4X7MA 5HEKA 1FLVA 5T57A 3ZDZB 2JLAA 4F2GA 5IG2A 3TQTA 4ZU6X 1G5RA 4P6VF 1NKVA 5B57C 1DPGA 4QDZA 4D9IA 3RUEA 1V16A 3O1JC 4BNFA 1OHHA 3BWYA 1VE6A 1YJBA 3OF3A 1DBQA 4YTEA 5D5HA 2OC9A 4M53A 5T4FA 1X15A 3O6VA 2VPPA 3F90A 2XVXA 1WBDA 4U7HA 1V43A 4FHZA 3P2KA 3OA2A 4KC0A 4RMNA 2PGJA 5IBRA 3E18A 1WPGA 3QY9A 3R7NA 5BNWA 1SXGA 2H7CA 3T9DA 2FHSA 4C14A 3QX9A 4PQGA 3ILSA 3RIEA 4BJ5A 3D0KA 4E30A 5KOHB 1HG0A 1JWBB 4GI5A 5DHFA 4FI3F 3K0CA 3NYRA 1JEYB 1N0IA 2BFOA 2QSJA 3GROA 3GJYA 4KAXA 4LK3A 1B4DA 3DOCA 3KVRA 3SEFA 1JH9A 3ILYA 1SQGA 1ZGJA 1CT9A 3ITDA 5HZGA 1YDWA 4MDFA 2GX6A 1Z8DA 4AB1A 4MA4A 1QVRA 1R8XA 3R24A 3FPAA 3ROPA 1JLLA 2NX2A 1JWAB 1B8OA 4HDAA 4HMOA 1O4VA 1FFDA 3UK1A 2YNMA 4PZEA 2DC1A 5BSFA 2XRMA 5LWHA 3AEKB 5D8DA 2AFIE 1E3JA 2X5XA 5ADHA 1A95A 1MBZA 3BXOA 3SNHA 5A0FA 4ZT6A 3LUJA 2HJWA 2GWHA 2QQEA 1X2BA 4OHMA 3THRA 4BATA 1J06A 3WYCA 2A3NA 3DE0X 4PPYA 4DMRA 1YSCA 1NXSA 2P5UA 3RJTA 3SP1A 1G4HA 5JRDS 1AK9A 4HGNA 3C7TA 3T0IA 5HM8A 1PNRA 2FEXA 3PS9A 1JNXX 1PQ4A 2FEWB 2M6RA 3HYNA 3D6NB 3IVCA 4AUKA 1H3EA 4WUVA 3VRHA 3ZCRA 4NCIA 4YXWD 4ECEA 3M1LA 5CB4F 4TQ9A 1G20E 1FTQA 5J63A 4GIBA 1L5HB 1DCFA 4JN6B 3AY7A 4D9FA 1RZUA 1VPLA 5BUSA 4LE0A 2NO9A 1U9YA 1E1DA 5J1SB 3I2FA 1OC4A 2BMJA 4KQMA 4V39A 2AVDA 5TMBA 2IOHA 5AVUA 4GL2A 1XD8A 3RUIA 1Z62A 4IWNA 4CQNA 3UAZA 4EPTA 1MB4A 3E27A 4LNUA 4AZTA 2H18A 3OUUA 4QWMA 1Q2XA 4Q15A 4CN8A 4F11A 4UTRA 4MV5A 4ZWNA 1QAMA 5JDCC 1O7JA 1UBTS 2YBEA 1NVAA 3ZJ5A 5EHXA 4OOEA 3NUZA 4KPYA 4YAWA 2QY6A 1TJ4A 1ML4A 3DDUA 4BGVA 4QGAA 2AG5A 5CIWA 1USUA 1VQ1A 3IUMA 4K6GA 4OXQA 1B43A 3EK2A 2FQQA 2FPGB 4J2OA 4TMWA 1JJIA 4UTZA 1JEQA 4B6GA 5K8IA 2ZSFA 3O8CA 1SKMA 4Z3KA 2QN8A 3NHZA 2QUJA 3QOFA 3VR1A 5JCXA 5L7YA 3D31A 5AKGA 1XZIA 2WB2A 4E5KA 1L4FA 3DZGA 3WZMA 5F9MA 1ISJA 2Q5LA 5AHXA 4P93A 4EUFA 4Y6RA 1QOQB 1GZ5A 1ORVA 4H7JA 2BBTA 4BO9A 3KU1A 3TZQA 2WM8A 4KZPA 4ON9A 2QV0A 4HRVA 3UA4A 3TSOA 1U28A 4LQ4A 1SBZA 5CH5A 3OQVA 5IDWA 2G8NA 1E79A 2WAYA 4D46A 2BDTA 4JJZA 4XQEA 3OPYA 1O87A 5JWOA 1GZSA 1R7RA 2XMQA 3T35A 2HEGA 2GPNA 3GAFA 1JJ7A 4TLDA 4UBIA 5C8VA 1K6JA 1YI0A 4QM7A 5JSYA 5TS3A 2VTBB 1KOGA 1FSZA 2HF2A 3S2SA 4D6PA 1P7ZA 2ZZMA 2CNOA 1M67A 1FF9A 1CW2B 5PGMA 4Q9LA 4R2HA 2C1ZA 1SHTX 2JNWA 2WJ6A 4PNHA 1ADCA 4DQKA 1Y4AE 4Z4EA 4TKLA 4ZYVA 4Y7DA 3GMTA 4CUZA 2IXDA 3H9CA 4A8JA 4EJFA 1BW9A 1ZP6A 2W0MA 2W2OA 3D6MA 4ZOQI 5IAGA 2ZYHA 2BMWA 3QVXA 4CNBA 2WRZA 1ESEA 3H5LA 3EXIB 3DOJA 3FE2A 4BGIA 1T36B 3EGDA 1BQEA 2NXJA 3SXJA 3AERA 2ECQA 3LPMA 4EA9A 1IOZA 2BJWA 1WPQA 4LYDA 1H2EA 3DZFA 4ZQIA 4HGQA 1DTEA 2AQHA 1YJCA 1VI2A 2JLQA 3EZXA 3OT1A 4P4GA 4B8ZA 2G3YA 5CA0A 4DV0B 2FX2A 4JCOA 3UG6A 4IJWA 3OFSA 3M8KA 1JHYA 3KZNA 3R20A 4M88A 4LOIA 1L7VC 2R4QA 2PL3A 3HCAA 2H8GA 2J3DA 2WT9A 2PQ2A 4L5JA 4IO0A 4OM8A 4YAEA 5JSQA 5HE8A 4Q18A 2E2WA 2FUNB 1QMGA 2GBLC 2NPOA 2QP9X 2VT6A 1WUTA 4WKOA 3O93A 2B1GA 2ENWA 2HRDA 4LHEA 3VR6H 2GDJA 3DKRA 5J2UF 1D1SA 3OZFA 4PS0A 3ELDA 2Y4NA 1EYZA 4NYJR 5DWQA 3BRWD 3BWMA 4RGBA 4JYBA 3C45A 4ZT4A 5I9MA 1SUAA 2A2ZA 1SOVA 2NYRA 5KX5B 5T4HA 1KDTA 3SYRA 5DCLA 4B7ZA 5BQPA 1VBKA 4UUNA 4YRKA 4Z51A 2C7PA 3UPDA 3E61A 4L1KA 3CF6R 3JYHA 3QVUA 4REMA 2YW9A 2ZIFA 1NX6A 1RVV1 4IFIA 4FR5A 4DE5A 1TW3A 5LZ8A 4KVZA 1M0WA 5LUAA 2ZI5A 1JKXA 1DRKA 3CPJB 2ODQA 1WDWB 2VYQA 3FSJX 3SZMA 1E4OA 3GCDA 4ZC8A 1I3MA 5I8PA 4QGBA 1RE0A 2PMWB 4L16A 1MMFB 3LBIA 3ZHVA 4MVJI 1JT2A 1NI3A 3PNOA 2XGMA 3WWDA 1NI4A 1KVQA 2PS9A 3E9ZA 5CTJA 1Y7PA 2BR5A 5FOSA 3V4SA 5C37A 2OP1A 3CX8A 3UN1A 5C8DA 3DEKA 1NR7A 4INAA 3V9PA 2WY2D 1OJLA 4W9NA 2D3WA 4UAGA 2M2IA 3EDCA 4TQUS 5T7BA 4KKVA 3LC0A 4YRRA 1DIHA 3MT7A 2DLCX 2P3QA 1GGKA 1BJTA 1QANA 1P29A 1QKIA 3VV3A 4X41A 3N39C 4UU1A 5D1HA 1UDRA 2R2GA 5SY9A 1I14A 3VU0A 2AR0A 1R2QA 4V1CI 4YONB 4ZXFA 4KPGA 2QXTA 2RONA 4NYMR 4OIFA 1N3YA 1SVSA 4FXPA 1RW4A 3FCSB 2O1EA 5K0EA 2DKNA 4F5EA 2QTTA 1NI5A 4L2IB 1NW3A 3R6WA 2YICA 3DONA 4M7RA 4OB7A 1WXHA 1AKWA 3DNPA 1OOEA 3FAZA 2JFXA 2AFHB 3MWLA 3D7LA 3SR0A 5JXIA 1TU3A 5CTAA 3JQ7B 3C8ZA 4ZAZA 3UGKA 1U8ZA 2GNOA 3HJAA 1QVWA 3PFWO 4YHBA 2R6ZA 5FA8A 1J23A 4RK1A 2OHFA 4AD8A 2Z95A 4UMFA 3PFHA 2V65A 3N7AA 3NO4A 4JB8A 3DLBA 5HA5A 4J4BA 1SCAA 1MJ5A 4CMJA 4DARA 4R83A 3GFOA 2YZNA 4MI9A 2ZQZA 1SCUB 1C3XA 1Q92A 3AQIA 1CUYA 4M0UA 1XMXA 1WKBA 3DTVD 2XMCA 3REQB 4FDUA 1D8AA 4TVOA 4MKXA 4D0SA 4AJHA 3I4CA 1S2GA 3FFAA 1OF1A 3BZUA 3HNPA 4FDVA 4DA9A 1XTUA 1E2BA 1IPFA 3CLHA 1OGIA 3QBDA 4DUGA 3KV1A 1VG9B 2IELA 3IKVA 3HKEA 4MV0A 3VR2A 1APBA 2Y71A 3A27A 4ZQBA 4GZLA 1ZJZA 3BFXA 1GGMA 2XLCA 3PE6A 1OVGA 2ECOA 1BSVA 5FR2A 3BIJA 4PZDA 4UEOA 3PICA 3RC7A 5J58A 3ASUA 1QG4A 2ZRIA 4NK4A 2PMFA 4WA8A 4S12A 2J6CA 4Q4DA 4PRZA 4DIDA 5B58T 121PA 1U3TA 3A1NA 4LYHA 1RM3A 2Q0XA 2QYSA 4G41A 4X7PA 3AVTA 1HYBA 1U0LA 1TCCA 1XDDA 2J0UB 2WIDA 4DM4A 3CUUA 2F59A 1AG9A 4JJEA 3P71T 2I33A 5EXDA 4KYUA 4P5EA 3UMRA 1YVRA 3X2SA 4F5WA 4FYHA 4HVCA 4E7OA 5BRJA 1W88B 3SBDA 4CQMB 3HZRA 3VUFA 4V24A 4TWRA 2PBZA 4OF4A 3T3EA 5HUHA 1ZCAA 2FPPA 1BFUA 4IY1A 3BE5A 3NRBA 4OV6B 5LXTA 5EFOA 5LMZA 2HA6A 2EJWA 3EUAA 3IEXA 2KQUA 2J6IA 4J43A 4O4IF 1CJMA 3NBQA 3GYBA 3QW2A 2JHFA 1CKEA 4H6WA 2H9YA 1JFFA 1FDVA 1PZEA 4MV4A 1FMCA 4Q6WA 2EVWX 4LDPA 1TIPA 5HFJA 2XQGA 2CXPA 5ISMA 3GZ4A 2TSYB 2B35A 3INRA 3UOGA 3D6FA 1F1JA 1JIIA 1NA5A 1DIRA 2JGAA 2PD3A 2WWIA 3L41A 3L6BA 5FL7A 1XXHA 4ZAFA 2I22A 4DSTA 1E7RA 2PR2A 4GBGA 1EGVB 3F74A 4HNSA 4LAFA 3W79A 4E5YA 2HPVA 1UDBA 1HY3A 5KQGA 2PH5A 4F7DA 1FIUA 3BFPA 2XGGA 5JAIA 2JHPA 5DWVA 1E60A 1YR1A 3V8QA 3I76A 3JQFA 2D5CA 2H1SA 1H66A 1G5QA 1I7PA 3ZCSA 4X66B 2I4NA 1EUDB 3KB8A 4CODB 4F46A 3EQ9A 1SCIA 1OROA 2PVSA 5FORA 3W5DA 1KS9A 3W5UA 1H9AA 2EATA 3RIGA 3WK4A 2NSDA 3VGJA 1YU9A 2FG6C 2WZCA 3G8AA 1O95A 5EWJA 3IDQA 2ZT5A 4PLPA 5K8UA 3T1HB 1NNI1 5IVDA 4BUJA 3FGOA 2PNFA 3NWOA 4KLCA 1C1XB 1R00A 3LGXA 4TVBA 2V59A 1G3QA 1NR5A 4NNJA 1B6GA 2HV9A 1OY1A 1KEWA 1FE8A 2CKDA 3MJVA 2CUTA 3O3OB 4PU0A 3Q8WA 2JFQA 2Y1OA 1N7HA 3DB1A 1F3OA 2GEKA 1MT3A 1O2DA 1KVRA 2ATVA 4BQNA 1WW8A 8GPBA 3HXMA 3FYHA 3BXGA 3K32A 2VK4A 1CQJA 2H1FA 2P9EA 4J0DA 1N1MA 3ET5A 3ONDA 2PYDA 5K0NA 3RRBA 4CQJA 4E5UA 2ILVA 2XECA 3BT7A 1NW6A 2C1EA 2CMDA 3CSUA 4IHQA 4MQ5A 1AUXA 1PNOA 1PFUA 2HSDA 2V7QD 3D3JA 4FE3A 3EEYA 1JBQA 4OU4A 4CF6A 3JQBC 1ZJWA 2IGBA 2YOGA 3SAJA 4G0MA 4PRLA 2WSYB 1TU4A 3H4VA 3BJRA 3EIEA 3V4VB 1M2WA 1ZMBA 2I4TA 1MT0A 2CXRA 5CP8A 4J29A 1P6QA 1VIVA 3OWHA 3VYUB 3BQNB 1QNFA 2GSDA 2H54A 1TTQB 2PMCA 1R4MA 3KZOA 3JARB 3LC2O 1IWPB 3C5HA 4EYOA 1QIGA 1NKTA 4CQLB 4EJSB 5HX7A 3RBAA 3DFIA 2O2ZA 2EG9A 1ZC3A 2X2EA 1P91A 3O8NA 5SV2A 4A6EA 3K4PA 1UMCA 3G5MA 4QATA 3Q6MA 5JO0A 1QR6A 3K96A 3WK5A 5K05A 1I2MA 5FWDA 4WRRA 3GRKA 1Z2NX 4UVEA 2C20A 1LK7A 4K1XA 4ROTA 5AKLA 5DSXA 4C4TA 2NV2B 2QSUA 2F3PA 3ETEA 4QXPA 1G38A 4MEJA 1T1JA 5IAAA 1NULA 1ZHFA 1OX5A 3CRQA 3JQAA 3OTWA 4FDAA 4OP1A 3F47A 4Q1BA 1PYOA 4CMKA 3U19A 3AR7A 1N6NA 1UM9A 5CW2A 4DIEA 4YQYA 3RVPA 1MH9A 3NWEA 3OQOA 1ZNQO 2ZUBA 1IY0A 3NM5A 1KY3A 1CBUA 2Q8PA 2VR1A 4TM8A 3S5UA 3N59A 3G13A 5AR1A 2BFPA 4BIMA 5JROA 4J0HA 3FWNA 2PCJA 3PQ6A 4LHSA 1U04A 5EJAA 3V32A 3WGLA 4LBVA 4EEXA 4X1IB 4EMTA 4Y6LA 5IC4A 1N32B 4Q16A 5A7FA 2YYAA 3KOOA 5KSYA 4TL6A 3AUJB 3GFBA 2IU0A 3TR6A 4DCGA 2AXEA 4IFBA 1W1UA 3RSCA 1YB2A 3ER8A 1FYVA 3CIFA 4KR2A 3RH0A 1G8HA 4MVJA 3RF7A 5CLGA 2XVAA 3G02A 4Z49A 5JJCA 4MV8A 3F5QA 3HRIA 5SZIA 3EFOA 3KB2A 3G68A 4LDRA 1K4MA 1OAOA 1N0UA 2FUEA 2JBAB 4JSRA 4RLHA 4FLEA 4TRJA 5DU2A 3ZQJA 3IAS6 2IDJA 3WWYA 4LZOA 3MAJA 2OPBA 4TMXA 5ENZA 3IXLA 3QYJA 1NDHA 3UICA 2HR1A 2WDZA 2QUBA 3N05A 1QR2A 2YCBA 3O4HA 4N5LA 1NR1A 3OPQA 4QTTB 5EE0A 1F4VA 3GLUA 1CUDA 3MPOA 3MWGA 4KW7A 2O3UA 3EF1A 1ORHA 4HZUA 1LXCA 1EVYA 1MW9X 2JK1A 4UE6A 2NZYA 2VUIB 3ROZA 1XZEA 4YJHB 5FWNA 3DUWA 5BMVF 3FIUA 4ANFA 1GG2A 3GGOA 1J0EA 1ADFA 1NHGA 4MR9B 4FONA 1FFBA 2RHGB 1LPAB 1T1EA 3KKLA 1DXQA 4FFNA 2DHRA 1NUAA 5JARA 1VA4A 1DIAA 3O0DA 4UEWA 3MRSA 4C4AA 2CHVA 2PKWA 3AF1A 4P32A 4GRIA 3OCUA 4PC2A 1YKSA 5FPTA 2YX1A 3EAGA 4J0GA 1O58A 1QQTA 1TVEA 3QUQA 3RJ9A 3EHDA 4B7CA 4OYRA 3R7WA 3WL5A 2CMHA 3OJXA 4URHA 3GRVA 2IVFA 3DAHA 5CT5A 5C8XA 3FDFA 5GWXA 1KS2A 2OCXA 3COZA 4G1MB 1MGPA 3D3EA 4GW3A 2A9KA 4R6WA 2W7TA 4FNOA 4R7TA 1Z45A 1MQSA 2X8BA 4G1EB 2J87A 4WSOA 4A73A 4RA9B 4J6FA 3GRPA 1RWXA 3LDGA 3P0IA 1BE6A 1JFRA 3PI7A 4JI7B 2A1TS 2PRYA 4ZGGA 1JAYA 1DOHA 3WWOA 1I5EA 1BTOA 4JLJA 4LJ6A 3KALA 4YRLA 5AQEA 1RFGE 3CTMA 4D9CA 4EGFA 6REQA 1TQ2A 3GFPA 5TC4A 3EF3A 1XU4A 1NAHA 4XSGA 4FDLA 2DJIA 3LUPA 1A9SA 2QMYA 1AM4D 2C2XA 1GGVA 2P27A 3JYLA 3FPBA 2G83A 3ORHA 4YV1A 1INLA 1FA9A 5JBNA 4DB4A 3ED5A 4OOFA 4AO8A 2QLMA 1GCIA 4CG2A 4ID9A 2EHDA 4DT1A 3CR3C 5JCJA 4EI9A 3QNUA 1FDUA 1TM5E 1GAXA 2IWHA 2P2ZA 4LRSB 1F06A 3RSSA 3WK7A 4DNQA 3PIDA 4RNCA 2NAPA 5BUZA 1X9IA 1GDHA 3PDUA 2ZU6A 1LZLA 3KEQA 4FCTA 4W8GA 5DHUA 3TJRA 4DDUA 5KKCA 1RU3A 1QHSA 4G8JA 4CEJB 3ZIUA 4RMJA 4B79A 2C58A 3CH6A 4K6MA 1CDOA 1LTQA 4TMVA 1NU6A 4NENB 2XV1A 4AG5A 3E7XA 2QPOA 1DT5A 1K6XA 3SEQA 4N7BA 1PHRA 4AS2A 1JQAA 3BMNB 1F9EA 3AZOA 3AZQA 3QI2A 1KARA 4HO1X 1A9PA 3HNRA 2VJDA 1FLNA 1X92A 2YUIA 3EJWA 3K53A 1SCBA 3KHSA 4HSEA 4RS3A 2BBWA 1JYFA 3RIMA 4DAOA 3UMMA 1NJFA 2HA4A 3FNEA 3ZHZA 4LZJA 3FMPB 3FVTA 3M89A 4XIIA 1RBQA 1OE0A 1HLGA 3O2QB 4CI9A 5A1JA 1IVYA 2GF2A 2QTVA 3HEBA 3ICVA 4UEQA 4UM8B 2RI6A 2XUHA 5ALLA 2LW7A 2XR1A 3DXYA 1JR4A 1QTIA 1J2EA 1JUDA 2G9VA 3GUHA 4KWHA 5A3RA 1DOZA 2QYHA 4L75A 4E94A 1AXGA 2EC5A 3FTEA 3NAZA 4NQZA 3WIUA 2CEAA 5AUOB 2WNIA 3LQQA 1ZCFA 4MPRA 5IYZA 1W2GA 3I34X 3P27A 1HT0A 1Z26A 3QF4A 4BNDA 1SUFA 1ENYA 2WYOA 4DR4B 3EVBA 1CE8B 3AI3A 1LBTA 3LT1A 3OZWA 4IV8A 5DOVA 1X3SA 1Z2OX 4BMDA 2P6RA 1Z5ZA 3T1NA 4BKMA 4DILA 3V4RA 4I4TB 3FXAA 5K6TA 4ND5A 5M04A 5AVTA 1TT5B 2VHEA 3AI1A 1IMOA 4OB8A 4Y0VA 2JIQA 2QP3A 4XYMA 3WKBA 4Q3BA 2DRIA 2YQZA 3E9CA 5EYPA 2GB4A 4IHAA 1IVNA 1GHTA 2QOEA 2WSSA 2K7ZA 2XOEA 3N86A 5L7WA 2BZ0A 5L45A 4M7PA 3EVNA 1HLFA 3CG0A 1X13A 2ZYRA 1F2TA 4AT1A 4RKQA 2QZJA 1PZMA 3G0OA 3N6VA 3VJKA 4D9EA 1DEXA 4N82A 1ZMTA 3DFZA 1ULZA 1VIMA 3D3NA 1BN7A 1OWPA 1DC6A 2A14A 2P5SA 2PX3A 1K7FB 4I3FA 4JUBA 5DM0A 3ML1A 5F1PA 5J5AA 3U4GA 1GFZA 2R96A 2DULA 1BX0A 4HXEB 2H57A 3EGOA 3BSWA 3AM1A 3Q87B 1U5AA 1D6JA 2GA9A 3BIWA 1RTKA 1Y6RA 2D8MA 2QTFA 3MS4A 2EAUA 1Z7YA 4JS0A 5JLAA 1HZZA 2HA2A 3ROGA 4DMLA 5CCXA 1EX9A 1UPTA 2AI2A 2G1UA 4HTFB 4GUDA 1W36D 3QNWA 4B43A 1PR0A 4DCPA 4Z4IA 4FWBA 3MF4A 2RGNA 3WL7A 4QJIA 4BL5A 2HUPA 2NW6A 2OOKA 4YRNA 4IZIA 4JNCA 3CGWA 4TTVA 1OWLA 5G0UA 5HKAA 5H1YA 1ZN2A 2RG7A 2QY9A 1OV4A 1FVXA 3IYLW 3MMXA 4ESEA 3ONVA 3VU3A 1UBCA 5J2TB 2HCFA 1FDSA 3TRIA 4RLQA 1SKBA 3FD8A 4G56A 1QHNA 5EWMA 2A94A 2ZPTX 5A3VA 4A5OA 4PCAA 4GAEA 4Q00A 2H7YA 3LP5A 3HPRA 5I9BA 4CIAA 3KC2A 3L6DA 1Z25A 1AHPA 1KQFA 4N5MA 4P82A 3ZDCA 1NLUA 1U3DA 1UXJA 1YS9A 3EGWA 4KXMA 1Z29A 1K8XB 4KUHA 4MI3A 2WTEA 5BWCA 1RCTE 2RH9B 4NFYA 1HMPA 1DU4A 1S96A 1P1RA 2I6QA 4I4LA 2J5BA 3B6MA 4AJ9A 5J4HA 3WTBA 2QROA 2C8VA 5EMLA 4DYDA 5K0GA 4LF6B 1XD2A 4YRGA 1E0DA 1ZK2A 4KIWA 1ECBA 2UZ1B 4URZR 2BFWA 3MSXA 3TL3A 5IT5A 3LXRA 3GAZA 4URFA 3UWOA 4EMUA 2E89A 5H82A 1QYRA 2ON6A 1VKZA 2ZRNA 4IDGA 5FTMA 1NVVR 3IA7A 5HG0A 2BFEA 3C7DB 3CNNA 5E9QA 5DTEA 2YV5A 3CN9A 4HGZA 2IUFA 3QBEA 4BFUA 2WUGA 3ZWPA 3UM9A 3R9XB 4B7UA 2REOA 2JJ1D 4Q39A 3WRXA 5JVDA 2LE0A 5FYDA 1DC7A 3HN7A 1YI1A 3AFOA 1JFTA 1OX4A 2FFQA 4JHXA 1FFEA 3NIWA 2Y2VA 1HG1A 4MIOA 3LAWA 1GNLA 5I4BA 3OZRA 5DWDA 3EISA 1XMJA 4WFQA 3MGGA 2Q3CA 2O06A 1N8KA 1AMNA 4AMBA 5ABPA 2ZLBA 3R5FA 1PCXA 1WMDA 5A71A 3I30X 2WD7A 2PYIA 4KDCA 1Y7LA 3M2TA 3IVXA 5LMCA 2ZTUA 3QLVC 3T94A 1N0HA 1XLWA 2WF5A 4S04A 3L4KA 1YUNA 4FKZA 4CMIB 3O31A 3HUTA 3CLTC 1JXMA 2MIIA 1L4YA 3KR1A 1U2DC 1UKVY 1V47A 1V9LA 2ADMA 3F4BA 1SQFA 3G85A 2XHEA 4XIGS 4C76A 4DW8A 4BMVA 4IDBA 4JQOA 4DXHA 2FE4A 3P4YA 4R41A 5FI5A 3OLWA 5JNLA 3IOEA 1YS1X 1X9HA 2SKEA 3GJ8A 3WYFA 4ZZ3A 2FUKA 2CV0A 4H77A 3TTYA 2IITA 1PJLA 1NXOA 3G8BA 2JJ8A 2W71A 1PTJC 4MS3A 1Q0RA 3KT6A 1KFBB 3UPTA 2GUWA 2PN1A 2JH3A 3EGVA 2DFNA 3RFFA 1F20A 1N3IA 3AYXB 1CVRA 3CF4G 5ES4B 3ZU6A 1Y1KE 2QD1A 3M7IA 4QREA 4US1R 1AKVA 1TYEB 3D6UA 5J1TB 3A6FA 4M1TA 1M8PA 1H22A 1QHHA 3AFMA 3JALB 4FQ7A 4QRDA 4KQ2A 4U7TB 1DKLA 3G2JA 2Q2WA 3FA2A 5KPJA 5LQSA 421PA 1P18A 2GT1A 2ZIEA 4K3VA 1YQDA 3STUA 2Y6VA 1GDDA 1R0BA 3AF3A 5KVCA 3GGGA 4J7CA 4J3FA 1YB7A 1AKTA 2GPJA 4FP9A 3VVMA 2MYUA 5HGXA 2VZ9A 1TF7A 1U0FA 1YQGA 2CJWA 2PTHA 4CV0A 3ZDAA 5A6SB 2ZWIA 3MJHA 1HDEA 4HJRA 3VMFA 2WZDA 1GVNB 4G86A 4MX8A 4D8TA 1QO0A 4F38A 3N2KB 3PA8A 3WQBA 2O14A 3IE2A 1J70A 2J9FA 3I9FA 3WTCA 4AQDA 5LQRA 4LFBB 2FEPA 4KQJA 1PWYE 1Z6GA 5T4BA 2X7XA 2FFHA 3BDVA 1U8CB 3CX4A 5GJCA 1QVAA 1M6WA 3BDAA 1E2UA 2BI7A 5DHAA 3TAXA 4O2AA 1MD9A 1U0GA 3H2YA 2IHBA 2AEEA 2IEIA 3O90A 4HYYA 4UTXA 2X19A 2WWYA 3ZUGA 3F1LA 4K0RA 1OZFA 5L3RA 2WP8J 1FP1D 4TKVA 3OPVA 3HYLA 1PIWA 1OKKA 4FOTA 4J90A 5DTRA 5EIHA 1NVWQ 3A6JA 3K1AA 4HQRA 1IUOA 5D5QA 3S8YA 4BBPA 3D3KA 1XR3A 2C9CA 3PCXA 1KP2A 2YZ2A 4HAVA 4KQIA 3RYTC 1VPEA 5FT9A 1VJDA 1XVUA 1O3YA 2FPMA 1KJZA 4OI2A 2HY7A 3TECE 3CT4A 4CRWB 1MV5A 3R5XA 3TZHA 1I24A 4QDUA 1M2EA 1W4AA 4RNDB 3O95A 2ZE7A 3WMGA 1SOUA 3A8TA 3LSTA 3GGPA 4C05A 2B21A 1ORDA 3K1ZA 1XQVA 1XYVA 4B6PA 2E6UX 4S05A 2NSYA 4EG4A 3U9SA 3G9TA 2Z83A 3KOWA 4R1OA 3RS7A 3B53X 5IDQA 3KFLA 3AM3A 4DIOA 2B4RO 2RK3A 1ZONA 1TU0A 2VJYA 1XXHE 3K70D 2H1CA 4XFDA 3UK0A 2RFLA 3DZJA 3OTGA 3LKVA 1P9WA 2BKAA 1XLUA 1URPA 2ATIA 2JFHA 3FGZA 5CM9C 1SCJA 2BM1A 3I9JA 1ZN9A 2BKXA 3E7FA 3GQBB 3I9MA 3MTAA 3PQFA 4NESA 4ARBA 1WPXA 4RYDA 4YNBA 5A5GA 2I4OA 3BE8A 3I42A 9MHTA 5KBYA 2DTEA 4G0VA 5H8WA 3L92A 3Q5GA 1YI8A 1V37A 3CJTA 2FZWA 3G0GA 3JASB 4R3NA 4ZEWA 3WS7A 5CDUA 2FPLA 4YJKA 5IJXA 2VF4X 1LRLA 2PS0A 5D6OA 4DBLE 4M49A 1QRAA 3N8KA 4AZ0B 3ZXYA 2C2WA 3RTBA 4EHNA 4EHJA 5KQLA 2QAGA 3ICEA 2ID4A 3GWZA 1PV4A 1YUMA 4NZYA 4XDZA 1KORA 4JLKA 4OSOA 2OB2A 4LYYA 3EPKA 3MWDA 2R1ZA 3M6UA 5EHQA 2ZVPX 4QULA 1ZOOA 2I7VA 1YQXA 5TX7A 5DW3A 1IVSA 4OLHA 3B6ZA 3WIEA 4X3PA 3ZUPA 3SFZA 4PC6A 2ZUFA 1R6TA 4BYGA 4B2LA 2XGOA 4US2R 3FSRA 5ANRB 3P7MA 1MA3A 1V7PC 4CHTA 2C98A 5E4FA 4XASA 1X87A 4M9XA 3AYZB 3OLYA 2QT1A 1UC5B 1AB6A 1G21A 1X38A 1USIA 2AJ8A 3FB1A 1IYZA 3HU3A 4HX9A 4PWYA 1CG6A 2J0EA 3I8OA 3TOCA 4L8YA 4MAFA 1J8VA 1K2VN 1Y3DE 2BHRA 4QHTA 3ZVNA 3IAS1 1J22A 1MH1A 3LSYA 1M9NA 2AF4C 3QZUA 4IOKA 4Q4AB 2WFLA 5TF4A 1IHOA 1J07A 1XRLA 4MQ4A 2P11A 3UZUA 2AXNA 4JGGA 4MQLA 4CV3A 3GMIA 3GPBA 3MK31 4E1BA 2Z5GA 2O57A 4NZPA 5HJ5A 3TW8A 2EKBA 1MJGA 2OCIA 4KQGA 3RDPA 4BDSA 2IIVA 1QFMA 3F3KA 4KAFA 4MS4A 3TK1A 3FWZA 3JX9A 1E9CA 1NT4A 1ZIPA 1RYYA 3QEBZ 3K8YA 4OHRA 4ILKA 5P8WA 2WWGA 3WG9A 5KDLA 1T0IA 4MAAA 4RL6A 1BCRB 1A8QA 1QWSA 5I51A 4D25A 1GYRA 3R3UA 3V3KA 3VNRA 1QE3A 2HW8A 1UAGA 3OLQA 3RJZA 5CK5A 2P6MA 3QXXA 3CLTD 4JBNA 3NHBA 1P74A 3N6XA 4L22A 2XT6A 2QD5A 2WVJA 2DMRA 5JO9A 4FYXA 4ZJUA 4UUMA 1QRSA 4YCSA 4XSVA 2E37A 4A1FA 1CPYA 1WCYA 5JH7F 4NZNA 4XYEA 2BM8A 2KWIA 4WN3A 5K3SA 4PM4A 1VCIA 4M8KA 1K3FA 2NVUB 3X43A 4RWZA 1JWLA 4GKJB 2QR5A 1EHIA 3IVAA 4R1QA 1FK8A 1FL9A 2YJNA 1N6OA 1U8FO 4KFSA 3LOPA 2DAPA 3VJMA 3ZXUB 4ZHQB 4NBTA 1BH6A 3MOIA 3ABSB 4LY0A 2J30A 5KJCA 2PR7A 2CNBA 1DBRA 4MVJE 4ARSA 4QLAA 4QTZA 1MR3F 1P5ZB 4ZKDA 1I4WA 2PQ0A 4YRBA 4OJTA 1QUEA 2P2SA 4ZZ2A 1QHXA 1DEKA 2ZIGA 3BTVA 2E55A 2FHPA 3D5EA 3OF5A 2OHVA 3M33A 3THOA 3TIIA 4C0HA 4OCZA 3IC5A 5TQJA 1XMSA 3VSBA 1K0UA 3QFHA 3L1JA 5EMJA 3T12A 1SO8A 4U7WA 4MSUA 3HV2A 5DK6A 3ZDYB 4BAUA 2CXXA 5LL6P 3A32A 2WBLC 5A9SB 1Z5VA 1P39A 3OUTA 2FQXA 2EP8A 1XQWA 1ZJ5A 1JHAA 2D1FA 3RBXA 2XDAA 4I3GA 3QX7A 1NBWB 1UWKA 4MW9A 2R00A 4QICA 1DINA 3NEJA 2RD2A 4GP6A 1K92A 4WZBB 3V46A 3IPCA 1P17A 1NOKA 3L0BA 2HZBA 3ZWQA 1DGQA 2EFJA 3ZDFA 5LUBA 4QSHA 1ZJ4A 1BMFA 1NQUA 2FTKE 3BG5A 4JGBA 4XLTA 1PSZA 4JJAA 4QTYA 4W5HA 1C5KA 3BXZA 4CKCA 5CK4A 2VCYA 4HR7A 4JB0A 4NV3A 3I5XA 1D0SA 1P5HA 5G0TA 3UB2A 2YUTA 1G8AA 2LGJA 2ZSHA 5G1NA 2XUZA 5DBIA 4EQ6B 1CEEA 4KWCA 3TDNA 2OBLA 1Z12A 2JJ2D 1R4NA 1YVUA 3B89A 4N5IX 4M1MA 2JIDA 1G16A 3QU7A 4JA2A 1SC1A 2HADA 1RLJA 2JFNA 4KWEA 3GLIA 1FXWA 3MJTA 3K9NA 4GG1A 3T0GA 3W3ZB 2MMGA 2HNAA 3B6EA 5HTKA 2V0NA 1O6CA 3P8ZA 4N0QA 4XX1A 4JI5B 2Q50A 3EQ8A 3RTEA 4BS9A 1GNRA 1T26A 4EGAA 3K2QA 3KVNA 3FJYA 4P34A 1Z35A 2J3KA 4GDFA 2OQIA 4UTPA 2IH4A 1MF7A 2BI4A 2VDWB 2ZYIA 1ZHHA 2NOAA 2ZIWB 4CKWB 5C7IO 1M1YE 1FMTA 1FNBA 1TK9A 1RHKA 4HS4A 3BA1A 4UULA 5CJPA 1YASA 2CK3A 1IIRA 4LJ8A 1AKEA 1T0PA 2WM9B 2Z5LA 3C6ZA 4J03A 5COQA 3ZWAA 4E2WA 5DE3A 1DO8A 4MP3A 2PZAA 1FRFS 3CX6A 4W7HA 4BZPA 5B1EA 5KWJA 1QZTA 2E7ZA 1RQXA 5LMNB 4JI0B 1QB8A 4QTXA 3ETLA 5B3LA 1M73E 1E2HA 4BLOA 2YY7A 1AUPA 1HDCA 3ETHA 4IRXA 3FTPA 4QPZA 4DA0A 4C0LA 1PQYA 4WZZA 2GLTA 5DO9A 5F2OA 4QT0A 2G0TA 4F93B 1R3DA 3VVLA 4BKQA 3DF9A 5KHAA 3IMGA 2OZLA 2PWAA 2CHFA 4FD2A 1XFAA 4FI3C 5JSUA 5K6AC 2FU5C 1AV6A 1DQYA 4DWWA 1MEJA 4DZTA 4BTEA 2ZRGA 1T8RA 3UB3A 2NZXA 1X80A 1QF7A 4XB1A 3AFGA 3NH6A 3MINA 3ER9A 1BDJA 3HR8A 3IGFA 3VR6A 2BR4A 1KAQA 4C04A 3ND8A 2EZ9A 2OOSA 3R44A 4MLZA 3GCWA 3RJ5A 1Y6FA 5IZ4A 1OLSB 3EMVA 4PG8A 2HH9A 4UXJA 3RCBA 3G8CA 3WKAA 3DHEA 3I5UA 2W5UA 1QCCA 3EA4A 3IP7A 4HQLA 1L5GB 1AHIA 3V6LA 4DTCA 1Y98A 4N39A 2ZDHA 3KKOA 4LXHA 4R2KA 2PL5A 3GUYA 4RADA 3LTNC 2PUGA 3GMDA 3EZGA 1A0OA 1AZWA 1OPXA 1SUIA 4FEYA 1PBNA 4JT8A 2XT0A 2DPLA 3H3JA 4JENA 1C8BA 4WZAB 3H2ZA 4MB6A 2OYSA 3RFVA 3ZGYA 4UATA 1EK5A 2DWPA 3RIYA 1Y1PA 5A4DA 3KQKA 5GMOA 4H9GA 4OMUA 4AWBA 1YJAA 4C5CA 4AQYB 1IJKA 1E1NA 1YMUA 1KFJB 4D9MA 4RTQA 2H85A 2WIKA 5ALRA 3OQMA 1AV7A 2G4VA 3STTA 1OU0A 5E1DA 3ZTTA 4E2YA 2AE1A 5AVRA 4N6NA 5EJ4A 3UJAA 2ZBQA 2R47A 2YQ5A 3WA6A 4I55A 4YV0A 3GNLA 4QWWA 4CMEA 2IBTA 1ODJA 1WXWA 4RSHA 3JYNA 1U5BA 4EABA 3W04A 1S2DA 1QOPB 2ZAOA 1B6RA 4IGFA 1NUSA 5CVVA 3SC6A 4NSNA 3NWPA 3KPVA 3W6NA 1W34A 1EP9A 1F8FA 1ZLYA 3OX2A 1GQ2A 1OAKA 2W6PA 1TGYA 2O0LA 1T2CA 1XRSB 3H97A 4RU1A 2BGWA 3UJPA 1I4DD 1J21A 5B1DA 3AM5A 1KYQA 4QUJA 5A0VA 5JD3A 3P2EA 2YWEA 2J0SA 1HDXA 2OD7A 1KQ3A 2O4CA 3LPCA 2JGDB 2HSGA 2QQFA 3LRPA 5F5LA 3L8YA 3NB0A 2O54A 3JVUA 2OHIA 4BP1A 2ID8A 2CNKA 2P4HX 4LGYA 1JMYA 4WUTA 2Z6QA 1EVEA 1NIJA 2E4VA 1SXJA 2FW1A 2GN0A 5L3QA 1RAGA 5A62A 2DERA 4Q4HA 3EX7C 1ZJJA 1ZD8A 2CLMB 1AIPA 1YGYA 4QLBA 4TYNA 1QRTA 1GQRA 3IOYA 1AMUA 2C9MA 3LM8A 4JASB 3GPLA 3R3JA 4O4HB 1R64A 4OK6A 3IMKA 3NLLA 2BMEA 5DYTA 5F35A 1GILA 3U7EB 4DAEA 3PQ2A 4EA7A 2IL1A 3QU4A 5JBIA 1PFGA 1I1QB 4MQUA 1Q1BA 5BQ5A 3DD1A 1ZRHA 1ETHA 1RHMA 1GP2A 3AVVA 4GSYA 1FRVA 4W1QA 3MOGA 2JGFA 4QTUB 4RJKA 4AY4A 1G8MA 1K7EB 1ZLXA 2KMLA 2Q0QA 1UPXA 2FDRA 1JEEA 2MYNA 2UVPB 3LT2A 2HBYA 3ADPA 1RJEA 4IXWA 3K9HA 1MC8A 3LUHA 4XIJA 3CRMA 3HYTA 2Z3ZA 3D2CA 3FR7A 5CAEA 1VBMA 3TAUA 5LA6F 2NWQA 3I0NA 4BFYA 1OXTA 3K0CC 1QU2A 1T8YA 1YC2A 4DCJA 3HB9A 3B1VA 5FJJA 4Q7QA 2FN4A 4BZWA 4DY6A 1ZIXA 1NXWA 3OQ1A 2O8EA 5EQJB 2OAEA 4AZ3B 4LE1A 3FVRA 3CEPB 4ND8A 2WEKA 2DWOA 3BB1A 4IDPA 1GL6A 2H65A 3ZEIA 3AOEA 4H6VA 1IHPA 5CFRA 1KWGA 4CF7A 4H1WA 3DFKA 1VJCA 3RS9A 2BOVA 2ES4A 2HB6A 8AT1A 2DWQA 1E4YA 4JP5A 1LRKA 4KYTA 2VI5A 2BTOA 2LRHA 3TOXA 2GN8A 2I3GA 2CFSA 2OORA 1UFOA 1H2ZA 2OGZA 2PZMA 1K6IA 1RI2A 1YZLA 2R60A 3ENKA 4L4ZA 4C0JA 5FWXB 1A8UA 3AKCA 1J25A 5GJVC 3VR3A 4DR7B 2VPWA 2POQX 4LNHA 1OREA 2YRXA 4IKOA 4Y67A 3JWJA 5B1IA 4ZOLF 1NXPA 1DJOA 5EL0A 3PJRA 1ZMOA 2HWUA 4Z3OA 2JRCA 2FSUA 2QVBA 1KJWA 4E5SA 2AG1A 3E6AA 1D03A 2B0CA 4LBYA 1OA1A 4HH3C 3W2TA 4A2PA 5IWAB 3MB5A 1ZA2A 3SOZA 2D13A 3AEKA 4MVJM 3BWVA 4HQFA 1SNYA 4KQ6A 1T6BY 3NRCA 3BKXA 3AHDA 3R9WA 3ELWA 1C7JA 2O2SA 3FLMA 2N46A 3Q3JB 3DVSX 1FSGA 4FZRA 4ZTZB 1XDZA 2C96A 3NEAA 4LMRA 4PYJA 2IV7A 1UZUA 5H81A 5JNWA 1M8JA 1RWMA 2CXUA 2YR0A 3B5EA 2XZLA 4BNWA 5BNFA 2PAAA 3I61A 4YV2A 2P9BA 5JOQA 1AB5A 3VAZA 1EFDN 1T2UA 2ZYAA 2GM9A 1F6BA 1E1KA 1G2QA 2V7PA 3E8XA 3H9EO 4MI1A 4FHEA 3T34A 4N12A 2BONA 5C9ZA 5EJMA 3JRNA 4O2BF 4IVNA 1W75A 2R6CA 1DCTA 5TPWB 1ZOPA 4UMDA 2JHCA 1L5HA 1X1AA 3BHNA 4TYMA 1YB6A 4GVPA 1DPFA 5TMPA 3DDWA 2HMTA 2B99A 2WTXA 4MQEB 4FHDA 2XUQA 3L04A 3U5ZB 1MC4A 4JLDA 3DVAA 4R9VA 5CGQB 3OKFA 1WCIB 3TTWA 1WOMA 2LDBA 4RHXA 1T6YA 4H7FA 2QX8A 4KN6A 5GV7A 5CCDA 1ZU4A 3M49A 2O2XA 1KI3A 3K4QA 3Q7EA 2BH2A 3LGAA 4G0UA 3PD7A 4JC0A 1U28C 5IBCA 1RQRA 1CUVA 1F3LA 4K28A 4A27A 1P75A 2OILA 2EL7A 3AETB 4EPRA 5I6DA 3RSFA 1XT6A 5ERGB 2FPGA 2P9ZA 2X0FA 4CLEA 4QUDA 1Z4MA 1E6UA 1RRGA 4RKYA 1FX0B 4DG8A 4LKOA 4GLOA 3EDOA 2VHUA 4M22A 1XL1A 1JVNA 1AKMA 1QLWA 5JY1A 3NOXA 2PX5A 4KGDA 4ND4A 3UAYA 4BAZA 1Z5GA 1GUZA 4ALLA 1LF0A 5D3QA 1DRUA 2J46A 5JAOA 1HTTA 3JQRA 2O19A 4C7JA 3CUWA 3NXSA 3NW9A 3O75A 3B36A 5FFNA 3WR5A 2O05A 2OG2A 1Q0LA 3EF0A 2NU8B 4OGWA 1CZOA 1NOIA 1QG2A 2FDCA 1T8TA 1NZJA 4YGYA 1MDFA 4GMXA 4C03A 1P9RA 4C0QC 2KJQA 1KJNA 2GM5A 2QK4A 3A0RB 4UEKA 3S2UA 4KN9S 1QM5A 2GYYA 1II8B 2ETXA 1KGSA 2K4MA 4YCJA 2VTBA 2BFFB 1K7SN 4KI0A 3QVTA 4PYOA 4AMGA 1SC4A 1EP2B 2RG1A 4M86A 2HI0A 1X8XA 3DEZA 1JAXA 2QTBA 2R7MA 3AHCA 3UENA 1A9OA 1GU0A 2J4FA 2X1MA 3RVDA 1ULHA 1DLIA 1REQB 2QRHA 1Y8AA 2YV4A 4FGWA 4R2IA 4ZO9A 5IP5A 2YHIB 1AA9A 2A5GA 3T54A 1CFJA 1IC6A 1JZQA 3O4JA 4D96A 3GARA 4TT3A 3UFBA 2OV1A 5DOZA 2HOQA 1C9KA 1DKRA 4OXYA 4OQDA 1I1HA 1L8LA 1T36A 3FNIA 2QUHA 4Z7JA 2OK8A 2IWRA 5K99A 3WGKA 2P1DA 1NT2A 3A4YA 3A6GA 3IAAA 1QQ6A 3FSGD 4OAPA 3HCCA 5BPFA 1R10A 4Y9TA 3TLCA 3VU9B 2JZCA 4E5NA 1VB5A 2HU8A 1DSSG 1ZOSA 4X97A 5FIUA 4FZJA 5K0CA 1KJYA 4GQIA 1LV7A 4PYQA 5ETJA 3AP1A 1VMDA 4PX9A 4BNUA 1QRDA 1R5JA 1JEOA 1HLPA 4MLPA 3IDAA 4OMFG 3SCZA 3ND9A 3GBPA 5I7OA 2EIXA 5C51B 3GA7A 3FBGA 3OG9A 3EIXA 5IF9A 1Y3IA 1MPXA 1ZD4A 3BB3A 4FNGA 4RKFA 3HWRA 4L7QA 2F2TA 3H6KA 1O9BA 2GEBA 2QVGA 3ORRA 1ISGA 4YQFA 3PGLA 4FYKA 2VRWA 1Z5PA 1KI4A 4OFZA 4P1ZA 5KX5A 5KPDA 4KQFA 3CM0A 4FQ5A 3CEHA 3H5IA 2IZZA 5HFAA 5JBQA 2AQKA 3JAWB 5AHKA 4AZWA 4ZVTA 2B9EA 3B7WA 5CPBA 1M1NB 1VECA 5EQTA 1YFJA 1G21E 2QT9A 2WSLA 3GT4A 3ZKAA 1O6ZA 2OV2A 5JZ9A 4F1KA 4KZKA 4G89A 1SEPA 2UYYA 4LJ5A 3HH8A 5M3BA 5IFLA 5MFPA 1FJGB 2IDKA 2VH1A 2GMWA 4FJ0A 2WWWA 3ORSA 2FFRA 4II3A 3SKYA 2NQ8A 4EZIA 2Z3VA 4MJ3A 1W36B 1GPYA 1IZ0A 4CV1A 2XODA 4NPAA 1VI6A 1L1RA 4GO1A 4TT8A 3HN2A 3ILHA 1KI9A 1QF6A 1C1HA 2DECA 2JS7A 1CQWA 3IOBA 2B4YA 2FWJA 2FF7A 3SIPA 4NOMA 5BN5B 4HNQA 2VG8A 1ZRSA 4NCNA 2BLNA 3HGMA 3DM5A 1M7BA 1M2HA 1ZMXA 3D6TB 1IU9A 2MU1A 2IV3A 3HMQA 4POAA 1E3SA 1YQUA 2HO5A 2OWEA 4UD6A 4XM0A 2B7CA 3QMWA 4JLBA 3REGA 2GBPA 3IRVA 1I2DA 5DYIA 1UQTA 5A06A 4L2IA 2YJ6A 1DAPA 3QH4A 4U7JA 3UH1A 4BV2A 4IIYA 2FF5A 2A0XA 2AFHA 3DFUA 2CVZA 1WS6A 4X20B 1HSZA 3AU9A 5DGTA 3JQ7A 1CEXA 4F4DA 5KDDA 3WLAA 3Q4GA 1WBBA 1XTSA 1YHYA 1YR3A 4TWAA 1XMQB 2D5IA 1T34A 2CFRA 1MVNA 1QHYA 1VRCA 2G09A 3ORFA 4DQLA 1N4DA 2GTPA 1BU5A 1YUBA 3FYSA 1HFJA 4B6FA 2HQBA 4IMPA 1WDLA 2VYNA 1UEJA 3FMGA 4UUOA 5KWSA 1WMSA 2FOXA 1G3IA 1WKVA 4KAJA 3LWBA 2XE7A 5DGDA 3HV0A 5DSTA 5D6NA 3VC3A 1D4AA 3QHAA 3LV8A 2OGUA 2AOTB 2PJUA 3MCZA 3FOCA 4NMLA 4Q7JB 4ZVPA 3U7QA 3D6HA 3FKSA 5EPUA 4B3SB 2A9RA 5DN9A 3QBJA 5TE9A 3IURA 4UVIA 3UYKA 1O5OA 5G3YA 1Q83A 2Y0CA 3OPXA 2B2XA 1CUXA 2H0QA 4WXPA 2VRBA 1A9QA 4LV6A 4H35A 1F14A 4FZ5A 2NADA 3JWGA 1GT6A 4LYFA 2BGNA 3PQ5A 4G85A 3W6UA 4KBGA 1K4YA 3CF4A 5BR8B 1OLOA 1DBSA 1L5WA 5DNEA 5KREA 3CXUA 4DREA 4MK4A 5DLEA 2AG6A 1THZA 1E79D 1UKBA 1Q7BA 1BMTA 3M6WA 2DSTA 1G7RA 2NACA 2J0UA 1P7CA 3HUEA 1T4DA 1BHQ1 4B4WA 3HB0A 2JLSA 2QU8A 4MJ7A 1W88A 1RJGA 4CQMA 1Z56C 2D2IA 1RI1A 4IIEA 1VCOA 4M9QA 4M9SA 3ELBA 3U3RA 1VYHA 3DZIA 4PSKA 4DY4A 2V7XA 3GLIE 4IMRA 4L07A 1T1GA 2BR3A 1DKOA 3PFBA 1U3CA 4YUXA 2OGWA 3KOUA 1A69A 2ZWOA 4EKNB 1QV6A 5G2OA 1HNXB 2H5LA 4W1RA 4DQDA 2EDAA 2WJJA 1SC6A 3F7NA 2QEQA 4E3WA 2AQ8A 1JPUA 3G3EA 1TLLA 3N9IA 4OI0A 2QYOA 2ONCA 4CV2A 2VJCA 2TMDA 13PKA 4LY6A 2PUCA 2ZE5A 1O9GA 3WVNA 2FUCA 3R9IA 3PNVA 5KTOA 5JDIC 5L7TA 4KGXA 3SVTA 4Q1VA 4NECA 4D2IA 1KMMA 2YN4A 2FR8C 1O03A 5B1HA 2H4JA 2OO3A 2QX9A 1YOBA 3NGXA 1SQ6A 3OX1A 1UR5A 3MYRA 1E98A 4JX8A 4XYGA 2FJUA 2J6HA 2QL5A 1X7XB 5L8VA 2YWBA 2CKMA 5G4LA 3UMVA 5JUWA 3IQGX 4N7JA 3OD5A 4E51A 3WBBA 3H1BA 1EUDA 5ALYA 2WJ4A 3G82C 2PUHA 3TNDA 1XQYA 3NYIA 5JJLA 1DIOB 2Y93A 3RUFA 4EYEA 4OG2A 1CJUC 2OBXA 4OVKA 2R0QC 1KVTA 2OBNA 3ESCA 1IY2A 1GPUA 2OBFA 1GPH1 1E8NA 2GYVA 2C0CA 3Q98A 4C3OB 4X85A 3AFHA 4A5SA 1Z2AA 2W2PA 3WQSB 2JEYA 1Z4PX 1C1XA 4ER6A 1EFVA 1XNHA 1PFYA 3LGSA 1QH8B 2ADOA 5AHRA 3DDOA 1T3ZA 4Y2VA 1A82A 2AG8A 2B1IA 3AESA 2IOFA 2Q5QA 5EA2A 2FI1A 3BCSA 4X54A 3UAWA 3T5PA 3M4YA 2IS6A 3REOA 5FDFA 5K1ZA 3IUSA 1K3UB 2JGEA 2JLUA 5ED4A 4L95C 2AL7A 3WLFA 1PTKA 4J94A 2IQ5A 5EZ5A 1VXRA 1IAVA 3KKNA 1U0NA 1J9EA 3QVJA 4AKIA 3GIDA 3HA5A 2OFWA 1U7XA 3MT0A 1GSHA 1W19A 3HDYA 3NVMB 4UCXA 3WJAA 4WLNA 1RWKA 4PQYA 3FYUC 2JZOA 1HQKA 2BY4A 4G07A 3H6HA 4MUAA 5FR1A 4YT4A 4GE3A 1VJ5A 1W59A 4EKEA 2I55A 4J1QA 3ZV7A 3AEZA 4HWOA 1N5LA 1G291 2ISQA 4PZYA 3JARA 1OFGA 2EXXA 3KHUA 4BQSA 5B6JA 2GHIA 2P9JA 4QPJC 5AM5A 3RC2A 4CQLA 1JH8A 4JR2A 3URKA 1CVIA 1Q74A 5CA0F 2WUVA 2DR0A 3H7IA 3WFZA 4C20A 3E3NA 3DBLB 4PPFA 2XQKA 5E3HA 2LCIA 1PR2A 2FPSA 3HZOA 1KI2A 2CL6X 3V5NA 5CFNA 3G5AA 3D8HA 5TQ0A 4MR7A 2IF2A 1B0UA 2FN7A 2YXLA 3AR3A 1T13A 2BWJA 2UZIR 1DIBA 1KJQA 5B7GA 2DHDA 1J8DA 2XZDA 3P2YA 4B33A 2N75A 1S2NA 2GKOA 4NDZA 3P9SA 3RRFA 5JJKA 1QTRA 3FBWA 2VP9A 5T64A 5HIKA 3SYMA 2Q4TA 3D59A 1F5NA 4KMOA 3QQ5A 1ILEA 3QYAA 5FUXA 1ESNA 4HS9A 3Q7TA 3RRNA 3WRYA 4BC0A 4HGYA 2TMGA 3RSGA 1RIFA 4X1IA 3COPA 4IKEA 3RVQA 4TYWA 4GNRA 4WBSA 1HMYA 4KQXA 3VPCA 4HRAA 3DR3A 1SXJE 4RTMA 1UKZA 2R85A 1RD4A 2J59A 5JAHA 5MN5A 1N75A 2I34A 3S7TA 1DEHA 3TW0A 4DUGD 5F7OA 1G8GA 2OT3B 1KRWA 4HDOB 2HMAA 4FDMA 1ZESA 4Q3DA 1YBHA 5FNVB 2D74A 1RWPA 4F21A 1MOSA 1UZNA 1E7MA 1YRHA 4FX2A 3UOAB 5EJGA 4EYKA 1J4AA 1IMJA 4KGVA 4W5TA 3RQSA 2JBAA 3A6PC 2EW1A 3T8YA 4ZXPA 3ADCA 2CDRA 5HNKA 2N9UA 2AXQA 1GFIA 1MO4A 1MRZA 3PJGA 1R88A 3E1KA 4ITRC 1L7RA 1RAIA 2QNIA 2VWQA 2OG1A 2ZI6A 3E22B 4RO0A 2X0RA 3LA8A 4UXIA 1MQ9A 2PRIA 1XYYA 3P5BA 4U63A 3RUDA 3LY8A 2ZRBA 3CWCA 4RVOA 4UZFA 3BMCB 2RDMA 1GTJ1 4BO6A 4BO0A 1CDEA 1CP3A 1SK8A 2UVDA 3MS7A 4DLUA 3U1TA 4D45A 1XNJA 2BEKA 3OQHA 1R3UA 2IHYA 3OWOA 5FOXA 1J2RA 1H1LA 4YJHA 1OPRA 1TUGA 3AINA 4ZAXA 4CT4B 3NFYA 3SS8A 5JV5A 1XP8A 1UBJS 4DDVA 2Q0HA 1GNSA 3N5CA 5DTMA 4MR9A 3A31A 4F2DA 3ZD7A 2WZBA 1PQWA 4TXJA 1YBAA 3NALA 1NYTA 1ZK4A 5E3IA 3DVQX 1MJGM 5B37A 5IT4A 4W6QA 4ETMA 4KQ1A 4ZDIA 4TGLA 3M81A 5JMOA 3ODPA 2QMZA 3P4UA 1GPNA 1J2TA 3AIOA 5CLLA 2JIOA 4Q9AA 3SJZA 4F2HA 4C6HA 3JZAA 1EESA 2GR9A 3A58B 1EFKA 4HLDA 1SUCA 3OWXA 3AP3A 3SDSA 3QE0A 3P9IA 5KCZA 3QLEA 2ASVA 1Q19A 2JCXA 2ZUTA 2AB0A 3VO9A 1NVXQ 1BFDA 4RA9A 2GBCA 4OQEA 4TWJA 5DNCA 3LC1O 4U6NA 1L3CA 3WLMA 2R6JA 2YL2A 3KOZA 4Z54A 3G7NA