2VH5R

Crystal structure of hras(g12v) - anti-ras fv (disulfide free mutant) complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional Intracellular Antibody Fragments Do not Require Invariant Intra-Domain Disulfide Bonds.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords ANTI-RAS FV HEAVY CHAIN
total genus 55
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2007-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2vh5R00
2REBA 3CH5A 4BLTA 1GILA 4PSVA 5FL3A 4C4PA 4DCNA 4CEIB 4QBHA 4LJAA 5BN5A 1OFIA 1OJLA 1GKUB 3K0AB 4P4SB 2IS4A 2REXB 2D74A 3NC1C 2JLWA 1NJFA 1NRJB 4HEJA 4RD4A 3KJIA 1LS6A 2WSMA 2GETA 3BE4A 4HUQA 4Q7KA 3QSYA 1OIVA 3EXAA 4JMPA 4TYPA 2XZLA 3VX4A 1GFIA 3LAWA 3RWMB 1KMQA 1OXTA 1N6IA 3R20A 2ZI7A 4LYAA 5J4LA 2GEUA 1XMIA 1R10A 2J3EA 5CYOA 3GJXC 2MMGA 3H0KA 4P4TA 3QUSA 3SJCA 1U9IC 3MJRA 1YHNA 1H8ED 2OCPA 3A1WA 4JJKA 4IJMA 3AP2A 4KCGA 3EZ7A 3MSXA 4HLQB 1E9FA 2ZVPX 2ZREA 4G01B 3EX7C 5LD2C 1IXZA 2ZSFA 4GMDA 3Q7PA 1ZRHA 2XEXA 2CLCX 3QKSB 2IYYA 2WAXA 2YC4C 5FR2A 3GPLA 3EZ9A 3GLIB 3J81k 4TTPA 1CR1A 2GRJA 4TLCA 1GP2A 4A6PA 3RABA 5HKKD 1SVMA 5DNYB 1UKZA 1II8B 2A3RA 2YWEA 2FPKA 3HYRA 4DUGA 1VCOA 5K8UA 2RGCA 4Z8YA 3AV0B 4LJ8A 4AG6A 1LW7A 4AYWA 2H18A 5AUQA 2NIPA 4C3ZA 3VR6A 3UPUA 1OE0A 2F43B 4UNPA 4Q9JA 2ZVQX 1NI3A 2W6JD 4LHYA 4CIDA 2BEKA 2D62A 2GJAA 4QG7A 3CNOA 2WAYA 1N5KA 3TSZA 2CMKA 4Y0AA 2O8BA 3SQXA 2O8EB 4IFBA 2C2HA 1G8GA 4BWYA 2RKOA 1US8A 2UZIR 3FDIA 1NLZA 4MH0R 3KJEA 4NU0A 4PANA 4OHYA 2PLFA 3EC2A 4LV6A 4MKIA 3Q5EA 1SVLA 4XWOA 1ZIOA 5FOSA 3WY9A 3CB4A 1XD8A 4HSEA 3U4QB 4KBGA 4TQ9A 4Q7JB 1XMJA 3VKGA 1AJEA 1ZNXA 2ZJOA 3A58B 5DHAA 1G9XA 1JPJA 2MSEB 5FI0B 4AC9A 3I3SR 1YR8A 2WVJA 3QEOA 1XU4A 2AWOA 2E87A 2QBYB 2X19A 3N70A 1R7RA 5CJPA 4D26A 3TSWA 3LFUA 2JIZA 3EWAA 3BIFA 1KNQA 3L0IB 3CNLA 4LBVA 3CM0A 5SZHB 3X1XA 1FW6A 1SXJC 1I2MA 2YWFA 4DKXA 3Q9LA 2Z5FA 2KB0A 1SULA 2BMJA 621PA 1XJ0A 2R6GA 4TZ6A 4B2PA 1H8EA 2IYTA 4MGZR 2D3WA 1SXJD 2ODEA 2XZOA 1Z6TA 3MCAA 1ONBA 4HUQB 1Z07A 3LW7A 4CDGA 3ZGXA 5JJIA 1X1RA 3X1ZA 2DB3A 5F3WB 4LZZA 3W8RA 1FL9A 4NCNA 5EP4A 4CT5A 4B6FA 2GAOA 4KO8A 1CIPA 2AK3A 2I3BA 5FBLB 3SYLA 4B2IA 2OG2A 1OFTA 4KJZA 3U44A 1DO2A 4PHTA 4GI7A 2QAJA 3AKDA 4DSTA 4C2TA 2ZQ5A 4EPVA 1DAHA 4OQXA 3IQWA 4QJ3A 3KFVA 3IEVA 4Q7MB 3PEVA 2X2EA 2HCBA 2W58A 1FP6A 4DZZA 1UM8A 3ZS8A 1ODFA 5HE8A 5P21A 2ZJYA 5JI3E 4QGAA 5HCIA 4EPWA 1UADA 1NY6A 3Q3JB 3CRRA 5BWMA 2FSHA 2BCGY 2GXSA 3U7EB 1JB1A 2GF0A 121PA 1M2OB 5FFMA 3DEFA 1KSGA 3WNBA 3TUZC 1K8RA 2JLUA 1GWNA 1FTSA 4MRVA 3U6BA 3W90A 2QMHA 1ESMA 4EPYA 1PVOA 1U94A 1DS6A 2CNWA 1E98A 2F7SA 1P2VA 1OPXA 4UJ5A 3AF1A 1FUKA 1W49A 2F3RA 3FHCB 3P4XA 3TW8B 1T3LA 1R0XA 1RZ3A 2JLXA 2ZRNA 1FNNA 2AN9A 2JATA 4TQAA 2ZR7A 1XJCA 1L7VC 1X8LA 2XTZA 3HPRA 4MYUA 2BMFA 2RGBA 4FW9A 3LBIA 4O3MA 2RCNA 3QJYA 2QPOA 3TVDA 1G8HA 1QRAA 3QIAA 5CM9C 2DYKA 4Q1AA 4B44A 3K0EA 4Q19A 3W3ZB 2J5XA 1NMYA 4ABYA 2R9VA 4A0GA 3AP3A 3LV8A 4LBYA 3GJ0A 2BBTA 3BH6A 5KDOA 1AGRA 4G5RA 2FFQA 3WYAA 3KQHA 2V1UA 1F60A 1E96A 1EK0A 5EUMA 1I4LD 1Z0JA 1DG3A 2HLDA 4TSFA 4D80A 2WJYA 4WA7A 3B78A 2WZQA 3K9GA 3KKNA 3GMTA 5C46F 3QOFA 1ZM4A 4TTRA 5DI9A 4DLVA 1M7HA 4KITB 1E69A 3QKRA 3C16C 4RZUA 3T5DA 2G0TA 4JL8A 4BZXA 2TMKA 2AWNA 2JAQA 4HATA 4DCSA 2VPPA 4CVNA 2VIIA 4M4SA 3C8UA 2J7KA 4M9XA 2ZI6A 4DSOA 3RWOA 1OH5A 4LWZA 5H1YA 2QI9C 4PQRA 3VNUA 4X8MA 2FZLA 4ZIRA 1YQTA 4H1VA 3RNLA 2GILA 3EASA 3ASYA 2I1QA 3CRQA 1GRQA 2H92A 2I4IA 2VQSA 2HV8A 4KVAA 5GVSA 4N3NA 4Z51A 3ZD6A 1EFUA 3ZS9A 3W9YA 2GK7A 1GKIA 3PEYA 2C9OA 4DLXA 3GJ6A 3B85A 4OK3A 3DL0A 4OJKA 4MKGA 3C7KA 3K0AA 4DDTA 3EW9A 3RYTC 2H7VA 1HEIA 2FV8A 1GRNA 1G8PA 2QGNA 3EA5A 3THWA 1UJ2A 1L8QA 4B3FX 1JR3E 1ZUIA 2Z43A 4JLVA 4HLDA 3U3RA 2HLDD 2FFHA 2ZE5A 1EFRD 4NCKA 1OFUX 2FZ4A 3GLGB 4Z54A 3NKVA 2FF7A 4URXR 1VYUA 1D6JA 4Q02A 4F4IA 5C18A 4XVQA 3GLHA 1E0AA 3UKDA 3WRYC 1VIYA 2CK3D 2H57A 2J87A 1OXVA 1W44A 2V7QA 1X1SA 1E1RD 1KO8A 2IF0A 5B30A 2WOOA 2GBLC 2ZUCA 3W6OA 2YVUA 1VYTA 1MRNA 4RCYA 3FVQA 2ATXA 5TY0A 1EXMA 3CLVA 4JLPA 3CO5A 1W36C 1E94E 4Y0VA 5A0FA 1XEWX 2EWWA 2F1JA 3CRVA 3RLFA 1E4YA 3CWZA 1JEEA 1U8AA 2W6IA 3TSOA 2NGRA 3S1AA 3CRMA 1RVDA 2GEVA 2ZYUX 5GJCA 2ECKA 4K81B 3SN6A 2WIAA 1GNPA 3GJ4A 2VSXA 1EWRA 1EFHA 2Z6VA 4TL7A 3SR0A 4QOSA 4IDPA 3TR0A 1VYVA 3VFDA 1G7RA 2O8CB 3LO5A 3H4MA 4RY2A 4UNRA 4B3XA 1Q3TA 2ZI3A 4R7ZA 3SBDA 2A78A 2GCOA 1G4AE 3KUCA 3RANA 1S4QA 4XSGA 3MMPA 1Z28A 4GT1A 3X1WA 4IOJA 1FUUA 2Q0HA 1G7SA 2BKEA 3DHWC 4UNNA 1E1QD 3GLFB 1DTSA 1WCV1 2FJUA 2OFWA 2FEMA 4RFVA 2WMOB 3KFXA 4HAYA 4OHXA 3NWJA 4URWR 1DE0A 3TAUA 1R6BX 4EQ6A 3O47A 4YC7A 3KQLA 4BQSA 1R0WA 3CPHA 2BIFA 4C2UA 4PO9A 3NH9A 2EFEB 3B13B 2VHJA 3O8CA 1Z2CA 3ZYCA 3T1QA 3FYHA 4Q5IA 2Q21A 1G18A 3GJ5A 3CH4B 4HLUC 1E1RA 2WWIA 3OZXA 2A9KA 3OE7A 5JRJA 2PJRA 4JVMA 4ZIRB 3L8ZA 5AJXA 3T35A 2YZ2A 2AD1A 4IKEA 221PA 4ZDWA 4EPRA 2IS2A 2O8FA 1J8MF 5JJKA 4PTLA 3U2QA 4DBLC 3U61B 1Q1ZA 1UEJA 3DVLA 5JRZA 5M04A 1KI1A 2BM1A 2ZE7A 1HE1C 3I32A 2IC5A 4D4MA 3ETLA 2EFGA 3GEIA 2OLKA 2QBYA 1ZC4A 5FBWB 3KUDA 3Q85A 4QNRA 4AD8A 2JLRA 3BC1A 4EIWA 3PR1A 4WZ6A 3KQKA 1ESNA 1BYIA 5FOTA 2FN4A 2PH1A 3ONWA 1LTQA 4GRAA 2WWGA 3OIYA 3W5IA 2ZITA 5AWFC 4RD3A 1ZUNB 4Q01A 4JSYA 5JWHA 2ZS9A 3AP1A 5TARA 1NF3A 3W3AA 2V6JA 3BFXA 4HAWA 2CVHA 1SKYE 4M9QA 2WWYA 5KU1A 1X8JA 2O8EA 1CULC 1S9DA 2GVDC 4CEJB 1LF5A 1SKYB 1VG9B 1BO6A 1VG0B 3I5XA 2ATVA 1SQ5A 2D7CA 5DLQC 1DAEA 5CIQA 2DWOA 4JLKA 3QXHA 2O8CA 1QHIA 4TLAA 2DFKB 1YE8A 3BJIC 2E9SA 3CIOA 3OIVA 3P26A 4QJ4A 3AKEA 1KJYA 2IEYA 1Z0DA 2IXEA 4W7SA 1YZTA 4A6XA 2XNSA 2Q3MA 2V54A 1KZGB 4RCZA 1GZSA 3D6TB 3BB3A 2RGEA 1L4UA 3F0TA 4ZI3A 5BW8A 2XB2A 2G3YA 3CR8A 3DM5A 5TB5A 3QG5A 4PAOA 1FPMA 1AS2A 4Z1MD 1OH7A 1H65A 3K9NA 4XD7A 1R5NA 1A82A 1DAGA 1F3OA 1T3SA 4LOAA 1T0JB 4ILEA 1VG1A 1XP8A 1JXMA 3FMIA 1U0JA 3QXJA 1TU3A 3RRYA 2UKDA 4YMTA 3U3KA 2F9LA 4F38A 3WMEA 3SQWA 4P31A 3R7WB 3CF6R 4C0AC 3GJ8A 4N0DA 4PX9A 5L3VA 4RD0A 3K0CA 4A8JB 3RRMA 4CT4B 4DLZA 2NO9A 1QG2A 2ANCA 1GUAA 1T3HA 3VMFA 1D2NA 3RC3A 2J0QA 5EJEA 2QMOA 1T6NA 3SE0A 1DOAA 1Q1BA 3LBNA 2HJVA 4NYJR 2O0JA 4Q66C 5CDFE 1E79D 4AKHA 1SHKA 1ZCAA 1JNYA 4KU4A 3B5JA 5FUWA 1UAAA 1X3SA 3O8DA 2P5TB 1WQ1R 1ZU5A 5FOXA 1T0HB 1OYYA 1IN8A 5JBQA 5FBQB 2V4ZA 5EQTA 1XPOA 1W2HA 4MRNA 4WIAA 2H16A 3CRW1 4TQUS 4DDVA 4IOKA 2IK8A 3RDPA 3TNFA 4FXPA 3A4NA 4B33A 3FFAA 4NL4H 4C30A 1LY1A 3LXRA 5FUXA 4DIEA 4TMXA 4QBIA 4MDEA 5AJWA 3PCRB 3QF7A 4HUTA 3OEHA 3ZVRA 2P3SA 5DISB 3VAAA 4XD7D 4Q7LA 1W48A 4OHZA 2BEJA 2GEDA 4LBZA 1SKQA 3MWYW 2FPLA 1XCGB 5FOWA 4C7OA 3PQCA 1OHHD 4V0LA 1MO4A 4PZYA 1IN6A 2C95A 2RGNC 3X1DA 1Z29A 2NQ2C 2HXSA 2P2LA 1Z6XA 4A82A 1M7BA 2QT0A 3OIUA 1HQYE 1N6RA 4C0QC 1COWD 2W2TA 1VCNA 2IYZA 4HZIA 1KK3A 4HB4A 2XNDA 3BB4A 5JCZA 2ODWA 3OFND 3GEEA 1CJKC 4XIGS 3RSOA 4LJ5A 2HDNB 2ONJA 2BHRA 2PZEA 2VP2A 4A8JC 2ZSBA 1JEDA 5K8TA 1UBGA 1XXHE 2H1LA 1E4VA 1N6HA 1ZINA 2QTVB 4DLUA 2VHQA 1AZSC 1G19A 1OV4A 2WV9A 4OJQA 3WHLA 3SJAA 1G3MA 1Y63A 2W0SA 3B1YA 5L3QA 3I8XA 2FWRA 3BFVA 2JIZD 4PQFA 2IWRA 2ZE6A 4JVLA 3TK1A 1WBDA 1P3JA 2V3CC 1W0KD 3QBVA 2W0MA 4KI0A 4JYBA 4XVRA 3THWB 3QG1A 1F2TA 2FPMA 3B82A 3I1FA 3A37A 3KKQA 4V0MA 1HQCA 5KPJA 4I4LA 4RZ2A 2Q3FA 4IVPA 2ASEA 3ZZUA 3DMDA 4NH0A 3JVVA 1NG9A 1KK1A 1ZM3A 4WBSA 1G3RA 4HDQB 3GLIE 3EIEA 4EPXA 4BLRA 3LY5A 3QKTA 2MSCB 2ZAOA 3AQ4A 4XWKA 2LCFA 5CB8A 3AKCA 4TL9A 3AVOA 2A5GA 4IOLA 5JWOA 4B32A 3KTAB 1TUIA 1KJWA 1Q20A 2WJHA 4I1OA 2IBMA 1UFQA 4TMVA 4HAVA 1JJ7A 1W1WA 4ZKDA 2QP4A 4E09A 2X8AA 4MITA 2OCBA 1TF7A 1WP9A 4URZR 1N6NA 1Q1QA 1Z0KA 2ZIAA 2DCUA 3WBKA 1P9RA 4A0FA 1F2UB 1BMFA 2BWJA 3EC1A 1J99A 4MRRA 4EJSB 3UATA 1CS4C 3AF0A 4KSCA 2GAAA 3KZ1E 2WSSA 2ZJ8A 3GP8A 2ZRMA 4KODA 4AYXA 4ESHA 2YC2C 3DZ8A 1DBSA 4Q9KA 4GMXA 5FR1A 3VHLB 3C5HA 4DLRA 4F4CA 5C4GB 3BB1A 1XBTA 2RHDA 3N5CA 1Z0FA 4R2IA 2OAQ1 2PT7A 2ZRCA 1G64A 1KY2A 5D3MB 5HR5A 1P6XA 4AK9A 1W5TA 2Q6TA 4I1VA 4B35A 1RPZA 1JQLB 3UMFA 1G20E 2HF8A 2OCYC 3W6PA 4EQ6B 1RJ9B 4L16A 3DDCA 4URYR 1L2TA 4DLWA 4IXMA 1Q0UA 1ZM7A 1US8B 3MWJA 5CITA 1P2TA 3CONA 4OBEA 3DMNA 4B76A 3QPVA 3ICQB 4IXNA 3QXXA 4DDUA 4V0KA 2X77A 3IIJA 2IUUA 1F2UA 2NZ8A 3K0SA 5AJYA 4BFSA 3TE6A 5B2ZA 2I1VB 2UZ3A 4Q03A 5C1BA 3C41J 3SC3A 5IRCD 2ZTSA 1Z8FA 3LW8A 4NYJQ 2ZSDA 3A36A 5G41A 1NN5A 4A1FA 3ICEA 1FP7A 1NNEA 1CR2A 2ZRFA 3SU8A 2VL7A 2Q9CA 4KHZA 1DAIA 3PV0A 4CF7A 3CZPA 3WXMA 2IXFA 1LVGA 1IXSB 1XCPA 2D2EA 2FH5B 1GNRA 3B1ZA 2Z4RA 3U3OA 3OHMA 4A2QA 1CF4A 1KYIA 2QA5A 2L0XA 4E03A 4US0R 3CF2A 2R6FA 4TMTA 2CCKA 1NMXA 5F9FA 2O52A 1IQPA 1N0WA 2BCJQ 3TQFA 4KFTA 1YRAA 2C9YA 2OV2A 3AF4A 3QXCA 4A0RA 5J47A 2GVZC 2J41A 1CR4A 4B75A 2VO1A 2ZRPA 3V4RA 4C0BA 4FMDB 5IK2D 1FOEB 3D7MA 5EXPA 5LB2A 1G1MA 2NZJA 5KNBA 1JR6A 4MRSA 4K8OA 4OQMA 1ZW6A 3IEUA 5DI3A 2G1JA 5DN6A 5J4HA 3EARA 1KJZA 2ODNA 2W83A 3M6AA 1W36D 4RJLA 3K70D 3EIHA 4POAA 3WP0A 5FPTA 1KKLA 3R9WA 1TADA 1MABA 2QN6A 1WE2A 4LYJA 1S0UA 2JJ1D 4NE2A 3ZJYA 4EJSC 4NTZA 3GJ7A 1HA3A 2ERYA 2GWHA 4IEIA 3HDTA 1H8HA 3BGWA 1OT3A 3X1YA 5KDDA 2GCNA 1YZLA 3K09C 1R8SA 3HWSA 4YDSA 2HT1A 1EX7A 4DEYA 2YHSA 3IUYA 1EGAA 2ZSEA 4ZV4A 3LBHA 3C15C 2ZRJA 3WNCA 3AVVA 2P6UA 3EAQA 2VHUA 1GKYA 1LV7A 1MT0A 2DBYA 1TQ4A 2G9NA 4BRUA 2IL1A 1DELA 2D06A 4ZCLA 4ZKEA 3WYFA 2OM2A 1KI4A 4CEIA 2CLSA 4XJXA 5KO2A 3JZMA 4WAUA 3N2IA 3K53A 4NDZA 3NIBA 3LRPA 3FHTA 1G7CA 1LS1A 4TZ0A 5FOVA 2AD5A 2NG1A 1IONA 1Z5ZA 3P27A 4PO1A 3FMOB 3CPJB 3B7GA 5EXSA 2EQBA 3UK6A 1I4TD 3AUXA 5B64A 2C03A 3LDAA 4DT1A 8OHMA 4QC2A 4D25A 4N1AA 1A4RA 1CJUC 2FEOA 4ZPXA 5J4VA 1KDTA 1EFTA 1FNMA 1RRGA 2J45A 1E9SA 4GOJA 4LYFA 5EUQB 3THXB 3LQQA 2PEZA 4Q4JB 3DKPA 1KK0A 3SYNA 1W0JD 4G3XA 3K0FB 5KSOA 1KI6A 5KSYA 2R62A 2MMCA 1E2MA 1P62B 3ZQJA 1Q22A 3LD9A 5K8LA 3NBXX 4BUJA 1GSIA 3ZD7A 2YYZA 2CHGA 1ZCBA 3QKSA 4Q1FA 1XDBA 2JJ2D 4OI0A 2RMKA 2GKSA 2VHCA 4A8JA 2P5SA 1G21E 2GZHA 1KK2A 1OXXK 2V9PA 3AVXA 2QT1A 2VEDA 2BBSA 3W6NA 2IHYA 4JKIA 4FCVA 4S35A 1D9ZA 3PXGA 5FOUA 1C4OA 4X8HA 2YKGA 4RSGA 4WXPA 4DIDA 1OFHA 2IHBA 4KAXA 2GESA 1BH2A 4YONB 4BLQA 3MD0A 3QF4A 4US1R 3WRXC 2HXYA 2OLJA 4U02A 4LJYA 4E22A 3KTAA 2WJVA 4M1YA 2PZFA 4RKEA 1XD2A 2PL3A 4B73A 4P32A 2GXAA 1BMFD 3LA6A 3SI7A 3NEJA 4MDFA 1M74A 3VHXA 1G7TA 1OH8A 3EPLA 4B3BA 3KB2A 3NEYA 3RS5A 3C5CA 2F1IA 1RRFA 1OF1A 1ZM2A 3IHWA 2XXAA 1GAJA 1G6HA 2OT3B 3GCGA 2QP3A 1II8A 2A5DA 5FPSA 1F2TB 4LY6A 1UBEA 4M1MA 4QL3A 1SVWA 1N2CE 2GTPA 3QVUA 1QZXA 4JIMA 2Z0MA 3UMRA 4C9BA 3SYKA 1UDWA 4B3DA 2ZRGA 3AVTA 4GFDA 3HU1A 1DG1G 2BBWA 5B58C 3A1SA 1CJMA 5KSZA 4BASA 3MAAC 3THYA 1Z83A 2BDTA 2ZXUA 3EWSA 3KXLA 3GD7A 1W2GA 5J4KA 4LPKA 4Q1DA 4KLZA 2A5JA 1CRPA 2IA5A 2ORIA 1KGDA 1KKMA 3EZ2A 5KUTA 2ZRDA 4JLNA 3B2EA 1DAFA 1WRBA 4JBXA 2Z83A 4CEJA 3IIMA 1HY3A 421PA 1G3QA 4Q4JA 4BPBA 2J0SA 2DWQA 5KNDA 4ESVA 1NVXQ 4EUNA 3IILA 3U44B 4DB4A 1IY1A 3AVPA 2GA8A 2RGNA 3E5HA 4JLJA 4LJ4A 2ZEJA 5JSZB 1HUQA 5L3SB 1KDOA 4J0QA 4YXWA 4B71A 4IW3B 4EFLA 4MRPA 4OKSA 5JS7A 4DVGA 4O2RA 1CXZA 3B8HA 3K09A 4B2LA 5CIWA 4TSFD 3TIFA 1KO4A 1OHHA 4OL0A 3AVWA 4Q9HA 4H9GA 3WYGA 4RKFA 5IK2A 4RFSA 1DVRA 3BFKA 2NPFA 2DY1A 4DLYA 1MRSA 2GXQA 3BOSA 4X8LA 4AG5A 3DPUA 1G5RA 3P32A 4M21A 4UKDA 1GL7A 1M34E 5JEEA 3PVSA 4HB3A 2CCJA 2VTKA 2GJ9A 4PPFA 4R2HA 1VPLA 1OIWA 2GHIA 4LYHA 1JAIA 1QHSA 1E2PA 1UBFA 5D3MA 1XMSA 2HUPA 4GDFA 1UKVY 3LNCA 3TBKA 4TT3D 2QENA 4M1SA 3V4FA 3L0SA 4Q4LA 1PV4A 3BS4A 1ZP6A 1R2QA 2ZR9A 1WA5A 3OEHD 4FI3C 4DC9A 3O8RA 1EWQA 5LDDC 2ZYVX 3AB3A 2FSIA 2EWVA 1KNXA 2IUTA 3D8BA 3FGNA 5HTKA 5AJVB 3OEEA 5F9HA 2JDIA 2N1BA 2H8KA 1II9A 4KYIB 2F43A 2AXNA 2YOFA 4O25A 1KI2A 1EFRA 1BYUA 4A0HA 3UWOA 4DHEA 2YV5A 2EW1A 4XVUA 3S1AB 2XOKA 1WB9A 4M1TA 1KMHA 4PZLA 1OYWA 1SGWA 1G8YA 1CJVC 1RFLA 4C7OB 1IJFA 2ZANA 3REGA 4MUAA 2B92A 4PPQA 1ANKA 2X1VA 1NIJA 1RYFA 2B21A 2QNRA 1J7KA 2XB4A 5UKDA 5G3ZA 3PEUA 5EE3A 1TUEA 1VMAA 2IT1A 4LJ9A 4UQOA 3CPEA 4YXWD 1MO6A 4JLAA 5CK5A 1MV5A 1JPNA 1KDRA 2GCPA 2YWHA 3QQ5A 3PUVA 1W0JA 2QQEA 2QMUA 1W46A 5IT5A 1DPFA 3BBPA 4DCTA 2RAPA 3SNHA 1E2EA 2QE7A 4LJ7A 1BOFA 2F6RA 4FCTA 4MYCA 2JCSA 4AY2A 4MA4A 1KSJA 4IDNA 3RSLA 2CVFA 5AUNB 2XSZD 2FG5A 3IBGA 4TYNA 4OQLA 3CUEF 1R5OA 4FMBB 4XSHA 1U2RA 3R9XA 1Q3HA 4Q9IA 1KSFX 2GNOA 1OKKD 2FX3A 3THOA 5FPKA 4AURA 1XJQA 4Z8XA 4ERNA 5JS8A 2MSDB 2XSZA 4IRUB 4CGZA 4GSYA 4MKFA 1XTIA 3CR7A 1XTRA 4D4LA 4DCVA 2OO7A 3FE2A 4JL6A 3SHWA 4L9WA 4HDCA 4PC2A 1NJGA 1JAHA 3IDQA 1P2UA 4TTQA 4WXRA 2CHQA 2WJJA 1UKEA 2VRWA 4FMCF 3OFNA 3EPKA 4PHGA 2BJWA 2O0KA 4RD2A 1J70A 1NSTA 2CXXA 3NH6A 2XGJA 2WJIA 3CW2A 1AIPA 2XJ9A 5ELXA 3EPHA 3LQRA 3NDPA 3ZVLA 3H2YA 1VCIA 1T8TA 5AUPB 1DO0A 4QXAA 2JDID 4RZXA 2CL0X 4HZUB 2EFDB 3ADKA 4U00A 3EIQA 1L4YA 1RIFA 4YMUA 1OKKA 5AR1A 1YVDA 3PUZA 1GTVA 1P4SA 5CYPA 4P3YA 1VHTA 5CJ2A 5E3HA 1CP2A 1Z06A 2W2XA 1Q21A 4K46A 1TEXA 1CU1A 1UPTA 3THXA 1XX6A 3AH8A 4OQFA 4PAMA 1IN7A 5BYJA 1BKDR 1GIAA 4Q1CA 4TMWA 3P4YA 3H86A 2ZYWX 5HZHA 3NBYC 1Z0AA 2ZI9A 4ASUD 1QG4A 1IBRA 4AKEA 2AX4A 4OK5A 2D4HA 2PCLA 1B23P 1NKTA 1C1YA 1R4AA 5BYKA 4NYMQ 3KJGA 4ACBA 1F6BA 2EFCB 3QKRB 5HZKA 1CLUA 1T91A 2ZI4A 4JVNA 3ZZ0A 3ADDA 2ANBA 2BM0A 2PCJA 2OUKA 4JBWA 2QL6A 2V8OA 3KB1A 4PO8A 1E9DA 3IPXA 3MWKA 4DEXA 1TX4B 4JS0A 1S9HA 4KSBA 2XZPA 1AZTA 4DDWA 2CE2X 1XD9A 2IYXA 2ONKA 3EZFA 4HLCA 2QPAA 4RZ3A 1LFDB 1WMSA 2IYWA 2ZJ2A 4JLMA 1DARA 2F9MA 1YKSA 1AS3A 1XF9A 2G88A 2VP5A 2WWHA 5FBVB 2NO0A 3HJNA 3R8CA 3ZZTA 4PQYA 1HT1E 1U81A 2GJSA 4FCWA 1ELOA 1SZPA 1D9XA 1E9BA 2AK2A 1G3UA 4GZLA 4IVRA 4JYCA 4AI6A 4M1OA 1MO3A 2QRZA 3P1JA 4NONA 4LV8B 2GJKA 5GJWC 3I72A 5KTYA 5CLQA 2GF9A 2H5EA 3BAFA 3Q72A 1J8YF 2VP4A 2YINC 3DZDA 5DE3A 4MGKR 4V0OA 4JBYA 2OAP1 4B74A 2IYVA 4PZZA 1E0JA 5EP1A 5ANRB 1O3YA 2W2VA 3U3MA 4GBMA 1TU4A 1CR0A 2FOLA 3SJZA 2F1HA 2QUZA 3CWQA 3K1JA 2ZR0A 1E9RA 4KBFA 2CCGA 2JLSA 3T06B 4RFSB 2VP0A 2PX3A 4YMSA 1CRQA 1XCMA 3AGQA 1AM4D 1D2EA 3WMFA 1E2IA 2QTHA 4I81A 2N42A 3FKSA 2R6AA 4CYMA 3RC8A 1AS0A 4G5OA 4II7A 4GP6A 4CEHA 4UXHA 2OE2A 4R98A 4DLTA 2CE7A 3CX6A 2CL7X 2WICA 5G53C 2ZM5A 1RKBA 2IUSA 3TQCA 4D6PA 1VHLA 1YZUA 4JVSB 2OFOA 1NVUQ 2YWGA 2LKDA 1NBME 4AIIA 1IM2A 3QVVA 2OXCA 1GNQA 4B47A 1E0SA 2ZU6A 1SVIA 1W4BA 4FMDF 2F1RA 2P67A 2K5UA 3I8SA 1TF5A 4XOIA 1FFHA 3RS7A 5KOYA 3K70C 1NY5A 4YLGA 1F5NA 2QM8A 1IY2A 2VF8A 3OEED 5JZVA 5TVKA 2R65A 4TMZA 4DUGD 1PLKA 5CDFA 1Y3AA 1DEKA 1A1VA 1OXUA 2SHKA 1QHNA 3EZ6A 4BECA 2FDCA 4BFUA 1N6LA 4KYUA 4M1KA 4AKGA 2G77B 2PMDA 2QAGA 2CNWD 4KFUA 1ZAKA 2JA1A 1Z6AA 4ITRC 4LHZA 2PJZA 3GFOA 1MKYA 4FWTA 3WNDA 2QROA 4WZBE 4TLDA 3RS4A 4I99A 4IOMA 1G291 2W6ID 3B1XA 4L4UA 1FQKA 2RGXA 4ASUA 1W36B 4OHWA 4LX0A 3TRFA 3VNVA 2OXRA 1KAGA 1PUJA 4XTRA 4UJ3A 1TMKA 1CJTC 3I4LA 3KX2A 4QBGB 5AUOB 2PMKA 4PSKA 4RD6A 4W5WA 3SOPA 4QM6A 3L82B 4A36A 1S3SA 3PUWA 3TLXA 3FFBA 2J9RA 1QHHA 2CLDX 4U7DA 2FA9A 2J1LA 1K6MA 2IEZA 3E70C 1CKEA 4NPHA 1T8UA 1NKSA 1S8FA 2AXPA 6Q21A 3QPUA 4NYMR 3KQNA 5SZJA 5A4JA 1U98A 5GJBA 2P6NA 1TL7C 4MGYR 4NP6A 1YR7A 4NBSA 2C8VA 4Q18A 1AN0A 5BN4A 4Q9LA 5JHHB 3DKVA 2ZUBA 1M6NA 1P61B 3PUXA 3VU9A 2DFNA 4TYQA 1HT2E 1A7JA 3P20A 1U0HC 3O8BA 5JECA 2NOAA 3B6EA 4TLBA 1N6PA 2W6JA 2ZRKA 4BFYA 4PHFA 2IYUA 2KWIA 1UBCA 3ZLJA 3PENA 1V5WA 4TN1A 1G41A 3EA0A 1GVNB 2JLQA 5EE5B 1NMZA 1IAQA 2ZETA 2PBRA 3CNNA 1CBUA 1KMHB 2V1XA 5JLJA 3ASZA 2OESA 5IHPA 3RRNA 2C04A 2FE4A 2G0NA 3L8YA 3BWDD 1K5GA 1S3GA 2XAUA 3PFIA 4TLEA 5FUVA 1A5TA 4WZAE 1QBKC 2GJ8A 3TVTA 2HCJB 2WM9B 4A92A 1D2MA 1U8ZA 4G5GA 1XTSA 3VQTA 2O5VA 3SDZA 3BK7A 1E0KA 2ZRLA 4Q00A 1TQDA 1W47A 2EYQA 2PX0A 1J2JA 4HZUA 2IXGA 3MUFA 2C96A 1TEVA 4ZO4A 4B48A 2C77A 2IWHA 1GRRA 1SXJB 1FX0B 2WPDA 3FKQA 3K8YA 3WP1B 4DWJA 2WWFA 3DM9B 5EXXA 1P60A 3CX8A 3ADCA 3PUYA 3RVBA 4BFZA 5KSPA 4OK6A 3T61A 3C14C 2EVWX 5JSZA 5L3SA 1E2DA 2BJVA 1D8TA 3AF3A 2NPIA 1U0LA 2BVNA 5L3RA 1MH1A 1YZKA 4LK2A 5JWRA 1FMLA 3IO3A 3T1VA 1OIXA 3FWYA 3NHAA 2A2ZA 2QG6A 1EESA 5EE9A 3EPJA 4PC3A 4KVGA 2C99A 3KKPA 4LDJA 4F92B 3U4QA 4DLSA 1I4DD 1VIAA 2XJ4A 4Q47A 2VHTA 3Q7QA 1RW4A 2RHMA 2JJ2A 4DCUA 2JJ8A 1QVAA 3U60B 1S96A 1QHYA 2E1RA 4M0LA 3LX5A 4NHOA 3VR2A 2IYRA 3SFZA 4F4JA 2UVQA 1XB2A 2ZE8A 1TAGA 3E2IA 4DJTA 2QMEA 1AQYA 4NKRA 4OI1A 2EFHB 4FMCB 1KAOA 4W5JA 1V43A 4OHVA 2OEPA 3UWKA 1NLYA 4QHTA 2WKPA 3A4MA 1AK2A 3UANA 1ZMXA 4TYWA 1T5LA 4D81A 3WBJA 1Q1EA 3GFTA 2B8TA 2ZRBA 1ZVQA 4EDHA 4O2LA 4QM7A 1TNDA 1E79A 4Q4AB 5J5CA 3MLEA 2QM7A 3HP1A 3LH5A 2FFBA 3OAAD 5TMPA 2FMXA 3AGPA 1R0ZA 1RE0A 1E9AA 2OFXA 3H84A 3RS3A 1Z63A 1Z47A 3VKWA 3A4LA 3U6KA 1NN1A 1Z0IA 5FPYA 2C9CA 5K8IA 2HF9A 1W7AA 4HI0E 1VG8A 1ZNYA 4AYTA 1PZNA 1MO5A 2ZJBA 3QNUA 4BZPA 4A2PA 1G5TA 1MABB 1JR3A 2PLRA 2NO6A 1N5IA 2JASA 3FB4A 1YRBA 3B1WA 3OESA 4I1UA 1AA9A 1B0UA 1BS1A 1XEXA 4MGIR 5EP2A 2IS1A 1G8FA 3HYTA 4C0JA 5FTMA 2JEOA 3TKLA 1MR3F 3IGFA 4IHQA 4A9AA 4IVQA 1YR6A 2WPDD 1KI3A 3QE0A 5JJLA 1N5JA 5KHOC 1VECA 1TF2A 3QENA 4GOKA 4GPTA 2NO1A 3IKJA 2VA8A 3LWNA 4TWZA 4BFVA 3AVYA 1E2JA 5B57C 3NBFA 3AUYA 1P9WA 4DXAA 5C2JB 1M8PA 5KNCA 2GCOB 4LBWA 3BERA 4H1UA 5IDVA 4OI2A 2IF2A 1KIMA 3RHFA 3W8NA 4Z1MA 1U90A 2LWIA 2ZRAA 2J0VA 1W0KA 1G17A 1SVKA 1XZPA 4QHSA 1ZIPA 4LGMA 1KO5A 3KKMA 2VYFA 2WBLC 2ZUDA 3CX7A 1N6OA 5HCNA 4F91B 3SZRA 2LKCA 2XNDD 4MYHA 5SZIA 3GLFE 2AKYA 2PZGA 1XMVA 2WIBA 3E1SA 1WF3A 3UG7A 4IFEA 2ZS8A 5FTKA 1PJRA 1NIPA 3W34A 4NYIR 1AQUA 2J0UB 4HLUA 5CLLA 1NL3A 1ZU4A 3VX3A 5JMTA 3QF4B 2OBNA 2FNAA 1G6OA 5FPHA 2PEYA 1TPZA 1ZM9A 3DO6A 3IO5A 4M22A 2NTYC 2Q9AA 4FIDA 4WW0A 4R71A 1OH6A 3M4YA 1R5BA 2ZPTX 3A1VA 3ADBA 3SHFA 4MYTA 2VP9A 4BZQA 3U7HB 3MRSA 2VSFA 3X2SA 2BMEA 2B8WA 5H8WA 4KV9A 4M9SA 1ZC3A 2VLIA 2AFIE 1T9HA 4HAZA 4C0KA 5FH9A 1JBKA 5HKKA 1R8QA 1JECA 1RRPA 4IDQA 1S1MA 2NO7A 1XFAA 4BEJA 821PA 4KFSA 2F3TA 1Z22A 4YMWA 1IN5A 1NVVR 1YU9A 1LNZA 2CEAA 4BFWA 4DB2A 2CJWA 4EKDA 4B3CA 2NMVA 2HEIA 2KJQA 4DT1B 3HU2A 2CDNA 1D5CA 3ECCA 2C98A 1X6VA 1RYHA 3FMFA 2KBEA 2QZ4A 2WWWA 2YOGA 4O0MA 4EFNA 3KXKA 2B6HA 3TJZA 1E2GA 2VF7A 3RAPR 2OCAA 2R44A 4QBFA 4TYYA 2ZRHA 2CL6X 2WSSD 4URUR 4PXAA 2ZRIA 5KDLA 2IX3A 2ODBA 1NBMD 5L8VA 4P4UA 2IW3A 1UF9A 2V6IA 721PA 4QKQA 4ARZB 1S2MA 4QRHA 2DWPA 2FFAA 2ZU0C 2RGGA 4P33A 3QY0A 4L9SA 3IQXA 3MWLA 1Z3IX 1AKYA 1XPRA 4HB2A 2GZDA 2O8DA 1OB2A 4Q1BA 3NBZC 4P0TA 2WKQA 5TXGA 3W5JA 2Q9BA 3GJ3A 2ZYTX 1U99A 521PA 4B34A 2QU8A 2QQ0A 2GBLA 3SJBA 4HYYA 1JJVA 1KI8A 2KBFA 4Q4HA 4M9ZA 4G1UC 1E2QA 1KO7A 5E95A 2Z4SA 2XITA 4PC7A 2QORA 2IYQA 4ZCIA 5JEDA 1UDXA 4LC0A 4PPGA 3GLIA 1NG1A 2QAGB 2R6DA 4W9MC 5EXTA 2GDJA 5DH9A 3TR5A 3G0HA 2QE7D 3NXSA 1KO1A 4L15A 5G40A 3UIEA 1YZGA 4TL6A 4EFMA 2N46A 4PSAA 3HR7A 4JKYA 1XTKA 2QEQA 4GL2A 2OHFA 4FD2A 4HAXA 4JLBA 2WTUA 1KI9A 5E7JA 1ZJ6A 3VU9B 2D2FA 2RGAA 3B1VA 5HE9A 2BOVA 2XTMA 1COWA 2RH5A 4LSGA 4BFXA 4ZDKA 5GADl 1WBBA 4JLOA 4FWIB 1JQJC 1MOZA 1KTVA 1XTQA 4IDOA 2QAGC 1W4CA 1II0A 3FPAA 3QI2A 3AF2A 1IOZA 4Q4HB 5KYKA 3KQUA 2D7DA 5JFGA 1PUIA 1QHGA 5AK0A 2A7QA 2BV3A 3NC0C 4NCJA 1P72A 2OBMA 3FTQA 1N5LA 1XEFA 2OSBA 1M7GA 4OI4A 1GDDA 4XWAA 1NSFA 3FKSD 4NYIQ 1NVWQ 4D0LB 3A8TA 5L3QB 2V55B 4G0NA 3C4JA 2HYIC 2IS6A 4QGFA 3MJHA 3K9LA 4EJSA 4KFRA 4CRWB 3V00A 4QFMA 5H70A 2ERXA 4ARZA 5CK4A 3PITA 1HH4A 4C0HA 1XPUA 3JZAA 3ZVMA 3GLFA 3B9QA 4V03A 2JJ1A 5FTJA 1YR9A 1XEWY 3HR8A 3TW4A 1JXOA 1Z2AA 2OZEA 2QPTA 1N3BA 2DR3A 4FN5A 3NDBB 5FUYA 1RJ9A 3TGPA 3L43A 5JCPA 1GL6A 2O8DB 1OSNA 3Q5DA 3QBTA 2BKUA 4P4SA 4QJ5A 1XRJA 3R7WA 2O8FB 1IHUA 3ND9A 3K0FA 3ZQ6A 3IBYA 1Z6YA 2J59A 3L0PA 3PEWA 1OLOA 3RRZA 3PJRA 1RRCA 4Q4AA 1CEEA 3VKHA 5J40A 2QY9A 5JHGB 2AL7A 2DFTA 2REOA 3I5YA 3T1OA 1SXJA 2WJGA 4LHWA 4BLSA 4OQNA 1F48A 4MQBA 2ZS7A 3ZIAD 5JI2E 1QDEA 3VR3A 3KL4A 4CEHB 2QRNA 4S2EA 4LC1A 4PR0A 4AWXA 1HE8B 1GL9B 1XEXB 4A4DA 5AJZA 2V7QD 1QHXA 4EPTA 1TQ2A 2G6BA 3KJHA 3Q8XB 5DYIA 5E7IA 4LCBA 2JLZA 1ZYUA 2QP9X 3D31A 4Q21A 5DHFA 5FL7D 2IYSA 5DO9A 4IEEA 1E6CA 2VSOA 2R8RA 2VBCA 1NN3A 4TT3A 4NCIA 1M1YE 4B43A 4QHYA 1RC8A 2J0UA 4PHHA 1E2NA 2A5YB 3OIWA 2ZAMA 3H1TA 1LF0A 4LHVA 3QXSA 4BRWA 4YQFA 4NMMA 1I2DA 4D2IA 4A2WA 1ZD1A 4JJZA 5FL7A 1T4GA 5EP3A 1Z6GA 4LPSA 3I92A 1GITA 1LB1B 4HAUA 1FZQA 2FSGA 3GEHA 3A1UA 2B7BA 1GM5A 1DADA 2FGJA 3BRWD 4BE7B 1P73A 1E9EA 3I73A 3NTUA 3ZIAA 2OBLA 2YOHA 3MGCA 1KI7A 1ETUA 2GZAA 4E07A 3VR1A 4GP7A 2P0EA 1KY3A 2EU8A 3KXIA 3R9IA 2VP6A 1QF9A 3QPWA 1EG7A 3CBQA 1U8YA 2ORWA 1W4AA 1X86B 3GLGE 4F93B 1Q57A 4PC1A 3VR5A 1CTQA 1ZD8A 3GLHB 1IY0A 2HT6A 1VTKA 3SFVA 2QSZA 3JVUA 4GNKA 1X8KA 4QNMA 3TAHA 2IYLD 3SBEA 4GZMA 4A15A 4QGGA 3MFYA 4BLOA 1BIFA 2A5FA 2C5LA 3K0CC 1E2KA 3SS8A 1W4RA 1Q12A 2G83A 3U7GA 3F5FA 1IJEA 1QHHB 5D3QA 2ZJZA 3B60A 4URVR 2BBOA 3TUJC 3RS2A 1R0YA 4DRZA 2WOJA 1SHZA 1E3MA 4D4JA 3QKUA 5DSZA 1E2FA 1KHTA 1O87A 4LJ6A 4M1WA 4X8OA 4V0NA 2QGZA 1E1QA 2C78A 1ZD9A 2VH5R 3TMKA 1DAKA 2CBZA 2KI5A 4QGHA 1OXSC 2J7PD 2XX3A 5F2EA 3LVRE 3PIRA 1AGPA 1J90A 1FX0A 1KSHA 4JT4A 5DGXA 2WWXA 5DI3B 5SZKB 5DN6D 4ACAA 2FGKA 4B6EA 2JLYA 5GJVC 1TQ6A 1VDZA 2O8BB 2R2AA 1E2LA 3PG5A 5EE0A 3LXXA 4V02A 3CZQA 4M8NE 4ZI2A 1DAMA 4BEBA 1WXQA 1N0VC 1HV8A 3G82C 4PPNA 1KI6B 3SEAA 3I61A 4NCHA 5G3YA 3R8FA 5DYGA 3EG5A 5H68A 1S1CA 2A30A 1FTNA 3A6PC 5FBRB 3GQBA 1GOTA 1A2BA 5IF9A 5FTLA 1ZNZA 3NHBA 4OYHA 1XNJA 3FOZA 3I62A 1KOFA 3WHKA 1QVRA 4XTCS 2YNMA 4LV5B 5A5GA 5LBIA 4KXFB 1E32A 1FMJA 4M2LA 2Q3HA 2ZSAA 1IN4A 1U9IA 5TDHA 1ZNWA 1YZNA 3U3JA 1ZBDA 1NVVQ 2X2FA 2EYUA 4C0LA 5HPYB 5FTNA 4ZCMA 5BQ5A 1P7CA 1KZ7B 1N0UA 4LHXA 2BMDA 4RVCA 4W5HA 5EZ5A 3WMGA 4PFSA 4G5QA 4C0SA 4I1SA 1N6KA 3HU3A 4ZDIA 4BGDA 1SXJE 1XTJA 1NP6A 4UXIA 2AHOA 5LPNA 1W5SA 4UXJA 5GVRA 4AKIA 1P5ZB 2O0HA 5EE1A 3UXMA 3GLHE 3REFA 1P9NA 3MG9A 4GOXA 1UKYA 2B7CA 4IDHA 2CJWB 3V9PA 4PAQA 1VKJA 1G3IA 3G5UA 4JT2A 3ZDQA 1P2SA 1JI0A 3FHOA 2W00A 2ZJ5A 1NBMA 4MUBA 2GXUA 3M1IA 1E9CA 1H8HD 2KSQA 1N25A 5TV2A 5BN3A 2AFHE 2CK3A 4G5SA 1YZQA 1G4UR 1P75A 3OAAA 3IPYA 2AR7A 2J7PA 1YJ5A 3GFPA 3KKOA 1XXHB 2H17A 4D4KA 1C9KA 2HJGA 4TL8A 3UG6A 4UNSA 2DPXA 2RGDA 3NVAA 5EZ6B 1G16A 4BFTA 1G5PA 1GG2A 4L8GA 2ORVA 4YMVA 5CB6A 2JGNA 3AVQA 2HYDA 3T15A 1TTTA 1EFCA 1HYQA 3KDSE 1XD2B 3IHLA 2WHXA 4LRWA 4R9UC 3IIKA 2WMNB 3D3QA 3T5GA 1NN0A 4JLDA 2OILA 2FSFA 3DOEA 2R6CA 2ZJAA 2AKAB 3DOFA 4ZDJA 1Q44A 3BH0A 4XH9B 1OW3B 5DIFA 1HTWA 2ZI5A 4HB0A 3HPQA 4Q48A 4E5UA 5E4FA 5KPDA 4KLNA 3L0OA 2J46A 3U5ZB 3N2EA 3LLUA 4JL5A 1AKEA 5FI1B 2G1KA 1K5DA 1IXRC 2BC9A 2FU5C 4ON9A 2P6RA 1WDTA 3LVQE 5LB4A 1HURA 3QEJA 3FMPB 3M0EA 4M53A 1XZQA 3A1TA 4WOPA 3VTKA 4LUCA 3RS0A 4MKHA 2Y8EA 1E2HA 1A2KC 5LD2B 2QSYA 3THYB 3LX8A 1UEIA 4F7WA 3AVUA 4NZYA 3ZH9B 1SVSA 4CZ2A 2PT5A 5E7MA 2CHVA 3T1TA 2DFLA 1KDPA 3K70B 2XOKD 3F8TA 3K9HA 5J4YA 4WVFA 3CF0A 2RB4A 2P65A 2GK6A 4TMKA 3GLGA 5F98A 4V0ME 3LLMA 4U5XA 3L2OB 3OE7D 3UMSA 4BLPA 4US2R 1FQJA 4JZKA 3CKLA 1VCMA 4CW7A 3VR4A 4FINA 3BD9A 3B9PA 2XXAB 3ND8A 3U7FB 4L5BA 3TUIC 1Z08A 4LI0A 4DSNA 5BXQC 3AEZA 2JLVA 3AKYA 3F3YA 1PLJA 3BH7A 1ZUHA 3AM1A 4D0GA 4N0EA 3BXZA 4UNQA 3TH5A 1E99A 4EAQA 1XXHA 1JR3D 1NLFA 3BORA 4D82A 3T34A 5C4MA 2YJTD 2F55A 1XWIA 4YDHB 3OF5A 4RD1A 1SVOA 2QTFA 4PC6A 2KE5A 4B3GA 4D0NA 3ZVNA 2XTNA 5CM8B 2WKRA 1PLLA 3T12A 4DSUA 1T5IA 4Q1EA 4HDOB 2ZROA 1OB5A 3NG1A 2DHRA 4JSTA 1EX6A 1JALA
chains in the Genus database with same CATH superfamily
1FF9A 2WM2A 2W2NA 3CH5A 3V6MA 3RIGA 4DCNA 4J0EA 2FPIB 5EEHA 2NYVA 2C00A 3V8QA 1JZSA 4LJAA 3EXFB 4J91A 2C9BA 5KTRA 1E89A 1MFPA 2REXB 5ELMA 1P9OA 3IEPA 4BNDB 1GTSA 3UTDA 1NRJB 1KP9A 1TE2A 3CHYA 3DXXA 3NASA 1I01A 1LS6A 5D7BA 3WQSB 3OCCA 4QEKA 3L7BA 4ZYVA 3FETA 3E9DA 3VX4A 3VNAA 1G4HA 5JDCC 3EB9A 2P40A 2X6TA 1EQUA 2FQWA 3PNKA 5LZ5A 4EVQA 4YO8A 2GEUA 1OC4A 2J30A 3OUTA 5LOVF 1IATA 4QGSA 2J3EA 4HDNB 3BIOA 3IRVA 3NFRA 3GJXC 2MMGA 2A67A 3E22B 4U9UA 5CYFA 2D3TA 3H0KA 2EJVA 1XLWA 2QAIA 3HLKA 5H3LA 1A76A 4KH0A 1U9IC 3HS3A 2E4AA 2H2FA 3MJRA 3QBDA 4M7RA 4IDAA 5CP8A 1DINA 1YHNA 1H8ED 2ZB2A 2OCPA 3M1YA 3W5AA 4MW0A 2JCYA 3DNMA 1JLMA 3G9UA 3MSXA 1F7VA 4MHSA 3T9BA 1U1GA 4UM5A 3UQYS 1PJ3A 4G01B 1NOIA 3HDHA 5DNDA 1GQRA 1P2DA 2EL9A 1NBEA 4CQLA 3E3AA 4GMDA 3Q7PA 3SPXA 3DQZA 1H0RA 4AMGA 1A95A 5ENZA 5FR2A 4DIOA 2R8ZA 3IPRA 4PYJA 3UCXA 2AOUB 3HCBA 1N3LA 5FLYA 4TTPA 4X7PA 2I80A 4WGGA 3PSHA 1NXPA 3RABA 2BFDA 2J9ZB 3KWJA 2A3RA 2YWEA 2DY0A 3CJRA 2C94A 2IQ5A 4CKCB 3KKZA 1Q7RA 4LGYA 4MA5A 4LJ8A 3FCEA 1PZFA 3RIHA 2Y93A 3DMTA 3MINA 3VR6A 5ED4A 2G5GX 1KP2A 3JALB 3H1BA 1UZUA 2EV9A 3RTAA 2A1UB 4C88A 1NI3A 1KHHA 2GKOA 5B1SA 5GINE 5H4GA 4BBPA 2BEKA 3KAKA 2GVNA 2WC1A 5LMCA 2WAYA 2J6BA 1N5KA 3EQ2A 3RREA 2AN4A 2CMKA 1U5BA 5ITZA 2PWYA 1F6WA 3SQXA 4NCBA 1WABA 2LP4Y 3LJKA 3PF8A 2C2HA 4HFRA 2RKOA 2V6FA 3EK2A 3FDIA 3RTDA 4MH0R 1U9ZA 1H1TA 3A06A 3IHTA 3MCZA 4E7OA 4MI6A 4LV6A 2OSVA 3GC6A 3GRFA 3UGQA 4O4JA 4ZGBA 3BMCB 3IXMA 3TPFA 4W5RA 4X94A 4CMEA 3CH7A 5FOSA 4YMHA 2ZUFA 7REQB 1HDOA 2XW6A 1XDGA 4J0KA 4ZAWA 1XD8A 4D3ZA 4CM9D 5CCEA 2C42A 3U4QB 3L49A 5KYUA 2VH1A 1TZBA 3QLJA 1XMJA 4Q7JB 1I2CA 2D7JA 2FRDA 2ZJ1A 4YRPA 4CT0A 2EWMA 1NGSA 3TIVA 2BHSA 1QTNA 1XU4A 2AWOA 2E87A 3DZIA 1EGQA 1T2NA 2FOXA 2VQDA 2X19A 5AKEA 1PJCA 2EF1A 3A6GA 1RLUA 2H4YA 4N4AA 3UOAB 2G9VA 3EWAA 5TT1A 2HDOA 4B31A 1DZ3A 1Q74A 1SC1A 3O3OB 5JZSA 4PCLA 4ZTZB 2Z5FA 4MJLA 5KIAA 1A50B 2J33A 1YVEI 2KB0A 4COOA 4QT4A 5BP7A 5C7OO 1GZDA 2JI4A 3OCVA 3EIFA 5IU6A 4DWVA 3TLYA 2BFWA 2HRQA 5ALIA 3PQ4A 1Z6TA 2XZOA 2CMGA 3I2YX 4PR3A 3WGLA 2V3WA 3LW7A 4R1NA 4YRGA 2UVPA 5JJIA 3DDNA 1X1RA 2WTNA 3DPSA 3E8XA 1Q6ZA 4LZZA 3W8RA 2ZCUA 3NETA 2X1HA 4YROA 3RASA 5K4HA 3H13A 4B6FA 4G37A 2ZBUA 2PYZA 1CIPA 3CG4A 3VNRA 2AK3A 2ZJ3A 3OF2A 3ZLUA 4TZKA 3ROTA 2AXEA 2PH7A 2G08A 1XQVA 2OG2A 3A6DA 3AINA 4D5EA 4F45A 1F9EA 2XQJA 3U44A 4BU1A 1UBJS 2QAJA 3AKDA 2NUPB 3TRDA 1DC3A 5FUMA 3EDCA 2DGDA 1LLFA 1TRHA 1KY5A 2FJPA 1A9RA 2NZWA 2O1XA 3JD1A 2Q27A 3PEVA 3GGGA 2PMBA 4RLQA 4OSEA 4W5QA 3D43A 1WDMA 4DZZA 1H93A 1ODFA 5P21A 5JD5A 3VR2D 2J5KA 3NBUA 2CDAA 5FT9A 1PE0A 3R40A 2HWKA 5HCIA 4BNMA 1UADA 3FUWA 1NY6A 1U2GA 4EPWA 4ZGWA 3CRRA 3PGA1 3AR8A 5ALDA 1G59A 2GF0A 1RKQA 1UJNA 1USWA 1TZ2A 121PA 4Y2VA 4BZZA 1OGIA 3DEFA 1M34A 4RHEA 5HRCA 3TUZC 4QPZA 4MRVA 4JNCA 4DMFA 3QI7A 3W90A 3D8NA 1I3MA 4O08A 1ESMA 2JGJA 1E98A 4KACA 1OPXA 1FB5A 2RCYA 3JD4A 3UUEA 3AF1A 2QR3A 2GS9A 4GR9A 5MN6A 1W49A 2F3RA 3AIKA 2JBWA 3LYLA 4GXQA 1R0XA 4EOGA 1RZ3A 1PW7A 4LDRA 2ZRNA 2JATA 5GGYA 1PNRA 2ZR7A 4BNZA 1X8LA 4QTYA 2ZYSA 4M87A 3HPRA 4R40A 2BE7A 3V4LA 2DKOA 1EAYA 2WHPB 2AMFA 2ZTLA 3A6FA 3A6EA 3CMCO 3M6MD 4KLRA 3IOEA 2QPOA 1RTKA 1JX6A 2C5GA 4KQIA 1TAUA 1QRAA 4XGRA 2OM6A 1OD6A 3HN6A 3K6SB 1BJRE 1PVVA 1VJ0A 3WK5A 2DVMA 3LWDA 4D56A 2R3SA 2J5XA 3SFZA 3DLAA 4UVDA 4IIJA 2EKZA 4IIYA 5I3CA 3RKRA 3JVEA 1BXGA 4WN3A 3AP3A 4A0GA 2GLTA 3BH6A 5KDOA 1FFEA 2ADFA 2FFQA 4DA6A 3C8HA 3S40A 2XUIA 3DC7A 1I4LD 1WS6A 1BHO1 5TMDA 1Z0JA 4R8SA 4KGXA 4TSFA 3RD5A 3VPSA 1YF3A 4J4TA 2GNAA 1Y37A 3PICA 1YA6A 3IVCA 4R7GA 2IGTA 3ELYA 1DC6A 3QOFA 4YGYA 4MAFA 1KIAA 3IV9A 5BMVB 4GU5A 4JOBA 3S1LA 1XUOA 4NABA 4KITB 1CNMA 1E69A 2IKSA 1X1QA 2VJLA 3C87A 3GEDA 4I7EA 3WA6A 2V5AA 4EZEA 4RZUA 5KVVA 3T6KA 2G0TA 1GLVA 1TCUA 4JL8A 3SF8A 2TMKA 4UVEA 4U7HA 4BZXA 2WF7A 3R3YA 1BDMA 1QGZA 2JAQA 4DCSA 1RMTA 2E4WA 1D7OA 1OPRA 1QZZA 3CNHA 1MHTA 4DSOA 3RWOA 2Q4BA 2QI9C 2H31A 5A06A 4A0QA 2OZLA 4YHHB 1EX1A 1ZQ9A 1USUA 1LX7A 5I9MA 5DM0A 3PFBA 2VQSA 3GGOA 2RBKA 4Z51A 3ZD6A 3ETJA 2IW1A 2GK7A 2J31A 5AW9A 3VYRB 4XQCA 3PEYA 1L1QA 4EO7A 5L51A 5KQLA 2QYOA 4RM2A 5EL0A 5B2FA 4FOOA 4OJKA 4MKGA 5KYWB 4ZYTA 2ATIA 3KSZO 2P1DA 1IYZA 3EW9A 4DIFA 5C8ZA 1HEIA 2FV8A 2O2EA 2OQRA 2PQ0A 2A3NA 4IVNA 1L8QA 4M1QA 4B3FX 3ACCA 2Z43A 4KZPA 4PGMA 1C8BA 2CUTA 3H2KA 1V7PC 2HLDD 1EFRD 1LI4A 4XWYA 1EM8A 1PFUA 3S4YA 5KMGB 3QVGA 1MB3A 1MB4A 1P2BA 4PLPA 4BWGA 4Z54A 2HJWA 1ST2A 4URXR 1VYUA 3PC3A 2D1YA 4F4IA 5I4BA 4ZYWA 3A2MA 4RWEA 2CK3D 1QQ7A 2BI8A 3K0BA 3OCZA 4WNAA 5EIBC 3VU1A 3V8NA 3K8ZA 1ONOA 2IF0A 2QYSA 1G9SA 2WOOA 3LNTA 3SCZA 3CLVA 4MUXA 5ALHA 4XCQA 3CO5A 5SY6A 4I4IA 1GQQA 1XL1A 1XEWX 3PFHA 4OGFA 2C07A 1J0DA 1E4YA 1GZUA 4MPPA 4Y2GA 1JEEA 1GCIA 2IJGX 1U8AA 2W6IA 3WIBA 2NGRA 2Y6UA 1QFSA 3CRMA 3O2QB 4F3CA 1X7WA 2ECKA 3SN6A 1VMEA 1JH8A 3GJ4A 2F3PA 3KVVA 4GF5A 4D9BA 2NUBA 4RGQA 1AE1A 1MBZA 1WUJS 3FSGA 4NS1A 2QSJA 5TJHA 3FR8A 2QE6A 3H4MA 4UNRA 4B3XA 4BRSA 4R7ZA 5JAHA 2E55A 3WK9A 2XMCA 4P36A 2GCOA 1G4AE 1SD1A 3E03A 3HHEA 4XWGA 2R00A 1EAMA 3MMPA 5FEMA 3H9QA 4WZBA 4GT1A 3IFSA 5C5CA 3X1WA 1W76A 2FZEA 2IHZA 4A8TA 3GLFB 1E1QD 3HO8A 1DTSA 1J1ZA 5FJIA 5LOVA 2FEMA 4OB6A 1VYHA 4I46A 1QTQA 3V9AA 1QOQB 2XWBF 2XECA 3GH3A 4OHXA 4URWR 4P0QB 1DE0A 3L93A 3ZUPA 1DXHA 1V1RA 1HC7A 3CPHA 4ZI7F 3OPYA 4H17A 4WLOA 4GMFA 4C2UA 1IB6A 2OBBA 2QU7A 5J5AA 3B13B 4M0CA 5HJ5A 3ZYCA 2JLAA 1UBRS 3L6RA 4G85A 4M1ZA 4D02A 3T3EA 3HU5A 1R0CA 2Q21A 3A9VA 3G9QA 2ETXA 2YN4A 1E1RA 4GSLA 1TK2A 2XUOA 1RWPA 4PLWA 3ZI7A 2AQIA 5JRJA 4LVNA 2HKIA 1FP4A 4ME6A 4HGOA 221PA 4EPRA 4EHJA 3C6KA 2ZJ4A 4K6FA 1S8AA 5EN4A 4X63A 1HPLA 1KFKB 3U2QA 4Z9AA 4DGSA 1KXJA 2QVLA 3PR3A 2FEXA 3KB6A 7GPBA 4XIIA 2ZE7A 9ATCA 4D4MA 4WE3A 4TX1A 3IDOA 3QX3A 2JLRA 1UANA 4EIWA 4KNVA 4BTLA 2BCEA 3BXOA 4WZ6A 1ZH4A 1BYIA 1RXYA 3NNSA 4PZPA 5FOTA 2PH1A 2WIJA 4NK4A 5K3DA 2WWGA 3ZE8A 3UJNA 3OIYA 1EK6A 4P4NA 3U7QB 3WWEA 3HKDB 4JZYA 4F6RA 4RD3A 4EF6A 1PYGA 4Q01A 3WIEA 3AP1A 4IQ0A 5ALQA 3W3AA 1J21A 3IUMA 4NAVA 2V6JA 4FT4A 3SY8A 1ESDA 2CVHA 5CDYA 1VA5A 2R8BA 3K9CA 3L4EA 2GVDC 4RK0A 4ES6A 2F8SA 5GZ6A 3ZXXA 3GOHA 3I39X 4TWBA 4C3OB 3Q87B 3NHYA 2E6UX 5CPBA 3JQCA 5DLQC 2DWOA 3KV3O 3DLTA 5BSUA 2O8CA 1Z15A 2BZSA 4CTNA 3OY2A 2OP1A 3HUEA 1GLGA 3OIVA 2XVZA 3CX4A 4QJ4A 4Q7EA 2NT3A 4S24A 4X1IB 3QZUA 3IAAA 4E12A 1E8NA 1HYEA 2Q3MA 4KPUA 1KZGB 2WF5A 3R7DA 3NGLA 2VRBA 3BB3A 1OX4B 4IJWA 1L4UA 2G28A 3F0TA 5B3LA 1YBVA 4UUAA 5EJ6A 1GYPA 2XB2A 2O54A 4KK3A 3U39A 5LMNB 3PA8A 2NV2B 4IM7A 1WEHA 4CMJA 4Z1MD 4EJ0A 5B7PA 1H65A 1WUTA 5C5IA 4Y9SA 1X7DA 5H80A 3K5PA 1RWOA 2J3IA 2GPJA 3INGA 1HL7A 4S1TA 3ASUA 1K5HA 3AOEC 3Q7IA 4M3NA 4HC4A 1M1YA 2F9LA 4F38A 1G8MA 4GI1A 4EB6A 2WU8A 1QGDA 5ICEA 2IY9A 2V3VA 5BUZA 2Q0QA 3R3JA 2M6RA 4PX9A 2I9PA 2BZ1A 1T0BA 3A1FA 3JRNA 3VVCA 4CT4B 2RHTA 2RBEA 3GRKA 4L50A 1SK9A 3KLBA 2HRRA 2Q62A 1AT1A 4LTMA 4UEJA 3ZKAA 3VMFA 1T3HA 3R3ZA 4FQ5A 5JS6A 1B0AA 1APBA 4Q37A 2WZBA 1K4YA 5JSQA 1E7WA 1SXPA 4J1NA 1QOPB 2JARA 3CXRA 3ZD9A 1H2ZA 4OAQA 5SYMA 4OIFA 1SXGA 3EH2A 3NMUF 4Q66C 3AUUA 4PQEA 1KVSA 1SHKA 1ZCAA 4EHDA 5BSGA 2E0IA 4WZZA 3KSUA 5ERYA 2AE2A 3ULKA 1QQ6A 4DQLA 2Z1DA 2P5TB 3DZHA 5JAUA 4DRYA 1QCYA 2NO4A 3EIUA 1GPNA 1XRNA 3LSYA 4HK4A 4YAWA 5HGXA 4MKXA 3OJOA 2ILVA 5FD8A 1TYDE 1IN8A 1PT5A 1ZITA 2QVXX 3I5UA 4MZDA 4ZU6X 4MRNA 2OXTA 3B6JA 3NHFA 4DDVA 5ILQA 2IK8A 3IEKA 4FXPA 5K1ZA 1CJCA 4NL4H 3LXRA 4DIEA 4TMXA 2EZTA 1ZJJA 4MDEA 2ZYDA 3QF7A 4ENUA 3QYPA 3W9BA 3ZVRA 4D8XA 4RIEA 3E1GA 1ADGA 5DISB 3VAAA 1M72A 1Q0TA 4HPWA 4L3WA 3TS1A 4RAOA 2OOKA 3BBLA 2QRVB 3GPCA 1M2VA 3AI2A 2DLDA 4F2WA 1XJ5A 4GWKA 4FDAA 2NZVG 2YY7A 3EGXB 4ZALA 4PZYA 1PP4A 1IN6A 3X1DA 2A0KA 2IOFK 3Q3VA 1Y8QA 1C4XA 4EHLA 2JHPA 3D3NA 6AT1A 2YRWA 4GAEA 4N01A 1N6RA 1J8VA 5KYVA 4C0QC 5IBQA 4AG3A 1VCNA 4RDHA 3KJNA 2BN4A 1DKLA 1KK3A 2VYVA 3ELDA 4HZIA 4AY4A 2AE1A 4HQOA 3BB4A 4HT3B 3E22A 1KQFA 4XXHA 1CJKC 1GPH1 1IEQA 2VC2B 4LJ5A 4BO9A 5IC6A 1XZJA 2VP2A 2ZB3A 2EBWA 3DF9A 5A1JA 1AQIA 4DMUB 6GPBA 4RSMA 4A8JC 2FPUA 3RVQA 3H2ZA 3D4BA 4LK3A 2AGVA 1ZINA 4OCZA 1I1NA 3WGOA 2AF4C 4Y2TA 1DBQA 3NOXA 3RBAA 1W581 1Z8HA 3G2KA 1BKYA 1Y3FE 5E3JA 2C2YA 3TKAA 4R9RA 3QUQA 4OIMA 2P9GA 2WV9A 2LV8A 3WHLA 2PM8A 5L3QA 1FTWA 4ZVQA 4HY3A 1SU7A 1HMYA 3BFVA 2JIZD 5B36A 2IWRA 2ZE6A 2PKYX 2CNOA 4JVLA 3AJAA 1VB3A 3L5OA 1WBDA 4UBOA 1W0KD 3QBVA 1IWOA 1JSXA 4KI0A 1BVRA 3QG1A 1E6UA 2MTBA 2MHCA 2W8BB 4Y2RA 4BKQA 2FRVA 3CTPA 5F2NA 4PWYA 4V38A 1KBQA 3VVLA 5K8VA 4WZBB 3DMDA 1XZCA 2PKXA 4NH0A 4ZEWA 4X64B 4KW7A 2H54A 4OJNA 5A4DA 3JXEA 3MJSA 4MWOA 3T3PB 1DTEA 1R6UA 3RVSA 2BH2A 1JEQA 2QVBA 3KNZA 2XQVA 4BLRA 4XWKA 3AQ4A 1ZCZA 1V3TA 4O4HB 2LCFA 4F6CA 2JFQA 1LBSA 1QE3A 3AVOA 2A5GA 5JBNA 4IOLA 1E20A 5TNXA 3SXJA 5KNBD 5LXTA 2WI8A 3UBTA 5JWOA 4V0RA 1TM2A 3IJRA 4TKMA 1QH1B 1TKAA 2XMBA 2WP0A 1NV9A 4DPKA 2WJHA 3PJGA 3P52A 1UFQA 2V98A 3ZBPA 4HAVA 3IUSA 4I4TF 5DYWA 1QTIA 3IAS6 4XFJA 5E4TA 1JKXA 1WP9A 1XTZA 1Z0KA 3D1LA 1NTOA 3UJ9A 2DCUA 2XB9A 4A0FA 2PKQO 4CMIA 6CHYA 3WGZA 5IJXA 1M6YA 2ZGVA 3NKLA 3OZBA 3LXMA 2G71A 1BXRA 4QUBA 1JG3A 2GAAA 3KZ1E 1OLSB 3SS7X 3UBMA 1RE1A 1K2VN 5B6PA 1GPAA 3G8BA 1FFAA 5CX1B 4Q9KA 1HDRA 4GMXA 2W43A 2WU3A 3C5HA 4DLRA 4F4CA 1S02A 2C0QA 3BB1A 1HE3A 1KBZA 3GJSA 1LSSA 2ZRCA 2PGIA 4LVUA 5D3MB 1L1RA 5EPOA 3HKBA 1B1AA 1NPYA 1H6CA 2Q6TA 3Q10A 1R00A 2C5FA 2V7PA 1JQLB 3SSOA 3LPCA 3UMFA 3AHDA 1E5TA 5B53A 1RJ9B 3EWIA 4LY9A 1O6CA 4K9PA 4LWOA 2FWBA 2BZGA 4DLWA 4OBBA 3NI2A 1PR6A 1ZM7A 1VE3A 2WSIA 2XYQA 3CONA 3MWJA 3DMNA 3OU7A 4OBEA 3ROKA 3TLAA 1YK1A 1MX9A 2FZWA 3QPVA 4DBLE 1YFJA 3QXXA 4MVYA 4DDUA 4DV7B 2P77A 4WLUA 4YVFA 4DXHA 2NZ8A 5BSEA 5AJYA 3PQEA 4L74A 2GTHA 1GAWA 2H2AA 2UZ3A 2WWTA 5IRCD 1FMCA 4QA9A 2WAMA 5LYJA 3ZZNA 3HJBA 3I0NA 3WLQA 2NXJA 4A1FA 3T54A 2Q5CA 4L4XA 1CR2A 4UVIA 4AN4A 3TFOA 1CQPA 4EX6A 3NHPA 3SXUB 4KHZA 4B1FA 2I55A 3PV0A 3IHKA 2IXFA 1LVGA 2D2EA 5ITSA 3V32A 1CG6A 4A2QA 3I0ZA 5KSWB 1REQB 4IXTA 4J4BA 1UP4A 3CSSA 3HMQA 3HYSA 4L0CA 3CF2A 4TMTA 3ZZMA 5L7TA 3IVMA 2C2WA 4BO2A 4ER0A 1K8YB 1GUFA 2DBVO 3CB2A 3LDHA 1YRAA 2OV2A 3AF4A 4KQ6A 4HO1X 2J41A 3CEAA 3KTDA 4C4SA 1SCIA 2XA9A 1DIBA 3P9YA 1MMFB 4HZGA 3V4RA 2C7OA 5IK2D 1E8MA 4R7TA 1UBTS 3D7MA 1TFUA 5EXPA 1RWQA 4R54A 1CY0A 1GZ4A 4PBSA 4YJ3F 5CFLA 3HE3A 1KQGA 2V74B 2WIFA 4GRIA 4Z0TA 4B3IA 3GGCA 3IEUA 4HD8A 4J07A 4QU9A 5DI3A 3BYZA 2G1JA 2LVBA 5DN6A 3EARA 4IGAA 1JU9A 1G2OA 3HDGA 2BD0A 4RJLA 1BCSB 1H1DA 1WMBA 3NT4A 3UHFA 4ZJYA 1F2DA 1BDJA 5FPTA 3TIXB 4O2AA 3ADPA 4KR6A 1PDWA 4J0JA 4EMSA 3AHGA 4EJSC 3KT0A 4D0SA 1HX7A 2QLMA 4NTZA 4DYDA 2HMSA 2V65A 2XT6A 3ZV7A 3C3WA 3DDSA 5JYEA 3HJUA 1QKIA 4RV5A 3LLCA 3STYA 1OOEA 1Z0ZA 3FYUB 4N8DA 1OT3A 3CZ4A 4HN9A 2E3JA 3QU7A 3OLQA 4YDSA 1T4MA 4S12A 2AJCA 3QMMA 4LRYA 3OICA 3W5UA 4DEYA 2YHSA 4Y2YA 2HT1A 1EGAA 1E2BA 4LYGA 3AK4A 3G7SA 4RANA 3RGWS 4ZV4A 4WNYA 3LBHA 2VFAA 2ZRJA 1JIJA 2JKZA 2XWSA 1GN8A 2HF2A 2X40A 2AOUA 3C5VA 1P5FA 4GQIA 3WNCA 3E7XA 4AMUA 5AM1A 5AW6A 1WB4A 3EAQA 2CLEB 3A0RB 2QZSA 1MT0A 2DBYA 3DWFA 3N5KA 1TQ4A 2G9NA 4ZCLA 4MKRA 4LG1A 3WYFA 4CEIA 1KI4A 3PYMA 2CLSA 5C52B 4D3SA 2GAFA 3PC8A 3ZNOA 2F8TA 3PGMA 4JCOA 5CVDA 3RYFB 3V2IA 3EEFA 1KGSA 4Q3BA 3FHTA 3F3MA 1M0SA 1IK6A 3IT1A 4IEFB 1O6FA 3EFOA 1YB4A 1QLJA 2AD5A 1IONA 2BFEA 2NG1A 3ILXA 4LS3A 4NZ9A 5EMJA 3WLIA 2XI4A 2WWRA 1Y6JA 2EQBA 2RGUA 4H7FA 3R09A 5B64A 3LDAA 4DT1A 3D5TA 4HDNA 3U09A 1M2NA 4D25A 1YCDA 3EEQA 5DXAA 3QOYA 1THGA 4ZVVA 4B40A 4EECA 4E30A 4AP6A 1QPZA 3A9TA 2OOSA 1UPUA 2VG8A 5CT8A 5CTJA 4F60A 5EUQB 3ZDRA 3LQQA 2FDXA 3HA7A 4L0QA 4Q4JB 4NS4A 3TG2A 1IEXA 3WZ2A 5JBIA 2VAPA 4G3XA 2ZJ0A 3E2MA 5KSOA 4OXQA 3H04A 3BMNB 1VRWA 2R62A 4YB8A 5BRNA 2YL2A 1P62B 4LRXA 2P7HA 4Y6OA 3ZQJA 2CKMA 2BP7A 3O8NA 1B8PA 4UDYX 3UMCA 3ZHSA 2H5IA 4NBRA 2YYZA 4DDMA 2V7EA 2PD4A 1ZCBA 3FI0A 1V41E 4Q1FA 1O6BA 1KQ3A 2GKSA 5JJ5A 1KK2A 4OG2A 4W6QA 1XLVA 1TK3A 3OZVA 5JO0A 1Z45A 1U4NA 4UHJA 1X38A 4DS3A 2SKEA 4GD3Q 1YT5A 3AWIA 3FCCA 1Y6QA 1U0EA 3BCUA 3NCHA 3W6NA 1I7DA 3LKDA 4RMJA 4JKIA 2DTDA 4FCVA 3R5TA 3ITEA 3KHUA 3D0RA 3KSAC 5IVIA 3JD0A 5FOUA 1XPJA 4Z4HA 1CZLA 2M1XA 1M5UA 1OFHA 4DTCA 3ZCVA 1H2AS 2HWWA 1AVTA 1BH2A 2ASVA 4AJLA 3IQZA 3DV0B 5FUQA 1AQJA 2VNIA 3WRXC 2JH8A 4TSRA 5G0VA 2WJVA 2PZFA 3E18A 4RKEA 4YR9A 4P32A 1WV1A 2W6PA 3JYQA 3FRJA 5I45A 2NZXA 4S3MA 2CDBA 4B3BA 5AKLA 2V0NA 4N3GA 1FBNA 3RS5A 5INTA 3C5CA 2F1IA 1ZM2A 1OF1A 3IHWA 4CIYA 3KM0A 5DWDA 5K2MA 2XT0A 3EVGA 1Q1AA 1I8TA 3DZKA 1JF8A 3TL6A 1ZONA 2P9YA 2C3MA 2ATEA 2OQVA 1FP4B 4RW0A 2DPHA 3AIOA 4Z3DA 1F2TB 2GN4A 2C92A 2VDWB 3EFOB 4JUDX 5ARBA 2PUAA 1R9GA 2C4UA 4R6WA 1EJ6A 5J1TB 3QVUA 2ZTVA 1A9YA 4JIMA 1RYBA 2Z0MA 3K2IA 2IX9A 3LQ1A 1UDWA 4R0VA 4BNTA 1PV2A 3TZLA 1QYWA 4D44A 3ITDA 4RJKA 4EW3A 1WXDA 4GMGA 1DIOB 3D4PA 1P3DA 1XZGA 2C7GA 3A1SA 3BMNA 3HEAA 4WESB 5EYPA 2DFVA 4RTJA 5KTOA 4BNUA 1G1AA 3G17A 4O3FA 1EWVA 3R3SA 1WJGA 2N0SA 5GONA 2FX2A 3ZXYA 3G7UA 2FSSA 3GD7A 1VSQA 1NT4A 1PZMA 4ZXFA 4KLZA 4C01A 3MIIA 3PFFA 2F17A 2IA5A 2TRSB 5TRTA 1CSEE 1VC2A 4BKUA 1Q0ZA 2ZRDA 4JLNA 2BFBA 2IU4A 4IIHA 3FI9A 1WRBA 1L7MA 1V5GA 3D5QA 3TNDA 2GBCA 1GUYA 3PVZA 5F35A 1HY3A 1SHLA 5EEGA 2YXEA 5JQWA 2WMYA 3LHDA 4X1IA 1W85B 3ANMA 4RL4A 3OFKA 1CDZA 1R6XA 1CPYA 1ND5A 4QDTA 3UB2A 1LNQA 2MSKA 3AVPA 1JDSA 2QXUA 4UUNA 2WZCA 3OMLA 5DXJA 4C43A 1LI7A 3CLRC 2YXBA 3DO5A 3E5HA 2UDPA 1WETA 4K2AA 4TQGA 5FWNA 3GXBA 1HE2A 2NVOA 4TXJA 4EFLA 1IOLA 4EFKA 2WD9A 1ZEJA 4KQMA 4O2RA 4W82A 4ERXA 1IUKA 3K09A 3NTQA 1ECLA 5A5DA 5I4IA 1SMKA 3JQ7B 1M8FA 2M6KA 4ENSA 4EF5A 5IK2A 1W8DA 1GNSA 5E2AA 3K32A 4EQZA 4I6EA 4OHUA 1GGKA 2H2DA 3NOOA 4YJGB 2CWDA 3PDIA 3BOSA 3BJMA 3H11A 4N54A 1SUDA 3LFHA 1PN3A 3HB7A 1GDTA 1GL7A 5HF9A 1ZIYA 5BQ3A 2K4MA 3KBOA 4YAUA 2O0LA 2OORA 4NY1A 5IT9A 2XLBA 1ZIXA 2YIDA 4Z9YA 5LR6A 2GJ9A 3MMSA 4KQXA 4ZI7A 5HP4A 5CU7A 4FFBA 3BXHA 4R2HA 3R9XB 1SWWA 1C3LA 1H9AA 2BFCA 1VPLA 2WW8A 3IP9A 1OIWA 5I4KA 5MGNA 4AY3A 1E2PA 2CXSA 5D01A 3TQQA 3TGLA 1XMSA 2HUPA 2OHIA 4DV5B 4TT3D 2H2HA 2XQIA 4M1SA 3DZFA 3V4FA 4FD3A 1PV4A 1ZP6A 1C2YA 2DE0X 4M38A 5HIKA 4Y1RA 3HJFA 4MCIA 1EWQA 4BVLA 1EDBA 3AX6A 2ZYVX 5LDDC 1GZHB 1PEAA 2B69A 2QV0A 3QIVA 4WHMA 1MA3A 1L5KA 1KP3A 1J2UA 3T7KA 3S29A 2FSIA 3DV9A 2IUFA 3I6BA 1MB0A 3P4UA 1KNXA 4QSHA 1GXSA 2IIBA 5EI5A 5F9HA 3FNHA 3OEEA 3OZCA 2N1BA 1TLTA 3RUPA 3JQDA 2ZRQA 1FJGB 4H0FA 2H8KA 1HE4A 1II9A 1ZVVA 4KYIB 2AXNA 1ZDMA 3KQQA 2C61A 2LDBA 4EGQA 2VQEB 1L5VA 1NJSA 4AKTA 5A62A 1A2OA 1BYUA 2FRDC 5D5QA 4CL3A 4A0HA 1I4WA 2IH4A 4O2AF 1JDBB 2VK8A 2VHWA 1AHIA 4FR0A 2R6R1 2QJOA 5C34B 3UMJA 3INYA 4NU8X 4YP9A 1V5IA 4IIEA 4ENQA 5CCBA 5JASA 1GPBA 3DUFB 2XKKA 2YZGA 4C3UA 1OYWA 1JNXX 3GNQA 4JJAA 1B3RA 1RPTA 3RRJA 4C6TA 4UTRA 5KX5B 2VJKA 4PPQA 3M5WA 3W79A 3ZU6A 5KHLB 5MF6A 3WMRA 2QNRA 4IUDS 1ISGA 4I8IA 3KDPA 2VUSA 1QGYA 1WNFA 5UKDA 1CUUA 3FSEA 1YQGA 5K0JA 3ABOB 3CLSD 3RJ5A 5E38A 4A73A 1VMAA 4K9DA 4KNWA 2XRYA 2X8JB 4NAUA 2X5XA 1WEKA 1MO6A 2A7XA 1YKGA 4JASB 3I5XA 3H7IA 4EO4A 2YWHA 5JZBA 1LPPA 2CYBA 1VKRA 1TUBB 3K9BA 1IZ9A 2VK1A 4M9CA 5LQMA 5BOSB 3W7BA 1T9BA 3LHSA 2RAPA 3QJ5A 4JUCA 4W5OA 1U9CA 1W85A 2Y9PB 1KQNA 1NXWA 2GQ0A 4AY2A 5TJ9A 2I1LA 3RSLA 4CF3A 4B8WA 2CVFA 2Q0XA 1IDOA 2FG5A 3DMYA 3IAXA 3IBGA 1SU8A 3OC6A 4QBKA 1ZR2A 3ZU5A 4HEA1 5KOIA 3KLPX 4CKBA 1C7ZA 3JVDA 4RPGA 4DM4A 1Y1PA 3R9XA 3EJWA 2FPRA 4ZREA 1JFFA 5EKXA 4NEQA 1Q7GA 1OKKD 2FX3A 2J48A 1ND6A 2RK4A 3SHQA 1GN9A 3JAWA 4DBZA 4AURA 1SUPA 1QHEA 4C3VA 2X5NA 2PUGA 3U16A 1Z34A 4J3JA 3CT6A 3PL1A 1PG5A 4MWCA 4MKFA 1DXOA 1GYRA 1XTIA 3TIIA 3RC9A 5GTDA 5LU8A 3BMXA 3FZNA 5LSAA 2MOKA 4GLJA 4DCGA 4LEIA 3OZIA 3Q3GE 4GYYA 2B25A 1JG1A 3AXSA 5F73A 1N2JA 4ZT5A 4I3HA 4L9WA 1B6TA 1E3IA 4WXRA 4HWRA 3U49A 1VL2A 3TX2A 3ZJUA 3FZYA 2WJJA 1UDBA 4RK5A 5CNIA 4OAOA 1DX4A 3ZBTA 4ALLA 3AFGA 3KT6A 1VJ1A 4FMCF 5JS1A 4B0PA 4G8CA 2HSJA 2O0KA 4XI9A 3FOWA 1J70A 4WOBA 5T8KC 1R6DA 5KNCD 2EAUA 1NSTA 2A94A 2POCA 1GRCA 3BULA 3WNZA 5GP1A 1UUFA 1QS0B 4AJKA 1AIPA 3K0KA 3TB6A 3S8MA 1CUVA 3FPGA 3JYLA 2G8NA 3NDPA 3S3TA 3EPHA 4AP9A 1DO0A 4GI2A 4DCOA 4QXAA 2JDID 2CL0X 4FHEA 5KNLA 4H1HA 1K1EA 4DCPA 5CA0B 4WWHA 5FNVA 3DVQX 5JCOA 1Q6YA 4K88A 5T6BA 1RAGA 4YMUA 1XMPA 3ID6C 5AR1A 1U1DA 2HO4A 5CYPA 1EE9A 3HH8A 4P3YA 2QUBA 1V0JA 4N9QA 2BMWA 1ENPA 1HLDA 1R4NB 4O4HA 1ADCA 1JAYA 2P6PA 3SHVA 4E2YA 1TEXA 5CFPA 5JJBA 4FOPA 2PANA 4HXEB 4PAMA 1IN7A 1RPJA 1BKDR 1X2BA 1WXWA 1ZHHA 4HLNA 4X1KA 2D1SA 2KLHA 3AHJA 3O2JA 3M4NA 4QQKA 1JYSA 1QG4A 2D4HA 1YJCA 3LXUX 1RJFA 3GRZA 1B23P 1M10A 1CB7A 1F8GA 4QZVA 1VHQA 3ZCSA 2YYYA 5ALRA 5IBRA 2G25A 1L7RA 1QH8B 3BDAA 1WPQA 4O0LA 2DHCA 2CDCA 3NATA 4J1QA 4YYZA 3T3NA 3EODA 2EFCB 1C3VA 3NNDA 3G2MA 4ZRNA 1W88B 2J5QA 2ZI4A 4Q24A 5BV8A 1UJ4A 4KQEA 3T4UA 5AHWA 1DJOA 1NUAA 3B70A 5A1TA 1TYAE 1YB1A 2ANBA 2GHRA 2KM1A 2BM0A 2VQ3A 3L01A 1G5QA 5LP6C 1KKUA 1Q91A 1R16A 1KETA 2DUNA 2N47A 2QL6A 3KB1A 2XTAA 3CVUA 1OBHA 4HQFA 1FTGA 1LBIA 1V8ZA 4OHPA 4ZVOA 4DEXA 5JALA 4WKPA 3MC1A 2X22A 3EUEA 3ZBUA 3BHNA 1WXFA 4RXMA 4ER7A 1RAFA 4RZ3A 4B7CA 4UTPA 3FX2A 5BMOA 4WKGA 5BN1A 2FMKA 3HXOA 4Q3KA 3TZQA 1BWRA 4LOJA 3OCXA 2PKCA 2WF9A 5CEFA 3VHXB 3FPBA 2PU5A 3R5HA 5AVYA 1NLMA 2WWHA 2WVHA 5IJ0B 2GAJA 3DV2A 3HJAA 4L02A 3O6VA 3ZN2A 1YOVB 4EATA 3JATA 4FJ2A 3BXXA 4K28A 2GJSA 3CW9A 3T7EA 4P53A 4D9KA 4PFJA 1FY2A 1D9XA 2R1VB 1A27A 1MPTA 5IFKA 1LLUA 4R4JA 5JQGF 2GCGA 4GZLA 4BGEA 1N2HA 1SG0A 3KQPA 4O33A 1M6WA 2P2CA 5K5EA 1BA3A 4LV8B 1JAXA 3LC0A 1QYRA 5SYAA 1WQ4A 3RVLA 3OX2A 1XLUA 3LTEA 4Z3KA 4R9VA 5B3KA 3NTLA 1IMOA 2C0CA 3D81A 1J8YF 3AW9A 3WLPA 3AXTA 4MJXA 4P2BA 1SHUX 3JALA 4B74A 1W4ZA 1K3FA 2QTGA 3PX7A 3SDBA 1O3YA 3PGLA 4NMLA 4BAZA 1MJ5A 1CR0A 3OTOB 1CZOA 2BFAA 5JY1A 5B37A 3V1UA 3WL8A 3WOHA 5DN6D 1U1EA 4TLMB 3K1JA 2RH4A 4BO0A 5IWCA 1E9RA 4O5AA 3NB0A 4IICA 2WU0A 2Q2OA 5AHKA 3T06B 4JITA 3CKMA 5K9ZA 1W88A 3AETA 4R2KA 3LUPA 3OA0A 2VP0A 3BMCA 3QWAA 1PEYA 1AV6A 1DQRA 5L7WA 3N0RA 1CRQA 4GDMA 1L5LA 1AM4D 4MJ3A 1RNLA 4IGKA 5AK3A 4ZVPA 3WMFA 1M5RA 2AOTA 4AZVA 3N0TA 1XRPA 1E2IA 1RYYA 2FR8C 3Q6IA 3ZWXA 3RC8A 2R6AA 3NIGB