3SC6A

2.65 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose reductase (rfbd) from bacillus anthracis str. ames in complex with nadp
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
281
structure length
281
Chain Sequence
KERVIITGANGQLGKQLQEELNPEEYDIYPFDKKLLDITNISQVQQVVQEIRPHIIIHCAAYTKVDQAEKERDLAYVINAIGARNVAVASQLVGAKLVYISTDYVFQGDRPEGYDEFHNPAPINIYGASKYAGEQFVKELHNKYFIVRTSWLYGKYGNNFVKTMIRLGKEREEISVVADQIGSPTYVADLNVMINKLIHTSLYGTYHVSNTGSCSWFEFAKKIFSYANMKVNVLPVSTEEFGAAAARPKYSIFQHNMLRLNGFLQMPSWEEGLERFFIETK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Bacillus anthracis dTDP-L-rhamnose-biosynthetic enzyme dTDP-4-dehydrorhamnose reductase (RfbD).
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Oxidoreductase
molecule keywords dTDP-4-dehydrorhamnose reductase
total genus 91
structure length 281
sequence length 281
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.133: dTDP-4-dehydrorhamnose reductase.
pdb deposition date 2011-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04321 RmlD_sub_bind RmlD substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3sc6A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3sc6A02
5JDIC 4TVBA 2X9VA 3RD5A 1NP3A 5EPOA 3K8ZA 3SXPA 2G17A 4FC6A 3H7AA 4FJ2A 5A03A 3TJRA 3WGOA 3SJ7A 3TZQA 1NPTO 1U28A 4XR9A 4DPLA 1YL6A 1HDRA 2BGLA 2FSSA 1UZMA 1B3RA 5JPIA 5LDHA 1EUCA 4RF5A 3AY7A 1EFLA 4MKXA 4E5MA 3OF2A 3EVNA 5DBIA 1X14A 4Q3CA 2CFCA 2WYWA 4O0LA 5DBFA 3ZW9A 4FIZA 1LA2A 5C3MA 3MOIA 1HE3A 2H1SA 3F47A 4TWRA 4WCFA 1A71A 4S1VA 4W7HA 4NJMA 1ZK3A 1BTOA 2AQIA 4NBTA 1UZNA 3M1AA 3JQ8B 4RCVA 1P1HA 1XQ1A 3Q3CA 2IYOA 4CM9A 1LLUA 3FI9A 1P77A 3R6DA 1IOLA 2WD7A 3AJRA 1VJ0A 5L4NA 2GD1O 1N2SA 3N58A 4GLOA 4RVSA 2Y99A 4YEDA 4AJIA 5ILGA 3WNQA 3PP8A 4EJ6A 4M89A 1A72A 4ZICA 2X6TA 2ILTA 1KYQA 2GUGA 3EHEA 1BG6A 3VTZA 1U4OA 3ADOA 3E8XA 3OJEA 4AJKA 3F5QA 3R3JA 3S2GA 4IDFA 1UXIA 1AHHA 2VT3A 4A26A 1F0YA 3JYQA 2P9GA 4CUKA 4IMRA 1E7WA 2X9GA 3DEYX 4DYDA 3E48A 1I2ZA 2IZ1A 2A4KA 2ET6A 3L4SO 4L76A 3L4BC 4O1MA 4FPXA 2QZZA 4UEOA 1QP8A 1MC4A 3OJ0A 5TT0A 5AYVA 3DBLA 1X1TA 2PGLA 8ADHA 1ENYA 2JCVA 3GC6A 1E7RA 3ZWAA 1PR3A 2BHLA 3D3WA 4R1SA 1YVEI 1HE2A 5KCZA 1QMGA 3JYPA 3GH3A 2Q2VA 1LEHA 1PL8A 2D5CA 2C7GA 3RUIA 1UDBA 3QA9A 5C5IA 1Q0LA 3OHSX 1PGPA 1HL3A 2C5AA 1SC6A 1DLIA 4QECA 5JAZA 2WSBA 3OEWA 1HWYA 3BXXA 4CMHA 4CM3A 3ZNNA 1SB9A 3KM0A 4WEQA 1ZK1A 3K96A 5TT1A 4I8XA 3UN1A 1QYDA 2C59A 5IAAA 3KSDO 2PNFA 3MWDB 4OHUA 4XGNA 2WE7A 2PZJA 2X0RA 2EV9A 3SEFA 3RQSA 4RL6A 2VNSA 3AM5A 2WWRA 4RPHA 4MVJP 5JAQA 2X8LA 3DOOA 3WYBA 4UUPA 4L0QA 5IZCA 4BS9A 2X0JA 5KNLA 1X0XA 3L07A 4XRGA 1PJTA 4GSKA 1HSOA 2VHWA 1Y8RB 4YTEA 3ZZNA 3OQ1A 3PYLA 4UUNA 1O95A 3I1JA 4XWYA 2BGKA 4DIFA 3KYCB 2DM6A 1KVSA 4J16A 3O03A 2HK8A 4RORA 4W9NA 2DU8A 5IJZA 1MFZA 4R51A 1HYEA 2JKVA 1TB4A 3NRCA 4O5OA 5A04A 3JQEA 1KIFA 4LCJA 3PDJA 2CVQA 1DSSG 4E2ZA 1IHYA 4NFHA 5B4VA 1GQ2A 1VJTA 3LVFO 3NDRA 4XYMA 2J5KA 4OQZA 3U4DA 4AJ2A 2P4QA 4CMIA 4BO4A 1BSVA 1SEVA 1KC3A 3GEDA 1NHGA 2J8ZA 4GSLA 1ZJYA 4D43A 3HUDA 1HLPA 3IKTA 4Q3NA 4A2CA 4NI5A 3WFIA 2EJVA 2V65A 2BFOA 2IDZA 4O6VA 3PQFA 2I76A 4I9UA 4QX6A 2D59A 4XD2A 4MDHA 1PZGA 4YQZA 3V5NA 1L7EA 3D5TA 3H6KA 3JQ7A 1HDGO 1O94A 5EERA 1LSUA 4DMLA 5GY7A 4IDCA 3X2FA 3UGKA 3U4HA 3CE6A 2VN8A 4YBZA 2UAGA 4D45A 2FY8A 4JP2A 1PL7A 4E32A 3DOJA 2WE8A 2XXJA 3HNPA 1M66A 3MOGA 3ROPA 3MJVA 3OM9A 4FQ8A 1Y8QA 4GBJA 3C1AA 1HXHA 4ILKA 2YFQA 1TT5A 3GRPA 3OQBA 1GZ3A 1E1LA 1UDAA 4BNLA 4XQGA 2YYYA 4CODB 2XPCA 3ZHYA 1BXGA 1X7GA 4YJDA 1XDWA 4CLRB 2E49A 4BB5A 1ZKMA 3QVSA 3GOHA 5COAA 4ZRNA 4NU6A 3WGZA 1DC3A 3JQAB 2DBZA 2J3HA 4UVHA 4NK4A 4BO7A 4KOAA 5U1PA 5B12A 1T1SA 4IQ8A 1R37A 5ES3A 1NTOA 4CJXA 1E5LA 1U3WA 5KVSA 1HDXA 4CM5A 1HLDA 4NK5A 3OA0A 2VWQA 4DA9A 4NPCA 6LDHA 1Q7GA 4PG6A 2WEKA 5BNFA 4B7CA 4XA8A 1Q7CA 2R2GA 3DXFA 3PK0A 2CD9A 3PGXA 4R4JA 1RJWA 4HV4A 3OH8A 3ZV5A 1MB4A 1R15A 5JMWA 2E37A 3RC2A 4JIGA 2RH8A 3OJLA 1X7HA 4EBFA 3DFUA 4FR5A 2G1UA 4MIOA 1UP4A 3DO5A 1ZMOA 4B4UA 2IEBA 4QO7A 4BB6A 3INGA 4RLHA 4J2OA 1X1EA 5CDYA 3F5SA 3NTOA 1I3NA 5JCXA 3A4VA 4TKLA 1QYXA 1DJQA 3ZWCA 2HJRA 3RUFA 1UP7A 1HF3A 1XYGA 2P4HX 2Q3EA 4HY3A 5BT9A 4F6CA 1ZFNA 2UUOA 3H3JA 1ONPA 1UUFA 3WB9A 1P45A 4LRTB 1CEQA 2O48X 3PWSA 3ITDA 1E3JA 2O2YA 5JO9A 5I7SA 2LDXA 5CEFA 4OM8A 2HQ1A 3ZHXA 4W99A 5F5NA 3HN7A 1PU2A 4MVJM 1HE5A 3ROMA 3RSHA 4R69A 4GKVA 1I3KA 3LLVA 4ZQFA 3RWBA 5A05A 3SC6A 4ND1A 1PJSA 2X23A 5DZSA 3TRIA 5JY1A 3NT2A 1VLLA 3CSDA 3LT4A 2JFFA 1GAEO 1YONA 5T5QA 4MIEA 1KERA 3CXRA 9LDBA 5JSFA 2P2SA 1O5IA 2PH5A 3AU8A 4CLOB 5KIAA 2CSUA 2CMDA 1NQOA 4F46A 4YT2A 4WEOA 4B7UA 4KUHA 1PIWA 4UUMA 1EMDA 2GZ1A 4IM7A 5MGBA 4E3ZA 1Z7BA 3ZWPA 2ZK7A 3R3SA 4L75A 4EW6A 5KKCA 4FCCA 3BHJA 1U9JA 2O2SA 3DBHB 3RROA 3VKUA 1PL6A 4DVJA 4PG7A 2YQ5A 1J4AA 3WSVA 2FN7A 2HMTA 4RVFA 1H6AA 1JU9A 1QLJA 2PWZA 4HXYA 4XEHA 3Q0EA 1E92A 1YJQA 1PJBA 1CRWG 2HUNA 2Q2WA 1N1GA 4J7CA 4IIVA 4W4TA 2O7QA 3FR8A 1GADO 2Y1CA 1HT0A 3BZUA 1N92A 1H9AA 4NQZA 1NHWA 3VZRA 3WGHA 1BXGB 2O3SA 1KY5A 1NQTA 3KYDB 3S2EA 3PHHA 4IJKA 5G0WA 4I5GA 1FK8A 1YRLA 4B8ZA 3GN2A 4INAA 5LDGA 1C0PA 1TT5B 3I9JA 3ZWNA 2QRLA 1JLLA 4OQYA 3U62A 1NFFA 1A27A 3O8QB 3E5RA 1FDVA 1LQTA 4M86A 4EUEA 1XA0A 1JKJA 2GN9A 2ZTLA 1GQYA 3IC5A 4H7PA 3FTPA 5F21A 3RBVA 4R1TA 1DAPA 5CG1A 1Z73A 4HFMA 5IXSA 2YHIB 1IL0A 3NUGA 1DIGA 4DIOA 5JE8A 1YO6A 2OHXA 4FSHA 3EZYA 1NYTA 1IPFA 2C20A 4JJFA 3TOZA 1OFGA 3NYWA 2B5VA 3U49A 3WIDA 3I5MA 2YFHA 1I30A 3Q9NA 2X1HA 4EUHA 1W6UA 3ICPA 3ZNPA 5HS6A 1CERA 1QYVA 2JD1A 1HKUA 2VCYA 4FBGA 3ZWYA 2AQKA 4UVEA 1BHSA 3BTSA 1EQ2A 1JVBA 3TFQA 2FMUA 1U1IA 1A4IA 3HDHA 3GDGA 5DBGA 1DBVO 2EF1A 2FPIA 4J4TA 4CLXA 3JQDA 2H6EA 3LT2A 2HSDA 1K0UA 3GT0A 4HNGA 2PY6A 4YWJA 1UH5A 3GGOA 3Q6IA 1PJ3A 4FDAA 4IJVA 3VH2A 1DO8A 4K6CA 1IULA 4I9NA 4R1UA 3FPCA 3BYZA 3G3EA 4ZD6A 1ADFA 1WAMA 3RIHA 4ALLA 4BMNA 4OSPA 3QWBA 1LTHR 4GI2A 3VVBA 5IN5A 3WYEA 4KZPA 3HFGA 3VZPA 1Y9AA 5JBIA 3AK4A 4DIBA 3ZN2A 3KV3O 4R41A 1AGNA 3DZKA 3OEYA 3LZ6A 4H15A 4AVYA 2J3IA 3ZU5A 3V8BA 3I9OA 2QYSA 1SOVA 4PLFA 1RM5A 1XU9A 4OMUA 4XQCA 4MVJE 2QX7A 1YBVA 4RDHA 1FJHA 4OH1A 1CJCA 1X13A 3IAHA 3VC7A 4CUZA 3C7DB 3RCBA 4RDIA 3F9IA 3KLMX 5F1KA 4NG5A 4BO9A 4PRKA 5CDTA 3GG2A 1RM3A 1HRDA 4J1NA 1JWAB 1UDCA 3ZCXA 3DZIA 1NQAO 5IZCC 1KC1A 3DZHA 5K6AA 2OL4A 4IZHA 2O4CA 4IUYA 3QE3A 5JW6A 4CV0A 2O23A 1I24A 4J43A 3GZNB 4DMMA 3ETGA 2IZ0A 4PG5A 1I01A 3KVOA 2DUWA 3MJSA 3UICA 4YAIA 1LSJA 1ZSYA 4IY1A 1KEUA 2GN8A 2BMAA 3Q1LA 1MXHA 4CQMA 1V3UA 5L9AA 1C1XB 2VHZA 3I9KA 5L7WA 2E48A 2QHXA 3GR6A 4OOFA 3IJRA 3ADPA 2WDZA 3UW3A 5C7LO 3FNHA 3EZLA 1ZK4A 3TQHA 3WTCA 4EITA 3AY3A 4HUJA 3G49A 3DZJA 3GEGA 5CDGA 4C4OA 4U6QA 4RV9A 4OL9A 4XDZA 3TL2A 2YQ4A 2AG8A 2X58A 3GZNA 5DF1A 2PFGA 1U3UA 1G1AA 3W6ZA 3JQGB 1GCOA 3L6EA 1T4DA 1MA0A 1GZ4A 2PKQP 3H3FA 4AJPA 3AW9A 1JTVA 3L6DA 2HMWA 4FFRA 2QZ9A 2GERA 3HDYA 3LC7O 5JC1A 4E6PA 3IS3A 4QFCA 7MDHA 3GK3A 2OFPA 3PJGA 2BH9A 2ZB7A 1GFSA 2B4TO 4DLLA 2H63A 2OO5A 1N7GA 2PV7A 4RQUA 2EIHA 4LVCA 4MINA 2O4UX 4WLEA 1PJQA 5JS6A 2YUTA 3K2BA 3KO8A 4GQAA 5ER6A 1KVQA 3CPSA 3DZBA 4BGUA 3V2HA 4GMGA 5DDIP 4C7JA 4ND3A 1DHRA 2GZ2A 1M75A 3VPSA 3GVPA 4PVDA 4FGWA 2I5PO 4NR0A 4NZ9A 4ZRMA 3H9UA 1KY4A 1I36A 3D4OA 2DUUA 5T67A 3FN4A 1LLQA 5IG2A 2Q1UA 1U3VA 2B4QA 5KOIA 3U4CA 3ZU2A 2IXAA 4BMSA 2PGJA 4QEDA 2VRCA 1Q0HA 4G5HA 4B3JA 3JYOA 1J49A 3GGPA 2AE2A 3A06A 2HDHA 3LYLA 3RBXA 5TX7A 4Q39A 4YB8A 4ESOA 3NEPX 4PRLA 3ROQA 5DP2A 4MJLA 1MX3A 2DBQA 3B1KA 4MP3A 2VUSA 5DCUA 1FDUA 4YT8A 5KKAA 1M6WA 2GZ3A 5HWSA 4BNYA 3GAFA 4FOOA 2AG5A 4IS2A 4QXMA 5L3ZA 1LDNA 2EEZA 3NTQA 5KJEA 3T7CA 5I9MA 1C0KA 2Y66A 1ORRA 4AJHA 1N5DA 2Y1EA 5DOVA 1KEPA 2W98A 5FYDA 5TS3A 2AMFA 1Z75A 2IYPA 3JQBA 4IZIA 1NFRA 1EBFA 4FOSA 1V35A 1A7AA 3B70A 3O4RA 1DC6A 1T4BA 4TROA 4NU5A 1RKXA 3D4NA 3RU7A 3HHPA 4JJGA 3GY0A 3WBFA 2PD6A 4LMPA 1XU7A 2Z5LA 3P19A 2O50A 3Q2KA 1NQ5A 4W6ZA 5ENVA 2VOEA 1M6HA 3DTTA 4RZIA 4BNMA 9LDTA 4PLYA 1AUPA 3V1UA 1DIAA 1B7GO 1E3IA 1CWUA 1R12A 1FF9A 1ZEMA 3IOYA 4BO0A 1T26A 3WX0A 3ANMA 3PLNA 3OJFA 2EJWA 4AJEA 1PTJA 5JNLA 5JCJA 3O8QA 1LXCA 1AN9A 3H65A 3PFWO 5HM8A 2OBNA 2O7SA 3W8EA 3ZWMA 2YV3A 4ALMA 5FF9A 1LDBA 1BW9A 4BO6A 2HAEA 4URFA 5BSHA 4JGBA 2VTDA 4XRRA 2G82A 2J3KA 3ZI0A 4UREA 1UXHA 1LLCA 2X7HA 1Y7TA 2BF7A 3GHYA 3TWOA 4E4YA 3JD4A 1EQUA 2A35A 1ID1A 5H81A 4E2YA 4WNCA 5FI3A 3TL3A 1Z45A 2ZYAA 5HA5A 1DB3A 1K2WA 1ZBQA 3WXBA 1IYZA 1WZEA 2PZLA 3WMXA 3JQCA 3DZGA 4YXFA 3K31A 1ARZA 4JN6B 4JROA 3HB4X 3WICA 1WXDA 3G1UA 3ZWOA 2ZKLA 2ZYDA 5CEEA 1ZVMA 1B8UA 2D2IA 1MG5A 4K9DA 3VH3A 2VWPA 2BFMA 4AL4A 3RJ5A 2VOJA 3MJEA 4ALNA 1DFIA 3IIEA 1ZUD1 3DWFA 1Z6ZA 4TSKA 4WLVA 3ETEA 2GNAA 4TVOA 2I65A 4P8RA 4AJOA 4MVJF 1PZHA 3EYWA 4OAQA 4YAJA 3IKVA 4PIVA 4BNKA 3NX4A 1CDOA 3PEFA 4WGGA 4Y9DA 1NPYA 3JSAA 3PJDA 2H5LA 4HBGA 1CQJA 5CPBA 1RM0A 4FW8A 4A7PA 2CF5A 1K6IA 3GQVA 4N18A 2WYVA 3ONFA 4TZKA 1YB4A 1VSVA 1IZ0A 1I3LA 1GYPA 5K9ZA 2NM0A 1YL7A 2CDBA 3B1FA 3DDNA 2VYVD 2OP1A 3A28A 4R9SA 4WPGA 2IODA 1C3VA 1EDZA 4Q3EA 1T1RA 2ZTMA 1LDEA 3C1TA 3O26A 3GLQA 5MDHA 3PVZA 4HFJA 1WZIA 2VT2A 4M49A 3NT5A 1E3LA 1ZJZA 3QWHA 4EGFA 3OIDA 5KJFA 1YOVA 5TRTA 1WWKA 2EP7A 4KDFA 3RUDA 4XR4A 1GPDG 3OMLA 2G5CA 3SLKA 2AE1A 3T4EA 3JD3A 4DC0A 5JAIA 3VPXA 3H9QA 1QV6A 2B83A 3GNQA 4PG8A 1B3BA 1E0DA 4ZQBA 4CLRA 1WDLA 3U3XA 1RYDA 3UH1A 4AJJA 2FWMX 3BHMA 2YHIA 4MVJD 1GL3A 4OGWA 1MFPA 4GGPA 2Y1DA 3TDKA 5L53A 3H8VA 4QSMA 4E5KA 3F6YA 1S7CA 1GV1A 2J5RA 4N5LA 2NACA 4N7RA 3WQSB 2NVUB 4CM6A 2HMSA 2NWQA 3I9LA 3DAFA 4NDNE 2FRDA 2I99A 1X7DA 2HK7A 5CHEA 3JQGA 2G0TA 2PKQO 2VZ9A 1PQPA 1BVRA 5EINA 1LNQA 5GZ1A 3D3EA 2G76A 5TNXA 2VRBA 1F8FA 5L4LA 4E30A 3D1LA 3EW7A 1ULSA 3GUYA 4KDEA 1ADBA 2Q46A 4Y8VA 4WECA 3FNGA 2O3JA 3RJ9A 1SCUA 1R66A 1CYDA 2A9FA 2EGGA 3CIFA 1LX6A 3P2OA 4PVCA 3DFZA 4EI2A 1O6ZA 2C2YA 3QWFA 4HP8A 1YWGO 1LRJA 1KVTA 4WCDA 4UVDA 2NQTA 1UZLA 2E6UX 3X2EA 3LF2A 3PJFA 1YQXA 1T2CA 1EVJA 3QJ5A 1HDZA 5I7FA 3HSKA 2NU8A 1SZJG 4S3MA 3VAZA 4XYGA 4KQWA 4CMEA 4TKMA 4CLDA 1NM5A 5A9RA 4CLOA 1IPEA 1ADGA 3KYCA 4GL4A 4JJIA 5A9SB 1EVYA 1D1TA 1I3MA 4I08A 5HTOA 3H9EO 1E3SA 2YV1A 4XIJA 2Y0CA 4QQRA 5KJCA 4M55A 5T8KC 3AUUA 2D4AA 4GX0A 2CF6A 3WOHA 4ALIA 1YXMA 4EDFA 4WOKA 3F1KA 1AXEA 1Z82A 3TZHA 1LLDA 3DAPA 2B37A 3E5MA 4RF3A 3TPCA 2WD8A 2Z1MA 4E2XA 3VHRA 4CM7A 4P38A 3RC1A 5GZ3A 5L45A 3WWYA 4XYLA 2OORA 3QVTA 2ZATA 1YJ8A 6ADHA 2Q4BA 4RJTA 1BDBA 4O59O 1NBOA 4B4WA 2E82A 4MKZA 2OOSA 3KRTA 2ZCUA 4B3IA 4XB2A 2EKLA 2DC1A 4XX0A 1D8AA 3QRWA 4EEZA 3GFGA 1HETA 4J1TA 2EWMA 4BNJA 5CDUA 1DOHA 4KQXA 3JQ8A 5C7IO 5C37A 2FR8A 2AEJA 4IDEA 3A9WA 4Z0PA 2Y0DA 2Q50A 3KETA 1ZW1A 2BFAA 3JQFC 5KVQA 1T2EA 4A03A 3U4IA 1XLTA 1NR1A 2GYYA 3U09A 3JD1A 4XIYA 3RUEA 2J6IA 4BNFA 4XGKA 5JCJD 3ZWWA 1WDKA 2VYVA 3K73O 4LCEA 1V9LA 4CQLA 2JJYA 1F8GA 2JCXA 5G0TA 2X5JO 3ZU3A 1H93A 2HMVA 4IQ0A 1E77A 5FEUA 1EVIA 4IQGA 1OC4A 3OIGA 1D7OA 5AXAA 2NTNA 3LF1A 4OO3A 1WVGA 4BKOA 5JAMA 5FFFA 4X54A 1SPXA 3TSCA 5A4DA 1V3VA 4EEXA 1V6AA 1GV0A 2D1YA 4BUCA 5CPFA 5I7VA 3E1KA 4N54A 1I32A 1HDYA 1UP6A 2B36A 2PD3A 4RF4A 4WLFA 4PLWA 2ZJ0A 3DHEA 3NGLA 4UVIA 4M87A 2F1KA 3AOEC 3NT4A 3RC9A 2ZTVA 3F1LA 1MUUA 1DEHA 3ASUA 5DN9A 1ZZEA 3EUWA 4RPKA 4WASA 3ULKA 3I9MA 4BNVA 5F1OA 3AI2A 1OMOA 4PFJA 4II2A 4JX8A 5IDQA 2FR0A 3QQPA 3SC4A 1KS9A 3QIVA 3QWIA 5J23A 1OZAA 1YL5A 1UJMA 5TC4A 4UEKA 4J4HA 3PJEA 4TZTA 2A94A 3C7AA 2P9EA 4HFNA 4U8GA 3PDUA 3UF0A 3UAGA 4BNWA 1ENZA 3G17A 1Y9EA 2VRCD 2QRJA 1PSDA 4XYBA 3E03A 4R01A 1RM4A 3QLJA 5EL0A 4WCFC 1I10A 3OBBA 4IDDA 1EDOA 4NFSA 2V6GA 1LC3A 4BNXA 3C8MA 3PWKA 4NBVA 3KEQA 3ZNOA 4XB1A 4BV8A 2BI7A 2X5KO 2Y0EA 3PHIA 3DB2A 4JNKA 1P1IA 3ZWXA 1Y6JA 3RFXA 1XGKA 5BNTA 3S55A 3GRKA 1MGOA 5I8WA 3VH4A 1Q1NA 3KB6A 2P5UA 1JW9B 1A7KA 1OAAA 5L51A 4L4XA 1NNUA 3FWNA 4HWKA 2I66A 4J1SA 5IZ4A 4XCVA 1V0JA 3DBRB 4CR6A 4AICA 4ND4A 2NVBA 3GGGA 4LRSB 1RYEA 3I52A 4WE3A 3L9WA 4PGFA 3BMCA 3DBVO 4BL5A 4KP7A 2BRUA 1G6KA 3GNTA 1EEHA 2JD0A 1LDMA 2C2XA 4U0JA 2JAHA 1CIVA 2DVMA 1R4NA 1KVRA 3GAZA 1ZCJA 3ENKA 3WSWA 5I9NA 2Q2QA 4G2NA 3DBRA 5IXYA 4A27A 4KTVE 3CKYA 4H16A 3TZCA 1VKNA 4O63O 1F12A 2BGMA 1ISFA 2AEFA 3ZGYA 4YAGA 1ZH8A 3LC1O 1UXKA 1LDYA 3EGOA 3P7MA 3ITKA 4YJFB 5EJ2A 4RQTA 1BVUA 1QKIA 2JD2A 5HBRA 2R00C 3C7CB 4WLNA 2C07A 4BNNA 2WM3A 3WS7A 1P1KA 3BTOA 1DIBA 1DC5A 1GZ6A 2FSVA 3KYBA 1ISGA 2Q99A 1PGNA 1Q2XA 1Y5RA 5F3RA 3B1JA 4D44A 1P33A 3JQAA 1JVSA 3UOGA 1YH3A 4DLBA 4RZHA 3JQFA 1XQ6A 1ISHA 4Q3BA 1HZJA 3VOSA 4MKRA 4DUPA 2AXQA 3FTNA 2X0IA 3JYNA 4RPLA 5DULA 1A4UA 2P68A 3D3WB 1H9BA 5ENDA 4WUVA 2CVZA 1XR3A 2IE0A 4DQXA 2RBEA 3D7LA 5IDWA 4IS3A 1XWFA 1E7QA 4ZVVA 1LBEA 1E1NA 3OP4A 1P3DA 4ROSA 3PIIA 1S6YA 4E5NA 4BQPA 4YJHB 2OP0A 3FSRA 1NPDA 2RIRA 3FPLA 2O3TA 4J0EA 4MVJH 2NVWA 4TMFA 5IDYA 1PZFA 1IB6A 5A5EA 1YKFA 4IINA 1E3EA 4CL8A 2AHRA 2DTEA 3FHLA 4OKNA 1DRVA 4L74A 4TQGA 4MOWA 2NU9A 1ISJA 4DC1A 3SX2A 2YV2A 4IDAA 2Z1NA 4BKUA 3K2EA 5CEJA 4U6SA 5DT9A 3INTA 3UFXA 3IQDB 3G1TA 1XHLA 3WBBA 1VL6A 5JYDA 1N9GB 1B0AA 2DPGA 5K6AC 3TNLA 3LK7A 3W4KA 2HRZA 3GA0A 1NAHA 2VNAA 2XF8A 3FBGA 4LK3A 1X15A 1KBZA 1VSUA 3AUAA 3GMSA 3GVXA 4D42A 2R6JA 4BNUA 4CQMD 3BAZA 4IGEA 1ISMA 3AUTA 4GX5A 1B15A 1P1JA 3HDQA 3H5NA 3PQDA 3RU9A 3MJ4A 2OUIA 4BO2A 2P91A 4K28A 1EUDA 1U7TA 1V8BA 1SAYA 1YGYA 4E5PA 4OJNA 1W8DA 2RAFA 4GX1A 1E7YA 3COSA 4OKIA 2DT5A 3RC7A 4QTZA 1EE9A 5B1YA 4CR8A 1TT7A 1VM6A 3VZQA 5AVOA 3Q2IA 4H3VA 1U4SA 4DQUA 1XSEA 1JDJA 1NAIA 4Z3KA 1HTBA 3LU1A 4CM1A 5TQVA 3PYXA 5AXBA 3KXDA 3ZV6A 5G0VA 1OOEA 1I8TA 3CUKA 3GZ4A 4KWHA 4ND2A 5G4LA 5CAEA 3MEQA 2AEMA 3AFNA 2Y1FA 3T7EA 1Z7EA 2I9PA 1R4NB 3JQ9C 4E21A 5G0SA 2OZPA 4AJNA 3S8MA 4CV1A 3OJOA 1EBUA 4ZQEA 3WJAA 2GPTA 2D0IA 4ID9A 1WPQA 1E3WA 2EW8A 3BMCB 4FFMA 4ZGWA 4BNZA 4YYZA 4UEJA 1Q7BA 3ON5A 3PTZA 1IY8A 1W73A 3V2UA 3L4BA 1F17A 1TXGA 2TMDA 3JTMA 1EZ4A 3EVTA 1I2CA 4WK6A 4IBOA 1P9LA 4P4LA 4QUKA 4P22A 4GGOA 1N7HA 2X9NA 2VWHA 4NNJA 1ENPA 3JQ9A 4NJOA 3CMMA 3HB5X 3AY6A 4I5FA 3JQ6A 1IUKA 4YDRA 1GPJA 5KWEA 3HN2A 4TRMA 4OXKA 1LSSA 1GR0A 4YAKA 4BV9A 2EP5A 3I4CA 4CMGA 1P31A 2I6TA 2YDXA 1H6BA 3C3XA 3NJ8A 3OFSA 4FJ0A 3ZW8A 1XKQA 1R16A 3GVIA 2B35A 4MIYA 5A5FA 2NUAA 2Q45A 1VPDA 1VC2A 2NLOA 4GVLA 4ITUA 3MWEB 2IEDA 5F5LA 3NGXA 4PLPA 3LLSA 3CMCO 1W4ZA 1JKIA 1ADCA 1T2AA 4LISA 5A3JA 4GWGA 1SEPA 4IXWA 3SJUA 1NWHA 1UAYA 3NDIA 3RUHA 4IIUA 1TLTA 3WFJA 2J3JA 4CM8A 3DC2A 2PZMA 3HG7A 5BQFA 4I5EA 3VTFA 1B14A 4LW8A 3V1YA 1U5AA 3K6JA 3PHJA 3F4LA 3CZRA 3DR3A 3QY9A 3H9JA 4WCFB 4BGIA 4R9RA 3O38A 3ASVA 3QP9A 4M54A 4D0SA 3BMNA 3M2PA 3CEAA 4L9RA 5FI5A 2JHGA 1EVZA 1GUZA 1RPNA 4XQEA 5A1TA 3ORFA 3IDSA 1HYGA 3N7UA 4R68A 1OBFO 1UR5A 2FHSA 2JFHA 3W4IA 1XIVA 3W8FA 3VDRA 1EK5A 8LDHA 1H6CA 1EE2A 1M76A 1LU9A 4RLSA 3PLRA 3WDSA 4YQYA 1MC5A 2C54A 3PQEA 1ZXBA 5IF3A 3KZVA 1GUYA 1LDGA 3G0OA 3ZWVA 2CDCA 4JP3A 4D3FA 5ILOA 4CQLB 2X0NA 1GYRA 4J7XA 2BI8A 2ZCVA 5CDSA 1QR6A 4XJTA 2GF2A 4B4VA 2NADA 2NV6A 1C1DA 3ROKA 4GWKA 2UVDA 2H9IA 5EESA 1MV8A 2C5EA 1F06A 3BTVA 3ZWBA 5ADHA 1LRKA 5KVVA 3SVTA 1NWCA 2I3AA 5DOZA 3WTBA 4CM4A 2W2LD 1CETA 1D1SA 1AE1A 2QIOA 3K92A 1P44A 4OXNA 1LQUA 4LN1A 4ALKA 4BKPA 3FRJA 2FP4A 4PZDA 4W82A 2D8AA 1P1RA 2DFVA 1DRWA 3BMOB 2B69A 4ALJA 4DL9A 3BMOA 4NBUA 3DHNA 2ZJ1A 3BA1A 3TZ6A 3FD8A 1UAGA 4EJMA 5KTKA 5COBA 2GSDA 2QQ5A 5I7EA 5L40A 3Q11A 4NHEA 3T4XA 4WJZA 3AU9A 2PK3A 3EY4A 2Q1SA 1QXSA 5DCWA 1PZEA 3PGJA 4J91A 1JA9A 4M8SA 4D79A 2VUTA 3STHA 1IZ9A 4PLVA 1FMCA 2SCUA 3PWZA 1V3TA 2EKQA 2VTEA 3GN1A 4KTTE 3VDQA 1HDCA 2B0JA 2D5AA 4OSOA 2HRBA 1E6EA 3WGYA 5EQFA 5JC8A 4BVAA 4UVGA 3MZ0A 2HO5A 2CDAA 2ZB3A 4UAGA 3IL2A 4YR9A 1CQIA 1AXGA 4XQ9A 3ICCA 5K0ZA 2FPPA 3E82A 1PR9A 3TFOA 2P9CA 3SLGA 3ZHZA 5KVCA 1NVTA 2EERA 3JQAD 3G79A 3ZHBA 5ITWA 4YVFA 1FDWA 3ETDA 1SBYA 3WNVA 4MO2A 1SMKA 1Y81A 1JN0A 4DBVO 2ZYGA 5JDCC 3C1OA 3H2SA 4GPD1 1O89A 1C14A 1YS4A 4ZU3A 3S2IA 3UVEA 4DBZA 5KJ6A 2Y1GA 3RAJA 2VWGA 4EUFA 3A1NA 1T2DA 3LDHA 4WOJA 4XKJA 4IPTA 3KEOA 4UULA 4A73A 2UUPA 4GX2A 4BGEA 5IFLA 4BNTA 2CUKA 2B4RO 4YPOA 1XELA 1HE4A 4RO0A 4PLHA 3WIEA 4BO1A 3AFMA 4MP8A 1K6XA 1WMAA 4OXYA 5U9CA 1MXFA 1B16A 2WD7B 1IE3A 3ZV3A 3WQQA 4PG4A 1DHTA 1ZO8A 3GDFA 4HX5A 4NIMA 2D3TA 2DTXA 1DIHA 1QRRA 1QYCA 5A9TA 3P2YA 4CUJA 1QLHA 2DQ4A 2Y05A 4AJ1A 4CLHA 1KETA 3OETA 3H2ZA 4GLLA 5GZ6A 1YBAA 5CP8A 1QG6A 4FS3A 4OOEA 4J0FA 2PZKA 1PGJA 3OIFA 1TEHA 3ZH2A 4N5MA 4BKRA 1M67A 5T6BA 4OIMA 3QV1A 2PGDA 2IXBA 4A0SA 5DNAA 2PLAA 4Z3DA 4YT4A 1X0VA 3ZU4A 2PTGA 3OICA 4IJWA 3DQPA 4BOYA 2GASA 1T25A 4GH5A 2VYND 4BMVA 3GF4A 2DPHA 3AI1A 4Z0HO 4NBRA 3TN7A 5TF4A 3WWZA 2QYTA 1KVUA 4OYRA 4F3YA 2X5OA 1SB8A 3QVOA 3F4BA 1DRUA 3H5RA 1Y8RA 5A9SA 1L7DA 3VPFA 2W90A 4PZEA 1G0NA 2HCTA 3VZSA 1NVMB 3LT0A 4TRJA 1GEGA 4D3SA 3AM4A 1VI2A 2DFDA 1K89A 1LC0A 1YQDA 4U0KA 3PIDA 4FFPA 2ZIZA 3AUSA 4N5NA 1PQWA 5IDXA 1T2FA 4PZCA 1DC4A 5G2OA 2DTDA 2VQ3A 2O3QA 4JXKA 4WLOA 2OGUA 4UUOA 1NASA 4CMKA 1BGVA 3KSZO 4CMAA 3PYMA 2W8ZA 1XEAA 3WLEA 5HS4A 3WLFA 3WMWA 4YA6A 2C82A 2VHVA 3E6AA 3DMYA 3PHLA 1WMBA 4W9NC 4CMEC 4DWVA 3HQ4O 1P74A 2PR2A 4P4NA 2OMEA 3CINA 2O3UA 3W4JA 1PS9A 5BSEA 3PZRA 4MP6A 3IP3A 1FDTA 4NBWA 3DONA 2C7VA 3VPGA 4PLTA 2NVUA 2EXXA 2Y1OA 4YJGA 4L8VA 3PRJA 2HLPA 4KUEA 5T8KA 4DLAA 3D4PA 4LMRA 2X4GA 3RUAA 2JHFA 2F00A 4DXHA 2W2KB 1A9ZA 1WDMA 3JQBC 3OSUA 1C0IA 5G4KA 1TA4A 1VE9A 1ZK2A 1H5QA 2XAAA 3NDJA 5LC1A 4GKBA 4GMFA 3TZKA 3EAGA 4B79A 5ICMA 3GPDG 3PI7A 4CMJA 3IUPA 4J6FA 3GEMA 3ST7A 4NFYA 4YT5A 1JKFA 1JWBB 1D4FA 1YDWA 1U2DA 1ZIDA 2YJZA 3WGTA 1O8CA 4IMPA 4YJHA 4R5MA 3VVCA 2NNLD 2PD4A 3KBOA 2DBVO 2FPGA 1YB1A 3M1LA 5H83A 1BDMA 2V7PA 2YZ7A 5HRUA 1HZZA 4E13A 3U9LA 3KHUA 3HFSA 1R4MA 2JCYA 2ZB8A 1Y5MA 1ZNQO 2XXBA 3LT1A 5KJ1A 1LUAA 3D5QA 2ZB4A 1GCUA 3PZBA 4LSWA 3UCXA 4U7WA 5L7YA 2NU6A 4NJMB 3KYDA 1GUFA 1DJNA 3JCZA 4WKGA 2BKAA 3U0BA 1PWXA 1FDSA 4Z9XA 1ULUA 1C0LA 3E9QA 4ND5A 4CV2A 4FB5A 4MVJA 3DL2A 1W0CA 3L9XA 1B8PA 5U4QA 4Y6SA 4F45A 1BWSA 1ZK0A 4E2WA 1E7MA 3H9GA 3H5AA 4W7IA 5I8ZA 2QRKA 3CTMA 3WR5A 3FBTA 4YRDA 3I6QA 3KLPX 4J90A 5THKA 4BIIA 3OECA 3D64A 3R1IA 4KWIA 1E6UA 2VHYA 1DPGA 3IJPA 4HADA 1YBMA 1Y8QB 3S2FA 3WQRA 3GG9A 5GMOA 2R00A 4Z6KA 5TSDA 2RH4A 4QT0A 1UXGA 5ICSA 1WP4A 1O0SA 2DBRA 2EW2A 4JBGA 1VL8A 2VZ0A 4B4OA 3L6OO 1LJ8A 1I0ZA 2HK9A 2DKNA 4BO8A 1B2LA 1I5RA 2QW8A 3HE3A 3E18A 2LDBA 3NTRA 5TJHA 3E9NA 1E5QA 5A3VA 1PS0A 1BW9B 3PFFA 3W8DA 2GDZA 4C7KA 2UYYA 4D3DA 3W6UA 4Z0TA 4JK3A 2W2KA 3MTGA 1C1XA 4B7XA 3EDMA 3DBHA 3RFVA 3KTDA 4ONEA 2YY7A 3I83A 2PH3A 2NTJA 2Q49A 4R3WA 5LCXA 3PHGA 3MCVA 4YAEA 2CNBA 5TGDA 3BMQB 5JYEA 5FWNA 1U8XX 1EFKA 1XG5A 4Y98A 5L7TA 3FR7A 1N1EA 4MVJG 4AG3A 3WGIA 4Q9NA 3S1LA 2WMDA 3U5TA 4JBHA 2CY0A 2HJSA 4D46A 4K26A 1I33A 1HDOA 1P0CA 1K5HA 3K9QO 3BIOA 3IP1A 2EKPA 3KSUA 4RVUA 4FJ1A 1U7HA 1VJ1A 2VUUA 2AW5A 4E33A 2BLLA 1PJCA 1PEDA 3BMNB 4IXTA 3FCOA 3V1TC 2TMGA 3B20A 3HWRA 4I5DA 2NSDA 4BO3A 4RF2A 4A10A 4K6FA 3BHIA 2DAPA 3TF5A 5JLAA 2GGSA 1ONOA 5EMHA 1JAXA 3FWZA 3HADA 1LI4A 2AQ8A 3NV9A 1BMDA 5A02A 2PKRA 2VYNA 3L0DA 1TI7A 1GQQA 4DREA 1BXZA 3KUXA 3RKRA 4MPDA 4CM9D 3OA2A 4JCOA 4LSMA 3RASA 1DAOA 1CF2O 1P0FA 1O9BA 1H6DA 2XOXA 4RVHA 5JDCA 2V6BA 2ZQYA 2FZEA 1DLJA 3O9ZA 4J9VA 1AHIA 4QO8A 4E5YA 2ZTUA 3RVDA 1R4MB 1Q0QA 3ABIA 4WLUA 1N9GA 3QHAA 3QVWA 4BNHA 3DTYA 1LRLA 3B6ZA 2HKIA 3CH6A 2FOIA 3M6IA 2EG9A 4E0BA 3VH1A 1TVEA 4Y67A 4DRYA 1LSOA 3IUSA 4BKQA 1GTMA 3NJ4A 1GU7A 5G0UA 1MP0A 1WLYA 3C24A 4PCVA 5JDIA 2YHUA 4FC7A 4PLGA 1GEEA 1GDHA 1MG0A 1R6DA 1H2HA 2WJPA 5BSFA 3N74A 3EK2A 4HKTA 1Y1PA 4YJFA 5TLSA 3DMTA 2JFGA 3HZZA 3WG9A 1PWZA 2Y93A 2GCGA 2Q1WA 3RUCA 1VL0A 1YDEA 5CFZA 4R5HA 3JYLA 4L4SA 1PGOA 5AXDA 3PPIA 1OC2A 4E31A 2QG4A 3I6IA 1RWBA 2I3GA 1PJ2A 4NMHA 3GDOA 1E3WB 4DYVA 1T24A 3I3OA 1OI7A 4CR7A 2I67A 4CPDA 1GD1O 3TOXA 1ZMTA 3JQ7B 1QSGA 5T64A 5BSGA 2JAPA 4I9HA 4XYEA 4XGIA 1QYWA 5THQA 1HSZA 2C0CA 3SBOA 3F3SA 1Z74A 1ML3A 1PX0A 2V6FA 4HNHA 2VZ8A 4XZ3A 3UCEA 3AOEA 5JXWA 5B4UA 5CG2A 3EMKA 2YW9A 3I9NA 3NAQA 1EK6A 1L1FA 5G4KB 1FXSA 3GVHA 3ZV4A 3D0OA 4BGVA 3CZMA 1H2BA 1EUZA 3UHAA 4FGSA 1GY8A 2OXIA 4LVUA 1ENOA 4CQMB 3DOCA 4PLZA 3GUCA 1JAYA 1HYHA 7ADHA 4NH4A 4YRBA 3ONEA 3QW2A 3WYCA 4DPMA 4GAEA 1NXQA 2WTBA 3JD2A 4IJUA 4RGBA 1PQUA 5BR7A 1R0SA 5AOVA 3INRA 4YCAA 2WYUA 1PS8A 1PJ4A 2X86A 4EZBA 5EN4A 2EHDA 4R54A 5B4TA 4RVGA 1JQBA 1QORA 2YDYA 4MVJI 4JQCA 4RPGA 4D7AA 3M2TA 2GN4A 3ANNA 3DBLB 4II3A 3VPHA 3P5SA 1KEWA 1A5ZA 2CZCA 4DTIA 5JY6A 3GNSA 1NR7A 1ZXLA 3ZDFA 4JLWA 1BRMA 3FNEA 3K5PA 1BXKA 2BFPA 5JFOA 2NU7A 3GPIA 1E6WA 1NX6A 2GN6A 3WGQA 4ZA2A 4CV3A 3A14A 4J49A 2E4AA 4HFRA 3QWAA 4M1QA 3LSYA 1J0XO 2IRWA 4LGVA 4Y6RA 4ZHSA 1K6JA 3DHYA 2IZZA 5C7OO 4PLCA 3AM3A 1A9YA 5AXCA 1H0KA 5EQDA 1E7SA 1YQGA 4IDGA 1U2GA 3PXXA 4AJLA 5AQ1A 1KEVA 2P5YA 4J3FA 1E1MA 2AA3A 1M2WA 1NVGA 3DZFA 4KMSA 4RPJA 3W1VA 1ZEJA 3ONDA 3RFTA 3EC7A 3ZNQA 4Q3DA 3RBZA 3WJ7A 2UDPA 1D3AA 3I4FA 2Y67A 5TJ9A 3MTJA 4CM4B 3Q9UA 4L73A 3FNFA 2Y68A 3NKLA 4TRNA 1HEUA 4JBIA 4E12A 4F6LA 1K3TA 5I9LA 4BNIA 1YOVB 3JV7A 2PA3A 1DDOA 4XJSA 4Z9YA 4U5QA 2C29D 5H82A 3GMDA 5DCYA 3QVXA 2HU2A 3RI3A 1ZSNA 4FD3A 2NQ8A 1YE3A 1IHXA 3MJTA 2O3RA 4IDBA 1B8VA 3I23A 1N8KA 4CMCA 1I2BA 5L4SA 2A92A 4Q3AA 4XDYA 5A06A 2NTVA 4DGSA 5B37A 1MLDA 1UXJA 2RCYA 4J1QA 1U8FO 2FR1A 3DMTC 4CL3A 4I1IA 4FFLA 3GHHA 4D0RA 2EGHA 5JMPA 1WW8A 5IN4A 4WNIA 3HDJA 3C85A 4CLEA 2BD0A 4G81A 1J6UA 2DLDA 2W2LA 1XCBA 1ISIA 3K30A 2ZQZA 3UCFA 3V2GA 4ZQGA 3JD0A 4K1LA 4ZQHA 4TRRA 4ZN6A 4J9UE 3BMQA 1U3TA 3AWDA 1VRWA 4J4BA 3VKVA 1ONNA 4GVXA 2GR9A 2Z95A 3QSGA 4FN4A 3UXYA 1SOWA 1R0KA 1WNTA 4J7UA 1DFGA 4CM8B 1DIRA 3LQFA 1R0LA 1GYQA 1U5CA 1G0OA 2X22A 3E9MA 3KOUA 4AFNA 2BELA 3WGGA 3ENNA 3FF4A 3UKOA 3HJAA 5ER9A 2FZWA 3ANLA 2GRAA 4YJGB 3AOGA 1NFQA 1YB5A 4R16A 4YRAA 4BQRA 4Z9FA 4BO5A 1QV7A 2RHCA 2Q1TA 3R0IA 4A5OA 4D41A 4Y6PA 3IMFA 4B8WA 2RHRA 2VHXA 3GFBA 5TIIA 1E1KA 3F46A 1PGQA 2UV8A 1PJLA 2JL1A 5COQA 5F1PA 4CMBA 4CMIB 5T57A 5DP1A 5L95A 2OBYA 2CVOA 3GVCA 4EJ0A 4EYEA 1J5PA 4IGFA 2J5QA 4R1NA 1VKOA 4QFDA 2V6MA 4P4GA 5EIOA 4PN3A 1B26A 1P1FA 3MJCA 2AQHA 2B5WA 1C1DB 1ZSVA 3UUWA 4G65A 3OQ6A 4FFNA 1SNYA 2POQX 4YACA 2GLXA 1SO8A 2Q4EA 3H4VA 2W4QA 5BNIA 3L77A 4BNGA 3LC2O 3RKUA 3AI3A 2GO1A 4J2HA 1KOLA 4B3HA 4DPKA 5JO0A 4BHTA 1DFHA 1F14A 4DQVA 5ITVA 4RVDA 2HMUA 3BTUA 4R3NA 1DXYA 4FFOA 4L4RA 4ZJUA 4AJ4A 3DAGA 4KUGA 1H94A
chains in the Genus database with same CATH superfamily
1M8PA 3I3SR 2YWBA 2E4VA 3ISTA 3K8ZA 2G17A 4AY2A 5JADA 2HCRA 5A03A 1J25A 1QG2A 1W0KA 3KT0A 4MQUA 3SJ7A 2MYNA 4Q1CA 1NPTO 4Z2YA 1L5KA 3TZQA 4WKPA 3IVGA 1Z62A 3E2PA 5JZBA 2FSSA 4G4GA 5LLTA 4A23A 4BXOB 3Q6MA 2CXQA 4FMBB 4K86A 2W42A 1U7OA 1G6OA 3EVNA 2IF0A 2P8JA 5DBIA 5KMGB 3UA3A 3QG1A 4AY3A 4O0LA 3ZW9A 4YRNA 3L02A 1G4HA 4YAOA 3U4GA 3JU3A 2D5LA 3OOHA 4R7GA 2H2AA 4ICIA 4TWRA 3F47A 1W8IA 1OLUB 2IYXA 2R4TA 3ILXA 4S1VA 1I4OA 1NLUA 4Q15A 4HVLA 4K7JA 3MJFA 1E63A 3BRWA 1U6KA 4LJKA 1UZNA 2F9FA 1P1HA 1XQ1A 3Q3CA 3MAJA 5CURA 3WNZA 1Y42X 4CM9A 4ZEWA 4EG8A 4FBMA 1X2BA 4JV5B 5ALZA 2ZAOA 4X6YA 1QE3A 2WD7A 2O2CA 1QS0B 4UARA 4Z5XA 2PU7A 1GPMA 4YPVA 2ONZA 4YRKA 5J58A 5F9FA 1L9XA 5ILGA 3ZE8A 4EJ6A 2HLDD 4Q4AB 3UWDA 1P3JA 3EXEA 1NNI1 2XWJI 3FJOA 2LR0A 1DT5A 4II7A 1KYQA 4JJKA 4AKGA 1JR3E 4BLSA 4Q7MB 1GQRA 2I4IA 2W6IA 3OJEA 1Y1RA 5FUVA 1K7SN 3JARA 4P58A 4HVTA 4JASB 3F5QA 1CUZA 3R3JA 3WJ1A 3S2GA 1NMEA 2BCJQ 3A58B 1AHHA 3L82B 5EWLA 1OLOA 5J1TB 1F0YA 4MW5A 2JEOA 3QXCA 1ACLA 3HLTA 4DIDA 4X92A 1JDBB 4EUNA 5K4GA 1RU3A 3DEYX 4DYDA 4IX1A 1SCIA 5JWRA 2IZ1A 3FLEA 1PW7A 2FEOA 3FGPA 3MCZA 1II8A 5FHQA 2V45A 4MV7A 4N7MA 3DE7X 2PRJA 2D0PB 4NPHA 4JL5A 4DJTA 4EJSC 2R3SA 3I53A 2Z2IA 3NQ41 3OJ0A 4KKVA 5JQWA 2XUZA 4PY2A 1ADYA 2PGLA 5AK4A 1YQ9A 2IWHA 1SKYE 3CNBA 1C7FA 1PR3A 5LQDA 2BHLA 1WEKA 2V6JA 3TM4A 3W9BA 4QXAA 1YS6A 3RRBA 4KOEC 4J3JA 4ZC1A 3NBAA 2D5CA 2ZE7A 3SQDA 5H3HA 3DDUA 2NO6A 4ENPA 5C5IA 1IFXA 1OBVA 2IGBA 2ZBRA 4O2AB 2C5AA 3PFIA 2FPSA 1WL8A 2VDUE 2IXGA 1W76A 2EOAA 1MB2A 1KP9A 1GL9B 2QTBA 5P8WA 4ZAVA 4CM3A 4O25A 4BQOA 2SCUB 3ZNNA 2R5NA 3IR6A 3QY0A 4Z99A 1JEYA 2OCKA 1JAIA 2C59A 3HJFA 3KSDO 1KL7A 4X8MA 2QW1A 3MWDB 3FCCA 3MLAA 4BWFB 1GFZA 4DWOA 3QKRB 4QODA 5FTLA 3KJXA 4IWXA 2FXIA 4KFRA 2WE7A 1RWOA 1KKUA 2X19A 4DRXB 4IV5A 4OK3A 3DLIA 4GZ6A 1M34E 1PT5A 4MITA 4TYWA 3RVQA 1MMFB 4RPHA 1RLMA 3RRFA 1W36B 3DAHA 2X8LA 3DOOA 3A3OA 4X1KB 1HUQA 4UUPA 1FLAA 5J2TA 1J70A 4MRRA 3B53X 1G8PA 2X0JA 3CUWA 4V3BA 4ZQIA 1XK7A 3L07A 2VAVA 4I55A 4C78A 4BDTA 4AROA 1REQA 2VQFB 1I1HA 4H7IA 4Y18A 1T15A 3ZZNA 1QFMA 2GCOA 3HYNA 4JA2A 1EFPA 2B82A 3PYLA 4KW7A 4IICA 4UUNA 3RVRA 4AZ0A 5KYUB 5FNVF 2AXPA 3AETA 2BGKA 4DIFA 3AERA 1EX6A 3HO6A 5IJZA 3O03A 1E9EA 4W9NA 1U63A 3ZHOA 2IEZA 4TS1A 3JAWA 2AOUA 2MSLA 4QSHA 5EKDA 1JG2A 2ECPA 2JKVA 3AR7A 3LHIA 4WK2B 5A4FS 5KREA 1RC8A 4CXMA 1G42A 1KIFA 3BCHA 3PDJA 2G5GX 2P9BA 1L7AA 1BYIA 4J0IA 4ZAWA 3V1MA 4QPPA 4N9QA 4YS6A 5C7YA 5KUTA 1T3HA 3LVFO 3II6X 3NDRA 1YBFA 1RRCA 1VKZA 2J0UA 3NB0A 3LHFA 3NWBA 4Z7JA 1K3UB 1KYZA 3NC0C 3OLWA 4LZWA 1G63A 4OQZA 1DUIA 1EU1A 1BSVA 4EVIA 4HVCA 5KTPA 1ULBA 4MDEA 3GEDA 3HM9A 1NHGA 1DO0A 2J8ZA 3PUJA 2WWGA 1ZJYA 3NGMA 4A9AA 5EGNA 4BQSA 4LJ9A 1ZH2A 4LHYA 1HLPA 3IKTA 4B6OA 3HXMA 1T0IA 1E6LA 2PGNA 1RTTA 5AM2A 2TYSB 3BE8A 3C74A 5IT5A 5LLSA 2RGXA 4I9UA 4KI7A 5IASA 1VSQA 1US8A 2E2WA 2XI4A 4INJA 3D5TA 4F4HA 3H6KA 3IMKA 3N5CA 4CTJA 4YMLA 2ODQA 1J5XA 2AGVA 1QPGA 5EERA 5GY7A 1RYHA 4IDCA 4BN5A 3IVCA 3CE6A 4YBZA 3P71T 3HU1A 2XQGA 5KYXA 3T06B 2FY8A 3DOJA 2MSDB 5ICFA 1M66A 3H1AA 3W9SA 2MINA 3MJVA 4FQ8A 1Y8QA 5KNBA 3C1AA 2WWTA 1V5WA 4X7BA 5GWXA 5JR3A 2XRMA 1K6MA 1UDAA 2QI9F 1D2MA 2OK8A 3AR3A 2Q7DA 4XQGA 4KPYA 2ZBVA 3LCRA 3DF7A 4P4SB 3ZHYA 4CCYA 4QATA 1W25A 4M1EA 4O4HB 3FM9A 2DFTA 4UQLA 3FYUA 3EPKA 3LXXA 1R0XA 2W93A 1C8BA 1JR2A 4D9FA 4OB8A 2ANBA 2W6CX 4OGLA 5EEGA 3E5HA 3WGZA 1DC3A 1FNNA 2H9YA 2J3HA 4DR3B 3GFSA 5J9FA 4AN1A 4O2AF 2OUKA 2Q4RA 3PTLA 1Y3IA 4EQZA 2QK4A 1T1SA 1R37A 2CKDA 3GQBB 1G20E 3RTCA 2XE6A 3D4IA 4HGOA 4EHLA 5BWOA 1F8YA 3SGLA 1LV7A 3FA2A 4E7OA 4DXDA 4EUSA 1U3WA 4YN3A 2R65A 4GE0A 4UM5A 4UAJA 3VO8A 2WB2A 2P1ZA 3FF1A 1MR3F 2E7ZA 1S2DA 4U3JA 1AD2A 1YRBA 1JTEA 2CLKB 1GCIA 2EBUA 4ND8B 4PG6A 2WEKA 4MR7B 5BNFA 2OZLB 3H5WA 4IG4A 1YS2X 5TQ2A 4B7CA 4BHHB 2R2GA 2ECOA 3DXFA 3PGXA 4R4JA 1RJWA 2QTVA 3LVRE 3DKVA 1G8AA 2E37A 3RC2A 1C4OA 4JIGA 2GETA 2ZS7A 3OZCA 2NUAB 3KZKA 3PNVA 5TNXA 1BQEA 2G1UA 4DLKA 1ZMOA 2ZG6A 1RQXA 2IYFA 3EHDA 4J2OA 1X1EA 2CNDA 3F6CA 4K9OA 1C9DB 1YSCA 3NTOA 3SZRA 1QE0A 4DCCA 4HEA1 4FXOA 4QTXA 4US2R 2KPOA 5BV0A 4H3SA 3AEYA 4CHTA 5E8RA 2VVTA 1W59A 3ZWCA 4MQFB 1DQSA 5EZ6B 4M36A 3RUFA 1KEZA 4HY3A 4UE2A 1GAWA 2GEVA 1KDOA 1Z0KA 2HLHA 2PMCA 1ONPA 4B4VA 1GXSB 2FVYA 2VQEB 3R77A 1E3JA 2FW9A 1A7UA 1E89A 5I7SA 4MROA 1VYUA 3HA2A 4C6RA 1WSDA 2JZCA 3AERB 2REXB 1G4AE 1ZCFA 4UM9B 3AETB 1JVNA 1PU2A 4G6ZA 4JLMA 4MVJM 4U02A 4V03A 5BN4B 4QRIA 3D02A 4A6PA 2YC2C 3U4MA 3NBKA 3ZCVA 3LLVA 1QCZA 2HPZA 4JQYA 3SC6A 4LX0A 5K3SA 1K63A 2AH5A 3DZDA 2X23A 5EYPB 5KINB 3GBSA 3TRIA 5JY1A 4MUHA 4QBIA 4BGPA 4QA9A 3WL7A 3CXRA 1SRRA 1K06A 4UZEA 9LDBA 2CSUA 2CMDA 1OT5A 1QG0A 4F46A 4YT2A 1N2HA 3PRKE 1GARA 1XXLA 1PIWA 3CF6R 1EMDA 1T6NA 4P82A 4WW0A 5E9JA 4AYXA 4E3ZA 2D74A 3FI0A 5FCDA 1ESMA 2W8BA 2ZK7A 3R3SA 5DYNA 5K0LA 1I6KA 3CUYA 4EW6A 4JD5A 1DAMA 3BHJA 3P27A 3LL4A 2UUCB 4BRZA 5BWLA 1U9JA 2O2SA 1L6RA 3RHZA 3OX2A 3EMBA 2YQ5A 1J4AA 2VPQA 2P6UA 3WSVA 1JU9A 1K68A 1C81A 2Z2JA 1Z7YA 3Q0EA 4HXYA 3U3ZA 2AB0A 3EDQA 1YJQA 4DWJA 4IGKA 1CRWG 2Q2WA 3N59A 4TTPA 5D1HA 3ROZA 3WYDA 1GADO 2Y1CA 5LMCA 4LF9B 5IABA 1NHWA 5IVIA 1FRFS 2FUCA 3C1UA 3I30X 1P8AA 1L8OA 1BXGB 4YRTA 2EJCA 1NQTA 4RTQA 3PHHA 1OFUX 1EB9A 1KI6A 4WZZA 4CIVA 5J47A 1QAMA 1KAHA 5FPTA 4BE4A 3BERA 4B8ZA 9MHTA 2XT9A 2CNWA 1MIHA 3F98A 5TGTA 1C0PA 2C2GA 5CA1B 4EHIA 2AXEA 4JODA 1W2GA 1N8NA 2HA2A 3A3NA 4JVMA 2HYDA 1JLLA 2LVBA 2QRLA 3RS2A 5B3LA 2O19A 3E5RA 2VBGA 3ZU6A 1FDVA 3GDHA 2IOQA 4M86A 4LZOA 1XA0A 3DOUA 4H7PA 4PU0A 5F21A 5FUQA 5LPNA 2HA7A 5JCZA 1P5JA 2A5YB 3FCUB 4R1TA 4BCCA 2YHIB 3DTVB 4I1OA 4WINA 1CT9A 3W3ZB 3GUHA 3NUGA 1KTVA 5I4CA 4DIOA 3CS3A 3I0NA 4QHSA 4M88A 5JE8A 4C0QC 4ZI7B 3EZYA 4HPXB 1NYTA 4JJFA 3U49A 2X3UA 3WIDA 3NYWA 3EGXA 2X0DA 2O2JA 4OEHA 3NUZA 1XJWA 3R23A 4PAMA 1N0VC 1KOGA 3OZGA 4EI8A 3AO0B 3AHEA 3ZNPA 3FKSD 5HS6A 4KG7A 1RYZA 1CERA 1QYVA 2VCYA 1ZUHA 4S12A 4ZYTA 4UVEA 2DEUA 3TFQA 3EGEA 2H5JA 1KF0A 5CA0B 1H2AS 2YMLA 3GDGA 3HI6A 4BGDA 5DHTA 3ODPA 4J4TA 3DULA 3GB9A 3RR2A 1EXDA 1FA9A 2NUPB 3E61A 4CLXA 3LT2A 4M98A 3GT0A 3H9BA 4YHBA 4I6EA 4NENA 5DJ5A 2C5GA 4EVQA 3GD7A 1BKYA 1MQ8B 2G72A 4YWJA 2QU7A 5LM3A 3GGOA 3UHJA 2YVKA 5J3JA 5I9TA 3Q5GA 4MW6A 4Y9RA 2VTVA 4K6CA 5GONA 3STVA 1P2FA 4AAYA 2QNIA 1WLSA 4PZ0A 2V1XA 3KQVA 3ZTTA 3M6UA 4ALLA 3G3EA 3HJGA 4RHUA 4DADA 5IJAA 1TZMA 1WY5A 3K6RA 7ABPA 1WV1A 5JUWA 3NRJA 3U48A 4KAJA 1ORWA 1M5TA 3VVBA 4B33A 5IHXA 4E08A 3W06A 2EFHB 3WFZA 2PX4A 4KZPA 3EFOA 4ZCTA 3A6ZA 2H3EA 1NXSA 2ZPUA 3KZCA 3LDGA 3ZLJA 3F5MA 1AGNA 3DZKA 4AVYA 4ZZ3A 2WNSA 4IG9A 2GM5A 4ZOEA 3VR1A 1DOZA 3EARA 4OMUA 4R1QA 1FUKA 2QX7A 3OCCA 2EKDA 3HEBA 4JA0A 3EA4A 2X2FA 1SR8A 2FP3A 4OH1A 3IAHA 1VMAA 3CQ9A 4L15A 3AKDA 5JSZB 1ZONA 3C7DB 4NESA 1C4XA 5DYGA 3IPRA 2VT6A 4N4AA 2XKJE 5M5BA 4RDIA 3F9IA 3G82C 3KLMX 2QT9A 2WG2A 3D8TA 1MZVA 4YJ3B 1D2AA 3N3BC 1FDIA 4B0OA 5JQGF 4FW9A 1RM3A 1QZZA 1HRDA 1N5LA 2DETA 3ZQJA 1ODFA 1NDQA 3KD2A 3DZIA 5IZCC 4LA4A 1SUEA 2VBCA 4IUYA 3PDCA 3LDFA 2Y4NA 3QE3A 1SVNA 2AD5A 3UB2A 3D59A 1WHTA 2QROA 4QYWA 4KXQA 3EQ8A 1KYXA 1OT3A 3GZNB 5LZ5A 4DMMA 1DBPA 3DBOB 2IDMA 5HDQA 4BNDB 1IXZA 1L8LA 2BE7A 4PG5A 2JBAB 2RJNA 4ZOLB 4DUYB 3KVOA 3WE7A 4Q7KA 1QIKA 1NM5C 4HN4B 3FKQA 4QAJA 4KODA 1IN7A 4GRAA 4B87A 4D0GA 4WXMA 3MK31 1NY6A 1R8QA 1KAMA 4B6SA 1Z4NA 3Q1LA 1TCCA 4DJ5X 3TFWA 4M9ZA 3QFRA 5AJWA 5DO9A 2EBWA 5GQSA 1HPLA 2HIMA 5EP3A 4V2UA 4D9HA 4Q6BA 3KOZA 2YR0A 5C7LO 3EZLA 1JALA 3WTCA 3A9UA 5CXSA 1FBTA 1IK6A 1OXVA 3GLRA 3I76A 5F7JA 4TWIA 1X86B 4OX9Y 1BWPA 1S89A 1GRNA 3VC2A 2WMNB 3OEEA 4Z54A 5JPDA 5DTJA 5LQRA 2JIOA 2YQ4A 3ONWA 3CUVA 3DZCA 4Y0AA 3ETHA 3GZNA 5FFNA 3ZVRA 2RGUA 3ED5A 3DTVD 4P33A 1NONA 1ZINA 2HA4A 3BL6A 2WMOB 2YBDA 1GT91 2Q62A 1GCOA 2W22A 3WK6A 1H1LA 5AWFC 1YZGA 2CN1A 1FNMA 2DFKB 1LWNA 4UM7A 4YMVA 3CPEA 2VXBA 2X0EA 3B5EA 3L6DA 4EY5A 3EPPA 4AUNA 1V9CA 2K87A 2OWDA 3F5DA 1MJ5A 3LC7O 3HDYA 4I1VA 3T6KA 3ZTYA 3ZE2B 3DE2X 1XDDA 1PHRA 1H8HA 4QFCA 4P2GA 2RC6A 3PHBE 1QKJA 2OFPA 1DKPA 3PJGA 2BH9A 1F8XA 1HFKA 2B4TO 2NO7A 2OO5A 1HG1A 1N7GA 3Q15C 3DXYA 3TRKA 2HF8A 4DLLA 3QJGA 4X8LA 3LLUA 3ZCTA 3NDBB 1PJQA 1X94A 2LKCA 4WFIA 5ER6A 3B3JA 1RWMA 3CNEA 1LFAA 3UT6A 2NO0A 5J2UF 4TX1A 3UYLA 2O2XA 4C7JA 4ND3A 3OE1A 2GZ2A 1M75A 2ZS9A 4O2BB 3VPSA 2QIPA 2QTMA 1RJDA 3PNBA 4PVDA 4WIAA 1KEEB 5GM1A 4ZIRA 1G21B 1VFNA 1ZNYA 3RDPA 4O5AA 1CULC 1DEAA 2BFWA 1AKQA 1QIFA 3FDXA 4B2YA 1LPBB 4LXGA 2A3RA 5T67A 3R0JA 5E4JA 1LLQA 3JR7A 3TZLA 5IG2A 3HO8A 4C6TA 4QQFA 4R2JA 3GEPA 2ECKA 3MGGA 1Y7IA 4ZQCB 1STOA 3ZU2A 2IXAA 3MS7A 4Z1MA 2ZRMA 2FZ5A 4LG1A 1XOIA 2CVHA 2VRCA 4DSAA 2XKAA 3EQ6A 1J49A 4LHXA 3FNIA 3GGPA 3JZAA 4KBYA 4U2DA 3CGWA 2AE2A 3A06A 5CLJA 3O9VA 2YCBA 4XDHA 5TX7A 3TLAA 4C4PA 1D2GA 4I4LA 4ESOA 3B51X 1LF0A 2CXXA 3SXJA 3MTIA 1IOVA 4E15A 4MJLA 3QPWA 1J7KA 1MX3A 3I64A 1RWVA 4IDPA 2BKEA 3ND7A 5DCUA 4Y2TA 5KKAA 4I55B 3ZCQA 4C7MA 3LUHA 4PC1A 5BWBA 4I4CA 3MSCA 4HZGA 3GAFA 3EGXB 3KBBA 2HBZA 2AG5A 4QXMA 3AR2A 4OQLA 4CHGA 1J33A 5KJEA 4NYIQ 4XFKA 2Y66A 4ARAA 1ORRA 4JMPA 3EBOA 1OPRA 2FZKA 3OCYA 4ZPJA 1P6QA 3B48A 2ZYTX 4CETA 1RKVA 2KW5A 2IDJA 1AV7A 5ALTA 3UJ6A 2IYPA 3VM6A 3CG4A 1P5HA 1RQGA 2XEXA 1UZUA 2AT1A 3RHSA 3TX2A 1Z7GA 3ZZ0A 1SBIA 1V35A 4EPVA 1L3BA 4M8IA 1A7AA 4KLRA 1SOUA 1DC6A 2FSPA 4BBJA 3QI7A 1XTTA 4UU7A 4KBFA 2PCLA 2NMVA 3LYAA 4U7PB 1A9QA 2GRUA 3D4NA 3KXIA 1TMYA 1X7ZA 1ZMRA 2HDOA 1V7ZA 3HHPA 1L5QA 3GY0A 1TTQB 5F7ZA 3UFBA 1J8FA 3WBFA 3H5OA 1SXQA 1JHQA 1R5NA 2FVXA 3MELA 3JPWA 2ZIXB 2P65A 2P0YA 3E4CA 1GNVA 4WV3A 1X8JA 3DTTA 3CF4G 1VLHA 3H11A 3EEIA 3GMTA 5LUBA 3CW9A 2GVNA 1ZEMA 3JY6A 2NQ2C 3P9PA 1ORHA 1NU8A 3E35A 3I2FA 1T26A 4NS4A 4B84A 4BJ3A 3J7AC 1GTZA 3PLNA 3K0HA 1MO3A 3DNMA 5EVJA 3PQCA 4HQKA 4YLEA 1AN9A 2PX0A 1KFEB 3PFWO 3KVRA 5B58T 5HM8A 1C3JA 3THYA 3LA6A 3NFRA 4CWAA 1RQLA 3BWYA 1AQLA 3QXSA 3GPBA 5FF9A 1N0HA 2OBMA 4L27A 4IIJA 4URFA 5BSHA 4C7OB 4EKIA 2VTDA 2WHYA 3IEMA 4Y6OA 2ZJOA 1OI3A 5FPHA 2G82A 3RYTC 1QP4A 2QEQA 3MFQA 4CTNA 5G41A 1JSCA 4LOJA 1CB0A 1F4PA 4UREA 2QG6A 4CDRA 3CC8A 5INTA 1LLCA 1YIOA 3GMIA 3CLUD 4M1SA 2JEZA 2P2LA 2Y2VA 2A35A 5H81A 4ARUA 1W29A 3M5PA 1F0PA 2GKGA 4K40A 3TL3A 1DUSA 1E6MA 1BU8A 2XIJA 3EG5A 1PW5A 3DW3X 4WA8A 2M6SA 4EQ6B 1N5MA 3P2IA 1ARZA 2IW1A 2UXCB 1E4YA 2Z9CA 4IV0A 5EZYB 1TGYA 2ZKLA 1DWPA 2TS1A 5CEEA 1HR0B 2IIBA 1IN6A 3OPYI 2X77A 3H83A 1DKOA 3GH1A 3RKSA 4E5UA 3RJ5A 2VOJA 3MJEA 3T61A 4ALNA 4EOGA 1P5RA 1FTNA 1ZUD1 2APJA 2WKPA 4G01B 3UJ8A 3B5JA 3ZHCA 4AJOA 4P8RA 1PZHA 1JLHA 4OAQA 4UE6A 4BNKA 3IV9A 3M6VA 3NX4A 1CDOA 1KK2A 4IWNA 1SHKA 5EJGA 2KYRA 3AHJA 3K1TA 2H5LA 3FUTA 4HBGA 2NO4A 3D7NA 4EY4A 3EX7C 2JNWA 3PQ8A 3IYLW 1E66A 1EK0A 2BHTA 1W5AA 1AQ6A 2VHTA 4FW8A 1G5RA 2GTIA 4K6GA 2CF5A 2RHTA 2ETVA 1K6IA 3GCDA 4LYEA 4WNAB 2WY2D 4HXFB 5BW5A 4N18A 4W5OA 1S1CA 2HJWA 1CS0B 1M0WA 4EY3A 4F2HA 1ECLA 1YL7A 2A8YA 2ZEJA 4NMWA 4W1QA 2OP1A 3R09A 1T6YA 4YXWD 2XY4A 3OKPA 1MIOB 3OZWA 3BCRA 5DI3A 1UT8A 4WPGA 3L0OA 1ZITA 2P40A 5CH5A 2IODA 1C3VA 3RIEA 4F91B 4RJLA 4Q3EA 2ZTMA 1KJQA 4BFZA 4YDQA 3ZDYB 5MDHA 2Z30A 4FWTA 5DTMA 2B7CA 1HLFA 4H1UA 1DV1A 1CDZA 1SVKA 2VT2A 1YB6A 5HKAA 1E3LA 4U2KA 4WSOA 4PR3A 3T34A 3CH7A 3LW7A 1KMQA 2D3WA 4K9QA 5SZKB 1M2HA 1WWKA 4JB0A 5DGIA 3L6CA 3T3HA 5DWQA 4XR4A 1VL5A 2G5CA 2HHLA 2N1BA 3KPVA 3SLKA 4OUKX 3D0QA 1PT6A 3DCNA 3CLKA 3O4VA 1V8ZA 1K4KA 4DC0A 2D2EA 2ZI6A 4G8DA 3VPXA 1XDBA 3GNQA 1VG0B 1WDLA 1WM1A 5CLFA 1I4TD 4PYMA 4BU1A 1EJ2A 3A9VA 3UBMA 4WXEA 4XM0A 2P78A 1MIOA 4FDTA 4FFSA 1D2RA 1EK1A 1USVA 2J9YB 3K1AB 3ORSA 3AF1A 1HQCA 5G3ZA 4F3RA 3TQQA 1GLNA 3W2GA 4LXYA 5E8JA 3WWCA 3CO0S 2DYKA 2NACA 4GM0A 3KB1A 2FPPB 4P1ZA 3WQSB 4MYCA 5KQRA 3J81A 2H8KA 1UF9A 4Q03A 2NP7A 4FU0A 4GOJA 1X8KA 5JZ9A 4QJ5A 4IH9A 4NDNE 3MIIA 4OBXA 3LXRA 1X7DA 2CYCA 3JQGA 2G0TA 4L7VA 5CXUA 2FSHA 1J2YA 1F9EA 5KSOA 1II9A 1NJ1A 5CT5A 4W5RA 1LNQA 2GBPA 5LIRA 3D3EA 3KD3A 4G86A 1JXAA 1F8FA 3MT0A 1CUSA 5F2EA 3GUYA 2J9RA 4RJKA 2YC4C 5L4LA 4GKJB 4CI0B 1HMYA 4RUKA 3TK1A 3QX8A 1RRVA 2M1ZA 3L7CA 2EGGA 1RMTA 3JZIA 3GWZA 4PVCA 1LX6A 4IGIA 3K9WA 1O6ZA 3JRNA 1MTZA 1W6RA 1TRHA 2YOHA 4HP8A 4K9MA 3VHXB 3MYRA 1Q0UA 1LPSA 2A33A 3CRMA 5AOAA 1TLLA 3PEEA 3PQ4A 5I5GA 2VH5R 2I7CA 2YN0A 1T4MA 3U4QA 3LF2A 2XZOA 5C8VA 3VAAA 1SIOA 3O4HA 1T2CA 4W9RA 2XNDA 3C3AA 5I7FA 2WF8A 2PUGA 2NU8A 2QD4A 5HQJA 5AUOB 4S3MA 4QWWA 1DBRA 5A9RA 1V8OA 2QSJA 4MK4A 1IPEA 3LP8A 3OZSA 4HS9A 1IY2A 5A9SB 1EVYA 1P72A 1VP9A 1J2UA 4Q4HB 4LYFA 2DMRA 5IYZF 1YTLA 1OIXA 1EFUA 1KDRA 1YQQA 3GRCA 2DR2A 2MU1A 1JIVA 3FETA 4FSDA 4N49A 2YV1A 4IIJB 4G1VA 1H0RA 1CR0A 1KK1A 1Z5NA 1ESZA 3UB3A 2DPLA 4QQRA 1T91A 5KJCA 3LQRA 5BR8B 5EJAA 5T8KC 1JHVA 1EAYA 3AUUA 3IULA 4XASA 3IQHX 4GX0A 1MEOA 2CLLB 1PWYE 1ECFA 3VNUA 2Z2XA 3OURA 3K5IA 1WCV1 2HF2A 4B76A 2WF9A 4EDFA 3R6WA 4MRMB 1CY6A 1OA1A 5LA6A 3X0DA 3GAMA 4WOKA 3F1KA 1AXEA 4TXNA 3GLIA 2F1RA 1LLDA 1CJUC 2B37A 3AKYA 3E5MA 2O8NA 2VAXA 5D86A 5IXJA 4OYYA 3PF8A 2QYOA 4TMVA 3ESBA 1J0CA 4OJTA 2WHXA 3RC1A 5B7PA 1O4WA 1XE3A 4IKOA 4Z8YA 4C5CA 3BG5A 3BT7A 1SA0B 3QVTA 3RK1A 3DFIA 2VZLA 1GRVA 2JJMA 4WMLA 3IV7A 1EFPB 4CIWA 5ESXA 1W94A 2FWRA 5AI4A 1P0IA 2H51A 3KQLA 3CF4A 2CNWD 3OM0A 4LFBB 1BE0A 1E2UA 4QUBA 2OOSA 2R8OA 5I7HA 2RH5A 3QE2A 2ZXUA 3DEFA 4ZCLA 3K0BA 1UL1X 1V6SA 3GFOA 5FTMA 3AJEA 3GOQA 4QIHA 1UWCA 2FFBA 4GOND 4DCVA 5CFNA 3GFGA 4NFLA 2JB9A 4J1TA 1DC8A 1Z07A 2WWWA 4BNJA 4E07A 5HUJA 1Z22A 3JQ8A 2AI1A 3A1CA 1L5NA 2OKGA 4C89A 5C37A 3OVMA 4UTOA 2AEJA 1IY1A 2FG5A 3LAWA 2IHJA 4IDEA 4NXNB 3IV6A 3KQTA 4F12A 4FFWA 4Z0PA 2Y0DA 3SIRA 3QX3A 4KQJA 3UGQA 3KKQA 4FX2A 3KETA 4OX9B 2D5BA 2WJWA 3P9CA 4LC1A 2QTWB 2EATA 4MPPA 1E1QA 3U4IA 4JAVC 4LHEA 3F74A 1N6NA 2FJUA 3JD1A 3OLZA 4RKFA 2WHQA 4ZPXA 5EXEA 5FHRA 3RUEA 3S6JA 3UJCA 3ZVMA 1LPAB 2O8DA 1ESNA 2REOA 1XO1A 3A26A 1TA0A 1TTPB 1Z15A 1FUYB 1VKJA 1SQGA 1WDKA 2VYVA 3K73O 1EDDA 1NZJA 2RGBA 4LCEA 3T5MA 8GPBA 1CF4A 1F8GA 1KSJA 2C00A 2F3UA 5AW2A 1Q21A 4YJ2F 4C07A 4FEYA 2HMVA 4J1TC 4MUKA 1PEAA 4IQ0A 3JWEA 2J32A 2ZUSA 3MWLA 4FMDB 4PHGA 1O9GA 1QPBA 2ZDQA 3VSBA 5E1MA 5L3SA 2JIZA 4IQGA 2XKKA 3VYTB 2AOVA 3REOA 1UEJA 3SXUB 5AXAA 3LF1A 5JWOA 2IYEA 1WZCA 1S2MA 1M2JA 1P2UA 1OHHA 2C8JA 1LPPA 1SPXA 4K6HA 1JR6A 1S2IA 2VAWA 3I8XA 3G2JA 3LUBA 1V6AA 1XZGA 3DD1A 1QS0A 5LJLA 4WZAE 3FLAA 1N2GA 3HVJA 4BUCA 2JHPA 5CPFA 4Q6WA 4N54A 5I7VA 1WIWA 3PD0A 2JPDA 1KIMA 3ONNA 3WIUA 4U2GA 4P92A 3GP5A 5AUNB 4O2BA 1IBLB 1MORA 3KJHA 4PHFA 4UBLA 4XI9A 1KWKA 1WZNA 2PQ0A 3RC9A 3SKVA 3EJWA 5K1ZA 521PA 5B36A 2XOEA 1MAVA 3O8BA 4EECA 2XJ4A 4J0HA 3L7AA 1PFYA 1TDJA 5J5VA 4BNVA 2HXGA 4ZVKA 4BECA 2QRUA 5F1OA 1NBMA 1DAIA 3N2YA 4II2A 3PG5A 3C6XA 1KJJA 3GCWA 1QP7A 1PDVA 2OY0A 5KTYA 2ZPTX 3J81k 4YY3B 1OVMA 3I8OA 1OZAA 1YL5A 1NRWA 2HWKA 5JATA 1M2OB 1UJMA 3B7PA 5C4IA 2COKA 4C0XA 5LUAA 3RRJA 2QLLA 1JQAA 3D81A 1PO7A 2P75A 2QRVA 3O82A 1S9HA 3C7AA 4K46A 1ZVVA 1AGYA 3PDUA 2B94A 1J2RA 1AGXA 5C8XA 4FNMA 5ALXA 4WBNF 1Y34E 1L3IA 1U2PA 3OIUA 3VMMA 1HK7A 4R01A 1YVDA 5HG0A 3KQSA 4LKRA 1RM4A 5IM4F 1L8XA 3ET4A 3ZE6A 1BXRA 1M8GA 1UJ5A 1XKLA 1I10A 2AMLA 3LPAA 1EDOA 4FFDA 3IDFA 4MR9A 3C87A 4NFSA 1VI6A 3TD6A 5IKMA 2G71A 1NJ8A 1OV4A 1V71A 1X1BA 3AF4A 2NXNA 3KEQA 3PNPA 4MWCA 4Y0NA 2VP3A 3ZNOA 4CTMA 2A1UB 3PHIA 4BX9A 1Z6GA 2BKUA 2JGJA 2Y0EA 2VP5A 1P1IA 2HDNB 3ZWXA 1L5WA 3HNOA 3I5UA 4MVWA 1U65A 2JH8A 1XGKA 5BNTA 1TJPB 3NP9A 1MGOA 4P86A 4QOIA 1A95A 3ER9A 4ETMA 5LMNB 2A1TR 1JW9B 5TPWA 2JK1A 1VIDA 3O3CA 4L4XA 2IU3A 3GA7A 3PC4A 1S3IA 1OX5A 1X9HA 5K09A 4XCVA 1V0JA 3NAMA 2R1TA 4TUYF 1QC5A 4EJFA 3GGGA 4LRSB 2OV8A 3I52A 4TTQA 3TKAA 3EH1A 1NBHA 3QLUA 3HU2A 3IO5A 3BMCA 4GDMA 5LR6A 3DUWA 4JUBA 5THXA 4D6YA 1JDBC 1Q3KA 4Q9LA 1IOZA 1TW3A 4EI7A 1OH7A 3ZX4A 1T2VA 3PNMA 3A1FA 3IEUA 4U0JA 2DVMA 4W5JA 4MYDA 1R4NA 4UAUA 4L6IA 1LI7A 4R0VA 2GQ0A 3WSWA 4HBZA 3M9XA 4NAUA 5IXYA 1MJFA 4HLCA 4A27A 3CKYA 4JSYA 1G64A 3E9YA 2V9CA 1RAGA 1ISFA 4YAGA 2G06A 1DTEA 2Q5OA 3WK4A 1MX9A 1OAOC 4HGPA 4KQEA 3GJSA 3PGKA 1KH2A 3TOVA 3ZD7A 1QKIA 1GTG1 1XP5A 2J0QA 2OKCA 4DANA 4QYIA 3IVAA 3C7CB 5F2KA 2VTBA 2CEKA 4AUEA 2YWDA 4BBZA 4CT5A 3E84A 3VX4A 4Z7NB 2WM3A 3LHKA 1TM5E 3OX1A 3T7SA 1GZ6A 2Q6LA 3KYBA 2Q99A 1Y5RA 4LFAB 1WCYA 4S1WA 3B1JA 4Q1BA 2ZBPA 2C9YA 3T95A 1P33A 1QO0A 2B6NA 1JVSA 3IVRA 3GFVA 5A5DA 1SRQA 3KVYA 3RSGA 4LCBA 4N9WA 3B9QA 5HZGA 1Q19A 4PC7A 4HSEA 1ISHA 1O0BA 3N0XA 3QMPA 4DUPA 2XGGA 5DULA 4E88A 4I3FA 1DKRA 5JLJA 2WWXA 3AEUB 4RZSA 4WUVA 5GTDA 3I1IA 1CRLA 1XR3A 3BPSA 1YZLA 4JOCA 4KEAA 4REQA 3R8CA 4Y1RA 3CIOA 2H4YA 5CB4B 5JSUA 4C06A 3EDYA 1E1NA 1XFAA 1P3DA 3SM9A 3QNUA 1YFKA 2IITA 1ZNWA 3HVIA 4YJHB 2OP0A 3H05A 1NJFA 2I2FA 2IV2X 2EDCA 4O4LB 4FDUA 2Y1LA 1ZM2A 5FOWA 3RYFA 4Q4JB 2O3TA 4J0EA 2NVWA 1XQXA 3CZ5A 1WB9A 4IINA 4C30A 1QGED 3ZG6A 1O94C 4K87A 2RKWA 2X8JB 4P08A 1NQUA 4N3CA 5JW6A 1XZCA 4EHHA 3L1UA 4L74A 1IG0A 4OQNA 4GEGA 4TTSA 1N6RA 1TCUA 3GJ5A 4HRYA 1AU9A 1RNLA 1SZDA 2WFZA 3SX2A 3DE5X 1VPEA 2DHRA 2JH3A 3D43A 4PQEA 4YROA 5FA8A 2Z1NA 5CD9A 3K2EA 4XW2A 5J4LA 2XCTB 2DF8A 3E3MA 4L4UA 3WK9A 5JROA 4Q00A 1UEIA 3IQDB 2I4NA 2VH2A 1TZBA 3NCTA 4L08A 1M2KA 4WFQA 4Y1RB 1XHLA 5EJ8A 1VL6A 2WAXA 1YBHA 1W85A 5K6AC 3S27A 2ZI7A 1F1BA 2QAIA 1E2DA 1E32A 2PLFA 3BGIA 5DLDA 2IV3A 3TNLA 3VHLB 1E2EA 4FILA 3W4KA 1TZKA 2HRZA 3GA0A 5K3CA 4CKCA 1SC9A 5DTQA 3G68A 4MJ7A 5C18A 1JZQA 3GEEA 1D6JA 3IUQA 3FBGA 1ORTA 1KBZA 4D42A 2C0QA 2DJIA 4JQZA 2VKTA 2F1JA 1MB9A 1S2LA 3A1UA 3BAZA 3HR8A 4CQMD 1ISMA 2G77B 4LYAA 2BH2A 5C0OE 1B15A 3H5NA 3PQDA 4YPFA 3MJ4A 1JU3A 1PT8A 3A70A 4I46A 3GUUA 4NOLA 3FTFA 2X8BA 2DULA 1EUDA 2HF9A 4BQIA 1NRJB 1NUAA 4G0UA 2OBLA 2ISSD 5TDHA 4E5PA 1W8DA 4MDYA 3Q87B 2ONKA 3IXLA 4F5YA 2RI0A 1FZQA 2HIGA 2J6CA 3QOXA 4NYJQ 3F6BX 1QC5B 1NXOA 5AVOA 3JQQA 3Q2IA 5FUYA 1YF3A 1XSEA 3OTQA 5FI1B 1NAIA 1NTRA 1NOIA 2VT7A 1HTBA 2JS7A 3LU1A 4YQEA 1I2AA 5TQVA 4TS3A 5IP5A 4CM1A 4L16A 3LP6A 3PYXA 3W34A 3VJRA 4KK4A 4KX3A 1I8TA 2X1MA 4KWHA 2QN6A 4ND2A 3T12A 1G291 1BAPA 1WCIA 3MEQA 4RFLA 3DOHA 1Z3IX 2ATVA 1R4NB 2CNLA 2OQ2A 3JQ9C 2O1XA 2QXTA 4O0MA 2J3DA 5G0SA 4BN4A 2YXLA 3KFVA 3S8MA 3GP8A 2YNMA 3WWOA 4JLVA 3C41J 1E1DA 3N05A 5JD6A 2D0IA 4GOXA 2EBHX 4BBPA 4DR7B 1I4DD 3IAM6 1AB5A 3BMCB 4FFMA 4MGKR 1JFFA 4ZGWA 1C2YA 4YYZA 4RNDB 4UEJA 1S2NA 5BNZA 1Q7BA 2B4KA 1HT3A 2WA2A 3LZDA 5J5CA 1EUQA 5ICEA 3PTZA 1W73A 3V2UA 4N1AA 1F17A 3NPAA 4KVGA 4Q21A 3OX3A 4DNPA 5H5JA 3CUSA 4PNEA 3S99A 4C4SA 1T9ZA 3JTMA 5KZMB 2B2XA 3SF0A 1UMBA 4IBOA 4P4LA 3ADBA 4QXPA 4P22A 3JALA 1U9IA 1N7HA 4MWGA 4W5QA 3JQ9A 5HM6A 3B1XA 5D6OA 3HB5X 2XVMA 1JEQB 3Q7RA 3PNKA 4I5FA 1LBIA 2ODWA 3LP5A 5C1IA 2HNKA 1DADA 4YDRA 3HBLA 1P1BA 1LSSA 1GR0A 4PQYA 3MCWA 2EP5A 3W6NA 3BRSA 2RGWA 4HGNA 4JYCA 3H18A 5I3ZA 2F9LA 1L4MA 2XNCA 3HR4A 5FJIA 3TZEA 3C3XA 1CC1S 1OCEA 4H7HA 3ZW8A 4XVUA 1A8HA 3AP2A 3R7WA 5AHKA 5LZ8A 3SQMA 1CKEA 2B35A 5J4VA 5EHZA 2NO9A 2NUAA 3LIIA 1R0WA 3DE6X 4EB0A 1VPVA 1N57A 2O2GA 3IODA 2GBGA 2RBGA 4U7HA 3UMVA 4D8UA 4I6JA 2OD9A 1PK8A 2PUBA 5F5LA 3CTPA 1F0NA 1UDXA 1AO3A 3CMCO 2FWAA 1W4ZA 1JKIA 1T2AA 1BQ4A 3KUCA 5A3JA 3TX6A 3ROFA 3KJQA 2WF6A 2RSLA 3ISVA 3IE0A 1UAYA 3NDIA 3L6BA 4IXWA 4AMBA 2Q0HA 5K3FA 1K8ZB 2E3JA 1QU3A 3WFJA 1N2IA 1Y63A 1N0WA 4XWTA 3TMYA 3ESRA 1JT2A 3P9YA 1B14A 1U4NA 1X1AA 4EO7A 1UBUS 5B3JA 1T5IA 3DO8A 2FEAA 3RE1A 2WZBA 1GN8A 1U5AA 4DA6A 3DNPA 3K6JA 3R6TA 1FFXB 3F4LA 3CZRA 4AMYA 4BX0A 4ZI7A 2IUSA 3H9JA 3UJAA 2XQKA 3P0RA 1C7QA 1ZJ6A 2JLRA 1DELA 3F5FA 3O38A 3ASVA 3R76A 2OV2A 1Y1LA 2B2CA 2BOVA 1R6AA