3SC6A

2.65 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose reductase (rfbd) from bacillus anthracis str. ames in complex with nadp
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
281
structure length
281
Chain Sequence
b'KERVIITGANGQLGKQLQEELNPEEYDIYPFDKKLLDITNISQVQQVVQEIRPHIIIHCAAYTKVDQAEKERDLAYVINAIGARNVAVASQLVGAKLVYISTDYVFQGDRPEGYDEFHNPAPINIYGASKYAGEQFVKELHNKYFIVRTSWLYGKYGNNFVKTMIRLGKEREEISVVADQIGSPTYVADLNVMINKLIHTSLYGTYHVSNTGSCSWFEFAKKIFSYANMKVNVLPVSTEEFGAAAARPKYSIFQHNMLRLNGFLQMPSWEEGLERFFIETK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dTDP-4-dehydrorhamnose reductase
publication title Structure of the Bacillus anthracis dTDP-L-rhamnose-biosynthetic enzyme dTDP-4-dehydrorhamnose reductase (RfbD).
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Oxidoreductase
total genus 91
structure length 281
sequence length 281
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.133: dTDP-4-dehydrorhamnose reductase.
pdb deposition date 2011-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04321 RmlD_sub_bind RmlD substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3sc6A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3sc6A02
2CY0A 4N54A 1IB6A 3GVIA 2B0JA 4KTTE 3WOHA 3TZCA 4F3YA 1R66A 4IJVA 4NJMA 3PYXA 1DLIA 2DUUA 9LDTA 4AJIA 4YT4A 4Q39A 1E1MA 4U6QA 2NTJA 3MOIA 5G0VA 5TGDA 3JQCA 1B8UA 4J9UE 4XYBA 3GAZA 1T1SA 4WCFC 3QIVA 1GAEO 2SCUA 5IDXA 2ZJ1A 1WZEA 4Z9FA 1VI2A 3AM3A 1PJ4A 4PVDA 5I9LA 3PEFA 1ZSNA 3GNSA 3D4PA 3U4CA 1MC4A 1H2BA 1EMDA 2VZ9A 4BV8A 1X1TA 4FSHA 4JROA 4R1NA 3B1JA 1M6HA 1OC4A 4A73A 2W2LA 3ORFA 4ALNA 5GZ6A 2GZ1A 3H3JA 4ALKA 4BNFA 2DTEA 4UVGA 2A9FA 3AUAA 3GZNA 4R5HA 1ZUD1 3L6DA 1BSVA 1P45A 2D4AA 2F00A 3GEMA 1R4NB 4UAGA 3RUDA 1X14A 3DAFA 2QRLA 3U0BA 1WXDA 2DLDA 5MDHA 1G6KA 2NV6A 5ER9A 5KVCA 4MVJM 1VLLA 1C14A 1DB3A 3H5RA 1QYDA 1UP6A 1LLUA 3AOEC 3WYCA 3EUWA 4EJMA 1X7HA 4CR7A 4JIGA 3JQ8B 3B1KA 1N7HA 1WDKA 1YJQA 3GG2A 4TVBA 1ZFNA 5ILGA 2GSDA 4CM8B 3WWYA 3OM9A 1P3DA 2CMDA 3SC6A 2JL1A 3PXXA 4YYZA 3DHEA 4JCOA 4S3MA 4XGKA 1NAIA 4BV9A 4UUOA 2X7HA 4DLAA 5KCZA 2X9GA 3ADOA 1UXKA 2FN7A 4J4HA 4XZ3A 4BNKA 1VJ1A 2HK9A 4BGEA 4DLBA 1TB4A 5JW6A 3KHUA 5L3ZA 3ZWNA 1A4UA 1QYXA 4JN6B 2WM3A 4BMVA 4DA9A 1T2FA 2PR2A 3C8MA 5IN5A 1HE4A 1SOWA 4OOFA 5HWSA 5IDQA 4ND2A 5A9TA 4HBGA 1ZNQO 4MIYA 2OOSA 4YAEA 3WICA 1W6UA 2BELA 5KVQA 2QX7A 2HK8A 4IJUA 4MVJD 5DF1A 3PHHA 1PWXA 4ILKA 4KUGA 5HA5A 3GT0A 3C1TA 5ICSA 4E2YA 4K28A 1UH5A 3VTFA 4AJLA 4BKOA 3PDJA 1GCOA 4URFA 3MJ4A 3L77A 1RJWA 2CD9A 4II3A 4E6PA 4FC7A 4YWJA 3C7DB 4FR5A 5JY6A 3ONEA 5F1OA 1E7RA 3AUUA 4ND1A 5FEUA 3UF0A 4QO7A 1ONPA 1HSOA 2X5KO 4M87A 1GZ4A 1NTOA 4BB5A 4R54A 2ZTVA 5DNAA 1PL7A 1PGQA 4YRBA 1YBAA 4OOEA 2VT2A 2DBRA 3ZHYA 1R4MB 4I08A 1Q7BA 3F9IA 4HY3A 5CPBA 1XR3A 2D2IA 2V6BA 4OSPA 1YB5A 1I3NA 2P5YA 3DZKA 4IY1A 5DDIP 5U4QA 1GR0A 1HE2A 1PZFA 2IODA 3GA0A 1O8CA 3H9UA 3TPCA 1VKOA 4A5OA 2AG5A 3PQFA 1EUDA 4EITA 1R4NA 3GRKA 3WYBA 2LDXA 1DIAA 4QSMA 3PTZA 5ADHA 2Z95A 3TN7A 3AI3A 2ZYDA 4BO4A 2Y0EA 2OP1A 2AE1A 2HKIA 4ZA2A 4JK3A 4RVUA 5COAA 3WSVA 2I3GA 1T4BA 3GEDA 1GUYA 3GGPA 1DFGA 1PR3A 4BMNA 1CDOA 2X9VA 2BFAA 4J1QA 3MZ0A 2DVMA 4J4BA 4BKQA 4NK4A 3SEFA 3GDGA 1SB9A 3WB9A 1XU9A 3IP3A 3QVWA 4YJFA 4ZRNA 2RHRA 2YW9A 3PGJA 4ONEA 4HX5A 1S6YA 2HSDA 4BO5A 4E33A 3AI1A 2GR9A 2W2LD 2GCGA 3Q11A 5CDTA 4DPKA 2P91A 3KSDO 2AQHA 5J23A 1C1DB 4E12A 3DC2A 1CF2O 1H2HA 1I36A 3TF5A 3VTZA 5B4VA 2P9CA 1TI7A 1DSSG 3C1AA 3QWHA 4UVIA 2JHGA 5C37A 2BH9A 4WE3A 1JWBB 3PWSA 2IXBA 4PG4A 3BHJA 2EV9A 1P9LA 1PZGA 5B4TA 3A14A 4N5NA 3S2GA 1L7DA 1QV7A 2AEJA 3BMQA 2CZCA 1SEPA 2YDXA 1O0SA 2Y99A 4LW8A 3UW3A 1PJBA 1HT0A 3ZI0A 2AE2A 2NWQA 4WJZA 3V1UA 4YRAA 1HDGO 2E37A 1QRRA 3CE6A 5JO9A 2FMUA 3SXPA 2VHYA 1K2WA 1IPFA 2IYPA 3AI2A 4BNTA 4XJTA 3CXRA 3NDJA 2O3RA 3U09A 4RDHA 1VSVA 2HRZA 1DEHA 3DZIA 3HG7A 1Z82A 5F5NA 4BHTA 3D5QA 1LDGA 3RVDA 4RGBA 4B79A 4NNJA 2RBEA 3I1JA 2V65A 5I7SA 1N9GA 3K96A 4YJGB 3VPHA 4QT0A 1ZO8A 1ZKMA 2OP0A 1R4MA 2OZPA 3DB2A 5LDGA 2PGLA 4CQMB 4BNYA 3NT5A 2Z1NA 3NX4A 4FPXA 1TEHA 1NX6A 2RIRA 4G65A 4H3VA 4IXTA 3VZPA 1LA2A 2BF7A 1ZH8A 2EEZA 1ORRA 1UP4A 3CPSA 4G2NA 1WP4A 1YQXA 2ET6A 4FFLA 5TS3A 4IJKA 1NNUA 1Q0QA 2J3HA 3QHAA 3TDKA 5FI5A 5CAEA 3FTPA 3LC1O 4CLEA 5JCJA 2X8LA 3PZBA 1YL5A 1UDCA 4D79A 4PG6A 3C1OA 5FYDA 1BXZA 3GQVA 3WX0A 2CVZA 3QA9A 1F14A 3TZQA 5IN4A 3ASVA 3JSAA 3PIDA 4BGUA 5AVOA 1K6JA 4R41A 1O5IA 5CDSA 4BGVA 4QEDA 5AOVA 5IXYA 3OETA 2NQ8A 1C1DA 1PJSA 3EGOA 4WCFB 1U2DA 2NU9A 4D0SA 3F3SA 1P0FA 1BXGB 4NFSA 1DRUA 5JAZA 1V9LA 4NFYA 1WDMA 5C7OO 1NWHA 3AY6A 3W4KA 4DGSA 3G0OA 2ZK7A 4CODB 3LF1A 2JAPA 4NBTA 5EN4A 3ZU3A 3EC7A 3QSGA 4IDAA 3DHYA 4XGNA 4IINA 1XQ6A 4TMFA 3WJ7A 2B36A 1YKFA 2B4QA 2JCVA 3IKTA 1A9ZA 4B4VA 1U8XX 2VHZA 1I2CA 5DP1A 4AICA 3IMFA 3GN2A 4YEDA 4MVJI 4W6ZA 1NVGA 1F8FA 2G76A 3KM0A 1NQ5A 3ZWXA 1BVRA 1DBVO 2PZKA 2B5WA 4YAGA 1Q7CA 3ETDA 2JFGA 4ZRMA 1E3LA 1WPQA 3PLRA 3K6JA 3LT1A 3IUPA 4MVJP 4N7RA 1PQPA 4PZDA 1H5QA 1EBFA 4ESOA 3BTVA 3FN4A 4UEJA 2IEDA 3LQFA 3U4DA 2NSDA 3L6EA 4Z3KA 5T57A 2YDYA 2ZIZA 1W0CA 2PKQO 4WLUA 3NT4A 4NFHA 4YXFA 3BYZA 1Q7GA 3PYLA 2X6TA 4R68A 4YAJA 3MJTA 1G0OA 4GSLA 4BO9A 1A9YA 3V2GA 3UH1A 3ZWVA 4C4OA 5BNFA 5L4SA 5ICMA 3LF2A 4E5NA 3F1LA 1R0KA 1E7SA 2D5CA 3EMKA 3PJEA 1EUCA 1U3WA 3WXBA 3IJPA 2VWGA 3GHYA 2YV2A 1CQIA 1SO8A 2WD7A 1V3TA 2AQKA 3KZVA 1B3RA 4PG7A 4U0JA 2JJYA 1O89A 2D5AA 4CQLA 3TL3A 1J4AA 1Y9EA 4FGWA 4ZQHA 4GGPA 7ADHA 4D0RA 3VZRA 1XWFA 1D1TA 4E2WA 3UAGA 1I33A 2VCYA 3BMCB 5KVVA 3DOJA 2PGDA 3WR5A 1IHXA 3GNTA 1YBMA 5CDGA 4FCCA 2ZB7A 1ENPA 3PQEA 4ID9A 1PS0A 3G3EA 4AJ2A 4R9RA 1RM4A 4ZGWA 1UXIA 4E5MA 5KWEA 3S1LA 5K6AA 3CMMA 1NR7A 4PLVA 5HTOA 1JAXA 3GZ4A 4DC1A 4TWRA 3M1AA 4B4WA 3ZWYA 4Q3BA 5H82A 1O9BA 3NJ8A 3G1TA 4DIFA 5A05A 3P7MA 3E03A 4D45A 2Y0CA 2EP5A 3RBVA 1E3WA 2ZB4A 1DJNA 4EJ0A 1F8GA 4WASA 3BTSA 3HB5X 3C85A 1B3BA 3FD8A 2GASA 4R3WA 1PL8A 3W8EA 2VHXA 2A4KA 4IQ8A 4CLHA 4UVDA 3JD0A 3BMOB 4IUYA 1ENOA 3HADA 1LQTA 3IKVA 2EIHA 1J0XO 5JMWA 1A5ZA 2GN8A 4EGFA 2Q99A 1F17A 1ISHA 1LUAA 1NR1A 1DHTA 1DIHA 4YR9A 3WTCA 5JE8A 1HDZA 4J91A 3OJ0A 3U62A 5EESA 1XIVA 2H63A 2O50A 3CINA 3GVHA 2O2YA 2UAGA 1QKIA 4E4YA 1A7KA 2G82A 3KO8A 4U7WA 1SMKA 1GD1O 3GPDG 1BDMA 4WLOA 4DIOA 1FMCA 1GADO 2I9PA 4P4LA 4CUKA 5JO0A 2OBYA 4YT2A 2J6IA 4FFRA 4I9NA 5JAQA 3ZNQA 1ZK4A 3HDHA 3PP8A 2PKRA 3P2OA 4B8ZA 2X5OA 1QORA 4XKJA 3W4JA 1N1GA 3WQRA 4BNNA 5JAMA 1I24A 1KVRA 2C54A 1HZZA 1X1EA 3KSZO 2AHRA 2QYTA 3WSWA 1YRLA 2BFPA 3C24A 3JQBA 3NJ4A 1FK8A 1VSUA 1XLTA 2GLXA 1F12A 5A3VA 3UCXA 1C0PA 2BD0A 3JQAB 4WEOA 3TFQA 2FHSA 1H94A 2X23A 5JDCC 2IZZA 1U28A 2UUOA 3V8BA 4BNZA 2O4CA 5L7YA 1GZ3A 3M1LA 5ENDA 3JQ7A 3WGGA 4PLPA 3ZNNA 2GZ3A 2JHFA 2NUAA 3I9NA 2P4QA 3HDYA 3ZV5A 2AW5A 2DPGA 3KYBA 1LEHA 4CMGA 3BMCA 1DAPA 3D3WA 4ND4A 4O6VA 4A10A 3PIIA 3K2BA 2OORA 5DBIA 4M55A 3DMYA 1OOEA 1DIRA 4GGOA 4CQMD 4EJ6A 3ZDFA 1KOLA 5T64A 4EUFA 4XQGA 4IDEA 1EUZA 4RPJA 1SNYA 1GU7A 4NK5A 3DBRA 5U1PA 1PGNA 4XJSA 4ZQFA 3R1IA 2QRJA 3OJLA 2HJSA 2NTVA 1PIWA 5A5FA 1UXJA 3LDHA 3DZJA 1WNTA 3PJDA 4XIYA 1O6ZA 2W2KB 2ZTMA 5TJ9A 3F5QA 3VH3A 4CM1A 3L07A 1HEUA 3AW9A 3GPIA 1UZNA 4EBFA 1L7EA 1U4SA 1T4DA 3FHLA 4UEOA 3DTYA 5JAIA 5EIOA 1GV0A 4HFMA 2DTXA 3IAHA 3PI7A 5T67A 1MGOA 3I9LA 5JDIC 3WNVA 3TOXA 5A9RA 1LTHR 1X7GA 3E18A 5TT0A 4BKRA 4LN1A 3OA2A 3FNEA 2RCYA 3OQBA 3PHGA 4R1UA 4CM9A 1YO6A 4A2CA 1GEEA 3JQ9A 1LJ8A 4QUKA 4YTEA 4KDEA 3EY4A 3GDFA 3WGTA 4NJMB 4TRJA 4ZQEA 2E49A 4E21A 1KERA 2OMEA 4MIOA 3N58A 4EEXA 3B1FA 5ILOA 3H2ZA 3L4SO 3VKUA 4XR4A 3ZWPA 1E7MA 3RCBA 5KTKA 3RSHA 1WMBA 2P2SA 4L8VA 4KUEA 5L7WA 1ULUA 3DONA 1PS8A 3JQDA 5L9AA 1DFHA 1TLTA 2EWMA 1GYPA 4CV0A 4CLRA 2YZ7A 3D1LA 3NTOA 3ZWAA 1YOVB 1PJCA 2YYYA 4BO6A 2CDAA 1ZVMA 1DC4A 5TRTA 2PGJA 4CV3A 1LRLA 1ENYA 3OFSA 2WE7A 4X54A 3TNLA 1LU9A 4BKPA 4PRLA 4KP7A 3E9MA 4XQ9A 2RH8A 1Y9AA 4Y6SA 4LSMA 1XELA 3VAZA 3E82A 5KKCA 2VN8A 2EGGA 3UXYA 5I9NA 4J7UA 3IUSA 4P4GA 2PD6A 1NQTA 4E31A 3GG9A 3COSA 5JC1A 2PWZA 2E6UX 3WBBA 2WE8A 1YH3A 1UZMA 2QQ5A 2IXAA 5C5IA 4WLVA 2BKAA 3AM5A 3P19A 2G17A 4O59O 3ZWOA 5HM8A 2A92A 4BO0A 4GI2A 4CMEA 5EPOA 1BTOA 3BZUA 3IJRA 3NKLA 3WQSB 3O4RA 3OIFA 4BNHA 1BXKA 2PH5A 2DPHA 2FZEA 1Z73A 1M75A 2UVDA 4FC6A 1QYVA 3C7CB 3UOGA 4E32A 1ML3A 4HUJA 2VZ0A 3INRA 4M8SA 3ROPA 4AJOA 2HCTA 3PQDA 4CR8A 1ID1A 5THKA 4MKXA 4KUHA 4CM7A 8ADHA 5IDYA 1VJTA 4OGWA 1I2ZA 4M1QA 2EKLA 3OMLA 3LLSA 4BO8A 4BKUA 3JQFA 4RDIA 3VOSA 3GUYA 2WSBA 3O9ZA 2POQX 3S8MA 1H9AA 1LLDA 4XYLA 3GVCA 8LDHA 2NU6A 3P2YA 4FDAA 1P74A 4BO2A 1NP3A 1HDXA 2VOJA 3RD5A 1KEPA 3GMDA 3X2FA 1HDCA 5EQFA 1U3VA 2O3JA 3VVCA 3HFSA 1T26A 1HYHA 5TX7A 4RQTA 4D7AA 1FXSA 1FDSA 5C7IO 3I23A 4UULA 3RC1A 2GPTA 5A03A 3ENKA 2VUSA 4D3DA 4PLYA 2EERA 1KETA 2W8ZA 1U2GA 1YVEI 2WEKA 3W1VA 4XYGA 1B26A 3TZHA 2D3TA 3GFBA 2I65A 1WLYA 1YOVA 1VE9A 3ZN2A 2D0IA 3I83A 4CM9D 5TLSA 2J8ZA 3GH3A 3JD3A 1RM5A 2VRCD 4D41A 3G1UA 4U8GA 3ANMA 5BSFA 1VRWA 2O3SA 4AJHA 4GBJA 5FFFA 1G1AA 2VHVA 5I8ZA 3JTMA 1Y8RA 3ZV3A 1I2BA 1H6CA 4KTVE 4G81A 4XIJA 1Z45A 1JKIA 3ZWMA 2WYUA 3F46A 2G5CA 5FI3A 3RQSA 5G0SA 2A94A 2H5LA 5KIAA 1HF3A 5F5LA 4EUHA 2VTEA 3DBHA 3RUIA 4DPLA 3Q9UA 3S2FA 1EQUA 1O94A 1ZJZA 4A7PA 4YJFB 1KEVA 4EEZA 3VZSA 3RUCA 4CLDA 4PGFA 1JKJA 2CFCA 2DT5A 2FR1A 3R6DA 1HSZA 1EFKA 3JQAD 1OC2A 5KKAA 1H93A 2VYVD 3NDRA 3PZRA 1XU7A 1UXHA 5TC4A 4LRTB 3FWNA 4A27A 5CG2A 3OJFA 1U4OA 4RF2A 3DWFA 2FWMX 3VH4A 1F0YA 3UICA 1TXGA 3JQBC 3EHEA 4I8XA 4DUPA 4NG5A 1QP8A 2CVOA 2JD2A 4BNWA 3RU7A 5GZ1A 4CMJA 4Q9NA 4PN3A 1HKUA 1ZK2A 4BUCA 4H16A 2EXXA 1E3JA 3A4VA 1E5LA 5LC1A 4UVEA 1Y6JA 5G0WA 3A06A 4ZD6A 7MDHA 2J5KA 4BNMA 1I8TA 3AK4A 3OHSX 3BMQB 5B37A 1EVIA 5L4NA 1HETA 1MB4A 3CEAA 4R1TA 1K6IA 4KOAA 2Q1TA 1V8BA 5T8KC 3AFNA 1E7WA 3WDSA 5DCYA 1UUFA 1DOHA 3RJ5A 1GZ6A 3KB6A 3ROKA 1JU9A 4FFMA 1XG5A 4PLZA 1NASA 3DMTA 3H5NA 5DBFA 2VWHA 3D0OA 1V6AA 2W4QA 4IJWA 2QZZA 1N9GB 4RVGA 4GLOA 4XB2A 4NR0A 1E3SA 2C2YA 3KEOA 1D3AA 2XF8A 4BNVA 4BOYA 3WWZA 3ZU4A 5A04A 5BSHA 1AXEA 2XPCA 1IY8A 4E3ZA 1VM6A 1E1KA 2HJRA 1QXSA 1IZ9A 4MJLA 2JCYA 4XA8A 5B4UA 4Q3CA 1H6AA 5JCXA 4KDFA 4ND3A 2O23A 4OM8A 4MKZA 4D3SA 1P44A 3V1TC 5DBGA 3GF4A 1GL3A 5CEEA 1KVUA 5DULA 5G0UA 3RUHA 2BFOA 3TWOA 1LC3A 3KV3O 3VDRA 3MJEA 1RKXA 4RPKA 4Y67A 4U6SA 2YQ4A 4Y8VA 3GRPA 4QX6A 1YJ8A 3GY0A 3I4FA 4D43A 5TIIA 3DFUA 3W6ZA 3K8ZA 4R51A 3ZNOA 2JAHA 1YONA 3H4VA 3TQHA 1OI7A 3MJVA 3PHJA 1FF9A 1NXQA 4PLWA 3ADPA 1ADBA 4FFPA 2C59A 4A03A 2PZMA 4I9UA 1E6UA 4IXWA 2DAPA 3IC5A 1GTMA 3Q1LA 1QV6A 1EBUA 3FBGA 4J1TA 4M54A 5DT9A 5KOIA 1SOVA 3VKVA 4AJPA 2YQ5A 2FPIA 2PZJA 4LISA 1AHHA 4I5FA 3PJFA 5EERA 4EW6A 1DDOA 5CHEA 1ZJYA 4Q3EA 1K5HA 1D8AA 1DPGA 3ASUA 4CMIB 1B2LA 6LDHA 2NADA 1MV8A 3U4IA 2CDCA 2YJZA 3D4OA 3OECA 4AJEA 3FNHA 1T2AA 2GUGA 2HU2A 3LZ6A 1MG5A 2PY6A 4CM6A 4NHEA 5ENVA 3HFGA 2VYNA 5AXBA 2O2SA 3MWDB 1FJHA 1ZSVA 4OO3A 3ROMA 2QHXA 2VHWA 1LRJA 3LT0A 3R3JA 5JNLA 3RUAA 3WGIA 2PD4A 3O8QB 4GX1A 1E1LA 1WDLA 3BIOA 2C29D 1K3TA 1VL0A 5JY1A 4BO7A 2RH4A 4IS2A 5ITWA 2I3AA 5KVSA 3KBOA 4UVHA 3GVXA 3RWBA 1DC6A 4DWVA 3KYDA 4QXMA 5A4DA 1IUKA 1C0IA 4IDDA 3A9WA 3S2IA 3INTA 3CUKA 1D1SA 1ADCA 3VC7A 1NQOA 4O63O 1CWUA 3NUGA 2BLLA 2ZCVA 4M86A 4TRNA 4CM3A 4XGIA 1TT5A 2PKQP 2X0RA 4FBGA 3OJOA 1JKFA 5BNIA 1UP7A 2PA3A 3E8XA 1TVEA 4JBHA 1Q0HA 4EDFA 1LXCA 3QWBA 6ADHA 3ZGYA 2O4UX 2X4GA 1KIFA 3H3FA 4N18A 4MVJE 3PVZA 3KEQA 5A3JA 5L53A 4RF5A 2WD7B 1KVTA 1LNQA 2FSSA 3RC2A 3ICPA 4CQLB 4HFNA 4HNHA 2Q3EA 1HYEA 3OA0A 5JC8A 3WNQA 3ZWBA 3PYMA 5AQ1A 4Q3DA 3AJRA 1JVSA 3ENNA 2B4RO 4EI2A 4XX0A 5ITVA 4GWKA 2EJVA 2VNSA 1EFLA 4H7PA 4DREA 3UGKA 4MINA 1J5PA 3P5SA 4R9SA 3K9QO 4NBRA 2AXQA 1YBVA 4OXKA 3LK7A 1U5AA 3RBZA 3T4EA 3DFZA 1ZXLA 1X0VA 2PFGA 4IQ0A 4QECA 3AWDA 2HMTA 1P1HA 2B4TO 2JCXA 4RLSA 3EZYA 3Q0EA 4D3FA 4LGVA 3VHRA 4PLGA 1E3WB 3LSYA 1I30A 1LLCA 4CMIA 3RJ9A 3I4CA 3TSCA 3E9QA 2Y68A 3I5MA 1HXHA 4HWKA 1IULA 4PZEA 5I9MA 1PU2A 3NTQA 1UR5A 2OHXA 2X5JO 4I5EA 5GMOA 3ABIA 4BL5A 1LDNA 4GX0A 1A27A 3DZFA 3AFMA 2Q50A 4FFNA 3H9JA 3GEGA 3ETEA 1P1KA 2NVBA 2VRBA 3Q2IA 1Y1PA 1NFQA 3O8QA 2Q2VA 1LDMA 5JBIA 4GAEA 1H9BA 1HYGA 1M67A 4ZICA 1KVQA 1C1XA 3WJAA 4RVFA 1CRWG 1Z6ZA 4A0SA 1HDYA 3BHMA 3CKYA 1LSSA 3F5SA 3JV7A 3LYLA 5DOZA 4PIVA 2EG9A 3Q2KA 4BNLA 4OXYA 1BMDA 2AQ8A 1R37A 2XXJA 4WNCA 2DFVA 1LDBA 2WYVA 4XRRA 1I10A 4WGGA 1Q0LA 3KSUA 4UUMA 1UDBA 5CP8A 4YB8A 1IHYA 2IEBA 3DZHA 3E5RA 3ULKA 4AVYA 5L95A 1GPJA 4RZHA 4GMFA 1ZEMA 1V3VA 1NPDA 4CL8A 2UUPA 1KY4A 2JFHA 3SX2A 2ILTA 5EQDA 1C0KA 2CVQA 2OO5A 4IBOA 1IYZA 1B8VA 3OQ1A 3FSRA 2Q1SA 4WOJA 4WCDA 3JQ7B 1MP0A 5GY7A 1IZ0A 1Y5RA 2YHUA 4L4XA 2HK7A 1M2WA 4E5PA 2NLOA 1LDYA 2J5QA 1I32A 1ZCJA 3F4BA 3UCEA 3D3WB 1G0NA 2J3JA 1PJTA 1W73A 3V1YA 3CMCO 3H7AA 5BNTA 3I6QA 2DBZA 5G0TA 3W8FA 3GMSA 2PD3A 2C5EA 2G0TA 3K73O 3DBRB 4IDBA 4OMUA 2EHDA 4XDZA 4PCVA 2I99A 1JWAB 1YL7A 1MG0A 1DHRA 2Y66A 1U7TA 4ZHSA 4CMAA 3N7UA 3WGOA 1UJMA 1E3EA 5JYEA 5IZ4A 3KLMX 4MDHA 1LLQA 3OQ6A 2FRDA 4JXKA 4YCAA 3H5AA 4WUVA 3H8VA 2C82A 3ANLA 3EVNA 3JQ6A 3RFXA 5JCJD 4XRGA 3WMXA 2PH3A 4Z9XA 4ZQGA 3OP4A 1TA4A 3PWZA 3WBFA 2RHCA 2WYWA 2P4HX 4GKVA 5IFLA 3DAGA 3FR8A 3GOHA 4YJHA 5L45A 2DU8A 1L1FA 3DZBA 4CLXA 2BRUA 5DP2A 5HS4A 3A28A 3OH8A 5F1KA 9LDBA 4OXNA 5BQFA 1P1FA 1PL6A 3DAPA 3AU8A 4O0LA 4Z0TA 4U5QA 1QG6A 3C7AA 4BVAA 1R12A 2DTDA 2Q4EA 1DIGA 4G5HA 3B70A 3U4HA 3EDMA 2I66A 3BTUA 1O95A 5KJEA 3F4LA 1HDOA 1KEWA 3BXXA 5F3RA 1PJQA 1RPNA 4CM4A 4J9VA 4L76A 3L4BA 1LSJA 3JYPA 1M66A 3T7CA 3UCFA 3AOEA 3FNGA 4CLRB 3EZLA 3PHIA 5L4LA 1SB8A 4FJ2A 1CEQA 3EVTA 1EK5A 1GQQA 2JFFA 4IDFA 1Y5MA 3RIHA 4L75A 2OFPA 1MX3A 2VTDA 4AL4A 3VVBA 3E5MA 4HV4A 3CIFA 2HO5A 3GAFA 4WLFA 1EE9A 3DHNA 2VT3A 1GV1A 2Y1EA 2Y1DA 4Z0PA 2PTGA 1QMGA 3ETGA 1AE1A 1E1NA 4GL4A 4J6FA 4E13A 2DKNA 4ITUA 2EW2A 3NGLA 2OL4A 5TJHA 1N7GA 4UEKA 3DDNA 3RFVA 4WPGA 5AYVA 5EL0A 5TF4A 3UN1A 2IZ1A 3K30A 5I7FA 3BA1A 2VQ3A 3K92A 5EMHA 3I9MA 3BAZA 4CR6A 2H9IA 3I9KA 1CQJA 1X0XA 2HRBA 4Z3DA 4EUEA 1EE2A 4NDNE 3GDOA 1KC1A 4L73A 4CV2A 5CDYA 5MGBA 4YA6A 3DO5A 4K26A 3NV9A 4XQCA 1Q2XA 1T2CA 2Q1UA 4HKTA 4GWGA 3ZU5A 4KWIA 3X2EA 3ZW8A 3CZMA 4JBIA 5G2OA 5B1YA 3ZHBA 5CEFA 3L9XA 4L4RA 1HTBA 1YB1A 4ZVVA 4JJGA 2NACA 4J2OA 3DOOA 1GUZA 2P9EA 1HDRA 1R16A 1Y81A 4MP3A 4PZCA 3IOYA 3JCZA 3CZRA 1Y8QA 5JMPA 1E77A 3JYOA 2I6TA 1N5DA 3ZW9A 2IZ0A 4DTIA 1GPDG 3F6YA 3BMNB 3H65A 5JLAA 1QR6A 1YDWA 2WWRA 1VC2A 3ST7A 2UV8A 1YQGA 1RYEA 2BFMA 4J1NA 4OQYA 4BMSA 2Y1FA 1A71A 4CMCA 2C07A 4E2ZA 4Y6RA 3D5TA 1E5QA 2V6FA 4Z0HO 2ZATA 2C5AA 4RORA 3W6UA 3FBTA 4XCVA 1N2SA 3GN1A 4DMMA 1EK6A 2X58A 1GY8A 2C2XA 2NU7A 4MP6A 3A1NA 3DXFA 2VOEA 3QQPA 3QVOA 3LC2O 4CMHA 4XDYA 4ND5A 3QRWA 5DN9A 4IDCA 1YWGO 3MWEB 3HN2A 1CETA 3UFXA 4GVXA 4DLLA 1KY5A 2HDHA 4QTZA 2Y1OA 2GN9A 3QE3A 1Y8RB 4C7KA 4MVJH 5TSDA 3D4NA 4LSWA 4WOKA 2GDZA 2J3IA 3HUDA 1I3KA 3JD4A 4MPDA 4W9NA 3UKOA 3AM4A 1XA0A 4M89A 1YXMA 2ZB3A 1HWYA 3DBHB 4J3FA 1WVGA 2O7QA 3FCOA 2V6GA 3LLVA 4PG5A 3U49A 5BSEA 4IMRA 1SEVA 1V0JA 2BI8A 3TRIA 3DL2A 4YBZA 1U3TA 3GLQA 2P68A 3PDUA 5TNXA 2Y93A 3KOUA 4P8RA 1P31A 1E0DA 2FR8A 1ADGA 3GHHA 1EZ4A 2ZCUA 4YVFA 2Q49A 4GSKA 2YV3A 4OYRA 5AXCA 4Z6KA 3DBLA 3RKUA 4NBUA 5BR7A 4MVJA 2CUKA 4BO1A 1K6XA 4GX5A 3V2UA 3H9QA 3S55A 4B3JA 2QIOA 3CTMA 2WJPA 1FDWA 1RM3A 3R3SA 1FDVA 4WKGA 1ENZA 2P5UA 1AXGA 4AG3A 4PLTA 2ZQYA 1HLPA 1I5RA 4J0EA 4IS3A 5IAAA 1ISGA 1BRMA 5IG2A 2B35A 3BMNA 2ZJ0A 4D44A 3PGXA 3ZHZA 4ALJA 4UREA 1OZAA 2EJWA 2GN4A 3GC6A 5A9SA 3QY9A 3FPCA 3OIGA 1Z75A 3FI9A 3K2EA 5K6AC 5BSGA 4U0KA 2Y1CA 3EK2A 1PSDA 1EVYA 1BHSA 2W90A 4JJFA 3RC9A 2NU8A 1CERA 5THQA 2HQ1A 3ZV6A 3H6KA 3ZZNA 4C7JA 4YQYA 1VJ0A 4IMPA 1YB4A 4BIIA 4H15A 1B7GO 1K0UA 4RO0A 4BB6A 3UVEA 3QV1A 2GD1O 2IYOA 3N74A 3INGA 4DMLA 3NYWA 1PEDA 4MO2A 4M49A 5TQVA 4OSOA 3QVSA 1ISJA 5EJ2A 3KTDA 1KC3A 4R4JA 1N8KA 3E1KA 5HS6A 3WQQA 4F46A 5GZ3A 1P1IA 1ZMOA 1BW9A 3OBBA 4LRSB 3CSDA 4XQEA 4OH1A 3VZQA 1BWSA 1KEUA 1AN9A 1UDAA 2YHIA 1EDZA 1NVMB 2BGMA 4XYMA 4YT8A 4FJ0A 4NBWA 1B15A 1NQAO 1D7OA 2OGUA 1NYTA 3HE3A 4RPHA 4J2HA 4BNXA 2OUIA 1PR9A 5F1PA 1ZEJA 1H0KA 4GLLA 3PFWO 3QP9A 3FPLA 3PRJA 1CIVA 3H9GA 1QSGA 3HNPA 4JNKA 5FF9A 4YAIA 3HDJA 1CYDA 4LK3A 4W99A 4CPDA 3L4BC 3PLNA 3WFJA 1NWCA 3FF4A 2Y1GA 3JYQA 2YY7A 3QWFA 4DXHA 1BDBA 4CLOA 1P0CA 1BG6A 1PS9A 3RROA 2NVUB 1IPEA 1T25A 3WGZA 1VKNA 5A1TA 2ZKLA 4TVOA 4B8WA 3ZWWA 3GGGA 4IGFA 1U1IA 1NAHA 4NH4A 1JDJA 4TZTA 4AJKA 3NT2A 1SZJG 1KYQA 1XQ1A 2C7VA 4P38A 3M2PA 4TQGA 5HRUA 4WLNA 3WS7A 1NBOA 1EVZA 3GK3A 2GF2A 4J7XA 1X13A 1ZBQA 2XAAA 3HDQA 4I5GA 4W82A 4DC0A 2C0CA 3GVPA 1IL0A 4DIBA 2C20A 3QW2A 3W8DA 2BGLA 3H9EO 3RBXA 2X1HA 4AJNA 3FNFA 4LCEA 4RZIA 4AJJA 5I8WA 3WG9A 4L74A 1BGVA 4JP2A 1H6BA 1GFSA 4INAA 2Q2QA 4BQRA 4F45A 1ISMA 1MC5A 3GR6A 4RPLA 1VL6A 1GDHA 2F1KA 1MA0A 4MVJF 4TSKA 1UZLA 3BHIA 2FR0A 3KYDB 4JLWA 3JD1A 4DQVA 4R1SA 5KJCA 3ONFA 1PJ3A 3WIEA 1E6WA 1MFZA 1ISFA 1ZK0A 4RLHA 5CFZA 2EF1A 4N5MA 1TT5B 1MXFA 3HSKA 3STHA 1M76A 3LC7O 3WLFA 5CG1A 2O3UA 1YS4A 2EGHA 1TT7A 3O26A 4PG8A 1NVTA 3KLPX 3PK0A 4BNJA 4I9HA 3ZNPA 3JQ9C 2X22A 5B12A 1B0AA 1GCUA 4MKRA 3Q3CA 5A06A 3SJUA 1OFGA 3AUSA 1HZJA 4P4NA 1YL6A 4OAQA 1JQBA 4KMSA 2GRAA 1RYDA 3QWIA 4YQZA 3I9OA 1PQUA 3NTRA 5JXWA 1SCUA 2FOIA 3OEWA 2B37A 2ZYAA 3DOCA 3IIEA 4TRRA 4D46A 4YAKA 5KJFA 4YACA 3M2TA 1A4IA 4J43A 3ZU2A 2WTBA 1NFRA 4WNIA 1NHGA 1GQYA 4I5DA 3SVTA 1JA9A 5I7VA 1LSUA 4WEQA 3SBOA 4DPMA 3D64A 3DBVO 3TFOA 3DQPA 3JQ8A 2NVUA 3IS3A 4W7HA 2AA3A 2D59A 2HMVA 3VPSA 4CM8A 2O48X 1YE3A 1R6DA 2YV1A 5IDWA 4XWYA 2FP4A 2VWQA 4F6LA 1IE3A 4NJOA 2X0NA 3ZV4A 2D8AA 2Q1WA 2CF6A 1JN0A 4ALMA 2CSUA 4MP8A 4HP8A 4UUPA 1FDUA 1YDEA 4YPOA 2EKQA 3GFGA 2UYYA 1XSEA 4WLEA 4W9NC 4DYVA 2V7PA 1ADFA 1V35A 4NU5A 1A7AA 5L40A 2HMUA 4GH5A 3WMWA 4CMEC 2GO1A 3VPFA 4BNIA 5CEJA 1J49A 4B7XA 1C1XB 3QWAA 5JDCA 2I76A 3ROQA 3MJCA 4OIMA 4DL9A 5A02A 3OICA 1JVBA 1U7HA 3TZKA 4CM5A 4EZBA 3KRTA 3HN7A 2HMWA 4O5OA 4KQXA 4MVJG 1C3VA 3NGXA 3WLEA 4HNGA 3FRJA 4JP3A 1LRKA 3Q6IA 2GZ2A 4RV9A 1PWZA 3E6AA 1PJ2A 2FPPA 2ZB8A 5JFOA 4HFJA 5K9ZA 1P33A 3I52A 3JQFC 4AFNA 2JD0A 3ZWCA 4J49A 4CV1A 3TJRA 4R69A 4FS3A 1OAAA 4IIUA 5DOVA 1LDEA 3S2EA 3RFTA 3IDSA 2JD1A 1ARZA 2TMGA 3ANNA 3ONDA 3T7EA 1VPDA 1JW9B 1V3UA 4L4SA 4W7IA 2NQTA 3G79A 3WGQA 3AUTA 3D3EA 3O03A 4K6FA 1KBZA 1S7CA 3WGHA 4E0BA 5JDIA 3Q9NA 5LCXA 4CUJA 2ZTUA 1DRVA 4HXYA 2YUTA 1MUUA 2ZYGA 1R0SA 2EP7A 3F1KA 4LCJA 4QQRA 3HJAA 4ALLA 1XKQA 4PFJA 4RVSA 4RVHA 5A5EA 3ZHXA 3NEPX 5KJ6A 2HLPA 3V2HA 5KNLA 4NZ9A 1W8DA 2QZ9A 4PLFA 2E82A 1JAYA 4WK6A 2OXIA 4Q3AA 4BNGA 4LVCA 4B4OA 4XB1A 4OJNA 3ZCXA 4DQUA 3L6OO 4FOOA 3O38A 3AY7A 4NU6A 4YJHB 1RM0A 3WYEA 2HMSA 3UHAA 5K0ZA 4RF3A 2R00A 3WIDA 4WECA 3I6IA 2O3QA 2R2GA 3LVFO 1NM5A 4DYDA 2IDZA 4TZKA 3SLKA 4IZIA 4JGBA 5DCWA 3VH2A 4A26A 2NTNA 4E5KA 1EEHA 4PRKA 2VUTA 4NQZA 5T6BA 3VDQA 1T1RA 1UAGA 1Z74A 2VUUA 4HADA 4TRMA 4I1IA 2FSVA 4J16A 3AU9A 4PVCA 5HBRA 1E3IA 2I67A 3RUEA 4GPD1 3OIDA 4JBGA 4CM4B 1HL3A 1SBYA 3IQDB 1D4FA 1PGPA 4DBZA 2XXBA 2E48A 2J5RA 1LC0A 4IZHA 4LMPA 2Q45A 2VYND 3WFIA 3RKRA 1Z7EA 4B4UA 2HUNA 3VPXA 3L0DA 4JQCA 4JX8A 4IDGA 1EVJA 3DTTA 2X86A 2O7SA 2ZTLA 2QG4A 4YJGA 3E48A 2AEMA 3JQEA 5JPIA 1PTJA 2DBQA 4NIMA 1PGJA 2FY8A 1EQ2A 1DC5A 2UDPA 4S1VA 1OBFO 4CQMA 3KVOA 4K1LA 1B14A 1NPYA 2B69A 4PLCA 5KJ1A 4KZPA 4NI5A 1U9JA 3HZZA 3ICCA 3JD2A 2Y67A 1X15A 3F47A 1P77A 1PJLA 4TROA 4KQWA 2Q46A 1A72A 1Z7BA 4GMGA 5G4KB 3MCVA 2VZ8A 2J3KA 3BTOA 2YFHA 3TL2A 3DMTC 4OKIA 1BVUA 1ZXBA 4IPTA 3NRCA 1XYGA 1X7DA 3DR3A 1PX0A 5IZCA 1YQDA 4RPGA 2X9NA 4IM7A 2LDBA 1ISIA 1GEGA 3AY3A 3B6ZA 2HAEA 5F21A 1W4ZA 1IOLA 2QW8A 1ONNA 3K31A 2Z1MA 3KUXA 4CL3A 1N92A 2QRKA 5L51A 3KYCB 4RCVA 2YFQA 1AUPA 4ZU3A 5COQA 2D1YA 4CJXA 4BQPA 4ROSA 1P1RA 2V6MA 1HE3A 1R0LA 4Y9DA 4B7CA 3GGOA 4WCFA 4BGIA 1BXGA 5JYDA 1WAMA 1YGYA 2NVWA 3I3OA 2PZLA 3OJEA 4RVDA 3QLJA 1P1JA 3B20A 3RAJA 1Y8QB 5COBA 1PZEA 2TMDA 1HRDA 1R15A 3SC4A 2GERA 3EW7A 5DZSA 4AJ1A 3ITKA 4J1SA 1DJQA 1ZK3A 3QVXA 5G4LA 2PNFA 5T5QA 4CMKA 3DEYX 4LVUA 5C7LO 3IL2A 1JTVA 4DQXA 4FIZA 4K6CA 4FFOA 3DZGA 4XEHA 2BI7A 4GX2A 5AXAA 3FTNA 1DFIA 4OHUA 4FB5A 2DBVO 2I5PO 4R5MA 4AJ4A 1DIBA 2P9GA 1QLHA 1QYCA 1LBEA 4J4TA 4EYEA 4L0QA 4E2XA 3L9WA 4YDRA 4GVLA 3MTGA 4FOSA 1EDOA 5H81A 1GYQA 3WTBA 1DAOA 2BHLA 3HHPA 2DC1A 3EAGA 1MFPA 4BO3A 1I01A 1I3LA 1T2DA 2DQ4A 3I9JA 3JQGB 2B83A 4B3HA 1U8FO 2OBNA 4OQZA 2EW8A 2AG8A 3OEYA 2EKPA 3W4IA 1UAYA 3G17A 1MXHA 4W4TA 3JYLA 5G4KA 1LI4A 3FWZA 4E30A 4II2A 1SPXA 3QVTA 1XHLA 2IRWA 1HLDA 1AHIA 1ZZEA 1NPTO 3U5TA 3NDIA 3VH1A 2H1SA 5FWNA 2R6JA 3TOZA 3MTJA 2WD8A 1SC6A 1LQUA 2VNAA 3C3XA 2GYYA 4FD3A 4NMHA 5L7TA 2G1UA 2Q2WA 1WW8A 1RWBA 1GYRA 2H6EA 5C3MA 5EINA 4ALIA 3KYCA 2AMFA 5T8KA 4QFDA 5U9CA 1XGKA 4BNUA 4FQ8A 3RU9A 2Y05A 1NFFA 4GQAA 3MJSA 3HQ4O 1HE5A 1ZMTA 3DBLB 4F6CA 1ZSYA 3U9LA 4R3NA 1VL8A 5ER6A 2PV7A 1FDTA 1SAYA 4Y98A 3RC7A 4DRYA 1JLLA 2Y0DA 3LT2A 1WWKA 3AOGA 1K89A 4P22A 4UUNA 3G49A 4RF4A 3IP1A 4FN4A 1GQ2A 2FPGA 1T2EA 3PPIA 4RL6A 1GUFA 1PGOA 2BMAA 5BT9A 2Z5LA 1LX6A 4ZN6A 1F06A 3GNQA 3MOGA 4FJ1A 1B8PA 2CDBA 3T4XA 4XYEA 4DVJA 3BMOA 5AXDA 3ITDA 4JJIA 4XR9A 4TKMA 5TT1A 1ZK1A 2GGSA 3ZH2A 5A9SB 3JYNA 4R01A 3U3XA 3E9NA 4D42A 5IJZA 1U3UA 3HB4X 2WDZA 1XCBA 3RI3A 4DBVO 2A35A 1ZIDA 5H83A 1E7YA 4ZQBA 4RQUA 2VRCA 3LU1A 3D7LA 1KVSA 2WMDA 5IXSA 1I0ZA 5CPFA 4RJTA 1KS9A 3RASA 3WGYA 4PLHA 1AGNA 3GUCA 1MLDA 2W98A 1T24A 3MEQA 4ZJUA 4OL9A 4NPCA 2CF5A 4NBVA 1LSOA 3JQGA 4LMRA 4MIEA 5I7EA 4IIVA 4E5YA 5JS6A 3H2SA 3QJ5A 2DM6A 1BW9B 2JKVA 2ZQZA 4TKLA 2RAFA 3PWKA 2R00C 4XD2A 1QLJA 5JSFA 2Q4BA 2YHIB 2O3TA 4IGEA 1E7QA 4Y6PA 1XDWA 3JQAA 3PJGA 2VYVA 3VPGA 3HWRA 2NM0A 3FR7A 1NHWA 2PK3A 1Q1NA 4FGSA 2GN6A 4YJDA 5ES3A 2X0JA 2GNAA 3KETA 3K5PA 2VWPA 3LT4A 2C7GA 3GZNB 1M6WA 2BGKA 4YRDA 4K9DA 2AQIA 1WZIA 2X0IA 3UUWA 4L9RA 3RUFA 1U5CA 5CDUA 4GKBA 1WMAA 4J7CA 1XEAA 3KXDA 4MOWA 1ZW1A 2CNBA 4N5LA 4Q3NA 3V5NA 1J6UA 5IF3A 1PQWA 1ULSA 1I3MA 3SLGA 4BS9A 2AEFA 4O1MA 4R16A 4CLOB 4IQGA 2IE0A 3ON5A 1H6DA 1B16A 2FZWA 3R0IA 3OF2A 4B7UA 1DRWA 4J0FA 2NNLD 1E6EA 4HFRA 4J90A 1C0LA 2QYSA 4CUZA 3EYWA 2E4AA 1CJCA 4QFCA 2DUWA 3M6IA 1OMOA 1UXGA 4QO8A 2PLAA 4B3IA 2B5VA 1N1EA 3NAQA 3CH6A 2W2KA 3TZ6A 3OSUA 1ONOA 4KWHA 1E92A 5DCUA 1PZHA 1DO8A 4FW8A 2XOXA 1DLJA 4CMBA 1DC3A 1DXYA 5LDHA 3PFFA 4Z9YA 2DFDA 4OKNA 4YT5A 3PHLA 1Y7TA 5IZCC 3SJ7A 1QYWA
chains in the Genus database with same CATH superfamily
3DUWA 3EOBI 3U60B 1R5NA 3H75A 3GCWA 1OV4A 3SNKA 1KI6B 5HFNA 3ZZ0A 5MN6A 3CYFA 4F3YA 1EFPA 3P2IA 4YMHA 3M6LA 1GG8A 9LDTA 2CLIB 3T4PA 4QUGA 2NXEA 5A5VA 2C5GA 1E1MA 1O7JA 2NTJA 1YV9A 2VPXA 3TKYA 4FMCB 2XIJA 1OUMA 5AM3A 1FP4B 4OHXA 1B8UA 4MEBA 4RLQA 4J9UE 4WCFC 2ZJAA 2ZFUA 4JMPA 4KI7A 4DIUA 2A8YA 4EG3A 7GPBA 1NLYA 1HRKA 721PA 2ZJ1A 1WZEA 3PL1A 1VI2A 3AM3A 1LV7A 1PJ4A 3FKSD 3OEHA 4PVDA 4V3BA 1UMCA 3UB3A 1SIUA 1XD2A 2VZ9A 4IQ4A 2I7XA 4YJ2F 4FSHA 3QTBA 1G4AE 4MQBA 1OC4A 3RIGA 4A73A 4KQCA 2GZ1A 5FPHA 4Q3LA 4ALKA 1AKTA 1U8UA 4QQKA 5E3IA 3AR9A 2ZI7A 2EFDB 5BT8A 2W11A 3U7FB 4CTKA 3RFCA 5K3SA 3SSNA 3L6DA 4UAGA 3S44A 1X14A 2ATCA 3IEKA 2VSNA 1QIJA 1G6KA 4P54A 3B1ZA 5JMOA 1E64A 1VPLA 2OV6A 2NV6A 2V7WA 2WBLC 3WLRA 1G21A 4MVJM 5HNKA 4RULA 3G2IA 1DB3A 4QRIA 5DLEA 2XGJA 1QYDA 3KX2A 5AW5A 3T7AA 2FLKA 3OCUA 4EJMA 1X7HA 3RQIA 2UYOA 1JFFA 3C0KA 3OZCA 3HCRA 3UGJA 2XAUA 2F8TA 4N01A 5FPTA 1E20A 2OHHA 4CM8B 4F92B 5NULA 3IB3A 3WWOA 2DHCA 5AWFC 2CMDA 4CIAA 4G0OA 1WZ2A 3WL6A 5GQSA 4R2XA 2QI9F 3GRZA 4YYZA 1P4JA 1YBFA 3PRKE 4Y30A 4HWPA 1FYVA 1NAIA 4Y9UA 3WY9A 3Q7RA 2X7HA 1Z7WA 4IIXA 4LZPA 4PHGA 2VHQA 2PSSA 3ADOA 4B87A 4J4HA 1K97A 2C4TA 2F8MA 2I6GA 4G37A 4RHCA 1L7OA 1ORHA 4HC4A 3DNMA 3X1WA 4PPFA 2W6QA 3KAPA 1JLSA 4QPNA 3ZWNA 1A4UA 2NGRA 4YCJA 2DF8A 4LOHA 5AW6A 5CFPA 1Y6FA 3U7RA 5CVCA 1PW5A 4JLVA 3TXXA 4BMVA 3QKSB 1T2FA 2CXUA 2PR2A 3C8MA 4IGIA 4Y9SA 5KYWA 1M1ZA 2RFLA 3UAOA 2G0AA 2PVPA 3UY4A 1AA9A 4D9JA 1KA9H 5KHAA 5EJ8A 3QITA 1VMEA 4N39A 5IDQA 2PLFA 3P4YA 5IEJA 1B8OA 1JSZA 5DYTA 2OOSA 3CF6R 1I6KA 1MJ5A 1TJYA 2BELA 1NSTA 2H08A 2HK8A 2QX7A 3LECA 4IJUA 3QPVA 3X1YA 3K8OE 4JLOA 1YQTA 2BHTA 3JAWB 3VTFA 4AN1A 3RPEA 1LI5A 3R3VA 1W75A 5SV2A 4J0JA 3FW1A 4LJ5A 3HGQA 3UMJA 1RJWA 3R5SA 1BHO1 1LBQA 1VE1A 4B48A 4RUKA 4II3A 3BK1A 3MELA 4L7QA 4YWJA 4ZDWA 4TL6A 3ZC3A 2XADA 4M9XA 2FPPB 3PQ5A 1E96A 4LWQA 4FR5A 3UBTA 2PX3A 2Q0SA 5ADVA 1E7RA 2VSQA 2ZTHA 3CUVA 3EY9A 1NN5A 3UF0A 2B8TA 2X40A 1NTOA 2AN9A 4X24A 2ZTVA 1AMUA 1HQDA 1PL7A 3BXFA 1YBAA 4YRBA 4P5DA 3AVYA 2DBRA 3JATB 4UEWA 3ZHYA 4I08A 4UQLA 2YWDA 1V11B 1Q7BA 4HY3A 3WHIA 2PIAA 1UWVA 5K0TA 1XR3A 5IPFA 1OXXK 2RK3A 3LXMA 4G0XA 5CB8A 2BGIA 3R7LA 4EKNB 2D2FA 3NHBA 2P5YA 4IY1A 2PL3A 1HE2A 5IJ0A 2IODA 2PZGA 4Q21A 1O8CA 3GRRA 3V8PA 2Q3LA 4KVFA 4A5OA 2Z9BA 2J67A 3A6DA 4EPYA 3NGMA 3PQFA 4KR6A 4D9IA 1ZP6A 3FPHA 4LXIA 2O1XA 4QSMA 2Z95A 1V7PC 1BWPA 3AI3A 3NHAA 2Y0EA 4RD0A 2QGNA 5D1NA 1WVIA 1XVIA 5FWYB 5G41A 4JK3A 2FDCA 2GN2A 1T4BA 3GEDA 4Z2AA 1EGAA 1GUYA 2P30A 3GFPA 2RHJA 2ZPUA 3KFXA 5AI4A 2X9VA 3D6MA 3B13B 1GZ5A 2BFAA 3FUTA 5JSHA 3MZ0A 2QGFA 2CXXA 3THSA 4IIBA 3D0KA 3GPBA 3SEFA 3GDGA 1AJEA 4OUDB 4AP9A 3O2JA 3QVWA 4MZXA 1A9PA 2ORVA 1XXHB 4BATA 2YW9A 4GM4A 4NZZA 2V5UA 2LP4Y 1W0KD 1YK1A 1VSQA 2GR9A 2QX9A 1RWWA 1OLXA 1UBOS 4P2GA 1M1NB 2ZCJA 3H83A 3ZDQA 2AQHA 4IWYA 1L8LA 4E12A 3C41J 3DC2A 3NHFA 5BY2A 1T0UA 1IOVA 3TF5A 1M8GA 3RVJA 3VTZA 3W05A 4C0BA 1N6PA 3PPXA 3QWHA 1XV5A 1RWKA 2BH9A 1TVMA 5AW4A 3DXXA 3FPKA 4JUDX 1H0SA 5AW9A 3SZOA 3QLUC 1BCRA 2PRJA 3QKSA 2FQYA 3ZDEA 1SUCA 1DC8A 4LQLA 2XVMA 3BCSA 4FFBB 2J9XB 3KT3A 1RAEA 2RHBA 5EE3A 2XWBF 4N5NA 4PQGA 3R7SA 1QV7A 3LG2A 5EJMA 3S2GA 4UFPA 3AVTA 4KYVA 4E14A 1EX6A 1SEPA 1A9QA 2VPYA 3P9PA 1O0SA 4C1NA 4E70A 2QR2A 4C2BA 1PJBA 1PZXA 2DSTA 2Q3CA 2AZ4A 4BLWA 4V1CB 1FMJA 4LHZA 4LRYA 4GSYA 8ABPA 3ZJVA 2V7TA 1XPOA 2NWQA 3EF1A 1HT1E 2X5XA 4YRAA 1QE0A 2ENUA 4HR7A 1NBIA 5CFRA 2VHYA 1E3MA 3UJNA 1IPFA 5CU7A 3EEFA 4B33A 2IYPA 1W29A 1IUNA 3Q40A 3U09A 1BQEA 2CUTA 3EODA 5F2OA 3WWEA 4FYPA 5T4FA 4RDHA 4IIDA 1VSVA 4UC0A 1DEHA 4OAOA 5CLHA 5F5NA 5JISA 3GLIE 2J31A 4R7GA 5DSZA 3RVDA 5IT5A 4RGBA 2ZZNA 2VDPB 5LQDA 3B85A 3ELBA 1AZSC 5I7SA 1N9GA 2CJWB 4R9VA 5KNCH 2OP0A 2BTQA 5LDGA 1V11A 2QM7A 1II8B 2FPMA 3VU8A 1R0YA 3BS4A 2FPWA 5BOSA 1TEHA 3R8CA 4EY4A 3ZBPA 5IFKA 2FZCA 4DJAA 5DYIA 1Y9DA 2X3YA 2CCGA 3VZPA 2BF7A 3PNVA 1ZH8A 3UJ6A 4B3GA 2EEZA 3LP5A 1NMQA 1SGWA 1UFKA 3CPSA 3IKLA 3AF5A 4G2NA 4MUXA 2GEFA 3A4TA 1PNTA 2PYIA 4OQMA 3X43A 3AEKB 1C7EA 1G2IA 3Q15C 1ZZGA 3PSAA 4FFLA 4P3KA 4IJKA 5LNK1 1Z0JA 3OQMA 1FLAA 2PS3A 3WE7A 2W6JA 4BU1A 5CAEA 2YBDA 4X65B 1VECA 1CQIB 4QOJA 3KUUA 3U4MA 5ALKA 3FPJA 4UKDA 2LWIA 1LW6E 4TT3D 1CUSA 2G5PA 1FBTA 1WL8A 3O2NA 1IPHA 4H6PA 4OHVA 4M1MA 1XC7A 5LQKA 2HHHB 1R8XA 4GZ6A 4RA9B 2W2TA 3JRNA 3C1OA 2OCXA 3UMGA 1XXHA 1GNTA 3B89A 1P9NA 4PY2A 5SYNA 1SXJC 1F14A 1DX4A 1P6QA 3TZQA 5IX8A 3QF7A 3ASVA 3JSAA 5HZGA 3NPAA 5AVOA 4Q1EA 4WINA 2VUIB 4H18A 3QMWA 4U9UA 3T5CA 4BGVA 3OO1A 1ZI6A 1Z2AA 3OETA 2NQ8A 1PJSA 2NU9A 3O4JA 1BXGB 4NH0A 3W0LB 5FD8A 1H1TA 4LHVA 4FEYA 4L27A 4AN4A 1B2RA 1PQYA 4CDRA 2V54A 5C7OO 1G9XA 2COEA 4P1ZA 3AY6A 3K9GA 3RR2A 3UQZA 1F38A 1KIAA 1XRPA 3VU3A 5J2UA 2ZIVB 5B3JC 2E1PA 1DARA 4TS4A 4CODB 3ESZA 2ZJ5A 1WTCA 3V7YA 2PT6A 3NWOA 1L5QA 1MCZA 4HAIA 3VH2A 3WKCA 4IJMA 5HZKA 1G8MA 4IDAA 2AMVA 4XVRA 1TYCA 1K3UB 2OLKA 3L0IB 8GPBA 2YWRA 3SQWA 4RM2A 2OMKA 3Q5EA 1IN7A 4V24A 1S2OA 1K7YA 2B4QA 2JCVA 3PQ2A 2J4CA 1GUAA 4NZOA 4LHEA 2YN2A 1OX5A 5KYUA 1I2CA 1QQAA 1S4MA 1G63A 1WUKS 4YEDA 3WMEA 4B2PA 5FWDA 2C2GA 4POOA 5KWSA 1RQLA 2GD2A 3GGDA 2R6DA 1KF0A 2G76A 5DRTA 2GCEA 4F06A 4KGZA 2H52A 4ZODA 4XE5A 2PZKA 3TOSA 1C8VB 1E5DA 4Y7DA 5E8RA 1Q7CA 3KQPA 3V4LA 5C1PA 2PQMA 1GU1A 4FILA 3PLRA 1WPQA 5H7XA 3K6JA 5FA8A 3IUPA 4MVJP 4C6HA 2ERYA 4OQFA 5KYTA 1I80A 4EDHA 1PQPA 4CWAA 2XQIA 4YMIA 2O59A 1PYGA 3CBQA 3U4DA 2NSDA 4FBMA 3TQSA 1QTNA 3L6EA 5T57A 3TIXB 4Z3KA 2Q3JA 2Q5HA 2PA0A 3RLFA 2PQ0A 3FFBA 2XUGA 3G5UA 4NFHA 4Y2VA 4XGRA 1H1DA 1XALA 1Q7GA 3PYLA 3CH7A 3CZPA 3D54D 3PE6A 4P4SB 4CG0A 2G1KA 4BO9A 2R8RA 3V2GA 4Q4JA 4FYHA 2HMAA 5ICMA 1NKSA 3LF2A 5ILQA 4HSEA 4E5NA 3RNOA 4F9TA 2VHEA 5AW1A 4ICIA 4N41A 5EY5B 3WXBA 3ZI7A 3IJPA 2GBCA 2VWGA 3BSFA 3RARA 3BL5A 3GHYA 1CQIA 2H07A 5FXMA 1V3TA 1P5RA 2WLSA 3C8ZA 3DOIA 3RVSA 1I14A 2YNMD 4CQLA 3CUSA 3WB0A 2BMWA 3ZJ5A 1W93A 2WNHA 4FGWA 4ZQHA 2VXOA 4AKSA 2C31A 2W22A 3PL5A 2PCJA 1XWFA 3VZRA 3KAJA 1NVUQ 2VCYA 3MHTA 4S24A 1YCGA 5AW2A 2E89A 4RA9A 2BM0A 2XQFA 1Y3DE 3FGNA 3PQ6A 1XFAA 4RIEA 4EHNA 3GP5A 4LF8B 1Q2UA 3GJXC 4MAMA 3UAYA 5DJ5A 1PS0A 4PPYA 2RKBA 3PV0A 3ECAA 4A2QA 4R9RA 2AT1A 3KAKA 5FBWB 5KWEA 3KYJB 3GXOA 1RQ2A 1NVEA 4UNQA 2FPSA 2LGJA 5KNBA 2RIPA 3LPMA 3QX9A 1YASA 1GL9B 3E1SA 3EQZA 3M1AA 4B4WA 4C2AA 4YJKA 4DIFA 5JNWA 1M8FA 1SPBS 4XLTA 2EP5A 2IC5A 2ZRIA 2HXSA 3L41A 1RPAA 1XTQA 2CEAA 3PQ3A 4L57A 4LCBA 3WNBA 3I5YA 5EOVA 1A98A 1F2UA 2AOTB 4M9UA 2B0CA 3A1SA 1B3BA 2GASA 3EPKA 5EYPA 3F71A 1EX7A 4MWDA 3W8EA 4AX8A 2P9ZA 1G7RA 2A4KA 1ZGCA 4CLHA 4RYLA 1IG0A 3JD0A 4IWXA 3HADA 3IKVA 5AKEA 2I29A 2PLNA 1MABB 2EIHA 3BCRA 3IERA 1D03A 4OL0A 3NWPA 2PU7A 4RZQA 5C4GB 3SHOA 4DXDA 4DV5B 1Q11A 5I9SA 1QIFA 2ZJBA 4OB6A 4EY7A 3FIJA 2CVHA 4KX3A 4J0GA 1TUEA 1F17A 1ISHA 2Q99A 5E6RA 1LUAA 4YR9A 4FR2A 1J23A 5NLLA 3WTCA 4M38A 3U62A 1L4HA 2HSGA 3JWHA 3TEMA 4BBAA 4C0LA 5KOHB 2VSYA 4ZYTA 2KMLA 2XBUA 1R5BA 1ZM4A 3CNQS 4R9UC 4ZOAA 2C9BA 2LKCA 4Q6BA 5KKNB 1N2IA 5HK9A 4G6ZA 3CH5A 1WKCA 3EZNA 3KQOA 5CHYA 4ACAA 2GFQA 1R64A 2GNPA 4JT4A 3KT0A 4UCWA 3TRKA 3HUTA 1GADO 3CY6A 1C3LA 1DBWA 1YUBA 4P31A 4KLCA 4ABYA 2ISCA 3FAKA 2KHZA 1QJ4A 2X5OA 1QORA 3AHCA 3ZK9A 1H2EA 4LGYA 4J0IA 5KYXA 4GZ3A 3EZ2A 4EO9A 3HUEA 2MSCB 5KTYA 1PBTA 1X6VA 3KSZO 3BXGA 3OZXA 3CNEA 2QYTA 3VR4A 3WSWA 1YRLA 2VA9A 3JQBA 4FE7A 4P4SA 3RRXA 4DQLA 3R9WA 1VSUA 2VO1A 2V8OA 4BX2A 3MRSA 2KLBA 2AC7A 3NM5A 1C0PA 1SBHA 4J0HA 4KRGA 4LBZA 3JQAB 4H27A 5FUVA 1H94A 4P3PA 4V0ME 1K88A 4A6EA 1FNMA 1AURA 3VR2D 1CJKC 5I7HA 1U28A 4IF4A 3H9CA 5L7YA 1GZ3A 2H48A 4WXMA 1B6TA 3JQ7A 1RRKA 3WGGA 2CD7A 2NUAA 3I9NA 1JG3A 3PUWA 3ZV5A 4ZYXA 3Q3JB 3WL7A 2G28A 5JBNA 4QRDA 4ZTZB 1A8IA 1Q0ZA 1D9ZA 4O6VA 1T0PA 1GCGA 4A10A 3IOMA 2OORA 3K1ZA 1T8WA 3PGKA 2AEEA 4EX7A 3GT4A 3AKDA 3K9HA 4CQMD 3MNFA 3A6EA 3IBTA 3FUWA 1KOLA 4MH0R 1N5KA 1WDTA 3G5MA 1U2RA 3TCXB 3ER8A 1IBSA 2VDQB 1F2DA 1NMXA 3MYYA 2YNMC 4I5IA 1EUZA 1UKYA 2VQDA 4O4JF 4YP9A 2WP8J 2H2DA 3GMTA 2OCYC 5ANRB 1HGXA 5U1PA 1CB0A 1DC7A 2IQ5A 4R3UC 2WNIA 1B93A 3ZY5A 4W1QA 2OBMA 5C3UA 3TH5A 4FNMA 3ZPXA 1EBBA 3I9V1 4DCJA 1E2KA 3EXAA 5JVDA 3A6KA 4PF1A 5IT0A 3AEUA 5T3UA 2GTHA 1NQWA 1WB4A 2AFIB 5TJ9A 4CM1A 3L07A 2IXTA 1IQRA 1KJZA 4JI2B 3WJ2A 1C9MA 4XFKA 1BFUA 3R20A 4EBFA 1IC6A 1WUIS 2JBWA 3OOYA 3RABA 2JIMA 2PH7A 2Q3BA 5JIBA 3FZQA 2I87A 3CRW1 5EIOA 4ZAXA 1GV0A 1WXQA 4HFMA 4HLUC 4KPGA 5IARA 5T67A 4WA7A 4DKJA 4G09A 1N2ZA 1MABA 5LOVF 2V59A 4LJYA 3TSAA 1NYLA 1GGJA 5DWQA 1J06A 4HL6A 4Q9DA 3X1DA 4CHTA 1N2CE 1LTHR 1W35A 3FSGD 4BKRA 1U0FA 4I99A 3FNEA 1TA9A 4R1UA 1U8TA 4AX4A 5GV7A 1LPBB 1H8ED 3E9EA 3H6HA 3JQ9A 1LJ8A 2OE2A 3P9XA 5ECYA 5ARCA 2ONJA 4A2CA 1LZLA 1MRSA 2WF9A 3EY4A 2CNLA 2H5IA 2R8YA 5KOHA 4N82A 5DYYA 3WHPA 1ZKDA 4JYCA 2BSXA 1M0WA 3GFTA 3PWTA 3ORRA 4MWTA 4AF7A 5JJLA 4O2BA 1LBSA 1QFJA 4QXQA 2XB2A 2PSDA 1N4AA 4Q01A 3N58A 1FMTA 3BSSA 4H0FA 1WS6A 4EEXA 4XASA 4X64B 1ONBA 3HY3A 1Q14A 3JWEA 3RCBA 3O3NB 1Z56C 1LK0A 3DGFC 5KTKA 4L8VA 4LPSA 2NUBA 4GS5A 4P84A 4Z5XA 2H57A 3Q7PA 3NOXA 5L7WA 3DONA 3SJBA 2FJUA 1K8RA 5L9AA 1TLTA 2QL5A 1L4KA 2I0FA 1F4LA 2Y4OA 4HGQA 1DKNA 1A1VA 1DQZA 4C04A 3B5JA 4HH4A 1UBEA 4DCMA 3WIUA 4YRGA 2DKOA 2CDAA 5JH7A 1JXMA 1ZVMA 3CR7A 3DE2X 3QXXA 3CH4B 4JYMA 1ENYA 3QG1A 1EXDA 5CXQA 1JZSA 3B3JA 3RRFA 4J75A 1FP2A 3OE5A 2B3DA 5CFQA 1QK4A 3E9MA 4XXHA 1YS6A 1KFCB 1Q57A 1Y9AA 4Y6SA 2ZRNA 2OQRA 3GFQA 3SY8A 3UXYA 4BEVA 4C08A 5I9NA 1HY3A 1NQTA 5IXJA 3GG9A 2XNDD 4JQSA 5JC1A 3BD6A 3SQXA 1UBTS 2E6UX 3T9DA 1YH3A 3KIPA 4C0XA 5DM2A 2AX3A 2ECKA 4G5XA 4M83A 3QXHA 3UWDA 3ORYA 4BX3A 1ADJA 2W37A 2RI0A 3BGDA 4ZVTA 3P19A 2G17A 1D07A 3FLAA 3LL7A 4WNAA 5HBGA 4BO0A 4CMEA 3PFGA 1N57A 1WUYA 4BVFA 1BTOA 2HDOA 4HDCA 5K0LA 2FUCA 4ECAA 4CDNA 1WSDA 4MHTA 1JLRA 4UBNA 5EJAA 4E5UA 1JXOA 2AWOA 3EBOA 3OIFA 3OLZA 4M37A 4DJJA 2ZI9A 3OQNA 2PH5A 2W6MA 3OKPA 4K9PA 2FZEA 4B73A 1JKMA 3WXMA 4FC6A 1QYVA 1EZ1A 3C7CB 4TV9F 1KU0A 1ML3A 5AK0A 5F77A 1N3IA 3UOGA 1ZAYA 2PUCA 1IQPA 4X7PA 1ID1A 4JWTA 4BLQA 2ACEA 1S3FA 1XRLA 1YKSA 2G4LA 3IQFA 3LA6A 3IO5A 1I2ZA 4M1QA 4C5AA 4ERXA 5BW5A 2G8LA 4G67A 4Q00A 4AO6A 4BKUA 4BO8A 4RDIA 4IFEA 1Y34E 3A26A 1VLVA 3FVRA 4MGIR 3H8SA 3AF6A 4JNCA 3N8GA 3DEAA 2YZNA 2D5IA 3AB7A 4Q4AB 1P2VA 1W34A 3FCUB 1T2UA 3LBAA 4YMTA 2PS9A 4BO2A 2X8JA 3C43A 1HDXA 1XMIA 3A9CA 4YRIA 4UZFA 1L5VA 2MHCA 4CU5A 4GE0A 5ULLA 3EWAA 4FCWA 4KV7A 3T41A 1UIMA 3A6LA 3DE3X 5EQFA 1U3VA 1XLWA 3VHQA 2GN0A 1AKEA 2HGZA 1GITA 2P5SA 2EFJA 1G8AA 3IPCA 4RQTA 1Z13A 1AZTA 4X85A 3NUQA 2A3RA 4HHEA 1FXSA 4TLAA 4HZUA 5AM0A 2B7LA 3FKQA 3EAQA 2CYAA 2XYRA 1JT2A 2GPTA 1BZYA 5BRAA 1OTXA 1JG1A 2PZ8A 3L8YA 1N2BA 2NZVG 2P6PA 2WEKA 2N75A 4M2LA 4EZIA 3GEIA 3O4IA 3CVWA 2FSUA 4B6JA 4U2GA 4MUBA 1Q84A 3O74A 3GFBA 3E70C 5HQJA 1QIDA 1Z6PA 2R60A 3PC2A 4XWGA 3U81A 4CUKA 1UKCA 4EARA 5B58T 4A8JB 5G40A 1WQ1R 3KV1A 2BV3A 3FY4A 1KBQA 3U61B 1IM2A 5E7MA 1RM5A 3JQPA 4TXJA 1JEQB 2OHIA 2B21A 5BSFA 3TEFA 4DLPA 4GEKA 1JWLA 1VRWA 1Z4JA 2IYTA 4D4MA 3BEDA 4XJXA 2HFKA 2EIXA 1I1OA 3RE1A 1E58A 2FKAA 2H31A 3L8ZA 4KTVE 1U3DA 4XIJA 1GCIA 1U99A 2B4AA 4NVRA 3HO1A 4HD8A 2G5CA 4H59A 1XJ5A 2XCQA 1SIWA 2H5LA 3DF7A 3G8AA 4RGQA 5KIAA 3L40A 1ITZA 3AL0C 2FE4A 1O03A 4D3XA 2VTEA 4NYIQ 1KR5A 1XRQA 4NQRA 2B2CA 3KXPA 5KOJB 2ICAA 3Q9UA 1BVHA 3S2FA 3VX3A 4AS3A 5C8VA 1W52X 4B6EA 3FJ1A 3W3AH 3V34A 3GGSA 1KEVA 4V0QA 3VZSA 5LB2A 3DCYA 4UNPA 1XUOA 1DAIA 2H1FA 4KN8A 1OC2A 5KKAA 1X8XA 3PCTA 4XVUA 1EDDA 1YRAA 3NDRA 4G5SA 1XU7A 3N6RA 4GWLA 4Q1FA 4YO7A 5LBIA 4LRTB 5EJ4A 4OI1A 3Q8MA 3FWNA 4JEHA 2SKEA 4OK3A 4JENA 3FOFC 1ODIA 4P83A 1C9YA 4W5TA 4MSUA 3CF2A 1F0YA 1FVFA 1NVVQ 3NH9A 3ODPA 3C3PA 4I8XA 1UJ2A 4AZ3B 3EIUA 4K9QA 4ED9A 4N8DA 1QP8A 3PIRA 2OY0A 4CMJA 5AOAA 3MW8A 1ZK2A 3PCXA 1TCBA 4BUCA 1VA4A 3A4VA 4IXMA 4JLSA 2VQSA 4QNMA 2PSFA 4M6WB 3LL4A 4QELA 1AF4A 4R83A 4UM7A 2XNSA 3A06A 4QOHA 2PE5A 7MDHA 4Q4AA 2QSZA 3OWOA 2IYXA 3AK4A 3HYNA 4AQDA 3EQ2A 3MAGA 3U3DA 1EVIA 3BRWD 1H8HA 1KJNA 4B43A 3E9YA 4QA9A 1WETA 1BN7A 4WESA 3TOVA 2HW8A 5SICE 1QC5B 3SYKA 4UU7A 4Y6OA 1V8BA 2EOAA 3AFNA 3FCAA 1QH9A 4OLFA 5CX1A 5HXAA 3K09A 2C4UA 4Z9BA 2ODEA 4FD2A 4F93B 4MPTA 4P2BA 1OLUA 2FEMA 3ROKA 3P0IA 2ZKIA 2QV0A 4MAFA 3AVOA 3LS2A 3U4QB 2CMHA 2VWHA 3G2JA 4MRAA 1C81A 2W4QA 3PD1A 4RNDB 5J4KA 1CZUA 3MUEA 4MRVA 2ZRHA 1A9XB 3SYNA 1Z8FA 4KN9S 2BHSA 4L3WA 4P33A 3SEQA 1K7EB 3HU2A 4IRXA 3RHTA 1C7RA 4CTMA 3K1AB 2Q21A 4I3FA 5ALLA 3CZCA 3Q3HA 3WWZA 3ZU4A 1XTPA 2HQRA 1P5JA 2XPCA 1G19A 2DQSA 2J32A 1DT5A 1E1KA 2P67A 3PFBA 4EF4A 1IZ9A 2CLDX 3UMCA 2I2BA 2ZREA 1X1AA 1P1BA 3HYLA 4UZEA 6Q21A 1CNEA 2DX7A 1P2FA 2IPMA 3ZS9A 2C5LA 4JZYA 3RREA 4MJ3A 4M0CA 5EWJB 3MB5A 1JMYA 1Q0UA 2GHQA 3N8DA 4FINA 4B2IA 4ZOEA 5DBGA 1WCXA 1GL3A 2A9JA 1ECGA 5CEEA 1XAGA 3CJTA 5HKBA 4Z0NA 3HBMA 3ZCTA 1C8KA 1MB3A 3MQFA 1LD3A 1DBQA 1GOTA 5SY6A 1M83A 3MJEA 1QQBA 1R3DA 3S29A 4U6SA 4XW2A 2LVBA 1X74A 1WCYA 1KXZA 3GRPA 4QX6A 4D43A 3CWCA 3EQ9A 3VTAA 1JIIA 3W6ZA 1CHDA 3EDCA 4R51A 1YONA 3IQXA 3MJVA 3MRVA 3QUBA 4H35A 4PLWA 3TGPA 2IYQA 4FFPA 2GS9A 3HUFA 1AGRA 1B1AA 2FUKA 3NXKA 3E22B 5J47A 1UPXA 1BYIA 1GTMA 2B78A 3SU8A 1U90A 1EBUA 1H42A 1N25A 1V1RA 1X9IA 2NXCA 3FBGA 3IX7A 5DT9A 3VXKA 4DWJA 4AZ3A 1OIWA 2PZJA 3QPWA 1AHHA 4TLCA 5CIWA 4S1OA 2FFBA 5LMZA 1GGKA 4ZJPA 3L1KA 4ZKDA 1X3LA 3VPBA 2IS1A 4EW6A 1UJNA 1DDOA 1XZFA 4H0CA 3KOMA 1CUEA 1YB7A 1B2LA 1L4FA 6LDHA 4QOGA 1US8B 2G7MC 3U4IA 2X0DA 4YMGA 3HXQA 2CDCA 2FQXA 2MTBA 3D4OA 4OA8A 3DG9A 4OJKA 4YRJA 3MTDA 1S8FA 3EA4A 6YASA 1V2HE 3IP5A 1MG5A 2PY6A 3NC4A 4G0YA 4CM6A 5D51S 4EIWA 3EGWA 1VMKA 2O2SA 3F67A 3OJWA 2I2FA 3DWGA 2Y2VA 4JD5A 4OO3A 4AMUA 2VP4A 3MMSA 2ZQ5A 3TRDA 3L43A 4BMYA 4OHPA 1YE8A 2F64A 4Q4LA 4RK1A 5FUWA 1NW7A 5I9TA 4X1YB 3SFZA 5HJ2A 1PFVA 1E1LA 3TNYA 4HSGA 5DIZA 1CY2A 4ZAWA 2ORED 3IPRA 3RS4A 3X2SA 3LUGA 3OQIB 3DE7X 2F9LA 3CRZA 3IB6A 2I3AA 2VAVA 4ZCLA 5ITWA 4KR7A 3KBOA 3Q7SA 1OTHA 3OC0A 1DC6A 2I2AA 3KYDA 4UATA 5A4DA 1V96A 4IDDA 4QDUA 5DV9A 1PJ8A 3A1FA 3INTA 4LECA 4PO8A 3CUKA 1TVKA 1XROA 1KP3A 1ADCA 3OZTA 4CFYA 5BR1A 3ZS8A 2MSNA 4O4JB 2XNKA 4QQ8A 1K7XB 3BCHA 4M86A 4HN9A 5AFSA 1RJ9A 3ASZA 5LR6A 1XFDA 5BNIA 1C7QA 1CY0A 1ORDA 1GXSA 1UP7A 4R1QA 5DGHA 1P6XA 4YHHB 4RTNA 1RYMA 4IV0A 4LXHA 2JK0A 2M9MA 3D3JA 1G3MA 3M4ZA 4MRMA 3DS8A 1H2ZA 4RD3A 4FEGA 4ZEXA 2IU0A 3UZUA 5B7GA 4BFZA 1HUQA 2X4GA 3C39A 1H05A 4I2NA 2KBFA 1GTSA 1KIFA 3EFHA 4WXYB 5JHGB 1AMOA 5CA1F 3KEQA 3EQ8A 3UQYS 3NVAA 5L53A 4RF5A 2WD7B 1EGVB 4JCCA 1BMTA 2LCFA 3IV6A 5K0BA 3MCZA 4DV4B 1FJXA 3ENWA 3H3XA 4HFNA 5BV2P 1NVWQ 1HYEA 2ZRQA 3DDWA 4Q24A 3KC2A 4Y6QA 4NENB 3K72B 3AC0A 5HEKA 3BULA 1JVSA 4I0WB 4PBRA 4EI2A 4BX8A 3D31A 3L7KA 3O95A 3RHZA 3S7ZA 2EZUA 3E81A 2VNSA 1EFLA 3KQKA 1PR4A 4WZ6A 1EFRA 2J5BA 1G8KA 4TMYA 4DREA 5JXIA 4MINA 1J5PA 2RG7A 1Z25A 5HRCA 4OXKA 5E4FA 4B2YA 5I5EA 3ORSA 3CLSD 2XRMA 1NW3A 1TKAA 3HCOA 1G5HA 3SJAA 3T4EA 4D99A 4UW9A 4C30A 1Z4LA 1X0VA 1DU4A 2HYDA 2A9VA 1MH9A 1EG7A 1V8FA 4MWGA 2JCXA 2YJGA 3EZYA 3NOVA 3QXGA 4RLSA 1VXRA 3HTXA 3ZOKA 2KSQA 4P3XA 4FXPA 4PLGA 4BZQA 4FONA 4O33A 4HDSB 5CM9C 3ABZA 3UC5A 1YZFA 4IH1A 1RABA 1US8A 3I5MA 3ET5A 4UU8A 4YDSA 2PT7A 4GP6A 2UZ1B 3NTQA 2OV4A 3EXFA 4I6EA 5F4BA 3SXUB 2PAFA 4BPRA 2X5JO 5FTLA 1OH6A 2CFRA 3R09A 4HH0A 2PKCA 1SC1A 2C4NA 3L84A 5BVHB 3DOHA 4GX0A 1UF9A 1A27A 1NOJA 2F4NA 2BZSA 3AHJA 4KW7A 1CVIA 3B8HA 3UJ3X 3B7PA 3EIWA 4FFNA 2WWTA 4M0UA 3DYIA 2P40A 1ZMRA 4O4HA 4L07A 4MDYA 2RK4A 2JIRA 4YGXB 4F4DA 3GEGA 4UHJA 4NEHB 3SM9A 1UIRA 3VC1A 1P19A 2HM7A 3DMDA 3OLYA 2VRBA 4TL7A 1IN8A 1LDMA 4Y2HA 3E3MA 1KYTA 4DCSA 5JRDS 1HYGA 5L8VA 1ZCBA 1MR3F 2OAEA 5FUYA 4RVFA 5ECDA 1RLIA 3G9QA 1AQNA 6CHYA 1XVTA 2F3RA 1EH5A 2MIIA 1LSSA 1ZMBA 2HNAA 3BIWA 1SD1A 3LFTA 2Q2OA 3LYLA 3MQ4A 5BQPA 5DOZA 2EG9A 2EKDA 2P75A 1T6YA 1FQWA 1RXVA 3DUFB 3SLRA 2F3TA 4OXYA 3ZZUA 2VNHA 2C9DA 3IBSA 4C4XA 1GA4A 2WJ3A 1LDBA 1XMVA 3H5VA 4KZKA 4XRRA 4M1KA 4W6QA 3KSUA 2X4DA 3JXEA 5KNBH 5FUMA 2R4TA 3E5RA 5L95A 1GPJA 3QU5A 2C1ZA 4RZHA 4C20A 1ZEMA 1V3VA 1NPDA 1EXWA 1L8QA 2QUJA 2UUPA 4AG6A 2IBTA 2AFHA 3RFFA 5IVKA 1C0KA 4IBOA 3PX3A 4N8SA 1Y6GA 3PR1A 1IYZA 4N5HX 4MJ7A 2BIFA 3K20A 2JIDA 4IMIB 4TV9B 5HPYB 3B12A 4BBJA 1LBTA 3IAAA 4UTZA 4WOJA 1JILA 5GY7A 3BL6A 2FX2A 1IDOA 3H99A 4DLXA 4BVEA 2YHUA 4HPXB 1EB9A 1WEHA 2NLOA 2C8LA 4YCLA 2C57A 1ZCJA 2J5QA 1RQXA 2EATA 4IVNA 3D3WB 1G0NA 2J3JA 4I3GA 4EZEA 1I2AA 2Q29A 3CM0A 5AKZA 3V1YA 4D80A 5DI9A 3CMCO 4DC9A 1U0TA 2RGRA 2VPIA 3C48A 4BLPA 4HB0A 1MAWA 5BNTA 1NNEA 2NXJA 3M6VA 2XGOA 3A1CA 1X3SA 3ZDBA 1U7ZA 2F1IA 1OX4B 1RLMA 3MINA 5G0TA 5JTTA 3G23A 2VBFA 1GKLA 1ZUIA 3LQ2A 2G0TA 3K73O 2B92A 3DBRB 3RV3A 5KC8A 1N8SA 3K3PA 3SIXA 2GK7A 2WLTA 2CN1A 2EDAA 1C3XA 1THZA 1XZCA 3TAXA 1DHRA 3O91A 4MYUA 4ZVMA 4GMXA 3ZGVA 2Y66A 1MIOB 5LU8A 4YV1A 2MSLA 5HF8A 4PYIA 4Z8YA 1UJMA 1E3EA 1NXTA 4HDSA 3WV5A 1I4WA 2QM0A 4RHEA 1U1CA 3JU3A 1ORVA 2FRDA 2RGWA 3DAOA 3LXXA 3TB4A 3H8VA 2Q0QA 1J21A 1NNSA 5FTWA 3RFXA 1TMGE 5KDLA 3NBXX 4FGKA 1SCKA 1ZJ5A 1Q3KA 4HRAA 4XCQA 4NHOA 1E1RA 3P27A 4UM8B 2WYWA 2XMQA 2IITA 3NIBA 1CS0B 3P0FA 5IFLA 4BKMA 3OLQA 3FCCA 5AR1A 1JGTA 2HF8A 1JSCA 3RYIB 4JXZA 3W5BA 4F85A 2NT3A 1XRSB 3DZBA 5AI9A 3PX2A 4TYYA 1QV9A 1HLGA 1DEOA 1GNVA 2BOVA 9LDBA 1Z63A 3IEVA 4OXNA 1TYZA 2V1UA 1NVFA 4RTMA 1PL6A 1QVWA 3ZKWB 3PXDA 4LI0A 2BF4A 3ANTA 4UDYX 1FS6A 4Z0TA 3ZCQA 2H18A 4LNAA 4WN3A 5AK3A 3OIWA 4UHCA 2DTDA 1W1UA 3SR4A 2D7JA 2PQ2A 3CEPB 5DYNA 1II0A 3HUUA 5C8DA 1FFDA 1QF9A 3EDMA 3CF0A 3WK8A 3ZHSA 4UTPA 1QE5A 2WVHA 1UC4B 2Z9DA 3ISVA 1KEWA 4RY8A 1QOZA 4F9EA 4L76A 3B7WA 4TLBA 4NE2A 1D6JA 2DT8A 1YTUA 2HCRA 2G9NA 2PS1A 3T7CA 1VHDA 3OJCA 3BJEA 1KARA 1Q50A 3GPLA 3M81A 3O9VA 2I1QA 5DNCA 2WI8A 1WNFA 3RS8A 2Y4NA 4A15A 4YONB 2XECA 1EK5A 2Q0XA 2R84A 2JFBA 4HNAB 2V9ZA 5LP6C 3VYTB 1RQNA 2VTDA 3VVBA 3CIFA 2HO5A 4RHTA 3RRZA 3H0CA 3KU4A 4BPBA 4MQEA 3T4UA 2H17A 1GG5A 1NBMD 4WLFA 1W36D 4X1IB 1Q5PA 2NZ8A 2RCNA 2QX4A 3GRYA 1GV1A 2Y1EA 1V3QE 2Y1DA 5AICA 4D6YA 3M5DA 3GZTB 1TCVA 3Q7IA 3TD9A 1JH8A 2X8BA 3CPHA 2DKNA 4ITUA 2MSEB 5TQ0B 1D09A 2OL4A 5FOSA 5TJHA 1GA6A 1N7GA 3GLIB 4DF3A 2ZAGA 1GGEA 2GVNA 4WPGA 2VA8A 2IPNA 2QA5A 4O8CA 5EL0A 5TF4A 1P0MA 1DELA 3RYFB 3UN1A 2FV8A 2H2HA 2XVYA 3PQ8A 4DA8A 4NCAA 1GAXA 3A58B 2V5VA 4AWBA 2ZXUA 3BE5A 2D0DA 3BAZA 3OZVA 2ZUFA 3I9KA 1PKXA 1X0XA 4LVNA 1YJXA 3P96A 2BP7B 4EUEA 4GOXA 4L73A 5BNWA 1K9VF 3T1NA 1MIOA 3B6IA 4MV1A 1MX9A 4DOMA 4XQCA 3QX7A 4TTQA 3DC7A 4LX0A 1T2CA 3SYLA 3W2TA 4G36A 4DIEA 4DSNA 2B8EA 1VGVA 2Q41A 3VKHA 3ZG6A 2PKEA 5B1YA 2H4WA 5CIQA 5G2OA 3WJ1A 3CSSA 3FNIA 2HWKA 5JCOC 3IMGA 4NMMA 3NM4A 3LWZA 1HTBA 4WSOA 2W70A 4A91A 4CIVA 4COKA 1L5OA 3QELB 2OB2A 1LJUA 2Q2NA 3FVVA 4OI2A 3DGEC 5IYZF 5LL6P 2UZIR 3IA7A 3KUDA 4KIGA 1R16A 1IY0A 2FEPA 4FLMA 4NPAA 4TV8B 1BH6A 5FA5A 2WZQA 1L3BA 4MWOA 5FPSA 1D4ZA 4C6SA 5ICSA 4N6OA 3FDIA 4CNQA 3CZRA 1Z4NA 2VJNA 1Y6ZA 4XH9B 2FUEA 3MPOA 3R0XA 4BC0A 4DA0A 4G1VA 5JMPA 2YWHA 1SQSA 2DERA 4KKXB 1E77A 1LKZA 1RWQA 3N2KA 1NP6A 3UK2A 4DTIA 3CQ9A 3RNLA 2PT5A 1E9FA 4NBKA 1V1MB 1YJCA 2G4CA 3JR7A 3QJGA 3F6EX 5G1PA 1K2VN 3C70A 1OBHA 4RTLA 4J1NA 2WTXA 2OXCA 4I55A 1CLUA 2Y1FA 2C07A 1X7ZB 2J4FA 4TMZA 1ID8A 2AIRA 3AEQB 3KJEA 4E07A 2V6FA 1VRCA 2XOKD 2C5AA 4RORA 3FBTA 3AF2A 2X9QA 2XA9A 3ESDA 3K94A 1N2SA 1XZLA 1NLUA 4FKBA 4L6CA 4LV6A 2X58A 2YMPA 1RW4A 2NU8B 2IYSA 2AZXA 5AM2A 2OG2A 3AF3A 4ND5A 3CN7A 4ODIA 4WKPA 1SVLA 3H19A 3ZE6A 5LQNA 1CETA 3UFXA 4GVXA 4MCIA 4DLLA 5AUNB 1FUIA 5DBHX 3WAGA 5T41A 3TQCA 3RVNA