2VH5R

Crystal structure of hras(g12v) - anti-ras fv (disulfide free mutant) complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords ANTI-RAS FV HEAVY CHAIN
publication title Functional Intracellular Antibody Fragments Do not Require Invariant Intra-Domain Disulfide Bonds.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2007-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2vh5R00
1HY3A 4LSGA 2Z4SA 2Q9AA 5BQ5A 1NIJA 1R0ZA 1OXUA 1HQCA 4IXMA 3U60B 1JBKA 3SQWA 2VHTA 1E32A 4TLAA 2H18A 2F9LA 5JBQA 3GLFB 2WBLC 2BWJA 4KODA 1C4OA 3GMTA 1XXHB 4XJXA 3LQQA 2BEJA 3SE0A 5TB5A 4V03A 3GD7A 3N2EA 1G8PA 2V8OA 4MGZR 2QMHA 4GFDA 4V0MA 4HUTA 4DB2A 2ERXA 1BYUA 5FL7D 5HR5A 4DDUA 3IILA 5EZ5A 3RYTC 5LD2B 1NMZA 2KSQA 4DLUA 1DG3A 2CNWA 3LNCA 5EJEA 1NG1A 2FGKA 1P62B 2WJVA 4HLCA 3P20A 4NMMA 2W6ID 1HQYE 2YYZA 3EIHA 1TU4A 3GJ4A 5CDFA 1WDTA 1XEXB 3KXIA 1SVKA 3L0IB 1MO6A 4JVLA 5TXGA 2VF7A 2HCJB 3T1OA 1PV4A 3N5CA 4QOSA 2V1UA 2VP5A 2YINC 3H2YA 4Q02A 3DZ8A 1ZM4A 3LD9A 3WXMA 2FV8A 2BBWA 4D0LB 1PLLA 1RZ3A 2R2AA 4WZAE 2HDNB 3OIVA 3KTAB 4PQYA 3CX7A 2GAOA 4DUGA 4QRHA 2IYUA 2VHQA 1HTWA 4TL9A 3EG5A 5HZKA 4YMSA 4QGAA 1DAMA 3GEEA 2AR7A 1KK2A 3LV8A 4HB2A 3B1WA 4M9QA 2LCFA 1CRPA 3GJ0A 1HUQA 3L8YA 2J0SA 2QNRA 5J4VA 1OV4A 2ANCA 1MR3F 2DWOA 2IBMA 2PEYA 2IA5A 4OK3A 3UWKA 4A82A 2C9CA 1OH6A 3CF0A 1U9IA 4L5BA 2HF9A 121PA 3GLFE 5TARA 1VG1A 3H4MA 2O8FA 3VKGA 1XXHE 4KBFA 4CEIB 2WIBA 4RD1A 2AKAB 3KQKA 1VIAA 2CMKA 4BFSA 1E0AA 1F60A 1HT2E 2OAP1 3CRRA 3NH6A 1EFRD 4JT4A 3S1AA 3UK6A 4IFEA 2XB2A 4O0MA 1L4UA 1RRPA 2ZRIA 5CYPA 1II8A 1U2RA 2X2EA 1N5JA 3SI7A 4C7OB 2J0UA 3AV0B 2QTHA 1Z47A 3K8YA 2QQEA 3Q7QA 5L3SA 2REXB 4OK5A 3DEFA 221PA 3SYLA 1E98A 2J5XA 4DT1B 5FBWB 4Q4HB 2EFDB 3CIOA 4YMVA 2AK2A 4TT3D 1PJRA 2FNAA 2YWEA 1R10A 4Q1DA 1KZGB 4WOPA 2CCJA 1TQ4A 2OLKA 4GL2A 2JDID 4EQ6B 2FE4A 5KSYA 1QHHA 2QP9X 5JZVA 4PC2A 3VR5A 1WBDA 2BBTA 4MKGA 3FHTA 1RW4A 2GK6A 4B6EA 1J8MF 3NWJA 1P61B 3A4MA 1YZLA 4NYIR 3PEWA 1DBSA 2OBMA 4NDZA 4Q18A 4LJAA 1NSTA 3GJXC 4KAXA 1E9SA 5DI3A 3PJRA 1S1CA 1Z29A 3WHLA 5DIFA 1E99A 5AWFC 2BMFA 2JJ2D 2QORA 4QNRA 1FX0A 3EW9A 2C99A 2IS4A 2Q6TA 1LF5A 3L2OB 1P9NA 3TVTA 1FP7A 1GWNA 1R0XA 4E03A 2RGEA 1JEEA 2W6JA 2ONKA 4LOAA 3RANA 3TSOA 1AS2A 3HYTA 4RD6A 3CH4B 4CDGA 5CB8A 3DVLA 3EPKA 4XD7D 2JLSA 1UKEA 1XCPA 3F5FA 5A4JA 1OSNA 3TK1A 3ZZ0A 3REFA 4C0KA 2FPKA 5BYKA 4FWTA 3LWNA 1M7BA 4DCTA 3NVAA 1D2NA 3OESA 2QAGC 1U99A 3A1TA 4HB3A 4M4SA 1KAGA 4FWIB 1XJQA 2IXGA 2ZRCA 4EPWA 3A8TA 4BPBA 1P75A 2OHFA 4A6XA 2BBOA 2AFHE 3F8TA 2YV5A 3OZXA 1J99A 2EQBA 2WZQA 1Q22A 2GJ8A 2IF2A 4DIDA 5IHPA 4NYJQ 2G9NA 3Q72A 5K8LA 2FPMA 2UZ3A 3CPEA 3PUZA 2ANBA 5JI2E 3TGPA 4E22A 3LXRA 3BWDD 3QNUA 5JCZA 3RS7A 1IN8A 2HLDA 3MFYA 1QRAA 4US2R 5FPYA 2IYXA 1QHYA 4A0RA 4HAXA 1X1SA 3OIUA 4PZYA 3R9WA 4Q7MB 4LV5B 2QRNA 1Z63A 4M1YA 4P31A 4UKDA 2XZOA 3ZD6A 1G7SA 4X8MA 2ZSAA 3ADBA 4M9SA 4MYCA 4AKGA 3VU9A 1I2DA 2B7CA 2XEXA 4IDQA 4QJ4A 4PSAA 3EX7C 2PL3A 1LV7A 3IQWA 1COWA 4RZ2A 2C77A 4URUR 4XWAA 5EE9A 2ZE5A 3U6KA 5FBRB 1F5NA 1Y3AA 1MABB 1FZQA 1E9EA 5CB6A 2WV9A 4F93B 4TQUS 1G3UA 2GJKA 3N2IA 4JKYA 3U2QA 4OKSA 3TMKA 2RGGA 3QKSA 2ZJBA 4KCGA 1OXTA 4JBYA 4FMBB 2ZITA 2RGNC 2BJWA 2P5SA 3ZIAD 3L8ZA 3SFZA 2EYQA 2H57A 1K5GA 1NLYA 3KX2A 621PA 2EFHB 1KJYA 1OF1A 2V55B 2KJQA 2BKEA 5E4FA 2WOOA 1RRCA 3K53A 3ICEA 2C98A 2ZYVX 4IJMA 5DO9A 4EJSC 3PENA 5KDOA 2JLZA 3BK7A 3K9LA 4KFTA 2R8RA 5JRZA 4LK2A 2WAXA 5FBVB 1GNQA 2BKUA 2V6IA 3AP2A 1U8YA 1W48A 1OIVA 3QJYA 3AP1A 1RRGA 3CONA 3SS8A 1E69A 1HYQA 1YZKA 1CKEA 2A9KA 4PC6A 4LX0A 4JLNA 3OIWA 2ZE6A 4DCUA 3B1XA 4FMCB 3CR7A 5J40A 4BRUA 5DN6D 1UKZA 4ARZA 2GDJA 3BJIC 1KMHA 2D4HA 2RCNA 1XPOA 3O47A 2HJVA 4Q7LA 3LVQE 2IYSA 4B3FX 1N5LA 2J0QA 1M6NA 3B13B 1DOAA 2OEPA 1O87A 1CULC 2RH5A 3LBIA 1DAHA 2ZRFA 4F92B 1OKKA 3G82C 3A1SA 2WSMA 2ZU6A 4XTCS 2HT6A 2OCPA 2ZAMA 4BFWA 3JVVA 2WTUA 3BAFA 1E2NA 5CLLA 2NG1A 3AVYA 1ZVQA 1K6MA 2QP4A 5LD2C 3Q7PA 4JL5A 2FF7A 3MWKA 5DH9A 1BMFD 1W0JD 2ORIA 4Z51A 4IXNA 4OI4A 1MOZA 3TUJC 4OHZA 3UMSA 4POAA 3GP8A 1E3MA 4XIGS 2QUZA 2ZIAA 3OE7D 2IT1A 2IYTA 1G291 3QVVA 1W2GA 2BV3A 4LHVA 4QBIA 3O8DA 1N5IA 5EE1A 4RJLA 2O8FB 2VHCA 1E2PA 4HAVA 5IRCD 2IL1A 2XNDA 5KOYA 3B6EA 3HP1A 4AD8A 1NF3A 3FFAA 2FFQA 2VQSA 1TUIA 3SR0A 4HAUA 3S1AB 1TX4B 2BJVA 5FR2A 1ZCAA 4UNNA 4CYMA 1NLFA 1WF3A 2CHVA 2FX3A 1X8KA 1NBMA 1II8B 1UBEA 3AVPA 3CX8A 1E79A 1KI6A 4LJ8A 4CGZA 4HZUA 4B48A 2J0UB 3RSLA 4LPSA 1NSFA 2QMOA 5L3SB 1E0SA 4B3BA 1CF4A 1G64A 1IY1A 3THXB 2IS6A 3KXLA 3TLXA 5F9FA 3AF1A 3FPAA 4DLYA 4M1TA 1B0UA 2F1HA 5B64A 3NG1A 1W0KA 4Z8YA 2H92A 3LDAA 3CNOA 1Q1BA 1ZYUA 2OT3B 1ZM2A 2ZJ2A 5BN5A 4IVRA 4L16A 2G3YA 2F3TA 3JZAA 1GZSA 3IEVA 2HEIA 1R5OA 5KSOA 2EU8A 2G0NA 4IOJA 4C0SA 3H86A 2O8CA 1N6RA 3ETLA 2RHDA 4FINA 1U98A 1KJWA 1Z83A 5DI3B 4LDJA 5JS8A 2CBZA 1RFLA 1TU3A 5E7MA 5CM9C 3W34A 2WSSA 1G21E 2BM0A 1FX0B 2GJSA 1G3RA 3MG9A 2WPDA 3LW8A 4F38A 2FU5C 2JLYA 1AKYA 4IEEA 1Z06A 1AS0A 1GOTA 2FZ4A 3NHBA 3U6BA 1E0JA 4HAWA 4P0TA 1UFQA 4UXJA 5G40A 4FN5A 2PT5A 2VP2A 3N70A 5ANRB 1G4UR 1GL9B 4QXAA 2NMVA 1YRBA 1AKEA 4XH9B 3HU1A 1Z6GA 2DFTA 4FXPA 3R7WA 3VKWA 2QMEA 3WNBA 4EPVA 5C4MA 1JI0A 4D81A 3LBNA 2RHMA 3PUYA 4V0OA 2I1QA 3BB1A 2ZR9A 2QTFA 4JSYA 4F4IA 2CL0X 3WNDA 4PAQA 2FZLA 4K8OA 3ADCA 2P2LA 4AG5A 3JZMA 4DLTA 1UDWA 2ECKA 4PZLA 4US1R 5KSPA 2VTKA 2EFCB 1MO4A 4JYCA 5KU1A 4HLUA 3A1UA 4ZKEA 4G1UC 2QBYA 3U7HB 3UIEA 2AXPA 3QXJA 3TSZA 3LLUA 2IYYA 3W6NA 1TADA 1IOZA 2DWQA 2R6GA 4DVGA 4CEJA 3WHKA 4JLMA 2CK3A 3BB3A 1E2GA 2P65A 3MJRA 4OYHA 2BBSA 2EFGA 2X2FA 1GG2A 5J4YA 3VU9B 2GCOA 4QBGB 1NLZA 2PCJA 1TEVA 3VR4A 4DSUA 4C30A 4PHFA 2GBLC 2AXNA 2QL6A 5FTJA 4D0NA 2OFWA 4LJ6A 4RFSB 1YHNA 2CXXA 1CR2A 4HB0A 4PZZA 1H8EA 3DM9B 1II0A 3QKSB 4LC1A 4PR0A 2D06A 2OUKA 3ZJYA 5AJVB 1E96A 3R9IA 1MO5A 1N2CE 1OYWA 4M9ZA 3I62A 3HR8A 1W49A 1IY2A 3A1VA 2V54A 3MGCA 5K8TA 1EWRA 3BS4A 2J46A 3SHWA 2W58A 1AJEA 3KTAA 5HZHA 3DZDA 1TMKA 2GXQA 4LHZA 2YHSA 1Z0IA 4DSOA 3Q3JB 1E9RA 3EZ9A 3I4LA 3QBTA 4GOXA 5FL7A 5KNDA 3EPHA 3NTUA 1GNRA 1OB2A 1G41A 3K09C 4OI0A 4KBGA 1BIFA 1KYIA 3IIMA 4YXWD 1J70A 1R7RA 2G83A 3EIEA 2Q3MA 1XTRA 1BYIA 1N6LA 3KKMA 3D3QA 1I2MA 2HUPA 4O2LA 4ARZB 1OXVA 2NGRA 4AYWA 1KMHB 4AKIA 3VQTA 5CITA 3PEUA 1G7RA 1VCNA 2WKQA 1KI9A 3LXXA 4MH0R 1Q44A 1RE0A 2VHUA 3LA6A 2WWFA 3NHAA 5AR1A 4JSTA 2ZRDA 1NVWQ 1N0UA 1VYTA 1GL6A 4Q5IA 2I4IA 5L3RA 1PUJA 2QTVB 4Q7KA 2GHIA 2Y8EA 3RABA 4CIDA 3AUYA 4RZUA 1CR4A 3MAAC 1ETUA 1ODFA 4ZDKA 1XTKA 3GJ3A 3Q5DA 3NXSA 1RJ9B 1OXXK 1AGPA 4M1SA 4RY2A 4F91B 2J7PA 1GNPA 3IO3A 1GP2A 2HJGA 3BORA 4WW0A 4YC7A 2CLDX 2E87A 4TMXA 3VHXA 2N1BA 2QQ0A 5K8UA 4LHWA 1HH4A 3LVRE 4GOJA 3KFXA 5SZIA 4IOMA 4RVCA 5H68A 3KJIA 2C04A 5GJCA 3UG7A 1OE0A 2YJTD 2NQ2C 1G5RA 1KI6B 1X8LA 4KFRA 1SVMA 1SVSA 4HZUB 3MRSA 4UQOA 5F9HA 4PSVA 3OF5A 3AVUA 1YVDA 4JZKA 3U5ZB 2A7QA 3MLEA 4TWZA 2WHXA 1AA9A 1LW7A 5HKKD 2BCGY 3RVBA 3CNLA 5DISB 3B1YA 3V4RA 4AIIA 4HAZA 3NBFA 4JMPA 4QG7A 1U9IC 1KAOA 4DLSA 2NO7A 2NZJA 2QY9A 2RGXA 3B1ZA 4M1WA 4YMWA 1NVUQ 3RRZA 3IIJA 1NN5A 3B8HA 4URZR 1LS6A 4DCNA 3DO6A 2YWFA 4BLQA 3DMDA 4P32A 3UPUA 5LB2A 1NN1A 4LV8B 4TTPA 3NC0C 4D4JA 4IDPA 1VG8A 4EPRA 3B82A 4V02A 2G88A 1KSFX 2IW3A 3DOEA 2D2EA 1XBTA 2JJ8A 3PUWA 4PHTA 1OFIA 4GP7A 3AGPA 1P2VA 1JPNA 2WKRA 5G3YA 4KLZA 4UNQA 1SULA 3AF3A 2ATVA 1CRQA 4OI2A 1NMYA 1DEKA 1DO0A 2ZE8A 4GSYA 3SJBA 3OFNA 2F1IA 4PX9A 4V0LA 4QJ3A 5BN3A 4Q1AA 1JR3A 2ORWA 3TKLA 4BRWA 2EVWX 4GZMA 2ONJA 1E2MA 3EPLA 1A2KC 5SZKB 5JWRA 3RS0A 2AK3A 4OI1A 4LCBA 2ZU0C 1KK1A 2JGNA 4D4MA 2DFKB 3R7WB 2O8CB 4N0EA 5B58C 4Q7JB 1NBME 4M1KA 1X1RA 2ZSEA 3W90A 2CCGA 2XB4A 4II7A 4JLBA 3AVQA 3NC1C 4RKEA 2EW1A 1LB1B 3THYA 4BECA 4D26A 3SJZA 1RIFA 1TTTA 3EWSA 5E3HA 4WXPA 3F3YA 3TNFA 4EFMA 2VA8A 2H1LA 2J59A 2DYKA 2PMKA 5EXTA 4MDEA 4OHYA 4YDHB 2V9PA 1G8YA 1KO1A 4Z1MD 2IYQA 2ODBA 2WWIA 5A0FA 3GFPA 4KFUA 2AD1A 3AKYA 2QBYB 4LI0A 1KSJA 3FMIA 1HURA 5GVRA 1E2FA 1JJ7A 3CZPA 4AKEA 3FMPB 1CLUA 4XOIA 4A0GA 4CEJB 1QHSA 2QU8A 4Y0VA 4ZDWA 1JEDA 1G6OA 3EC1A 3QEOA 3SC3A 1NJFA 2VRWA 1SVIA 1KMQA 2QM7A 3KKQA 2O0KA 3D8BA 4HLQB 2GCOB 1F2TA 2EWVA 2JEOA 2QE7D 5JHHB 4ZO4A 4B3CA 5KO2A 4R2HA 1D6JA 1MV5A 1OIXA 2ZRPA 2ZRGA 3PIRA 3C4JA 1NVVR 2W2TA 2ZI6A 3BH7A 5FTLA 5EP1A 1G17A 521PA 4YONB 4JLVA 1WE2A 1RPZA 3P32A 1WA5A 1BOFA 1OFHA 5IF9A 4A8JA 3AVVA 4QGHA 3ICQB 1OXSC 4G3XA 4LHXA 3VMFA 1UBGA 1UJ2A 4PAMA 4BLSA 4MDFA 4G5RA 3VR6A 5JEDA 4ABYA 5EXSA 1GIAA 1OIWA 1II9A 1GKIA 2QZ4A 3B7GA 5F2EA 2XTZA 1DO2A 5A5GA 1IONA 2V4ZA 4LV6A 3ZS9A 5JSZA 3DM5A 1ZP6A 2MMGA 4AKHA 2PZEA 3C5CA 4B75A 3KQNA 1VIYA 2DCUA 4BFYA 1KTVA 1AZSC 1Z08A 4RD4A 4LZZA 4TMKA 1G8HA 1JALA 1OHHD 1T0HB 3EZFA 3U3OA 3W3ZB 1JAHA 4A9AA 4TZ6A 1G19A 2EYUA 3B2EA 4BZXA 3ZGXA 2O8BA 2A5JA 4EUNA 1US8A 4L9SA 2IHBA 1Z0AA 1DVRA 2C5LA 3BFVA 4D2IA 4AURA 2ODEA 4C0AC 3K9HA 3R9XA 4MGKR 4MRVA 3GLIA 2DR3A 2LKDA 1IN7A 4DZZA 1A82A 4M53A 1W46A 3K70B 3CRQA 2AD5A 5EZ6B 1ZM7A 1GL7A 3DDCA 1VMAA 4HDCA 4LYJA 1EWQA 1T5IA 2G0TA 2FPLA 4GNKA 3ECCA 1ANKA 1F48A 2XOKD 2GF9A 4EPTA 3QENA 3THXA 1FMLA 1VG0B 3KL4A 3CUEF 5JRJA 2V7QA 2VSXA 4LJ9A 3OE7A 2C9YA 2XSZD 4U5XA 3CNNA 4PO9A 4DRZA 4PQRA 2Z0MA 2GESA 2P6RA 3UMFA 3E70C 4BEJA 3OAAA 3IKJA 3BH0A 4TMZA 3LO5A 3SJCA 4H9GA 1M74A 2IXFA 1ZW6A 4OBEA 4P3YA 5BW8A 3SQXA 3QKRA 2PT7A 1TF5A 4A1FA 4ZDJA 3GPLA 2BIFA 2GKSA 2DPXA 2ZS9A 1XD2A 2Z6VA 4JIMA 2WOJA 1BO6A 1G20E 2D74A 4JLDA 5JI3E 1KJZA 2CVFA 4GI7A 1W47A 3WYAA 5CM8B 4TL8A 4R7ZA 1IN5A 1G8GA 1M1YE 4A36A 1OJLA 2NZ8A 4V0KA 1SXJA 3CBQA 5FTNA 3TR0A 1LVGA 3BE4A 1PVOA 1R2QA 3W8RA 4ZDIA 2GILA 3HU2A 4Q9IA 1IHUA 2WWGA 3PEYA 3TQCA 1GSIA 2BC9A 5M04A 5L3QA 5EE3A 3AQ4A 1W36B 1IM2A 1R5BA 3KXKA 3QUSA 5BXQC 1HE1C 3ASYA 4BE7B 4HSEA 3LBHA 2NO1A 4E07A 1LFDB 3I5YA 1G3IA 4JKIA 1DPFA 1WRBA 2PJZA 4AK9A 1H65A 3T35A 3RAPR 3BB4A 1QF9A 3RS3A 1ZM3A 1KGDA 1QVRA 3WBKA 4XWKA 1VTKA 4HB4A 5FPTA 2QI9C 1E1RA 5HTKA 2IUUA 4P4TA 3RS5A 1KDPA 4TTRA 3B1VA 4K81B 4PC7A 1FFHA 2BDTA 1M7HA 5HCNA 2ZUBA 1CJUC 4Z54A 3LRPA 1R8QA 4FMDF 4FD2A 5EUQB 1A2BA 2BM1A 1AM4D 5GVSA 2FDCA 4FCVA 2NO0A 2I3BA 1DARA 4PPNA 1JR6A 3TBKA 5GADl 2JLWA 5EE0A 3GJ6A 4X8OA 2ZSBA 5IK2D 1YZNA 3K0FA 4TYNA 3ZDQA 3W6PA 1NY5A 1Z6AA 2PCLA 4IFBA 4RD2A 3WY9A 1T0JB 1W5SA 1D8TA 2IEZA 2Q9CA 5FOVA 4A6PA 2O8EA 3K0EA 2OAQ1 4RFSA 2YC4C 1YKSA 4TMTA 3EASA 1EFUA 2WAYA 3QE0A 3CR8A 3THYB 3BFXA 5JWOA 4HATA 3ZVRA 3WP1B 5GJBA 1FPMA 2FOLA 4BLTA 1XMVA 1ZUNB 2FJUA 3GFTA 4A2QA 5JLJA 1A1VA 2A30A 3GEIA 2UKDA 3DOFA 3VFDA 3AF4A 3VTKA 3T5GA 4B74A 4MYHA 2P5TB 4ZI3A 1ZIOA 3I8XA 4KVGA 4GPTA 1XCMA 2QEQA 1P60A 5JJLA 1KDOA 2CNWD 2IK8A 2IF0A 3X1DA 3C8UA 4HZIA 4WA7A 3L43A 1XJCA 1D5CA 3KQHA 3KUCA 2GA8A 1F2UA 1YZGA 2HCBA 3V9PA 3X1XA 2JIZA 1M34E 4CF7A 1NNEA 1OLOA 1NY6A 4JVNA 1F2TB 1TQ6A 3LY5A 4B34A 1G3QA 4PTLA 3TVDA 5KUTA 4HLUC 4DJTA 3U4QA 1J8YF 5AJYA 4LWZA 1SHZA 3Q5EA 1Y63A 2GXSA 1L8QA 1SKYB 4LUCA 4MUAA 2KE5A 4LY6A 5KPDA 1JR3E 1N6NA 1K8RA 1N6HA 1KOFA 4D4LA 3T1QA 3I92A 1GUAA 4DUGD 5FTKA 1OFUX 2P67A 4A8JB 2J7KA 1ZD8A 5SZJA 5FUYA 1HE8B 3M0EA 1YR9A 1GAJA 1NMXA 1IN4A 4M21A 4B71A 2TMKA 5TMPA 1ZUIA 3QSYA 3K0CA 2DB3A 1E94E 3TW4A 2F55A 2J45A 5KDLA 2B8WA 5JSZB 1XZQA 2B21A 1EX7A 4TSFA 1C9KA 3LFUA 3JVUA 3J81k 5DYGA 5JWHA 3KFVA 4YXWA 1RJ9A 3L0PA 2WJHA 3P27A 3FMFA 3K0AA 4NBSA 2GVZC 2PLRA 4F4CA 4A0HA 2QG6A 1YU9A 3TUIC 5AUPB 3V00A 1GM5A 2WMOB 2WWWA 2O8BB 2KB0A 3X1YA 1US8B 4TQAA 4CW7A 2NO9A 2R6FA 3EWAA 4HEJA 1XTIA 2JJ1A 2ZS8A 2XNSA 3GLIB 2X77A 4Q9LA 3GJ8A 3IBYA 3P4XA 4V0ME 3GEHA 3CPHA 4JL6A 4EFLA 1FW6A 3MD0A 3P1JA 1CR0A 4DDTA 5H8WA 1QVAA 4NU0A 1Q3HA 3T06B 4DDWA 4IOKA 4BGDA 2ZM5A 3Q8XB 2ORVA 4BASA 2GETA 1T6NA 1YJ5A 1XFAA 3ND9A 4PPQA 4KI0A 4IHQA 3BH6A 5EUMA 1E2JA 1E0KA 2OILA 2UZIR 2F9MA 3PEVA 2QGZA 5JCPA 4KVAA 4CZ2A 3GJ5A 2F7SA 1KZ7B 5KYKA 1TNDA 2E9SA 4RZ3A 5CDFE 1Z0DA 3U3JA 3K9GA 1KI4A 3WMEA 2W00A 3KQUA 3I72A 3NIBA 1KSHA 2CHQA 3FHCB 2ZQ5A 4JLJA 1JNYA 4I99A 4DLWA 1R8SA 1GKUB 1W4AA 1A7JA 2QROA 1CBUA 1T5LA 4B2IA 2WKPA 2X1VA 2A5GA 2ZJOA 2FFBA 3K70C 4FI3C 1SGWA 2C2HA 5FI1B 1TUEA 1G1MA 4X8LA 4W5HA 1G5PA 5EP4A 3QKRB 4Q19A 1BS1A 2KBEA 5CIWA 2K5UA 1XD2B 3FYHA 2MSEB 2W6JD 5FOTA 3RWOA 3C16C 1P2SA 4JLAA 4B6FA 1G3MA 1R0WA 3NEJA 4DLZA 3U44A 4G0NA 1T9HA 4X8HA 1XMSA 2ZJ5A 1SXJB 3CKLA 3PFIA 1Z0FA 2OV2A 1MKYA 5HE8A 6Q21A 2A5YB 4GP6A 2GRJA 4DEYA 1ELOA 2W0MA 1W2HA 2O0JA 4Q1BA 3UG6A 3GLIE 5L3QB 1H8HD 1AS3A 1ZD1A 1GRRA 4CRWB 1WBBA 2XAUA 4IDNA 1AN0A 2AWNA 2NIPA 4Q1FA 3TRFA 1XX6A 4JLKA 4HDOB 4PPGA 1XZPA 4B2PA 3AVOA 2WIAA 4G5OA 4KYUA 2REOA 2RGNA 3MUFA 1AQUA 1ESMA 4DWJA 1SVOA 1G9XA 1S3GA 2HLDD 4XVQA 1N6PA 4NHOA 5JFGA 3VNVA 2ZETA 3VR2A 2O5VA 4BQSA 2IX3A 4C2TA 1JECA 1RKBA 2OFXA 4A15A 3CRMA 2ZRMA 3KQLA 4A0FA 1DG1G 1W36C 4QM7A 1R4AA 4UJ3A 4NYMQ 4NYJR 1CJMA 1COWD 4QNMA 2ZRHA 2KI5A 3MWJA 1EGAA 3EA0A 3PQCA 3WP0A 4ESVA 1KO8A 4PFSA 5FUWA 3K0FB 3W5JA 2XITA 1YR7A 1ZC3A 2OBLA 5LPNA 3TR5A 4D6PA 3A36A 1T8UA 5KTYA 2JATA 1XJ0A 2O8EB 1W5TA 1VDZA 1KI7A 1S1MA 2V6JA 2VL7A 3L0SA 2FG5A 3TIFA 1SXJE 3QPUA 3WBJA 5B30A 1E9BA 3T61A 4GBMA 1N25A 3NEYA 3B5JA 3CZQA 3UMRA 2VHJA 1AZTA 3PUXA 5BWMA 1XPUA 2XXAA 4HAYA 3GLGA 3DMNA 4TMVA 4PC1A 3GJ7A 2NPIA 2AWOA 3UXMA 1HEIA 4C3ZA 2PMDA 3VX3A 3AKEA 4B33A 3C7KA 3B9PA 5CJ2A 2PZFA 2VEDA 3GQBA 2QPOA 4WXRA 1OH7A 1U0LA 4Q00A 1P4SA 721PA 2JASA 3CF6R 1Q12A 3FMOB 4MKHA 1KO4A 5F3WB 4HUQA 3VNUA 2FEMA 4L4UA 2OG2A 4RCYA 4EPXA 2PEZA 2P6UA 1GRQA 1F2UB 2W2VA 4JVSB 1ZIPA 1J7KA 3AGQA 5P21A 3HR7A 2BMDA 3T34A 4IVPA 3LQRA 2W6IA 3ADDA 3WMGA 1CEEA 4NH0A 4C0LA 4W5JA 3U4QB 2BHRA 1KIMA 3FTQA 4UXIA 3U3RA 1FUKA 3FDIA 3D6TB 1OKKD 3EXAA 5JECA 4G5GA 2A2ZA 4I81A 1JB1A 1XTSA 4UNPA 2WM9B 2GZAA 5HPYB 5LDDC 3PG5A 2JLRA 3M6AA 2C96A 1W44A 5C1BA 2IS1A 5CYOA 5C4GB 4O2RA 1NG9A 2Z83A 5JJIA 4EKDA 3EPJA 1XEFA 1ZUHA 1U8ZA 5AJZA 4TYWA 4RD3A 4W5WA 4KFSA 3K0SA 1U0HC 2OCAA 3IBGA 1R5NA 2ZRJA 1Z22A 2ODNA 4PO1A 2ZSFA 4WBSA 2CE7A 3L82B 3RS4A 1P72A 1E1QD 2ERYA 1OHHA 1E2QA 2VH5R 3PV0A 3Q85A 4I1SA 1RYFA 5C46F 4C2UA 4GMDA 2WICA 2XNDD 2H5EA 1KK0A 2HF8A 2IYWA 3K0AB 5JJKA 4OHXA 4W7SA 4V0NA 1XB2A 5B2ZA 1ZU4A 1KDRA 2RGDA 2GZHA 4PC3A 2BMJA 2CHGA 3B78A 4MKIA 3D7MA 4A8JC 4JLPA 4TLEA 4JBXA 4ILEA 3EZ7A 1NBMD 3SOPA 3SZRA 1EFRA 4LYHA 4C0HA 5FBQB 4ZCLA 1KO7A 4D25A 1UKVY 1E79D 1Z3IX 2R6CA 4MRNA 3NBYC 4OJKA 2ZJYA 3OHMA 5JS7A 4P33A 4CT5A 2BEKA 1F6BA 3P26A 2F3RA 2AKYA 1NIPA 3LW7A 5L8VA 4Q01A 3TAHA 3CRVA 3W3AA 1B23P 1AIPA 3SFVA 1Q1EA 2GAAA 4LJ4A 4MYTA 3QY0A 1UAAA 1X8JA 1BKDR 1OFTA 5FUVA 3EC2A 4TT3A 3SDZA 3THOA 5E7IA 1W0KD 2I1VB 4FCTA 3ZQJA 2JDIA 1NRJB 5DI9A 3IPXA 1XMJA 4F7WA 2VSFA 4B3XA 2IYZA 1EXMA 2QPTA 4Y0AA 1KI2A 2ZTSA 1RVDA 1S3SA 1XTQA 5F98A 1ZAKA 3BIFA 1E9DA 4IOLA 1WQ1R 3A58B 2FGJA 5GJVC 2ZRBA 3AEZA 3C5HA 1KY2A 2BMEA 1A4RA 1GTVA 1Q1ZA 4HI0E 4UXHA 2WSSD 5D3MA 4F4JA 4ZKDA 2YC2C 4RFVA 2WPDD 3MWYW 4ASUD 3AVXA 2C03A 2JJ2A 2YNMA 2ZI4A 3AH8A 1NKSA 2Q9BA 4DLVA 3C41J 3QIAA 3RLFA 3VR3A 1VHLA 2IC5A 1NKTA 2OESA 3TE6A 2FMXA 4MGYR 4B3DA 3U44B 2OXCA 5KHOC 1AQYA 821PA 4U02A 4RKFA 3FGNA 4XD7A 2B92A 1GVNB 2RKOA 2ATXA 2VIIA 1D2EA 3M4YA 3K1JA 1IAQA 1TQDA 3LX8A 1W7AA 1IXSB 4C0QC 2J0VA 2QSYA 2HYIC 2VO1A 2D3WA 2PZGA 3I1FA 1S4QA 4QHYA 2BVNA 3EZ2A 4JT2A 4TL6A 2ZRNA 4XWOA 3R8FA 1DAIA 2GBLA 3TQFA 2QP3A 1GITA 1U90A 2YVUA 4OL0A 4BFTA 3WMFA 4BEBA 5TDHA 1CIPA 2ZRLA 1G7TA 2WJGA 4PAOA 4Q03A 2GCNA 3AKCA 1KI8A 1N0WA 2YZ2A 1A5TA 3HJNA 4WIAA 1Z5ZA 4ZIRA 5J4LA 1G6HA 1IN6A 4MRSA 1SXJC 4OHWA 5FPHA 1G16A 1T91A 2OBNA 2ZR0A 5DE3A 3RRMA 2IUSA 4ZCIA 3RDPA 4EPYA 3IO5A 4I4LA 3T1VA 4UJ5A 4IKEA 1Z0JA 2CK3D 1DAGA 2DHRA 4CEHA 1FNNA 4QFMA 4B43A 1XF9A 3D31A 3GFOA 1F3OA 3BBPA 4ESHA 3QF7A 4DCSA 3EAQA 2B8TA 1OYYA 2QAJA 4EFNA 2SHKA 1V43A 2FSIA 2IWRA 1OPXA 3KKNA 1ZNXA 2IYVA 1E9FA 1ZNZA 1M8PA 4JLOA 4DLXA 3A6PC 1H8ED 2ZJ8A 3R20A 1EFHA 1E2IA 1S0UA 2ZI5A 1SVWA 4GOKA 4I1OA 5FPSA 2H16A 1SKQA 2F43A 5DNYB 4NYMR 2XZLA 4ZPXA 4W9MC 2O8DA 1W4RA 2QPAA 3VKHA 2XX3A 2ZEJA 3P4YA 1P73A 3DL0A 3FE2A 2MMCA 4NZYA 3CW2A 4JL8A 2J3EA 4DC9A 4TYPA 3E2IA 3ZZUA 4NL4H 1K5DA 3B60A 3I8SA 4KLNA 3QG1A 3ZIAA 1ZC4A 2O52A 3AB3A 5DLQC 1ONBA 4B44A 4HYYA 3IPYA 3QXCA 3LAWA 5AUNB 3GLGB 2XXAB 1N6OA 2F6RA 4GT1A 3RRNA 2QT1A 5DGXA 4B76A 3RWMB 4DKXA 2Q3HA 2A3RA 2XZPA 1ZJ6A 4LJ5A 3KB1A 3KUDA 4TL7A 3SBEA 2YOGA 2ZE7A 3HU3A 1ZD9A 3KJGA 2PX3A 3NH9A 4HUQB 1CTQA 1NN3A 4OK6A 2QGNA 1E2KA 2C8VA 1CU1A 1AK2A 2A5FA 2JAQA 2FFHA 2KBFA 4EIWA 5DN6A 3FWYA 4OHVA 3BC1A 4KU4A 5AUQA 4ACAA 2X8AA 3FFBA 1JPJA 3OEED 2FSGA 4AI6A 3K70D 2PH1A 3THWA 1XU4A 2FEOA 4DBLC 2OFOA 5TVKA 4TYYA 1JXMA 3CRW1 1XEWY 2RB4A 4BZPA 3SEAA 4YMUA 1U0JA 5EXXA 1TAGA 1P7CA 1DS6A 1T8TA 3AM1A 5JEEA 1UEJA 5FTMA 3BFKA 1I4DD 1Z6TA 4PPFA 4RD0A 2ZROA 3MCAA 1GRNA 3LX5A 1BMFA 1VYVA 1W0JA 1ZCBA 2J7PD 2GTPA 2PLFA 4U7DA 3LLMA 2DFLA 1YZTA 3TSWA 2O0HA 1D9XA 3E5HA 1Q20A 2B6HA 1T3LA 1UADA 2G77B 1XMIA 1T3SA 1KO5A 3U61B 3GLGE 4WZBE 3WYFA 1PUIA 2IYRA 2B7BA 2XJ4A 1YRAA 2ZS7A 1VKJA 1L4YA 1UPTA 2R6DA 3PVSA 2AX4A 5FBLB 3V4FA 4JVMA 2BCJQ 1CJKC 2LWIA 4PQFA 3FKSD 3FVQA 2MSDB 2VP4A 3CF2A 4BWYA 1WCV1 1U8AA 3K0CC 4E09A 1S8FA 3NKVA 1P2TA 1KNXA 2ASEA 5FOSA 3UWOA 1S9DA 2VBCA 3OEHD 1KSGA 4H1VA 4NCHA 4ERNA 4Q1EA 1I4TD 2XTNA 3HPQA 4R9UC 1W36D 4QGFA 5D3QA 4LBWA 3QG5A 3IDQA 2OE2A 2QRZA 5G41A 4R2IA 1CR1A 4MRPA 4P4SA 1G7CA 3DPUA 4M9XA 4M1OA 1D9ZA 4O3MA 3DKPA 4MITA 3PUVA 1R0YA 1TF7A 2VYFA 4MGIR 1UEIA 4L9WA 4URYR 1S2MA 4BLPA 4OJQA 2J87A 3W6OA 1GKYA 2DFNA 3IQXA 4Q4JA 2E1RA 4PSKA 3K9NA 2R9VA 3GLHA 5J47A 4DCVA 3CLVA 5D3MB 2W2XA 1KKLA 4KXFB 2Q21A 2X19A 4P4UA 2OO7A 5HE9A 4O25A 1FL9A 1NL3A 3ADKA 3BXZA 3OFND 2WJJA 4KO8A 2QT0A 1XD9A 1CS4C 1JR3D 1NVXQ 5AK0A 3SYNA 5H70A 4JBWA 4DXAA 4S35A 1ZNYA 4NE2A 3CWQA 4LC0A 3PR1A 4QKQA 4B3GA 2RMKA 3PCRB 3FOZA 2IXEA 2G1KA 4DSTA 1H8HA 3MSXA 5J5CA 3AF2A 4BFUA 1TL7C 1G4AE 4BFXA 3G0HA 4MRRA 3E1SA 3W5IA 1Q57A 3H84A 4BZQA 4U00A 4MYUA 1QHIA 5FL3A 2Q0HA 1AGRA 4FCWA 4IDOA 5EXPA 4YLGA 4AG6A 4AWXA 4EDHA 1MRSA 5KPJA 3AVTA 3TUZC 2GXUA 1QG2A 3SU8A 1IY0A 4ZIRB 3PITA 4Q9KA 3O8CA 2F1JA 1KDTA 1IXZA 5FI0B 4B73A 3KDSE 5CIQA 3QI2A 3A4NA 4M1MA 2NPFA 2LKCA 1Z0KA 2GF0A 3RS2A 1DTSA 4CEHB 4FIDA 1FNMA 2HXSA 3ZVNA 3QXHA 4DDVA 1XD8A 1Z8FA 4E5UA 1GFIA 2WWXA 1M2OB 2V1XA 2CL7X 4I1VA 4URXR 1PLJA 1O3YA 3VR1A 3NBXX 4C0JA 4MKFA 4BUJA 1UBFA 1X6VA 4NP6A 4KITB 1ZU5A 2JCSA 3SHFA 4Q1CA 1E2DA 2DBYA 4CT4B 3KKPA 2P6NA 1R6BX 3FHOA 4NCKA 1TEXA 2F43B 3QPWA 3ZVLA 5GJWC 3VAAA 1QG4A 3A4LA 4OQLA 3T12A 2O8DB 4PANA 3W9YA 1OB5A 3U7GA 4L15A 2JLVA 1LNZA 2GJ9A 1OH5A 1UM8A 4H1UA 1N0VC 2IHYA 1GILA 2PX0A 3I3SR 3ASZA 2F1RA 2QSZA 3ND8A 4DB4A 3CPJB 2DY1A 2NTYC 3EARA 2ZANA 4GRAA 5K8IA 4TLDA 1VPLA 1XNJA 2FFAA 2ZYTX 2ZPTX 2NO6A 4LPKA 4BFVA 2Q3FA 4DLRA 4A2PA 1IXRC 4TLCA 4G5QA 3I73A 3HYRA 2OZEA 1LY1A 2VF8A 3EZ6A 2YKGA 3MWLA 4QHTA 3M1IA 3ZH9B 2GEVA 1E9AA 3I61A 3OIYA 2HV8A 5FOWA 4WVFA 3GCGA 1DAEA 4TLBA 2IEYA 5CK4A 1XTJA 3RRYA 2W0SA 4KV9A 1E2LA 2HXYA 4B47A 2ZREA 1IBRA 2ZYUX 1EFCA 2KWIA 4XTRA 3SJAA 3PXGA 3THWB 1QZXA 1XWIA 1MH1A 3U3KA 1HA3A 3T15A 1WP9A 1XP8A 2VP9A 4AYXA 2QMUA 3TW8B 1XEWX 2QA5A 3RC3A 3FKQA 1QBKC 2R65A 2V7QD 4XSHA 4IW3B 1YR8A 1KY3A 1W4BA 2GJAA 4KYIB 1DADA 1SZPA 4WAUA 3QF4A 3BERA 1ZNWA 1E1QA 3T5DA 1S96A 3IEUA 4MQBA 4AYTA 4M8NE 1SKYE 3OAAD 1XCGB 5CLQA 5KNCA 1VYUA 1UF9A 1WB9A 2QAGA 1CXZA 2P3SA 1G5TA 4LBZA 5TV2A 4CVNA 3CB4A 2WWHA 1ZINA 1CJVC 2XJ9A 2RGBA 3W8NA 3WRYC 3WYGA 1J90A 3UKDA 2FN4A 1N3BA 1YQTA 1RYHA 2DWPA 4IVQA 4TYQA 4NPHA 4Q4AA 1KI1A 2CDNA 4LBVA 3X1ZA 1SXJD 2ZVQX 2OLJA 3B85A 4GMXA 2PBRA 4PHGA 2ZI9A 5AJWA 4BFZA 5DYIA 1E2EA 5L3VA 4UNSA 3IHWA 2Z4RA 2J1LA 1HT1E 3L0OA 4WZ6A 3NDPA 1QHHB 4NCNA 4NONA 1XPRA 5HKKA 4BLOA 2AN9A 1FOEB 1VECA 1XRJA 2WJYA 3U7EB 5FPKA 1I4LD 1Q3TA 1ZMXA 1BH2A 3QEJA 4HDQB 4DIEA 3CO5A 1DAFA 4N1AA 5J4HA 3QXSA 4LJYA 2G1JA 4ZV4A 1P2UA 4URWR 4P4SB 2FA9A 3IHLA 3UANA 2VP6A 2L0XA 1GDDA 1OW3B 4LBYA 4R98A 2D2FA 2WWYA 1N6IA 5HCIA 3TH5A 3VX4A 4Q4JB 2RAPA 4JJZA 2NOAA 5DHAA 3A37A 1DAKA 1UKYA 3U7FB 4ASUA 1E1RD 3GLHB 3QOFA 3QVUA 2IUTA 4K46A 3I5XA 1UBCA 1ZRHA 4Q66C 1FP6A 2G6BA 2AL7A 4QL3A 2CJWA 2JA1A 1W4CA 1DELA 2MSCB 2Z43A 1PLKA 2ZUDA 3HPRA 4YDSA 2AHOA 5IT5A 4YQFA 3IIKA 2VPPA 1L2TA 3SYKA 1FTNA 2QM8A 3KJHA 4EJSA 1X3SA 2BOVA 2ZR7A 4RSGA 4TMWA 4C4PA 1NN0A 5TY0A 4B32A 4A2WA 2AFIE 1C1YA 3CWZA 5IDVA 2GXAA 1IJEA 2IWHA 4YMTA 4ZCMA 1Z6XA 4C9BA 1E2HA 1TQ2A 3RC8A 421PA 2YWGA 2C9OA 1VG9B 2CVHA 4M2LA 3H1TA 5AUOB 4XVUA 1QHNA 4JJKA 3B9QA 2FSHA 1KHTA 3WNCA 3REGA 1D2MA 3GLFA 4RZXA 2WVJA 3AP3A 1T4GA 4IRUB 3X1WA 1M7GA 1XXHA 4LHYA 1E4YA 2WJIA 3I32A 3QQ5A 4LGMA 3WRXC 1TPZA 2GNOA 1OT3A 4ACBA 1FUUA 4Z1MA 1Z28A 4QBFA 5EQTA 5BN4A 1LTQA 1TF2A 2YOHA 2RGCA 2D7DA 5FOUA 3HDTA 1NVVQ 1EESA 2CCKA 2ZYWX 5KSZA 2WMNB 4JS0A 3LH5A 2FH5B 2JIZD 3GLHE 1EX6A 1SVLA 2REBA 4MUBA 1SHKA 2FSFA 4KJZA 4M0LA 4NCIA 1VCMA 3SNHA 2CEAA 2C95A 3KKOA 1XEXA 5FUXA 1E6CA 4GDFA 3NDBB 3ONWA 2J41A 4GZLA 2QE7A 3UATA 4N3NA 3O8BA 4AC9A 4UNRA 3T1TA 1N5KA 4DSNA 3HWSA 4PO8A 4QBHA 1NJGA 2JLQA 1XDBA 2H7VA 4I1UA 2HYDA 1CJTC 1P9RA 2EFEB 4PHHA 1KNQA 5FOXA 1NP6A 1J2JA 1CP2A 3AVWA 2GWHA 3DKVA 1VHTA 3QKTA 3RNLA 5LB4A 4QM6A 1NI3A 1QHGA 2OCYC 5FH9A 4TTQA 4Q4LA 4S2EA 1YZUA 4HLDA 1MO3A 2QENA 3EA5A 1ZM9A 4LYAA 4MA4A 2CL6X 2ZSDA 1JAIA 5DSZA 5UKDA 3Q9LA 4TSFD 2GEUA 4Q9JA 2QN6A 3ZLJA 4ON9A 1YZQA 4A92A 3DHWC 1Q1QA 4LJ7A 4KSBA 2JLUA 2CE2X 5E7JA 4L8GA 4CEIA 2XGJA 1FMJA 4D82A 5JHGB 3KZ1E 4ZI2A 3CM0A 2OSBA 3OEEA 4RCZA 3RSOA 3F0TA 2C78A 4FMCF 2JJ1D 4QHSA 1U81A 4NCJA 1DE0A 3C14C 1VCIA 4US0R 4KHZA 3ZD7A 2R62A 4IEIA 2CLSA 3U3MA 1V5WA 3KB2A 4C7OA 2D7CA 3TAUA 2GZDA 1JJVA 3ZZTA 1LS1A 2YWHA 2ZRKA 5C18A 5BYJA 3O8RA 4D80A 2ZXUA 3ZYCA 4DT1A 1N6KA 4Q4HA 2GK7A 2OXRA 1YE8A 2ZVPX 3ZS8A 1KK3A 5FFMA 4IDHA 3CH5A 3RHFA 1HV8A 1JQJC 4G5SA 4LRWA 4NYIQ 1FQKA 4BLRA 2PJRA 1WMSA 2P0EA 3KJEA 1X86B 2XOKA 2ZAOA 2N46A 1E4VA 4EQ6A 2IS2A 1Z6YA 3EIQA 1Z2AA 2FWRA 3NBZC 1VCOA 1Z2CA 2ZJAA 4J0QA 4AY2A 2D62A 2R6AA 3QF4B 2VLIA 3AF0A 4Q9HA 5EP3A 2XSZA 3TJZA 2Z5FA 2ZRAA 1ZBDA 1E9CA 1UDXA 2R44A 4OQXA 2CLCX 5EP2A 1ESNA 2W83A 1EFTA 1EK0A 2JLXA 3QKUA 1G18A 2QAGB 5CJPA 4XSGA 4G01B 3VHLB 4FW9A 4ITRC 3BOSA 1LF0A 1QDEA 2GEDA 1MRNA 1Z07A 2IYLD 3IGFA 4Q47A 2UVQA 3R8CA 3SBDA 1S9HA 1L7VC 2J9RA 4C0BA 2ZI7A 3IUYA 1KI3A 3AKDA 3FKSA 1W1WA 1Q21A 5E95A 4B35A 4R71A 4FMDB 4Q4AB 3ZQ6A 1P5ZB 4TQ9A 2GVDC 3OEHA 4DEXA 4TN1A 4OQMA 1IJFA 2XTMA 4OQFA 1JXOA 2A5DA 3AUXA 3QXXA 4KSCA 2V3CC 1IQPA 2ZUCA 4LYFA 2OCBA 3X2SA 2ZJZA 3QBVA 4QGGA 4EAQA 3MMPA 4Q21A 4XVRA 3SN6A 4URVR 2H8KA 2GCPA 3BRWD 2N42A 5G53C 1EG7A 5AJXA 5H1YA 4TZ0A 1YR6A 4D4KA 2OM2A 5C2JB 3FB4A 2YOFA 3H0KA 5CK5A 5SZHB 1G8FA 2H17A 3MJHA 1P6XA 2A78A 3A1WA 1OH8A 4PXAA 5KDDA 3ZVMA 4N0DA 4Z8XA 5FR1A 2ZI3A 1P3JA 3CX6A 5LBIA 2ODWA 1WXQA 1PZNA 1KKMA 3G5UA 1SQ5A 3BD9A 2VSOA 4Q48A 1MT0A 4OQNA 2RGAA 1T3HA 5EE5B 5G3ZA 4JYBA 2EWWA 2VP0A 4NKRA 4B2LA 3C15C 5KNBA 2CJWB 1JQLB 4A4DA 8OHMA 4M22A 4DHEA 1U94A 3QPVA 4EJSB 5ELXA 4QJ5A 5JMTA 1QHXA 1RRFA 1P9WA 4QC2A 5DHFA 1Q0UA 4D0GA 5J4KA 1RC8A 1MABA 3BGWA 4NTZA 1FQJA 3K09A 5B57C 2HT1A 5IK2A 1FTSA
chains in the Genus database with same CATH superfamily
1HY3A 2ABWA 2VBGA 2AEJA 1ZD5A 3FZNA 5BQ5A 1NIJA 1RE1A 1NPYA 1OXUA 3EGVA 1CZOA 1QZZA 4I5GA 1SA0B 2WKSA 1F2DA 1HQCA 3FCXA 4KX5A 4I4TA 1JBKA 3SQWA 1E32A 2QUHA 1S2IA 1IIRA 4ANFA 3UW1A 1K3UB 1C0EA 2V6GA 5GONA 3QE9Y 2JANA 3NAMA 4G85A 4IIJF 4OFXA 3ND5A 1NW6A 2ZIXA 3P52A 2WQZA 5TQ2B 2EJBA 2BI4A 3RK0A 4A7PA 1Z6PA 4DIMA 1O89A 3GMTA 5J5VA 2XCTB 3LQQA 2Z04A 3IP5A 4K9SA 1QQBA 2RHOA 1DEXA 3GD7A 3LA8A 2KX7A 1QTNA 4V0MA 4DB2A 1SCIA 1T8PA 3VGPA 5HR5A 2H2FA 7ADHA 4DDUA 3IILA 2SNIE 1JU3A 2ZATA 3CLSC 1NMZA 4K2HA 4FFBA 4DLUA 1DG3A 1GLVA 1ULTA 5ESWA 1XMPA 2HNKA 3LPMA 2YJGA 4FKMA 3ZU6A 1SBIA 2WABA 3OTQA 1XNQB 4NBUA 2FGKA 4LZNA 1JHRA 3DE1X 5EESA 4NMMA 3FNBA 1DKOA 1TU4A 1KVRA 3LDHA 1C9EA 1DRUA 1WDTA 4EUEA 3LGAA 4UUAA 4AUEA 2IHJA 1SXQA 4Y30A 4IO1A 4RHYA 2GRUA 3H17A 1C3OA 2Z3WA 3LM8A 2VF7A 1PNOA 2ZBFA 4JDPA 5BR7A 3AUUA 2ZYIA 2VP5A 3K32A 2G40A 1TFRA 2F3UA 4EY8A 3DZ8A 3WXMA 1OBOA 3BSYA 3G9TA 4WKPA 5ALZA 4MS1A 3ILSA 4CQMD 2AYXA 4ETWA 2VPIA 2DKNA 1X2BA 1KE2A 2XGGA 3OIVA 5C7OO 3KTAB 1M3SA 1W9HA 4RABA 1BAPA 4QRHA 1XVAA 2VHQA 1A96A 3FKJA 2SCUA 5A9RA 5KQLA 4TL9A 1XZCA 3EG5A 1W8IA 2I3DA 3ROQA 2B1IA 1DAMA 1HTBA 2BFAA 3ZLTA 5CD1A 2BGJA 5JD6A 2Z57A 2LCFA 3FUTA 3HV2A 2VZ9A 4M9QA 4D7AA 1E3TA 4QUBA 3F3KA 3LC1O 2EG5A 1JMVA 2GCEA 2N1MA 2E21A 1OV4A 3UOGA 4EK9A 1MR3F 2CLFB 5K3BA 4O2BA 2IA5A 3TOCA 4CR8A 1H5UA 2BI8A 2C9CA 2NUTA 3OUTA 5CDUA 2WB4A 3MBOA 4M46A 1U9IA 2FZGA 4I2NA 4G41A 1B8OA 121PA 1ZUWA 7MDHA 1R9MA 3VKGA 1G38A 4GRIA 1XXHE 4EFDA 3PQ5A 3Q41A 4RF3A 2OHXA 3H6HA 2CMKA 4J0KA 1Z18A 1JKXA 2JD1A 5ECDA 1E0AA 4BN5A 1GGMA 3EGXA 3S1AA 1BCRB 3EG9B 4FFVA 5IJ0A 1RRPA 3IR6A 5CYPA 1II8A 1WSDA 2X2EA 2FOIA 4MDYA 5A7HA 4DIFA 1N5JA 1E1CB 3EDQA 3FRHA 1CY7A 1S3IA 2BEWA 3HDQA 2ADOA 2J0UA 3HWX1 1CS0B 1Z47A 2CXHA 2DLDA 4KDEA 3O8QB 4PINA 2QQEA 2TRSB 4NBVA 3OCUA 2GBPA 1N75A 3BF8A 4OK5A 4OLBA 4MTLA 1WXWA 2QZPA 1P3DA 2FP3A 1HYHA 1NF8A 1BXKA 4YMVA 1MPXA 2AK2A 4IAOA 4HDSB 5KKNB 2BZ1A 1PJRA 3H5VA 3PQ3A 5B2EA 3OUUA 3OFJA 3FLAA 1R10A 5B1DA 4Q1DA 4AROA 1KZGB 3EVCA 1G59A 2CCJA 3VNAA 1N3YA 2YZ7A 1QQ5A 2YWBA 3KLOA 1J33A 5K3OA 2FE4A 1B93A 3FCYA 3OJWA 2YDXA 1AKRA 1RYEA 3C45A 1UJ5A 3DBHB 4K87A 5K05A 4LE2A 3ZIUA 1DZ3A 3TS1A 2ZAYA 4UHBA 5ESRA 3FHTA 3CNEA 3OKCA 2YBEA 1YZLA 4IDCA 4J0HA 4NYIR 1DBSA 1Z7WA 1AO3A 1KHHA 1W88A 2PKRA 3EE6A 3CINA 4IHJA 1RPNA 1NSTA 3F3MA 3RTCA 5ERXA 3JQFA 3H5TA 3AIOA 4F1KA 5DIFA 2YNMD 2QORA 3UT5A 3PZBA 1FX0A 1HOXA 1RAGA 3EW9A 3J7AC 1PDWA 4QBTA 1AQ6A 4ENTA 1UJ4A 4LDQA 3VR3D 3PX2A 1F06A 2JFZA 3A9RA 3TVTA 1FP7A 1R0XA 1Z62A 2ZSJA 4RGVA 4F5WA 4YIHA 1ETHA 3VJLA 1JEEA 3NATA 2ONKA 2VHWA 1W0CA 1F8UA 1AS2A 4UE3S 4CDGA 5CB8A 5JQGF 4RXUA 3EPKA 4XD7D 4JX8A 2JLSA 1UKEA 1ZXLA 3PDWA 5LQRA 3BE8A 5M3BA 1C7ZA 1IM8A 3T3PB 1KWGA 2DEUA 1N2CA 3HCPA 1H42A 4C0KA 2ZUEA 2PRKA 3KR2A 4FWTA 3LWNA 2OL4A 4EMUA 1N5MA 1RLUA 3VHRA 3MLAA 4NU6A 4YRKA 5AM3A 3ZV5A 1U99A 2FEKA 2QF7A 4YJ2B 3JQAD 3TB4A 5EKDA 2YYAA 2NACA 4U7HA 1ZVJA 2ERCA 2WTEA 4HB3A 5EVCA 4FWIB 2IITA 4YAWA 3NOOA 1XJQA 3WWEA 1I1OA 4B31A 3H4IA 2WTBA 2ZJ0A 4RE6A 5K0LA 4EPWA 3CKMA 3K5PA 2AVNA 2OHFA 1GZ3A 3NHRA 3F8TA 1EYZA 4Y9RA 1I3MA 1MB4A 3TLKA 4QFCA 2IF2A 2CMHA 3LQ2A 3UTDA 5IHPA 3RCBA 2MINA 3IC5A 1GGVA 2FPMA 2UZ3A 3L7KA 5EUCA 2ANBA 1MAHA 1PGJA 1E4EB 2YJNA 3LXRA 3QNUA 1WHSA 4BMXA 5JCZA 3P0IA 1IN8A 4GVPA 5AVXA 2HLDA 1FVHA 4C6SA 4UVGA 1NNLA 4RCVA 4PSUA 4AY3A 4L76A 3PLAE 2O1WA 4FDAA 3LXMA 3R9WA 4PZYA 2PR2A 4M8SA 3PWSA 1KERA 2DH6A 2GNAA 2GZSA 2C7BA 2GPYA 1A9OA 2X40A 1K5HA 4LV5B 4MWSA 3QM1A 2I8CA 1SWVA 4GPBA 3LRTA 1K06A 4JT9A 4UKDA 5FULA 3W9UA 5HEKA 2ZSAA 3ADBA 3I6IA 9ATCA 3F6SA 1YS7A 2JGJA 1QTIA 2B7CA 2IXTA 1NZDA 2XEXA 2YWCA 3F74A 1WKCA 3P94A 4IDQA 4AZSA 4BNNA 3EXEA 4UHJA 4URUR 3FRIA 4G4SO 5FBRB 1BCSB 3DMGA 3MS7A 5H80A 3W4JA 4Z49A 5K01A 4F93B 3FOWA 1E62A 2YVKA 4KVFA 3MM4A 4TQUS 3FSGA 3WO0A 4C07A 2HPVA 1ZH0A 3WRWA 3RH0A 4JKYA 4OSOA 4OKSA 1ZRNA 4WFJA 4KCGA 3SX0A 5CA0A 2YZKA 3G5AA 5THXA 1BE1A 3B53X 3RASA 5EQJB 3ZIAD 3QOXA 3SFZA 1I1HA 3USZA 1LSOA 1I5RA 1OF1A 4AMVA 2BKEA 3PLRA 2AOUA 3OOHA 3C6XA 3ZWQA 4C2BA 4C88A 1GUBA 5ENVA 5KTRA 3U19A 1T8YA 2ZYVX 1ZOSA 3ZZ1A 4C4XA 2XF2A 4IJMA 5DO9A 4KL8S 1J6UA 1KE1A 1ZNQO 3V3TA 4DOMA 2CMDA 1LU9A 2NU6B 5LJLA 4MWBA 3WGTA 4BO4A 2C57A 3IA2A 3MQ4A 2ZYDA 2R8RA 4HEA1 4XIYA 5JRZA 2OC9A 3TEFA 1PZMA 2BKUA 3GB9A 4HNSA 1VP9A 1Q92A 4J1NA 1GARA 3ROMA 1OB5A 2BKAA 3AP1A 1WBBA 3CONA 4NOMA 3T9AA 4LZLA 2MT9A 5BRAA 1JA1A 5JARA 3DOJA 3VC2A 2A9KA 2X58A 2IEDA 2Z09A 4WDQA 1CSEE 4BNMA 1EFAA 4I7EA 4J75A 3KJQA 4UUMA 2QJWA 5J40A 4BRUA 5TMEA 1GRVA 1UKZA 3QUTA 3AHGA 1XCBA 4UFOA 3ZY5A 5L7TA 4OH7A 3S2FA 2FB9A 5CJJA 1TQHA 1ST2A 4Y6LA 2D4HA 3NHZA 1XPOA 4Q05A 3O47A 2R6R1 4EHBA 2BKLA 3MF4A 3PIIA 4OMUA 1YZVA 3BE6A 4X95A 5AIAA 5KIAA 1M6NA 2J33A 3GG9A 3E9QA 3C97A 3HWRA 4ZAZA 2WSMA 3GVIA 1EKXA 2FHPA 1WD5A 2HT6A 2OCPA 2OD7A 3JVVA 4NI5A 5EHIA 3CKYA 2JHAA 4QXRA 2XHEA 2NG1A 3MTGA 3A6GA 1K6MA 5LD2C 3L46A 5M7EA 2GKOA 3MWKA 2QTNA 1BMFD 4D97A 1V6SA 2JI8A 4IXNA 4CHTA 10MHA 3PUJA 3PGA1 3GOQA 4OI4A 5CDYA 1FW8A 3GRKA 5LNK1 3UMSA 1USKA 1FFSA 1I6MA 3ELUA 1ABFA 3EMKA 4Q3EA 1NVEA 4YJHA 5ICSA 3PRYA 2BV3A 3M3DA 1QS0B 3C85A 3CO0S 4PYMA 4QBIA 3O8DA 4ZQHA 2WQ6A 1ZD2P 1N5IA 1V6CA 4N4AA 3VR6H 1VL1A 1NBAA 3G2QA 1NU6A 1LX6A 3OI7A 3PSHA 4IQFA 5IRCD 2XNDA 3IVXA 4MB6A 3B6EA 1MORA 1O1YA 3ISVA 4JB8A 4D41A 1SIWA 4ZAXA 2Q3CA 1FYXA 4ITVA 1OVGA 4P7GA 1JWAB 4HAUA 4PZDA 1BOOA 3SR0A 3U17A 3TFQA 5TLSA 1ZCAA 4ZRNA 4NWIA 2XXBA 4MI3A 1NLFA 4HGNA 1WF3A 2CHVA 4HRAA 5BMVA 1I7DA 3ZCVA 1L4GA 1SIOA 4PZUA 3K4HA 3AUAA 1UC4B 3G68A 5HGJA 3SPXA 4HZUA 1NVTA 3K7EA 4B48A 3RSLA 3V1TC 4MVJE 4DA0A 1IHXA 1C30B 3HYLA 5IBQA 4E1VA 5L3SB 1E0SA 4B3BA 5IFKA 1MHPA 1YFLA 1CF4A 4O1HA 4UCXA 3TLXA 3R0VA 5C1PA 2ST1A 3AF1A 3LQ4A 2YUTA 4ZOLB 1NYLA 1FMFA 1HF3A 3I6ZA 3KHTA 4M1TA 3B3QA 3GLSA 2F1HA 5G4KA 2Y27A 3H9EO 1JVNA 5DGIA 3VAZA 2FPOA 2H92A 3OCVA 1V5IA 2Q1TA 5CW2A 5AQEA 1AMOA 1ZM2A 3WICA 1NONA 5L51A 2IHZA 4JIGA 3JZAA 2R84A 1QK4A 4IOJA 3FIJA 5DPMA 1T8WA 1Y7HA 4CNBA 3R0JA 3ETLA 2RHDA 4FINA 4TUYF 1ORVA 1U98A 4P3KA 1KJWA 1KFBB 1Z83A 2EF0A 1ZISA 3ANSA 4PONA 5CU7A 1TU3A 4GOMD 1CQZA 4L3VA 1Y5IA 3IKVA 4IG4A 1PW5A 3H65A 1ITZA 3W2TA 2IP4A 3ZE2B 5AXAA 1TKCA 5DBHX 3BCRA 1CNMA 2JLYA 1BJTA 2Q5CA 1C7JA 4IEEA 4CF3A 4NXMB 3ANNA 3OZAA 4Z1OA 3VDQA 5IFLA 3TOSA 2NYVA 4XEHA 3BM5A 4YALA 1YB6A 5HOEA 4IHKA 4K9DA 4LY9A 4JUCA 5CA1A 3U6BA 1IPFA 2ACEA 2YDYA 1E0JA 1NJSA 4WNYA 1J0DA 1DAPA 3ICVA 3PCXA 5FNVB 1Y8CA 1M5UA 4QDUA 5G40A 2QTAA 4BGEA 4BVEA 5KQPA 4ENPA 2EW8A 2FPIB 2B1RA 1L8LA 1PQPA 3N70A 4QXAA 5ANRB 4G0VA 2NMVA 5IN4A 1AKEA 1OX4A 1NUUA 2ADFA 2DFTA 3A3YA 3ODPA 5T3YA 3T3GA 3VM6A 1F9AA 4EPVA 4Y6RA 2VJOA 4QARA 3X43A 2RHMA 4NNPA 4V0OA 4K3VA 1JDZA 4QDJA 4L5IA 1E3EA 4F4IA 2PSEA 4OYLA 1UT8A 1VIVA 5JNUA 3WGIA 4FSXA 4UHHA 5TMBA 2C54A 5H82A 1TVMA 1QO9A 3AJEA 1V96A 1Y1PA 4F45A 4QRIA 1Z5UA 5L40A 3DDUA 2FR1A 2IIBA 2WG0A 5KU1A 4GI3A 4HLUA 2IYOA 1MX5A 1IMJA 1C0LA 3A1UA 1IWPB 5CGQB 3H13A 2AJLI 4KOAA 3CG0A 4M0EA 4BTVA 2LP4Y 2O14A 2VG8A 3TRIA 3OFKA 2DQSA 4ND7A 4R0VA 1J06A 3U7HB 4ZYLA 3QXJA 3LLUA 4AECA 4M38A 1THGA 1TADA 4II3A 4LTNA 3VH2A 4CMGA 5IKXA 3Q0TA 1PBTA 1XDUA 4CEJA 5TPZA 1G1AA 4E7PA 1R4MB 4JLMA 3B3JA 2P7HA 4LZPA 4HYTA 2XMDA 1PNTA 4OYHA 3KAQA 3Q3EA 1MEJA 2BR3A 2JNWA 1YI1A 2XLCA 2Y2VA 4JC0A 3VU9B 5LFAA 5H4HA 2GCOA 4ZC1A 3JWJA 2D5IA 1TEVA 3VR4A 1QRRA 3TLEA 4BO2A 4DSUA 1FXUA 5FWYA 5JH7A 5AH0A 2P0AA 4PHFA 2GBLC 4OJYA 2OFWA 3RRXA 3U4AA 2XH8A 3K6KA 1Z5OA 2CXXA 1CR2A 1CT9A 3QVGA 1JFLA 1ES9A 2R11A 1II0A 4TV8F 1V16A 1BWQA 2SICE 4I6GA 4J29A 2CNDA 3BKWA 4KP7A 4YEDA 3TGWA 1FXWF 2D06A 1H1LA 1EBFA 2JBAA 1JPVA 2XE7A 3R9IA 4OX9Y 4P08A 2PWBA 3ZOZA 2PD3A 1GU7A 3UJ8A 4B9EA 2FSPA 2WIDA 4XX0B 1NXOA 3ZHBA 1EWRA 4LJSA 2PO7A 3D6AA 2HSEA 4IX9A 5DYYA 1CHDA 1TI7A 2E89A 5FORA 3EZYA 5JPIA 1ZMBA 2FWAA 1PKEA 5F52A 2V5AA 3F1LA 5J23A 1LJUA 5K0FA 2Q4DA 2NXJA 2UYQA 1E9RA 2K2QB 5KNDA 1QGYA 2NN3C 4LZWA 4I8IA 3EPHA 1QV6A 3PC3A 1U0RA 1Z3CA 4W1SA 2VXYA 1TE2A 3WNQA 2JH3A 3WLRA 5JDIC 4ZOAA 3QX8A 4NJMB 3HCDA 5JYBA 5M2QA 2XB9A 4TTIA 4KBGA 1BIFA 1FFXB 1WR8A 1J70A 3A10A 3H1EA 4I5FA 3J81A 2QYSA 2R68A 2XNKA 3IDOA 1YK0A 2Y1LA 2GT1A 1QE3A 3EIEA 3MC1A 2Q3MA 3GMIA 5DTEA 2FPWA 5THKA 1BYIA 4PF1A 2AN1A 2Y05A 5CFPA 3D3QA 3ZTYA 4QSMA 1I2MA 2HUPA 3CUTA 4II2A 4MCAA 2NGRA 3JASA 2HH9A 1GYPA 2XR1A 2N3ZA 1SZCA 3IR7A 1Z56C 2QRVA 4EJFA 3PEUA 1G7RA 1PT9A 1QCZA 1KI9A 4Q9NA 2H2GA 2GAIA 1RE0A 2PNJA 1ADGA 2Q6OA 4DR5B 1M2WA 1WD7A 3ZWPA 2A9QA 1KJQA 2IZZA 1TM4E 4Y9SA 1KYYA 4Y7CA 2I55A 4YP1A 2XA1A 2XVYA 4PRZA 2PBFA 5E3JA 4Q5IA 4WY2A 1R0CA 1USWA 5L3RA 2X2PA 1PUJA 3RWBA 2Y8EA 3RHZA 1T3TA 1PG5A 3EEOA 1ETUA 4ZDKA 1D5WA 1BFKA 1SRQA 3GJ3A 1RQXA 3OA2A 3NXSA 1HQKA 4HQ0A 1ZGJA 3AV3A 3PFBA 3C3EA 4PIPA 2F00A 4RY2A 4F91B 4MVJF 4BP1A 4IR7A 4QDTA 3UA3A 3BWEA 4Z6KA 3R7DA 1IIBA 4H2DA 4Y7DA 3MGAA 4O8CA 2E87A 2EJUA 1EVLA 2N1BA 2X5KO 3ESQA 3DD5A 1R3DA 3JALB 3L8CA 4DUPA 3VO9A 4JOCA 3QUCA 5E7QA 3ROXA 2QD4A 1HH4A 1GZ5A 4GOJA 5BNIA 3KFXA 3R5TA 4LHSA 1V3UA 3JQRA 3RV4A 3SP1A 3KKLA 1UDBA 1V25A 2C04A 2RAFA 5GJCA 1QH0A 5H68A 5HIAA 5DW0A 1AGNA 3NAGA 1V7QA 1OE0A 3CX3A 4RDIA 5IJ9A 1X8LA 1OZ0A 1DQNA 2O23A 1SVSA 4KFRA 4CM4A 3MRSA 5K2OA 1T5BA 3KDAA 1NBOA 1LW7A 5H59A 5HKKD 3RVBA 4ZCRA 2PZ8A 3GGGA 3B1YA 1GTRA 3NBFA 4WK4B 4QG7A 3L4KA 3O74A 3U7JA 1U9IC 1KAOA 4FHZA 2NO7A 1A71A 2QY9A 4RXMA 4YCJA 5DLYA 4DLSA 4UUOA 5CNKA 3F73A 1NVUQ 1BS2A 1J0XO 2OENG 3OPYB 3DSRA 3SXPA 1VHQA 4GWGA 1JMYA 2QTWB 1Y3HA 2B1GA 1LS6A 2XUKA 1JIIA 3RGGA 2YWFA 2OR3A 3DMDA 1T0IA 1NN1A 2QXYA 3L6OO 3NC0C 1E3DA 4IDPA 3V33A 4PYNA 4V02A 4XFJA 3EPPA 1KSFX 1P4HA 3IDZA 1IAVA 3KJZA 3L92A 4ARCA 3KWMA 5J58A 2D2EA 3FG9A 4I55B 1XBTA 3TFWA 4QAQA 4MP3A 4WOJA 4ARBA 1ZZEA 2AZTA 1U7PA 4GP7A 4K1LA 5B7QA 4AAYA 1DKRA 3CUSA 2YZNA 1SULA 1V6AA 2YTZA 3TLGA 2PS9A 1ZLYA 2QOEA 2XMBA 4R9NA 3TIIA 1DEKA 2ZE8A 3SJBA 4HNUA 3OCXA 3E1KA 1KVSA 3S7TA 5E9AA 3L9XA 4Q1AA 1P7PA 2ORWA 3TKLA 5ECGC 4WY8A 1JLMA 1Y1QA 2AZ4A 2YXLA 1DWOA 3INGA 3C39A 4GZMA 4NATA 2XT0A 3ZKWB 4EHNA 1LPSA 3ETEA 4I5EA 4JB3A 2JFYA 5FQOA 4R51A 4ZHQF 4QEKA 3ZR4B 5BW4A 2ZU0C 2W6QA 1KK1A 3O1LA 4WLOA 2DFKB 3GLUA 3R7WB 3E3MA 3EZXA 3C6BA 4UW9A 4I1RA 4DABA 3NU1A 3PYLA 4Q7JB 3VU0A 1U5BB 4M1KA 3I30X 3JQFC 1U1DA 3KXDA 4IYJA 1KAHA 2Y93A 4ZGBA 2DG2A 3B1KA 4HFNA 5EJ4A 1QHFA 1U3GA 3IOBA 2X86A 3AM3A 2G5PA 1MB3A 1JB9A 2UUBB 1YACA 1CIJA 1CR6A 3EWSA 5AMXA 4JI3B 5IZCA 2H1LA 2J59A 2O1EA 1Q7TA 1GQYA 3M9LA 5MFZA 2G1PA 4F8EA 1G8YA 4RLSA 5DHUA 3K8ZA 4Z1MD 2IYQA 1DKNA 3GFPA 4L75A 3JSXA 4NDAA 4PLFA 5B1SA 2HMSA 3Q5GA 4LI0A 5CMLA 1KSJA 5K0JA 2B61A 2PLNA 4J1TC 4YJFA 3FMIA 4KB5A 1FTGA 5FT9A 1BH6A 4DDMA 1P7ZA 1OAKA 1VRCA 2PL5A 4WECA 3M5WA 4AKEA 4F72A 4P35A 5JFTA 4XOIA 5EY5B 1TT7A 4Y0VA 2PX5A 4M36A 1XTVA 3QEOA 4Y6OA 1DEHA 1KMQA 1RLIA 2OLEA 3VKUA 1UZMA 3U4HA 4F1WA 2O0KA 3H4VA 4IJ5A 4RF2A 1PJTA 1Z2EA 2ZBVA 4J49A 1F2TA 4KQCA 4JLWA 1MIOA 4F46A 5ILOA 3DAYA 3OQOA 2Q1YA 4JFRA 1JZQA 3BAZA 1N2XA 4ZO4A 1U1GA 3GPDG 3C48A 3OZUA 5REQA 1QFZA 1P5HA 2ZRPA 2RHRA 1BKSB 1WSAA 3DWFA 4F86A 3ZJTA 1OAAA 3C4JA 2W2TA 3BH7A 3G7UA 1SXIA 4KK3A 4PWYA 4RMNA 5EP1A 2JARA 1TZJA 3CVWA 521PA 1RM0A 4FUQA 2RBGA 3PU6A 1E3WA 1PS9A 4HGOA 3W9BA 2P2SA 4UDYX 5JC8A 3UQZA 5EZSA 1OFHA 5K4AA 4QGHA 3ZCTA 2DSTA 1OXSC 3OEWA 1PWYE 1IUOA 2X4GA 1EGHA 4ARVA 4DREA 4G4IA 4MVJP 5HS4A 3CE6A 2CBGA 7REQB 1RKQA 1L8OA 1I14A 5GY7A 5TS3A 4B6RA 4G5RA 2Q2VA 5JEDA 4X97A 4D5GA 1A98A 1JG6A 1B6RA 2J9FB 1OIWA 1GKIA 1W96A 3QHPA 1M0TA 1NVMB 3IP1A 5LQDA 1Q0TA 4HRVA 2QG4A 3ZS9A 5A0TA 4XLZA 1V4BA 3A3PA 3GN2A 4M88A 2PZEA 4CKBA 2DP4E 1PO7A 3EUFA 4NARA 1DC4A 4CM1A 2O0MA 3KQNA 2CKDA 2H1IA 3P9YA 1FNBA 4TMKA 4MVJM 4BFYA 4N6GA 4C0XA 3HRHA 4PFJA 5B36A 4JA0A 4TZ6A 5CVTA 2O2JA 2RHLA 2XZDA 2EYUA 2K87A 3B2EA 4BZXA 4EUNA 4GPAA 3IRVA 1US8A 1QQAA 3A2MA 3M6FA 3G23A 4UBJA 2XVAA 1OBCA 4HO1X 4P2GA 3OX1A 2ODEA 3G5MA 1WPQA 4N12A 4UEOA 2GERA 4C0AC 1GGNA 3D5TA 1Z8DA 2FW9A 5KX5F 3C6YA 2QSJA 1IN7A 1KXZA 5K3FB 4DZZA 4M53A 5EIEA 1W5BA 2B94A 4OSPA 2OV1A 2AD5A 1NP7A 4G1BA 3DDCA 4EOGA 3V1YA 1VMAA 1HDYA 1BU8A 3PKJA 4GEGA 3PUIA 4LYJA 3WIEA 1H3FA 1EWQA 3KZNA 3GZNA 4GNKA 3W3AD 3ECCA 2Q7XA 2XOKD 3UHAA 4GHWA 4BZZA 3QENA 4BCDA 3CVVA 2J32A 4CMAA 1O6GA 4Z4GA 3CUEF 4INZA 5J5AA 3OE7A 1PJBA 4MQFA 3KB6A 1Z5PA 5JAPA 3FW1A 4AMYA 2DM6A 1Y8RA 4KWEA 3I9OA 2PN1A 3C7AA 3AW8A 3E70C 3RFFA 4PY2A 3U40A 1C1XB 5CURA 2RJNA 2MR6A 2D7JA 1GZUA 2CDCA 2I34A 3A1FA 2P3LA 3JQEA 4W1PA 1TF5A 5CVVA 3W78A 4AF7A 1JJFA 4RVFA 4IGEA 2ZS9A 2AMLA 3BUSA 4PGAA 4RSMA 1F6WA 1BO6A 2D74A 5MGNA 1LLDA 2VNHA 3AC0A 2IOFK 1YU6A 3EGIA 4QYIA 4W63A 4EEZA 4HQ6A 4KQ9A 4R7ZA 4YFVA 1JH8A 1LDGA 3WL8A 1OJLA 4QU8A 1Z2OX 3EHEA 3SMVA 5HNKA 1KYVA 4P1ZA 4BWFB 4OFWA 1QPBA 4FE4A 4UASA 3KWFA 4P7BA 3DFMA 3G59A 1W4LA 2WWGA 1JFFA 5K3CA 2B8NA 5TT1A 3E8MA 1KETA 3GFGA 1YJAA 2HQSA 3EZNA 5IMSA 3NBQA 1IM2A 3O8RA 3ZQUA 3H2ZA 2VPQA 3UWDA 5BUQA 1H05A 1HE1C 2FMIA 3ASYA 2N0SA 2YICA 3FUXA 4NZMA 1Z6ZA 2BT4A 5JVDF 1LFDB 1TEHA 2B4QA 3I5YA 2C1ZA 5D3KA 2W42A 3UXHA 1TEZA 4MS4A 3JQ9A 3DMYA 1DPFA 1HDGO 2CBXA 2C94A 3DYBA 4N3CA 4WINA 2Y76A 3A1NA 4J0FA 4RIIA 3R74A 3ZN2A 4BMPB 2LGJA 1QCDA 3BB4A 1QF9A 1JAYA 1RYBA 1T5HX 2HK6A 2OC4A 3O31A 4UVDA 5ERGB 5IVIA 3WBKA 1VTKA 5KREA 5HTKA 2OV4A 5L45A 3UK1A 2XMCA 2ZB8A 1KDPA 3HKEB 4TTRA 4JUFA 3HGQA 3Q11A 4RIHA 1A7UA 2ZUBA 4UBMA 5CHYA 3BWVA 1RP7A 1MJ5A 2FLVA 3C7CB 1A2BA 1YJQA 5EPOA 5GVSA 2WZDA 1N2BA 4FCVA 4CDMA 1AK9A 4IH1A 5IUKC 4K6MA 2AOVA 2JZOA 4OGWA 4D1YA 8ATCA 5IXJA 1JR6A 1DMSA 3OOSA 4M7PA 3N8GA 4TKZA 3REOA 4UM7A 4J43A 1W85A 5T64A 4E15A 1FDRA 5IK2D 3UMVA 1S8OA 4C08A 2FN9A 1NY5A 1XKTA 2PCLA 4BBZA 1N7IA 4YUYA 4CLRA 3KETA 1T0JB 5FPQA 1XN1A 5FOVA 4GI1A 4BXOB 1N32B 1P0PA 4OAPA 1CUJA 1MVOA 1E3IA 3GYBA 4RFSA 5EWJB 1PJCA 1SZJG 3PBKA 4CV1A 1OZGA 3QE0A 4O2AF 3BFXA 4HATA 2R1VB 1QIGA 1WKVA 3WP1B 1FPMA 2FOLA 1BDMA 4BLTA 4YRCA 1UODA 2J48A 2RGUA 4TS3A 4Y1RA 4A2QA 5ES4B 1E3MA 3GEIA 3ANMA 4KR0A 2WU4A 4ZVTA 3AF4A 4B74A 1JXAA 2VNKA 4TKUB 5I9TA 4MYHA 3PFKA 3AUSA 4L9AA 1J49A 4XCQA 1I0IA 4ZI3A 4KVGA 1JH9A 1SB8A 2CB9A 4NSNA 4EGFA 4X62B 3ENQA 1BMTA 2RGYA 1KDOA 5JJLA 4IRMA 3EF0A 3UPTA 2Q9UA 1QSGA 1NSYA 2JRCA 3L43A 3P0EA 4OIFA 5C3UA 1J8DA 2R8OA 2WUVA 5KNBH 2J9ZB 3UAWA 4HH0A 1F2UA 1YZGA 3LT4A 3V9PA 4AZTA 1GAXA 4L8WB 4LS3A 1FDOA 2VEOA 4CF7A 3EXFB 3IPCA 4QPNA 3AJDA 2HBYA 3QWIA 1NNEA 1OLOA 2HDWA 1TQ6A 2ON6A 4B34A 1ICIA 1PX0A 1A5BB 1QORA 1SBYA 2H1WA 1J97A 1T1GA 3MHPA 4KE9A 5CT8A 1BHO1 3WLQA 1ORWA 5JAIA 4HLUC 3U4QA 3JU3A 4LWZA 1JDBC 5AW5A 3Q5EA 1L8QA 3GEBA 4MUAA 3SHTA 4IIXA 4EEXA 5KPDA 4PPYA 3EZLA 1JR3E 2QRGA 2YRWA 3Q8WA 1N6NA 3E6AA 3ABQB 3AEKB 1JEYA 1N6HA 4D4LA 3N6XA 4DUGD 1P4AA 1OFUX 3SCZA 1BFDA 4GZ3A 2UVPB 3IV7A 1ZD8A 1QNLA 1VBKA 1PT6A 5FUYA 2P62A 2OHGA 3GJSA 3ESYA 3OURA 4MYRA 4FFPA 4OMFG 2VTBB 1YR9A 2O3JA 1IN4A 2HHAA 4M21A 5HF6A 4ZI7A 2XBMA 3NAQA 1ZUIA 3KYCA 2DB3A 4WXMA 4F3KA 4R68A 4ND6A 3TOZA 1ONSA 3J80A 1A95A 3KOZA 2G9ZA 3N2YA 5KOIA 4JOSA 5DYGA 4YXWA 3JCZA 2V7XA 1YB5A 3L0PA 4EO7A 3F6EX 3K0AA 3GUCA 2PLRA 4EW3A 1JQKA 3MCVA 5T4EA 5FD8A 3ND7A 1NULA 3FSJX 1VSBA 1PV1A 2B98A 1Z13A 3ZZNA 1HO3A 2C82A 4NBRA 4GXRA 2O8BB 1I1QB 1P39A 1OX6A 1NR7A 4TQAA 4ZOBA 1FS5A 3I6MA 2G8LA 3VVCA 4CMCA 4CW7A 1AKTA 2G9VA 2VVTA 1XTIA 2JCVA 3MFQA 5KHLB 1G9TA 1S2NA 3E15A 4KO3S 4MEAA 3GLIB 2X77A 3DDWA 4DV1B 3GJ8A 3IBYA 3P4XA 5LM3A 4Q9DA 1JG4A 3GEHA 4MQ4A 1GNLA 4V0ME 3HXLA 2YFHA 3MD0A 3P1JA 5A4FS 1O08A 5H8WA 5AI4A 1MOQA 4DPMA 4Q34A 1WABA 3FHLA 1J1IA 4IOKA 3T8YA 2PMBA 2R8BA 1K1EA 2OHJA 4NOKA 3UICA 1PQUA 1RT9A 2GHQA 1ZS9A 4IHQA 5EHQA 3DT9A 1IBLB 1HKHA 1A72A 1E0KA 3ADPA 4NZPA 2F9MA 4TXLA 1NUQA 3WQHA 2IY7A 5KYKA 1AO0A 1D2GA 1Z0DA 2V97A 3K9GA 1KI4A 1O77A 5DMXA 5JXHA 3I72A 3NIBA 4IIGA 1KSHA 4N47A 2VJMA 2ZQ5A 2ALJA 4JLJA 2FRXA 3M4XA 4KO2S 4RGYA 1YB2A 3C8HA 4Z2AA 1XKXA 2A5GA 2VJAA 3H9QA 3K70C 4F2GA 4U2DA 3TDMA 4MYSA 4LMPA 1TUEA 5BWCA 3ZHQA 1G1MA 5EP4A 2HK8A 2BTQA 1EU1A 2Y77A 1UPCA 2KBEA 2Z5VA 3A1CA 1C81A 3OJOA 2Q5QA 2VYVA 4HN2A 1UPXA 3FYHA 3QVLA 4RIGA 1PNRA 3TDKA 4EYKA 1QV9A 1BW9A 3FYDA 1P2SA 4HXFB 4JLAA 3ROFA 4P7FA 2FFRA 3NEJA 3OM1A 4UFPA 1Y98A 3OO0A 3VNQA 1OILA 2Z56A 3RNOA 3ZU4A 1D6MA 2VRCA 4BO9A 3G2HA 1U8TA 3PX3A 4FB4A 6GPBA 1L4MA 4C87A 1XMSA 1Z4PX 4HUJA 3LBFA 2F64A 3IE2A 3OLZA 4QGBA 4YASA 3SHVA 3I4FA 4TMYA 3VZQA 4DDHA 2A5YB 5DHPA 2C9BA 4A8TA 2X7JA 4REOA 5CVUA 5JALA 3WB2A 2R8EA 3MXTA 2W0MA 2O0JA 4LF9B 5EZQA 5AW3A 2WU3A 3MJDA 1VSQA 5LQCA 1AS3A 3WYBA 3EDOA 4P5EA 4B8ZA 3AR3A 1H4QA 5HK9A 4N7MA 3PQ6A 4IDNA 1AN0A 4Q1FA 2JFPA 1AHNA 1T1EA 4MUJA 3T7TA 1UK9A 2WIAA 2BZGA 4FGLA 4RYDA 5LUBA 3S5UA 2OZKA 1GEGA 1NDHA 4IIJB 2BI7A 3AZPA 3EQ9A 3MS2A 2YFQA 1QIMA 2P5YA 2QX8A 4F56A 3RK1A 4E2ZA 4RH3A 4RTQA 3P0FA 5D5PA 3FI0A 4BE4A 1FFDA 2J5QA 3JZDA 4OM8A 4XVQA 4F84A 3DZBA 3VUFA 5F2NA 1XZHA 2ZETA 4IUDS 4MS3B 4NH4A 4GX2A 4X90A 3TZLA 4BVBA 2Y6UA 5HUJA 4AJHA 1GSOA 2OFXA 3QYFA 2OA0A 5T5QA 5C4IA 5JY1A 1JA9A 3PTAA 3CRMA 4A15A 1VSTA 1RXWA 2ZK7A 3QUAA 2QVYX 3PNKA 4ZJUA 4P93A 2PGJA 3LBAA 3DWGA 3IAEA 2W93A 2QMQA 5FP0A 1KQFA 3UJNA 4L51A 3Q1LA 2JAWA 1JEAA 5CGZA 1KEZA 2VQDA 4NYJR 4WRRA 4WBNA 1I5EA 4H1TA 4EYEA 4F71A 4EI2A 1ZOPA 3B2NA 4DR7B 1IY8A 4KC0A 3MWJA 3HUDA 3MMXA 2AH5A 2IH2A 2C2ZA 2IVZA 1KO8A 3FBTA 1R8XA 1QOPB 2O2HA 5BURA 2GQ0A 3GFRA 1YR7A 2OBLA 4P54A 4AIRA 5IAAA 1GTL1 2C7OA 1YUMA 1IBCA 1QP0A 4YCLA 3A36A 1MB2A 3BZUA 3ROZA 2ILTA 3TLAA 5KTYA 5AKEA 2GFQA 3ZWAA 4YJDA 1S1MA 4B4DA 1WXXA 3FGPA 1KJJA 3OETA 2H3HA 5B30A 1N3IA 5JTUA 4QWWA 4XW2A 4GBMA 3TRKA 1N25A 1U2DA 2WJ3A 2OZVA 4U1RA 1XK6A 3W5UA 2VHJA 1AZTA 1TCCA 4XUDA 4UC0A 2XF8A 3ZWMA 4R83A 2I3ZA 1XPUA 3GLGA 4JJ4A 3IXMA 4N82A 4TMVA 5LL6P 3GJ7A 3UFXA 4C3ZA 4B33A 3AKEA 5CNJA 3SYTA 3DW3X 3B9PA 2PZFA 1HNNA 2ZWMA 1VIMA 2HHLA 1U0LA 1M83A 4DV4B 1P4SA 2LW7A 4BVKA 4PV7A 2IKQA 1EDOA 4JMLA 2W48A 4MKHA 2Y66A 4OBBA 1GLNA 3BWYA 1Y3IA 5F3WB 3O0TA 3VNUA 3LSYA 4CQNA 2AGVA 5AK6A 4WCDA 3ESCA 2W2NA 4CDNA 1Z2NX 4MULA 1KY5A 2BMVA 2P6UA 2W2VA 4IJVA 1UCFA 1H4SA 3PHBE 4C4ZA