2VH5R

Crystal structure of hras(g12v) - anti-ras fv (disulfide free mutant) complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
166
structure length
166
Chain Sequence
b'MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTI-RAS FV HEAVY CHAIN
molecule tags Immune system
source organism Homo sapiens
publication title Functional Intracellular Antibody Fragments Do not Require Invariant Intra-Domain Disulfide Bonds.
pubmed doi rcsb
total genus 55
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2007-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2vh5R00
2W83A 1X3SA 3L0PA 3W6OA 3QXJA 1KMHA 2IYRA 2J0UA 2R8RA 1H65A 2IYSA 3AM1A 1NSFA 5AJYA 2O8CB 1CTQA 3T06B 4ESHA 4JVLA 4HSEA 1G64A 1KY3A 4H1VA 4A82A 3AB3A 3CF0A 2ANBA 4RZ3A 3PXGA 1QHIA 2GCOA 1DAMA 1M1YE 1GRNA 1E79A 221PA 3H1TA 1D9ZA 1E94E 1P7CA 1E1QA 2GJAA 1N5KA 1VYTA 2ZRIA 1N25A 4DLTA 1G41A 1W4AA 4P33A 3G82C 3GLHE 3TKLA 1YZGA 3SJZA 3EZ2A 4KFRA 4V02A 3ZDQA 4MDEA 3HPQA 4HB2A 2E9SA 2HEIA 5CJ2A 1F3OA 3K0CC 3I1FA 3RVBA 2GRJA 3UMRA 4Q1FA 1RRPA 3NC0C 2B7BA 3RHFA 1M6NA 5G41A 2JJ1D 3BD9A 3E70C 4OQFA 3KFXA 2XTMA 1KO4A 5IK2D 4BFXA 1S8FA 2A5YB 4Q9KA 2FG5A 2FA9A 3AVVA 1RVDA 2NZJA 4DEXA 1IN4A 1KK2A 2J0QA 4GPTA 4CT4B 1R7RA 5JEDA 3VNVA 2JIZD 4JIMA 5JWHA 5JI2E 4O0MA 1YR9A 2FOLA 3BIFA 2PEZA 1ZJ6A 3VX3A 5CM8B 1RFLA 4IEEA 4WIAA 3C41J 2MSDB 4XTRA 4ZDKA 1I4DD 4QGFA 2OILA 2FSGA 3QKRB 4KLZA 1LVGA 2BM0A 3AKYA 3LLUA 2JLRA 2ZR0A 4B6FA 4NH0A 1QHGA 1NN3A 2CHVA 4KVAA 1AQYA 5E3HA 1IBRA 1E9DA 4Q7KA 2GK7A 4G01B 4QJ3A 4DSOA 4OI0A 2RGNA 2WAXA 1PUIA 5SZJA 2HJGA 5C46F 4EPWA 1DAIA 4R71A 2P5SA 4UQOA 1Q20A 4C3ZA 4B3DA 4Q9LA 5KPJA 4Q4AA 2HLDD 4ZKDA 2GEUA 3PJRA 5E4FA 5JLJA 3VAAA 3B1YA 1U9IC 4OJKA 5FI0B 3U2QA 4BLQA 3VR1A 1QG4A 1DG1G 2KJQA 3U5ZB 3AVTA 4IW3B 4C2TA 2VSFA 4AYXA 4US1R 1XCGB 1P72A 2AX4A 3M1IA 3ZS8A 3UATA 2ZIAA 1GOTA 1QHXA 2GJSA 2NG1A 4LC1A 2DFLA 2AXNA 4RFSA 1NN5A 1E1RD 2CJWA 2JA1A 3QY0A 1XTQA 2CXXA 2ZYWX 1EFRD 4FN5A 4RZ2A 1MR3F 1Q22A 1VG8A 4EDHA 2FN4A 2ZJZA 3BFXA 4PZLA 2WSMA 2QN6A 1WA5A 2FJUA 3ZZUA 1Q57A 4POAA 4RKFA 3SJCA 4WZAE 2D2FA 3EW9A 1CBUA 2RMKA 3A4NA 5CYOA 2YOFA 5L3QA 4CEIB 2ZRPA 1Z29A 3A4LA 1W49A 1HT2E 2MSEB 2PJZA 2VYFA 4MKHA 1P62B 4M9SA 1H8ED 2HXYA 4PHTA 1LTQA 1D2NA 3O47A 4FWTA 1DO2A 4TSFD 2RGAA 2IYYA 2QTVB 2GXSA 3T34A 4XTCS 3MD0A 4CIDA 1G1MA 2GBLA 2YNMA 2VH5R 4TMWA 3BH6A 3L82B 3H84A 3LV8A 5BN5A 2PMDA 3BC1A 3HDTA 2XZLA 2UZ3A 3GQBA 4IDQA 2ZRGA 3B9QA 3GLHB 2GILA 2P6NA 4KYIB 1T8TA 3W5JA 3WP1B 1CR0A 1CEEA 3E1SA 2WWXA 3MWJA 4LHYA 1ZM4A 2X77A 3GP8A 3Q7QA 2BCJQ 2IF0A 2QAGC 1XPOA 1XMSA 2BIFA 4R7ZA 4W7SA 1P61B 1TNDA 2WV9A 2PBRA 2HF9A 1P9WA 1J99A 3CRMA 3QF4B 3SJAA 4W5HA 3SS8A 2GF9A 4PQYA 4MGIR 2J7PD 3VHLB 4RFSB 4D4LA 1E9CA 1CULC 4TTRA 5JSZA 1ZYUA 2JJ1A 4M21A 4RSGA 1N6PA 4IOJA 5TY0A 2PZEA 1S3GA 1E32A 4ZCMA 1ZIPA 4B3XA 5DH9A 4RJLA 2MMCA 2CHQA 1ETUA 1SVWA 3A1WA 5FPKA 5FOSA 3P32A 5GJCA 4QKQA 4D80A 3WY9A 1MT0A 1WP9A 3OZXA 2RGDA 5E7JA 3T35A 3KQKA 3FB4A 2NTYC 3LD9A 4Z1MD 1X1RA 1G5PA 3IUYA 5HTKA 4JLAA 5DHAA 2ZYUX 1RPZA 2MSCB 1J70A 1Q3TA 2QI9C 4LV6A 4RD1A 3TUZC 3TSZA 4EPRA 3VMFA 2H5EA 2Q6TA 4OKSA 5JJIA 3QXSA 1LW7A 2UVQA 1KI7A 4EFNA 1SXJB 2W6JA 2DFKB 2YJTD 3CPHA 2GZAA 4A92A 3K0AA 2ZREA 1G6HA 2BKUA 4NPHA 4Q03A 5LPNA 2HJVA 2QT1A 2W0SA 4TMKA 2Q9BA 1DVRA 2IS4A 4RY2A 4I99A 2YOHA 5EZ6B 3HU3A 1DAHA 3QF7A 4GT1A 2IHBA 3EIQA 1AJEA 1KO8A 1GL6A 1ZD1A 1IN7A 2QQEA 1Q44A 2H18A 2J41A 4MYUA 4MUBA 2N46A 2QROA 3TAHA 3THXA 1CXZA 4JLVA 1CKEA 2DPXA 5G40A 3D3QA 5FTNA 3AKDA 4C0JA 3HR8A 2WOJA 5JJLA 1ZNYA 2V8OA 3ONWA 2YHSA 1T0HB 3P26A 4B2LA 2REBA 1WXQA 1EG7A 2CNWD 3CX8A 3O8RA 3LBNA 5C18A 5FI1B 3MLEA 4GOXA 3KKQA 4IDOA 4XWAA 3KXIA 4NYMQ 3SE0A 1UBFA 2JDIA 2ANCA 2VSOA 4U5XA 1T4GA 3DEFA 3RSLA 2CJWB 1N6IA 2QNRA 4B2IA 1KO5A 1Z47A 2YC4C 1Z63A 1G6OA 3R8FA 1EX6A 3RAPR 1U94A 2JJ2D 4LOAA 2IX3A 4LGMA 4IFEA 2J45A 4CT5A 2FSFA 5FL7A 3WNCA 3K09C 2FDCA 3AF0A 1CS4C 1E1QD 3C14C 2WSSA 1J8MF 5ELXA 1UDXA 3LQRA 3V9PA 2A5JA 4QHYA 1LS6A 1FP6A 2F9MA 3AEZA 2EFEB 2G83A 1U99A 2P67A 1IHUA 3CF6R 2VBCA 3QBTA 1RC8A 1AK2A 1SGWA 1JQLB 4D82A 5F9HA 2KBFA 2ZRDA 3NKVA 3ZIAD 4BRWA 1N2CE 3O8BA 4DKXA 1Z8FA 1R4AA 1UADA 1E2PA 2ZEJA 3DZDA 2J1LA 4TQUS 5EQTA 3SR0A 3MAAC 1G16A 4K8OA 2BMDA 2ZE6A 4GZMA 4V0LA 4KITB 4M1YA 3I61A 4JT4A 3H2YA 1EX7A 3DMDA 4PFSA 1B0UA 3AQ4A 4M9XA 2F1RA 3QUSA 2PL3A 3NH9A 3SJBA 3U60B 5SZHB 2RGBA 4CRWB 4Q47A 1L7VC 2NO6A 4LSGA 4ESVA 5FFMA 4AY2A 2FV8A 2DCUA 4NHOA 4DLWA 4A2QA 1ZAKA 3OEEA 4DLUA 4A36A 3LO5A 1JAHA 1N6HA 4DDTA 1G5TA 4HB0A 1E2FA 4TYPA 1UBGA 3AVXA 3U7FB 4AURA 3DKPA 3MWLA 3JZAA 3K0AB 4ERNA 2RHMA 4BASA 1NVVR 5EXXA 3CUEF 1OKKD 3RABA 4L15A 1LF0A 2W00A 4PQFA 4QBIA 4D6PA 4QG7A 2FX3A 4ZKEA 2O8DB 2G88A 4YONB 1UKVY 5A4JA 1P9RA 3RRYA 4A2WA 3FHTA 1E0JA 4LHZA 4BLOA 2GVDC 1NSTA 3GJXC 1E2JA 1Z6TA 1WF3A 1E9AA 1ZC3A 5F9FA 1P2TA 3B78A 2WOOA 1G291 1U8YA 4PC7A 2C03A 2WWFA 1OH6A 1R2QA 2Z6VA 5IT5A 3FMIA 2F9LA 2P0EA 1PJRA 1G8PA 2WZQA 1II9A 1RW4A 1NN1A 2GF0A 3BJIC 1Z0FA 4KVGA 2C9OA 2QPAA 3QPUA 2OHFA 1G4UR 5KSPA 1E2MA 3GLFE 2AR7A 5TDHA 3U44B 3I4LA 2VO1A 5JS8A 4D0LB 4OQLA 2QRZA 2GWHA 2KWIA 2G9NA 4JSTA 1S1CA 2OE2A 4MYTA 2BOVA 3EIHA 1IN8A 1G8GA 2XITA 2BV3A 3KFVA 1PLKA 2NO7A 721PA 2Z4RA 4OJQA 1KZ7B 4LX0A 1P2SA 2WWGA 3PENA 4IOLA 4DCSA 1UEJA 5TARA 1SHZA 4EJSB 2GK6A 1HQYE 1KNXA 2QAJA 3OIWA 1HEIA 4BZXA 2B8TA 4DC9A 3SZRA 4GNKA 3GLIB 1KI2A 3I62A 1XZPA 1AGRA 3K8YA 1E9RA 1JEEA 4FCWA 2CEAA 4Q4JA 3IQXA 3N5CA 3A36A 5DLQC 5C1BA 4FMDF 1X8LA 1QHHB 4MRNA 5EXPA 2GJ8A 1XTSA 3GLFA 5F3WB 3NDBB 4GI7A 3SEAA 1RRFA 4BZQA 1TEXA 2WPDA 1XXHB 4HAXA 5K8TA 4KYUA 4W5JA 3MJHA 3CNNA 5LB4A 3TLXA 4C7OB 1FQKA 5P21A 4NYIR 2DR3A 2FPMA 3DHWC 4QBFA 2P6UA 4DLZA 1JR6A 3AVUA 4H1UA 1UKZA 3JVUA 2C98A 1UFQA 1E2KA 3U3KA 1G17A 3IEUA 2VF7A 3SDZA 1VYVA 3CB4A 3ADDA 5EP4A 4R2HA 2HCJB 4JLBA 4O25A 1S3SA 3LQQA 3ZJYA 4MQBA 3GEIA 5CDFE 3X1YA 3OIUA 3CX7A 2QRNA 3NC1C 2QZ4A 3PR1A 4G5GA 1Z0DA 4DDVA 2DY1A 3DL0A 1LV7A 2IT1A 5DN6D 4HLQB 1W0KD 4P4SB 4B3GA 3BBPA 2AWNA 1Z06A 4M22A 2RGCA 1E2GA 2GJ9A 3EZ9A 3QXHA 1IXSB 2V4ZA 2OLJA 4JKYA 4LK2A 4JLJA 4Z8XA 1R5NA 1EFRA 4CZ2A 1XBTA 3HPRA 5HZKA 4LY6A 2O52A 1W36D 3PEYA 3E5HA 3R20A 5EE1A 2QENA 3CZQA 5JS7A 1W4BA 4HZUA 1VIYA 1G3RA 3WMEA 4L16A 4NCIA 1CJMA 3RANA 4OL0A 3QI2A 2V7QD 3MJRA 3PITA 4DCVA 4W9MC 4CEJB 2ZR7A 1E99A 1P60A 3KJEA 1A1VA 3CNLA 4OI1A 4MYHA 2XOKA 5H68A 5HPYB 1XDBA 3SYKA 4XVRA 2ZE8A 1RE0A 2WJHA 3ETLA 5JMTA 2F55A 4LC0A 2VQSA 1XWIA 2ASEA 1NLFA 1K5GA 1ANKA 2TMKA 1EESA 3ND9A 4OHZA 3I5XA 3TSOA 3GJ6A 2QG6A 4OQMA 4Y0AA 3CIOA 1S9DA 2A5GA 2Z83A 2Q9CA 1U90A 2QSYA 4RD4A 4LWZA 3GMTA 4BFZA 3GLFB 2C04A 1JXMA 4NONA 1QHSA 1TU4A 3RNLA 3LY5A 2LCFA 5IDVA 4Q4JB 1OFTA 3DPUA 3ECCA 1Z08A 2F7SA 1E2EA 4Q4LA 3KB1A 1WQ1R 4PSKA 4PAOA 3IEVA 4YMVA 4BLRA 2BEKA 3ZZ0A 5H8WA 3LW8A 3QPVA 3KQUA 1YZKA 4MITA 3U3MA 1NG1A 2ZJ5A 2ZRCA 1E2IA 2REXB 3IHLA 3K0FB 1CJVC 4Q7LA 4QOSA 2O8CA 3Q7PA 3IBYA 3W9YA 4JL5A 4NCNA 2ZVQX 1E2DA 1JXOA 1XEXB 1QVRA 1OXVA 4NKRA 4JYCA 1YZUA 5FTMA 1XMVA 3W90A 4B6EA 5FBVB 3OFND 4TLAA 1R8SA 1JB1A 1NRJB 4KO8A 3K70C 1YRAA 3BH0A 1OF1A 2HCBA 3WYGA 2ATVA 4TYYA 2R65A 2C96A 2R6DA 4KV9A 2BMEA 1GL9B 1RRGA 2FWRA 3RSOA 4X8OA 4LV8B 1KNQA 5DI3B 2H17A 4Q5IA 1GNPA 4DUGD 1LS1A 2BWJA 3BOSA 3FPAA 3KKNA 5JI3E 2XXAB 4MYCA 5HE8A 2Z4SA 2JLUA 1W36C 1R6BX 3VNUA 5LD2B 4LBYA 3SOPA 421PA 4AKIA 1GP2A 3S1AA 3KDSE 2AFHE 1R0XA 2Z43A 2KE5A 3Q8XB 3OAAD 5F98A 1ZC4A 4KBFA 4KAXA 2CDNA 5CJPA 4DVGA 4DZZA 3GJ7A 1W0KA 2JGNA 2CCKA 1MOZA 4QFMA 2EWVA 4A8JB 2DWOA 3THWB 2NO1A 5HR5A 3WYFA 2VHUA 4Q00A 1U8ZA 2XEXA 3R9IA 2IWHA 2QA5A 1G7RA 1EWRA 3LLMA 3A1TA 2EU8A 3F3YA 1F48A 4B34A 4U7DA 3NVAA 1QG2A 5KTYA 4PTLA 2OCAA 5GADl 3GEHA 1P3JA 2XSZD 2J3EA 3QPWA 1HY3A 4EPXA 4JLPA 4FINA 1XPRA 2XNSA 3Q5DA 4PXAA 2OCYC 2QTHA 2HXSA 4LYFA 4DUGA 4WZBE 2BBOA 2OG2A 1FX0B 2GJKA 4A15A 2AD1A 2V6IA 4AK9A 1T5LA 4KXFB 4M1MA 5KNDA 1GTVA 4C9BA 1AZSC 4Q18A 2WJYA 4R9UC 4U02A 4A0HA 1FMJA 4LHWA 4XH9B 5EZ5A 1T5IA 1Z0AA 3AKCA 2W6IA 1KZGB 4C0SA 5L3VA 1E79D 1S2MA 2WAYA 2OAQ1 1CU1A 3C5HA 1IOZA 1RIFA 4UXHA 3ZVRA 4HEJA 3V4RA 1JAIA 1VYUA 1E9BA 1QVAA 4TQAA 4JLNA 1P9NA 1KDPA 5DIFA 3X2SA 4HAUA 1NY6A 2C99A 4Q21A 3C4JA 3K9LA 4OI2A 3FFBA 3ADCA 3X1XA 1P2UA 4A1FA 4BZPA 2IHYA 1V43A 2YC2C 1G18A 4AG5A 2YYZA 4IFBA 2DFTA 1M74A 1OXTA 4HI0E 4DCNA 2JLWA 2QPTA 3D8BA 1IXZA 5IHPA 2IA5A 3CWZA 4KSCA 5FUWA 5A0FA 2V54A 2I1QA 2PMKA 4CGZA 1ZM2A 2BBWA 4MRPA 4TTPA 5EP2A 4CEHB 2B8WA 1BH2A 5DO9A 3G0HA 2ZJYA 4QGHA 1XD2A 5KDLA 5DHFA 4M1KA 2O8BA 1XXHA 4B47A 4P32A 3P4YA 5KUTA 2WWWA 4B76A 5J40A 3FKQA 5AJXA 3L0IB 1BIFA 1QHHA 1SXJC 3CWQA 4FI3C 4UXJA 3TH5A 3UWKA 3U7HB 2WJVA 4M0LA 3VR3A 5AUNB 3LBIA 4IHQA 5KDDA 1PZNA 1DG3A 4Q48A 1QHNA 1OKKA 1W5TA 2CNWA 2D74A 1VDZA 1Z6GA 4BECA 1RKBA 2H92A 2ZETA 4TYNA 1P4SA 2WMNB 2JCSA 3PVSA 1GRQA 3NTUA 5K8UA 1OW3B 1XX6A 4HLDA 4HAYA 2G3YA 4MKGA 4JT2A 1NMXA 3AF3A 3KTAA 4I4LA 1VECA 2OZEA 3K09A 3DDCA 4D0GA 2H16A 1TF7A 5EUMA 1Z22A 4HAZA 2OO7A 5EP3A 1W1WA 1A7JA 1JJVA 1Y3AA 2YKGA 1MABA 3W8RA 3BB1A 1FL9A 4JKIA 2XTNA 4A6XA 2IW3A 3GFOA 3RRMA 4MRVA 1DE0A 3T1QA 1E4VA 1N0VC 4LJYA 4TT3A 4ZIRB 5FPYA 4M1TA 1TAGA 4L9SA 3D7MA 3ZIAA 4D2IA 2O0KA 2ECKA 1COWA 2Y8EA 4GZLA 5AJVB 1DELA 5AUQA 1NMYA 4Q1BA 3KKPA 4FXPA 3QG5A 4OHXA 5FTKA 2XAUA 2FE4A 2OT3B 4JYBA 3RC3A 5HE9A 1KTVA 4KU4A 3L8ZA 1Z5ZA 1AS2A 4PAQA 5B57C 2GXAA 4JVSB 1AKEA 3L2OB 1FMLA 2A2ZA 2ZRKA 3GLHA 1OPXA 2J87A 2LWIA 4Q1AA 2W58A 2GNOA 3IGFA 3TBKA 1KKLA 4BLTA 3F8TA 2IYXA 2OBMA 3KL4A 4JMPA 3KJIA 4J0QA 4KJZA 3LA6A 4B3CA 4Q7JB 1XEWY 3KXKA 3SQXA 2R44A 1UJ2A 1DEKA 2QMEA 3HR7A 1PUJA 2WBLC 2BBTA 4B33A 2H57A 2OV2A 2XJ4A 4LHVA 4L8GA 3UG6A 1JBKA 1OB2A 4HDOB 1TU3A 4LJ5A 1XJ0A 2IYZA 4CVNA 4Q66C 4V03A 5AK0A 1XD2B 5GVRA 1G8HA 1W46A 2FFQA 2G1KA 4M2LA 1J2JA 1E4YA 2ZJOA 4NZYA 4ZO4A 2ZJAA 5FBQB 3P1JA 4XOIA 1NIJA 2CK3A 4G1UC 3FYHA 3KXLA 1FNNA 4ZPXA 1KK1A 3TUJC 2ZJ2A 3U4QB 1GSIA 2PLFA 4QXAA 1WBBA 2Q0HA 4AD8A 3NBZC 1MO3A 3C8UA 1YZQA 2C8VA 4IDNA 3T5DA 2J46A 3TRFA 4TT3D 4HUTA 2ZI5A 2OAP1 2JEOA 1N6OA 2WWIA 3P20A 4NYJR 1JR3D 2CL6X 2FFBA 2NPIA 4YC7A 2FGKA 4PO8A 3C16C 4OBEA 3FVQA 2X1VA 1GDDA 2NO9A 2ORVA 2RGGA 3DM9B 2GDJA 2GVZC 5C2JB 1EFUA 1KI6A 1ZP6A 1DADA 3QE0A 3VFDA 5KHOC 4BFSA 3PEVA 1L4UA 4I1OA 1CR4A 1KIMA 2R6FA 2CCJA 4PZYA 4WA7A 1GITA 3LRPA 4ASUA 2FFHA 4HLCA 4IOMA 2HF8A 2ZS8A 2ODNA 2HYIC 3ZD7A 4EKDA 2VTKA 1I2MA 4XVQA 5FTJA 1XU4A 3F5FA 4LBWA 5FOWA 3W34A 4B48A 3GD7A 1NMZA 3DM5A 2I3BA 3QG1A 1G8FA 3CX6A 1BMFD 4G5QA 3D6TB 1ZUIA 1DAEA 2ZRAA 1XZQA 4S2EA 1TQ6A 5DYIA 3EZFA 1HV8A 2D06A 3R7WB 3UXMA 2OBLA 1WBDA 1ZCAA 1VCIA 1Q1QA 1JR3A 2BM1A 4NBSA 3EPKA 2ONJA 1SXJD 2YWGA 3SI7A 2D7DA 5E7MA 3BRWD 3SN6A 4C2UA 2V1XA 4B43A 5EXTA 1COWD 3SBDA 2RHDA 1GNQA 1CJTC 3TMKA 1AKYA 4HATA 5GJVC 1KSJA 5E95A 5KO2A 2ZSEA 3FOZA 4C4PA 4D0NA 3VKHA 2O0HA 1JJ7A 1SXJA 2EYQA 4BRUA 4DB2A 1ZW6A 3T1OA 2GAOA 1A82A 4R98A 1TL7C 2QM8A 5KU1A 5DNYB 3AF1A 1T9HA 1U9IA 1G7CA 1NY5A 5BQ5A 5JWOA 2CMKA 5HKKD 4LCBA 2VPPA 3N2EA 5M04A 5J4YA 2F3TA 4WAUA 2JLQA 3CRRA 4KODA 1ZM9A 2HV8A 3UK6A 4BFYA 5DE3A 4ZV4A 3EA5A 1G7TA 4NTZA 5H1YA 1VHLA 2IUSA 3AV0B 4IVQA 4JS0A 1Z3IX 3NEJA 2BKEA 5DI3A 3FKSA 5DYGA 3UMSA 4B44A 2QPOA 2RGNC 3OE7A 1KMHB 3NHAA 2JATA 5TB5A 3AVPA 2B6HA 3I32A 3I73A 2NIPA 3OF5A 1IN6A 3IHWA 3SFVA 1MABB 4D26A 1CJKC 4IVPA 3CW2A 4HUQB 2GXQA 1DAGA 3B13B 5KYKA 2VP2A 3HP1A 4JBWA 4Q4HA 1FP7A 3E2IA 1KAOA 2IYUA 1N5LA 1W4CA 2X19A 1F2UA 2ZRFA 1KI4A 3GJ5A 4EFLA 5L3RA 1CF4A 1HYQA 2A3RA 4QRHA 2DWQA 1HUQA 4TL8A 4NU0A 1H8HD 4TL9A 1O87A 1VIAA 5JHGB 2JLYA 3QXXA 3VR6A 2PCJA 3H86A 3K0EA 5CB8A 2QTFA 2P65A 1BS1A 1GIAA 3QKSA 4BFTA 2N42A 3QIAA 4XD7A 3WXMA 3K1JA 2GKSA 4I81A 1Q12A 4NYIQ 3EIEA 1VCNA 2Q21A 4LJAA 1VHTA 3TVTA 3ZVNA 2IYVA 3GJ4A 3B60A 1E9SA 4JVMA 4WZ6A 3IKJA 1SVLA 3K0CA 4G5OA 3U3OA 2PJRA 2X8AA 3X1ZA 2DWPA 1K5DA 2QORA 4QM7A 2Q3MA 3U3JA 4B35A 5JRJA 5D3QA 2ZE7A 2FMXA 5FPSA 3FMOB 3PG5A 1RJ9B 1T3LA 4QBHA 2XZPA 1EFCA 1W4RA 1F5NA 2JJ8A 1WRBA 3Q72A 4LJ8A 4CEIA 2BCGY 4QC2A 2B21A 2NGRA 3EPJA 4E09A 2FZ4A 4H9GA 2QT0A 5EE0A 2NPFA 1JPNA 1YZTA 2SHKA 2YWFA 4M4SA 4BFWA 5FTLA 4MDFA 4EAQA 4EQ6A 3VTKA 2ZS7A 5L8VA 4TLBA 5TVKA 2ZI4A 4KSBA 2R9VA 4YMTA 3SYNA 4R2IA 2XB4A 5D3MB 1AM4D 1HE8B 4KBGA 3UANA 1NLZA 1QDEA 1JQJC 3LVRE 4EPYA 4CEJA 5DI9A 2L0XA 2XTZA 3AP1A 4A0FA 4CW7A 4DSNA 1A2KC 2ZSAA 2JLXA 2O5VA 5FOXA 2J7PA 1OJLA 1OYYA 2V6JA 3K9HA 3K70B 4JBYA 1IJEA 2IS2A 1X86B 2AFIE 1SULA 2ZVPX 1VCOA 1JR3E 4A0GA 5AUOB 3RS0A 2ZROA 3PFIA 1CR1A 1YR8A 4TZ0A 2OXCA 1S96A 1UF9A 4LJ7A 2NO0A 4QGAA 1XTIA 4PC6A 1DOAA 1OH7A 3B9PA 4FMCB 4GSYA 3ZGXA 4FMDB 2IYLD 2E1RA 1SVIA 4A0RA 4P4SA 1KGDA 2W0MA 4LJ9A 3UIEA 3BH7A 5CLQA 1U0HC 4C0KA 3O8CA 2WTUA 2KSQA 4P0TA 2CLDX 1KK3A 3TQCA 1E2HA 2XB2A 3FGNA 1H8EA 4YXWD 3TNFA 3ZH9B 5EE9A 4RD3A 2KI5A 2R6AA 3SU8A 4ZI2A 3WBJA 4TQ9A 3WRXC 1IJFA 3QJYA 2QM7A 2WHXA 1XD8A 2AKYA 3L0OA 4JBXA 2ZR9A 1C1YA 2W6ID 4TSFA 1VPLA 3PUWA 2ZE5A 1E69A 4OHYA 4V0MA 5JEEA 1XEWX 3DO6A 1IXRC 4FW9A 4OK6A 1L8QA 4TLCA 3W3ZB 1K6MA 3ZQJA 2X2FA 4ABYA 4ZDJA 4P31A 3F0TA 2D3WA 3CM0A 1NG9A 4G3XA 2QEQA 1GWNA 1F2TB 2WWHA 4Q01A 2VIIA 3KUCA 3O8DA 5J5CA 3TVDA 1ZNWA 3PV0A 3WBKA 1NL3A 2PX3A 4LZZA 4N0DA 1G21E 2PLRA 3W6NA 3CNOA 3FMFA 4BUJA 1X1SA 4D25A 1AQUA 3HJNA 5G3YA 3RLFA 4LPKA 4UKDA 3GPLA 1J90A 3FWYA 3V00A 3EA0A 4KCGA 3LH5A 3ZD6A 3IIJA 4TMXA 1E2NA 1I2DA 4IXMA 4LBZA 2QL6A 5FPTA 2ERXA 1LNZA 4UNRA 5J4HA 2IS6A 2IK8A 821PA 2QSZA 4XVUA 4PZZA 4NL4H 3LXXA 4RZXA 2W2VA 1OV4A 3VKGA 1ZUHA 1R5BA 3WHLA 1E0KA 2IYWA 5K8LA 2A5FA 3A1SA 3IO5A 4QHTA 5CLLA 4BEJA 4RD0A 1TF2A 3FFAA 3LDAA 2Q9AA 4RKEA 2ZXUA 2ZSFA 1BOFA 2R6GA 3QXCA 5TV2A 4A9AA 4F4IA 3QEJA 3KJHA 2DBYA 2OCBA 1FTNA 4OQXA 2GESA 5GJBA 1AGPA 3ASYA 4GFDA 1DPFA 1XMIA 1Y63A 2EYUA 3LW7A 1U0JA 4DRZA 3T61A 4ARZA 2MMGA 4RCZA 5H70A 1P73A 4BGDA 3J81k 1FFHA 4GL2A 3CR8A 1UBEA 1DS6A 2VLIA 3REGA 3B2EA 3HWSA 2V9PA 3VR2A 4FMBB 4YLGA 1ZM7A 4DLSA 4DEYA 2E87A 2XGJA 1EXMA 2GAAA 4NP6A 4E07A 3LBHA 4U00A 4LJ4A 3RRNA 4CF7A 3OIYA 1GKYA 1K8RA 3R9WA 1NVXQ 2ZAOA 3IQWA 1UM8A 3T1VA 4NCKA 4URUR 1G20E 3RS7A 4PO9A 2FFAA 2G0TA 3K9NA 4GOJA 1YZNA 3U6BA 4EFMA 1XCMA 3LFUA 2C2HA 1JI0A 4S35A 5KOYA 1KJZA 4HZIA 1JALA 1UBCA 3CRVA 4KFUA 1XJQA 1D9XA 3RDPA 3R7WA 2ZYVX 1OIXA 5B30A 1FTSA 4AKGA 1OXXK 2LKDA 3D31A 4OHVA 3ZQ6A 4ARZB 5LDDC 1ELOA 1LY1A 3I8SA 4YQFA 2PZFA 3CRQA 3WYAA 3X1DA 4BQSA 1G4AE 1WB9A 1TTTA 1XCPA 4PHFA 1KI3A 2V55B 3TAUA 4V0NA 1NF3A 1NJGA 3Q9LA 2XX3A 5KPDA 2G77B 5CDFA 3TIFA 4M1OA 2BVNA 2CLSA 2IS1A 1VKJA 1XD9A 2A9KA 1R5OA 3AVQA 4BLSA 4TN1A 2ZJBA 2BC9A 5HZHA 4DCUA 1Z6XA 4PC3A 1E0SA 1MV5A 1U8AA 4URYR 1Z6AA 1BO6A 3BERA 2JLSA 5AWFC 4YMWA 2WKRA 2YVUA 3MFYA 1YKSA 4D81A 2DHRA 2B92A 5DISB 2QMUA 3AF2A 2ZYTX 1TUIA 1T3SA 4X8LA 1SKQA 1GUAA 1G3MA 2VHCA 2CVFA 3IILA 5A5GA 2WPDD 3VQTA 4WVFA 3AVYA 2GCPA 1PLLA 2PCLA 3TE6A 1W48A 2IYQA 1II0A 2VRWA 1Z07A 3GFPA 3IPXA 4IJMA 4QJ5A 4DXAA 5C4MA 4TMZA 3GJ0A 1W7AA 2IC5A 2VA8A 3DOFA 2FEMA 1FNMA 5FUXA 1ESNA 1OFHA 2ODWA 4F93B 2G6BA 3CLVA 3R8CA 3TSWA 1ZU4A 1Q21A 5TXGA 1R8QA 1YE8A 3B1XA 1UPTA 3WNBA 4TLDA 4GP7A 5AR1A 1D6JA 2AWOA 1P75A 4WOPA 1LB1B 3KKOA 3P27A 4B3FX 2QE7A 3AGPA 4LDJA 3THYA 1KK0A 3THXB 2Q3FA 2CL7X 2PT5A 3LX5A 3OHMA 1KI9A 3P4XA 4N3NA 1T0JB 1NLYA 4XWOA 2ZU0C 4KI0A 5JRZA 2JLZA 3NWJA 3QNUA 2J9RA 4ZCLA 2F6RA 3KX2A 2RKOA 1NJFA 4DLYA 2QQ0A 4FMCF 3HYRA 1N6KA 3OEHD 2ZRNA 1UKYA 2ATXA 2VP0A 4UJ5A 3EASA 4ACBA 1II8B 4RD2A 1AS3A 4ITRC 1Z0IA 1BMFA 3W6PA 3W8NA 3CZPA 2BEJA 1CIPA 1ZUNB 3RRZA 1W44A 1HE1C 1IAQA 2QMHA 4AC9A 3VR5A 1E9EA 2XNDA 2V1UA 3UKDA 1ESMA 1Z0KA 2ZRHA 4OK5A 4Y0VA 1XPUA 3CR7A 1OIVA 3KB2A 2GCNA 1NNEA 4B3BA 5FBLB 5LD2C 1S9HA 3BORA 4ASUD 2C9CA 2WSSD 4HUQA 5JECA 1CLUA 1XNJA 3ZZTA 2WICA 1ZCBA 1QHYA 1SVSA 4XJXA 2OLKA 4Z54A 3PEUA 3T12A 3V4FA 4Z8YA 3CKLA 3EZ6A 1S0UA 2JJ2A 3FHOA 1GFIA 3TQFA 3L8YA 1F6BA 1TQ2A 3TJZA 2YZ2A 4LYJA 5CITA 1ZNZA 5J47A 2I1VB 2F43B 3KQHA 2W2XA 4LYAA 1BYIA 3KTAB 2IEZA 4WXPA 4JLMA 2WKPA 1G8YA 3U7GA 2ZI9A 1Z6YA 4DDWA 1EK0A 3KJGA 3AVOA 4WXRA 4UXIA 1M2OB 2RH5A 2FH5B 1Q0UA 3T5GA 3ICEA 2HUPA 4PHGA 4M53A 3Q5EA 1KYIA 4XSGA 1XP8A 3FDIA 4HLUA 2VP6A 1TADA 2G0NA 1Z0JA 5L3SB 4L9WA 3PUVA 2WJGA 5E7IA 3U7EB 2QBYA 3EC1A 2ZUCA 4JL6A 5KSOA 2WVJA 4JSYA 3PIRA 1DTSA 2ZSBA 2O8BB 2J0SA 4NYJQ 1YZLA 4GOKA 3ZVMA 3EX7C 3A8TA 1R10A 1EGAA 1QZXA 1N6LA 1US8A 3EAQA 1T8UA 4PSAA 4D4JA 4GP6A 4Q02A 1XB2A 4X8MA 1P5ZB 4PO1A 4Q1EA 4EIWA 2FF7A 2ZU6A 4HAVA 1U0LA 5CIWA 1NP6A 1F2UB 3TR5A 3EWAA 1FW6A 3G5UA 3KQLA 4Q4HB 4PPGA 2A30A 3GJ3A 2K5UA 3AH8A 1G3IA 2H7VA 3BK7A 3HYTA 4MA4A 4UNQA 5FL7D 3AP2A 2DB3A 1FZQA 5EP1A 4XSHA 4LBVA 2FZLA 4NMMA 1N5IA 1T3HA 3NBFA 3FKSD 3NIBA 2ZUBA 2F1HA 2OXRA 2F1JA 2J0VA 2UZIR 1KKMA 2FU5C 3MMPA 4A6PA 2PT7A 1MRNA 3ZLJA 3WNDA 4URZR 2N1BA 5GJWC 3EZ7A 4E5UA 5B64A 1WE2A 4HB4A 4MUAA 3PUZA 1UAAA 2DFNA 5BN3A 3M6AA 4HYYA 2IYTA 3B85A 5BW8A 1KI1A 2ZI3A 1MKYA 2QGZA 4Z51A 1E3MA 1J8YF 1SVOA 3EPHA 2V3CC 2GZDA 4TYQA 2D2EA 5KSZA 2PZGA 5FR2A 1EFHA 3FE2A 3MWYW 3QOFA 1GRRA 4MH0R 4TTQA 1IONA 1G5RA 1KOFA 3DVLA 4PQRA 4TWZA 3VHXA 3VKWA 3VU9A 4DSTA 3T1TA 3CONA 4TL7A 4HDCA 4I1UA 3EC2A 4QL3A 5BXQC 4L4UA 3QKRA 3RS4A 1F2TA 4BPBA 1W2GA 3CH4B 3IIMA 1ZMXA 1NIPA 4IDHA 5FR1A 2XZOA 4TZ6A 2ZS9A 4PPFA 3NDPA 1W0JA 3WMFA 2ZRBA 1GNRA 3C15C 3ZVLA 3H0KA 4ZI3A 2WIAA 4II7A 1AA9A 1GKIA 1TUEA 3A1UA 3RWMB 1M7HA 5EE3A 1GZSA 5JZVA 2W6JD 2QAGA 3DZ8A 1TEVA 3OESA 1F60A 1OSNA 4MGKR 1XXHE 2A5DA 4FCTA 3TR0A 1E1RA 1XJCA 1NKTA 3K9GA 2EFCB 4JLDA 5UKDA 4DB4A 4GMDA 3NHBA 3EG5A 1JNYA 2D7CA 2ZTSA 3ADKA 4RZUA 2AK3A 1O3YA 2GEVA 1TF5A 2IUTA 1GM5A 4D4KA 2GBLC 1H8HA 4M9ZA 3PEWA 1BKDR 2IEYA 1YQTA 3B1ZA 3DKVA 4JLKA 3HU1A 4PX9A 2JDID 2BMFA 4F7WA 1ODFA 3UMFA 2CE2X 3B1WA 1KO1A 1IN5A 4OHWA 5FOVA 3UWOA 4HB3A 2IBMA 3IIKA 3TW4A 1D8TA 2BMJA 2LKCA 4TMTA 1C4OA 3MGCA 1DAKA 1KJYA 3K0SA 2ZI7A 1Z2CA 4AWXA 1ZIOA 4C0HA 2JASA 3QKTA 2GETA 1KDOA 1MH1A 1N5JA 2XXAA 2GCOB 2C77A 1HH4A 3TUIC 2YOGA 5JHHB 3WP0A 2VHJA 2VP9A 2A78A 4GBMA 4PC1A 3JZMA 4JJKA 1QRAA 1G7SA 2QGNA 1E2QA 3BGWA 2HT1A 4V0OA 2A7QA 1AS0A 2GEDA 2HLDA 1YHNA 3B82A 2B7CA 2AKAB 2VHTA 4KLNA 1EFTA 1T91A 4GMXA 5BN4A 4NE2A 5SZIA 2F3RA 3GCGA 2IWRA 3B1VA 4PR0A 2FPKA 4F92B 1X8JA 2VP4A 2WMOB 2JIZA 3C5CA 2EVWX 2Z5FA 3L43A 4M1WA 4FWIB 2WWYA 3M0EA 4WBSA 4O2LA 1KMQA 2OM2A 2EFDB 5LB2A 1A2BA 4US0R 4QGGA 5SZKB 1ZD8A 2GTPA 3FMPB 3I8XA 3RS5A 3IO3A 2R62A 1M7BA 2QE7D 3C7KA 3K0FA 4GDFA 1KDTA 2CVHA 4YMSA 1OXSC 3I5YA 2RB4A 5FUYA 5G53C 1N6NA 4LRWA 2IXGA 4MGZR 4C0AC 1AZTA 4RD6A 4JJZA 1KSFX 1X6VA 4XIGS 1AIPA 1G9XA 1E0AA 3X1WA 4NCJA 4IOKA 4Q19A 3BB4A 4DIEA 2P6RA 4Q1DA 2WJJA 5B58C 1OH8A 2W2TA 2UKDA 2HDNB 4ZCIA 1D2MA 3T15A 1R0WA 2RAPA 2AD5A 2ZQ5A 3QKSB 5FL3A 4DCTA 5L3QB 3CPEA 3LX8A 2WIBA 3WMGA 3MRSA 1PV4A 1W47A 4PSVA 1NBMD 1W5SA 1YRBA 2WKQA 3GEEA 2PX0A 4JLOA 2FSHA 4YMUA 1X8KA 2WM9B 1SXJE 4URVR 2ORWA 2OUKA 1GVNB 4GRAA 4JL8A 2Z0MA 2ONKA 1KO7A 2VEDA 1G19A 3PUYA 1IY0A 5KDOA 5FUVA 1GILA 2CLCX 4URWR 4L5BA 3UG7A 2JLVA 1VTKA 2NOAA 2AL7A 1N0UA 2EQBA 2KBEA 1MRSA 1TMKA 3K70D 5CM9C 1PVOA 4FIDA 3A37A 4HZUB 5B2ZA 1YR7A 5IK2A 2EFGA 3RYTC 3BFKA 2ZI6A 4IKEA 1A4RA 5GVSA 4DLRA 4KFSA 3AP3A 4Q4AB 3NXSA 4HAWA 5EE5B 3OAAA 3SQWA 1SZPA 1OH5A 8OHMA 2GA8A 4JZKA 1ZINA 4NDZA 1E6CA 4Q9JA 4PANA 2VHQA 1OLOA 2CHGA 2ZUDA 4LV5B 4B75A 4PPQA 2P5TB 2KB0A 3WRYC 2YWEA 4C0BA 1D2EA 1U2RA 6Q21A 4Q9IA 1R0YA 1U81A 2R2AA 2CE7A 5JFGA 5JCPA 1C9KA 5DGXA 2QP9X 1SHKA 3GLIE 4HLUC 1DO0A 1JECA 5BYKA 3SHWA 2C78A 3MG9A 3IDQA 2XSZA 1YR6A 4IRUB 5CB6A 1FQJA 1JPJA 1R0ZA 4LJ6A 4DIDA 3OIVA 4DLXA 1CR2A 1E9FA 5IF9A 4LUCA 3B8HA 2QAGB 1KJWA 4LPSA 2QU8A 4AIIA 1SQ5A 3PUXA 1OIWA 4O2RA 3GFTA 4TL6A 1LF5A 4K46A 1WMSA 3LVQE 4G5RA 2O8EA 3QBVA 4BEBA 3MSXA 2ZRJA 4PC2A 3BXZA 3Q85A 3NEYA 2H8KA 4AKHA 1FOEB 5KNBA 1XF9A 1UKEA 3SYLA 2GXUA 2H1LA 2I4IA 3VU9B 3KQNA 1G3UA 3K53A 3GJ8A 3QVUA 3GLIA 1FUUA 5AJZA 5IRCD 4LYHA 1OT3A 4FCVA 2CL0X 5FBRB 2RGXA 1KI6B 2C5LA 1OXUA 1NBME 1Q3HA 5EJEA 1HT1E 1Z83A 3BE4A 4OYHA 3SBEA 1G3QA 2ZITA 2OFXA 5FH9A 1HURA 1CRQA 4IVRA 3W5IA 3U3RA 4Q1CA 3ZS9A 2J0UB 1XTKA 5DSZA 3CPJB 3OFNA 1E96A 4B73A 4I1VA 4PPNA 4X8HA 1Z2AA 2P3SA 2FPLA 3CO5A 3B6EA 3CBQA 4W5WA 3N2IA 4UNNA 4LI0A 4DWJA 1ZBDA 3VX4A 4M9QA 1YVDA 1PLJA 4B2PA 2ERYA 1I4TD 4PAMA 4B71A 3GLGE 1LFDB 3U4QA 3TW8B 2AXPA 3L0SA 4AG6A 121PA 3OE7D 1KAGA 1S1MA 1OFIA 2IF2A 5HCNA 4PHHA 1US8B 1VG0B 3RS3A 4UNPA 2FEOA 1E98A 1RZ3A 4BFUA 1ZM3A 4M8NE 4MGYR 1W0JD 3GLGB 3QKUA 4EJSC 2Q3HA 2O8DA 2ODEA 1J7KA 1TX4B 2QBYB 1SVMA 1KI8A 3KKMA 2PEYA 5L3SA 2X2EA 4P4UA 3QQ5A 1OFUX 2BBSA 3NBXX 1SKYE 1M7GA 1RRCA 4UNSA 1A5TA 5LBIA 1CJUC 3IPYA 2IXFA 2R6CA 4DSUA 3U61B 4A8JA 4KHZA 2JAQA 2QY9A 2NMVA 5KSYA 2NZ8A 4EPVA 1MO5A 4MKIA 4DJTA 5FOTA 4P4TA 5AJWA 3HU2A 2CK3D 1L4YA 4IXNA 2YINC 3DMNA 4MRSA 2VF8A 4G0NA 5C4GB 4XWKA 4A2PA 3SHFA 5CYPA 4WW0A 4LHXA 2RGEA 3BB3A 2F43A 2BDTA 1YJ5A 4CDGA 4DT1A 2FGJA 4QBGB 3CH5A 2P2LA 2HT6A 4ZIRA 5F2EA 1ZVQA 4DBLC 1DBSA 2XOKD 2EFHB 3NG1A 1XTJA 4CYMA 2FSIA 3SNHA 2ZSDA 1Z28A 4FD2A 3RS2A 3ZYCA 2F1IA 4MKFA 2REOA 2OFWA 1U98A 1GKUB 2ZRMA 4KFTA 4B74A 1NVUQ 3U6KA 1XEXA 3M4YA 1HA3A 1ONBA 3AF4A 3QVVA 3AUYA 2D62A 4M1SA 1UDWA 3Q3JB 5JBQA 1IY2A 4QM6A 4RCYA 4N0EA 2QMOA 4BFVA 4C0QC 3REFA 1II8A 1WCV1 3LWNA 4QHSA 2BHRA 4Q7MB 1OE0A 3FTQA 2ZPTX 4URXR 3WHKA 4IDPA 1KSGA 2QUZA 2WJIA 4F91B 1GG2A 4QNRA 5HCIA 2NQ2C 1IQPA 3EWSA 1Q1EA 4B32A 2ZM5A 2O8FA 2QP4A 5TMPA 4V0KA 1NBMA 1OYWA 3VR4A 1I4LD 521PA 4TMVA 3THYB 1OHHA 1ZU5A 3TGPA 2J7KA 1ZNXA 1NN0A 2PH1A 2CBZA 2OBNA 4F38A 3I92A 1CP2A 1JEDA 4BLPA 3CRW1 2O8EB 3JVVA 4V0ME 2GZHA 4C7OA 4CEHA 2ZAMA 4G5SA 1Q1ZA 3N70A 5EUQB 2RCNA 2QP3A 2OEPA 2V7QA 4ILEA 5CK4A 1XTRA 2ZANA 1XFAA 4MRRA 2G1JA 3SFZA 4HDQB 4OI4A 4Z1MA 3A4MA 1XRJA 1RYFA 5FOUA 2O8FB 4A8JC 1XEFA 4QJ4A 2AN9A 3W3AA 1T6NA 1Q1BA 2OESA 1HTWA 2OSBA 4ON9A 1TQ4A 2AK2A 1ZD9A 1VG1A 3EARA 2XJ9A 1BYUA 3RWOA 2EWWA 2ODBA 1N0WA 3A58B 3BAFA 2YWHA 2VP5A 1YU9A 2J5XA 3MWKA 4ACAA 4F4JA 5J4VA 4DDUA 3A6PC 4BE7B 2XNDD 3PQCA 4EJSA 5FPHA 1WDTA 4UJ3A 4AI6A 1DAFA 3MCAA 1L2TA 1P2VA 1M8PA 4TLEA 2OCPA 5CK5A 4RFVA 5JCZA 1QF9A 1KDRA 3ADBA 1GL7A 2HYDA 4AYWA 1VCMA 4BWYA 3SC3A 1SVKA 1NI3A 4D4MA 1IY1A 1ZRHA 1M34E 3MUFA 1OHHD 2BJVA 1IM2A 3QEOA 4YXWA 2EW1A 1CRPA 1FUKA 4C0LA 1W2HA 1D5CA 1VG9B 3TK1A 5HKKA 3R9XA 1GAJA 4YDSA 3ASZA 3BFVA 5AUPB 1FX0A 4O3MA 2DYKA 3AUXA 4N1AA 5FBWB 3U44A 2IXEA 3QENA 2ZJ8A 3BS4A 3KUDA 1HQCA 1MO6A 1P6XA 2O0JA 4C30A 4ZDIA 3ICQB 4EUNA 3NBYC 5JSZB 3DOEA 1B23P 2BJWA 4DT1B 3OEHA 621PA 3CF2A 2VL7A 3PCRB 3AKEA 2OFOA 1DARA 5D3MA 4DHEA 3QF4A 3B7GA 1MO4A 1N6RA 5JJKA 1NVVQ 3EXAA 4EQ6B 4YDHB 4TYWA 1FPMA 5BWMA 5EXSA 3UPUA 5CIQA 5J4KA 1RYHA 1SKYB 1E2LA 1QBKC 1NVWQ 5JWRA 1W36B 4K81B 3LXRA 2GHIA 4E03A 4AKEA 3A1VA 2CCGA 3LAWA 4I1SA 4DLVA 1RJ9A 2IL1A 3I72A 2IUUA 1N3BA 3I3SR 3RC8A 4QNMA 2J59A 1AN0A 3KZ1E 3AVWA 1KSHA 5J4LA 1V5WA 3IBGA 1VMAA 2C9YA 4OQNA 5KNCA 2ORIA 2D4HA 4A4DA 3LNCA 3FHCB 4NCHA 2ZRLA 1KHTA 4EPTA 2FNAA 3S1AB 4P3YA 1OB5A 3GLGA 3B5JA 4Q9HA 3QSYA 3OEED 4JVNA 1UEIA 4ZDWA 5ANRB 1XMJA 1NKSA 1TPZA 2VSXA 3NH6A 4OK3A 3BWDD 3ND8A 4AYTA 5BYJA 5K8IA 1EWQA 3EPLA 2YV5A 3H4MA 3THWA 3THOA 2C95A 4IEIA 3AGQA 4NYMR 4US2R 5G3ZA 5DN6A 2AHOA 4RVCA 4E22A 1KY2A 1TQDA 4F4CA 1S4QA 4XD7D
chains in the Genus database with same CATH superfamily
1Z5VA 1EB9A 1IEXA 3ZOZA 5I7WA 2ZTUA 2AYXA 3WAKA 1I51A 4JC8A 5LCXA 3QXJA 3I42A 5IG2A 1NXPA 5DYYA 2OR3A 2R8RA 4BNFA 4DEVA 3WIOA 2C2OA 2G0AA 1NSFA 1AGXA 2ZBVA 1H94A 1I7LA 3OC6A 4JJ6A 1ARZA 5AJYA 3RHTA 4CV3A 2O8CB 2HXGA 1G64A 6AT1A 2HH9A 2PDAA 3AB3A 4RZ3A 1T0UA 3PXGA 4MJ7A 3STUA 4L85A 4BEVA 5LYJF 1PIWA 1QIEA 1D9ZA 2VF4X 2YVLA 1X8XA 4B4UA 1NE7A 5JNVA 4DFDA 1F7VA 4QTTB 3C0KA 4WN9A 2ZTVA 3OTOB 4AUNA 4DLTA 3L4KA 3UFXB 2KQUA 2OFPA 1LI5A 1W4AA 1BJKA 2GEFA 3ITNA 1XMPA 4LXGA 4P33A 3GLHE 3LHIA 4MINA 2AOTB 4V02A 2VPYA 3I9KA 4JLWA 4BKPA 1Y1QA 1YASA 2I3ZA 4JYPA 1NWHA 3UAWA 1E7WA 3NKLA 1IZZA 3URKA 1FFDA 1MTOA 1F3OA 1F38A 1FDSA 1ODKA 2MR5A 4Q1FA 3RWBA 5G0WA 3UGQA 3NC0C 3HXPA 1Q1NA 5IH3A 2B7BA 4R9SA 1M6NA 1Y5IA 2JJ1D 2ZWAA 1W5BA 2GLTA 2YICA 4ZVPA 2HMAA 2O1XA 2IE8A 3BE5A 4QWWA 5IK2D 1S8FA 4Q9KA 2FG5A 2FSUA 4EY3A 3CR3C 4BGUA 4DEXA 1KK2A 1SR8A 1ULSA 3MN1A 1HBJA 5FQOA 4CNQA 4CTMA 3BX1A 4CT4B 3EQZA 3VNVA 2UZAA 4JIMA 2H1RA 5JWHA 4O0MA 3Q7IA 4EKYA 1AHHA 1BEZA 1ZJ6A 3C1UA 5CM8B 1IAVA 3E2PA 4IEEA 3C41J 4XCVA 2MSDB 2Y2UA 1C80A 4KTTE 5E8JA 4C7KA 4WLUA 1A96A 2I7TA 3P9KA 4GRDA 4KLZA 1F4VA 3N53A 2BM0A 5LP6C 2GPTA 3PGXA 5B1YA 4LF6B 3REOA 1QHGA 3RODA 4HGPA 1U7OA 1Q50A 2OL4A 4G01B 4QJ3A 1WHSB 4DSOA 2Z6QA 2X8JA 4OI0A 3WXBA 4MLCA 4CJXA 3L6BA 4WZAA 5BV0A 1PUIA 3GGGA 4QBTA 4CM9D 5CDYA 1GVHA 2QJRA 1T5TA 1H2HA 1PF7E 1YC2A 4FYJA 4AM8A 4UQOA 4EPWA 1TCCA 2VJLA 1IMOA 1WVGA 4C3ZA 4LXUA 4FJ0A 4IWYA 4AFNA 2HLDD 4EG3A 2GEUA 3UYKA 3D6MA 1EAMA 1EDDA 3SEFA 3V1UA 4D9JA 5IJAA 2OY0A 3KUKA 4RVNA 4P7KA 3OZRA 1U9IC 1ZUD1 1GZ4A 1IOLA 1QG4A 2VZEA 3K0BA 1DG1G 3U5ZB 1B3BA 1I5OA 4ZOCA 2P2DA 2XUFA 2VSFA 4Y6QA 3T8YA 2IP2A 4HEQA 4J0CA 4US1R 3RVSA 1FNCA 2ETVA 3T5CA 1KORA 3G6WA 5HIIA 3QRWA 5FUMA 1GOTA 4DTIA 3FCSB 2XVZA 3P19A 4UZEA 3ZE1B 2C3PA 1OFUA 4G56A 1E1RD 1PZGA 2JA1A 1EFRD 3NHUA 2WJ6A 2NU7B 1Q22A 1Z56C 4UMFA 3R5FA 2FWAA 4PZLA 4E30A 3BIXA 3NVKI 3V32A 4MQ6A 3ZZUA 4EVRA 3WHIA 4FYWA 2Y3IA 1RHRA 1XNGA 4JDUA 3EW9A 2YJ5A 4KR9A 4D3XA 3KWLA 1CBUA 2XMRA 4U1RA 5CYOA 4I50A 3MB8A 4AJ4A 3FOCA 5B3KA 1AOXA 3H5LA 1EQ2A 4TWIA 3TI9A 5EN4A 2EF1A 3BFPA 4GWKA 2H4YA 3I52A 5CHYA 1D6MA 3B6IA 2PJZA 5KTNA 1K7YA 4MKHA 4M0MA 3ERCA 3IMFA 1DKQA 1LTQA 4BDTA 2CSXA 3R75A 3O47A 4B80A 2VHWA 1DO2A 1KFBB 4AJIA 4TSFD 4WUTA 4P38A 4B6PA 4F8EA 4I8IA 2IYYA 4CTKA 1L7AA 1OXKB 4E7OA 1MC8A 3N8IA 5K3OA 3MD0A 1APBA 4HY3A 2YNMA 2X23A 2JGFA 1IDN1 1TA9A 3LV8A 5CH3A 4QASA 5BN5A 4FNOA 2D0IA 3BFJA 3BC1A 3GEPA 3FGZA 1EVEA 2JBHA 4IDQA 5EZYF 3QYJA 3KETA 2XZLA 4O8ZA 4YBZA 1T8TA 4HDKA 3WP1B 5D87A 4FCCA 4LOIA 1CR0A 1CEEA 1EUDB 3MINA 3IOMA 4JUCA 3H9CA 4NZNA 5FKJA 2HK7A 2Y92A 5TT1A 5I9NA 2Q6KA 3GP8A 2IBSA 3P2YA 1XK6A 1ZA1A 2QAGC 1W93A 1XMSA 3QVXA 5AHWA 3S55A 4BJ6A 1CETA 4W7SA 3CUSA 3B6MA 3MWDB 4BIMA 1TNDA 2F17A 3UOGA 1R6TA 3BBLA 4OD0A 2HF9A 2CV0A 3CRMA 3SJAA 4BLUA 1HYEA 2HDOA 4N6OA 1E64A 2W42A 1YFKA 2MOKA 3SXUA 1QX4A 3LYLA 4ISCA 3WZMA 5GTDA 2AOWA 2EAUA 3FNIA 4AS2A 4YYZA 1I9GA 2VSNA 4J2TA 3OT1A 7MDHA 1ZYUA 2C61A 4M21A 3N8HA 4A27A 1H9CA 2BFCB 5TY0A 3OZTA 1BZYA 1ZVJA 6ADHA 2BCEA 3DHVA 3GAZA 1OA0A 4B3XA 1D0SA 3W2HA 7AT1A 3O4HA 4P9NA 3SIRA 3ZZNA 1XLTA 4PF1A 1ETUA 3ROKA 4TUYA 1WF6A 4D80A 1U8XX 3M34A 3FB4A 1X7YB 1X1RA 1G5PA 2OAEA 4YHHB 1MQ8B 1S6YA 3GF4A 5DHAA 3EPRA 3TLAA 3TXXA 3UKOA 4QOIA 5TQ2A 5JSHA 4NNPA 1KOLA 4D9KA 3QX9A 4RE5A 5KVQA 3ZY4A 2H5EA 4H6WA 4L3OA 1GTRA 2UVQA 4ZRNA 2OQ2A 5K3BA 2O48X 3JV7A 3RKSA 3S68A 1KQPA 1NWCA 3AUSA 2XR1A 2QRVA 1G6HA 3EFHA 1XU9A 1U3GA 3IQDB 3KWMA 1GLGA 1Z2OX 4QE3A 4JXZA 1DAHA 1E60A 2VJCA 3E82A 4S12A 3EBPA 5EFZA 4L73A 1AJEA 1ZD1A 1TLTA 4J7CA 4D92A 2HJ9A 2QQEA 5CXXA 4FFMA 1CUWA 2GZRA 4TX1A 1JRLA 1R3DA 2AOVA 2RGUA 5AI5A 5H81A 1UWVA 2Q1UA 4JLVA 5B3JA 3T3GA 3N2KA 1QAOA 1CFZA 1YMQA 3DEZA 1YI1A 4L6AA 4EBFA 1VLLA 4WLOA 3FPSA 2WWTA 5CVTA 3NHPA 2HJWA 2C4VA 1GFSA 2FWNA 2D2XA 2YHSA 3KSDO 1TOAA 3ONWA 4RDIA 2WD8A 3V2IA 2REBA 4D56A 2ESRA 3DLAA 2CNWD 2RHWA 3O8RA 2WQZA 2OECA 5C18A 3SIPA 5FI1B 1HDXA 4LRUA 3BRQA 3KKQA 4OHKA 4ZVKA 3SE0A 4NYMQ 1WX1A 4WFIA 3KE9A 4WGGA 4X24A 2AG0A 3JSAA 2VSOA 3TL3A 3VTAA 3RSLA 1P74A 5FD8A 1N6IA 4YX9A 2QNRA 3KALA 3MT9A 4MMXB 2B9VA 3AZPA 1U1IA 3MJCA 4G97A 5D2CA 1G6OA 1YJBA 4FFBA 4KE8A 4XASA 3ELBA 3SGLA 3VHXB 1JSLA 3N58A 2JJYA 2A59A 4AQDA 3WFJA 3FZQA 2IX3A 3D4IA 3ER8A 4KIJA 4O08A 2UZ1A 3V4OA 4B31A 4DNQA 2FSFA 1NQTA 1NBEA 5FL7A 3WNCA 3NHLA 2EDAA 2Z09A 3S2UA 1L1QA 3WIVA 4F71A 1TM7E 3KLNA 1NF8A 4RAOA 2R6R1 3MXTA 1WSBA 1UDXA 4Z99A 2BE7A 5BYAA 2PUBA 3LQRA 1U8EA 3D4OA 2A5JA 3MK31 2NV6A 4ARIA 4QHYA 1K6IA 1DC8A 1OREA 4FYHA 5I9SA 1RAFA 3A11A 2HSWA 4S04A 1IBCA 5B36A 1NC1A 1L4FA 1WCYA 4HBGA 2UUCB 3DP9A 3MVEA 1IIRA 4LZAA 4YAWA 2BTOA 5DTMA 4ZMRA 1JQLB 2Z2JA 2PIAA 4OH1A 5F9HA 3U4MA 2XRZA 3R7LA 3R7AA 2ZEJA 1UADA 4TQUS 4W5TA 3VV3A 1ISRA 1VGVA 3MAAC 4ECEA 2VAVA 4K8OA 2AE2A 3LT0A 5DU2A 3PD1A 1CLEA 4FQ5A 2JK0A 4GP9A 4WLFA 3K6SA 1JR2A 2YDXA 2ZJ6A 4GXQA 3RGWS 3H2YA 1DIRA 1IWPB 4AZWA 2PQMA 4AY5A 4Z49A 3EQ2A 5JFTA 1YRYE 1V9CA 1U0OC 4M9XA 2PUHA 3WX0A 4L5YA 4EHFA 4BNYA 3S1LA 2PL3A 3LHSA 4JUFA 3SJBA 1E9VA 1NW4A 4DC0A 1DAPA 2RGBA 3GJRA 4CRWB 1L7VC 3PNMA 1VLVA 3OX4A 1O95A 1MPXA 3HGQA 2VJMB 3KJNA 4LY9A 4D02A 1EDOA 3HWRA 3HXKA 4H7IA 2Q27A 5HF5A 2OXIA 3X1JA 5JDCA 3AHCA 4X9XA 5KWJA 4PEVA 4KPUB 1JAHA 1YI0A 1N6HA 1O97C 1G5TA 4DDTA 4E12A 1R6VA 5HX7A 1BH6A 1E2FA 1ODSA 1QIGA 4MV6A 1PBTA 2BEUA 1RACA 3MWLA 2YH2A 4OL9A 4K40A 4L76A 5BPFA 2RHMA 2Z30A 4LZJA 4RDHA 5EXXA 2X9GA 1M1ZA 4PQFA 5GINE 3INGA 4QBIA 1DDGA 1RAHA 1UWCA 4B8WA 2XD4A 2DULA 2FX3A 1AKVA 4YONB 1UKVY 4UCQA 3G59A 1VJCA 4PPYA 4A2WA 1C0LA 2B98A 3GJXC 4I4TF 5IDWA 1DXQA 3SQNA 3UPDA 3RHZA 4ENVA 2WOOA 3WNZA 3BN3A 4L22A 3R7SA 1U8YA 4PC7A 1QK3A 3IJPA 1G98A 2H2WA 2H1HA 3WWYA 1G60A 1HE4A 2F9LA 2C8KA 2P0EA 3C1AA 1G8PA 1II9A 1G21B 1RW4A 4I9GA 1VJTA 4IPTA 4KE7A 1L4EA 1BW9A 3OLWA 5HMLA 3ZK7A 3WQSB 4A8TA 4H4EA 1E2MA 4IO0A 3U1TA 4WBNF 4RXTA 5CFRA 3U44B 3T4PA 3RVDA 3I4LA 1ZFNA 2VO1A 3ETCA 5JS8A 3BL6A 3IHTA 4ZTZB 1RHMA 4JSTA 1FJ2A 3V3TA 1J6UA 3EH2A 2V5AA 1Z7BA 3EIHA 3KYCA 3ZD9A 2XITA 3DDSA 4DMHA 3OA2A 3NOVA 3RUAA 2VAMA 3FYCA 4L8WB 3D1VA 4F85A 4WVLA 2NO7A 2AFIB 4OJQA 4D5GA 4WK0B 4F4FA 1ABBA 4ZEMA 4IF6A 3PENA 2GZSA 4PLYA 1L4MA 1UEJA 4NU6A 3ZHOA 1Y33E 1A8IA 3D3EA 1KC3A 1Q7EA 2GJ4A 4N5IX 3AOEC 4OHMA 4YCDA 3UAXA 1DT3A 1MX1A 1PQ4A 2FPGB 3PIDA 3OQNA 3RAEC 1Z4PX 3OIWA 2Q62A 5I7UA 2SKDA 4D96A 3H5NA 3G2KA 1JG3A 3A2LA 1RKXA 3M89A 3SZRA 1KI2A 5EIBC 5FJIA 5TLSA 4KXYA 5IXJA 4KR0A 2V7WA 4PTYA 2QAIA 3KHTA 2O23A 3NORA 5EJFA 1RQLA 1P1FA 1N2BA 4JITA 3H5VA 1CG6A 2A8YA 13PKA 1A9OA 2XUQA 3A36A 4I4TB 3MWFA 4UUNA 5DYTA 4HVAA 5C1BA 5EXPA 2I4MA 3HEMA 1XTSA 4A8HA 2ZB7A 3L8FA 2AT1A 4TM7A 3SEAA 3G88A 1XQVA 4BZQA 4HAXA 1QH0A 3OLQA 3WKCA 5JR3A 4S24A 4W5JA 3MJHA 3RYFA 4QUEA 2D5IA 1BCRB 3OECA 4BGDA 2XXJA 2BKAA 3QTBA 4D45A 1Z75A 2HOQA 2Y66A 3ZC3A 2K2WA 2OCXA 4R7TA 4PRYA 5F73A 1C9DB 4XGNA 2Q8PA 2WM3A 4H1UA 1SVUA 2P5YA 3U3KA 2XT6A 1G17A 1JDSA 5I7AA 3O75A 3IVXA 1ZK4A 5DHQA 3GRUA 4PY2A 4R2HA 4CWAA 3O7WA 4OU4A 4UEJA 5HP4A 2IZ7A 1EJ6A 2P3QA 1KFKB 1ZQ1A 3HGMA 2MINA 2Q5IA 3DL4A 1VZ2A 1UBLS 1NVTA 5CDFE 1Q0RA 2P2ZA 3CX7A 3N87A 2QRNA 3E5MA 1QS0B 2QZ4A 2BH9A 2R0QC 2DY1A 4G65A 2Z04A 3G17A 4BNDB 4HLQB 2G7MC 5DN6D 4P4SB 4XUGB 4EYOA 2HK9A 4B3GA 1RI5A 1ZS9A 2PRSA 4M22A 1ECCA 2RGCA 3H6GA 2GJ9A 3NBAA 2ZYSA 4DDKA 3NHKA 3I6BA 5A4IS 4JKYA 4MQ5A 1RM3A 3ACCA 1X77A 3HDJA 2WVHA 3VMMA 1N75A 3HCNA 5KNLA 4RY0A 3EIXA 5K3AA 1EFRA 5GV8A 3HPRA 1VLMA 3GRAA 3R2JA 4HN4B 3UJBA 1GZ3A 4NXMB 3ZIDA 2H2HA 2DSTA 4ZC1A 5K3CA 4XGQA 5BUQA 1LCIA 2QENA 3KVVA 3LUKA 3DTYA 1N4AA 4B4OA 3N7TA 3DGFC 3OZCA 2V7XA 2FSPA 2GZ3A 5T4HA 5JYDA 1YK1A 4EKIA 1HZZC 1X2BA 2R7LA 4M87A 4P84A 1QGOA 4NCIA 2JCBA 4OL0A 1JIQA 1J2TA 4PNEA 2I33A 4R2KA 4CEJB 5EEHA 5EJIA 3A4IA 3KJEA 5IT0A 4LOKA 4NEQA 2IDMA 5H68A 4RJKA 3SYTA 4KREA 3L1VA 2EIXA 4FS8A 4NOMA 4QRDA 3FPBA 4OYYA 1I2BA 2ASEA 1DZ3A 1NLFA 1ANKA 1R8YA 5JD6A 4OHZA 1I1NA 2XCSB 2WTNA 1EESA 1FMFA 5K0CA 1TJ3A 3VSEA 1W8DA 2WE7A 5JQGF 3H04A 4WXMA 5I48A 3Q12A 3AZOA 2WT8A 2P2YA 3WLPA 2QTWB 3OM8A 3BQMB 4PFQA 3RE1A 1G38A 4GYKA 1FIUA 3B36A 4J7UA 3LY5A 4CMHA 2NLOA 5IDVA 1VSBA 2DM6A 1OFTA 3QWIA 1D03A 2BDEA 4OOFA 3ECCA 1W9MA 5HKLA 5BSVA 4LF7B 4EO4A 4CQMD 2VT3A 2JFHA 5KU7A 4Q4LA 5FV7A 4R84A 3HTXA 3N2ZB 3WB9A 4MWSA 3F4BA 1DQNA 5G1OA 5AM1A 1JIJA 1XN1A 2YZGA 4A91A 2BEKA 3ZZ0A 3TNJA 3A27A 5H8WA 1NNSA 1NYTA 3OE1A 5DJ5A 1NG1A 1Z15A 1JHPA 2H4WA 4P5PA 3IHLA 2REXB 4Y6GB 5AVYA 2D0DA 4EB3A 3ND5A 4RUKA 2I2DA 2YFKA 2PS0A 5E7QA 5CFLA 3IB3A 4GPIB 4NCNA 1E2DA 4F1WA 5EFOA 3AIIA 1N2EA 1NVKA 3KYCB 2QUJA 4NKRA 3FTEA 3ER9A 1Y8RB 3G1WA 4C20A 4ZODA 3ZU4A 3A9SA 4PZ0A 5A3SA 2XLBA 1TCAA 1YCFA 3UNXA 1UBKS 5D51S 4A23A 1T26A 4P6VF 3VPCA 3BH0A 4MB6A 4CTJA 3RSZA 2BGIA 1X7ZB 1YR3A 3ANTA 1P9LA 3EFOB 1CF2O 1T6ZA 1FS6A 1FXWF 2R6DA 3L8DA 2E85A 3PR2B 1GL9B 2PV7A 2VBFA 4HFJA 2WFLA 1H0KA 4P53A 2C84A 1GNVA 4X00A 1KNQA 1TVMA 4X8OA 5DI3B 1I7NA 4YP6A 5AKZA 1PNRA 4REQB 2H17A 5GMOA 4R3NA 5J2UF 3JVIA 3PX7A 1LS1A 3BOSA 3Q6MA 5JI3E 2FK7A 1H3EA 3PI7A 2Z4SA 4KQCA 3OJLA 1W36C 1R6BX 2WILA 4YCMA 1BVRA 3BUSA 5I9MA 1L5GB 1TRHA 3VNUA 1GP2A 1HYGA 4CM3A 3KDSE 2AFHE 1D8AA 1R0XA 2AJDA 2W37A 4X7BA 1YDHA 1CP3A 2JHCA 2KE5A 2H2IA 3Q8XB 3WL5A 5LBTA 4ETWA 5F98A 4XDZA 2CDNA 1WDWB 1PQUA 2VH1A 3P9NA 1T1IA 4OMFG 5JMWA 2CCKA 1JSRA 4FWBA 4QFMA 3QPCA 1JQBA 3FTDA 2IPMA 2M6RA 2WMYA 3PWKA 3UC5A 1PEYA 3UT0A 3TOXA 4CIXA 1K4MA 2YR0A 2P40A 4OOEA 1Z3CA 2VHUA 1KZ4A 1U8ZA 4Q00A 3SR3A 1FYXA 1RAIA 1K92A 2JRCA 4CV1A 4GM4A 1EWRA 2WV7A 3LLMA 3OZFA 3UCEA 4YJGB 5ITSA 1T3GA 1V9LA 3CF4A 3O94A 4FFVA 1HDCA 3KQVA 3RTCA 4B34A 5DHTA 2YWDA 4Y2PA 2P62A 2HFJA 1GXSA 1RIIA 1CDEA 3GEHA 1HWYA 2XSZD 4V1CB 3KJFA 4U0KA 4KK4A 5EMMA 3ZWPA 1HY3A 3U7JA 3GQVA 1SA0B 1DEHA 5GM2A 4RV4A 2XNSA 3TTYA 2YV4A 3DV2A 4CUZA 2NNLD 2AI3A 1IU9A 3G23A 4Q0MA 2BR3A 2I80A 2XE8A 4FYXA 4ECAA 5A3QA 2HXSA 4GKBA 2R1VA 4X93A 1SKBA 2H2AA 3AW9A 3BULA 3IUJA 1AQ6A 3KTDA 4YJDA 4HD8A 1W19A 3AJ8A 3NBKA 2Z5LA 1NHGA 4DUGA 4NFSA 5KVVA 1GTZA 1W75A 2BBOA 2Y0CA 1EB8A 3T7CA 4A15A 2GJKA 4WNAA 1X7XA 4FE3A 5D7NA 1K7EB 3M5DA 3SHTA 2AD1A 5JPIA 1PZMA 1PYOA 1T5LA 4KXFB 4AK9A 4EATA 3UJAA 5EJ9A 5IMSA 3IUEA 1P5JA 4C9BA 3NNDA 4U02A 1GU0A 1UK6A 1F5SA 3ZX5A 4DR5B 2G36A 3AKCA 2BTEA 3BD6A 3LRTA 5L3VA 3ZU2A 4C01A 2IEGA 4D8WA 2PS9A 3ND7A 2J6CA 4DMRA 2VI5A 4CM4A 1I6MA 3LHKA 1U0RA 4ND8B 2OAQ1 3I2KA 5H9WA 4J6EA 3SF8B 3HKCA 4FZVA 4HEJA 3RFVA 1JAIA 4GUAA 5J23A 5A0VA 5FWNA 1J8VA 4S1OA 4TQAA 3ICWA 5DIFA 5HFNA 1X1QA 1IXYA 2ZSJA 3WGQA 3B53X 3S5UA 3MLAA 4Q21A 2Q3EA 1Z0ZA 3C4JA 4HTAA 1UOQA 1J9EA 5MFPA 3ADCA 4TKUB 4R3UC 2OSVA 3AFNA 1P2UA 2VJYA 1TZBA 4TZTA 3IAUA 1G18A 1D04A 5E1OA 3UGKA 4IFBA 4ZOLF 2DFTA 1L7DA 2NYUA 1XZBA 4HI0E 3MUOA 5JSYA 5JATA 1KZYC 5IHPA 4BUZA 4KSCA 5FUWA 1QGED 1A72A 2LNDA 3AILA 1MB4A 3EQ7A 3L7KA 1PL0A 4HWGA 5DF1A 1ZM2A 3A0RB 2C2BA 5IC4A 4S0ZA 3OX2A 3G0HA 1QGDA 3RBZA 2ZJYA 2JANA 5ALMA 3FZEA 3LVBA 5KDLA 4DY6A 2OHJA 3QK7A 5K09A 2O8BA 5GAJA 4O2BA 2QLNA 1MG5A 4B47A 3P4YA 4B76A 3SMVA 3FX2A 4HQOA 5K01A 5BOVA 3WYDA 2NTVA 4YT4A 1Y4SA 1ZSYA 3A6KA 2GCGA 1N7GA 4F5YA 3LBIA 1JQ5A 2HPHA 4IHQA 1FW8A 4LF5B 1DPGA 1EVLA 3AM4A 4UDYX 1JQEA 1W5TA 3C3WA 4EX6A 2CNWA 3CZMA 2D74A 4B46A 2V58A 1E8NA 2H92A 1GPBA 2JFWA 2X22A 3TLYA 1WB5A 2JCSA 1JMKC 3PVSA 4D46A 3E3LA 4OXIA 4C7VA 5K8UA 3EBOA 3HCWA 2G1UA 5T4BA 5U4QA 2PBLA 4C7XA 4JEUA 4JT2A 4D43A 3HL0A 1GPH1 2RIPA 1SB9A 1T1GA 2OZEA 4WCFA 5ED0A 3DDCA 4AF6A 2N3ZA 3L93A 2HA0A 2P1ZA 4HAZA 3USZA 3HMQA 4H31A 3R1IA 2AEMA 3TJMA 1ECFA 1Y89A 4NFLA 4QXPA 1QIDA 4MVJG 4RQAA 2OC9A 1T4DA 3VTZA 4ML3A 2LZ0A 3BB1A 2R1TA 4ARBA 3OQMA 4CQMB 1FL9A 3EVZA 4EW3A 1XDWA 4YEDA 4A6XA 1I7DA 4MOWA 3STXA 1RBMA 4O1IA 3DMPA 3CVYA 1X1BA 1B8OA 5K0EA 4QFDA 2Q46A 2D1FA 3DG9A 3NB0A 2E4WA 4RADA 3T1QA 1N3YA 2GHQA 3CMMA 4TT3A 3OOWA 4LOLA 5TEVA 3L06A 4EB8A 4M1TA 5KOJB 2DWCA 3ZIAA 1SHLA 3F4LA 4PBSA 2COEA 4F04A 2J67A 4AX8A 4DVJA 4Q1BA 2CMDA 4FXPA 3I1YA 1DKOA 1R27A 4EQZA 4X6LA 2ZB4A 1LC0A 1FSZA 2XMSA 1JEYB 3GPDG 5A2QA 4KH0A 5A6SB 4KU4A 1Z5ZA 4MARA 3M5PA 1AS2A 4LNAA 4KQMA 4OQYA 1TKAA 5B4TA 4RZQA 4E32A 1AKEA 2AR0A 1VB3A 3L2OB 4HDKB 1H1LB 2CJPA 1Y8QB 3BCUA 3DEKA 2A2ZA 5CP8A 3EIFA 4OP3A 1OPXA 4WERA 4BO2A 3Q15C 4HDMA 3KHUA 2XB6A 1JEAA 4R1NA 2W58A 5HIMA 1UJMA 3WOHA 4PGHA 3DC7A 1KKLA 4BLTA 3VA7A 1BU8A 3OVMA 2Y76A 1XYVA 4B3HA 2AZMA 2CFOA 3VNSA 4J0QA 4KJZA 1M8FA 4JFRA 1OI4A 3P0FA 1XEWY 3G2QA 5ICFA 1KPHA 1Z33A 2R44A 3AL0C 2XB9A 3OE4A 5IUNC 1DEKA 2QMEA 1V35A 5C3UA 1RJFA 1M73E 2H57A 4LHVA 4Q3EA 3UG6A 1GJRA 3JWEA 1OB2A 4N9QA 4CVNA 1XJ0A 5C5DA 5EHXA 4Q66C 1Y7LA 2VDUE 4YT5A 4V03A 5AK0A 1XD2B 3TZKA 1JLLA 4TV8F 4NZYA 3UHAA 3WRYC 1JXAA 4DA8A 5H7XA 3H05A 1UINA 4ZYVA 3P1JA 3DZBA 1V8ZA 3GO4A 5DHUA 2GN1A 3OMXA 1P7ZA 3ZE7A 1F8XA 1VLQA 1H6AA 2BFDA 2IVFA 1V8FA 2YCLA 4GVLA 2WMDA 4I5IA 3OJOA 3TUJC 5K7SA 4A0QA 3EUWA 3IR6A 5LDGA 5F3DA 4ZI7A 3D4NA 4MP8A 3ROQA 5TS3A 4X62B 1DJPA 3D3KA 1K7CA 1SU7A 1C8KA 2W71A 3DOHA 3C8UA 5IASA 4H18A 1X80A 3K71B 3QFFA 5KKAA 3BWYA 2MSNA 1N2HA 3IP1A 4IDNA 1ST3A 3VC2A 1V5GA 2M9MA 4PX2A 1C29B 3RCBA 4DA0A 2YVAA 4HQ0A 1SN7A 3I5MA 2ZI5A 5JLAA 1KJJA 1XEAA 2CNDA 2JEOA 4ZI5A 4NYJR 1CZLA 4HTFA 1JR3D 2NPIA 1JHAA 3CYFA 1J2RA 3ZNQA 4CG1A 4G8JA 1JZTA 1FBNA 3MT0A 4KXWA 5IZCC 1L5HB 5AQEA 3DM9B 3RV3A 1NQUA 1XDUA 2GDJA 1AT1A 2HRCA 5C2JB 1EFUA 2FSVA 2W2LD 1P0QA 3DXZA 3AY6A 4MNTA 3S2ZA 4YXFA 3VFDA 4INOA 1L5MA 3QE3A 4N01A 4OXRA 1FFCA 3NANA 1CR4A 3DFFA 3UW3A 4E1BA 2R6FA 1I9CA 2OM6A 5DNCA 4YTEA 2NQTA 3TVYA 4YUAA 1AHNA 1F06A 3KJQA 1QYIA 3GBPA 2SNIE 4R0VA 4AP6A 2DERA 2HF8A 3FCCA 3OPYI 1GADO 2YX1A 2V9CA 4WNAB 4CKBA 2ODNA 5EIWA 5CB0A 2HYIC 3OOSA 3H16A 3MW8A 5EJGA 3ULKA 4W1SA 4XVQA 5FTJA 4C4XA 4Q4DA 2JGJA 1PGPA 2CXNA 3TE7A 4EKDA 5IU6A 5KNCD 4LBWA 1WZCA 5CAEA 3QSGA 1JHVA 3GD7A 4K8RB 4ZO6A 3DM5A 1YJAA 4IHJF 1G8FA 1ZK3A 4C5CA 5L9AA 1BMFD 2H63A 3I28A 2ERCA 3S44A 1ISSA 2VXBA 4R6XA 3IP5A 3MWEA 5AOCA 4IFTA 4ND7A 1UBOS 2G40A 2QVLA 2OBLA 3QTLA 1QNLA 1JR3A 1AO3A 2BM1A 4R9VA 2E5LB 2NVOA 3SI7A 3NV7A 4FP9A 1PT7A 3KKZA 5COQA 4QEKA 2I2AA 2NSJA 3I01A 3QPAA 1P4GA 5CW1A 2ECQA 4OXNA 5GV7A 1L1EA 3NBQA 1CJTC 3D9QX 1AG9A 1AKYA 5GJVC 3KHKA 1T15A 3HUDA 4ARAA 3I9OA 4EHDA 3OLVA 1VC2A 1D0IA 3C3BA 2WJAA 3KNZA 1KQOA 3HJAA 3KM0A 3LDHA 1L5NA 5JYBA 2H1VA 4P3NA 1J1IA 2D5AA 3OD5A 2TSYB 1PX2A 2GAOA 1TL7C 3N2GA 3QKIA 2FI1A 4FHCA 4JENA 2XKBA 4IMIB 1FXSA 3F5QA 2JIMA 3IR7A 3PNPA 1ESDA 5HKKD 3J81k 2VPPA 2XQVA 3OU7A 3A6LA 1LGYA 2F3TA 8ADHA 4IIFA 1H1TA 4M36A 4ZT2A 1RYMA 3PK0A 4EG4A 3UK6A 2XECA 3A1NA 1C1HA 1EEHA 3GDWA 3ORRA 2XUIA 4WUVA 4NTZA 1VHLA 2IUSA 3AV0B 1A9SA 4G4JA 4FKBA 4JS0A 1ZLXA 2DUUA 4UE2A 2FPPA 2PU7A 1TT5B 3DUWA 1K8XB 2B6HA 3VC1A 2FZCA 3OF5A 4KW7A 1AXGA 8ATCA 2R1TB 2X1MA 3IHWA 1Z4KA 2CV2A 2YJ6A 1GCGA 2C3OA 4KO3S 2DOKA 2RBKA 4UCXA 5IKPA 4HUQB 5H80A 1Y9EA 4BRSA 1DAGA 4G85A 3UUFA 1AMUA 4QFBA 4EAAA 3THWB 1LDNA 1W4CA 3GJ5A 1F2UA 4WINA 1PE0A 2A3RA 4NU0A 3D0RA 1H8HD 1KE1A 3BHMA 4KPYA 4HQLA 3QXXA 5FA8A 2JLYA 2PCJA 2XTJA 1QFJA 5CB8A 2QTFA 2WG1A 4JXKA 5E0KB 1RQ7A 3WRVA 4ER6A 1BS1A 3MINB 2FOXA 2YS7A 3PZRA 2NZ2A 1DTWB 2O7RA 2PRKA 4ITUA 4UNIA 5ER9A 3K1JA 3C3DA 1TZMA 1GYRA 4I81A 4ZZ3A 3S2SA 5KYYB 3EIEA 3LSYA 1VCNA 3PTZA 3HRIA 2X15A 3AW8A 1NVAA 3H5WA 4ODIA 3ZK8A 1S2LA 1EVQA 1FFXA 1BQ3A 1D2AA 2PJRA 2X8AA 2H0RA 4B85A 4M1ZA 3QE9Y 1HX7A 2GK3A 3U3JA 2XMDA 3DW3X 4HEHA 3V4SA 1BE6A 4AMUA 1UBRS 3L8EA 5FPSA 4RS3A 4UVEA 4ZEWA 3UB2A 3GRPA 3ZKWA 1W4RA 3EQ9A 1F5NA 2JJ8A 1GTMA 1QCYA 2B21A 1UBUS 1X0XA 2QT0A 4PZAA 2SHKA 5EE0A 4BV8A 2C0CA 2JD2A 5B55A 5FTLA 4C6SA 5JDIC 1L9XA 4YNBA 2I22A 4EQ6A 5L8VA 1EUZA 4BAUA 1NNLA 4TLBA 3KT3A 3D2CA 4KSBA 2R9VA 5TVKA 3FM9A 6REQA 3ENNA 4AUKA 2JIPA 3MRXA 1AUOA 3NVMB 2QB5A 4KBGA 5HA5A 1QDEA 3RAFC 3LVRE 2WU4A 4GMKA 3WL6A 3WTBA 1FF9A 4CEJA 1V5FA 1XSEA 2XTZA 4BVHA 2PL5A 3WE7A 5MN6A 1E7SA 3LT4A 2A4MA 4L5CA 5CLHA 2G5GX 3E3OA 1DKMA 4AJJA 2J7PA 4P2GA 2V6JA 5EIEA 4X1KA 3AKZA 3L6EA 1QRRA 1HLGA 2ID7A 3O2SB 1Y6FA 2IS2A 3KB8A 1SULA 4OHUA 3ZHBA 4E2XA 2UUAB 1FU4A 4A0GA 1JR3E 2NM0A 1QONA 3O92A 4L78A 3VZSA 2BHTA 5KWIA 2VOJA 3A10A 1XJWA 4CPDA 3AETB 2D4AA 2I5PO 1YR8A 5K3EA 3WLJA 4NSNA 5KYWA 1S96A 2O9JA 1VJ5A 1YFJA 2NO0A 4MRMA 3DLBA 1ZGGA 4PC6A 1QDUA 4G6ZA 5L3ZA 3UICA 2FX2A 6YASA 4V1CA 1H66A 3LQKA 2QSUA 4CM9A 5LIRA 2E1RA 5ECYA 1W9HA 1KGDA 3FPHA 2JLBA 2W0MA 4PXSA 3DKKA 1PTJA 3M6MD 3CZ9A 3MPOA 2JGEA 1JSZA 3QLTA 3ZBQA 4YFVA 3N5KA 1W4ZA 3O8CA 3QLVA 2KSQA 1ZXXA 2CLDX 1JG6A 4NY1A 1KMCA 1I3KA 4PM4A 3DFKA 1E4EA 5LNK6 4MVJA 1SZCA 2PRIA 3HUEA 5C8YA 3I34X 3TNFA 3DE3X 1B8NA 4EGFA 4PZUA 2B1JA 2KI5A 3SU8A 4KUHA 3HVRA 1Z4JA 2IX9A 4TQ9A 2WAAA 1IJFA 1XKQA 4LKRA 2QM7A 3LECA 4ZGGA 4A10A 5FOQA 4MWGA 4MV5A 3U81A 4MRAA 4LAFA 4JBXA 1YZHA 3LWBA 1XTVA 5AI9A 3KLOA 2OCGA 1QHFA 1CQXA 1BWQA 1MAAA 1FA9A 1RZVA 2CDBA 4EOGA 1J24A 3FCEA 2RKWA 3R6WA 4YRIA 5JEEA 4RL4A 4MWZA 5B6IA 1L8QA 1U7XA 1M6VA 3ZQJA 3BXXA 3NNSA 1H5UA 4WPGA 3MFQA 3I30X 3DQQA 1E4OA 2P6OA 3IH5A 3D2BA 1P0IA 2DBRA 1G5IA 1NG9A 1GWNA 3PE6A 3RTGA 4Q01A 1WD7A 3DMYA 5J5CA 3KKEA 3SPXA 4KFCA 3HACA 1GARA 4LZZA 1SOUA 3R77A 4DNOA 1NMQA 2AVDA 1J00A 3DWEX 4RZIA 3X2EA 4DW8A 5IYZA 2VK4A 1ODCA 5TF4A 4ZAYA 2QTTA 5CFZA 1G2IA 4JZYA 1L5OA 5K99A 2UYCA 4LXTA 1X1SA 4CR6A 1AQUA 1PWZA 4D25A 2Q28A 3RLFA 1TM1E 1ONSA 2YJZA 4LPKA 5CT9A 2G8LA 5AKKA 4HXYA 4QDKA 1SIWA 2Q6OA 3GPLA 2DBVO 1AGYA 3EA0A 1CUFA 5EJ2A 4E5VA 1DGQA 1O6GA 2QZSA 5BN3B 3ZOKA 5D7BA 3RKRA 1YL7A 2PMBA 2A33A 4IXMA 3SJUA 3WDLA 3FG9A 2ERXA 4UNRA 5J4HA 1YAJA 2IK8A 3TTXA 5JAQA 2OG1A 3EXFA 3RK0A 1V48A 3LXXA 2W2VA 1FDWA 3LX6A 1B6TA 1WMDA 3AY3A 3V9AA 2B35A 4MPPA 3VZRA 4KR3A 1T5SA 4J0IA 3ZI7A 5LIPA 1MXHA 2Q9AA 3FZNA 3AR8A 3OIFA 4RKEA 4QQKA 4HV4A 1KY5A 1J2EA 1BOFA 1L4LA 1A8UA 2Y6UA 4MI9A 4A9AA 4IUCS 3RUHA 5JBIA 5LQUA 1YNOA 2MYPA 2OCBA 3IP8A 4FZJA 2IE0A 2P4UA 2QZJA 2V8BA 1HNZB 5FEMA 2W7TA 2EX4A 4I46A 5GJBA 1L7PA 3DFZA 3M4ZA 1AGPA 5T67A 1DPFA 3C3EA 1XHLA 1EPUA 2IV3A 2ZIXB 4HWRA 3UWSA 1Y63A 3MCUA 4AY3A 4BX3A