3SC6A

2.65 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose reductase (rfbd) from bacillus anthracis str. ames in complex with nadp
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
281
structure length
281
Chain Sequence
b'KERVIITGANGQLGKQLQEELNPEEYDIYPFDKKLLDITNISQVQQVVQEIRPHIIIHCAAYTKVDQAEKERDLAYVINAIGARNVAVASQLVGAKLVYISTDYVFQGDRPEGYDEFHNPAPINIYGASKYAGEQFVKELHNKYFIVRTSWLYGKYGNNFVKTMIRLGKEREEISVVADQIGSPTYVADLNVMINKLIHTSLYGTYHVSNTGSCSWFEFAKKIFSYANMKVNVLPVSTEEFGAAAARPKYSIFQHNMLRLNGFLQMPSWEEGLERFFIETK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dTDP-4-dehydrorhamnose reductase
publication title Structure of the Bacillus anthracis dTDP-L-rhamnose-biosynthetic enzyme dTDP-4-dehydrorhamnose reductase (RfbD).
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Oxidoreductase
total genus 91
structure length 281
sequence length 281
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.133: dTDP-4-dehydrorhamnose reductase.
pdb deposition date 2011-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04321 RmlD_sub_bind RmlD substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3sc6A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3sc6A02
4HX5A 3CMMA 4N54A 2B36A 2FOIA 3D1LA 5ER9A 4ALIA 4INAA 1DBVO 5TSDA 3GHYA 4U7WA 4MIEA 2HCTA 5I8WA 1P33A 2BFPA 2VCYA 3GA0A 1GR0A 4W9NA 4CM7A 3Q9UA 1YOVA 2PFGA 1AE1A 3LC7O 3VVCA 2BGLA 5CDGA 5C5IA 3GAFA 4I5FA 1LDBA 1V3VA 4HFRA 1P44A 4J91A 5TT0A 1IOLA 1IUKA 2YY7A 4LRSB 4F6LA 5L95A 1E1LA 3BTUA 1OI7A 2A92A 2Y1FA 1LUAA 1EFLA 1RYDA 1U3WA 3OETA 3PDUA 4IDCA 3ZWYA 4E5PA 1H6CA 2VNSA 3ZWBA 1E3JA 5KOIA 1BRMA 4DMMA 1TEHA 5JY6A 2ZTUA 4MJLA 3WNVA 1SEPA 4KQWA 1PTJA 4IJUA 4BGUA 3RC7A 4YJFA 1VC2A 5KVVA 2X4GA 2NACA 4UVIA 5EESA 3L6DA 4OQYA 4GMGA 1PL7A 1E6UA 1I3NA 3SJ7A 4GBJA 3C7DB 3WGZA 4RQTA 1HE3A 4GH5A 1Q0HA 2ZK7A 6LDHA 3JQBC 1E1NA 2UVDA 4B8WA 5FWNA 1NTOA 5JXWA 1B2LA 4BNJA 3GY0A 3RVDA 2OFPA 1E3WA 1Y5MA 4R1SA 1IB6A 4MVJE 3W4JA 4XGNA 4BMNA 4EJMA 2C2YA 2C07A 1WP4A 4E5MA 2BHLA 3B1FA 3NDRA 4YTEA 1YB5A 3CE6A 4B7UA 1HRDA 4IBOA 3PYLA 2I66A 3EW7A 1O5IA 3WJAA 3JQFC 3LVFO 4RGBA 4HUJA 5G4KA 3RKUA 3QY9A 1F8GA 4N5LA 4OGWA 2DFVA 4D7AA 1U3UA 1NXQA 1HXHA 5JDCC 3SBOA 2NVUA 3QE3A 1A72A 1U3VA 1U8FO 2PD3A 3UHAA 3VC7A 1PGPA 4IDAA 1E7WA 3DZIA 3JTMA 2V6BA 2DVMA 1BGVA 1PU2A 3K2EA 4CM1A 3PHJA 3GNTA 4CV0A 3ZHXA 3C1AA 1OBFO 5A03A 2ZQYA 4J9VA 1GZ6A 3UCEA 1WVGA 2ZKLA 3DHEA 4MOWA 5KVQA 1OMOA 1X7DA 4FDAA 2GZ2A 3FTPA 4IJVA 1SBYA 2FSSA 2HJSA 3RUHA 1YBVA 3W6UA 4DPLA 1B16A 3JV7A 2WYVA 1R16A 3OA0A 3OFSA 3UFXA 2J6IA 3EHEA 5GMOA 1N5DA 3R1IA 1ZKMA 4J1SA 5CPFA 1T4DA 4BVAA 1S7CA 2WWRA 3SC4A 3VH3A 2FY8A 3ETDA 2GNAA 1DIRA 5ICSA 5DDIP 2HUNA 2GD1O 1BVUA 3ZWVA 4CLXA 1SEVA 3DFUA 4J2HA 4K6FA 4RV9A 5T5QA 2Q4BA 4IQGA 2XAAA 4XDYA 2IEDA 3S2GA 1HF3A 1GZ4A 1DHRA 3IAHA 1WMBA 3OMLA 4BO9A 4YYZA 3IUPA 2NU8A 1K5HA 3Q9NA 4EEXA 3RQSA 2GERA 2J5QA 1ISIA 1GQQA 2PH3A 5JPIA 3ZV4A 4YJDA 3WR5A 1G1AA 2AEJA 2Y05A 3INGA 2AQIA 3QQPA 5T64A 4DBVO 5JO0A 1KBZA 1Z73A 4CM8A 2AE1A 2X22A 5JBIA 9LDBA 5IDXA 4YR9A 4O1MA 4P38A 1HDZA 2Q2VA 2RH4A 1FF9A 2O3QA 2POQX 1YOVB 3DBLA 3OEWA 4YAJA 1VKNA 3D4OA 2WEKA 3FWZA 4GPD1 4CMAA 4FFMA 1T25A 4AJIA 3OM9A 2QYTA 4TQGA 1HYEA 3MCVA 5TF4A 5B37A 3WFIA 1H6AA 4W82A 2ILTA 2P9EA 3K8ZA 4R4JA 4E0BA 4GX0A 2Y93A 1LU9A 3VKVA 5DCWA 4PZDA 1NR7A 2NU6A 5KCZA 2UYYA 1KIFA 1N1EA 4IDGA 3GVHA 4J4BA 1E7SA 3DWFA 4IQ0A 5L53A 4D3DA 2ZATA 2ZCUA 1BHSA 1ISMA 2NQTA 4RPKA 2B83A 3CKYA 2C5EA 4LVCA 4OKNA 4UREA 4ITUA 4YJFB 5IDQA 1P31A 2BLLA 2HMWA 5BSGA 4EI2A 1MP0A 4A7PA 2QYSA 1B8UA 1OC4A 1PWXA 1KVSA 3RASA 2P9GA 3ENKA 4DUPA 4WNCA 4ZRNA 1J5PA 3M1AA 1Q7BA 3N58A 2X9VA 1A7AA 4FD3A 4BL5A 4R41A 5BR7A 4HNHA 5AXBA 3ZU4A 3GG2A 4MKZA 5G0TA 5CDTA 2E49A 5EQDA 3ZNNA 1U1IA 2DBQA 2B4TO 4DPMA 1C0PA 1E3WB 2H9IA 1ZFNA 2E4AA 3F5SA 3JQ8A 4MVJP 5FI5A 1LX6A 1PZFA 3ZHYA 4CLDA 3O38A 3NEPX 4OXNA 1EE2A 2O3RA 2IEBA 5TS3A 4WCFC 2CZCA 4Y9DA 2V7PA 2AMFA 6ADHA 5G0VA 3NRCA 4NQZA 1NPYA 1YGYA 4U0KA 5G4KB 1ZW1A 2C29D 2HU2A 4RPGA 5COBA 5FF9A 1CYDA 2NU9A 1BWSA 4N5MA 4CV2A 1F14A 1DIAA 4J4TA 1Y81A 3HE3A 1F12A 3U4HA 1PJSA 1KEWA 1YL5A 4MKRA 2NVUB 5KVCA 4J7XA 3Q2KA 4FFPA 4ND5A 2IZZA 1C1XA 4B7CA 5FFFA 5ENDA 3DC2A 2LDXA 3I9NA 4PLPA 1QYDA 3HDQA 4WE3A 5TJHA 4XR4A 2ZYAA 3IL2A 4YQZA 4WUVA 2HRZA 3I3OA 3QVSA 4EITA 3WWYA 3HB4X 4NPCA 3DHNA 1XCBA 3PTZA 1BDBA 3K73O 1JU9A 3L9WA 3P2OA 3CZRA 4ILKA 4TROA 4JK3A 3RFVA 2A94A 1H9BA 1NYTA 4QFDA 3ETEA 1P3DA 3E1KA 4YJHA 2FSVA 4TRMA 2YUTA 3I5MA 4I8XA 4ZQFA 4Q9NA 3UW3A 4WJZA 1YBMA 2HK7A 3W4IA 5GZ3A 3DONA 4FBGA 4D3SA 5A06A 4NK5A 4RVGA 1P74A 3RSHA 4QFCA 1VJ1A 2PWZA 4F6CA 2VYND 1F17A 1ISHA 2JFFA 4QT0A 1I10A 4QQRA 4DQVA 4W6ZA 2NWQA 3NTQA 2JCYA 1GQ2A 2J3HA 3JSAA 1PGOA 3GNSA 5CEJA 1Y5RA 2IXAA 1R0SA 3B1KA 4EYEA 1E7QA 2B5WA 1NQ5A 4B4UA 1NPDA 1DFHA 3SXPA 1NP3A 2HK9A 3H8VA 5EQFA 2Q49A 3KEOA 4QTZA 1LRKA 1DLJA 1PS8A 3PQEA 1KERA 3VZPA 4K26A 4MVJH 1E6WA 8ADHA 1XELA 1NPTO 1C0LA 1P0FA 2G76A 3OF2A 3OIGA 2VHXA 3I4CA 4FGSA 3EZYA 3Q0EA 3U09A 1PR9A 4CM8B 2AEFA 4NFYA 3U0BA 3ZWAA 1HE5A 4FB5A 3OBBA 4HY3A 3F4BA 4NK4A 3D4PA 4E12A 3DBLB 3V8BA 1GUZA 4XKJA 1PQUA 3WGQA 5ITVA 2PV7A 4OMUA 2W2LD 3A4VA 5I9MA 3IP1A 5C37A 5JDIC 3VZSA 3WB9A 3WIDA 5CP8A 4Z0HO 2A4KA 2AQ8A 3JQAA 1UZLA 5IN5A 1T1RA 3MOIA 3K92A 1R4MA 4KQXA 3QP9A 1NVMB 3ROKA 4CQMA 5JS6A 4YRBA 2AE2A 1JTVA 3JD1A 1K6IA 3FI9A 2O50A 3HUDA 4MINA 1JN0A 1SCUA 4AG3A 5CG1A 3EVTA 3WGIA 2DTDA 1BSVA 3C7CB 3A1NA 4MP3A 2HMSA 4RQUA 2Q1TA 3PFFA 5HTOA 1XWFA 3GEMA 4M86A 3D7LA 2D1YA 3KBOA 5GY7A 4J6FA 1SC6A 2PTGA 2QW8A 4NMHA 4BO5A 1NBOA 1E7RA 5EINA 4DRYA 5IAAA 5JAMA 4XWYA 4DL9A 4Y6SA 1N9GA 2J3KA 2GLXA 4RVSA 2Y1CA 4R68A 5L9AA 1QV7A 3HDYA 3JQ8B 3QW2A 5K6AC 3GGGA 1U8XX 4YPOA 2CMDA 2VT3A 2UDPA 3VPSA 5FI3A 5BSHA 1WMAA 3RKRA 4XYEA 5GZ1A 5JFOA 1IHXA 4JX8A 1QLJA 1FDSA 3ZW9A 4JP2A 4LGVA 1EUZA 1B8PA 3G1TA 4PLZA 4YVFA 4BNUA 1WLYA 1AUPA 1E1MA 3DZHA 4DLAA 4WECA 8LDHA 3EDMA 3SX2A 2BI8A 2G82A 4FIZA 4UULA 1P9LA 2O3UA 1WZEA 3FBTA 4XDZA 1C1XB 1M66A 4FR5A 2XF8A 3ZWCA 1BG6A 4R9RA 3CSDA 2EP7A 4YXFA 4JIGA 4WLFA 3IP3A 5I7EA 3KVOA 4R3NA 4BB6A 2WD7A 1UH5A 4NU5A 2BI7A 2PKRA 3RU9A 5F1KA 1R6DA 3BIOA 4M49A 1HYGA 1U2DA 4AJPA 3QVXA 3QVTA 5IZCA 4NU6A 4YACA 3IUSA 1D1SA 4U0JA 1U4SA 3LT0A 2HQ1A 2ZB3A 4HBGA 1LLDA 1EQ2A 2HMUA 4D0SA 3PQDA 4GQAA 4N5NA 1BXZA 1YXMA 4GLOA 3I9JA 4O5OA 4RPHA 4DLBA 4EZBA 1PEDA 4YJHB 1LNQA 3GRKA 5T8KA 4BUCA 2AG8A 2O4UX 1LLUA 3FRJA 7MDHA 3AOEA 1TI7A 1I3KA 2JL1A 4J43A 2QG4A 1H5QA 3FNFA 1PS0A 3FF4A 3L0DA 1PJLA 4HFMA 2VRBA 1QKIA 2CNBA 2PZJA 2JJYA 4W7HA 3RJ9A 3BYZA 4XB1A 1YRLA 4RF2A 2UV8A 4MO2A 3PIIA 3SC6A 4QO7A 4XYGA 2V65A 4KMSA 3E9QA 3TDKA 3U4CA 1MC5A 4I08A 1AHIA 1MFZA 4NBRA 5DCUA 2DBRA 4BO4A 5JAZA 3F47A 4A03A 3V2UA 2V6GA 1CJCA 3PPIA 3AJRA 5BNTA 1GU7A 5JAIA 4WEQA 2ZJ0A 4OL9A 2E48A 4QX6A 2Y1DA 4B3JA 3QVOA 1O6ZA 4R69A 1EVYA 3LQFA 1SAYA 5EERA 4CQLA 5B12A 4EJ6A 3HFGA 4AJ1A 1N1GA 1YJ8A 3AI1A 2OO5A 3ZWOA 4K1LA 1ONNA 1VKOA 2Y1EA 5JYDA 3FCOA 4BMVA 3E9NA 3ZNQA 3PWKA 3COSA 4RZHA 1FXSA 3PQFA 1DXYA 1NASA 2GO1A 1L1FA 5CDYA 2WYWA 2SCUA 1X0XA 1DRWA 1N8KA 1P1FA 5KJEA 2OP0A 3OH8A 1HETA 1LLCA 3GPIA 3JQAB 4WEOA 1XEAA 1KEPA 2ZYGA 2CSUA 2GSDA 1R4MB 3EYWA 2IDZA 2HJRA 3RUIA 3JQDA 4CQMB 1GV1A 5DBGA 1MA0A 1SO8A 4XGKA 1GFSA 3DBRA 1I3LA 1VSUA 1Q0QA 1AGNA 4RO0A 1KETA 1R15A 2X1HA 3Q6IA 3QVWA 4WK6A 3WLEA 3ZGYA 3JQ9C 3PWSA 3H5RA 3H9QA 4OHUA 1E5LA 3DOOA 1YS4A 2WM3A 2DUUA 4XB2A 3JYPA 1BDMA 3TN7A 4BKQA 3HN7A 2R2GA 3DB2A 4R1TA 1DC6A 2WTBA 1OAAA 4TKMA 3OEYA 1UP7A 1VRWA 4XYMA 3ZWNA 2W2KA 1N9GB 2NSDA 4OSOA 1RM5A 4ZHSA 5DBIA 3F5QA 4CL8A 4YRAA 4Z9FA 5L45A 2CDAA 2D59A 2BFAA 2EEZA 4RCVA 5F1PA 3LT1A 3B70A 4P4LA 5CEEA 2F1KA 2EGGA 3PYMA 4EW6A 4PG7A 1Y1PA 1HDXA 4G65A 4JCOA 4PN3A 3OQ6A 4CLHA 1V35A 3VH2A 3V2GA 5BQFA 4QSMA 5CG2A 3GHHA 2PR2A 1LSOA 4BNZA 1SMKA 5EMHA 4YQYA 4PZEA 3GF4A 2AA3A 5ADHA 2BD0A 3TZ6A 3BTSA 4PLCA 1UAGA 5MGBA 1MXHA 2PY6A 1NWCA 2X0RA 2A35A 4B7XA 4BIIA 3NDJA 2DM6A 2VRCA 1XG5A 4JBGA 5AXDA 1VL6A 4LSWA 2WD7B 2D4AA 4TWRA 2DKNA 2X8LA 2VQ3A 4E13A 1H94A 1RPNA 1WDLA 1JKFA 3WYBA 3IQDB 5HM8A 4GSKA 5L7YA 5GZ6A 1E0DA 5THKA 3OQ1A 1B14A 2P91A 1B7GO 2VN8A 1T2FA 3QWHA 2W8ZA 3GN2A 2FR1A 5B4UA 3DZGA 1U3TA 4E2XA 4IMRA 4NG5A 4BO2A 1P1JA 4Q3DA 5TRTA 3ZWMA 1V9LA 3GAZA 2Y68A 4OOEA 1XSEA 1D1TA 1EVZA 4HNGA 4TSKA 1HZZA 2VYVD 1X14A 2YJZA 4R5HA 4AJHA 2X7HA 4BGVA 3ANMA 2I65A 4GKBA 3G1UA 2OBNA 1M6HA 2BF7A 2VHVA 1JAXA 5COQA 2YZ7A 3E03A 4TVBA 3BTVA 4RORA 3ENNA 1HYHA 2RHRA 2O3JA 1PL8A 3V1YA 2BRUA 1LSJA 2VUUA 4IJWA 1LXCA 1ZSYA 1X1EA 2EJWA 4WOKA 1HKUA 5A9RA 4OYRA 3HWRA 1KOLA 5JW6A 1PJCA 4BKOA 4FOSA 2PLAA 1ZEMA 3JYQA 1ZK4A 4UEOA 3BAZA 3NKLA 4CQLB 3JD0A 3PGJA 3QRWA 2X6TA 3OSUA 1DFIA 5DP2A 1VJTA 3PLRA 3DMTC 4I1IA 5ER6A 3H65A 3RAJA 1T26A 4K9DA 3TL2A 4MVJD 1XU7A 1HDRA 1LSSA 2V6MA 3IMFA 1NFFA 2ZQZA 2XXJA 2R6JA 1X13A 3TQHA 1NVTA 4YRDA 3RBZA 4ZQBA 5CHEA 4ND2A 4GI2A 4KDEA 5A3VA 3HFSA 1Z6ZA 1EUDA 4D46A 5EJ2A 1UAYA 1M6WA 1ZO8A 3DBVO 3GRPA 3P5SA 2OXIA 2UUPA 2Z95A 3FWNA 3UUWA 1QV6A 2Q1WA 1ZSVA 4BGIA 3GVCA 5DF1A 2QZ9A 1PJQA 3NV9A 1WAMA 4J3FA 3NX4A 3AUSA 3DBRB 3VPHA 3GNQA 3ZCXA 4E21A 5L3ZA 2CD9A 4TMFA 2GGSA 1EEHA 1OOEA 4UEJA 3GEGA 3F4LA 4PLFA 5HWSA 3DTYA 4IQ8A 4R54A 1I2ZA 2LDBA 4CV1A 2OUIA 3FNGA 1DDOA 3T7EA 2HK8A 2Q2QA 2W2KB 1MXFA 2Y0EA 4M1QA 1PQWA 2ZTLA 4E30A 3L9XA 3ZI0A 5TGDA 3ICCA 2GF2A 3ONFA 3PRJA 4XA8A 2X23A 3H9EO 2NLOA 5F3RA 1KVTA 2G0TA 1T2CA 4FCCA 4HV4A 5HA5A 1HLDA 1EBUA 1WNTA 4KP7A 3KO8A 5JY1A 3CTMA 4CMHA 4D44A 1FMCA 3UF0A 1IY8A 2Q99A 3GZNA 5KTKA 1JVBA 1ZJZA 3EZLA 3RU7A 3FD8A 4IS2A 3AY7A 3ZU2A 3PWZA 1CQJA 3INTA 1GY8A 4CJXA 3W8DA 4TZKA 1EBFA 1FDUA 3CPSA 3GVIA 4DYDA 1LDMA 4JNKA 5CDUA 4JQCA 4JP3A 2X9NA 3TZHA 3JQ6A 3JD3A 3BMNA 4JBHA 4XCVA 3AU9A 4XRRA 4XQ9A 3LF2A 4I9HA 1XYGA 4L4RA 4PG5A 4IGEA 2EKPA 1EVJA 4FC6A 3TF5A 3ASVA 4B3HA 1LRJA 1O94A 1TXGA 3ZV5A 2FR8A 3WQRA 3ZWWA 1E7MA 4FFNA 4JGBA 3WFJA 3GMDA 3PZRA 3H9GA 3MJTA 4BNLA 2OP1A 2I99A 1LSUA 1ORRA 4NZ9A 1T24A 2QQ5A 1XGKA 3DOCA 3VPGA 3P19A 1NAIA 4J0FA 4D3FA 4UVHA 3QJ5A 4CLRA 3C1TA 1KVRA 3NTRA 2VWHA 3VOSA 3SLKA 1O95A 1QR6A 1GAEO 4PRLA 3BXXA 1A7KA 2O48X 4J0EA 4XIYA 1I01A 3MJCA 4R01A 4IZIA 2VTDA 3GQVA 5EPOA 4ZA2A 3VH4A 2HKIA 1EFKA 1YO6A 5BT9A 3ABIA 3OECA 2ZJ1A 1I8TA 3JQCA 1ENZA 1P1IA 1QMGA 1GD1O 1YQXA 3HSKA 2DQ4A 4NBTA 4D45A 2WJPA 4OXKA 3EGOA 1ADFA 5H81A 3DAPA 1MUUA 2NADA 5COAA 2JKVA 2GUGA 3NT2A 4O63O 2AHRA 4GMFA 5DT9A 1AXEA 3W6ZA 1I24A 1TT7A 4GX1A 5CEFA 3KXDA 1HE4A 3RROA 3N7UA 1AHHA 4XRGA 3QHAA 4R5MA 1UXGA 3GN1A 2CVOA 2PZKA 1LC0A 1U7HA 3MTJA 1ZZEA 4I5DA 1PJ4A 1XLTA 3R3SA 3IDSA 4F45A 3L07A 3L4SO 1ZCJA 1Q0LA 4C7JA 3FTNA 2A9FA 1ENYA 1A71A 1UXJA 2NQ8A 1V6AA 2EV9A 2C54A 3WTCA 4S1VA 4A5OA 3RC1A 4ZRMA 4TRRA 2BKAA 4WASA 2O7SA 4YAEA 4EUFA 1ZBQA 2PKQO 3FR7A 2RIRA 3VH1A 4BV8A 4CM9D 3BMCA 4BOYA 1UDAA 3ICPA 5AVOA 1Y8RA 5I9LA 3DEYX 4CR6A 1UR5A 2X5JO 2FZEA 1P45A 4E2WA 1LDYA 2AQHA 3CEAA 2P9CA 1E77A 2JFGA 3O9ZA 4IIUA 4CUJA 4KTVE 4ALKA 3CXRA 4I9UA 5J23A 2HO5A 4BKPA 4J7CA 1GZ3A 1CDOA 1ZMOA 3CMCO 1RM3A 3U62A 5JC8A 3QLJA 4FFRA 3RUCA 2E6UX 1NFQA 4FJ0A 4BNVA 5HS4A 1KYQA 4A27A 1BW9A 1LEHA 1AN9A 3I83A 1ZSNA 1YQGA 1H2HA 4PLHA 5T57A 4L0QA 4IZHA 3PFWO 3GUYA 4NNJA 3O03A 2ZTVA 5JSFA 4BO7A 5KJ6A 1PIWA 2Y66A 4RVDA 4BNKA 3FNHA 4NFHA 1MG0A 2HAEA 4B79A 3NT5A 3PJFA 2GR9A 1NM5A 3WYCA 1OC2A 3L4BC 4RVUA 2YW9A 2R00A 3GZNB 3HNPA 5DOZA 2DTXA 3UGKA 3VVBA 2Q50A 4JXKA 5TX7A 4CUZA 4IPTA 4XJSA 1IZ0A 1NAHA 1E5QA 3LLVA 4LISA 3K6JA 2JFHA 3WX0A 1PJBA 4PVCA 4L73A 1I32A 1T2EA 4KTTE 3H2SA 4J16A 3LU1A 4ND3A 4A10A 1PQPA 2VZ8A 1LLQA 4WLVA 4UVDA 3BHIA 1PGNA 2I3AA 1QLHA 4XQEA 4CODB 5TQVA 3ZNPA 2GASA 3AK4A 1D3AA 1UP4A 2DBVO 1MB4A 3OIDA 1HLPA 5IN4A 2B4RO 4ID9A 1MFPA 1GADO 4YT5A 3RD5A 3OICA 4FQ8A 5AYVA 3BMNB 1JLLA 3JCZA 3DBHA 2P5YA 2G1UA 4CLOA 2EKLA 2EP5A 5LC1A 3IKVA 1K6XA 2FZWA 3I9MA 3WGOA 3H3JA 1VL0A 2IE0A 2JCXA 1LBEA 3FR8A 2HMVA 4CR7A 4IY1A 4H7PA 1HWYA 3DZJA 4NJMA 5K9ZA 2W98A 1MC4A 4HP8A 5ENVA 3WBFA 5U9CA 3G0OA 4UVEA 1GUFA 1KY4A 3E5RA 3HDJA 3ZN2A 1PJTA 4CLRB 1B3BA 3I1JA 3LC1O 3UVEA 2W4QA 3K9QO 3I9LA 4DQUA 4ND4A 2VT2A 2AG5A 2H5LA 4PZCA 2FPGA 1TB4A 1R0KA 1UZMA 3UKOA 4AICA 3DXFA 2DC1A 3ANNA 4W4TA 4W9NC 5FEUA 2O2YA 4WLOA 2GN9A 4O0LA 3W1VA 2Y1GA 2B0JA 3PK0A 5DULA 5U1PA 4FFLA 3JQBA 3OJ0A 4DIOA 2VUTA 3ZZNA 1DEHA 3STHA 3AI3A 4AJ2A 2X5KO 1J0XO 1WW8A 1YL6A 4U6QA 3JD4A 1KVUA 5KJFA 4BHTA 3UOGA 2JHFA 3BHMA 3DFZA 1GL3A 1XQ1A 1GEEA 4TZTA 1W0CA 3VHRA 4UUNA 4LCEA 2DTEA 1NX6A 3X2EA 2UUOA 5A1TA 3WQSB 3PDJA 4ROSA 4NBVA 1GYRA 4G5HA 4GLLA 1CQIA 2PD4A 4IXWA 3FBGA 3JQFA 1GUYA 1NHWA 1V3UA 2BGKA 5ES3A 1DLIA 2EHDA 3ZNOA 2NU7A 5DP1A 3BA1A 3U3XA 3L6EA 3G17A 4OSPA 1DIGA 5CPBA 4IS3A 3SEFA 4DQXA 1DAPA 3KSUA 3PLNA 4EEZA 3OJEA 3TZKA 4RPJA 2V6FA 1CEQA 5A9SA 1JA9A 4UEKA 3IOYA 1B0AA 4CLEA 5DBFA 4QECA 2PH5A 3W4KA 1QP8A 1LI4A 3TRIA 2O4CA 3BMCB 3EK2A 3WDSA 3S8MA 1YKFA 1Y8RB 4KDFA 5ICMA 2OL4A 4MVJM 2H6EA 1YDWA 3ST7A 4OM8A 4YWJA 3MJVA 5BNIA 5I9NA 3WTBA 3G49A 3VPXA 1ADCA 2X0NA 3NAQA 2I67A 3VZRA 3C7AA 3AWDA 3Q2IA 3WGGA 1YQDA 4WLEA 3I4FA 1Y7TA 4Q3BA 4HXYA 2QX7A 3PP8A 1HDYA 2Z1NA 1O9BA 1ZK2A 4EUEA 4P4NA 2YFQA 1SPXA 4E2YA 3ZW8A 4ALMA 5A05A 3JQEA 3NTOA 1CETA 1DSSG 2IXBA 1BW9B 1IULA 3DR3A 4IGFA 1GPDG 4WLNA 2CVZA 3V2HA 1C0IA 2DPHA 1N2SA 3QIVA 4LVUA 5IXYA 2YYYA 1BMDA 1Z45A 3WGTA 5JLAA 3MTGA 4PLYA 2Q2WA 3OJOA 4JJFA 2OORA 4U8GA 2XPCA 4RZIA 5JE8A 3KYCA 1IPEA 3IC5A 1JDJA 4IXTA 2AEMA 2VOEA 3PHLA 3LT2A 3NJ8A 4LN1A 4GX2A 2RHCA 3WJ7A 3MZ0A 2IYPA 2B35A 3ON5A 4LK3A 4PG4A 4PG8A 3MWDB 4YB8A 3I23A 1SOWA 4FFOA 3RIHA 3OP4A 1UP6A 1HSOA 2VYNA 4UVGA 3UCXA 3ZHBA 5KVSA 1A9ZA 3E9MA 5AQ1A 3KB6A 2FMUA 5F5NA 4RDHA 5JCJD 1J4AA 2YV2A 4Z9XA 5U4QA 2QIOA 3TZCA 2F00A 3DBHB 1P1RA 4CLOB 3KUXA 3PHIA 5F5LA 1D8AA 4Y67A 4CMGA 3PJGA 1K3TA 1LDGA 3PZBA 2D0IA 3HB5X 4KWIA 5I7SA 1B26A 3ZH2A 4B3IA 1BTOA 2C2XA 3GDOA 1FDVA 4Y6PA 1XR3A 4YBZA 4NJMB 4WCDA 1EQUA 3EUWA 4LMPA 1V0JA 4LRTB 1WDMA 2W90A 4E4YA 3AI2A 1O89A 1YONA 3F3SA 3LF1A 1HTBA 4IDDA 1M75A 1U7TA 4A73A 1GCUA 5TC4A 2NM0A 3PHHA 5KNLA 3KYBA 2ET6A 3FHLA 3GH3A 2W2LA 3S2EA 3JQGA 2NUAA 1Q2XA 4PLGA 3Q11A 5TLSA 5IG2A 3H9UA 5IZ4A 1D4FA 2NNLD 5DZSA 5EIOA 5EL0A 1FK8A 3C3XA 3T4XA 5IXSA 2CY0A 5THQA 4DC0A 1K89A 1X7GA 3V5NA 4Z6KA 2H63A 1ZVMA 1HDGO 4NR0A 1DO8A 4XJTA 4B4VA 3RJ5A 4ALJA 3KHUA 3R0IA 2NV6A 1C1DA 1J49A 3KOUA 5G4LA 1H9AA 4BS9A 1VM6A 3BMOA 3D3WA 5JO9A 3AOGA 5HRUA 4DVJA 1PZGA 4O59O 1FJHA 1T4BA 2CVQA 1YB4A 3WGYA 1YJQA 3RUEA 4Q3NA 1LDNA 4K6CA 4WCFA 4J1NA 5A4DA 2PGJA 3E8XA 5G0UA 2BELA 3UCFA 2AQKA 3KSZO 3ROQA 3NUGA 3RFTA 1TLTA 1GCOA 4E5NA 2D8AA 1FDTA 3AUUA 4TVOA 3OQBA 3MJ4A 3V1UA 2P2SA 1I0ZA 1Q7GA 1I2BA 2GPTA 1P1KA 3DL2A 3R3JA 5DN9A 4BNTA 1AXGA 4CMCA 1U5CA 5G0WA 3ZWXA 5A9SB 1PJ3A 2HMTA 4I9NA 1DRUA 1QYXA 5A3JA 2TMGA 4TRJA 3AM5A 3PHGA 2I6TA 2IYOA 4XD2A 3H4VA 1H0KA 4NFSA 4BB5A 1I2CA 1LRLA 1KC1A 3T7CA 2J5RA 2JD2A 3OIFA 4J4HA 3GOHA 1N7GA 2GRAA 2OZPA 4YCAA 3FNEA 4DPKA 3NJ4A 4BQRA 3ORFA 2YFHA 4O6VA 1FDWA 3P2YA 4BKRA 5IDWA 3GVXA 2FPIA 3CUKA 1R37A 3QWFA 1MG5A 3DHYA 1N7HA 4M89A 3S1LA 3ULKA 4KUGA 4DGSA 1MV8A 3GDFA 3GMSA 3VDRA 4TKLA 1XDWA 3AY3A 4CMKA 3HG7A 1E7YA 1LJ8A 3PJDA 1L7DA 4UAGA 3KYCB 5IJZA 1LQTA 3ADOA 1ZNQO 1K6JA 4F46A 4E5KA 1X0VA 3GC6A 3CINA 4YAGA 1NVGA 4MVJI 3KLPX 2I76A 3UH1A 1PGJA 1IL0A 2R00C 3RWBA 2Y1OA 1I5RA 3QWBA 3RBVA 5DNAA 4FN4A 3H6KA 4L74A 5L40A 1Z82A 3Q1LA 4OKIA 1QSGA 2VNAA 5BSEA 4YAKA 5T6BA 4DC1A 2XOXA 4J90A 4RPLA 1YDEA 1KS9A 1UXHA 2C7GA 2GZ1A 4IMPA 3C8MA 3ZV3A 2X86A 5JDIA 4NI5A 5A9TA 3K96A 3QV1A 1ML3A 4IDFA 5JMPA 2GZ3A 2J3IA 1UJMA 4GX5A 2BMAA 4EJ0A 4PG6A 2ZIZA 1W6UA 3H5AA 1ZEJA 3SJUA 1ZJYA 3DTTA 3PIDA 3E6AA 4P4GA 4DYVA 3HQ4O 1DC5A 3BZUA 2TMDA 3M2TA 5AXAA 2BGMA 2Q45A 3JYLA 2Q1UA 4Z0PA 2P68A 3JQGB 1NNUA 4L75A 2PK3A 1CWUA 2DLDA 1LDEA 1ZK0A 3I9OA 4ZQGA 3NGXA 5DOVA 2JAPA 4BNIA 4BMSA 5B4VA 3EMKA 1ZK3A 2Q1SA 1PR3A 3K5PA 3SLGA 3ZU3A 2WE8A 3IJPA 3KYDA 5JC1A 4AJ4A 4BNNA 2DFDA 3OJLA 4EBFA 1XQ6A 3TL3A 2GCGA 1C1DB 2DAPA 3HN2A 3WG9A 3ANLA 4L8VA 2C5AA 3HDHA 1DIBA 4NIMA 3BMOB 3D3WB 3IJRA 3O8QA 4AJLA 4Q3AA 4ZICA 1PX0A 2J3JA 4RDIA 5K6AA 3SVTA 1C0KA 3DMYA 3AFMA 4WCFB 4DREA 1GQYA 1HE2A 3D3EA 5A02A 5CFZA 4YT2A 1UZNA 1NQOA 4MIOA 4TRNA 3VDQA 1VPDA 3DDNA 1R66A 2AXQA 1S6YA 2VWGA 4A26A 2Z1MA 4D42A 1ISJA 3LC2O 2GN8A 5TIIA 1EMDA 2DT5A 2Y99A 3AY6A 1HDOA 1Z7BA 5I7FA 3I6IA 4AJKA 4CV3A 3I52A 1Y9AA 3EAGA 4FJ1A 2C20A 4CR8A 3GEDA 4YAIA 1YB1A 2PKQP 3HHPA 1NFRA 3LLSA 3MJEA 2NVBA 1HL3A 5C3MA 3JD2A 1Y6JA 4CMEA 4BKUA 4DTIA 1E3EA 4QUKA 2PZLA 1Y9EA 1BXKA 1JWBB 4I5GA 4CM6A 4DWVA 1H93A 1W4ZA 4XX0A 4ZQHA 3DZFA 3IIEA 1I36A 4J9UE 1E1KA 2YHUA 3W8EA 4GAEA 1DAOA 4FGWA 4F3YA 4PIVA 4RF5A 4AJJA 3HJAA 3A28A 3AM3A 4ALLA 2EG9A 2Y0DA 5G0SA 4AVYA 1DC4A 1KVQA 3D0OA 3GZ4A 2RH8A 3LDHA 3ZHZA 1U2GA 2FRDA 2ZCVA 1ZIDA 2BH9A 4Z3DA 1U4OA 2BFMA 2QHXA 4UUMA 3QA9A 1DJQA 1A5ZA 4HWKA 2DU8A 4GVXA 5L4LA 5KKCA 1KY5A 1IZ9A 3WXBA 2EERA 5MDHA 1ZUD1 3HADA 5IZCC 2IZ0A 3K30A 4CM4A 3GVPA 4L9RA 4Z9YA 3I9KA 3N74A 4JBIA 1ADBA 3G3EA 4MPDA 1JWAB 1CIVA 4HADA 4AJOA 1C14A 1ADGA 2Z5LA 1MLDA 4PLWA 1R0LA 1JVSA 5TJ9A 3F1KA 2FPPA 2VWPA 4I5EA 1DC3A 1VJ0A 2RAFA 1NQTA 2VYVA 2E82A 3NYWA 5T8KC 5K0ZA 3O4RA 3AOEC 4ZQEA 1DJNA 1M2WA 2VZ0A 5AOVA 5KJCA 1ULSA 3IS3A 2FWMX 4YJGA 2OHXA 3WWZA 1I3MA 4XEHA 3DZBA 2EXXA 4LMRA 4AL4A 4Y98A 4CM5A 3LK7A 3LZ6A 2D5AA 4R1NA 4B4OA 3OA2A 1V3TA 4ZD6A 4DIBA 4HKTA 1DHTA 1D7OA 1Z74A 2XXBA 3MWEB 4BO1A 3GFGA 3QSGA 4XGIA 1ISGA 4R9SA 4BNGA 4XZ3A 2BFOA 4EUHA 4IDEA 3PI7A 4KZPA 5HBRA 3KM0A 4RLHA 3UAGA 1QYCA 3GLQA 2CUKA 3JQAD 1PZEA 1XKQA 4KWHA 4E33A 4QEDA 4II3A 1G0NA 3VAZA 4CQMD 4MVJA 1PS9A 2IZ1A 4GGPA 4FW8A 3JQ9A 1LC3A 3VPFA 4URFA 1HDCA 4LW8A 2VHZA 5G2OA 2D5CA 4GSLA 3ZWPA 3RFXA 2UAGA 3GG9A 4P22A 4YDRA 3KYDB 1LTHR 1H2BA 3HZZA 1DRVA 3S55A 4MIYA 2YDYA 4PLTA 4NJOA 3JQ7A 3MJSA 3UICA 1GTMA 4RJTA 5T67A 2CF5A 2X9GA 2JD1A 3O8QB 4NBWA 4QO8A 4IDBA 3U49A 3R6DA 1ONPA 4NBUA 3ZV6A 2Q4EA 1PSDA 1G0OA 3X2FA 5ITWA 3ROPA 3TOXA 2GDZA 5ILOA 1Z75A 5FYDA 5H83A 1SOVA 4FSHA 3W8FA 3F9IA 4Z0TA 2EIHA 4ZU3A 1T2AA 2I3GA 5KJ1A 1ONOA 5KIAA 4ESOA 4E6PA 1EUCA 1X7HA 4CMBA 4H15A 2PNFA 1G6KA 5JNLA 1NHGA 4OAQA 4EGFA 2X0JA 2O3TA 1N92A 1UXIA 2QZZA 2RBEA 4J1QA 3GPDG 2O23A 1V8BA 3E48A 2O7QA 1A9YA 2B69A 3F46A 1TA4A 3WLFA 4P8RA 1A4UA 4BV9A 4HFJA 4N18A 3M1LA 4D0RA 1GYQA 2DBZA 4DXHA 3V1TC 2B37A 1GDHA 1YH3A 4UUPA 1F0YA 1HT0A 4FC7A 5IDYA 3DO5A 3VTZA 4LCJA 4BNXA 3TFOA 2I5PO 1IE3A 1YBAA 4WNIA 4KUEA 3GR6A 1BXGA 2EJVA 4XQGA 3TZQA 1JAYA 1TVEA 4GWGA 4UUOA 3A9WA 2RCYA 2ZB8A 4L4SA 1K2WA 3F6YA 2PGDA 3FN4A 1O0SA 3ETGA 2YHIA 3B1JA 5CDSA 1O8CA 2HRBA 3KEQA 4BNWA 2YQ5A 3FPCA 3S2FA 2EF1A 1E3SA 2C0CA 1YE3A 3E18A 1WDKA 2QRKA 4DMLA 1F06A 5LDHA 1TT5A 4OH1A 4R51A 3E5MA 3NGLA 2O2SA 2ZB4A 3O26A 4CM4B 4II2A 1BVRA 2HDHA 1L7EA 4XR9A 2EWMA 4DLLA 1R12A 4R16A 4BO3A 4MKXA 1KEVA 4MVJG 3ITKA 3A14A 1X15A 3LT4A 4HFNA 1WPQA 4RL6A 4J1TA 4BO8A 3WYEA 5JAQA 4GKVA 3AUAA 4KOAA 4M87A 4OO3A 5IF3A 1LQUA 4YJGB 1UXKA 4E5YA 2HSDA 4K28A 3ZDFA 3LYLA 3DMTA 1PL6A 3AM4A 4J2OA 4U6SA 5AXCA 4DA9A 4YT4A 1SZJG 1ZXLA 3BTOA 5BNFA 2HLPA 1OFGA 1EZ4A 4AFNA 1VI2A 3DAFA 3ROMA 5B4TA 2VWQA 1QG6A 1PWZA 4OXYA 5C7IO 3TJRA 4BO6A 4WGGA 2CF6A 3PXXA 2ZB7A 5DCYA 3VZQA 4R3WA 4WKGA 2GN4A 4J7UA 5JYEA 1H6BA 1VLLA 3EVNA 4Q3EA 1RWBA 1YL7A 2VTEA 3PEFA 5I8ZA 5L7TA 3JYNA 2X5OA 5HS6A 1NWHA 3DOJA 2X0IA 5F21A 3U9LA 4JJIA 4PGFA 4E3ZA 2OOSA 4CPDA 1ARZA 5LCXA 5JDCA 1W73A 1ZH8A 1R4NA 4M8SA 4AJNA 4H3VA 4MP6A 3K31A 2PZMA 4BNFA 4Q39A 1ID1A 4WPGA 3VKUA 5A5FA 2YQ4A 1MGOA 1X1TA 2B4QA 1Q7CA 2AW5A 1B3RA 1UUFA 4Y8VA 1CRWG 2J5KA 3Q3CA 4RVHA 3JQ7B 4BNMA 4CM9A 2C82A 4QXMA 1PZHA 4WOJA 4IUYA 3GK3A 1Q1NA 2FHSA 2VUSA 4BNHA 3IKTA 2WSBA 2CFCA 2CDCA 2NTNA 4C4OA 4MP8A 3KETA 1JKJA 2D3TA 1EE9A 3NDIA 2ZTMA 3PVZA 3PGXA 5BSFA 2NVWA 4PFJA 1NQAO 3ZU5A 3EY4A 4JJGA 3VTFA 4E2ZA 1P1HA 3RCBA 5L4NA 3AFNA 3FPLA 1OZAA 4NHEA 5A5EA 2H1SA 2YV1A 3GUCA 3H3FA 3KZVA 4GGOA 1P77A 5L4SA 3RBXA 1ISFA 3I6QA 4WLUA 4MDHA 1I33A 2G5CA 4XYBA 1GPJA 3L6OO 4BQPA 3TPCA 1ZK1A 5C7OO 2VZ9A 2OGUA 1RM4A 2J8ZA 2JHGA 4NH4A 4R1UA 1P0CA 3WS7A 4LSMA 1DFGA 2Q3EA 3RC9A 7ADHA 1Y8QA 5A04A 3KTDA 4PCVA 4G2NA 4ZJUA 4M54A 4EDFA 4W99A 2VRCD 5KKAA 2IRWA 4CL3A 4CMEC 2JAHA 2OMEA 1SB9A 2WDZA 4FS3A 4IINA 1MX3A 3QWAA 3BMQA 3WMWA 1BXGB 4CMIA 3KV3O 4D43A 3D4NA 3EC7A 4J49A 5TT1A 1PJ2A 3CIFA 3GGPA 4RF3A 2FR0A 2G17A 1HEUA 1IHYA 2VHYA 3WIEA 4PLVA 3H2ZA 1DPGA 3QWIA 4RF4A 1RKXA 1XA0A 3M2PA 4CM3A 1E3IA 3H5NA 4GWKA 2YHIB 4JROA 4ZVVA 3RI3A 4Z3KA 9LDTA 1IPFA 1QXSA 4XQCA 2JD0A 3DZKA 1ZXBA 2GYYA 2PGLA 3B6ZA 3D5TA 4BNYA 4OOFA 3D5QA 4E31A 4IM7A 1NR1A 1TT5B 4FJ2A 1ZMTA 1DIHA 1A27A 4DBZA 5JMWA 2FN7A 4PVDA 5I7VA 4B4WA 5TNXA 1DB3A 1K0UA 4RVFA 4X54A 3S2IA 3E82A 4D41A 1E6EA 3UXYA 3RUAA 3INRA 3C24A 3U4IA 4ZN6A 2DPGA 1UDBA 5L51A 3ITDA 4FPXA 2EKQA 2E37A 1C3VA 3U4DA 1ULUA 3KRTA 4GL4A 4GVLA 4DIFA 5L7WA 3ONDA 3DQPA 3TWOA 1CERA 1ENOA 1RM0A 2PA3A 2EW8A 4AJEA 5JCXA 2PD6A 3PYXA 2X58A 3WICA 4CMJA 1PGQA 3B20A 4H16A 1EK5A 3GFBA 2P4HX 3WNQA 3P7MA 3H9JA 1U28A 3ONEA 4JN6B 1VL8A 3RUFA 1EK6A 2O3SA 1SB8A 3FSRA 3TSCA 1QYVA 3K2BA 1J6UA 4OJNA 3MOGA 4MVJF 3M6IA 2P5UA 1W8DA 2NTVA 2WYUA 2YDXA 4BGEA 1YWGO 3TOZA 1RYEA 2NTJA 4A2CA 1XHLA 4FOOA 1JQBA 3WSVA 4G81A 2C7VA 1WZIA 3RC2A 1GYPA 3F1LA 1HSZA 2Y67A 1IYZA 3A06A 4RLSA 5H82A 4ALNA 5ILGA 1HZJA 3ASUA 3OJFA 2Y0CA 3PJEA 1E3LA 4XYLA 1QYWA 1T2DA 1DOHA 1B8VA 1R4NB 2VHWA 3TNLA 4C7KA 2WD8A 4IJKA 3WMXA 3UN1A 3NT4A 1WWKA 2EGHA 3GGOA 5KWEA 1SNYA 4Y6RA 4OQZA 4NDNE 3TFQA 1T1SA 3JYOA 1XU9A 2I9PA 2IODA 5C7LO 1M67A 2Q46A 2B5VA 4ONEA 1EDOA 1KC3A 2WMDA 4YA6A 1LA2A 4XIJA 1M76A 1YVEI 1EVIA 3RUDA 3H7AA 1GV0A 4IIVA 3OHSX 5B1YA 2VOJA 2QRLA 1JKIA 1WXDA 4S3MA 5IFLA 3LSYA 4M55A 2JCVA 1E92A 3L4BA 5EN4A 1KEUA 3GDGA 1U5AA 3CH6A 1JW9B 1ENPA 4W7IA 2YV3A 3DAGA 4YEDA 3KLMX 4ZGWA 2DUWA 2EW2A 1H6DA 4A0SA 4L76A 2FP4A 2ZYDA 2OBYA 4KUHA 3ADPA 3WOHA 5F1OA 1CF2O 4CUKA 3AU8A 3L77A 4PRKA 4U5QA 3WSWA 4B8ZA 2WE7A 2C59A 1I30A 1Z7EA 1VE9A 3WBBA 3CZMA 4D79A 5LDGA 1Y8QB 1A4IA 3G79A 4OIMA 1XIVA 2D2IA 1F8FA 4L4XA 3C1OA 3WQQA 4YT8A 3AW9A 3KSDO 1QRRA 2QRJA 3MEQA 1GEGA 3WGHA 1RJWA 3C85A 3U5TA 1UDCA 3T4EA 3BMQB 1B15A 4JLWA 4N7RA 4CMIB 4E32A 4Q3CA 3AUTA 2CDBA 5CAEA 4ND1A 1U9JA 3BHJA 1QORA 2GN6A 2P4QA 3D64A 1EDZA 1VSVA 5JCJA 3GT0A 4BO0A
chains in the Genus database with same CATH superfamily
1RLTA 2XMQA 5CFPA 4LXQA 2C5BA 2IFTA 3T5TA 2QEQA 2FOIA 1JEJA 2YWDA 3ZI7A 5HYVA 1B6GA 3T1YB 3OZCA 4INAA 4PONA 3QSYA 1PNVA 1DBVO 3K4QA 4KBGA 4PANA 4U7WA 2HCTA 1P33A 2BFPA 3K0AA 4JLJA 3FYHA 1BS2A 1GR0A 4GRAA 3Q9UA 4ARUA 4RKEA 3CW8X 4K87A 1BXRB 3U7QA 3VVCA 5I4KA 3SQNA 2BGLA 5BXQC 3DYVA 4I5FA 3ZDDA 4WDQA 4EW1A 1P44A 5JADA 3T7SA 3KZ1E 4UDXX 3THRA 3RVKA 4QTUB 4TYMA 5C8YA 4IOMA 3BTUA 1K4MA 2IP4A 1KYZA 1LUAA 1ZOOA 3ZZUA 3WGKA 1ZGJA 4FWTA 3MM4A 3PDUA 4JB8A 3FYDA 3ZWYA 4PIMA 3DKKA 3RPEA 4B3FX 2ZRCA 5FWYB 2NXCA 3TLGB 5KOIA 1TEHA 2B3TA 4QYXA 4XX1A 1SEPA 2GN1A 2FMXA 2H5EA 3D2AA 4BGUA 1DAHA 1W1WA 3FTFA 1Z34A 2FPSA 4UU7A 4ZC8A 1MQSA 2X4GA 4UVIA 4HDRB 2GS9A 5G02A 5TQ0B 5HVNA 2HV9A 3IAM6 3SJ7A 2XADA 4G4SO 1HMYA 4DDVA 1HE3A 3MTBA 2ZK7A 5KYYB 3EFOA 4EKDA 4UPDA 1G20E 3JQBC 3ZVKA 1E1NA 4WK4B 1E4YA 1N0VC 4H6XA 5LBIA 2QR3A 5JXWA 3VDMA 4KIWA 4BNJA 1YF3A 1E9RA 3DR5A 3FLEA 1Y5MA 2I0FA 2QXTA 5KYKA 2ACKA 5AM4A 4WJKB 3UWDA 3V3TA 2ZIEA 2IPNA 1QGUA 2C07A 4EJMA 1QHHB 1MDFA 4EFKA 2PMKA 4LKRA 3SDBA 2BHLA 1E2NA 3B1FA 4YTEA 1YB5A 3CE6A 1IQ0A 3AJEA 4L5BA 4B7UA 4IBOA 2HRCA 3L4JA 3TX2A 3ESRA 1KMNA 2GSWA 2WHQA 3JQFC 4N5IX 2IDKA 3WJAA 3KK0A 1Z5GA 1KQPA 2BGJA 3BRCA 3FWKA 4GG1A 2C2GA 4HUJA 4Y2UA 3PDCA 4YP1A 3T3EA 4MW9A 3QY9A 2WA2A 1FYFA 3L6RA 4IEIA 2QLLA 3CC8A 9MHTA 1T9AA 3FJOA 3MCZA 2DFVA 3DE3X 4OMFG 4Q1CA 1U3UA 1NXQA 1NYRA 4C7OA 3T94A 1DE0A 2NVUA 2F7SA 2QRZA 2PD3A 3W2HA 4L9SA 4TV8B 2R8OA 5CD1A 4WDRA 1E7WA 1HE8B 2WIGA 2PBRA 1Z16A 2I1LA 1TCAA 3A9TA 3SM9A 4A6EA 5DTIA 2O8NA 2SHKA 4LHSA 5IXJA 2P9JA 3CU5A 3R75A 2ODWA 3AKDA 3GJTA 1AZLA 4QOHA 4TPKA 4KGZA 5A03A 4L8GA 3X1MA 4J9VA 3V7YA 2RH5A 3DTNA 2J9YB 1TEZA 3KPVA 1H5NA 1T6ZA 3TAUA 2B4AA 3L0OA 1OMOA 4HN9A 1T0IA 3A8TA 4MCJA 4QOFA 3SXUB 3S2ZA 2GZ2A 3CEJA 3FTPA 4M0MA 3V9AA 4QJIA 4IDUB 1SBYA 1PR2A 1OWLA 2NT3A 3FCXA 3M9LA 3OWXA 1OJ7A 3MGKA 4JGGA 1E89A 3OIVA 3S70A 3I32A 2W43A 2ZIUB 4IRXA 3W6UA 1M5UA 2ONKA 3WKCA 2AKAB 3F9CA 3TO5A 4AO8A 3PUJA 4EY6A 4ZOAA 3H5TA 3HXOA 1E69A 4M38A 1C7ZA 5KQMA 5CPFA 5K0CA 3HR7A 3SC4A 2PWAA 3TD2A 4DEYA 5DXFA 2XB2A 1SC9A 3OP1A 1Q7EA 1U9ZA 3ETDA 3FIJA 5ICSA 3JPWA 5DNEA 1I6MA 5T6MA 4CLXA 1SEVA 5T5QA 4HDQB 3VV3A 2GTIA 1LNZA 1ZQ9A 4L4ZA 2OORC 4XDYA 1P2VA 2ZU6A 4G1BA 2P11A 4PO9A 2QRVB 2G1JA 1GZ4A 1IY0A 1YCDA 3S2SA 1YB2A 4Q4DA 3MW8A 3B6KA 1AK9A 3NORA 4LXIA 4N41A 2EZ8A 1C2YA 2DJ5A 2FPRA 3O7MA 1CJVC 3IEXA 4JFAA 4YJDA 4G1MB 1TTTA 2AEJA 2NZXA 2Y05A 3DDUA 3G0BA 1GKYA 4AMGA 1OROA 1KSGA 1G1MA 4RTOA 1UEJA 5SZIA 3L0YA 3ZJ5A 4PC7A 4N7BA 4E7OA 1O6CA 1AKMA 1QQ6A 2H5IA 4P0TA 5DM2A 3VC1A 4BVJA 2F8TA 5JBIA 2Z09A 9LDBA 4UDOA 4O1MA 1F4VA 1QUEA 5F2KA 2RH4A 2WP8J 1YOVB 4BVFA 1OXUA 4B71A 4YAJA 2FSPA 4NPHA 2WEKA 5E6RB 5ALZA 2C7OA 4GPD1 1RMQA 2MJLA 1F4PA 4FZVA 2RG1A 3KG2A 1P6UA 3RVQA 2WQZA 3VR4H 3WFIA 1MAAA 4ES6A 1R8QA 4F60A 2IVZA 5EEHA 3OTOB 4E0BA 2GJ8A 2YIVX 5LL6P 4HTFA 4YC7A 4KAJA 3K9GA 3M6FA 2WAOA 3CTPA 3QMVA 4PZDA 5DCWA 2XMBA 2W42A 4QAJA 4Q6BA 4E1VA 5KI6A 2UYYA 3GVHA 3RAFC 4NOLA 1E7SA 4F8YA 2XR1A 5BYAA 2IZ6A 2FK7A 2ZCUA 2B99A 3K94A 4CKWB 1IXRC 3SX4A 2B83A 4B9AA 4RVNA 4ITUA 2VA9A 4YJFB 4HNUA 5HXAA 4F3CA 2PUWA 5E2BA 4P35A 5IC6A 3RYHB 3EZ2A 1D2RA 4A7PA 3LHDA 1B8UA 1Q15A 4AU1A 4PYKA 4C30A 4UXIA 1BO6A 3KPYA 2N1MA 4P7JA 4DUPA 3PC3A 2WFLB 3M1AA 4D5EA 4FD3A 1A7AA 4ARIA 1CRLA 4R41A 5AW6A 2D2VA 3QX7A 2AMLA 3JAMA 3R7WA 2F55A 4Q7JB 3C3BA 1CU1A 1FVXA 1V6SA 2ZRKA 1RR6A 1M72A 4OQ4A 5IKEA 5ECWA 3WLAA 1OA1A 2QRUA 1ECCA 5FQOA 4L0CA 4MWTA 4XSHA 1C5KA 1I2DA 1X9IA 1TYAE 2GKSA 3F5SA 4Z49A 1KQOA 3DUFA 1RKUA 5LQNA 3SYRA 1FJGB 1PZFA 4CLDA 4YFVA 4QOSA 1ISSA 3GELA 1V4NA 3NHZA 1U5BA 2RBKA 3R09A 3P9XA 2AFIE 2G71A 5EKUA 1BJRE 3CVVA 6ADHA 3VXKA 2AJLI 1IQRA 1BIFA 4MHTA 4KXVA 5CVEA 2A6PA 4DLXA 3F96A 2X2FA 1ZINA 3P9ZA 1ZW1A 2C29D 1PSZA 3G2NA 4RPGA 4ETNA 3PQ6A 1CYDA 3LG2A 5EP2A 3DCIA 5FF9A 2P30A 1BWSA 1E1QA 2O7VA 1F14A 1M8JA 1Y81A 5E2IA 2WUVA 1U1DA 1ZOPA 3AC0A 2YMQA 3P94A 1ATIA 4J7XA 4FFPA 4ND5A 1N2CE 2IZZA 1C1XA 1YR7A 1U8ZA 2OESA 3BXFA 1SCKA 4DGQA 1JR6A 5HILA 2DQZA 2CBXA 3DC2A 2LDXA 4PLPA 1QYDA 3HDQA 3N86A 1IIBA 1H8HA 3UM9A 2HCJB 1QHGA 1FRQA 2ZYAA 3KTFA 2VNKA 4YQZA 4WUVA 2Q3HA 3KWMA 2HRZA 3AKCA 3I3OA 5HQJA 4Q0MA 3FWYA 3H97A 4EITA 1SVSA 3I01A 3O74A 4JOCA 3MSCA 1E8NA 5CNMA 4YRQA 2Q5CA 3DHNA 5DYTA 5DHUA 4TZ6A 2P0AA 1CJUC 4MB6A 4EGSA 2FF5A 1QF7A 1CDEA 4JK3A 4ETWA 3VNUA 1NYTA 3DE6X 5GAJA 2XEXA 3VM6A 1A5TA 4KPYA 1SKAA 1Z5OA 3DEAA 1JB1A 1P3DA 4MKGA 4EY8A 3RT1A 3UFXB 2PLRA 3PBKA 3BD8A 4PNPA 4EW3A 3E3AA 1NMEA 1VIVA 1VLQA 3LQ4A 1AMOA 2IHKA 2LZ0A 1CP3A 1THTA 1Z3CA 2OPHA 1L7AA 2YOHA 3OUZA 5A06A 4MGYR 2GCPA 3ESYA 3NQ41 1QRDA 2C3PA 3B12A 3IAEA 3LXXA 3RSHA 3RV3A 2CYCA 3ACBA 1Z36A 5DK6A 1VJ1A 2PGAA 5DV9A 4D9GA 1GP2A 4TKUA 2VYND 4QT0A 1I10A 3LHIA 4AS2A 3NUZA 1UIRA 4MV9A 1FSZA 4DCUA 4EYQA 2NZUG 4F2DA 5JJ5A 2AVDA 2X5NA 1IM5A 4L6AA 1XWIA 5CEJA 4IFBA 1Y5RA 2WFMA 4L02A 3TGPA 1R0SA 4ZEMA 1OBCA 3LL7A 4DCOA 2CLFB 4CF4A 1XQ9A 4FFBA 1XZLA 1NP3A 2IYRA 4U9HS 1KZ9A 5HEKA 2Y1XA 4QTZA 2ZYRA 3NBMA 3VO8A 1IVYA 1D1QA 4KVGA 3KHTA 4AKTA 1V7QA 3T3NA 1KERA 5IAEA 3L06A 4B1FA 4DVGA 4K26A 4ROTA 1XZHA 1XELA 1OBOA 1P6XA 3O3OB 3OF2A 4B87A 2GN0A 2SKEA 2X5XA 5HZGA 1KYIA 2PKEA 3ZWDA 4CDMA 1J1UA 4RWZA 1U7WA 1NT2A 1C9EA 1QGOA 5JR3A 4NFYA 4QBKA 3AR5A 5C8XA 1KDZA 1E6MA 3DOUA 4U9UA 4F1JA 4FMCB 3THYB 3BE4A 2PV7A 4OMUA 1DBIA 2QAGB 3IP1A 2ZE7A 1P7WA 4O4JA 4AP9A 5C37A 1YFKA 3EZNA 1JR2A 1UC9A 3V00A 3V55A 2AF3C 3BL8A 4ADSG 3HR4A 2YWHA 1F9AA 4MROA 1JXAA 2QRPA 3GFSA 5DLPA 1UK7A 3AJDA 2VP4A 2HIHA 3PI6A 5CP8A 1UZLA 2FFAA 5FL3A 4NV3A 4S1OA 1R4MA 4CN8A 3ADKA 4C01A 3ND8A 1FTNA 5IBRA 4CQMA 2NU6B 5HHTA 4KQFA 1E6KA 4MWOA 5E3IA 3ZXXA 1ZI8A 1CUSA 1E61A 4C08A 2EFJA 3TLXA 3IQXA 4Q01A 4Q9DA 3QYAA 4GF5A 3KQYA 1ICEA 2DKFA 1KP2A 2YMPA 3HUDA 3IVGA 3N8KA 4PAGA 3SJAA 4CW7A 4XE5A 4BB0A 2WWIA 5CG1A 3DJFA 2DTDA 2HSZA 4K0KB 4B5LA 1L4GA 3LY8A 1DGQA 4RQUA 3PFFA 4XUDA 5AVSA 5FTWA 1ORTA 3GEMA 1AGRA 3O4GA 5GY7A 1LPNA 3GD5A 4J6FA 1XD2B 3EBPA 3IEIA 1KZ7B 2QW8A 3GWZA 2L19A 4NMHA 4CT0A 2AZXA 4EG1A 4X1YB 1NBOA 3SEAA 4YRKA 5JAMA 2PWBA 1M0EA 3DMNA 2X9LA 4DR1B 1XVUA 4FXPA 2VJKA 1DKPA 5L9AA 3W1WA 2QGZA 3F9RA 5KDDA 3HDYA 3JQ8B 4YPOA 1N5KA 1TYBE 2YXEA 3H87A 2VT3A 5GM2A 2UDPA 3RYFA 5BSHA 5FI3A 1K5DA 2RHJA 2WKPA 4XYEA 2EAUA 5FNVA 3T99A 5GZ1A 4FFWA 3U3DA 4TS1A 4LWPA 4WD3A 3O8OB 4UAVA 2XUZA 3WL3A 3F5FA 5CXUA 2RGGA 2IH4A 4JP2A 4LGVA 3BXHA 1B8PA 3IDAA 5EE3A 4M1ZA 1KWGA 1AUPA 1E1MA 1HLFA 5ALTA 4HH3C 1PDWA 4DLAA 4TLCA 3R9KA 1MW8X 2X40A 2FJUA 4RMIA 4BX8A 1JECA 1TCUA 3F8SA 3I5YA 1UBKS 4UULA 1JFSA 2PTHA 1VTKA 4X8LA 3TIFA 3UJCA 3FBTA 5CJ2A 3S0JA 5CDFA 1KYTA 1QDEA 1XTSA 3OOYA 4R9RA 2EP7A 2CLDX 4JOSA 1JA1A 4JIGA 4U7FA 5TARA 5JXIA 3U7GA 2XDQA 1L4NA 2NSJA 3EXFA 4HLUC 5I7EA 1Y1SA 3KVOA 1Q0RA 1E5TA 1YR2A 2WD7A 3T1TA 2GPNA 2EU8A 2F59A 2PWYA 4NU5A 1ZHOA 3F49S 4HVAA 2PBFA 1N8NA 2BI7A 2QTVA 4G2TA 2PKRA 1IAQA 2WDPA 1U7UA 1D6SA 1R6DA 2VPTA 4M49A 1DWUA 3E0QA 1YVPA 3QVTA 4UM8B 3KZMA 1YD7A 1H23A 1K7EB 1KR5A 1JTEA 1Z2DA 3IE0A 4Z8XA 4DDWA 2J9FA 5FL7A 4KH1A 1PV2A 5I45A 1U4SA 1Z6TA 1NMYA 1LLDA 1EQ2A 2HMUA 3GGSA 5CVTA 5EIEA 5CX1A 4N5NA 4DLBA 1LQ2A 3I9JA 2A1UB 3GIWA 3V4PB 2P9YA 2R5WA 4NYIQ 2H2GA 5T8KA 4BUCA 3FRJA 1AHPA 2FRDC 1TI7A 3WKBA 2IOFA 5JNTA 4MV3A 1XQVA 2QG4A 4UHHA 2C4NA 3NOOA 4CCYB 1PUXA 1C4OA 4NQRA 3UTCA 3L0DA 3PSAA 4K7JA 4DNXA 4ETMA 4XWGA 4HFMA 3RJ9A 2JDIA 4W7HA 1XA4A 3DLAA 3K53A 3WLNA 4C89A 1YRLA 1CDDA 2CT8A 1P7PA 1XJWA 1J1IA 3PIIA 2ZYIA 4QO7A 3T9FA 3RBAA 4M36A 2V65A 1V3QE 5CBKA 4ZI3A 4TMTA 5BN3B 5DHRA 3C2QA 2R8YA 1FP1D 4B8YA 4NBRA 1E2IA 1W7AA 5KTNA 3B82A 2JCGA 3AR6A 2EQBA 3DCNA 3H6GA 5EZ6B 5EIBD 3F47A 4C7VA 3JWGA 1AKTA 2W6CX 4RE5A 2BFDB 3EFHA 4DIEA 1WU7A 5JAIA 4OL9A 3TQCA 2C0PA 2IT1A 1AA9A 2Y1DA 3RRYA 1XPJA 2HGZA 3LQFA 1EVLA 1VFPA 1DVRA 1J2YA 4ZV4A 2ZXEA 1U0BB 1N57A 4AJ1A 1DEXA 3F7MA 1GWNA 1P3Y1 1LK0A 2OO5A 4DR6B 4YIHA 1K92A 1NRIA 4BFVA 1VKOA 1IBKB 2Y1EA 1E2FA 2HA6A 4UAGA 5JRJA 5G1OA 3B3FA 5BMVF 4AKGA 5JYDA 4V0OA 4BMVA 4MV1A 2EBUA 3PWKA 1NASA 1DRKA 2Y27A 1K68A 3DFMA 4BFWA 2SCUA 1X0XA 1N8KA 2Z2YA 5I7WA 2OP0A 1JI3A 1PJ8A 3LFUA 4FOPA 1HETA 4A3SA 1LZLA 1NVDA 3G2IA 3JQAB 4K9MA 4XLLA 5DTJA 3T9DA 2EF0A 3FPHA 3KWFA 3HM9A 3RUIA 5DBGA 4MARA 3RREA 4XGKA 4EX6A 1Q1GA 2C95A 2G83A 4QG7A 3KKKA 1O9GA 2XIQA 3ASYA 2X1HA 2WT8A 4WK6A 3WLEA 5JQWA 2G4LA 2EVWX 2ZAYA 1IJBA 1YS4A 4CI9A 5FFNA 2WM3A 5IM4A 3TLYA 3UAOA 1JHDA 3DWIA 1B6RA 3HCDA 1SC1A 3BH6A 3ENVA 3MTQA 4FYJA 2OD7A 3ZEAA 4FBLA 1W88A 4S2EA 2WU1A 2R2GA 3HN7A 2XMDA 1TF7A 1Y3HA 3T3HA 2ZRPA 3FFWA 2B61A 1V2HE 4LZNA 5IH3A 4PEVA 1T13A 3TMYA 3BCHA 4QXPA 3QZUA 4N76A 1KKUA 3PPWA 4IIXA 4O2BF 4WBSA 1VRWA 2FZGA 1S7GA 5LQAA 3GT3A 2PZFA 3ZWNA 4OSOA 3MMSA 3BFVA 1ESZA 1UT8A 5DBIA 2X13A 2ZSUA 1P9NA 3F5QA 5L45A 1IN8A 2O54A 3GCGA 2Z5FA 2BFAA 5DIZA 5F1PA 4C0XA 3LT1A 4P4LA 4ODIA 5CEEA 5HSGA 2EGGA 4GR5A 4EW6A 3IH5A 3U7RA 1NMZA 2C8VA 4Q1VA 4CTJA 1U1EA 3DQZA 3PB3A 5DLDA 3HWSA 4PG7A 2NMVA 1Y1PA 1APBA 3JAKA 2NGRA 1XNHA 2VYFA 4C43A 4CLHA 2A58A 3NWEA 3U60B 4QSMA 1FNSA 1V43A 3RLFA 2PR2A 2GHRA 3DLIA 1AKWA 2QN1A 1POWA 3U6BA 4QM7A 1SMKA 5KYNA 2FX3A 1M8PA 2Q3CA 2VDUE 3GJ3A 5EMHA 2XKKA 1HQDA 4O02B 4PZEA 3LX8A 4D0LB 3GF4A 2MDTA 1L4BA 2AA3A 5ADHA 1U0FA 1N2JA 4F21A 1F5SA 1UAGA 5K5EA 4N3NA 1QGZA 3SYTA 4BIIA 1SG0A 4EPXA 4YROA 4L50A 2G8NA 1XG5A 2VRCA 2ZYSA 3AETA 1FLAA 3DC7A 4LSWA 4BX9A 5E9WA 1QWSA 4DDUA 4UNPA 2GB4A 3W5DA 1P39A 3AXTA 3P1JA 1RPNA 4M21A 3J7AC 2VJMA 3IQDB 1P72A 5TXGA 5T4EA 2JZOA 1DRJA 2QL7A 4Z7NB 4BAUA 4JB0A 4PFKA 3T1OA 221PA 3L0SA 4IWYA 3JQRA 3BDVA 1E0DA 2YWXA 5THKA 1D2HA 4ZDIA 4KPFC 1B14A 2P91A 1OAOA 2QVZX 2V96A 1TZ2A 1BGXT 1V7CA 2INGX 2VN8A 2W8ZA 1Y5NA 3DTVD 1OHHA 3G9XA 4HEHA 4JP1A 1DMRA 3DZGA 4PCAA 1NT4A 1SQ6A 1Q5PA 1U3TA 3RHFA 3HY3A 3EIFA 4GHWA 3P2IA 4BO2A 2BMEA 2LV8A 1SPBS 4OOEA 3AF5A 3NBFA 1IBRA 1DWPA 1CHDA 3Q0TA 5DHPA 5A71A 1D03A 2FW7A 2H5JA 1E4EA 1PJZA 1YZHA 4FS8A 2QRMA 2ZIWB 5HM6A 1RRVA 5F9FA 2YXDA 3PC4A 3DT9A 1TK2A 1U3DA 4FD2A 1DEAA 2V45A 2QM7A 4XCQA 4FGUA 4BGVA 5IBCA 2D1FA 1BN7A 3ZR4B 4AF8A 5MF6A 1M6HA 1L3BA 4YCBA 1CY8A 4C1NA 2QTTA 2PX5A 2WIJA 4OV6B 3GT4A 1FBNA 2OC9A 4RORA 4ACBA 1HYHA 1MC8A 1VLVA 5GM1A 2RHRA 2FXIA 2GZAA 1HQYE 2QMEA 5LB2A 3MUFA 4ZK6A 2O3JA 1HOXA 1PL8A 5JNVA 4DV0B 4QU9A 1LSJA 5E9QA 2FW8A 2VUUA 1LXCA 1ETHA 3WKEA 4ABTA 1QFMA 4RZUA 3IMCA 4NAUA 1KBOA 3TYXA 3BXZA 4Z0NA 4PX3A 1V5EA 4E4TA 3C4JA 1MO3A 3O95A 2A2ZA 2QZ4A 4QGFA 2NYVA 4A23A 3J81A 2PLAA 1ZEMA 3VVMA 4EPWA 4WZ6A 2WIKA 2YY6A 3BAZA 2O59A 5F4BA 5C1DA 3W8RA 4DCGA 1TUGA 2J30A 1ZIOA 4GU5A 3N5KA 1J0DA 3NANA 1VHTA 4C7BA 3F6EX 3LRTA 4PRZA 3DMTC 2Y2VA 4I1IA 3SIRA 3T0IA 1R6VA 1JS1X 1LSSA 3IMFA 2ZQZA 3EEQA 1JIJA 3RYFB 3V6LA 4ZVTA 4DN6A 4OI1A 2D7DA 2MSNA 3MGGA 3HVIA 4D0GA 3GZJA 2C42A 3CLSD 2CJWB 2QQGA 4Q1AA 4G26A 5A3VA 3HFSA 3ZDEA 3ICQB 4ER7A 3ZCRA 1AZTA 1UAYA 2R4UA 3GRPA 3P5SA 4G9EA 1GU0A 1KGDA 1SBQA 4YO7A 3UATA 4EMTA 2PL1A 4K9PA 1QJ4A 4MRMA 3T5MA 2OCAA 3WQHA 2I2XB 2Q1WA 4OHVA 3RTGA 5JH7F 5KC9A 1T5TA 1NUQA 1WAMA 2YWGA 3DBRB 2PA0A 2QJRA 2ZI4A 1QZTA 2ZTSA 4GMDA 3IGFA 1C7EA 2WRZA 4ID3A 1P4HA 1N6PA 4RA9A 5PGMA 5TPZD 1PZNA 4PNHA 4BQSA 1J2JA 3C4VA 2WWXA 3LCCA 2ZPAA 3Q7QA 5TEWA 3C6KA 5B57C 1U02A 4R54A 2LDBA 4CV1A 2QGNA 3BWXA 5K8VA 3DVLA 3FNGA 2AD1A 4PNZA 2FSHA 3G7UA 3EDOA 4KJZA 2DFLA 4OXIA 3BRQA 1CY7A 2VI5A 1Y9JA 2HK8A 3EGDA 4L7VA 2Q2QA 2C61A 1V1RB 2W70A 1YDGA 2H2FA 5EUQB 3L8MA 1L5HA 1TU0A 2V5AA 2W2KB 2WR8A 1PQWA 1GQOA 4LE0A 2RI6A 4RH0A 3O73A 4FYPA 2GF2A 2H4WA 2ZT6A 2X23A 5F3RA 4Y6OA 1NMQA 3CCBA 3H8JA 1UBCA 4Q24A 4MW7A 1HLDA 4TUYF 1L7RA 1EBUA 1CKEA 2FTKE 3A6GA 1UODA 3GL9A 3I0ZA 1MJFA 4CMHA 4PNEA 3MINB 1H69A 4UU1A 3QEAZ 2Q99A 3PHBE 3ZBPA 1FNNA 2AUNA 3RSCA 3B6IA 4TLDA 1MGPA 4JI4B 5CA0A 3JX9A 1Z38A 1QK4A 3HBJA 1RABA 1O0CA 1OV4A 3ANTA 2C9ZA 2ZETA 4V0ME 3NVMB 5DX1A 2BZ1A 5AM1A 4KZKA 1BHJA 4KNWA 1Z35A 3INTA 5IVPA 1SKYE 2RH9B 2X0FA 4P4UA 1M2FA 4I4CA 5B7QA 4KMMA 3OQJA 4C0HA 1ECLA 1MW9X 1Q0ZA 1FDUA 4DYDA 2HEGA 2H4XA 1LDMA 1B00A 1PR4A 4JQCA 1RI5A 5FTMA 1NW4A 1IMJA 3PSHA 4HQLA 1THZA 3JD3A 3ISJA 2WMYA 3TDNA 3GLRA 3DVQX 3N0VA 3LF2A 4I9HA 1XYGA 1U8TA 2VH2A 4IGEA 1W36B 3TF5A 1EVJA 5C4IA 4H31A 2ZAIA 2P5TB 4YONB 1O94A 3F5MA 2XYRA 3GFRA 4KQMA 4FINA 1GQSA 1CQPA 1XTKA 2GO7A 3WQRA 5CNKA 3WFJA 4AKEA 1KFBB 2AG0A 2FPWA 3G0CA 1AS2A 3D02A 1IN4A 3A3YA 1X7YA 1YS7A 2ZWAA 2V7WA 2I8LA 2GKGA 2I99A 1NBWB 1LSUA 2XMRA 4NENB 1T24A 2GXSA 2NYAA 2QU7A 3VPGA 4OU5A 2QKYA 4UVHA 3QJ5A 2HOQA 1MNQA 2IIQA 1SVOA 2PZBA 1KAEA 3C1TA 5KQRA 5LP6F 1QOZA 1VRVA 3LX4A 3OCYA 5B2EA 3SLKA 1NXOA 1O95A 2F3PA 2VH5R 1CNFA 3JATA 1CVLA 1A7KA 4Z99A 3M0EA 2V6JA 4J0EA 4XIYA 3PD0A 1KQ3A 4IZIA 1U9YA 2VTDA 4JC4A 4P3XA 4Z1MA 2GFIA 5BOVA 5BT8A 3FOZA 1WEHA 1EFKA 1YO6A 3ESXA 3PC6A 4IJMA 1JBKA 3ZDBA 2ZG6A 5AK6A 1TJYA 1BX1A 4QELA 1RI4A 4JELA 4MEJA 4PHCA 3LBIA 1P2SA 3LYHA 3CLVA 1XDZA 3QKSB 1K63A 1EFCA 4LZLA 3HJRA 3RNOA 1XTQA 1PFGA 1W5EA 4FONA 2WJPA 1AS3A 2G07A 1RFGE 4OXKA 3OEHA 2A9OA 2CJXA 4NF2A 5T3UA 3EGOA 3CLRC 3SZRA 5BUQA 2XE7A 4U2EA 5ERXA 1JPJA 5F64A 1Q22A 1M73E 4GMFA 1AXEA 2ZE5A 3BJEA 1PDVA 1I24A 1BQ3A 2C2BA 2Q21A 4MVWA 4PC6A 5B37A 4Z5XA 1WRBA 1SKBA 3K1YA 4EJSB 3I6ZA 5EMJA 3SJBA 5JJBA 3KXDA 3R0XA 2W6ID 3BS4A 3OLVA 4MUEA 2XHZA 4XRGA 1T6NA 2DCUA 1SULA 2RARA 2MTBA 1UKBA 1JL3A 1PJAA 3GN1A 5LD2B 1EP1B 4AY4A 4RGVA 2CVOA 4FGZA 3VR5A 2P3QA 1ZH6A 4I5DA 5M34A 1RPAA 1ZZEA 2C9CA 1V5IA 5LA6B 1XZNA 2VPIA 2IUSA 3CUUA 1XLTA 5EYPB 4C0KA 4F45A 3G2QA 4KVAA 1Q0LA 3N2EA 4TL7A 2P65A 3JTEA 4HQFA 2EV9A 3TJZA 2C54A 3PNPA 2NZ2A 3TI7A 4W5RA 2ZR8A 3DM5A 3QE2A 3CUYA 4OQEA 1JG1A 4IIJA 3GJSA 4A5OA 1MO6A 3RC1A 4DPMA 5IKMA 3IXMA 4ZRMA 1O58A 2R96A 4EUFA 1EVEA 2XVYA 3EGVA 4MEAA 1UT6A 2PKQO 3ORRA 1TIKA 3UOWA 2V7TA 3BMCA 1UDAA 3VO9A 2JJMA 4DLWA 5I9LA 2HQRA 3DEYX 3IP6A 4HYQA 4F3RA 1G21A 2LKCA 3L7DA 1E8DA 2J7PA 4IIUA 721PA 5ISMA 4CUJA 2O14A 1BFUA 4DHWA 2HO5A 2F3QA 3X1WA 5GTDA 3CMCO 1NA5A 1KFKB 5AVXA 1S02A 1IOVA 3HVUA 5BPHA 4Q9KA 3WLJA 3OCCA 3R9IA 1KYQA 4R2LA 4BY9E 1VZ3A 3AGQA 4C0JA 2HCRA 2IUTA 1H2HA 1TDJA 2IITA 3DS8A 5AMXA 4LYGA 3GUYA 4RHYA 4JXXA 1U81A 1OXKB 1X80B 3BEDA 2N47A 3S6JA 2Y66A 1XTBA 5HTKA 1DWOA 4NFHA 2HAEA 3NT5A 4ZVPA 1HK7A 2QTRA 1R10A 3PJFA 1SCBA 4AMBA 1R0WA 4DXDA 3VSEA 3R3VA 2YW9A 2Q5FA 3GZNB 4URXR 2IHZA 4R83A 3HK2A 1JEOA 1BRTA 1ZRMA 2Q50A 1J0CA 2HYDA 4JXKA 3OPNA 4NCKA 4AWXA 2D00A 3LLVA 2Q2NA 4LISA 3WX0A 3TQQA 2BMVA 3GLIB 1DJOA 3UMGA 1XYYA 2OFWA 2Y1WA 1XWWA 1XJ5A 1BWRA 1D4OA 1FRVA 4ND3A 1FDIA 4D4HA 1VYTA 2PT7A 1CQJB 3SY8A 2HV8A 2X8AA 3QPUA 5JRDS 3II6X 1C50A 2A0XA 4YRFA 3AK4A 2DBVO 1UP4A 2FRVA 3OIDA 4X1KB 5IN4A 3EEIA 4PZLA 3DAOA 1GADO 2WM9B 2EZTA 4KYVA 4YT5A 3TSAA 2YMLA 3RD5A 3OICA 4FQ8A 1A97A 5AYVA 4BBAA 4BVHA 2A30A 1V1JA 3UGQA 4BJHB 4AQYB 1FU7A 2LIVA 1MQAA 1EJ6A 2TYSB 2EKLA 4L5AA 4Q4JA 5AFSA 3U4QA 4QUGA 5AK5A 2C4WA 4AY3A 1RRGA 1VG8A 1Y4SA 2HLNA 4GOLD 3CNEA 4UZSA 2QD4A 4NS4A 2IE0A 5AJUA 2HMVA 2WFAA 1M6VB 4IY1A 3LL4A 4H7PA 3AFGA 5E1OA 2FW9A 4MRAA 3N75A 2P0YA 4HP8A 4PC3A 4TM8A 5BNWA 1LJLA 5GONB 2KS6A 4UVEA 2CCKA 3QUSA 5JVDF 3E5RA 4JBYA 2PRSA 3LC1O 1IHUA 1A5SB 4IWXA 1XRSB 3HLYA 4GZMA 4EG7A 5ES4B 2XXAB 1K5GA 4MQMA 2PCLA 2FPGA 4ND8B 1Q57A 4U02A 1MO2A 3UKOA 3DXFA 3ANNA 5FEUA 5M04A 3DQQA 4RU1A 4UCQA 5AHRA 4O0LA 4URYR 1RI1A 2G28A 4GC5A 5AJTA 4ASUA 3WY9A 3HU2A 3ZHOA 4RCZA 3S29A 3LXUX 3JQBA 3OJ0A 4TS9A 1P60A 1VMKA 4LHXA 4BN4A 3KQNA 2DUJA 4I6GA 1E9CA 1WB4A 1DEHA 3ZZNA 3STHA 2IEIA 9ATCA 3VA7A 4K6KA 4MULA 3WDLA 2RJ3A 1SA0A 4Y1GA 2V7UA 3FSGA 2X5KO 3HVKA 1J0XO 2RJOA 3CNOA 1KAHA 3JD4A 2CDNA 4U6QA 4AN1A 5LR6A 4BHTA 2M6RA 3CO5A 3R24A 4ZYLA 5DYWA 2IYEA 1GO2A 3KB2A 1GL3A 5CJPA 1PFWA 3H1PA 4TZTA 4UUNA 1AQJA 2G08A 4LCEA 4RHFA 3EOAI 5J43A 3PDJA 1UOEA 4NYJR 3CG4A 4ROSA 2IX3A 3H2GA 2WV9A 4DR4B 3G9TA 4G5HA 1Y1KE 3UT0A 2Z57A 3FBGA 3JQFA 4QA9A 3H2BA 3L93A 1NHWA 2MYTA 3S8EA 1DADA 1VB3A 2NZ8A 4KH0A 1LBHA 1NI4B 5EXPA 3FZQA 5AOAA 2GUWA 1IK4A 3PFIA 4UBMA 1YI0A 1P4GA 3G17A 3QVGB 1FLVA 2RHDA 4PAOA 1DIGA 3HUFA 2KLHA 4IS3A 5IMSA 2YBDA 3TLAA 3TZKA 3GLGE 4RPJA 4GLJA 4Y2GA 5A0VA 4EDHA 3PCTA 4X7MA 2JGEA 1ZESA 3IOYA 1B0AA 1J0AA 4HT3B 4CLEA 4MYHA 4PQEA 5DBFA 1W4RA 2VHJA 1P5FA 2PH5A 3ORSA 1LI4A 2CEKA 2P6OA 3TRIA 1ZI9A 2VP2A 3MK31 4MX8A 1X2BA 1J07A 2O8CB 2PGNA 2ZSJA 3W5UA 5ICMA 4C76A 3AJ9A 2P6UA 5KNDD 3CX8A 2H6EA 2YWFA 3ST7A 4YWJA 5EJ4A 3GXOA 2WUFA 4TQAA 3IFSA 5FAXA 4XOUA 3OD1A 5IFKA 4F9EA 4RFSB 3C7AA 4OK3A 4URUR 4QBTA 3EVFA 4ZPJA 1Y7TA 4OJYA 2WWWA 4Q5IA 2AWNA 2R751 4ML3A 3TOCA 2K7FA 1O9BA 3D2BA 3E3NA 3H2JA 2HQBA 3HA2A 4P4NA 5ALVA 4YHBA 1K0FA 1MX5A 5HF9A 3UMVA 4F38A 3LBFA 2O8BA 1U6KA 4B84A 1K2VN 4ALMA 2PZAA 1I7DA 1PW7A 5A05A 1DSSG 3LPLA 1L8QA 2QVYX 2VJDA 5AK4A 1CJSA 1GPDG 2BWJA 2XCIA 4WLNA 1XDBA 5BVHA 1C0IA 1N2SA 3HCAA 2EYUA 2RGDA 4BN5A 1EUYA 3WGTA 4PLYA 2QSJA 3OJOA 1UBEA 2OORA 3TUZC 2XBMA 2JKZA 2XPCA 3KYCA 1IPEA 1W19A 2DOKA 4V0QA 3RTAA 3TNFA 3ABZA 5AW3A 2PQ6A 4RSMA 2VOEA 4HNAB 1QIMA 5AVRA 1UBHS 2ZJOA 4D5GA 1I3CA 3AHEA 1XK6A 1J7KA 5AJZA 4EZEA 2I4MA 1YJXA 4HNVA 3DDZX 3I72A 1RZRA 4WAUA 1OU0A 2XUPA 3MWDB 4O4HA 3D3KA 3EVZA 5SY4A 5IYZA 4TZ0A 4MXDA 3O7WA 5IH7A 1H2RS 3T7RA 3UCXA 4MUMA 2YXBA 4BE9A 1JB9A 2GCEA 3WGMA 4GR4A 1D4ZA 1F2TA 1P29A 3V4ZA 1X1CA 5F5NA 4RDHA 3W77A 3OC6A 3MYYA 1J4AA 3DE1X 4QOIA 2V0GA 1VYVA 3LGXA 1WOYA 1SIOA 3NHPA 3P52A 4R2JA 3DFKA 3KUXA 4CTMA 5I51A 2BTOA 2GPAA 4D8VA 2QG6A 1O2DA 2PCJA 4PTLA 5J1TB 4Y67A 5CW1A 4EF6A 5CDFE 4EYOA 3KUUA 2HF8A 2LPMA 3TKAA 4E94A 2AFHE 1N7JA 2GTPA 3GDOA 5CT5A 3V4VB 4JWKA 4WBNA 2FR8C 2ETVA 2IEZA 1NOJA 3O94A 3MWKA 1TMGE 1DG9A 1V0JA 5HJ7A 2ZJYA 4LRTB 4OLJA 4QICA 4XUGB 3RAEC 3DKIA 2W90A 3B1XA 3AI2A 1YONA 1JI0A 2NO9A 2WYHA 1HTBA 4QJ5A 2MSCB 2PX3A 1OLSB 1OW3B 1JILA 3FUWA 5IAOA 3GGJA 2GDJA 1ODIA 4INZA 2ET6A 3C97A 3FHLA 3W5HA 2W2LA 3JQGA 4RK7A 1WSBA 2B98A 3CZAA 3LY7A 4PLGA 3FDZB 1B43A 3G2KA 2RGEA 5I8PA 2NNLD 3K0KA 3C3XA 3K1ZA 3GLVA 4O2AB 1P4RA 4OHZA 4D25A 1JHAA 2H63A 1GRVA 5EGSA 4JLPA 5KOHA 2UU9B 1DO8A 4B4VA 4ER6A 1KE2A 1W48A 1JIKA 3B9RA 3R0IA 2BP7B 2HF9A 4HLNA 4AS1A 2V7GA 2BGUA 1U1GA 1WJGA 3JVDA 2IBTA 1N3IA 3DUWA 1VM6A 3D3WA 3PJRA 2DP4E 1OU4A 4QQ8A 1JSCA 1RJ9B 2ZSHA 2PR7A 2V6IA 3C3KA 1DV2A 1M8FA 2QMYA 4CEHB 3WGYA 1BU5A 1YJQA 3LV8A 5CYFA 3RUEA 1LDNA 3N3BC 4K6CA 2HGSA 3KE8A 4EQ6B 5J47A 1BEEA 3NEYA 5KTYA 4H18A 5T41A 1TECE 3KUDA 1M74A 1VSTA 3MOSA 2AQKA 2CFTA 3LUDA 1FP7A 5BW5A 5JI3E 5LZ2A 3MTEA 5BQOA 3FRIA 1IEVA 1K97A 3IPXA 2NU7B 2CZGA 2QA5A 3ET5A 3LUKA 5ALOA 3MVEA 3KL4A 3FAZA 2D8AA 1UK6A 1FDOA 1Y1LA 1G4HA 1FMFA 5IJ0A 2ZKIA 2PUAA 1Y63A 3IIMA 3LY5A 4BNTA 1MZPA 1TJPB 3QU4A 5JZ9A 1ZPDA 1W1UA 1E0JA 1BX0A 4LWQA 1PJ3A 3ZWXA 5A9SB 4QXQA 3H3XA 2HJGA 2WUWE 1SUCA 1QYXA 3IIKA 5A3JA 2B25A 2TMGA 1TYDE 1VMAA 1WXHA 1XZBA 3AM5A 3GP5A 1NN3A 3PHGA 3EVGA 4HDAA 4CG2A 10MHA 4YO8A 3AYXB 3JASB 4XD2A 4F3TA 1TUIA 1Y4ZA 2QDXA 3GGDA 3KJZA 4Y9SA 3A9UA 4WN9B 1L1EA 4EA8A 3OT5A 1I2CA 5CMLA 2ZUSA 1EPUA 3ONVA 4PQYA 5D3MA 1G8FA 2J5RA 1SUBA 2M9MA 3H99A 3WLRA 2VYCA 3GOHA 3MELA 3OTQA 3UK0A 1MIOB 3KZNA 5J2TF 2OZPA 5K7SA 1SJ9A 1A2QA 2WA1A 4PO3X 1LWOA 1SCDA 1N4DA 1J8MF 2CVFA 3ORFA 1UMBA 4YMVA 3FDFA 4RADA 2NV2B 2D74A 3LOQA 3KVRA 2XQFA 1VECA 3CUKA 2PUFA 3T3PB 1NW5A 3CRRA 4REMA 2GXAA 5C1BA 4KUGA 3R7AA 4DLKA 2R8EA 3IUMA 4XPZA 3IJEB 4B9EA 1ZUIA 3AY3A 4BTVA 4K88A 3HG7A 1E7YA 2P1RA 3LK6A 1TW3A 3RS3A 3ABOB 2A67A 4ZZ3A 4RULA 1J09A 1PKXA 2GAOA 2ZRMA 2WHPB 2XOKD 1CJTC 1G7RA 2XCLA 3ADOA 3DH0A 4V0LA 2VZLA