4HFRA

Human 11beta-hydroxysteroid dehydrogenase type 1 in complex with an orally bioavailable acidic inhibitor azd4017.
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
260
structure length
255
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPLVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVMQAAPKEECALEIIKGGALRQEEVYYDSSRWTTLLIRNPSRKILEELYSTSYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of a Potent, Selective, and Orally Bioavailable Acidic 11 -Hydroxysteroid Dehydrogenase Type 1 (11 -HSD1) Inhibitor: Discovery of 2-[(3S)-1-[5-(Cyclohexylcarbamoyl)-6-propylsulfanylpyridin-2-yl]-3-piperidyl]acetic Acid (AZD4017)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
total genus 99
structure length 255
sequence length 260
chains with identical sequence B
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4hfrA00
1GUYA 1V0JA 3E9NA 1W6UA 4DIBA 1PWZA 3GVHA 3UW3A 1QYXA 3TFOA 7ADHA 3BMQA 3DBRA 1B16A 2DKNA 4K6CA 4HV4A 1DC6A 2O3SA 4JJGA 2J8ZA 3RFXA 1MC5A 1ZZEA 2G5CA 3LF1A 4PG4A 3AOEC 1T2EA 3HN7A 3JD1A 4B7XA 3OM9A 1Z73A 2J3IA 4EBFA 4NH4A 5CDYA 1C1XA 4GLOA 4XRGA 3WFJA 3KLPX 4XYGA 1GQYA 4UUNA 3WMWA 4BNFA 1WMAA 3ZWOA 2OHXA 3DZHA 1YB4A 4W7HA 4AJHA 1ISJA 4BNYA 4M8SA 1NAIA 5KKAA 3VVBA 1WAMA 2OFPA 5EIOA 1GQ2A 3D4PA 5KJCA 1ISHA 1C3VA 1ZO8A 1LTHR 3B6ZA 4BMVA 1L7EA 1P74A 5DBGA 1YOVA 4OQZA 3KTDA 1XU9A 4CR6A 1PZHA 3NV9A 1ARZA 1GUZA 2VT2A 2GSDA 1IYZA 1X14A 4NBUA 4GKBA 3DQPA 3WQRA 3W4KA 1U3TA 1UR5A 1PJBA 3G0OA 1Z82A 1XG5A 1WDKA 4EZBA 2Z1MA 1LRKA 2PD3A 2RBEA 5ES3A 3H2SA 3KYCB 1V3TA 3FHLA 3HG7A 5EMHA 3DBHB 5JW6A 3VZRA 4EGFA 3OJEA 2C7GA 3GN2A 5JCXA 1VJTA 4E2WA 1E7MA 2OL4A 3EYWA 4YAEA 2FR1A 1YE3A 1B15A 1XA0A 2G17A 1FK8A 3EVNA 3I9LA 3ZV6A 1BW9B 5BNTA 1YB1A 1H2HA 1IHYA 3KUXA 3E03A 3PDJA 3U3XA 4DQXA 4R9RA 1PL8A 3LT4A 4IY1A 4J1QA 3D3EA 4PN3A 1GYPA 1Y8QA 3EZYA 4A7PA 3SVTA 4DIOA 1IE3A 1HYHA 3VZPA 4Y6PA 4PRLA 4DREA 1HE2A 4XGIA 5KVVA 1BSVA 2WJPA 2VZ9A 4FN4A 3RAJA 5IZCA 1LBEA 1XHLA 2NACA 3BIOA 3F9IA 1M66A 1Y8RA 5A9SB 3E48A 4IXTA 3CZMA 1MG5A 3QVTA 2HMWA 4WLEA 3JQ8A 2EKLA 2CD9A 1HWYA 4BKPA 1UP6A 5ICMA 2IEDA 3PYMA 2C5EA 4HADA 3O4RA 1VKNA 1MB4A 1R0LA 3LSYA 3Q9UA 4FS3A 3W1VA 4FOSA 2D3TA 5DDIP 4AJEA 2OXIA 4UEOA 3DBVO 4Q39A 1IB6A 3HFSA 3JD2A 4O5OA 3NRCA 4XIJA 5IDQA 3MZ0A 3ORFA 3GUYA 1XQ6A 2Y99A 3DHYA 4J4TA 3DEYX 3QHAA 1E1MA 4E4YA 1HKUA 1BW9A 5L4SA 1O89A 1PX0A 5TLSA 1LDMA 1NP3A 4HWKA 1HDXA 2GCGA 9LDBA 3VPSA 3F5QA 3WIEA 2NQTA 3DBLA 4A03A 1GR0A 3E6AA 3K6JA 3H65A 4O63O 4AL4A 5CDGA 1QR6A 3KYCA 2B4TO 1HDRA 1I32A 4KQXA 4WASA 4FOOA 1LSJA 3CEAA 2NU9A 3DZKA 4P8RA 4CV2A 1PJ4A 2Z95A 4D42A 1DOHA 2EKQA 1Y7TA 3GFBA 1HF3A 3OIDA 3ONDA 1ULSA 1ZJZA 2Q2VA 4E5MA 2PNFA 3DAPA 1PJTA 4F3YA 2YYYA 3DOCA 4XQ9A 4CQLB 3JQAA 4BV9A 3LT0A 4PG8A 3QVSA 3VH4A 4CUJA 4PZDA 1RWBA 1OI7A 4TWRA 1K2WA 3KZVA 1O8CA 3X2FA 1NFFA 1J5PA 2WYUA 5TC4A 4LRTB 4BGUA 1HDOA 4LVCA 3PHHA 1JW9B 2NVWA 5B1YA 3C85A 1IPFA 1I2BA 4R69A 4AJKA 1JVSA 1R4MA 3GGOA 4Y9DA 4YXFA 3ENNA 1I2CA 4I8XA 2H63A 1A5ZA 1VSUA 1DIAA 2ZB7A 1P3DA 5IDXA 3KBOA 2GO1A 4MVJE 1Y5RA 2DBRA 4DLAA 2X58A 4KP7A 3ZU4A 1FMCA 2O4UX 1D1SA 2X5KO 5IJZA 1ZBQA 2PR2A 1C14A 2SCUA 4KZPA 4IQ0A 4G2NA 1IUKA 4W99A 3EDMA 1I3MA 4OHUA 1HSZA 3MJEA 4GI2A 1SEVA 4ZRMA 3AY3A 4IQ8A 2VT3A 3PIDA 5C3MA 2QRJA 3DZIA 3CTMA 2GYYA 4CMHA 4GKVA 4MP3A 5F1KA 3STHA 4AJOA 4MVJM 4B3IA 5IZ4A 4XGNA 3TL2A 3WXBA 1DFIA 1WXDA 4CM1A 4CL8A 3PHIA 3DONA 2EIHA 1I3NA 2EW2A 2Y0DA 2VHYA 4Z9XA 4GGPA 2AQ8A 4XCVA 1HZJA 3TNLA 3WGOA 5KOIA 5TJHA 3V5NA 3L9WA 1U3UA 2C29D 3F4LA 1E7WA 4KTVE 2ZTMA 2I76A 4D41A 1N7HA 2DPGA 3AU8A 4WOJA 1LI4A 4XDZA 5JCJA 5C5IA 2RH4A 1M76A 3U09A 1LNQA 3ANMA 1KVQA 2V7PA 1YL7A 4D46A 3IDSA 4I1IA 2C07A 2OBNA 3TOXA 4BO0A 4I5EA 4CM7A 4XX0A 3FRJA 1X1EA 2Q99A 5AQ1A 4BNNA 1X0XA 3F47A 1YS4A 3JQAB 1E3JA 4N18A 1ZIDA 2W8ZA 5DBFA 4CQLA 4ESOA 5KVSA 3WNQA 1SO8A 2DFVA 4CM3A 2X0RA 1KYQA 2HU2A 5KCZA 2Q1WA 3OA2A 2CDBA 3U4IA 2HJRA 1UZLA 3H9EO 1B8PA 3GDGA 4E2XA 3MJCA 2VN8A 1B0AA 1U5CA 4GX2A 4Q9NA 2PTGA 4R1UA 4YJGB 3JQBA 2PA3A 3FWZA 4IQGA 3FNHA 3S1LA 3E8XA 2DT5A 1L1FA 4MINA 3VVCA 4CLXA 5H81A 1YQDA 2BLLA 5I7FA 2PFGA 4NBVA 3PI7A 3C1AA 3HFGA 4AJPA 1PGOA 1EQ2A 1Q0QA 4FFRA 1UUFA 2Y66A 3CINA 4KWHA 1TXGA 2C2YA 3O9ZA 1F14A 5EINA 3O8QB 4W6ZA 4JP2A 3TF5A 4BGVA 3LT1A 5IF3A 4OSPA 1UAYA 2DU8A 3ULKA 4BNJA 5HWSA 1OMOA 4E3ZA 3VHRA 4M87A 2VNSA 1HRDA 3VOSA 1O0SA 1S6YA 1H94A 3PFWO 1U4SA 3BYZA 3GEGA 2HSDA 4L0QA 2AMFA 3VZQA 4BNTA 1R16A 2A92A 3TFQA 1LLQA 1E7SA 1WVGA 3UCEA 2J5QA 1YBAA 2VCYA 2FHSA 4DC1A 3GUCA 4NQZA 2NNLD 2GN9A 3WBBA 1M67A 3FF4A 3TZQA 3ZHYA 5IXSA 3QWAA 4HX5A 4YT5A 3ETGA 4RL6A 3TPCA 1NHWA 2TMDA 3GOHA 4JK3A 5IN4A 1DIHA 3IJRA 3CKYA 3RFTA 4LSMA 3ZNQA 5FFFA 3L4SO 5JO9A 3F5SA 2POQX 2WEKA 4YTEA 3GMSA 1UXGA 4WCFA 4JXKA 3DMTA 1LUAA 3LK7A 2BELA 5CPFA 3H5NA 3VKUA 4EJMA 1ORRA 3GH3A 2PY6A 3QLJA 1WZIA 1U5AA 4FFNA 2D59A 2NTNA 4NG5A 3JYPA 1ISMA 1DIRA 2VHXA 4FJ0A 4OJNA 4L8VA 4F45A 5F3RA 3RFVA 1QYVA 3ZU2A 4BL5A 3W8FA 2PGJA 1DC5A 1XWFA 4BO7A 3VTFA 1XR3A 2PZKA 1HDYA 5J23A 4R1SA 4CM8A 2WWRA 3FN4A 4AJ2A 3DTYA 3ZNPA 4YQYA 4XYBA 3FR7A 1UP7A 1GZ4A 1YDWA 4ND2A 3RD5A 4HBGA 1A9ZA 1QYWA 3R0IA 5JDCC 2DBQA 2FPPA 2CUKA 2X7HA 3NTQA 4KMSA 1YOVB 1N2SA 2D2IA 1BHSA 5AVOA 3VPGA 3H9QA 1JU9A 3B20A 3TRIA 1TB4A 2O50A 1HSOA 1PWXA 2X1HA 5EN4A 1NASA 4K1LA 1ENYA 4R9SA 4YA6A 4INAA 5I8ZA 4BS9A 1PJQA 3BTUA 1PJSA 4D44A 4MVJH 4BB6A 3FSRA 4R5HA 4WEQA 4M54A 4WE3A 5JY6A 1C1DB 2HRBA 5A05A 2P4HX 1I5RA 1EBFA 3PXXA 5JYDA 1PS8A 5COQA 4KQWA 4Z9FA 4LMPA 3MOIA 2D4AA 2NU6A 1E7RA 2X9NA 1Z74A 4Q3DA 3R6DA 4TZKA 4XJTA 4HFRA 2GRAA 1QV7A 2VZ0A 3D5TA 5FWNA 5L4NA 2NVUA 3DBRB 3BMQB 4F6CA 2FR0A 1RYDA 3D7LA 5A9TA 2RAFA 2J3HA 1TI7A 2BGKA 2WD8A 3D3WA 4PCVA 4Q3AA 1EFLA 4QSMA 5K9ZA 3LLSA 4BNWA 1VKOA 3AJRA 2R00A 1DRVA 2ZTLA 4BQPA 2IRWA 2NTVA 3JSAA 4WECA 5THKA 1DO8A 5I9LA 2IYPA 1PSDA 3MJSA 1W0CA 1VL8A 4PLPA 5JAIA 1NTOA 3DMYA 2B4QA 4FQ8A 4J9VA 1Y81A 3PQDA 4LCEA 1X1TA 4J9UE 1WLYA 4KUEA 3WWYA 2ZB4A 3LZ6A 3WYBA 4HNGA 3M6IA 3OJOA 1LDGA 3KYDA 2NTJA 4CUZA 3B1KA 2ZQYA 5COAA 1X7DA 1ZUD1 3GNSA 4FFLA 4J4BA 4UVHA 4YB8A 2Q45A 3VZSA 2YDXA 3PK0A 4O6VA 3IUPA 4XYMA 3IAHA 3ZU5A 2Q4EA 1DB3A 3W8EA 5THQA 3INGA 1KIFA 3BTVA 3LC1O 3OFSA 4D0RA 3WTCA 2FZEA 4KTTE 5GY7A 4OAQA 4ZQBA 2VYND 2UUOA 5ENDA 4PLFA 4J1NA 3SJ7A 3ETDA 3IQDB 3KEOA 1NM5A 3RU9A 1DLJA 4BO9A 2Y93A 3NGLA 4HFJA 3T4EA 3PPIA 4MIYA 2BKAA 4RF3A 3FBGA 5FF9A 4BO1A 5HTOA 5G0UA 2QG4A 4WJZA 1R6DA 4RPLA 4O0LA 5EQFA 2P91A 2P9EA 5F1PA 3GZ4A 1U2GA 2B0JA 4RORA 4RVDA 4D3SA 3L77A 1HE5A 5IXYA 3GVIA 5MDHA 3I9OA 4UVGA 1BG6A 3ZWXA 1VM6A 4RLSA 3JQ7A 4ZRNA 3OQBA 5A4DA 1NVMB 2E82A 3U4CA 4QFDA 5JCJD 1JQBA 1HDGO 2GF2A 3RJ9A 4PVCA 3QVOA 4ILKA 1QYCA 2GPTA 3GG9A 1LLUA 1KEPA 3JQFC 4OIMA 3VAZA 1GV0A 2B5VA 2ZCUA 4XR9A 2Y1EA 1QYDA 1EVZA 4UAGA 4R54A 4NBWA 3IMFA 5JFOA 4CL3A 1K6XA 4HKTA 5L95A 5TGDA 1Z75A 3I6QA 1WW8A 1KVTA 3E1KA 2P9GA 1F8FA 1U8FO 4BB5A 3GVXA 4JNKA 2A9FA 3NGXA 3PWZA 4W9NA 2YJZA 4BMNA 2Q2QA 4BKQA 2PD4A 3FI9A 4U6QA 4XD2A 5JXWA 2AA3A 3EC7A 1S7CA 1NX6A 2QRLA 1U7HA 3OH8A 4CM9D 4I9NA 3CXRA 4BGIA 2HMUA 1I2ZA 2P5YA 3COSA 1QRRA 3FPCA 1E0DA 3HDQA 4MDHA 3NJ8A 4CODB 2BGMA 1MFPA 4TSKA 5ER6A 5EESA 2A35A 5EJ2A 3N58A 2O23A 2Y1DA 3K2BA 4QUKA 3BZUA 3PFFA 3PYLA 5ER9A 2X5JO 3IKVA 2NLOA 2C20A 3ZV4A 4KDFA 4MPDA 4GH5A 2C5AA 2XXJA 1MFZA 1C0LA 1T2DA 3PTZA 5JMWA 4O59O 2W2LD 4D7AA 4IPTA 1KY5A 1Q2XA 1L7DA 3PDUA 1D4FA 5EPOA 4ALKA 3OECA 4BUCA 1U8XX 3BMCB 1PJLA 4NI5A 3TOZA 3L6DA 1NR7A 4FFMA 3ONFA 1NPTO 2X22A 1GPDG 3Q6IA 1NR1A 2D1YA 3BMOA 3NYWA 5DOZA 2P5UA 5ITWA 5AXCA 3IC5A 1FF9A 3DZBA 3HUDA 2ZATA 2E37A 1ZSYA 3S2GA 1W8DA 4EEZA 2AW5A 3D3WB 3T7CA 3AUSA 4WKGA 1P44A 1GAEO 4ND3A 4NDNE 3U4HA 5IZCC 4IIUA 4N5LA 3WQQA 3K8ZA 3OEYA 3EVTA 4PG6A 1NHGA 3ENKA 2RH8A 3CE6A 2IE0A 2VUTA 4HFMA 3R1IA 2UYYA 4MO2A 4AJ4A 4BOYA 3I5MA 4YQZA 4AJLA 4NBTA 1E7YA 2J3JA 4FFPA 4RQUA 1C1DA 4EDFA 3AY6A 1GADO 2ZQZA 2W2LA 1CJCA 4NJOA 1GPJA 2O4CA 4XYEA 1H2BA 1U4OA 4B4OA 5A06A 2QYTA 1EUZA 3RUCA 5CPBA 1B8UA 3K5PA 1OBFO 1KS9A 1K3TA 2WD7B 5KJ1A 5A9RA 3WNVA 5F5NA 5BT9A 1E3IA 3UN1A 1UDAA 3DZJA 1LRLA 5CDTA 1B14A 2PZJA 2JKVA 1YBMA 1LSUA 1OZAA 3WDSA 4CUKA 1NVTA 1MLDA 3ZHZA 4DTIA 1ISIA 4W82A 3KHUA 1LC0A 3WR5A 5AYVA 3VDQA 5ADHA 4RDIA 5CG2A 5TX7A 1GCUA 3GDOA 4IUYA 3RJ5A 1LDBA 4RVSA 1EBUA 1QKIA 2C59A 4J3FA 3ZNOA 4L4XA 4PG5A 3UICA 1G0NA 4DLLA 4QT0A 1CETA 1E3SA 4G5HA 3GC6A 1WDMA 1B26A 1FDUA 3UKOA 4ND1A 1UXJA 1P77A 1JTVA 3PYXA 3Q11A 3C7AA 4YBZA 3WSVA 4WCFB 1E1LA 3H6KA 3V2HA 3GT0A 3ROQA 1E3WA 1KEVA 1WDLA 1N1GA 4EI2A 4OQYA 1WNTA 4ND5A 1T1RA 1JVBA 4PG7A 1C0IA 5CEEA 4IMPA 4DL9A 4YDRA 1PZEA 4OKIA 2IZZA 1DBVO 1ZMOA 3Q1LA 4IS3A 1H9BA 3T7EA 1BDBA 4PVDA 1U3VA 3ZV5A 3ETEA 1EVIA 1UJMA 1W4ZA 5F1OA 3DAGA 4FGWA 4QXMA 1ZK4A 5I7EA 3NDIA 4YJFB 3PJFA 1XEAA 3WIDA 4NU6A 4OOEA 2HDHA 5KVCA 3I9KA 1HYGA 3JD3A 3RC1A 1N8KA 3H3FA 4MKZA 2OOSA 3I6IA 2ZJ1A 4PLZA 3EGOA 4O1MA 4WEOA 4RZHA 5CEJA 3KLMX 3RQSA 4B4UA 1I36A 4UEKA 2R00C 2UAGA 4XIYA 1YQGA 3O8QA 1H93A 2EP5A 7MDHA 1VPDA 3INRA 3UGKA 1DC4A 4OXKA 2YW9A 3ZWCA 1EFKA 1T2FA 2E6UX 4J7XA 1Z7BA 1D8AA 1LLDA 1IULA 2RHRA 3AM5A 3GPDG 2OO5A 1WWKA 5CEFA 3ZW8A 1T24A 3QW2A 4EUEA 4YCAA 4EITA 5A3JA 2PD6A 4MVJF 4BKUA 1QG6A 2HK8A 1B3RA 3PEFA 1AHIA 3KETA 3HADA 3FNEA 4X54A 4M1QA 3OSUA 2I3AA 1GQQA 3MTJA 3W8DA 2JAPA 5B4VA 4L76A 5JMPA 3LU1A 4RF5A 1H6AA 4FR5A 2NWQA 1RM4A 2C0CA 1RPNA 4K26A 5AXDA 4TMFA 3WGZA 1E3EA 2IXBA 3HSKA 5CDSA 2HK9A 2WE7A 3SC4A 2YHIA 3BHIA 2R2GA 3FD8A 4PLHA 1V8BA 5K6AC 4CMKA 4WLOA 1I8TA 1XLTA 5LCXA 4DC0A 5GZ3A 3LF2A 1QORA 5BSFA 5JDIA 2NADA 2G82A 3F1LA 1ZKMA 1ID1A 3EZLA 4GWGA 4NFSA 3KO8A 3UF0A 2PLAA 3VKVA 1XYGA 2YV2A 3DO5A 3LVFO 5TS3A 2W98A 2EW8A 4CM4B 3INTA 1JWAB 4F46A 4Z0HO 3RKUA 5ILOA 3UUWA 1YL6A 1Q0LA 4IDAA 2C7VA 3GAZA 4CPDA 1VL0A 4N5NA 3G79A 3WS7A 3AI2A 3TZHA 4NK4A 4RPGA 5I7SA 4DYVA 4UUPA 2YQ4A 5T8KA 4R1NA 5A3VA 1NFQA 3JQ9A 3ZI0A 1PZFA 2Q1UA 1E7QA 2NQ8A 2BHLA 3DZFA 4OH1A 1ZXLA 3AOEA 3W4JA 2AEJA 4H3VA 1O94A 2DQ4A 2PV7A 4A5OA 3QWIA 4PZEA 3I23A 1EVYA 4MVJD 2V6MA 1IOLA 1PJ2A 3FR8A 1TT5A 2FPIA 2BI7A 4BNLA 1ZSVA 4TVBA 5DN9A 4LCJA 1EK5A 2OORA 4C7KA 2JD0A 1JAXA 2PKQO 4DRYA 2H6EA 3GRPA 3H5AA 3RUHA 4ZJUA 3WX0A 1RM3A 3GVCA 2DM6A 4DQVA 5T64A 3LC2O 4BO3A 3TWOA 5JSFA 2VWHA 1EMDA 5L53A 2DFDA 2I67A 3U5TA 3KV3O 2J5KA 2IZ0A 2B4RO 2QW8A 4RPJA 5KJEA 2ZJ0A 3ITKA 3KOUA 4RVHA 4D43A 5L7TA 1P1FA 5I9MA 3E5RA 3WBFA 3NJ4A 2I99A 2GZ1A 1HXHA 4OMUA 1BMDA 2QRKA 4D3DA 1DSSG 3PGJA 3G3EA 4YT4A 3MJTA 1LQTA 5GMOA 3JQEA 1RM5A 2BFMA 4GPD1 4IJWA 1IPEA 3IL2A 1GFSA 3JQGA 3A1NA 4HNHA 1LC3A 2WYWA 2EEZA 3WJ7A 1H6DA 3E18A 2C82A 5I7VA 4P4LA 3PHJA 4JROA 4RO0A 4W9NC 4ZQFA 4U0JA 1P1HA 5G2OA 1RM0A 4IZHA 2JAHA 3DOOA 2JCXA 3FWNA 4ZHSA 1D1TA 5C37A 2FSSA 4GX5A 4GWKA 5JAQA 2YHUA 1QLJA 2ZB8A 1ZFNA 4ZQGA 3N74A 3X2EA 1O95A 4N7RA 3HHPA 1NQOA 1LLCA 8ADHA 3GPIA 4GBJA 4GSKA 3VTZA 4L75A 4E0BA 2EKPA 5IFLA 5TQVA 3E9QA 1PGPA 1PL6A 4DMLA 1PU2A 3H9UA 1JKIA 6LDHA 1YXMA 4BNKA 2VYVA 2VYVD 3P7MA 4KWIA 1DRUA 3DL2A 3GZNB 3JD0A 1IHXA 2QZ9A 1D7OA 1PGNA 4LMRA 2EGHA 1YVEI 1R4NB 3BTSA 1B2LA 3KSZO 5G0WA 5JY1A 4U7WA 2W2KA 1UZMA 3RUDA 1VC2A 4PLCA 2JFGA 3GGGA 4JBIA 1O9BA 3JQ8B 4EUFA 1Y6JA 1ENZA 4RF4A 1RKXA 4C4OA 3I9JA 1GCOA 1K6JA 1R0SA 4DWVA 1Y8RB 4QECA 5AXBA 1ML3A 4UUMA 2J5RA 1M6WA 1PR9A 1MGOA 2VUUA 4RVGA 4CJXA 4K9DA 4CM5A 3RUAA 1ENPA 2AQHA 2VZ8A 5L4LA 4BKRA 1HZZA 4II2A 1ADCA 3EY4A 1CRWG 1Y8QB 4RVUA 4UVDA 4NPCA 3UVEA 3WLFA 2QX7A 2AG5A 3S55A 4GQAA 1TVEA 1MX3A 1H0KA 2IXAA 2PH3A 1ZW1A 1EZ4A 2JJYA 2VWPA 1P31A 5JNLA 2ZTVA 4R4JA 4ZVVA 2HCTA 2F00A 3OICA 3IP3A 4M86A 4XB1A 4OXNA 3N7UA 2PWZA 3U49A 3DBHA 3BMOB 1KEWA 3RUFA 3NDRA 1XDWA 3B1JA 3FTNA 3D5QA 1WMBA 5EERA 4A27A 3BHJA 2AEFA 3ASVA 1A71A 1HE4A 1JWBB 1N9GA 3GEDA 3OMLA 4FB5A 5JDIC 3I9NA 1TEHA 4R3WA 3H3JA 1YB5A 3RIHA 4CLDA 5K6AA 3Q2IA 4KOAA 4RQTA 1BTOA 3I4CA 4YAIA 2JD2A 1KETA 4ITUA 1LDYA 2YDYA 4RF2A 1A9YA 2AHRA 3V1TC 1KVUA 2VWQA 4D79A 4IINA 1P0FA 4TKMA 2O7SA 2PZMA 1XELA 5HS4A 1HLDA 2H5LA 3PZRA 1UZNA 4UVIA 4WLFA 1Y9AA 2PGDA 3QQPA 1HETA 3LT2A 4CMIB 3FTPA 3ANNA 2GERA 3QVWA 3F3SA 3NT4A 3PGXA 2DTXA 5TSDA 4M49A 1I30A 2O7QA 4Y6RA 1ULUA 1CF2O 3OHSX 5DZSA 3I9MA 1C1XB 1YGYA 2GGSA 4J2OA 4YRDA 2E49A 3WYCA 3ZWWA 2JCYA 5L51A 1FDVA 2FY8A 4ROSA 1M2WA 3Q9NA 2HLPA 1X7HA 2JHGA 2VTDA 3SEFA 1U2DA 1YKFA 1ZVMA 4ZGWA 5DNAA 2QZZA 1FDTA 3JQAD 2B36A 3GVPA 4BNXA 2CFCA 5L40A 1LA2A 1YRLA 2CDAA 1UDBA 4E2ZA 2BH9A 3HB5X 3BTOA 1TA4A 3AUAA 4Z9YA 5JO0A 2YZ7A 4FW8A 4R16A 3HDJA 3KSDO 4CQMA 4JJIA 1SOVA 2DBVO 3ZHBA 4RLHA 2Y68A 1PGJA 1ADGA 3Q3CA 1AN9A 2OBYA 2XXBA 4D3FA 2DTEA 4NMHA 3GF4A 1E77A 1F0YA 5JBIA 2EV9A 2NV6A 2ILTA 2LDBA 1JA9A 2G0TA 2XPCA 3D1LA 3ITDA 1DHTA 1N1EA 3OP4A 3V1YA 1P45A 3IUSA 2TMGA 2VRCD 3H9GA 1Q1NA 5L9AA 1Q7CA 1XSEA 3EUWA 3H2ZA 4NZ9A 3FNGA 3ZWYA 4E21A 3NKLA 1SEPA 2OZPA 4RZIA 1N92A 1V6AA 3CMMA 1P9LA 2O2SA 4B8ZA 1BXZA 4BMSA 3JQ6A 3QA9A 3DMTC 2HQ1A 4WCFC 1GZ6A 3K30A 1YWGO 4Q3CA 1F06A 3DAFA 2RIRA 4F6LA 3QVXA 5COBA 4CMCA 2HMSA 1YJQA 4I08A 4Y67A 1T4DA 3CUKA 4PIVA 2ZYGA 4NR0A 3C1OA 2B83A 1R12A 5F21A 4XQEA 5H83A 1C0KA 3NTOA 1PJ3A 4MVJG 3SXPA 1WPQA 5FEUA 2UUPA 1NFRA 3RBXA 3G1UA 5IG2A 2ZTUA 3QV1A 2X0JA 2WMDA 1BRMA 3EHEA 4CQMB 1T25A 1U3WA 2VWGA 5DOVA 2E4AA 2DVMA 1VJ0A 1XU7A 5JAZA 4QFCA 1R37A 4C7JA 2X8LA 2JD1A 1NQTA 3P2YA 4JJFA 1PL7A 4I9HA 4A10A 1P1KA 4BNUA 2NVUB 3IKTA 1A4UA 3WGYA 4XA8A 4XRRA 4CLOB 4FIZA 3DFZA 5B12A 2FZWA 4B3JA 1OAAA 1PQPA 4DVJA 4UVEA 2YV3A 1JDJA 4Q3BA 1ADFA 4JBHA 4YAGA 1FXSA 5BNIA 3WFIA 3M2PA 2HUNA 2BMAA 3K2EA 4YAKA 3TSCA 1I3KA 4BIIA 1ZK3A 3ROPA 4I5DA 3QRWA 5DBIA 4YVFA 5FI3A 3WTBA 4GX1A 2OGUA 4ID9A 4Y6SA 3RC9A 4JP3A 1A7AA 4AJNA 4IDFA 2AXQA 4KDEA 2F1KA 3AI1A 3L6OO 4ZQEA 1J0XO 4LRSB 4QO7A 2AE1A 2G76A 3WMXA 3KXDA 3HWRA 1T1SA 2I5PO 4OGWA 3A28A 4NJMA 5JE8A 1QXSA 3PQFA 1G1AA 4TQGA 4U5QA 4LSWA 2DC1A 2DLDA 4ALMA 1P33A 4YT8A 5B4UA 1N9GB 1Y1PA 2CVQA 3GR6A 2BFOA 3TDKA 4YPOA 4ZD6A 5U4QA 4CM9A 5EQDA 2O3JA 3MOGA 1DHRA 2GN4A 1SCUA 2Q2WA 1ONNA 4Y8VA 1J49A 4LGVA 2EG9A 2PH5A 4HUJA 4BNIA 3H5RA 4BNHA 1QSGA 1WZEA 2D8AA 3SJUA 2VTEA 1G6KA 2PZLA 4U6SA 3TL3A 3DXFA 3F46A 4J91A 3RUEA 1E92A 3JV7A 1JN0A 1GYRA 4HP8A 3UFXA 4L9RA 3OJFA 4GGOA 2ZIZA 4JX8A 2V6GA 4NJMB 3DFUA 2YFHA 5G0VA 3B1FA 3S2EA 2FN7A 1KEUA 4WGGA 3VH2A 4PLGA 2X9VA 4MKRA 3RC2A 3HNPA 3AW9A 2IZ1A 3UXYA 1VSVA 3WSWA 2FOIA 3HE3A 3LYLA 3WQSB 1BXGA 1OOEA 2J3KA 3EK2A 4CMEC 2W2KB 4OM8A 4TRRA 1Q7BA 3ZH2A 2BD0A 3ZDFA 1Y9EA 3Q2KA 3PP8A 1FDWA 3GY0A 5DF1A 4GAEA 4JBGA 4E5PA 3HQ4O 3D0OA 4BNVA 2PK3A 4CV0A 2P68A 3E9MA 4L4RA 1ONPA 4R01A 4E12A 3WOHA 4DQUA 1R66A 3WGHA 3JQFA 3OBBA 2GDZA 4QX6A 5HBRA 4LVUA 1AGNA 1C0PA 2JFFA 3FPLA 5CFZA 1K5HA 1LSSA 3NAQA 4TKLA 3PHGA 3ICCA 4RCVA 3OIFA 1CIVA 2VHWA 2IDZA 4XZ3A 4CV1A 4CLRA 1B7GO 1B8VA 2JL1A 2B35A 4I9UA 3F1KA 1PZGA 3UCFA 2OMEA 2P9CA 3G49A 4CR8A 1ZCJA 3EW7A 2DUUA 2FRDA 1ADBA 1DEHA 1IZ9A 4MP6A 4E30A 3VPFA 4IZIA 1T4BA 3JQGB 4OYRA 3WLEA 4GVLA 4CQMD 4BNZA 4YJGA 4AICA 4L4SA 3A06A 3C7DB 2FMUA 2UDPA 3WB9A 1UH5A 3OEWA 2EP7A 2V6FA 4U0KA 5A02A 3H7AA 3U9LA 2HMVA 3EAGA 1GYQA 1ZK1A 4WK6A 3UHAA 3IP1A 4RPHA 1ZK0A 3MJ4A 3MEQA 1KVRA 3A14A 4H15A 2WTBA 4DBZA 1WP4A 2DUWA 5MGBA 3DDNA 5CG1A 1AXGA 4PFJA 3MTGA 2BRUA 1A4IA 3HJAA 1NWHA 1DAOA 2VRCA 1K0UA 1TT7A 3EMKA 2O2YA 3PWKA 4NNJA 3KSUA 1KC1A 3AUTA 4W4TA 5CHEA 4IIVA 4BO8A 2IYOA 4OXYA 1YL5A 4WCDA 3MCVA 4LW8A 2BF7A 2GZ3A 5FI5A 3ZWMA 4L74A 2CVZA 3T4XA 1JLLA 4FGSA 1SMKA 2UV8A 4TZTA 1TT5B 1GZ3A 4ND4A 4R51A 3U0BA 3VC7A 3WGGA 4XYLA 1VE9A 1ISGA 4D45A 4E5YA 2FP4A 5BQFA 3NEPX 4XKJA 3AM4A 3ST7A 5BSGA 3VH1A 1A27A 1JAYA 3PZBA 6ADHA 1EDZA 5A03A 2Y0EA 4GSLA 1PQUA 3IS3A 4XQCA 3ONEA 3DB2A 5BSEA 1CERA 1KVSA 1LEHA 3FCOA 3QP9A 3GNTA 3VH3A 4JQCA 4PRKA 5ILGA 4ZN6A 1PIWA 3ZWVA 2C2XA 4PLWA 4TROA 5TT1A 3M1AA 3TN7A 4P4GA 1DIGA 3NDJA 4J4HA 2O3QA 3UCXA 1DAPA 3I4FA 1YO6A 3L4BC 1ENOA 1NQ5A 3ZU3A 3H4VA 4MIEA 4BV8A 1I01A 2XF8A 2ZKLA 5AXAA 1EE9A 3WWZA 1UXHA 1MP0A 4YYZA 8LDHA 1R4MB 4I5GA 4OL9A 4XEHA 4FJ1A 4QTZA 2R6JA 2O3UA 1IL0A 4L73A 1PS9A 4CMIA 1MV8A 4YJHA 4B7CA 2EHDA 4FSHA 5HRUA 1P1IA 1LDEA 1F8GA 1LX6A 2YHIB 2HRZA 3SC6A 4MVJP 1PQWA 5K0ZA 1I24A 2ET6A 2VOEA 3UOGA 3QSGA 4QEDA 3D4NA 1AUPA 1GY8A 1CQJA 1VLLA 2VQ3A 1PJCA 1ZEJA 5HM8A 1DFGA 1NBOA 2HO5A 4MIOA 3BHMA 5JYEA 5G4KB 3OJ0A 3AOGA 2EJVA 4QQRA 1I0ZA 2RHCA 5HS6A 2O48X 3D64A 2D5CA 4IJKA 3K31A 3KM0A 1CQIA 4Q3EA 4FDAA 9LDTA 3ZWPA 5JC8A 2NM0A 4Y98A 4E13A 2Z5LA 2VHZA 3ADPA 4J49A 1H9AA 4JIGA 1CEQA 2LDXA 1KY4A 5EL0A 3TQHA 2IEBA 3ZWNA 4PLVA 3LLVA 3RU7A 3DBLB 1GDHA 3O26A 3BAZA 5C7LO 5DCWA 5U1PA 2X0IA 1DJNA 1VL6A 2HKIA 4EJ0A 3AUUA 3WICA 1VRWA 4URFA 4CV3A 4G81A 2GUGA 3QWBA 1P0CA 1JKJA 4WLVA 4RPKA 4XGKA 2A4KA 2Q4BA 1BDMA 1BVUA 2AG8A 2YUTA 3SLGA 4CMBA 1HTBA 1EUDA 1H5QA 1GV1A 4YJFA 1V9LA 2V6BA 3RKRA 3PRJA 2HAEA 4G65A 4HXYA 3GLQA 4HY3A 3AFNA 3DZGA 4R5MA 5KKCA 1F12A 1MUUA 4RDHA 1R4NA 1TLTA 1Z6ZA 3JYNA 2CSUA 2ZB3A 4E33A 4JCOA 5A9SA 3GZNA 5BSHA 3OQ1A 3VDRA 3WJAA 4FD3A 2BGLA 4FC7A 1XCBA 4IGFA 2FPGA 3E5MA 1HT0A 3RWBA 4J1TA 2X4GA 5BR7A 3OF2A 2VUSA 4II3A 1Q0HA 3MWDB 1V3UA 3V2GA 3ZCXA 4NFHA 2JHFA 1NVGA 3DHEA 4FPXA 2GN6A 2NU7A 4J7UA 5B4TA 4UREA 4DLBA 2PGLA 3M2TA 3W6ZA 1CDOA 1PEDA 1GUFA 4WUVA 2NUAA 3K73O 4S1VA 1DPGA 1DLIA 3GA0A 3ZV3A 2WYVA 1KERA 4R41A 2FR8A 5DCYA 3AM3A 1ONOA 4KUGA 3U62A 4R1TA 3GK3A 4J2HA 1E5QA 5CAEA 2P2SA 2Y1CA 4M89A 4GLLA 5JDCA 4ZQHA 3KVOA 4B79A 4IXWA 2Y1GA 1DXYA 3H9JA 2HK7A 1V35A 3PVZA 3TZCA 1R0KA 3TJRA 2CY0A 3SLKA 2ZYDA 2DBZA 3V2UA 4AVYA 5KVQA 1U1IA 4TRJA 5DULA 1I3LA 2CF5A 3GEMA 3DR3A 4ALIA 3E82A 1JKFA 2V65A 4U8GA 4XJSA 3DOJA 1H6BA 3RC7A 4MOWA 1EDOA 3W6UA 2XAAA 1LDNA 4M55A 4N5MA 1GTMA 1ZMTA 3JCZA 1HYEA 5JC1A 1YONA 4CLEA 4MKXA 1OFGA 4WNIA 4QO8A 1UXKA 3A9WA 1XKQA 4NBRA 2J6IA 3QY9A 1ZNQO 4K6FA 4WPGA 1GU7A 3LQFA 2GASA 4CMEA 1KBZA 2NU8A 3OJLA 1XIVA 4Q3NA 4WNCA 2GLXA 5KTKA 2ZCVA 4DUPA 3PJEA 1H6CA 4J0FA 4RGBA 1NXQA 4WLUA 2Z1NA 1SZJG 4Z6KA 1ZH8A 5A04A 3LDHA 1P1RA 3CH6A 4KUHA 4PLYA 3ZNNA 1GEEA 3RBVA 4BVAA 3DHNA 1LQUA 3JTMA 1X7GA 3IIEA 3F6YA 2QYSA 4FJ2A 5LC1A 4IJVA 2AEMA 2CZCA 1QMGA 3KEQA 1EEHA 1RYEA 1EQUA 1SB8A 1B3BA 2JCVA 2BFPA 4B7UA 2A94A 1Z7EA 5G4KA 4OO3A 2DTDA 2I65A 1QP8A 3WG9A 4OKNA 2FSVA 2QQ5A 4CM4A 3R3SA 1Y5MA 4IDDA 3NT5A 4AG3A 1NQAO 4R68A 4EW6A 5I8WA 3JYQA 5KWEA 4OOFA 4IBOA 3ROMA 1MG0A 4E5KA 1SAYA 3ADOA 2NSDA 2OP0A 1ZXBA 4YJHB 3O03A 3QIVA 4P38A 1SBYA 1R15A 3KB6A 3RSHA 4E5NA 2IODA 5KNLA 3QWHA 1M75A 1I10A 5JS6A 1YDEA 1LU9A 4HFNA 2DPHA 1A72A 3P19A 4GMFA 2W4QA 3K96A 4J16A 3ZW9A 3A4VA 4EUHA 3OQ6A 1NNUA 3G17A 5TF4A 1HDZA 2X5OA 3FBTA 1J4AA 5L3ZA 5LDHA 2GN8A 2GNAA 2YV1A 3UAGA 5A5EA 1E3LA 3MWEB 2Y1OA 3JQCA 5TRTA 3VPXA 4B3HA 4EJ6A 5DP2A 4P4NA 4Z3DA 4UEJA 3KRTA 1CYDA 1QV6A 3RASA 1U28A 2NVBA 3AK4A 4NU5A 3HB4X 2QIOA 4W7IA 5A1TA 5GZ1A 1NPYA 1T2AA 3P5SA 3I3OA 3G1TA 3GNQA 3ZGYA 2Q49A 3C3XA 1KC3A 1T2CA 4N54A 3JYOA 1O5IA 4IDBA 3RUIA 4EYEA 1G0OA 3L0DA 5JPIA 4H16A 4DYDA 1UP4A 1CWUA 2CVOA 2D5AA 3HZZA 3FNFA 3OIGA 4PGFA 4UUOA 5LDGA 3V8BA 4CMJA 4WLNA 4J6FA 2EERA 4PZCA 4RV9A 1BVRA 3ICPA 5TT0A 4FCCA 4BNGA 3I52A 3JQ9C 1NAHA 4UULA 5TNXA 3Q0EA 3GG2A 3GHHA 3ASUA 4R3NA 1BXKA 4YRAA 4YJDA 1LXCA 5AOVA 1SB9A 3PJGA 1EK6A 4RVFA 2VYNA 4DXHA 3HDYA 4ZICA 3RVDA 1E3WB 5C7OO 3UH1A 4XWYA 1U7TA 4CMGA 3QWFA 1DFHA 5TJ9A 3C1TA 1PS0A 2B69A 2Y1FA 4EEXA 3RROA 3DTTA 5H82A 1MA0A 2AQKA 1K89A 3L07A 1SOWA 2QHXA 4DGSA 1SPXA 3CZRA 4CLHA 2Y0CA 4MVJI 1OC2A 4GL4A 1GEGA 4CR7A 2Y67A 2CNBA 1E1KA 4J7CA 3GGPA 5CP8A 4DBVO 3SX2A 4BO4A 4J1SA 1ZEMA 3PHLA 4CLRB 2EXXA 5ICSA 2UVDA 1IY8A 3NTRA 4GVXA 3F4BA 1O6ZA 2D0IA 3K9QO 3HN2A 4S3MA 4DA9A 5GZ6A 1YJ8A 3DC2A 3R3JA 4BO6A 1FJHA 2Q50A 1UAGA 3BMNA 4ZU3A 3RBZA 3M1LA 4B8WA 4BO2A 3TZ6A 3AFMA 4AFNA 1XGKA 2BFAA 1X0VA 3C24A 4YEDA 1D3AA 4J0EA 2G1UA 2CDCA 3MJVA 1AE1A 1EUCA 3I83A 5T67A 5KIAA 1K6IA 2EWMA 3CMCO 3L4BA 1E1NA 2WD7A 4YAJA 4DPMA 1UXIA 1X15A 4TRMA 2E48A 2RCYA 3PIIA 2OUIA 5L7YA 2X0NA 1KOLA 5A5FA 4A0SA 4RJTA 1BXGB 1YH3A 1DDOA 2YQ5A 4GX0A 3IOYA 1UDCA 4IJUA 2GD1O 5T5QA 1N5DA 3L6EA 3RI3A 2VNAA 5T6BA 4TVOA 1ZJYA 1AXEA 3P2OA 4E32A 5F5LA 3NT2A 3JQBC 2CF6A 3W4IA 4P22A 2YY7A 2H1SA 4MJLA 4YACA 1MC4A 4A26A 1AHHA 3BMNB 3JQDA 5FYDA 2I9PA 3QE3A 4CM8B 3IJPA 2Q1SA 2VHVA 5IDWA 4YR9A 4D0SA 5ENVA 1U9JA 2BI8A 4A2CA 3O38A 4FBGA 3OETA 3WGQA 1HEUA 3PLRA 2H9IA 5BNFA 4IGEA 3K92A 4AJIA 3HDHA 3PJDA 4IS2A 3U4DA 1PTJA 5IAAA 3ANLA 2CMDA 2GZ2A 1M6HA 2WM3A 5G0TA 2P4QA 3GDFA 1T26A 1J6UA 3ROKA 4TRNA 4BO5A 2W90A 4PLTA 2I66A 3BMCA 1HL3A 3CPSA 4ZA2A 1Z45A 3ZN2A 4MP8A 4NHEA 1X13A 3QJ5A 4I5FA 3BA1A 5I9NA 1GL3A 1DRWA 5CDUA 2Q3EA 4JLWA 5DP1A 3WGTA 2AE2A 5DT9A 4FC6A 2DAPA 2X86A 5IDYA 3GFGA 3JD4A 4Z0TA 1F17A 2B37A 2WSBA 5TIIA 5HA5A 4E31A 2VRBA 3L9XA 3WGIA 2PKRA 3GN1A 3AU9A 4IMRA 2Q1TA 3ZHXA 4DPLA 1LRJA 3AI3A 3AY7A 4YRBA 2X6TA 2C54A 1RJWA 4YWJA 1HDCA 5T8KC 3S8MA 1DJQA 4IDEA 3GAFA 1I33A 4WOKA 3GRKA 4XB2A 1ZK2A 2WDZA 4CMAA 4ALNA 3DWFA 5JAMA 3VPHA 4Z3KA 4CLOA 4JN6B 4NK5A 3AWDA 1YBVA 5G0SA 1OC4A 2O3RA 4YT2A 1EVJA 2FWMX 4NFYA 1DIBA 4J90A 4GMGA 4K28A 5C7IO 1DC3A 4XDYA 1E6UA 4XR4A 2VOJA 4XQGA 1N7GA 4IDCA 2OP1A 2PKQP 2B5WA 1BWSA 3ZZNA 1XQ1A 5U9CA 2EGGA 4Z0PA 4E2YA 3PLNA 5L7WA 3B70A 4BQRA 4DMMA 3C8MA 1ZSNA 1E6WA 3JQ7B 5ITVA 3JYLA 4MVJA 4JGBA 3PWSA 3LC7O 1NPDA 4FFOA 5KJ6A 2I3GA 3ZWAA 4LK3A 4A73A 2ZYAA 1NYTA 1ISFA 1PGQA 3GHYA 1SC6A 4DPKA 4ALLA 1IZ0A 5JLAA 4BNMA 1MXHA 3CIFA 4J43A 4DIFA 3ABIA 5L45A 1Q7GA 3S2IA 4IM7A 2GR9A 1NWCA 4BKOA 2HMTA 2X9GA 4BHTA 2XOXA 3D4OA 5G4LA 2HJSA 4LN1A 3WYEA 4AJJA 5T57A 1P1JA 3CSDA 1HE3A 2YFQA 1PR3A 4H7PA 3NUGA 1EE2A 1HLPA 4E6PA 4B4WA 3ZWBA 4ONEA 2X23A 3C7CB 1YQXA 5DCUA 3NX4A 1LJ8A 1VJ1A 1GD1O 1A7KA 1SNYA 1V3VA 1BGVA 2EJWA 2Y05A 4CM6A 2O3TA 1VI2A 5KJFA 2Q46A 3TZKA 4AJ1A 1QLHA 4LISA 3SBOA 3GMDA 3KYBA 1W73A 3KYDB 3S2FA 2JFHA 1FDSA 4NIMA 2ZK7A 3OA0A 1LSOA 3PQEA 5B37A 3BXXA 4BGEA 3I1JA 3ON5A 2EF1A 4IDGA 4ALJA 2AQIA 1E5LA 5IN5A 1E6EA 1MXFA 3H8VA 4B4VA 3RCBA 4OSOA 2I6TA 3V1UA 2WE8A 3GQVA
chains in the Genus database with same CATH superfamily
5JZVA 3E9NA 4KR2A 4DIBA 4ARSA 3HKEA 3UW3A 1QYXA 3WGMA 4QPDA 2FW1A 4DT1A 1AGXA 4JELA 3BMQA 1B16A 4AX8A 1MOPA 1BO6A 2OO3A 5AK3A 3GGDA 2JH8A 2O3SA 2O0HA 4JJGA 1W1IA 1OB5A 4IDHA 4RTKA 1DAMA 1MC5A 4PG4A 3X1YA 5C32A 3AOEC 3A31A 4RKEA 6GPBA 3JD1A 5JPDA 4B7XA 5JAHA 4MB2A 4EUKA 4EBFA 1FW8A 4Y2PA 5CDYA 4UU7A 2FX3A 2IBMA 3TTUA 1VSBA 4MPTA 3U7EB 3SSAA 4M1OA 1PT7A 2L17A 3N6XA 1PYGA 4DLYA 2FFJA 2WKWA 5K3OA 1WMAA 1VYVA 4TMWA 1BS2A 3EPJA 5LQJA 1WDTA 3DW3X 3DHWC 4RH1A 2QY6A 3DZHA 5EIAA 5IBPA 1V8FA 1VXOA 2VBCA 5DYGA 2FA9A 3OCYA 2WP8J 3WLAA 2C3PA 1GZSA 3F6BX 1C1YA 3RSOA 2A5FA 1PZNA 5LQMA 2BL4A 2PJRA 3FJOA 4IO0A 1QTIA 4JSRA 2P3SA 3L7CA 4FUQA 3ZQJA 2HK6A 1YOVA 3T52A 3JWJA 4JZKA 4OQZA 3HVUA 1XU9A 2QMHA 3NP7A 1N5IA 1SXGA 1ZY2A 2D1RA 3TSWA 4CR6A 1M6YA 4HN2A 1KEEA 3WHIA 4DY4A 5JBNA 2Q2OA 2IYVA 1XEWY 1GJRA 1GUZA 2GSDA 2VT2A 2YBEA 2YV4A 3V2IA 1X14A 3WA6A 4CU2A 2V54A 3Q3IA 2IW1A 3PNPA 2GKOA 2YUIA 3HJRA 2Z9DA 4FEAA 1XG5A 2O8CB 1X38A 3PLAE 3HJHA 1QIHA 4EZBA 2O5EA 1PJZA 3ABZA 2PD3A 2C9OA 1V3TA 2ZETA 2ZPAA 2AJ8A 2A9OA 2NUAB 1U81A 5IYZA 1KP9A 4D25A 1BS9A 1P4SA 3I0ZA 3I4LA 4BFXA 5M29A 3MELA 2QKYA 1NUAA 5JCXA 4HDNB 4RACA 1NDQA 4GR4A 1C3XA 2FVXA 1UPBA 2JZCA 2FR1A 2GVZC 3EVNA 1XA0A 5EXTA 3RK1A 2XUHA 3G8AA 3ZS8A 3ZDCA 5BNTA 1IHYA 3PDJA 2OCPA 2P6UA 4HDKB 4DQXA 1PL8A 1Y8QA 3L1UA 5HK9A 1K5DA 3R8XA 4A7PA 1NXWA 3SVTA 3K9HA 1BHJA 1NBIA 1NX9A 2QSJA 2JFWA 4UDXX 5CW2A 5TDHA 2HSEA 2WJPA 2QTTA 5K3BA 3WKDA 3LP8A 1FYXA 5KKNB 1LBEA 4IDQA 1M66A 2GBPA 1Y8RA 4MWZA 5CD1A 4RMGA 1MG5A 3OE7A 5IF9A 2NYVA 3LRTA 4QUDA 4R40A 3PS9A 3FIUA 1QH8A 2DKFA 4EHBA 1JR3E 3ZVNA 4OYHA 3ZDYB 3ZHRA 4URZR 1W88A 2IEDA 2BEUB 1V16B 1R00A 4YIKA 1Y33E 4HADA 2WIJA 3O4RA 1JEAA 1VKNA 3PG5A 4D4JA 3LSYA 3QA3E 3W1VA 5U4XA 3UEOA 3SAJA 1RWWA 2H4HA 1P5RA 1S3GA 1RBYA 3DBVO 3KKPA 5TMEA 3ZGXA 4CFZA 1ZMBA 5KSZA 2F3UA 1AA6A 1KZHA 4C6HA 4EJSC 1WV0A 3P9YA 5AJTA 2X3FA 4HPJB 3H97A 4XDGA 4KE8A 4HRAA 2QORA 4XIJA 1J90A 1QVRA 3L1IA 3MZ0A 3ORFA 3ZH9B 2YXBA 3G8YA 4BRWA 3T1YB 4M0UA 4BN5A 4CKCB 1V7PC 1ABEA 3K32A 3QHAA 1BMTA 1IDN1 2A9KA 1RYBA 1HKUA 1BW9A 3VYVA 5L4SA 3P9RA 1RWXA 2B78A 4X97A 3U4MA 4LDRA 1WEKA 2H2GA 4PSKA 1FLAA 2P7IA 3W0LB 2PT5A 3VPSA 3F5QA 2FZGA 2NQTA 3DBLA 3KP1A 4NABA 5E4TA 3R9IA 4A03A 4IX9A 1GR0A 4W5OA 2PMDA 1YUBA 1E1RD 5CA1B 3H65A 5CDGA 4YV2A 1YI1A 4G5RA 3CHYA 1I32A 3B7WA 4WASA 1GPLA 4YONB 1CQIB 1XZMA 3DZKA 2I71A 4C4RA 2QY9A 2JAUA 1PJ4A 2XE7A 4LC9A 1Y3AA 2W6IA 1RAIA 2YN2A 4CKWA 1Y7TA 4NE9A 3SY8A 3B6EA 4RNCA 1OXTA 1YZNA 1HF3A 3CIOA 4MJ3A 4EMBA 3ONDA 2RONA 4NHOA 2XA9A 1T8RA 3NFYA 4XAQA 1SVKA 3DAPA 3NBKA 1PJTA 4F3YA 3SWWA 1SXJC 2YYYA 3VV2A 4JKYA 3DOCA 3ZVRA 1RZVA 1YR8A 3AKEA 1EJ6A 1NQUA 2C57A 4HDOB 4X44A 2XMCA 4DSOA 3UIEA 4FLFA 3KZVA 3PUJA 4NCAA 1MO4A 4MV1A 1VLQA 2J6BA 3FSGD 4YNBA 3KQUA 2HA4A 1JW9B 1B23P 5JSKA 4R69A 4N0PA 1WB6A 1RXUA 4N7JA 3ZHCA 4WESA 3ENNA 3AG5A 3S28A 2AFHB 3RK4A 4RK6A 1DIAA 1MZPA 3G2MA 3WLNA 4POOA 4JLDA 1Y5RA 2DBRA 2MYPA 3SYLA 5CLFA 2W6MA 4XLZA 3UXEA 1MOSA 3BQMB 3TM4A 2IHUA 4GOXA 4B0OA 1NVAA 3ZQ4A 1Z63A 3HABA 3GLUA 3IBFA 1GG2A 1UPAA 2B20A 2X5KO 1Y1RA 1TCBA 3LX6A 4I1YA 5SV2A 5IJZA 4HZGA 3FYUC 2SCUA 1C14A 3U3JA 3C6QA 5CFOA 4KZPA 1FVHA 1NM5C 4RD3A 4G2NA 1IUKA 3X43A 2YRWA 2OBXA 3L0IB 2N47A 2G8LA 2WHQA 3DMPA 3EVEA 3BFXA 4PPGA 3UT5A 3RAFC 4ZRMA 4RFVA 3NHKA 1K1EA 1DKNA 4TQUS 4DIUA 5DEIA 3DZIA 4L9AA 3PTLA 3CTMA 4JI8B 2VJMA 1ZHHA 3STHA 4MP3A 4B3IA 2E4WA 1NDUA 4I50B 5BW8A 1WXDA 2C2OA 2VF2A 3FCAA 5EIWA 3B38A 3MLBA 3V7UA 1SKQA 2AQ8A 3T3IA 2VAVA 1R50A 2XMGA 3D2AA 4HDQB 3DH0A 5LYJF 4XQ0A 1L8LA 1PFQA 4LYGA 3WGOA 1NKTA 1P61B 4C14A 5KOIA 1JEYB 1F5NA 1U3UA 3MNFA 4NYJQ 1XK6A 1ICIA 3FVRA 1B6TA 4D41A 1EDBA 1LVGA 2F17A 3QENA 1I94B 1UKEA 5B58T 1DT5A 3IR7A 4WOJA 1JQAA 3LKZA 4HQOA 3KR1A 5JCJA 4NATA 4ABTA 1Z6QA 1VJCA 3AR4A 2RH4A 3IUBA 5KTMA 3G02A 4UC0A 2RK4A 3DV9A 3ANMA 4CN9A 5DBOA 6CHYA 2HEIA 2Z5GA 3R4CA 3U61B 1V7ZA 1FFEA 3IDSA 2PU5A 3KD2A 3TQFA 2P8JA 2HLHA 3KT0A 2IDKA 1USIA 3TG8A 2R8XA 4KXNA 1G9TA 5IP5A 2Q99A 3EF3A 4FGJA 3ZGZA 2LKDA 1FNSA 1R6BX 3JQAB 4K6OA 1E3JA 3DXXA 4ESOA 2W8ZA 5IABA 1OU0A 1EPUA 3AHEA 3OFND 4TUYF 4X20A 4F4IA 2DFVA 3KUDA 4ZPXA 4AUEA 2X0RA 4I36A 3REQB 2DSTA 1Z12A 1HK7A 4ENTA 5HJ5A 3Q7EA 5KAMA 2C92A 3S7ZA 2F1JA 3OA2A 3CRVA 4R31A 5FORA 2HJRA 2QTLA 4E2XA 1B8PA 4PZPA 3MJCA 2WUVA 3OOHA 1U5CA 3I8OA 4YECA 2PTGA 2VDRB 1DAKA 1SKAA 1A8SA 5AW2A 2P9QA 2CHQA 1TKRA 1M33A 3E8XA 4OI1A 2DT5A 3N1UA 1Q12A 2ACWA 5AW9A 4BWFB 4KXUA 4JZYA 5TGZA 3Q5GA 4U6NA 5H81A 1R3UA 4UOZA 4ZCTA 3A1TA 1SUPA 2PFGA 4NBVA 3Q3GE 3T1QA 4EGQA 4C2AA 5LYJB 4M0EA 4LHYA 3SYTA 3QNMA 2WYHA 4LY0A 1MTZA 2RGAA 2Y66A 4YMGA 5E6UA 4EYKA 3ZY3A 2C2YA 3O9ZA 3AUJB 5F35A 1UPXA 2ZUFA 4W6ZA 1QB8A 1IAQA 1Q0TA 1DOZA 1SKUA 4DA7A 2FG6C 1TQDA 3ULKA 1N0UA 3THYB 1JHAA 2A3NA 1Z2OX 5KTSA 1K6EA 3P9QA 3S1AB 3E58A 1H94A 3PFWO 1D0SA 3UFBA 3GEGA 4L0QA 2AMFA 2VJAA 2FP3A 3KL2A 3Q40A 3FKQA 4J0HA 2A92A 4OBBA 2EX1A 3GJSA 1L4MA 2ZRGA 3UCEA 5E0OA 1ORTA 2AOXA 4P7KA 4NQZA 3L93A 2GEUA 2AC4A 3LPNA 4WINA 4EVQA 1MAHA 2X9QA 3GJ5A 2Q5LA 3OURA 3TZQA 4OREX 3ZHYA 1NJ1A 4U4AA 1OXBB 4QQKA 1UBKS 2YJ6A 4HX5A 4IIJA 4EQ6B 1G5FA 4RL6A 1NHWA 2V7UA 1EUQA 5EKTA 2LCFA 1T3GA 2IEYA 4JK3A 5C8XA 5IN4A 3IJRA 1B93A 3CKYA 4LSMA 1EWKA 5FFFA 1YQTA 4J29A 3RM3A 4DSTA 4YTEA 4HDRA 1QCYA 4GECA 4RFLA 3JAWB 1TM1E 4RD4A 4MV9A 4WCFA 3DMTA 2H3EA 1LUAA 5FKJA 3HGTA 1FTGA 1KHHA 4O25A 5IWAB 2C2MA 3G2HA 1D7AA 5K3CA 2WT8A 9ABPA 2PY6A 2PUTA 3QLJA 4CLXA 3L3BA 1TTPB 3FVQA 2D1FA 4IVRA 1XTRA 2JGJA 3ICWA 3I5YA 1FNBA 4KX5A 4MUXA 5F7OA 2H2FA 3EZ6A 1KSGA 4L8VA 3AJEA 5BOSA 2EJBA 1BKSB 1XWFA 3DV0B 3VTFA 1NXPA 3BWBA 4HX2A 4ROTA 1XR3A 4WDQA 5BRJA 3C3KA 4LAFA 2ZU0C 4AWBA 5CDHA 1NE2A 3D2CA 5J23A 4MRNA 3K9FC 2PHZA 4XTCS 1FNDA 1EVLA 4I9FA 3DTYA 1FU8A 3TAHA 1EFRD 2AUMA 1JT2A 2V7VA 3FR7A 2GZDA 1NVEA 4PHTA 2H17A 2I33A 3C98A 4QXPA 2B7BA 3U4GA 1NUQA 4FWBA 2FZ4A 2CUKA 3I6BA 3K1YA 3MWFA 3NJRA 3NTQA 1G4AE 3N0TA 4KW7A 4L8GA 4QNNA 1KDZA 3VNBA 1IEWA 5HQTA 4Y2XA 3GARA 4HWOA 1G7RA 1HSOA 1L7BA 2X1HA 1ZHOA 3AIMA 4IR7A 3L7MA 4M1WA 4YA6A 1SH7A 1PWHA 2R6DA 4INAA 4C0JA 3BTUA 5JSHA 4BB6A 4KHPB 3TTWA 3KOXA 2W48A 1D2GA 1W5AA 5JY6A 2IYZA 3QX7A 1GNQA 1X3LA 4X63A 3N05A 2C1XA 4Q48A 4AY5A 4RYLA 1T5HX 4P36A 1EBFA 2FPMA 5JYDA 2C61A 2PR7A 5EJ4A 1CE8B 1VLMA 4QELA 3ROFA 2D4AA 4Y9RA 3NHFA 1MAWA 4PBTA 2NU6A 3QNUA 2XUAA 1FRQA 2GHQA 4FHFA 3TRKA 1Z74A 3WYNA 4TZKA 3W2HA 1YRWA 3I2FA 4TLEA 3K70C 3O8DA 3P9ZA 1ZU4A 2GD2A 3ZBTA 3ZDBA 1A98A 1SBCA 3BBPA 5HQJA 1C9KA 1T6XA 1NOJA 5IYZF 1VE1A 4LV8B 5ALRA 4EY8A 4XVHA 1CVLA 1GILA 2L69A 4HRXA 5I45A 3W34A 2WD8A 1Q74A 2P1DA 3MFYA 4PCVA 1EFLA 1MJFA 4FLEA 4BNWA 1VKOA 4L8FA 4ZOLF 2R2AA 4BQPA 2XIJA 3JSAA 4JC0A 5THKA 2WI8A 4G4GA 1SBNE 4DXDA 5FCDA 3D5EA 2CLHB 4MTLA 4PLPA 2F1HA 5AICA 1NTOA 1I5OA 1QHFA 5JVDB 4CIYA 3ZCRA 4C6TB 1E2BA 3RAGA 1A9QA 2ZRLA 1M72A 1BAPA 2ZB4A 3LZ6A 2PIDA 1P7WA 3WYBA 3FWHA 4NU0A 3RHSA 2Q27A 4PTYA 4CUZA 3FDXA 1H2FA 2ZQYA 3ENQA 4BP9A 4WKCA 4F5EA 4MRVA 1L5OA 2M6RA 3A6KA 4FFLA 5C1DA 3VR3D 3BXZA 2IK8A 3VZSA 2YDXA 4RDXA 3PK0A 1XRNA 4O6VA 4AO7A 4WBSA 5AIBA 3IAHA 3ZU5A 1JYSA 5THXA 3EVZA 1AK1A 1T5OA 3K2QA 4W6QA 3W8EA 1CIPA 1IBRA 1OZGA 3QTBA 3N9IA 4B43A 3GLFA 3VRHA 4QYTA 5HOEA 2YIMA 3LFHA 5FPYA 2RAVA 5ENDA 3SJ7A 3IQDB 4OHKA 2OHOA 1D2AA 3H0EA 1NM5A 2C8LA 1UBCA 1ELOA 3R3ZA 2QMOA 1O0CA 2Z5VA 2I4MA 4R9UC 1AUQA 2GEVA 5CYFA 2BKAA 2MOKA 2VHUA 2R8ZA 5BN1A 1CRLA 1JL3A 5FF9A 1U2QA 2GNPA 2ZITA 5G0UA 3LPDA 4MW2A 4RPLA 1L8AA 1UMCA 1N2GA 2PS3A 2P91A 5F1PA 1MJGA 3GZ4A 1TD1A 4RORA 4D3SA 3L77A 3T7SA 4U1RA 2EFCB 2VH5R 2HXSA 4W5WA 5E9QA 5EE1A 3UWSA 5CA0F 2CL0X 1JG3A 4DJTA 2ZSFA 3B12A 4ZRNA 5ELLA 4DMRA 1N8NA 4QDUA 4PYKA 3HGQA 5C80A 4GI7A 3OTIA 4F4CA 3U4CA 5FR1A 2OCKA 2YWEA 4X7MA 1DINA 2GF2A 4LXTA 4ILKA 2GPTA 1FFCA 2PJDA 1LLUA 1H9CA 5EGNA 3O4FA 1GV0A 2ZCUA 5DGDA 4XR9A 1GXSB 1WCXA 3GFRA 3D9QX 1Y1LA 5LJLA 3VPCA 1E18A 2J6CA 3PENA 2PNJA 1TZMA 3IMFA 1V5FA 2Q7DA 4I14A 1GCIA 1GPBA 1NJGA 5BORA 3P27A 2OBBA 4TLBA 3WRVA 4G01B 1RAHA 3KLBA 1GAQA 2VC2B 4QGSA 2ZWPA 3DPUA 3C7TA 1FY2A 1KVTA 2WWVD 4ZCRA 3BK1A 3CH7A 4D57A 1F8FA 1JIQA 1A04A 1EP3B 3E2PA 4JR0A 1EDEA 1UPTA 4K05A 1XNHA 3PWZA 1O6BA 2YJZA 4JP1A 4O4IF 4MV6A 4BKQA 3FI9A 1JE0A 1M2NA 3U37A 1KI6B 2EFEB 2J85A 3QOXA 3UQYS 1S7CA 1C9EA 4DMUB 3LO5A 4DDUA 3ND8A 5LP6A 4N6NA 3IMGA 1U7HA 3CEHA 3OH8A 1IXYA 2IHNA 3WL5A 1B76A 1YZUA 1ZI8A 4GKAA 3V97A 1QQBA 1Y5NA 2WWYA 1Q3HA 2NZVG 2F2TA 2P5YA 4M7OA 3FPCA 3MRSA 2ZJ4A 1SELA 5EIBC 3HDQA 3L7IA 4BU0A 1SWWA 2IVFA 4QJ4A 5FT9A 5ER6A 5EESA 2G71A 2VP0A 2O57A 4QUKA 2KW5A 3FCXA 5K3SA 1F2UA 2TSYB 1XZBA 2VJPA 3PFFA 5ER9A 3UMMA 1U1GA 2X5JO 1DL5A 2FUEA 3EMDA 3NHSA 4KDFA 2NZ2A 3CLUD 4GH5A 2C5AA 2XXJA 3QX3A 1C0LA 3GGJA 3PTZA 3L01A 4LDAA 2OILA 4OBXA 5JMWA 2WF7A 4G23A 4O59O 5D00A 2PUDA 3NNNA 4CCWA 2IXDA 3GX1A 3W6OA 4ARZB 2BSAA 1D4FA 4DCTA 1PNVA 1Z0JA 1KIMA 2JGAA 3EUEA 3OECA 4ND6A 4EGJA 1U8XX 1PJLA 1Z56C 3L6DA 4KRFA 1JJIA 2Q41A 4HAOA 1ECFA 1X1BA 1LI7A 3A6ZA 3FE2A 3NWJA 3P0EA 4GM4A 1U3DA 4IHAA 4XE5A 4M1KA 4C6TA 4LI0A 3ETJA 3LRPA 4MKHA 1NR1A 3BMOA 3EEBA 3FX2A 3NYWA 4OVKA 1ONSA 2R1UA 1A9XB 1EXMA 2XNSA 5AXCA 5ITWA 3UA3A 3U40A 3EHDA 3FKSA 1IEXA 4MUGA 3EPKA 4OBEA 4TSFD 2H4JA 4H7EA 4WZBE 2ZATA 4BBZA 4KJZA 3T7CA 3AUSA 4HJRA 1E69A 3UAZA 5FBLB 1GAEO 5IZCC 1PNTA 2QD4A 4NDNE 3U4HA 1W2HA 3TKYA 2VT7A 4F8YA 3WQQA 3VKHA 3HCAA 1ZMRA 3EVTA 2XSZD 1NHGA 4PG6A 1FEZA 5FQNA 5GINE 4H7HA 2OKCA 1GP2A 4Q4HB 2G06A 5JQGB 4HFMA 4HEA1 2OGWA 5KSOA 2UYYA 1PP4A 1BGXT 4BOYA 3I5MA 5ALGA 4X6XA 4NBTA 5CTJA 1U0HC 2F43B 2J3JA 4JDPA 3TQTA 3I01M 1UBLS 4NF2A 5HJEA 4PPFA 4NBSA 2DUMA 2PS1A 1XPRA 2UZAA 3VKWA 3BPSA 4O8ZA 4B4OA 1BOFA 3PCTA 1SKMA 4Q19A 2C8VA 1N77A 4LGMA 1KJZA 1M34A 3RUCA 1QIKA 3FNQA 1L7QA 2PBLA 4P5EA 3O75A 1YR2A 3R6TA 1ZM3A 5LWQA 4BX2A 4FFDA 4BP8A 2QB5A 1P2GA 2BFBB 2LCIA 2FN3A 4WAUA 1XTPA 2OXFA 3ZE7A 4X45A 5BT9A 4UMEA 4QAJA 1DPFA 2HDOA 3QF4A 3QYFA 4CG1A 5KOHA 1TF7A 2GJAA 1O6GA 1LSUA 1U7UA 4Q1BA 5KO2A 1RLMA 4EUNA 5A6SB 3I2JA 5AVZA 1EFCA 3X1ZA 3A04A 3B3GA 1LC0A 2QAGC 3QNWA 5AW0A 3DV0A 1WUJS 4JLVA 2JBWA 3KVRA 1PK7A 3CVYA 1KOJA 2WG2A 3SYRA 3LQYA 2ZUCA 4RK1A 1KK3A 3ONNA 4IUYA 1EBUA 2ZVPX 3BRWD 3I34X 3OLVA 4KVGA 4XIGS 2C59A 1O96A 3EWAA 1EXVA 3ZNOA 2BGRA 4L4XA 3UICA 5JQGF 4QT0A 4ZCSA 3DWEX 1P9WA 3FAZA 4RBNA 1E3SA 3LD9A 5HHTA 5HCNA 2ZBFA 1QRDA 2A1IA 2HM7A 3CPEA 4HGNA 4ND1A 4X6UA 2H2IA 3I1IA 1JTVA 3Q11A 3KTAB 1Z08A 1W581 3WSVA 3PE4A 4WCFB 6NULA 1OXXK 2OHFA 3V2HA 1PSWA 3ROQA 3QIAA 2OM6A 4EHHA 5CYGA 4XVQA 1WDLA 2P4SA 4TXNA 1GPAA 3CG4A 5BN3B 2PL3A 2Y2VA 4IIEA 1KH3A 3D6UA 4L85A 4HC4A 4ZCQA 4DCPA 4MYHA 3T3HA 1T1RA 4WXPA 2VJKA 5CEEA 4JBWA 5CB8A 2FW9A 2D1TA 4UXJA 4F9GA 3CZCA 2C77A 2H51A 3T7EA 5DTQA 1QZ3A 3ZGNA 1U3VA 3ZV5A 1W4ZA 4FSXA 3AM1A 3DAGA 4HLNA 3L2OB 1AQLA 4QXMA 3LE8A 4MV8A 2ZI6A 1D4AA 3R0QA 1LW7A 2ZBPA 4O33A 4UPEA 3JD3A 2PS9A 5DHAA 3RC1A 2CLCX 2JI9A 4LFCB 3RYFB 3UGQA 3M6WA 2I0FA 4MKZA 4KLCA 1L3CA 3I6IA 4BVEA 3B89A 4PLZA 1K7SN 2IOYA 3EGOA 3PNBA 4HG2A 2R00C 1LPMA 1NJ6A 2UAGA 4A91A 4RE5A 4L02A 4YMSA 1VECA 4N7BA 1H93A 2QN6A 2OCXA 3VI3B 2FRXA 4DQDA 4WBNF 4FNMA 1DC4A 1XDUA 2BGUA 4OXKA 4TVKA 3ZWCA 3AO0B 1P2DA 3HCWA 4HVAA 4C04A 3VPBA 2NUPA 1LLDA 1IULA 3KT3A 3AM5A 3GAAA 1Z37A 2XJ4A 4K9MA 2FZKA 2MMGA 3MD0A 1T24A 3QW2A 4PAMA 3RANA 3TQRA 3ZLTA 3R7SA 2H4YA 1JF8A 1NN3A 3O8OB 3WK5A 3G9UA 2D7CA 1QG6A 3CNNA 3OCWA 1VL5A 4PU0A 3OZIA 4PSDA 4LKOA 3MWEA 4D98A 1F3OA 1JJAA 4F56A 1KU6A 1B2RA 2CXOA 3R7WA 1DQZA 3FNEA 2ETVA 4GUAA 3W5IA 4M1QA 2I3AA 1GQQA 3HS3A 2WFMA 5CVUA 1C7EA 2PWPA 3SOZA 1Q0UA 3MTJA 3T7IA 3LUCA 2JAPA 2HC9A 2QNBA 3F7MA 2JIDA 2D1SA 3EOZA 4L57A 1E1RA 5L3RA 2FG7C 4YP9A 4RF5A 1H66A 4OATA 2O19A 5E9AA 2E5WA 3TL6A 5CURA 1RM4A 2ZE7A 4JENA 3WOVA 3AF6A 4F3KA 3UXMA 5BNZA 1AK2A 3KYJB 4U2CA 2HK9A 4F93B 2OBLA 3FROA 4IX1A 4AIRA 4QODA 1JHXA 1SUWA 5CM8B 4RUKA 2QMZA 2RHJA 1E8DA 4JYMA 2D4HA 4IFBA 3QFSA 4JI4B 1ITZA 4WLOA 2ZXUA 2C83A 1RMTA 3ZU6A 3R3XA 1HUQA 1P8JA 3RVNA 1U0NA 1YRBA 2AV6A 3L8HA 4QRDA 2JLCA 4JYBA 3EZLA 4NFSA 3TBHA 1KYWA 4FDVA 5B57C 3VKVA 4D8UA 3DP7A 5ALHA 4YGXB 5HKOA 4KFRA 2EW8A 4ML3A 4CM4B 3RWMB 4FBLA 4JBXA 5E1DA 1JEYA 1JWAB 4RIFA 1SN7A 1X1RA 3LFTA 4US1R 1YRYE 2NO4A 1Z22A 3CUSA 3QELA 2Q1YA 4NAVA 4Y9TA 3RKUA 4E6EA 5LJIA 2WR8A 2JLSA 1JMVA 1A9PA 2ZSKA 2C7VA 2WSIA 2CCGA 4CPDA 2FQQA 5KREA 4N5NA 3G79A 3WS7A 1O8BA 4P86A 1W4LA 2N75A 4NK4A 1TZJA 4HI0E 5AMXA 3OFVA 5I7SA 1M8KA 4UUPA 2YQ4A 3RYCA 4R1NA 3OF5A 5A3VA 3PQCA 4HUTA 2HPZA 2VJMB 4ID3A 3HJUA 1CKEA 2PUEA 1L7OA 1YZ3A 4BFYA 2F59A 3HUFA 2RGCA 3ORSA 3EWIA 4PZZA 2O8BA 2YYZA 2P4UA 2B8WA 4H3VA 2I91A 4Q4JA 3CF4A 2IXFA 2OQ2A 3PNLA 3BFPA 1BQ3A 3HL0A 4D9IA 4K2AA 3NUQA 1EVYA 1PBTA 1RU3A 1W96A 1X2BA 2JJ2D 1LWNA 3CNHA 3UAYA 3EA4A 2CLEB 2AC2A 3DTVA 5T6MA 2H0RA 2IPOA 2Z9CA 1R6UA 1A2OA 4XXHA 5CCDA 1FFGA 2GN1A 3UHPA 2UYGA 3D8NA 1RLTA 3DHVA 3N75A 1QFYA 4C7KA 4EELA 3DMHA 1D6JA 2JD0A 4Q1AA 2PKQO 2DERA 2H6EA 3EODA 3H5AA 4KIFA 5P8WA 1K6MA 3WX0A 1E9VA 5I9IA 2OXRA 4DNFA 1A8UA 5DBHX 3TWOA 4CF5A 2VWHA 1EMDA 1Z6PA 4ZI7F 1U28C 3QG1A 3U5TA 3NGMA 2JAQA 3Q5EA 4BRZA 4ARIA 1E5TA 1IG0A 1CZKA 4F2WA 2IZ0A 5KJEA 3PC6A 2ZJ0A 4L5CA 5GM2A 5AUPB 2I7DA 3KOUA 3LLMA 5H4GA 5GADl 5L7TA 1U90A 1XJ5A 3DBIA 1P1FA 4GU5A 4DRXB 3JARB 3WBFA 1HNWB 5HQ3B 2I99A 1M2KA 1HKHA 4D3DA 4OK6A 1UQRA 5HOQA 1UIRA 4B33A 1IHPA 1YNSA 2B8EA 3OZGA 3PGJA 1EI9A 4J2TA 3ZHOA 4E1VA 5LQCA 4N0EA 5GMOA 3JQEA 5FUWA 2P9ZA 3CT6A 4MUAA 1RM5A 2GK3A 4Q7MB 4U2EA 4A23A 1GFSA 2A14A 1KGSA 2KE5A 2PCJA 3A1NA 4ETMA 1QK5A 3PX3A 4X61A 5JNSA 1H6DA 2C82A 1TA0A 2FUCA 1UXOA 5I7VA 1GRCA 5G2OA 4PEVA 4TXLA 3H17A 7REQA 3PICA 5ALIA 4ZVNA 3CKMA 4PQEA 4BFWA 5CA1A 3AVXA 3ZJTA 3FRIA 1C29B 2JCXA 3I0NA 4GYYA 1LPNA 4BQEA 3QW4B 4ZHSA 1KSHA 1IIBA 2LZ0A 3V6LA 2FSSA 2RI6A 1EWVA 3DA8A 4GWKA 5JAQA 2ZB8A 4YJ3F 1NW9B 4Q37A 4ZTBA 3WNCA 5F3WB 2B3DA 2M32A 2ST1A 1NQOA 4WZBB 1OBVA 4ZMRA 2QMQA 4GSKA 1OFUA 4G9EA 5A2QA 3RIEA 4L75A 4CL0A 5J2UA 3R9XB 3U80A 3X1MA 1HOXA 1QZUA 2EKPA 3IDFA 3K72B 4P35A 3K5IA 4XWTA 3U7IA 4ER5A 4HNTA 2D62A 4RD2A 2WZDA 2VYVD 4UBJA 3DL2A 2ALJA 3GZNB 1IHXA 3C3YA 2QZ9A 1D7OA 2IQ5A 4LMRA 2EGHA 1P17A 1R4NB 2FSUA 1YVEI 4WZAE 2Z57A 1YCHA 1HBJA 1V16A 3DYBA 3ZLBA 1BE1A 2WM8A 2MIIA 4PLCA 4KMOA 2GXQA 1Z6XA 5MFPA 4EUFA 1JIUA 2PQ2A 4PGMA 5JG7A 4KNVA 2HWKA 4YASA 5K1ZA 1ETHA 1ENZA 3QOYA 3I9JA 1GCOA 1K6JA 2XWPA 2AXEA 4MWEA 1Y8RB 4HB2A 5EKUA 5TEVA 1YJCA 3KYIB 3IOCA 4FDTA 2JLBA 3NOQA 1LTQA 4RVGA 3W3AA 3KUKA 3K53A 4K9DA 1EWQA 1F51E 1QFZA 2VZ8A 1SXIA 4MRPA 2Q9AA 4HMOA 3HKCA 5C8ZA 9ATCA 1CRWG 1Y8QB 2OY0A 3FCSB 4NPCA 5I5EA 1CB7A 4HDSA 3D81A 4HDKA 5DLYA 2L19A 1U0LA 3MWJA 4BFLA 3D0RA 2WZQA 4EG5A 4Y6QA 2IU3A 1IWPB 2ZI7A 3B48A 2E4ZA 1P31A 3O1LA 5JNLA 4ZVVA 4N6GA 4RTQA 3IP3A 5L6LB 4IMIB 3FYTA 5K20A 3CRW1 4OXNA 2JAOA 3PFBA 5ERXA 3WGLA 3C6MA 1NF3A 1Z8FA 2GVNA 2PWZA 3B60A 3DT6A 4ED9A 3U7RA 3F3MA 2G4VA 3UXHA 1I4LD 2OSBA 3I04A 3EQ2A 1IJEA 1V5WA 3FTNA 3D5QA 3JASB 4HQRA 5FUXA 2WT4A 3ASVA 3GEDA 2PL5A 4ZIRA 4FB5A 4BDSA 4II7A 2PXXA 2OQVA 1PT5A 3T0FA 4BLPA 5BV0A 2IIBA 4Q1VA 5EWMB 5HJ2A 2RFLA 2RBGA 3ZI7A 1RPTA 1S01A 3E22B 2WHPA 3Q2IA 1TRKA 3RSFA 4RQTA 4P3PA 4QG3A 1O6CA 2XUZA 4MS1B 5FOUA 1LDYA 1F60A 3HEAA 4TMKA 3K0CA 4RF2A 4CE6A 1GWNA 3LCUA 2W58A 2YOHA 3G13A 4GQIA 4D79A 5BVGB 1U02A 1ZUNB 1P0FA 5F9FA 2PZMA 2CT8A 1HLDA 2H5LA 2QTCA 1UZNA 3VJRA 1Y9AA 3UUEA 1UFKA 2QLFA 4QOGA 4V39A 4X3PA 2OO7A 3LT2A 3O21A 3L4EA 2B82A 3QVWA 2A9JA 5AHXA 3NT4A 4KVZA 3U4QA 1ZBDA 4OU5A 3NP9A 4ETWA 3CNEA 3OIYA 4PC3A 1EP2B 2D5LA 2GFIA 1Y4UA 1ULUA 3EF1A 3NH6A 2PU7A 1XRQA 4J2OA 4K9NA 2J3EA 4Y6OA 4YRDA 1GRVA 3WYCA 2JCYA 4DSUA 4B6OA 3NO4A 1AO0A 3QXGA 4M99A 2I7XA 2AK2A 2FWPA 1L4GA 2OO5C 4C0XA 4I1RA 1M2WA 3HVKA 5E9JA 2YJNA 1RYNA 2ZIUB 3Q9NA 2GEJA 4ZGWA 1U2DA 1YKFA 4NMLA 4YPVA 1JHVA 3KJHA 1FDTA 4OAOA 4AUMA 2B36A 1CRZA 2ACKA 1IQ0A 2ZFUA 3OIWA 3DAOA 4MWCA 2QZJA 4NQRA 2OG1A 4Y1RA 4M1ZA 1JZQA 5BP7A 4CU5A 2WLSA 3O90A 4ZMBA 1L7MA 2QLLA 4F04A 2X1VA 4HGQA 4Z9YA 5EE3A 3ZYZA 1RXWA 2H7VA 3KSDO 4BLWA 3CF0A 3SF0A 2GAAA 4OQPA 2FP4B 3AEQB 5CM2Z 3QPDA 1AKYA 3BGSA 1VHJA 1JDBC 1PGJA 4RLHA 1YQ9A 1FPQA 3Q12A 3OCXA 1AN9A 3Q3CA 1C41A 2F1OA 2DTEA 4NMHA 2D7JA 2UXCB 3F3KA 5EUQB 4ZXFA 3L7JA 1CUWA 5ELXA 4JUAA 2ILTA 5CXUA 2VSNA 3GU3A 3LUGA 1EXNA 4EUSA 1PKXA 1TCCA 4K6MA 3NHBA 1VIDA 2TMGA 4OQQA 3GLIB 2WHRA 1JNXX 1Z4JA 4X9XA 3ACBA 3H04A 2G72A 2V3WA 5E7MA 2G4CA 2JJ8A 3RF6A 1Q7CA 1XSEA 4IVPA 3SX4A 3FNGA 3P9KA 2GAOA 3A9RA 1G5QA 1DUVG 3EIUA 3PNSA 4AB1A 3CMMA 2BHRA 4F1JA 2B21A 3TM5A 5JXIA 3DE3X 3B1YA 1UT8A 1AZLA 4AKSA 1AV6A 4O4IA 2JIPA 4U63A 5CM9C 3DMTC 4OP1A 1QOZA 4WCFC 4CDMA 3O8BA 1TMOA 4TV8B 3DQQA 1Z17A 3BOSA 4JI0B 1F06A 2RIRA 1NVFA 3QVXA 1FSPA 2C97A 2VPIA 4JYCA 5COBA 1IMOA 2N46A 4I08A 4MMXB 4F4DA 2IC5A 1Z8NA 3MLAA 5KYYA 1QGZA 2ZAOA 3OCUA 3A4NA 4NR0A 3E9CA 1A97A 1CX9B 2JJMA 3GJ7A 2VG8A 2AFHE 3EG9B 4XQEA 1X7XB 3VNQA 4YV1A 2YICA 1PJ3A 4RK7A 4O4HB 3ACDA 1AZTA 5A5GA 3TTXA 5JZ9A 1MW8X 1VPWA 1RAAA 3THSA 2O7VA 1HE8B 2AX4A 3OQJA 3PA6A 2O2DA 3RBXA 4BYGA 1NNSA 3BCSA 1U3WA 3TD2A 3VAYA 3VOBA 1L7NA 1RYHA 2DVMA 1EX6A 4QXAA 2WJYA 3B8EA 1JJFA 3P2YA 3CNQS 4PBSA 4CTJA 4Y1RB 1PL7A 4UHDA 4Z3OA 1MVNA 3WV5A 2QRVB 2XUGA 1VGQA 1E2JA 4PAOA 3ZPXA 2ZXFA 2QWXA 3M1IA 1GIAA 2DQYA 4BNUA 2NVUB 1UANA 4AP9A 2PUJA 5AUNB 3OLXA 5EMKA 4MH0R 1AURA 1IVNA 4KH1A 4MI9A 4XRRA 4MR7A 4R6XA 1LK0A 2W11A 1N2HA 4QU9A 2JS7A 3DFZA 1NXVA 3IPLA 2W6JA 4RHYA 5JI3E 1PQPA 2QW1A 1JDJA 4Q3BA 3PXEA 4QEZA 2MYUA 1FXSA 2VDOB 3IA2A 3K35A 1W4RA 1QG0A 4PV7A 4D9HA 5B36A 5L3QA 2DETA 3AERB 1YR1A 2HR1A 1FW6A 5HYVA 1U4NA 1HG0A 1KI9A 1RJEA 2A30A 2OD9A 2C9CA 4OUDA 3RVRA 1JECA 1I3KA 3J7TA 3LUKA 3E7FA 4MS4B 3FUCA 4UFNA 4BIIA 4M9QA 5IVHA 1P9OA 1TTHA 2PSSA 1TVKB 4I5DA 2KLBA 3K70B 4YVFA 1E4VA 1NURA 1SZCA 3OTOB 4GNRA 3EXHA 2ADFA 2ZT6A 5JV5A 3RC9A 2CXQA 2EFJA 2W22A 3OPMA 4J16C 4C0HA 5AVRA 5KDDA 2MT9A 1YI0A 2HQBA 2JG3A 1ORVA 3EOAI 3OM8A 1JIKA 1CB0A 5KNBH 3QV2A 2Z58A 3H2YA 4MS1A 4U3JB 1RLOA 1J5EB 3SNHA 3TW8B 3ZBUA 4M8NE 2FPPB 2I5PO 1E2UA 2JGKA 4MR9A 2WHPB 1OY1A 4LCBA 4OGWA 1UDXA 3VNSA 4AN4A 5CFQA 2FWRA 3WWDA 5EWMA 4PNPA 3WISA 3ZDDA 1L6IA 1KFCB 1P33A 2VYQA 5G1OA 4YT8A 1TQ4A 2R68A 5TQJA 2XT0A 3VPDA 2IWHA 2IF2A 5I48A 1UM9A 2GM3A 4NULA 3JASA 3I1YA 4ZD6A 3UH0A 5EQDA 4A0QA 2O3JA 4FHZA 4MMYB 2H1HA 4E3WA 1U9YA 1NI3A 3MOGA 1DHRA 2X4DA 3MWKA 1UJBA 1SCBA 1ONNA 5EIEA 1MCZA 1D2HA 5SYAA 1DQPA 2ENUA 4DB4A 2AJTA 5F9MA 5E8RA 2PH5A 4BNIA 4DNQA 2OZLA 3HWX1 2NPIA 1QSGA 4XM1A 3NTXA 2K87A 4XD7A 3QEJA 5F52A 1FVXA 3U1VA 2C1ZA 4N9QA 2VTEA 1KH2A 4YJ3A 1D0IA 4BE4A 4L95C 2BGWA 3IAS1 3OJCA 4U6SA 2CL7X 5JHHB 3TL3A 2BIFA 4KN5A 4RHXA 3OQHA 5T4EA 4S24A 2QNRA 3RUEA 1E92A 1N3BA 1Z0AA 1JN0A 1GYRA 2HWUA 2IZOA 3JV7A 3A1EA 3HKCB 4UM9D 2YS7A 1WBBA 3QUQA 4GOND 4PANA 4TT3D 4MEBA 4MW5A 5KU1A 3NM5A 1WX1A 2X2PA 1SVMA 1EGMB 1YJXA 1L7PA 2V6GA 4TLDA 3SN6A 5G0VA 2XUDA 1F8XA 1HORA 1Y98A 3CONA 3GXBA 3HV0A 3GDWA 3LGXA 3QLEA 4WGGA 1AKUA 3VH2A 5M04A 4EO9A 2GJKA 1JQ5A 5KTOA 4YX9A 1ZI6A 2ZJOA 4G2TA 4M46A 3AW9A 1M5RA 2VZEA 4TYQA 2FOIA 1BXGA 2J3KA 5K3FA 3NDBB 3LL7A 3FAKA 1Z9BA 2ZVQX 4LE0A 2YNMD 1Y9EA 4X7PA 3PP8A 3MMXA 2I7TA 4GAEA 2K7ZA 1NU8A 2F90A 1Q21A 2F64A 1QFXA 1YMVA 3C2QA 4OFWA 2FAXA 2IPAB 4R2MA 2XOEA 1XK7A 3RSSA 4XGRA 2EBUA 3N2NA 3OVMA 3WOHA 2EQ5A 3ANTA 4DQUA 4GEGA 4XASA 1W5EA 3ELWA 3O7WA 1L7VC 4X95A 4Y9UA 1BFUA 4MGHA 4BMPB 4DILA 2YMMA 4HVCA 2H08A 1B41A 4LVUA 3HU5A 3RS2A 1V4BA 4QTXA 1EJBA 1TEZA 1P0MA 4B76A 4TKLA