4MOWA

Crystal structure of a putative glucose 1-dehydrogenase from burkholderia cenocepacia j2315
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
248
structure length
248
Chain Sequence
MSKLAGKVAIVTGASKGIGAAIAKALADEGAAVVVNYASSKAGADAVVSAITEAGGRAVAVGGDVSKAADAQRIVDTAIETYGRLDVLVNNSGVYEFAPIEAITEEHYRRQFDTNVFGVLLTTQAAVKHLGEGASIINISSVVTSITPPASAVYSGTKGAVDAITGVLALELGPRKIRVNAINPGMIVTEGTHSAGIIGSDLEAQVLGQTPLGRLGEPNDIASVAVFLASDDARWMTGEHLVVSGGLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Glucose 1-dehydrogenase
publication title Crystal structure of a putative glucose 1-dehydrogenase from Burkholderia cenocepacia J2315
rcsb
source organism Burkholderia cenocepacia
total genus 90
structure length 248
sequence length 248
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.47: Glucose 1-dehydrogenase (NAD(P)(+)).
pdb deposition date 2013-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4mowA00
4GLOA 4XYBA 1DIAA 4KUEA 1LDNA 3DBRA 4NMHA 1CETA 3VTFA 3TFOA 5LC1A 1HSOA 2OFPA 3M6IA 3GA0A 1KVSA 2PGLA 4EJ6A 4NBVA 3FTNA 3R6DA 4BL5A 1PR9A 2HK8A 1JWAB 1FK8A 2ZYAA 1BXGA 3QA9A 2VZ9A 4IIUA 2UAGA 4PG4A 2AHRA 1A4UA 1HL3A 1GV1A 1PQPA 1NYTA 1GPDG 5HBRA 3B1JA 5CDGA 1Q0HA 1R0SA 4R1UA 2P5YA 3U5TA 4GWKA 3MTJA 4NFHA 4RVUA 4GX1A 3PIIA 2X1HA 5TJ9A 3DB2A 2OORA 4XEHA 2X0RA 3BTSA 2NLOA 4CL8A 5BQFA 2YDXA 3WXBA 1Z6ZA 1EE2A 1LJ8A 3E9MA 5ILGA 4YDRA 1ZK3A 4XIYA 5KCZA 3U4CA 1EE9A 4WEQA 4IIVA 1JTVA 5JW6A 1NR1A 1XELA 1PJ3A 5COBA 1V3UA 4FW8A 5CEFA 2VUSA 1YBMA 4TSKA 3QSGA 5IDXA 1EFKA 3WGOA 2FN7A 4HFJA 1I2BA 4WPGA 1BW9B 3GVIA 4FIZA 1BG6A 3ZWWA 3I83A 5L9AA 1LC0A 1I24A 1U3VA 2O2SA 3DBLB 3M1AA 2B4QA 2EV9A 2GD1O 2XOXA 2B37A 3NT4A 7MDHA 4XGIA 4IINA 3RU7A 1TXGA 3F9IA 1NP3A 1DAOA 3G49A 1PGNA 4P4GA 1KOLA 1EDZA 1FDWA 4K1LA 4MIOA 3E03A 3QWIA 4MVJH 5T57A 4XDZA 3H2ZA 1LLDA 3CZMA 4A26A 1EDOA 2Y0EA 3DONA 1JAYA 4QO8A 3KYBA 1TT7A 2W4QA 3K2EA 4BGEA 3S1LA 4MP6A 4IQ0A 3U0BA 3ROMA 3ZV3A 1MP0A 1NVTA 4BO6A 1CERA 3A1NA 3DAGA 1Y5RA 3NJ8A 1F8FA 1HDZA 3AWDA 1YDWA 5TLSA 5DCWA 3PJEA 3R3SA 3IOYA 4U7WA 3R3JA 4YT5A 5EQDA 3GAFA 1E3EA 2PGJA 2DTEA 3DZFA 4O63O 5BNFA 4AICA 3WG9A 4XA8A 5TT1A 3QWAA 4B8WA 3E9NA 5B37A 1UH5A 2ZQZA 2P91A 3UKOA 1BW9A 1OC4A 4QO7A 1WAMA 3IIEA 3GH3A 5BSFA 3DBLA 4RVHA 2BGLA 4AJJA 1EFLA 2CNBA 3RUDA 2PV7A 4LK3A 2VYVA 3AOEA 3NAQA 4UEJA 4YRBA 1AGNA 3ONDA 1Q2XA 4FC6A 5L95A 4YJGB 2UYYA 4CM9D 3ZWCA 1H6AA 2DTXA 4PLYA 5T8KA 3DDNA 1HDYA 3GRPA 3BMCB 4M89A 3ZH2A 4NJOA 3DZJA 3BHMA 1BTOA 4IMPA 4TRRA 1Y7TA 1LUAA 2EW2A 3UGKA 4I5GA 4BNMA 1IHYA 1V0JA 4BKQA 3EY4A 2ZQYA 4JJFA 4RPGA 4FFOA 3OA0A 3QHAA 4R9SA 2HKIA 2XF8A 2AQ8A 4QEDA 4MOWA 4WJZA 5HS4A 4RF2A 1N5DA 1T4BA 2HRZA 4IS3A 4J7UA 3H7AA 3I9KA 4XIJA 1CRWG 5I7FA 4JJGA 5ICMA 4BNGA 2Q99A 1LDGA 2D5AA 1EUZA 4EUEA 3AI2A 3JQFA 5G2OA 5I9MA 1TEHA 2X23A 1ONPA 4R1TA 5IG2A 3HZZA 4CMEA 2GN4A 1PGJA 1PGQA 1F06A 1GADO 1MG5A 1OFGA 2FOIA 4OMUA 5AXBA 4TMFA 3WGYA 3UXYA 2DPGA 5F1PA 4P38A 5KJ6A 3ROQA 1U8XX 3GC6A 2VUUA 3RKRA 4YJGA 1YRLA 1F8GA 4OSPA 2HMVA 1O0SA 3RUHA 3ADPA 4LVUA 4OXKA 3F6YA 2EWMA 4N5MA 5AYVA 5IN5A 3BMCA 4J1QA 1MX3A 4NDNE 1HZZA 1A9ZA 4DQVA 3LVFO 5JYEA 1TLTA 2GLXA 5JPIA 4TZTA 2JFHA 5FFFA 4FN4A 3WWZA 4LCEA 2DUUA 4NBTA 3Q3CA 5TRTA 4DUPA 4E2YA 3W4KA 2J5RA 2JFGA 1RJWA 2PKQO 2G1UA 1MGOA 1BWSA 4MKXA 1PZHA 2YFHA 3WBBA 1NHWA 2R00A 3ZW9A 2P2SA 2HMWA 1CQJA 3OHSX 3ZZNA 9LDBA 2IZ1A 3PGXA 3ZGYA 3BTUA 3OIFA 4INAA 5L40A 4IQGA 4E31A 1Y8RB 1E6UA 4OKNA 1UDCA 1D8AA 3L6EA 1X7GA 1P1JA 2HK7A 5A5EA 3FSRA 1EK5A 2EGHA 2QQ5A 3FBTA 1VL0A 4TKMA 1H9BA 1PZGA 3H9UA 3UF0A 1JLLA 4GGOA 2GR9A 3I4FA 1NPYA 4CR8A 4GVLA 4Q39A 1D1TA 4UREA 3DO5A 2JKVA 2X8LA 1MC5A 3OSUA 5DOZA 3AY6A 5TF4A 1DLJA 4X54A 4I9UA 4A2CA 3AOEC 4DC1A 1LNQA 1VM6A 1OZAA 1T2EA 2AG8A 2BLLA 1Q0LA 3ONFA 4YAEA 5TS3A 3SXPA 4XGNA 1HXHA 2W98A 4JIGA 3C1TA 3PFWO 1Z7BA 1G0NA 5K9ZA 4WE3A 2Y0CA 1DIBA 1R16A 2IXBA 3PI7A 5IXSA 2CVOA 5L51A 3PYXA 4TRMA 5FF9A 1M2WA 3VPGA 2EIHA 4A03A 2Y05A 4YAGA 2YUTA 5EINA 1J49A 2NQ8A 3TZCA 5JCJA 2VYVD 4GQAA 3ZWVA 1A4IA 3ZV4A 1Q1NA 4Z0TA 4YAKA 5JDIA 1Y8RA 4CLOB 3I52A 4RPJA 2D4AA 4NI5A 1E92A 3ZWBA 2A92A 1GTMA 2YJZA 3GPIA 1KEUA 1X15A 3ITKA 3KUXA 3OMLA 5BNTA 8LDHA 1PJTA 2DVMA 2VWQA 1HDXA 3ETGA 3T7CA 3ANLA 1E7QA 1E3IA 1NPDA 5IDQA 4WK6A 3JQFC 2P9GA 2WYVA 3KHUA 4CMEC 2X0NA 3OETA 3RWBA 2AEJA 3JYLA 1T1RA 2VHZA 4QTZA 3TPCA 4A73A 4A5OA 1YH3A 2PKQP 3GN1A 5CDUA 2VN8A 5EMHA 3I9NA 1YJ8A 3OM9A 1O9BA 1DHRA 4BNWA 1NXQA 3WQQA 3FBGA 4FS3A 4PLVA 5KIAA 5ER6A 4PLGA 4PVCA 3KO8A 3ETDA 3UCXA 4BNYA 4NG5A 3WJ7A 2J5KA 2X5OA 2A9FA 5BSGA 4BKUA 5G0UA 1P0CA 2JHFA 2AEFA 5ADHA 2AG5A 1DJNA 1GEGA 2HU2A 1PZFA 4J7XA 2YY7A 4IZIA 4YEDA 2P5UA 4TRJA 4ZVVA 3SVTA 4Q3BA 2BFAA 1PQWA 4BO5A 1NVMB 4HNHA 4PRKA 5DN9A 2BHLA 4CLOA 3ZV6A 1EVYA 4BO9A 5TT0A 1VRWA 2R00C 3EVTA 3FPCA 3NV9A 4FGWA 4OYRA 1B7GO 2ZB4A 3PQFA 4IDFA 3WGTA 4PLCA 2B36A 2Q45A 3JD0A 4OO3A 3JYQA 4U5QA 3DZGA 3NRCA 2BH9A 1PSDA 4YB8A 5I8ZA 2RHRA 5JNLA 3OECA 1ZMOA 2BGKA 1DOHA 4M54A 2ZB3A 3MJVA 4MIEA 4P4LA 2NVBA 3FNHA 3F1KA 3B20A 4MIYA 3C7AA 1WW8A 4FD3A 1KVTA 1XGKA 3LT1A 3UN1A 3EAGA 2Q4EA 1MXFA 2FR1A 4M1QA 4L0QA 4CM3A 1LC3A 3LC2O 1GU7A 3KSDO 3SBOA 3CEAA 1QYWA 4KDEA 1BDBA 4BMSA 2EKQA 3MOGA 2AW5A 2LDBA 3QJ5A 3RI3A 5A1TA 3P2YA 4IJVA 3RKUA 1M6WA 2WD8A 3NDJA 4KP7A 1ONNA 1B3RA 2J5QA 3P7MA 5JAZA 1C1DB 1R4MB 1CYDA 4DVJA 4AJ1A 3DTTA 2JL1A 3BHIA 2PD4A 3U4DA 1YL5A 2OUIA 3PHLA 3VVBA 5JDIC 4OJNA 5JAQA 2AXQA 1OI7A 1B8PA 2J6IA 3R0IA 3RROA 2VWHA 1LRKA 4XQ9A 4RJTA 1NBOA 4CV3A 2LDXA 4DIBA 5EESA 5JMPA 1HYGA 3OJOA 2CD9A 4JGBA 4ITUA 1BVRA 1MXHA 3CH6A 3KRTA 2O4CA 1FMCA 4QFDA 1XQ6A 5TX7A 3DXFA 4R16A 5DZSA 3KB6A 5KNLA 5FWNA 2W8ZA 1WVGA 5THQA 1D4FA 1NNUA 1WP4A 5CPFA 5JCJD 4WNCA 4J1SA 1TT5A 5A5FA 3V1UA 4UAGA 2FR8A 1ZNQO 4GSKA 5KJCA 2GO1A 3N58A 4GPD1 5IF3A 1LSJA 1DC5A 1UP7A 5F1KA 2G5CA 5JDCA 3HG7A 1U7HA 1V35A 1C1DA 2WSBA 2PTGA 3SC4A 4B7CA 1R4MA 1W73A 1YXMA 4IUYA 1YB1A 2NV6A 1LRJA 4RZHA 4AJ4A 4AJPA 1AUPA 4RVDA 4ND5A 3IUPA 4FSHA 4G81A 1LQUA 3DZIA 2IYOA 5JY1A 4AJIA 4FBGA 3AFMA 4BNFA 2FWMX 1YBVA 3VPSA 2JCVA 3DHYA 4AJ2A 1LTHR 5T64A 2Q1TA 3WOHA 2QYSA 3IJPA 3CTMA 1PJSA 4IXTA 3U09A 3DTYA 3OQBA 3U9LA 4UUMA 5U1PA 4MVJF 4RQUA 4BS9A 1ZSYA 2BMAA 5IAAA 2NADA 2QZZA 2Y99A 1HDOA 3VDQA 4IZHA 4EW6A 3T4XA 4J0FA 5IDWA 1A5ZA 4D46A 4BNUA 3SEFA 2HUNA 1O95A 3GG2A 1YVEI 2ZTVA 1H2HA 1SEPA 4Z6KA 3E82A 1TI7A 4IY1A 4ZJUA 1YE3A 2Q2VA 4J9VA 2A4KA 3PEFA 3DWFA 4ZU3A 4BNXA 4UUNA 2O3TA 1QLHA 5G0WA 1Q7CA 1ID1A 2J3IA 3H6KA 4W82A 2NVUB 5CDTA 1I3LA 2HSDA 3FHLA 3ASVA 3JQ8B 3LU1A 1ZJZA 1FXSA 2POQX 1YKFA 3LZ6A 1XU7A 3ZWOA 5ITWA 3O38A 2O23A 4FFMA 2C5AA 4XR4A 1T2FA 2VRCA 1AHIA 3PVZA 4DMLA 5AQ1A 3HE3A 3DBVO 5JC1A 3H9QA 5JXWA 1LLCA 4I9HA 4HV4A 3PFFA 1ULSA 2X6TA 3ENNA 3EVNA 3AI3A 3OQ6A 4WLFA 1TVEA 2RIRA 3A28A 2BD0A 2Q1WA 1U4OA 2ZTMA 1E7SA 4J4HA 1KVUA 3OH8A 3WLFA 5G0VA 1OAAA 1WDLA 3OJFA 5I7SA 3MJTA 5JCXA 4NHEA 1BRMA 4I5FA 2JFFA 1U9JA 4J49A 1C1XB 1F17A 1NTOA 2XAAA 3OA2A 4ZQHA 4NZ9A 5JDCC 2VYND 3SLGA 3UH1A 4PFJA 2NVUA 3AK4A 1YB5A 3ZU3A 1HE4A 5JAIA 1L7EA 3BMQB 3HDQA 1GFSA 4LVCA 2SCUA 3JQ8A 1XEAA 1JKIA 5FI3A 4Z0PA 5KVQA 3CMMA 3WFIA 4YYZA 1ZK2A 3ZHXA 5CPBA 1L1FA 3QW2A 4FPXA 2NUAA 3H2SA 2ZYDA 2Y1EA 1GCUA 4W9NC 1NAIA 2FR0A 5A04A 4AFNA 4WGGA 4JN6B 4TROA 3M2TA 3EC7A 4W99A 1O5IA 3K30A 5KTKA 3ETEA 4DBVO 2RH4A 4DPMA 4L8VA 3C24A 2GYYA 2C7VA 4FFPA 5DP1A 4OKIA 2OXIA 1I5RA 3I6IA 5T5QA 2DFVA 4JP3A 3KLMX 3M1LA 4L4XA 3VVCA 4EDFA 2VUTA 2QX7A 2UVDA 1ARZA 3GEDA 5DBFA 3DAPA 3RBVA 3GHHA 3PHIA 3DOOA 2GUGA 4KWIA 1TA4A 3TJRA 1HE3A 2PLAA 3K73O 1MG0A 3MJ4A 2D0IA 3B1KA 3JQBA 4D3FA 4P4NA 4IJWA 4BNKA 2EKPA 3BMQA 5KJ1A 5L3ZA 4E32A 4XRGA 1PU2A 2X22A 1P31A 2Z95A 5HA5A 2V6GA 1T2AA 1PJ2A 2VOJA 1WDMA 4J4TA 1SC6A 4BKPA 4CQMD 1IPEA 3PHJA 3JD4A 4BKRA 5GMOA 1ONOA 2BRUA 3UW3A 3ZU2A 4PRLA 2PZLA 4OIMA 4BQPA 2DQ4A 2QRLA 4HX5A 2Y1GA 4XB1A 3RUIA 3HDYA 2Q50A 1QG6A 1HTBA 4HP8A 4QX6A 1P1RA 1T2DA 3GZ4A 3D64A 4EUHA 2HMUA 4GMFA 4BNTA 3S2EA 3SLKA 4B8ZA 4YXFA 3D5TA 3D3EA 4OSOA 4IDCA 5DCUA 4PVDA 3OIDA 4WOKA 2CDAA 2Q2WA 3GG9A 1SOVA 3PRJA 4NK4A 4E2WA 1WMAA 3NDIA 2VRCD 3KYCA 4R5MA 1S6YA 3ZI0A 3PK0A 3I6QA 2Y1CA 2ET6A 5ENVA 1J4AA 4M49A 3KYDA 4KTVE 5BSHA 2DBRA 2FPIA 5KJFA 7ADHA 4TZKA 2I66A 3IS3A 4E30A 5EIOA 5I8WA 2FZWA 3PDJA 4U6QA 3D0OA 1XG5A 4FJ1A 4CLDA 4ALKA 3HADA 5BNIA 2AQKA 1RYEA 1IPFA 3C85A 4B79A 1BGVA 3LDHA 4Y67A 3WGQA 1LBEA 1NPTO 1YQXA 4DWVA 4PG8A 3ZW8A 1Y9AA 3GUCA 2DBZA 3Q2IA 1VKOA 3FWNA 4N18A 3RAJA 2OO5A 4XYLA 2OOSA 1GL3A 4PIVA 4MDHA 2UUPA 3TZQA 2JCYA 3DOJA 4RF3A 4BMNA 3DMTA 5C3MA 3H3FA 3L4BA 1U3TA 3VH1A 2HLPA 4Z9XA 4YPOA 3SX2A 4FGSA 1MA0A 2EP7A 3F47A 2AA3A 4WLUA 4D7AA 2D2IA 1RYDA 3GGGA 1ISIA 2B4RO 1VKNA 3WX0A 4DA9A 4AJKA 2Q1SA 1HLPA 2YQ5A 2CVQA 2NTNA 4O6VA 4YQYA 5IDYA 1IE3A 1C0LA 4Q3AA 1N1EA 4E2ZA 4J2OA 1XSEA 3F5QA 3K6JA 1B8UA 3JQBC 4GBJA 3F3SA 1T24A 1UUFA 1E3SA 2Y68A 3GDFA 5KKAA 1K3TA 4ID9A 2H63A 1FJHA 3HN2A 5L53A 3QVXA 3GDGA 1EVJA 1NM5A 3WR5A 1KVQA 3F46A 2X58A 1NQTA 2I76A 3EMKA 3WMWA 2WYUA 3TSCA 3LSYA 4S3MA 3HNPA 2AE2A 4CLXA 2B35A 4O0LA 2O7SA 2OL4A 4ZRNA 3GPDG 3ZCXA 4RV9A 4QFCA 1GZ4A 1I3KA 3TOZA 1QYXA 2CF5A 4RQTA 1LDBA 2Q46A 2BGMA 3CE6A 3RC9A 2VWGA 1VL6A 3DC2A 2Y93A 1E1MA 1Y8QB 2H6EA 3GFBA 3JSAA 4BO3A 2PR2A 1LQTA 3NKLA 3QVTA 3DMYA 3UAGA 2O3RA 1C14A 5F5NA 3RASA 4BNVA 5GZ3A 1LSOA 2BKAA 4MO2A 3IKVA 2DM6A 4FFLA 4K6FA 3MWDB 2NWQA 2Y1FA 4FFRA 4Q9NA 2YHUA 2JHGA 3ZWAA 3UCEA 1CF2O 1QP8A 4YAIA 3KXDA 4CM1A 1PJBA 4HXYA 1QR6A 1SBYA 1WMBA 3I9LA 4GL4A 4MINA 4R54A 4YTEA 1BHSA 5TJHA 1X0VA 1P3DA 1HKUA 4Y6SA 3VTZA 5B1YA 3VOSA 4G5HA 2BELA 4IJKA 3WSWA 4Z3KA 1T1SA 2C59A 4YQZA 1DIRA 5HS6A 1UXIA 4WECA 2CY0A 4BO4A 3PXXA 4EGFA 1IL0A 4DXHA 2GN8A 1I10A 2XXJA 1B0AA 4PLFA 1NQOA 2YQ4A 4OAQA 4EI2A 4BNHA 5JE8A 2P9EA 3VHRA 5T6BA 5L4NA 4Q3EA 1HWYA 4Y98A 3WTBA 3A14A 1XR3A 2CDCA 1DBVO 4MJLA 2EP5A 3MTGA 2OZPA 1Y8QA 1DRVA 4LGVA 1NWHA 3DMTC 1U3UA 1PJLA 2VOEA 2ZTUA 2DBVO 2NU8A 1F12A 2WEKA 5HM8A 3L4BC 4PLHA 2IEDA 3T7EA 3B6ZA 1QYDA 3WTCA 1XKQA 3E6AA 3LLVA 1EBFA 5JS6A 3PGJA 1ZSNA 2I9PA 3GOHA 3PHGA 1GCOA 3EW7A 3TZKA 2DFDA 4GGPA 2E37A 1P33A 2GZ3A 3C7CB 3RU9A 5BSEA 1VI2A 4GX5A 5K6AA 3LF2A 1ENZA 5JBIA 3LF1A 4MVJM 4LW8A 4J16A 3L0DA 4CUJA 2PFGA 1PQUA 3JYPA 4R1SA 1E1KA 1E7WA 3KLPX 1XWFA 1Z82A 1DRWA 2Z1NA 2HJRA 4I1IA 4Q3NA 3WSVA 4J1TA 2DPHA 2CMDA 1PWXA 3KTDA 3L07A 4Z3DA 4MVJD 2V6MA 1CIVA 3MJSA 4J7CA 3WBFA 3WNVA 4NNJA 2AQIA 2GERA 3INTA 5IZCA 2X86A 4JP2A 3H5AA 4CV0A 2HK9A 1SOWA 3F1LA 1EZ4A 4NJMB 1ZBQA 2X4GA 4IJUA 2DBQA 1ZVMA 2WTBA 1H93A 2O3JA 3I9JA 1Y5MA 3AM3A 3KV3O 4FOOA 2E4AA 3V2HA 3W6UA 1B3BA 2DTDA 2BFMA 1KIFA 3GF4A 1TB4A 2PD3A 4XD2A 1YOVB 4F45A 4FOSA 2JAPA 3WGGA 1QRRA 1PGPA 2YYYA 3ICPA 4I5DA 4II2A 4UVIA 4YVFA 2UDPA 1EVZA 1R6DA 1ZW1A 3L6DA 3ZN2A 1LDEA 4OL9A 3H4VA 4HADA 1HDCA 4IQ8A 4ZQGA 2FHSA 1J6UA 2VRBA 4KQXA 3WS7A 4BIIA 3PHHA 2BF7A 3K31A 4EJMA 2NSDA 3VKUA 3SJ7A 1GR0A 2VZ8A 4YJDA 1CJCA 2WMDA 5KJEA 6ADHA 1H6DA 4QXMA 1WPQA 5TNXA 4BO7A 4XB2A 1UAGA 3JCZA 3QV1A 1W0CA 3L6OO 1UP6A 4KWHA 4NJMA 3HSKA 1LLUA 4U0KA 2PH5A 1DRUA 1NX6A 1RM0A 5IJZA 5JLAA 1LRLA 3D4NA 4BGIA 3AM5A 3OJLA 3LLSA 1UDBA 4YAJA 3RFXA 2UV8A 1EMDA 4PG7A 5F3RA 2JD1A 2RH8A 3GN2A 1V3TA 3OIGA 1G1AA 3IAHA 3LQFA 3PJFA 4G2NA 1YOVA 4NU6A 4Y8VA 3ZV5A 5K0ZA 5CDYA 1JKJA 4JXKA 2G76A 3K2BA 3CMCO 2AE1A 1ZSVA 4Z0HO 3OFSA 3WIDA 2HRBA 1GYPA 2PZKA 2QHXA 4DBZA 1ZK4A 2RCYA 4PG6A 3CKYA 4NR0A 3V1YA 4M55A 4XWYA 2DKNA 3HWRA 5K6AC 4BNNA 4GX2A 4GWGA 1A7AA 1T2CA 3FWZA 1JKFA 1DJQA 1DLIA 4Y6RA 1HRDA 3KSUA 4R4JA 1L7DA 1XU9A 4QUKA 2NACA 1E5LA 1SB8A 3X2EA 1K6XA 4AL4A 1QORA 3V5NA 4W6ZA 5IZCC 2ZYGA 4R9RA 3L9XA 2Y67A 3NDRA 2EG9A 1O8CA 3JD3A 3ZNNA 4Q3CA 1GDHA 4DMMA 4E13A 1GD1O 3WGIA 3PP8A 1B8VA 2HAEA 1I33A 4H7PA 1VJTA 3TDKA 1IZ9A 2VHWA 2NTJA 4OXYA 1YL6A 2YV2A 5JAMA 4QECA 2RHCA 2YV3A 4IXWA 3RIHA 5GZ1A 4J6FA 1YS4A 4WLEA 3AM4A 1KYQA 3FR7A 4ZQFA 4JK3A 2AQHA 3WB9A 4CJXA 4ZHSA 4O59O 4RDIA 1QV6A 5COQA 5EN4A 1U2DA 2C7GA 3NJ4A 1ZJYA 2GNAA 3VPXA 4ZRMA 4NPCA 4R01A 1PTJA 1UR5A 4JNKA 3X2FA 3ZNPA 1MB4A 1EUDA 1RWBA 4CMBA 4RCVA 4GKBA 4UUPA 4CLHA 2C2XA 1N9GB 3AUUA 2OP1A 3AW9A 1HE2A 4CLRB 4K26A 1X0XA 5B12A 3WFJA 1H5QA 3QWHA 1EVIA 2VZ0A 5CAEA 1ISMA 3WQRA 1DC4A 1ZZEA 2C54A 3DR3A 5CG2A 4B3IA 5L4SA 1HDRA 4WASA 5AXAA 3RSHA 2FSSA 1YBAA 4ALIA 1QV7A 2P9CA 1N1GA 3NTRA 4NFSA 2OBYA 4L75A 3RBXA 1RM5A 2PK3A 3L4SO 4XR9A 3QP9A 1YGYA 3JQCA 1EK6A 2IYPA 1IYZA 1NFQA 1X1EA 3VH4A 1UZMA 2VYNA 2FSVA 4RL6A 3RFTA 3G79A 3PZRA 4RLHA 2V65A 4N5LA 1I2CA 2WYWA 2W2LD 3NYWA 3BAZA 5C5IA 4ZQBA 4WCDA 2BFOA 2B0JA 4IPTA 4RVSA 3GUYA 5A3JA 1C3VA 1N8KA 1T4DA 4AJNA 2OP0A 3VH3A 3LT2A 4CMCA 4XYEA 3K5PA 4II3A 4RVGA 1V3VA 3CZRA 3O4RA 3OF2A 2FMUA 5U9CA 4ZGWA 3GVXA 4AG3A 1N9GA 2HCTA 4RPLA 3DQPA 4LN1A 3PZBA 1DXYA 1JN0A 3RQSA 4CLRA 1HF3A 1P1IA 1KEVA 4CQMB 2J3HA 1U3WA 3W8EA 3I4CA 3N7UA 2HQ1A 1E7YA 1YONA 3JV7A 1KC1A 4M8SA 1LSUA 5IN4A 3EZYA 3D4OA 1X7HA 2A94A 4N7RA 3FD8A 2E49A 1NFFA 4CPDA 3GDOA 4XQCA 3U4IA 3MJEA 3DZHA 4W9NA 1HETA 4OXNA 4E5YA 1E77A 4GVXA 2IEBA 2O7QA 4R69A 4DRYA 1DFHA 4IM7A 1PGOA 5A9TA 4LISA 1V6AA 5LDGA 1ML3A 5JO9A 4EITA 4MKRA 2NNLD 2B4TO 3H9EO 1V9LA 1ADCA 1QMGA 3OP4A 3D4PA 2IRWA 1C0KA 1WZEA 2CZCA 4YJFB 3OEWA 4DQUA 2B5WA 1ZH8A 1E3LA 4ONEA 2ZB8A 1R0KA 3U62A 1SO8A 4D0SA 4L76A 4D43A 2CFCA 2VT2A 4YBZA 1ISFA 2F00A 1YQGA 3P5SA 4DIFA 1Z45A 4J3FA 2HDHA 3GZNB 2NVWA 3RUEA 4CM6A 3AUTA 1ISJA 3GMDA 4CQMA 1GUFA 4LRTB 3U4HA 3INRA 2Z1MA 1ZCJA 2P68A 4XX0A 1XIVA 3WDSA 4FFNA 1BXKA 4HFRA 3CXRA 4KDFA 3WYCA 3ITDA 4L4SA 4EZBA 1DFGA 1CQIA 1U7TA 2ZCVA 3G1TA 3K96A 3NGLA 4EYEA 1WZIA 1PJQA 1O94A 3GFGA 1EUCA 3LYLA 2Y66A 1FDTA 3K8ZA 1XA0A 4R51A 3O26A 4GI2A 3IJRA 1I2ZA 2AEMA 3F5SA 1I32A 2QRJA 1NVGA 2D1YA 1KEWA 2IZZA 4YJFA 3JQ6A 1YQDA 1H2BA 2E82A 3IUSA 1G6KA 2VHYA 3ZWYA 1KC3A 1E3JA 2EW8A 3RC2A 3Q0EA 1I3MA 5C7IO 3JD2A 4BB6A 4XKJA 4ILKA 1HYHA 3P2OA 5IFLA 5ER9A 1IZ0A 1M66A 4F6LA 3K92A 5COAA 2WWRA 3GZNA 4QQRA 2R2GA 4XYMA 3AJRA 3ROKA 4MKZA 4CMIB 5TIIA 5FYDA 3UUWA 2E6UX 2OGUA 4W7HA 3ZDFA 5L7TA 5CEEA 4Q3DA 2OHXA 3GNQA 2CF6A 2YZ7A 4YRAA 4OH1A 1YL7A 1JA9A 2Q1UA 1Y81A 5JC8A 3NEPX 3PYMA 3O8QB 4C4OA 5IXYA 1GEEA 1RM4A 1Q7GA 4NU5A 4CM5A 3GY0A 4YJHB 1DIHA 1I01A 4B3HA 4FQ8A 4RPHA 1FDVA 2FP4A 4KOAA 4U6SA 3ANMA 3UICA 4CM7A 3QY9A 3VDRA 3DFUA 2VTDA 3EYWA 1JU9A 2FY8A 4YA6A 3RCBA 4OOFA 3JQ9A 4FJ2A 4R3WA 4ND1A 4PLZA 3G0OA 1BSVA 5F21A 3DZBA 4RDHA 3E8XA 2PNFA 4J4BA 5DCYA 1DC3A 2QYTA 3S55A 4RVFA 5G4LA 4PGFA 5TGDA 5ILOA 2EHDA 2WDZA 4CMIA 4XQGA 2I6TA 5GY7A 1CWUA 3ICCA 3W1VA 3WNQA 4HFNA 2TMDA 2GN9A 3HFSA 1ZO8A 3HDJA 1P0FA 5DDIP 1C1XA 4ALLA 1LI4A 4BB5A 5KVVA 2JAHA 1Z7EA 3O8QA 3RJ5A 4AJLA 2ZKLA 1ZK0A 3TL2A 4D3SA 4YJHA 1P44A 2XPCA 3DFZA 1C0PA 5ITVA 1V8BA 3OJEA 1VL8A 1NQ5A 4DYVA 1VLLA 2CVZA 1AXGA 4U8GA 1LSSA 3FRJA 1ENYA 2PH3A 4BNJA 2DAPA 2H9IA 3GEGA 3PWZA 5ES3A 3WIEA 2GPTA 4BMVA 1E1NA 3RC1A 2DUWA 5HWSA 3L77A 1VSUA 4AJOA 2PD6A 3BMOB 1BXZA 5AOVA 1Q7BA 4ZICA 1BDMA 1A71A 1M67A 1RKXA 2GSDA 1VSVA 1W8DA 5CG1A 1J0XO 4D45A 4NK5A 4WUVA 3MWEB 5AXDA 4KZPA 5A05A 3ZHBA 2YDYA 1B15A 4NBUA 4RLSA 3U3XA 2W2KB 4GH5A 4B7UA 3V2GA 3UCFA 3GT0A 4R3NA 4XQEA 3TWOA 4EEXA 4B3JA 1P77A 4JBGA 3R1IA 4HKTA 1U8FO 4HUJA 4E5KA 1XLTA 1VJ0A 4GKVA 3GVHA 3KBOA 4NQZA 3WICA 4EBFA 1MFPA 3KZVA 1M75A 2YV1A 5THKA 2Y0DA 1N92A 1P45A 4FB5A 1I0ZA 3WYBA 2GF2A 3F4BA 2NU9A 3INGA 3NT2A 3ZU5A 4XDYA 4RORA 1ENPA 1GYRA 4TWRA 4OHUA 3KEOA 3V1TC 5KVCA 1KERA 3OICA 4MP3A 4CV1A 3PJGA 3AY3A 2O48X 3MOIA 5MDHA 2P4HX 1UXJA 2OBNA 3AUAA 3HDHA 1RPNA 3ZWMA 3ZNQA 4HNGA 1P1HA 2FPPA 4UVHA 3BMOA 1KEPA 1GY8A 2HMTA 5ICSA 2EEZA 5JYDA 2BI7A 3WMXA 4BKOA 3W6ZA 4CM4B 4L9RA 1H6CA 4YWJA 3JQ9C 3JQAB 2JJYA 3CIFA 4PLTA 2NU7A 5DBIA 4DTIA 5JMWA 2W2KA 3I9MA 3AU8A 3NTQA 4XJTA 2PWZA 4MVJA 4GMGA 4DLAA 2BI8A 3RJ9A 3S2FA 2Q4BA 1ENOA 1KY5A 1R12A 4K28A 4CR6A 1Y1PA 1GAEO 5DT9A 5KOIA 4BNLA 1B14A 4ALMA 3BA1A 5DULA 4AJEA 1ZUD1 5I7VA 1ADFA 1U5CA 4LRSB 3RUAA 5A03A 3JQGB 4LMRA 2F1KA 1LA2A 4UVEA 3FI9A 4PZEA 5I9NA 3JTMA 3ON5A 2FRDA 3FF4A 4DQXA 1EBUA 1X1TA 4PLPA 2DLDA 2Q49A 4BOYA 2R6JA 3TNLA 5L7WA 4A27A 3Q9NA 1IULA 4N5NA 3FTPA 1EEHA 2HMSA 1HZJA 3I23A 4R1NA 3M2PA 4CM4A 1AE1A 1SCUA 1T26A 3TRIA 3JQAA 3QIVA 3HFGA 3ONEA 3KVOA 5JY6A 1GQYA 3DEYX 1UXGA 5TQVA 3GMSA 1KETA 1PWZA 3TF5A 4J90A 1F14A 2J3KA 4PZCA 5ENDA 3ABIA 5FI5A 4FCCA 4MVJP 2GASA 4I08A 3WLEA 2Q3EA 1UDAA 5KKCA 3ROPA 3DHNA 5LDHA 3RFVA 1O89A 4ZN6A 5A9RA 4AVYA 1U5AA 3U49A 4B4UA 1R0LA 4CODB 2RBEA 4A7PA 2C5EA 4ROSA 1P74A 3JQGA 4F3YA 5A9SB 4G65A 4I9NA 3PQEA 4XCVA 4Z9FA 2VHXA 1YB4A 4OQYA 2O3SA 3IQDB 4IGEA 3GR6A 3COSA 3N74A 2JCXA 4URFA 3SJUA 2Y1OA 1MV8A 4CMJA 1KY4A 4BGUA 1Y6JA 1LDMA 1NQAO 2D3TA 2PY6A 3IP3A 3DBHB 4MVJG 4PCVA 1GUZA 1HT0A 4DYDA 1VPDA 1U2GA 3KOUA 3C1AA 3QQPA 1UAYA 2O3QA 2C0CA 2EKLA 3A06A 4Y6PA 2I3GA 2P4QA 1LU9A 2Q2QA 4UEOA 5AXCA 1A7KA 3G3EA 4ND2A 1PIWA 2H1SA 3HQ4O 5MGBA 5CFZA 3B1FA 2G0TA 3GK3A 4HFMA 4O5OA 3RD5A 4D41A 3BTVA 3RVDA 4BV9A 4E12A 1I36A 1KVRA 4FC7A 4J43A 1K2WA 1DAPA 1ZKMA 4C7JA 2GGSA 4TVBA 4J9UE 5C37A 2QIOA 2IODA 4DGSA 3O9ZA 2C29D 3FR8A 4UUOA 3TZHA 1SPXA 3KEQA 5A9SA 4ESOA 4E5PA 1CDOA 4RF5A 4TKLA 1MC4A 3VC7A 5BR7A 4GX0A 5T67A 1EQ2A 1U4SA 4XZ3A 4JCOA 3EDMA 1DB3A 2D8AA 2IE0A 2WE8A 4IS2A 4KMSA 5L45A 4ND4A 4WCFB 2X7HA 3GAZA 1QXSA 4R5HA 3DBHA 4M87A 4LSWA 5JO0A 3PQDA 5TSDA 3Q2KA 3C3XA 3ULKA 4K9DA 4W7IA 4BVAA 5EJ2A 3MJCA 2W90A 3ADOA 3HN7A 4EEZA 5F5LA 5L7YA 4HWKA 1DSSG 1C0IA 2Y1DA 2X5JO 1A72A 3GRKA 4D42A 3CINA 2GCGA 5BT9A 3E5RA 4FR5A 4IDDA 3VAZA 1A27A 3GQVA 3E9QA 2OMEA 1IB6A 3OJ0A 3UOGA 4YACA 2X5KO 2C20A 1E7MA 4J0EA 1IY8A 5A4DA 3GVPA 5EQFA 1WNTA 3QWBA 3GVCA 2EJVA 1NWCA 1JVBA 3S2GA 4ALJA 2H5LA 5B4TA 1AXEA 3Q11A 1UZNA 4UVGA 1JDJA 2WD7B 1PL7A 3T4EA 5B4VA 1SEVA 3JQAD 9LDTA 4WCFA 3SC6A 1HEUA 3VPFA 4RGBA 3PIDA 3G1UA 4JBIA 4KTTE 1GZ6A 4XYGA 3LC1O 2NQTA 2W2LA 1ISHA 1P9LA 2QW8A 2I99A 3HJAA 4MP8A 1PX0A 1XHLA 1Z75A 3H9GA 1R66A 3BTOA 5H81A 3PYLA 5DF1A 2X0IA 3LT4A 2JD2A 4MVJI 4YCAA 3PWSA 4QT0A 1B2LA 5T8KC 3NX4A 4XRRA 1HSZA 1DHTA 3EUWA 4JQCA 3ZHZA 3IL2A 1E3WB 2GDZA 3BZUA 3GLQA 1O6ZA 1U28A 3G17A 2E48A 4L4RA 3ZHYA 1FDUA 4J2HA 8ADHA 4ND3A 5JFOA 3JYOA 2VT3A 1N7HA 4HY3A 5EPOA 3DAFA 2WD7A 1NHGA 2NM0A 4E2XA 1W4ZA 2AMFA 1NFRA 4BV8A 2GRAA 1P1FA 3K9QO 1HYEA 5A06A 1F0YA 3FN4A 2QZ9A 3RUFA 3S2IA 1MLDA 3BYZA 4JROA 2VQ3A 5G0SA 6LDHA 3KSZO 3AI1A 4JJIA 2O2YA 4YRDA 3GEMA 4K6CA 4E3ZA 1ZXBA 3D7LA 3ZWXA 4BO2A 3D1LA 3LC7O 3O03A 4E4YA 3Q6IA 4WKGA 4IMRA 1E3WA 5EERA 4U0JA 4A10A 4KQWA 4CV2A 4JX8A 1H94A 3GNTA 4ZQEA 4UULA 2X9VA 3ZNOA 2IDZA 4P8RA 3VPHA 3V8BA 1DPGA 2EJWA 2VWPA 1LLQA 3PTZA 5HRUA 3JQDA 1YDEA 4B4OA 2ZIZA 4O1MA 3QE3A 3C8MA 3P19A 2NTVA 2DT5A 4H15A 3VZSA 3MCVA 2PGDA 1PJCA 3LK7A 3S8MA 5C7LO 1IOLA 2CSUA 2NU6A 3MZ0A 4WCFC 2CUKA 4R41A 4BHTA 4D79A 4F6CA 3KETA 1OBFO 1R37A 3RBZA 4LMPA 1OC2A 1IUKA 3WGHA 3WQSB 4S1VA 1ZXLA 1PZEA 1HLDA 2G82A 3CUKA 1D3AA 1B26A 2PZJA 2X0JA 4ZD6A 3D5QA 4WOJA 1SZJG 1QSGA 1TT5B 1E1LA 4H16A 3VZRA 4CMGA 1WDKA 1BMDA 2ZB7A 1U1IA 1GZ3A 4KUGA 2JD0A 1XYGA 4OQZA 3JD1A 4XJSA 4DC0A 1JW9B 2IZ0A 3VZQA 4Z9YA 2ZK7A 1PS8A 4FDAA 2YW9A 1ZFNA 2DC1A 2TMGA 2ZATA 2WJPA 3I3OA 3V2UA 3IDSA 1T25A 2BFPA 3WJAA 4CMAA 1I30A 4MVJE 4BQRA 2FPGA 1DEHA 4B7XA 2V6FA 3QVOA 2PZMA 4BO0A 4J1NA 1E5QA 3H8VA 4L73A 4UEKA 1PL8A 3UFXA 4NIMA 5L4LA 4DIOA 3OBBA 3GHYA 1ZIDA 2I67A 3STHA 3TN7A 4TRNA 4BGVA 1KBZA 1I3NA 3B70A 4DREA 5CP8A 4WNIA 4H3VA 3AY7A 4P22A 1MFZA 1UP4A 5H83A 4GSLA 3FNEA 3PLRA 3ANNA 2ZTLA 3A4VA 1LXCA 2EF1A 1E6WA 1PS0A 4B4WA 4WLNA 1K0UA 1QKIA 4GAEA 4DL9A 3E1KA 2O50A 1D7OA 3FPLA 3AUSA 2VHVA 4BO1A 4D3DA 3GGOA 1E0DA 4WLOA 3W8DA 3H9JA 4J91A 1RM3A 5HTOA 1PJ4A 3NTOA 2YFQA 2EXXA 1XDWA 4R68A 4JBHA 4CQLB 3ASUA 4E5MA 3W4JA 4TVOA 5I9LA 4CM8B 3TOXA 1VE9A 5KWEA 4F46A 1OOEA 1DC6A 4WLVA 4PN3A 4NBWA 2XXBA 3L9WA 2O4UX 2CDBA 3WGZA 4CL3A 2WM3A 3BMNB 4IDBA 1OMOA 1KS9A 1QYCA 3WYEA 1AHHA 4DLLA 1UXKA 2VNSA 1X14A 3NT5A 4DLBA 1D1SA 1XQ1A 1UXHA 3DZKA 1VJ1A 3I1JA 5H82A 3EGOA 1E7RA 1N7GA 1H9AA 3DOCA 1Q0QA 2V7PA 3IMFA 1GUYA 2I5PO 2O3UA 3F4LA 4YT4A 4RZIA 2DU8A 1NASA 3EZLA 3TL3A 4RF4A 4CR7A 1M6HA 4PG5A 4CMKA 2ZCUA 3KM0A 5IZ4A 1NAHA 1H0KA 3CPSA 1M76A 4A0SA 5DOVA 3GNSA 4IDAA 4NBRA 2B83A 2C82A 4OOEA 4MPDA 5I7EA 4CQLA 3E48A 1JAXA 4PZDA 4CM8A 5U4QA 2ILTA 1UJMA 4ALNA 3HHPA 5CHEA 4IDEA 3A9WA 1R4NB 3C1OA 3H5RA 3D3WB 3AOGA 4M86A 1PL6A 1ADBA 5GZ6A 3VZPA 4E33A 5AVOA 3VKVA 2PA3A 5DBGA 3JQEA 1ZMTA 1CEQA 3BMNA 3PWKA 1EQUA 4QSMA 1ZEMA 3PJDA 4RO0A 5B4UA 2I65A 1WXDA 3QVWA 2GZ2A 1B16A 2IXAA 5EL0A 4OM8A 1GQQA 3WWYA 1S7CA 1DFIA 1FDSA 1SNYA 1ZEJA 3Q9UA 4E0BA 4EJ0A 1PEDA 3QRWA 5A02A 4TQGA 5G4KB 4FJ0A 2ZJ1A 1ZK1A 2FZEA 1Z74A 3H5NA 3UVEA 3W4IA 3FNGA 3BHJA 2YHIB 4YT2A 5KVSA 2B5VA 1SAYA 4ZA2A 1AN9A 1FF9A 1GPJA 2D5CA 3C7DB 2ZJ0A 5DP2A 4YR9A 2QG4A 3AFNA 3H3JA 3HB4X 1R15A 2QRKA 2C07A 3PLNA 2UUOA 1K6IA 3HB5X 1Y9EA 4E5NA 3RC7A 5FEUA 4W4TA 1R4NA 3NUGA 3I5MA 1A9YA 3D3WA 3FCOA 3ZU4A 4JLWA 1E6EA 1IHXA 4BO8A 3E18A 1WLYA 1GQ2A 3AU9A 4I5EA 3W8FA 1ISGA 4IDGA 4B4VA 1DIGA 1W6UA 1YWGO 5J23A 2GN6A 2J8ZA 2HJSA 4I8XA 4YT8A 3UHAA 3JYNA 5G4KA 3QVSA 1P1KA 4BNZA 1XCBA 4KUHA 2X9NA 3LT0A 3TFQA 1MUUA 4AJHA 2RAFA 4LCJA 5A3VA 2I3AA 3QWFA 3HUDA 3FNFA 1GYQA 2YHIA 5TC4A 1LX6A 3JQ7B 4CUKA 4UVDA 2V6BA 2D59A 4E21A 4C7KA 1K89A 3TZ6A 5DNAA 1SMKA 1K6JA 1Z73A 4D44A 2GZ1A 3OQ1A 4NFYA 3DL2A 2HO5A 1LDYA 2G17A 3OEYA 4WEOA 4XGKA 1X13A 2A35A 1ULUA 5C7OO 3DBRB 2EERA 1GV0A 3I9OA 4IBOA 3Q1LA 1QYVA 2EGGA 1PS9A 4OGWA 3MEQA 4IGFA 4NH4A 5JSFA 1DDOA 5CEJA 3DHEA 1LEHA 4RPKA 3ORFA 1PR3A 3PPIA 3KYCB 2VNAA 1BXGB 2B69A 2J3JA 3RUCA 3VH2A 5CDSA 3BXXA 1K5HA 3KYDB 5LCXA 3IKTA 5G0TA 1G0OA 1YO6A 3CSDA 3QLJA 3EK2A 3IC5A 1H6BA 1SB9A 4LSMA 3ST7A 3TQHA 4BUCA 3PDUA 4Y9DA 3E5MA 3ENKA 4CMHA 3H65A 1J5PA 1UZLA 1NR7A 4CM9A 1ADGA 4E6PA 3BIOA 1WWKA 4L74A 1HDGO 3GGPA 1ORRA 1N2SA 4D0RA 4CLEA 2VCYA 1JVSA 1DO8A 2Z5LA 4PLWA 1JQBA 4EUFA 2C2YA 4N54A 3JQ7A 3IP1A 4BNIA 1QLJA 2X9GA 1HE5A 1YJQA 4GLLA 3NGXA 1I8TA 2PKRA 1VC2A 4HBGA 5F1OA 4DPLA 1X7DA 4CUZA 3ZWPA 1BVUA 1JWBB 2WE7A 2VTEA 3ZWNA 4DPKA 3EHEA
chains in the Genus database with same CATH superfamily
3OE5A 1BS9A 1FL9A 5LQDA 5CXSA 2H2HA 4NMHA 3DWEX 1CETA 4GI3A 4E4TA 4ER7A 4P08A 5I4KA 3JRWA 4IKEA 3M6IA 3GA0A 4MQBA 1U0HC 2WYOA 3AERB 4B3MB 5E1OA 2FN3A 1GZ7A 4NBVA 1IFXA 3R6DA 4L5IA 4CDGA 4CKCB 4BY9E 1UKAA 2HK8A 3SS9X 3VU3A 1U0GA 3D5EA 1M6VA 3QEMB 1FK8A 2WMNB 2XITA 3QA9A 3TSOA 3AI7A 3PTAA 4Y2YA 1K4KA 3GLKA 1A4UA 4PYNA 3ONNA 4K9OA 2WZBA 1PQPA 2R4QA 1PT6A 4OAPA 3OQOA 2RARA 5REQB 2B8TA 2JLZA 4DV2B 3WA7A 3L4EA 3C7KA 3DPSA 1XAGA 1M1NA 2WUDA 3N1UA 2D2VA 5C18A 1ESCA 3DLTA 3C5WP 4N0MA 4H77A 4Y2HA 4HI0E 1CJTC 2WNIA 3UK0A 3QG1A 4XEHA 2X0RA 3BTSA 1RAHA 1G5PA 2IE8A 3A3OA 2NG1A 5BQFA 3LDAA 3TQCA 1SOAA 3HA7A 1Z6ZA 2AXPA 1CE8A 1HFWA 2OHJA 4BVBA 4EM6A 3RUPA 5A5VA 3U4CA 4JUBA 4Q03A 3KSRA 4EHLA 3TK1A 1R5BA 1MIHA 1PJ3A 1XELA 5CK4A 1V1MB 2HADA 2DUNA 2VUSA 1YBMA 3H8SA 3HM2A 5AUNB 5CDHA 5B3JA 1OASA 3DE6X 4RVCA 1BW9B 4G1BA 3KZ1E 1BG6A 1C9EA 3ZWWA 3DV0A 2ATCA 2O2SA 3E3AA 4HXFB 4G8CA 2IV7A 2B4QA 1XT6A 2B37A 1Z2AA 2R3SA 1U8ZA 2ZI5A 3HYTA 3ICOA 2C1EA 1TXGA 2C78A 4MWGA 4PHGA 3ZV7A 4LBZA 1H3FA 5DHQA 3STYA 4KLRA 3TIVA 1PR1A 2UVPA 2VPPA 3WLJA 3C8ZA 4URWR 3KS9A 4JVLA 4MVJH 2L2QA 3JRNA 3ODPA 5H3HA 4DIMA 3WL7A 3HGTA 3NNSA 3L8ZA 4F9EA 5BVGA 3KQKA 3IBYA 3V7WA 2TRSB 3CZMA 2YZ2A 1JLKA 3OF5A 1P9OA 1J2JA 2XTZA 1NU6A 1D1PA 3AHJA 1TT7A 3SZ3A 3KJFA 2W4QA 2FN8A 4CNQA 2OY0A 4XWKA 1YZNA 1ZNWA 2F7SA 5HKLA 4RFSB 1Z7WA 3ROGA 2ZOSA 3DE4X 3PE3A 4ND6A 4DIEA 3A1NA 4P5EA 1CG6A 1N2BA 3KJZA 2EDAA 3N6VA 3ZBUA 2BFEB 5BQOA 5IH7A 3SC2B 5KYKA 3ME5A 1DBRA 1LWNA 1R10A 3IOYA 4GC5A 4LF9B 3N75A 3R3JA 4YT5A 4MO9A 5TEVA 4AICA 3MWGA 1RBQA 4BLRA 4EKIA 1XAHA 3VI3B 5B37A 4H3SA 1QH1A 1L8XA 1UH5A 1Z2EA 2ZQZA 1A2OA 3C98A 3G2IA 3ZD7A 4DNXA 1OC4A 4FOPA 4O2AF 1FE8A 3HV0A 4KSBA 3GH3A 2KHZA 2I4RA 4RVHA 2RGWA 3KLNA 1EFLA 2X9LA 4ZK6A 1OD6A 3EZFA 3FRHA 3P9XA 1TVCA 4LK3A 3ISJA 4WBNA 5LP6A 4HB0A 4KR2A 1FTYA 4UEJA 4YRBA 1AKNA 3ONDA 4LHEA 1QB8A 4FC6A 3TI7A 5JQWA 1G9XA 1PI3A 2D1RA 1NXWA 1PFQA 2FX5A 2GK6A 3KUKA 2H4JA 4L7VA 2PUAA 4N6OA 5GM2A 4RTLA 1KRWA 2A33A 1OU0A 3ZWCA 5DGIA 3KCQA 5T8KA 3OX4A 2ZIEA 4TMYA 2BGWA 2BHSA 4I3GA 1YVPA 4KXWA 4NJOA 3DZJA 3DHVA 3GW8A 9MHTA 1NXPA 2PBFA 1BTOA 3I2JA 4IMPA 1HNWB 4QT4A 5JD6A 4YAFA 3T9CA 2OOKA 3GBVA 3EY4A 1UKCA 3LY5A 3OA0A 1VPEA 4M1WA 4MRNA 3TZBA 1Q0ZA 2XODA 1LPMA 3BB4A 3NBQA 2RBKA 2Z2KA 5TQ0B 1CUZA 1GQRA 4G1FA 4IDOA 4IS3A 4J7UA 2FMIA 3DFIA 3NP7A 2HA6A 2MDTA 4F97A 1RAFA 4BNGA 1SVOA 2Q99A 2D5AA 2QN3A 4V0QA 4Y0AA 4QASA 1IXKA 1QHSA 3LP8A 2C42A 2PSHA 4N01A 5LQNA 1TEHA 4EK9A 1MZPA 2W6MA 1GSAA 3M3DA 1AQYA 1TK9A 1PGJA 1JHOA 1ZM9A 2VDMB 5EJGA 4OMUA 4TMFA 4WW0A 3CW2A 2ZR8A 3G7SA 2A0UA 1WCXA 3ESCA 4KAAA 3QE2A 4PC1A 5KJ6A 3QF7A 2F64A 2PTHA 3T3EA 2GBFA 1G8HA 2VUUA 3ADDA 5D3KA 3TRDA 4OSPA 3LLCA 5J47A 4EVRA 5EIBC 4LA4A 4OCZA 1SCAA 2VR1A 4OXKA 3RUHA 4OLJA 1V6CA 2EWMA 3WXMA 3EMVA 1CEEA 3VO1A 1QMPA 1W0JA 3BE4A 3ZQ6A 4MQ4A 4MSUA 2FRVA 7ABPA 1MX3A 1HZZA 5HVNA 1S96A 1NI4B 4BJ6A 1A9ZA 1C5KA 3ISVA 4G56A 3LA6A 3MWLA 5IVPA 5JYEA 5I45A 1FLDA 2GLXA 2O19A 1CUBA 1MJ5A 2EQBA 2AH5A 4DA0A 4Q3KA 4FN4A 1JDBC 1NP6A 3LWZA 1DZ3A 1QIMA 5KDOA 2J5RA 2JFGA 2PKQO 4IXNA 1KOJA 1WHSA 2G1UA 4WA8A 2R00A 2VDVE 1Z5WA 2J7PA 3D9QX 3QUBA 5IARA 1TYAE 3OHSX 1J33A 3LOQA 3GGDA 3UW1A 3S5JA 2Y4NA 3PGXA 1US8B 2IYSA 1W48A 4INAA 4C88A 2AOUB 1HG1A 4Q34A 1Y8RB 1QBGA 2E4ZA 1XD2A 2J67A 1PEKE 2X2EA 2YVUA 2I7TA 3A58B 2WFZA 1RMQA 4YRKA 4KNYA 3OZIA 4LJKA 5A5EA 3FSRA 4ID3A 4G24A 1AUOA 3EHDA 4CIXA 1VL0A 1NL3A 1PZGA 3KZMA 3NHWA 3UF0A 1Z0UA 4OYLA 3TBFA 5HRCA 3SBEA 4LFBB 1T5HX 4GVLA 4Q39A 4NLLA 4ARCA 1E9VA 2JKVA 3TLBA 5DOZA 3UBMA 1CU1A 3HCDA 1DCTA 1DLJA 1WHTB 4X54A 3AOEC 3QXJA 2WICA 3OCCA 1QH8B 3OJWA 4MW4A 3JQPA 2BDTA 3ACDA 5LQMA 3KKEA 1OZAA 1T2EA 1Z06A 1GL7A 1Q0LA 1YQ9A 3EHEA 4ICIA 4JC4A 4KYTA 4BN4A 2V7GA 4XGNA 3IAM1 5E0KB 4OMDA 2CKDA 4P6VF 1G0NA 4WE3A 2XA2A 2H52A 4RMJA 4M0EA 3HL0A 5BYBA 1Y33E 4D4GA 2QP9X 4PFQA 4C3UA 2OKCA 3KDSE 1MC8A 2I4MA 1D4ZA 2C4KA 2ODNA 3GQBB 5L51A 3HWWA 4O4HB 3T7TA 5B6JA 5ESWA 4E51A 5EQTA 3VPGA 2EIHA 3BIWA 4Y1RA 1QVAA 5EINA 2BMEA 1AKEA 3VJKA 4BQSA 4JI5B 1FRZA 2VYVD 3ZWVA 4B3DA 1A4IA 2Y6VA 4Z0TA 3A6HA 3BZWA 1QFMA 3D7NA 4MGYR 1OB5A 5DHAA 1E92A 3ZWBA 2FHPA 3ITKA 4DG8A 1W4RA 1XZQA 1PJTA 1MJNA 3AHIA 3WK9A 4AY2A 1NX9A 2E18A 2YN0A 3ETGA 1QG2A 4BQFA 4OU5A 3CRNA 1Q77A 4NG4A 4WK6A 3EGVA 1SD1A 3E7DA 4F3NA 4B6FA 5DSXA 4PE5B 3S28A 4CMEC 5EMKA 2X0NA 3IVGA 3ZVNA 3NR2A 3B2EA 3RWBA 4BCCA 1XNHA 1CJUC 2VHZA 1HQDA 5AVRA 3HXLA 1XPOA 4A5OA 2MR5A 4UMVA 4TKVB 4PEVA 2C7QA 3T1HB 3RU2A 3VQTA 2CLFB 3OM9A 1A9SA 1DHRA 4BNWA 3OQPA 1FNNA 1V2GA 2GPWA 3F7MA 3FBGA 4FS3A 4NS1A 3WQQA 5KIAA 4MV6A 2BMJA 1EGHA 1QGYA 3AFIA 4RPIA 3CIOA 3NG1A 2J5KA 4AN4A 1XHEA 2ZJ8A 3TIGA 1VGVA 1T5DX 4BKUA 3W5VA 2XYVA 1XNJA 4Z0NA 2AEFA 4F11A 4GHWA 4DCNA 5JPDA 2DXIA 1RYHA 1GEGA 2QAGC 4YRRA 3IT1A 3CC8A 4YEDA 4ZVVA 3PXCX 4PXSA 2B94A 4OQLA 2CLDX 3FZNA 3EXHC 4QQFA 4BAGA 4JKIA 3N87A 4GYWA 4QWWA 3I5UA 3L18A 3UT5B 4ZFNA 2ZJOA 4D6PA 5LLTA 1YC5A 2QV7A 3ER9A 4L6CA 5TT0A 3PXUA 3EVTA 2JJ2D 4FGWA 1YJAA 1TAGA 2XR1A 1C1HA 1PVDA 2B2XA 2WOJA 2WF7A 4GXTA 4OYRA 2B36A 2ZSKA 3BX1A 2Q45A 2YXDA 4AKGA 4MGIR 3C0KA 4FX5A 5JUWA 3ESYA 3DZGA 1FTNA 3NRCA 1KMNA 4K9MA 2D0DA 3ZX5A 5PGMA 1PSDA 5EYPB 2O8BA 5I8ZA 2RHRA 3HBAA 3I4LA 4LHXA 5SZIA 4JSYA 1ZN8A 4L8WB 4R1OA 3AH8A 5ESRA 3EC2A 1BEZA 3GP8A 4MIEA 3F1KA 2EFJA 1KKMA 1UKVY 1CVLA 3B20A 1U7OA 3IQZA 2ZRAA 4MIYA 1WW8A 4ZAWA 3U39A 4BRZA 4Z54A 4URYR 5HHTA 5KOJA 3HXOA 4LYHA 3UN1A 1OI4A 5ERGB 2Q4EA 1FFWA 3RT9A 3CGGA 1E3DA 4M1QA 3IEXA 2C98A 3KSDO 3WLEA 1QYWA 1P5ZB 2ATXA 3E3NA 3IPXA 4JLUA 2QN9A 4V0ME 4EY6A 2QD2A 5AOCA 1FPQA 1Z6GA 2LDBA 2Q5LA 3LPMA 4QGAA 4YRSA 2BE7A 1XTUA 3BT7A 2H5EA 5AICA 2WPDD 2CLKB 2MSCB 3FUUA 1FYWA 3D6VA 4BMYA 1XXHE 5EEGA 4CNBA 2DPYA 4Y1FA 4RKYA 2QGNA 4GZ6A 2GFQA 3R5FA 2W2OA 5K3DA 3SVZA 1T3LA 3P7MA 2XV1A 1WLSA 1ESZA 2FI1A 3CVYA 4ZOLF 1J8FA 1R4MB 1UEIA 1ECBA 2AR7A 1AKUA 3NIDB 4RD2A 3RT1A 5LIRA 1AUVA 1QRTA 2QM8A 1XQVA 1LVHA 3IB6A 2JL1A 2VP5A 4TMTA 3BHIA 3PL5A 3RRZA 4DMGA 4EENA 5BR1A 2ZIWB 3URMA 5ICGA 5KS2A 4PX5A 3ZK7A 2BBWA 2LRHA 3MT9A 2NU9B 2AFVA 1K8XB 1F6BA 2AXQA 2J6IA 3IPCA 3R0IA 4PBRA 2EYQA 4BMXA 3KP1A 1RCFA 1RXSA 3HU5A 4GUAA 3CT4A 5FH9A 1SUSA 3PE6A 3L4JA 1SKAA 2LDXA 2FOLA 3HGMA 4DIBA 1JA0A 2PSDA 2VXBA 3EOBI 3OJOA 3SYNA 4R9UC 4DCOA 1W9HA 4HATA 2BZ1A 1SWVA 5CLIA 4XD7D 5THXA 3QU2A 2W83A 4UFOA 2BE9A 3KRTA 3ROFA 3HXMA 1GN9A 1G20E 3ENZA 4ZOBA 4BFSA 3QPUA 3ETHA 2EL9A 5AW0A 1O96A 2QTAA 5DZSA 3NVMB 4TL9A 5HMMA 5KNLA 2W8ZA 5JJBA 5THQA 1NNUA 3VNVA 3LPCA 5CPFA 5JCJD 4WNCA 4A91A 1NVVQ 4J1SA 4PCUA 1SQ6A 1RJFA 2WKRA 3AHHA 3NM5A 3V1UA 3VR6A 3N9IA 4AYTA 2K2QB 2GPSA 4GSKA 5BQXA 5KJCA 3D0KA 3JATB 4TMXA 5FPTA 1FFSA 4GPD1 5IF3A 1TCUA 1QG4A 1XJQA 3S27A 3UM9A 2XA9A 2FWPA 4I6GA 4Q6WA 3O8RA 5JDCA 5DSTA 1FSGA 1ZONA 1U7HA 3H9CA 3RSFA 2G71A 4F1KA 1ACLA 1AUPA 1Z2NX 4RVDA 2A0WA 4FSHA 4ND5A 4ISCA 4WADA 2XUDA 5D2CA 5D7BA 2WHQA 4C6HA 1IQPA 3DZIA 1X1QA 5JY1A 1YJ5A 1HNXB 1SBNE 3D8RA 4OA8A 4UMEA 3NDBB 4BNFA 4D9KA 3GGJA 3IR7A 5I47A 1XRPA 3VPSA 2JCVA 1UPAA 3DHYA 5CA1A 4IIEA 4WVFA 3O1LA 4I5IA 4IXDA 4AJ2A 5IVIA 3CVXA 4WOPA 2GCIA 1ZH2A 2Y1WA 3FUWA 2Q1TA 4GYYA 3GH1A 3VV2A 1CZRA 4ZDIA 4IXTA 3U09A 4NBNA 2PUWA 3HJFA 1MAWA 4UUMA 1BN7A 2JDIA 3ZLBA 1T8YA 721PA 1JYEA 1PR5A 1U3FA 3IP6A 3ZGXA 4EEKA 3JQRA 1A82A 1XKTA 1QIGA 3L1HA 1CUSA 4QELA 1W0KD 3AP1A 3VFDA 3T1VA 2XTAA 4Q7QA 1WSWA 4IZHA 1Y89A 2FEOA 4EW6A 5F7OA 4J0FA 1VGQA 1ODFA 4GPBA 5F2EA 1Z4LA 3GG2A 5FA6A 1GGKA 3UWMA 2MINB 1H2HA 2Y1LA 3CX6A 3MAAC 5G3ZA 1PR6A 1EVKA 2WU8A 4FZVA 4RKEA 3QA3E 1QTNA 4BFLA 4KLZA 4ZJUA 4G0MA 1YTUA 2Q2VA 3U6KA 2VK8A 1J07A 2J59A 2PLNA 3PEFA 5DWQA 2G1KA 4JEMA 2CFTA 2NO5A 1GJRA 4RDCA 4EFMA 4BNXA 2HT1A 3ND7A 2I91A 3L49A 3BWCA 1D5WA 1ZH0A 4Q3LA 2OBMA 1ZGGA 4S0ZA 3HKDA 1Q7CA 3HV2A 5FYQA 4IDPA 1BCSB 2GI4A 2ZRLA 3D7SA 3SF8A 1JQJC 1UPTA 4W82A 4K88A 4IEEA 3FDJA 5ICCA 2RGAA 1FU7A 3K3PA 2V98A 1NW9B 4HDAA 2Q4DA 4PM4A 5KB3A 1TMKA 1ZP6A 4MV9A 4LHYA 5AJTA 1WMSA 2WILA 3L0ZA 1XU7A 3LUFA 5KYWA 3DVAA 2FB9A 1V11A 3EG9B 2NUAB 1W25A 4FHDA 1TQ4A 4R81A 4XVRA 2VRCA 1CC1S 3PVZA 4D2IA 1OIWA 3HE3A 2MYNA 3E3LA 3H9QA 3KPWA 4F38A 4MWZA 5JC1A 3RC8A 3SDZA 5K8CA 5DSZA 2QGZA 2V5UA 1HOXA 5EZQA 1UJNA 3MWFA 2YBEA 3C3CA 4IUDS 2P6NA 3DP7A 5ALGA 2IXFA 3LBNA 4Q21A 4WLFA 4GE0A 4E7PA 5HP4A 5JJLA 4KITB 5P8WA 3LDUA 3T3DA 3DEJA 4J4HA 2W0MA 3K6SA 1QH0A 1U65A 4MS4A 1N3LA 1E2PA 3K4QA 4CE6A 4TN1A 3H0CA 3V4RA 2OC9A 4DBLE 2FR8C 3WLFA 2PQMA 1SZPA 3VXKA 1WCIA 3PNLA 5FJJA 5JCXA 1RYNA 5DYNA 4FDUA 1F17A 1PFYA 1LI5A 4NZ9A 1TGYA 2BM0A 4AMUA 3VR5A 3CNHA 4EYGA 2JFPA 1QTQA 1DG9A 2D1SA 2XI4A 3OY7A 1HQYE 1BX0A 1Q0PA 3AK4A 3ZU3A 3UK6A 5FA5A 1L1QA 1PFWA 1JG1A 3BMQB 5J2TB 3W2EA 1RKQA 2AKAB 4MICA 4B6SA 1E2IA 4HUQB 1JKIA 1UPFA 1CR4A 1KSJA 3CMMA 4GI7A 3WFIA 2IPXA 1OXTA 3ZHXA 3QW2A 4FPXA 4HZUA 3AEUB 2ZBFA 4Y1GA 1U2TA 2FR0A 4ARUA 2IYYA 2XGOA 5I4BA 3THOA 1IXRC 1TIKA 3JARB 2XMCA 4JN6B 4NJEB 1BE6A 1Z08A 4TROA 3RS2A 1LPNA 1DDGA 4S04A 2FDRA 2B1RA 4KOEC 4QTYA 1OVMA 4RHYA 4L9WA 1XNGA 3ILVA 3OU6A 1DAFA 2ACWA 1XQXA 4DQ0A 1NN3A 3PDHA 4DBVO 1A76A 1V4NA 4L8VA 1R0RE 1EI9A 3PQCA 1AD2A 3QFFA 3LUDA 4IMJB 3QW4B 2C7VA 1UBGA 1NF9A 2GAAA 3SFZA 1H9CA 2SHKA 3O91A 3V3TA 1CYEA 3VDNB 1BEEA 4ZAYA 2DFVA 4JP3A 2RAPA 4M0LA 4AZTA 4L4XA 1E2MA 4EDFA 3FWHA 4BRUA 1S3SA 2UVDA 2OWDA 1ARZA 3OKFA 5GJWC 2HYIC 2VDOB 5DBFA 4EMUA 4F5WA 4PO1A 2BEKA 4EFLA 3SYTA 3ZD6A 2EZUA 4JLPA 3QKSA 4JYAB 1TA4A 2Q41A 3NONA 1U1EA 4C7VA 5ALJA 1HE3A 1YNOA 4XIFA 2G83A 3K73O 2ZVDA 3ZUPA 5UKDA 3B1KA 1M8PA 4Z51A 4D3FA 2AD5A 4DIUA 1F9AA 2CXUA 3B7GA 5L3ZA 4XWTA 1PO7A 3KVYA 4P3PA 1RMYA 2ZRHA 2ZRQA 2BGJA 4CT4B 4E5SA 4E32A 1VI6A 2JZOA 3DLIA 2RHHA 4XRGA 2DHRA 3H2JA 3S40A 2X22A 4DJJA 1NBHA 4R8RA 2W2PA 1U0LA 1GGMA 2XUJA 2V6GA 3AGPA 1Z34A 1PJ2A 2VOJA 1O95D 4DDTA 5FBLB 5AVWA 2X8WA 1G5IA 4JBWA 5CB4B 2VQFB 1SC6A 4AI6A 2JFQA 2N0SA 3HDTA 4BKPA 4X61A 1WIWA 4B6QA 4BKRA 5GMOA 1ONOA 1J00A 4OIMA 2ZSFA 2DQ4A 3UYKA 2CL5A 3RUIA 3UMMA 2QLJA 3I2HA 3D8BA 4RABA 3WGVA 4HP8A 2PN1A 5KC9A 1QHHB 2QLLA 4EUHA 3U19A 4RQBA 4I19A 4B8ZA 2O6LA 3WIVA 3B9QA 1F4VA 3IMCA 3U37A 1WP9A 2P1ZA 4OSOA 4R6WA 5DCUA 2NO6A 5HZGA 3OQIB 5KWSA 1HMYA 2N3ZA 4N65A 4MHOA 4K2AA 2IQ5A 5I7WA 5DM70 4D25A 1O94D 2ZGVA 1Z0SA 4WCVA 3VA7A 4CT5A 1J42A 3G0CA 3NHZA 5HE8A 2O8CA 2XADA 1X7XB 4JV5B 5LUAA 1AF7A 1GPH1 1WMAA 2FSHA 2VDJA 3DM5A 3IPYA 1XP8A 3LV8A 4IIYA 3KYCA 5CT6A 3RVSA 3WRYC 2POCA 2RE8A 2G70A 2YZGA 1AMOA 3PV0A 1JEEA 2XD9A 4KTVE 4JZYA 5M04A 5KJFA 1KJIA 2O2CA 2Q5QA 3L5KA 5ICFA 7ADHA 5DI3A 4E30A 2IYNA 4WTOA 1I7SB 3PDJA 2P8JA 4Y9UA 3D0OA 1D2MA 2C5LA 2I3DA 1F7VA 5JQGF 2FDXA 3LCJA 5BNIA 1W581 3GXBA 1H1DA 1Y3HA 5FUXA 3CNQS 1Z56C 3ORRA 4U2GA 4FWBA 4BX8A 1RYEA 4QBKA 3C85A 4GICA 4B79A 1WSAA 4JY7A 3U0VA 2BGRA 3ZKAA 2YOFA 3SP1A 1AGYA 1R8SA 2NP6A 3Q98A 3IDQA 3BSFA 3DKRA 3ESQA 3WBJA 3GUCA 3NVAA 2DBZA 3E9ZA 4HX2A 3FWNA 5L3SB 4TZ6A 2OO5A 2OKGA 1U99A 5TDHA 2JA2A 1NDHA 1GL3A 3HK2A 5I7HA 4UHEA 1NBME 2M98A 2JCYA 4RF3A 2DMRA 1FRNA 4EFNA 3EDCA 5C3MA 4E1VA 4LF7B 3VV3A 1T36B 4PAMA 1TK3A 3H3FA 3L4BA 1C3XA 3TSYA 2HLPA 3HM9A 1RS0A 2EP7A 3D02A 1AQIA 4B3GA 2RH5A 2ERYA 2ZUWA 3PQ3A 1XK6A 1MOSA 1C80A 2D2IA 4GQBA 3WX0A 2C2WA 1ISIA 2B4RO 3U6BA 1DCFA 1KXZA 4N1AA 2WP8J 4I3HA 4I4IA 4LJSA 2EJTA 1DCKA 1HLPA 2WJJA 3SIRA 2NTNA 3MTQA 4YQYA 1XMOB 5IDYA 4P7JA 1IE3A 4L8YA 4MYRA 3F4KA 1MTZA 5LKRA 4RXMA 1NBEA 4F96A 4F4HA 3UY4A 2EBUA 3FNIA 1OXKB 4NH0A 3VU1A 1E3SA 1R0CA 2QPTA 2Y68A 2ALJA 4DTCA 3TLZA 3FHCB 4ZZ0A 1RZUA 4C4ZA 3H11A 1EGVB 1M9NA 2XMBA 3GDGA 3QVXA 3WR5A 4KFUA 5GWXA 2X0FA 2NP7A 2QRVA 2I76A 3U1VA 3LLMA 4WVLA 3SOPA 2ZUFA 3LSYA 3HJRA 5C31A 2W43A 5K7SA 2XRZA 1KRHA 2PT9A 3FPAA 4LE1A 4PC6A 3ZIAD 2O7SA 3CWCA 2LR0A 4OHOA 2JA1A 1GZ4A 4MUNA 1I3KA 2IJGX 3WZLA 1QYXA 2ZRJA 2CF5A 3PFIA 4O2BB 5FPPA 3U17A 3CE6A 4TYWA 4U00A 4Q6BA 2I2BA 2WIFA 2ZIXA 3RC9A 4ENQA 3G88A 4CCAA 5F3WB 1Z3IX 3JSAA 2NTEA 4HZIA 2TECE 2JGIA 1DQYA 3DMYA 3UAGA 1IRIA 1C14A 4BNVA 3DE2X 1JG7A 2O8EA 1LH0A 2BKAA 1Z4PX 1L8LA 3U26A 2P9HA 4LYJA 4K6FA 2N46A 1Y7HA 3ZXXA 2Y1FA 3QTLA 1XTRA 2FZKA 3CM0A 4OJYA 2Q3CA 3HKCB 2JHGA 4KI0A 1T4CB 3MN1A 5GGYA 3UCEA 4ARAA 3MYYA 1CF2O 4ITRC 3G5UA 2P9YA 3EZ9A 1O0BA 4I36A 1CD5A 3LUGA 3LDFA 3TM4A 621PA 4YAIA 4HPJB 3KXDA 2B0CA 4HXYA 1WMBA 1T0IA 4KGZA 5AH0A 2XCUA 4YFVA 2Z4RA 3MHPA 5SICE 5DWDA 3S2SA 1BHSA 4X1KB 2GF9A 3PEWA 4G63A 1THZA 1XAIA 2OZLA 3QKUA 4Y6SA 1HKUA 3RNOA 3VTZA 4DEXA 5KX5A 3U80A 2W6CX 4MS3A 4G5HA 2XYQA 3TG2A 4IJKA 1BOFA 1T1SA 1JR2A 2C59A 3TGWA 2HXYA 2QTBA 4WECA 3EFBA 3K9HA 2P1DA 3PXXA 5F1YA 3VSDA 1I10A 4TSRA 4AZWA 2C9DA 2B34A 4Z7JA 3MBKA 4AS3A 1J06A 5JE8A 2JFUA 4ENVA 3WLTA 1G2PA 1KEKA 1TMGE 1XX6A 1Y6ZA 3P2EA 1V16B 4LF5B 4NSNA 2W6PA 3A14A 5H16A 1XR3A 1DBVO 3SJBA 3NEYA 2CN1A 4B2PA 2Q4TA 5FT9A 2OBXA 1N33B 2IS2A 1DRVA 1KO7A 1M2OB 1NWHA 3CEPB 3DMTC 4NS4A 5TQ2B 2P2DA 1E1RD 1PJLA 1EWVA 4I55B 4RNDB 1EDBA 1SC1A 2JJ2A 3RDPA 1P4RA 2JGAA 4PLHA 2IEDA 3T7EA 3ESAA 3VOTA 3MFQA 4HQKA 1QM5A 3RTEA 1EBFA 2L18A 3G85A 2I9PA 1EWKA 3QEKA 3JWIA 2PNJA 3DFFA 3TUIC 3TZKA 2HWYA 1M2HA 3C3JA 2DFDA 2YRFA 2E37A 3IRUA 4MV5A 3VSEA 1JB9A 3C7CB 4E5VA 5BSEA 3F6SA 1ENZA 1S2GA 2IV2X 3LF1A 4TTVA 4LW8A 5JBIA 1TZCA 3K6KA 1XAJA 2C5HA 2J9FB 4MYHA 5IHXA 1KNQA 3H0EA 3PR1A 1T9CA 5ICEA 2TS1A 5DW0A 3BCHA 3QE4A 1PR2A 2Z1NA 4OQXA 4BB9A 1JT2A 1GPMA 4HJXA 4MMYB 3V4ZA 4D0LB 1HOTA 2DPHA 4RENA 2V6MA 4GGMX 5FULA 2Z5VA 3HYCA 4YASA 4P3KA 2Q5FA 2B99A 3WNVA 4UBKA 2F8MA 1TW3A 2P90A 2AQIA 2AYZA 2GERA 4X8OA 2ZIFA 3TH5A 4EPTA 1SUAA 5ALOA 1MU0A 1NUTA 4A0RA 1FNSA 4GG1A 2RKOA 2WPDA 3AQ4A 4HG2A 3ET4A 4PYOA 4RHCA 4TGLA 4UBLA 2WWWA 3U48A 4DG9A 3ZR4B 1N32B 4MQFA 1W2HA 3U9SA 4B44A 3IA7A 3GFQA 2Y71A 2FZ5A 3L84A 4ZI3A 1H93A 3QGMA 2O3JA 1EG2A 3SHTA 3I9JA 5DX1A 5DM4A 4KAJA 2ZW9A 2DX7A 3W6UA 2DTDA 3O21A 5EEHA 4RY0A 4PS0A 1KIFA 4RK6A 4X95A 2PD3A 5AI6A 4A2PA 2ZWMA 4HDCA 3LUPA 1G8JA 2BH2A 1PGPA 2GMWA 1P7CA 1Z35A 2RHGB 3D6JA 4HH0A 5A5DA 1JKJB 1TEVA 4EGCB 4EA6A 4II2A 3K1TA 3VKWA 3CCCA 2YHBA 3IO5A 4RFVA 5KWJA 1G21E 3IQFA 1P2VA 1EVZA 2FNAA 3GCZA 4X41A 3H4MA 2PMCA 3L6DA 2ODAA 1CRLA 4ZREA 4OL9A 1TJNA 3ZE7A 2P9ZA 4GPTA 1R9GA 4ZI7B 1EPUA 3QLUA 4L95C 4HADA 1HDCA 4YP7A 4C4AA 1QGUB 3L7AA 1J6UA 1E2QA 4ODIA 1JSRA 3V97A 4KQXA 4XD7A 5LYJA 1SC3A 3BIJA 2NUTA 4EY4A 2XUHA 4EJMA 5AKZA 3C41J 1GR0A 2VZ8A 2IYUA 5CNJA 2JFXA 1S89A 2OYCA 3A6LA 4QXMA 5JCOA 1T0PA 1T3TA 3NWOA 4P86A 4YFYA 5EHZA 4P35A 4PO9A 3K72B 2RC5A 3QUAA 3CF4G 1W0CA 3QV1A 4KWHA 4OB6A 3C5EA 4HD8A 4BLPA 2CFOA 2GSWA 1K7YA 4Q4JB 3ZBQA 5K1ZA 4XASA 1Z4JA 1E6CA 1JMVA 5FNVF 5FP0A 1QE0A 1WTCA 3RSOA 1QX3A 1PYDA 4JLSA 3T9AA 3W9SA 1KMCA 1U4NA 3RFXA 2OLKA 1XL0A 2VH2A 2DY0A 4QEZA 4V1CB 2WC1A 4WZZA 1RVV1 3U7QB 4FI3F 5CCBA 1ZM3A 3LHIA 4AYXA 1XBTA 3GN2A 5DXJA 8ATCA 5JTUA 3PJFA 3K70B 3STXA 1B0ZA 4BUZA 1YOVA 4NU6A 1ZHOA 4NMXB 3ZV5A 3I0MA 4LHVA 2JFZA 4RDXA 3ICWA 2IK8A 4MWDA 2GHRA 5CHYA 4LXTA 1IBKB 1CX9B 4JXKA 4F92B 3FGZA 3PPXA 4HMPA 1V7ZA 3CMCO 2AE1A 4XWWA 1XA3A 1FTQA 4R9NA 4I14A 2XY4A 3BWDD 4Z0HO 1OBVA 1TLFA 1GIAA 3I9V1 3WIDA 2RGNC 4BTVA 1GYPA 3K9WA 3SQOA 2QS9A 3VNAA 2GXAA 3IAAA 1JJ7A 2WZQA 2XEDA 1L0BA 4KH1A 3CKYA 1JLMA 4P83A 4WBSA 1L5HA 1EXMA 3O2NA 4IFIA 1F3OA 1O77A 4XWYA 2DKNA 4MAAA 5K6AC 4BNNA 1QDLB 4GX2A 4QNNA 2EGUA 1B43A 4D9GA 1EUDB 2NZXA 1A8SA 2BW0A 2V3VA 3AUYA 3KSUA 1TQ8A 1N0VC 2ABWA 2QORA 4ZI5A 4OU4A 4ZEOA 4ZCIA 4ZVKA 3TTYA 1KAGA 1S2IA 1L7DA 4H0FA 1XU9A 5CVJA 1QAMA 1AS0A 1TIPA 3U60B 3QKRA 2WJIA 3Q5GA 4LV5B 1R6VA 2IS4A 1P4JA 2BAGA 3GLHB 2IKSA 2VJDA 1M2VB 1HK7A 2O2JA 2V5AA 3KPJA 1BS1A 3Q6NA 4H7FA 4O0MA 1PN3A 4OGFA 4PN7A 2JIZA 3NDRA 3X1MA 2OQ2A 2RHLA 3A4TA 2XCOA 3UENA 5D00A 3JXEA 3L7IA 4BTLA 4XLZA 4OHBA 1W36C 4F21A 4CEHB 3H8JA 1Y0BA 1B8VA 4RH3A 3DMGA 1U7UA 3VPBA 4Z99A 1KGDA 5EZYF 2VHWA 3ZIUA 2NTJA 4NE9A 5IBPA 2X1MA 3T5AA 4TT8A 4WLEA 2O5VA 4M38A 3HP4A 1E79D 2P6UA 1RIIA 2HDWA 2NIPA 2QF7A 2YWJA 3CCBA 3EW9A 4JVNA 4QLOA 1QV6A 1TYBE 2FMHA 3DOFA 4PY2A 3GUVA 5EN4A 3CLRC 3GWZA 3NJ4A 2M32A 1GL6A 2IIQA 3DE7X 2HXSA 4RELA 4NPCA 5SV2A 1C4KA 5DB4A 4TMWA 3CG4A 1CEYA 1F4LA 4LECA 1K9VF 5BR4A 3IE2A 4EIWA 3UT0A 1JIQA 4CMBA 1CULC 3I0ZA 4UUPA 2XMPA 4X20A 2WSLA 4CLHA 3AW9A 4Z49A 1KDRA 3ZDDA 4K26A 3HJCA 4MHTA 1JMKC 2Q6VA 5EUMA 1YS9A 2I87A 3QWHA 4CGZA 1Z3CA 5CAEA 1ISMA 1DC4A 1ZZEA 1DUVG 3DR3A 5CG2A 1JEAA 5FBVB 4IRMA 4F93B 5L4SA 4OTZA 3DCJA 5F7ZA 1MIOA 1OLUB 4ALIA 3KLOA 2VJYA 2DSNA 4C2AA 5KEIA 2WR8A 5B6IA 2P9CA 1YAJA 3AV0B 1WEHA 2WJ6A 3NTRA 4FQ7A 2OESA 4TTRA 5EFOA 3GUHA 2ZYRA 5FOVA 3RBXA 2CXHA 1JJVA 3B9RA 3AKZA 2Q28A 3NV7A 3PXAA 4CWAA 3QELA 1EK6A 3FOEC 2J41A 2I1VB 1I0IA 1OIVA 4QZVA 2FSVA 3H2IA 4OXQA 3RFTA 1G18A 1KI3A 2AFIA 2JZNA 4CTOA 4MDEA 2RGRA 1XZAA 1DVRA 4IJQA 2R4UA 2V65A 3W77A 1XOIA 1I2CA 1V8FA 4C3ZA 3PICA 3QEOA 1P9NA 3G8CA 3TKAA 4ZVRA 1AT1A 2AT1A 3K71B 2BFOA 2B0JA 1A9QA 3MBIA 2HOQA 4ZT2A 1BFDA 1N8KA 3WLSA 4AJNA 2O52A 3LS2A 4ND7A 4DARA 3LT2A 5ISMA 3I1YA 4II3A 4AULA 1T4MA 3O4RA 4QGHA 4CI0B 2Q3JA 4GL2A 4MYTA 3RRYA 3GVXA 3T38A 1N9GA 4FWTA 3LBAA 3IP9A 5ALNA 4EX7A 4TTTS 4YLEA 2ORED 1HF3A 1QCDA 4CQMB 2JLWA 1N1MA 4QOGA 1AQJA 4B82A 3OZUA 4YRPA 4A3SA 1CDEA 3AIOA 2QY9A 5IN4A 1E9DA 4BLQA 4XAQA 1AQNA 1V25A 2NZ8A 2ZIUB 1F6WA 2OHIA 3C6YA 3N5CA 3S81A 2PE5A 4MUYA 3MSXA 3KJHA 4CPDA 3BJRA 3R0XA 2YKGA 4KREA 3LXXA 4TMVA 2KYRA 2XMQA 5KOYA 4KW7A 3V55A 4HAUA 1KR2A 2PUGA 4U7JA 1CFJA 2GZRA 2A9QA 4HDMA 4JR1A 4TTAA 1NBWB 3OCUA 1OFHA 1FFHA 4IM7A 1PGOA 3EISA 2X0DA 3PF8A 4MKRA 1NXOA 3A6DA 4OV6B 1KY2A 1FP1D 1WA5A 1Y37A 1ADCA 3N0XA 4X90A 4MDFA 3OP4A 1NT4A 4MITA 1QHIA 3D8TA 1OROA 4Y9SA 3WC4A 2BR5A 4UQPA 4BMCA 1ZXXA 5I3ZA 4JVOA 1TTHA 2VNJA 3E70C 1UBLS 4ONEA 1RTKA 1NXVA 1RXCA 2KLHA 1T5IA 3GB9A 3KL2A 3UMRA 4JEHA 4D81A 4D0SA 1PT9A 1MZVA 1RE0A 4L76A 4F5DA 5HPYB 2FGJA 2XQVA 2PRJA 1C3JA 1H0HA 4QTTB 3B6IA 4RLFA 4P2BA 2F00A 4YMUA 1YQGA 1KOFA 2IVZA 4WNYA 1JL3A 1PBNA 1Z45A 2HDHA 1UEXC 1PTJC 3GZNB 3NC4A 4G4SO 1QE5A 1J8DA 1L4EA 1G1MA 1IH8A 3AUTA 1ISJA 5DEIA 1DOAA 5ALFA 4CM6A 4QARA 1JAHA 3RAEC 2G88A 2HA0A 1RU3A 4ZZ2A 3SKXA 2DHEA 5EXEA 4XX0A 2A5LA 4O4JF 2O1SA 2PIDA 2CCJA 4FFNA 3UAVA 1BXKA 1YR8A 4HFRA 4HX9A 4AWBA 4DF3A 1A0OA 1X3SA 4KDFA 3RYCB 1MHTA 3ELDA 4F4JA 2NNWB 3OWOA 1WY7A 2B8EA 5IT4A 2EFDB 3QV2A 4M9CA 5JJ5A 1T6BY 3DV9A 1IUNA 1GRQA 1JT9A 1UBEA 4EYKA 4B32A 3WNCA 4EYEA 3S8YA 3FKSD 4TQ9A 4OXRA 1O94A 2PX6A 1A2KC 1C30B 1EUCA 5EKXA 3IXMA 4R51A 5KTSA 3IJRA 3K2IA 3TLGB 2D1YA 3SE7A 5C8YB 3PRKE 4MW5A 3OIYA 4A1OA 3QY0A 3FHOA 1GSIA 4OQQA 3VX4A 2K6GA 3IUSA 3FDFA 3OZCA 4OB8A 1K8YB 1E3JA 1KC3A 1RLMA 4MCIA 5H1YA 1GLVA 1YV9A 4JJ4A 2ZSHA 1P2TA 4R2KA 2H1CA 3H99A 1AKWA 2MSEB 3A1TA 4PONA 4QQNA 5EVCA 1H23A 5U4XA 3TTUA 3ZW8A 1MB0A 2VBGA 2R97A 5ER9A 2WSIA 5COAA 4IV8A 1SM4A 1PFGA 1BKDR 4KNVA 5C0OE 5JR3A 2C8JA 3AJRA 3ROKA 1J09A 4G5SA 3BXOA 1TUBB 2CDRA 2ZRCA 4H08A 4MKZA 5FO1A 5FYDA 5LQJA 1TTQB 1N3YA 2XCQA 3I6ZA 3FDZB 1QZXA 3UWSA 4UFNA 2XVAA 4Q9KA 4I1PA 3QVGA 1P9WA 1PDVA 4YRAA 4OH1A 4D92A 4G97A 4JC0A 1Q91A 3SI7A 4G37A 4H1UA 1K7XB 4H2DA 4Q4AA 4RV4A 2H7XA 1DE0A 1VLQA 5E7MA 3W34A 4TLDA 3LNCA 4J2TA 1GEEA 1CPYA 2ZP1A 4NU5A 4O8ZA 6YASA 4YJHB 1KK2A 1QHEA 3MOSA 3RYIA 4EQ6B 2V03A 3AKCA 1NONA 4E70A 1U0TA 4KOAA 1M1YA 1ULTA 1RFLA 4K5QA 4PGMA 5ALLA 3DDHA 1D6NA 2W2XA 4MRAA 1MW9X 1OFIA 2VNIA 3VRHA 1DKNA 3EN0A 2FPUA 5JG7A 2JKZA 2FQWA 2ZUUA 3RCBA 4OOFA 3U7JA 1FJ2A 2XUZA 1KJQA 3ETLA 4ND1A 3RABA 5IMSA 1FS6A 2DB3A 4WDRA 4J4BA 4QNRA 1QRDA 3PA8A 1OBHA 1UBKS 1SELA 4RVFA 5G4LA 3QFHA 4R9VA 2UXCB 5ILOA 4E07A 5AM2A