4HFRA

Human 11beta-hydroxysteroid dehydrogenase type 1 in complex with an orally bioavailable acidic inhibitor azd4017.
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
260
structure length
255
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPLVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVMQAAPKEECALEIIKGGALRQEEVYYDSSRWTTLLIRNPSRKILEELYSTSYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Discovery of a Potent, Selective, and Orally Bioavailable Acidic 11 -Hydroxysteroid Dehydrogenase Type 1 (11 -HSD1) Inhibitor: Discovery of 2-[(3S)-1-[5-(Cyclohexylcarbamoyl)-6-propylsulfanylpyridin-2-yl]-3-piperidyl]acetic Acid (AZD4017)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 99
structure length 255
sequence length 260
chains with identical sequence B
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4hfrA00
1P1KA 1PSDA 3FF4A 4G65A 3UH1A 4FFLA 1H2BA 2GN9A 1DIBA 2FY8A 2ZQZA 4YJHA 3DTYA 1PJ3A 1RPNA 1RYEA 2PZJA 3RUIA 3X2FA 5ITVA 2VZ8A 2BGMA 4OIMA 1XU9A 4B79A 2JCXA 1T1SA 4BO8A 1HE3A 4R01A 3JQAB 4TRRA 3VVBA 4BO7A 4B7XA 1VC2A 3U5TA 2AMFA 2X9VA 1WZEA 1W4ZA 4ND4A 5DULA 2QRLA 3KTDA 4IDAA 4O59O 5DN9A 2JCVA 1G0NA 3WX0A 4YAKA 4FC7A 1UZLA 3PI7A 4RPJA 3LT2A 4WNIA 1WLYA 2SCUA 1LDNA 3VDRA 4C7JA 5T67A 4AJOA 4M89A 4KQXA 5G0UA 2NACA 3PWZA 3WGGA 1E7RA 1AUPA 2AG5A 1GL3A 5EL0A 4RDIA 4A7PA 5CDTA 3UICA 2YV3A 3U09A 4OYRA 2J3HA 4J6FA 2ZCVA 4FGSA 4PLPA 4QQRA 2OHXA 1I2BA 4ND5A 4A27A 1MX3A 3OM9A 3ETDA 5IXYA 1DIGA 1NQOA 3R6DA 2BGKA 2JAHA 2IZ0A 3TZKA 3PDUA 3FN4A 2YV1A 3F5QA 3ICPA 3JV7A 4Y8VA 1E5QA 2X7HA 3O38A 4NBWA 2X0JA 3OJ0A 1UP6A 1LSOA 1P31A 1YQGA 3GNTA 4RJTA 4NFSA 2OOSA 1HDOA 1ZK0A 3FWZA 3ADOA 1ISGA 1RKXA 3JD0A 1E7YA 1NFQA 2Q50A 4EJ0A 1KEPA 3ZNQA 1Y9AA 3ROKA 2HO5A 1UP4A 2PK3A 3DOCA 4B8WA 1P1IA 4IM7A 5A9TA 1RM5A 3IQDB 3ZCXA 4KDFA 4IS2A 1BXGB 4YPOA 1JW9B 2JD1A 5THQA 3OQ6A 4IXTA 3C24A 1NQTA 2O2YA 3TL3A 2CVZA 4CM9D 2O7SA 4RORA 3SC4A 4ZQBA 1NNUA 3FR8A 3KBOA 4BNMA 3GLQA 2VRBA 2ZTUA 4XYMA 1PGPA 3T4EA 5EQFA 1ZZEA 5A4DA 4HBGA 5IFLA 3JYLA 3OICA 4OKIA 5F5NA 4RCVA 3GH3A 3LT1A 3ZWXA 3CH6A 3F4BA 4FSHA 4DVJA 1DRWA 1P9LA 2FRDA 4FD3A 2O3TA 3ORFA 2Q49A 2AA3A 2B35A 1IUKA 4CLHA 1EUZA 5HTOA 1JKIA 4BO3A 3DQPA 3D64A 3V1TC 3MCVA 4BNXA 4D3DA 4DA9A 3M2TA 1YBAA 1ZVMA 1H6AA 3DR3A 4QSMA 3B1JA 5TJHA 2V6BA 1XG5A 1U9JA 2B83A 3JQAD 4BUCA 2ET6A 1B15A 1Y8RA 4DMMA 1YDEA 1DHRA 2IZ1A 5A03A 3OP4A 1X0XA 3IS3A 4U0KA 1NPTO 1M6WA 8LDHA 3ANLA 1GEGA 2ZIZA 4WCFA 4GPD1 1UXGA 4LRTB 3HZZA 1NVMB 1RWBA 3RAJA 5IN4A 4L4RA 1CJCA 1IE3A 2FPIA 1GY8A 2Y1DA 3GZNB 2D2IA 4U6SA 5A3VA 3MJVA 1I3MA 1BTOA 4EUFA 2LDXA 5HRUA 1M67A 4YRDA 3QIVA 1VRWA 2G82A 3ULKA 1V6AA 4FIZA 3LQFA 4M8SA 2VT3A 4GL4A 4O6VA 4Z3DA 3K5PA 5IDXA 1B26A 1NWHA 1YRLA 3FHLA 2VQ3A 3KYDA 4LVUA 1WAMA 4CM8B 1HSOA 1T24A 1X7GA 2RH8A 1ZMOA 2EJVA 4PZEA 3CKYA 3H9EO 4F45A 1RM0A 2GN4A 3W4KA 3KO8A 4DYDA 4KUEA 3NKLA 5G0TA 5DF1A 4PIVA 1LLUA 5FYDA 2GN8A 4DWVA 3AUSA 2YFQA 1GZ6A 2PFGA 1UJMA 3DWFA 5COAA 3PQFA 3W8DA 3AUTA 3PJGA 2WYWA 4FW8A 1LXCA 3UW3A 3ZHYA 1TI7A 3JQ9A 4WECA 8ADHA 5JAZA 4WPGA 4H7PA 1GV0A 4D3SA 1WP4A 5I9MA 5DT9A 3WTBA 3TZHA 4F3YA 2J5QA 1T4BA 2EKPA 1A71A 4DIBA 1Z6ZA 3F1LA 1KEUA 1ZK2A 1V9LA 1DSSG 4W99A 4XQGA 1MGOA 4BB5A 1C14A 1U2GA 2NQTA 1NTOA 3H5NA 4MOWA 4ID9A 4OQZA 4Z9YA 5DOZA 2O3UA 2X22A 5TF4A 1TXGA 1ID1A 2UDPA 1ZO8A 4GVXA 1KVSA 2PGDA 2V6MA 4IZIA 4B4VA 1X7DA 3TWOA 3TZCA 1O94A 1DEHA 3BAZA 5HM8A 4MVJP 4OOEA 5H82A 4C7KA 2D59A 2QZZA 1EDZA 1A4UA 3U0BA 4E0BA 1LRJA 1XELA 3G3EA 1KEVA 4MVJE 3S2FA 2Z1NA 3H5AA 3KUXA 1HE4A 4HFNA 4AJJA 5ITWA 3WWYA 2DPGA 3DHNA 3Q3CA 1LNQA 4YAEA 2O4CA 1Z73A 2VCYA 3KB6A 1T2EA 4E5YA 3NTQA 2Q2VA 3ZV6A 1TA4A 4J7UA 3ENNA 4RVGA 4D0SA 3MJEA 5EIOA 1VLLA 1Y5MA 1JQBA 1E7MA 4CQMB 5JXWA 2GZ3A 4CR6A 1RJWA 1GPJA 4WNCA 1C0KA 3DOOA 1WMBA 2F00A 2JD2A 4XDZA 3GR6A 3AUUA 5KWEA 5BSFA 1DIRA 3WGIA 4OGWA 1EK6A 2JFFA 3VPGA 1E6EA 1I36A 4CUJA 4H15A 1MXFA 3BMQA 1FDSA 4EITA 4D79A 3PYMA 2B5WA 4B3HA 4DLAA 1KVTA 2C7VA 5IDQA 1F8FA 3AU8A 3GRPA 5EN4A 3QWIA 4RVFA 2JJYA 1KS9A 2DU8A 4YJHB 2VTEA 5C5IA 3ZW9A 1FF9A 3ASVA 2PH5A 4AJ1A 1ORRA 3GUYA 2Y1CA 3N58A 4BNWA 2WD7A 2Y67A 3WIEA 1PL6A 3ETGA 4CM9A 1E1MA 2YDYA 3L4BC 4Q39A 3WSVA 3WNQA 1JVSA 4QT0A 1O95A 4L9RA 5B4UA 2C2XA 1T1RA 4R9SA 2AG8A 4ESOA 2G17A 4PLYA 4B7UA 2QRJA 3GK3A 1VL6A 4Y6RA 3DZJA 3P2YA 5CG2A 4DIFA 3PHJA 2FZEA 4R1TA 4XRGA 1Q0LA 1CWUA 1TT5A 2FOIA 2HKIA 1MP0A 3AU9A 4LISA 1T25A 1UAYA 3H4VA 4IDFA 4Q3BA 3M1LA 4UULA 2J3IA 4UEJA 4YAJA 5KVVA 4WEQA 3WGZA 4WLEA 4RDHA 5I7FA 4JROA 1I5RA 3WNVA 1UDCA 1LDBA 4E5NA 3K2EA 4R68A 1QLHA 4FB5A 3AK4A 2Y66A 4R1NA 4ZQEA 3BHJA 3EAGA 2IE0A 1B8UA 3JQBA 1SO8A 2C0CA 1R4MB 1MLDA 2BFPA 3GMSA 4E31A 4ZHSA 3JQAA 1I3NA 1GUZA 4XB2A 3GPDG 2DTXA 3W4JA 5MDHA 4UEKA 2HMSA 4UVHA 3VH4A 1YQXA 4EJMA 1XGKA 1E77A 4LVCA 4P8RA 1PJ2A 5I8WA 3QLJA 1N92A 3K96A 3F46A 2AW5A 4JX8A 5C37A 3U62A 4DRYA 3A14A 2WYVA 3DFZA 4IMPA 3ZZNA 3S2IA 4XYBA 4PLCA 4JP2A 1HDRA 2AQHA 1D3AA 2IRWA 2HJRA 1ZNQO 1LC0A 2GYYA 4ALMA 3DBLA 4KWIA 5EQDA 4CQMD 3RUAA 3KHUA 3JD3A 2OZPA 4LSMA 4PLWA 3AFNA 4AFNA 3NT4A 4CM3A 5IZCC 1EEHA 1M2WA 3S8MA 4Y98A 3ZWOA 1MFZA 1B3BA 1DIHA 2HMWA 3N7UA 4XGNA 1H5QA 3QRWA 4U7WA 2HDHA 2P9CA 4P22A 5CPBA 5ICSA 5TNXA 1QP8A 1Q1NA 4QUKA 5JLAA 1PL8A 1C0PA 1BG6A 2YY7A 4R54A 1LA2A 4J9VA 3H5RA 1CQIA 1KC1A 5TC4A 3PVZA 3WQSB 2Y1OA 2AEJA 3QHAA 3WGHA 2GPTA 1BXGA 3G0OA 3DAFA 3WSWA 2QQ5A 3MJCA 3L0DA 4RVSA 4YT5A 5JAIA 1LLDA 1P1FA 4RPHA 4ALNA 2GO1A 4W4TA 4N7RA 4I5DA 1V8BA 1V0JA 5GZ1A 1Y6JA 3GVPA 2FWMX 2EHDA 3A4VA 4KUHA 1A9YA 1XWFA 5JAMA 2BI7A 2IXBA 1YBMA 2OGUA 4YJDA 3RIHA 1B3RA 4NHEA 1IY8A 1DPGA 1BWSA 4R16A 2H5LA 3F4LA 2VWGA 4BNYA 1DJQA 4IIVA 3U49A 5U1PA 3GZ4A 2X86A 3S2GA 1HETA 1CYDA 1G0OA 3D4NA 3WTCA 3WWZA 1HZJA 1ZW1A 1JWBB 2AHRA 3P19A 4JNKA 2Y0DA 3JQ9C 1A4IA 1DFGA 1EZ4A 1FDUA 3ZH2A 1HDGO 1O89A 2HMTA 3KSDO 4J91A 1NQAO 3WGTA 3HJAA 4TRMA 3KYDB 3KM0A 3NT2A 3UCEA 3B6ZA 1NXQA 1K0UA 1AHHA 1NFFA 2Q45A 4GLOA 1PEDA 3EW7A 5HA5A 1P74A 1P77A 3LLVA 3OFSA 4HFMA 3SVTA 1LDMA 2OP0A 4FS3A 1QYWA 4HFJA 1LX6A 2X6TA 3VKUA 2AEMA 4W9NC 1Y1PA 5T5QA 4ITUA 2HQ1A 3WOHA 4RPGA 1DHTA 4Z0PA 4BNIA 3DEYX 4ZN6A 4FN4A 1F17A 2VUTA 4CLOA 3I5MA 4Q3DA 4CJXA 4IDEA 3VC7A 1FMCA 4IY1A 1JA9A 3PQEA 1SB9A 5AXCA 1F12A 2P5UA 4YQYA 4A5OA 4UUPA 3GZNA 1DAOA 2I3GA 3GG2A 4LGVA 5TJ9A 4NMHA 3H65A 3ABIA 5BNIA 1MFPA 1PL7A 2QRKA 3GHHA 1P3DA 3KETA 1CDOA 4DXHA 5CDGA 5DCUA 1TT7A 4UVIA 4LCJA 5JDIA 4BNHA 1YOVB 3ZWWA 5J23A 4J1SA 1YDWA 4XGIA 5EINA 5T8KA 2FMUA 4WGGA 2NM0A 2HK8A 3PHIA 4Q3NA 4Z9FA 3OA0A 3C1AA 3D0OA 4MKXA 4PFJA 5DBFA 1UH5A 5DCWA 3GC6A 4MO2A 3W8FA 2C59A 4XYEA 3NUGA 4G2NA 5JE8A 2Y05A 2J5KA 1PGJA 5KVQA 1R0SA 4A0SA 3LU1A 2W8ZA 1E1LA 2E6UX 3GDGA 4K6CA 4MIOA 3AM5A 3QVWA 4K6FA 3ENKA 4YAIA 3I9MA 3RI3A 4BNVA 5KKCA 3V2GA 2YJZA 5K6AC 2YUTA 4YRAA 1EVYA 3W6UA 1S7CA 2B5VA 4M54A 5L7WA 4OMUA 3ZN2A 3D1LA 3QW2A 1I30A 1H9BA 3K73O 4EZBA 4IDGA 2DAPA 1H2HA 4DPLA 1AXEA 4Z0TA 4DTIA 4E2XA 4EJ6A 2VT2A 1CEQA 3Q2IA 1ISIA 3I23A 3NRCA 9LDBA 4FR5A 3I9JA 4MDHA 1EVJA 1GQYA 5CAEA 1IHXA 3ONEA 2PZMA 3ZWAA 3ZU4A 4CMAA 3BMQB 1OZAA 4E4YA 1XLTA 4AJLA 3KYBA 1T26A 3OETA 1ONNA 4RZHA 1DRVA 4CODB 5ER6A 1EFLA 4W82A 1WW8A 4XB1A 3IP3A 4R3WA 4Q3EA 3WBFA 4HY3A 1B0AA 4GGOA 2AQ8A 3ROQA 2YHIB 3TL2A 5L4SA 2BD0A 4OAQA 3D4PA 2EJWA 2WD7B 2V6FA 3B1KA 4XD2A 1BSVA 4XQ9A 1K2WA 3AOEA 3GGGA 4WLOA 2FN7A 4FQ8A 3H8VA 2WMDA 3GFBA 3L07A 3DZIA 3IUSA 5KVSA 1E0DA 1KYQA 1ZIDA 2X0RA 3C1OA 4CMKA 2J5RA 4YACA 4J4TA 3KVOA 4IGEA 4NH4A 5L7YA 4E2ZA 1OAAA 1DBVO 3S55A 1U2DA 3FCOA 4BNKA 4C4OA 4E5KA 1B2LA 1WDKA 4BKRA 1D1SA 4L4XA 5JO0A 4HXYA 1W6UA 3RUDA 5FFFA 2IEBA 4BV9A 2NADA 2OORA 1DFHA 3D7LA 4IZHA 2LDBA 4D42A 5TRTA 3IAHA 4R5HA 1IPEA 3ASUA 1HE5A 4Z3KA 4OQYA 3VTFA 4A2CA 2VZ9A 4NK4A 1ADCA 2GRAA 3KEOA 4AJHA 3DBHA 4PN3A 2PKRA 4WEOA 1DXYA 1UXIA 5IXSA 4XZ3A 2EXXA 4XKJA 5ADHA 3NJ4A 3ST7A 4ZQHA 3U4DA 1SCUA 4A26A 2G76A 2VN8A 1B8VA 4HUJA 2VUUA 3PLNA 3H3FA 3GNSA 3LK7A 3QVTA 3FSRA 2C20A 4JXKA 1ADBA 1C0LA 1ZSVA 4KZPA 2O7QA 4O1MA 4YT2A 1VKOA 5CEJA 1B7GO 5A02A 4BIIA 2R00C 1E5LA 1H93A 3BXXA 3I83A 5JAQA 3GAFA 2EEZA 4UVDA 1EFKA 2DPHA 4CLRA 2GLXA 3F9IA 2H6EA 3G79A 4J1TA 1B16A 2HK9A 4TKLA 1SAYA 2RHCA 1G6KA 3AI3A 3SX2A 3DBLB 5A06A 5LDHA 3UOGA 1Z75A 4K26A 1P45A 5CDSA 2EGGA 5DBIA 4XWYA 1VM6A 1BVRA 3OIFA 1JDJA 1V3VA 1R4MA 4TZTA 1KC3A 3IP1A 2DM6A 4GLLA 3RBZA 4ALJA 2WE8A 1U3UA 1X15A 4YAGA 1I2CA 1H0KA 3IMFA 1AE1A 1SOVA 4YTEA 2CMDA 2DT5A 1O9BA 1ZH8A 3Q9NA 2V65A 1J4AA 1EQUA 1SOWA 2YZ7A 3GG9A 3O9ZA 5JY6A 3HUDA 4J2OA 2OBNA 4UEOA 1L1FA 1PTJA 3DDNA 4N5NA 3JQ8A 2V7PA 2PD4A 2QZ9A 4R5MA 1LEHA 4ND2A 3PIIA 2Q3EA 3KSZO 1U4OA 1A9ZA 2BGLA 3V8BA 3DMTC 2DUWA 3DZKA 4BNLA 4DQVA 4RQTA 3F6YA 3QWFA 2X1HA 3PHGA 5JS6A 4ZU3A 1VE9A 4ZQFA 4MKRA 4J4HA 3GMDA 1HYHA 4TVBA 3EZYA 4RLSA 4AJIA 1NBOA 3EY4A 3C8MA 3OJLA 2NNLD 2QIOA 2C54A 4PRLA 3C1TA 4NK5A 5EMHA 1XHLA 3DTTA 2Y93A 2X9NA 1QRRA 4WOKA 1VJTA 1ZEJA 3WICA 2EP5A 2JFHA 2G0TA 1HEUA 4FC6A 3BZUA 4P4NA 3JYPA 4P4LA 3PJDA 3QSGA 4PRKA 4UUMA 4ZA2A 4DBZA 1KOLA 4XEHA 1O0SA 3WYCA 4CMEA 3RUHA 4BO6A 3OA2A 3CEAA 4NDNE 2EKLA 2YV2A 3JSAA 5A3JA 3RUCA 4NJOA 3VZPA 2F1KA 1UDAA 1PZEA 4Q3AA 1LTHR 2HSDA 2UUOA 3U4IA 3GVIA 2BFOA 4HP8A 4MJLA 1DAPA 1YQDA 4WJZA 2VUSA 3HDYA 1WVGA 4AG3A 5JFOA 2BI8A 4HV4A 4CLOB 4URFA 5F1PA 3H6KA 1YL7A 4B7CA 5TGDA 3LC7O 1Z82A 3WMWA 1Z7BA 3H9GA 1O5IA 1UXHA 3HHPA 1UAGA 4R69A 3K92A 5IJZA 1IZ9A 1HL3A 3AI1A 1X7HA 3FRJA 3DZGA 3QVOA 4QTZA 2BF7A 5AYVA 5T6BA 3Q1LA 1PR3A 3SEFA 1KEWA 4AJEA 4BGUA 4E2WA 2Q4EA 3QA9A 1U7TA 3JQDA 4J2HA 4GKVA 1IL0A 1TVEA 4BNGA 1EMDA 1E3LA 1DC6A 1ENYA 4QO7A 3AWDA 1GYQA 2VZ0A 2Z95A 3DL2A 1HDZA 1ZFNA 3ANNA 4CM4A 1GZ3A 2ILTA 2ZQYA 3ZNOA 5JC8A 5TS3A 2PD6A 2IODA 4UREA 3SC6A 3VTZA 3GUCA 3MWEB 4CV3A 5B37A 1GFSA 2JKVA 3JQFA 4GSLA 4CPDA 2CF6A 4FFPA 2X5OA 5C7IO 1YWGO 4MVJF 5I7SA 4FFNA 1M75A 4BMVA 4E6PA 1LBEA 5CEFA 1HKUA 4NI5A 3KXDA 2AQIA 4JBIA 5TX7A 4MVJA 3DAGA 4JJGA 4E21A 4R51A 2XXJA 2G5CA 1I2ZA 4NU6A 1I8TA 3OIGA 1UZMA 1YO6A 5K9ZA 2WTBA 4TSKA 2QW8A 3K8ZA 1CF2O 3HB5X 1YOVA 2EKQA 3IUPA 5IF3A 2ZB7A 1DRUA 3R1IA 4NFHA 1NR1A 3RJ9A 3RVDA 1U28A 4KWHA 4BMSA 1DC3A 4YVFA 5B4TA 1HE2A 5JCJA 3ROMA 1LJ8A 2NTNA 4RLHA 3BMCB 5BQFA 3AM3A 2AQKA 3PJFA 3ZU3A 2GN6A 3I3OA 2UYYA 1E1NA 3SLKA 2OL4A 1PJSA 1N8KA 1U8FO 1LSUA 1ZXLA 4CMCA 4IGFA 2XF8A 4NFYA 3WYBA 2QHXA 2W2KB 1B8PA 3JYQA 5CP8A 3HWRA 3ZV5A 3DMYA 3OBBA 4OSPA 1I32A 5AXAA 3RKRA 2HU2A 3CIFA 3TSCA 4AVYA 4BNFA 4I5EA 4CMJA 2ZATA 3RCBA 5DP2A 3BTOA 4CR7A 4BGIA 2HMUA 1FDWA 2VYVA 2IYOA 2NU7A 3NDIA 2OUIA 4D41A 1E3IA 1WWKA 2NVBA 4XIJA 2GZ2A 1HXHA 2PZLA 5A9RA 4YYZA 1F8GA 5LDGA 2ZTVA 3H9UA 1PQWA 3GN1A 4IMRA 2Z5LA 1Z74A 2O48X 3NV9A 3G17A 1ZBQA 4N5LA 3HFGA 4BO1A 4TKMA 2BFMA 4ZQGA 2YQ5A 5GY7A 5DBGA 3TNLA 4PG8A 1C1XA 1YB4A 4FOOA 4RZIA 3HDJA 3PHHA 4A73A 1PQUA 4BGEA 5TSDA 5KJCA 3ZWMA 2HUNA 4ROSA 4XYGA 4GH5A 2C7GA 1Q7GA 2YHIA 1U3TA 4INAA 3ICCA 3DBHB 1AN9A 2O50A 4L4SA 2RHRA 1HF3A 1FDVA 4MP3A 2NQ8A 2OP1A 1I33A 2VHWA 3CE6A 2E48A 4O5OA 1Q0HA 1MG5A 1QYCA 4IJKA 3I1JA 3VAZA 2E49A 3WQRA 4IINA 2Y1EA 1E3WB 1HT0A 2C07A 4GVLA 2CSUA 3D5QA 3IIEA 4MVJM 2EP7A 4PG6A 1RYDA 2ZB8A 2QYTA 1JKJA 1I01A 3FTNA 1XQ6A 4YCAA 4EGFA 3L6DA 3PZBA 1E3JA 2VYND 2NU6A 4QX6A 4BMNA 4CLRB 2P4QA 1U8XX 3JCZA 5JBIA 5KOIA 1XYGA 2FSVA 3NGXA 2RBEA 2GCGA 3TDKA 3JQEA 2GERA 5C7LO 3A06A 1XDWA 3VDQA 4YT4A 5U4QA 4I5GA 2QG4A 2XXBA 1EUCA 1EQ2A 1YH3A 4FPXA 5L9AA 1R12A 4FJ2A 5JYEA 3E5MA 4ONEA 3PTZA 5GZ3A 2QX7A 2I5PO 4IDCA 4XR9A 1NAHA 1V35A 3UCXA 4BS9A 1LU9A 4YEDA 4NBRA 4PG4A 1U3VA 2CFCA 4KQWA 2VWPA 4LW8A 1CIVA 1HZZA 3NT5A 1J6UA 2HRZA 2GSDA 4FOSA 3IKTA 2UAGA 3JQ8B 5U9CA 3R0IA 4BOYA 1GDHA 1ULUA 2FZWA 3HDHA 4F6LA 1GCOA 3SXPA 6LDHA 1TLTA 1L7DA 1YBVA 2W2LA 2B37A 1SBYA 1NYTA 1YL6A 1PZHA 4I8XA 4R4JA 3NAQA 3DOJA 4Q9NA 1R6DA 1YKFA 2PGJA 5BSGA 3PRJA 4D46A 3OMLA 4WLVA 3GGPA 5IDWA 4H3VA 2BHLA 1T4DA 3HB4X 3F1KA 1VL8A 3UAGA 4D43A 1NHWA 3TQHA 2C5AA 4JBHA 3MOIA 1WMAA 2DFVA 2O3JA 4CM1A 4CMGA 1EBUA 1PU2A 4WLNA 3PP8A 4ZRNA 4CMIB 1KERA 1PJTA 3HADA 2R2GA 2I76A 1BVUA 2Q2WA 1SB8A 5COQA 1C1DA 3B70A 4WCFC 3ZWYA 2Y1FA 2CD9A 3VZRA 2Y1GA 4I08A 2O3SA 4RVDA 5HBRA 4M86A 3INTA 2DBVO 4N54A 4DC1A 4XDYA 3A28A 1E7WA 4DPMA 1DOHA 3EZLA 3U3XA 1U3WA 2WM3A 5KJEA 5JYDA 2D4AA 3LC1O 3U9LA 3TF5A 1IOLA 2DFDA 3KOUA 1GEEA 3RC1A 4D45A 2B4QA 3B20A 5AXDA 3HN7A 1TB4A 2D3TA 1ISJA 1VL0A 3I6QA 2PH3A 2WEKA 1HSZA 2VRCA 4PLFA 2P9GA 3ZWCA 2Q2QA 3LT4A 5G0VA 5C3MA 4GMGA 1ULSA 3WS7A 4BKUA 3T4XA 1BHSA 3L9XA 1IZ0A 1P33A 2P91A 4WLUA 1BDMA 3RU9A 4HNGA 1GYPA 1CQJA 1P1RA 4GWGA 1Z7EA 2PZKA 2DTDA 3WB9A 3UN1A 2YFHA 1UXJA 4BQPA 2GR9A 1IYZA 4MVJG 3CXRA 2VWHA 4M1QA 5DCYA 3UXYA 4HFRA 5JDCA 2DKNA 1O6ZA 1HYGA 1NM5A 3RSHA 1OC4A 3NX4A 1LUAA 2D1YA 5F3RA 4FFMA 1DJNA 2Y0EA 1NWCA 4Y67A 2HLPA 3ZWPA 5L7TA 1N7HA 3W8EA 4RGBA 1F0YA 1KY4A 1P0FA 4PLGA 2H9IA 3C3XA 3GEGA 4TRNA 3TZQA 5I9LA 3WGYA 3VH1A 3MZ0A 2X0NA 5IG2A 1LSSA 1ISHA 4CM4B 4Z9XA 3M6IA 4YDRA 3ONFA 3WDSA 3RD5A 5ICMA 3QVXA 1GU7A 2E4AA 3GAZA 1ENOA 2V6GA 3B1FA 3BMNB 1D1TA 1YXMA 1H94A 3LZ6A 3PEFA 4PLZA 3FNGA 4CM5A 2Z1MA 4EEZA 2VTDA 3O03A 3RKUA 1R16A 1HYEA 1GR0A 5JC1A 2PKQP 1V3UA 1U5AA 2O4UX 1O8CA 1ZSNA 2HCTA 3RC9A 5JY1A 2IDZA 3NDRA 4OXNA 3JQ6A 1R66A 5FEUA 4GX5A 4JK3A 1HLDA 2R6JA 4J16A 3I4FA 4E12A 3HQ4O 3DO5A 4AICA 2A9FA 4JJFA 2ZKLA 1PJBA 4OH1A 1I3LA 4BL5A 2XPCA 2ZB3A 2PWZA 3E18A 5BSHA 2O3RA 5KJ6A 3L4SO 1FXSA 3VH2A 1I10A 4MVJH 3OQ1A 1DC5A 1X13A 2FR1A 1OBFO 3DBRA 1WZIA 2ZB4A 2VYNA 2E37A 4IS3A 3E03A 3CINA 1I0ZA 1FK8A 2ZJ0A 4FBGA 4HNHA 5LCXA 4RF4A 2VNAA 1M76A 2ZK7A 3DXFA 2BH9A 1BW9A 1BXKA 2HAEA 3O4RA 2B0JA 3SBOA 4BKPA 2DBQA 4WKGA 3T7EA 3VPXA 1R0LA 1X1TA 4DL9A 4B4OA 1VKNA 3D3EA 3H7AA 4GBJA 2EW8A 3GN2A 2C5EA 3QJ5A 4NBVA 3JYNA 3ZU2A 3WXBA 1ISMA 5BNTA 3KLPX 2NUAA 1LQTA 1T2AA 3INRA 3WFIA 1I3KA 4PLVA 2WJPA 2X4GA 1VJ1A 5ER9A 3RC2A 5CG1A 1PJQA 1MB4A 3BTVA 3DHEA 3M1AA 4RF2A 3S1LA 4MP8A 3BMCA 1IPFA 3E9NA 1NX6A 1ZEMA 1C1XB 3JYOA 1E1KA 4YJGB 1VSUA 1KVQA 2Q1SA 2W2KA 4P38A 3JTMA 3KYCA 3GA0A 2ZJ1A 3LLSA 4G81A 1NPYA 1PGOA 1ENPA 1X14A 3R3JA 5GZ6A 3NDJA 4DQUA 1HDYA 4RV9A 4NPCA 4FFOA 2X9GA 5CFZA 4JQCA 4BKQA 3F47A 3ZV4A 4JIGA 3G49A 3JQBC 3GVCA 3PGJA 4TMFA 3H3JA 5I9NA 2Y99A 4I9UA 2DTEA 4GQAA 4BO9A 4XYLA 5KTKA 4D3FA 2I9PA 3PYXA 2Q1WA 1GZ4A 1JVBA 3RFXA 2NU9A 4J7CA 3WJAA 3E6AA 4CL3A 4IJVA 3I9NA 3P7MA 5KKAA 3V5NA 1GYRA 4IPTA 4S1VA 4WE3A 1MC5A 4RF3A 4MVJD 3GGOA 2EF1A 4XX0A 2CF5A 4BB6A 1QYDA 3CTMA 1UUFA 4CV1A 3GEMA 2DBRA 4E5MA 4YXFA 1IHYA 1XEAA 4HKTA 1LSJA 4PG7A 5B1YA 1LI4A 4J1NA 5FF9A 3FNEA 1JN0A 4JLWA 4UVEA 1L7EA 1U1IA 2RAFA 3MJ4A 3AY7A 1R37A 1EVIA 2I66A 4TRJA 1NPDA 3RQSA 3JQGA 1BGVA 2RIRA 5CHEA 4BNUA 3PPIA 1E3WA 3WG9A 2C2YA 5JCJD 1YVEI 2AXQA 3AW9A 5DP1A 4J1QA 3NTRA 4BGVA 1ADGA 3OEYA 4B3IA 2NV6A 1D4FA 1I24A 1OFGA 3I4CA 1N5DA 2OO5A 1PX0A 2JD0A 4IUYA 1UXKA 3NYWA 3Q11A 1RM4A 1GD1O 5TLSA 3IL2A 5DOVA 3LF1A 1AGNA 3HE3A 1E92A 2C29D 1IULA 1ZMTA 1E3EA 1WDLA 2B4TO 1T2FA 4D0RA 4F46A 3VZSA 4LMPA 1GPDG 2EV9A 4DQXA 4FGWA 2WYUA 2TMDA 2NLOA 2WWRA 2VYVD 1KIFA 3WFJA 3WJ7A 4I5FA 3FNHA 1F06A 3KSUA 3PQDA 1K6IA 3ZGYA 3I9LA 4CQLA 4GAEA 5BNFA 4L73A 3WQQA 2BMAA 4HWKA 3ZDFA 3RUEA 4W6ZA 3PJEA 5LC1A 3AUAA 1CERA 1D8AA 2YQ4A 2JFGA 3L4BA 3WMXA 2DQ4A 3UKOA 4ZD6A 2EW2A 1C1DB 4X54A 1WPQA 1BDBA 3HNPA 4IDBA 4R1SA 1Q7CA 2E82A 4J3FA 2X5KO 4TWRA 4XCVA 4XGKA 1EBFA 1LC3A 1VPDA 2OMEA 4OO3A 5A1TA 4LCEA 2PD3A 5JDCC 4CMBA 2D5AA 2Y0CA 4BNTA 1JLLA 4UVGA 1LLCA 2W4QA 1PGNA 2VHYA 3PYLA 2CDBA 3UF0A 4PZDA 1N2SA 4CLDA 2I3AA 4WUVA 5IZ4A 3LC2O 4IQ0A 3BTSA 1LDEA 1AXGA 3QWBA 1SZJG 3ZV3A 3PXXA 1X0VA 2X58A 4GGPA 3ZHZA 4HADA 4AJNA 3BMOB 2A92A 4PVDA 1QKIA 3RWBA 3RROA 3QQPA 4IJUA 1ISFA 4TQGA 5HS4A 1XSEA 4L0QA 3I52A 4RPLA 3DC2A 4YT8A 2HK7A 1SNYA 3GDFA 1MC4A 4F6CA 5GMOA 3MWDB 1R4NA 3O26A 3STHA 3EUWA 3K2BA 3DAPA 4B3JA 3EVNA 1R15A 3ZW8A 4CMIA 4E3ZA 4LK3A 4CM6A 5H81A 4YA6A 4QFCA 3UFXA 3MOGA 3F3SA 1CRWG 4FFRA 4FJ1A 1V3TA 1UZNA 4IBOA 4RVUA 2I99A 1WNTA 2VHVA 1M66A 3TOXA 4Q3CA 1A27A 4OSOA 1NP3A 2FR8A 5A9SA 2ZTLA 4UAGA 3CZRA 5COBA 1Q7BA 4AL4A 1NVTA 1GUFA 4QECA 1H6DA 3GEDA 4GWKA 3DBVO 3VHRA 1E6UA 3WR5A 2FR0A 4ALIA 4NQZA 3A1NA 4E33A 5JDIC 1SC6A 1ZKMA 4TVOA 4ZRMA 2GNAA 4RQUA 3C7AA 4DBVO 5T8KC 3IC5A 4OL9A 3K6JA 2FHSA 1XQ1A 5JPIA 2AE1A 4JGBA 1HTBA 4JBGA 1N9GA 1A72A 3E1KA 3L6OO 4MVJI 4R9RA 2B4RO 1UR5A 4NU5A 4WCDA 4TZKA 4KTVE 3ETEA 4YBZA 4RVHA 3TPCA 1TEHA 5IZCA 5EESA 4E30A 3EMKA 1P1HA 3EGOA 1GV1A 3IDSA 2WSBA 3JQ7B 2VHXA 1GQQA 3H2ZA 3VOSA 4EUEA 1YS4A 4EEXA 1XR3A 2CY0A 2W2LD 3E48A 1JAYA 3TN7A 2BLLA 2Q99A 3LSYA 5I7EA 2DVMA 1A7AA 3QWHA 4OHUA 3RBVA 3FBTA 4YB8A 5KCZA 4OXYA 3OHSX 5TT0A 5L95A 4W7IA 4K28A 1ZJZA 2CDAA 3JD4A 2ZTMA 4GI2A 3HFSA 1NFRA 3DZHA 3I6IA 3WGQA 5KVCA 1LRKA 1DFIA 5DNAA 4BNJA 4S3MA 2XAAA 3NEPX 4E32A 1DO8A 4JP3A 5KIAA 2EIHA 3BMNA 3DBRB 1ZJYA 4L75A 1PQPA 1JKFA 1JU9A 4BNNA 3IJPA 3W4IA 2GZ1A 5G4KB 3C7DB 4B4UA 1CETA 3ADPA 2Q1TA 2VWQA 1PR9A 3JD2A 4LN1A 1BW9B 3ITKA 5EPOA 1VSVA 3RC7A 1YL5A 4LRSB 5IDYA 2NVUA 2EERA 1S6YA 2CUKA 4WOJA 4OM8A 5ENVA 3H9JA 2DUUA 5MGBA 3EHEA 1GAEO 4IDDA 1JTVA 3ZU5A 1MG0A 2VRCD 4YJFA 5IN5A 2OXIA 2VOJA 4EI2A 4RPKA 3AOEC 4CUZA 1PJLA 2P4HX 1E6WA 4CLXA 4II3A 2PA3A 4Y6PA 3QV1A 1OMOA 3L6EA 5L53A 4XQCA 2IEDA 3RBXA 2YYYA 4DC0A 3OH8A 1NAIA 4EDFA 3SLGA 2X8LA 4R1UA 2B36A 4MIYA 3ZWVA 2XOXA 5JCXA 3UUWA 5T64A 1P0CA 3OJEA 3IJRA 2PGLA 3VPSA 3KYCB 4KMSA 4BO5A 3GNQA 4M49A 5ILGA 3K30A 1YGYA 4KDEA 4CM7A 3ANMA 4BHTA 3PK0A 1P1JA 1IB6A 2CVQA 2GUGA 4W9NA 1XA0A 4QFDA 3TFQA 1SEVA 3U4CA 1LLQA 1LQUA 1C3VA 1ONOA 2HRBA 1VI2A 4J49A 3FWNA 4A03A 1Y8QB 1QMGA 3AY6A 4DLBA 1U5CA 1M6HA 1PJCA 3ITDA 5A5FA 4CR8A 7MDHA 2JAPA 3PDJA 1A7KA 1DC4A 3PWKA 4JCOA 4OKNA 3G1TA 4EW6A 3NTOA 4KOAA 4PVCA 2FPGA 1KVUA 5JW6A 1NQ5A 2VNSA 2UVDA 4D7AA 4FJ0A 5F1KA 2IZZA 4MINA 1MXHA 4CMHA 1DIAA 3G1UA 4GX0A 3RASA 2JL1A 1PZGA 3DZBA 3KLMX 3FPLA 4Y9DA 4BO2A 4P4GA 1Q2XA 5C7OO 1ZCJA 3E5RA 4YJGA 4QXMA 4CLEA 5F5LA 2NTJA 3BYZA 3FNFA 4BV8A 3D3WB 5AQ1A 2FSSA 3BTUA 3IOYA 3C7CB 2JHGA 2POQX 3PZRA 4KP7A 4NJMB 3CMMA 2P9EA 1K3TA 1W0CA 2AE2A 4BO4A 1KVRA 3OJFA 1OOEA 3GVXA 4GKBA 3ZHXA 1JWAB 2J8ZA 3E9QA 5KJ1A 4R41A 3A9WA 1W73A 3FTPA 1ML3A 3PHLA 3JQGB 1Z45A 3RFVA 5K6AA 1EE9A 3HSKA 4NNJA 3NGLA 1ZK4A 1FJHA 4Y6SA 1YB1A 4YQZA 4B4WA 1EVZA 3TJRA 3ZNNA 1NHGA 1H9AA 1KBZA 1Y5RA 3C85A 3IKVA 3UGKA 3O8QA 2BRUA 1Q0QA 4HX5A 4B8ZA 2PY6A 3SJUA 3GPIA 3CPSA 1EDOA 1SPXA 4U5QA 3LVFO 5AXBA 3WIDA 3GT0A 1GUYA 4WASA 2GF2A 2ZCUA 2DBZA 3BHIA 4UUNA 1U7HA 5F21A 1ONPA 3QVSA 5JMPA 2PNFA 1T2DA 3GQVA 1ZSYA 1W8DA 2AEFA 5BT9A 5G2OA 3M2PA 4DPKA 4U8GA 3RFTA 1PZFA 4ALLA 1MV8A 5A05A 3VVCA 4CQLB 3UVEA 1BMDA 4K1LA 2CDCA 3FD8A 4O63O 4DYVA 2VOEA 1H6BA 2ZYGA 4YR9A 2PV7A 4L74A 2WDZA 1Y81A 1EE2A 2J6IA 3H9QA 4A10A 4ZVVA 3PFWO 1EUDA 1KY5A 4CV2A 3RUFA 3GRKA 4GSKA 1K5HA 4WLFA 2Q46A 4KUGA 5G4LA 1E3SA 3MTGA 2VHZA 2BKAA 3SJ7A 4CL8A 1GQ2A 4DIOA 4AJPA 1JAXA 3FBGA 4IXWA 1YJQA 4AJ2A 1X1EA 3PLRA 4W7HA 3T7CA 3COSA 4M55A 1N1GA 1SEPA 4NIMA 3V1YA 3GFGA 3GY0A 5L51A 1VJ0A 1UDBA 5T57A 4E13A 1PWZA 4U0JA 4E5PA 4EYEA 4PLTA 3TZ6A 1DB3A 3DZFA 2WE7A 3MJSA 5ES3A 2W90A 4DREA 4Z0HO 3GDOA 2RH4A 2PKQO 3FR7A 4CMEC 7ADHA 1BRMA 3EYWA 3W1VA 1D7OA 4M87A 4PG5A 3OQBA 4JN6B 4J43A 5I8ZA 1SMKA 4MP6A 1PS9A 3Q6IA 3KV3O 1R4NB 2J3KA 4J9UE 4PZCA 5FWNA 2I6TA 4XIYA 4GX1A 1BXZA 3JD1A 2A94A 3RU7A 3Q0EA 1QG6A 3HDQA 5A04A 4XJSA 3FI9A 3Q2KA 3WYEA 3ROPA 4NG5A 1XKQA 3E82A 5DZSA 3EVTA 3I9KA 4KTTE 2IXAA 1GADO 1QYXA 3EK2A 4O0LA 4YWJA 5TQVA 3QY9A 2X5JO 2O2SA 2NTVA 1OC2A 3D5TA 2IYPA 4XJTA 5A9SB 2EG9A 4ND3A 2D8AA 4LSWA 4LMRA 3JQCA 4K9DA 5ILOA 2FPPA 3P5SA 2R00A 1ZK3A 4CUKA 3OSUA 3WLEA 6ADHA 3VZQA 1C0IA 4QO8A 4TROA 3BMOA 4J90A 5HS6A 4ILKA 2NVWA 1PGQA 2CVOA 3CZMA 5JSFA 5L4NA 5BR7A 4MKZA 1H6CA 3AFMA 3KRTA 1K89A 1N9GB 3MEQA 4ZGWA 3HG7A 5I7VA 3TFOA 3AM4A 4BKOA 5B4VA 5A5EA 4XA8A 1E7QA 3PIDA 1HDCA 2D5CA 1MUUA 4N5MA 2GD1O 2A35A 3PWSA 1QV6A 3OF2A 1UP7A 3JQFC 1ARZA 1Y8RB 1F14A 5IAAA 2D0IA 4BNZA 4MPDA 5TIIA 3Q9UA 3LYLA 5JO9A 1J0XO 4WK6A 2G1UA 1Y7TA 2WD8A 4WCFB 3W6ZA 4DLLA 1PS0A 2CZCA 4GMFA 4FCCA 1PWXA 2EWMA 3WGOA 4II2A 1WXDA 1QLJA 2NU8A 3ZHBA 3KEQA 4XQEA 4DUPA 4NR0A 3ONDA 1A5ZA 3OEWA 3MJTA 3PGXA 4UUOA 1GTMA 2Q4BA 4OJNA 1LRLA 4DMLA 4U6QA 3DMTA 4J7XA 3V2UA 2P5YA 1GCUA 4BVAA 5G0WA 2YDXA 3ZNPA 2I67A 1PIWA 1XCBA 3HN2A 5KNLA 1J49A 4OXKA 3N74A 4OOFA 4NBTA 3VPFA 1K6JA 4L8VA 1OI7A 1ADFA 4D44A 3OIDA 2NVUB 3DHYA 3JQ7A 3GVHA 5AOVA 5B12A 4XR4A 1HDXA 3CMCO 2BFAA 3K9QO 2HJSA 5H83A 2UV8A 4RL6A 4YJFB 2I65A 4I9NA 2PR2A 2X23A 1QR6A 1NASA 4DGSA 1HLPA 4G5HA 1ENZA 2BELA 5HWSA 3ZWBA 2QYSA 4IQ8A 3S2EA 4Z6KA 4NBUA 2TMGA 4CV0A 1DLIA 3GOHA 3L9WA 4AJ4A 4EUHA 1XIVA 3BHMA 2EGHA 3E8XA 3H2SA 4RO0A 5BSEA 2DLDA 1P44A 5AVOA 4H16A 2NSDA 3GHYA 5ENDA 3TRIA 2RCYA 5G4KA 4ALKA 2A4KA 3P2OA 1T2CA 2H1SA 4CM8A 5EERA 2DC1A 4XRRA 4JJIA 2W98A 1RM3A 2PTGA 1NR7A 3QE3A 4NZ9A 2YW9A 1HRDA 1QSGA 4BO0A 2GASA 4PGFA 4QEDA 5FI3A 2JHFA 1E7SA 1PS8A 2YHUA 4ND1A 4BQRA 3E9MA 3INGA 3RJ5A 3LDHA 5L45A 1DLJA 3EDMA 5CDYA 1WDMA 1N1EA 2FP4A 1XU7A 3EC7A 3F5SA 5L3ZA 3ON5A 1B14A 2GGSA 5TT1A 1K6XA 5K0ZA 5L40A 4MIEA 2J3JA 3OECA 1FDTA 4ZJUA 3BA1A 1HWYA 5CEEA 4ZICA 3ZWNA 3WLFA 2UUPA 5G0SA 1LDGA 5L4LA 3VPHA 3UCFA 2OBYA 3D4OA 3X2EA 3AJRA 5JMWA 2H63A 5THKA 3AY3A 3BIOA 3DB2A 2C82A 4L76A 1U4SA 1AHIA 3PFFA 1Y9EA 2X0IA 2HMVA 3R3SA 5F1OA 3LF2A 3QP9A 3V1UA 3VH3A 1NVGA 3CUKA 5JNLA 2B69A 4GX2A 4IIUA 3CSDA 5DDIP 3OJOA 1Y8QA 9LDTA 2P68A 5KJFA 1N7GA 4J0FA 2O23A 1YJ8A 4J0EA 3QWAA 4YRBA 4I1IA 4J4BA 5FI5A 2ZYDA 1J5PA 3K31A 3DFUA 4PLHA 1YB5A 4IQGA 2OFPA 4EBFA 2P2SA 3KZVA 3WBBA 3O8QB 1QYVA 3L77A 2PLAA 2Y68A 4I9HA 4IJWA 1KETA 3AI2A 2ZYAA 4PCVA 4CQMA 1ZUD1 2JCYA 1QXSA 4N18A 1PJ4A 3TOZA 5CDUA 3I9OA 4FDAA 3U4HA 2Q1UA 3GF4A 1ZK1A 1G1AA 1QORA 1YE3A 1EK5A 3D3WA 4R3NA 1R0KA 1TT5B 1YONA 4NJMA 3V2HA 1MA0A 1LDYA 3DONA 1QV7A 2CNBA 3FPCA 3VKVA 4E2YA 1ZXBA 5CPFA 4RF5A 1DDOA 2O3QA 3LT0A 5EJ2A 3ZI0A 3UHAA 3AOGA 2NWQA 4AJKA 3NJ8A 3MTJA 2GDZA
chains in the Genus database with same CATH superfamily
2O8BB 1PSDA 1RLIA 3FF4A 2IELA 4EHFA 4ED9A 1UMBB 2RDMA 3CLVA 5EHXA 2FY8A 2ZQZA 3CSUA 3O7MA 3S4YA 4WBNF 1GZDA 2HM7A 2XCIA 1FC0A 2BGMA 4OIMA 1CNFA 2Q9UA 3ORSA 4MR7B 4ZOLA 1I7NA 1N6NA 5GONF 3IKJA 4EM6A 4B79A 3AXSA 1T1SA 3M7IA 1IC6A 4II7A 1QVWA 2Z1DA 3IJ5A 2XNCA 4RK6A 1HE3A 1I4EB 4LWOA 5EC8A 4ERXA 1APBA 1AHPA 5LU9A 1JSXA 1V71A 2QSJA 1YI8A 3OCJA 1VC2A 2IW3A 3U5TA 1XEXB 1O58A 4F84A 1W35A 3TBKA 3D6MA 1C9NA 3EBLA 3H19A 4ND4A 2O59A 4YAKA 4IDAA 4RYDA 2JCVA 1G0NA 1WA5A 5HRCA 3PI7A 3QPWA 1FFGA 3LT2A 5I7HA 1M7HA 1FTNA 3VDRA 5GVSA 4A91A 3IESA 4DLNA 2XZDA 2XKJE 5ERYA 3VNUA 4AJOA 1FRNA 4GMDA 5G0UA 1WP9A 2DR0A 5BMVA 5EWMB 4A7PA 5ALUA 5EL0A 3SVZA 1W87A 4G8JA 5CDTA 2SICE 3VU9B 1UQTA 2AR0A 2Z08A 4Y2SA 4DLUA 1RXYA 1IMJA 1FSZA 2ZCVA 3OUUA 3LCUA 4MGZR 2PLFA 4BCBA 4HH4A 2A1IA 4ZKEA 3V42A 4CKWA 3RG2A 3ND9A 2PL1A 5J2UF 3BGWA 1M2JA 3ORYA 3UMRA 1VHLA 1C81A 1UBOS 5EXXA 5BPFA 1RRKA 4L95C 1NQOA 1NZFA 3ZU6A 2JAHA 1YVRA 2IZ0A 2ZIXA 3A1WA 2ZR0A 4OJYA 2PXAA 3ZHSA 5KB3A 4NQRA 1DPFA 5F1YA 4BX8A 5BR4A 1MQ9A 3ICPA 5JFTA 3WK8A 4O8ZA 1I4WA 3JARA 3OP1A 2QV0A 3AP3A 4GI1A 4LYEA 5CGZA 3FWHA 3ZVRA 1FFSA 1LSOA 2PLRA 2Q8QA 4RJTA 4BYGA 3PXCX 1R64A 2OOSA 3B3JA 1ZK0A 2GNOA 3DA8A 4QYWA 3ODGA 1RKXA 1WMFA 2J7PA 2Q50A 4QJBA 2PMCA 3ZVKA 1JFSA 3ZNQA 1UJ4A 4Y2XA 1TYDE 2FQQA 2HO5A 2WT4A 3IMEA 3V1KA 2E5LB 1CU1A 2PK3A 4O4HA 4XWTA 4OK6A 1QGDA 1FMJA 1P1IA 1SC4A 2OTCA 1RM5A 3RDPA 4IS2A 2QDXA 5H9VA 2J3MA 1CYEA 1RZ3A 1M10A 1J9EA 1JW9B 2JD1A 5GJCA 3OQ6A 3RTGA 2AG0A 3C24A 3DB1A 3JRXA 5KYTA 3NVDA 3SF8A 4LZNA 5AW6A 2CVZA 1SCQA 3JAWB 4C5CA 5T7BA 1H4TA 3PFKA 5TQ2B 4N9QA 4YJ3F 3RREA 4DJFC 4QREA 5CB4B 3KKKA 2Z0MA 3AEKA 3KXLA 1QQ6A 3OD1A 1WXIA 1Y8AA 5AKGA 1RAEA 4BNMA 3I6ZA 5AVXA 2WHQA 5KOYA 3BB1A 3P71T 1E4VA 2UZ4A 1P17A 1ZZGA 1WSWA 2XMSA 1YVUA 1NVVQ 2IUSA 3T4EA 2QXTA 4QPPA 5C0OE 5A4DA 1LNSA 3IVAA 2QE7A 4HBGA 3OICA 2YN2A 4OKIA 4URHA 3K94A 4RCVA 5F5NA 3K0HA 4HGOA 3LAWA 3SK0A 5AESA 2Q5FA 3I39X 5T4HA 4AY6A 4A16A 2D6FA 2HPZA 3EA5A 1MT3A 2NU8B 4ZO4A 4ZMBA 4RSMA 5AOBA 3B3QA 3PNSA 4FD3A 3TAHA 4P81A 2Q3CA 5A5VA 4CLHA 3SU8A 3MIIA 3O73A 1K1EA 2H4ZA 4INPA 4BO3A 3DQPA 1IIBA 3EPKA 4M6WA 2Z83A 3LHDA 3D64A 1JJ7A 2IIQA 3KDAA 4FWBA 4NCKA 4AX8A 4BNXA 4GOND 1EP2B 1YBAA 2HF2A 2Y1XA 1ZVMA 4K3VA 1H6AA 2OILA 2R66A 3NBFA 4NHOA 4UOEA 1QONA 3FGPA 1GPKA 1MABB 3LQRA 4TXLA 1BHQ1 1QZXA 1UPAA 4WHMA 3SZOA 2P78A 2ET6A 4AF6A 5BWCA 5EG5A 2VT7A 1X19A 3LD9A 4TMZA 2H0RA 5DHQA 3IS3A 2JFUA 5C8YB 2FWJA 2AZTA 2QGNA 3G2PA 8LDHA 1T1GA 1IDOA 5FI1B 3KQYA 1TGVA 2W93A 5EJ4A 5IARA 3HZZA 1RAAA 3CJTA 1GCAA 1NSTA 2FWPA 3CZAA 4IVNA 4L4RA 2W37A 4A6XA 5JZSA 2AJDA 3R40A 5DYGA 4V0ME 3M6XA 3IV6A 2Y1DA 3CWQA 1JHAA 1JHPA 3RBAA 3AI7A 4H1HA 1VCMA 1JHYA 3STTA 1XJ5A 3DD5A 1Z06A 5A3VA 5THXA 3FCSB 2EHJA 2LBPA 1I3MA 1BTOA 3GUVA 3BH6A 3MJVA 1M67A 5ULLA 2HI0A 4N12A 2G82A 5JU6A 1O03A 2E3JA 5D5PA 1KDOA 4GL4A 3LFTA 4Z3DA 2Q5EA 1ZONA 1N9KA 1KQPA 1NWHA 1QQ5A 3GRFA 2FFJA 3I4LA 4DBLE 4CM8B 1T24A 2NXEA 1T4CA 3CKYA 3H9EO 2BGIA 1J39A 1ZINA 3GXOA 6PFKA 1VJDA 1DCFA 1R9JA 4ZVOA 1L5HA 1KZ1A 4BP1A 4EFNA 2GM4A 1LLUA 2RG7A 1VG0B 4G4JA 4R2IA 2H1LA 2ODAA 4ENSA 1VA4A 1N77A 1YAHA 2YFQA 1GZ6A 1U31A 2PFGA 3OOJA 5FLYA 2WOJA 2O8VA 2PCJA 4HQ6A 4C0XA 4F7DA 1TFUA 1JYFA 1XJCA 1DAGA 2HIGA 2WYWA 1DKQA 2FPOA 4G0MA 3DSRA 3SEZA 3ZHYA 1PVVA 2VL7A 4B71A 1DE0A 2O6LA 1EJ2A 4NNOA 3E5HA 1TJNA 2B9EA 1GGKA 3F5DA 3S3TA 1FVHA 1SHZA 4EKIA 1ZN2A 2ANBA 5HFJA 2C97A 2R86A 5IJ0A 4FKMA 4FWIB 5DT9A 1JHUA 1DCTA 1PR0A 3TZHA 1JG1A 1L5RA 1VYTA 4KGXA 5FV4A 2EKPA 3F1LA 1C3LA 2JNWA 1V9LA 2CYBA 3I1IA 2HD4A 1RQXA 1MGOA 1A9TA 4FFSA 1ZQ1A 4Y18A 5FPTA 2G06A 2ATXA 4MWCA 5CFZA 4MOWA 4ID9A 5EMNA 4DYHA 3O8CA 3FYDA 1KSGA 5FPYA 2DZDA 3RK0A 1B6RA 2X22A 3T7RA 2G5GX 3MTDA 1RVDA 1AM4D 1ZO8A 4GVXA 5DJ5A 2FK7A 3BIXA 3OVMA 3A3YA 3O84A 3TWOA 3TZCA 1MRNA 2VNJA 4BAGA 1O94A 2YIDA 1BS1A 2CMFA 2D62A 3HKEB 4BEVA 2CDNA 5JG7A 1Y1RA 4DABA 2HA7A 3NWBA 4C7KA 4ZVTA 1A0OA 1H1LB 1A4UA 2WWWA 2YUIA 2ZE5A 1ZUNA 2XKAA 3AKEA 1XELA 1S02A 1DVRA 2Z1NA 3H5AA 3TSWA 3KUXA 2GPJA 2L69A 2L19A 2QM7A 2AVDA 4JDPA 1Z5PA 4YAEA 5H5JA 3W3ZB 3GRYA 1XRNA 4ZI2A 1TA4A 1G8JA 3CUYA 4J7UA 1NMQA 4RYLA 3KX2A 2HMAA 3L8YA 2V8OA 3QVGA 3VBCA 2R8PA 1Z0KA 2PSSA 2JATA 3GAMA 3HKDB 4WFQA 4TKZA 2ZETA 4WNCA 3DOOA 2F00A 3IIJA 4LRUA 5LMZA 3KPWA 4CTMA 5K6RA 2FPXA 5KWEA 4F2DA 1TF5A 1ZJWA 1EFRD 5TVKA 3ZZTA 2QBYA 2FW1A 1E6EA 5CM8B 3Q8MA 3L7JA 4EO9A 5K0JA 4BP9A 3ECAA 4IRUB 1KFCB 2I54A 3VO8A 5IC5A 4EITA 1W581 4D79A 3PYMA 1GG8A 2B5WA 3O2SB 4NXMB 1VHWA 1N0WA 2P9QA 3DUWA 4V02A 1ZM4A 1Y6QA 5EN4A 1NVEA 3BB4A 5C3UA 5F52A 5TY0A 1TZMA 3GFOA 1IWPB 2VTEA 4YJHB 5E8JA 4F3NA 1NV8A 3W5DA 2O7RA 3RKSA 3AEQA 3ASVA 3QYAA 4Y1EA 1XAHA 3AILA 3GUYA 4JJZA 1JQEA 4DARA 3QX8A 4BNWA 2CHQA 1A76A 5IU6A 1V8PA 2PX8A 1PL6A 4QQFA 1IFXA 3GNLA 3L4BC 1CZOA 2X2OA 4IIEA 4Q39A 4JELA 5KYUA 4DY4A 3L4JA 3WSVA 3WNQA 1B1AA 2YASA 2YJGA 4W8OA 3GLIB 5B4UA 4JT2A 2C2BA 4X6LA 4R9SA 4YCMA 4ESOA 4PLYA 1QIKA 3EPPA 2QRJA 3NPMA 4GE3A 4WGFA 3GK3A 4ZAYA 3P9IA 3ZY4A 3G7SA 3WYGA 2CXUA 3P2YA 4NONA 4PFSA 3MJDA 4EPYA 3V48A 4C20A 5CG2A 4LKRA 3PHJA 2DRIA 2FZEA 3R0QA 1CWUA 1TT5A 2ECQA 2HKIA 3FETA 1CUXA 3KXKA 4LISA 3H4VA 4Q4HB 4B3XA 4QXPA 4OL0A 5IYZF 3HB7A 3M1LA 3C8DA 2XD9A 2JIMA 3WGZA 1K9VF 4FOPA 1VPVA 2P27A 2FFRA 3E4DA 4QYXA 2XB2A 5AKHA 1EIZA 4Q4AB 5LQCA 2GJ4A 2H0QA 1ZR4A 3WNVA 4E5NA 1R6AA 3O3OB 4A3SA 4DGQA 2JLQA 5FOWA 2CNWD 1YHNA 2I4MA 1BMFA 1QLHA 4FB5A 4AG6A 2B7CA 3EIQA 2DOKA 2BDTA 4R1NA 4I9GA 4ZQEA 5CDFA 3RRNA 1B8UA 1FMTA 3G7UA 3JQBA 3TW8A 2JCGA 2XV1A 4E31A 4PY2A 5DN6D 5JMOA 2H1IA 3VU0A 5KNLA 2X5XA 1Y7IA 4FE3A 5A6SA 3MBIA 4KAAA 3E1SA 5EEHA 3QLEA 3KLOA 4YY3B 1YE8A 3GPDG 1F38A 1LPPA 1ATZA 2DTXA 2Z8YM 1I6LA 1TQ4A 3ANYB 5HTKA 3W4JA 5MDHA 4HDQB 2OGTA 5FNVF 3V4LA 1OSNA 2V7TA 1VGQA 2O8NA 1U65A 4EJMA 1E4EA 3CPJB 1PJ2A 3MGGA 4Z4CA 1E5TA 2FEMA 1QCYA 3KL2A 1N92A 2N1BA 2PUAA 4MQ5A 1QE3A 4TUYF 5JSZB 2XSZA 2C5FA 5C37A 1VMKA 2Q27A 3I6MA 3WDKA 4KR7A 3D81A 1Y89A 3KFLA 4WN3A 1Y6GA 1GZ7A 2HCJB 3H86A 1L7OA 3KQQA 2BZ0A 3PR1A 1EVKA 4PLCA 2W2VA 4PPQA 2VBFA 2IRWA 1E9EA 3CY6A 3NM6B 2HJRA 2VDLB 3GA5A 3KKPA 4MMZB 1AB6A 4QODA 3DBLA 2M6LA 1BRTA 1Z62A 2FUEA 4KITB 1NBIA 3GLGA 1IUNA 3T5CA 1UBTS 4OK3A 1ZYUA 4PLWA 3AFNA 1P18A 3K70D 1XPUA 4RGQA 3NT4A 2IOQA 2YCBA 4CM3A 4QOSA 1EEHA 3CO5A 4AKSA 4BMDA 3U61B 2FJPA 4DQDA 2XTJA 1W85B 3DPUA 2J33A 1P5RA 1DIHA 2HMWA 1TMKA 5DYNA 3B51X 3EIWA 2VHEA 2R5WA 3K09A 1CB7A 1H0SA 5EIFA 3KKOA 1X8KA 1F51E 2A3NA 2P9CA 1UIRA 1FRVA 2WHRA 1R0CA 4X20B 3GFSA 4ZT7A 1GVNB 1PL8A 3D2BA 5JLAA 3ZCQA 4WQMA 4R54A 3FCUB 2FUG6 2C92A 3A6JA 1R00A 3IP8A 1UWKA 1CD5A 2JAQA 1CP2A 3H5RA 1KC1A 4PHFA 5TC4A 4TWAA 3WBKA 4MYCA 4G5QA 4BVLA 3D7MA 4RTQA 2GPTA 1KI1A 3G0OA 1KMHA 3DAFA 4M7WA 3TJMA 1QPZA 1Y8CA 4P34A 5CLLA 1DC7A 1G59A 3I73A 3PGVA 5LKAA 4C21A 4YRJA 5CXXA 5P8WA 3NOXA 4LDNA 1DAFA 1T36B 2WICA 3K0AB 5AW2A 4W4TA 3KSBC 3RC8A 3ANSA 1JALA 1V8BA 4NU0A 1PVOA 1AZLA 3LUGA 4Q4JB 2AHOA 1M1YB 1Y7HA 1A9YA 3B3FA 3L82B 3W79A 1XWFA 1U8YA 3HBNA 3PTAA 4B3MB 4G4GA 2EP8A 1JNYA 1RJFA 1YBMA 2L2QA 2OGUA 3O93A 5AHXA 3RRJA 4ZHQF 3THXA 2IIBA 3O3NB 3PB3A 4HJRA 5JVDB 4P5DA 1QCCA 3F4LA 3IAEA 4QOGA 2C84A 2VWGA 3ONWA 4NZZA 5JSYA 5U1PA 3GZ4A 3A9UA 2RC6A 3WYDA 1UBMS 3V7WA 1K97A 5C81A 3S2GA 3QMPA 1HETA 1FNSA 3D2CA 1G0OA 1KJJA 4E1AA 2IF2A 2CKMA 4WNAB 4ZQIA 4MUMA 1T6BY 1JWBB 1RU3A 4B3GA 2WIDA 3TINA 2MMGA 2W6MA 1JDNA 4TV8B 5EVCA 3ZHUA 1A4IA 5L3SA 3I5YA 1YF3A 1EZ4A 3PC6A 1FDUA 4KBYA 4BN5A 1FXUA 2ZJ8A 5FEMA 1WLSA 2HNKA 3CNHA 3KSDO 4MV4A 5BVGB 1OH6A 2FPWA 3HJAA 1TIPA 3B8HA 3KM0A 5GM2A 4AIIA 4LBZA 1WTCA 2C4NA 5EJ6A 1YR7A 3MUNA 3ZEAA 2ZSFA 1NXQA 1XPRA 1ODLA 2Z6VA 4OP3A 2Q45A 1IHDA 1KK2A 4GLOA 3EW7A 4I7EA 5HA5A 5TEWA 3PRHA 1COZA 2VRWA 3L18A 4WXHA 1IY9A 1QYWA 2C9DA 2WJGA 1XMSA 3B1WA 4HFJA 3OOYA 4OQPA 3IQIX 5FL3A 2F67A 2BCJQ 3A2KA 4GEGA 1Y1PA 4QAQA 3DHVA 3ZV3A 4KZKA 3FWKA 5JBQA 1F17A 2CC2A 3I5MA 1V9CA 3VR5H 4CJXA 3BPSA 1FMCA 1P3Y1 1U99A 3N2IA 1SB9A 1FDRA 3BE6A 1XZIA 2P5UA 1N8SA 4YQYA 1GM5A 2M6KA 1KS2A 2I3GA 3VYRB 1JH8A 4KBGA 1A8QA 1FTQA 1XP8A 3CRQA 4BJ1A 4BLVA 3H1GA 4MYRA 4DWJA 1QTIA 4PYOA 1WCIB 4B8YA 3PTLA 1T1EA 1N32B 1E9DA 4LY6A 4J0QA 4YYEA 4DMFA 3N1UA 4LCJA 4DLSA 2VP6A 2NO0A 4DG5A 5CA1B 4Y2VA 4BNHA 2EYQA 4J1SA 1YDWA 3M1YA 4HYQA 3OZVA 2QM8A 3EISA 3BRQA 4Y1RB 5T8KA 2NM0A 4AZTA 1WOYA 1D5CA 1Z35A 2R8OA 4MKXA 5DBFA 1WCXA 2W00A 3EIUA 3V8PA 4MO2A 2CLHB 3LTEA 4LHEA 4JCCA 1QIIA 3NJRA 5AI8A 1REQB 2WWTA 1NDUA 1CX9B 3QLVA 3NUGA 4A2PA 1ZR2A 2Y05A 3CT4A 2JGRA 2JVJA 3K0BA 1TU4A 3IT3A 1E1LA 5L3SB 1DKLA 1QNFA 5DXAA 4A8JC 2ZJ4A 4DV2B 4RA9A 2TMYA 4JI5B 4YAIA 4YQFA 4TQAA 1D6JA 1CBUA 1L5YA 2F1IA 3ZE8A 3TGLA 2CNOA 4IEFB 3BCHA 4BRUA 5IF9A 4FSXA 1NIPA 4TQ9A 4B6SA 1IVNA 5KYXA 5LR6A 2A0YA 1PDVA 2EKDA 4C0HA 2YUTA 1LVUA 4YRAA 4M54A 4JFRA 1U2ZA 1ZOLA 5L7WA 4OMUA 4KBFA 5IAEA 3ZN2A 3QW2A 5ICGA 1H9BA 5BMOA 3D43A 1YVDA 4IDGA 2DAPA 4DPLA 2P6PA 1AXEA 4DTIA 2OV4A 3CVUA 1ZGZA 2PIDA 2YZGA 2BRUC 3CKMA 1I6MA 4NS1A 3ZE6A 1BZYA 4JI8B 3I23A 1U8CB 5E6SA 4TYMA 9LDBA 5D87A 3AP1A 1N2OA 1GQYA 3UC5A 3ND8A 2JGFA 3TLXA 4MQFA 4JOSA 4R9VA 3ZWAA 4OU4A 4JUBA 2X3YA 3I76A 2IPOA 3RSZA 3TOVA 4AJLA 1ONNA 4QDOA 5AVYA 3FM9A 1P2FA 5EKXA 1EWYA 1WW8A 4KYUA 4OYHA 5HCNA 5TPWA 4FQ5A 4HATA 3EVFA 1QVVA 4Q3EA 4XVHA 3WBFA 2ZPAA 1B1CA 4GGOA 1KI2A 1EEXB 3RRYA 1NOKA 1RRGA 1NGSA 5L4SA 4QRIA 4PSDA 5DBEX 3K6SA 4IAOA 4I6JA 3THYB 3D4PA 4C5BA 3OCZA 2EJWA 2V6FA 4XD2A 1KR2A 2W71A 1L4KA 4YHBA 1ISRA 3AOEA 5E1MA 2GBFA 3WK5A 2I2CA 3MXTA 4WLOA 3T3EA 3RR2A 1NSYA 2H92A 2CL7X 1R4AA 2MTBA 3ZBTA 2WMDA 3GFBA 4XE5A 3DZIA 3IUSA 4JB8A 5KVSA 1QCDA 1WMEA 4I4TB 1OKKA 3KVVA 2J5RA 3FSGD 3IERA 4YACA 3KVOA 4WOPA 1ZH6A 1LK0A 3OQPA 1WSBA 2X7XA 2YFKA 2YWRA 3HGMA 1VB5A 1U2DA 1W5TA 1Z25A 5C1PA 3OO0A 3A05A 1A50B 2ZBEA 3V33A 1E69A 3WL3A 4CF4A 3LXXA 2HLDA 3X2SA 2C9OA 3N8DA 1OILA 3TTUA 4H1TA 4EW2A 1YJBA 2OORA 4COOA 1WKVA 3D7LA 2XW6A 3R7DA 4YMSA 3VPBA 4ZOLF 3N2KB 2MYUA 1MD9A 3SP1A 4Z3KA 3F4KA 4LXHA 2GSWA 5CYGA 3RVSA 5EXSA 4CEJB 1PBNA 4EFMA 3BN3A 2P0AA 3WL5A 5GM1A 1G8PA 2AT1A 2OKCA 1IEXA 1E89A 2WHEA 1L4UA 1L7AA 2Z58A 3NHYA 2VLIA 3UHFA 2X0KA 5GJVC 1M5RA 1UXIA 5IXSA 1OB5A 1WO8A 2ETXA 4H17A 1PCXA 3GPLA 2V1UA 2O57A 1GPAA 1FFAA 2G76A 4EGAA 5CXUA 2VN8A 4LRYA 1T5DX 4X94A 3LY7A 2XUHA 5LQUA 1U0EA 3LV8A 1PR2A 3H3FA 3GNSA 2OBFA 3BXGA 5CIQA 3FSRA 1VG1A 3A0UA 1VHQA 2VK2A 4JWTA 4KZPA 5J2TF 1JAHA 5CEJA 1NUHA 2NAFA 2YZMA 4KQKA 4FLMA 4UNPA 3MQ2A 4BIIA 4DOMA 4ISCA 5JAQA 1HFKA 3M6FA 3GAFA 4OQEA 4JUIA 1O3YA 5FBWB 1GP2A 2EEZA 2FUKA 1EFKA 4HGPA 4KPFC 1G6HA 1QGAA 2FLWA 2Z6QA 3WXMA 3B2QA 2H6EA 2BBWA 1CXZA 3G79A 4HMPA 5EE5B 4B1FA 2B4AA 1QH9A 2NZJA 4ROTA 2NMVA 4UFNA 1SAYA 1VFPA 2AWOA 1G41A 3BGSA 3WAJA 2YWHA 4R98A 3WIUA 1MTOA 1L7QA 1XWWA 2P9ZA 3DPSA 4RKRA 2HGZA 4XTRA 3IAFA 3RYIA 3CLSC 4ESHA 4YV1A 4NV3A 5CDSA 1PJZA 5LKRA 1VM6A 1NMEA 1BVRA 1TIBA 2BFBB 4I1SA 3L8DA 4TZTA 2DY0A 3BICA 5D5HA 1Z0ZA 2B25A 3E53A 2ZIWB 4JC5A 3HBJA 4TKVA 1FFBA 1GA4A 2PJUA 3ZVLA 4B40A 2AVNA 2CXQA 2QSYA 2NO5A 3IMFA 3I01M 5LQNA 1SOVA 2D7DA 2F8MA 1Z47A 4HNSA 4CBVA 1NI3A 2CMDA 1ZH8A 1X80B 3DOIA 2V65A 1SPBS 1VIAA 2AD5A 3O9ZA 4G25A 1K5GA 5KTRA 1U11A 4HX2A 3V8RA 3ZBQA 4YRNA 1L1FA 5CNIA 2D13A 5ALKA 3WWDA 3DDNA 1GOTA 1DIOB 4IDNA 4OXIA 4S1PA 3R75A 3REFA 4EFKA 4Z7JA 2I2FA 2QZ9A 4BX3A 1XVTA 3Q9SA 1X9IA 1P4RA 1Z6XA 1AKRA 1X7YA 1GFIA 2DG2A 2Q3EA 1F6WA 1KZ7B 3V8BA 4C0WA 3HKBB 3ROTA 2WZDA 2Y4OA 5LIRA 3MBOA 5LB4A 2WAOA 1RFGE 3EAQA 3M6VA 1KSHA 1ZESA 2I1LA 3QWFA 4Q9LA 1XK6A 3R3XA 2G4LA 3PHGA 4FDMA 4JS0A 5TQ0A 1S96A 3GMDA 1EP3B 1ZCAA 3L0OA 1ZLXA 4OXQA 4TVBA 3BWMA 2CFOA 1MR3F 1NBOA 3C4JA 5EZQA 4AJIA 4F93B 2YMPA 1FX1A 1Q74A 2RAUA 3CFYA 1FNNA 3JATA 4PRLA 4GO1A 5DTEA 4H1WA 5ABPA 4ID3A 1H1DA 2YN4A 1UJBA 1SOMA 2EYUA 2Y2UA 4J0DA 4KKVA 3FGZA 2FEKA 3DTTA 2G6BA 2Y93A 4G9EA 1QRRA 1AKQA 2WSSA 1FJGB 2XRFA 1ZC3A 2BDEA 1B6SA 3G1WA 2WF6A 3DLTA 5EQTA 1CY8A 5D84A 3UK2A 5KX5F 4A8TA 2BJHA 4S35A 3RS5A 3L06A 1ZM7A 2DKOA 3JYPA 5DGHA 4W1QA 1S8FA 3E3LA 4MQBA 1AKYA 1OAOA 1N2HA 4DBZA 4GR9A 2H11A 1O0SA 5EMKA 2YNMC 4GI5A 2JDID 2IVFA 3SKXA 5ELLA 2Y3IA 3U3MA 3CEAA 4NDNE 3ZTTA 4BO6A 1SBHA 1NULA 1XHFA 3JSAA 3PHBE 4P54A 5A3JA 3HVRA 3B12A 3RUCA 3VZPA 4EJSA 2W8BA 3CS3A 3DMRA 1FSPA 4A1FA 1N2CA 2UUOA 2VPXA 2ODNA 3U4IA 4R05A 3SHVA 1ZICA 1A1VA 4HP8A 1DAPA 1BCRA 1E9SA 1DAIA 2MSKA 3MT7A 4WJZA 4EX7A 3LRXA 4KGZA 5JFOA 2ZRJA 2ZUWA 1ZA2A 3ICVA 4CLOB 3ROFA 1GGFA 4HV4A 2ECPA 2XTNA 3L0PA 4MSUA 2OD2A 1RYFA 3WMWA 1Q3TA 1Z7BA 3H9GA 1O5IA 2AZ4A 4A5SA 2MINA 4KIGA 2R6ZA 4JU8A 1PD1A 1UJ2A 2HV9A 5D6NA 3ES9A 5BVHA 4Q48A 5IJZA 4L57A 1XZAA 2Z3WA 4YRCA 1IM5A 1OXTA 3FRJA 4QTZA 3ZLJA 1QS0A 3F74A 2BF7A 5HILA 3QE2A 1TL7C 5F77A 1KDTA 4OJQA 2HCFA 1RAGA 3QA9A 4I4NA 1P0PA 3JQDA 1ORHA 5I9BA 1XZDA 2WUVA 2JGIA 4Q3LA 2OBLA 3OG9A 1MAUA 1U7PA 3QBJA 4L5AA 2C2HA 1TVEA 2PXXA 1H23A 2YCLA 3AVOA 3EXAA 3HCEA 3I8XA 2PMEA 4EARA 4DCOA 2I87A 1ENYA 5EZYF 1OPRA 2OHOA 2OBBA 3A3PA 4L5CA 4QBHA 3B5EA 4QO7A 3DL2A 1AV6A 4FILA 2V7QA 2AFHE 4JL6A 1HDZA 4TM8A 3ANNA 5FPPA 4PPFA 4ZK2A 4KO4S 2LCFA 1DMRA 4DDHA 4RAQA 4E5DA 4EIWA 3ADBA 1EXNA 1TECE 5K51A 1RAFA 6REQA 4TS1A 3G8DA 1XXHB 3PDCA 3KCQA 4IL5A 2QL9A 4LYJA 1CNMA 3SC6A 4IMJB 3VV3A 4D5GA 5I6DA 1GFSA 2JKVA 1KDZA 2WSMA 3A9SA 1ZMRA 2O5EA 2QMOA 4XGQA 3DE6X 4D99A 1YWGO 3PF8A 3EA0A 1HG1A 4MVJF 4FFNA 5DRTA 4BMVA 4IXDA 4DILA 3I5XA 3ZV7A 4QOHA 4WVFA 4UM8B 2XGGA 2XVAA 3D6AA 5CEFA 1SVSA 2MSCB 1U81A 4K6MA 3G0IA 5FUXA 2H65A 4JJGA 4C2AA 1RMYA 1KNQA 1BVHA 5G1PA 2HMYB 2K6GA 1FBNA 3ICWA 4IDQA 1ORVA 1YO6A 1D2RA 4HDSA 5KYNA 4O2BB 1XMQB 3AUKA 1KFBB 4MWDA 3THRA 5DNYB 4FR2A 4HDNA 4BYMA 1KBQA 3EEIA 3M6WA 4R6XA 1H5NA 1IAQA 1RTKA 3HB5X 3AJ8A 1PFWA 1L8XA 4KR0A 5IAJA 3ABZA 5CAEB 1QO9A 1SOUA 1DRUA 1ZGCA 3R1IA 2AC7A 4KGVA 1A5TA 4NFHA 3TQSA 3RVDA 2WV7A 4BMSA 1TZBA 5FTLA 4YVFA 4AF7A 5JCJA 4IILA 4C4ZA 3QELA 3D0RA 3BMCB 3DZDA 3FMOB 2X13A 5SZJA 5BQFA 4DUZB 5M3BA 1GSOA 2R751 2UYYA 3BERA 5BUZA 2OL4A 3DTVA 3P20A 3E4CA 2QQEA 3TMYA 3QYFA 4GPEA 4IGFA 2OAEA 2XQFA 3PNQA 2QHXA 4NV1A 4UW9A 3RQIA 2PX2A 1NVBA 4PZUA 1BHJA 3JZIA 4A0GA 4D3ZA 4URVR 3DMYA 3UANA 5AXAA 3GT7A 4WKOA 2Q6VA 2OORC 3C6QA 2F8LA 2OB1A 1JTEA 3RKRA 5ESXA 1GN8A 1BE8A 3CIFA 4I50B 5IUNC 3GCDA 1K7CA 4UBOA 2VS1A 3IDQA 4I5EA 3FG9A 5KYWB 5DP2A 1W5FA 4O2AA 1ICIA 2HMUA 3OZTA 2X14A 4JT4A 4UD2A 2VYVA 4WNYA 2RJ3A 3TTTA 5KNBH 2GBGA 1XCLA 2OUIA 3WNZA 1H8ED 4DA7A 2NO6A 2GZ2A 1HXHA 4EYGA 1EWTA 2VDMB 2XBLA 4BQNA 2H59A 1AUOA 1TM1E 1PDWA 1YZHA 2R9VA 4EMUA 5FTKA 5DM2A 4L28A 4ZI7B 1C30A 1NW9B 3HFGA 4X1IB 3LY9A 3SXUA 4BO1A 2JGJA 2XWSA 3SX2A 1AY0A 1NE2A 4P86A 1QH1B 4V0NA 1Z0SA 1CFJA 4NZYA 5DBGA 4ZAZA 3TNLA 1YB4A 4PG8A 4A73A 1CR6A 3U6KA 2HUNA 1JILA 2O07A 3TRKA 3WKEA 5EPUA 3LDFA 4B0PA 5AFSA 5CBPA 1U3TA 1QGOA 1ZH2A 2MDTA 4UNRA 5JNRA 4AMVA 3ICCA 3VR6D 4ZZ0A 1AN9A 1BX3A 1MJGM 4ZP1A 5LMUB 1SVLA 3AR2A 1A98A 1PO7A 1K88A 4GDMA 4MP3A 5FBKA 2NQ8A 1TK9A 1DTWA 1HYQA 2RH9B 2VHWA 4XD7D 2E48A 4X44A 2GPNA 2PCLA 3L02A 4LNHA 1NN1A 5G02A 4CI0B 5E4TA 4S1TA 3QY0A 4L8FA 4BTVA 2A9VA 2CSUA 4GXQA 4N03A 1Z0FA 4KXFB 1GTZA 4FXOA 2LD4A 4N8EA 4L1KA 1GPNA 1N5KA 2QYTA 2A9RA 1JKJA 1TJ3A 3TLCA 3FTNA 3TRHA 1Q20A 1FS6A 1LFAA 1GKKA 3AVTA 1PUJA 3RIGA 4M22A 2ERCA 4N0MA 3KP1A 2Z30A 3VUEA 1NLYA 4EB8A 2HYDA 4EI9A 1ESNA 2WJVA 2BN4A 4FFWA 4HEHA 1YUNA 4LJAA 3EZ7A 4TXHA 2GF0A 4BFZA 2C3UA 3TDKA 1S3IA 1BCSA 3ZE7A 5C7LO 3A06A 3S7ZA 3ELUA 3FKSA 1MOPA 1XDWA 3RH0A 3VDQA 3WRXA 3U3OA 5U4QA 2AXNA 1NQWA 2AFIA 2IZ5A 3B7PA 4NC9A 2FWIA 4TWZA 1THTA 3H99A 4AO6A 5ISMA 4E7OA 3LDAA 2QTBA 3KB2A 4LVOA 4FPXA 3DMGA 4DMGA 5L9AA 5LNK6 3KOMA 1UMCB 2ODBA 2X1VA 4PYIA 4BBZA 4EJ2A 4G0UA 1RT9A 2ODEA 3F6SA 4MWEA 5EYPB 4JLVA 3UPUA 5F9FA 3UCXA 4BS9A 4P3OA 1LU9A 1E98A 1WB5A 2J5BA 4NBRA 1QP0A 1LWOA 2DUJA 3F9RA 4M99A 2QUAA 4KQWA 4KQIA 3TG2A 1Z2PX 2UZ3A 3NT5A 3K9BA 1OX4A 4KAJA 4MWSA 4YP9A 1XKXA 4TSRA 4AZ0A 3WHLA 3Q4GA 1QX3A 1M0WA 3JVDA 5ALXA 1K92A 2OFOA 2A0UA 4HZGA 5F3WB 2XBUA 1GGJA 1YZQA 2PANA 2X77A 3G5MA 3I09A 1GPMA 5SV2A 3ZLTA 2WNHA 3SXPA 9GPBA 3CCFA 1L7DA 4NE2A 4DJEC 1KA9H 4PYRA 2JKYA 3MELA 4ZODA 4QQNA 1E4YA 2YX1A 3DWGA 1JTFA 4ARSA 5BSGA 4QZVA 5IDWA 1N0HA 2VATA 4WSOA 3N75A 3MWYW 3WNBA 3HB4X 2VKQA 3LW8A 3HUUA 3UAGA 1VDZA 4IOMA 2P69A 2VZEA 4H1UA 3TQHA 1HG0A 1FPQA 2C5AA 3N0TA 5AHOA 5DYTA 1C9EA 3EEFA 4HLCA 5BQ3A 2O3JA 3KSRA 4CM1A 1MIHA 4JBXA 2G5PA 4TL6A 1VMAA 1NY5A 2HRRA 4BRZA 4EJSC 3WRVA 1PU2A 2PIAA 2J9RA 1QUEA 1T13A 2Z2YA 1PJTA 3DGEC 4WLNA 2I76A 4HK4A 2ZUVA 2XTMA 1R0WA 3FZYA 1C1DA 3B70A 4HN2A 3QLUA 1AH2A 2Y1FA 1SIBE 1W36C 3QVMA 5L3RA 5JBIA 4M86A 2DBVO 4ZDIA 5ENZA 1F2UB 3N87A 3AERB 1DOHA 3EZLA 3U3XA 1U3WA 2WM3A 2FK8A 4J3NA 4Q0MA 3U9LA 4EKYA 5H16A 5IDVA 3T06B 3RC1A 1GEEA 4D45A 3TLJA 3VOBA 1JSZA 3NYQA 4Z1MD 1ULHA 2HWKA 2YJNA 2WEKA 2OCYC 4KMMA 4Q9AA 4PLFA 4ZOAA 1K7SN 2JFWA 4OQQA 3ZWCA 4CKBB 3F5MA 4GMGA 4U9UA 4R7GA 4TT3D 2J6HA 3T4XA 3ZY6A 9ATCA 4KR6A 2CD7A 4GZ3A 4LTNA 4CNQA 5LJLA 1NTRA 1YQEA 1LBIA 3I3SR 4DXDA 1P1RA 2BCGY 2DWUA 4UATA 3OLXA 4LBVA 2VBGA 1W1IA 5DK4A 4BRWA 2JFNA 3TZLA 3GLGE 2XZLA 1U94A 4KIFA 2B9VA 2PMBA 4AYWA 1KYVA 1QTNA 4JI1B 2GR9A 4HS9A 3WQBA 2VWHA 4HPXB 3ZQ4A 3N3AC 4HAOA 4L3OA 4UTXA 4W5OA 3LIPA 4HFRA 2WIGA 4AQDA 2QRZA 1O6ZA 4WY8A 5E7JA 2B7BA 5EMMA 3KQSA 1QHNA 3GJ7A 4AY5A 1W0KD 3G8BA 4M37A 2V7XA 2PQMA 2FG7C 4M9CA 1WMSA 1JPVA 2Y0EA 1Y3BE 4AZ3A 1G20B 4JXZA 2KMLA 3WWEA 1ZVJA 5FNZA 1ODSA 3W8EA 4RGBA 1SKQA 1F0YA 1G7TA 2XTAA 4L0DA 4OPMA 4A2WA 1KY4A 1EUQA 2EJTA 3B7WA 4BV2A 3O75A 4M9XA 4PLGA 2QW1A 4UEWA 3VJLA 5B7GA 4QOEA 3THWA 5BSVA 3T5GA 3TZQA 4LRWA 4ZGGA 3VH1A 2C5SA 3P9PA 2XOKA 3ETJA 3N28A 3OFKA 4LG1A 2C2ZA 1LBQA 3H83A 1KWKA 1ISHA 1H4QA 2HEGA 1CTQA 1U2GC 1ZRNA 2JBHA 4HEA6 4I3FA 3DLHA 4Z9XA 2COKA 5FCDA 3BD6A 3ESYA 4Q00A 3RSLA 1T3GA 4YDRA 1KDPA 5H3CA 1XHEA 4AZWA 4RTSA 2D74A 3EIEA 5FTNA 3TNDA 4CKEA 4ECAA 2E4AA 3CPHA 3B1FA 2I0FA 2WKQA 1BQ3A 4JLNA 1H05A 4LOAA 5EJFA 1D1TA 2OSVA 4FINA 3ZDRA 2ZSAA 3X43A 4KPUB 5HZHA 4K8RB 5ALFA 3V4OA 3K2QA 1Y37A 1OGYA 1YR6A 2OGSA 1RLTA 1T9GS 3M9LA 2IUYA 1XOIA 1P3JA 4GYKA 2WQ6A 3QNMA 2H08A 1GPH1 3O3CA 1G8KA 5A71A 3O03A 1JXAA 4Q05A 4LJ6A 1QHEA 1HYEA 1HT3A 2NPOA 3KJFA 1RI1A 1A9XA 1WTAA 1CZNA 2EGUA 2YRXA 4Y7DA 2OZLA 1ZSNA 2HCTA 2ST1A 2JBWA 4CDGA 4LHXA 3RC9A 1TKAA 1Z2CA 2XYHA 2YOHA 3NONA 3MVEA 3T6KA 4YMWA 2X2FA 3MMNA 1R66A 4ZVMA 2PWBA 1UM8A 4JGGA 4JK3A 5BQXA 4J16A 3H2KA 5BURA 3FDZA 2QY9A 2IV7A 1JSRA 3DO5A 4F85A 1ITZA 1ORTA 2Z04A 4ZYYA 5JC8A 2ZKLA 3EXIA 3IPXA 4AX4A 2PWYA 5E9JA 3IILA 2ORWA 5BSHA 4KAXA 1A77A 5KJ6A 2VC2B 3FFAA 5EXTA 2YWBA 4DRXA 1I10A 1XZMA 1P8AA 2R7KA 2QLLA 4DV3B 1BDHA 5F76A 1DWPA 2V4MA 3B78A 1PE0A 3RYHB 4CCSA 1B73A 4HYYA 2VYNA 2E37A 5JJCA 1L8AA 1VXOA 4RHXA 4C7XA 4DDKA 2ZJ0A 3GFTA 3ESZA 3PBKA 1Z12A 4HNHA 3TLYA 5AUOB 2RGRA 2JEYA 1VPLA 3DXFA 1H2FA 1M3SA 5HF6A 5FDFA 1BXKA 2XE8A 5KPDA 1J7KA 1XB2A 2HAEA 2TRSB 2AC2A 3AIOA 3O4RA 3MCWA 4K6KA 3ZXYA 4TGLA 4M2LA 1E2JA 5E1DA 3CKKA 5DIZA 3T7EA 5E3IA 4LYFA 2V96A 3G8CA 3KAQA 2EW8A 3NG1A 4V1CB 3VYTB 4INZA 4NBVA 4JR0A 5BNTA 3WXBA 3GYBA 5EVJA 2VDWB 4N1AA 2NSYA 1T2AA 2C7BA 4DV6B 1W48A 1ZL0A 1O95C 2OXEA 1E1QD 2WJPA 4PC2A 4PLVA 5GP1A 2H1FA 1L0BA 3V4VB 3HB0A 1VJ1A 1Z63A 4QIHA 3FRHA 2IOFK 1PJQA 4RF2A 3M1AA 1MKYA 2FUCA 3EIHA 3L8ZA 3S1LA 4MP8A 3Q0IA 3PVCA 5BP7A 1NX6A 3Q8XB 1RW4A 1YZGA 3ENVA 3LVQE 2OG1A 3FNRA 3FXAA 4YJGB 3ZDXB 2WHPB 3KDSE 4Q4DA 4LFCB 1VSUA 1AKEA 2PL5A 2Q1SA 4EMSA 2P2YA 1WF6A 3AUJB 3KYCA 1RKUA 3W2IA 3GA0A 4IZ6A 5FUBA