2VH5R

Crystal structure of hras(g12v) - anti-ras fv (disulfide free mutant) complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional Intracellular Antibody Fragments Do not Require Invariant Intra-Domain Disulfide Bonds.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords ANTI-RAS FV HEAVY CHAIN
total genus 55
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2007-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2vh5R00
2J46A 3NBFA 1P72A 2VHUA 3KFVA 4XSHA 1S96A 2CJWB 2X1VA 3IBGA 5J4VA 3AB3A 3SBDA 1ZBDA 5IF9A 1YZUA 4PSVA 3VNUA 3R8CA 2H17A 3G0HA 2PL3A 1UEIA 1NNEA 1R5NA 1Q1ZA 2OLJA 2VP9A 4E09A 4XD7D 1UDXA 4IOKA 4NMMA 4TT3A 3PIRA 3CR8A 4B33A 3BH7A 1E69A 2C5LA 4V0OA 2QMUA 1E9DA 1RJ9A 1KAGA 2ZUBA 2ZI3A 3EA0A 2A5YB 4OJQA 1DARA 3L0PA 1XEXB 1FFHA 4GNKA 1TU3A 5IK2A 4AWXA 1P5ZB 1QHGA 4LRWA 3SI7A 4Q01A 3PUWA 4O2RA 1YHNA 2W58A 4QG7A 2VP6A 3E70C 1CEEA 1L4YA 4B2PA 3ZLJA 2XTNA 4KI0A 4RZ3A 4GL2A 3ZS8A 3QEJA 4L5BA 4PQYA 3D3QA 3LLMA 5G3ZA 4US2R 2VYFA 4OQMA 4UNQA 4QBHA 1UKEA 4WAUA 1YR9A 2QRZA 3GQBA 3L0SA 4L4UA 4R9UC 1KK0A 3V4FA 2ZI7A 2ZJZA 2HCJB 5FBVB 2QQ0A 3F8TA 3MGCA 1U8AA 3NTUA 1IY1A 5GVSA 2XJ9A 1VG1A 2IYXA 4GRAA 5CYOA 4HLCA 1HURA 4LJ5A 3K70D 3EPJA 2CE7A 1J99A 1XDBA 2WWIA 3L43A 4X8HA 1FZQA 2QBYA 4A8JC 1F3OA 1M7BA 1A2BA 2GRJA 3QQ5A 2BEJA 1XJ0A 1R5OA 2W6ID 3CW2A 4CDGA 3GLIE 2PX3A 2WSMA 5C1BA 4ZO4A 4ASUD 2ZVPX 3N70A 1UDWA 4C7OA 3X2SA 3VKWA 1MO3A 2WWXA 4OI0A 1KZ7B 3B1XA 3E1SA 4HYYA 4JL6A 2GCOB 4LC0A 1XPRA 4RD1A 2HT1A 1FP7A 4D0LB 2RGDA 2GJAA 2XX3A 3VQTA 2IS2A 4Y0AA 4LBYA 2OFXA 2FOLA 4M2LA 3A1WA 5DN6D 5LD2C 3AM1A 5IRCD 5KSYA 2JLSA 3MRSA 4YLGA 2GJSA 2HEIA 2QP3A 2IYUA 3ZVNA 1KNQA 2D2FA 2A2ZA 4JYCA 1EWQA 1G4UR 3B1ZA 1PUJA 1M8PA 2IEZA 4UJ3A 2J0UA 1CXZA 1A82A 4DLWA 3FWYA 4DLRA 1N6KA 4QXAA 2WWHA 4DLVA 1YZQA 3SE0A 4CEIB 1F48A 1LVGA 4UKDA 1OLOA 1YZTA 4Q19A 1ZAKA 1E2KA 3W6PA 1T5LA 5JI2E 5TXGA 3EZ9A 3OE7D 2WJIA 4JVLA 1KKMA 2EQBA 4TZ0A 1WE2A 1KHTA 2VHCA 2J0VA 1MO5A 5G40A 4OHXA 4C0KA 2AFHE 2FSFA 2V55B 3B9QA 4YONB 2ZE5A 2EFEB 2OEPA 4IFEA 3OHMA 4PAQA 4RD2A 4DCUA 3SJCA 4XTCS 5BN5A 4DSTA 2QA5A 1D9XA 2JEOA 4PQRA 1VKJA 2H16A 2FU5C 4AIIA 4BFUA 1KTVA 3A1UA 4TL8A 4WXPA 4YMTA 3W8RA 3U61B 1YR6A 4Z54A 3OIVA 5A0FA 1ZVQA 2O8EB 3U4QB 1RJ9B 1Z6GA 1AS0A 4UXJA 1Z3IX 2A9KA 3AP1A 1H8HD 2R6AA 3Q85A 3SS8A 2JLXA 5KPDA 5BXQC 5K8LA 2HCBA 3QPWA 3B82A 4FN5A 4A15A 1T8UA 3WNDA 3U7HB 3K0CA 3FKQA 3AF3A 1HE1C 1DAHA 1W49A 2ZU6A 4URZR 1G4AE 1P60A 2GA8A 2OSBA 1E94E 2Z4SA 4BEJA 3THYB 4PC2A 2FZ4A 3S1AA 4OQNA 4S35A 4AI6A 1IBRA 4H1UA 2G0TA 1GUAA 3R9IA 3IPXA 4WBSA 3K0AB 4E03A 3LV8A 3CLVA 3MJHA 4Q1DA 2PZGA 2HV8A 2NO6A 2BMEA 3I1FA 3F3YA 3W6NA 4DLYA 4WA7A 3NVAA 4Q66C 1X8JA 1WDTA 4KLNA 5CB8A 2HYIC 4URWR 1OV4A 4EIWA 3V9PA 4KBFA 5FBQB 3KFXA 1JAHA 1TQDA 2BMFA 5HKKD 1C9KA 3ZZ0A 5KHOC 1KDTA 2OFOA 3OZXA 3R9XA 2PEYA 3CZQA 1BMFA 4Q9HA 5KNDA 2WIBA 2QEQA 2ZI4A 2XNDA 4G3XA 2DR3A 2HF9A 3CH4B 3KXIA 4QL3A 3OIUA 4GT1A 3CRQA 2F1HA 1KAOA 2YV5A 2ZR7A 3CRMA 1AIPA 2FPMA 2YYZA 4BFTA 5E7IA 3ZD7A 5AJXA 1G16A 3I72A 3RHFA 4DT1A 5CB6A 2B8WA 5UKDA 1V5WA 1C4OA 2W2TA 1RPZA 1IHUA 2B8TA 1MRNA 2J41A 2IT1A 3VR5A 4UXIA 3T12A 4KODA 1XP8A 1IAQA 3N5CA 3PCRB 2PH1A 2GKSA 2C77A 3P4XA 4KO8A 3OESA 2CLCX 2JJ8A 1HYQA 2Q21A 4EPTA 4W9MC 3GPLA 2Q9AA 4L8GA 2C95A 3X1DA 4LBWA 5GJVC 3QF4B 2VF8A 4A9AA 4NYMR 3HR8A 3Q3JB 5J5CA 3TSWA 4M0LA 1DE0A 4NDZA 3LXXA 3EW9A 1OB2A 1NY6A 4M1OA 4ABYA 2YZ2A 4URUR 5KU1A 1XB2A 1GP2A 1XTIA 4DLUA 4RCZA 4MKFA 4JLKA 5KSPA 1VHTA 1LS1A 1VCNA 3Q7PA 4Q1CA 4CGZA 3AKEA 1XXHA 1P2TA 1ZRHA 3FHCB 2CXXA 2AD1A 4LX0A 1JALA 1G5PA 4LCBA 4LHXA 5KPJA 3A4MA 2ZEJA 1QZXA 4Q1EA 2WIAA 4F92B 3MJRA 4JYBA 4A4DA 1X6VA 4HDQB 1FMLA 2J0QA 4QGHA 2BBTA 4JJKA 2MMCA 2HUPA 1A2KC 1ZNYA 1WBDA 3QKRA 3U4QA 4PHFA 1N6LA 2J7PA 2WWWA 4D80A 2C96A 1Q0UA 2O0JA 3U7FB 1BYUA 3T1QA 1KSJA 2FSGA 3FGNA 1YZLA 3IIJA 1N6HA 2ZUCA 5F2EA 1E0SA 5EXPA 1FX0A 5EP1A 4AG6A 2QTHA 4H1VA 2PCLA 2REBA 1L7VC 2VTKA 3T1VA 3LNCA 4HUQB 2AK3A 4LDJA 1KGDA 4KVAA 1E9SA 2IS1A 4OQLA 1G8YA 2ZRMA 1JECA 4N0DA 1AGPA 1S2MA 3K0EA 2WKPA 3DPUA 2REXB 2UZ3A 4LHVA 1LY1A 1GKIA 2LCFA 4MDEA 5DH9A 4QHYA 2GESA 4FXPA 3IHWA 2DFKB 3SJAA 1TAGA 2QY9A 4PAMA 4Z8YA 4JBXA 3PJRA 1I4DD 5JSZA 5HR5A 1AJEA 2EWWA 2YWHA 3Q5EA 5FI0B 1OXTA 3RAPR 1II0A 3WMFA 1W46A 1G7TA 1KDPA 3RS3A 4OL0A 1E2GA 2FPKA 3THWB 2FMXA 2NIPA 1E2MA 2IYZA 4Q7JB 1W2GA 3EWSA 1CR0A 2IYWA 1E32A 1Z47A 4KCGA 4KLZA 1YQTA 3O47A 4DCSA 1RKBA 1HT1E 4BLTA 1KMHB 2NG1A 4YXWA 1G21E 2EFDB 1LF0A 1G291 1LV7A 5FI1B 3AVXA 3WP0A 1COWA 4LJYA 1W4BA 2CDNA 3GFTA 4OI4A 1E0KA 1G8PA 1QG4A 2RMKA 3B1VA 2QM7A 4OYHA 2O8CA 4DLZA 4Q9KA 2F9LA 3SDZA 1TPZA 3KQLA 3NC0C 3OFNA 3BC1A 2NZJA 2IWRA 1Z6XA 1W0KD 3JVUA 1XPUA 2J3EA 4KFTA 3AF2A 1D5CA 1NJGA 4Y0VA 3E2IA 5JHHB 1NIJA 3DOEA 4LYAA 5J4KA 5SZHB 2FWRA 1XD9A 4LYFA 3SOPA 1QHYA 4NU0A 3Q72A 3NBZC 4I1SA 1N6OA 2QAGB 2OCAA 3W6OA 1P3JA 3Q5DA 4XWOA 1OYWA 4M22A 1YR8A 4OHWA 1TUIA 1ZCAA 4V02A 2QROA 1BH2A 4CEIA 3DVLA 3FB4A 2J9RA 1SXJD 5FTNA 2AKAB 2VEDA 1SKYB 3I5YA 2VIIA 5BQ5A 3V4RA 5BWMA 4XD7A 3D8BA 2ODWA 2A5JA 2F55A 2Q3MA 2UKDA 5CM8B 3B1WA 3HPRA 2XOKA 4BRUA 1PVOA 2WBLC 3RLFA 4JKYA 4LHZA 4LJ8A 3P26A 2ZSEA 4FI3C 2C78A 4I4LA 2YWEA 4PAOA 3OEEA 1HQYE 4IOLA 3PUYA 1Z22A 1XXHE 2GEVA 2A78A 2WWGA 3K1JA 4RZUA 2NPIA 4TTRA 3SJZA 2YINC 4DIDA 4TMVA 5FBWB 3PEYA 2CBZA 2XGJA 2ORVA 3ZZUA 1NVWQ 1Z0FA 2FFAA 2FSHA 4TTQA 5F9FA 3AQ4A 4R71A 5K8UA 1XTRA 2OUKA 2QP9X 1RFLA 4PSAA 1G41A 2BKEA 2IYVA 2AR7A 4NL4H 2L0XA 5A5GA 1Q1QA 4QNMA 5DGXA 1YZNA 4URXR 3TRFA 2I3BA 4DT1B 1OIXA 4M9XA 5FUXA 3X1XA 1P7CA 3ICEA 1NSFA 2Z0MA 1G7RA 1FP6A 1NVVR 4IXMA 1T3SA 2XXAB 4LOAA 4OJKA 3VMFA 2J0UB 4MRNA 2ZRFA 5EP3A 2GZAA 1XCGB 2ZS8A 1CJMA 1JPNA 3A1VA 4L9SA 4M1KA 4PZZA 3ASZA 4FW9A 2B7BA 5EE3A 1CJUC 2PT5A 4C0QC 4LJ4A 4LV6A 3ZS9A 4JLJA 5JS8A 4P31A 2VRWA 4XVQA 4JT2A 1C1YA 3FMPB 1T5IA 3DKPA 1WB9A 5EP2A 4GP7A 5LDDC 4QGAA 3KJEA 1WQ1R 1VDZA 3ZYCA 2Z5FA 2QQEA 3U44A 3BS4A 1NL3A 4QHTA 2ZSAA 4PO8A 4ZDJA 1Z28A 5D3MA 3U3OA 1D8TA 2Q9CA 2NO1A 1OHHA 2PBRA 4IRUB 1TMKA 4YC7A 4CEJB 4F7WA 2IW3A 1TNDA 1ZD9A 2R6FA 1W0JA 4IVPA 1RRCA 4ZI3A 4DSNA 3QXSA 2G0NA 4DWJA 3R9WA 4NYMQ 5C18A 2JLWA 4KXFB 1EX6A 2FF7A 2A7QA 1E79D 3DEFA 5L8VA 3K9HA 4A82A 3PUZA 8OHMA 2KBFA 3DHWC 3LW7A 4TL7A 1FQKA 1T0JB 2A30A 3U3KA 5HZKA 4IW3B 3KTAA 4B34A 1G6OA 2QG6A 4Q4AA 3EIHA 2C99A 4BFYA 2XNDD 4EPVA 4TSFA 1Z6TA 1ZIOA 1R0YA 3L8ZA 4D6PA 3KKNA 2NQ2C 5JJKA 3EASA 3H0KA 4C2UA 1I4TD 3HYRA 3OEHA 3ADDA 1XPOA 2ZRNA 3GCGA 1XMIA 4QM7A 2AWNA 3W9YA 4DSUA 1ZC4A 2YKGA 3GLIA 3U3JA 3Q7QA 5CDFA 1P6XA 4WXRA 1K8RA 1NF3A 1YZGA 3CX8A 2WSSD 1IY2A 2GF0A 2H92A 1KY3A 2OM2A 4PTLA 4Q48A 5DISB 4XWKA 4KITB 2FNAA 4NCNA 5B2ZA 4N0EA 2VA8A 2AL7A 4PC3A 4B48A 2XZPA 1SVOA 4LK2A 2H18A 4M21A 2XNSA 4NCKA 2JLYA 1NKSA 2C9YA 3X1YA 2B92A 3MWLA 4F93B 1G5TA 3NHAA 2I1QA 4M9QA 1KY2A 2RGBA 5EQTA 4PC6A 1JBKA 2FEOA 1CR4A 4AC9A 3VX3A 4YMVA 4PSKA 4IVRA 4CW7A 3SYLA 3SYKA 4R2IA 1N5KA 1LNZA 1XZQA 1GL6A 1G6HA 1XMJA 121PA 2A5GA 2W2VA 1EFTA 2QI9C 3ZZTA 3ND8A 4B32A 1VG9B 3M0EA 5AK0A 4LI0A 4LV8B 1O87A 1SVIA 4B3XA 2YC4C 2AKYA 1MO4A 3AVQA 3CB4A 4C0JA 3NEJA 1XX6A 2RCNA 1HH4A 4H9GA 4V0LA 4NHOA 3FMFA 2JASA 4JSTA 5KO2A 4OKSA 4JLNA 2EW1A 1CTQA 1Q20A 3AVPA 4EKDA 3GLFE 3I62A 3ADBA 3EPKA 2GNOA 1XXHB 2FZLA 3TH5A 3GEHA 4BLSA 2Z83A 3W3AA 3I73A 3ZIAA 2NZ8A 4U00A 5JEEA 4NPHA 2QZ4A 1TADA 1P4SA 2O8BA 1UAAA 2OFWA 4EPXA 1TQ4A 1IXSB 1ZNWA 2WJYA 1IN7A 1MKYA 5H68A 5JEDA 4MGYR 3WNCA 3K53A 4P0TA 1OH5A 4TZ6A 2NO7A 1ZM9A 3CKLA 2WAYA 4F38A 3CPEA 5CK5A 4S2EA 2ANBA 4Q7LA 4TL6A 1NLZA 1TX4B 3ZQ6A 2QMEA 1Z5ZA 4Q1BA 1NI3A 4MGZR 4US0R 3JZAA 4MA4A 3W3ZB 3PEWA 1OH6A 2OCBA 4DVGA 1AM4D 1ZC3A 2ZE8A 4TMTA 1JR3E 2VBCA 4EFMA 3I92A 1FX0B 2VHQA 1G7CA 5FUVA 1VPLA 4A0RA 4CEHA 3AP3A 3AVVA 1AA9A 2IUSA 4KAXA 1M6NA 2BC9A 3U3MA 1L8QA 5FOSA 5P21A 5FBRB 1ESMA 2PMKA 2YOHA 4ESVA 3KQNA 3L0IB 1JXMA 1P61B 1P75A 2Z43A 3C5CA 3UG7A 5BN4A 5IHPA 2G1JA 1P2SA 2FEMA 2XTMA 1SXJC 2FV8A 4HLDA 3AP2A 4HSEA 2ZJ2A 1RIFA 1TQ6A 1NIPA 4M4SA 1OE0A 5F3WB 5CLQA 1CP2A 4G5GA 1G5RA 4PC7A 4V0MA 1GRQA 1R2QA 1GVNB 2E87A 1GFIA 1KDOA 1SVSA 4ZI2A 4EQ6A 3MG9A 4JKIA 5C4GB 3FMOB 2W0MA 3K0FA 1Q3HA 4EAQA 2GBLC 2P3SA 1W4RA 5AR1A 2X8AA 4EPYA 3RSLA 1HA3A 1RRGA 1N6RA 1NSTA 1ANKA 1AQYA 3ZGXA 5KOYA 4C0AC 5JRZA 4EPWA 3RS7A 1TUEA 3IO3A 3KXKA 5JHGB 3GJ0A 4A8JA 3GLHA 3IPYA 4NH0A 3PFIA 1VMAA 2ZE6A 1ESNA 4ERNA 2ZXUA 1P9RA 3NXSA 1AKEA 1E1QA 5EE1A 2UZIR 1Z8FA 2ZJBA 2VSOA 4GOXA 1KJZA 5DO9A 1N2CE 2OG2A 3DL0A 2HXSA 5CM9C 1T91A 4B74A 4DZZA 4LV5B 3TGPA 3IO5A 4RD3A 1FUUA 1G9XA 4PPFA 4KSCA 2YWFA 3QBTA 521PA 1NLYA 1NMYA 1Z06A 5FPTA 1XCPA 3GJ4A 4JSYA 3KKMA 3CWQA 5GJWC 1F2TA 2OCPA 1XEWX 3P1JA 4BLPA 5TV2A 1W5TA 1KI6B 4PZLA 2BHRA 1JNYA 2FFBA 2RGEA 1QVRA 1W4AA 1JEDA 2KJQA 2G1KA 3VFDA 1DAKA 3CM0A 3R20A 2ZJOA 1ELOA 1BIFA 1F5NA 1X86B 3CBQA 5EE0A 1PLLA 3QIAA 1SHKA 4CVNA 3TW8B 5J4LA 1E0AA 2MSDB 4B3DA 4LHWA 4OQFA 3AF1A 1ZCBA 1Q21A 2KB0A 4OHYA 1NN0A 3BJIC 5CK4A 2X19A 2O8FB 2MSCB 2WV9A 4G5RA 4DIEA 1A1VA 5L3VA 4PC1A 3IHLA 4BFWA 3EARA 3B5JA 2H5EA 2NTYC 4JVMA 4OK6A 1FMJA 4LJAA 1CRPA 4MYCA 1GOTA 3GJ8A 4FWTA 4BQSA 3KJGA 1E3MA 4O0MA 4PR0A 4C4PA 3K09C 1S1MA 1CR1A 2Z4RA 1XD2A 2ZAOA 1YZKA 2CHGA 4JJZA 4M1YA 4Q47A 2WTUA 4HAXA 3IEUA 4ZKEA 1YRAA 1W36D 2HJVA 3IEVA 2D7CA 1KO4A 1CBUA 4L15A 3MAAC 4A8JB 2F43A 3CF0A 3VX4A 2HJGA 2ZVQX 2DBYA 3QNUA 5K8IA 2GF9A 1WRBA 4OHZA 1JXOA 1VTKA 3SJBA 5KSZA 3B85A 2R44A 3NBXX 3THXB 4Q4HA 3L0OA 1VCIA 1RRFA 2RGAA 2XXAA 3MWJA 4TL9A 4MUBA 4ZIRB 1P2VA 2HLDD 5HE8A 3WNBA 4A2PA 2QTVB 3WMEA 4PPNA 3QOFA 1KJWA 3QBVA 1GRNA 2VO1A 4NYJR 2PEZA 5J4HA 1W2HA 2DHRA 4Q7KA 2CLSA 1DG1G 4GP6A 4CYMA 1M1YE 2XOKD 3T1OA 1E1RD 3FE2A 1G3UA 4UNSA 1JR3A 2GK6A 2ZRPA 5DHFA 1W4CA 1LTQA 1E4VA 1W5SA 2CL6X 1SHZA 2CLDX 2F9MA 1D9ZA 2I1VB 1DO2A 4NE2A 5FL7A 2GEUA 3RRMA 2F3RA 3C15C 2C9CA 2ERYA 1VIAA 4GSYA 2BOVA 2ZITA 3CPJB 3W5IA 4DCTA 1M74A 4AKGA 2OESA 2OAQ1 1Z6YA 1EWRA 1JB1A 2W83A 3G5UA 3LWNA 4EJSB 1R10A 3LD9A 4B35A 1T9HA 4OK3A 3BOSA 4QNRA 1NMZA 5TY0A 3ZJYA 4B6FA 4DCNA 1VYUA 1CIPA 1KNXA 3B8HA 3QF7A 4LYHA 5H1YA 1N5IA 5TVKA 3SN6A 2GTPA 4HLQB 2ZRKA 3ECCA 3SQWA 2QU8A 2QENA 2PJRA 4JMPA 2CEAA 3CNNA 4B6EA 3C14C 3KQUA 4TLAA 3CUEF 1QG2A 3HJNA 1PUIA 5FL3A 5JECA 5JWOA 3MWKA 2GCOA 4U02A 4PFSA 4TWZA 1OFTA 3AVUA 4YQFA 4DHEA 3CRVA 4DSOA 2XZLA 2WPDA 4Q03A 4KYUA 3O8RA 2QORA 3UIEA 1U8ZA 1XJCA 3SYNA 1J7KA 1MOZA 4EFNA 2X2FA 5CJ2A 2B7CA 2BMDA 2RGCA 3QKRB 3T1TA 4QBGB 1GG2A 4FMBB 1ZUNB 1X8LA 2AXPA 2IYQA 2AXNA 4RKEA 4CEHB 5AUPB 1Q12A 3SFVA 2O8CB 4ZDKA 4HI0E 1Q3TA 2OT3B 4AKHA 4LPKA 2CVFA 4RD4A 4CRWB 3VHXA 4URYR 4M53A 4KSBA 2D74A 1KMHA 1Z6AA 4C0HA 3FKSA 1I2MA 3QKSB 4KFRA 1QHNA 4JLOA 4M1SA 2PT7A 4OK5A 3L8YA 4PO1A 1XTJA 5KDLA 3PVSA 4LGMA 5TMPA 4DDWA 1ZU4A 2XTZA 4RFSA 3CZPA 4NCJA 4DCVA 4HLUA 3H2YA 4C2TA 5GADl 2QMOA 5E7MA 2OXCA 3H1TA 5TDHA 4F4IA 1Z0DA 1I2DA 5CDFE 1GAJA 1E2LA 2IHYA 4D0NA 2JJ2D 3A8TA 4DLTA 1ZJ6A 3IIMA 3Q8XB 4NCIA 5H70A 2QN6A 3R8FA 5FPHA 1EGAA 3RNLA 1Z0JA 2AWOA 3THOA 1QVAA 1S9DA 5F9HA 1OSNA 3FFAA 3RRZA 4DLSA 4A1FA 1CF4A 2P6RA 4B43A 4C0LA 1ETUA 5H8WA 5JRJA 3EPHA 4D4LA 2GAOA 3E5HA 4Q5IA 5JCPA 2PJZA 2XB4A 2QPAA 2W6JD 4AYXA 3B2EA 1R8SA 1XEWY 3FDIA 5FPKA 5FPSA 3IBYA 4E22A 5CJPA 1HT2E 4YMSA 5TB5A 2BBSA 4N1AA 4EFLA 5EZ6B 5HCNA 1K5GA 3TAHA 4NZYA 5M04A 3QY0A 1CJTC 4XVRA 5DI3B 4HZIA 4D81A 3KUCA 4TLDA 5J4YA 3QXHA 1MABB 1VG0B 4ZDWA 4MYUA 1DEKA 4ON9A 4BLQA 3Q9LA 2QMHA 1UKVY 2ZJAA 5HPYB 2DY1A 2D2EA 2F1IA 4F4JA 2JLZA 4DEYA 5EP4A 4BLRA 3ASYA 3HP1A 4ZDIA 1COWD 5EUQB 3GLFB 5TARA 1AS2A 3LFUA 1L4UA 4P32A 3IDQA 5BYKA 4Q02A 3TK1A 4BUJA 1GKYA 2OO7A 1OT3A 2R6GA 1MH1A 2JIZA 3BORA 4DB2A 1AS3A 3A6PC 3WRXC 2QNRA 1Q57A 4E07A 4LBZA 2IK8A 5FFMA 1NY5A 2ERXA 1IOZA 1Q44A 1XCMA 2V9PA 2CMKA 4NP6A 4W7SA 4DJTA 3A4NA 3GP8A 1JR6A 1US8A 3U5ZB 1IY0A 1AKYA 1NKTA 3RRNA 1VCOA 5LD2B 3EXAA 4JLMA 3QPVA 1DBSA 2FX3A 2ZRBA 3BIFA 3RDPA 2C2HA 1JJ7A 3EIQA 1R5BA 4MH0R 4TMXA 2W0SA 2EYQA 3BWDD 3QSYA 3KB2A 1ODFA 2J87A 5C4MA 1IONA 1ZW6A 2VH5R 3ZVLA 2ODBA 3PEUA 4AY2A 3T34A 5SZJA 2XJ4A 4AYWA 3RANA 5EUMA 1JAIA 5AUOB 5L3QA 1EFHA 5SZKB 1R0ZA 1KI9A 2PCJA 1DOAA 4KHZA 4QOSA 4A2QA 1XJQA 1WMSA 2X77A 3NKVA 4B2LA 3AEZA 2OBLA 4LC1A 4RFSB 4HZUB 5KYKA 4TYYA 3TJZA 5A4JA 3H86A 1GRRA 1KKLA 1U98A 1UEJA 1R8QA 4QRHA 5C2JB 1DAGA 4R2HA 4UNNA 3LRPA 4PHHA 4ESHA 3HDTA 1HY3A 5EXXA 5CIQA 2RB4A 1J8MF 2HT6A 2TMKA 3OF5A 3UPUA 1SGWA 3FHTA 1B0UA 2P67A 1BS1A 3FTQA 3UK6A 1S9HA 1M2OB 1G64A 4BZQA 2IXEA 3FMIA 1KI2A 2ZROA 1Z0AA 1AZSC 1KI8A 4PHTA 1KJYA 1E9AA 1SKQA 5FOWA 3LW8A 4GBMA 3DDCA 4WZBE 1S1CA 1EK0A 2A5FA 2IYLD 2NOAA 5IDVA 4D4KA 1U90A 3H4MA 3RYTC 1G8FA 4GFDA 1K6MA 2OZEA 1SVLA 1Q1EA 1HE8B 4C7OB 4B75A 5JMTA 3GD7A 1NN3A 3AKCA 4RSGA 3WY9A 1E9RA 1T4GA 1QDEA 2YOGA 1EESA 4P4SA 2AHOA 1N0UA 2ZS9A 1YE8A 1S3GA 1NRJB 3BH0A 5AJVB 1G7SA 1GIAA 4O2LA 4AYTA 4M8NE 5DYIA 4HUTA 4MGIR 4Q9LA 1TF5A 1ZD1A 4IJMA 3TSZA 3A4LA 4MRRA 1KSFX 5G41A 2CK3A 1D2EA 2ZR0A 2OV2A 3AF4A 4TYQA 821PA 4G5QA 1LW7A 2JLRA 2JCSA 1FNMA 4POAA 2R62A 4KVGA 5FTKA 2ZRJA 4R98A 5HE9A 3C4JA 3BAFA 3FYHA 4JBYA 2NMVA 2G88A 2WPDD 4NONA 1Y63A 4B73A 3G82C 1F2UA 1Z07A 2QTFA 2VHTA 4BPBA 5DN6A 2WMNB 1DAFA 3KKPA 4RZXA 2ODEA 1X1SA 221PA 4QKQA 2PZEA 4PXAA 2O0HA 1A5TA 3TBKA 1HV8A 3NEYA 5B58C 4RKFA 5KDDA 4P4UA 4A36A 1OPXA 2YVUA 2Q9BA 3CX7A 5LBIA 4BWYA 2Q3HA 1XU4A 2EVWX 3T06B 4TSFD 2EFCB 421PA 2Z6VA 2C98A 1KO8A 4IEIA 5DE3A 2P65A 1T3LA 3B78A 2CCGA 1GL7A 3WYAA 1H8ED 2QGNA 4ASUA 4GMDA 3I3SR 4Q7MB 1XEXA 4LUCA 3SQXA 3M4YA 2ATXA 1IJEA 5LPNA 5L3SB 3CF6R 2C04A 3GLHE 3TIFA 1N0WA 3ND9A 3LBHA 1Y3AA 4PQFA 2G9NA 2GBLA 3GJ5A 1OKKD 5J47A 4D25A 4TTPA 1E2IA 4RJLA 2HF8A 2A3RA 2NPFA 3M6AA 4JVSB 2GZHA 3TUIC 3K9GA 4CT5A 3I5XA 2EWVA 2JJ1D 3THWA 2JLUA 1JI0A 1W1WA 2BCJQ 3ZQJA 3K0SA 2QGZA 2IX3A 3K9LA 2RGGA 1IN5A 2JAQA 1SXJA 1TEVA 2YOFA 3I4LA 4GZLA 4F91B 4AKEA 2N1BA 4DXAA 1FPMA 2O8BB 4PANA 2KBEA 1NN1A 2V1UA 4D82A 1R4AA 1JQLB 5HKKA 1E6CA 1OXXK 2GXSA 3HYTA 4Q4JB 1OIVA 4D4JA 4QBFA 3V00A 4KYIB 4IOJA 4DEXA 1SQ5A 2ONKA 5DSZA 2WVJA 3PUXA 3VR1A 5FOVA 2XZOA 1MRSA 4CF7A 3K9NA 1P73A 4HDCA 3RWOA 3SFZA 4AG5A 1GM5A 1O3YA 2AD5A 3T5DA 1XF9A 4L9WA 3RSOA 3B6EA 3GMTA 2ZPTX 2O8EA 1T3HA 4Q4LA 3ZD6A 2G6BA 3EIEA 2OCYC 1JPJA 2V8OA 3QXCA 4LY6A 4QHSA 3X1WA 1AN0A 1D6JA 4JIMA 3MFYA 3TQCA 4HDOB 4FINA 1RE0A 4XJXA 4MYTA 3TVDA 1W44A 3DMNA 1KIMA 1KSHA 4MUAA 4TQ9A 3U6BA 1II8B 1OKKA 1ZUIA 1CULC 1ZM7A 5FTMA 3NDBB 1GNPA 1LFDB 5JLJA 2ZAMA 1ZM4A 4BECA 1E2FA 1QRAA 1E2QA 2C03A 2P6UA 3DM5A 3I8XA 2OLKA 4C3ZA 2BM1A 4MITA 4U5XA 3VR4A 4A92A 2F6RA 1J2JA 2GCPA 1J8YF 2CJWA 1PLKA 2GVDC 4LZZA 5CIWA 4C9BA 2BBWA 1YR7A 3EX7C 1TTTA 3WYGA 2PX0A 2IUUA 3K0FB 1SXJE 4J0QA 1F2UB 2GETA 2FGKA 2DB3A 1GNRA 4HEJA 3I61A 2K5UA 2QT0A 4JBWA 3QKSA 2C9OA 2IL1A 5GVRA 4NYIQ 3QVVA 3QXJA 1U2RA 1GILA 1IXRC 1NG1A 2E9SA 1WBBA 2ZI9A 3I8SA 1XRJA 1FQJA 4US1R 2IXFA 4CT4B 4PPQA 3C7KA 3GEEA 3J81k 1NBMD 2CVHA 2IYYA 1KYIA 4A0FA 3O8DA 1G3RA 5E95A 5AJWA 3KUDA 1ZMXA 2P2LA 2B21A 1QHHB 1WA5A 2IHBA 2YC2C 4G01B 3REFA 2ZJYA 4G0NA 1NG9A 1QHXA 3GLIB 2ZSFA 3AKYA 3TLXA 3CX6A 1KSGA 3U2QA 1N6IA 1XFAA 1CS4C 1ZINA 3LDAA 3UMSA 4XOIA 4G5SA 4Z1MD 2P5TB 5C46F 3TSOA 2ZU0C 3CWZA 4OQXA 5D3MB 3SBEA 1P62B 5JBQA 1WCV1 4HAYA 2XSZD 1TU4A 2EFGA 4M1WA 3UWKA 3O8CA 2FA9A 2PLRA 1DO0A 4QGFA 3TE6A 1H65A 3KTAB 4RFVA 4ILEA 3LY5A 4YDHB 3QVUA 3U60B 2GAAA 3EAQA 2JLQA 2BBOA 5AWFC 2F7SA 3U7EB 4DKXA 3BB1A 4BZPA 4IDHA 4PPGA 4UNPA 3B13B 3T15A 3U6KA 2P6NA 1S0UA 4CZ2A 2WOJA 2BM0A 2ORWA 3LXRA 1EFUA 1P9WA 2QSZA 3QUSA 3C16C 4KBGA 2ZUDA 4BFXA 3WP1B 1VECA 3MMPA 4WZ6A 2UVQA 3T35A 1RYHA 1D2NA 1BOFA 2H8KA 2RGNC 4TLBA 4UXHA 2WJVA 4M9ZA 1M7GA 2ZRLA 4FMCF 4HATA 4V03A 1AQUA 1GNQA 3TAUA 3TMKA 1XTQA 1SKYE 1NN5A 3NDPA 3W90A 5E3HA 4TN1A 2JIZD 4MRSA 4Q1AA 2FH5B 2KWIA 1RC8A 5K8TA 2BEKA 4ZCIA 5FBLB 1DAEA 2ZTSA 3F0TA 1NVUQ 3UANA 1R0WA 4TQUS 1PLJA 2VPPA 3LX5A 1SVKA 2BWJA 2EU8A 3SNHA 4EDHA 5KTYA 3VKHA 3ZVRA 2GEDA 1OYYA 3KX2A 2AX4A 4BGDA 4YXWD 1VYVA 2RH5A 4B71A 2IXGA 3BFXA 3NHBA 3OEHD 1MO6A 4D2IA 2QSYA 4G1UC 1Z63A 1VCMA 2BCGY 4M9SA 4BLOA 2PZFA 2H7VA 2QL6A 1KO1A 1S4QA 1YJ5A 2V6JA 4A6XA 3TQFA 4LSGA 1Z08A 4AD8A 1N6NA 4E5UA 1FW6A 3AKDA 2SHKA 4ZCLA 1KO5A 1UBEA 2V6IA 2Y8EA 2O8FA 2GZDA 2P5SA 4BASA 1N0VC 4B3GA 4W5HA 4P4TA 2VP2A 2XEXA 3K09A 3VR3A 3HU2A 1HTWA 3AUXA 2X2EA 4B44A 3WRYC 4P4SB 1E4YA 2DYKA 4NBSA 1F6BA 1K5DA 3EZFA 1W47A 3AF0A 1ZYUA 2VP0A 2FJUA 3VR6A 2O52A 5B64A 1XMSA 2RAPA 1B23P 2RKOA 4EJSA 4BE7B 1LF5A 2IBMA 4GDFA 1QBKC 4U7DA 3K70B 1HQCA 2RGNA 4FMDF 3TNFA 1PV4A 2E1RA 4HAZA 1OF1A 5FR2A 2REOA 3AH8A 1U94A 1Z83A 2GJ8A 1KI1A 4DDVA 3QF4A 4XIGS 2ONJA 3TR5A 3BXZA 1ZM3A 3HU1A 4NYIR 5J40A 3JVVA 3D31A 4UQOA 2VQSA 5KUTA 1N3BA 3PENA 1GTVA 5CITA 3UWOA 1H8EA 3EZ7A 1KI6A 4D26A 3RC8A 4GMXA 3RC3A 4IHQA 3DZ8A 4ZPXA 3D6TB 3IGFA 3L2OB 3PEVA 6Q21A 1U9IC 2CHQA 1UFQA 3QEOA 3SR0A 2JATA 2KSQA 1A7JA 2ZSDA 3W5JA 4JLPA 4BRWA 5KDOA 3QI2A 2BKUA 4LJ6A 5FOXA 2FFQA 1E9FA 5AUNB 4Q4HB 1KK2A 2CCKA 2XITA 1EFRA 5KSOA 3BH6A 2GXUA 1RZ3A 1VYTA 1ZP6A 2D4HA 3A58B 3JZMA 4LJ7A 4Q00A 1U0LA 2VP5A 3D7MA 3DM9B 5EZ5A 1X8KA 2F43B 1RW4A 4GI7A 4QJ5A 4WZAE 3KKOA 1NP6A 1G19A 1ZU5A 2DWOA 4JS0A 3B1YA 4V0NA 3VNVA 1IN8A 1SULA 3BRWD 4DC9A 1J70A 1BYIA 4PO9A 5ELXA 1AGRA 2J1LA 2IEYA 2PLFA 2FE4A 2VHJA 5DIFA 2ZJ8A 2JJ1A 2QAGC 1R0XA 2KE5A 4HAUA 2IF0A 1MABA 1KI7A 2DFTA 2LKCA 4JL5A 4GOJA 2BMJA 5L3RA 5L3QB 1GDDA 4RY2A 1HEIA 2R8RA 3N2EA 2ZM5A 4I1OA 2O8DB 4ITRC 2QBYB 4Q9IA 2ZRHA 1IQPA 3MSXA 2R6CA 4TMZA 4ACAA 2V4ZA 1KMQA 1II8A 4M1TA 1GL9B 1UADA 1Z29A 2JA1A 4FMDB 1Q1BA 4DUGD 2P0EA 2G77B 4A0GA 3NH6A 4QM6A 4LBVA 5FL7D 1E9EA 3A37A 3L82B 5JI3E 5JZVA 3EZ2A 4OI1A 3IIKA 1UM8A 1Z0KA 3K8YA 4TMKA 4EPRA 3A1SA 4WOPA 3B60A 1DG3A 3B7GA 1G8HA 1XD8A 3BB4A 3PUVA 4V0KA 1RYFA 2QUZA 1R7RA 1Z2AA 3LBNA 5FH9A 5L3SA 2MSEB 5IT5A 3AVWA 1OFUX 2IF2A 1OFIA 2WZQA 1BO6A 4IOMA 4KU4A 1NVVQ 4QFMA 2FFHA 4LHYA 5D3QA 1N25A 2CHVA 1YKSA 2JJ2A 3EPLA 1E9BA 3QJYA 2CL0X 2OBNA 3ZH9B 2FDCA 4B47A 4Q4AB 3DKVA 1Z0IA 2MMGA 2ORIA 4LYJA 4NCHA 3ZVMA 2QP4A 1MT0A 4DBLC 4JLBA 3GLGA 2WSSA 2ZRGA 3RS0A 4XSGA 3AGQA 2Q3FA 2DWQA 3GJ7A 2F1RA 3QKUA 1KI4A 2IYSA 2VL7A 4X8MA 3U7GA 3KQKA 1T0HB 2GK7A 4B3BA 2CK3D 1GITA 4RD6A 4I1VA 5FPYA 1II9A 4MQBA 5DI3A 2GJKA 2YJTD 3LVRE 5JWRA 2F1JA 3VTKA 3LX8A 1U99A 3O8BA 4I99A 1US8B 3RVBA 2IUTA 2FG5A 3BK7A 5EE5B 2V7QA 1W7AA 2YNMA 1N6PA 4X8LA 4B3CA 2V3CC 1U9IA 1AK2A 1E1RA 1OXSC 4QC2A 5DI9A 3EZ6A 2B6HA 5EJEA 2IC5A 3FOZA 3ADCA 4UJ5A 4JT4A 4Q18A 2WM9B 3HU3A 3SHFA 2BV3A 1TF2A 4Z8XA 1XZPA 1UBGA 1TL7C 3NG1A 3OE7A 4FCTA 1MR3F 4HB2A 1CU1A 2ZR9A 3HR7A 2O0KA 1FTSA 2ZI6A 1PJRA 5CLLA 1SVMA 3T61A 2QE7D 1NLFA 3LQRA 4NTZA 4QJ4A 5JS7A 2WWYA 3ICQB 3C8UA 1TEXA 4HAWA 3DZDA 4K46A 5JWHA 1E2DA 2WKRA 5JJIA 2CCJA 3IILA 4ACBA 1D2MA 2QPOA 2QRNA 4MRPA 3ZIAD 1EXMA 4A0HA 3SZRA 1XTSA 1H8HA 1G17A 1EX7A 2BDTA 3HWSA 1EFRD 1WXQA 4I1UA 2NGRA 4LPSA 3FVQA 4BFSA 3LO5A 1W36C 2D62A 1CKEA 2GJ9A 1ZUHA 1E1QD 3FPAA 1SVWA 1UKYA 5FTJA 3QPUA 2JDID 4JZKA 4IEEA 4TT3D 2ZYUX 1HUQA 1UPTA 2CNWD 2QAJA 4BFZA 4II7A 1E96A 1ZNXA 1Q22A 2ZETA 2ZRDA 2O8DA 5FOUA 2CNWA 4EUNA 5AJZA 5FR1A 3MCAA 3TR0A 1E2HA 4MDFA 2HXYA 3QE0A 1F2TB 1E79A 2H57A 5AJYA 2ZANA 5LB4A 2GCNA 1E2EA 2BJWA 2F3TA 2QT1A 1CJVC 2LKDA 4IDPA 4CEJA 1EG7A 1LS6A 2ODNA 3OAAA 2IYTA 2R6DA 3QKTA 4IKEA 2D3WA 1U81A 4P3YA 1DS6A 2HDNB 3U44B 3CRRA 2QM8A 721PA 1P2UA 4RZ2A 1OXUA 1VIYA 1M7HA 2J7KA 3CF2A 4IXNA 3P32A 4ZIRA 5GJBA 4HB0A 1ZM2A 3MUFA 5SZIA 5FUWA 1U8YA 5KNBA 4P33A 5EE9A 4DLXA 2IYRA 1WF3A 2Q6TA 5JJLA 1V43A 4OBEA 3TUZC 3KQHA 1NBMA 3BD9A 3NIBA 4GOKA 4EQ6B 2ZYTX 4RCYA 2N46A 3M1IA 2ZE7A 3BGWA 1FL9A 1KK3A 3EG5A 5DNYB 4R7ZA 3THYA 1GZSA 3IKJA 3C41J 5AUQA 4B2IA 3X1ZA 2RHDA 2D06A 3K70C 1N5JA 1OW3B 4KFSA 3DOFA 2I4IA 2DWPA 4G5OA 3GFPA 2VP4A 1JEEA 2ZYVX 4WVFA 4ARZB 4Q1FA 3SU8A 5B30A 1XWIA 1OB5A 1IXZA 1QF9A 4O3MA 5JSZB 5BN3A 2ATVA 4MGKR 2EYUA 3AGPA 1XEFA 2IA5A 3PQCA 1U0HC 3P20A 3QG5A 4QGGA 5E7JA 2O5VA 4NKRA 3KL4A 4YMWA 2IWHA 3SHWA 2OILA 1UJ2A 2J45A 3ETLA 1DAMA 1E2JA 1ZIPA 1XNJA 4C30A 2C8VA 4GZMA 1DVRA 1G3QA 3I32A 3PV0A 4FCVA 3W8NA 3LBIA 3CR7A 3REGA 3BB3A 3WHLA 4C0SA 3VAAA 1LB1B 1OHHD 4QBIA 2YHSA 2ZJ5A 4FIDA 2DFLA 1KI3A 4TYNA 5DHAA 5FUYA 4XVUA 1YVDA 4JLVA 4ARZA 1GSIA 2JLVA 2V1XA 3KKQA 3ZDQA 4F4CA 2ZQ5A 3UMFA 3AV0B 1G20E 2XAUA 5LB2A 2GWHA 3FKSD 3B9PA 2FGJA 1BMFD 1VG8A 3VU9A 1IM2A 4KV9A 1XD2B 2OE2A 3RWMB 3KDSE 4AURA 2BIFA 4URVR 1NBME 3DMDA 4WW0A 1JQJC 1WP9A 5BW8A 1DADA 1SXJB 2GILA 4D4MA 4ZKDA 1IJFA 1OXVA 3PR1A 1E9CA 1ZNZA 1EFCA 2DFNA 2WAXA 2ANCA 1KK1A 1KZGB 3KXLA 5EXTA 5BYJA 3EA5A 4BZXA 2AN9A 1G1MA 3VU9B 2ZRCA 3GFOA 2WJJA 3CO5A 4FMCB 1CR2A 2WJHA 4AKIA 4B76A 3F5FA 5DYGA 4DDUA 3GJXC 3GLGE 3ONWA 3TVTA 3THXA 3KJHA 1UF9A 2GVZC 5E4FA 3CRW1 4HLUC 4MKIA 4TYWA 5DLQC 4RD0A 3BFKA 3WHKA 3LA6A 1DAIA 2HLDA 1X3SA 2AFIE 2OHFA 4TYPA 3UMRA 2FPLA 2VF7A 1E2PA 4DB4A 1YU9A 4DDTA 3AVTA 2IS6A 1FOEB 2CL7X 1W0JD 1T8TA 2V54A 3BBPA 2OBMA 1DPFA 2BJVA 4HB3A 3UKDA 3WYFA 3OAAD 4BEBA 2NO9A 2QPTA 4C0BA 3PITA 2A5DA 2CE2X 4PHGA 3FFBA 2D7DA 4JLAA 1J90A 4JVNA 3OEED 3GEIA 3KZ1E 1OJLA 3CIOA 2DPXA 3RS4A 1KOFA 3GJ6A 4IDNA 1E0JA 2IS4A 2ZI5A 4GPTA 2WHXA 4IDQA 3GJ3A 1G8GA 2QE7A 4IFBA 3IUYA 4A2WA 4B3FX 5F98A 2WICA 2RGXA 5CYPA 3FHOA 2FSIA 2AK2A 4XWAA 4YDSA 4TMWA 2G3YA 4MYHA 1OH7A 5HCIA 3GLGB 3WMGA 5B57C 2DCUA 1JJVA 3IQWA 1OH8A 1CRQA 1G18A 1GKUB 4D0GA 2ZSBA 3T5GA 5JFGA 2XB2A 3EC2A 4CIDA 2RHMA 2VLIA 1JR3D 2WWFA 4I81A 5G53C 3OFND 3PXGA 1L2TA 1Z2CA 5EXSA 4FD2A 4XH9B 3SC3A 2PMDA 1W0KA 4FWIB 3CNOA 3VR2A 1A4RA 3CPHA 5KNCA 4DRZA 1PZNA 1R6BX 1UBFA 3QG1A 3WXMA 2XSZA 3TW4A 4HAVA 1QHHA 3GLFA 3BFVA 3LQQA 3SEAA 3UATA 3AUYA 1U0JA 1IN6A 2ECKA 1XBTA 2QAGA 3PG5A 3RS2A 3U3RA 4FCWA 2BVNA 4TLEA 1KO7A 2ZRIA 3MLEA 2OAP1 2Q0HA 2ZIAA 1E99A 3QENA 5IK2D 3GLHB 1TQ2A 2W2XA 4V0ME 2H1LA 1UBCA 2N42A 2R2AA 4XTRA 2LWIA 1OFHA 2HYDA 4K81B 4TQAA 2NO0A 1BKDR 1GWNA 1NMXA 4ZCMA 3TKLA 2ZREA 1FNNA 3ADKA 4MKGA 3W34A 4DUGA 2ZRAA 1CLUA 1XTKA 2J0SA 1P9NA 1E98A 3LLUA 2KI5A 3UG6A 4Q21A 621PA 3MWYW 2R9VA 1AZTA 2VSXA 1RVDA 4RVCA 1DELA 3IQXA 2V7QD 1S8FA 1ONBA 4M1MA 4QJ3A 2YWGA 4ZV4A 5FTLA 3R7WA 3VHLB 2VSFA 3A1TA 4L16A 2GDJA 4W5JA 1X1RA 4YMUA 3TUJC 2ZS7A 1RRPA 4O25A 2OXRA 2GXQA 3LAWA 1ZD8A 4UNRA 2W6IA 2ASEA 3A36A 1MV5A 4HZUA 3NWJA 3CH5A 2G83A 1SZPA 4IVQA 4WIAA 3WBJA 4JL8A 4KJZA 4OHVA 1T6NA 1W36B 4Z1MA 3K0AA 1DTSA 3MD0A 2WJGA 2J7PD 1CJKC 1UKZA 2WKQA 3KJIA 4N3NA 3CNLA 3QXXA 4PZYA 1NJFA 2WOOA 1NVXQ 3NC1C 2GHIA 5GJCA 4EJSC 1VHLA 4HUQA 2FN4A 4X8OA 4AK9A 3OIWA 2WMOB 2JGNA 4Z51A 4MRVA 3AVYA 1XMVA 4BFVA 3NH9A 1N5LA 1W48A 3EC1A 3K0CC 3NBYC 3BERA 5JCZA 1G3MA 3BE4A 5HTKA 3N2IA 2JDIA 4LJ9A 1S3SA 4W5WA 1M34E 4K8OA 3RRYA 5G3YA 4NYJQ 1QHIA 3LH5A 2J5XA 3DO6A 2W6JA 2R65A 1F60A 3EWAA 3HPQA 3RABA 3RS5A 3H84A 4JLDA 2J59A 3AVOA 1I4LD 1FTNA 4KFUA 4IDOA 4LWZA 3S1AB 2GXAA 3LVQE 5FOTA 3CONA 1TF7A 4OI2A 4PX9A 3KB1A 4Q9JA 4Q4JA 1G3IA 1YRBA 1IN4A 2W00A 4A6PA 3C5HA 3R7WB 3WBKA 1OIWA 2EFHB 3UXMA 1KDRA 4HB4A 5HZHA 1QHSA 4MKHA 3VKGA 1E2NA 3OIYA 4TLCA 1FUKA 5ANRB 3P27A 2ZYWX 3P4YA
chains in the Genus database with same CATH superfamily
2O50A 2J46A 2O1SA 3NBFA 2IH2A 4EHLA 1FFAA 3LWDA 2VHUA 3JQEA 1KYXA 1L5RA 1FYDA 2R7NA 4HEA6 1OXMA 2MSNA 1WDMA 3SBDA 1W9HA 1ZBDA 3ITKA 4XWGA 3P71T 2H17A 2ZT6A 4DV2B 2PL3A 3G0HA 2I54A 2YDYA 1R5NA 1MIHA 1Q1ZA 2OLJA 3MT0A 5JSFA 3V3KA 1JQ5A 1UDXA 2WFZA 2B4AA 4CHTA 3FRIA 3ROFA 5JAIA 5CFRA 4MMZB 4ZJPA 3PQ3A 4FFLA 4V0OA 2QMUA 3UB4A 5DX0A 3ZWOA 2ZUBA 1KAGA 1VE7A 4LOKA 4O4LF 2OOKA 1DV2A 1I4WA 3F49S 3O73A 4Y6GB 5ALLA 4RTSA 3L4SO 4ZT5A 4B6OA 3AR2A 4F2WA 3OE5A 1FFHA 1H66A 1SCAA 1TU3A 4I08A 1P5ZB 1WSBA 3O7MA 3GVPA 4O2RA 2ZIUB 1YHZA 2XOXA 2W58A 2IBSA 4UM5A 1K4KA 4U6NA 4KHPB 4U7GA 2NVUA 2XTNA 3RFCA 1FFXA 2B1JA 1GA1A 3WRYC 1TOAA 5A3QA 3MXOA 3QEJA 4JU9A 4PQYA 2YFYA 4CMBA 3NOQA 2ZIXA 4C7KA 4EA6A 1DIHA 4ZOQI 4US2R 4UNQA 4OQMA 1NSYA 4JC4A 3CY6A 1RXEA 1J09A 4R9UC 1YVUA 1KK0A 3I62A 5HK9A 1BEEA 1RI3A 3DULA 1Z5PA 1DG9A 2ZT8A 1P4JA 3EFBA 3IVRA 5JS6A 2OBFA 4HAOA 5GVSA 2VPZA 1X7YB 3S8EA 1VJ1A 2OOSA 4JASB 3GRVA 4MTCA 4HLCA 4OHFA 3DLAA 3EPJA 4GI1A 4LIPD 3ZLVA 3C87A 3WGMA 4JP5A 1MF7A 3L6CA 1F3OA 3C7DB 4YJFA 2HEGA 3RB8A 2JIBA 4IZ6A 1MC8A 3KAKA 2OGUA 3DZGA 1NM5A 2O8NA 4DJJA 5C1BA 2Z4TA 5FA8A 5LIPA 1GCOA 2CNBA 2E18A 4KVZA 3VKWA 5BMVA 3E9EA 1KZ7B 1LQUA 4LXIA 3RUAA 3ED1A 4CMGA 4ZVQA 1LWNA 2GWRA 3LKBA 4NG4A 3CLRC 4E4YA 2CHFA 3GA5A 1CVLA 1CZKA 2GN8A 2RGDA 3OTGA 4F6RB 1SK9A 3K72B 4D8TA 2Z57A 4M88A 4RIFA 4Y0AA 1X1AA 3WLJA 4KE7A 1QDUA 3NVMB 3WZMA 3H42B 3L7CA 2QX8A 4DKJA 1R0KA 3DF7A 4BMPB 3S2UA 1TEHA 1ISIA 4Q16A 2JLSA 4XB2A 1AKRA 1SKUA 5TSDA 4YLGA 1L4LA 5A04A 2QP3A 3UIEA 4X94A 1KNQA 1SBIA 1NJ5A 2D2FA 3UPDA 3UA3A 4PYLA 3K5PA 1QGED 4KIFA 2J0UA 2NU6B 1CXZA 4OXXA 4UJ3A 2QVXX 2OZKA 4QELA 4MEBA 1M2NA 1XKXA 4XGRA 1N6KA 3P2KA 4CEIB 1J20A 1TO2E 3SE0A 3ZWMA 5IT9A 1I5RA 2VAMA 1WCIA 1LVGA 4IEFB 4UKDA 3TNYA 3KPVA 4R0MA 4RADA 1H4VB 1XHFA 1Y1TA 1WOMA 1YOBA 4NBUA 5CLGA 3A2NA 3PJEA 5K5EA 1UIMA 3EZ9A 3G2LA 5TXGA 3KYIB 2WJIA 2X3FA 1YZFA 3V55A 1AKNA 2D5CA 2QGFA 3GVCA 3TZCA 5E3JA 3OIGA 4EX7A 1UBNA 1QCZA 4G1MB 1JQAA 3F6EX 3ZXIA 1VRWA 2J0VA 4MICA 3N58A 3ITNA 1GG8A 2AFHE 2V55B 3A6LA 1HXHA 4E13A 3SY8A 2AC2A 4NEQA 4IFEA 4IZOA 1ZXXA 4DCUA 1XZEA 1L5MA 5TVGA 3SJCA 2HBYA 3G89A 2B5VA 2Q3DA 4XTCS 4EUHA 1Z25A 4DSTA 2JI4A 2JEOA 1KGSA 2NU7A 1VKJA 4ID3A 1KTVA 1UWVA 4ZVUA 1H4SA 4YMTA 3KL2A 4Z5XA 1JMYA 1B6RA 5IYZA 1U9JA 1YDHA 1ZVQA 4TTIA 4LC9A 1IRIA 4HCJA 4QVIA 2NPOA 3O31A 2A9KA 2A57A 1KFBB 1NHGA 1Z75A 3UXYA 3SS8A 4E6EA 5E6UB 2JLXA 1KL7A 3Q3IA 4EF6A 4F5ZA 2JS7A 1RXUA 3MILA 4X66B 4FN5A 4OQEA 2J3HA 5KHAA 3H7IA 4I6JA 3SPXA 4S04A 2G36A 1U2GC 1M2JA 5DM60 1E7YA 1XA0A 1N2ZA 1ZAYA 2ZU6A 3Q41A 4FNMA 4URZR 5B36A 3I5AA 2OSBA 3MTIA 5A71A 2LE0A 1E94E 1Q17A 3FJ1A 4BEJA 1QYDA 1UKAA 2CHEA 2FZ4A 3QYAA 1F2VA 1T6XA 1IBRA 3RUHA 1E77A 3E35A 5EGSA 3K0AB 1Z5VA 5KMGB 1WUYA 4Q1DA 2BYTA 5GM1A 4RTKA 2NSYA 4F6CA 3W6NA 1P9LA 2QLFA 3GK3A 4Q66C 1WDTA 3K4HA 4H6VA 3O2QB 5CA1F 2P0AA 2IP2A 1UFRA 2AC7A 4EIWA 3V9PA 3X1MA 2YFHA 2JEZA 3BCRA 3KFXA 1JAHA 4KBFA 4AUKA 2EJTA 3GFRA 4ZWNA 5JQWA 1C9KA 4Q93A 1N1MA 3GGJA 1KDTA 2OFOA 3OZXA 2CHUA 2PEYA 3L0DA 3WGTA 1C3JA 2VBGA 3R0JA 2VPTA 3ZOKA 4OSEA 1NXVA 1YDMA 4EKNB 5JAPA 1DX4A 1EK1A 2E4WA 4WOKA 2DQSA 4UPVA 5HTOA 2XNDA 2VKTA 4G3XA 4I4TA 3HHEA 3HV0A 2HF9A 3WOVA 1NQTA 2OGWA 3ORRA 3WO0A 1YVEI 4GT1A 2YV5A 3RKRA 1DQZA 2WU3A 4QO7A 4BJ3A 2YYZA 3KR0A 2OM6A 1I33A 1UMDB 2VEOA 1E1NA 3ZD7A 5AJXA 4WI1A 4NOJA 1U7PA 2DBVO 4NMHA 1P74A 3E8SA 4TTJA 1TC1A 1NC3A 2V5AA 4MV8A 5UKDA 3VR5D 3ZVKA 4OA8A 4XDHA 4AJ2A 4I4TB 1M54A 1JVNA 1MRNA 2PRIA 5H83A 1X70A 1QKJA 3BSFA 3CG4A 4YGYA 3STTA 4UXIA 1ZCJA 1VDMA 3AI1A 2QIOA 1K0FA 2Y1FA 3I83A 3ZNNA 1XP8A 1IAQA 3HL0A 3SDSA 2DERA 2P69A 2VH1A 4JMLA 1XKTA 1OZGA 1ZX1A 3AUTA 3OESA 4KO8A 4M9UA 4EWLA 4Z4IA 2XZDA 4Q3KA 4UZFA 1ABBA 2Q21A 4IQGA 2I9KA 4L8GA 2YS7A 3TW0A 3WRWA 3NAMA 5KSWB 2FDRA 4KRGA 4ZJUA 5BMVF 4JYAB 3PRHA 4R2JA 1LPSA 4Q1VA 1TO6A 2B1QA 1EQAA 3K94A 1DE0A 4M0LA 4KN6A 2ODTX 1FMCA 3OOEA 2R66A 3EW9A 3G2IA 4HNAA 1OB2A 4CDRA 1QYWA 4M1OA 4QOGA 4RK5A 2ZTHA 3IVAA 3WS7A 1BN6A 1XB2A 1GP2A 1JW9B 1NXSA 2X1MA 3UJCA 3D3NA 3PC8A 1X38A 3U5TA 3TTUA 1RYDA 2ZXFA 1OZ0A 2XCIA 5KSPA 1M5TA 1L4KA 3UGJA 3PVZA 5MGBA 1BHSA 1ZUD1 4X45A 5BURA 1L5YA 2HREA 1I1NA 1L4EA 2QVLA 3G0CA 3SM3A 5KO2A 2CSXA 2AD1A 1QCDA 4D43A 1MIOA 3P0IA 4ETMA 3SVZA 1T2NA 5BMOA 1EP2B 3KKKA 1NE7A 4LCBA 4AJEA 3TZEA 1BWSA 4IUYA 4F92B 5JO0A 5HP4A 3IXLA 4JYBA 4GIBA 1X6VA 4XASA 4XEUA 2Z6QA 3G8AA 3QX7A 4Z4GA 2J0QA 3VI3B 4QGHA 3T7CA 5KMGA 3N0WA 2J85A 3MWDB 5K8CA 3OWHA 2GM5A 3JYHA 3LZDA 3U4QA 4MVJA 3TKAA 4DWOA 4LZPA 2J7PA 2A94A 1D1PA 2OCDA 2C96A 2O9JA 2OQVA 5A0VA 1OU0A 1KSJA 1VLJA 2V9CA 3T1QA 2QXUA 3NDIA 3LHDA 4PLVA 5F2EA 2LIVA 2ZUCA 4QECA 3VVMA 3T9DA 1V6SA 4YAOA 4BVJA 2YY5A 3HCDA 3OCCA 4LF5B 4N54A 1L7VC 3AT1A 2QW8A 5H3HA 4GRDA 1SRRA 3EDYA 5FF9A 3W1WA 4KVAA 4R0NA 4BIIA 3M1AA 2IS1A 3DQQA 3ZU2A 1P7VA 1A8IA 2FSUA 3QLTA 1R4NA 3N53A 3ZV5A 4D3YA 1Q1GA 1V1JA 1JDTA 2A9RA 5C5IA 5D2CA 2Q4EA 4LHVA 4A6EA 1LPOA 4YEDA 1XV5A 4FXPA 2NQ8A 3IHWA 2DFKB 2Z08A 3NCHA 1O6FA 4G2TA 1K7SN 4RLFA 2B2CA 1PDWA 2CVZA 2QRKA 4R8RA 2ZZKA 1W25A 4JBXA 2P7IA 3HCEA 4YO7A 5JSZA 1D7AA 1AJEA 3OLYA 1UUFA 2C3YA 3IODA 3FNRA 1PE0A 3OC6A 1K0UA 4ARVA 2VJYA 4KNYA 1RDFA 1KDPA 3IEKA 1QKKA 3OPMA 3E9ZA 1ORDA 3VSAA 1J0AA 3ZE1B 3COVA 4Q7JB 3EW7A 4KO4S 4F8EA 3EWSA 3GG9A 1U3CA 3R7LA 3DFMA 3S4YA 4KLZA 2GUGA 4FBGA 4EP1A 3SHOA 4UPDA 2RARA 1A95A 4JZYA 4AJ9A 2J08A 1EG2A 3IKLA 2NG1A 3MOIA 4YXWA 4BLTA 1G21E 4G6ZA 2EFDB 1LF0A 1G9TA 2JAOA 2O23A 3QVSA 4GOOD 4O08A 5ENDA 4E31A 1FPQA 2VP3A 5BV8A 1RWXA 4MXDA 5FI1B 2I55A 1Z9BA 3U9LA 3S1SA 4QVGA 1KQ3A 3GFTA 4QDJA 1XDZA 5HDQA 5SYAA 2O8CA 3KQLA 2EGGA 3OFNA 5HKAA 5LFAA 1Y6GA 1N2JA 1RWMA 1UMKA 2QV0A 1EWKA 2ODAA 1DJQA 3F78A 2CLLB 3OBBA 3AF2A 5DGIA 1AKMA 1SUIA 4CGYA 4WN3A 4Y0VA 1VJDA 1BOOA 3M49A 5TRTA 3UT5B 3QLJA 5HBGA 3ZY4A 4E1VA 1L5VA 1Q15A 4CWAA 5SZHB 3LCCA 3SOPA 5EMNA 4NU0A 1LCIA 3Q72A 3QUBA 2C7BA 5CW1A 3FTDA 4MULA 2BFFB 3OG9A 3T3HA 1P3JA 2FQYA 1U2ZA 2G28A 2V4UA 3WQQA 1Z56C 1MAVA 2YJNA 1ZCAA 3F4KA 2QROA 1TZ2A 1TYEB 2QR2A 3DVLA 2B2NA 3RQIA 5F2KA 1TZMA 5LP6A 1M72A 1NNLA 1QR6A 1X9GA 4LVNA 4WTOA 3EMDA 5FTNA 3MW8A 2NVOA 5BP7A 3DCNA 4XQGA 5DCUA 2ZWAA 2ODWA 4UEJA 5DTQA 3N8IA 2Q3MA 1YFZA 2AFRA 1N3LA 3C97A 4FK8A 2XOKA 4BRUA 2DJIA 3QOWA 1BN7A 1TVKA 3SYRA 4G0PA 2ZSEA 4MRMA 4FI3C 1BWPA 3V1MA 4FYHA 2C78A 1VHJA 3TTTA 1X1DA 3LLVA 4PAOA 2G4LA 4IOLA 3PUYA 3RVDA 2GEVA 3E53A 3DDSA 1HF3A 3OA0A 5B1HA 5LP6B 3W05A 1Q7BA 1Z5NA 4DQ0A 4TMVA 1NVKA 4EF4A 3L77A 2CBZA 3PEYA 3IUQA 2Z9DA 1NVWQ 1PP4A 1RTTA 1Z0FA 2O6LA 5F73A 3GUYA 5JW6A 2Z04A 3AX6A 3SBOA 4HV4A 1I1HA 1XTRA 3OM8A 5ERGB 2BKEA 2F1OA 4PFJA 4EMUA 2L0XA 3W5CA 2IV3A 4QNMA 1SKBA 5DGXA 4JOBA 1E2UA 3MCVA 2BGLA 4HDNB 5I9NA 2XWSA 2GM9A 3G6WA 3JW8A 3D6VA 1P7CA 2LIPA 3SKVA 4R3WA 3KTDA 5BSHA 1RXWA 1NSFA 1G7RA 1FP6A 2FPPA 4IXMA 3SZLA 5HMMA 5IAKA 4LOAA 1E60A 3EZNA 2H1IA 5IBQA 3A70A 3VDQA 3VMFA 3OA2A 5EP3A 4O4JA 1XCGB 5REQB 4QU0A 4PZZA 4FJ1A 4FW9A 4EBFA 1OXKB 2B7BA 4LYYA 2CUKA 2WWVD 4CKXA 1LBQA 3NONA 3ZS9A 4ESOA 1N32B 4P31A 2VRWA 4XVQA 1E64A 3PZBA 3ZU5A 1T5IA 2I33A 1WXGA 2GAJA 5EP2A 4L22A 3N6VA 1VDZA 1PO7A 1FJGB 3RKSA 4IMJB 3UT0A 4ALIA 2ZDGA 3GRUA 4TTTS 3ODPA 4N76A 3BS4A 3T7EA 3VTFA 2FR8C 2ZSAA 4BQOA 5D7BA 5CFZA 5I7WA 4L75A 1HORA 5JCOA 5D3MA 3U3OA 3GPDG 3AEYA 1HFEL 3AFOA 2XUKA 3K9QO 1J24A 3QFCA 4IRUB 4YC7A 1GQRA 1TK9A 1CFZA 1TNDA 1ZD9A 4K87A 5MFZA 1W0JA 2VT6A 4MS4B 1K06A 2ATEA 2I0FA 4PLWA 3GHYA 3HY3A 5FPPA 4DSNA 3QXSA 2Y4NA 1O08A 1YE3A 4NYMQ 4Z7QB 5C18A 1H3EA 2JLWA 3MVEA 4KXFB 4PVCA 5EMMA 3ZI4A 3KJXA 3X1DA 2OCIA 5IFKA 4ENVA 2QD4A 2DVMA 1E79D 1V3QE 5L8VA 1T8WA 4J4BA 3PUZA 3R3HA 1ZL0A 2KBFA 1CQIB 1YONA 4MUIA 4RA6A 1NT4A 4XIJA 1Z17A 5JCJD 1F0PA 5HZKA 4IW3B 2QG6A 4Q4AA 1M66A 2WVHA 2IPAB 2IOHA 3V1LA 4DNFA 5JH7B 1RVV1 3AI7A 2DFDA 3F5MA 3QLEA 3HA2A 4H31A 1NR1A 1ZIOA 2AUMA 2ZAYA 2IXBA 3L8ZA 2ZSJA 3F4LA 1OH6A 1R12A 4CL2A 1UBLS 1ZG3A 4AM8A 1AB6A 4WK4B 1LK0A 2C9BA 3ADDA 3OEHA 1QTRA 1JVBA 2ZRNA 3GCGA 1XMIA 2C2WA 4HO1X 1SUPA 3HVHA 3IH5A 5MN4A 4QM7A 4HVAA 3W9YA 2E0IA 3QVXA 1DMSA 1B8NA 4UEWA 1HG0A 1SPBS 4N9QA 3GLIA 1ISJA 3Q7QA 4O8ZA 1CYEA 2I6FA 3DBIA 4OAQA 3MWDA 3L8HA 4ML3A 4WACA 1NF3A 2GYYA 3IAAA 1P91A 2AZXA 4YBRA 4MDHA 1TA0A 1IY2A 3C3XA 3L7OA 1EBUA 2H92A 2OM2A 1XRMA 2Y0DA 3T9FA 2DTEA 4OLAA 3MWEB 3SX4A 5BVHB 4B48A 4KQFA 3BVPA 1SRQA 1ADFA 2XZPA 4U9HS 3VAYA 6ADHA 2WP0A 1FVOA 2P40A 2GBGA 3EULA 1E3WB 2XNSA 3LPCA 3OPXA 4M21A 1DC3A 4NCKA 4TXJA 1Z73A 4V39A 5J2TF 1Z4QA 2JLYA 5HM8A 1NKSA 2C9YA 3GRKA 3X1YA 3FXAA 1FSGA 4NAHA 1L7NA 2GFQA 1JAYA 1NUPA 2FRXA 1G5TA 1R4NB 2C0CA 5B2FA 2IZ5A 5ILQA 5K3OA 4YXFA 4L7VA 5BW4A 1ULZA 3VV2A 3MWEA 3S2YA 1JBKA 1AGXA 1P17A 4AC9A 3GNSA 3ZXXA 3FVWA 5EJ7A 4MLDA 4PSKA 4CW7A 3B1JA 5EVJA 5AVTA 1IQUA 2VYCA 5HKOA 3ZIDA 2QN7A 3QOYA 2XXJA 2WU1A 1HE2A 3LT1A 5IVKA 1UPXA 2EDAA 3ZZTA 1MB9A 5BWOA 3IUEA 2C57A 2GO7A 3M0EA 4LI0A 4RTQA 2HU7A 2ZUFA 3BJEA 3P9PA 4GKAA 1P7ZA 4PO3X 2Y1LA 2PA0A 4B3XA 2YC4C 3WLKX 3C8ZA 1MO4A 4RV9A 3T3GA 3ZWYA 1UOOA 1TT5B 1DCMA 3HFSA 1Z2NX 3KKZA 4JSTA 1I4OA 3MGKA 1GT6A 1Y48E 5BR1A 3DYIA 3OP4A 2EW1A 1CTQA 1Q20A 3AVPA 4JLNA 1PR4A 3JRNA 1IJKA 3UYKA 2PGOA 2QX6A 1EHCA 3EFHA 4CL0A 4RMHA 4EKDA 5B2EA 3ADBA 2ZB4A 4D3XA 3LUKA 1VKOA 4GW3A 3I9LA 2GNOA 1XXHB 4RHUA 4RUKA 5EI5A 3HWRA 3TH5A 1NT2A 1VSUA 2FW0A 2Z9CA 3GZ4A 2H06A 2RJNA 2Z83A 3K1TA 4JC0A 4J7AA 4BLSA 3W3AA 4KFCA 1YD7A 2ZAGA 1WXEA 2OV3A 3RJZA 4U00A 2B5WA 3D5EA 1TADA 4ZVVA 1FLAA 3MK31 2EIHA 1YL5A 1MKYA 3LPNA 4BKQA 1N2GA 3T1HB 3PXXA 3K53A 4XI9A 1ZA2A 2CVOA 1UBJS 3CJRA 2E1PA 4ZFNA 1Z18A 3QOXA 4Q7LA 3ZQ6A 1NLZA 5KQRA 2VT3A 1DBWA 4OUKX 1Z5ZA 4OUDA 2FW1A 1UDBA 5T8KC 4MNTA 4JNCA 1HQKA 2IPOA 1S5PA 2PZJA 1AM4D 1ZICA 2I5PO 2QI9F 3BUSA 4K40A 2VYND 4EFMA 3NORA 1GEGA 1PZFA 2WG1A 2WMDA 3A3NA 1U1FA 3FCXA 3M34A 3OJCA 1CEYA 4ZAGA 2IHZA 2VHQA 3EEFA 5J58A 3EJWA 3M1YA 4A0RA 1N7JA 2R4UA 3AP3A 3ISJA 5C8YF 3AVVA 1KAEA 3REOA 5HGXA 1F8FA 3LPAA 1VL5A 2A9JA 3T4XA 4MS3B 4V0RA 1DOZA 2FOIA 1E0DA 4G65A 1VKHA 2Q50A 2YWDA 3Q12A 5C32A 1ESMA 4QUBA 1V1MB 2YOHA 2IEAA 3ZR4B 5I8PA 4ESVA 4HN4B 2XA9A 4PPYA 3UG7A 5I4KA 4I5EA 3FVRA 1WMBA 2VNHA 1RWWA 1P2SA 2J9XB 3D3EA 2FEMA 5K3CA 4EG0A 4ZTZB 2X2PA 4N12A 4CBVA 4HLDA 4BMSA 3WIEA 2X86A 2ABWA 5EWLA 2QTWB 3KVVA 4UHKA 1NA5A 1EVKA 3QRWA 1MDFA 1NBIA 4KXLA 1TQ6A 2O20A 2JAPA 3ZDXB 1V4BA 1NIPA 3DMTA 3PTZA 4H27A 1AE1A 4G5GA 5CLQA 3C5VA 4BLUA 2D13A 4V0MA 4JJIA 3GJYA 4IIDA 5DNAA 1IXYA 2L19A 1GVNB 1UXJA 3TLGB 5TX7A 2OFFA 1SVSA 1RYZA 3CHYA 3FLMA 1H85A 3DT9A 1NZDA 3ITDA 3AHIA 2OZVA 4XPIB 1W4RA 5AR1A 3E6AA 2X8AA 1CDDA 1RBMA 2YV4A 3LO8A 4EPYA 3GEGA 1RRGA 1FXWA 4YH1A 1ANKA 1AQYA 1ZA1A 1FDTA 3DE3X 4HQNA 4WH0A 4KQHA 3TTXA 3ZGXA 4C0AC 1V48A 3RS7A 16PKA 1TUEA 3KXKA 3L6BA 4GQAA 4ZICA 1R8YA 4A8JA 1TKBA 2ZT7A 5D86A 3CKYA 1MOPA 1VMAA 1ESNA 2WTMA 2ZE6A 4X1OA 2HSDA 4FEEA 1WS6A 4N3BA 4Z0HO 4CI9A 4E11A 3L7AA 3CW9A 1E1QA 3L7YA 2DBQA 1J97A 2P9BA 1Z8FA 3KEOA 4L07A 3W6UA 2ZJBA 4F9TA 4AMBA 3SS9X 1K7FB 1Y7IA 4GOXA 2O8VA 1KJZA 5DO9A 3PDCA 3RVPA 2HMYB 4E15A 1OZHA 5LA6F 2VT7A 4LV5B 3IXQA 5CX4A 3TGPA 2IKSA 1G9XA 4X91A 1U2DC 2JKZA 1AXGA 1NLYA 1NMYA 2VZEA 2QD2A 1XCPA 3WMXA 5GJWC 1ORHA 4WZZA 3ZN2A 2OCPA 2PIAA 3P1JA 4MROA 3WAJA 1KI6B 3IELA 3KJFA 4BQQA 2X0IA 2BHRA 4LSMA 1JNYA 4BFXA 4HFMA 2QS9A 2RGEA 4HGOA 1W4AA 1C41A 1JEDA 2KJQA 2G1KA 2P8SA 1E7WA 1NVTA 3CM0A 2R87A 3GNQA 3ORQA 4YRQA 2ZJOA 1E1KA 1ELOA 1F5NA 4MQ5A 5KVQA 1JH9A 2K6GA 1YS6A 4PG5A 3RC2A 4CVNA 2A5LA 1Y9AA 1TAQA 1HLPA 4KN5A 2RHJA 3F6SA 3MBKA 4LYDA 1UWCA 1Y4UA 3B1FA 4RNDB 5ALOA 5KVCA 3D7SA 3GC6A 2OHXA 1Z82A 1W8IA 4LHWA 4Q12A 4AULA 4OQFA 4FT2A 3QPCA 2KB0A 1Q21A 3VC2A 4C4OA 4EI2A 1D0VA 1PT5A 4PBTA 2QVCA 4DA8A 1XHLA 4Z9FA 1A9SA 2YIJA 4HD8A 4DIEA 5I5EA 4YJGB 3G6KA 1CUXA 1C29B 1T4DA 2FMUA 3AEXA 3IHLA 4GR4A 1KVRA 4BS9A 1XROA 2ZK7A 4RKQA 1Z68A 2L2QA 3A14A 3HACA 3ENKA 3I23A 4J0GA 5IEBA 4PF1A 4L02A 3QH4A 4LJAA 4U6SA 4UASA 5ICCA 4R8LA 3LYAA 1ZQ1A 4IJ6A 3KWFA 4O0MA 2XTJA 4CM7A 3S0JA 1S1MA 3MJVA 2SKDA 1SB8A 1EIWA 4EGFA 2R84A 3G1WA 4UVIA 4TZTA 2YRXA 4YRKA 8MHTA 5AM4A 1QRRA 1Y8AA 2Q99A 3BL6A 1YRAA 2YJ5A 1W36D 1KO4A 1UXHA 4L15A 4LJSA 4XFDA 4RH0A 2YZ7A 4LQLA 4YJHA 1FZTA 2A9OA 3ZHBA 1RZVA 2C0QA 2I76A 1C7QA 2ZVQX 3LUBA 5IBRA 3FSRA 3A1CA 3EXEB 3HKCB 1GGNA 3H7AA 3QNUA 4Z99A 1A69A 2VHZA 5T6BA 5HVNA 4LEIA 1J2EA 1VTKA 1QQ5A 5KSZA 2R44A 2FWPA 1B1AA 3DMPA 1S89A 4Q4HA 5D51S 2AZ4A 3WFJA 3THXB 2G06A 2I71A 5HF6A 1QPBA 4FFWA 4MCJA 3NALA 3NYQA 2GHTA 2RGAA 3AIIA 1ACMA 3TI9A 3EYAA 5CB4B 4MUBA 1P2VA 3DXXA 4A2PA 5K0GA 2XCQA 2G5CA 1IEXA 2WVGA 1OC2A 3O9ZA 4F72A 3S2ZA 2VSNA 3C1TA 5BUQA 4HSGA 2FR0A 2CVPA 3S40A 3PHBE 3DKKA 1ECJA 4NYJR 4HAIA 3I76A 5J4HA 1GZ7A 3R3VA 2V6FA 4L78A 3WDKA 2FZCA 2VQFB 1DG1G 3HVKA 5F64A 5HJEA 4U2KA 2VAWA 5LYJA 1MEEA 3T1OA 1TCCA 3RODA 3PC7A 4DS3A 1W4CA 4YP6A 5FLEX 4CN9A 4NE2A 3DD1A 1VPEA 3OTOB 2GEUA 3C5WP 2Q4DA 4YAEA 4E0BA 4UMEA 4GSYA 4I9NA 1IVYA 3D1LA 1XP5A 5JMOA 3M9LA 5AKJA 4AJNA 1ZN7A 3A1NA 4C3UA 1Y1SA 3MS2A 2XB6A 1XU9A 3QWAA 1EE2A 4I6EA 5BWNA 2COUA 4W9NA 4B35A 1R66A 1Y8RA 3LD9A 5T4BA 2XUPA 1G5IA 3PQ4A 5G0WA 2QVGA 4OK3A 4QNRA 4AMYA 3H75A 3ZWWA 5E2AA 3LTNC 3BXOA 4LYHA 1NRIA 1LRLA 3PKIA 1ES9A 3MGGA 5H1YA 4YUZA 1TIKA 3KALA 1C9MA 2XWQA 1JE1A 2DX7A 4NSNA 1X77A 2ODQA 2ZW9A 3M7IA 3T1YB 4QULA 4FOPA 4IAOA 7GPBA 4ZVRA 1WLYA 3CNNA 2PFKA 4B6EA 3SSOA 2Z3VA 2A1UB 5HEKA 3KDPA 1Z7YA 5JECA 3EDCA 5JWOA 1KEUA 3MWKA 1B4DA 4E70A 1AURA 1PR9A 4U02A 1VQ1A 1PX2A 3GBPA 5A03A 4DHEA 1H2BA 1PWYE 2BW0A 5C7YA 5FNVA 3O8RA 1TJ5A 1WW8A 2FEWB 4KR0A 4ZYZA 1U8ZA 4A26A 2QYSA 4N65A 4EFNA 4WBNB 4E5NA 5AQ1A 1FEZA 1X1BA 2BMDA 2RGCA 2JFFA 3QKRB 4QBGB 4RCVA 4F56A 3T1TA 4PV7A 4KREA 2IYQA 4KE6A 3HKBB 2BEWB 3L41A 4YCLA 2VAVA 3SFVA 4UE3S 2O8CB 3DR3A 3TYXA 1KJNA 3KK0A 3M3PA 4RD4A 1BMTA 1U2SA 1L5WA 2YJ4A 3PC8C 3Q2OA 5DYTA 1ZGBA 4NRDA 4DV7B 4KSBA 5JC1A 1AQ6A 2D74A 1QLHA 1KMHA 3DV0A 3VVCA 5CHYA 1XMQB 1FTWA 3IOCA 1PYDA 2G1AA 3O91A 3B9RA 1VJGA 4C0HA 1KETA 1LXCA 1YBFA 3FKSA 5AHWA 3R9XB 1RLUA 2JCYA 5EZQA 3OLVA 3H9EO 2PSDA 3L18A 3ZY2A 4ROSA 4N5HX 3DHYA 2F8TA 4JLOA 4OK5A 3L8YA 3D6AA 2C31A 4RPCA 1XTJA 2PUHA 3PPWA 1D4FA 5KDLA 2TECE 2W4QA 2XMPA 4LGMA 2OYRA 3G2MA 4QODA 3TLZA 5TMPA 4DDWA 1W34A 4RFSA 4R84A 1P7YA 1RU3A 2BSXA 2B0JA 2P30A 1QLWA 2G4CA 4DCVA 1MVLA 1TUBA 3T38A 5B5SA 3A28A 4ZREA 3IEXA 5EJIA 5GADl 5TDHA 2IZOA 4O4HB 4PIMA 5BO5A 4DBVO 1NBWB 1I2DA 2AEMA 1E2LA 2IHYA 3HNPA 2EHDA 3A8TA 1YAHA 1ZJ6A 3Q8XB 3C8HA 4NCIA 3R8FA 1UJ5A 5EKSA 2VPIA 2R1ZA 2X0JA 3E7WA 3FNEA 1Z0JA 3RNLA 4OQPA 3THOA 3IP1A 1BKYA 1GLNA 1KJ8A 1S9DA 1EFKA 2OCLA 3LYLA 3MQ2A 1OILA 2PL1A 5KB3A 4NHEA 2D3TA 4ZK2A 5DOZA 2AR9A 4JBGA 3E58A 2UYYA 5KNCD 4W8GA 3H2JA 5FI3A 3EPHA 2PX5A 1E4OA 3E5HA 3RASA 5JCPA 4KK3A 1ZMOA 5F52A 2PUDA 1CQJA 2R3SA 1O96B 3B2EA 1XEWY 3QPBA 2DHEA 5FPSA 3IBYA 4E22A 4YP0A 5A05A 2V03A 5CM2Z 3OBIA 1UZMA 5KYVA 4WWHA 5TB5A 4EFLA 3FDXA 2E5WA 4LZNA 3TF5A 1RZRA 4E09A 4WEOA 4ATNA 4DPMA 3N76A 4MP3A 3TS1A 4R9VA 4W82A 1J9ZA 1ZVKA 2Q5LA 4XVRA 2HDHA 2D0DA 2I4TA 2ST1A 3OPYB 5DI3B 3KUCA 3SLKA 4U1RA 5BORA 4O4JF 1EKXA 3OM1A 1P3DA 4MYUA 1DEKA 3PXAA 5A9RA 2QMHA 1OLUA 2XTAA 3NTVA 4XARA 5HPYB 1SZDA 2JLZA 2HW8A 4M0CA 5AKLA 3EGVA 3HP1A 3IPAA 4LK3A 4KMMA 4MJXA 4ZDIA 2ZUTA 2P9CA 4NJMA 7ADHA 3FPLA 1T35A 3VH3A 3IAS6 1L4UA 4CR7A 4EY7A 5BYKA 2X4IA 3KB6A 1RYNA 1QZ3A 1T25A 4G0VA 1OT3A 1QPZA 3KS9A 4DB2A 3CN9A 3KSDO 3ZDFA 3A6PC 2AE2A 1B16A 1NY5A 1TMGE 2ERXA 1XG5A 1P6QA 3EZXA 3FNIA 1XYVA 1Y98A 2IZ7A 2V9PA 2CMKA 1FYWA 3RIHA 4D46A 3Q3VA 3IUSA 3GP8A 2C2MA 4XYBA 3I6MA 1US8A 1XVLA 2EKQA 2YASA 2EJBA 1NQUA 1X15A 1Y9JA 2J4CA 3DAPA 4J3JA 4I8XA 1VCOA 2JFUA 3EZLA 3JAKA 1EM8A 4L74A 3RRNA 4KH0A 4RVNA 1IBKB 1YL6A 4HDRB 1R6XA 3D0QA 4XUEA 2C2HA 3O38A 2QRMA 1JJ7A 1GGMA 1TM3E 3EIQA 4YWHA 4RJKA 3KZMA 1P0CA 4HQKA 2W0SA 1R37A 3BWDD 1LZKA 1IONA 2VH5R 5K0LA 4YJ3A 3V80A 2Q7XA 1Y89A 2W9XA 3S3TA 4AY2A 3AWDA 1GPBA 1XWFA 3ZWNA 2DH5A 2HDWA 2OO3A 4R2WA 5H59A 5EUMA 4BC1A 1KVSA 3UVEA 5L3QA 4I3FA 4DY6A 1YCDA 2HU5A 2DSNA 2X4GA 3JQAA 1KI9A 1U7WA 1VLQA 4Q24A 5DX8A 4ER3A 5HSGA 5TQJA 3FFWA 4EI8A 4YLYA 1UBTS 5JT1A 3TL6A 2F3QA 3DFZA 1KRWA 1MH9A 2G80A 4LC1A 2C9DA 4PG6A 4UZEA 5KYKA 2X42A 3DNMA 4YCJA 2GPWA 4QRHA 1M0TA 1GSOA 1R8QA 3D7RA 3EVTA 1DAGA 4TTSA 5C2JB 4GPEA 3A3YA 1WEHA 3OQ1A 3H9JA 5DXFA 2HQOA 4B3JA 2CXUA 3HDTA 5KWJA 4BTEA 1J8MF 2Y0BA 4QTZA 1SGWA 4G1BA 2P67A 2Z8YM 1BGVA 1BS1A 3A32A 1P0FA 2E4XA 4KQEA 3UK6A 4NNOA 1G64A 4DM4A 1UZNA 2FPIA 2PUAA 1KI2A 1KI8A 1CY0A 3O1IC 1SKQA 3K71B 3EY9A 2WF7A 3FAZA 4M98A 1BH6A 2WI8A 3DV9A 4WZBE 5D1HA 1S1CA 1EK0A 1GL3A 2A5FA 1YGYA 2NOAA 3MTBA 1U90A 1B43A 1P3Y1 3BZWA 3FGZA 5DHUA 4BATA 1UJCA 3E7FA 3RUCA 1DRUA 4GFDA 4C4AA 1WEKA 1SVLA 2K2WA 1PKXA 4K9QA 1MQSA 2NV0A 2ZVJA 4LVCA 5CFNA 4B75A 4YR7A 2WQ7A 2H31A 2JF0A 3E82A 3QZUA 4GLLA 2BEVB 5JAZA 1PFWA 4CMEA 5EG5A 2M6SA 3WY9A 4ZU6X 4YAJA 4JUIA 4DQLA 1EESA 1IJBA 1DKLA 2NXJA 1Q0RA 4YPOA 1DDGA 2QLNA 1DIRA 4UEQA 3DVQX 1Y9EA 3HZHA 4CF6A 4ZVSA 4AYTA 1BHQ1 4HUTA 4NQZA 5CFPA 4CUJA 4MGIR 3T4UA 2IBTA 2EGUA 1TF5A 1TMOA 4F5YA 3IMFA 4L5CA 5ERYA 3FR7A 3N1UA 3U7IA 1UIRA 4C07A 5ALTA 2BHLA 4AKSA 1H0HA 5JTUA 3TO5A 1ECLA 3OP1A 4G5QA 4C43A 3P2JA 3TNLA 1PL0A 2JCSA 5LIRA 3GA7A 3K3PA 4CCYA 2R62A 3DBOB 5HE9A 5KOJA 4KTTE 4OLFA 4Y67A 3MCWA 2DF8A 2H5JA 3JQBA 3R5KA 1M6HA 2J09A 4FGKA 3P94A 2WY2D 2JFPA 2A88A 2WTAA 2IHUA 2X41A 5IWCA 1Y63A 4C7MA 5CLFA 1MJGM 2VHTA 3GDWA 1F5SA 5TEVA 1P5FA 2WMNB 1DAFA 1SAYA 2WZBA 2ODEA 2P41A 4QKQA 2EKDA 3PCXA 3T7TA 2BP7B 1F1JA 1NULA 3D6JA 3QVLA 1HV8A 3NEYA 4NBRA 5B58C 5JQGA 4QDTA 4P9NA 2R47A 3GZJA 4WKOA 1E1CA 4P3XA 1ND5A 3Q0EA 1NQWA 3BAZA 1HR0B 5ICFA 4DGSA 3SQLA 5HJ2A 4EKIA 1JSCA 1P7WA 4OP3A 2H4WA 3JPYA 4TSFD 4PNZA 1QVVA 2FUG6 5FQNA 2ZLBA 1P2DA 1YC5A 3DDHA 1VB3A 421PA 2L18A 1J5XA 2ACKA 2ZWOA 3Q2IA 1AF4A 4RAOA 4RABA 4JITA 3TIIA 2P65A 1NBHA 3HCWA 4G9BA 1T3LA 3ASVA 2CCGA 3B78A 2VPXA 1GL7A 3KU4A 3RSHA 3VZDA 2VN8A 3BJZA 1H8ED 1UP4A 3FDJA 3KYCA 3P2MA 4GMDA 4GPD1 4XSVA 3I3SR 4DBLE 4LUCA 1YL7A 5LQSA