3SC6A

2.65 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose reductase (rfbd) from bacillus anthracis str. ames in complex with nadp
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
281
structure length
281
Chain Sequence
KERVIITGANGQLGKQLQEELNPEEYDIYPFDKKLLDITNISQVQQVVQEIRPHIIIHCAAYTKVDQAEKERDLAYVINAIGARNVAVASQLVGAKLVYISTDYVFQGDRPEGYDEFHNPAPINIYGASKYAGEQFVKELHNKYFIVRTSWLYGKYGNNFVKTMIRLGKEREEISVVADQIGSPTYVADLNVMINKLIHTSLYGTYHVSNTGSCSWFEFAKKIFSYANMKVNVLPVSTEEFGAAAARPKYSIFQHNMLRLNGFLQMPSWEEGLERFFIETK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords dTDP-4-dehydrorhamnose reductase
publication title Structure of the Bacillus anthracis dTDP-L-rhamnose-biosynthetic enzyme dTDP-4-dehydrorhamnose reductase (RfbD).
pubmed doi rcsb
source organism Bacillus anthracis
total genus 91
structure length 281
sequence length 281
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.133: dTDP-4-dehydrorhamnose reductase.
pdb deposition date 2011-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04321 RmlD_sub_bind RmlD substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3sc6A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3sc6A02
4URFA 3SLGA 3RJ5A 3UN1A 4PG4A 3DDNA 2C54A 9LDBA 4FFMA 3R0IA 5L4NA 3OEWA 4QO8A 1Y5RA 1GEEA 4CL3A 4NFHA 5HS6A 1K6JA 1HDGO 3HFSA 2OBNA 2PGDA 3MEQA 4UEOA 3SBOA 4PLZA 1D3AA 3HDQA 3PLRA 4EUEA 5B1YA 3HUDA 1LRKA 3AWDA 4HP8A 4J9UE 1DLJA 1DO8A 3NT4A 3RROA 1G6KA 4CUKA 4LVUA 3DXFA 5EMHA 2ZYGA 3O26A 5EESA 3ENKA 5T8KA 3Q9UA 4BO7A 3UHAA 3H4VA 4JQCA 4RPKA 3PJFA 3IAHA 1T2FA 3V1YA 1O89A 1GQQA 5I9MA 5TSDA 4BNIA 1VL6A 5U1PA 3UFXA 2FR1A 1B0AA 1A4UA 4OQYA 1U4OA 4UVEA 4Z3KA 5JS6A 2DPHA 1KYQA 2YQ5A 3G1UA 2PA3A 3C7CB 3RQSA 3VVCA 5CPFA 5JDCC 4BO9A 3NJ8A 4QUKA 4GGPA 4A7PA 4AJKA 3OQBA 3JD4A 1XSEA 2UDPA 4XYEA 4BIIA 4Y98A 5CHEA 4G5HA 1ZMOA 3DL2A 1NNUA 4QO7A 2DBRA 2GD1O 2D5CA 3SX2A 3ADPA 2ZB8A 3NDIA 5TJHA 4JLWA 3F5SA 1Z45A 1DJQA 4H16A 2NU8A 1UJMA 3RCBA 3HSKA 3V1UA 2C07A 2DVMA 4ND1A 5DOVA 3O38A 1JA9A 4RGBA 3UOGA 3B20A 1N2SA 4WK6A 3AK4A 3I52A 4RVUA 1V8BA 2WSBA 4ND4A 4CM4A 4BMNA 3R6DA 2W4QA 5IN5A 4YDRA 2GNAA 3RIHA 1LEHA 4U6QA 3WSVA 4YJDA 4FB5A 2VZ9A 4NFYA 5DCWA 4XGNA 3GEDA 3EK2A 4R1NA 1OFGA 2VRCA 3IMFA 3DMYA 1LRJA 4QTZA 4S1VA 2IYOA 4ZQFA 1AGNA 4NNJA 1PZEA 2GERA 1X1EA 4BKPA 4CLHA 5KJCA 4MPDA 4J16A 5BNTA 2GZ1A 4I9NA 1HDXA 1HSOA 1OC2A 2BH9A 4OGWA 4W9NC 4J0FA 1KEUA 4XQGA 4BO1A 4KTTE 1ZNQO 4A2CA 5C37A 3X2FA 4GX2A 3BYZA 3NKLA 2E6UX 4ZICA 1LA2A 1YQDA 4A73A 4EEZA 4CLXA 1LNQA 2TMGA 4NHEA 2P9CA 3MJVA 2FZEA 4J0EA 2F00A 4YQYA 1YL6A 4DYVA 2E49A 2GDZA 4OYRA 1EVYA 4O59O 3PTZA 1HE3A 3QHAA 1QORA 2ZQZA 1SCUA 3OJOA 4OAQA 4E5MA 4RVDA 3PHHA 1NVTA 3JQEA 3WFJA 1U1IA 3M1LA 3V2HA 1QG6A 2JAPA 3V2GA 4DUPA 1W73A 1SC6A 4PG5A 4XGIA 4K26A 4ROSA 3KM0A 2FSVA 1TLTA 4O1MA 4M86A 1NVGA 3A4VA 4BNZA 1PJTA 3LZ6A 3ZH2A 4E0BA 5EERA 1GPDG 4BNJA 3E03A 1T1SA 5AXCA 1DFHA 1UP7A 5JY1A 1KY4A 1NQTA 1F14A 1O0SA 1TT5A 1K3TA 2B4TO 4JNKA 5DBGA 2Y0EA 1UDCA 2I3GA 2NTJA 3OIFA 1SNYA 4O0LA 3BXXA 4AJ4A 3L6DA 4WLUA 3VAZA 4XJSA 3BTSA 3ZU3A 1GYRA 3RI3A 4LISA 2JD2A 1DC4A 5DN9A 3SC4A 1SPXA 3GZNB 4YAIA 1E3EA 2HMTA 3M2PA 2RCYA 3O9ZA 5BSGA 3JD0A 4YTEA 1AE1A 5TIIA 3DZIA 1IOLA 4PLPA 3QVWA 3JQBA 5B37A 1VI2A 1G0NA 1E7QA 1W0CA 5A05A 3ABIA 5FF9A 3ZU2A 3GNSA 1ENZA 1HYEA 2OP1A 2NLOA 4YJGB 4Y6SA 3F6YA 2O3TA 2PKQO 1XG5A 2EV9A 1NQOA 3H2ZA 1Q7CA 4BKQA 3TN7A 3JQAB 3BTOA 4AG3A 1YBAA 2XPCA 4N5LA 3LT4A 4UVDA 4UUMA 1YJ8A 4E13A 3MTGA 4JJIA 2YFHA 2YFQA 1WWKA 1GYPA 1RKXA 5KKCA 4GMFA 1ZEMA 1HE4A 2NTNA 2Y0DA 3G0OA 4B3JA 3AM3A 4L75A 1QXSA 2OO5A 2WJPA 5DBIA 3W6UA 3GDFA 1F06A 2VRBA 4OOFA 4DLBA 1U2DA 2I9PA 3E8XA 4PFJA 3JQGB 2NU7A 4KUGA 1GZ6A 2DTEA 1VKNA 1E6EA 5T57A 2J8ZA 3RFTA 3AOEC 4OQZA 2IZ1A 3T7EA 1AN9A 1QYDA 4DC1A 3ZW8A 3DBLB 4NK4A 3GOHA 4CJXA 4E2WA 1PL8A 3IL2A 3E9NA 3VZQA 2JL1A 1HSZA 3N58A 3F4LA 1C1DA 4MVJE 2UUPA 4KWHA 4LCJA 5JCJA 2OXIA 1KC3A 3QA9A 1YKFA 3NTOA 4D79A 2PTGA 2XF8A 4JJFA 3RKRA 4CMGA 4FGWA 2CF6A 1U3UA 4J1NA 3WIDA 3AUUA 3EDMA 1Y5MA 2D8AA 5CEEA 2IRWA 3OJFA 4MIYA 3OM9A 1P33A 4RLSA 2Y0CA 3MJSA 4CMIA 2ZK7A 2PFGA 1ZK2A 1A5ZA 1DIAA 3W6ZA 1EE9A 3IC5A 1Z73A 4FFPA 4JP2A 1JVSA 3GRPA 3H5NA 4CQMD 1NPDA 3GEGA 5F1KA 2AQIA 2FOIA 1OOEA 4BNLA 2GYYA 3AUTA 3WYCA 3CE6A 5G4KA 1PWZA 4YJFB 4UVIA 4II3A 1EBFA 4E3ZA 1N92A 3JQGA 5CPBA 3L07A 3PI7A 4D43A 4MVJI 1VLLA 3CH6A 3C1OA 2YV1A 1UZLA 5TRTA 1Q7BA 3DBLA 4YJHB 2DUUA 1NXQA 1Q0LA 4NZ9A 3NTQA 2AA3A 4CM8B 2GCGA 5JO9A 1ADGA 4CMCA 1V35A 1U28A 3PZBA 4MVJA 5EINA 3RKUA 4MIEA 4IINA 3ST7A 1IY8A 2QX7A 5ITVA 4L9RA 1X14A 2X86A 1W6UA 5LCXA 3KEQA 5DULA 3F4BA 4EJ6A 3IKTA 3WB9A 2A4KA 3MZ0A 2C82A 1SB8A 4UAGA 2BI7A 3AI3A 4ZQEA 4QXMA 1MLDA 3QWFA 3Q2KA 3EMKA 1T24A 5I8WA 1WXDA 4KUHA 1N1EA 8LDHA 3BA1A 3AI1A 2NVUA 1Y6JA 3FF4A 3WTBA 2WYWA 3K30A 3GDGA 4DBVO 1RM4A 1H0KA 1OBFO 3GUYA 3KVOA 4PZDA 2GR9A 2RIRA 3PJDA 3H5AA 4A5OA 5AOVA 1K6IA 3MTJA 4YJFA 1B3BA 2X0JA 4BO6A 1ADCA 1PGPA 3JQCA 4K28A 4PG8A 5JAMA 2AE1A 4WLNA 1MXHA 2HO5A 1ULUA 5B12A 1A71A 4ID9A 3PYXA 2JCXA 5U4QA 2Z5LA 4LMRA 2Y05A 3BZUA 3H8VA 2PGLA 5A5EA 1XA0A 2R00C 1MG5A 3B70A 2J3JA 5EQDA 3GNQA 4XA8A 1NAHA 3DMTC 3PQFA 4DIBA 3K2BA 4Y9DA 5JYDA 3HE3A 1F8GA 4JBGA 4L4RA 4PZCA 3I6QA 4CMEC 5LDHA 3S2GA 3FNEA 1PR9A 4CUJA 1X7GA 4QECA 3KHUA 5HM8A 5AVOA 3PWSA 3R1IA 2A94A 4MJLA 4I1IA 1SOWA 1WMAA 1UUFA 3GGGA 4IBOA 4DVJA 1P1RA 5FEUA 1A72A 3NV9A 2Q2VA 4OOEA 3GZ4A 3VPXA 2AMFA 2EERA 4TVBA 1C0KA 1ZIDA 4GX5A 4IM7A 4R1TA 3B1JA 3QLJA 3VC7A 3PVZA 1GU7A 3B6ZA 5K6AC 3JQ8B 3OQ6A 3WOHA 1D1SA 1D8AA 3QP9A 3W8DA 4J49A 4YT8A 1C0LA 1HDYA 2EKPA 3ZWYA 5K0ZA 3JYNA 4I9UA 2NWQA 2PR2A 1C3VA 2HLPA 1ZSNA 1HWYA 1Z75A 2RH4A 1GEGA 2O48X 3HADA 4FJ0A 3FCOA 3WDSA 3INGA 4MVJP 1A9ZA 5KNLA 1GD1O 1FDUA 4YT2A 4GKBA 2VTEA 1CF2O 2QYSA 2BRUA 3L4BC 3OJEA 2D2IA 4CV2A 1LDBA 1GZ4A 4GX1A 4OJNA 2R2GA 3TQHA 2DUWA 2VNAA 4WLOA 5DF1A 2EXXA 2UYYA 1GUZA 1GV1A 2CVZA 3RUDA 2AQKA 1A27A 4RCVA 3ZNOA 1ZK3A 3NJ4A 1QLHA 4BNYA 1LSJA 2Q46A 4ITUA 3FNFA 5IDQA 3CZMA 4Q9NA 4C4OA 3DOCA 1PTJA 3SJUA 4I5EA 1PWXA 4Q3BA 1GUYA 2G82A 3DEYX 3AUSA 4WJZA 3STHA 2VT3A 1OC4A 3K5PA 1GR0A 3VPGA 2WE7A 3AW9A 3BMCA 2P91A 4RPGA 1ENYA 4NJMA 3EY4A 4RV9A 5CP8A 1YRLA 2Q4EA 4M89A 4GL4A 1C1XB 2X23A 2UAGA 5L7TA 4PN3A 3F47A 2X58A 2H9IA 3NYWA 4NFSA 4N18A 3GVIA 1P1KA 1D4FA 3H65A 1PS8A 4L8VA 4BO0A 4LSMA 4D0SA 1I30A 1U5CA 4OXYA 1SAYA 4L4XA 3DFZA 2ZTVA 4II2A 1V0JA 3ITKA 2EIHA 1H6DA 3EUWA 3H9UA 3RFVA 1H2HA 1IYZA 2W98A 2YY7A 2HU2A 2YW9A 4ONEA 2YHIB 3O8QB 4EGFA 2FPPA 3TFOA 2HK8A 2W2LD 3WR5A 5BR7A 2C5EA 3AUAA 3IJPA 4XYMA 2PKQP 5EPOA 2EW8A 3JQ9C 4TSKA 2GN4A 3RJ9A 2B4RO 3P7MA 4L74A 5AXBA 4MIOA 1LDEA 2NACA 1AHHA 2O7SA 1N9GB 2Y93A 4NG5A 5T6BA 4O63O 1BDMA 2ZQYA 3R3JA 3FWZA 4WEQA 5BSFA 4AJ1A 3PGJA 2X22A 2BFPA 1UXKA 1L1FA 4M87A 6LDHA 4J4BA 3WQRA 2OMEA 3IS3A 3QSGA 4CMBA 1I01A 1NYTA 3DBVO 1O94A 3ETGA 3OETA 1Y8QB 3CMMA 1WZIA 4FFRA 4Z3DA 3HDJA 4AVYA 4G2NA 4J7UA 4BNUA 5TC4A 5IZCC 3VHRA 3OA2A 2PGJA 3CUKA 2IXBA 2DFVA 2PKRA 5JCJD 3D3EA 3CXRA 1UXHA 4FQ8A 4I5DA 4R9RA 4GLOA 1GY8A 2JD0A 3F3SA 1IPEA 3OA0A 1KBZA 2VWGA 1V3VA 1XU9A 2I6TA 3OSUA 1KEPA 4WE3A 4CQLA 2PLAA 1ML3A 4E5NA 5L53A 1ISHA 3QIVA 1LQTA 2J6IA 1PJQA 2NU6A 4IJKA 3EC7A 3LC2O 4BO4A 4FJ1A 4UULA 8ADHA 1DAOA 2O3RA 5A9SB 3CINA 4GGOA 3DBHA 1VC2A 5JO0A 3OH8A 2QZZA 2Q4BA 2C2XA 1HZZA 3GDOA 3JCZA 4E4YA 5A02A 1YOVA 4W99A 3PRJA 3UGKA 1F17A 2CNBA 2GZ3A 4JGBA 2C29D 1MFPA 3LSYA 1KVQA 1KETA 1QRRA 4DGSA 1E7WA 2V6BA 4AFNA 3GVXA 4K9DA 4R5MA 1E3SA 1P31A 5GZ6A 1HYGA 2RHCA 4Z0PA 3QV1A 3G3EA 4AJJA 2WD8A 3OJ0A 1YQGA 4IXTA 4P8RA 2ZB3A 3C85A 4CMHA 2Y66A 1E6WA 1PGQA 5K9ZA 3KBOA 1QLJA 1VL0A 1GDHA 2QRJA 1DDOA 3TL2A 1VSUA 5DZSA 5MGBA 3L0DA 2WDZA 3DHEA 4LGVA 2DPGA 2X7HA 4NBVA 3JD2A 4MVJD 2EJWA 4UEKA 4LCEA 3ETEA 1R4NB 3SVTA 3JD1A 4KWIA 2JCVA 2FHSA 3C24A 3GGPA 3JTMA 3K73O 1R0SA 1FMCA 3FBGA 3H5RA 2PWZA 3L4SO 1BXGB 3VKVA 1DHRA 4G81A 5ER6A 1RYEA 1LLQA 4H3VA 3D4PA 4PVCA 2X5JO 3AY6A 3BMNB 5A9SA 1I2BA 3FTNA 1DIGA 1R0LA 5DCYA 2HMVA 4XYGA 5I8ZA 3EW7A 4FN4A 4D0RA 4YAEA 4BV9A 3PHLA 4CMAA 2YQ4A 4E5YA 5IDWA 5JDIA 3DB2A 2BFOA 1ONPA 2Z95A 3DFUA 1N8KA 3Q0EA 2VHZA 1WDLA 3ICPA 4IZHA 5L7YA 1RM0A 1GTMA 2R6JA 1NR7A 4P4NA 1Z74A 1YE3A 5A1TA 4YWJA 2GN9A 1P0FA 4YT5A 3NRCA 2D0IA 5DT9A 1GUFA 3H7AA 1U3WA 4TMFA 4B79A 1ZXLA 1DAPA 4YRAA 1IPFA 1MFZA 1TVEA 5ADHA 1C14A 2GSDA 5AXAA 3IUPA 3F5QA 2EJVA 1XQ6A 2WD7A 2OUIA 3ZV3A 4E32A 4E5KA 1YO6A 1YBMA 1QYCA 1GCOA 4GSLA 4UREA 4IJVA 1EUDA 4BGEA 3F1LA 4AJEA 1R4NA 4HUJA 1EDOA 4FC6A 1O95A 5DCUA 4PG7A 3JSAA 4IMPA 3HDHA 3GHHA 2B5VA 3W1VA 4EITA 3G17A 3LF1A 4PLVA 2FR8A 1PQPA 2B0JA 3UUWA 1B26A 3WGGA 2BGMA 5KOIA 4J6FA 1MB4A 2ZB4A 1SBYA 4UUOA 3WLFA 3ASVA 3S1LA 2FPIA 2I5PO 5IJZA 3WFIA 3OHSX 3ZNQA 2QZ9A 2O7QA 4WKGA 4KQWA 1VKOA 1UR5A 1WNTA 2BI8A 4RZHA 2X9NA 3WQSB 4Q3CA 4IXWA 2POQX 3FPLA 2NSDA 4XDYA 3VPHA 4J91A 3E9MA 4CM5A 5CDYA 1D1TA 4W6ZA 1P45A 5CG1A 4R3WA 3D4NA 4CM3A 4M55A 5U9CA 3JYLA 3TWOA 1JLLA 5C7OO 4ZD6A 1K2WA 3LT2A 4GWGA 1XGKA 4NR0A 2X0RA 4KDFA 2G0TA 4E6PA 5JDCA 5KVCA 4FCCA 4NMHA 4TQGA 2Y68A 3D3WB 4O6VA 4XWYA 3W8FA 4FFOA 4YCAA 1Y8RB 2BKAA 1FDSA 4OSOA 4RVHA 3VH2A 3TNLA 1C0PA 2Q1SA 1YB4A 5A9RA 4IGEA 5CAEA 2VYVA 2AHRA 4O5OA 5IF3A 2WEKA 1KEVA 4FIZA 1E7RA 1NP3A 3W4KA 2ZJ1A 3D4OA 1IZ9A 2DLDA 4DREA 5CDGA 4MP8A 3ZV4A 1HT0A 4EDFA 4OXKA 2AEMA 4E12A 3CIFA 4QEDA 3TFQA 5JPIA 4GVLA 1JAXA 1FXSA 2BELA 2GZ2A 1YBVA 3JYQA 4BS9A 1N7GA 5A03A 2P5YA 3QY9A 1BVRA 4WGGA 1CJCA 4L76A 3JQ7B 5JAZA 1LTHR 3WGYA 1LSSA 1XKQA 2AG5A 1YH3A 1SOVA 1MA0A 1UZNA 1UXGA 3ZNPA 1H93A 2AE2A 4XGKA 2G76A 1WPQA 3DBRB 4C7JA 1JDJA 1KEWA 5EQFA 3ETDA 3PHGA 1R66A 3D3WA 3U4DA 1GAEO 3JD3A 1Y8RA 2ILTA 2EP7A 3FN4A 2V7PA 1ZCJA 3NX4A 2BF7A 1OAAA 4LK3A 2VOEA 4HFMA 1EBUA 5DNAA 4R41A 5F21A 2PZKA 4ZQBA 4GSKA 2B37A 5H82A 1DHTA 3H6KA 3HN7A 4IDDA 3LF2A 3FSRA 4FFLA 3KLPX 4OM8A 1QYWA 1J0XO 4XDZA 3UAGA 3GR6A 1A4IA 1XLTA 3BHJA 3OP4A 4ZU3A 3RU9A 3WGHA 1ISMA 4CV0A 1R0KA 2DT5A 3AU9A 3OEYA 4RPLA 2YHUA 5GZ3A 3OQ1A 3DZFA 1E1LA 1RYDA 1ZW1A 3JQ7A 3OF2A 1FDTA 3FNHA 1E7YA 4UVHA 4AJOA 4IS2A 4W7IA 4I5FA 3DZKA 3BTUA 4N54A 1N7HA 3ZHYA 3L9WA 2C7GA 1CQIA 5BNFA 1UDAA 3EVTA 3E5MA 3GUCA 3LLVA 3TOXA 3GGOA 3AM4A 1VJTA 2EKLA 3DBRA 3PIDA 3IQDB 2JHFA 4OMUA 3K92A 1VM6A 1VRWA 3ASUA 3AY7A 3ZI0A 2ZB7A 2BFAA 2DTXA 4MOWA 4YEDA 2CSUA 3C8MA 2VUTA 1PQWA 3LLSA 1YB1A 1PSDA 4IIUA 5T64A 3INTA 4XQ9A 4LRTB 5BSHA 2GLXA 1B2LA 4R54A 4RPHA 5DDIP 4P4LA 3GAZA 3CSDA 1PJCA 1PJSA 4UVGA 3BAZA 4KP7A 3Q9NA 1M6WA 3WS7A 5C3MA 1LRLA 2BD0A 1KVUA 4BO8A 1I3NA 3LVFO 3PYMA 4HFRA 1PZFA 3GZNA 1F12A 4ZQGA 5L4SA 1J4AA 4PLHA 1PJ3A 3MJEA 4K6CA 5A3VA 2WMDA 4RVSA 3WYBA 1EZ4A 4BQPA 4M49A 3WMXA 2NNLD 3WSWA 1LU9A 3LT0A 3RBXA 3MJTA 2O4UX 4F6CA 1UDBA 3ICCA 4U7WA 2PD6A 2AEFA 3G79A 2PZJA 3TZ6A 4HADA 3FBTA 3DO5A 2Q3EA 4GQAA 4N7RA 2NV6A 1E5QA 4YQZA 4YJGA 3TZQA 1UXIA 4XIYA 1DC3A 4GI2A 1IE3A 2P68A 4ZRMA 3FD8A 4ALJA 1E3JA 4MO2A 4CLRB 3JQAA 3PQEA 2Y67A 2Q1UA 4IIVA 2O2YA 4FD3A 4R4JA 1XEAA 2PH5A 1ISJA 2WWRA 3AOEA 1Y1PA 4ZQHA 5KJ1A 4CPDA 3E6AA 4PZEA 4XIJA 3E82A 1GADO 1YXMA 3GT0A 4F45A 3FWNA 4F3YA 4Z6KA 1P1JA 2VN8A 4YBZA 4DQUA 1T2DA 3GEMA 2JFFA 4EYEA 4DPKA 4E30A 3WGQA 4J43A 1EEHA 1UAGA 1UP6A 1YGYA 2G5CA 3PJEA 4HWKA 2C0CA 4TRRA 3QWIA 1DPGA 3IDSA 5HTOA 3E1KA 1GL3A 1H6AA 1P44A 4B4VA 1JKIA 5JFOA 1C0IA 4D45A 4HKTA 5IG2A 2B83A 4OXNA 3UVEA 2JFHA 3IKVA 4YT4A 1XU7A 4IDFA 1AXGA 1ORRA 3GFGA 3RC9A 3VH1A 3Q6IA 4FFNA 5G0SA 5LC1A 4YXFA 5L51A 3WGZA 4PRLA 1X13A 3WJAA 2HUNA 3GK3A 1H6BA 1SEPA 3CTMA 4CODB 3IJRA 4Q3NA 5A4DA 2SCUA 3MWEB 3ZV5A 3GA0A 1I3MA 2XAAA 4HV4A 4XYLA 5FYDA 1WAMA 1Z7EA 5IFLA 1WLYA 4I9HA 1DEHA 2D5AA 2EEZA 3OICA 4WECA 1X0VA 4NQZA 2NM0A 3I9OA 2BGKA 3DAPA 4RJTA 1GCUA 3Q2IA 5G2OA 4CMKA 5TNXA 2FZWA 2FP4A 5JNLA 4YA6A 1LLUA 5F3RA 1I3KA 4PIVA 1LLCA 2FWMX 3IP1A 3DZBA 4RQUA 4BNWA 3NEPX 1VL8A 1EVIA 1LDGA 3K6JA 1N5DA 1XR3A 4TWRA 3U4HA 1BG6A 4YJHA 3U9LA 2EG9A 1HZJA 4KOAA 1YL5A 1L7DA 4AJ2A 3VDRA 4CM8A 4BNFA 2X9GA 3OFSA 4KTVE 5JAQA 2XXBA 1NM5A 2ZIZA 2PD3A 4XR9A 5IDYA 1GPJA 4LN1A 3U09A 2WE8A 3I9LA 3KSZO 2PZMA 1I2CA 3IUSA 3RUHA 2NU9A 2VT2A 1H6CA 4RDIA 4GX0A 2C2YA 1B7GO 4GKVA 4BNKA 2X4GA 1M76A 3V2UA 1F8FA 2IEBA 9LDTA 4XB1A 3ZWVA 1NASA 2I76A 4W7HA 3WXBA 4AJHA 3JQFC 3KB6A 4MVJG 4RO0A 1HETA 2VRCD 1QR6A 2XXJA 4ALIA 4L4SA 2R00A 1RPNA 2AG8A 5JY6A 1I3LA 4PLFA 3ZWOA 3BHMA 1BWSA 2J3KA 4FOOA 3KSUA 4IJUA 4AJNA 4AL4A 3DMTA 4R01A 1R16A 3E18A 3ROQA 3KXDA 5KKAA 3DZGA 4CM1A 4CMJA 1EQUA 2X8LA 3ZWNA 3PLNA 4CMEA 1GQYA 4L0QA 1V9LA 1E3IA 1ZJZA 4G65A 3VZRA 3VH4A 1BXZA 3RBZA 2P9GA 1T2CA 4QFCA 5ENVA 1E77A 1M75A 1QYXA 5COAA 3A28A 2ZTMA 4Y67A 3LYLA 4CM6A 5A04A 2X5OA 2YDYA 1CDOA 1PJ2A 4U6SA 2X6TA 4IPTA 3V5NA 1JQBA 5HA5A 5K6AA 5IN4A 3KYDB 4AJLA 4NK5A 1MX3A 1F0YA 1PEDA 1ZH8A 3T4EA 2HSDA 2Z1MA 4NJOA 1P77A 5A5FA 2VOJA 4D3DA 2YZ7A 3EVNA 4RDHA 3ONFA 3QQPA 1H2BA 2Q99A 3KRTA 2GF2A 3GRKA 4WLEA 3AJRA 4A26A 5BQFA 1GV0A 1PGJA 3I4FA 5J23A 3GN2A 2QW8A 3PWZA 3GFBA 5COBA 5KIAA 4QFDA 1PGNA 5G0VA 1H9AA 1ZO8A 3JQ8A 5IDXA 2DTDA 2UV8A 3L4BA 1I5RA 2IYPA 3VZSA 1BHSA 4EI2A 3JYPA 4YB8A 3ZGYA 1EE2A 1DIHA 1Y9EA 3ANMA 4IUYA 4A0SA 3H9GA 2YYYA 3O4RA 1ULSA 1DRWA 5KVSA 2E37A 2ZYDA 3A1NA 2O2SA 4WCFC 3SJ7A 1BMDA 1TA4A 4D42A 1ADBA 3PYLA 3FPCA 4HX5A 1NBOA 1QMGA 3GMDA 1PJ4A 1BGVA 3BHIA 5KJ6A 2RBEA 4DRYA 3WWZA 2NTVA 4HXYA 3GMSA 5BSEA 3HN2A 2H1SA 4B3HA 4CLOB 3R3SA 2VHWA 2HJSA 1JTVA 1HKUA 3QWAA 3IP3A 1S6YA 3PEFA 4R16A 4BL5A 3AM5A 1R15A 3QE3A 4BNNA 3GF4A 2HRBA 4H7PA 3W8EA 5KJFA 1LX6A 3DZHA 4ALKA 4B3IA 5CDUA 3BMOB 4MDHA 3SEFA 4FDAA 5CEJA 4MVJM 1I36A 2VHYA 4XD2A 4JIGA 3OBBA 3U49A 2X9VA 3M2TA 3UXYA 2G1UA 4QX6A 2HMUA 2DFDA 5FI5A 3RASA 3LT1A 1H94A 1U8FO 4JJGA 4I8XA 3ORFA 5TJ9A 2HK9A 1Q2XA 4CL8A 7MDHA 4BGUA 4FS3A 1I0ZA 4D46A 2ZCVA 1DFGA 3P19A 3DTYA 2C20A 2OORA 1C1XA 3N7UA 3KYBA 3ZWXA 1U3TA 1WDKA 2VCYA 2QRLA 2DBZA 2F1KA 4IZIA 1DFIA 4R9SA 3V1TC 3ZU4A 5B4UA 1J6UA 3JQ9A 1T1RA 3WNQA 2NUAA 4NI5A 4XYBA 1LJ8A 4UEJA 1ONNA 1PGOA 3RD5A 4TKMA 1NHGA 1O5IA 4Q3DA 1BW9B 1K0UA 1ZMTA 2H63A 3JQAD 4BMVA 1EDZA 5CDSA 1OI7A 4CLOA 1R37A 3Q1LA 3VVBA 3UW3A 1ZK0A 2O4CA 3PGXA 4XR4A 4B4WA 1WDMA 2HKIA 4GPD1 1E1NA 2YHIA 2WM3A 3O8QA 3SXPA 3EHEA 2H5LA 3ADOA 4ND5A 4D44A 1I10A 3LC1O 1U5AA 1HE2A 2JJYA 2VYNA 4OIMA 5KJEA 5IZCA 5B4VA 1HLDA 1PJLA 4LRSB 4U5QA 5KWEA 1GYQA 3PK0A 2J5RA 4TRMA 3HZZA 1MC5A 3BMOA 1N9GA 1JVBA 2E4AA 3GVHA 2CZCA 2OZPA 3PJGA 2HAEA 5KVVA 2P9EA 1ID1A 3WBFA 4CQMB 3ZDFA 1CWUA 1EK5A 4BNVA 4E21A 5ITWA 3U3XA 1MV8A 2A35A 1VE9A 2YV2A 3HWRA 4AJPA 4Z0TA 2CDAA 3U4CA 1U9JA 4LMPA 1Y8QA 3S55A 2I67A 4BGIA 3BMQB 2PY6A 3AY3A 3Q11A 3DTTA 2VZ8A 4BB5A 2O3SA 4KUEA 1E1MA 1P1HA 1T4DA 3ZHBA 4XRGA 1S7CA 3KYCB 4WEOA 3A14A 4WPGA 1HLPA 2J5KA 3ZNNA 3I83A 3COSA 1E3WB 4RF3A 2FPGA 2X0NA 4J9VA 1WW8A 3S2IA 3ZHZA 1HE5A 1DXYA 1P1FA 2HCTA 1E7SA 3H9QA 3RUIA 4ND3A 3I9MA 4ZN6A 3VZPA 4EBFA 3UICA 2V6GA 4H15A 3JV7A 5JMWA 4RL6A 2O3QA 3TDKA 3G49A 1LDNA 1DBVO 1ZKMA 4GAEA 1KOLA 3DQPA 3UCXA 2JKVA 3KSDO 3F46A 1PQUA 5JC1A 2HJRA 4IDGA 1PS9A 3M6IA 3TPCA 1PL7A 2D4AA 3RUAA 1IUKA 2DBQA 3CKYA 4JXKA 1Z82A 1NAIA 1VJ0A 4E2ZA 4BKUA 5H83A 3U5TA 3TZHA 2E82A 4TZKA 4CQMA 1LSUA 1KVSA 2EGHA 3WG9A 3HJAA 3NDJA 3RU7A 3T7CA 5THKA 4CM7A 5JYEA 1YL7A 2DC1A 3BMQA 2PD4A 4IDAA 1NWCA 4GWKA 3WWYA 5C7LO 3ZWCA 3N74A 1XELA 3KYCA 1MP0A 2FN7A 2B69A 4OO3A 2AXQA 5T8KC 2DM6A 4DA9A 2ZYAA 1E3WA 3ONDA 3GN1A 1ZK4A 1WVGA 4L73A 4BNMA 4IQ0A 1ZXBA 1BXGA 4J4TA 2BMAA 3SC6A 3V8BA 3BMNA 4FR5A 2W2KB 3ROPA 4Y8VA 3ZU5A 4D41A 5F1PA 1LXCA 2VWPA 3TF5A 3C7DB 2OBYA 5I9LA 5TLSA 3WGOA 5JE8A 4A27A 3TSCA 3QWHA 4ZA2A 4IQGA 1YVEI 1E0DA 4AICA 4IDBA 1EK6A 2QYTA 4CM4B 2BHLA 1KERA 1V3UA 2ZATA 1XYGA 3H2SA 5CDTA 2CF5A 5G0UA 4EJ0A 2CUKA 1ISIA 3I9KA 4CV1A 4PG6A 4BNXA 4YAGA 1NPYA 2Q50A 1VPDA 1BVUA 4ESOA 4M1QA 2D59A 5A3JA 5C7IO 4XCVA 1UZMA 2PK3A 5KCZA 4KZPA 4B4UA 3QW2A 2AW5A 1I24A 4RF4A 1LC3A 2CVQA 3K96A 4WOJA 2VNSA 4R69A 1U3VA 2CVOA 3HG7A 2OHXA 4RQTA 1T2AA 5L95A 1BSVA 4I5GA 1HDCA 4PRKA 1GQ2A 4BO2A 4WUVA 1EUCA 2D3TA 3FR8A 2CDCA 4DMLA 1LLDA 3I9JA 5L40A 1H9BA 4U0KA 4JBIA 3I23A 5IAAA 4FW8A 4R1UA 4XB2A 3ZN2A 5LDGA 3PHJA 1PS0A 2JAHA 4UUPA 1WP4A 3ZWWA 1BDBA 2W2KA 1HEUA 2YUTA 3PP8A 3QVOA 4BUCA 2G17A 2J3HA 1I33A 3EAGA 1EUZA 1M6HA 3PPIA 5I9NA 4Y6PA 1B8VA 3HNPA 2HRZA 4BOYA 3TZCA 2EKQA 3F1KA 2CFCA 3WNVA 4XX0A 1JKFA 1YB5A 3OJLA 1YQXA 3DZJA 2W90A 1M2WA 4K1LA 4MKXA 3GPDG 2YDXA 2HDHA 2H6EA 3K9QO 2O3UA 1X7HA 3ON5A 1P3DA 1DOHA 1TT5B 4IDCA 5IZ4A 1KC1A 1ZUD1 4RF5A 4TRNA 1RWBA 3L6OO 3B1FA 4E5PA 3FRJA 5ICSA 3INRA 1DB3A 4JCOA 4K6FA 6ADHA 2IZZA 2Q1WA 5CG2A 3ULKA 4HFJA 5AYVA 1NWHA 1FF9A 4BQRA 1CQJA 2Y1OA 4W9NA 4TROA 3VPFA 3I9NA 1DSSG 3L77A 4TKLA 3C3XA 5I7FA 2PH3A 1X7DA 2FRDA 3MCVA 4W82A 1TB4A 3FTPA 1SB9A 1QYVA 3HQ4O 4N5MA 4RZIA 4ZVVA 1VJ1A 3AI2A 4IQ8A 4JROA 3I4CA 4Y6RA 2C7VA 3C7AA 1CIVA 1MGOA 2P2SA 3RUFA 1ZSYA 2RH8A 3UCFA 4WNIA 3WYEA 3AFMA 5I7VA 3ZCXA 3ENNA 1NFQA 4HNGA 3S8MA 1JAYA 1J49A 5I7SA 4BVAA 3OIDA 3JQBC 3D7LA 2B36A 2HMSA 2EP5A 3NT2A 3QJ5A 1A7AA 4MVJF 2HQ1A 3M1AA 3MWDB 3TJRA 5HS4A 5L9AA 4Z9YA 4RF2A 3I5MA 4LW8A 3PHIA 1PIWA 5ES3A 4NBTA 2CY0A 4ALLA 1E1KA 1TI7A 4WLFA 3KTDA 2QIOA 2OGUA 2Q2WA 1V3TA 3B1KA 4BHTA 4DPMA 4DMMA 3WICA 1ISGA 1EFKA 2OP0A 2QHXA 2WYUA 1NVMB 3NDRA 2BFMA 4BB6A 3NAQA 2V6MA 5KVQA 4HNHA 4R1SA 1C1DB 1EVJA 1XHLA 7ADHA 3FI9A 3H3FA 4OSPA 4R5HA 1ENOA 4ALMA 1DRUA 3DAGA 3OMLA 5JXWA 1RM3A 3TRIA 3WLEA 3S2EA 4TZTA 5GMOA 4BKOA 4EEXA 1HDZA 1Z6ZA 4ILKA 2NQTA 4QQRA 4DC0A 1NFFA 3DOJA 3PWKA 5CEFA 2A92A 2VYND 3ONEA 4YRBA 1P9LA 4YAKA 5BT9A 1R6DA 1YS4A 4XQCA 4YAJA 4CMIB 3KETA 1Q0QA 4KQXA 3RFXA 1A9YA 2GASA 2JFGA 3IOYA 5T5QA 4A03A 5HRUA 2HMWA 3KLMX 1R12A 2ZTLA 3MOGA 4IS3A 2FSSA 2W2LA 2Y1CA 5FWNA 2JCYA 2VUSA 4B4OA 4DL9A 5L4LA 1NTOA 1XWFA 4TRJA 3DOOA 4FGSA 4ZGWA 3VTZA 4P38A 1MG0A 5FI3A 3GY0A 1XCBA 3QVTA 2VUUA 2J5QA 4FJ2A 4J3FA 5G4KB 1AHIA 1XQ1A 4DWVA 2GRAA 1X1TA 3IIEA 2AQHA 4PLTA 5MDHA 2UUOA 4YACA 2FMUA 1M67A 1ZVMA 1DC6A 2FR0A 1JW9B 4D3SA 1KVTA 2Q49A 1ZSVA 3DHNA 1G1AA 4JX8A 4HBGA 4EZBA 3W4JA 3DWFA 3E48A 1KVRA 3WTCA 1U8XX 3X2EA 3CZRA 2OOSA 3CEAA 4BNGA 2I66A 2TMDA 4Q3AA 5ENDA 4CLEA 1PX0A 3U4IA 4MINA 2DBVO 3HB4X 4OHUA 1SMKA 1FJHA 4J2HA 1L7EA 2GN8A 2Q2QA 4PLYA 2O3JA 2UVDA 4KMSA 3HHPA 1VSVA 2B4QA 2P4HX 3QRWA 4DPLA 3ITDA 2DU8A 1LUAA 1ZJYA 3MJ4A 5ILGA 4J1QA 4FSHA 2X1HA 3GG2A 3SLKA 3P2YA 4NDNE 4E31A 3KOUA 4NIMA 3F9IA 4IGFA 1HXHA 2NVUB 3NTRA 2FY8A 1NPTO 4XJTA 1Y9AA 4NU5A 3H9JA 2J3IA 2VTDA 5TGDA 4DTIA 3RWBA 1FDVA 4LVCA 2NVBA 1DRVA 1SO8A 3K2EA 4PLCA 2BLLA 2VWQA 4B8ZA 1B15A 5TX7A 4Z9FA 1WZEA 2C59A 3A9WA 1HL3A 1JKJA 2JHGA 4PVDA 1EMDA 3D1LA 4NBUA 1ZFNA 4CLRA 3PIIA 4XRRA 1TEHA 4N5NA 5EJ2A 4OKNA 1B8PA 1XDWA 2X0IA 5A06A 2B35A 1EFLA 2A9FA 4CV3A 3PFFA 1I32A 4LSWA 4CR7A 5JLAA 1GFSA 1UAYA 1ARZA 1FDWA 5F5NA 4DLAA 2CDBA 3WQQA 2EF1A 1ZEJA 3VPSA 2LDXA 2O23A 2X5KO 5DP1A 2Y99A 2WTBA 3WX0A 1TT7A 1YDWA 3NGXA 4Q3EA 2PV7A 5A9TA 2NQ8A 4EJMA 4EUHA 4IJWA 4GBJA 1UP4A 3H9EO 3EZYA 1B16A 4YRDA 5ER9A 5JC8A 4INAA 4Q39A 3RC1A 2V6FA 4CM9A 1PJBA 4MP6A 1O9BA 1Y81A 4Z9XA 4GVXA 4JP3A 4Z0HO 3WGIA 2GGSA 3GG9A 3WGTA 3LDHA 4PLGA 3K8ZA 1TXGA 3WBBA 1DC5A 1LBEA 1ONOA 5B4TA 4B7XA 4R51A 1QV7A 4E2XA 1PU2A 2GPTA 3GHYA 4MKRA 5L45A 5HBRA 5I7EA 3KO8A 2NADA 1H5QA 3FR7A 4RVFA 5EN4A 3HFGA 1QP8A 1A7KA 1RJWA 2YV3A 3C1AA 1CEQA 1MC4A 3GLQA 3DHYA 4MP3A 3VH3A 2OFPA 3VKUA 2IODA 3MJCA 1ZK1A 4U0JA 3GC6A 5DP2A 2VYVD 1UXJA 3ZWMA 3BIOA 4DXHA 1DLIA 4PLWA 3U62A 4RORA 2E48A 4EW6A 3RSHA 4GMGA 2ZTUA 3GH3A 1DJNA 4YPOA 3L9XA 1I2ZA 3I3OA 2EWMA 3G1TA 3DONA 4JN6B 3PXXA 3WJ7A 1NQ5A 3ROMA 1M66A 1CETA 4JBHA 1T26A 1LDYA 3D64A 1PR3A 1CERA 4W4TA 4DBZA 3LQFA 4D7AA 3JQFA 4YYZA 5JW6A 2EW2A 5ICMA 3GPIA 4B7UA 4E2YA 5F5LA 1JWBB 3Q3CA 3HB5X 1X15A 3BMCB 1QSGA 4P22A 1YONA 4NJMB 4J4HA 1PL6A 2P4QA 2ZJ0A 1SEVA 3GQVA 4F46A 4U8GA 3GVCA 3ZV6A 2EHDA 3ANNA 4WASA 4PGFA 3W4IA 5CFZA 3VTFA 1CYDA 1IB6A 1V6AA 1QKIA 1NFRA 1MUUA 4WCFB 1GZ3A 4QT0A 1FK8A 3HDYA 3PFWO 1IZ0A 3AU8A 4BMSA 4XQEA 2YJZA 4F6LA 5G4LA 5TT1A 4BNTA 3WMWA 1NHWA 3PQDA 3ZWAA 1KIFA 4DLLA 5KTKA 2Z1NA 2XOXA 3NUGA 3QWBA 2Y1DA 1JWAB 1Y7TA 2NVWA 3UH1A 3D0OA 2V65A 1U7HA 3AFNA 3I6IA 1HDRA 3D5QA 4X54A 4HFNA 3JQ6A 3I1JA 2OL4A 1IHXA 4BKRA 1ZZEA 5DBFA 1EQ2A 4J1TA 2AEJA 4FPXA 3TZKA 3E5RA 3VDQA 5JSFA 4DQXA 1O6ZA 1LDMA 3LU1A 2VHVA 3PDJA 4CLDA 1E3LA 5HWSA 1P1IA 4OL9A 2BGLA 5G0TA 3ZZNA 4QSMA 1X0XA 1KY5A 3EYWA 4J7XA 3KYDA 5TQVA 3RC7A 3VOSA 4BNHA 2IDZA 1W4ZA 1E6UA 1UH5A 2D1YA 5JMPA 1XIVA 4FC7A 5C5IA 4A10A 2RHRA 5IXYA 1HTBA 4M54A 4J7CA 1JN0A 4BGVA 1ADFA 2PZLA 4OKIA 4WNCA 4NBRA 5ILOA 3PDUA 4NU6A 4FOSA 4RLHA 3RUCA 2I3AA 3H3JA 4WOKA 4P4GA 3CMCO 3GVPA 5FFFA 2IE0A 3UF0A 4DIOA 4CQLB 4WCFA 3RC2A 3GNTA 5JAIA 1BXKA 3ZW9A 1J5PA 3EGOA 4B8WA 4D3FA 2W8ZA 3KUXA 4FBGA 4IY1A 4B7CA 3RUEA 1RM5A 1LQUA 4ALNA 3DBHB 4KDEA 4R3NA 4DIFA 5GZ1A 4JK3A 4HY3A 5T67A 1YOVB 2VWHA 1E92A 1D7OA 1NR1A 3JQDA 4J90A 5JBIA 1SZJG 4NBWA 2P5UA 1E7MA 1W8DA 4IDEA 3PZRA 2DKNA 1P74A 4ZHSA 4XEHA 5EL0A 5L7WA 4UUNA 2ZCUA 3A06A 1IHYA 2AQ8A 5IXSA 5TF4A 1ZBQA 4S3MA 2Y1EA 2VQ3A 1B8UA 3DC2A 5DOZA 2LDBA 4CR6A 3D5TA 1AUPA 2EGGA 3K31A 1YDEA 3UKOA 1MXFA 4NPCA 4R68A 1NQAO 4I08A 4XZ3A 1PZHA 3OECA 1T2EA 2QQ5A 4J2OA 1NX6A 4MKZA 3LC7O 3WIEA 4EUFA 2WYVA 5G0WA 3EZLA 3P2OA 3NT5A 3KEOA 4RPJA 4BO3A 1AXEA 3RAJA 3T4XA 5COQA 1IULA 4ZRNA 1R4MB 3AOGA 3GAFA 3P5SA 1DIBA 3TL3A 3KV3O 1Q1NA 1OMOA 1BTOA 1E5LA 3MOIA 1HYHA 3FHLA 3O03A 3RBVA 2DAPA 1EVZA 4GH5A 1P0CA 4E33A 2VZ0A 2Y1FA 2CD9A 1U7TA 3ZWBA 3LK7A 4DYDA 1HDOA 4YR9A 4MVJH 5TT0A 4ZJUA 2Y1GA 3DR3A 5AQ1A 1U4SA 4CUZA 5BNIA 3BTVA 4RVGA 4OH1A 5TS3A 1HRDA 1K5HA 2GUGA 2ZKLA 4CR8A 2I65A 1ISFA 1I8TA 4C7KA 2DQ4A 1WMBA 2QRKA 5GY7A 2C5AA 3KZVA 3ZHXA 4PCVA 1B14A 3C1TA 1G0OA 3NGLA 1BW9A 3S2FA 2GN6A 1O8CA 1ENPA 3UCEA 3JYOA 5JCXA 5JDIC 2WD7B 4TVOA 2Q1TA 3ZWPA 5L3ZA 1K6XA 3ANLA 2QG4A 3FNGA 2JD1A 4XKJA 2I99A 1YWGO 3TOZA 1LC0A 4YVFA 1T4BA 1YJQA 5F1OA 4WLVA 5AXDA 3ROKA 1CRWG 4WCDA 3DAFA 1N1GA 3CPSA 4J1SA 1JU9A 1Q0HA 2PNFA 1LI4A 1U2GA 1BRMA 1Z7BA 2B5WA 3RVDA 3U0BA 5THQA 1R4MA 4IMRA 4BV8A 4GLLA 2Q45A 1OZAA 2CMDA 4ND2A 1LSOA 3QVXA 5EIOA 2IZ0A 2IXAA 3OIGA 4CM9D 2ET6A 2VHXA 2HK7A 1Q7GA 2O50A 4M8SA 3L6EA 4NH4A 4AJIA 2GO1A 1B3RA 4DQVA 3E9QA 1K89A 1IL0A 2IEDA 3QVSA 1HF3A 1T25A 1PZGA 5H81A 1DIRA 4BO5A 1KS9A 2RAFA 1QV6A
chains in the Genus database with same CATH superfamily
2UYGA 5J2TF 4PFSA 2FFBA 5JNTA 4FEYA 1NL3A 1UDWA 5L4NA 1J9GA 3BH6A 1K66A 3BJIC 4QO8A 3GLHB 4U7FA 3A6GA 4KR7A 1TJPB 3HFSA 3HUUA 4KC0A 5JXJA 2QJFA 3MEQA 4OKSA 1JLLB 3IQEA 4FT4A 2A7QA 1IZ8A 1JG7A 2CCJA 1YZHA 3RHFA 1MTZA 3BILA 3OTGA 4LXGA 4J3NA 4FU0A 1LRKA 4J9UE 4HP8A 3SJBA 1YT5A 3RYHB 2H0RA 5ALFA 4A6PA 1T9CA 3AKYA 2W2TA 3RROA 3UK7A 1G6KA 2OM6A 2YIDA 5DHSA 4CUKA 3D7SA 3I0NA 3I2JA 3L7NA 1FXWF 5EMHA 5FBRB 3O26A 1QO0D 3WSTA 5EESA 3LCCA 2HHAA 4BO7A 2RARA 4JQCA 2HZBA 3QLUC 2EDAA 1V5FA 1T2FA 1YZ3A 2FEAA 3PJFA 4HDKB 1QE3A 4WGFA 4ZU1X 1DUSA 5I9MA 5ER6A 5U1PA 3UFXA 4EHBA 2J3LA 3O4JA 2YIJA 4TS1A 1A4UA 1SIUA 1OBCA 2WJZB 3HSYA 1VG0B 1ZBDA 3I9V1 4DJAA 4Z3KA 4QPJC 1ZITA 1YI8A 4QOGA 3MQFA 3OLZA 1HG1A 2RGDA 3C7CB 4L78A 4D97A 2ZIXA 3I39X 5IVPA 3NJ8A 4QAJA 1QWOA 4GGPA 4A7PA 2FZ5A 4CKZA 1NRWA 4E07A 3ORQA 1FW8A 3OQBA 4BX0A 1SK9A 4XYEA 3PT9A 4RK5A 5DTEA 4DNXA 5BOSA 3IHKA 5H7XA 1L8AA 1QH1B 3T9CA 5DNYB 4OI1A 3DL2A 3VHQA 4JYPA 4P7GA 1L5WA 2VAMA 3W7VA 4MQ5A 2DETA 3ZBPA 2DBRA 4OCZA 1DKQA 3LBYA 4WFJA 4UTVA 4HR7A 4OUKX 5DM4A 2BZSA 3SYTA 1A8IA 2XCTB 4JLWA 3AEYA 3AINA 2I87A 2N1BA 3DFKA 1ZM7A 1Z45A 1IUOA 1AKEA 1KZ4A 1A8HA 1DJQA 1LVGA 2O9JA 2ZT6A 4LI3X 3T5DA 3FLAA 4BZPA 3B2NA 1ETHA 1H2AS 2IYLD 3QLVC 3RCBA 4E70A 5TS2A 2LCFA 3HSKA 5D01A 2PL5A 2V1UA 4JLOA 2C07A 3O38A 4G1FA 4RGBA 5SV2A 3LQ1A 1YR7A 3UOGA 3RVJA 1ORHA 5CYFA 2VQEB 3LQ2A 4WBXC 4RVUA 4HMQA 2ZBQA 4XDHA 3G2HA 4ND4A 2LZ0A 4WIAA 1YCHA 4CM4A 4XX1A 1RWQA 5IN5A 1EX7A 4BMNA 3WSVA 2GNAA 6YASA 1LEHA 1QKJA 5BN1A 3M6FA 4RSHA 1B1CA 2F43B 1KYYA 3FZNA 4XGNA 4DCCA 3GEDA 2XE6A 1FNMA 3EK2A 3O95A 3OAAD 4LWZA 1PYOA 4K9RA 3KVNA 5CU7A 3TCKA 1PW7A 4XDGA 5M2QA 1LRJA 1CUWA 1P7PA 3QVKA 4KR9A 4ZQFA 5IANA 3AF5A 3E3LA 2I33A 2GERA 3LOPA 5LOVA 3W05A 4JI0B 3DYBA 4MV5A 2I4LA 4PZZA 2Q4RA 4B35A 3QX3A 4AURA 1P9WA 2QN9A 2VKTA 3GGSA 4D4HA 4BO1A 5K0SA 1W0KA 1DX9A 2I4RA 4W9NC 3T7SA 3FUXA 1O5OA 2QWXA 5EKDA 4B6JA 3BFJA 1LPBB 1QOPB 3KQMA 4HQFA 4V0OA 3PXEA 3NKLA 4ZICA 4YCBA 1S3FA 1M33A 4IHJF 4MQ4A 1XNJA 4NHEA 5KTRA 1OH8A 4MHOA 3MJVA 2FZEA 4J0EA 4PE5B 3QXHA 5I5EA 2F00A 4RM3A 5J9FA 5JH7B 2CJYA 4QFBA 4G0YA 3UJAA 2V98A 2XCSB 4C08A 1E8MA 3SF8A 4GMXA 4J75A 1XD9A 1GLNA 4ZAZA 2QUIA 2VPXA 3W9UA 1C8LA 1WU7A 4XVUA 1CQIB 2RHGB 3EZNA 1M2OA 1UDXA 3SS8A 2ADMA 4RWZA 4C4TA 1FYWA 2BTOA 3KKQA 3QHAA 4NNOA 3DHVA 5B1SA 1LS6A 2LIVA 4J03A 3V2HA 4DUPA 2UU9B 1QG6A 4NEGA 2ZBPA 5HF8A 1R00A 2CXQA 3SX0A 1G8HA 2YRWA 1W73A 1Z28A 1IN1A 3NHBA 5T4FA 3ND9A 2SKEA 4W1SA 2GD6A 1UOPA 2R79A 3T9AA 2BZ1A 4H7HA 4M86A 3AILA 3FMVA 1PJTA 4E0BA 5DT2A 4NP6A 3IVMA 2IGBA 4YROA 5EERA 1XYVA 3F6EX 3QTLA 4X3PA 1NJ5A 1K7YA 1VIMA 2WHYA 4RHUA 5HOQA 1Q0RA 3UGJA 2GBIA 4JNKA 1T5SA 1ZCAA 2P5TB 2WOJA 3QBEA 4GXQA 4QC2A 2Y0EA 3OIFA 5CYPA 4F4FA 1UBTS 4GUAA 4X6UA 4NLLA 1OBHA 2H52A 5LQKA 3L6DA 3VAZA 2J46A 1GYRA 1T13A 3L05A 1D2NA 2JD2A 2VDWB 5DN9A 3RSGA 4MR7A 5FWXB 2YR0A 2Q5FA 3M2PA 5JQGB 1NP6A 3CLVA 3MJFA 1P80A 1U7WA 1XXHE 3JD0A 2PJUA 5T41A 1X39A 3DPUA 5TIIA 1RCUA 2YZGA 2DMRA 2JBAB 1NLYA 2RKWA 3DZIA 4MB0A 4PLPA 4RCZA 3ZLTA 1EXDA 1UBSB 3OM1A 1TLLA 2BFCB 5B37A 2R7LA 3T1NA 5A05A 2HCRA 2PQ6A 4WN9A 4JUCA 1Z37A 1HYEA 2GRJA 3AL0C 2NLOA 3GO4A 1G20E 4YJGB 4EHLA 1VCIA 4FGJA 3OKPA 4IUDS 4ETMA 1Z07A 3GFOA 1KZ1A 1BKSB 3GJSA 1XZKA 1RQGA 3TN7A 1WCXA 4M0LA 2XA9A 1GFIA 3ZQJA 3GLVA 2EKZA 1ULAA 5AI5A 4XIFA 3RF7A 1K9VF 2Q8NA 1KJ9A 1LV8A 2YFHA 3HU5A 2ZT7A 1U98A 1F0KA 4V0NA 3SU8A 1WWKA 3TUJC 2J3EA 4GZMA 4BYMA 1H05A 4ZREA 3Q8LA 4X1KB 1V45E 2VK8A 4LXXA 1NNLA 2ZBFA 1DT3A 1QC5B 3AM3A 4L75A 4LC9A 2WRZA 2FUKA 1WRBA 2WJPA 3EQ9A 1F06A 4CTKA 2AKYA 4DLBA 3EZ6A 4MCIA 2F1IA 1HA3A 1VXRA 1WD5A 2C8KA 121PA 3FNBA 3KXIA 3ND7A 4PX9A 4EA9A 2HNAA 4GM4A 1KDYA 2J9XB 3WDMA 2JLRA 1GZ6A 3HMQA 2H5JA 1VPVA 1KTVA 3RFTA 4NMMA 3PI6A 3F2VA 4JNCA 3T7EA 3W9SA 2GEKA 4OM7A 1W47A 5CCXA 4TMWA 4Z4GA 4RADA 3IL2A 5TQ0B 3VZQA 4H1TA 1C4KA 3F4LA 2A30A 4MVJE 2UUPA 5LU9A 5LQRA 4LCJA 4C7VA 1KC3A 1WUHS 4LYYA 3SMVA 1CPYA 4LNAA 1G7SA 1K27A 2Q7XA 1MABB 1SUAA 3AJEA 5IKOA 1CG6A 2OGSA 2VP0A 1Y5MA 3HBLA 3WIDA 4ZKDA 5CEEA 5HF6A 3ZI4A 3QVUA 1JDBB 1P33A 1A2QA 3KVVA 4PBRA 3CWCA 3MJSA 4CMIA 3SNKA 3RS9A 1ADJA 3H75A 4D6YA 3L01A 4UMEA 1M2VB 3W6ZA 2KSQA 4HNAA 1BYUA 1EE9A 3FIJA 3IAXA 2YY5A 1YUNA 3N59A 1A8QA 1Z73A 3H5NA 4CQMD 2H59A 2J08A 3IIKA 3BMXA 5ADVA 4BCDA 5F1KA 3HS3A 2AQIA 4CT5A 2R85A 1Q1EA 1KI6A 1OOEA 1K92A 3IQZA 1M1YB 5JD3A 5F7JA 4CKWA 3A6FA 5LA6F 2X7JA 2GYYA 2I22A 5LLTA 1KMQA 5C1BA 1GTRA 3SGLA 1QDUA 2XT9A 1JEJA 5EEGA 4YJFB 3FHJA 1KF0A 1XV5A 1N3YA 1GAJA 1V39A 2QKYA 4II3A 4KG7A 1N92A 1J09A 3JQGA 4MAAA 1RKQA 4O4IB 1ZJWA 3L07A 1N4AA 2IIQA 5FADA 3GB9A 1TECE 1Z56C 4Q3KA 5G1OA 4F9TA 3PXCX 1YCFA 4QVIA 3WYNA 3X1XA 1KU0A 4Q1CA 1J1IA 4L4ZA 4YJHB 1R4AA 5EHGA 4EJFA 1NLMA 3FAKA 2B1IA 4I3FA 2GZAA 1W8IA 2EBHX 3R7FA 1W19A 4FM9A 3L6RA 1ADGA 1Y82A 4WNYA 3TCNA 5GVRA 3RKUA 5KSWB 4MIEA 1JT2A 1BX0A 4IINA 1NJGA 1IZZA 2DT8A 1JG6A 2MSWA 2QX7A 3MWJA 4J3JA 3ZGXA 4XSVA 1JIUA 2AVNA 4L9RA 1ODTC 2J7PA 2WSMA 3CGWA 3T8YA 1W4RA 5DULA 4MR8B 1I6LA 4UAGA 2BI7A 2L82A 2PJDA 2IYVA 1QH8B 3HCBA 4QXMA 3OLWA 1MLDA 4IKEA 4GXRA 3DD5A 1AOXA 1A9TA 2NG1A 4PSUA 1UBGA 4MUFA 4CF4A 1N1EA 2HY7A 4BLUA 8LDHA 3AI1A 5JD6A 4WK2B 4DJTA 3F5FA 4DBVO 1H0KA 2GVNA 3BEOA 3GUYA 1HEYA 2CZQA 1PWEA 5JTUA 3BWDD 3KVOA 4DV2B 1QH9A 2BP7A 2GR9A 1IK6A 1Y7IA 4OP1A 3Q8XB 2HJGA 4ZCQA 4G0XA 4BTEA 2ZJ3A 3H5AA 4A5OA 1RHMA 3KKLA 1S8AA 4MPTA 3MTJA 1UOEA 1B3BA 2X0JA 1ZESA 3AJ9A 1V4NA 4CEHA 8GPBA 4K28A 3V34A 1J99A 2C2ZA 5B12A 5AW5A 3NBFA 1A71A 1B0ZA 2XBUA 2GEBA 1AMOA 4EEKA 1OR8A 1H3NA 3H8VA 4LJKA 4D4MA 1VXOA 3U17A 5A5EA 4ZOBA 3DWEX 3QE2A 1EFTA 3EVEA 5KNBH 1H8HA 1CLEA 2E4YA 1CULC 3A4TA 1XTTA 4ZZ0A 3B70A 2OECA 5BVHA 2HTFA 3UTCA 1SUBA 4GF5A 3E22B 4OQMA 3DMTC 3PQFA 4DIBA 3DFIA 2QD4A 1JJ7A 3MUOA 3CZ9A 3NQ41 5IWCA 1OWPA 1F8GA 1SELA 2GHTA 1IUPA 1CR4A 1E1QA 1HY3A 1U6IA 1QG0A 2B2NA 2PMFA 3I6QA 4HEA6 1R8SA 4Q7MB 4XCQA 1T3HA 1G9XA 1M74A 4H7IA 1NR5A 2KW5A 1QQ5A 1A76A 2DH6A 2PT5A 1KZ7B 1QDEA 2EVWX 4QECA 1AMUA 1ZD8A 1C29B 4G56A 2A94A 4WBNB 4C5BA 3GGGA 3PA6A 1C7JA 3MOSA 5CNIA 5FEUA 4X8LA 1LF5A 1ZD2P 4M53A 3CNBA 3F6CA 4CN9A 4MUNA 4EB0A 5IVHA 2HA6A 1GPH1 4TYMA 1XMJA 1T5OA 2GXUA 4O4HB 2QX8A 3VPXA 2P2YA 4FOTA 3D2AA 2GRUA 3LBNA 5AJWA 1ZIDA 4D9FA 3B1JA 3QLJA 5K6AC 1CYEA 1N57A 4LRWA 4UXJA 5F1YA 3H13A 1D8AA 3PC7A 3QP9A 3W8DA 1RYMA 4J49A 4YT8A 3QEJA 5H80A 5C1IA 1W0KD 1FQOA 3DKIA 3MXOA 4NZZA 5K0ZA 2DHDA 1GKIA 3TLMA 1RXWA 3ME5A 2LNDA 1KFKB 3QKTA 1HYQA 2NWQA 2R1TA 2BISA 2WJGA 2GS9A 3ZDAA 1XZFA 1AC5A 4PFKA 2R5NA 3CKMA 5AI8A 2EQAA 5E4TA 3RSSA 2XZPA 2P1DA 4PZLA 1ECBA 2QQEA 3FJOA 4TV9F 4RY9A 5H70A 2ZRKA 1MO3A 1NVEA 1N2CB 3CW2A 3DDCA 1W44A 4FJ0A 5DGXA 5FLEX 3WDSA 4JT4A 4KQMA 3JQQA 1M0WA 1PNVA 3U19A 1GGHA 5KNLA 1TKBA 2J9GA 2WV9A 4C5CA 2QTRA 4Q48A 4RA6A 5FNVB 2G71A 2QYSA 3L4BC 3A6DA 4TOIA 4LTDA 3QX8A 4DV6B 4UC0A 1Z5GA 3K6RA 4GX1A 3EIWA 4JIMA 4MYUA 2WAAA 1GCGA 1VKHA 5TEVA 3ZK8A 3F71A 1RAIA 4BVJA 3TQHA 2Q1XA 2ZVPX 3TRKA 2UYYA 2VJBA 3QUTA 1GV1A 3TD6A 1QGUB 5CA0F 1CUCA 3NJRA 1A4XA 1IY2A 3REOA 2VYFA 3SZMA 5ULLA 2Z2YA 4ARZB 2AB0A 2V0CA 4RCVA 3RGGA 4DUZB 3CKLA 4EYSA 4HQLA 4BNYA 4XH9B 1YD7A 4P4SA 4UNQA 4X5OA 2Q46A 4PSCA 5IDQA 3FNFA 3PQ4A 3NW9A 4C89A 2WU0A 1M54A 3TB4A 2ZRGA 4C4OA 5JYCA 1ILEA 1SBTA 4ERNA 1B43A 3NEYA 4Q3BA 2Y2UA 4F1WA 3II6X 1CFJA 4EHIA 1KZHA 3DULA 3DXYA 4WJZA 3D02A 4BLRA 2VT3A 1N32B 1HT1E 1GR0A 2VSNA 4MW1A 4S1OA 1AX9A 1V8DA 3Q41A 1C7IA 2JA1A 2O8NA 4B34A 2AOTB 2A5GA 2JVIA 1TEZA 3IIMA 1NZFA 2Q4EA 4ZT7A 2R6HA 5JATA 3K9BA 3P5BA 3DCJA 2NYAA 2IYRA 4XCXA 3WISA 3P26A 4Q12A 4YRJA 4N18A 3GVIA 1VHQA 5BW5A 4L8VA 4BO0A 4QQKA 4LSMA 4D0SA 1I30A 1NMZA 2ODNA 3GQBB 4ZJPA 4DJEC 5K8LA 3B1VA 3DFZA 2JIPA 2ZTVA 1V47A 3SPXA 4AU1A 1V0JA 1GTSA 3SZUA 3H2JA 3DCIA 3QVLA 5B7PA 3ENQA 3EUWA 3FFTA 1GNSA 4U9UA 3BRSA 2YW9A 1RC0A 1UKYA 1Y3IA 4MGYR 1H2YA 3O8QB 1TO1E 1MAVA 3MQ4A 1LF0A 3TFOA 1V26A 2W2LD 1Y6FA 5ALHA 4LE0A 1CVIA 5BR7A 2C5EA 2BBTA 2FE4A 3IJPA 4A8JA 1OLSB 2YWBA 1A2KC 2EW8A 1S4QA 3D2LA 3JQ9C 1XZAA 4JS0A 3RJ9A 5AXBA 2J45A 2NACA 2VPQA 4B6OA 1D6MA 4ZVPA 1SQGA 4O63O 1BDMA 1TU0A 2ZQYA 4M76B 2ZRJA 5A6SB 5T6BA 5IJXA 4AJ1A 4DCPA 4DEXA 3Q7SA 2DUMA 2I71A 4J4BA 1HMYA 1EXWA 1IHPA 1PKEA 2PL1A 3TIVA 4A8TA 2P6RA 3DBVO 4NPAA 5C2JB 3ETGA 3OETA 1Y8QB 5AJZA 3L06A 5HHTA 1PR0A 2V58A 1Y34E 2J9FA 2YCBA 4AVYA 4G2NA 1ZKDA 4J7UA 4N1AA 5D3QA 4MS4A 4XTRA 4B3BA 5JRJA 3NBZC 2VLBA 5IZCC 2OFXA 4MV6A 2IA5A 2QVLA 4JAVC 1PVVA 2PGJA 4Q4CA 5JAPA 1QGOA 2IXBA 2DFVA 5B30A 3D3EA 3NVMB 3ZQUA 2OPBA 3LD9A 4OBWA 2OQRA 2ZS7A 4GLOA 3RT9A 4EFLA 2C2WA 3IMCA 4Y1RA 1IPEA 1LPNA 1V1RA 3OA0A 3QENA 1JHRA 4CTOA 1K8YB 2HX1A 4WE3A 2HXYA 1ML3A 2PLAA 3AIOA 4E5NA 1ISHA 1JAZA 2YWRA 2EC5A 3QIVA 1ACJA 2ONZA 2HLDA 3P0FA 1EGQA 3EC7A 4HX2A 4BO4A 2ZWAA 2O3RA 4YUAA 5A9SB 4CRWB 2QZZA 2XNCA 2JIDA 4GC9A 4E4YA 1HZZA 5A02A 1ZHOA 1F9AA 3OKCA 3QKSA 4N65A 1II0A 4W99A 3VR4H 3G2IA 3TQQA 3N39C 1MENA 2W2XA 3B6IA 4U2CA 2BPOA 2CNBA 1E1RA 1VIDA 1XRMA 2FP3A 3A7DA 3LDAA 2C31A 3LY9A 4G9EA 4JR1A 4KQ1A 5CTJA 2IPLA 2PWBA 5DBHX 1QRRA 4R0MA 4Q7EA 1QPBA 2AYYA 2O8FA 3G2PA 2V6BA 2ORIA 1KU6A 4AFNA 2RSLA 3TG8A 2R8PA 3HR4A 2JJ2A 3D54D 4HN9A 2CE2X 1ESZA 1P31A 3DT9A 3N0XA 4P35A 4PHCA 2AYXA 1W76A 3S0JA 1M0EA 1NBME 5KYTA 1JH8A 4IXTA 5IS2A 3NOOA 4PQGA 2ZB3A 1WXEA 3C85A 3SOPA 4B75A 1MIOA 2BTQB 3C1UA 5DSZA 4N40A 2G63A 4MWBA 4FHZA 5CH5A 1GDHA 5HQ3B 1TFUA 1DDOA 4G4JA 2CXXA 3GRYA 5JS7A 1VSUA 3V2IA 1TX4B 1AK2A 4LGVA 2ES4A 3PGVA 2DPGA 4YALA 4OJTA 1WU8A 4S1WA 4AO6A 1EUDB 3KPJA 2A9KA 3ZX5A 2DX7A 4WXYB 3FFBA 5ALEA 3QKWA 4V39A 1QTNA 2GKSA 3QEOA 4B4KA 2GM4A 2J7PD 1H5NA 2A1IA 4D25A 4XLLA 3H5RA 4AK9A 2CT8A 5G40A 3VKVA 4R71A 4N9QA 2QRZA 2VEDA 2Y71A 3T3PB 3CRQA 4PVCA 3KLOA 3MTDA 2VJQA 2QP4A 3AY6A 3NTVA 4W63A 3KC2A 1O57A 5EWJB 1T9AA 5IH3A 2BEUB 3E3MA 2IOYA 3D59A 5KYUA 4KOEC 4B6GA 2MSEB 4EY6A 2G72A 5DCYA 5CFRA 5LXTA 1Y8ZA 1J7KA 2YN0A 4XYGA 3EW7A 1K6MA 4D0RA 2OT3B 2F67A 5JDIA 2YQ4A 4P08A 1RXVA 3DB2A 3O2JA 4KSBA 3Q87B 4L5IA 5HIIA 2BFOA 1YR2A 2ZREA 2ZJ8A 4FMCB 4MGHA 3D1JA 5IAJA 1XCGB 5JSQA 2Z95A 3HKDB 5LQAA 1IWOA 1N8KA 1QDLB 3GFPA 4ER0A 2ATCA 3C74A 1E9BA 4FGLA 4GPAA 3A11A 5FXMA 3LUFA 3TH5A 1GARA 1NR7A 221PA 3NH9A 1Z74A 2RJNA 3SXUB 3UMYA 4OMFG 1J0AA 3DH0A 3E61A 3OWOA 4YT5A 2GKGA 3NRCA 5KCMA 3H7AA 1HE1C 1U3WA 1DAPA 1V3QE 1H8HD 1IPFA 1MFZA 2WWTA 4YRAA 5K0FA 1C14A 2F17A 4HS4A 3LIPA 5A3SA 1XQ6A 2OUIA 2Q5JA 1R0RE 3STWA 1WHSA 1QYCA 3DMRA 4FD2A 4GSLA 4FX2A 4PYNA 4HLNA 3WGLA 2PRZA 3M6LA 5KZMB 1E1QD 2Z6QA 1BGWA 2AI1A 3CY6A 3DNMA 1R6AA 1D0SA 3LO5A 4ED9A 3CRZA 4L57A 1ZUHA 2C1ZA 1ZWLA 4KXUA 3GLIB 3DE5X 2H16A 2ZGVA 3FWPA 1PG2A 1X80A 2FCRA 3H5TA 5AM2A 1TA0A 3P2EA 3T5GA 1QVAA 5KB3A 3IFSA 1B26A 4DF3A 3OCUA 4LNUB 4J0DA 1FMFA 5D2CA 5ECDA 5KOIA 4FWBA 2JC3A 4EATA 2GXQA 4LYEA 2JRCA 2UZ4A 1Y33E 1ZOSA 4ND8B 4X1YB 4HWGA 1N6KA 2YJ4A 2QD2A 3KZMA 3WLFA 3T1QA 2QRGA 2D4HA 4K6GA 4ZOLA 3P20A 3W5AA 4ZT3A 3OHSX 3CTPA 4DM4A 4OBEA 3WBJA 2AXPA 2QZ9A 1PR4A 2WPDA 3HZOA 4EB3A 5L3QA 3F7OA 1WNTA 3B7WA 4H2DA 3PEEA 4Q3CA 2CB0A 2FLVA 3WGUA 4IXWA 4L28A 1E2MA 4WN3A 1T8UA 4N4AA 4XDYA 3LZDA 1YZUA 3S2SA 1AQLA 5D51S 1I4EB 1TQHA 2JLQA 3DV0B 3E9MA 3HA3A 1NXVA 4J91A 4OQLA 3QLUA 3VPHA 4CM5A 1T8RA 4JLBA 1FQWA 1PG0A 3D4NA 5FOTA 4AY4A 4CM3A 5H4GA 3P9KA 2XCIA 5U9CA 3PEWA 2HRDA 3TE6A 2IEGA 3TWOA 3KJZA 1V9CA 4O1HA 4ZOCA 4HQRA 5D85A 4ZD6A 2P3QA 2ROQA 3ESRA 1XJ0A 4NR0A 4AKEA 2X0RA 4ZXPA 3OOEA 1THMA 1CQJB 1XA3A 1G6OA 1U7ZA 3HRKA 4PZ0A 2GJ8A 4MQMA 3VUEA 4I46A 2P65A 4KCGA 4QYIA 3U7QA 3WNDA 3OTQA 4M3NA 2BKAA 2BCGY 3OCVA 2HQBA 1AB5A 1U81A 4CDNA 5KQLA 5KNBA 4RVHA 2BYTA 2Q1SA 3JR7A 2HJWA 1YB4A 2Q07A 1E9FA 3CH4B 5C8DA 4Y2PA 1QANA 1Y3AA 5FBKA 3B7PA 2XXAA 2NTYC 2B1JA 1M10A 1HFKA 1G5RA 4C4YA 5BQXA 1ZUNB 2P90A 2R47A 3PQ7A 4O5OA 1ESCA 3BB1A 2QMHA 3HJBA 4PCUA 4R05A 4HPXB 2RG7A 1OROA 3DCYA 4IIGA 4RZUA 3SJZA 2PLNA 2XGOA 3QLVA 3A4YA 2C92A 4QU9A 3TLBA 4JFRA 2ZJ1A 5EZYF 3W79A 2DLDA 1F2UA 5JASA 4EX7A 4DDWA 2VNHA 4OHYA 5FD8A 1GG5A 3B5IA 4LC0A 4RYDA 1XI2A 2O06A 4QEDA 3MMXA 3ECSA 1E58A 2WM8A 3KSRA 1MHTA 1FSZA 2V96A 2DY1A 1C30B 3F6PA 3JVUA 2W6QA 2GZ2A 1GZHB 2VJCA 2JLAA 1JJBA 3JYQA 4IHAA 3EGIA 1PFYA 1J90A 1OFUX 5A03A 3ZUPA 1USKA 2I8LA 1BVRA 1V8OA 1A9RA 3IAEA 2C5SA 3K4HA 3K2IA 3A58B 2OWDA 2H4FA 3B5EA 1SXGA 1XKQA 5BOVA 3X1WA 4Z49A 4D3ZA 4ZTZB 2JFYA 1M8FA 3IBYA 5EKXA 3CLHA 3IILA 1H93A 4RELA 3ZNPA 2AE2A 1X92A 4W5TA 3K8YA 1VPEA 1AU9A 4LBVA 4C7JA 4MUIA 1KEWA 2CN1A 4ZO9A 4MUXA 1T0UA 1R66A 2A2ZA 5MHTA 3EPHA 2WVHA 3W0LB 3ZV7A 3OE5A 3OY2A 3U4DA 1N2ZA 3O83A 2ILTA 3D6HA 3FN4A 4JUDX 4IO0A 3LX4A 2FPUA 5J2TA 2FSUA 4QTXA 4RJ2A 2OZLA 3CZAA 4HFMA 1T15A 2VJMB 3AESA 3O73A 5A1JA 2WA1A 1NT4A 4HZUA 5DNAA 4ARUA 1CP2A 3AP2A 5H82A 5C5EA 3H6KA 2LR0A 3UJPA 4OP2A 2ZU6A 3QEBZ 1WA5A 4OM8A 2ZAYA 2CEKA 3VX4A 4CQJA 4XDZA 3UAGA 3T9BA 2EDCA 3H1PA 3OP4A 3BHJA 5EMMA 1XAGA 2AMYA 4PAQA 1XL1A 2QUHA 5D7BA 1BU8A 3A6KA 1Z08A 4RPLA 1FXWA 3K05A 3RWMB 2EBFX 3BGDA 3ILYA 5GZ3A 1V7PC 3MFYA 2D5BA 3OQ1A 3DZFA 1VHLA 2QRHA 4UE6A 1E1LA 1WUKS 1ZW1A 2E5LB 4BXOA 3FNHA 5EUMA 2C5BA 3NYRA 4OHXA 4E1VA 4AJOA 1T2VA 1H1DA 2V8OA 1W5AA 4I5FA 3BTUA 3N0WA 3MIIA 4HAWA 3RRXA 1CNMA 5BNFA 1YJ5A 3VDXA 2C4VA 3E5MA 2F6RA 3LLVA 1P61B 2QA5A 3GLUA 2HPHA 1L5VA 4RZ3A 5JNVA 1UDRA 3ASUA 3AY7A 1Z5NA 2EF0A 2ZB7A 3B1ZA 4URHA 4A8PA 1E9EA 1IY9A 2CSUA 2HLDD 2VUTA 3AEUB 2BFFB 1CUUA 3LLSA 4IIUA 4WW0A 1UKEA 2JIMA 4CTNA 4F4HA 3PDIA 3S68A 3FX2A 5IWAB 2C9MA 3PLAE 3TECE 1GGFA 1VE3A 4X9XA 5DW0A 5H0IA 3V9PA 1B2RA 1WCWA 1EM8B 3CSDA 2ODWA 2YY6A 1E1RD 1KO5A 1PJSA 1U2PA 3IQWA 3MGBA 4JJ6A 4O25A 5IT4A 2IH5A 1MW8X 2H65A 2IYFA 4LFBB 3DMPA 3T7TA 3KSAC 4EF5A 1CF4A 5C3MA 1W34A 1QF6A 1WM1A 3VU9A 1OWMA 3ZE1B 3CU5A 4BEJA 3PYMA 1VFNA 3V4OA 1PZFA 4J7AA 4WZ6A 4Y9TA 1ZRMA 2YVUA 4ZQGA 5LM3A 3CVXA 2FGJA 4PLHA 5L4SA 5LKAA 3MJEA 4IWYA 2ZPTX 1WZUA 2QY6A 3QPVA 4FWIB 2WMDA 4R1QA 3U3OA 3WYBA 4BQPA 4M49A 3WMXA 2XKKA 1Z34A 4N5IX 3NP9A 4F6CA 3T12A 4U7WA 6REQA 5FT9A 4RAOA 2OBFA 3ZJVA 1WMDA 2PZJA 4BQNA 3A2MA 1QHEA 3WZMA 2PBLA 2RD2A 1VJGA 4UTRA 4C30A 1UM8A 4N7RA 1E5QA 1CR0A 1NBAA 3K0FA 1UXIA 1X7WA 4PXSA 3HYSA 3S2ZA 3TZQA 4LRXA 3HR7A 1JHPA 3PNMA 4IQFA 2FFHA 4QICA 3FRIA 3RG8A 2QG9A 4X7MA 4KBGA 4QJBA 1ZHFA 2Y67A 4MZXA 2O2YA 2Z3ZA 1VB5A 3HU2A 3QUAA 5HM6A 1K5DA 1XB2A 5KSOA 3IUBA 1LPMA 3DUFB 4Q1FA 4CPDA 4N41A 2Z3WA 4PZEA 2PCLA 2XWQA 4A1OA 3OZIA 4F45A 5BO5A 4M1YA 2PUBA 3LAWA 2ZEJA 4XM1A 1SQ0A 1W2HA 3HEAA 3UK0A 2O0JA 3P2IA 3OPVA 4F21A 4R8VA 4NJEB 4UAJA 4Y2VA 1JH9A 2I9KA 2FP4B 5D3ZA 5WRFA 3DVSX 5DN6A 2D2XA 3E1KA 5GJVC 2ZROA 4TL7A 5FPKA 2VJDA 1H6AA 4UQPA 3U31A 1P44A 2PANA 1JKIA 4Z53A 3E9EA 4E5SA 5JPDA 1BJRE 1OH5A 4B2PA 4R2LA 4RLFA 4D45A 3IUNA 2DWUA 2YZNA 5FA5A 1YZVA 3VR4A 4H7DA 4FGUA 3HYNA 4P7KA 4YRTA 3IKVA 2OGWA 4ETIA 1H1LA 3R09A 1Z5OA 3JPWA 1I2MA 1PNTA 2DPYA 2YJ3A 1XU7A 4ZJZA 1J7JA 5B1HA 1I7PA 1RAGA 3GELA 4IDFA 4MRRA 5ALXA 1N2OA 2ZFUA 5FA6A 5LC1A 4C03A 1Y63A 1KR2A 3R9WA 5EE0A 4P4UA 2V3WA 3GUZA 3EVCA 1S2IA 4FEEA 1BRTA 4NG4A 1ACLA 1F1BA 3CTMA 3VJLA 4CODB 3O8NA 4Q3NA 3AKEA 2SCUA 2O2GA 3GA0A 1I3MA 4G4SO 2B8WA 5CM9C 3VISA 1EDEA 3RIYA 4MXDA 4HDRB 4B4DA 5ALOA 1T9BA 5FYDA 3ROFA 4YUVA 2G4LA 2PS0A 4KR0A 1XRJA 2IOFA 1FYEA 1UMCB 2EEZA 3OICA 4WECA 3LNTA 4JT8A 5J4LA 3I9OA 2QL7A 2Z8XA 3DAPA 4MPRA 3WMGA 2Z43A 4RHXA 3VI4B 3JASA 3Q2IA 5TNXA 3RVOA 4H1HA 5F4BA 2I2WA 2R7AA 3BCHA 1XPRA 5JNLA 3EE6A 5LMZA 4MVCA 3BXGA 1F5NA 1LLUA 3IE2A 4PIVA 5CLQA 1DQZA 2FWMX 3IP1A 3DZBA 2XGSA 1IMJA 1K98A 3LOQA 3NEPX 1EVIA 2ECPA 1YDGA 2WJ4A 4BVHA 1RHJA 2PVCA 4QL3A 2WPDD 4XFDA 3QQ5A 1VE6A 1T1EA 2ANBA 3ZDEA 1XN1A 1XR3A 4TWRA 4EKDA 5GADl 1IIRA 2OHJA 5LYYA 1AK9A 5BN5B 1R8JA 4DDVA 4TKVA 4KOAA 4ZWNA 5J5CA 4AJ2A 4WZBA 4F3TA 2O8EB 4CM8A 4LHEA 4BMZA 1LCIA 2X9GA 1E4YA 1WHTB 3DSRA 7AT1A 1A50B 4DILA 5FTLA 1OX4B 3RIEA 2Y1WA 3G8CA 4RIEA 3BFPA 4AF8A 4Q24A 1EFVB 2FW1A 2HF7A 4V0MA 3O93A 2OB1A 2C58A 3WL7A 1ZA1A 4CI0B 3IUSA 3GRZA 3G6WA 1ZH4A 2VT2A 1Z36A 2ZWPA 4NH0A 1B7GO 4GKVA 4X95A 4BNKA 3WK5A 3C3JA 2PUAA 2IEBA 2XR1A 1DXQA 2LD4A 2QX6A 3G0IA 1UODA 1MNQA 3EPKA 4URUR 5LQCA 4QQ8A 4M0MA 5KNBD 3KB6A 4MVJG 5TEWA 3WHPA 5KYGA 1N0IA 2VRCD 1QR6A 1XFAA 3QBDA 4A92A 2BFBB 1UBUS 3IO5A 2AG8A 2CNLA 1I3LA 3R0JA 5IJWA 4FKBA 2CJPA 1JR3A 1WVMA 1VQ1A 2G5PA 3BHMA 3G2MA 3PRYA 4Y2RA 4G0NA 3ZWOA 5IUNC 1KTIA 3PCXA 2GTHA 3DMTA 2G06A 3IAS1 3L0CA 4NV1A 1LWNA 4R01A 3ROQA 4M8KA 4Z4IA 2XB9A 3DZGA 5G53C 1ZZGA 2J5BA 2BJWA 1EQUA 4UNPA 4CMJA 4FIDA 3ZWNA 3R4CA 3FHCB 1BC5A 1C8BA 3SIWA 4F9FA 4AROA 4L0QA 1V9LA 3BG5A 3LY7A 2UUAB 5BYJA 1ZJZA 4G65A 1A4RA 2IYAA 3VZRA 1RXUA 3VH4A 5G1NA 4B17A 4RD1A 4WOPA 4CNQA 2P9GA 2JFPA 3OFKA 3TOCA 1WB5A 4DA7A 3L7OA 2H2AA 4EJSC 5COAA 1UBCA 2GDJA 4Q1AA 1UPCA 2Q3HA 2ZWVA 1X87A 3L02A 3W1WA 1PSZA 4YDQA 4Y67A 3GLGE 5A04A 4L95C 2YDYA 3ZDXB 4CKBA 4KQIA 3VVLA 4IPTA 4HQ0A 1UBNA 1SXJC 3BCUA 2YVLA 1I5OA 2IYXA 3R5KA 4MQFA 1JQBA 4NAVA 4Y7DA 4KQCA 2OE2A 4LRQA 5K6AA 4JLMA 2GXSA 2NP7A 1QONA 1MX3A 1F0YA 2QP9X 3E4DA 4F85A 4OGKA 3A3YA 3C3KA 5KSPA 2Z1MA 2IUTA 4I99A 1PT9A 1LK5A 1P7YA 3QOXA 1RNLA 3FWHA 5GM2A 3KUCA 5A4JA 4R7ZA 1GCAA 3IEMA 1QIFA 2QNRA 3KRTA 4K03A 5FUYA 4YRPA 3GRKA 3FWKA 3HWX1 4WLEA 1JQDA 4YQEA 1FYDA 3QELA 4AZSA 1U2ZA 5ALZA 4ZDJA 4GFDA 4QTTB 3HL0A 5GGXA 3RVMA 3K6SA 4B3XA 1COWD 2AFRA 3ELUA 3G5UA 3N2NA 4QFDA 3RYCA 3Q7PA 3H7IA 1H9AA 1AQYA 1ZO8A 3JQ8A 3K94A 4NV0A 1AUOA 1FA9A 1LX7A 1NY6A 1TK3A 3CZPA 3L4BA 2JGAA 2R96A 2HA0A 1EAMA 2IYPA 5CT8A 2GPJA 3RSQA 3TSAA 3VZDA 1C3OA 3JYPA 5K8TA 2Q3LA 1FJGB 4RMJA 4YB8A 1BS9A 3E1SA 4UEWA 2VFAA 3QU2A 4IUYA 1QR2A 2VP4A 3LKVA 3NU1A 2UYOA 1TEVA 2H1CA 1DINA 1V96A 5KVSA 1UBKS 3IXLA 1E61A 2E37A 4B3RB 3LOUA 5D3KA 1BMDA 1X1SA 2O0LA 3LBHA 5GWXA 4D42A 1YA8A 2Q2OA 3D6NB 5K7SA 3NHJA 3GMDA 1PJ4A 5KJ6A 1JLRA 3EF0A 4YRGA 1R88A 2RBEA 3FYDA 4ENPA 4I50A 1MN6A 1J8YF 4MS1B 4ZYUA 1G38A 2PZAA 4KXNA 4DWWA 3HN2A 2QYHA 3UYKA 5I01A 3EIQA 4B3HA 2C9DA 4CLOB 4N48A 4EYKA 4BN5A 1JG1A 1CE8B 3EF1A 2GPYA 4V1CB 1E60A 1RQ7A 3PDWA 4OPMA 4R16A 3PEFA 5E6SA 5JZSA 1XNGA 4BL5A 3O3OB 1R15A 4U2GA 2X4LA 3O3CA 1OXTA 1SJ9A 2OV2A 4G6ZA 4JB0A 4G0ZA 4LX8A 4Q7JB 1GDTA 3UANA 1QQBA 3ENVA 3KT8A 3W8EA 1GGMA 1GG2A 1PK7A 3N2KA 3ZK7A 5AVYA 2W6IA 1CR6A 3BMOB 4MDHA 3KPVA 3E27A 2FJ0A 4ZOEA 4J1GA 5K3DA 3U49A 1CZLA 1E8DA 4JIGA 3OBBA 1OB2A 1Y8CA 3OM8A 4I2NA 4D80A 5BURA 2Q6VA 2CW5A 4FYWA 3K0AB 3LUDA 3B5JA 3I5UA 4HB2A 4MSUA 3RASA 5A2GA 5JJBA 4BLPA 1M2JA 4JKYA 2O5VA 4I8XA 3OCZA 5I9SA 1J25A 1Q1BA 5L3SB 5TJ9A 4CL8A 1TQDA 7MDHA 3LKBA 3GXOA 2WW8A 4JI3B 3TGPA 3VYSB 1E2HA 2ZCVA 3MILA 2O0HA 3DTYA 3B36A 2C20A 3RARA 1C1XA 2K7FA 3UQYS 3OHPA 1P81A 3ZWXA 1U3TA 1MO6A 3GX1A 2C7RA 4MPPA 1WJGA 1MQAA 3ZU4A 2VQDA 3MWKA 1XLVA 4D9IA 3OPQA 4DT1A 3JQ9A 4GWLA 3HJTA 3GLFB 1E9SA 3UPTA 4L85A 2NUAA 2PUJA 1FLNA 4KH0A 4UAUA 3W8NA 5GOTA 1WCIA 2PO5A 3BBPA 5BUZA 2JG3A 4MLZA 1ONNA 1PGOA 1UFVA 4M0PA 4BMVA 3QTTA 2H63A 1HEIA 3K70C 4MAFA 2VBFA 1JTEA 1CNFA 4RV5A 1QE5A 5HE9A 3VVBA 1YI1A 5F7ZA 5I4KA 3PGXA 4B4WA 4ZI5A 1QQAA 5JAMA 2HKIA 5AKLA 3SXPA 4PNEA 4BFLA 3ADOA 4R31A 1XTKA 1XX6A 1QIJA 1AA9A 1WMSA 2GJAA 1I10A 3LC1O 3QEKA 4KPUB 5CFMA 2W8BA 3OCYA 3B9QA 3EVAA 4G63A 5IZCA 5B4VA 1OY1A 1PJLA 3UMSA 2F1JA 1QS0A 2FQYA 2PT7A 2WTNA 3M83A 3N1UA 3HZZA 4TRMA 5KWEA 1TL7C 3SBDA 1U0OC 2A7XA 3CUSA 1UKCA 5AHWA 4OK3A 1RPJA 4DV1B 1LBSA 5CK4A 2BN4A 4CQMB 2OENG 5ITWA 4IIDA 1VE9A 2ECKA 3HWRA 4Z0TA 4LMPA 4DGQA 1JL3A 3M4XA 1Q0UA 2I67A 2OILA 4QYTA 4BGIA 3BMQB 3TNDA 1TF2A