4HFRA

Human 11beta-hydroxysteroid dehydrogenase type 1 in complex with an orally bioavailable acidic inhibitor azd4017.
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
260
structure length
255
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPLVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVMQAAPKEECALEIIKGGALRQEEVYYDSSRWTTLLIRNPSRKILEELYSTSYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Discovery of a Potent, Selective, and Orally Bioavailable Acidic 11 -Hydroxysteroid Dehydrogenase Type 1 (11 -HSD1) Inhibitor: Discovery of 2-[(3S)-1-[5-(Cyclohexylcarbamoyl)-6-propylsulfanylpyridin-2-yl]-3-piperidyl]acetic Acid (AZD4017)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 99
structure length 255
sequence length 260
chains with identical sequence B
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4hfrA00
2I6TA 2HMWA 4R16A 4UREA 1PJSA 1LEHA 3FNHA 4IPTA 3X2EA 3JYNA 3ZHYA 4GKVA 2Z1NA 2WD7B 3PWSA 1PJLA 4K1LA 4DTIA 2ZQYA 1V3UA 2LDBA 1LDNA 3FBGA 4L4XA 1M6WA 4OM8A 5A3VA 3ETEA 4CM4A 3EUWA 4I9NA 2GGSA 3KETA 1LQUA 1ZSNA 2JCYA 4MVJE 2HO5A 1ISFA 1JAXA 3ONEA 3TZKA 4TKMA 3ZWVA 1O6ZA 1PS9A 1P33A 2Q2QA 2D3TA 2CZCA 4RL6A 3SXPA 1X0VA 1LU9A 4FGSA 3VAZA 4YAEA 4IS2A 4IJWA 1GQYA 1PL8A 4A0SA 3CTMA 3UHAA 4RF4A 4I8XA 1XKQA 1GAEO 1P77A 2YV3A 4E6PA 4YB8A 4BGVA 3DBVO 4J4BA 3UUWA 1JTVA 3VOSA 1IULA 5T8KA 1C14A 3HFGA 3GHHA 2Y0CA 5TF4A 3RUEA 4AJ2A 2JAPA 4PFJA 1ZNQO 3GAFA 1OI7A 3CSDA 1ZW1A 2FZWA 4U6QA 3QSGA 4BHTA 3WBBA 3JQFA 1EDOA 3HN2A 3V8BA 3DOJA 2YHIB 1VPDA 3UCFA 1J6UA 1GZ4A 3O8QA 3G0OA 4RPGA 2GO1A 4LCEA 3DFZA 3GHYA 1A27A 4PZDA 3NKLA 5G4KA 4BNZA 1XDWA 1A9ZA 1K6IA 4DA9A 4FIZA 4GI2A 2BELA 4YJFA 2NTVA 3IC5A 3WBFA 4DIFA 3GFGA 4FFMA 1G0NA 1VI2A 4CV0A 5AYVA 4ID9A 4XCVA 1B26A 1KC1A 1J4AA 4EJ0A 4LVCA 3B1FA 5IF3A 4PLTA 2EKPA 3WQQA 4CL8A 2P9GA 5JE8A 4RDIA 2CVOA 2VUUA 1WNTA 1Z7EA 3KLPX 3KSUA 3TZCA 4XYLA 3M6IA 4CQMD 1GUFA 3JD3A 4I5DA 2Y1EA 3HFSA 3E9MA 4MINA 4B4OA 4FD3A 4WNIA 4PLWA 4TRRA 3VH2A 3GVIA 1O94A 2CF5A 5HA5A 2G1UA 4D0SA 2DUWA 1E0DA 4XRGA 2DTXA 1I0ZA 3H3JA 1DC5A 1UZLA 2EF1A 3TZHA 1AUPA 4XA8A 1P1JA 3C7DB 4JJFA 3VVBA 1DB3A 3WTCA 1PS0A 3OF2A 3S2IA 4DYVA 1P3DA 2GZ1A 3QWFA 3SJUA 3T7EA 4JNKA 1A7KA 4NFSA 3RUAA 2PH5A 3FBTA 1PIWA 4ZQBA 1PS8A 1HETA 3O9ZA 1PJ2A 1P0CA 3OQ1A 3B70A 4ZQHA 1L7EA 4CV2A 4E2WA 1WDMA 1A7AA 5T57A 3HB4X 4CL3A 5F5NA 2FPPA 1I3MA 3GG9A 3Q1LA 4LSWA 1E5QA 4Z0HO 5ILGA 4AJHA 5DDIP 3EW7A 4WEQA 4R1UA 2EW2A 1IE3A 3G17A 3ADPA 2NQTA 4BO9A 2B0JA 5C7IO 3I5MA 4CMKA 3LZ6A 1PR3A 3OA0A 4WLUA 1U4SA 5T6BA 3SVTA 3M1LA 4ITUA 1BTOA 4HXYA 7MDHA 1E7SA 3L6DA 4YA6A 3WYEA 4PVCA 1NASA 1VJ0A 4Q3NA 3ZHBA 4LRTB 4BS9A 4KUGA 1MC5A 5HS6A 5KKCA 2I5PO 4I5EA 3ZCXA 3U09A 1KVUA 1YL7A 3ZU4A 4DQXA 1XCBA 1DLJA 1LDMA 1IZ9A 1V3VA 5BR7A 4NG5A 3NUGA 1T25A 4J1QA 5DP1A 5JO9A 3PFFA 2G5CA 2W2LD 4BO2A 5AQ1A 4JJGA 3C8MA 3CEAA 3WG9A 5BSGA 1EBFA 5CDGA 5DT9A 4DVJA 2CFCA 4RLSA 1NVGA 1U5AA 3FI9A 5TC4A 1J49A 1XG5A 4UUOA 3LT2A 1RYEA 4Q3EA 3RJ5A 5TQVA 2AEJA 2NLOA 2UYYA 1C0LA 1JWBB 1Q2XA 2PGDA 3PEFA 4HNHA 4DMLA 4JBGA 2OZPA 5BT9A 3ST7A 4RCVA 5EMHA 4Y6RA 3DAPA 3RAJA 4XYGA 1T4BA 2PD6A 4E0BA 3HNPA 5F3RA 3RC9A 3RFTA 4F6LA 3PP8A 2O50A 2R00A 1GU7A 5F1OA 2PV7A 5TGDA 3TRIA 4D41A 4PZEA 1ISIA 1H93A 1SOVA 2JJYA 2IODA 3UGKA 1GQ2A 4YJGA 3CIFA 4NZ9A 4P4GA 3ZH2A 5LCXA 4BNXA 3H9GA 2JFGA 4FJ1A 5TJHA 3A4VA 1KERA 3P5SA 4EUFA 1E6UA 1F06A 2FP4A 4NJOA 2GD1O 4JP3A 5CG1A 2VNAA 4G65A 1A9YA 1FDSA 3WDSA 4AJEA 1N1EA 4BO7A 3OA2A 4J90A 4OMUA 1DFHA 4R54A 1U4OA 3O4RA 4D3SA 2O23A 4PG5A 2E82A 4M54A 4R1TA 4UEOA 3TPCA 1GPJA 3A1NA 4BO1A 2C29D 4ALLA 3WGOA 2JD2A 1MA0A 4IJVA 3WLFA 5JBIA 1YBVA 4CR7A 1LBEA 1PGOA 3RC1A 4NK5A 2OO5A 4BO4A 1K6JA 3AI1A 3AUAA 1C1XB 1I2BA 4U7WA 4QTZA 3MJSA 3WMWA 1RWBA 3N74A 3QV1A 3QHAA 2JL1A 4ZQFA 4TZKA 4W9NA 1O5IA 2P4QA 3GFBA 2FZEA 4HFNA 4R1SA 4M8SA 3F5QA 1GEGA 4J1SA 3TDKA 2EG9A 3Q9UA 4YPOA 1E92A 5L40A 2A9FA 4EUHA 2G0TA 1DOHA 1ZK3A 2YZ7A 3AM5A 3H5RA 4L73A 5KJ6A 2GSDA 3D5QA 3S55A 4KTTE 4WCFA 1BRMA 4CQLB 4EI2A 1HDRA 1EE9A 1LSUA 1T2DA 3KYDB 5JDIC 4OOFA 2X86A 4HWKA 3QLJA 3STHA 3K8ZA 2VHYA 2BLLA 2Q2VA 5DNAA 3IP3A 2F00A 4L9RA 5TJ9A 1HSZA 2WDZA 3WB9A 4BQRA 1HRDA 4CMGA 4OHUA 1IOLA 2FR8A 4XJSA 3LLVA 4LN1A 4OQZA 1GUYA 3MTGA 4YXFA 1DRVA 1B3BA 1AE1A 3JQ9C 3I6QA 4O0LA 5DBFA 5F1KA 1BW9B 1ZKMA 2RHCA 1P44A 1JKJA 3BYZA 2B5WA 4W4TA 2UUPA 2Q3EA 1T2FA 1V6AA 3VPGA 3ZHZA 3NDRA 4M89A 2J3IA 3H7AA 5L4NA 3VTZA 5JDCA 2WD7A 1DRUA 1ZEMA 3ETDA 4IY1A 1E6WA 1Y5MA 2W2KB 1ZBQA 3S8MA 1R4NB 1FF9A 4FOOA 3U0BA 2E4AA 2PH3A 1N8KA 5C37A 5A9SB 3G1TA 1XEAA 2X1HA 3LU1A 4J0EA 4YYZA 2EERA 3B1JA 5AXCA 1H6DA 1NQOA 3D5TA 2QRKA 2VTEA 3RUCA 3GDFA 3GEDA 3PWZA 1VE9A 1GCOA 4UULA 1JU9A 1KVQA 3EDMA 4XIYA 3GPIA 1AHHA 1W8DA 3NYWA 3L07A 2DAPA 3DZHA 1Q7BA 4PLZA 1ZSYA 4B3IA 6ADHA 1AN9A 1NM5A 3FN4A 3K73O 3WLEA 4ND4A 4J4HA 2ZATA 3OIFA 1TLTA 1ZK2A 2FHSA 3V2UA 1V0JA 4MOWA 4RF5A 1LXCA 2QYTA 4GL4A 4DQUA 2CVQA 2JCVA 3P19A 4OXKA 1MXFA 3WGYA 1LSOA 1GYPA 5T67A 1KY4A 4JCOA 3DONA 3RU9A 3KO8A 2WYWA 2Y67A 5IZCA 4PLHA 2B37A 1SNYA 3K31A 4QFCA 4CQMB 1MX3A 3GZNA 4DBZA 3K9QO 4CMEC 2NU8A 3WFIA 1LDGA 2YHIA 4YAGA 1Q0LA 2Y0DA 1GL3A 3OICA 1QYDA 3GVPA 3Q11A 3GGOA 2Q1TA 1I3LA 5F21A 1LDYA 1XYGA 3AM4A 4HFMA 1UDAA 1GR0A 3TSCA 3CMMA 4IDGA 4EGFA 4ZRNA 1ZMTA 5JAMA 4J43A 4B7UA 4BUCA 3FWZA 5IAAA 1K6XA 4AG3A 1M75A 3BMNB 4BNWA 3U4HA 2FOIA 2CD9A 4AJLA 4A2CA 3OQ6A 1UP6A 2I65A 3DZIA 3OJLA 2E48A 4PN3A 1SAYA 3DBLB 1S6YA 2E37A 4NFHA 4J4TA 3V1YA 2UV8A 2PD4A 4I9HA 4RF2A 1R6DA 2VRBA 4E5YA 1QMGA 1SO8A 4R1NA 2IZZA 3HHPA 3WQRA 1MFZA 1M2WA 1DDOA 2BGMA 2VUTA 2YQ5A 3K2BA 3L6EA 2YY7A 2H1SA 3FWNA 2JKVA 5AXBA 4BO3A 3CINA 4IDAA 3RU7A 2BGLA 1DO8A 3HWRA 5A9TA 1UP7A 3L9WA 3RCBA 5A04A 1YQDA 1RPNA 3JTMA 3KOUA 2ZB4A 3LC1O 1LA2A 1PQUA 2CDAA 1FDTA 1VSVA 2VHWA 1B15A 1ADGA 2X23A 3FNGA 3CUKA 4I08A 2D5AA 5T64A 4ALIA 1H0KA 2GUGA 1VSUA 5ICSA 1GQQA 3PYLA 1ZZEA 3EGOA 3N58A 4NBRA 3GVCA 1I01A 5K6AC 3DTTA 1B0AA 3UCXA 3PHLA 2JD0A 1ZCJA 1U5CA 4BNMA 4CLXA 1K5HA 3H9EO 4YCAA 3DL2A 3NDIA 1GPDG 1PTJA 2X9VA 4M49A 4W99A 2VYVD 4DC0A 1B8UA 2A94A 4ALKA 5EESA 3UN1A 5LC1A 5L4LA 1V8BA 1PR9A 2ZJ0A 1E77A 3JQ8B 5JY6A 4PG4A 1VM6A 3I9NA 2O3TA 4DRYA 4Z9YA 3C1TA 3L6OO 3R3SA 3TL2A 4FPXA 1SBYA 1YL6A 4RZIA 1RM4A 3JYPA 4Y98A 4BGEA 4XGIA 1SMKA 4K9DA 3TZQA 3I9KA 4BNTA 4KTVE 1XWFA 2Y05A 4FB5A 4ALJA 2WTBA 4QX6A 1X7HA 1UXIA 3Q9NA 2P5YA 4CM8B 1F12A 2Y1DA 1O89A 2HRZA 4I1IA 1R16A 2PKRA 3JQ7B 3PWKA 5LDGA 2R2GA 5DOVA 1KVSA 2BFPA 1B8VA 4GWKA 1F8FA 1U28A 4UVHA 4OQYA 3H5NA 1Y1PA 3QVXA 4XRRA 5JCXA 4D43A 2Z95A 4DBVO 4E33A 1U7HA 3DO5A 2X5OA 2FPGA 1A72A 4NMHA 3OHSX 4FFPA 3GOHA 4JJIA 4MVJI 3RVDA 3JQBC 3AU9A 5DCWA 4E4YA 3BTVA 3Q2IA 2HSDA 3ZZNA 4IZHA 3ZWNA 1SOWA 2ZTLA 1EBUA 3FHLA 2VRCD 4CMIB 3H2SA 3FSRA 4JXKA 5BNFA 1H6AA 3DDNA 2VZ0A 2HK9A 4L0QA 3FPLA 1E3SA 5CEJA 3M2PA 5EQDA 1CF2O 1EK5A 2VT3A 1HL3A 3KSZO 1SC6A 4D42A 2BMAA 4TRMA 3WXBA 4BKUA 5A1TA 4XIJA 1DEHA 1CQJA 3Q0EA 3V2HA 2OBNA 3LVFO 5FYDA 4Q9NA 4FGWA 3BAZA 3JYOA 5MGBA 3FNFA 1YDWA 4MVJP 1R0LA 4MP3A 5K9ZA 4G81A 4LW8A 1WDKA 1GZ3A 3LT0A 4NNJA 3ZU5A 5JYEA 3FR7A 1Q1NA 3IKVA 4MKZA 3H9QA 4NI5A 1T1RA 2RIRA 2A92A 1HYGA 4H15A 2I3GA 1YBAA 3NJ8A 5ENVA 5TLSA 3LT1A 5I9NA 1AXEA 2PZLA 1DC4A 4LMPA 3UXYA 5KVSA 1IUKA 4ESOA 4YRAA 2NVUB 3NV9A 4ND2A 4XDZA 1WMBA 5KJ1A 3VZSA 3AOGA 2GYYA 2OXIA 5IDQA 4FCCA 1RM3A 2VOEA 4HX5A 3F5SA 4J7CA 4CLRB 2PA3A 3ICPA 4PRKA 4AJ4A 4BL5A 2D2IA 5EN4A 3DB2A 3RI3A 1C1XA 5KVCA 3HSKA 5I9MA 5TSDA 4R9SA 3ZWXA 1X15A 3WNVA 1Q7CA 5KJCA 1NXQA 1A4UA 3ZV5A 1CQIA 1I2CA 1LC0A 1L1FA 4YBZA 3WTBA 2OP0A 4XX0A 1ONNA 4DYDA 5JCJA 3RBVA 4H3VA 2RCYA 4NJMB 4ZICA 4Y6SA 4CQLA 4E30A 1NQAO 2B5VA 1Y8QB 5I7FA 2QIOA 4YWJA 3MZ0A 1R15A 5KVQA 2Y1OA 1U8FO 2AEFA 4YEDA 4RVUA 3INRA 3NTRA 1A5ZA 5BSFA 2I76A 3QQPA 4R41A 5CP8A 4DXHA 1Q7GA 5H81A 1F14A 2IRWA 2OP1A 2ZYDA 3ENNA 4PG8A 4B4WA 2WE7A 3G3EA 1JA9A 1QYVA 5AOVA 1T24A 2RH4A 3PQFA 2OBYA 2PKQP 4NBVA 1KIFA 1JLLA 3IJPA 4CUJA 5H83A 4WLNA 4KMSA 1NR1A 1U9JA 2PFGA 1PGPA 1HF3A 3W8EA 1R12A 3DBRB 4WUVA 1MG5A 3G79A 3RC2A 4EJMA 2C82A 2VOJA 2Y1FA 3ORFA 4LK3A 1B16A 5CG2A 4U6SA 3ZDFA 1ZUD1 2GERA 4GX0A 3MWEB 3CKYA 3PIDA 1R37A 5CDYA 2BD0A 4D44A 1R4NA 3ROQA 4YRBA 4YAJA 4DPKA 1KS9A 5COAA 3ANLA 2Q99A 4E2ZA 1YWGO 2P68A 3U9LA 1MGOA 3ANNA 2NTJA 3DR3A 4IQ8A 3UICA 1X7DA 3M2TA 1PL7A 4WLOA 4A26A 5KOIA 1DFIA 2VNSA 2DPHA 3PGXA 3PYXA 1ZSVA 4CR6A 5JC8A 1OAAA 1GADO 2JFFA 4EBFA 1RYDA 1PJQA 2ZIZA 4DGSA 5JS6A 4QXMA 4OH1A 1MLDA 3DMTC 1TT5B 1Z82A 2DFDA 4IDCA 2G82A 4L76A 4JK3A 2J5RA 4Z9XA 4GLOA 3QE3A 1LLQA 4YVFA 3RWBA 4F45A 5L7YA 1I8TA 1PZGA 2X58A 3L4BC 4R01A 2VWPA 3FR8A 3LF2A 5T5QA 4CQMA 1CWUA 1M67A 3PIIA 1QG6A 1HZZA 3U4CA 2IXAA 2WWRA 1PZHA 2WMDA 1M6HA 3BMQB 1C1DB 4Z6KA 4R69A 5JDIA 4DPLA 3FPCA 5G2OA 2HU2A 3VZPA 1FJHA 2DPGA 5HRUA 3QVOA 3KV3O 1E7RA 1CETA 3C24A 4ND3A 4YQZA 3D4OA 3DEYX 3K2EA 4KP7A 2NADA 3BMNA 5JY1A 3DHEA 4CV3A 4ZHSA 4JGBA 1LDEA 1UAGA 1WDLA 1QV7A 3JQ9A 1QORA 3BXXA 4RGBA 4YJHB 2EKLA 2V6BA 1BDMA 3QP9A 1PSDA 2CVZA 3SLGA 3DBLA 2PD3A 3IOYA 3NRCA 1IYZA 4OKNA 4RVFA 1BXGB 1NWCA 3PFWO 3B1KA 1KEWA 2DT5A 3K6JA 2PLAA 3GMSA 3RUDA 4BNYA 2PZMA 1JKIA 2Y66A 1BXZA 1LLCA 1M76A 3QY9A 3U4DA 1VJTA 3QW2A 1DXYA 3ONFA 3RFXA 3WIDA 4TQGA 1GCUA 4OYRA 3TWOA 9LDTA 1ISMA 1SZJG 3GN1A 3K5PA 1U3TA 2ZB3A 4GSKA 4ZGWA 2AG8A 4WOJA 4MJLA 4GAEA 4ZQGA 4RPKA 1WAMA 2BI7A 4FS3A 5U1PA 4YT5A 1Y7TA 5L4SA 2PGJA 4UVEA 3SBOA 1DFGA 4D3FA 1KEVA 2IYOA 5HWSA 4E32A 2WEKA 2ZCUA 4B8WA 3OECA 3F1LA 1P0FA 5B37A 5CFZA 3U49A 4F3YA 1ZFNA 5DCYA 5JAIA 4CM7A 3L0DA 2HCTA 3JQAD 3KM0A 3GY0A 4BMVA 2NNLD 2DM6A 2W2LA 2WYVA 4INAA 3PJEA 1U8XX 3BTOA 4MKXA 2JD1A 1VL8A 4CODB 2HKIA 1VKNA 3W1VA 5CEFA 3G1UA 5BSHA 4L75A 5DF1A 1NP3A 3RASA 3H65A 1D1SA 4CMEA 3SLKA 5A5FA 4II3A 4P8RA 1XSEA 3HG7A 1F8GA 2VTDA 1D8AA 1YGYA 2O2YA 3JQ8A 2JHGA 5U9CA 3ZWYA 4FFOA 3F4LA 4BO0A 2DUUA 3SC4A 5G0VA 4JQCA 2C5EA 4BMSA 1X14A 4Z9FA 1Y6JA 4IM7A 4CUZA 3JCZA 1X7GA 1YJ8A 1H94A 4WKGA 2JAHA 3W6ZA 3GNSA 4OGWA 3QWHA 1H6CA 1NHWA 1E3IA 3D3EA 4HP8A 5I8WA 2TMDA 2AMFA 3HDQA 3L9XA 4PLFA 1NPYA 1TVEA 2J3JA 4CM8A 1M66A 3TFQA 3JQ7A 3PYMA 3KHUA 4U0KA 1WMAA 1NFFA 4BNFA 3LK7A 1ZJYA 5JNLA 3BMCB 3P7MA 3H4VA 5JPIA 3ZW8A 3ANMA 4UEKA 1F0YA 1SB9A 2GZ2A 3JSAA 4IQGA 4YRDA 3PJGA 5C3MA 3GDOA 3EYWA 1P45A 5B4TA 1C3VA 3MJ4A 4R9RA 2PR2A 1LC3A 3KZVA 3T4EA 3WOHA 3DWFA 2V7PA 1ZIDA 1OMOA 1I24A 1P74A 3F3SA 1EUDA 5TS3A 1PWZA 2GZ3A 4CMIA 2P2SA 2YW9A 3D3WB 5CEEA 3IUPA 3ZWWA 2PZKA 4GKBA 4ZVVA 4NH4A 5K6AA 4ZU3A 4MVJH 3WJAA 3ITKA 4PGFA 2OFPA 1ADBA 2X9GA 2HAEA 4YJDA 4RPLA 4J2HA 5K0ZA 1ENPA 1NTOA 3OJOA 2Z1MA 1T2EA 1YB1A 1PJTA 2C0CA 2YJZA 4II2A 2VWGA 3WGZA 4BKQA 1EFLA 4NU6A 2NU6A 2O3RA 4TRNA 5JAQA 3OEYA 2QG4A 5DP2A 3WGGA 5L3ZA 4J9VA 3RBXA 1I3NA 2Q1WA 4Q39A 2VHZA 1E7MA 2WYUA 1I3KA 3VTFA 3W4KA 1ONPA 1YQGA 5ER9A 1YS4A 5HM8A 2B83A 4UEJA 4QFDA 1O95A 3E9QA 3CPSA 4BMNA 4CLOB 2EP7A 3B20A 1ENOA 2ZYAA 2WM3A 2P91A 2AHRA 1NQ5A 3FTPA 4GVXA 2NVUA 3EZYA 1U2DA 1UXHA 4WLVA 2Q50A 1IPFA 3CMCO 5I9LA 3EVNA 1U3VA 1Z73A 3UAGA 2BHLA 3DOOA 1E3LA 5ADHA 4CLRA 1J5PA 3DQPA 3MOIA 4TZTA 4J49A 4BVAA 4FQ8A 4DUPA 2O2SA 3SJ7A 3VDRA 2X0RA 1FDVA 2J3HA 2UAGA 3UVEA 1DIAA 1GDHA 2A4KA 4LGVA 2DQ4A 4XQEA 4OOEA 3WR5A 2B4RO 1DIBA 2FN7A 3FCOA 5IXSA 3KTDA 1UH5A 5B4UA 3JQBA 4G5HA 1PGQA 2HMTA 1CRWG 1KY5A 4E31A 3A14A 3AY7A 3X2FA 1ZJZA 5JXWA 1QKIA 2ZKLA 3ZU2A 2GCGA 2DFVA 2NV6A 1EZ4A 3BHMA 2Q46A 1WWKA 4ND5A 1IZ0A 4IINA 4B8ZA 5JAZA 1CIVA 4ALNA 5I7VA 3JQEA 4OAQA 1D4FA 3PZRA 5A06A 2QHXA 5FEUA 5ENDA 2HLPA 4N5NA 3HADA 3RUHA 2V6FA 1H5QA 4X54A 4DL9A 2NSDA 4QUKA 3IL2A 4E2XA 5KVVA 1EVZA 1X1EA 3PHJA 1QYWA 4NIMA 4NU5A 1NVTA 2QRLA 5FI3A 4XDYA 2X4GA 2PGLA 3PTZA 3QIVA 4J91A 5DZSA 3Q3CA 3R6DA 5TT0A 3UW3A 3HDYA 5GZ3A 5HS4A 3BHJA 1E5LA 1KVRA 3INTA 2CY0A 1PQWA 4DC1A 1LI4A 2H9IA 3IJRA 3NAQA 5J23A 4PLYA 3I9OA 1OC4A 5DN9A 1WXDA 5GZ6A 3JQDA 1UAYA 2GN6A 4XD2A 5CDUA 5MDHA 2FSSA 3CZMA 1E1LA 4KDFA 2UDPA 2D1YA 3WQSB 4P4LA 1D7OA 4WJZA 2Y1GA 4UAGA 1Z7BA 4BOYA 4UUMA 4KWHA 1W6UA 3VPHA 2H5LA 3GGGA 5GZ1A 4PVDA 4TWRA 1IB6A 4Q3BA 1NR7A 1LTHR 4PG6A 1VRWA 4O1MA 5BNTA 2HMVA 1WP4A 3GZ4A 1CDOA 1XU7A 3DAFA 3ZNOA 1KBZA 1E3WB 1TT5A 4YR9A 4J3FA 4JP2A 2I99A 2X9NA 2W90A 2Z5LA 4ZRMA 3D1LA 4B7CA 3D4PA 4D0RA 1N92A 2IDZA 4GX5A 5G4KB 1R0KA 1OZAA 3VH3A 3WGIA 4MO2A 4MVJF 4IQ0A 1DJNA 2AXQA 2HRBA 2P9EA 1LRKA 1EMDA 5AVOA 4R3WA 2Y1CA 4NHEA 1E6EA 1XQ6A 1MC4A 3R3JA 2C7GA 2J5KA 4KUHA 3LQFA 5CHEA 2P4HX 3TN7A 1N1GA 3DBHB 1HDOA 4K6FA 3W4JA 3ZWPA 4U8GA 2YV1A 3ICCA 3TFOA 5C5IA 5ICMA 5A5EA 3WGHA 2AQIA 2H6EA 1LSJA 3ADOA 3JQAB 2W8ZA 4BB5A 5TNXA 4ZN6A 4N18A 1NFQA 1NYTA 4YJHA 1VLLA 3AOEC 3RQSA 4J16A 1YH3A 2J3KA 3PDUA 4ND1A 1K3TA 3JQGB 3MJCA 3OMLA 4Q3DA 5A3JA 1TI7A 1YQXA 2RAFA 2B69A 2WE8A 4ZJUA 1ULUA 1OOEA 2VYVA 4LVUA 5L9AA 1BXGA 5I8ZA 1MFPA 4XJTA 2XAAA 1YONA 3PRJA 1Z45A 4IBOA 4C7JA 4Y67A 4BKRA 1T26A 4YTEA 4CJXA 2QRJA 3N7UA 4CMJA 2DBQA 1YOVB 2RBEA 2NUAA 4QO8A 4O5OA 1HLPA 3GGPA 1EUZA 3UH1A 2O3UA 1P1HA 1C0IA 3ZV6A 3ENKA 4FOSA 4YAKA 4PLGA 3VPSA 1UR5A 3E6AA 4KZPA 3TZ6A 4LCJA 3NT4A 4DLBA 2O3SA 1EK6A 1TB4A 1JN0A 3HDHA 3KLMX 1GV1A 3RKUA 3GRPA 4RQTA 4C7KA 1XU9A 4B4VA 1RKXA 4J7UA 2BKAA 1WW8A 1EQ2A 1K2WA 5KJEA 3EC7A 2CUKA 3U3XA 3DMTA 5CAEA 1S7CA 3QWAA 4KDEA 4ONEA 2RHRA 4BKOA 2VYND 3I9MA 4YT2A 2AE2A 3IMFA 1HDYA 3O03A 3WMXA 2VN8A 5B4VA 4ALMA 2FRDA 4OJNA 1T2AA 3PZBA 4GGPA 3L4BA 4R3NA 4FFRA 3Q6IA 3H5AA 4MVJD 4C4OA 4EUEA 2GDZA 3I52A 4N7RA 2YDXA 4K28A 2ZTVA 3O26A 4JIGA 4PCVA 1I36A 4B4UA 4OXNA 3HQ4O 1EVIA 2VRCA 3ZV4A 2HQ1A 1ZK4A 2PZJA 1U2GA 1MV8A 4WGGA 2NU9A 3JD2A 4BNUA 2HUNA 4DQVA 2Q49A 3IIEA 1T2CA 4BNLA 4E2YA 4XYMA 1JKFA 1ZK0A 1ZO8A 2YQ4A 3D64A 3OJEA 3BHIA 4BNJA 3DC2A 3HZZA 4EJ6A 4CM5A 3NGLA 5L51A 2NACA 4BB6A 1Z75A 4KOAA 3S1LA 1GZ6A 1XLTA 4IDBA 3QVWA 2D5CA 3GA0A 2C20A 1PZEA 1D1TA 4OSOA 5DOZA 5A4DA 3VH4A 4NK4A 4WE3A 4XWYA 3COSA 1WPQA 1GV0A 8ADHA 2Y99A 4CM9A 1E1NA 4GGOA 4CR8A 2BFMA 1Z74A 4D45A 4IZIA 1QSGA 3KYCB 4TVBA 5HTOA 3AW9A 1I33A 3UF0A 3GNQA 4WNCA 3ROKA 4HFJA 1EDZA 1NFRA 1SB8A 1X1TA 3TNLA 1ENYA 1NPDA 1NWHA 3CZRA 4BO6A 4GQAA 4Q3AA 3I9JA 4BGUA 4XGKA 2BGKA 4CLHA 3VDQA 1YRLA 3D3WA 1YO6A 4HNGA 5C7LO 3PK0A 3C3XA 5JMWA 1BMDA 4XGNA 4RJTA 3G49A 5IN4A 1LLDA 4J9UE 4NR0A 3GG2A 5CPBA 4BV8A 5KCZA 1BVUA 4FFLA 1YE3A 1LQTA 4U0JA 3F6YA 2C7VA 1PQPA 5G0WA 2Q1UA 3LYLA 4QO7A 1X13A 3GK3A 3HDJA 3M1AA 1TXGA 3ZI0A 3IP1A 3ZWBA 5BSEA 2YFQA 1HLDA 5L53A 3Q2KA 4AJKA 4J6FA 5EQFA 1UXGA 1V35A 3DOCA 3CH6A 4GVLA 4JROA 1BDBA 1GD1O 3ABIA 3BZUA 5TT1A 3D7LA 2OUIA 2UVDA 4GMFA 1DBVO 1FK8A 1HDCA 3F4BA 1B14A 2GN8A 2QYSA 4FC6A 5KJFA 1YL5A 1NAIA 2DVMA 1ISGA 2X0NA 4XYBA 4NBUA 1BVRA 4CLOA 1QLJA 1YVEI 2QW8A 3GR6A 4WPGA 1V3TA 3AWDA 3GH3A 1KEUA 3K30A 5DBGA 3HUDA 2RH8A 4XQGA 5TRTA 1NAHA 1NVMB 4N5LA 3DMYA 4E3ZA 4BKPA 3C7CB 3L4SO 3E03A 1EFKA 2ZJ1A 2OMEA 3B6ZA 2B4TO 3KXDA 3LT4A 4MDHA 2EXXA 1IHYA 2VZ9A 2ZB7A 3AUTA 1PU2A 3C7AA 1NQTA 1U1IA 2X8LA 3RC7A 3UKOA 4Y9DA 1N9GB 4MVJG 3S2GA 3KYDA 1VJ1A 3ZNPA 4ILKA 4UVIA 1PWXA 1QR6A 3I3OA 1E3EA 4PG7A 4DLAA 3GUYA 1R4MB 3F46A 3SEFA 4CPDA 1W4ZA 4HFRA 4J1NA 3JQCA 4JBIA 2VWQA 3RROA 3JV7A 3GC6A 3OETA 1EVJA 5B1YA 3JYLA 4P38A 4RDHA 4XR4A 3E9NA 4IS3A 5JFOA 2IZ1A 1OBFO 1DHRA 5CPFA 4LSMA 4AICA 1B7GO 4Z0TA 3SX2A 1BW9A 3C1AA 4O6VA 4KWIA 5TIIA 3KEQA 4Q3CA 5G0SA 4DIBA 5C7OO 3PHGA 1GY8A 1O0SA 5A9RA 1G0OA 3VVCA 2BRUA 2GPTA 4GMGA 3GRKA 4Z0PA 1CYDA 2W2KA 2GF2A 4OXYA 4Y6PA 2I3AA 1XGKA 4G2NA 4D3DA 3R0IA 5AXAA 5JCJD 5G0UA 5FI5A 5A9SA 1MXHA 2UUOA 4RORA 4UVDA 3NT5A 3AK4A 4IXWA 1LX6A 4R51A 4DPMA 2V65A 1R0SA 3WSWA 3KB6A 1MP0A 4NQZA 2NQ8A 4BQPA 3U4IA 3GMDA 2YHUA 3IKTA 4TVOA 3F9IA 5THQA 4E5NA 3ASVA 3OJFA 1PJCA 1QYXA 2GN9A 4PLCA 1SCUA 1U3WA 1ORRA 2O48X 2JHFA 4YDRA 3FD8A 4IMPA 3H9UA 4EITA 4PLPA 1ADCA 4A7PA 3OM9A 4MKRA 1LRLA 3ONDA 4L74A 3ZWCA 1FXSA 2WJPA 1YDEA 1DPGA 3BIOA 3PLNA 2OOSA 4RPJA 4CMCA 2DU8A 3LDHA 9LDBA 2IYPA 3GDGA 3GZNB 1HE2A 3RJ9A 2EGGA 3FRJA 5G0TA 4CLDA 3HB5X 1PJBA 3DXFA 4EDFA 3EAGA 2GR9A 5FFFA 5IJZA 3IQDB 2Y0EA 2C5AA 4RO0A 3KVOA 2QX7A 1HDZA 1E3WA 3A9WA 3TF5A 1UDCA 1EEHA 1SEVA 5KNLA 1N5DA 4O59O 3L77A 4CMAA 2XXJA 4J2OA 2WSBA 2IEDA 5ES3A 1RM0A 3BMOB 2R6JA 3OJ0A 1DSSG 2POQX 3H8VA 4OIMA 2DBVO 2IZ0A 4Z3DA 3GEGA 3AY6A 4BV9A 2AG5A 1Y8RB 3DBHA 4FBGA 1U3UA 2D59A 2AQHA 2NVBA 1IL0A 1RJWA 4QEDA 3ROMA 4JX8A 1X0XA 4B7XA 4XR9A 4GH5A 2C07A 3PQEA 2VQ3A 3JQAA 1V9LA 1LRJA 4M87A 5L7WA 4F46A 3NDJA 3JQGA 3GEMA 4W82A 2NWQA 4AVYA 2FY8A 3A06A 2Y68A 5F5LA 7ADHA 1O9BA 3T4XA 5A05A 1H9AA 4AL4A 1UXKA 1TEHA 3KYBA 3O38A 3KEOA 3NX4A 3ZWOA 1Q0HA 4BNKA 3WNQA 4DIOA 3KBOA 3NEPX 2X5JO 1YOVA 4URFA 3GF4A 4S3MA 4EZBA 1ENZA 5IN5A 1DIHA 2VHXA 5THKA 3PVZA 1N2SA 1ARZA 3R1IA 4YT8A 2NVWA 4HUJA 1KYQA 4W7IA 4DREA 4DLLA 1WLYA 4MVJM 3ZN2A 3LC2O 1B8PA 5IG2A 3ZWMA 2HJRA 3LLSA 4OL9A 4O63O 4BNGA 1NBOA 3AFNA 3QRWA 3EZLA 1BGVA 2O3JA 3I1JA 1AGNA 4FSHA 3OEWA 6LDHA 1ZEJA 1XIVA 3LC7O 1GTMA 3OP4A 4IUYA 5FF9A 1CEQA 1P9LA 4OKIA 2EJWA 2X5KO 4QSMA 4J1TA 2YFHA 4A5OA 1XHLA 3MCVA 4WECA 3T7CA 3ASUA 4XQCA 2CNBA 4F6CA 3HN7A 4NPCA 5G4LA 4FJ2A 4D79A 4CLEA 1UP4A 3E18A 1IY8A 3W6UA 5F1PA 1L7DA 4A10A 1UJMA 2BFAA 2WD8A 2AQKA 3VKVA 4XZ3A 5COQA 4WOKA 1I32A 1C0PA 1LJ8A 3IUSA 5DBIA 1ML3A 1DIGA 2Q2WA 4OSPA 4B79A 1GYRA 3C1OA 4CV1A 4RVHA 2O7SA 3AOEA 3WYBA 1P31A 1PGNA 4EEXA 2X7HA 1XELA 1SEPA 4IJUA 4RV9A 1EUCA 1DRWA 3OIGA 1H2BA 3MJTA 5L7TA 2YDYA 3AUUA 3ZW9A 1G6KA 4P22A 2D0IA 4WASA 3GPDG 1H9BA 5EIOA 1BWSA 1DJQA 3FNEA 1YKFA 1FDUA 1YB5A 1C0KA 2O4UX 3ON5A 4ROSA 2CSUA 3AFMA 5JSFA 3KYCA 4FFNA 3AU8A 3AUSA 3QJ5A 2O4CA 5JC1A 2IEBA 2D4AA 4FDAA 4AJIA 2FWMX 4JBHA 1BXKA 3W8DA 1K0UA 4ZD6A 2SCUA 2Q4BA 2BFOA 4P4NA 5JLAA 4HKTA 2E6UX 3ZHXA 2V6MA 4DWVA 3DZBA 3JD0A 4NDNE 2EKQA 4U5QA 4WCDA 3P2YA 4K26A 1W0CA 2C2YA 3GQVA 5AXDA 8LDHA 3CE6A 3GNTA 1TA4A 2XOXA 4LISA 4HV4A 3H6KA 5A03A 3WWYA 2XXBA 2A35A 3PGJA 3WGTA 5IDWA 1QP8A 2HJSA 2C59A 2DKNA 3EMKA 4KUEA 4AJPA 5KTKA 1HE4A 3U62A 5EERA 4B3HA 3GT0A 1H2HA 3NGXA 2H63A 5T8KC 4E5PA 1NNUA 1JWAB 1AHIA 2X0IA 4A03A 2AA3A 4IXTA 4KQXA 1N7HA 1RM5A 1LDBA 2AE1A 1HWYA 3DFUA 5ITWA 2EW8A 3V1TC 4GPD1 3QWBA 4I5GA 5FWNA 1PL6A 3JQFC 1HT0A 4J0FA 1YJQA 1CJCA 3S2FA 1P1FA 3I83A 3MTJA 5KKAA 5KWEA 2OL4A 4IDDA 3VKUA 2LDXA 1VC2A 4AJOA 3JD4A 1DLIA 2VWHA 2F1KA 1A71A 5JYDA 1LLUA 1OC2A 2TMGA 3I23A 5LDHA 2CDBA 3BTSA 3ZU3A 1ZXBA 3K96A 3D0OA 1G1AA 4PLVA 3WGQA 2FMUA 2DTDA 2FSVA 2AQ8A 3DZJA 3KUXA 1GEEA 4BNVA 3FTNA 3GLQA 1P1KA 2ZYGA 1I2ZA 4MIOA 5L95A 4IIVA 1ZH8A 3RKRA 4NJMA 1ZXLA 1GFSA 2EHDA 2VHVA 1UDBA 1N9GA 3W4IA 1NHGA 1Y8QA 1E3JA 2DBRA 4W6ZA 3CXRA 2JCXA 2HMSA 1R66A 4IGFA 4B3JA 1R4MA 1XR3A 1ID1A 5DCUA 4AFNA 5BQFA 4TROA 2ZQZA 5ILOA 1TT7A 2ZTMA 3GN2A 2EV9A 4UUPA 4EW6A 2X6TA 4XB2A 1ADFA 5EPOA 4WLFA 3K92A 4CM4B 2O3QA 4K6CA 5IFLA 4BIIA 2FPIA 2GN4A 4FR5A 4AJNA 3U5TA 2VUSA 3SC6A 4M86A 1VKOA 3DBRA 3AM3A 1WZIA 4FC7A 5BNIA 2Y93A 3EVTA 4E13A 2GASA 5I7SA 5JO0A 5H82A 3DHNA 5IDXA 4CM1A 4RLHA 1WVGA 4EYEA 3DZKA 1F17A 1VL0A 3DHYA 4NBTA 5IZ4A 2JFHA 4IMRA 2BH9A 1O8CA 2ET6A 2W98A 3TOXA 2B36A 3PJDA 1LUAA 1HSOA 1PGJA 2I9PA 2ILTA 2ZK7A 3PHHA 2GRAA 4R68A 3TQHA 3WSVA 1JW9B 1UZNA 4MIYA 3KSDO 3O8QB 4S1VA 4XB1A 3RBZA 3H2ZA 5EL0A 3UOGA 2EJVA 2I66A 4R4JA 4N5MA 4MPDA 1SPXA 3AI2A 4M55A 3LF1A 4PZCA 3ETGA 4GBJA 3IAHA 1OFGA 3JYQA 4M1QA 4WK6A 1YXMA 4KQWA 4R5HA 4YJFB 3OBBA 3RD5A 3ZGYA 4FW8A 4YT4A 2DC1A 1E7YA 1D3AA 2O7QA 1DAOA 3EY4A 4RF3A 3VZQA 4IDEA 3NJ4A 3BMQA 1C1DA 4FJ0A 4XYEA 1XA0A 3DZFA 4GX1A 4IIUA 4PRLA 4YACA 3VHRA 2QZ9A 4H16A 1QYCA 4HBGA 4Z3KA 3WFJA 4ZA2A 2CMDA 4GLLA 3GAZA 3WX0A 4UVGA 3ITDA 4BNIA 3MOGA 3VC7A 3BMOA 2W4QA 4HADA 3WIEA 3GVXA 1HE3A 2V6GA 3H3FA 3V2GA 4QECA 3BTUA 1Y8RA 3S2EA 4Y8VA 2PK3A 4BNHA 4CMBA 3I6IA 2PTGA 2GLXA 2Q45A 2GNAA 2R00C 3HJAA 1PX0A 4E12A 3WJ7A 1JVBA 1QLHA 2VYNA 3E5MA 3ROPA 2NTNA 1UUFA 3QA9A 4BO5A 1Q0QA 3RUIA 4LMRA 3P2OA 3I4CA 1YBMA 2X0JA 1DC3A 1P1IA 2I67A 4LRSB 4IJKA 1T1SA 2FR1A 3RSHA 3RUFA 4AJJA 4JLWA 2CDCA 5IXYA 3E82A 2OGUA 1HDXA 1B2LA 3E5RA 1Y9AA 1KVTA 4IDFA 4MVJA 1PJ4A 2VCYA 5EJ2A 2EIHA 4L4SA 3F47A 3I9LA 1PJ3A 1NX6A 1JQBA 3TL3A 1WZEA 2PWZA 4I5FA 3DZGA 1ZK1A 4CMHA 4ZQEA 3C85A 4BO8A 4I9UA 5CDSA 2HK8A 5COBA 1EE2A 4RZHA 1MUUA 1Y81A 4E5MA 1GUZA 2EEZA 3W8FA 1J0XO 3JD1A 1HE5A 3UFXA 5IDYA 4FN4A 1JVSA 1FMCA 2XPCA 3JQ6A 3ZWAA 2BI8A 3MJVA 1HEUA 4MIEA 3LSYA 5KIAA 3ZNQA 2IXBA 3ULKA 2BF7A 2EGHA 2ZCVA 3V5NA 1BHSA 1HXHA 3NT2A 4MP6A 1U7TA 3TJRA 4CM3A 2ZB8A 1LSSA 1GYQA 2Q1SA 4TKLA 2D8AA 1H6BA 4GSLA 1E7WA 4GWGA 5GMOA 1I30A 2J5QA 4TRJA 4IGEA 4W9NC 3DAGA 5U4QA 4BGIA 2IE0A 3AJRA 1A4IA 1P1RA 4TMFA 5GY7A 1BSVA 2J8ZA 2YUTA 3QWIA 1PEDA 5ER6A 5JMPA 1W73A 3GUCA 3VZRA 1HYHA 1DAPA 2EP5A 1HYEA 3E8XA 2P5UA 2B4QA 5HBRA 4OO3A 1I10A 3OIDA 4MP8A 3NTOA 4PIVA 4WCFC 2AW5A 3BMCA 2ZTUA 3DTYA 4QT0A 3OFSA 2E49A 4L8VA 1HTBA 3ZV3A 1DC6A 3AI3A 3MWDB 3OH8A 3H9JA 4RVDA 1ULSA 4RPHA 1HKUA 2G17A 4YQYA 1AXGA 2QZZA 4NBWA 3V1UA 1EQUA 1B3RA 1UXJA 4YJGB 2PY6A 4W7HA 4D46A 4H7PA 1VL6A 4DMMA 3I4FA 3QVSA 4A73A 4RVSA 3UCEA 2HK7A 3OSUA 3FF4A 1ISHA 3MEQA 1EVYA 2DLDA 5L45A 1QXSA 1MG0A 3QVTA 1FDWA 4XKJA 1HZJA 1CERA 3KRTA 2FR0A 3RFVA 3E48A 1NPTO 3PHIA 5A02A 2HMUA 2J6IA 2P9CA 4JN6B 4RQUA 5JDCC 1LNQA 3TOZA 1KETA 2DTEA 4XEHA 5DULA 2X22A 1KC3A 3AY3A 2AEMA 2PKQO 1T4DA 1E1MA 1IHXA 2PNFA 3GVHA 3IS3A 4TSKA 3RIHA 1ONOA 5I7EA 1E1KA 3VPFA 2NM0A 4AJ1A 1K89A 1KEPA 4E21A 1UZMA 4WEOA 4CM9D 1IPEA 1ZMOA 2VZ8A 3PQDA 4CUKA 5ITVA 1BG6A 5CDTA 3F1KA 4BNNA 3OQBA 4GX2A 2HDHA 3WYCA 3PLRA 2DBZA 1ISJA 4CM6A 4YAIA 1MB4A 3WS7A 1HDGO 4E5KA 2C54A 3HE3A 3WICA 3MJEA 4HY3A 3PI7A 1JAYA 1QRRA 3PPIA 4WLEA 2CF6A 5EINA 1ZVMA 2B35A 2EWMA 4RVGA 3PJFA 4QQRA 5IZCC 4L4RA 1N7GA 1PZFA 4XQ9A 3EHEA 1DHTA 5TX7A 1I5RA 3WWZA 1JDJA 4WCFB 1YB4A 3VPXA 3PDJA 1Y9EA 2G76A 1DIRA 3NTQA 4R5MA 5B12A 3PXXA 1QV6A 3VH1A 4N54A 4J7XA 3ZNNA 4D7AA 2XF8A 3INGA 1XQ1A 1E7QA 1KOLA 3IDSA 2OORA 2OHXA 3EK2A 5JW6A 2VT2A 3A28A 2NU7A 4NFYA 3E1KA 3BA1A 4A27A 2Q4EA 2QQ5A 1Y5RA 1Z6ZA 3D4NA 4UUNA 4EEZA 2YYYA 2YV2A 2C2XA
chains in the Genus database with same CATH superfamily
4E5SA 1OTYA 2I6TA 3MRVA 3OJCA 4KXYA 5BR4A 1OFHA 2JCBA 4IPTA 3JYNA 1WDTA 3OUTA 4FCVA 4F85A 4NEGA 2Z1NA 2ZI4A 3RRBA 3EUAA 2VHTA 1PJLA 1ND5A 3AVQA 3RIYA 4CTNA 5IKMA 2PS3A 4U2DA 1ZOPA 4K1XA 1BCRA 3DVLA 4C4RA 4EHBA 4UQPA 5L6LB 4INJA 5A3VA 3ZLBA 2JJ8A 4L1KA 4I9NA 4IW3B 2GGSA 1XTVA 3BK7A 4HRVA 4JCCA 4RDCA 1KJ9A 1LQUA 4WY8A 4A3SA 3RVOA 1VIVA 2HO5A 1ISFA 5LXTF 4BJ5A 4ZYUA 3EIWA 4GRIA 3L0BA 3SR3A 4YI3A 4RL6A 2CZCA 2ZYWX 2EGUA 4FGSA 1LU9A 5EC8A 3VAZA 4BQFA 4QAQA 4IJWA 1GXSA 1GQYA 1AKVA 1NP7A 1OIWA 1W5FA 2IUSA 4M7RA 3LPNA 4A8TA 2QMQA 1CUWA 5A4KA 2H7VA 4DDHA 1LV8A 4BN4A 1WU7A 4DWJA 1SWVA 2JGMA 4D2IA 1KAGA 3T7TA 3NIGB 5T8KA 3VUEA 2HN9A 4YRKA 1JT2A 2Y0CA 3R7WB 1I4DD 3KV1A 3BB1A 3T0GA 4Y2PA 1OI7A 3CSDA 1BIFA 1VTKA 5WRFA 4U39A 4I14A 4CL0A 1DWPA 2BGGA 3QSGA 5JSKA 2Z2ZA 3LA6A 5KNCH 4YDSA 1W1IA 3JQFA 4KODA 2ZR8A 3CNLA 4YS6A 4W1QA 2NU8B 3CO5A 5K3FA 1ZOLA 2YHIB 4NKRA 1FRFS 1XRLA 1XU4A 1IN8A 4IF4A 2ZYHA 4LOAA 3UOAB 3SF8B 4R8SA 1ZC4A 5A7GA 5KHLB 3HA7A 4JX9A 3JZMA 4JLBA 3DVRX 2QRVB 4D44A 2ONKA 4MS3B 1W1UA 3OOJA 3KCQA 1Q3HA 3NP7A 1Y1TA 1EXMA 1S8AA 4DA9A 4EA7A 3NR2A 4YJFA 2NTVA 3IC5A 4Z9AA 3WBFA 2IOQA 2V6JA 1R9GA 4FFMA 1BX0A 1VI2A 4LBWA 2Q2OA 4ID9A 3F2VA 4UCXA 4LNUB 1CZNA 4QA9A 1OROA 1ZOSA 2WBLC 5AWFC 3O47A 4QTYA 1Z5UA 3HJFA 3R76A 4GYJA 3SG0A 1DXQA 3B1FA 3PNKA 3U17A 4XM0A 5HIMA 3O4VA 4Q9AA 2P0EA 1NVDA 2DFPA 2XJ9A 3HYLA 1XJCA 1TZJA 4EI9A 4QOEA 2CVOA 5DM1A 2Z58A 1ZRHA 2ZM6B 1WNTA 1Z7EA 1JDTA 3KSUA 4CT5A 4XYLA 4ESVA 1NN0A 3M6IA 1IN6A 4CQMD 2DSNA 1HFKA 3JD3A 1LBSA 1Q3KA 1L7BA 3QV2A 4AO8A 1FDIA 3B3JA 3LPDA 1GZSA 1N1DA 4JELA 2OTCA 4FD3A 2UZ0A 1IBLB 3FTDA 5LMUB 3QG5A 4BEWA 2DUWA 4GM1A 4JBXA 5J5AA 2DTXA 4NP6A 4GZLA 4C2BA 4U2BA 5GWXA 1DC5A 1IEWA 1OWPA 1PBNA 2AJTA 2H00A 5FBWB 3I5YA 4UDYX 2BJHA 4XA8A 1W5TA 4BJ3A 1P1JA 1ZCFA 4YX9A 5SZKB 1JHZA 3NALA 3DM9B 2QG9A 3B9RA 2HQSA 1S01A 3OF2A 1P3DA 4B43A 2MINA 1YR7A 4EFNA 4JNKA 3I2YX 3TKLA 3TRKA 3OLCX 4B75A 4Y0NA 1G5HA 5DGTA 4DCPA 1J8QA 2HCBA 2J59A 4OUKX 4JI3B 4G97A 3OE7D 1SU7A 2BM8A 3L8YA 4MKHA 4CTKA 2FN4A 2W0MA 4ZQHA 3OQ1A 4Z1OA 3D6JA 1YT5A 3HU1A 1WDMA 3KS9A 1A7AA 3Q7QA 5T57A 1VG0B 4Y1EA 3HB4X 4CL3A 4YRZA 5F5NA 2FPPA 5FUVA 1ODTC 1I3MA 1RW4A 2PXAA 4YQEA 2QDKA 3AL3A 4FILA 5IJAA 3S70A 3W1EA 1MAWA 3GG9A 3Q1LA 4LSWA 2XJ4A 4RA9A 5BVHB 3SQXA 5DDIP 1E96A 2KSQA 4R1UA 5ES4B 2ZIGA 4UXHA 4BJ1A 2IHZA 3GH1A 5LMNB 3ADPA 3V3KA 3ADBA 2GNPA 2NQTA 2XB8A 5J2TB 2VG8A 2CHUA 4HEQA 2OYCA 5KQRA 5FQOA 3RYHB 1USKA 5DE3A 4F4DA 1FFXB 4JI8B 5FR2A 1IMOA 4PYIA 2W11A 1CC1S 2XDQA 4MRNA 3RARA 4CYMA 1T8UA 2AWOA 5AD1A 4V1CB 3W3AD 4M1TA 4XFDA 1T5TA 2FQYA 3IKLA 1UANA 2P4UA 3FJYA 4IG4A 1RMYA 1P6QA 1V3VA 3OHMA 1PAUA 1CY7A 3E05A 1H22A 5AVJA 3VPCA 2YXNA 4J1QA 2F3QA 3VJKA 1ZHHA 5JO9A 2Z6QA 3L49A 3U3KA 2G5CA 3RYCA 3DPUA 4FBMA 2YJ6A 4BO2A 1XN4A 5AQ1A 5IASA 5DFAA 4CKWA 3E5NA 1W34A 3Q3IA 1EBFA 3E0XA 3UMRA 2P9TA 4PQFA 1IN7A 1T6NA 2FZ5A 5GVSA 1U2RA 4J03A 1XFDA 3KT3A 4RLSA 2BIFA 2PSDA 1DKPA 3FI9A 2R5NA 2DCMA 4LTMA 3LT2A 4OQ4A 1RYEA 1YE5A 4UUOA 4KN6A 2OORC 1JL3A 3OFVA 1T9DA 4W5WA 1C0LA 1F2UA 3EC1A 3C6QA 4JUCA 5ILQA 3PEFA 3DE5X 1ZJJA 4OD0A 2IZ5A 2OZPA 1K08A 4MUMA 5F73A 3KZKA 5EMHA 1UEXC 2PPVA 1T4BA 1UBTS 4HX2A 1ZXXA 4HWTA 4K5QA 4FDLA 1GU7A 5MN4A 5LQJA 5BMVF 2NSJA 1TO6A 3HB9A 5AH0A 4UZFA 2REXB 1UEJA 2A9PA 2IODA 2WM8A 3TGLA 3LS2A 2VTBA 7GPBA 1ICEA 3K5IA 4UAJA 5FA6A 1FSGA 3IILA 3IDOA 4L5IA 3UFBA 2RG7A 3K0SA 1QIKA 1FBTA 3I04M 4P4GA 2PRJA 4LQDA 1WO8A 4RZ3A 3ZH2A 4EFLA 3NUQA 1F06A 4HNTA 4OU4A 1GKKA 2I7TA 2CEAA 2QAGC 4HSGA 5KMGA 3Q40A 3Q5DA 1Q0RA 4FWTA 4NOKA 4FB4A 4D26A 3EMBA 2RHMA 2VNAA 3DYVA 5DHFA 4AY3A 1ZWKA 1QFSA 3ESYA 2ZUTA 1G8AA 4OFWA 4TTPA 4ZREA 2CXQA 3OA2A 4J90A 4OMUA 4ZAZA 3O4RA 1WETA 2W2MA 4XWKA 4M54A 4O4HF 4YP5A 3K1YA 1YRYE 2I2AA 4LG1A 2JD2A 3CSUA 3FKQA 3BCRA 3M5WA 3EXHA 4IEEA 4M9RA 1KAQA 1PW5A 1N8SA 2O8CB 4ZTUB 2PE5A 3IAEA 4KAJA 3HA2A 2QXYA 3AQ4A 1H2AS 3NTXA 4TS1A 5HQJA 2G9NA 1QHYA 3RE1A 3RC1A 4Q4JA 1N5LA 2IQIA 3G2LA 4QTZA 5JYCA 3IQXA 2IW1A 1SXJA 2YY5A 5FYQA 4BLUA 3N74A 3Q7EA 6ABPA 4MGEA 3VNVA 3PF8A 4A8HA 5IJWA 3EDRA 5HCNA 4XWAA 3FF1A 2G07A 4US1R 4H1TA 1OGIA 3TSWA 1FQWA 1WUHS 1JEQB 3OLVA 3HZHA 4TXHA 3X1ZA 3KQTA 1GEGA 3INYA 4XQ0A 1N6IA 4EA9A 2BE9A 1ETUA 3CSSA 4J1SA 3TDKA 4CRWB 5AVRA 1HFEL 4YPOA 4HAVA 3PEYA 4JLKA 2W5UA 2IOHA 3C8DA 4Y3UA 5IHXA 2F9LA 1R8QA 1DOHA 3AM5A 3KLBA 2V97A 1AQYA 4IOLA 3T9AA 5JCOC 1N34B 4PYJA 4M8KA 4OQPA 2NV2B 2G5PA 1BQEA 3TSZA 2X77A 2BFEA 1E1QD 2WJHA 4EI2A 5E6RB 1J06A 1X7ZB 2OD2A 3I0NA 1QH1A 3A10A 4R2MA 4Q01A 4R1QA 1VRCA 3VQTA 1WKCA 5DHAA 3STHA 3UV6A 1LVHA 1XVIA 2EU8A 2HYIC 1Y48E 4FNGA 5KNCD 5DNAA 1GLGA 3STVA 2G8NA 5K0BA 3UJ9A 2QPTA 3F8WA 1HSZA 1IG0A 3UWKA 1JB1A 1V5IA 2O0KA 3AR6A 4P1ZA 1IOLA 2FH5B 3AILA 3L7KA 3KJGA 1R00A 1GR1A 3MTGA 1CULC 5HKAA 1DQPA 1AE1A 1GKLA 2D7JA 4HCJA 2F1JA 4A6DA 1JLLB 1Z4KA 1ZKMA 2BFWA 2RHCA 4FZ3A 4WKOA 4X7MA 1JKJA 1WP9A 3JPYA 1XXHE 2B5WA 4L8GA 1A2KC 1P8AA 5DBEX 1R6XA 3CGGA 4DM4A 1GTRA 3OFKA 4TV9B 2Q3EA 4OXIA 4PXAA 3A9UA 2XCUA 3I39X 2GXSA 1XYVA 2G0AA 2XUHA 3PXEA 1Z37A 3ZYCA 1RXVA 4M89A 2R65A 2PWYA 3VTZA 4KQCA 1F9EA 4Y2YA 5ESWA 4EX7A 4ZYXA 4H35A 1ZEMA 4EW2A 5BOSA 5IAOA 4DB4A 2QE6A 3N2KB 1C8VB 1E6WA 3NBYC 2H2GA 2HOQA 1MN6A 1OLSA 3TD6A 1PT9A 3QUQA 3F3YA 3A4NA 2E4AA 5C37A 1N8KA 4RTPA 1XEAA 3LU1A 4OREX 3EQ8A 5LZ9A 3ZQJA 4YYZA 4MJXA 2X8JA 2H29A 1H6DA 3KKNA 1P80A 3KQKA 1QE5A 2QRKA 1YGPA 5FWYB 4EYSA 5KEIA 4UULA 5E1OA 2I4TA 3EDMA 1TCVA 3RT7A 3RIMA 4B0OA 3NYWA 1NN1A 1J20A 1Q7BA 3RTGA 3QPBA 1AN9A 1NM5A 3FN4A 3H1PA 3K73O 3Q8XB 3PE6A 4ND4A 2NO5A 5C5DA 1VE3A 2ZCJA 1XRSB 2GCPA 2JF0A 4TYMA 1V5GA 2CYCA 3L1UA 3NVMB 4YFYA 1LXCA 3V2UA 3AP1A 3I1FA 2QENA 5CA1B 3L0YA 1J8VA 3QFCA 4IQ4A 5BQ5A 5JS7A 1ESZA 4YRCA 4KFUA 1LSOA 3B8HA 2J6CA 4Y2TA 1QH9A 4OI1A 2QA5A 1V71A 4DWOA 1G42A 1OLXB 1JPUA 2LE0A 2OY0A 3ID6C 2Y67A 3ZDEA 1XL1A 3K0FA 5IJ0B 2B37A 3K31A 4QFCA 1KE2A 1MX3A 2I87A 3GZNA 3UH0A 4PZUA 3WFIA 2ZBQA 3WLNA 4P7KA 1E61A 1XZPA 3D8UA 3F5FA 1UKAA 1NBME 1YRBA 2PZEA 3R0ZA 5IF9A 3ORQA 1GL3A 3WK7A 5C31A 3GVPA 5LBUA 3BIXA 4C7VA 5EG5A 2Q1TA 3QXHA 5F21A 1U8YA 5K05A 3GPCA 1UDAA 4DMFA 2H65A 2H18A 5L3VA 2GO7A 1N2EA 2ZBRA 5JAMA 1SD1A 4N3BA 1AY0A 2R8YA 1K6XA 4O33A 2IU0A 3BMNB 3H0KA 4A2CA 5B58C 3OQ6A 4A1FA 1A2OA 3GRYA 4DBLE 3DZIA 1AD2A 3QTTA 2OESA 4YWHA 4ZWNA 3W9BA 3N3BC 2E48A 2G09A 3OJLA 1CY4A 121PA 3OWOA 1S6YA 2E37A 4JJZA 4NFHA 3V1YA 2UV8A 5AVXA 4I9HA 1R6DA 5KX5B 4IO0A 4LXYA 4U8HA 4B3XA 2XR1A 4PZLA 5BSUA 4YGYA 3I1IA 3VAAA 3H5LA 1M2WA 1UJ5A 3WB2A 2IHNA 1FJGB 2JIPA 1IMJA 3GPBA 2XUPA 2YY7A 2PH1A 2KI5A 3FWNA 2ID9A 5AXBA 3HACA 2WTUA 2BGLA 1DO8A 2IDMA 2XXAB 3HWRA 3WLIA 3FTFA 1HOXA 3MN1A 3RCBA 2DE0X 4YRFA 4URZR 3N53A 1RPNA 4RZQA 3JTMA 5TF0A 4ASUD 4E14A 3KOUA 2ST1A 2WNIA 3LC1O 4Q4AA 4Z7JA 1LA2A 4BMYA 1QZTA 1XEXB 1VSVA 1D2NA 2ANCA 2DWUA 1ADGA 1IY2A 2JCSA 3CUKA 3F7TA 3C3KA 4NCJA 1ZNZA 3TVTA 3VR1A 1L5NA 4ALIA 4B82A 1MU0A 1GQQA 1YC2A 3D0RA 1EIZA 2OAEA 2WPDA 5ADWA 1X2EA 1X8LA 3DTTA 3MSCA 2LZ0A 4M1OA 5KQGA 4H6PA 2J1LA 4XUDA 2H5JA 2JGLA 3CEJA 1NNEA 1VP3A 2B1GA 3BQMB 2JD0A 4LGMA 5AVSA 2XUKA 3QOYA 2CBXA 5I4KA 2GCIA 2XD4A 2Y77A 2GMWA 3BIFA 3G5TA 3OPQA 3H9EO 4MWSA 1PV4A 2QX8A 1Z8DA 4G5RA 4Q19A 4G0NA 4G0OA 4RKQA 4WFJA 4PPQA 3AERB 2WT8A 3G0BA 4OB7A 4KFRA 4YDQA 5LP6A 4IFEA 1K8QA 1QIGA 2ZU0C 3NVKI 1TVMA 1A88A 5K20A 4JT2A 5EESA 3A2LA 1K92A 2PZFA 2QRMA 4LOKA 1M6VB 1P91A 4LEIA 2B8WA 4OK6A 1YA8A 5KTMA 3I5XA 3GT3A 5JY6A 1DMSA 2Q4TA 4G8BA 3GRCA 1VM6A 1JFFA 5P8WA 2O3TA 2F1OA 2GYVA 3C1TA 1Q95A 1C8BA 3TL2A 5CFLA 4JB0A 3QUTA 5C1IA 2EFJA 1SBYA 2Q07A 3FNRA 4TTVA 2V9ZA 3JYPA 3AP2A 3WRYA 1EGHA 3AQIA 4YIKA 4BNTA 3OEHA 4MRPA 2VPQA 5FLYA 3SFVA 1DUVG 2VVTA 3ESZA 5AW6A 5IJZA 1UMBA 1CB7A 3PBKA 2IYQA 3L05A 1C7FA 1Z88A 5CVCA 3NEYA 3ETLA 4I1IA 4TLLB 1ZCBA 1DCMA 1Z4LA 2QNIA 2QXUA 3QKSB 3JVIA 4IV8A 4NE2A 5CVDA 2A9JA 2FWNA 2MU1A 4GWKA 4UVHA 3SHWA 5C53B 4DA6A 3DOUA 4BLWA 3NHRA 2JK0A 5JCXA 3BD7A 4E33A 1U7HA 3JZDA 4HDCA 2X5OA 3AL2A 2CV2A 3PCXA 4YLGA 4ZV4A 3AVOA 4BFWA 2FV8A 1FUIA 3GOHA 4JJIA 5E6UB 4EPYA 4H7KA 1I94B 4DY6A 1GAXA 1OFTA 1UJ2A 3B1VA 4GF5A 3BTVA 3Q2IA 3ZZNA 3BC1A 2I55A 4UE2A 2YN2A 5AKLA 1E4VA 3KQQA 1EH5A 2HRDA 4QUEA 3KZOA 4RM3A 4GRDA 5FTJA 3TZBA 1AQUA 4COOA 3FOFC 4XD7A 2AFIA 1X7WB 2A0WA 1UQTA 4K2HA 2R8RA 1HQKA 1DBWA 4FVTA 3HYRA 2J9YB 3DDNA 5K0SA 4HHEA 5CEJA 4ZOLF 2CMHA 3M2PA 3R09A 3OZXA 1XCOA 2W70A 3VNUA 1HQDA 3G9QA 2P2YA 3TSOA 5K45A 5M04A 3PQ3A 5H5JA 3G5AA 4KXMA 1T3HA 1EFUA 4TRMA 3DWGA 4BRZA 2G72A 4DMCA 4O2BF 3L41A 2FK8A 2OBNA 3SEAA 4Q9NA 2ZGVA 1FLDA 1XJ5A 1Z17A 3BXPA 1M2HA 4PONA 1Z8FA 1VYVA 3FSEA 4R98A 1B8NA 4LW8A 4QJIA 1WDKA 4FMBB 2X7JA 1MRZA 3Q8LA 1W44A 2QL7A 3IUQA 4GQIA 4ITRC 3M81A 3IKVA 1NLUA 2ZJ5A 3DCJA 2BGRA 1B0ZA 2SBTA 3VYWA 3K9BA 3ZXUB 4FEEA 1T1RA 5TMBA 3BULA 5HK8A 2HIMA 2RGXA 5B6IA 5SICE 4LYHA 4Q1FA 2I3GA 4X60A 4WY5A 4E1BA 5I9NA 3A0UA 1MVNA 4FIDA 2VJOA 1QRUA 3RHZA 5IH7A 1DO0A 3W7AA 1C7RA 4ESOA 4HK4A 4ND2A 2FEPA 5KJ1A 2O0LA 3VZSA 2WT9A 3HA3A 2ZUSA 3VU1A 5IDQA 3HLYA 1F2TA 2XWQA 3F5SA 4HX5A 3TBFA 3ZI7A 2RBKA 1KDRA 1SVUA 3ABQB 3Q41A 2J85A 3PQ4A 4RSMA 4PRKA 2D2IA 3DB2A 3TQCA 4RCYA 1N0IA 3HSKA 2D0PB 3RVSA 2GEUA 3D6AA 2HHLA 2J3QA 2QR2A 4F7WA 1U7UA 2GI4A 3ZWXA 2C42A 4DQKA 3VAYA 1AQNA 2ZT8A 2C7QA 3QVGA 3ZBUA 5DW0A 5JI2E 5HJEA 4P31A 1A4UA 3LYHA 4DA7A 1LC0A 4RNDB 4R2HA 1TU0A 1L5ZA 1L1FA 2PRIA 5AVVA 3FFAA 4EVQA 2PO7A 5CT6A 4QWWA 4U7PB 1D7AA 1F6BA 4MV4A 3DKVA 4FGUA 4KIFA 4FYHA 4DYDA 5JCJA 1F5NA 2BHSA 1PK7A 1I51A 2EX0A 2GESA 4LBZA 4G0XA 2DFTA 1KI6A 2QQ0A 4NJMB 5B1HA 5A1JA 2C2MA 1RBYA 2Y27A 3M0EA 2MSDB 4X84A 1NQAO 2ZS8A 1TEZA 1P4RA 1EP3B 2ZJYA 3HL4A 4ZI3A 1F48A 4C30A 1CNEA 1Q2UA 2YL2A 3V97A 5I7FA 4KR6A 1G64A 3MZ0A 5CTAA 2JLYA 1TIBA 1NI5A 2SICE 4RHEA 3SSOA 4C4TA 3B3QA 1GPBA 1ZNWA 1A9SA 2AEFA 2G4VA 2HCRA 1RXEA 3ICVA 5BN4A 1A5ZA 2YNMD 5IARA 5CP8A 3T94A 5EE3A 2GJ4A 1P5HA 3G0CA 1NE7A 4N6GA 2O2XA 4ARVA 2OP1A 3HUEA 2VH1A 4L50A 4RSHA 2VP9A 4KX5A 3PG5A 4RULA 2JATA 2WVAA 3PQFA 2PKQP 4NBVA 3BEDA 3IJPA 4S0ZA 4MMZB 2XT6A 4CUJA 4DV5B 4M6WA 2XDWA 2Z56A 1PX2A 1H1DA 4BFSA 3DLBA 2DMRA 3RK0A 4UUAA 2LNDA 3CHYA 3FW1A 1XDUA 4MVXA 3EH1A 4TMTA 5LR6A 4EJMA 4NMMA 3ORFA 4LK3A 1B16A 3RODA 3G82C 2IPNA 4QU9A 3WLQA 3CKYA 3CUEF 4EUSA 5CDYA 2A78A 4DPKA 1KS9A 3LCMA 3ANLA 2B7CA 1E4EB 4PZ9A 1JDVA 2P68A 4CF5A 4E2ZA 3DL4A 1MOQA 4TKUA 3Q0TA 1XZ8A 5DHRA 5JSHA 5B64A 5JVDA 3UICA 5A0TA 1WPRA 2QLTA 1PL7A 4WFKA 4A26A 5CUQA 2DPHA 2OENG 3GEEA 3PYXA 4H1HA 1O6CA 1QKJA 4OLHA 5DBHX 4TT8A 2PLNA 1GADO 3IUNA 4QT4A 3DKKA 4LXXA 3COJA 1RXWA 2GJ9A 3ES9A 2Q0QA 3O4IA 1G41A 4DGSA 1IVNA 4L85A 2W48A 3K1AA 1N5JA 3E23A 1EESA 4HWRA 2LCIA 4LZAA 1Q6ZA 1MLDA 4GMXA 2O5EA 3UC9A 2RAVA 4HJXA 5DU2A 2HDWA 2EWWA 3GIWA 1HG0A 4MW1A 2VS1A 1P81A 2W6JD 3RJMA 1PUIA 3ZR4B 1P75A 2P9JA 2BFBA 2R1VB 4D9BA 3QE3A 4LGCA 1LLQA 1FQOA 1Z13A 2IP1A 2Y71A 3FUVA 1PZGA 3SDBA 3JAKA 5BR1A 3CUSA 5BRJA 2VWPA 3CX4A 3ZDCA 1CWUA 1ZAKA 1JHRA 3PIIA 4AYTA 1QG6A 4WUTA 5D3MA 5GJBA 5LL6P 1X19A 1VGQA 2JC3A 1QO9A 1QV9A 2IXAA 1PZHA 3GCGA 1WBJB 2GJKA 4Q9IA 3MBKA 4EI8A 3RW9A 3BMQB 3PX3A 5IVDA 1QQ6A 4Z6KA 2Q28A 3WYFA 5LXTA 3V7NA 4GXRA 5JATA 2ZRMA 3FPCA 2ZUVA 4FEGA 4M37A 4OP3A 2HU2A 5TPWB 3WLAA 2DPGA 1II9A 2WM2A 3M6LA 1CETA 1BVHA 1GGVA 3FUUA 4MYRA 4QUHA 3LTEA 4X8HA 1IEQA 4KK3A 4L15A 4GECA 5CT9A 4CV3A 3MWFA 4ZHSA 1Z39A 4C06A 3JQ9A 1QORA 3BXXA 4YJHB 1XX6A 4BB9A 1HNWB 3FPEA 1EDBA 3QP9A 2FW0A 5CYGA 1ZR2A 5I9SA 2F62A 4L8WB 2PD3A 4INPA 3RABA 3NRCA 4QJBA 4ERNA 2O5RA 3DKIA 4HLUA 4AKTA 4WESB 3TQFA 2ZRPA 4R8LA 1CQXA 3PGA1 2OCIA 2PLAA 3GMSA 1Z6TA 4X8OA 5K0LA 4QUDA 2Y66A 1BXZA 2CGEA 3H11B 3SN6A 5CFQA 1J21A 2AJCA 1MJFA 2BC9A 1SPBS 5CT8A 3PB3A 1O97D 2FFJA 3RFXA 3WIDA 1ZG3A 3QLUC 4K03A 1UBMS 2YYZA 3TJZA 2PRYA 4QU8A 4IO1A 4XFJA 1YHZA 5EJMA 5FPYA 3TCXB 3ANYB 4DSUA 5EWMB 3BJMA 3NYRA 3W5JA 1ISMA 3O1LA 4II7A 1KJIA 4G41A 2YTZA 1P60A 4IIHA 4YPVA 5K6RA 1U3TA 3KPWA 3VU0A 4G3XA 4PZZA 2CZGA 4ZGWA 2HNAA 4WOJA 1ORWA 2R44A 5I48A 5DM70 1WAMA 3RC9A 2OZEA 2ZBDA 2DQZA 3MUEA 2XBLA 4I8IA 3P0RA 5GONF 4R8KA 4B6GA 5L4SA 3NAGA 1DFGA 2F3TA 2QI9F 2RJNA 4EA6A 2IYOA 2BN4A 1N2IA 4O4LF 3WKDA 3IQFA 4YRRA 1FFAA 1RAFA 5B37A 2UYHA 3SICE 1OT5A 3I34X 4XWGA 3WL8A 1AK1A 2J4FA 3JQAD 2J7PA 1O9HA 2ZE7A 2W4IA 3IP9A 2NNLD 4KO1S 1N5IA 2QUKA 3DDOA 4WZBA 4A0QA 1QCZA 3PJEA 4HNAA 2P77A 2SHKA 1JIIA 3E1SA 2JD1A 4YRQA 3CLUD 1A95A 3VKGA 1CUHA 2BEWB 4EECA 5IS2A 4EM6A 1GZHB 3KELA 2IOFA 2J3MA 3CZ5A 4OIFA 1KJZA 1FFGA 4Y2VA 1KTVA 5HCUA 1QF9A 2VSYA 3IQZA 5DGXA 1WMDA 3SLKA 3OZVA 2AV6A 2R6DA 3DAOA 4Z1MD 5A5FA 1P17A 1MAAA 1XLWA 3R74A 2UYCA 2CYAA 2NMVA 2H4YA 5KTRA 1W85B 1NT4A 3TEMA 4EB6B 3A31A 5KTSA 4FFOA 3UPTA 3EFBA 1XVLA 3DJYA 2TYSB 3F4LA 3HM9A 2QPOA 5LMZA 2FSGA 3IFSA 4XI9A 2C5EA 1PDOA 1X14A 3OFJA 4WADA 4IM7A 3V1NA 2RGWA 3HHEA 3PA6A 1YJ8A 2J4DA 2JAHA 2ONCA 1DINA 4KDEA 3OTHA 3HUUA 1ZM3A 3L9XA 1KMIY 1NPYA 1TVEA 1VG8A 2WWXA 3KKQA 4PLFA 1M66A 1MX9A 4PSKA 4D57A 1RI4A 3W5DA 3KTAB 4IIFA 4EPXA 2O8BB 3A2MA 3I8SA 4Z8XA 5MN5A 1NFFA 1RRMA 1YKGA 1M2NA 2IF0A 1HEYA 2CL6X 4Q3OA 1CJUC 2P5TB 5JXIA 4I3HA 4G0UA 1N2GA 4KAXA 3P8ZA 1W47A 3N0TA 3HTXA 1YMUA 4EJFA 1RC0A 1SB9A 2GZ2A 1QFXA 3MWDA 1AS0A 5EGSA 1B76A 3AEXA 3FDZB 3PJGA 4FT2A 2CCJA 4QQ8A 1M5UA 2ZSKA 3T7IA 3EYWA 3EMDA 3GFVA 5B4TA 2QRQA 2JH8A 3RU2A 621PA 3FIJA 4GOKA 4R9RA 2PR2A 3CEPB 3T4EA 3WOHA 1X1CA 3D6MA 1QC5A 3GJRA 4HL6A 1IY0A 1XQWA 4Y1RB 1KZHA 4G56A 1EUDA 3IT0A 3QNUA 5TS3A 1NI4B 1AN0A 2LRHA 2OCBA 1FBNA 1N0VC 4CMIA 2WWYA 3H7IA 4B32A 4HNQA 1MEJA 3HCAA 2GHRA 3N2YA 1WIWA 5L3RA 2BUAA 3KCNA 1ZHFA 2E4VA 2ODNA 3FETA 3T34A 3AHGA 3WJAA 1QR2A 1W59A 2X9GA 2HAEA 1JJIA 4ZVQA 5J9FA 4MLDA 3F7NA 1G5FA 3F7OA 1ENPA 1NTOA 3QF7A 3KKZA 4X20A 1T2EA 3RSSA 3VKFA 1IPHA 2C0CA 3AJ8A 4AB1A 1HQYE 4C08A 4ZMRA 4RJIA 3BXEA 1ZUIA 4MR7A 4DMRA 1MHTA 1DEKA 4OYYA 4M0MA 3S28A 4NU6A 1F6WA 3ZHVA 2Q41A 5AW9A 1LWNA 3B1ZA 4FHGA 3AEKB 2OAGA 2XLCA 3KPUA 3WGGA 2FZKA 2F8TA 2Q1YA 1H4SA 5IT0A 4J9VA 3RBXA 5KSZA 5JS1A 1DVRA 1ZIXA 2ZRGA 1JZTA 3A36A 3LCJA 1DC8A 2AS0A 2OFOA 3KDSE 1ONPA 2NG1A 3W4KA 2QUAA 3SAJA 3ZC3A 1H3EA 4BV3A 1JE1A 5AKIA 2B2CA 2NO7A 4BMNA 3GJXC 2P91A 3RSZA 4BUZA 1OZHA 1XNQB 1DG3A 1NQ5A 1G98A 1WXFA 1ZWLA 2FA9A 2LW7A 3EVZA 3FTPA 2H54A 5BMVA 3ONWA 1IPFA 1IY9A 3QBVA 1U3VA 4L8LA 4RH1A 2BHLA 3UAGA 4Y0VA 4E70A 5FFNA 3MERA 4TZTA 2C5LA 3QITA 4J49A 2O2SA 3GFQA 4W5TA 2O1WA 3RLIA 1ST3A 4INOA 1XLUA 2VBCA 2DPXA 5DVZA 1W2WB 3V4LA 4BMDA 5EUQB 5BWNA 1YACA 2IXEA 4MICA 4BN5A 4KV7A 1GDHA 1PK8A 1NMQA 2A4KA 4MS1B 5A6SB 3LHIA 4A8JC 4DDVA 3R3VA 3U4MA 2J0UA 1MIOB 2DQ4A 4N5IX 4XQEA 3PRHA 4OOEA 4AO6A 5AUPB 1E3MA 4KWEA 4Q48A 1GA6A 1JTEA 3OX3A 1C50A 1YCHA 2W43A 3KTDA 3N9IA 1SKQA 3VO1A 5B4UA 3PXGA 3NKVA 2IKSA 1Q22A 3T1YB 2HMTA 2BFDA 3IV7A 1GQRA 1CRWG 1KY5A 2G1JA 3DR5A 4E31A 4WV3A 3B13B 4GMKA 5AW8A 4O4HA 1FYFA 2NV6A 2P11A 3QVLA 4IIJB 5DNDA 3TR0A 2VDOB 4J8PA 4E5VA 1QX4A 4M21A 4IINA 3PR1A 1KEKA 3LUCA 4B8ZA 1GQFA 2ENUA 1H2EA 3T15A 1WY5A 3UMJA 2R66A 4ALNA 3JQEA 4GIBA 2DPYA 1CR4A 4UNPA 1CSEE 5LZ5A 5ENDA 2PYZA 3CG4A 3RUHA 3FTCA 1BCSB 1H5QA 5F9FA 4IFBA 1XVAA 2IGBA 1NJ1A 4GLJA 1SN7A 2HU7A 1SC4A 3AT1A 5CBKA 5JD4A 3DE0X 4XLZA 1VIAA 1OYYA 1YK0A 2ODAA 2JKZA 1NVTA 4R6XA 3AHHA 5CLQA 5H3LA 4LHZA 4NHOA 4DR3B 1F3OA 4LRWA 1VHJA 2MR6A 2YOGA 3O74A 4CBVA 4J91A 2ZJFA 4JBYA 5HIIA 3EZ9A 1LPPA 2I4NA 5FNVF 2ZYVX 3EOBI 3V42A 4BX3A 1EK0A 3ZZ1A 1KVRA 5AI0A 2ZRAA 1VOTA 3AC0A 3RNOA 4B35A 4BPBA 4JSRA 2H9IA 2PX4A 1SBCA 2OM6A 2PKYX 2AFHA 4PLYA 1OC4A 1YCGA 2A1UB 3IJEB 1G7RA 3GUUA 5TQ0B 2JI6A 3JQDA 2GN6A 1KDPA 4MVYA 5EE1A 4CVNA 4HNVA 5HRAA 4L16A 4D6PA 2GKOA 2P30A 2PYIA 3K3PA 3PWTA 3DA8A 2JFWA 2A2ZA 3Q9SA 4UBKA 4WJZA 5FJIA 1XRRA 4LZWA 1Z7BA 1TK3A 3O2JA 1Y8CA 1OX4B 3A1UA 3KDPA 3I0ZA 3PITA 4BOYA 2EFHB 2OHHA 1W6UA 2OAP1 1C5KA 2VCEA 4LDPA 2JAQA 2AT1A 4ZVOA 4IDOA 1UJ4A 2ZVQX 4EVIA 1AIPA 1QGOA 3S1SA 1EM6A 5GZ1A 1UDRA 2WPNA 2WV9A 5K3FB 3UQYS 5K8IA 3DMPA 3H4IA 1NR7A 1LTHR 3FMVA 5HQTA 2YN0A 4IV5A 3F8SA 4QDUA 5HJ5A 3OPMA 2GXQA 5BNTA 3GZ4A 5BRAA 3TPFA 2O6HA 1NF9A 4U9UA 1XU7A 5D7BA 4ZU1X 1RRVA 1TU4A 3KKKA 1KBZA 1TT5A 1XPJA 2FXIA 2QU7A 3RVRA 5JANA 3EDYA 3G7UA 3D1LA 1E9DA 3D4PA 5JWRA 4TV8F 1N92A 1RJGA 3BMXA 5JQGF 4J1TC 3PQ2A 1OZAA 5F5XA 3TTVA 1NIPA 2LKDA 1DJNA 2HRBA 2P9EA 2CKMA 4Q1AA 1DOZA 1E98A 2ZUBA 3D3QA 3EEBA 1UBEA 4X61A 1SCIA 5CNIA 1DQSA 2HYDA 2Y1CA 4FINA 4MB2A 3VO2A 1RIIA 3OJWA 4C7MA 1ZICA 2V9PA 4NCIA 2FGKA 1MC4A 1U8CB 4KO3S 1OIXA 3AFGA 4KUHA 4DR2B 1G8FA 1K0FA 3LQFA 4JAVC 5ECWA 2E5WA 4ZCPA 3RJZA 3DBHB 4AWBA 2QLNA 3LDGA 5KNDA 2XD9A 1EJBA 1X3SA 5TMEA 3W4JA 2IIPA 1ZM2A 1QF7A 3FOEC 1VCNA 1ZM7A 2YV1A 3PQ8A 1MO5A 3O2QB 5C5IA 4LDZA 5BY2A 4HEA6 1OV6A 1EQAA 3FVWA 3ISJA 1LSJA 3PD1A 5EHGA 4MHSA 4ZN6A 3P9RA 5J5CA 3UGKA 4B2IA 1VLLA 3WIBA 4J16A 1SXQA 2JIOA 2QJTA 3PDUA 3SHQA 5CXQA 1VPLA 3OMLA 2Q5JA 4TSRA 1A1VA 2WQ7A 1QZ3A 1M34A 3O92A 1ULUA 1OOEA 4M53A 1SIWA 1WMEA 2L82A 3TIXB 1BXGA 1QP0A 2PX3A 5CURA 4X00A 3RFFA 5JNVA 1D2EA 3PRJA 1IH8A 4KACA 1Q7EA 3NCHA 4YGXB 5IBQA 5TMDA 1WMSA 2AOUA 2QRJA 5CB4F 1OH8A 2INGX 1Q1AA 4DG5A 4X9XA 1G7CA 4JKOA 2NUAA 3W0LB 4FLFA 1BDJA 2IHUA 1HLPA 3IAXA 2CDRA 4O5OA 2OQ2A 1EUZA 1PWYE 5EEGA 3UH1A 5KC8A 3UMVA 1FTNA 1Z2OX 4P3YA 3AF2A 3B3FA 1KAOA 3IHLA 2JJQA 2NZUG 2IUFA 1IHDA 3WO1A 2FVYA 4KZPA 3UA3A 2OCYC 1OI4A 1EK6A 1TB4A 1FP4B 2O3SA 2P75A 3L8ZA 3OLWA 2OV2A 4X71A 3SSMA 3ZGVA 3KTFA 2FPPB 3RTBA 1GV1A 3GRPA 3TECE 2O2GA 1YQ9A 4L51A 2BKAA 4B4KA 1K2WA 4DV0B 1J2YA 2D0OB 4KX3A 4TPKA 2WSSD 5EP3A 2ZIVB 2NYAA 5FI0B 5SZHB 3KLNA 3C3EA 3DMTA 1FP7A 4AWXA 1S7CA 5JCZA 2V1UA 2C9DA 4KDRA 3SZLA 2GK6A 1Z0AA 1SHZA 1URPA 2RHRA 2VYND 2WQZA 2NTEA 2WU3A 3I9MA 4YONB 3L02A 4CDMA 2VT6A 2EARA 4QQFA 3WMXA 2IUYA 2H2DA 3DVSX 4HTAA 2IP2A 1PFKA 4ALMA 4AS3A 1T2AA 4HDAA 2C2WA 4FXOA 3LHKA 4FDUA 4OV6B 1RHJA 5C8DA 2HWWA 3H5AA 2OGSA 1H1TA 2WK1A 4N7RA 1SCNE 2YDXA 2ZTVA 3H83A 4K28A 4FMPA 4MPRA 4P6VF 4PCVA 5ELLA 4JS0A 1KMHB 1YS9A 3HQ4O 1TZ2A 3UJBA 1N7IA 1YZFA 1EEXB 4KRYA 1ODJA 2VRCA 3FCXA 3FPFA 1Z0SA 3HL0A 3VI3B 1VKHA 3IB6A 3X1KA 5CW2A 1ZD1A 1IBCA 2PZJA 1U2GA 3UBTA 2IDKA 4WGGA 5FTNA 1U1EA 2NU9A 2BY4A 2V96A 2HUNA 2VRWA 3DNPA 5EHNA 1NT2A 4BNLA 4GI5A 1ZK0A 2ISSD 4XYMA 4WGFA 3D64A 1L5GB 1XKLA 1NUSA 1RWXA 3L40A 3DC2A 4K6OA 1TW2A 1L9XA 2COUA 3QKSA 3E3LA 2FSVC 1E3DA 3G9ZA 4QOIA 3WRXA 3BORA 2G88A 1QZUA 2BEKA 4KOAA 1VBNA 3S1LA 1XLTA 1F2UB 4PS0A 1NN5A 3LGXA 5DOZA 3LAWA 1D1TA 4OSOA 3VH4A 4WE3A 4XWYA 4NXMB 1Q7TA 2JLCA 2Q0XA 3F2IA 2ZVDA 4RV4A 3ZK8A 1NQVA 4CM9A 1L3CA 4GGOA 1S02A 1NJGA 4ZTBA 1IJEA 1M1UA 1XEWX 1DADA 5HTOA 4GT1A 4XIFA 1T35A 1JUDA 2VZEA 3ZY4A 1T6XA 4JLMA 5B5SA 5B3JA 3BXZA 3FUXA 5BYJA 1OWOA 3O83A 3NNDA 1RZVA 4F60A 5EJ7A 2IELA 3CVUA 1X1TA 4REMA 3USCS 2VDRB 1NWHA 2ODTX 1N6OA 4EPTA 1E89A 4BEJA 3B5EA 2IV3A 4GQAA 4BO6A 4KOEC 4YV7A 1W46A 3SKVA 3BGWA 3AUXA 4TQAA 4XGKA 5DHQA 2A88A 2B6HA 1N2ZA 2H7YA 3IHKA 3MXOA 2PKWA 4KVFA 4LXIA 4L22A 4X3PA 2O2HA 5AO9A 3VDQA 3D3WA 3NAMA 3EF0A 1TC2A 3FJOA 3UMBA 5KMGB 3PK0A 1V2HE 3C3XA 5JMWA 1BMDA 4XGNA 4H0CA 5LA6F 1I5OA 3G49A 2PXCA 2CHQA 3TK1A 4ZT7A 3GG2A 4HRAA 5EE9A 1GILA 1XV5A 3DLTA 2WDPA 3LCVB 3LLMA 3NWBA 4FFLA 4MUJA 4MPJA 1L5HA 3F6YA 5I3ZA 1UPCA 3ZE9A 5JPCA 5G0WA 3SCZA 4NZMA 1FJXA 1X13A 3GK3A 1E2HA 1TXGA 4QU5A 3UV3A 2NAPA 2PG3A 1J0EA 1PV2A 5EJIA 4BX8A 3Q2KA 4AJKA 4J6FA 2B5OA 4MQFA 3TIGA 2ERCA 3DOCA 1VE7A 1Y3HA 2ETXA 5TT1A 1MQ8B 1G8JA 3DO6A 2GEDA 2OUIA 2OGTA 3F67A 5ALGA 3WBJA 1E9SA 4GMFA 1FK8A 3QEMA 1SKAA 4QM7A 3OTOB 1LBTA 3UT6A