4HFRA

Human 11beta-hydroxysteroid dehydrogenase type 1 in complex with an orally bioavailable acidic inhibitor azd4017.
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
260
structure length
255
Chain Sequence
b'EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPLVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVMQAAPKEECALEIIKGGALRQEEVYYDSSRWTTLLIRNPSRKILEELYSTSYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Discovery of a Potent, Selective, and Orally Bioavailable Acidic 11 -Hydroxysteroid Dehydrogenase Type 1 (11 -HSD1) Inhibitor: Discovery of 2-[(3S)-1-[5-(Cyclohexylcarbamoyl)-6-propylsulfanylpyridin-2-yl]-3-piperidyl]acetic Acid (AZD4017)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 99
structure length 255
sequence length 260
chains with identical sequence B
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4hfrA00
3HJAA 1A5ZA 1N9GB 2HK8A 4II3A 4CMJA 5CEFA 3NTOA 4RQTA 3IIEA 1Y8QB 3BAZA 4WCDA 4Z9FA 1ZBQA 4OJNA 1T26A 2EHDA 4YRBA 5IDQA 5LCXA 5A9SB 5MDHA 2NTNA 2UUOA 4NBRA 3CZMA 4TZTA 4DXHA 1ISJA 2PGDA 3H5NA 1NFQA 4QT0A 1Z7EA 1UAGA 4MOWA 2X7HA 4L4XA 5ENVA 1DJQA 3PK0A 5CDYA 4K6CA 1NASA 3BMCB 3JD4A 4LCEA 4N5MA 3D1LA 2H63A 3IAHA 3ICPA 4K9DA 3OQ1A 1HSZA 3GGPA 5CHEA 1U3TA 3IJRA 1ZZEA 2C2YA 4EJ0A 4P38A 4JLWA 1AUPA 4EUEA 1P44A 1PZHA 2Q1WA 3C1OA 3LC2O 4CMEA 3DDNA 4NBTA 3JQFA 3WGIA 1XKQA 3OF2A 1O0SA 3RIHA 3I9KA 3VTFA 1Q2XA 3EW7A 4J9UE 2Y93A 4WASA 5CEEA 4PRLA 4CJXA 4JNKA 4J4BA 2EG9A 5DN9A 1B8VA 4L76A 3Q9NA 4OH1A 4IINA 3DTTA 1KYQA 4JJFA 1U4SA 3PQEA 1DB3A 4D46A 1T2CA 4ROSA 1EVIA 2YW9A 2VYVA 5CPFA 4KDFA 4MINA 3ZV4A 1UXGA 3VPFA 4LVUA 4F3YA 5JDCA 1LDGA 1ONOA 3TN7A 3RD5A 5TC4A 5BNTA 3QVWA 1U4OA 1YVEI 4G2NA 1A7KA 3RFXA 2VHYA 5ICMA 2DUUA 3LU1A 1Y5MA 2O3UA 3NGLA 3ZWWA 1HDRA 3JYOA 1LA2A 4DTIA 4NBVA 2DBZA 3C1AA 4YQZA 1ONNA 3WQQA 2UV8A 5JXWA 2NWQA 4R5HA 4RF4A 1PQWA 3EAGA 4M54A 3JCZA 2HJRA 2Q49A 3H5AA 4XJTA 3WIDA 5KCZA 3LT4A 4DQUA 4UAGA 1NVGA 3MJSA 4E2XA 4HFNA 4AVYA 2QW8A 1P33A 3CTMA 3WNVA 4P4GA 2FZWA 2G5CA 1DIGA 3K73O 5JE8A 4I08A 5TT0A 4I8XA 1HE4A 2YV2A 1S7CA 3C7AA 5TGDA 8ADHA 3E5RA 1N7GA 2X5JO 4B8ZA 1UXIA 2O7SA 1PZEA 3AY3A 5EERA 1SZJG 2Q3EA 5KWEA 4FB5A 4O63O 4YA6A 4PZDA 1A71A 4AJNA 2B4RO 1Q7GA 1PSDA 2NACA 3GDOA 3NT4A 4R1TA 5JY1A 4CR8A 2P9EA 1E3JA 5A03A 2GDZA 1NVTA 2X86A 3NGXA 3Q1LA 2POQX 4BIIA 4G65A 2P5YA 4ND4A 4RO0A 5AYVA 5I7FA 2RBEA 4AICA 2PZKA 4NHEA 1IZ9A 2OP0A 4NK5A 5BT9A 4CQMA 3UKOA 2W2LA 5CDUA 1HDGO 3RC1A 3GAZA 5AXBA 3CMCO 1ORRA 5KKCA 5JPIA 2PFGA 2Y1DA 3D3EA 1X14A 4PLZA 4XQGA 1HWYA 1YJ8A 3K96A 4E12A 3F3SA 4ZJUA 2DLDA 1K89A 4Q3EA 4BNJA 3DMTA 3ETEA 5DBFA 4D45A 4HNHA 3RSHA 1Z6ZA 4JXKA 3DBRA 3QVTA 4EUFA 5KNLA 4FOSA 1ISMA 4L74A 5HA5A 4BNWA 3D4PA 4GPD1 4CLDA 4TRRA 4QXMA 4YCAA 3DBVO 4E6PA 1AN9A 2VOJA 9LDBA 1ZSYA 4PLHA 4GLOA 1I24A 2VRCA 2BD0A 1ONPA 3ONEA 4LN1A 1DRUA 2OZPA 2PA3A 4E5KA 5TJ9A 2EW8A 1M67A 3INTA 2EP7A 2JFGA 4P4NA 3D5TA 5ENDA 1DIBA 1R4MA 1RYDA 5TRTA 3LQFA 3ICCA 1QYWA 3GN1A 3HG7A 3WQRA 1JKFA 2ZTLA 1B2LA 4OHUA 2Q1TA 3HDYA 2O4UX 5U4QA 1EZ4A 3NYWA 4FPXA 4QO7A 5KJCA 1PWXA 4R41A 1IY8A 1QV6A 1JLLA 2W2KB 3GVXA 3IJPA 3Q2KA 1PIWA 2VYNA 5L3ZA 4AJ4A 1W8DA 1VKOA 3TZHA 3ZV6A 1QYVA 4L9RA 1M75A 3MWDB 4MIOA 3UOGA 2WSBA 4Y98A 2GZ1A 3DAGA 3IOYA 3ONDA 2HMUA 3OQ6A 3RUFA 3H9GA 2IZ0A 3Q3CA 1I10A 1O5IA 5ITVA 4LRTB 5EQDA 3K5PA 4YQYA 4RF2A 1MB4A 3VHRA 1MXFA 3G17A 1MC4A 4GKVA 2HMSA 3OA0A 4U6SA 1H6DA 2PD4A 1D3AA 3JQAA 4JP2A 4L75A 3VPXA 1ADGA 5IXSA 4H7PA 4DLBA 2ET6A 4W4TA 4L4RA 2NNLD 4Y8VA 3VDRA 4UEOA 4O5OA 3T7EA 1V3UA 2WTBA 1SBYA 1DRVA 4DMLA 1TT5A 2J3HA 4XQCA 4YAEA 2GO1A 1O95A 3I9JA 1N5DA 4NBUA 1PZGA 5B12A 1I33A 3VZPA 3FNGA 2IE0A 3NTRA 2B0JA 3HFSA 3ZWNA 1IYZA 1HE3A 2EW2A 1U8XX 1I36A 3GR6A 5F5LA 1M66A 1KY5A 4XYBA 2FHSA 1K5HA 4ALKA 1NWCA 4FIZA 5AXCA 3N7UA 4HFRA 3KOUA 2GSDA 3GLQA 4M87A 2CSUA 2WM3A 4RGBA 4TMFA 1KS9A 1R37A 3CSDA 3DBHA 4DC0A 3KSZO 3OBBA 3AUTA 3H9UA 4MVJI 1NWHA 2VTDA 3CPSA 3OEYA 3PDJA 4NPCA 4FFNA 4IDGA 4OXKA 4F6CA 1ZEMA 1UZMA 3GDFA 4CODB 4JGBA 3ZV5A 2CDBA 4YJFB 5JLAA 4IZHA 4MDHA 4RPLA 3I1JA 4FJ1A 1Z45A 3WGOA 4FFOA 4NQZA 2Y1EA 1GV0A 5EIOA 1EUDA 2VWGA 3JQ9C 4ESOA 3NJ8A 3T4EA 3KRTA 3AM5A 3V2UA 1I5RA 2A92A 2QG4A 3S1LA 2X5OA 3T7CA 2AQ8A 4IBOA 2BFAA 1EBFA 1WLYA 2PR2A 1PGNA 4IQ8A 1UUFA 2VZ9A 2P4QA 2FP4A 3GGOA 4U0JA 1GYPA 2WD7B 4YT5A 3F46A 1KIFA 2EKQA 5L7YA 3GT0A 3OIFA 5DCYA 1ZNQO 4IIUA 4O0LA 4ZRNA 2D59A 2JD0A 4QO8A 3ASUA 5TX7A 5KJFA 4RZIA 5G2OA 4CMKA 2RHRA 5CDSA 1RPNA 2DBRA 5G0WA 3OETA 5IZ4A 1NM5A 3PEFA 4EZBA 3DB2A 3V2GA 1FXSA 2QZZA 4IS3A 1E1NA 1N92A 5IXYA 4L4SA 1Y1PA 1HKUA 4TKLA 1WDLA 5C7IO 3I9NA 4ALMA 4IGFA 2X9GA 4YRDA 2GYYA 2PTGA 5A04A 2Y1FA 4B79A 4D43A 3I9LA 3GFBA 5JNLA 5A3JA 1I3LA 2WMDA 1UZNA 2UDPA 5IG2A 3DONA 4AJKA 1KVQA 2G0TA 3EZYA 3PLNA 2FR0A 3RKRA 1GZ6A 3BYZA 3CINA 4R54A 1NXQA 4AJIA 1H0KA 1BVUA 4ONEA 3QVSA 3KEQA 1EDZA 4A10A 5JBIA 4J3FA 4W7HA 3W4IA 3ZNOA 4BUCA 3KEOA 3E9QA 1JKIA 4DLAA 2VUSA 5A5FA 3UGKA 4MVJM 5KTKA 3KXDA 3WR5A 1ZVMA 4BKQA 1KETA 5COQA 4CMCA 1K6JA 1CJCA 3DZIA 3WWYA 2PH5A 3DHYA 4B7XA 1OC2A 1YQXA 1EBUA 4WLOA 1M6WA 1H6BA 1MFZA 4LSWA 4TRJA 4JJGA 4Q9NA 2PKQP 5CPBA 3L6DA 2P4HX 1J5PA 3JQ9A 4PZCA 2VHWA 3W8DA 1R4NA 2DPGA 3GA0A 4BOYA 2DUWA 2O50A 2C7GA 1D1SA 1EFKA 3RUAA 2RAFA 2UAGA 1PL7A 2YDXA 3ADPA 4LMPA 3UUWA 3OJEA 4UVHA 1IHXA 1WZIA 3FNFA 3O03A 1YS4A 3U4HA 2VZ8A 1HF3A 2X9VA 4IDEA 1GUFA 4S3MA 4FC6A 3DFZA 4WEOA 4ZGWA 2GR9A 3FNEA 4IQ0A 3OJ0A 2X0JA 4OKNA 1U7HA 4O6VA 1FJHA 5EMHA 3U5TA 2GZ2A 3AY6A 3NKLA 3V8BA 2HLPA 2B4TO 4TZKA 1P0FA 3VC7A 3ASVA 3CH6A 3WLEA 3WSWA 1ISIA 5CP8A 3WYEA 1C1XA 1U1IA 1B8UA 3DOCA 3ZW8A 2Q4BA 2WE8A 4F6LA 2JFHA 3LF2A 2C29D 2Z1NA 5CDGA 2IDZA 5DZSA 3KYDA 3FCOA 2R6JA 2J3JA 3KTDA 3L0DA 3WJ7A 1Z82A 2WE7A 2Y1GA 5ILGA 1QP8A 4I9NA 3RVDA 5T5QA 4A73A 4R3NA 3F4LA 3ON5A 4K26A 4NU5A 4J0FA 3FWZA 3ROPA 1LRKA 2AMFA 3FPCA 4FGWA 4CPDA 2Q2WA 4RJTA 1H2HA 3ITKA 5I7SA 4ID9A 3ITDA 1IOLA 4CV2A 2FR1A 3GK3A 5H82A 1W4ZA 1HTBA 4FSHA 3AW9A 2FY8A 5KJ6A 1YO6A 3P2YA 1GDHA 1HT0A 3IMFA 1VJ0A 3BZUA 1K2WA 2GCGA 3COSA 4O59O 4YAKA 2CMDA 1PJQA 3TL3A 4PLPA 1U28A 4IXTA 3BIOA 4MVJP 3OM9A 4M1QA 2WYWA 1C0LA 4A0SA 3AFMA 3B6ZA 2DC1A 3B1FA 2XOXA 4I5DA 3CZRA 4PN3A 3TRIA 4JK3A 1R4NB 4FDAA 4IUYA 1BSVA 4XKJA 1X0VA 3ONFA 4F45A 3PFFA 1P9LA 3ZH2A 5KJEA 4B4UA 3UICA 1U2DA 4BNFA 3KBOA 4GH5A 5K9ZA 3S2IA 4Y67A 2EV9A 4PLYA 5THKA 5EN4A 1ENZA 1PZFA 3E03A 3TNLA 5F1PA 3VPGA 1C0IA 4EEZA 5FFFA 1TA4A 3HZZA 2FZEA 3GUCA 3EY4A 4CMBA 1XDWA 4TKMA 1F12A 1EQUA 4YJHA 2HQ1A 4BNXA 4EYEA 2HKIA 3WQSB 4HADA 2YUTA 4KWHA 4J4TA 3E1KA 1VJTA 2EKPA 3E6AA 3ROMA 2B35A 5COBA 3FBGA 2ZYAA 1MA0A 1QORA 1Z75A 1VLLA 1PS0A 2YHIA 1U2GA 4YAIA 1C1XB 4BGEA 1D8AA 1QKIA 2YFQA 3H9QA 3HB4X 4FJ0A 2PZLA 1LX6A 1N9GA 1P45A 1ZMTA 1H6CA 3K6JA 1N2SA 1QLJA 1Y8QA 1MFPA 3EYWA 1L7DA 1ZFNA 4BNLA 4LW8A 1CERA 4KTTE 2EJVA 3RC9A 5A9SA 4OKIA 1U3WA 1V3TA 2DTXA 1PJTA 1X7HA 3TOZA 2PD6A 4CLOB 3ZWMA 1DHRA 1U3VA 4UEJA 4J16A 3NJ4A 4CLHA 2Z5LA 4XDYA 2O3QA 1ENOA 5AXAA 3FR8A 2B4QA 3W6UA 3GNQA 5JCJD 4C7KA 4YR9A 4PIVA 4AJJA 2ZKLA 3KB6A 1GV1A 1XGKA 3BMCA 1PJ4A 4YPOA 3TJRA 1OAAA 1OI7A 1FDTA 5G4KB 4RVUA 3H4VA 3PHLA 1C0PA 3PJEA 1KVRA 1MV8A 4RPJA 3LT1A 3MJ4A 3PJGA 3SX2A 1D1TA 3V1TC 1V8BA 4J9VA 5TS3A 4BVAA 1EDOA 4IJKA 3L6OO 5KVVA 5MGBA 4L0QA 4PRKA 3UN1A 2BGLA 3A9WA 4HX5A 3HE3A 1GAEO 4CMEC 3LYLA 4CM8A 3ANMA 2HK9A 3KSDO 4QSMA 4A26A 3WWZA 2OHXA 4XA8A 5ER6A 4DVJA 1UZLA 2HSDA 2VTEA 4WKGA 4UULA 3V1YA 1ARZA 2VNAA 2F00A 3CKYA 3WGTA 2ZTMA 1YB5A 4BKOA 3ZWYA 2EEZA 3B70A 1IB6A 4XZ3A 4Q3AA 4ZRMA 4CLXA 3DXFA 3PHHA 4IMRA 4OM8A 1ZMOA 2ZTVA 4XYLA 5C37A 3HN7A 4CR7A 4K28A 4KUGA 2C82A 2GZ3A 4GSKA 1PGOA 3LSYA 2Q45A 4YJHB 4W99A 4CM9A 2NV6A 5CG1A 6ADHA 4HWKA 1NQAO 1H9AA 4YEDA 3L07A 2JCVA 4W9NA 5JDCC 3RBVA 2X4GA 1OZAA 1V9LA 4OMUA 3WNQA 2O2SA 2OFPA 4S1VA 3WS7A 4BO9A 2V65A 3M2TA 4E2WA 4R3WA 3FPLA 1PTJA 5L45A 1HLDA 1GTMA 4ILKA 4BGUA 3I6IA 2IXAA 3BXXA 5GMOA 4WEQA 4J4HA 4A27A 5KVCA 3DC2A 1IE3A 1A4UA 5F5NA 1WPQA 1CDOA 4B8WA 3AOGA 3DHEA 3PFWO 1AXGA 1J49A 3WMXA 5KVQA 4E31A 2PWZA 4UUPA 5A4DA 5JY6A 1UP7A 3GVIA 1G0OA 1M6HA 3WGQA 3SC6A 2VYVD 4K6FA 1E7MA 5A1TA 2A35A 1GFSA 2X0RA 4FC7A 2B69A 4PLGA 3MTGA 3P19A 1C3VA 4IIVA 3H3JA 2FMUA 4U5QA 1NTOA 1B14A 3WFJA 2OOSA 2YY7A 4YJGA 1VJ1A 4N18A 5DP2A 4CM7A 2ILTA 4HBGA 1B7GO 4YYZA 1YDEA 4Q3CA 3GH3A 2CNBA 2FR8A 1G6KA 3ZHZA 2IZ1A 1JAXA 4CMHA 4GBJA 1QSGA 1DJNA 1XU9A 1LDEA 4BO0A 3GDGA 5G4LA 4DPMA 4CQLB 4CM8B 3NDIA 2HMWA 4J90A 3OMLA 2P68A 4GAEA 4CL8A 3O9ZA 1YQDA 1B16A 1P31A 4GWKA 4IQGA 4YBZA 2IXBA 1BHSA 4PVCA 1JAYA 1NPYA 2BH9A 2JD1A 4GMGA 1NR1A 4I9HA 1U7TA 4E2ZA 1T2DA 2I65A 3JD1A 4BMNA 1CQIA 5G0VA 3UFXA 3HWRA 5TF4A 1ZK3A 3H8VA 3ADOA 4OYRA 9LDTA 1E7YA 1NQTA 1EUZA 3DMTC 5EESA 4LSMA 1FDVA 1GL3A 2BHLA 1WXDA 1V3VA 5BNIA 1UXJA 4FN4A 3DZKA 4FFRA 4RF5A 1YL5A 2D3TA 3DO5A 4ZQHA 4ND2A 4BO3A 3RJ9A 3H2ZA 4BQPA 2G82A 3OFSA 3D7LA 5TNXA 1O9BA 2VQ3A 2WWRA 3L9XA 3I6QA 3RROA 3AU9A 1M2WA 1PL6A 2A94A 1U5AA 3ETGA 3GEMA 1K6XA 2NQTA 3VKUA 4JBHA 3GN2A 1XEAA 5A9TA 1EK5A 1Y6JA 2HRZA 3PIDA 1HDCA 2W90A 4J49A 1CETA 3NRCA 4RDIA 1RKXA 5EINA 3GRPA 4XB2A 3U09A 4WLNA 1ADBA 2OBNA 5G0UA 4Q3NA 4BMVA 1NQOA 3TZ6A 3VPHA 1DRWA 4WGGA 1XHLA 2FRDA 2YDYA 3DZHA 4XQ9A 2W2KA 5LDHA 1WZEA 4JQCA 2RH4A 3KZVA 2E49A 4YJGB 5ES3A 1J6UA 4YT4A 3RUIA 1P77A 3IKTA 3UH1A 2J5RA 3DZFA 2YQ5A 1Y81A 3PDUA 1JA9A 1A9YA 3GEGA 3K31A 1I32A 1O6ZA 3ZNPA 1X1TA 2WEKA 3MTJA 4CV1A 2VRCD 3EUWA 5JC8A 3WFIA 2D1YA 4FQ8A 1YB4A 3INRA 3KLPX 1SOWA 1B15A 2NVUA 3GQVA 2QHXA 4QFCA 5C3MA 1DAPA 3N74A 3NDJA 1GYQA 4B7UA 4DYVA 2WYVA 3WGGA 5IFLA 3Q11A 1TB4A 4ITUA 2O23A 1UAYA 3DQPA 1EVZA 4PG6A 1P0CA 1T2AA 2O3JA 2JL1A 3SJUA 3ZW9A 4WJZA 2HK7A 4CMIA 3QQPA 2BI7A 1XLTA 4FS3A 5F3RA 1YH3A 3JYNA 3MJTA 4XCVA 1DFHA 4CV0A 1TEHA 3JQCA 3IL2A 3OP4A 1VM6A 2VYND 1D7OA 5FEUA 1ZKMA 4LISA 2J5QA 2H9IA 5JAMA 4R1SA 4IDBA 4YB8A 2NADA 3DTYA 4YTEA 5B4TA 1HZJA 2GERA 3WGYA 3DAFA 1B26A 4ZU3A 5CG2A 2C0CA 4OSOA 3JQAD 5IAAA 4YRAA 3K9QO 3UCEA 1P1IA 3U4DA 3H3FA 4UUNA 3FI9A 3GVPA 1YB1A 1I30A 3RFVA 2CDCA 3L77A 3W1VA 4NNJA 4FCCA 3A28A 4BNIA 3ZWPA 1FMCA 3RQSA 4E5YA 3RBZA 1IUKA 2Z95A 2O4CA 2Y99A 3QHAA 3AOEC 3PHIA 1RJWA 3MOGA 4J7UA 4YJFA 2VCYA 3QJ5A 1OFGA 2VRBA 4UUOA 4XGIA 2RH8A 2P2SA 1PJCA 1YJQA 4WK6A 2AEMA 3F5QA 2NU8A 5L53A 1SB9A 3RC7A 7MDHA 4RLHA 2PK3A 5B1YA 1GU7A 3JD2A 3U4IA 2QIOA 4H16A 4NR0A 1N7HA 3HDJA 3I3OA 1EE2A 2HMTA 2WD7A 1ENPA 1LC0A 2NVUB 2BFMA 1BTOA 5JO0A 3LT2A 1H2BA 3KYBA 4M8SA 4GMFA 1YBMA 2PGJA 5TSDA 2X8LA 1HXHA 3JYLA 4ZQGA 1HYGA 5BR7A 4KOAA 3RUEA 1BXGB 1MLDA 1O8CA 3ZU5A 4CMIB 2EJWA 3ZHBA 2H5LA 1O94A 4Q39A 1U8FO 1I01A 2OBYA 4JJIA 1ID1A 2ZTUA 1T2EA 1LTHR 5IN5A 3EVNA 3NAQA 4IZIA 1OC4A 3MWEB 5DP1A 5U9CA 2V6MA 1IPEA 1RM0A 1JDJA 4TWRA 3FTPA 2OXIA 4OIMA 2Y0EA 4KMSA 2G17A 1UDAA 3VH2A 4G81A 2DQ4A 4D42A 3E5MA 2ZCVA 2ZQYA 3S55A 4BL5A 3A4VA 4B3IA 2NU6A 3DEYX 4A7PA 1TT7A 2NM0A 3MZ0A 4JBIA 3F47A 1VC2A 3BMOB 3GHHA 4RV9A 1EVYA 4HV4A 1Q0LA 3OJLA 1V6AA 1PGQA 3E9MA 4OL9A 3AUSA 4OGWA 5HBRA 1BDBA 1E5QA 2AEJA 5JAIA 2BKAA 3DAPA 3AOEA 4HXYA 4M89A 4ZVVA 1A7AA 3RU9A 3FBTA 1M76A 3S8MA 3WX0A 5IZCC 2FPPA 1Q7CA 4EGFA 1DLIA 1NHGA 1R16A 5B37A 5T8KC 3FWNA 1LXCA 2D5AA 2Y68A 4PGFA 5HTOA 2YV1A 1AHHA 2O3TA 1WAMA 4XGKA 1JU9A 1V0JA 3WJAA 3CEAA 3PZRA 1CYDA 1H94A 2AQKA 1I0ZA 3G0OA 2UVDA 2I3AA 1DFGA 2I76A 3PHJA 4CUKA 1BG6A 1TXGA 5JC1A 1MXHA 4IDDA 3VH3A 2H6EA 5IJZA 3I9MA 2YV3A 3H5RA 2GPTA 3CIFA 1MC5A 2QRKA 3HSKA 3LC1O 5B4VA 3M2PA 4CV3A 3GG2A 3GGGA 4R5MA 4IPTA 4B4OA 4I5GA 5DDIP 4PLCA 2BGMA 3S2GA 2GN6A 1E0DA 4BO8A 1SPXA 2SCUA 4Q3DA 3W6ZA 3G49A 3JYPA 3HB5X 2ZB4A 3PWZA 1MP0A 1HZZA 2YJZA 1DC6A 3TOXA 1JN0A 2J3IA 2ZIZA 3W4JA 2HUNA 1ZK4A 1LSOA 3JQEA 4ND5A 1G0NA 5A06A 3RI3A 3PPIA 1EMDA 2IYOA 1HDOA 3O26A 4INAA 3BTVA 4J7CA 4D41A 3QRWA 2EGHA 1GEGA 5HRUA 4GVXA 1XYGA 1Q0QA 2P5UA 2X22A 3S2FA 3B20A 1GZ3A 4Z0TA 2O48X 3AUUA 4FJ2A 5HM8A 1CF2O 3H65A 4XQEA 5ILOA 1MUUA 3RAJA 1A4IA 3MEQA 3VDQA 2DFDA 3G1UA 4D79A 4E3ZA 3K92A 1GUYA 1DFIA 1H9BA 3EK2A 3PGXA 1AHIA 2B5VA 3E8XA 1LU9A 1LEHA 5IZCA 1H93A 5KKAA 1PS9A 3GZNA 3BTSA 1DBVO 3PVZA 5DNAA 4W82A 2J6IA 2IZZA 3H7AA 5AXDA 1E3SA 3ZDFA 4WNIA 2W98A 3W8EA 2BI8A 2PGLA 5T8KA 3VZQA 5KJ1A 2AQHA 5BSGA 1I2ZA 4Z0PA 3PI7A 2ZJ0A 4GWGA 3GG9A 3IP1A 1DEHA 3ULKA 2D2IA 3C7CB 3G79A 2BRUA 1E3IA 3RKUA 4ZHSA 1GY8A 4OOFA 4F46A 2DBVO 4DIFA 1FF9A 2FSVA 1XSEA 3I4FA 1DIHA 1VSVA 4HP8A 3G3EA 4BO2A 2B37A 1NPTO 3JD3A 2EGGA 3PJFA 2IYPA 3A06A 5I7VA 1NPDA 4CM5A 3ZHXA 1P74A 4YT8A 1DO8A 1PJ3A 4KZPA 2ZJ1A 3UF0A 1ISFA 2FWMX 4WPGA 1HYEA 1GCUA 3LVFO 3VOSA 3D64A 2JCXA 4JIGA 1X15A 1KVSA 2YQ4A 4RQUA 2GGSA 1VE9A 5FYDA 3ZU4A 3BHMA 2NU7A 2UYYA 4RVSA 1R0LA 3I9OA 5K0ZA 2Q50A 3U4CA 1W0CA 3F9IA 1WMBA 2BELA 4YXFA 5K6AC 4EJMA 3ENKA 1PGPA 3PWSA 8LDHA 3EHEA 5L4LA 4E5PA 5C7OO 3TPCA 4CLOA 4DIBA 1XR3A 1R0KA 3OA2A 4RZHA 1IL0A 4GX1A 1QG6A 3L6EA 1DIAA 1E3WB 1HE5A 4O1MA 4BNGA 4TVOA 4D0SA 2ZB7A 1WMAA 3GPDG 3IP3A 2D8AA 1YWGO 4JROA 4R01A 3AJRA 5I9MA 3QWBA 2B83A 1ZW1A 1XQ1A 3KYCB 5G4KA 3RBXA 5TLSA 3L4BA 3GZNB 1G1AA 4ND1A 3Q6IA 3OJOA 4D3SA 3JQGA 2Q1SA 3OSUA 4PVDA 1Z7BA 1DHTA 4OOEA 2DU8A 1LSJA 2JHGA 2RCYA 1T25A 4TVBA 4HUJA 3EMKA 4TSKA 4GSLA 2VN8A 1LLDA 4L8VA 5I7EA 1X13A 2P9CA 1OBFO 1ULSA 2AHRA 4AJHA 2X6TA 5GZ3A 1T1SA 2XF8A 3EC7A 3HADA 3LK7A 5COAA 4BKUA 5JFOA 5FI3A 1ZXLA 1KC1A 4MIEA 4XR4A 3WYBA 5I9LA 1HETA 4CM4B 4UEKA 4J1NA 4CL3A 1LBEA 3O4RA 1HL3A 4ALLA 4J2OA 1GADO 1Y7TA 3LLSA 1VI2A 1WDMA 4OO3A 3ZN2A 4BNVA 3X2FA 4GI2A 3AK4A 1SB8A 4N5LA 3BTUA 5FI5A 4RCVA 2Y1CA 4DWVA 4H15A 2QZ9A 5T64A 2X23A 2BFOA 4W9NC 1PEDA 1ZCJA 1L1FA 4YT2A 5IF3A 3NT5A 1PR9A 3DHNA 3U49A 1GEEA 2O7QA 1ISHA 1CIVA 3DZGA 4GLLA 3TL2A 3ZWCA 4IS2A 3WYCA 3GZ4A 3D4OA 1DLJA 2BMAA 3RU7A 4N54A 3PHGA 3GRKA 2F1KA 2OGUA 1ADCA 5K6AA 1QYXA 1ZIDA 4ZA2A 1LLCA 3W4KA 1A27A 2OO5A 4B7CA 3HUDA 1HLPA 1QYCA 4UVGA 4WOJA 4YAGA 4XD2A 5EPOA 4Z3DA 5DULA 3NEPX 2W4QA 2P9GA 2EERA 3JQ7A 5GY7A 4Z3KA 1UXHA 2EKLA 2D0IA 3VKVA 3R0IA 3GF4A 4E30A 2I66A 1HDXA 3UCFA 2DTDA 5JDIA 1T4DA 4WUVA 1JVBA 1F8GA 1F06A 3OEWA 3VTZA 2O3RA 1B0AA 5L51A 3BTOA 3UW3A 3SVTA 2EWMA 2C59A 2YZ7A 3OJFA 4XRRA 2XXJA 4FFPA 4HFMA 1Q1NA 4MJLA 1E6WA 1KBZA 1WP4A 3JQGB 1FDWA 3TWOA 1IHYA 1R66A 1Y9AA 4R51A 1H5QA 4TRMA 1MGOA 1KEWA 4NJMA 4QX6A 4AJ1A 1KERA 1NAHA 4CQLA 4FOOA 1N1EA 3LDHA 5CFZA 1IZ0A 1C1DB 3DZJA 4FR5A 4K1LA 4IY1A 1DPGA 1J4AA 4RPGA 3AWDA 3JQ6A 4JX8A 3JSAA 3QP9A 4M55A 3N58A 4RVDA 4AL4A 4PZEA 2VHZA 3I83A 5CEJA 1LLUA 4DBVO 3H9JA 3DWFA 4ZQFA 4D3DA 1TI7A 2VWHA 3VPSA 3QWAA 3F6YA 4EW6A 4AJPA 1E7QA 1CRWG 1BXKA 4B3HA 5TIIA 3QVXA 4KP7A 2CZCA 3ZWOA 2NVWA 1F14A 1YL7A 5JYEA 2E82A 4UVEA 1BW9B 1LRLA 3NUGA 4FFMA 4OSPA 2R2GA 3D5QA 1ZK0A 3JQ8B 4BNMA 4KUEA 2C07A 4U6QA 1ML3A 3DL2A 4UUMA 4WE3A 5T57A 3DOOA 1VPDA 4ALIA 5DCWA 3D3WA 5H81A 1F0YA 2WJPA 3OIDA 4GGPA 2HO5A 4JN6B 1R6DA 3QWIA 4FW8A 4HY3A 2AG5A 1NBOA 1E3LA 1BWSA 1KC3A 5T6BA 4BNTA 4NDNE 5T67A 3JQ7B 1GQ2A 3PJDA 4RF3A 4ALNA 1SEPA 2UUPA 3TFQA 3JD0A 1GYRA 4Y6SA 3WTCA 5IN4A 3STHA 1I8TA 3O8QB 3U9LA 2DT5A 2GN8A 2IRWA 3M1AA 4PG5A 4WCFB 1DSSG 2V6BA 4WLEA 1WNTA 3SJ7A 3QVOA 3BMQB 3TFOA 4MIYA 2H1SA 3JQBA 3QE3A 2OUIA 5AVOA 3AM4A 2DFVA 3VZRA 1EUCA 1B8PA 3P5SA 2EXXA 4BO6A 4XEHA 5LDGA 1GPJA 1UR5A 4LK3A 5CAEA 2R00A 3K30A 1LJ8A 4NJMB 5EL0A 5F21A 2HU2A 3NV9A 2PLAA 1LRJA 1QR6A 5BSFA 4CM6A 4RPHA 2IODA 3NDRA 3RJ5A 3JTMA 4RLSA 4QTZA 1PWZA 2NQ8A 4CLEA 1EQ2A 4MO2A 5DT9A 4NJOA 2DBQA 2C54A 2J5KA 3GOHA 3TDKA 1P1RA 3OHSX 1RM4A 4E4YA 3RCBA 4J7XA 1I3MA 3ZWXA 3FHLA 4MVJA 1U3UA 1KEVA 2C2XA 3GNTA 4IMPA 1XCBA 4LCJA 4XX0A 5IDYA 2J3KA 3PTZA 2HCTA 1XIVA 2B5WA 1LDMA 3GAFA 2AQIA 1BXZA 1GPDG 4IGEA 4KTVE 5I9NA 2FOIA 3DBLB 1ISGA 3I5MA 4BNHA 4W7IA 4YWJA 2V6GA 4DL9A 1YKFA 1ZJZA 3ZU3A 1U9JA 3HQ4O 3OIGA 4B4WA 4EJ6A 3D3WB 3TQHA 2AXQA 1VSUA 5JMWA 1HRDA 2XXBA 5HS4A 3ORFA 1K3TA 4QEDA 3PYMA 2GLXA 4U8GA 1MG0A 4X54A 4CQMD 5A5EA 1E1LA 2W8ZA 4DPKA 2W2LD 4EBFA 1HSOA 4NFHA 1J0XO 3DZBA 3PLRA 3ZNNA 4BNZA 1QYDA 5JAQA 3AY7A 1K0UA 3PP8A 3PYLA 1I3KA 4I5EA 4IDCA 4NFSA 1EE9A 4BO7A 4BNKA 3PZBA 1F8FA 3CXRA 3GUYA 4NMHA 4AJ2A 3ANLA 4IDAA 1LSUA 3TZQA 3HHPA 3BMNB 4JP3A 2CVZA 1SMKA 2ZATA 1XA0A 4RVHA 2WYUA 2E37A 3KVOA 4BNYA 1P1HA 2CY0A 3B1KA 4DBZA 4J43A 2Y0CA 5L4SA 2A9FA 1QV7A 3V1UA 2I3GA 3F1LA 3WIEA 1E6UA 5EJ2A 3P2OA 3QWFA 4RORA 2I67A 4MP6A 2ZYDA 4DRYA 3M6IA 4JCOA 1UXKA 5ICSA 4KUHA 5IDWA 3WICA 3ZCXA 3HDQA 2VZ0A 4E2YA 3K2BA 3L4SO 4XYEA 3TZKA 2Q99A 5THQA 4FGSA 1P1JA 2GD1O 2BGKA 4CUJA 2EIHA 1PJ2A 1BXGA 1P1KA 3BHJA 2PH3A 1BMDA 5G0SA 1GUZA 4XB1A 3M1LA 1X0XA 3PYXA 4PLFA 1ZJYA 1JW9B 3E9NA 3EZLA 3PQDA 1GCOA 4GVLA 5A02A 1T24A 2Y05A 1AXEA 5TT1A 2JKVA 3C85A 4IM7A 1MG5A 4LGVA 1EFLA 2NTJA 5TQVA 3UCXA 4E5MA 4PG7A 4XRGA 4Z9YA 1PQUA 2HDHA 5TJHA 1AGNA 3ZU2A 1BRMA 3A1NA 1WWKA 5ITWA 3T4XA 4J6FA 1E6EA 3E18A 1VL6A 3WXBA 3WMWA 2Q4EA 2YYYA 2CD9A 4DQVA 4PCVA 1OMOA 4FFLA 2TMGA 3C3XA 5A05A 3GHYA 3BMOA 2VT3A 4R69A 3BHIA 4XYGA 5GZ6A 2GNAA 1UH5A 4BS9A 3IC5A 2OORA 4R1NA 3SLGA 4PFJA 4CM1A 4RVFA 1NAIA 2QX7A 4NBWA 4XDZA 4Y9DA 5A3VA 1UJMA 2Q1UA 3WTBA 1L7EA 2NTVA 4QUKA 1JKJA 1ZK2A 2JD2A 4BO1A 3KV3O 5DOZA 1IULA 1A9ZA 1R15A 1ENYA 2WDZA 2Z1MA 3OH8A 4JBGA 3H2SA 1HYHA 2NSDA 4H3VA 3SXPA 1P1FA 2C5AA 3K8ZA 3V5NA 5JCXA 3L9WA 1ZK1A 3ZV3A 1T1RA 4GGOA 4MPDA 4XYMA 4WECA 2C20A 1KY4A 5DOVA 2GN9A 1JVSA 1LLQA 1KEPA 3DOJA 4Z0HO 1E5LA 2A4KA 2X0IA 4L73A 7ADHA 1C0KA 4XR9A 1YRLA 2E6UX 4J1QA 3KHUA 3Q2IA 4OXYA 2DAPA 5G0TA 5A9RA 3ETDA 4IJVA 3KLMX 4UVDA 2NUAA 4YAJA 1Z74A 6LDHA 4Z6KA 5I8WA 1SEVA 1Y9EA 3ABIA 4R9SA 1FK8A 3VH1A 3QSGA 3UHAA 1EVJA 1B3BA 2VT2A 1VRWA 2JAHA 3RASA 3ZWBA 1LDBA 4MVJH 2GF2A 4DQXA 3KO8A 1BDMA 3VVBA 3MJVA 3ZWAA 1U5CA 4GX2A 5ADHA 3QY9A 3DMYA 2Y1OA 3R3JA 3S2EA 1KVTA 1Y8RA 4PLVA 3KUXA 1TLTA 2AE2A 3EGOA 3G1TA 3LT0A 2DTEA 3OICA 5ER9A 1GD1O 3TZCA 3WBBA 4DPLA 3ZHYA 1SAYA 3LC7O 1UP6A 1HDYA 1LDNA 3P7MA 2PKQO 4CQMB 4LVCA 2JCYA 1HDZA 3IUPA 3D0OA 2TMDA 1XWFA 1CWUA 3GY0A 5U1PA 1LSSA 3LZ6A 4CLRA 5FF9A 1R12A 2Q2VA 3ST7A 1RM5A 2GRAA 3HN2A 3VZSA 3F1KA 4UREA 3PQFA 4YACA 5L7TA 2QRLA 2X58A 3WBFA 3INGA 1SO8A 1W6UA 4FD3A 4NH4A 3NX4A 2XAAA 3OQBA 2Q46A 2HJSA 4XIYA 2D4AA 3DBRB 4G5HA 3IUSA 3K2EA 4OQYA 4WLUA 3VAZA 1XQ6A 1PJSA 3I23A 5L40A 4IDFA 1ZEJA 5BSEA 3PWKA 1RYEA 1HEUA 2FSSA 4BMSA 3AI1A 2GUGA 2B36A 2E4AA 2EP5A 3AU8A 4NZ9A 4QQRA 4D3FA 3C1TA 2BFPA 2CVQA 3PIIA 4R1UA 3E48A 3PGJA 1R4MB 4NFYA 1GQYA 4IJWA 3JYQA 2VHVA 5DBIA 4BV9A 2G1UA 2OL4A 3AUAA 1BGVA 3LF1A 3V2HA 1JWBB 1N8KA 4UVIA 4DMMA 1I3NA 2JJYA 3U0BA 2QRJA 5DF1A 5L9AA 3QV1A 2IEDA 3SC4A 3RUDA 1T2FA 1UDCA 1E77A 4M86A 4LMRA 3WG9A 3MJCA 4ALJA 1C14A 2DM6A 4J1TA 2AW5A 1YBAA 3MJEA 1PQPA 2I5PO 1CEQA 1DAOA 1O89A 4URFA 3CE6A 3NTQA 4NI5A 5KVSA 2GN4A 5HWSA 5DCUA 4BB6A 2PKRA 1BVRA 1A72A 3WSVA 1Y8RB 2ZYGA 4MKRA 3CMMA 3GMDA 3WDSA 3JQAB 4Y6PA 1W73A 1XG5A 3UXYA 3GMSA 1LQTA 4CMGA 1FDSA 2C5EA 2RIRA 4ND3A 1YBVA 2D5CA 2QQ5A 1TT5B 2AEFA 4BV8A 1LI4A 3RUHA 5FWNA 1E7SA 4CLRB 3O38A 1YONA 3D4NA 4R9RA 3UVEA 1E3WA 4C4OA 4R68A 1WVGA 4R16A 3ZNQA 3GVCA 4AFNA 3GPIA 4ZICA 1QMGA 1DDOA 1VKNA 1YDWA 2NVBA 1PU2A 4MP8A 3KYCA 2CVOA 3EDMA 4PG4A 4YVFA 4EEXA 3IKVA 1NQ5A 1Y5RA 1F17A 3QW2A 1QLHA 3BA1A 1XU7A 3L4BC 4IXWA 1X7GA 3OECA 5EQFA 4GKBA 4LRSB 1DC4A 1NP3A 2I6TA 4HKTA 3QWHA 4GX5A 1KVUA 1PX0A 1YOVA 1VL8A 4A5OA 5JYDA 1EK6A 2OP1A 1D4FA 4YJDA 3ROQA 1E1MA 1UP4A 2FN7A 1IPFA 3DBHB 3QLJA 5CDTA 2HAEA 3C24A 2ZB3A 1DC3A 5L95A 4BGVA 4BKRA 2DPHA 3FTNA 1S6YA 2O3SA 4BO5A 4AJOA 3VVCA 5B4UA 1ZXBA 4CM4A 1NX6A 4WLVA 4P22A 3JQDA 4FBGA 3SLKA 2OMEA 4MP3A 5JW6A 2FPIA 3QIVA 1E3EA 3A14A 5AQ1A 2VWQA 2QYSA 3ZGYA 5J23A 2CF5A 4DUPA 2Y0DA 3ZZNA 5GZ1A 4U7WA 1E92A 3SBOA 4QECA 4WOKA 5JAZA 4CUZA 2CDAA 2ZCUA 2J8ZA 4DA9A 4DIOA 4XIJA 4Y6RA 4NIMA 4I1IA 3LLVA 1KOLA 3HNPA 4HFJA 4P8RA 4C7JA 1RWBA 1YXMA 5L4NA 1CQJA 1Q7BA 1NFRA 4ZD6A 2CFCA 1XELA 4OXNA 3WB9A 4EUHA 3I4CA 3AFNA 4QFDA 3WLFA 1OOEA 2LDBA 2Y66A 4I9UA 3WOHA 1ZUD1 5DBGA 3RUCA 1YE3A 4BNUA 3FN4A 1PJLA 4BHTA 3FR7A 1LDYA 5JDIC 4WCFC 3UAGA 3KETA 4ZQEA 3ENNA 4HNGA 4AG3A 3ZWVA 5IDXA 1KEUA 2VNSA 3IDSA 2E48A 3FRJA 2EF1A 2WD8A 3I52A 4GX0A 1E7WA 4J2HA 3KM0A 4R4JA 4YDRA 4DGSA 3DR3A 3VH4A 1YOVB 2AE1A 2VWPA 4B4VA 4BGIA 1SNYA 3JV7A 4XWYA 1C1DA 4IJUA 2X9NA 2DVMA 1V35A 1TVEA 4OAQA 2VUUA 3FD8A 4Q3BA 2CF6A 3WGHA 4BNNA 4KQXA 1PS8A 4KWIA 4BKPA 3GNSA 4PLWA 1YGYA 3GFGA 1E1KA 1WW8A 3AI2A 4DLLA 3FSRA 4DYDA 2Y67A 5I8ZA 3U62A 3Q9UA 4J0EA 2PY6A 1PR3A 1JQBA 3H9EO 5BNFA 4DREA 4A03A 4AJLA 2PNFA 1LUAA 1GQQA 5C7LO 1GR0A 1I2BA 4A2CA 1H6AA 4DC1A 5L7WA 3GVHA 3ROKA 4B3JA 1NHWA 2CUKA 1HE2A 2IEBA 5KOIA 4II2A 5JO9A 1WDKA 2V6FA 3R1IA 2ZQZA 3IQDB 3TF5A 1BW9A 2G76A 2JAPA 1QXSA 3JQ8A 3W8FA 2VOEA 2PD3A 1K6IA 5C5IA 1ZSVA 1YL6A 1RM3A 4CM3A 5F1OA 3X2EA 2O2YA 1ZH8A 3C7DB 3R6DA 2RHCA 3EVTA 4TRNA 2QYTA 5BQFA 1AE1A 3SEFA 5JS6A 1ZO8A 3PRJA 4OQZA 4CR6A 1DIRA 3H6KA 4CMAA 5LC1A 1JTVA 2NLOA 5BSHA 4EDFA 4PG8A 2HMVA 2Q2QA 4CM9D 3R3SA 4E32A 3C8MA 1SCUA 4GL4A 3O8QA 4W6ZA 1R0SA 2ZK7A 4WCFA 1QRRA 3RWBA 2LDXA 4J1SA 3KYDB 3BMQA 4EI2A 3U3XA 3AI3A 5H83A 4WNCA 1ZSNA 1NVMB 4BO4A 2HRBA 2PZJA 3JQBC 4M49A 3RC2A 1N1GA 3MCVA 4RVGA 4MVJE 4ZQBA 1B3RA 4TROA 4WLFA 1LQUA 5F1KA 4D7AA 1DC5A 4MVJF 4J91A 2R00C 1SOVA 3KSUA 2P91A 5KIAA 1NR7A 1PL8A 3CUKA 3GEDA 4N7RA 4KDEA 3WGZA 4E33A 2X0NA 2BF7A 3IS3A 2GASA 2X1HA 1SC6A 2JFFA 3RFTA 2BLLA 1DOHA 3NT2A 4BQRA 1ULUA 1MX3A 1ADFA 3MOIA 2X5KO 5AOVA 2PV7A 3Q0EA 4RPKA 4PLTA 2VUTA 2DKNA 1T4BA 3FF4A 3F5SA 3HDHA 2XPCA 2NU9A 1GZ4A 1PJBA 1Q0HA 3ANNA 1LNQA 3JQFC 1PGJA 4N5NA 1LC3A 1NYTA 4NK4A 3E82A 2I99A 1DXYA 3QA9A 4NG5A 4E13A 2PZMA 3F4BA 5JMPA 2JHFA 4Z9XA 4U0KA 3DBLA 4TQGA 3TSCA 1X1EA 2AA3A 3FNHA 1EEHA 4GQAA 1VL0A 1JWAB 4E0BA 4NU6A 2ZB8A 1I2CA 1X7DA 3DFUA 3ZI0A 4D44A 2FPGA 1YQGA 4MKXA 3PXXA 1NNUA 4BB5A 2AG8A 3B1JA 4I5FA 4D0RA 4AJEA 4KQWA 5JCJA 4E5NA 2C7VA 4RL6A 2I9PA 1E7RA 3AM3A 4XJSA 4MVJG 2YHUA 4P4LA 1P3DA 1UDBA 3HFGA 1NFFA 4E21A 4EITA 2VHXA 2YFHA 2V7PA 4MKZA 4MVJD 2YHIB 1FDUA 4ZN6A 3BMNA 5HS6A 4XGNA 4RDHA 5JSFA 1Z73A 3GC6A
chains in the Genus database with same CATH superfamily
2OEPA 2QY9A 1MB0A 1A5ZA 2C1EA 1N9GB 3HEMA 4G9BA 4BE9A 2BTEA 4RQTA 1DZ3A 1Y8QB 4IF4A 2JIBA 4MUFA 1E1QA 3VC3A 1T26A 2O2JA 5DNWA 4EFLA 3ZJVA 3W1EA 4AC9A 4N7BA 1ICEA 5JWOA 1TUBA 3D6UA 2XUJA 4E51A 1BN6A 2CEAA 3ASZA 4AD8A 1ISJA 1TZCA 3O7MA 2R7AA 1ORHA 3H2GA 3STWA 4HJRA 3H5NA 4PIMA 4XVHA 1HNZB 2UYGA 1S2OA 1Z7EA 4EG4A 2N0SA 2X7HA 4L9AA 4MOWA 4C4SA 4B1FA 1QVWA 2HBQA 4EL0A 2XZOA 2Q4RA 2WYIA 1WTAA 1T8YA 5KX5A 3BMCB 2VHCA 3MJDA 5CYPA 2C97A 5EFZA 2CV2A 5JS1A 1K7XB 2CMGA 2X3FA 4R8MA 3T3GA 1NIPA 3FPEA 4C3UA 4O1IA 4H18A 1NF3A 2FE4A 3LCRA 4UW9A 2PGAA 5CHEA 1WBDA 2WJHA 3AB3A 3NAMA 1QOZA 3IJRA 2WF6A 4EJ0A 2EQ5A 4IIJF 4IOLA 4TS3A 1Y5LA 3HUTA 1AUPA 1P44A 4A3SA 1PQYA 1JLRA 2CLKB 3LC2O 4CMEA 3TAUA 1KDPA 3DDNA 3NHRA 5E4TA 1WNFA 1BCRB 2W2QA 1X80A 2XDWA 1O0SA 3RIHA 4E09A 3USCS 3I9KA 4A0GA 3OZRA 1Q2XA 2NZYA 5HFAA 4J9UE 3BOSA 2G8NA 2M1ZA 4PC7A 5CEEA 4KL8S 2WABA 3IB6A 4ZVSA 3NBFA 5EXSA 3SKYA 4CJXA 1FXWF 3QELB 2DWPA 4P3KA 5H4HA 3O2NA 3BAFA 1P19A 1RWVA 2B99A 3Q9NA 3QOXA 4L76A 3PX7A 5DNVA 1K2VN 4ISBA 1OB2A 1MD9A 1KYQA 4JJFA 1E2KA 2P41A 2DHDA 3BWYA 2IEIA 2ZXUA 1M1YA 2WQZA 2R0QC 3KC2A 3U39A 1P4JA 2XQVA 3EXFA 3A1FA 3ZZUA 5BN3A 3FWYA 3NIBA 1S0UA 2GEDA 2JEYA 2W6ZA 3FVQA 4FDMA 4C6TB 2FPSA 2UUAB 4XM1A 1SA0B 3R40A 4F3YA 1QRTA 3SNKA 3OQOA 1ONOA 4A1OA 3RD5A 4G5YA 1MJHA 3QVWA 5BNTA 5JRDS 1N0HA 1XNGA 4QZVA 3LPLA 2J4FA 3G2KA 2O7NA 1A7KA 1NVUQ 4IJ5A 5LZ9A 3ZXIA 5AI6A 2AN9A 1M8PA 3LU1A 3WJ2A 4GR4A 4X1KA 2QI9F 3PFKA 1CNFA 1I6WA 4FHEA 4LOKA 1LA2A 3JVEA 3PKJA 4NBVA 4TWJA 3KWJA 2BZ0A 2XEDA 4V3CA 3EFBA 5ALKA 2OV2A 5FNVF 3RGWS 1EP2B 4DR6B 3X1JA 3F49S 4I6EA 1J1IA 3Q7IA 4FNAA 4U9UA 5J63A 3AFGA 1IM2A 3UJ9A 2CJYA 2B5OA 1CU1A 2CLMB 4ENUA 1XZMA 1IEWA 4YONB 1RBQA 3WAJA 1QFSA 1T4MA 1VE6A 3FGNA 4H7DA 3MJSA 1AK9A 5DGHA 4BEBA 4RD2A 2QW8A 2FMHA 4E2XA 2I9KA 3BPSA 2FX3A 3WRYA 3GZJA 2AN3A 4EHDA 3BJMA 4KLZA 3QEMA 3OD5A 4LJ8A 1HX7A 4Q05A 1GNQA 5DLQC 4LYYA 5M29A 4C01A 2G0AA 5TT0A 4CCSA 3OTGA 4D9EA 4NKRA 1LX7A 4BQFA 2PUAA 4PYKA 2C8KA 3P0IA 1K8RA 3UAWA 3W79A 1LWOA 4JODA 3J81k 4ZMSA 4TUYF 4HB2A 3ZD6A 4O4LB 1PZEA 1Q7EA 2MINA 2NXWA 4PC1A 4YMVA 5AHXA 3P71T 2AR9A 2N3ZA 4LZPA 1V8FA 4YA6A 4D81A 2B2NA 3V4RA 3TAXA 1ZHFA 1KK1A 1Q7GA 2B4RO 4R1TA 3GW8A 3NT4A 1F6DA 3Q0TA 4FOTA 4AY3A 1E3JA 3NGXA 2POQX 5JMOA 3PFNA 4QUDA 1U0EA 5AMXA 1T8TA 3WKAA 4BC0A 1IZ9A 2OP0A 4FGUA 5BT9A 1XTKA 3CVYA 2CLLB 3AIMA 3IERA 3PA8A 2W2LA 4W6QA 4FONA 5CDUA 4KAXA 5KHAA 5HF5A 2QSYA 5HK8A 1JIVA 4FMCB 1EAYA 4OQEA 4HRXA 2PFGA 1CQIB 4GC9A 3WKBA 4F2GA 3ZVKA 1NG9A 4N40A 2P4EA 1OLSB 3OHMA 1L5HB 5GIOE 3RSGA 2DLDA 3VZBA 2RGAA 4JEHA 4LYGA 4WX2B 1QVAA 3X1DA 3R5SA 1OXMA 4EJSC 1XRPA 1L8LA 2EWWA 4BPRA 3QXXA 4H17A 1U8YA 1CUJA 1KE1A 5B6PA 3KZ1E 3QVTA 4EUFA 3VA7A 1YMVA 2G5TA 5KNLA 1H3FA 1SKBA 2C92A 2V0NA 4P53A 1GSIA 3H4MA 4B3DA 5D3ZA 4QXMA 4BFZA 4PHGA 4QBTA 3RF6A 2YN4A 1G42A 3AERA 3D0RA 2CXHA 4TTJA 4OD0A 3LUFA 3QYAA 2GVDC 4X5OA 4D9CA 3VNUA 1Z2EA 4DOMA 1ONPA 1KMQA 3MLBA 3ONEA 3BRQA 2PA3A 3SU8A 4PO8A 5BO5A 3ZXSA 3T9AA 4YFVA 2EW8A 1M67A 4GKJB 2QMZA 1A5TA 2OVBA 5IUJC 1DIBA 4QLAA 2WSSD 1DAKA 3C0KA 3U19A 3IBYA 3EBLA 5TRTA 3LQFA 1Y80A 4KRYA 4OK3A 1B2LA 3P0EA 1UWCA 5D3QA 1FLDA 1V48A 2O4UX 4R2XA 1JIQA 3LDUA 3PC2A 1EZ4A 1GNLA 1CY7A 2W2MA 1P62B 3IDFA 4FPXA 2FFHA 3ZBPA 3D8BA 2OVFA 2W2KB 3GVXA 3MA0A 3IJPA 3Q2KA 3KU4A 4LJSA 1C9KA 2HWYA 3TZHA 2D2VA 5FO0A 2WJYA 3LCVB 2AYZA 2PS3A 3NOQA 4MIOA 4MS3B 5ALMA 3UOGA 1YI1A 3IOYA 1II8A 1NT2A 5CJPA 3OQ6A 5EG5A 3RUFA 4G1MB 4EJ6A 1Z18A 3N2ZB 2RHWA 2DY1A 1YIAA 1O5IA 3HU3A 1G2PA 3N0VA 1GVNB 1O54A 5HKBA 1QKJA 2Q5JA 4EYQA 5LJLA 1MXFA 3G17A 2AJBA 4NENA 1YVRA 4RHUA 4DLPA 1KGDA 2JBWA 2JFQA 4JP2A 1YVPA 1Q0PA 5K6TA 1X8KA 1ADGA 3T7AA 4H7PA 4RH0A 4RK4A 1K7CA 2VJMA 4ZZ3A 5T41A 1ESMA 3VOTA 4ARBA 3BWMA 4C7BA 1P7CA 4DCOA 1JPVA 4GRAA 3A27A 2D2EA 2WTBA 3NASA 4X1IA 1DRVA 1TT5A 2J3HA 1PVDA 3LE8A 4TTSA 4YAEA 4TM8A 3I9JA 3MD9A 4NBUA 1WB4A 1E69A 3QFRA 4C9BA 4EGAA 5LIRA 2VYFA 1IY1A 1IEQA 2HXGA 4NCJA 2JLUA 4NPHA 3NTRA 3HFSA 4HWOA 5E9WA 2GILA 4O2BF 3A7DA 3C48A 2VP6A 4L0MA 2JFOA 2H17A 1ESCA 3SZRA 3WFZA 4H3SA 1I36A 1QBGA 4I1UA 2AEEA 3JYHA 4JH0A 1IXYA 2P27A 3LD9A 3MTBA 4JQYA 1ZD8A 1JV2B 3OTQA 3FDFA 3IHLA 1KSHA 1E9RA 4S1NA 1UBHS 4Q1EA 1FFBA 3SKVA 5SV2A 3N7TA 5ESXA 3BDAA 1CUWA 2O54A 2GSDA 4I1YA 5AVXA 3MSCA 1DZIA 4QYWA 1KR5A 1MHPA 1Z0IA 4H6WA 4K2AA 4LVNA 5DJ5A 1PWYE 4H3HB 3U9TA 4GXTA 5H1YA 5JCOC 5LQNA 3DBHA 1GZUA 4DC0A 3OBBA 4KQIA 1U0TA 4J0GA 5JNVA 3C5HA 3IMEA 3SQWA 4DIDA 1S2IA 3C8HA 1SG0A 3GQBA 1MX1A 3KJNA 4WH0A 2AW3A 1W0JD 3C4VA 3C6ZA 4M7OA 4NONA 4F6CA 1L5ZA 4RESA 2HWUA 1TUGA 2CDNA 4KXUA 5KPDA 3K9FC 1ZMRA 4JGBA 3ZV5A 3B6KA 4KVZA 1HG0A 4JDUA 4PQYA 4ZHQA 3I1JA 4TT3D 4X62B 5MGNA 4B0OA 1Z3CA 3A3KA 2BONA 3KWFA 4FFOA 1RMTA 4RH3A 2Y1EA 3COJA 3JQ9C 4KDRA 3T4EA 3D2CA 3KRTA 5E1OA 1XX6A 3V2UA 4ARIA 2A92A 1FRFS 2QG4A 2OM6A 2WHQA 1X7WA 2X5OA 3IT1A 3S1LA 1R5BA 5IM4A 1A97A 4LF8B 2AQ8A 2MOKA 3VHXA 2XMGA 3AF4A 2BFAA 1FUUA 1WLYA 5G02A 4IQ8A 1PGNA 4PAGA 1D8TA 5LUBA 1GN9A 4D92A 1UUFA 4UTRA 5KQPA 3HKCA 2C3OA 4FUTA 1QR2A 1VL1A 4U0JA 1QDEA 4QLBA 3UXHA 3OFJA 3DL0A 2A2ZA 4KVGA 1CZKA 4CU5A 2PANA 5F7XA 1RZRA 3GT0A 3GFQA 2EKDA 2CKMA 1ZNQO 3AVQA 2RH9B 3EMDA 4ZRNA 4C4ZA 4D0LB 3ES9A 4ZCRA 4X65B 1OZ0A 1ZM7A 5TX7A 1H2WA 1JMKC 4O3FA 3BWDD 4PZ9A 3TZEA 1RPNA 2ZI3A 3OETA 2VHJA 1A9XB 4MQEB 4EZBA 4ZC1A 1OYWA 2G04A 1Z17A 1XZIA 2QZZA 4IS3A 4CHTA 2F1OA 2XECA 1K4MA 5HCUA 3H9CA 1Y1PA 4TKLA 1WDLA 1FDIA 1TK3A 2ECOA 5C7IO 3HYRA 1Y5IA 4R7TA 1RAFA 1OW3B 4NWIA 3IO5A 4KNWA 2ORWA 4YRDA 3TI7A 1QZ3A 1MJNA 1V4VA 1KI4A 2VDWB 2YFYA 3L8ZA 4UBNA 4JI5B 2Y1FA 5A04A 4FZRA 4B79A 3PQ3A 3KUDA 1JHDA 3D6JA 3D8NA 1A9QA 3EH2A 3W6PA 4CGYA 1KQPA 5BSKA 1EX1A 4URXR 3KOOA 4GOMD 4YRFA 2LP4Y 4N41A 2PZEA 2XNHA 4G26A 5KYKA 2ZBPA 3DONA 4L50A 3RSZA 4AJKA 4B6SA 4ZCLA 1D0VA 1E79A 1I80A 3Q7RA 4M3NA 5F52A 3F9CA 5H9WA 2DPLA 4D99A 5CM2Z 4AJIA 3HXQA 1CUIA 4LTMA 1H0KA 5CT4A 1BVUA 3OTHA 3KWLA 3DTNA 1P2BA 2QN1A 5BWMA 3RAEC 4J3FA 1IJFA 3U5ZB 4K8RB 3PD7A 4AO8A 2PR7A 3ZNOA 5A5FA 2Y9PB 2QVLA 1R9NA 3DFMA 1EXWA 3PDCA 4MVJM 2Z5VA 2ZIWB 1ZW6A 1LI5A 2PX8A 4JUAA 1NN0A 2PRIA 3KXDA 1QF7A 3FSGA 3R0VA 5KTKA 2RHTA 2VTBB 1A50B 1KETA 2YOFA 3WWYA 3V4ZA 2FX2A 1UT8A 3DHYA 2FFJA 4B7XA 3ZVNA 4MROA 1EBUA 2HFKA 1WD5A 4DNPA 3F8TA 2IY7A 1H6BA 2NZUG 4TRJA 4KPEC 3B38A 4QYIA 4LNHA 3AUFA 4Q9NA 4UXIA 5AM1A 3L6DA 3IRVA 3RV4A 1IXKA 3KX2A 4NARA 3ER8A 1PR0A 1L5SA 2YBDA 4QUGA 4PQEA 2DPGA 2DUWA 1RDFA 2O50A 4PAOA 4MUYA 2PL3A 2AMVA 3HEAA 1EFKA 3T6KA 4RKWA 2OBMA 3HU1A 2R4QA 2MSCB 4KYTA 3RUAA 5FJJA 1PSWA 4QUAA 2DYKA 1V2HE 5FOQA 4CDRA 3OJEA 4ZDJA 1IHXA 1SUSA 1U63A 3D4IA 2RGYA 4JASB 4OHFA 5D87A 5I7UA 3EODA 3OZVA 2CXTA 2P3SA 4NZYA 2ZJ2A 2BEKA 3Q8MA 2XJ9A 3CF6R 2CVHA 5YASA 1X1QA 1E2QA 1ZN8A 4IQ0A 3G5LA 2JKZA 4IOKA 1ULBA 4G23A 4IIDA 4OKNA 1U7HA 5KTMA 1FJHA 5ALIA 5K3BA 2Z9BA 3K1ZA 2Q6LA 3VR3A 1YZTA 3U5TA 1UK7A 2SCUB 4LJ9A 3V8BA 2XKBA 2OXRA 2HLPA 2B4TO 1G6Q1 1P0FA 4TZKA 2RGRA 1LBIA 1QHIA 3WLEA 4QKQA 1XTRA 4ODIA 4TZ6A 1WL8A 2QZSA 1OKKA 3WSWA 5ECYA 4P2GA 3O31A 1C1XA 1U1IA 3R9XA 1WQ1R 4YP1A 3AHDA 3L7AA 2JFHA 2C29D 2G70A 2QRNA 3IDZA 3LXRA 1PN3A 3CA8A 4V0KA 4C2BA 2FF5A 4TMTA 3WL8A 3L0DA 4R40A 5HCIA 4CZ2A 2HEGA 2I8AA 5ILGA 5A0VA 1O3YA 4AN4A 1G5QA 3RVDA 5LU8A 2H1LA 2QMEA 2H3HA 3EXAA 3F4LA 3V7FA 4AZWA 4K26A 2CFRA 1ONSA 2IIVA 3IUJA 4NU5A 2K87A 4EELA 3AESA 4X6LA 3ROPA 1OVGA 4NTZA 1XA3A 3T9EA 1ODIA 2AMFA 1UZUA 3IR7A 3WDKA 4HRYA 4AIRA 1RWNA 5I7SA 1QTNA 2HLDD 1K4KA 2CK3D 3G1WA 3QBDA 1JG4A 3HJTA 4KV7A 1IOLA 2QW0X 4LKOA 1DBWA 4TL9A 1HTBA 5JSZA 2PMWB 4FSHA 2V7EA 3AUXA 3AW9A 1PT6A 2P0EA 5ALRA 1J90A 3SF8A 5KJ6A 2OE2A 1Q3HA 3IHWA 3NVAA 3UYLA 4YYEA 5M7EA 2FMXA 2ID7A 4YAKA 1U1DA 4X61A 3E81A 3VYWA 1PJQA 3OM9A 1OH5A 2FMTA 1D6NA 3HJCA 3SYTA 1YZ3A 2WYWA 3GEIA 3Q88A 1JR2A 4QWWA 3CRQA 2Z09A 4EJFA 4B33A 3B1FA 2XZTA 3UPTA 4WOBA 4HSGA 2VVTA 1Y6QA 4BXOB 3CZRA 2A5GA 5J9FA 4I3HA 3F90A 3HCNA 4HMQA 1N4DA 3K9LA 1RHJA 1TIBA 3EOBI 1R4NB 2HTFA 2QL5A 3ITEA 4IUYA 4OL0A 3UW1A 5F23A 1H2RS 2Z2XA 5EJ5A 4P7KA 1X0VA 3T06B 3R75A 5LKAA 2C4VA 4LYHA 3A1SA 3DV0B 1S9DA 4MZXA 3ZH2A 5DSTA 4MQUA 1PWEA 5KJEA 2ZUVA 3HWX1 4GH5A 1G63A 3P9KA 3S2IA 3D3JA 2BMWA 4PLYA 1FZQA 2GXQA 2F90A 3VPGA 4C6RA 5F1PA 2WINI 2ZDQA 4A6PA 2ZIUB 1BHO1 2WG0A 3HZZA 4PPFA 2FZEA 1KK2A 4L5IA 4C0QC 4CMBA 2V3VA 4YJHA 1N3IA 1AKYA 2WOJA 4XSGA 1I0IA 1MT0A 2JLQA 3C3DA 4Y9SA 3K0BA 4ZOLA 2YUTA 3LNCA 5CYGA 5ADVA 3U16A 2OXEA 4UFNA 1Z0ZA 3E1KA 2DFLA 4HUQB 2C5GA 2ZSIA 4L8WB 4M83A 3SQOA 5COBA 1LF0A 2P35A 2ZYAA 1MA0A 3D7MA 3V42A 5L6LB 5EIHA 4LPKA 3BGOS 4JV5B 2AS0A 1MRZA 2IYLD 1VLLA 3A1TA 3LYHA 4IIFA 1JDZA 3IQIX 2BR5A 3MMZA 4R31A 1NVXQ 1D8AA 2I4RA 1BOOA 2RDMA 3FNIA 1FMTA 1AZSC 3AVXA 1LX6A 1N9GA 3IOBA 1OGYA 2LE0A 3NNNA 1YMUA 1Y8QA 3RVSA 5JMTA 3EYWA 3KLNA 5KC9A 4QUHA 1FP1D 1I4OA 4LW8A 1OWPA 1CERA 4QQ8A 5EQJB 1C8BA 1VZ3A 1XZPA 3ESZA 5C9ZA 1A2BA 2GM4A 1PD0A 3GIWA 1X7HA 4BBAA 2PD6A 1NW5A 3OWXA 1DQZA 1UM8A 1E9EA 2YW2A 4CLOB 2FWPA 1BS1A 3ZWMA 4BQSA 4E1BA 4R2IA 4N48A 4J16A 4H1VA 1L5VA 1OIXA 2ZXEA 4UJ3A 1SRRA 1RXWA 2GBPA 4EYGA 2GOYA 3ZQ6A 4C7KA 4AW9A 4YR9A 4IWNA 1BFUA 1GV1A 1XGKA 3BMCA 4JJAA 1HO3A 1FX0B 1PJ4A 1H4SA 4N0MA 2XWBF 4RYDA 1U0SY 4D97A 2EWVA 2Z9CA 3CJQA 4D5EA 1MV8A 4AS3A 4RPJA 3V6MA 3MJ4A 4CIXA 1D1TA 1TO2E 5AVVA 3VNAA 1YR8A 5TPZD 4IJKA 5KVVA 3Q3GE 3MBKA 4B84A 1ZUWA 3EQ2A 1X7XB 1H3NA 4D80A 4QUEA 5GTDA 4CMEC 1C50A 4DT1B 2UUCB 3I01A 4GYJA 1FUYB 3R9WA 4JAVC 3WWZA 4KPGA 1X38A 2AVNA 2HT6A 4DVJA 3EUFA 2VTEA 3QELA 1BKDR 4WKGA 4UULA 3V1YA 2VNAA 1IOVA 1E6MA 1E89A 3CKYA 5B5SA 3B9PA 1UZAA 3EASA 3IBFA 2EJUA 3B70A 4BKOA 3G8BA 1IB6A 5FWDA 3WQHA 1Z39A 4WJLA 2B6HA 4CETA 2YQZA 2A59A 3DXFA 4C2TA 2J31A 1VSBA 5C37A 3CEMA 2ZG6A 3ENWA 2F6RA 3PE6A 4TXHA 3WRVA 2GZ3A 5AKZA 4GSKA 1PGOA 2Q45A 3DAHA 4W99A 4C6TA 2NV6A 2Z3VA 4OLAA 4JBLA 2YL2A 1SA0A 1JI3A 1HG1A 2EX0A 4FE4A 4YEDA 1ZGHA 2Q6IA 3L07A 1P7WA 4V0RA 3TPFA 1ZD1A 2JCVA 2ZRCA 2HC9A 2X4GA 1OZAA 1V9LA 4R2MA 4OMUA 4P3OA 2ODNA 8AT1A 4BO9A 1KTIA 2HADA 3FPKA 2PLWA 3UG7A 7ABPA 4BVFA 2V65A 3DWGA 3H2HA 1D6MA 3ZY4A 3ANYB 3RIGA 3QFHA 4MW5A 1EK0A 2VH2A 4BGUA 3FSEA 1A8PA 4V0ME 3UJCA 4ARVA 4OGKA 2V7WA 4JZYA 4K86A 2F1RA 3ED5A 2X40A 5AK3A 1IE3A 3EIUA 5NULA 4B8WA 1G19A 1JE1A 3AOGA 3MUOA 3GWZA 3W5JA 5JZVA 3TL6A 2CUNA 2QX4A 4UHKA 1J49A 2BGTA 2KQUA 2WAOA 1FP6A 5A4DA 1IBSA 3B60A 3JZMA 4HNAB 4KQMA 2GEVA 1QOQB 2IW3A 1QVZA 4GMHA 3GVIA 5JZSA 4Q6WA 7GPBA 3RHSA 3SC6A 4K6FA 5G3YA 5A1TA 1SOUA 3M49A 4IUDS 2HIMA 1FB5A 1GFSA 2X0RA 1DJPA 1OWMA 4PLGA 2O8EB 1L1QA 1LBTA 3H3JA 2FRDC 2A1TS 3HB1A 1NUTA 3JTEA 4GG1A 4WK2B 4ZI7B 1KI2A 4PGGA 1PLLA 2EKBA 4CM7A 2WTNA 4L9SA 3SSOA 4YYZA 2IVZA 5CB0A 3KT6A 4O4LA 4F04A 2FFAA 2HQRA 4EY8A 1PR4A 1A2OA 1X1SA 4A0QA 5B1HA 1NVDA 2XYRA 3JPYA 4FYVA 2IZ1A 4WA8A 2XNJA 2IL1A 1CY2A 1Z13A 3CX4A 3O92A 2GAIA 4QQFA 2DQSA 2XKKA 3CRVA 3GDGA 4KHPB 4CM8B 4JQOA 4A23A 1ST3A 2GTIA 3N2YA 4J90A 4ZOAA 1N78A 1XXHB 4YRKA 1L9XA 3O9ZA 4HVCA 1AH2A 5E2BA 3PF9A 5GM2A 3CEJA 4BWYA 1KZ4A 1YQDA 3NRBA 3BZBA 1AB6A 1C9JA 1XTSA 1UBLS 3KTOA 4PVCA 4Z1MA 3B48A 2BH9A 2JD1A 1RRGA 1A98A 2ORYA 4GMGA 2C5BA 3ZD7A 2RONA 4K6OA 4ED9A 3VR5H 4P3NA 5TGTA 4JYCA 3K0SA 5BW6B 1T2DA 3AL2A 2OQIA 1N5RA 3GXBA 3V55A 1CQIA 1VB3A 1MB3A 1J00A 5E7JA 1EM8B 5JHGB 1ZK3A 3H8VA 1TYAE 2MCFA 4QVIA 1VBFA 4OB8A 5EESA 1EUZA 1PKEA 4BLVA 2CLHB 2BHLA 2H2GA 3R6GA 3ZDEA 4QNNA 2KMLA 3L0IB 3OURA 4TS1A 5BNIA 3N2GB 4FN4A 2W2VA 4QM6A 1A5SB 4MVXA 5LLTA 5CB4B 3PXDA 4ND2A 2BMEA 3RARA 1IHPA 4X8LA 2G82A 3OFSA 1Q2UA 5TNXA 1X1AA 2VQ3A 3DGEC 1NMQA 4HYEA 3ZQJA 4CT4B 3I6QA 1J5EB 1GRCA 2ZRLA 2COEA 3IEUA 4INPA 2A94A 4TS9A 3ETGA 5DHRA 1FTGA 4XD7A 4NCHA 3VSEA 1PNVA 1NKSA 5DGCA 4HDOB 4WN3A 4FYMA 1EK5A 5IARA 4LDJA 2IZ6A 2JA1A 5LKRA 4G0OA 4R8SA 2YWJA 4DKXA 5EUCA 1KDRA 1RKXA 3PZBA 4KHZA 4LNUB 1MEJA 5HP4A 4XDGA 3GRPA 1Q92A 1QG2A 1X9HA 2QBYB 1BA3A 4MMZB 4K9NA 1G98A 5BSMA 5E1DA 1SELA 2AFRA 3W6NA 1NQOA 3U80A 1T5TA 3L05A 4QAJA 4EHFA 1DRWA 4EB0A 3IP5A 3I30X 1ORTA 3IQWA 5IWAB 2W2KA 2B21A 4JQCA 4IIHA 5TQ2A 1LK7A 5KINB 3RAFC 2E49A 4YJGB 4HWTA 3UQYS 4BVEA 3DC7A 3MB8A 1D03A 3P97A 1RC8A 1W9HA 1P77A 2F67A 1NJSA 4MS3A 2J5RA 3DZFA 1DEAA 1Y81A 3IUBA 1I32A 1SVMA 1EUCB 3VU9B 3F97A 3RYIB 1Y3CE 4TXLA 3D6NB 2SKDA 4AQDA 2VRCD 4RE6A 3KE9A 2D1YA 3WFIA 4BMYA 3DMRA 2GJ8A 1SOWA 3KLPX 3DOHA 4U00A 1B15A 3GQVA 4MI9A 2QHXA 4F4HA 8ABPA 4JCCA 5C3MA 2ODQA 1TIPA 1VE5A 4DNFA 3N74A 3LP6A 1J2YA 4GR9A 1PBNA 1DEOA 2J87A 2WYVA 4D9MA 3KOYA 3PE4A 1TB4A 4OAOA 1O08A 2IT1A 2A0XA 5J47A 3SJUA 3JWHA 4B2IA 2JL1A 1RXVA 2IUUA 1QYRA 2HK7A 3L79A 1FVHA 2GJKA 2XUIA 4FS3A 4YJ3B 1G2OA 4OP3A 1WCWA 4NJEB 4XCVA 4KIJA 1FU4A 1T13A 3KDPA 3IL2A 2XGJA 3M6AA 5DB4A 1JHOA 1D7OA 1CY1A 4RIFA 2DKFA 1IN7A 4DDHA 3CVUA 4FDLA 4KIFA 4BV3A 2ZEJA 3TFWA 1QM5A 2K5UA 1L7MA 4CKCA 1ODKA 4R1SA 5KU1A 2GBFA 1E5TA 1NJGA 3G2PA 1ZD2P 1N2CE 2G6TA 5IVHA 3QPDA 2JFZA 1UDWA 1YD7A 4Q12A 3AUJB 5LQCA 3HDGA 3K1TA 3PGLA 2O2IA 2QD1A 4OSOA 1P81A 1Z33A 3E9RA 4YRAA 5IAAA 4D3YA 3H3FA 3HU2A 1OQAA 2X2PA 3B1VA 2KJQA 2CDCA 4RS4A 3RFVA 4IFEA 4MXDA 2QZ4A 2QU8A 3W1VA 5MN6A 1THZA 1LPMA 5EJ6A 4FCCA 4EO9A 1O4VA 5H3CA 3RQSA 4C3ZA 3RBZA 4L6IA 4M53A 2Z95A 4QXAA 4MTLA 4ARUA 4ZT5A 3W2HA 5K2OA 3EMVA 1HV8A 1RJWA 3OJCA 4QPZA 5F33A 1NATA 4J7UA 4MGEA 2GXAA 4UUOA 1BE6A 2VXOA 2RH8A 3OQHA 4B0PA 2QN6A 4E07A 5BSUA 2P2SA 4G5OA 5KPJA 3KQKA 3RGGA 2GWHA 3B3QA 4OJMX 4JL8A 4QATA 1M2GA 5FWYB 2P1RA 4MQ4A 3RC7A 7MDHA 4OI0A 5EYPB 3U7JA 1GU7A 2NSHA 2FJ0A 4JUFA 1EFAA 3JD2A 3JRXA 3PC7A 3LCCA 4ZU1X 4H16A 3SWWA 3SJZA 2RD2A 4WBSA 4E70A 2IU6A 1TM3E 2QM8A 3E7FA 3G2NA 2HMTA 4ESVA 4Y9UA 2QTFA 2H1HA 3TX6A 3LO8A 1JBKA 2ZRAA 4N3GA 1LC0A 2XQFA 1JH9A 4D2IA 1IC6A 1Z38A 3K9NA 2BFMA 3W3AD 3CG4A 1R8QA 5JO0A 4NXMB 4I14A 1H2BA 2FPKA 3C4JA 4BTLA 1XDBA 3KYBA 1F5NA 4M8SA 5ECDA 2QIPA 2FF7A 2KYRA 1RLOA 1HXHA 2B92A 3BGSA 3CVOA 1HYGA 2W37A 4IW3B 1OASA 4MQEA 4ZQGA 4B76A 5K0EA 1A9XA 1O8CA 3RS8A 4CF6A 2D1RA 1J22A 1M8GA 5CIQA 4CMIB 2J7PD 4UPEA 2Q9CA 1QHGA 1O94A 2O59A 3HMKA 3FFBA 1C80A 2OBYA 2VJKA 5IX8A 1UJBA 1ID1A 4JJIA 1H65A 3WLAA 3U4GA 3A9RA 1T2EA 1LTHR 7MHTA 4OHCA 5ERYA 1UDXA 2VDWA 3VC2A 1L7BA 1UL1X 1OC4A 1GZHB 2V6MA 3G9XA 1U1FA 4Z9BA 3ILHA 3E2PA 4J7AA 3FTPA 1UK8A 1JNYA 3HACA 2VBGA 4OIMA 5FI0B 2OAEA 3JWGA 2CSXA 3C45A 2G17A 3AVYA 2OZLB 2BV3A 2MMCA 4HUTA 3WLIA 3PX3A 4D42A 1ZZGA 5JD3A 2INGX 1YJXA 2ZCVA 3HJHA 3S55A 4BL5A 2ZUFA 4AWBA 3DW3X 4B3IA 1GG5A 1XTIA 3PTLA 3DEYX 1F2UA 4FFVA 3EXG1 2NM0A 1PHRA 3OCWA 4U2GA 3FLEA 3TE7A 2VNIA 4J75A 4LXHA 4Z2YA 4YROA 5AM5A 4KFCA 3LXUX 2PUGA 4ZVNA 4YRPA 4TN5A 3OJLA 1RP7A 4ZI2A 1WSDA 4OGWA 2VTBA 4FZ5A 2DULA 2W4IA 3W9YA 2ZGVA 4OAPA 5LOVB 3DAPA 3AOEA 4L78A 1A7AA 3FBTA 4MGYR 3V7NA 5CW1A 6ABPA 2WIFA 3F6RA 4US0R 5CX4A 3LCJA 5CDFE 1E2BA 3IT2A 3RVOA 2VPWA 3B6JA 3LPAA 5AHKA 3ILYA 3NCTA 1NHGA 1NVVQ 1R16A 3KL4A 3LQ4A 3NM5A 5B37A 2AT1A 1LXCA 2D5AA 2Y68A 4BVKA 2JFWA 2OHIA 3R44A 1V25A 3E9YA 1BCSA 1QIDA 1T1IA 4D98A 1Y3DE 4XGKA 1W4RA 2FW1A 3T0FA 4B47A 3ONNA 3SGLA 4MO9A 3DBIA 1QZUA 1DFGA 2JAWA 4KGVA 3UJ8A 3H5TA 3AXSA 1COWA 4DLSA 1RWOA 4CKZA 4NEGA 4IHKA 4JR0A 4JP8A 3GLIB 5IJZA 1FSFA 3L7JA 3V9AA 3GMTA 3I9MA 2HF8A 3FYUB 2GK7A 3NHAA 2SKCA 5LNK1 5DTIA 3QE0A 1WXEA 3FOBA 1A8SA 4LV5B 2IS2A 2BAGA 1H8HD 1XNJA 4FMPA 4X63A 2A5DA 1X9GA 2K7ZA 3VR4H 2NUBA 5FL7D 3Q8XB 2HV9A 3FPGA 4IHJF 3EVZA 4I5GA 5DDIP 4F93B 2IYAA 5DHTA 3W90A 1XZFA 3EFHA 4PLCA 3S2GA 3U48A 1DKUA 3BGWA 1QTRA 4EMBA 1FBNA 2EATA 2MT9A 2SCUA 2WIKA 3V4PB 4ETMA 4R71A 3W2TA 2UUBB 2BSAA 4GECA 5E9JA 2AKAB 2HCBA 4UARA 3SZUA 3T99A 1J33A 4EL5A 1P2TA 2A33A 3KYIB 3LAWA 1SXPA 1N2EA 1VYUA 4JEUA 4WDQA 3U3MA 3V2IA 1LSOA 2JFNA 3JQEA 2FRXA 3MGBA 3QXHA 1Y3FE 1F1JA 1NY5A 2AWOA 2IYOA 1E1YA 1HDOA 1AKRA 4F38A 3BTVA 5DK4A 3S5JA 4B75A 1LB1B 3OLXA 1XVTA 3QRWA 2EGHA 1E5VA 1EXDA 4F8YA 3CF2A 1A2KC 2I2CA 1RZ3A 1FFGA 1VFPA 3QJGA 1NOIA 3CB2A 2I4MA 1DC8A 4EJ2A 5KSZA 3L02A 2X22A 3N87A 2A9OA 3H9BA 3S99A 1STOA 4MV0A 3ZW7A 1YB2A 1GZ3A 4L1KA 1UMBB 5E4YA 2O6HA 1DGQA 2X4LA 2FX5A 3OX4A 4H7FA 4XQEA 4L7QA 5FULA 1Y8ZA 2WU3A 3F7TA 1T9GR 3RAJA 3VDQA 2IV7A 1TTPB 5GV7A 3FJ1A 2WJJA 4D79A 5K51A 3KOMA 3HXLA 4L6AA 3DYIA 4V0OA 1SHJA 4YUAA 8GPBA 3VTAA 3DLHA 4LKRA 3EK2A 3PGXA 2PMKA 1RLJA 2ENUA 4LRYA 4CVNA 4PY2A 2VQEB 4L02A 1T91A 3H99A 1PS9A 3GZNA 3O91A 4RZUA 5KQSA 4WERA 2VDVE 3TLBA 5DNAA 3LMKA 3LIIA 3H7AA 4W82A 5AXDA 4WNIA 1T5SA 1PT9A 5DGIA 3W8EA 4BJ1A 2PGLA 4C76A 3EPJA 3MGCA 4CFZA 5FPKA 4B2LA 1QGYA 5DO9A 4BXOA 3SQNA 3FZGA 3MJRA 3O6VA 3VZDA 4FX2A 3GG9A 1DEHA 3OKCA 3V4FA 4BV2A 4DJEC 1LQ2A 3CF0A 4NYJQ 1M2OB 3E22B 4KH1A 2A78A 3CM0A 2H48A 1E3IA 3C3PA 4IJMA 1GY8A 4F46A 2JJ1A 1SKMA 4RJLA 4DIFA 5LP6F 1Z4IA 4NAVA 2OKCA 3WZMA 3I4FA 4Q15A 2QD3A 2X1LA 5HJ7A 4HP8A 3G3EA 3G2IA 4DY4A 2B37A 2BLNA 3JD3A 2G4VA 3T7RA 5JXIA 2EGGA 3FNBA 5IVKA 2TS1A 3A06A 3QKTA 3FDZB 1NPDA 3WDMA 4C22A 3D2AA 1GPMA 2O5VA 3MN1A 9ATCA 1Z8NA 1RVV1 4KZPA 4MUAA 4KIWA 4HUQA 2FWMX 1KJQA 2CNWA 3LY8A 5KS2A 1G3RA 4CNQA 1RRFA 4F9TA 5IM5A 3D64A 1A69A 2GI4A 2V7VA 4RFVA 2YQ4A 2RKBA 2Z3WA 2FDXA 4RFLA 2JHPA 2IK8A 3L8FA 4RQUA 3TM5A 3MYRA 1E8NA 3VR6D 3ZU4A 3BHMA 3N0RA 3HZRA 3JQQA 3AF5A 1QH1B 1C4OA 3IUQA 1IZ7A 3U4CA 2VH5R 3ETHA 3PS9A 3F9IA 5ALTA 3LGSA 3LPNA 1N33B 1WMFA 3B13B 2E7ZA 4J0CA 2XWPA 4I3GA 1KI9A 2OLKA 2YMQA 2G5PA 3EHEA 4HVAA 5L4LA 4FSDA 2RKOA 5DXFA 3OEED 4B31A 4E5PA 4KQ2A 4PHHA 4DSAA 1Z5VA 4C1NA 1GTVA 3LA6A 5BQOA 4CLOA 2XCTB 1R0KA 3LBFA 3OA2A 3ZK7A 5BY2A 1I7DA 4D8VA 4TXNA 1X2BA 4ZRDA 4D9BA 1DIAA 4CIYA 1HE5A 4HH1A 4O1MA 1XTPA 1P2VA 1V1JA 4H4CA 5FTMA 1WY7A 4TVOA 5JARA 3PITA 3RE1A 2W6JD 1WMAA 4JROA 1YWGO 4OMDA 2N1BA 2Z43A 4C0KA 5JS7A 3WYNA 1POXA 4TV8F 1FX0A 4KOEC 3FLAA 4BWGA 2F1IA 3IBSA 3CO5A 3UKJA 1G1AA 3RFCA 3KOXA 3OFNA 4XIFA 3AQIA 3IO3A 2Q1SA 1E2DA 2P1DA 1DHTA 3FKJA 2DU8A 4CIAA 5DV9A 3KR0A 1DDGA 4ZAZA 5G1OA 5IYZB 5TB5A 1LSJA 3HKEA 4KPYA 1XJ5A 2YJ6A 4DT1A 4D9FA 3C7TA 2DHRA 5J2UB 2WG1A 3NBQA 1Z68A 2IDMA 1YS9A 2VN8A 3LHIA 1U9CA 5IAKA 1RI3A 3DE0X 4HAIA 1TCAA 1OBFO 2HYDA 3HJNA 4G8JA 4S1TA 2IPAB 2KE5A 2PIAA 2XGOA 4DDUA 1KRHA 1XLVA 4YIHA 4XR4A 4WBNB 4ZT6A 4UEKA 3NHJA 4YRLA 2XUPA 4KREA 4MDFA 4KXQA 3ZGVA 1G9TA 1GADO 2Z8YA 3LLSA 4AZ0B 1M73E 4CIBA 3ERCA 5FBRB 2YNMA 3B6MA 1ZP6A 3OWHA 4YRSA 5EJ4A 5FI5A 3BTUA 3L8MA 5ALJA 3RW9A 4B2PA 4DA8A 1QHNA 5HF9A 4OHWA 3LQYA 4HZIA 1R8SA 2V7GA 5CK5A 4KIUA 1ZLYA 3FMGA 1KZYC 4BMXA 4YT2A 1WCXA 1ZUIA 2AC2A 1NP7A 3DHNA 4Q9AA 1UXOA 3MPOA 3KL2A 3WYCA 4WQMA 2QZJA 4JUDX 2W42A 1K68A 1KFJB 4M9SA 4OA5A 4G84A 4KXLA 3RU7A 1FFXB 3GRVA 2ZRNA 1USIA 1TM5E 1UJNA 1ZI8A 4EB6B 3FTEA 1CEYA 3LY7A 3GJ4A 3N2LA 3AF1A 3DE2X 4H1TA 1T9HA 4TMZA 4ZA2A 3WI7A 4QTYA 1QYCA 4IF6A 4XOIA 1Z3IX 2GRUA 2F7SA 3M5PA 5BT8A 3ZE6A 4HNAA 1V11B 5DULA 1JHAA 2WF9A 1YSCA 2W4QA 2P9GA 1R6VA 5GY7A 1UIMA 1XZKA 3WWOA 1ACLA 4OFXA 2BJVA 4GKKB 3N2IA 3Q6MA 3VVLA 1M0EA 3C5WP 4KSBA 5BR4A 1UOPA 2O8EA 5AUOB 2ZJ6A 3OTWA 4ZMRA 1HBJA 1XFAA 3OZSA 4ZI7A 3KSBC 2VSFA 4C4XA 1JVBA 2CT8A 1F06A 3L8EA 3OEWA 2O3RA 3QF7A 3C3AA 1AK1A 3EGDB 3IH5A 2WT8A 4LY6A 4O08A 4OQDA 4POAA 3I6MA 2EWMA 2YZ7A 1O0BA 5HZMA 1IN4A 1RC1A 4GOKA 1OU0A 5ILQA 4AZ3B 1SXQA 4HDAA 1IM8A 2W11A 2C88A 4BB0A 1FDWA 1NBWB 3N8IA 3RYFA 6GPBA 2R2AA 1BEEA 1A7JA 2VA8A 3OMXA 1KSFX 1SCBA 4QX6A 1QFYA 3IDAA 1U5BB 5D86A 4AJ1A 2ZS7A 5L8VA 3GP8A 2TECE 1NAHA 1JIXA 4M0MA 4YWHA 2W0MA 3LDHA 5P21A 3N6RA 1XXHA 4R2WA 3N2NA 4RE5A 4EFMA 1LPPA 3OSZA 4UDYX 5HOQA 1Z2DA 1PW7A 2HU8A 2YV5A 5FOUA 4LY9A 4NL4H 3I28A 4I6GA 1G8KA 1KQFA 1GU0A 5T3YA