4MOWA

Crystal structure of a putative glucose 1-dehydrogenase from burkholderia cenocepacia j2315
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
248
structure length
248
Chain Sequence
MSKLAGKVAIVTGASKGIGAAIAKALADEGAAVVVNYASSKAGADAVVSAITEAGGRAVAVGGDVSKAADAQRIVDTAIETYGRLDVLVNNSGVYEFAPIEAITEEHYRRQFDTNVFGVLLTTQAAVKHLGEGASIINISSVVTSITPPASAVYSGTKGAVDAITGVLALELGPRKIRVNAINPGMIVTEGTHSAGIIGSDLEAQVLGQTPLGRLGEPNDIASVAVFLASDDARWMTGEHLVVSGGLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose 1-dehydrogenase
publication title Crystal structure of a putative glucose 1-dehydrogenase from Burkholderia cenocepacia J2315
rcsb
source organism Burkholderia cenocepacia
molecule tags Oxidoreductase
total genus 90
structure length 248
sequence length 248
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.47: Glucose 1-dehydrogenase (NAD(P)(+)).
pdb deposition date 2013-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4mowA00
5A06A 2Z1MA 1UUFA 2EG9A 4YRDA 3DBRB 2HMWA 3RWBA 1AN9A 4UUMA 5JO9A 4DVJA 2VRCD 3FNHA 1PL7A 2BGMA 1DLJA 2PKRA 1R4MA 2VTDA 2BF7A 3TSCA 2OFPA 5FYDA 4OXYA 5LCXA 2J5QA 4E5YA 5EQDA 1GUYA 1R0KA 1R4NA 4MJLA 5CDGA 3FD8A 2ZCVA 2NVUB 3VPSA 5C37A 1B3BA 3UICA 1OAAA 3F4LA 3S2GA 1B26A 3D3WB 2UUOA 1DFGA 3JQBA 3JQAD 4MKXA 1X15A 5G4LA 3RVDA 3I3OA 4Q3CA 1KEUA 4RF3A 3VHRA 2PNFA 1P77A 1XELA 3D64A 3K9QO 3DC2A 1B2LA 2Y66A 3GMDA 1VE9A 2O2YA 1AUPA 1YQDA 4HY3A 3I23A 1HLDA 3C1TA 2E6UX 2GPTA 1MXHA 1E3IA 4ND2A 3DB2A 4QSMA 3WWZA 1DHRA 1X1TA 5JO0A 3I9JA 1B7GO 1PJTA 1EVZA 4IJKA 3ZWBA 4DBVO 2VUUA 2EJWA 3O26A 1KC1A 2CVQA 1PZEA 2GO1A 2R2GA 1MFPA 1IUKA 2G1UA 4BGVA 3AK4A 1QP8A 4RF5A 4A7PA 4F45A 3NYWA 1PWXA 3ASUA 1PEDA 4M87A 1Z74A 4RVSA 3TZQA 4BO5A 5A1TA 1T2CA 1ADFA 1ONOA 4RDIA 2EKPA 3VH2A 4HV4A 3PWZA 3L6EA 5JCJD 1WZIA 2O3TA 2XOXA 5L9AA 1N8KA 4UVDA 3GZ4A 4ZQFA 2VHWA 1ZVMA 4P4GA 3CTMA 3S2EA 5BNIA 1KY5A 1YGYA 3COSA 2FZEA 4I8XA 4FPXA 4I5DA 1GADO 1WAMA 2HJSA 4GX2A 2O50A 2SCUA 4OHUA 4XQCA 2X58A 5A3VA 4CLHA 4CMKA 4RVHA 1H0KA 1Y5MA 5CPFA 4JCOA 2V6GA 2OL4A 3DMTC 3O9ZA 4IDFA 4IUYA 5K9ZA 4J4HA 2AQHA 4TKLA 3DEYX 4QX6A 2LDBA 4AJHA 3PIIA 1QLHA 4ZVVA 4N5MA 3I4FA 3C85A 2PWZA 4IZIA 4GGOA 4PLFA 5JYEA 5BSFA 4J9UE 4IPTA 4GGPA 3F5SA 1C0LA 2VN8A 1TT7A 5THKA 4DXHA 5LDHA 3VDRA 3BMOB 2BFMA 1U4OA 2I3AA 1BVUA 4J1QA 3DFUA 4CUKA 3HSKA 2Y93A 4WPGA 4FFOA 1XQ1A 3SC4A 3BMQB 3D4OA 5L51A 4FD3A 2P4QA 4PLPA 1HZZA 2VYNA 3NUGA 1K2WA 2JFHA 2YV2A 3RFXA 2HKIA 3PXXA 1ZK3A 4B8WA 3HWRA 2HMVA 3OFSA 1DLIA 4BNZA 1R15A 1ENYA 1I3NA 2CNBA 1GFSA 4DIBA 1X0VA 3OIGA 5G2OA 2DTEA 3NEPX 1NVTA 3DL2A 2Z1NA 1O95A 1ISHA 1G6KA 3DWFA 3ON5A 4NFHA 2B4RO 2Q2QA 3FRJA 1DIAA 2PH5A 4MDHA 5HBRA 3T7EA 1R4MB 1ENPA 1PL6A 3DZIA 1GDHA 2OOSA 1ML3A 2FR8A 1WMAA 4I5EA 5L7YA 4BNTA 4KQWA 4ND5A 2CF6A 2PD3A 3UFXA 1R4NB 3RI3A 1Y6JA 3A28A 1HDXA 3N74A 1I2CA 4R69A 3VZSA 5DNAA 4W82A 4KDEA 1YE3A 4WE3A 3JQ7B 4JP3A 5IDWA 1EEHA 1GU7A 4MKZA 2H5LA 1N1EA 4ITUA 4NFYA 4AVYA 1K6XA 5IZCC 1Q7BA 2X5OA 3U49A 4BNVA 3OJ0A 5F3RA 3AU9A 3NAQA 3E03A 6LDHA 4OMUA 1EZ4A 1RM3A 2GASA 4R1SA 1I2ZA 1YJQA 1YO6A 5MGBA 4GWKA 2UVDA 3CXRA 4TRMA 3MJEA 4R1TA 1ZXBA 4IZHA 4GMGA 3FN4A 3W1VA 2NUAA 3NDIA 1MA0A 3L9WA 1KOLA 3RFVA 1P1KA 2AXQA 4FGSA 3A4VA 1EVYA 2YQ5A 1KEWA 1SB8A 3ZHXA 2Z95A 3CKYA 1CETA 3PEFA 3BTUA 1KYQA 2RBEA 3K2EA 1JA9A 2XF8A 1HE5A 1BWSA 4XRGA 3NT4A 4J0FA 1B14A 3NX4A 3KBOA 3ASVA 4Y6PA 5H82A 2EW8A 1ULSA 3AM3A 3QLJA 4L9RA 4NBTA 3TNLA 3WFJA 3WQQA 3E5MA 1YDWA 3IKVA 4JBGA 1KVUA 4YDRA 4QT0A 2NWQA 1GD1O 3AFMA 5DCWA 3GN1A 5BNFA 3DMYA 3G0OA 3HN2A 4L4RA 3ROMA 3KTDA 4N5LA 5FEUA 3CPSA 1O6ZA 1N7HA 3DOOA 5GMOA 1V3VA 1VJ1A 4YCAA 4RF4A 4Z3KA 1WWKA 4CODB 3AW9A 4DA9A 4WOKA 4Q3EA 1BMDA 4UAGA 3ZWCA 4W9NC 2VTEA 5B37A 3BMCA 3INGA 3GOHA 5L3ZA 3EDMA 5EINA 5A03A 3RBXA 1PJQA 2G82A 2NU9A 2EP5A 4FC6A 3Q9NA 3DAPA 3Q6IA 3VVBA 1HF3A 1R0SA 2RH4A 1I24A 4BO4A 3WIDA 4E2YA 1XSEA 4GX0A 2P5UA 4NDNE 2HK9A 1QR6A 2GCGA 5IFLA 5L4NA 2B0JA 3KO8A 4FBGA 4EJ6A 3GVXA 1YWGO 3DONA 4CM9A 1E1LA 5F5NA 1GQ2A 1O9BA 1CF2O 5JAIA 2YZ7A 4GL4A 4GQAA 4B4WA 3ZU2A 2W2LA 3H9UA 2I76A 2NNLD 4CQMD 4IGEA 1D1TA 3GA0A 3JD3A 1ADGA 2OBNA 4DWVA 4YAJA 4IJWA 1YQGA 3IDSA 1HDOA 2O4CA 1Q7CA 3ZWPA 3O4RA 4Z3DA 1ZIDA 3IP1A 5I9LA 4YEDA 3LU1A 3EZLA 4E30A 1UDBA 2GRAA 3DZFA 4OM8A 1C14A 2FZWA 4YRBA 1G1AA 3NGLA 3GDOA 2C7GA 4A27A 1Y1PA 4KUHA 2FN7A 2HDHA 1UH5A 3D5QA 4ND4A 1E7RA 4XKJA 4K28A 1AHIA 4ZQEA 1WVGA 1E3SA 1PGJA 3ADPA 4AJKA 3PP8A 1H5QA 5COQA 1PZGA 4PIVA 3ZHYA 1HYEA 2HRBA 4E3ZA 2OUIA 2QYTA 3LZ6A 3WGGA 4CV3A 1KVSA 1S7CA 3W4JA 3PPIA 3WBFA 1PGPA 4EBFA 3ZH2A 1GEEA 2A9FA 1PJSA 3GR6A 3TZHA 4BNYA 4GI2A 4UVEA 3I9KA 2D4AA 3PFFA 3PLRA 3GFGA 3WLEA 4CMBA 3ITKA 3EAGA 3M1AA 3G1TA 3ZWMA 1D7OA 4M54A 4Q9NA 3KXDA 1K5HA 3VH1A 3INTA 4OOEA 5ICMA 4AJOA 1ULUA 4CR8A 3IUPA 5BT9A 4CUZA 1WLYA 2ZTLA 3LT1A 5KTKA 3W8FA 3LLVA 2C0CA 2BELA 4N54A 1P3DA 2J5RA 1ISJA 5A05A 2YHIA 1QYXA 1E7SA 1JLLA 1H94A 2QG4A 4DLLA 1J49A 4I9NA 1Q0LA 2YQ4A 3NTQA 3GFBA 3ROKA 1ENZA 2OHXA 3GEGA 4DQVA 1ZEMA 3ONFA 4TKMA 4Z6KA 3AOEC 4FOSA 1HDRA 3K6JA 4J2HA 4KDFA 1WZEA 4J1TA 3JYQA 2DBRA 4XQ9A 2ZTMA 4LRTB 3RUDA 1NTOA 2VRBA 4BNWA 5T67A 4YT2A 5IXYA 4NQZA 4OL9A 3S1LA 3S8MA 3CMMA 1LC0A 2QRLA 4ZQHA 4DPKA 5AYVA 1MC5A 2P9CA 4RORA 2EF1A 1DIHA 2VZ9A 5I8WA 1OBFO 4J49A 3F1LA 2QW8A 3B1FA 8ADHA 2DFDA 1XGKA 5DOVA 5TLSA 1LRJA 5A9RA 3BMCB 1N7GA 2J3KA 2B37A 4MPDA 1U8FO 1L7EA 1OC4A 3WMWA 3WJAA 2HJRA 3L07A 2BFAA 4XGIA 1E5LA 4BNMA 1YJ8A 2G0TA 1E6EA 3MJSA 5JCXA 5DCYA 1TLTA 2PGLA 3TN7A 3PZRA 1LDEA 4XDYA 5G4KA 1GUFA 4I5GA 1RWBA 1LDMA 2Y0DA 1Z75A 4XQGA 3PK0A 3KVOA 4MKRA 4FCCA 4IQ0A 4Q3AA 1KC3A 1W8DA 4WCFC 2NTVA 4ZHSA 4KTTE 3JQFC 1A5ZA 3JSAA 3MOGA 5BSEA 3STHA 1NFFA 4BKOA 1MC4A 4J2OA 4BS9A 3DXFA 4QECA 4DQXA 2O23A 2C82A 4PFJA 3HDQA 2QHXA 3QRWA 4H15A 4DC1A 5TGDA 2X7HA 3S55A 4B79A 1EK5A 2I99A 1WDLA 4MVJE 4YXFA 3KOUA 3VTFA 5CAEA 5C7IO 5CDTA 1CDOA 3CIFA 4CLXA 5CP8A 2JCYA 2I9PA 4QXMA 1YB5A 1RPNA 4EEXA 1X13A 5CEJA 3QWBA 3V2HA 3VZRA 2H6EA 4OSPA 4I5FA 2VOEA 1ORRA 1ISIA 1OZAA 4M89A 4WLEA 1HT0A 2B36A 2BH9A 1ONNA 1H93A 1H9BA 1NNUA 1MXFA 2D1YA 1VL8A 3GF4A 3JQ9A 1QLJA 2VRCA 5LDGA 3KYCA 4FFPA 3PYMA 2Y05A 3RQSA 1B8UA 1ZO8A 3H5RA 2B5VA 1C0KA 3DHEA 4XZ3A 5KJCA 2CUKA 3PTZA 2P2SA 2EGGA 2G76A 2IYOA 3L4BA 4BNIA 2O7QA 2I3GA 1V0JA 3C7DB 4PRKA 5K6AC 3ST7A 4BMSA 4BOYA 3S2FA 2ZB8A 5C5IA 2GD1O 3DBLA 5ES3A 5DP1A 1T2AA 4HFJA 5T8KC 3FWZA 4MIOA 1I01A 2ZJ0A 3ETDA 3JQAA 4D0RA 1A27A 4ALKA 3QWIA 2X23A 4YAIA 3K31A 3ZCXA 4YYZA 5HWSA 1J5PA 2ZYDA 3CUKA 1LRKA 1Q7GA 5ADHA 4UEJA 1NHWA 3DOCA 2YHIB 2B35A 1JQBA 1OOEA 3GUCA 4DMMA 2JFFA 2ZB4A 3WBBA 2DBQA 3NV9A 5H81A 2Q45A 3CEAA 1GR0A 2OMEA 3BYZA 4JJGA 1U3VA 4IINA 4CV0A 3LF1A 3WGIA 1QMGA 4LSWA 4ZU3A 3BZUA 1SB9A 3H65A 4QEDA 4U6SA 1FF9A 5JE8A 1AHHA 1F17A 5ITVA 2AQIA 2AQKA 1CRWG 4CR6A 3GHHA 1KS9A 3BHIA 2J6IA 2J5KA 2ZB3A 3W8DA 5CG2A 4GVXA 4BGIA 1HKUA 2BGKA 3E82A 5B1YA 3E5RA 5DF1A 4BGEA 3WR5A 1JDJA 3KM0A 2ZYGA 5JCJA 2OP0A 3JQCA 1M76A 4RQTA 4CMIA 3WQSB 1A71A 4BO9A 5L4SA 3IKTA 4R4JA 4HNHA 3UVEA 5IAAA 3VAZA 4BUCA 1JAXA 1PIWA 3OICA 1PZHA 4IM7A 1HDZA 4R16A 2YFQA 4IJVA 1FMCA 4PG5A 4W7IA 4MINA 1E3EA 5F1PA 5HA5A 1KY4A 3T4EA 1ZCJA 2IZ1A 2CD9A 2QX7A 2VT3A 2Z5LA 4IJUA 4BV9A 1C0IA 4R9SA 3WGTA 3PJEA 5CPBA 3DO5A 2TMGA 4WUVA 5DN9A 5G4KB 5I9MA 1YL6A 4D44A 3ENNA 4OGWA 2Y1CA 4QUKA 1SEPA 2NTNA 3KB6A 3DQPA 3DZHA 3BTOA 1PGNA 1QYVA 1K3TA 4E5PA 4JIGA 1Y7TA 1GV1A 1B0AA 4GMFA 3WSVA 1I36A 3ZNQA 4CM4A 1TVEA 4CMEC 4QQRA 5GZ3A 4EYEA 3M2PA 2C5EA 1UXKA 4YR9A 5TT1A 1DSSG 3UF0A 1P1HA 4K6FA 2EHDA 2O7SA 5TT0A 3FNFA 3AUUA 5DBIA 1YL5A 3I83A 4RPHA 4IDEA 4BNJA 2VWPA 4G81A 1PQPA 2V6MA 4ZICA 3OP4A 2VNSA 3KSDO 3R6DA 4ALLA 1HETA 4XEHA 4OKIA 4F6CA 1A7AA 2AA3A 5KKAA 4FGWA 2X0NA 3O03A 4X54A 2Y0EA 4HFRA 3KYCB 4WEQA 3TFOA 1DRWA 3GY0A 4D3SA 3ICPA 3RC2A 1B16A 1BXGA 5G0SA 1TEHA 1DAPA 1SO8A 5G0WA 3X2EA 5BQFA 5HS4A 3E18A 3MCVA 1U7HA 4D79A 4FR5A 1HDGO 5JDCA 4XGKA 3JQBC 3TPCA 1LTHR 1ZFNA 4CR7A 3DHNA 1U3WA 3ULKA 3ANNA 4JXKA 5LC1A 3VPXA 4DMLA 1DJQA 1NVMB 3DBLB 1UXHA 3FHLA 2BLLA 4P4NA 4NR0A 2PR2A 2WJPA 4EJ0A 2PGDA 3JQAB 4IS2A 2P68A 3MZ0A 4O63O 4R1UA 2O48X 1Q2XA 5KKCA 1VJTA 9LDBA 1NAIA 4IDBA 4D46A 1A4UA 3FI9A 1M6WA 3ZV5A 4YVFA 3PJDA 2WDZA 4P8RA 3OF2A 5TRTA 3EGOA 1QYCA 1V6AA 4U0JA 4ALMA 2WTBA 3QJ5A 1UR5A 1YRLA 3PWSA 3QE3A 3TDKA 3WGHA 4BKPA 2C59A 1DOHA 1GZ6A 1F14A 4D7AA 4KOAA 4L8VA 4E5KA 1DHTA 1EUDA 1I5RA 4Q3NA 3WJ7A 3AY3A 2I6TA 2FR0A 3IS3A 3JQGA 4Z9XA 3ZHZA 5IDXA 1ZJZA 5TIIA 2Q2VA 2VUSA 3FNGA 3I1JA 2VYVD 3GVHA 2P5YA 5T6BA 1UJMA 1E3LA 5JAMA 4RZHA 1NPYA 4IDGA 2WMDA 4IIUA 5B12A 3DAGA 3PYLA 1P0FA 3GGPA 3U4DA 1CWUA 3QHAA 1YXMA 4TVOA 1T4BA 4W4TA 4BO3A 1R6DA 3N7UA 2FWMX 3H5NA 3ZN2A 4CMIB 1J6UA 4FJ0A 1PJ3A 1MG0A 3DBHA 1TA4A 3F9IA 2RAFA 4D43A 5I8ZA 2DM6A 3PVZA 1DXYA 4PZCA 4R41A 2W2KA 2BFOA 3FR7A 2O3JA 3G3EA 1LBEA 4R68A 2D2IA 4IBOA 1ID1A 3OQ6A 1LDGA 3JQ8A 1HSOA 2NQ8A 4YJDA 3W6UA 2EJVA 4TSKA 3P7MA 2X0JA 2NU8A 3IJPA 4UREA 2A4KA 4Q39A 1U4SA 3I6QA 2DVMA 1XWFA 3ZDFA 1W4ZA 4NBRA 1LA2A 3TL3A 3QWHA 1H6AA 4E0BA 4MVJH 4L4SA 1C1DA 1HDYA 3CZRA 3WGOA 1E6UA 1LJ8A 1UXIA 3SJ7A 4CM4B 1R37A 3MOIA 1U1IA 4LW8A 1P1RA 4CUJA 2PLAA 3ONDA 2PFGA 4PVCA 3V1TC 3TRIA 4F6LA 4U0KA 3P2OA 5CDSA 2ZYAA 2RHRA 3GH3A 3FTPA 4DYDA 1LSUA 1ISMA 1EUCA 4U6QA 2ZCUA 4Z0HO 4CQMA 2X9GA 2WYWA 4R9RA 4FJ2A 3H3JA 2GUGA 1DDOA 1ZEJA 2NM0A 3VPFA 4PN3A 4WASA 1AGNA 2C20A 5FWNA 3OIDA 2IDZA 3U4HA 1T1SA 2CDAA 2Q4BA 2GR9A 4XDZA 2YDYA 1IOLA 1UAYA 1GPJA 2R00A 3LT4A 1N1GA 1WP4A 1X7GA 1ENOA 4E6PA 4XWYA 2O3QA 1AE1A 1BXGB 3IQDB 1EVIA 4AL4A 1I30A 2Y1DA 1OFGA 4ZA2A 4CLOA 4UUNA 1WPQA 2ZTUA 4J9VA 1Z73A 3KETA 1ZBQA 4FW8A 4JP2A 3QP9A 2V6FA 3AFNA 3MWDB 2IEBA 1H6DA 3IUSA 3QWAA 3A06A 2VUTA 3OJLA 1IHXA 3OEWA 4FSHA 2BMAA 5CEFA 3RCBA 1EE2A 1PGQA 2HQ1A 2WD7A 5A5EA 5A04A 1XKQA 2GERA 1DC5A 2JD0A 4EUHA 3NJ8A 4JLWA 3K73O 4RVFA 5A5FA 4I9HA 2JCVA 4YJFA 4FQ8A 4UEOA 4XX0A 5JC1A 4IIVA 2YUTA 1FJHA 3CSDA 4FFLA 1VJ0A 4CQLA 1NFQA 2A94A 2HMSA 4XA8A 4E33A 2HRZA 1KERA 2AEFA 3TOXA 3U3XA 2HSDA 1JTVA 2JAHA 2CZCA 4UULA 3DZJA 4J1NA 4NU6A 3IL2A 1CQJA 2YDXA 3JQGB 3BMNA 2FPGA 4NH4A 4BO8A 4ZRMA 1DC4A 4XYLA 2O4UX 4J90A 4LGVA 1GYQA 4ZGWA 5ILGA 3PQFA 2H9IA 3V2UA 4RDHA 2Q99A 1DC6A 3F3SA 3AI1A 1Y9EA 1F0YA 3HUDA 1U3TA 5L95A 1PS8A 5JY1A 4KUGA 1MUUA 2E48A 3GG2A 4BQRA 3OIFA 1HE2A 3HZZA 4L74A 1XDWA 1Y9AA 4WOJA 3BIOA 4OSOA 1JVBA 3DBHB 3MJ4A 3ZWOA 2JAPA 1FDTA 1Z82A 2IXBA 3GNSA 1LLCA 1ZH8A 3DBVO 4LCEA 4S3MA 4DYVA 2Y1GA 2D0IA 2W2KB 2BGLA 2VT2A 3C1AA 3H3FA 4NK5A 4GVLA 4CL3A 1C0PA 5DDIP 3F6YA 3JQ8B 2X0IA 2Q50A 2GYYA 2BRUA 3Q11A 3GT0A 3AM4A 4E2WA 5A4DA 1E3WA 2X0RA 3V8BA 4A73A 1ZK0A 2WEKA 3UCEA 4U5QA 3WIEA 4A10A 2E4AA 3HNPA 3C8MA 2ZKLA 4HWKA 4TZKA 1LXCA 1FDVA 2QZZA 3FCOA 4OQZA 3OH8A 1W0CA 4J7CA 1E92A 2QIOA 3WGQA 1C1DB 4B4VA 5HTOA 3G17A 3SVTA 4WLUA 1E1NA 3QY9A 4XIJA 2X9VA 3GEDA 1GPDG 1H6BA 4L0QA 4JBIA 3HG7A 4E12A 3K30A 1GQYA 1AXGA 4J3FA 3U5TA 2HK8A 4CPDA 3WWYA 4PG6A 1WDKA 3M1LA 1MFZA 5I7EA 1Z7BA 2HMTA 2P91A 2UUPA 1XG5A 5U9CA 3NKLA 4W99A 3PJGA 5G0TA 3RAJA 4CQMB 5HS6A 1Q1NA 4BNXA 2FOIA 4R1NA 4W9NA 3WOHA 1SEVA 3H4VA 1HXHA 3KLPX 1X7DA 1D3AA 1FDWA 4J6FA 4M55A 2W98A 3F47A 2P4HX 4XYGA 4AJIA 5JDIA 1RM5A 3RBVA 1A72A 4XYBA 5AOVA 1N92A 1BHSA 4CV1A 1B3RA 1SC6A 1DRVA 3EUWA 4YJHA 1D4FA 4LSMA 2VWHA 2O3RA 2C29D 1CERA 2FPPA 4CLOB 3JQDA 5EL0A 1PJBA 2D8AA 1M66A 4GKVA 4YJGA 4B4OA 5L7WA 3INRA 3VTZA 5BNTA 3KZVA 1P31A 1E6WA 2NU6A 3IIEA 4EEZA 3LVFO 4AJ1A 4OQYA 3ZHBA 1F8GA 5IDYA 2JHGA 4DIOA 3B1KA 2CSUA 1M67A 2CDBA 4JJFA 5C3MA 1GUZA 2VZ0A 2WD7B 3AUSA 3WGZA 1KBZA 3JQ6A 3AUAA 1NWCA 4MVJI 1ZKMA 5DCUA 1U28A 1KVRA 1V35A 3KUXA 5DULA 4B7UA 4YJFB 1QSGA 2ET6A 3RU7A 3SBOA 1PSDA 1VL6A 1O0SA 2BFPA 3UCFA 4RQUA 4CQLB 1PR9A 1Y81A 2ZIZA 3GRPA 3QSGA 4K6CA 4GX5A 2DFVA 3CZMA 3NGXA 4RZIA 4NK4A 3WGYA 4ALJA 4LVCA 1EK6A 3BMNB 3ZU4A 1UP4A 2H63A 1A9ZA 4P38A 5JMWA 2JKVA 1I10A 5I7VA 3FBTA 4J4TA 1ZK4A 2D59A 2GGSA 1NR7A 3JD4A 4BKRA 3LYLA 4JQCA 4J7XA 4XD2A 1U5CA 3RSHA 1I3LA 1U5AA 4RGBA 4RJTA 4OIMA 4W7HA 2EKQA 5ENDA 4Z9YA 4DLAA 4WEOA 3ZZNA 4B8ZA 4E32A 2CF5A 3PHJA 4KP7A 1M6HA 3QA9A 2IYPA 3H7AA 1KVQA 3WLFA 5A9SA 2FSVA 3RUIA 3UW3A 4E2XA 4CMCA 1UZMA 3PGJA 2C2YA 4GH5A 4A26A 3AI2A 4PGFA 4LISA 2EEZA 3UOGA 4AJPA 1W73A 3JD1A 3M2TA 1CJCA 3A9WA 1E3WB 3DAFA 3DDNA 4E21A 3GPIA 2IZZA 4Z0TA 2HUNA 2D3TA 4WK6A 3RC1A 1SOWA 3AWDA 1PWZA 2FR1A 4W6ZA 4CM6A 3FR8A 3GDFA 3HDJA 3HFGA 1I32A 1GAEO 5TJ9A 4NPCA 3RUEA 1SNYA 1EE9A 1TXGA 4HKTA 3WMXA 3ZWNA 4EDFA 3QVWA 4IMPA 4C4OA 1JKFA 3OA0A 4IY1A 5EQFA 3U09A 1BGVA 3ZV4A 1N9GA 3TF5A 1PJLA 3GAZA 4YQZA 1U7TA 5L53A 4Z9FA 3C7CB 4RVDA 2OORA 2Q2WA 3H2SA 4OOFA 3LDHA 2HLPA 1VC2A 1EFLA 1NP3A 1T4DA 1E0DA 1GZ3A 3QVSA 4L76A 3RKUA 2G17A 4F3YA 3L4SO 3SJUA 1N2SA 1FK8A 4PLZA 5JYDA 3RUCA 1HL3A 2HU2A 4WLOA 5DBGA 1P45A 4EZBA 2QRKA 4OXNA 2YV1A 3JQ9C 4P22A 4EW6A 5U4QA 3ROQA 2TMDA 2OP1A 4MVJD 1ZSYA 2GNAA 3BHJA 5T57A 4CM7A 2I65A 2DBZA 4DREA 2I66A 2VWGA 2RH8A 4YJHB 3RFTA 3NT5A 3GQVA 3AOGA 4LVUA 3VZQA 1E5QA 1EQ2A 3L4BC 1O89A 4I1IA 4M1QA 1YOVA 4YJGB 1QYDA 3D3EA 2AMFA 4F46A 3C1OA 3DOJA 4KWHA 3GDGA 3HJAA 1I2BA 5A9TA 2Y1OA 4RCVA 4YT8A 1IL0A 1NXQA 4GWGA 3ZW9A 1LQUA 4JBHA 1ONPA 4AJ4A 2C07A 3ICCA 3OJEA 2Y68A 3UHAA 4NIMA 2ZK7A 1NFRA 1PR3A 3EHEA 3I9LA 4LRSB 1Y8QA 3GNQA 2O2SA 4GX1A 3CH6A 1NX6A 4OJNA 4RPKA 3RC7A 1LRLA 4A5OA 1O5IA 1U2DA 1UZLA 3KYBA 4FC7A 1DFIA 2LDXA 4PLYA 2GZ2A 1T24A 5KNLA 2YW9A 3I6IA 1JWAB 4D41A 1QG6A 3D5TA 5I9NA 2NSDA 2X5JO 5C7LO 4DBZA 3O8QA 1I0ZA 3OJOA 1T1RA 4CLDA 1JWBB 5KIAA 3WYEA 1QRRA 3U0BA 2NVUA 5F1OA 2CVOA 4CM3A 2GDZA 5JY6A 1ARZA 3ITDA 1DRUA 3WYBA 1EBFA 3D3WA 4Q3DA 5KOIA 1PX0A 3VPHA 2G5CA 1BDBA 3HB5X 2EV9A 4INAA 2PTGA 4NU5A 3WXBA 1I3KA 2DPGA 3HDYA 3QW2A 5K6AA 3GEMA 2VYVA 3OSUA 3PHGA 3VOSA 4PLHA 3HFSA 4Y8VA 4DUPA 4BV8A 5IG2A 1HYGA 3ONEA 3ZW8A 4UVGA 5T8KA 2NVWA 4AICA 3JQEA 4HUJA 4TRNA 1UDAA 2AQ8A 1HWYA 4EUFA 3GRKA 3AJRA 4XGNA 4KMSA 5A9SB 4ROSA 3K5PA 4IMRA 3Q2IA 3UXYA 2OO5A 3AM5A 4I9UA 4N18A 3WYCA 4D0SA 2C54A 5JBIA 3V2GA 4XR4A 3KLMX 3NTRA 4TROA 5TJHA 1XR3A 1V8BA 2YYYA 3NTOA 4B3JA 1YH3A 1CYDA 1T2EA 2Q4EA 4Y6RA 2VWQA 1UP6A 2VNAA 3GVCA 1YBAA 4BB5A 4Y67A 5B4VA 3VPGA 1XLTA 1ZUD1 3OA2A 2PH3A 5IDQA 1XHLA 2UDPA 1ZJYA 4JN6B 1PTJA 1OMOA 2A92A 3R3SA 1WMBA 2PZMA 5COBA 1JW9B 3ZWXA 1KIFA 1E7YA 1J4AA 1LDBA 5TNXA 4BO7A 1A7KA 4GAEA 1B15A 5FI5A 1VLLA 1ADBA 2B5WA 2J3HA 1G0NA 1PJ2A 2Q3EA 3K2BA 3U4CA 3R0IA 4ID9A 4R54A 3CE6A 1N9GB 1ZSVA 4GSKA 3MEQA 4LMRA 1PQUA 3FPCA 3I4CA 4A03A 3NT2A 4CLRA 3F46A 1P9LA 4G5HA 3KYDA 1MLDA 1HLPA 3I9OA 3OEYA 2PD4A 3GG9A 4N7RA 4Y6SA 1CIVA 1LU9A 1UZNA 4YACA 3SC6A 3A1NA 3H8VA 4RF2A 1QKIA 2UV8A 3TZ6A 2PA3A 5CDUA 5F21A 4J43A 1M2WA 2Y99A 3EK2A 4AFNA 4WECA 4DIFA 1V9LA 3GAFA 1U8XX 2OXIA 1ZNQO 2Y1EA 4FFNA 1YDEA 5JNLA 4NBVA 3UUWA 5CFZA 2VCYA 4NG5A 4OYRA 1SAYA 1HSZA 1EBUA 2JHFA 5JDCC 4R3NA 1NAHA 1LLUA 1YOVB 1ZSNA 3IMFA 3IOYA 4CM8A 3RUHA 2DLDA 1X14A 4G2NA 5MDHA 3EZYA 1VSUA 2E37A 3G49A 5JSFA 1BSVA 2EIHA 4HX5A 3MTJA 3PGXA 3GNTA 1CQIA 1DO8A 1ZXLA 3L9XA 2HCTA 2PV7A 5TQVA 3ZWAA 1Q0QA 1EDOA 1MV8A 4BMVA 1P74A 3O38A 1NPTO 3SLKA 1Y8QB 1BG6A 3C24A 3L0DA 3P5SA 1VL0A 1DEHA 4CMHA 2H1SA 1BRMA 2OZPA 3EY4A 2PD6A 3V5NA 1PJ4A 4NBWA 4RO0A 3GK3A 3G1UA 3ZWWA 4GLLA 4S1VA 1KETA 2J3JA 3QQPA 4MVJG 4WNCA 1Q0HA 1QV6A 3OHSX 4MP6A 2DTDA 2YFHA 1VKNA 3O8QB 4JGBA 3MJVA 3TZCA 3IC5A 5BR7A 4J4BA 4WGGA 5F5LA 3RJ9A 4ND3A 3KRTA 5GZ6A 4G65A 3RKRA 3JQ7A 4ALNA 1LSJA 4PCVA 4C7JA 1C3VA 2BKAA 2YHUA 1LDYA 2CY0A 4BNGA 4NZ9A 2GN9A 1YB4A 1KEVA 3ADOA 4ZRNA 5COAA 3ZWYA 4ILKA 5HM8A 2B4TO 4GLOA 4IGFA 2PGJA 3TJRA 5EJ2A 2NADA 7MDHA 4RPJA 4YAKA 4FN4A 1TT5A 2YV3A 2QZ9A 4XCVA 4TRJA 3OETA 3W8EA 2EGHA 5GY7A 3LSYA 3AI3A 5T64A 5B4UA 1UXJA 2CMDA 2Q49A 1G0OA 3SXPA 4H7PA 2IRWA 2VHXA 4M86A 5KWEA 4RL6A 1PQWA 5HRUA 2CFCA 2HK7A 2GF2A 4L73A 5EERA 4M8SA 4FB5A 2JCXA 5L40A 1W6UA 1FDUA 1LSOA 1I33A 3GC6A 4IXWA 1UAGA 3JV7A 4YT4A 4NI5A 3UAGA 3VKVA 2ILTA 1P1JA 4RVGA 3LLSA 3ANMA 4QFDA 2IXAA 2DT5A 1HRDA 1GYRA 2NLOA 2W4QA 2J3IA 4EITA 1MP0A 2HAEA 3Q1LA 1XU7A 4R51A 5G0VA 5JMPA 4IXTA 4LK3A 1VKOA 1P0CA 3WNVA 1LQTA 3B20A 5KVSA 3PQDA 1JKIA 1DPGA 5JW6A 4TMFA 2GSDA 2QRJA 1M75A 3TZKA 1IY8A 3KEOA 4CLRB 3U4IA 6ADHA 2P9EA 4GKBA 4TZTA 1YBMA 1VI2A 3KYDB 2DU8A 4XB1A 3RUAA 1XA0A 3DTYA 1LUAA 4PG7A 4PZDA 3BAZA 5IJZA 3RIHA 2RHCA 5CG1A 4D3FA 1SOVA 4NJMA 4DGSA 4O0LA 5JAQA 1P1FA 4II3A 2R00C 5KJEA 3F5QA 4HADA 4BB6A 1BW9A 4FIZA 4PLWA 3DMTA 5ICSA 2V7PA 2WSBA 3PFWO 1X1EA 2YY7A 4KZPA 3GGOA 1OI7A 1E1KA 2PZLA 2GLXA 2DQ4A 4AJJA 4CM8B 1WDMA 3QVOA 4YTEA 5KCZA 2AEJA 3HE3A 1H9AA 3K96A 5AVOA 4BL5A 4ZD6A 1HE3A 4DTIA 3ANLA 5EIOA 4N5NA 4J7UA 3AU8A 4AJ2A 5AQ1A 4JK3A 5A02A 4BHTA 3PJFA 3OQBA 1U3UA 2IZ0A 4URFA 1ZW1A 4PRLA 3I5MA 4BVAA 1S6YA 1Z7EA 4P4LA 3ENKA 3WTCA 4O59O 5L7TA 4BNKA 5ILOA 4XJSA 1PZFA 2C7VA 3D7LA 1EMDA 2WWRA 2B4QA 3QVXA 2XAAA 1GZ4A 3QVTA 2DTXA 3P2YA 3AY6A 3CINA 4PLCA 2BHLA 3RUFA 1KEPA 1NM5A 4DPMA 2V6BA 3JCZA 3PDUA 4E5MA 2VQ3A 3DZBA 5EMHA 2WYUA 3HQ4O 2GN4A 3W4IA 5IF3A 3PQEA 3R1IA 1XCBA 2Q1WA 1DFHA 3E48A 4K9DA 2GN6A 1HEUA 1ZK1A 3H9GA 3LF2A 2JL1A 4II2A 4XR9A 3SX2A 4BNLA 4EI2A 5I7SA 3KEQA 3Q3CA 4KQXA 2X1HA 4ND1A 4YA6A 2XXJA 2NTJA 2UAGA 8LDHA 4OAQA 5U1PA 2HMUA 2RIRA 3WB9A 2IEDA 2DKNA 3PHIA 4K1LA 3WFIA 1TT5B 2DUWA 3Q9UA 4J91A 1GQQA 4CLEA 3OM9A 3W6ZA 1LNQA 4FOOA 4MVJM 5IZCA 4IDCA 1NVGA 4LN1A 3ZNNA 1H2BA 1DIRA 5JAZA 1NQOA 1PL8A 4IQ8A 4NMHA 4LCJA 3VKUA 3FF4A 4MIEA 3VC7A 4BNHA 4E4YA 4H16A 1BXZA 3NDRA 2NU7A 4WNIA 4BO0A 2Q1TA 2B83A 5JLAA 3WG9A 4BNUA 5F1KA 2E82A 5ENVA 1GV0A 1WW8A 3HDHA 4ZQGA 4WKGA 1T2DA 3G79A 2CVZA 4WCDA 4XB2A 1R66A 4HFNA 1YL7A 1D1SA 2R6JA 4BO1A 2BD0A 1MX3A 1NQAO 1HTBA 2Y1FA 1UXGA 2Q46A 2FPIA 4Q3BA 1NHGA 3KSUA 3RROA 4UUPA 3B70A 1YKFA 2CDCA 2BI8A 1E7QA 3OECA 4BKQA 3D0OA 3JYOA 1B8VA 1DC3A 3HADA 5L45A 1V3TA 5KVQA 2EXXA 1Z6ZA 2QYSA 3VVCA 2NV6A 5C7OO 1DB3A 3M6IA 4EGFA 3HN7A 1LI4A 4JROA 2E49A 1SPXA 3KV3O 1IULA 3MTGA 1YS4A 3H2ZA 4MP8A 1EFKA 2X6TA 4KUEA 1N5DA 1ZZEA 1YONA 1SMKA 4IQGA 4TRRA 1RYEA 2Q1UA 3GGGA 4RLHA 7ADHA 4QO8A 5JDIC 4NJMB 2ZB7A 5A3JA 1LC3A 3RBZA 2W90A 4MP3A 1DIBA 3DR3A 1Y8RA 2PKQP 1BW9B 1MB4A 3RC9A 2X22A 3LT0A 4ZQBA 3RJ5A 4TWRA 5KVVA 4DL9A 1K6IA 3EVTA 3W4KA 4BKUA 4D3DA 3D1LA 4FFRA 4MVJA 3ZGYA 4UUOA 1R12A 4UEKA 4R3WA 4E31A 2XXBA 4BO2A 1LSSA 4MOWA 1SBYA 2VYND 1DIGA 5H83A 1BTOA 1P1IA 4WLVA 2A35A 2NVBA 4RPLA 2EP7A 1O8CA 4ESOA 3VDQA 1LEHA 1GTMA 1UP7A 4BNNA 2NQTA 4JJIA 1NR1A 1RM4A 1IE3A 2FSSA 3R3JA 2GZ3A 4PG8A 2JD2A 1P44A 4BMNA 2NACA 3Q0EA 1QV7A 3U62A 3IJRA 1E77A 2EERA 3ZU5A 1NBOA 1K89A 1GYPA 1K6JA 4DC0A 5IN4A 3I9NA 1IHYA 1NQTA 5FF9A 1R16A 4YBZA 4CM1A 5L4LA 4CM5A 1PS9A 3AY7A 5IXSA 1I8TA 3BXXA 3DHYA 3Q2KA 1LX6A 3EVNA 4BGUA 3L77A 2BI7A 2EWMA 2I67A 1HZJA 3DZGA 4NJOA 3WS7A 1P33A 2GN8A 2X4GA 1BDMA 5IZ4A 4J0EA 3H9QA 3LC7O 1EUZA 3NDJA 3B6ZA 1GCUA 3ORFA 1JKJA 2C2XA 3DFZA 4R5HA 1ADCA 4BIIA 5BSHA 4MO2A 2DBVO 4OKNA 3LC2O 3E9MA 3PDJA 1NASA 2ZATA 1IPEA 3H5AA 2Q1SA 3F4BA 2AE2A 1T25A 3GVPA 5AXDA 4PZEA 3WNQA 1JN0A 5THQA 1RM0A 2AE1A 4A2CA 1GL3A 1PJCA 4BO6A 4DPLA 1JVSA 2AEMA 4RLSA 2JD1A 3H6KA 4QO7A 5GZ1A 2EKLA 3BHMA 3PWKA 1E7WA 1F12A 3NRCA 3DTTA 3LC1O 3ROPA 1WNTA 2AW5A 3BTSA 5JC8A 4AG3A 1J0XO 5KJ6A 4XRRA 1EDZA 4ONEA 1FXSA 3GMSA 1XEAA 5EPOA 2FY8A 4FJ1A 4O1MA 4YQYA 5T5QA 3FWNA 5TX7A 3FNEA 3RASA 3JD0A 3K92A 3QIVA 3RD5A 2DUUA 4WLFA 5DP2A 5JPIA 2QQ5A 3GN2A 4U8GA 2FHSA 1LLQA 1FDSA 3FBGA 3E9NA 4DQUA 1CEQA 3PLNA 4DLBA 4XIYA 1A9YA 3K8ZA 4XJTA 5JXWA 2Y0CA 3GZNA 2FRDA 4AJNA 1HDCA 2VHYA 3L6OO 5ER9A 3TWOA 2F1KA 1IZ9A 3AOEA 2P9GA 4JX8A 4MIYA 4NBUA 4HXYA 4HNGA 2C5AA 1YBVA 4HFMA 3UN1A 3VZPA 3BTVA 3LK7A 5AXAA 1RJWA 4O6VA 5J23A 3T7CA 3TL2A 1YQXA 2X8LA 4NNJA 4OXKA 4XQEA 2ZQZA 3OMLA 4GSLA 5IN5A 1NYTA 3ZI0A 3HHPA 3D4PA 4Y9DA 1TB4A 4ALIA 1PU2A 3X2FA 4AJEA 1PGOA 5KVCA 3PZBA 3PIDA 5FI3A 3E6AA 4CMAA 2VHZA 4OO3A 3VH3A 1BVRA 3GUYA 9LDTA 1F8FA 4KTVE 4UVHA 1Y5RA 4YB8A 1T26A 4RVUA 4PLTA 4TQGA 1E7MA 4ZN6A 4B7XA 1Y8RB 2ZJ1A 2FP4A 4FS3A 3L6DA 1QXSA 1L1FA 1RYDA 2IE0A 3ZWVA 3MWEB 2I5PO 4B3HA 2XPCA 3MJTA 1SZJG 3JD2A 5JS6A 1YB1A 4U7WA 4CM9D 3KSZO 3LQFA 4PVDA 3WQRA 1IPFA 3TFQA 1B8PA 2RCYA 2W2LD 1L7DA 1E3JA 4J1SA 3ABIA 1NWHA 1WXDA 1ZMTA 2DPHA 4WCFA 4QTZA 5EN4A 3JQFA 4DRYA 4EJMA 5TF4A 1DAOA 4NFSA 4KWIA 4UVIA 4HP8A 2WM3A 1C1XA 4Y98A 3V1YA 3TOZA 1IZ0A 3CMCO 3B1JA 4BQPA 4R01A 3EW7A 1KVTA 1E1MA 5B4TA 3DBRA 3FTNA 2O3UA 4M49A 5KJFA 3QV1A 4YT5A 5K0ZA 4C7KA 4NHEA 1ISFA 4AJLA 1XYGA 3I9MA 2VZ8A 2WD8A 4BNFA 1XQ6A 1ZMOA 3ZNOA 4CL8A 3MJCA 4R5MA 4RPGA 3ETEA 1QYWA 1SCUA 4L75A 4E2ZA 1UDCA 4MVJF 2JJYA 3PHHA 2D5AA 3ETGA 5FFFA 4K26A 3ZNPA 1JAYA 5ER6A 3JTMA 4J16A 1LDNA 3N58A 5G0UA 3V1UA 1QORA 4Z0PA 2Y67A 1U9JA 2POQX 4IS3A 2D5CA 4WLNA 5TC4A 5CEEA 1VSVA 2IODA 2UYYA 3EC7A 1VPDA 2PZKA 4MVJP 1EVJA 4B3IA 2YJZA 3UGKA 4E13A 3LT2A 4RV9A 3UH1A 3ZV3A 3FSRA 4D42A 4YAGA 3OBBA 3ZU3A 3IP3A 3SEFA 1A4IA 5JFOA 3E1KA 1D8AA 3E9QA 2VHVA 4JNKA 3KHUA 2V65A 3ZV6A 1MGOA 2AHRA 4PLVA 5DT9A 1IYZA 1XU9A 3WTBA 1OC2A 1NQ5A 1ZK2A 3T4XA 2VOJA 2J8ZA 3A14A 2X5KO 3PHLA 1NPDA 1GEGA 3PI7A 3TQHA 1DJNA 3BA1A 2WE7A 3GZNB 4YPOA 2PK3A 4CJXA 1IB6A 1VM6A 3JYPA 3OQ1A 3RU9A 2W8ZA 3C3XA 1TI7A 3WX0A 3GPDG 3SLGA 1DBVO 3WDSA 2F00A 1R0LA 2WYVA 4IDDA 1RKXA 5KJ1A 3JYNA 4YWJA 4GBJA 4PG4A 4FFMA 4B7CA 3F1KA 5DBFA 1PS0A 4HBGA 3JYLA 3VH4A 1JU9A 2GZ1A 5TS3A 4EUEA 4XYMA 2HO5A 5BSGA 3UCXA 1BXKA 2PZJA 4ZJUA 4E5NA 4B4UA 1Z45A 2AG8A 1VRWA 3WSWA 3S2IA 2X9NA 2PKQO 1EQUA 4I08A 4WJZA 3U9LA 3PRJA 1AXEA 1X7HA 5CDYA 4PLGA 4D45A 1MG5A 4CMJA 5DOZA 1F06A 4YRAA 3H9JA 1I3MA 2O3SA 3EYWA 3AUTA 3E8XA 1ISGA 2FMUA 3DZKA 3PYXA 4H3VA 5AXBA 4CV2A 4FDAA 4QFCA 5AXCA 2AG5A 3D4NA 3GLQA 1K0UA 3OJFA 4CMGA 1O94A 1GCOA 5TSDA 4LMPA 2B69A 3HB4X 1H2HA 2WE8A 2PY6A 3BMOA 1X0XA 3UKOA 3EMKA 5I7FA 1T2FA 4A0SA 2DAPA 2ZQYA 1V3UA 3C7AA 4IDAA 1HE4A 3GVIA 5CHEA 4WCFB 1GY8A 2EW2A 3BMQA 5EESA 3WICA 4YAEA 1H6CA 3GHYA 4O5OA 4XYEA 3QWFA 3H9EO 4TVBA 5DZSA 3IAHA 1LLDA 4L4XA 5ITWA 4GPD1 2OBYA 4CMEA 1C1XB 3FPLA 3I52A 1U2GA 2DC1A 1YVEI 1XIVA 2ZTVA 1HYHA 2OGUA 2X86A 3P19A 4OH1A 2JFGA 3NJ4A
chains in the Genus database with same CATH superfamily
5HCIA 3RRJA 2EG9A 1P7VA 3DBRB 3G9QA 3E3NA 3FOEC 2OV8A 2X8WA 1Z0JA 3OLZA 5LIRA 3THXB 1NN0A 4UUMA 2E9SA 1H2WA 2PKRA 3KU4A 4UUAA 3FHTA 1QE0A 4L3WA 1Z25A 3NJRA 3NOVA 4LXHA 1L5HA 2R5NA 1Y80A 2B3TA 5EJ9A 1SCUB 1U2SA 2J5QA 4E5YA 4M53A 4KLZA 4O2AA 2PX3A 4MULA 1R0KA 1R4NA 2RB5A 1C8BA 2HHCA 4OU4A 1U7UA 3IRVA 4ASUD 1KEEA 2NN3C 3GRUA 1F60A 1TFUA 5C37A 4QIHA 1D2RA 5J47A 3FDFA 1E1QA 3BGVA 3DEFA 3S2GA 4Q1DA 2XE8A 3FTQA 2CSXA 4RJJA 1BGWA 2OLJA 1J0DA 5CNMA 1CSEE 1LK7A 3LXRA 1OR8A 1GNVA 3I3OA 4E4TA 4QUDA 3C74A 3O3MB 2UZ1B 3D3NA 4E88A 2B9VA 4RF3A 3KJQA 3VHRA 1K66A 2PNFA 5C1OA 3U16A 1B2LA 3GMDA 1UEIA 4TTTS 2Q0HA 1AUPA 3CNNA 2OC4A 4QXAA 3EVZA 3P4YA 4HY3A 2QTHA 1PHRA 2IW1A 3WMGA 4CVNA 1TMYA 3C1TA 2E6UX 3CNQS 3V4ZA 1G5PA 1E3IA 4ND2A 4EVSA 1XJQA 4XJVA 4UHJA 3WWZA 5BPFA 6PFKA 1B7GO 1A8HA 2WQZA 3P0RA 5D84A 3W06A 3J7AC 2OM6A 4DBVO 2GPBA 4CKBA 1TC2A 5JUWA 4W9RA 2R8BA 1JG7A 2EJWA 3TE6A 1UKAA 1IM2A 3NWPA 3K4QA 5ERGB 2M2IA 1QQTA 4Q15A 5FLYA 3NYWA 4FCWA 2OCIA 3SR4A 3VDMA 1M8GA 3ASUA 4XEUA 3RVRA 5GJBA 2FEXA 2FE1A 3DW1X 2EDAA 4QU5A 4RVSA 5JIBA 3CSUA 3MWFA 4PFKA 3Q10A 4Z2YA 4XARA 2FMHA 2HDNB 2HBQA 4RE5A 1DBWA 4QVKA 1CC1S 3T5MA 1KH1A 2VZEA 4N82A 2QD2A 3LJKA 1ORVA 3FFXA 4EJSA 1IG3A 3OY7A 2EKDA 4UVDA 4V0ME 4C05A 3TOCA 4D9JA 3KR0A 4MQFA 2VHWA 5GINE 4I3HA 4P4GA 4I1SA 4LDJA 1M0TA 2GBLC 3VU9A 2PVCA 3CTMA 5LOVB 5BNIA 4X6LA 1N9ZA 4CCYA 1KY5A 2BHRA 2PWYA 1N57A 1DAMA 1K86A 1JMKC 5BR1A 4FPXA 3V48A 4V3BA 2IOYA 4QTXA 2BFEB 4GX2A 2O50A 2SCUA 4OHUA 5AK5A 3F6PA 2X58A 4JJ4A 4NBNA 5A4JA 4O0MA 7AT1A 3K70D 1RQPA 1TU4A 4Q05A 3O3CA 1E62A 5HKOA 1RBZA 1BHJA 1P0PA 1USIA 2VPTA 3O2NA 4JCOA 2E4XA 1G55A 2V6GA 4IDFA 3QMPA 1IQ0A 3BXOA 3JVIA 4J4HA 4K6KA 1PWHA 2LDBA 1T2VA 3PCTA 3PIIA 4BQQA 1OI2A 5HOEA 3VR2A 2QVLA 3AJ9A 4N5MA 2UYOA 4B6PA 1XL0A 1EXMA 2GN1A 3A9SA 4IZIA 4DLYA 1VPWA 5BSFA 3HY3A 4J9UE 4IPTA 4DRXB 3BE6A 3F5SA 2OQIA 1TT7A 4UDOA 3PQ4A 4RMNA 2A57A 2LTAA 2HREA 2VPQA 2XUGA 1OCEA 3PGLA 5K3CA 1U81A 4YUVA 1GA6A 4EUKA 4PBTA 3HSKA 5I7HA 4DUYB 3MTDA 1XK7A 1SG0A 5AKKA 3UK0A 4LF4B 2Z3VA 4TT8A 3OZFA 1YR6A 1M0WA 3T1TA 1P8AA 3BGIA 4FD3A 2WM2A 1KI2A 2W37A 5JH7F 3AETA 2J45A 4RAOA 1K9VF 1HZZA 5K8IA 3FCEA 2HLNA 3DPSA 3IBSA 3KOMA 1BOFA 3P1JA 5K03A 1WHSB 2FE4A 4AN1A 1Z88A 1VP3A 4WINA 1L7XA 2HKIA 3PXXA 1X1SA 1RNLA 1ZK3A 1CQIB 3HWRA 4OQNA 2V7VA 4OY3A 3TQOA 5CFPA 1R15A 1HFEL 1MB2A 4QDOA 3C6BA 3G88A 2RGDA 3THWA 4K5QA 3X1KA 3N5KA 2Z1NA 1NF9A 2V7TA 3M83A 3ZQKA 3CB2A 1O95A 1ISHA 1CUGA 4ER3A 3QJYA 4GQBA 3DWFA 4B3RB 2FUKA 3FRJA 2AJCA 2VDNB 3ZQ4A 3AM1A 1RP1A 2WT9A 1DIAA 2PH5A 4MDHA 2XUJA 3K5IA 3VI3B 1NMXA 4FHCA 1N0WA 4DCPA 2AMLA 4BNTA 2BEWA 3RANA 1YIAA 4ND5A 3VU1A 1ZRMA 3AMVA 2WSLA 1OQAA 4QUAA 3N74A 3RK0A 2EZTA 3PNSA 5TS2A 1QAMA 4JLKA 4J3NA 1YE3A 3NHAA 5CFNA 2GTPA 3JQ7B 3CF6R 3FYDA 5IJWA 1QR2A 5T4EA 4EHAA 1A2KC 4MKZA 4ITUA 1K6XA 1XALA 4GXNA 2FPUA 2C5BA 4IHQA 1M6NA 4Q21A 1YKGA 2L2QA 3OJ0A 4MWBA 1ZJ5A 3AU9A 1Z8DA 3EYAA 1GL6A 4EI7A 2ZR8A 4ZVQA 3E03A 1EWYA 4B81A 2P3OA 2Z58A 4R1SA 4MUGA 1EFHA 4D9FA 3HSSA 1KAOA 4ESVA 5HR5A 4Z99A 3IIMA 4TRMA 1EM8A 2ZS8A 4CF4A 2IUFA 4LHYA 2R48A 3RPEA 4EGQA 1C9EA 3L46A 3L9WA 4LJAA 1UANA 3BQ9A 1P1KA 3DLPX 1ATZA 3A4IA 2BGNA 3KZMA 4NZOA 1HM5A 1KEWA 3AX6A 4X1YA 1S8OA 2Z95A 3CKYA 3HACA 5JHGB 3CJQA 2XF8A 4XRGA 4X85A 2P78A 3G8DA 1S96A 2EX4A 3KYIB 4Q34A 1B14A 1EJBA 2YCBA 2FA9A 4F7DA 2R1VA 3GEHA 4IDPA 5GQSA 1E60A 1NYLA 3LECA 3LYUA 4LZAA 3R74A 2O2EA 3SHOA 4NBTA 3TNLA 3B5JA 3WFJA 3DQQA 5D8DA 1RC8A 4CEIB 4Y9SA 3KFVA 4DV4B 2GCNA 3LUHA 2ONCA 1HX7A 4KR6A 1GD1O 1HT2E 3D8RA 2OLKA 3HN2A 1MJGA 4HL6A 4N5LA 1L9KA 4DLPA 3J7TA 3MWJA 4A0GA 4UM9D 1O6ZA 4TLDA 1V3VA 1YMQA 2YOFA 3D8UA 3UHJA 4IVPA 5TF0A 4ARVA 1U2RA 4RF4A 2PXXA 3ESBA 3KZXA 3SS9X 5KOHA 3B60A 3IBGA 1KK0A 1TUGA 4JSTA 2YJ6A 4K9QA 3WQBA 4G37A 2OB2A 4CBVA 3R40A 4IF4A 1G2PA 1M2KA 4ZZIA 1DUVG 4DS3A 1YU6A 3TSOA 2IHBA 3HCNA 4HD8A 4HN9A 2V9ZA 5T4BA 4JR1A 2G82A 4FC6A 3RRXA 3UANA 4FKMA 4NDZA 1QQ6A 4M2LA 1Q1QA 1XRSB 3QY0A 4LF6B 4BO4A 4E2YA 3OPVA 4E1BA 1XSEA 3ET5A 1CJMA 3S4YA 2K5UA 1QRUA 1KO1A 2P5UA 2HTFA 4INJA 4WD3A 3R0XA 2IEAA 5GV7A 3KO8A 1NLZA 1H2ZA 4LJ5A 3CR7A 5F2KA 3DS8A 2IEYA 5JNSA 3T1YB 4QJ5A 2A0FA 4LBZA 3EGWA 4O3MA 4OB6A 3TUJC 1LD3A 1QS0B 1UBGA 2GYUA 1SK9A 2CE2X 2PAAA 3KKPA 2FETA 2ECKA 2YZ7A 5FOSA 1YI1A 3CW9A 2G08A 3PSHA 2W2LA 3DE7X 4FINA 3PE4A 5CX1A 2NNLD 5AHOA 3U4GA 5BWNA 4IGEA 1TYDE 1A04A 2CWWA 2ZW9A 4PZYA 3RRYA 4B43A 5DE3A 4H7JA 2OBNA 1CUXA 3N8IA 2A5YB 2H2WA 3OE7D 1ZDMA 2PVSA 4GI5A 4HB2A 4YAJA 3UV3A 3K6SA 1E9SA 1OXSC 2C4HA 1JLRA 3IDSA 4LQCA 2VZLA 2W6JA 2ZUCA 3O4RA 4Z3DA 3IP1A 5EXTA 3HS3A 2C2HA 1P19A 4KSBA 5AHWA 2YVUA 1E2HA 1RHJA 4TSRA 3ILXA 2DEUA 1DBRA 1UBUS 2ACEA 1AKYA 1M5UA 2Q3HA 2FZWA 4YRBA 1G1AA 1TAHA 3NGLA 3GDOA 2C7GA 4CKEB 2HDHA 3ANXA 1J25A 1E7RA 4ZQEA 1MIOB 4RCYA 3T1QA 1R0WA 3T54A 1E3SA 2JF0A 5I5EA 1MAWA 1PGJA 1ITZA 1Z2CA 3TUZC 4GBMA 4HO1X 5CB8A 3PP8A 2P2NA 3DEHA 4B4DA 4OA8A 4KDCA 2A9QA 1UBCA 1HYEA 1SR8A 1O54A 2W2MA 5B1DA 2P9ZA 2OUIA 3QEKA 4E3ZA 3WGGA 5F52A 2HADA 4YR7A 1ZD9A 5HX7A 1S7CA 3HR8A 4R2XA 3EEBA 3PPIA 1XRLA 4UTXA 4Z3OA 3IP7A 3ZH2A 1GEEA 5HHTA 1X7ZA 1PJSA 4KIUA 5J4VA 1AQJA 3GR6A 3FUTA 1L1RA 3PDIB 4P4UA 4J75A 3TZHA 4BNYA 4KR9A 5BT8A 4DR5B 3F7OA 3GLSA 4QD3A 1N6KA 1UBLS 3K0CC 4HR7A 1BH6A 2I29A 3M49A 5E0OA 4ZCLA 3TRDA 4MS4B 3PC2A 3SQLA 1WCV1 2PL5A 4RH1A 2OCKA 4HB3A 1S02A 3D02A 3KXDA 2L42A 5JPDA 1II0A 1WVIA 1ULUA 4CR8A 1OZGA 3IUPA 5BT9A 1UIMA 3TEMA 3ZR4B 3DR5A 4CEHA 1E3MA 2I80A 5JALA 1DXOA 3KZCA 4JT2A 3W8FA 4IQ4A 5DKFA 1P3DA 3CW8X 2J5RA 3R23A 1P4SA 1QYXA 2COUA 1PNTA 1TCBA 1JLLA 4W5JA 2LKDA 1ISRA 1D2CA 2W7TA 1J49A 3HY4A 3M4ZA 3VNRA 2A9PA 1Q0LA 2YQ4A 1II9A 3WYNA 4NCHA 3ROKA 5JFGA 1XI2A 3T1NA 4C2AA 4ZO7A 3U9SA 3I6MA 3GEGA 3GJRA 1DVRA 1M6VB 1TK2A 5K45A 1FZTA 3EH1A 4D9KA 5AM3A 1VB3A 1HRKA 2IS4A 3KALA 1ZM9A 4E11A 1SVIA 1P6QA 2OFXA 3AOEC 3OZDA 4FOSA 4LHSA 4LYJA 4RHEA 3K6JA 5CW1A 4EKIA 1YR8A 3OSZA 4XOIA 5B6IA 2VNKA 2YVLA 2VKTA 3WXMA 4ZMSA 1N77A 2GHRA 1X42A 3NFRA 4XQ9A 4ETNA 5B30A 1FFXA 3N76A 2EKZA 3OCVA 3ZCPA 3ICQB 1OZ0A 4KO1S 3MF4A 5T67A 3F71A 1KDOA 2VT6A 1Q17A 2BEJA 5IWAB 1GWNA 1ZM3A 2BLNA 3HFJA 1SOAA 1IWOA 2QRLA 3IAS6 4Q6WA 4ZQHA 4DPKA 1XLVA 1W2WB 2EF1A 3SAJA 4D4MA 4ZEMA 5JECA 2R4TA 1QU2A 3F1LA 1GKKA 3QBDA 1G16A 2V3VA 5FTKA 2QW8A 2WWVD 3SFVA 1NSYA 3DT8A 4F92B 1QH9A 1Y5LA 2REQB 4WOBA 4HLQB 5EP3A 1X38A 3BMCB 2KWIA 4FDLA 4CDRA 2X0FA 5E4JA 1T2UA 1U8FO 1L7EA 2JGAA 2P2CA 4TMYA 1MDBA 1TEXA 3WJAA 2CV0A 1Q22A 3AP1A 4JFRA 4KIWA 3FWYA 2NU9B 4DSAA 4F3TA 3MJSA 1LW7A 1EGQA 5LLSA 5DCYA 3P9PA 2BV3A 1J1UA 1DEOA 1PJZA 3IEXA 4OI1A 1M6EX 2AJ8A 2OZLA 1I1QB 3CRVA 3TN7A 4D6YA 4XDYA 1QFZA 2IS1A 2WT8A 4D25A 4I5GA 4JLSA 3W3ZB 4ROTA 5CLHA 3DDCA 4DDUA 1Q3HA 3SNHA 5HJ5A 3T52A 2JLVA 3IEVA 2ZDHA 4DV0B 4ZAZA 3BILA 1F7VA 1M2EA 4ML3A 1SKMA 4FR2A 3A25A 4IQ0A 1KC3A 4ERXA 4RWEA 2F48A 4KTTE 3JQFC 3AVPA 3TTTA 3JSAA 3K5HA 3L02A 3RYCA 3P94A 4X9XA 5BSEA 1TZJA 4TUYB 3WV5A 4LMAA 1OZFA 1MC4A 4J2OA 1IHUA 2RAUA 1DRJA 2HHJA 2G83A 3PXEA 2O23A 1FP4A 4BLWA 4HDNB 2Y9PB 3DV0B 2NG1A 4P80A 4QBIA 1EK5A 2I99A 2V5VA 4I1RA 3S55A 1CXZA 3NHRA 3I2IA 3KOUA 3M4YA 4BP8A 5CAEA 5C7IO 1PJRA 2QAJA 3LP8A 2WJHA 4ZQCB 1CDOA 1F3OA 5CP8A 3W5VA 4BB9A 5KTNA 4NMLA 4QXMA 1UDXA 4JBXA 1RPNA 3KAKA 3KJXA 5CEJA 1CY2A 1Q6ZA 2HHLA 3QFHA 3TS1A 3PXBA 3VZRA 2H6EA 4DXDA 3JR3A 3LHIA 3CN9A 4OSPA 4WERA 2CXRA 4R0NA 1GGVA 2V98A 4WN9A 2PQ0A 5DX1A 2B7CA 1S0UA 5JBNA 5FTJA 4N0DA 4CTJA 4ANFA 4MV4A 1RAHA 2XUAA 3ZE1B 5DHQA 3OIYA 3LXXA 4PO3X 3GLHE 2R8ZA 3A1EA 3LG2A 4ALKA 5I8WA 3ZBTA 3UNXA 1JJIA 2ACVA 2PANA 4G1BA 4RY8A 3NB0A 3OQHA 4A9AA 4M99A 2B5VA 4BTLA 4J16C 4WK0B 4X97A 3TBHA 4MYSA 4Y9RA 4HRXA 3PTZA 4IDNA 3PE6A 2G88A 3CLTD 3G85A 4UMFA 4DBLC 1R6AA 1Q16A 4EB3A 1MN6A 1V1MB 2G76A 2IYOA 3N3AC 4WA7A 1BQEA 2CUZA 4FMCB 1BFDA 3K0KA 4N9QA 1SPBS 1TYEB 4FI3F 4UMDA 5BRNA 5LMUB 5K09A 2QA5A 5M7EA 3FKSA 3IDFA 3S2FA 5C5IA 1LBIA 3ESYA 3OPNA 5DP1A 2JCGA 1Z5UA 2PBLA 1I4EB 3PFHA 4K81B 4ZU6X 2ABWA 4OGFA 4LHZA 5LP6B 4WACA 1YTLA 4D82A 4QKQA 4GBED 5BMVB 3HXQA 3ZCXA 3ESDA 1PCXA 3O47A 3EIFA 4CCWA 1EA5A 1Q7GA 1XMVA 1O2DA 4KEAA 1IRIA 3GP3A 3IA7A 5H5JA 3SZRA 1RTKA 3EUAA 3EGCA 1YR2A 4CNQA 5IEBA 1E9FA 1OOEA 1K6EA 5KU7A 4K1XA 3SDZA 1FX0B 3E7DA 1NJ6A 1UC5B 1PKEA 1MDFA 2JFFA 2QPOA 2WVHA 3PNBA 4IVRA 3VTZA 3OTIA 3DEZA 3JZAA 1KE1A 3P26A 2QZPA 3BFVA 3UXEA 3ZHTA 2OMEA 1JXAA 4TXLA 4HDSA 1KYTA 2E5FA 3H3XA 2O9JA 5EP4A 1UBRS 1QMGA 1QRSA 1B8OA 3MLEA 2ZJZA 3RT7A 4ZOLF 2BR5A 4LGMA 121PA 1JE1A 1AHHA 3L0ZA 2UU9B 2AQIA 3R3ZA 5JR3A 3ZJUA 4CR6A 1CIJA 4N8DA 3GLIB 1QUEA 2BFWA 2J5KA 2OV4A 3HJUA 3ZTTA 5CG2A 5CDHA 1FTNA 1ODJA 4WFQA 3AKYA 4JITA 5FBHA 1B42A 3HI4A 1QOQB 1RE1A 1UFKA 3CGWA 3WR5A 5CFOA 3U7QB 5LB4A 2I22A 3CH4B 3GRYA 3ERCA 3ZH9B 2BTOA 4A82A 4BLUA 1YD7A 3ESRA 1QZTA 2EJUA 2CHUA 4PX5A 3VYTB 4AKSA 2J31A 2BDUA 3DHWC 1GILA 3VAZA 1PIWA 1S3IA 3COPA 4IM7A 4YHBA 3REQA 1TQHA 5J5CA 5K8UA 4R16A 1DG9A 4PHHA 4PG5A 2Q6LA 5C18A 1SKYB 4FZ5A 3NO4A 1E3EA 4D9MA 5HA5A 1KY4A 2V4UA 4AWXA 5K8JB 3HRHA 4A0HA 1ZCJA 1AGPA 2IZ1A 1JI3A 2QX7A 2Z5LA 4NMWA 4NV0A 1I4TD 1O94C 2M6LA 1G6OA 3UK1A 5I9MA 1PR4A 4TKUB 2Y1CA 2YTZA 3NEAA 3R7WB 3DQPA 4HB4A 1N2OA 3ZVLA 5JNRA 3Q8XB 4QYSA 1E1YA 4MEBA 1XTPA 3ZLBA 4UXHA 1JQ3A 1QYVA 2FG5A 3KT8A 4LJ9A 1G8JA 5K0FA 3ZWQA 4YV0A 4DAOA 4WMLA 3RHZA 4MI1A 1Y7TA 3UMVA 4RXUA 3WC4A 5LMCA 3BJZA 3MWKA 5TPZD 4JLJA 2XCRB 3JY6A 1VHQA 4CMEC 1SHKA 1U1CA 3AVTA 4LQLA 4QQRA 4GG1A 5FOQA 3FYSA 4F2PA 3NHLA 3UWKA 1U2GC 4EYEA 2QF7A 5HVNA 2AR0A 4EB8A 3GEPA 1SFRA 4JLDA 3Q7QA 3L18A 3OCZA 1QIEA 3AI7A 1SQ6A 4GE3A 5TT1A 2OHIA 3E3OA 1C3OB 1P1HA 1P4JA 1Z26A 1V11A 2ID9A 4IFBA 5CVVA 4D4GA 1MB9A 3QTTA 1S8NA 5JJ5A 1Z68A 5TT0A 1FTWA 1Q77A 3AGQA 3I83A 1U5BA 2D4HA 3KQYA 4IDEA 3EAFA 1TQ2A 1RWKA 1KHTA 5M2QA 1DJOA 3RYFA 3R6DA 2RC6A 2J0EA 4CTKA 4OAOA 4BWGA 3OMXA 2C2BA 1HETA 4JQYA 1NW9B 3H4IA 4FDUA 4OKIA 1O7JA 4YCDA 5KHAA 4CFZA 3UJHA 3VC2A 3HV2A 1REQB 3IXLA 2PS9A 3ENQA 2Y0EA 4HFRA 4TV9B 4MLZA 3R7SA 4A8JA 3NAMA 4D3SA 3DV2A 1M1YA 4JOQA 5M29A 3EDOA 1B16A 1XD2B 2FEAA 2YHAA 1FQKA 3E18A 3MCVA 1XV5A 5FORA 2JAWA 3VYRB 1EVLA 4D79A 5C46F 1HDGO 2ZSEA 1C3XA 3JQBC 2ZJOA 1LTHR 4PIMA 2D1FA 4BRSA 2BHNA 4YT4A 1ZFNA 3NKVA 2QAGC 4XFJA 2EFCB 4QGSA 3PE3A 4ZVOA 4JXKA 3P97A 4HS4A 5LC1A 3ULKA 3VPXA 2EHJA 3I0NA 2VS1A 5TQ0B 1CZLA 4DCJA 4E1AA 4KE6A 3BQMB 4EJ0A 3H0KA 5HFAA 6ABPA 2DT8A 4IS2A 4IFEA 2ETXA 4O63O 3ZDYB 1Y63A 2KMLA 4F12A 3H7IA 2J9YB 3O8OA 4MDYA 2PYZA 4TTJA 1KS2A 1SD5A 3HTXA 4IDBA 1WVMA 1YB6A 3QIAA 3T8YA 1Y1KE 1NU8A 3FI9A 2XYGA 3TAXA 1M6WA 2X9LA 2K7FA 3PJDA 1CY4A 4P8RA 3OF2A 4LNHA 5TRTA 1V6AA 4OMDA 3PIRA 4M9SA 4CU2A 3UIEA 4EA6A 4UNNA 2FXVA 3MA0A 3PWSA 3QE3A 1IHOA 2ATCA 1K88A 2HJGA 3TDKA 3UQZA 2C59A 5K20A 4DSOA 1F14A 4D7AA 2X1MA 4KOAA 4L8VA 1JNXX 2Y0PA 4HEA6 2A78A 4WXMA 1R5OA 5E3IA 1V39A 2G7ZA 4Q3NA 3UMJA 1HMYA 3PFBA 1IUOA 2OV6A 4FFBB 3IS3A 3ZHZA 2ZBDA 4B3XA 3IAFA 4Z9XA 4IUDS 1GQRA 1R6UA 2ZBGA 3R9KA 2Q4TA 1ZJZA 2GA9A 5TIIA 3FMFA 1XL1A 5JQGF 1CT9A 1UJMA 1E3LA 2PWPA 5T6BA 4EQ6A 2KSQA 3Q72A 2WMDA 3UF0A 3HJGA 3OLWA 1ZJWA 4LPSA 4M21A 1GHTA 1OREA 1RKQA 4JVLA 1YXMA 3FJYA 3M6MD 4MCIA 5IM4A 4P92A 1EM6A 2MDTA 2Q8QA 1R6DA 3N7UA 2FWMX 3QXCA 2JLBA 4G9EA 4QUGA 3SDSA 3ZN2A 3MHTA 4BP1A 4DRZA 1QNFA 3E4DA 2NNWB 4FJ0A 1WUTA 3DBHA 4HSGA 4UPEA 1TA4A 4F38A 1FX1A 1LX7A 4H2DA 2RAFA 2GFHA 3EHDA 4D43A 1KAMA 2DM6A 1WSDA 3K9WA 2DP4E 2Q7XA 3UJAA 2I0FA 3FWHA 4J7AA 4QOEA 4FTWA 1X94A 1FW8A 1MAHA 1F4PA 1ID1A 2Q21A 1UWKA 4D8TA 1Z35A 2UZ0A 3W6UA 4FD2A 2PGOA 3VNAA 3CNOA 3RARA 3EPJA 4D3YA 3K0FA 2QV0A 2XDQA 5EZSA 1RRKA 1X3SA 1O9GA 1Y8AA 1ZG3A 2GARA 1W4ZA 2Q0QA 4R1OA 3TL3A 4OMCA 1C2YA 4MCJA 1GT6A 4Q5IA 1QZXA 2HT1A 4GI1A 5A71A 4MVJH 1HDYA 2HD4A 4XE5A 3WJ2A 1WBBA 3O5AA 2ZRFA 5LQRA 1E5VA 4JGGA 4E15A 3PNKA 2CNDA 2ZJAA 4CM4B 1R37A 2FTKE 1P1RA 4YUXA 3R24A 3BERA 1E1DA 2PFGA 3V1TC 5IYZB 3R6TA 4EF6A 4IXMA 3P9NA 5E2AA 5AW7A 3I28A 3O31A 1U9YA 2UZAA 2YRFA 4WKOA 2DSTA 5FJJA 1TM1E 3FMOB 1QH1A 2YUIA 3C3YA 4LZLA 4P3OA 4Z0HO 2X9GA 4R9RA 4OTZA 1L7PA 4TT3D 5C5CA 1DDOA 2GKGA 1QMPA 5K3EA 4TTSA 4JR0A 3GT7A 3OE7A 3T7JA 2QXYA 3N8GA 1PJ8A 3LVBA 2IYSA 3WDLA 4AUKA 2FQXA 5F12A 2CDAA 4G6ZA 2O54A 4XWKA 2FR8C 2YWEA 3B6IA 4DMCA 3GJYA 3NWBA 2QLMA 1X7WB 1FA9A 1SGWA 2QORA 1AJEA 3MUFA 4HAUA 1E1RD 3EFOB 1GPJA 1TEZA 1N1GA 5BYBA 2HDOA 3C5EA 2H4YA 3P9IA 1ENOA 4ZPJA 4CDGA 1VHTA 4XWYA 4ZCPA 3FCUB 1QUFA 1YZHA 2O2HA 4PC1A 4BX3A 3C43A 1YK1A 1MO2A 1M1NA 2IUSA 3DUFA 3EXG1 4PXYA 4UUNA 2AJDA 1QZ3A 2ODTX 2PKYX 2QAIA 3TTUA 1ZBQA 4QXRA 4PIPA 4IIBA 2V6FA 2OKGA 3MWDB 4HWRA 2IEBA 5LU8A 3QWAA 2A59A 1A7UA 1NMQA 1T9CA 3U7GA 3OEWA 1SBQA 2WJGA 5CH3A 2XVMA 4FSHA 4P4SB 3ET4A 2XY4A 1E2LA 1L5RA 1PGQA 4I3GA 4MV8A 1N8NA 3NBKA 2I4IA 2WD7A 2Y71A 4PQEA 3GMTA 4Y2GA 4A2PA 4EF4A 4QYXA 4XJXA 5GIPE 4RTMA 4ON9A 3I05A 3O9VA 4G36A 2JD0A 3NJ8A 4YP5A 4RVFA 4L4YA 4EVIA 4RGYA 1KU6A 4NV3A 3WV4A 3CX3A 1ULTA 1O96A 5KAMA 3LXMA 4UEOA 4C0WA 3OCYA 4XX0A 3TXYA 2ZDGA 1G42A 1WXWA 5KMGB 5CFRA 2C78A 2AFHA 4JKYA 4CQLA 3R9XB 1A8SA 1FP7A 1XKTA 2A94A 5DLYA 1VSTA 2HRZA 3DMGA 4H7EA 3TOXA 3C4VA 4ENPA 2VNJA 3FYHA 1EUDB 1SD1A 2DX7A 4OQXA 2Z9BA 2HT6A 4GOND 3DQZA 4J1NA 5DTQA 1GT91 1TKCA 3BWCA 4NH4A 1FNMA 1WA5A 1SQ0A 2O4UX 2R1ZA 2Z2IA 3GZTB 5JZVA 3K0SA 2B4AA 2HFKA 4ZGWA 2H9IA 2COKA 2ON6A 5IJAA 3LX5A 3B7GA 4GICA 4DFDA 1MW9X 1KI4A 3ND9A 1E2QA 3LUFA 3RSOA 2H1HA 2ZBEA 3I32A 4LGYA 3K0AB 3GUVA 2VSQA 5DHPA 4BQRA 5LQCA 4M37A 2ZRLA 2XXAA 1RRFA 1HE2A 2YXBA 1ORHA 3IDQA 1E1CA 1FJ2A 1XDWA 1RPTA 1KBQA 1Y9AA 4KLRA 1JVBA 3SJZA 1GPBA 4ARZB 3LDAA 1PDWA 4MQMA 3ABRB 4BQNA 2IXBA 5EHZA 3O8RA 1ODFA 1ZH8A 3DBVO 1N8TA 2ZT8A 2HCBA 1C3EA 3M9WA 1C4OA 6CHYA 3T5AA 1E2NA 2Y1GA 1TYZA 1I13A 3EX7C 1Z34A 3QFFA 3H3FA 3PUIA 4MGIR 3WLIA 2FJUA 3GRCA 4GVLA 3HKEA 4C0HA 3M9XA 4CL3A 4RTLA 5DDIP 5A2QA 3JQ8B 2Q50A 3O75A 2BRUA 3Q11A 5EFZA 3ZHVA 1YRQA 2HV9A 3NM6B 2Q07A 3MUOA 5EUBA 3HKCB 2NU8B 5A4DA 1PHPA 4L1KA 3WIEA 1UM9B 4HWKA 3SQOA 2QZZA 2ZSDA 1OTHA 1U7DA 2R6AA 5D2CA 3TXXA 3WGQA 5GOTA 3M9LA 2V1XA 4B34A 4Z4HA 1C1DB 2V9PA 2ZXEA 1HNWB 1H2RS 5K6RA 4JXXA 4FI3C 1N5RA 4EG0A 1E1NA 5GPBA 4HGQA 1L4UA 3GNLA 2W9XA 2YXDA 1HL7A 1QDLB 2VJKA 4E12A 3K30A 3A6PC 2N1MA 4RTSA 3UZUA 3ADCA 2Z2XA 2LZ0A 2RSLA 2HK8A 1VKRA 4OCZA 2WHXA 3ZK9A 4C4YA 3WWYA 4DN6A 5BYAA 1JEYB 2QRQA 1SXGA 1U8YA 3EXFB 1R9JA 1Z7BA 3AEZA 2UUPA 3CWCA 4G1FA 3HXMA 2EF0A 1DAEA 5G1PA 5FAXA 2YZGA 3ME5A 5A6SA 3EJ6A 4X6YA 4UM5A 5L3QB 4W9NA 5K3BA 3WOHA 1C4KA 1SEVA 1JHAA 2GWHA 3G1WA 3KLPX 1X7DA 1FDWA 3MQ2A 1T1EA 3UGQA 3R3XA 5EZYB 1KARA 1TFRA 2G1JA 2P4HX 2W98A 2ZB2A 4ZALA 3EBPA 2LXNA 2WKPA 4JBNA 3KJFA 2F17A 2WRZA 3MOSA 3OKPA 4RK5A 2FFQA 5AOVA 5ALGA 1Y8ZA 1BHSA 1OXKB 1P2DA 1Z6TA 1U9IC 1SC6A 3IUYA 4AXBA 2C0PA 2VHQA 2ZWVA 2RGNC 4YJHA 5KNDH 4LSMA 1IUNA 5ALDA 3WGMA 4H7IA 2C29D 1M7HA 1Q0SA 3UBTA 1O03A 1N2EA 2ZKIA 3L8MA 4NZPA 4QAQA 1PJBA 3L43A 2X8JA 2FPOA 3HCCA 3K4HA 4ND7A 4YJGA 2ATVA 3CNLA 4KQHA 3A31A 3INRA 4FMDB 1X7YB 2I7XA 3BHNA 3JAKA 3E70C 3KZVA 3IIEA 3A36A 3QI7A 4ZVNA 2REOA 4EEZA 4DR4B 4MDFA 1DAHA 4AY6A 4UU1A 1GFZA 1D7AA 1DTWA 1EFPA 1LJUA 2EZUA 3M0EA 4TMZA 5C34B 1K5DA 5HW0A 3AL0C 1M67A 1WPGA 1K4MA 2VYFA 2CDBA 1L8AA 2NSLA 2AUNA 5ISMA 3AUSA 3CW2A 1E64A 1E5XA 1KH2A 1W5EA 1KBZA 1YULA 3AUAA 4HH1A 4G0NA 4MUKA 4TLBA 1BVHA 2M9MA 3PX7A 4DG8A 4ZYVA 2D2XA 4I4IA 3R8XA 5DCUA 5GGYA 1M2NA 2P0AA 2KJQA 2IU3A 4CKCA 4ZYYA 1V35A 1LF0A 3KUXA 2M6KA 2P3LA 4YJFB 4B7UA 3ZK8A 1JL3A 2ET6A 4LI0A 2DKFA 4L5YA 2E18A 2FFRA 1ZS9A 4DXAA 4KYTA 3DMRA 4RQUA 2AUTA 4X90A 4C4AA 1BS9A 1NUPA 3TMKA 4X65B 1Y81A 3LWBA 3GDWA 4TMTA 3UBMA 3GRPA 3VNSA 4JYMA 4GX5A 2ZROA 3MRTA 4NK4A 3TD6A 1F4LA 4LVCA 4J1TC 1EK6A 1VGRA 3BJRA 2ZJ7A 1UP4A 2QW1A 2VSNA 3OQVA 3QU4A 4GHWA 4B5KA 4P38A 1BEUB 3TZLA 1I10A 4NOJA 1GLNA 4DHEA 1CS0A 5G3ZA 5KTPA 2JLYA 1ZK4A 1Z6PA 4QJIA 2XHEA 3JD4A 4LX0A 4O2BA 4P98A 4QNNA 1WEHA 5ESXA 3UAWA 3ZTYA 4EL5A 4QYTA 4E4RA 1I3LA 1T0UA 4DARA 4ZHQB 1F8UA 2V6IA 4L50A 1TCVA 1WSBA 2PU5A 3RK1A 1BIFA 4JB8A 2EKQA 3PF9A 3GH1A 4ND8A 3EQ9A 4LYDA 1I94B 4RBNA 1HTTA 2RGUA 3ENZA 4WY2A 3O94A 4KFTA 4I6EA 2CF5A 1T4MA 3T7AA 4KP7A 3UWOA 4ZYTA 3QA9A 3HWSA 3DE1X 1OI3A 2IYPA 3MWGA 4MQLA 1RU3A 1KVQA 1CCWA 3WLFA 2VXBA 4DCOA 2G80A 4CL2A 4L4UA 4CMCA 2NZ2A 3NVKI 2XSZD 1RQLA 3AI2A 4DDHA 4PYIA 2D1SA 2EEZA 4O2RA 4UBIA 4Q7JB 1TD9A 4RQAA 5E9JA 1G5TA 1KFEB 4LV6A 3GT4A 1ZR2A 2D5LA 4MHSA 3IVCA 4Z0TA 2HUNA 2V8BA 4X7MA 4AZ3B 4BLQA 4FVTA 4OJTA 4GT1A 5TPWA 2GZHA 4W6ZA 2FG7C 2QRGA 4TYYA 3PRYA 1E9AA 2YYSA 3GDFA 4FHDA 3A32A 3A3OA 1I32A 2F3RA 5ESRA 1OWLA 1T5BA 5EWMB 2PCJA 5L3RA 3LLMA 5IPFA 3SC3A 3SSMA 4IRMA 4MUXA 3IVRA 3CVXA 3RBAA 1V1JA 4NPCA 4TYNA 3WLOA 2WQ6A 1SNYA 4B6OA 3H86A 3PCRB 4ZQIA 1C30B 3DE4X 2BOVA 4BFXA 3W2FA 4X8MA 1M7BA 3O95A 5KUTA 4M88A 4Q9HA 3OPYI 3WMXA 1FRZA 3ZWNA 1DDGA 5I3CA 1Z37A 4RZSA 3EBLA 4TLEA 3OA0A 5TPZA 4IY1A 4O1HA 2BDTA 2V7BA 3A1FA 1T43A 3ZV4A 1XMOB 3EVEA 2CXXA 1PJLA 3GLUA 3IEMA 1U7TA 2DRIA 2QN6A 4LKRA 4B1FA 3P9XA 2F1HA 4RVDA 2DOKA 3LI2A 3BMXA 1VC2A 1NP3A 1T4DA 1V4BA 2HEGA 4I4CA 5FO0A 4EHDA 3X1ZA 5CVTA 2HMAA 3RKUA 2R84A 1L7NA 4NCIA 2O8EA 4RMGA 1G41A 2IVZA 1ZGGA 2ZZMA 4PLZA 3H9BA 2OMKA 2HU2A 2RBKA 3QXJA 1GPKA 1URPA 4WLOA 1P45A 1F6WA 3B51X 2QRKA 4P22A 4EZBA 5CA1B 3UMMA 5U4QA 4XW2A 3ROQA 3P32A 4BX8A 1J23A 1PT6A 1ZSYA 3L1UA 2KX7A 1WZ2A 4F85A 3LOPA 3VX3A 2JAXA 2OK7A 2VWGA 5AK0A 5ITSA 3JPWA 2FUG6 5J2TF 13PKA 3N7TA 2QTVB 2VG8A 4LVUA 1AGRA 1E5QA 1CLEA 2FPPB 2V58A 3LXUX 5LXTA 4BZWA 5A0VA 1O89A 3O9MA 3QMVA 4I1IA 4YMSA 4M6WA 1GGFA 1IAVA 2FWAA 1V8ZA 3DLIA 3KOWA 3M82A 4XVCA 3AHIA 1Z18A 2QN7A 2NU6B 2AMFA 3D3EA 4YJ2F 1W44A 3H6HA 4R7TA 4E08A 4U7TB 2B92A 5CVEA 3WQHA 3ZD6A 3AV0B 1YVPA 1CKEA 4RCVA 5MFZA 5GM2A 3IERA 1KAEA 4Q03A 4ZEWA 3DA8A 3U61B 2C07A 1W2HA 4Q4CA 4ARSA 2FPLA 1PW7A 3HRIA 3K2IA 1KDPA 3LTEA 2V0NA 2XECA 2W11A 4NIMA 3NBUA 4KBYA 3HCOA 1RQNA 2O0JA 1PR3A 4TUYF 1HYQA 3I9LA 3P9SA 3GNQA 2QI9C 4GX1A 5AUPB 4LOHA 1NVKA 1C7IA 4DDKA 1AHPA 5CIQA 5FOTA 3KYBA 2QX6A 3A6ZA 2XRFA 2EATA 3E61A 3KKKA 4KVFA 1GPUA 1DFIA 2HNBA 2QTZA 5ICGA 2AZMA 5KX5B 1WULS 3GB9A 3IT1A 5KKNB 3I6IA 1GA4A 1JWAB 2C9CA 4D41A 3SQWA 1F51E 1YDMA 2WOJA 3M89A 4PU0A 3IPLA 1Z39A 2QTGA 3CX8A 3MSXA 1DI0A 1BX3A 1XC7A 2G1KA 1QC5B 4E94A 4YUAA 4IX9A 1JWBB 4I1YA 2XMQA 3ZHCA 3A05A 5KWJA 4OX9Y 3GU3A 3PD0A 4X93A 5DNDA 2VUHB 5DYTA 2KBFA 2PJDA 4LXTA 2BUBA 5FP0A 5JVDB 2XUHA 3G9ZA 3LCJA 2PUGA 1N7JA 3IP9A 3AILA 3ZXYA 2XCSB 3FB4A 2FMTA 3HB5X 2EV9A 4L6CA 5CTAA 3H97A 3NHKA 1I3KA 1WU8A 4QTTB 1KQOA 4RIHA 1SUBA 3W2GA 5K6AA 4DUPA 4OK5A 3PHGA 4JJKA 2PNJA 2QG9A 1YRBA 4Y8VA 3VOSA 1Z0UA 4QDKA 1MB0A 4RGVA 4UVGA 2VHUA 4NNOA 3TM5A 4MVYA 2DFTA 2XUDA 3ILVA 5B7QA 1Y3DE 3DM5A 4AICA 1GG5A 2WTXA 3EXHA 3JQEA 4FMCF 4KSCA 2RHGB 1YV9A 2YMQA 3P0FA 1HWYA 4CL0A 1L4MA 3H8JA 4XGNA 5A9SB 4ZJYA 4IMRA 2OAQ1 1KR2A 4NC9A 4D0SA 3ODPA 4LNAA 2D7JA 1Z0FA 2R8EA 3Q5DA 3V2GA 2JK1A 4TROA 1NZFA 5FIUA 3RQSA 1V8BA 2Y8EA 5JQWA 5LP6F 2Q3BA 1M72A 2FF7A 4K6HA 1YHZA 4ARCA 5FBKA 2X76A 1MORA 2VNAA 3KSRA 3QJGA 5BMVF 2XBMA 3PUKA 3FDZB 4Y67A 2YZMA 3VHXA 5B4VA 3UT6A 4KR7A 3VPGA 2YW2A 1ABEA 1ZUD1 3PXDA 2G06A 2PH3A 3FPAA 1XHLA 2FPKA 2UDPA 3ILHA 3NBYC 4JLPA 3U1TA 4EFKA 3UMBA 1OMOA 2HGSA 1NBEA 3R3SA 1KI6A 1HYBA 5ARDA 1PNVA 1WMBA 1RJEA 4RE6A 5COBA 3BN3A 1P72A 1T4GA 2MR6A 4K9SA 2IU4A 1TPZA 1ML4A 1LDBA 1U0LA 5TNXA 4N03A 4BO7A 1A7KA 3Q41A 1B15A 5IX8A 1Q1AA 2IP1A 2RH9B 3AGPA 4IGIA 5EE5B 3B89A 1N3IA 5BQOA 1CDZA 3GROA 3JWIA 5EE9A 2IXEA 1L7BA 1SA0A 2P27A 4MUFA 4P34A 3PPWA 5B1HA