4HFRA

Human 11beta-hydroxysteroid dehydrogenase type 1 in complex with an orally bioavailable acidic inhibitor azd4017.
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
260
structure length
255
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPLVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVMQAAPKEECALEIIKGGALRQEEVYYDSSRWTTLLIRNPSRKILEELYSTSYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Discovery of a Potent, Selective, and Orally Bioavailable Acidic 11 -Hydroxysteroid Dehydrogenase Type 1 (11 -HSD1) Inhibitor: Discovery of 2-[(3S)-1-[5-(Cyclohexylcarbamoyl)-6-propylsulfanylpyridin-2-yl]-3-piperidyl]acetic Acid (AZD4017)
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 255
sequence length 260
chains with identical sequence B
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4hfrA00
4DPKA 1R4NA 3HSKA 2GN8A 4EI2A 3HB4X 1CETA 4CLOA 3JD0A 4L9RA 2OL4A 2GPTA 2WD8A 3FWZA 3RROA 3SXPA 2V6MA 4YT2A 3KOUA 4BO7A 2PGLA 3KHUA 2Y0DA 1K6JA 4DLAA 1AXGA 1U4OA 5T57A 4DIBA 1D1TA 2EJVA 3JD3A 1EFKA 1FXSA 4YJGB 4AJ4A 4XIJA 1Z75A 3QWIA 5EQDA 1EVJA 3VH2A 3VOSA 1WMBA 1HDGO 3C24A 3TWOA 2B0JA 1EBUA 2G76A 1ZVMA 3JQEA 1DRUA 4RF2A 2GSDA 1DXYA 3PJGA 4BMVA 1IY8A 4BVAA 2OFPA 3ITKA 4IZHA 3TZ6A 1PX0A 3OP4A 2A9FA 3RUDA 2OBNA 1CYDA 2NSDA 3FRJA 5G0TA 4S1VA 2EWMA 4NBVA 3PYLA 4WECA 3NRCA 4OSPA 4NIMA 5ILOA 3MCVA 2B4TO 3KTDA 3L07A 1XELA 1IOLA 4K26A 4YACA 4FOSA 2B36A 4RDIA 3ZDFA 4FGWA 1NX6A 4LVCA 4EYEA 2NVBA 1NQOA 2GZ1A 4GWKA 1P77A 2QIOA 3TZHA 1H6AA 2IXAA 2ZTVA 1N5DA 3H3FA 4KDFA 2FZWA 1XKQA 5ER6A 5U9CA 4J9UE 2EW2A 1GEGA 4NFYA 4CM4A 1HE5A 1RYEA 1JKFA 1RWBA 3FTPA 4CPDA 4PZCA 2DTXA 5IDXA 3ZNPA 1P44A 3DMTC 2O2YA 3QV1A 4J7XA 2GYYA 4J1NA 1GYQA 2HUNA 4NH4A 3ZH2A 3TZCA 2OBYA 3G0OA 3L0DA 4BNMA 3BMNA 1LC3A 3PHIA 5HS4A 4WNCA 4FGSA 3DWFA 2DBRA 5L3ZA 5EL0A 4PRLA 1ZUD1 4R1TA 5F3RA 1E7RA 3A4VA 2JL1A 3OIFA 4FDAA 3KRTA 4R1SA 3M1AA 1YQGA 3M6IA 2D2IA 3HDJA 1J4AA 1E7YA 4J6FA 4YT4A 2X0JA 4GWGA 3Q11A 4WNIA 3FNGA 3UGKA 4BMSA 1UAGA 4MVJE 4MKXA 3Q3CA 3V8BA 3U0BA 2YQ5A 2CDCA 4FQ8A 3U4IA 2JAHA 1P9LA 3VTFA 1B2LA 2QYSA 4I9UA 1T25A 1CEQA 1ZXBA 3ROMA 1H6DA 1JDJA 1PL7A 2H5LA 1Y6JA 4R69A 1ZH8A 4XYBA 3JQ7B 3WMWA 3BTOA 1ZEJA 4RPHA 3QY9A 4DRYA 5ER9A 2CNBA 3MJCA 1U7HA 2P5UA 2ZJ0A 4J0EA 3ICCA 1SC6A 4UUOA 1GR0A 4K6FA 1CWUA 4BO4A 3TJRA 5EESA 4BUCA 1CJCA 4B8WA 1OAAA 1HDOA 4Q3AA 4TSKA 5EERA 4BNHA 4DL9A 5DP1A 4J2OA 3JQDA 4BO9A 1R0LA 3ZU5A 1UZLA 2F00A 3RBVA 5MGBA 4KWHA 3AJRA 3GFBA 1UXJA 1X1TA 4AJHA 3KLMX 4JQCA 1AE1A 1LI4A 4U0KA 3WSVA 3HFGA 1XIVA 2JAPA 5F5NA 2BI8A 1N9GA 2HK9A 2VHYA 4YYZA 3GA0A 5I9NA 2FP4A 2V6FA 3CXRA 2AQIA 1DC4A 2O48X 4RVGA 1PQUA 1ZSNA 2C07A 3KBOA 3ETEA 4WASA 5JY6A 4CL3A 5HS6A 4LRTB 3U4CA 3PFFA 1UP6A 5CHEA 3QE3A 1PJQA 1UDBA 4D3DA 2EW8A 4UEJA 4DBVO 4GX1A 2G17A 1EVZA 1V3VA 1LLQA 1DB3A 5IJZA 2QRKA 1SO8A 2QX7A 3RUAA 3T7CA 1LDNA 1YONA 3QP9A 5EIOA 3PDUA 1BG6A 1P74A 4N5NA 3GZ4A 4FPXA 1I10A 3G17A 1KOLA 4C4OA 4Q9NA 5ICSA 1M67A 1KEPA 2PKQO 3OEWA 3WBFA 1KBZA 5CPFA 5K9ZA 3AW9A 1JLLA 1CRWG 4QUKA 5FF9A 3WLEA 4XQEA 1Y7TA 5COQA 2D5CA 3PJEA 1I2BA 5A9SA 4BO8A 2GN4A 4F45A 1D8AA 3JQAD 5TQVA 2PLAA 2BLLA 4KP7A 5C5IA 3H3JA 1PGOA 3AUTA 3KYBA 3FPLA 5EJ2A 3FNHA 1YDEA 4R3WA 2GGSA 2OHXA 4RDHA 1A9YA 2E82A 4I5GA 3WTBA 4A7PA 1BXGB 1GY8A 4F46A 1KVQA 1CIVA 3G1UA 5JCJD 5L40A 2FSSA 4HUJA 4OQZA 4CLRB 5U4QA 3DO5A 2H1SA 3WS7A 3X2EA 2EGGA 3QIVA 3AY6A 3BMCA 1EEHA 3HJAA 4NDNE 1U3VA 1NXQA 4KUGA 2J3KA 3K96A 3UF0A 3H2SA 3DB2A 4EZBA 4RVDA 5ITWA 2YDXA 1PGNA 3G79A 3ZV6A 3GN2A 3L4SO 2HLPA 3AU9A 4IQ0A 1JA9A 1RM4A 3WFIA 2X6TA 5F1OA 4XYMA 4TROA 3ZWXA 4OQYA 1EUCA 3HG7A 2O3SA 2VNSA 3D5TA 4CMHA 3CSDA 4XJTA 1YE3A 1FJHA 3O8QB 2VRBA 4GQAA 4RF5A 4CM3A 1I5RA 3H4VA 2NV6A 4WKGA 1ZIDA 3GC6A 4ILKA 1GAEO 3R6DA 2NVUB 4YEDA 4NBWA 4CM5A 3ROKA 3NT2A 2R2GA 2CUKA 3E03A 4HNGA 1C0IA 4UVEA 3GHYA 4U7WA 1DRVA 4E0BA 1DJQA 3U9LA 3D0OA 5C7OO 1DIAA 1I3NA 3B20A 3E9QA 1KERA 1ORRA 3JQ9A 2ZIZA 2YFQA 1LSSA 5I7VA 1A71A 1GPJA 5L95A 3PFWO 4PLWA 1GV1A 2PNFA 3CKYA 3SEFA 1ISHA 2HJRA 1G6KA 4BV8A 1DJNA 4UEKA 1TB4A 1D4FA 4XKJA 4RVHA 1DPGA 2EJWA 3RKRA 4D79A 4IQ8A 4R51A 3UN1A 1VC2A 1ZKMA 4OL9A 4YT5A 3ZWPA 5TX7A 1CDOA 4CQLA 2I66A 4TRJA 2DT5A 1O5IA 5BSFA 4GGOA 2VWQA 4WLUA 3GNQA 3ABIA 4XA8A 5KJCA 2JD0A 2B37A 1JU9A 4BB6A 4QT0A 4Y8VA 3JQ8B 5LC1A 3NGXA 5TT1A 5IZCC 4R9SA 4DA9A 4HFNA 1E1NA 4W6ZA 1PZHA 1O95A 3DAPA 3TL3A 4E5MA 2VHZA 2FSVA 3M2PA 2E6UX 3SC4A 2VUUA 4O0LA 5THKA 3ZU2A 1JKIA 3WIDA 4CM8A 4PLHA 1IPEA 3Q1LA 1KY5A 2UUOA 1R0KA 3LT2A 3IKVA 3PEFA 2DPGA 4HY3A 2P5YA 3MJVA 1EVYA 4S3MA 4Z3KA 5GMOA 4IDBA 3VZQA 1JW9B 2I76A 4WOJA 4ZICA 5JBIA 4FBGA 3NDJA 1YL5A 3RUEA 3FF4A 4ALIA 1VM6A 4FCCA 1NQTA 1XQ6A 4Q3CA 4UVDA 3TFQA 3JQAA 4OM8A 4B4OA 4NFSA 1YQDA 4GGPA 4AJKA 4C7JA 4CJXA 1ZFNA 1C14A 4N54A 9LDBA 4BS9A 3FR7A 3KEOA 4HFRA 3RVDA 2RIRA 1WDMA 1I8TA 3BTVA 3LLVA 1ONOA 1ZBQA 4IZIA 4XJSA 4YJFB 4A0SA 2AHRA 1EUZA 1S7CA 2E48A 4YCAA 4ALKA 1C0KA 2FY8A 1AGNA 3VKVA 3A1NA 4WJZA 4IJWA 1U9JA 1Y5MA 4LSMA 1KIFA 1K3TA 2Q2WA 1B8UA 5AVOA 1NPYA 1BDMA 3VPFA 1H9AA 3K30A 4RZHA 4BKOA 4Q3NA 4D42A 2ZQZA 3GQVA 1BW9B 3K8ZA 5I7SA 3GY0A 4HKTA 3AI1A 3ADOA 4HBGA 2OOSA 3AOGA 4J4HA 3DZGA 4BKRA 1JWAB 2UDPA 2Q1WA 4D43A 1DHTA 5EPOA 1O94A 1W73A 1NVTA 4MVJI 4EJ0A 3K2EA 4GX0A 1ZK2A 4CUJA 1PJ4A 1O89A 1LX6A 4ZQGA 4B3IA 2EKPA 3U49A 4F3YA 2PH5A 1XGKA 4DTIA 4KOAA 3GNSA 4UEOA 2VOEA 4IJVA 4H15A 1Y81A 4RF3A 3ZHZA 1E5QA 3OETA 2Q4EA 5ENVA 4FJ0A 5JE8A 3U09A 3F3SA 2IXBA 3IUSA 4AVYA 3JQFA 4JCOA 3VZPA 3ONDA 2DFVA 2J5KA 3F4LA 2JJYA 4FC6A 4CMGA 3AOEA 5IN4A 2EKQA 3H9QA 1DIGA 3GH3A 1CQJA 5T8KA 3PI7A 4RF4A 1HT0A 4G81A 1LA2A 3UAGA 1GD1O 1PIWA 2OORA 1YRLA 3AI3A 1P1KA 5IDQA 1QYVA 2PK3A 4L76A 4WEQA 3ITDA 5KJ1A 3LVFO 4B7CA 4F6CA 2AQ8A 1X7GA 1MUUA 2W98A 5EINA 3WTCA 4LCEA 1UAYA 2D0IA 1ZXLA 4D0SA 1GYRA 4E2XA 4WOKA 5U1PA 2ZTUA 3U4HA 5G4LA 4R5HA 5A03A 5FWNA 3OBBA 1OBFO 3FNFA 5BSHA 3QVOA 4XYGA 2J3IA 5JFOA 3NAQA 5H82A 3K92A 2AMFA 1I2ZA 2Q49A 3KYDA 2J8ZA 2BGLA 3R0IA 4RO0A 4CR6A 2DU8A 3UCXA 1W0CA 4IGFA 1A9ZA 3B70A 2NTJA 3MOGA 4BO5A 4P38A 1GPDG 2WYUA 1G0NA 1X13A 3L6OO 4O6VA 3DZHA 5FYDA 1PZFA 4NPCA 4A10A 1B8PA 1DAOA 5L7YA 4FD3A 3BMQB 4XGIA 4I5DA 3QWAA 2LDXA 2GZ2A 3GR6A 1LSUA 5DULA 1YOVA 4JJGA 1U3WA 1UZNA 5B12A 2WD7A 3FHLA 2GERA 5BNTA 2X1HA 3NDIA 1N7HA 1GTMA 1DIRA 3SBOA 4PIVA 1C1DA 1U3TA 5JO9A 4AL4A 3E9MA 1C1XB 1L7EA 3U4DA 2Q3EA 3WR5A 1GCUA 4MIEA 1T2EA 3KM0A 4BOYA 4J2HA 2QHXA 3JQGB 5ENDA 4R16A 4IM7A 3AI2A 3IJPA 3UH1A 1QR6A 4BIIA 3F46A 2ZCUA 4JBGA 3OFSA 4XRGA 1PEDA 3O26A 1HDZA 1PJCA 3GDFA 4NNJA 2ZB7A 1NVGA 2TMDA 3WMXA 2CVOA 4MVJD 3OM9A 5HRUA 1SEPA 1XYGA 4E31A 4DPMA 4DIFA 5DDIP 2VCYA 3ZWCA 2YHIA 4UUPA 5CAEA 4MINA 3TOXA 1P33A 5DF1A 2YUTA 3BMOB 3H9JA 3B1JA 3PHLA 1NNUA 1I24A 2ZYGA 5CDUA 4YVFA 1E7SA 5A3VA 1IHYA 4BKQA 2P4HX 1DLIA 4PG4A 3I9LA 4U5QA 1E7MA 5ES3A 2ZK7A 1UP4A 3IOYA 2V6GA 2H6EA 4H3VA 3STHA 4B4UA 4DIOA 4I1IA 5HBRA 1I01A 3DDNA 1MXFA 5GZ6A 4WE3A 1BTOA 1N92A 2IODA 4UULA 4P22A 2A35A 4JXKA 3ZW8A 3Q2IA 3S8MA 4FJ2A 2HAEA 4W9NA 3KO8A 3DTTA 1LLCA 4BQPA 3H65A 1DFHA 1HE3A 2WDZA 2HMSA 3DAGA 3DFUA 3JQ9C 5IDYA 3MWEB 2JD2A 5EQFA 3BHIA 1UXIA 3BA1A 1U5CA 1EMDA 1ZSYA 2E37A 1F0YA 3L6EA 4TRRA 5AXAA 1GYPA 3F1LA 2P4QA 1PQPA 3L6DA 3ZNQA 2PA3A 2DKNA 4DYVA 5GZ1A 1LXCA 3GLQA 1LUAA 3EY4A 1TT5A 2YQ4A 3ZGYA 3TOZA 4BNFA 3IS3A 1DIHA 3GGOA 5G4KA 5ADHA 2BGMA 2ET6A 3ANMA 1B3BA 3FBTA 1GUZA 2X5JO 4MIOA 1EZ4A 3I52A 3PHGA 2IEBA 1ZK1A 1EK5A 3OIDA 4KUEA 2Y68A 3Q9UA 1GUFA 1Q0QA 1VJ1A 2VN8A 4G5HA 4AJ2A 1JAYA 4MOWA 3V1YA 4LN1A 3PK0A 7MDHA 4Z3DA 4LCJA 2DTEA 1M6HA 1LLDA 3VPSA 2IEDA 5G0UA 3Q2KA 4LMRA 2X9GA 2HMTA 4M86A 4IS3A 4PG6A 3FBGA 4YA6A 2A4KA 2AW5A 3EVNA 4IS2A 4UUMA 1GQ2A 3QSGA 3ON5A 1PGPA 2GUGA 1B15A 1B0AA 2DM6A 1WPQA 3D3WB 3RBZA 3WYEA 1MA0A 3EZYA 2AG5A 2W2KA 3UCEA 3E1KA 2P9CA 3SX2A 3NEPX 3E8XA 2W2LA 3EC7A 5C37A 3VKUA 4Q39A 3GG2A 1M6WA 2E49A 4OSOA 3ZWVA 1K5HA 4DXHA 2D5AA 4IDCA 4PLFA 1QRRA 3DEYX 4NZ9A 1H94A 2V7PA 5IG2A 3F1KA 2C7VA 3JYPA 4HP8A 1CQIA 5HTOA 2PH3A 1VE9A 3OA0A 1R12A 4RV9A 4U8GA 1E3WA 4PLTA 5FI5A 4CQMD 1HETA 1P0FA 4O59O 5CEJA 1E1KA 2AEJA 2VYND 4FC7A 7ADHA 4Z0HO 2QRLA 4BNNA 1UZMA 5KKAA 5AYVA 3RQSA 3I3OA 3ZNNA 3GZNA 3TPCA 3I9NA 3RIHA 1XHLA 3ZN2A 2FPGA 1VJTA 1ISMA 3PZRA 4WGGA 1WXDA 1MXHA 4Z9XA 2J3HA 4MVJA 4U6QA 1X0VA 1GQYA 4KQWA 4EUHA 3O38A 3T4XA 9LDTA 1UR5A 3RUHA 3IL2A 2CD9A 1HZZA 1FDUA 2VZ8A 2AG8A 3NKLA 3BTUA 4E4YA 2O4CA 5JS6A 4R9RA 4BNLA 5KKCA 3DBVO 3D4NA 4P4LA 3H9GA 3K2BA 1LNQA 1D1SA 5JYEA 4MJLA 1H2BA 3MZ0A 3E9NA 5TSDA 3VVCA 1A4UA 1R4MB 4TKLA 2WE8A 4AJIA 1F17A 2I99A 4BO3A 2NVWA 1ADBA 5JC1A 4K1LA 1SMKA 1XA0A 4GKVA 1O8CA 1U7TA 4R1NA 1M66A 2J5RA 1OC4A 1DLJA 2Q1UA 1NM5A 4OXNA 4KMSA 2YYYA 4MPDA 4R41A 4E30A 3ROPA 1I3KA 2HK8A 3AOEC 1U8XX 1YB4A 4EITA 1Z73A 2OGUA 1KYQA 3HQ4O 3VH4A 2FZEA 2EIHA 5T8KC 4YJGA 3HZZA 1YH3A 3PDJA 2G5CA 1DHRA 4YJHB 2ZYAA 2W8ZA 1QYXA 2R6JA 3JV7A 3QVXA 2R00A 1K6IA 2HJSA 2V65A 4L4XA 3VC7A 2VHXA 2PZMA 1XU7A 2ZCVA 3EZLA 1PR3A 4Q3EA 3DBLB 4CQMB 5ITVA 3PXXA 3NJ4A 1E3LA 5DBFA 2HMWA 2Y1GA 3C3XA 5C7IO 1OMOA 3MJEA 4B3HA 5HWSA 2UYYA 3WG9A 4BNUA 1JQBA 1P31A 2PZLA 4OH1A 5TT0A 2Y1EA 3KSZO 3OJLA 2CVZA 3BAZA 5CEFA 4XB1A 2NADA 3DOJA 4PLPA 4WLOA 4ZRNA 4ND1A 4N5MA 2O4UX 1P1JA 2NU7A 3NT5A 2Z5LA 1NFRA 3WGTA 3E48A 2ZKLA 3WGZA 1R16A 1YL7A 3L4BA 3HFSA 5JY1A 1E3EA 5G0VA 3E6AA 4MDHA 2PZJA 5T6BA 1FMCA 3ZV3A 1WZEA 5AXCA 2EP5A 5T64A 3RJ5A 1NFQA 4WCFB 5DOVA 1L1FA 2BF7A 4MP6A 3I9KA 4GBJA 2IDZA 1Y8QB 1P1FA 1XCBA 3JD1A 3AFNA 3C7CB 3BZUA 1VL0A 2PTGA 1RJWA 3PWSA 3H5NA 4NK4A 5TGDA 2GF2A 3F5QA 4DMMA 2O3UA 3KVOA 1BDBA 1HL3A 1H9BA 4IIVA 4L0QA 4NMHA 2Y66A 1F14A 4O63O 3AY7A 2YV1A 3SJUA 3BHMA 4XCVA 3Q6IA 3OSUA 1HZJA 5F1KA 1UJMA 1JVBA 3OH8A 2GCGA 3VPHA 3W4JA 2VOJA 3C7AA 2ZB4A 1HDYA 4RLHA 3GVIA 4XRRA 1DC3A 1QMGA 4R54A 3E5MA 4F6LA 1XG5A 1HE4A 1X7HA 2GN6A 1QORA 3JQ7A 3HUDA 3KSUA 3NV9A 4RPGA 3PIDA 2FN7A 5L4LA 5B4TA 4CMBA 3JYLA 1TXGA 4R5MA 4I5FA 4NBUA 1WAMA 3LF1A 1E92A 3EUWA 1FDWA 1RM3A 2VWGA 2IYPA 3S2FA 3KYCB 1LBEA 2B5VA 4R4JA 4B8ZA 5CDYA 1RYDA 2WYVA 2C54A 2AA3A 5JDIA 4OKIA 3N7UA 4CM9D 3DHNA 3DZFA 4NJMB 3RJ9A 4CV0A 3PYMA 2ZJ1A 1YJQA 4PVDA 4W9NC 1VSUA 1SB8A 5EMHA 3ZWNA 3PRJA 3MWDB 3NGLA 3C1OA 3DTYA 4J4BA 4P4GA 4PCVA 3O9ZA 5J23A 1HSZA 4AJEA 2ZTLA 3ASVA 4FFLA 3OQ1A 1WZIA 4BO0A 4H7PA 3AFMA 4JP2A 4XQGA 3ROQA 3JYOA 3H6KA 2YHUA 1X15A 5FI3A 3VZSA 1ZK3A 5IXSA 5HA5A 3CUKA 2B83A 2WM3A 3PQDA 4IJKA 2PFGA 1ID1A 3ZHXA 3N58A 3OHSX 2I65A 2NTVA 4UVGA 4RPKA 1T2FA 3ANNA 3DXFA 3DZIA 2NTNA 4CLEA 1RKXA 1BVRA 3FR8A 1KETA 3K31A 1DBVO 1MC4A 2FPPA 4J7CA 5CP8A 4DBZA 4CMEA 1ZJZA 4TQGA 1B3RA 1E3JA 1T2AA 5DCYA 5A9RA 1B7GO 4GKBA 1UXHA 2QZZA 3D3EA 1E1MA 2AQHA 3ORFA 3OQ6A 4JBHA 1VKOA 1ULSA 3KYCA 1YXMA 1G0OA 1VL6A 5BNIA 1ZJYA 5L9AA 1WMAA 1Y9AA 3OMLA 2YY7A 3PTZA 2X7HA 4J1TA 3QWFA 4NQZA 4CV2A 2JCYA 3ZHYA 4ND5A 3GVHA 4AJLA 3FNEA 4GLOA 1LQTA 1U4SA 1I3MA 1FK8A 3IDSA 3WQRA 1T4BA 3PIIA 2HMVA 4EEXA 4A73A 1BXGA 3GPDG 5JAQA 1IUKA 4LMPA 1YBAA 2BI7A 2GLXA 5JDCA 4HNHA 4CLRA 5A4DA 2BFAA 3TF5A 5B4UA 3WDSA 1YB1A 2B35A 2VTDA 1H6BA 1UDAA 1LDBA 5LCXA 2X58A 3CMMA 5TIIA 3KETA 1I32A 4L74A 2B4RO 3RWBA 5KCZA 3DZKA 3GMDA 4R68A 4B3JA 1J6UA 4TRMA 1WDKA 2X4GA 2WE7A 4GSLA 4XB2A 4IDEA 1X1EA 4GX5A 4OO3A 4IINA 1GU7A 1E6UA 1HDCA 4X54A 5F21A 1QV7A 2GR9A 3OICA 2OMEA 3ETDA 3F5SA 2NM0A 4MVJM 4BL5A 2DLDA 3I5MA 1W8DA 1SNYA 4QQRA 1YBMA 3PVZA 1A5ZA 2LDBA 5A1TA 5TLSA 3OEYA 1IZ0A 3O8QA 1UUFA 3WFJA 4J90A 2CZCA 4LK3A 1I33A 2BFPA 2NVUA 2X0IA 1MP0A 3ZWWA 1KVSA 1UXGA 3W4IA 2Q50A 3DOOA 4RVFA 1PGJA 2XPCA 3HB5X 4NR0A 3SLKA 1MG0A 3P5SA 3INTA 1MLDA 3EVTA 3RU7A 1PWZA 3QWHA 5I8WA 3ZZNA 3GGGA 2Q1SA 1QYCA 4QEDA 3CMCO 3JQBA 5T5QA 1XU9A 5C7LO 1DOHA 1O6ZA 4M1QA 2HO5A 4OXKA 5KVCA 1GDHA 3R1IA 4IXTA 3VPGA 3GG9A 4MVJH 4YXFA 3CPSA 3WICA 4CM9A 5B1YA 1IE3A 1NWCA 2OP1A 3WQQA 2C0CA 2CMDA 1FF9A 3AM4A 1K2WA 4DWVA 1I0ZA 2AEFA 2VHVA 3A14A 3NX4A 4ZD6A 4KWIA 3B1FA 1BGVA 4XR9A 5AXDA 1HKUA 3RUCA 2Z1MA 4CMIB 4EW6A 5JCJA 1DFIA 1SBYA 1YDWA 4TZTA 3GEDA 4CM6A 2R00C 3ETGA 5KWEA 3JQ8A 3PJFA 5DN9A 3D7LA 4I9HA 1I36A 1I2CA 3W8DA 4E5PA 4OYRA 3GVCA 2OXIA 1Q2XA 5H81A 3MTGA 4ZHSA 2WTBA 3HADA 4CMJA 1Z6ZA 4BNIA 3AUUA 1PL6A 3ZWAA 5KTKA 3I83A 1N7GA 5L51A 1RM5A 3WBBA 1TA4A 4RCVA 1KVTA 1QP8A 1ISFA 2Q46A 4AJPA 2AQKA 3GDGA 4YJDA 4Z0TA 5COAA 4LRSB 1F06A 4CLXA 2G1UA 1GADO 5JXWA 2POQX 2PD6A 4EBFA 2FR1A 2VUTA 1XWFA 1DRWA 4E12A 4CUZA 1PU2A 3SC6A 2J5QA 4IJUA 4OXYA 5TNXA 4IY1A 1PSDA 3KXDA 4TMFA 1EFLA 4Z6KA 3LZ6A 4BNWA 1OC2A 1XR3A 2BELA 3L4BC 4ROSA 3WGHA 4L4RA 5TJ9A 3LLSA 4R01A 4B7UA 3A28A 1QV6A 8LDHA 1H5QA 1V9LA 2CF6A 4J49A 4PVCA 4YJFA 1ARZA 1JN0A 4IPTA 4EJMA 2WSBA 2I67A 1ZK0A 3I4CA 3QHAA 4W7HA 1NQAO 1TT7A 3WYCA 2PY6A 4YWJA 4RORA 2VYVD 3W1VA 2XXBA 1E1LA 4PLZA 1E0DA 3VH3A 4BGIA 3V2HA 1TLTA 4ZQFA 1F12A 4RVUA 1KEVA 2VWPA 4IDFA 2YV2A 4EGFA 1ADFA 1GZ3A 2P91A 3PQEA 1MG5A 1ONPA 4XWYA 1E6WA 5JMWA 2O7SA 1BW9A 2HKIA 4RVSA 2HK7A 2Q2QA 3INRA 4FIZA 1E7WA 3S2GA 1U2DA 3MTJA 1TVEA 1GEEA 2I6TA 3UCFA 3DAFA 1ISJA 3DBRB 2RHRA 3ZV4A 3ZW9A 2I5PO 1HLDA 1H6CA 4IGEA 2ZB3A 2Q4BA 1BHSA 3N74A 4YRBA 3RASA 1ADCA 2EERA 2UVDA 2P68A 3HDYA 2X23A 3LK7A 1DAPA 1KEWA 1PS8A 3GF4A 1FDSA 1Q0LA 2BD0A 4D3FA 1VLLA 2C59A 4WCDA 3U62A 4DMLA 3H9UA 2C5AA 3GEGA 4L75A 1HF3A 3ZU4A 1ZEMA 4BGUA 1PL8A 4ONEA 4TKMA 1HYEA 1R37A 2O23A 4XR4A 1UH5A 4FFOA 3MJ4A 5COBA 4NBRA 5JDIC 4E13A 4HFJA 2PGJA 1GCOA 1PJSA 4B4WA 5AXBA 4BB5A 2Y1DA 4XGKA 3W8FA 2CDAA 2J3JA 5DBIA 1ISIA 1OFGA 4GAEA 4UUNA 3ZNOA 4B79A 3RKUA 1P1IA 5I7EA 1LTHR 4J7UA 4DLLA 1NWHA 1DC5A 1Z82A 4JROA 3EK2A 3GFGA 1KVRA 1C0LA 4QECA 1YS4A 3SVTA 4RZIA 1SPXA 1MFZA 1WP4A 1Y5RA 1N1EA 4FS3A 3RC7A 4TVOA 3A06A 3AWDA 1PGQA 5AOVA 4OGWA 4II2A 3LYLA 3WX0A 3JYQA 4HV4A 3ENKA 3I23A 5G2OA 3IAHA 1LDMA 5I8ZA 4E32A 3ZV5A 3EYWA 4ZRMA 4YRDA 4AG3A 3DBHB 4CMEC 1K89A 2Z1NA 3CZMA 5A5EA 2Y1OA 3K9QO 2O2SA 2JHFA 3BMQA 1K6XA 2HU2A 2XAAA 3LDHA 3TZKA 2FWMX 2NU8A 3FSRA 2IZZA 4HFMA 4DVJA 3CZRA 3BIOA 2H63A 4N18A 4AFNA 4RQUA 1YQXA 2QW8A 4L73A 5GZ3A 3AM5A 3FI9A 4DC1A 4BGEA 1C1XA 2C5EA 3CINA 1BVUA 3WXBA 2X9NA 4RL6A 4WUVA 3JQGA 4ALMA 5L53A 3PLNA 5JDCC 3R3JA 2GD1O 1Y8RB 4DQVA 1NYTA 2B69A 3RFTA 1NFFA 2BGKA 3RC9A 2VYVA 4LVUA 3D5QA 1M75A 3ONFA 3WYBA 2CVQA 2W90A 2E4AA 3VH1A 4BNGA 1U1IA 5B37A 5JC8A 1N8KA 2BKAA 3X2FA 1YJ8A 4K28A 3GAZA 1HEUA 4FOOA 1NP3A 4XQ9A 4WEOA 4NI5A 3EMKA 2FR0A 4ZQBA 1P3DA 3VHRA 4I08A 4J0FA 4K6CA 2HMUA 4DLBA 2CSUA 4YAKA 3I9JA 2AE2A 1R4NB 3BMOA 4GI2A 2PD3A 3IKTA 3FPCA 1HLPA 2EKLA 4CLOB 2ZTMA 4CMAA 4UAGA 4D45A 2PV7A 4Y6RA 2QQ5A 2DUWA 2WYWA 3QVSA 4IXWA 4W82A 4JNKA 1Y1PA 3QVTA 4YAJA 5JSFA 4XDYA 1Q7CA 3ZWOA 5KVVA 1XEAA 1DSSG 4D7AA 1J5PA 3R3SA 3TDKA 4QTZA 4QO8A 3ENNA 1LRKA 4PG7A 4BNZA 4YDRA 3DHEA 3UUWA 5CDTA 4PLYA 3PGXA 3VDRA 2EP7A 3T4EA 2YZ7A 3V5NA 1BXKA 1NR7A 1LLUA 4OMUA 2HCTA 4B7XA 3JQBC 4K9DA 1I3LA 3P2YA 5GY7A 1E3IA 2DVMA 2IZ0A 2X9VA 4MVJP 1F8GA 1JWBB 5TRTA 2Y1CA 1W4ZA 4U0JA 4KTVE 3B1KA 1E7QA 1F8FA 5IN5A 4YBZA 4A5OA 1EK6A 1GFSA 5JO0A 3I9OA 3WJ7A 1IYZA 1NAIA 4XX0A 4H16A 3ZU3A 4I9NA 1YVEI 1AN9A 4OHUA 4XD2A 3TQHA 4N5LA 1A7KA 4E2WA 1PJ2A 3TZQA 4CM7A 2DBZA 2CDBA 1HE2A 1G1AA 1NHGA 4CM4B 2WMDA 2CFCA 2G82A 3H7AA 4MP8A 2IRWA 1QYWA 2X22A 3DHYA 1T24A 1V0JA 4YB8A 1IULA 3HDQA 5JPIA 4DQXA 1NPTO 2UV8A 1ENOA 3I6QA 5A02A 4ID9A 5BSEA 3D3WA 2C2XA 1LSJA 4BKPA 4ND2A 5I9MA 4CUKA 4PG5A 3BMNB 3WGIA 4EUEA 1M76A 4JJFA 1KC1A 4NK5A 5IZCA 1PJLA 1Z45A 5LDGA 3LT1A 4TRNA 2EG9A 2D4AA 5DT9A 3EAGA 3D64A 5BNFA 1NAHA 3RBXA 4XGNA 5KJEA 3RUIA 1HYHA 1U8FO 1FDTA 5IAAA 2VHWA 1PR9A 5A06A 1GV0A 3GVPA 1LSOA 2QRJA 3UVEA 3IJRA 4GL4A 1MFPA 4CV3A 4TZKA 3P19A 3JQFC 3U3XA 1LU9A 1KVUA 2X8LA 3H5RA 4M8SA 4W99A 1DDOA 5HM8A 1A7AA 1NPDA 3EDMA 4QO7A 2AE1A 5AQ1A 5CFZA 1OZAA 4YAIA 1ZO8A 3O03A 2HSDA 3OJ0A 8ADHA 3WOHA 3V2UA 3UICA 4R1UA 4WPGA 3UKOA 2IZ1A 2BHLA 1XQ1A 1SOWA 2I9PA 3ADPA 5L7TA 3WLFA 4YTEA 1DFGA 3KLPX 1XDWA 4AJNA 1U2GA 1P0CA 4XYEA 1CERA 2SCUA 4E3ZA 1X7DA 1KC3A 3HHPA 4YRAA 4I5EA 3CIFA 3C8MA 4II3A 1EVIA 2PKQP 2RCYA 3T7EA 2WEKA 5I7FA 6ADHA 1SB9A 4JK3A 4AJ1A 1PJBA 4A03A 1NTOA 3QQPA 4HWKA 2Y0EA 5F5LA 4YPOA 3OA2A 4J3FA 1A72A 4YQYA 5L4SA 1NHWA 1R4MA 3PWKA 1E6EA 4Z0PA 3GOHA 1VJ0A 1WNTA 3GPIA 1N9GB 2DUUA 1B8VA 3WGQA 4DREA 2I3GA 3JQ6A 1NR1A 3JQCA 4M87A 1Q7GA 4LISA 3V2GA 4GSKA 3JTMA 4NU5A 3I4FA 6LDHA 4URFA 4ZU3A 3HNPA 3UFXA 1GUYA 1O9BA 2Y67A 5IXYA 3H5AA 5DCWA 1Z74A 4NU6A 1U5AA 3AK4A 4YJHA 5EN4A 1YB5A 4IDAA 1A27A 4IDGA 5ILGA 1AUPA 4ND4A 1QXSA 4ZQHA 3DFZA 3DBLA 4PZEA 4CQMA 4N7RA 1ZMOA 3RFXA 2WWRA 4LGVA 2FMUA 2JCVA 2VYNA 3H2ZA 4WK6A 5C3MA 3LC2O 2OO5A 4B4VA 3NJ8A 4Y9DA 4MIYA 3QRWA 2X5OA 2D59A 5IF3A 5DNAA 2X5KO 2XF8A 4OIMA 4Q3DA 1ENYA 1WLYA 4BGVA 4QFDA 5A9SB 1E5LA 1VI2A 1UP7A 1C0PA 1K0UA 1N1GA 3TL2A 1T4DA 5T67A 4PN3A 3PHHA 2DQ4A 2QYTA 1MV8A 1NASA 2C82A 4MVJF 3W6UA 3ZWYA 2ZQYA 4IDDA 3PGJA 5BQFA 5KOIA 2RHCA 4YQZA 1EE2A 3KUXA 2VQ3A 4BQRA 4ALNA 2D3TA 3Q9NA 3BMCB 4FFMA 3VZRA 4CR8A 1AHIA 4GVXA 3WWYA 2DPHA 4DGSA 4XEHA 4WCFA 3ANLA 3GHHA 1IHXA 5TS3A 4CV1A 4PG8A 1Y8QA 2P2SA 1DEHA 2NNLD 1LC0A 3PWZA 4FSHA 4JX8A 4CLHA 2C29D 5KJ6A 2WJPA 1VRWA 2UAGA 1SAYA 3HN2A 3RC1A 4DQUA 1UXKA 3HWRA 1IPFA 1SOVA 2DBVO 3WGOA 3C1TA 1NVMB 3DOCA 1OOEA 1EQUA 1CF2O 3F4BA 4DYDA 3CE6A 2FR8A 1SCUA 4ESOA 4BHTA 5IDWA 4ZJUA 2HQ1A 4XZ3A 4U6SA 3DQPA 3IMFA 1ZSVA 3MOIA 1P45A 3HE3A 4OJNA 2D1YA 2VT2A 4OOEA 4J16A 3PZBA 2HRBA 3OIGA 1QG6A 3GT0A 1TI7A 2VT3A 4GVLA 3AUSA 3KV3O 4TVBA 1Y9EA 1P1HA 1V3TA 3GVXA 3K5PA 3K6JA 3JCZA 1LDEA 4KTTE 5B4VA 2FOIA 1JTVA 5A05A 3ULKA 4W4TA 4E5KA 3D4PA 1VSVA 4D46A 2NLOA 5KIAA 2H9IA 1E77A 2ZYDA 1JVSA 2X86A 3ICPA 1HSOA 2CF5A 1B16A 1TEHA 2DC1A 2QZ9A 1AHHA 3Q0EA 4CQLB 4FFNA 4NJMA 3S55A 1PTJA 2AXQA 2XOXA 5BSGA 2IE0A 2OUIA 1I30A 5H83A 4YT8A 4HADA 3ZWMA 4ZGWA 4L4SA 1GZ4A 1IL0A 2DFDA 3E82A 2HDHA 3NUGA 4KQXA 1YL6A 4CR7A 3VVBA 5A9TA 2JKVA 2JFHA 3BXXA 3L77A 1MGOA 2F1KA 3JSAA 1LJ8A 1YKFA 2VTEA 2VWHA 3GN1A 4EUFA 5CG2A 1ZW1A 4CM8B 5JAIA 3E5RA 2Q99A 3WWZA 4OOFA 4WLFA 2XXJA 1V8BA 2BH9A 3OECA 4ND3A 5CEEA 4JJIA 4JIGA 3DZBA 4BV9A 4NJOA 4RQTA 3WQSB 1GZ6A 3H9EO 3LU1A 2PR2A 2EV9A 3GNTA 1QLJA 3OJEA 1EDOA 1LQUA 5G0WA 4J43A 2D8AA 1L7DA 3NT4A 4CLDA 1T1RA 3K73O 3PHJA 3I1JA 1LDGA 2NQ8A 4YAGA 1MX3A 4M49A 1AXEA 1LRJA 3A9WA 2PD4A 4R3NA 3LF2A 3SJ7A 3W4KA 3F47A 1H93A 1U28A 3JQAB 3ZWBA 4I8XA 2EEZA 3DONA 2VUSA 4L8VA 1Q1NA 3QJ5A 4QXMA 3WNQA 3HDHA 3VPXA 1ZCJA 5IFLA 5KVQA 4IMPA 3DR3A 4Z9YA 3WNVA 3L9XA 1R6DA 3ZCXA 3QLJA 3UOGA 4DC0A 4Y98A 5BR7A 1MB4A 1J0XO 1JAXA 4KUHA 3U5TA 4GPD1 4PLVA 1DC6A 2EXXA 3D1LA 1HXHA 3D4OA 5CG1A 2GDZA 4FFPA 4KZPA 4CM1A 1YBVA 1T1SA 3ASUA 2Y1FA 1VPDA 1T26A 5L4NA 2Q1TA 1T2DA 5K6AA 5L7WA 1LRLA 2JD1A 5K0ZA 3NTQA 3JD4A 3S2EA 1S6YA 3BYZA 3NTOA 2FPIA 4PRKA 3S2IA 5CPBA 4CODB 2JFGA 4KDEA 4OKNA 2B4QA 2YV3A 2RAFA 4JP3A 4D44A 4MP3A 1SZJG 2OP0A 3GUYA 1MC5A 1QSGA 2GRAA 1D7OA 3PQFA 4XIYA 5A04A 2EGHA 4UREA 4JGBA 2BMAA 3FWNA 3EGOA 4PLGA 5BT9A 3BTSA 2VZ0A 5MDHA 5KJFA 2P9EA 4A27A 2Y05A 3EHEA 3MEQA 3QA9A 5LDHA 2EHDA 3WB9A 5FFFA 1B14A 1BRMA 3C1AA 4C7KA 4GX2A 4Z9FA 3RCBA 3OF2A 3WJAA 1DO8A 1ENZA 1QKIA 5DZSA 4E6PA 5JLAA 3CH6A 3UHAA 5I9LA 4A2CA 3HN7A 3OJOA 3IP3A 4E2ZA 5JMPA 2V6BA 4XDZA 5TF4A 4DUPA 1PS0A 3GGPA 3QW2A 3V1UA 1ENPA 3DMYA 3COSA 2A92A 2YJZA 1EQ2A 1EUDA 1IB6A 1N2SA 1Z7EA 4Q3BA 4W7IA 1WWKA 4BNTA 5DBGA 1R15A 3RU9A 4NG5A 5FEUA 4GH5A 3OQBA 1PWXA 4ALLA 3IC5A 3VDQA 1OI7A 3OJFA 1R0SA 3F9IA 2CY0A 2PGDA 2C20A 2Q45A 4FW8A 5THQA 3DC2A 4D41A 4LW8A 1IZ9A 3KSDO 2VRCD 3TRIA 4UVHA 5A5FA 3PYXA 1ADGA 1B26A 3QWBA 3KYDB 1P1RA 1QYDA 1ULUA 1HDRA 2X0RA 4JLWA 1V3UA 3W8EA 4CMIA 5JYDA 4RLSA 2IYOA 4P4NA 2Y0CA 4ITUA 3P7MA 3SLGA 2EF1A 3GAFA 3G49A 1NQ5A 2NACA 2GN9A 2NUAA 3TFOA 4GMFA 1PZGA 3WGGA 1PQWA 4G2NA 1PZEA 4AJOA 4BNYA 4Y6SA 2ILTA 4NBTA 4IUYA 1YOVB 1R66A 3DMTA 3KB6A 3ONEA 2WD7B 2YFHA 1YGYA 3PP8A 3ST7A 2YW9A 4E2YA 4EEZA 1XSEA 2YDYA 1C1DB 3IQDB 1U3UA 2Z95A 3IUPA 4MKRA 3H8VA 2G0TA 2GZ3A 1YWGO 1X14A 3BHJA 3WIEA 4BKUA 1LDYA 1ISGA 1H0KA 4J1QA 3INGA 4AJJA 3NYWA 2ZATA 2GASA 4M89A 4E21A 3LT0A 1O0SA 4Y67A 4NHEA 4DPLA 1Q0HA 3NTRA 3WGYA 4EJ6A 4RPJA 1SEVA 1A4IA 4BNVA 2W4QA 1KY4A 2NQTA 4QX6A 2JFFA 3FN4A 4WCFC 3TSCA 4AICA 3RI3A 1RM0A 4FB5A 4ALJA 3E18A 3M1LA 3GEMA 2YHIB 1ZZEA 3IIEA 3B6ZA 3GUCA 4GMGA 3MJSA 2B5WA 1W6UA 3C7DB 1BSVA 4BNXA 4P8RA 2RH4A 1ML3A 2O3JA 4Y6PA 3I6IA 4RPLA 1HYGA 4PFJA 2W2LD 5F1PA 2C2YA 3TNLA 4XQCA 2TMGA 4A26A 4HX5A 3NDRA 2PKRA 1T2CA 3RUFA 2O50A 2OZPA 1UDCA 1X0XA 3PLRA 3VTZA 4GLLA 3PPIA 1WW8A 2PZKA 1ZK4A 4QFCA 1ZNQO 4J9VA 1EBFA 3C85A 1EE9A 2BRUA 3DZJA 2GNAA 5L45A 1EDZA 3DBRA 4RGBA 4ZN6A 5G0SA 3M2TA 4J4TA 1Q7BA 3GDOA 5KNLA 1GL3A 3CEAA 3LC7O 3GMSA 2P9GA 4G65A 2O3TA 2C7GA 1D3AA 4E5YA 4E5NA 1JKJA 2BFOA 3VAZA 4UVIA 4MKZA 2FHSA 3JYNA 2Q2VA 4EDFA 3PJDA 2NU6A 1QLHA 3DL2A 2O7QA 3CTMA 4IQGA 4XYLA 1XLTA 4O1MA 3RAJA 5JAZA 4BO2A 1FDVA 2O3RA 1PS9A 4FFRA 1TT5B 1HTBA 4MO2A 3GRKA 4PZDA 2FRDA 4BNKA 1KEUA 4OAQA 3AU8A 3QVWA 2RH8A 3G3EA 5G4KB 3EW7A 4FR5A 4INAA 3G1TA 4LSWA 5CDSA 1ZMTA 4HXYA 5KVSA 2JCXA 4ZVVA 1M2WA 3LQFA 1LEHA 1E3SA 5ICMA 2VRCA 1GQQA 2O3QA 2RBEA 3TN7A 3L9WA 4BO1A 3KZVA 4CMKA 1HRDA 2Y93A 3AUAA 2ZB8A 1C3VA 3ZHBA 4J91A 4IIUA 4QSMA 1VKNA 3AY3A 2J6IA 4PGFA 5JAMA 4NFHA 3F6YA 2W2KB 4O5OA 3UXYA 4BNJA 4D0RA 3S1LA 1WDLA 2BFMA 3FTNA 1NBOA 2JHGA 2VZ9A 5DP2A 3FCOA 2GO1A 2HRZA 4FN4A 4RJTA 3DBHA 2DAPA 1KS9A 5TC4A 3V1TC 3AM3A 4WLNA 1BMDA 2X0NA 3LSYA 4FJ1A 4IBOA 1BXZA 2AEMA 5JW6A 3IP1A 1WVGA 1RPNA 3JD2A 1YO6A 1E3WB 5IZ4A 5JNLA 1H2HA 1Z7BA 4M55A 1BWSA 2NU9A 5CDGA 3UW3A 2NWQA 3LT4A 3GRPA 3P2OA 4PLCA 3I9MA 2UUPA 5JCXA 4YR9A 4CMCA 4J1SA 1ONNA 1HDXA 4MVJG 1PJTA 3GZNB 4IMRA 4CL8A 4WLVA 3W6ZA 5A3JA 3GK3A 3RD5A 4YAEA 4TWRA 2QG4A 5K6AC 5TJHA 3O4RA 4JN6B 4BMNA 3LC1O 1Y8RA 3RC2A 1J49A 4WLEA 3ZI0A 2Y99A 2A94A 2I3AA 1VL8A 3MJTA 4D3SA 2PWZA 3RFVA 1HWYA 4JBIA 2DTDA 3WSWA 1V35A 5DOZA 3FD8A 4ZQEA 4E33A 5DCUA 3RSHA 4BO6A 1V6AA 2DBQA 1DIBA 2VNAA 1PJ3A 4M54A 3KEQA 4ZA2A
chains in the Genus database with same CATH superfamily
4M1SA 5FTWA 4M1TA 2GN8A 3KJQA 4ZCLA 2GPTA 3FWZA 2OT3B 4OV6B 3RROA 4GIBA 2A9VA 3KOUA 4JJ6A 1XFDA 1JI0A 1DUVG 1P5FA 3FYHA 1GR1A 3H97A 2Y0DA 2YRWA 3KHUA 3FZGA 4FILA 4LTMA 4NU0A 5CFOA 5FWYA 4TTPA 1C8BA 1DIOB 4HQNA 1AXGA 5AJXA 4AWAA 4BX2A 1RLOA 2WM8A 3ND6A 4E22A 3EEIA 2H51A 2C3OA 3WKAA 2FK7A 1Z63A 3TW8A 1FXSA 1NT4A 2XD9A 3KKNA 2Q5CA 2WFLA 4U9IS 4YJGB 5C1BA 3GUZA 3QWIA 4PAQA 4XIJA 1CUEA 5EQDA 3LBNA 3TAXA 4MW4A 3HK2A 2XUFA 4FS8A 1GVNB 1JEOA 3G13A 2H8GA 4GECA 1WU8A 3K09A 2B0JA 3I1FA 1ZCBA 2HT6A 4RF2A 1YKSA 3NZEA 3HL0A 5T7BA 3L8MA 4RD0A 1YVPA 2I7TA 1JAZA 2J08A 2R84A 2PL1A 1USKA 4X0EA 4EHIA 1SXJE 1JSRA 3U5ZB 1G1MA 1QHIA 3ITKA 3SE7A 2YMPA 3OP4A 2ZSAA 3K5HA 1A50B 4GNRA 1CYDA 3BJEA 3QI7A 3GB9A 5G0TA 1M2GA 2QUJA 2R4UA 2VHEA 2VP4A 1M1ZA 3KPUA 4NBVA 5HJEA 3ZTWA 3NRCA 4KCGA 4WFJA 4OSPA 4NIMA 5ILOA 1A8SA 3KTDA 4JYBA 1KJIA 3OLWA 4FOSA 4CU2A 1Q3TA 1YMQA 1NX6A 3IT3A 3H11A 4FGWA 5CH3A 3SGLA 2X14A 3BK7A 3G9QA 3VBCA 4L3WA 4DRXA 5JALA 2P69A 4Q7KA 1WXQA 4RTJA 2G4CA 1JS1X 2QIOA 1H6AA 3TZHA 4BCBA 4MLCA 4DNQA 4HEA6 2FZWA 3COPA 2H11A 5K0LA 3IQXA 1P4RA 1XZLA 3R7BA 1AIPA 4WXHA 1GEGA 3R5TA 1ONBA 1HE5A 4O2AA 1O96B 3OPYI 3HU1A 3STTA 1RWBA 4EW1A 1XZJA 1G17A 4DR2B 3FTPA 3FPBA 1AX9A 1W96A 2XMQA 4N9WA 3WNZA 1MAAA 3Q85A 4CPDA 1M6VB 3ZNPA 1QKKA 2JHCA 3WLHA 3TZCA 3P9PA 3O2QB 4NH4A 1ZS9A 3G0OA 3L0DA 1M6NA 3PHIA 4BNMA 2OFFA 3WISA 2O59A 2NPIA 5F98A 1D4AA 1KH1A 1I51A 4FGSA 1UOQA 3DWFA 3QXSA 4FDLA 2GMWA 4OI4A 5DLDA 5L3ZA 3ZBTA 4C6SA 4HNUA 3HJUA 4MRNA 5KKNB 4PRLA 3K4HA 2FJPA 1SUDA 5F3RA 1E7RA 2ZRNA 5CYFA 4FDAA 2O54A 2FKNA 4R1SA 1T0BA 1XK6A 1YQGA 5A6SB 4CNQA 3X1MA 4J6FA 4E5SA 4YT4A 3T5CA 1DRJA 3INNA 4N6OA 3RRBA 4XD7D 3RG8A 4KE6A 3FMOB 4MS1B 3UGKA 1XDDA 3AQIA 1Z7YA 3MS7A 4MVJE 3Q3CA 3V8BA 4RTKA 4FQ8A 2CDCA 4EHDA 2JAHA 3AEQA 2K4MA 3VTFA 3QSYA 3KSMA 3T3EA 4NCKA 4BWFB 1XCJA 3NHJA 5CLGA 4DZTA 1R0YA 1U2QA 1CEQA 4CYMA 4LNHA 3RRNA 4EG4A 4AMGA 2XOKA 1JDJA 1PL7A 5BMVA 2FSFA 4C0HA 3WNDA 1PKEA 1Y6JA 4RABA 5BSVA 4X66B 3CLSD 3BXOA 5ER9A 2CNBA 2GK6A 4U3JA 2HWUA 4OCZA 4A23A 2P27A 3WK6A 3PC6A 2V8OA 2W6CX 4IFTA 2MYNA 3A9VA 3OQOA 5JSZB 4JSTA 1AXRA 1JZSA 2YICA 4I4NA 3ICCA 2WA1A 5LDDC 2AKEA 2YIVX 4B31A 1KQGA 5SY4A 1IY2A 1ECGA 1RWOA 4H4CA 3A9CA 4V3CA 3HJGA 4BUCA 1CJCA 3PXAA 1C80A 1EM8B 1OAAA 1VJ5A 1A5TA 3WB1A 1S2DA 4W5RA 5FLEX 4BNHA 5DP1A 2HA2A 2N3ZA 3OPMA 3LBAA 5EE1A 2OAEA 3BCSA 2YYSA 3LCRA 4Q4LA 4BO9A 3V4OA 1UZLA 1WMFA 3ZU5A 3T4PA 4KWHA 1EWTA 3HR4A 3GFBA 1X1TA 1VJRA 3SQMA 4YFYA 3KLMX 4GZ3A 1DADA 1FRVA 1P19A 1GG8A 3WSVA 3HEMA 1JGTA 3IDOA 1ULHA 2B0CA 2YWGA 4BRZA 1KMHB 1XIVA 2JAPA 3B78A 2ID9A 421PA 3KQMA 3ZDZB 2BEVA 1N9GA 2W2XA 3RT7A 5I9NA 1M2FA 4WV3A 3HXQA 3CZQA 3GLVA 1VMDA 4BFSA 4D8VA 5ELLA 4BMOB 1EP9A 1G291 4QA9A 2CCJA 5F2OA 2CFSA 2IP1A 1D07A 2C07A 2R8BA 4BNDB 4ZTBA 3LHDA 1Z37A 3MJFA 1RADA 3W06A 3PD1A 4DCNA 1A7UA 4LRTB 2RGGA 1UP6A 3MN1A 4Y2PA 4AECA 4AKIA 1PJQA 4H4DA 5J2UA 2JCBA 1QIDA 4UEJA 2H17A 4YRFA 2PVPA 1DB3A 1Q3KA 4LXUA 4EHNA 2QRKA 2BEWA 5JU6A 1IRXA 1UK9A 1HMPA 1RVDA 2QXUA 1M5RA 5KWVA 2XKBA 4MW1A 5FTMA 2FPPB 1V47A 3M4NA 4YRCA 4RY2A 3R5JA 1N34B 3GZ4A 1QCCA 2IYSA 1VKRA 2ZREA 1J2RA 4FPXA 4OH7A 4P7FA 4C4OA 3BZWA 1I94B 5KYKA 1LWNA 2PKQO 2FVYA 3W90A 1J8YF 3N5CA 2JFOA 1JEEA 5AJYA 1G66A 3TTSA 3WC4A 3WLEA 5AHRA 3O73A 3OE5A 1JBEA 1WXIA 1ODIA 2R9VA 2PZAA 5GADl 1TK9A 4EPWA 4BP9A 1ZJJA 1FFGA 1D8AA 5TQVA 2AD5A 3GELA 2XSZD 2Q5EA 4YRQA 4UXJA 3NTLA 2F62A 4GOLD 4R8KA 3P9IA 1QDLB 1N6IA 2A9QA 2XVMA 4HLDA 1YDEA 3GROA 1T9KA 4R3WA 5EJ2A 4OJQA 5BQOA 3W5AA 4G0VA 4QXAA 2E82A 3T3HA 4I5GA 3WTBA 4A7PA 2WPDD 1KBOA 1E8DA 4HYYA 3PV0A 1KVQA 2H0AA 4K2HA 1CIVA 2HMAA 3G1UA 1CY6A 4H6PA 1K2VN 1Y5NA 1K0FA 2CLIB 4OQZA 1GTJ1 4CLRB 3E9RA 5U4QA 2FQ1A 1GQOA 2OGTA 3R6TA 5IF9A 2I2BA 3QLEA 4XPIA 1NG9A 3T1HB 3PL5A 2DSTA 3AF1A 3VYRB 2EBHX 2PKEA 1VJDA 1KP3A 1MGPA 4MV7A 1ISSA 3R0XA 3O94A 2TYSB 2XZTA 2OCKA 2FWIA 5I4BA 3MUEA 2W71A 4EZBA 1CR1A 1P3JA 5ITWA 3A4YA 4Q9AA 1U6KA 2PX3A 3ZV6A 2CFTA 1O9GA 4KFTA 1RM4A 1U8TA 1N0WA 1JYSA 3IR7A 4XD7A 3FTCA 4G1MB 2L18A 3UWSA 1U5BA 4TROA 4PGMA 5CXSA 4J0IA 3MCWA 5IPFA 4P3OA 2O3SA 2JH8A 3KTOA 4IYJA 2P9QA 1X77A 3IUQA 4UARA 3VNAA 4CMHA 1C7EA 1FFAA 1FW8A 3HDTA 1P39A 1D9ZA 1XAHA 2PM8A 5ALPA 1FJHA 1RRMA 2F9LA 3C41J 5DU2A 1CS0A 1ST3A 3GI1A 3B60A 4H35A 2VRBA 4KLRA 2CXQA 4MWZA 1TMYA 3T0IA 3HY4A 5HX7A 2NV6A 4ZV9A 1XMQB 1GAEO 2E87A 3BIFA 3DZCA 2NVUB 3OWXA 4CM5A 3NM6B 2L82A 2VDMB 3EGXB 3NJRA 3WE7A 1QTQA 1XMVA 2R751 4ML3A 1WUTA 3TNFA 5KCMA 3GGSA 3U9LA 4ES6A 3DL4A 4QOJA 4G8BA 1I3NA 3CLRD 3B20A 5JATA 2F59A 3UG6A 3VXKA 4JB2A 4N0MA 4OHRA 1TQHA 1LSSA 1F1BA 1CUYA 1JZTA 3RHTA 4DA4A 1QIFA 1GTVA 2OYCA 5EKSA 3ZY4A 5L95A 5BWOA 1OH6A 3VU3A 2XMRA 4F1WA 4Q82A 1GV1A 2RHLA 3MCUA 1E59A 1I7DA 1G6KA 2O20A 5BWCA 3N8HA 1XMPA 4V0ME 3O0TA 1O5OA 3GLSA 3OJXA 5D5HA 1TB4A 4EB8A 4B09A 2QLJA 4HQOA 1TPYA 5A3SA 3RKRA 1R6BX 4KR6A 4LTNA 4FIDA 4US1R 4OL9A 4FONA 1U9ZA 2JLQA 4EB0A 1JG1A 2UKDA 2ZYUX 5EIEA 2P79A 2I66A 1Z8FA 4QDUA 1NNI1 4A92A 1O5IA 5BSFA 3T5PA 3DP7A 4O4IF 1N2CB 3CJQA 2AWOA 2P2YA 4YP0A 2JD0A 4B43A 4HVAA 3NLLA 2YFKA 4OATA 1JU9A 1ZIOA 4HDNB 4BB6A 2F4VB 1FNCA 1CULC 4GEKA 4ZAYA 5HNKA 3CN7A 3K09C 4NQRA 4Z4QA 1JLMA 5HJ2A 5F1YA 1L3BA 4DA9A 2O2DA 13PKA 1WCIB 3MRVA 4KIUA 4N39A 5BV7A 2UYCA 5BWMA 2ZBPA 2Z3WA 2WIBA 3R9XB 2O52A 3SC4A 3AINA 3C3MA 2JRCA 3E4CA 4Q4HA 4HEJA 1M2VA 1S8OA 3AWIA 3EIXA 4P4UA 4Q7JB 4QRDA 1MCZA 5E0OA 2X8JA 5EZYF 3PITA 2OBMA 3QOYA 3EA4A 3S68A 1NE2A 4KIGA 5I4CA 4B3TB 1XJWA 3VHXB 4BLOA 3FSEA 2JW5A 3Q1LA 1KY5A 4KMRA 1XPOA 1LNSA 3N2NA 5CXXA 3PEFA 2DPGA 4U2DA 4QULA 3W0LB 2P5YA 4QT4A 5JJLA 2BONA 3KAQA 2ICAA 4S3MA 1SUAA 5GMOA 5SZJA 2JF0A 1JW9B 4WOJA 2OLJA 4MKFA 4YC7A 5I45A 1I4TD 4TZ0A 1JFRA 1YL5A 3AG5A 3WIBA 1A5AB 3S7TA 3UT5B 5K3FA 1UKYA 4FCCA 1MO6A 1XQ6A 4WKBA 3CLVA 2XY4A 4TKUB 3C5HA 4OM8A 4NFSA 2B98A 2XSZA 4GGPA 5AWFC 4YRNA 5ARBA 3PNOA 4GOMD 4N54A 3ZCVA 4OYHA 3OTOB 4OFBA 3VR5D 3ORYA 3FR7A 3KEOA 4HFRA 3ED1A 5CT8A 3RWOA 1KJWA 2HJGA 2ID7A 1I8TA 2XCLA 3LQKA 3N3AC 4UCFA 1ONOA 3SHOA 1NQVA 1KH3A 1B4DA 2WPDA 4DHWA 2AHRA 3DH0A 1S7CA 5C8XA 2AC7A 5HZKA 1VYHA 3MUNA 1VCHA 2FY8A 3KR2A 1AGNA 1RYNA 3IOCA 4KBYA 1DO2A 4GHWA 3SVTA 2R1ZA 5C8YA 4JI5B 3CLUD 3TS1A 4BTEA 5FTJA 2ERCA 4HOYA 1KIFA 2WU3A 1OW3B 3Q7TA 2IZ7A 1YZVA 5AVOA 3V7FA 4RZHA 2R6FA 3VR4D 1GRNA 2JGMA 4Q3NA 3VV3A 2GH1A 4HK4A 1P8JA 3BXGA 3K8ZA 1Z2EA 4MQ5A 3ROFA 2IIBA 4C7OA 3CG4A 1ZJ4A 3ADOA 3CISA 3EG9A 3KPVA 2XCOA 2NO1A 2YYAA 1W36C 1R3UA 4FYXA 2XE6A 2I3ZA 1KDTA 2Q1WA 4MKIA 1Z0IA 2AB0A 3QTBA 5FL3A 4NFLA 1MO4A 4MVJI 5KPJA 3CW9A 1XVUA 1NBME 3K2EA 1HNXB 4QVKA 4CUJA 1M34A 1SWVA 1VSBA 2P2NA 2HXYA 3K0SA 3I5AA 1XGKA 3FZQA 3GNSA 4WHMA 5J40A 3V8PA 3VU1A 4IJVA 1FPMA 5IJ0B 4H15A 1Y81A 3BXFA 3CX7A 3Q8WA 1MW9X 1N2ZA 2AMVA 1JHPA 4LNUA 2XTZA 4Z4IA 1E96A 4B4DA 3QW4B 5EZ6B 3U09A 1KAGA 2C8JA 3IUSA 1D0SA 1DARA 3D8RA 3ONDA 3RNLA 3ZW7A 4WESA 4TYWA 2VI5A 3FDIA 4M83A 4FC6A 2OA0A 3FX2A 4EF6A 4LF5B 1B41A 4BLTA 3H9QA 4NSNA 4RFSB 2CLMB 4TM8A 1DIGA 1RI2A 1Y3DE 3RPEA 3WKEA 1HT0A 2RGYA 3GLUA 3UAGA 1ZUNB 4M76B 3TXYA 3VYTB 5B64A 3OCJA 1PIWA 3R3XA 1ZNYA 5D84A 1YRLA 1L7RA 3AI3A 1P1KA 3LPDA 1JLHA 4IDPA 4UOQA 4ON9A 3W3ZB 2C2KA 1SVSA 3FKJA 2CBXA 1QYVA 2NQ2C 2PK3A 3CZ9A 3BIWA 3ITDA 3KZOA 3NOXA 4B7CA 4YJ2A 2VQEB 4YO8A 2AQ8A 1X7GA 2Z6QA 3LQ4A 4RK5A 3AF6A 2HPHA 3KWLA 4MR8A 1TZ2A 3JR3A 3R6WA 4URHA 3RLIA 3R5KA 4YI3A 2D0IA 3ZD9A 4D0SA 1XWWA 1JDNA 3WHIA 3FTQA 4R5HA 3PU6A 1IBLB 2WABA 1OI3A 1SXJD 1V9CA 2QQEA 3CE9A 3OBBA 5BSHA 5JFOA 1NW9B 1BMQA 1IJBA 2ATVA 5H82A 2AMFA 5CIYA 1TA0A 1YHYA 2JHPA 7ABPA 3EJWA 1BRTA 721PA 2GXSA 3UCXA 3FVTA 2ZBRA 1A9ZA 4MW2A 3MTEA 4MEAA 1V7PC 4EFLA 2EBFX 4RKFA 4QGAA 4P38A 3LQYA 3ZCPA 1CEXA 2OB2A 5CIQA 2DX7A 4QBIA 3U7QA 4BWGA 4F2DA 5MN5A 1ZQ1A 1A4RA 1PZFA 4JS0A 5HUQA 2XMPA 4QEKA 1ZMXA 4PO8A 3HYNA 4A10A 3P4YA 1F2VA 2ID4A 1QC5B 1XU4A 3BMQB 4FD3A 2DLCX 1MTZA 5CD1A 3QWAA 3DL7A 3OX2A 3QU2A 5B58T 1ATIA 3GR6A 2NU8B 1LSUA 1NKVA 1TMKA 3HGMA 3UK0A 2Q7DA 5BNTA 3S1AB 9ATCA 5CA1B 5IKPA 2X1HA 3CVJA 1TM5E 4YGYA 3KUDA 4R2MA 1GTMA 3NIFB 2BW0A 3PHBE 5IM4A 1C1DA 3U81A 1PFYA 1T6BY 4GW3A 3E9MA 1C7RA 3PD0A 4UZEA 1C1XB 2D5IA 4NYJR 1IQ0A 2Q3EA 3WR5A 3UPTA 1WIWA 3VR5A 4KE7A 1T2EA 3KM0A 5CFNA 4Y9RA 4LJSA 2O07A 4C30A 2PWBA 1KXJA 3MQ2A 4EFMA 3IT0A 4HI0E 4IM7A 1NBEA 1LBHA 3IJPA 4LDAA 1QR6A 2LD4A 3TVDA 1J8QA 3V97A 3SK0A 4WFQA 2ZCUA 2OK7A 4RHUA 1YJXA 1V5WA 1FP4B 3WRYA 3O26A 4QQNA 1SD2A 3FJ1A 1W5FA 2YZGA 3L7NA 2H00A 4QHSA 1PV4A 1IXYA 3RUPA 1NVGA 2TMDA 2XDAA 3UJ6A 2VHTA 4MVJD 5SYMA 5HHTA 4FFSA 4C78A 1XYGA 1AK1A 1WW2A 3VR4A 4QICA 5FAXA 3WLQA 4JC8A 2IEYA 3DYVA 5DDIP 4LCBA 4U6NA 1GXSA 5CAEA 3MPOA 5F76A 3ROGA 3N8IA 4E4TA 3PHLA 1N1DA 3G6KA 5K3DA 1PLJA 4YVFA 1N4AA 4BKQA 1IHYA 1VECA 3MTQA 1MO2A 3K8QA 4HQLA 2F55A 4ZEMA 4PPGA 3GLFA 3N6XA 5ARDA 2QUHA 2ZK7A 5CFLA 2XDQB 4OHMA 1ORIA 1F0NA 3DLPX 1S3IA 4H3VA 1VIVA 2V9ZA 5DTJA 4B46A 4I1IA 2YJ4A 5JLJA 2C99A 4GYKA 1G38A 3OM8A 3CWZA 4TS1A 2QEQA 2R6ZA 3OKPA 3EEQA 1C4WA 4P58A 1NG1A 4P22A 4JXKA 4WA8A 3U80A 3Q2IA 1DAMA 3S8MA 3DT9A 3ESYA 1JIIA 3ZW8A 3KDAA 4W5TA 1S5PA 4ZK6A 2XMBA 2G08A 2OENG 1VL1A 5F64A 5B7PA 4DQDA 3PDWA 3DFUA 1J25A 3QPAA 5FBRB 2JD2A 3LNTA 2ZJOA 4M1YA 1CJUC 1P0PA 1AHPA 1MOSA 3IUJA 1U3CA 4TRRA 1PJZA 4N0QA 1GYPA 2DRIA 4LQ4A 3DLIA 2P4QA 4RY8A 1PQPA 1GUBA 4PHCA 1EG7A 3REOA 5GZ1A 4RYDA 3SYMA 521PA 3R24A 4XWKA 2E85A 5DSTA 4B34A 3N7AA 4M0CA 4L6IA 3EY4A 1UKCA 4CKCB 2FSHA 3NMUF 3H5WA 1HQCA 3RSGA 3EDQA 5K4AA 2QD2A 3ZGYA 4N7BA 3ZHQA 4BNFA 1EK0A 5MHTA 1KAOA 1J0EA 3ZDRA 4K9PA 2P5SA 1E2IA 4I8DA 2H31A 4MS3B 2QZJA 1N5MA 4Y2VA 1B3BA 2OGSA 1D0IA 2B94A 2QWXA 4KRYA 4XX0B 5CU7A 4FYYA 3CGGA 3KEFA 1KPGA 5D1NA 1ZYUA 5AJTA 1WZ2A 3AP2A 4DLRA 2F3SA 3OEED 1SXJA 1UFQA 4GOOD 1EK5A 2LKDA 1IG3A 5AK6A 1Q0QA 5ALQA 3TIFA 3E9CA 2V7UA 4JLAA 2YVAA 4BU1A 2N75A 3PK0A 1XYYA 4QU9A 4LCJA 7MDHA 1REQA 3EPRA 1ETHA 4BLQA 2X9GA 1ZR2A 3UWPA 1C3OB 4UUMA 4FWIB 5DYNA 3SR4A 1CZHA 5CCDA 1Y8AA 3SZ3A 2ZDGA 3IPAA 3ON5A 1P2SA 4EG8A 3D3WB 5I5GA 5AW1A 1VLVA 1WPQA 1X1DA 5ICGA 1XZPA 5KQRA 1VJGA 3NI2A 1F4PA 3UCEA 3HP7A 4A8HA 4RAQA 1PUXA 1MU0A 2NZ8A 3EC7A 3GJRA 3VFDA 3AL0C 4U2CA 4C5AA 2QRMA 2ECQA 4F3RA 1E0SA 2R6R1 3V2IA 1AURA 2E49A 2P8SA 2OV4A 3D6VA 1K5HA 4ZU6X 2M32A 3VKFA 2DWPA 4OYLA 3T54A 1B0ZA 2V7PA 3I2FA 3GLIA 4ZXFA 2MYTA 2HOQA 1K7YA 3NHMA 4QUJA 4ZHQF 5BURA 5KYYA 1FLVA 2RB4A 4CIYA 4WK4B 5ALXA 1YDFA 3CX8A 4A8JB 2VDNB 1HETA 4MLDA 3B5JA 1E9BA 4BFYA 1HA3A 4FC7A 1GFZA 5SZKB 4BFZA 3PPVA 4K6OA 3W8NA 4PAWA 3UWMA 4AM8A 2FFRA 3QGMA 4ZZ0A 5LN1A 2D5BA 1Q1QA 5FBKA 5AYVA 2RHBA 3LZCA 1FDIA 3MILA 5AKGA 3RQSA 4FYWA 5TQJA 5EJMA 3UM9A 3X1YA 1QX4A 1UKBA 3K7EA 3TPCA 2G3YA 3I9NA 3NKFA 1Y3HA 2FPGA 3ZWDA 5IBCA 1PVOA 3QM1A 3HFJA 3PZRA 4E70A 1MOQA 2B8JA 1QO0D 3DVAB 3H1FA 3O74A 4HN2A 2J3HA 4M1ZA 3M7IA 4MVJA 4Z9XA 4AULA 2WVJA 3OTQA 4EG5A 1CC1S 4M1MA 4EUHA 3O38A 2HPZA 3PT5A 2ODQA 1TADA 2A5LA 3BWXA 1HZZA 2ARKA 3L0BA 1RHQA 5IAOA 4RMNA 1W44A 4QDXA 5JZVA 1SCKA 5EIBD 2YN2A 1FJ2A 3IT2A 4HVTA 4TUYA 4IVNA 2EX0A 2QTZA 5JQGA 3TTUA 2BM1A 4X1KA 4DVGA 4N8DA 4R2XA 1WF3A 2HO4A 1C5KA 3UT6A 1QPBA 1FP6A 2H06A 5TSDA 1M2HA 2FU5C 2WE8A 4IIYA 2Q0XA 3MW8A 1VDZA 2PUTA 2NVWA 3BRSA 4FZ5A 4GXNA 3EZ7A 1DAGA 1PCXA 1HV8A 4K1LA 1MEJA 1SMKA 1XA0A 4PZZA 3TIIA 1CG6A 5C81A 3ZQUA 3SXUB 1DZIA 3C2QA 2B1QA 3FYDA 3GRRA 4TS4A 4W9RA 1H65A 4R1NA 5AKLA 4ITVA 4DCGA 1W29A 1M66A 3HMQA 2AK2A 3FFXA 1H4SA 3PE4A 4Y6GB 1NM5A 3LY9A 2M2IA 3P26A 2VF8A 2RHJA 2JPDA 5LBTA 1U8XX 4EITA 3CLRC 1KYQA 1A76A 3HQ4O 1HORA 3VH4A 4D80A 3WL4A 4YJGA 4M54A 2VDPB 3EFEA 3MT7A 4MULA 1Y6FA 1DHRA 3D6MA 4UCQA 1QYXA 3QVXA 2ZE5A 3BVPA 3F7TA 2D6FA 4P84A 4OGGA 4FOTA 1MJGM 4PX9A 4KRGA 4MQEB 1HFWA 4LY0A 4D56A 4KYTA 1PR3A 2B34A 5KC9A 4CQMB 1BCRB 5ITVA 5DBFA 2X8BA 2ILVA 3C3XA 3PQ3A 5E3JA 2WWWA 1Z5OA 4G1CA 4QUHA 5GTDA 1PFKA 1QK4A 1ZONA 1U1CA 2UYYA 3WG9A 1TL7C 4JLNA 3G85A 4BNUA 1JQBA 4EFKA 1Z2OX 2A0KA 3PGVA 3JZFA 2PZLA 4OF4A 1ACLA 3NHLA 1CP2A 2OG1A 3KSZO 3OKAA 3N75A 3OEEA 4PX2A 1ZLXA 4CG2A 2CVZA 5A0TA 2QJTA 3L18A 5GJWC 3SXJA 3WL5A 2VXYA 4EYGA 1NKTA 1RACA 2CC2A 1PK7A 4PLPA 5JYBA 3P71T 4WLOA 4CF7A 1SIUA 1SG6A 2ZBEA 4DLVA 1N6PA 5TEVA 1P1JA 1U98A 3RRFA 4N8EA 2ZSBA 3GP5A 2OCYC 4REOA 4BP8A 1BX3A 3JVDA 3O3OB 5CH5A 4DLPA 4ZTUB 8AT1A 2A1TR 3WGZA 2HJVA 3A1DA 2H1CA 1IY1A 2X2PA 3O4VA 4B6JA 1N6OA 1O96A 4P7JA 1QO9A 1A77A 1XKLA 5G40A 4RELA 2JHAA 5T6BA 1FMCA 1INLA 5AXCA 5FBZA 2EP5A 1WXGA 3DHVA 3MMSA 5CLHA 1NFQA 1YZFA 5TQ0B 3RIMA 5K01A 3ZJ5A 4QU0A 1M6VA 2Z2JA 1L1FA 1V2GA 1SK8A 4GBJA 5ALYA 2IDZA 3CUSA 1GU1A 1XDZA 3JD1A 2H57A 3BZUA 2EZUA 2Z2ZA 2ZYVX 1A0OA 4X90A 1OTXA 5FR1A 4KLAA 1N75A 3C8HA 3H5NA 2X76A 1PT7A 4K8RB 4NK4A 4QAJA 4WXRA 1U90A 4DMMA 1FTYA 3HR7A 1BDBA 2HLDA 3KVOA 4L0QA 1P7ZA 2Y66A 3I05A 3TR6A 4AC9A 1F14A 4O63O 2B78A 3HRKA 4PS1A 4DM3A 2QTRA 3SJUA 1K8YB 3BHMA 2QY9A 4XCVA 4AZWA 1N3IA 2EZ9A 4L6AA 5A6SA 5F1KA 1NLUA 4Y1FA 3UHOA 3FOEC 2GBLA 5AH0A 3BCRA 1LBTA 1RAHA 2ZRHA 3LG2A 2G28A 3G8DA 4HRVA 4MS1A 1H42A 1PEYA 2VOJA 4XGRA 3BGOS 4XI9A 3KQUA 4OU4A 1HDYA 5EHNA 3MCZA 4PTLA 3CLUC 3HDGA 2FN4A 2PZGA 1W8IA 3X1XA 4BDSA 4F3TA 7REQA 4DY4A 1X7HA 5MFZA 4P5DA 2GXAA 1NBMD 1BVYF 3K0KA 3KTFA 2EATA 4C87A 3SZRA 4RPGA 3H19A 2O8CB 3CRW1 4GKKB 4J94A 4LX8A 4I81A 1THGA 1L0BA 4B74A 5JSZA 4RD2A 4QU5A 1CY0A 1BEZA 5G3YA 3SAJA 1AZTA 3NHYA 3O8OA 3OQNA 5DRYA 2ZJ6A 1I9CA 2XMSA 1ZNZA 4YDHB 4B40A 1E92A 1EM8A 2QSZA 1RM3A 1RBYA 1RXSA 2VWGA 3EEYA 3P20A 3S2FA 1T5BA 3IIIA 4DCUA 4URWR 5CDYA 3OFJA 4U7FA 5K8IA 4BFTA 4K6KA 1XTTA 1UJ5A 5JDIA 4UZFA 4XH9B 5AOBA 1CRZA 5FADA 4WKOA 4A5SA 1GPWB 2B7BA 1QQAA 3I45A 4K40A 3TRJA 2I62A 1WUJS 2KQUA 3Q0IA 3KR0A 3QEKA 3ILVA 1XC7A 3EZ2A 1KMHA 4LVOA 2D1TA 2CZQA 4QARA 4LYYA 3O9ZA 3VI4B 3KXPA 2IOFA 3CNHA 5CVCA 4V0MA 5DK6A 5LWHA 3FUVA 4RIHA 1GDTA 1U1GA 2AXEA 3QOXA 4JP2A 5HDQA 1QHEA 5GGXA 1DWUA 1JJFA 4BNDA 2DWQA 2WNSA 3L82B 4PXSA 3IDZA 3JYOA 3KHSA 4QHYA 3H6KA 1CUAA 5FI3A 1ZK3A 1PBNA 3CUKA 4B5KA 2WM3A 2X40A 4IJKA 5KAPA 3SSMA 3M9LA 2I65A 3CONA 2NTVA 4Y2TA 1L7QA 4UVGA 4BFLA 1T2FA 3ANNA 2EU8A 2NZUG 3DZIA 3L6BA 4TLAA 1Y4UA 2P5TB 1GTL1 4FYJA 1T5TA 1BVRA 5H9VA 4JI7B 4CEHA 1KETA 4YRPA 1U81A 1MC4A 2FPPA 5KO2A 4DWWA 3T9CA 5IT9A 1ZJZA 1B3RA 1E3JA 3OLZA 1DX9A 5EMKA 3TYXA 1RFLA 5A9RA 2XRFA 1UXHA 3C3BA 3ZXXA 4ER3A 2QZZA 3ORFA 2R5FA 1VKOA 3EXG2 2UYGA 2JIBA 3DDWA 4I66A 3AW8A 3KYCA 2HEIA 2OXCA 1VL6A 4WY2A 3LFTA 4WXMA 3PXGA 1WMAA 1Y9AA 5HMLA 4GXRA 4J1TA 4NQZA 3QWFA 3RVNA 3BFKA 3WYAA 2ZBQA 2ZI7A 1QVVA 2YRFA 2FFHA 4M22A 1AQNA 4EYOA 5L6MB 1G4HA 1XT6A 1R0CA 2H29A 3JS5A 5L6LB 1T4BA 2IBSA 2XB2A 4MHTA 2I3DA 2ZP1A 3FE2A 3ZYCA 2X2EA 3VU0A 4IHJF 3GPDG 5E7QA 5GONF 5L8VA 1AZSC 3GLGB 4W5NA 2ISSD 2BI7A 4GL2A 2QTAA 4M0PA 4ZC8A 1VG1A 3RYIB 3TBKA 3WZ2A 4ZIRB 3G0GA 5A4DA 4CLRA 5DYYA 4CIDA 3L92A 2ZAIA 2B35A 4YR7A 1WY7A 2C2MA 3N6VA 4KXMA 4TWIA 1GTZA 3KQLA 1NV9A 5HGXA 1ZIYA 3QYPA 4DNFA 2CB9A 1KEZA 2HF7A 1I32A 1SQFA 2X3UA 4B3FX 1ISRA 1KHTA 1NJGA 2B4RO 3GMDA 4R68A 3RWBA 3ZLUA 3E05A 3IP7A 1J6UA 3GLFB 2O7RA 5E7JA 3RK1A 4TRMA 4LJ6A 4GSLA 5HIMA 4XB2A 5FHRA 1KOJA 4GX5A 4X54A 5E2IA 2CDRA 3UA4A 2J6BA 1JPUA 3Q8KA 2XV1A 2NM0A 1GQFA 4CI0B 3U3KA 1CDDA 2DLDA 4HMQA 4Q6BA 5BW4A 5JD5A 3L3BA 4IH9A 1OU4A 4PAGA 2Y0BA 2B8EA 4FHEA 1J2UA 1U2RA 2BM8A 5FL7D 4BMDA 5TLSA 5CURA 1W581 4Z8YA 1C4OA 1BMFD 3WBJA 2CZCA 2RSLA 1PE0A 4LK3A 2HU8A 4QFMA 1NBMA 2NVUA 4N12A 4PAOA 2QD5A 3SNKA 5A6VA 1HZZC 2LVBA 5ICCA 5JWOA 4H4EA 4MYTA 2Q0HA 3DOOA 3NHFA 3EGXA 4MV9A 4RVFA 2PJRA 1DEAA 2JFQA 3P5SA 1PI3A 3INTA 4G07A 2D7JA 4UBKA 5E38A 3SQNA 4HMPA 3EVTA 1A7JA 4KK4A 4LPSA 3GGGA 2Q1SA 1QYCA 1GPMA 4QEDA 1IN5A 2C3MA 2ZSJA 3OE1A 5DHFA 1WRBA 1O6ZA 3KWFA 3O31A 3W9YA 4C4TA 2HO5A 1GDHA 1SOMA 1OYOA 4JC5A 3C3KA 1MEEA 2GD0A 1ZGHA 2X8WA 4LV5B 4F2HA 4ZZ3A 3CVUA 3CPSA 5C8VA 3OBIA 4RIIA 2Z6AA 1IN6A 1NWCA 2OECA 4JFRA 1NM5C 2GFQA 5ANRB 1L4HA 4TN1A 2VHUA 2X0KA 3LLUA 2W2MA 1SN7A 4UNNA 2DR0A 3KL2A 4RXTA 3R3HA 5JQWA 3TGPA 1Z88A 1N3LA 4EB3A 4CMIB 1N2CA 2OZEA 4UDNA 5JCJA 1DFIA 4C06A 4KVZA 4XGQA 3HPQA 3FGZA 4HDNA 2GA9A 3ML1A 4EMTA 2MSLA 1CUHA 4KAAA 5DN9A 4UD6A 2LV8A 3RF7A 1GHTA 4MUFA 3ZVMA 1I36A 1I2CA 1EXMA 1WCIA 4WN9B 3W8DA 3MK31 4D74A 4E5PA 3DQQA 4FR2A 1Q2XA 4U7JA 5H81A 3HABA 3MTGA 2HTEA 3C7TA 2WTBA 3HADA 3HH8A 1TM4E 6PFKA 3O3CA 1FXWA 4PSUA 3I83A 1N7GA 1I80A 3PC4A 5F2EA 1L4EA 1XD2B 3HVKA 3VRHA 4BZPA 1J0CA 4RCVA 2PJDA 2JAXA 3VHXA 4OHZA 3FLMA 2UXCB 5FWXB 4KX5A 4BQEA 3TLMA 1ISFA 4WJKB 3ZDXB 2G70A 2FFJA 2JBWA 2AQKA 1XCOA 4JLPA 3ZBUA 4BV2A 1UWVA 5COAA 1F06A 2OGZA 3M5WA 4O2BB 5EWJB 2VDVE 2AXPA 2FR1A 4O08A 1XWFA 1DRWA 2QM7A 3ZV3A 4NESA 1ZMRA 3SC6A 3UT5A 1W7AA 2LCFA 3ETCA 2YZKA 4TKUA 5IJAA 2OV1A 2Z4TA 1L4NA 3H0CA 1WXXA 3LZ6A 1OC2A 3V1LA 2O0LA 4BMPB 4Z6KA 2BELA 3WYFA 2E4XA 4R31A 1M3SA 3O9MA 3UAZA 3LLSA 3A28A 3TQCA 1A5BB 4J49A 3DT8A 2ZE6A 4OSEA 5C4IA 4B6QA 3LCVB 4QUIA 4P54A 3VHLB 2JLWA 3AB7A 4IPTA 3OFND 2F3QA 1K4MA 3QHAA 4JD5A 4RTLA 1DPFA 4M9SA 3K70B 4YWJA 2VYQA 4AY5A 1OI4A 3LP6A 3LXRA 1T1EA 2FG6C 4UJ3A 1KIMA 1HE8B 2QTLA 3TSWA 1E0JA 3V2HA 1DL5A 4Z4FA 4IDFA 3TOCA 2WB2A 1BEUB 4EAQA 3PQEA 3QX7A 3R0ZA 3FLBA 4TTJA 5PNTA 2OD7A 4I1SA 4XWYA 4B3DA 2OBLA 2R97A 3QJYA 5KDLA 5JMWA 2WUDA 4H7IA 4FQ5A 4ZVSA 3KU1A 2OG2A 1TEVA 2W48A 3MAGA 2WY2D 3ZI7A 1F7VA 5EZ5A 2GBLC 3KEMA 3W9BA 3WK8A 4FIZA 1ZUIA 1U2DA 4LG1A 1U0EA 1E3TA 2GPYA 3MTJA 1TVEA 4LA4A 4DJTA 4UBJA 4COOA 1JFTA 3CVOA 4IQ4A 3FH0A 3UXHA 4R1LA 4RK4A 2J0QA 4MYSA 3M49A 5FYQA 4LJ9A 4M7WA 3NQ41 3TGWA 5AESA 1H6CA 5AVWA 2VF2A 2UXBB 2QX9A 2Q4BA 1CJKC 5IJ0A 3M6FA 2QI9C 1D2GA 5EE9A 1BMFA 2LTAA 5JZSA 2X23A 5FFMA 1PS8A 3CF4A 4I2VA 4M7RA 3EF1A 2J9YB 1Q0LA 2YKGA 2H07A 2I3BA 3EY9A 4PV7A 1XMIA 4GE3A 1K92A 2C5AA 3RVMA 1ZJWA 4KV9A 3V6LA 1HF3A 2H85A 2HZ7A 2ZRFA 3K4QA 4IWNA 4R05A 3ZU4A 1UBTS 1XPUA 2A57A 3DE2X 1XL0A 2I6XA 1UH5A 4G8DA 3HRHA 3OT4A 3F9RA 4A82A 3CCCA 4NE2A 2BGTA 5JDIC 4E13A 4FCWA 1Z68A 2PGJA 1T1JA 4PHGA 4ENWA 2CHQA 4Y9TA 5AXBA 2Y1DA 4X60A 4EMBA 1RJ9A 5BN5B 1HQDA 1UBKS 1UKVY 5AM3A 2J3JA 1MJHA 3AZPA 5DBIA 2RJ3A 1ISIA 1XJQA 1W5TA 3RTBA 3VR6D 2KBEA 2FDXA 3GXBA 4WOCA 2X13A 5I7EA 4INJA 4W1QA 4Q1CA 3CLTD 1KO1A 3G8YA 5AJWA 1NWHA 1RLUA 1PSWA 3H13A 5EKTA 5B3AA 3U26A 1DC5A 2W2PA 4CU5A 3OQJA 2FN9A 4JROA 4M8LA 4ASUD 3I53A 1FQWA 3PUWA 4L50A 2NO5A 1SPXA 4PEVA 2ZWIA 1T9BA 2LIVA 2PX0A 1WP4A 3D0KA 1BD3A 1H1TA 2GLUA 3C8DA 4HGNA 4EG1A 1IXRC 3U19A 1CUWA 3A06A 2YMLA 4TVOA 1RDFA 5LYJF 2JFZA 4O4JF 3DMHA 4OGWA 5IU6A 3R74A 3ZVNA 3JYQA 3J81A 1DAFA 1E8MA 3ENKA 1YC2A 3K1JA 4C89A 1KAEA 3GPCA 3M1IA 1SQGA 3R6LA 2YQZA 3I6ZA 4AD8A 3ZV5A 1Z5PA 1XZBA 4MA4A 2A59A 3EYWA 3KNZA 1IN8A 4I9FA 3DBHB 2C5BA 4IAOA 1WCYA 4PBRA 1XRNA 5A5EA 1GSHA 1JQDA 2EG5A 4KN6A 5I9BA 1RIIA 5A1JA 1QC5A 3BMQA 2I03A 1KARA 1RWPA 3IT1A 3F2VA 3IVGA 2HU2A 3D4IA 4Q19A 5HZMA 1HI9A 3TZKA 5JJBA 3JAMA 2NU8A 1KZYC 3KELA 4CETA 4HFMA 1NNLA 2B82A 3AH8A 3CZRA 3HCFA 4N4AA 3V9AA 1VPTA 4Q47A 1LI5A 3S1AA 5LNK1 4N18A 1N5OX 2Y0PA 4QGBA 3R9KA 5CA1A 3H2BA 2OYSA 5D6OA 2H4XA 3BD7A 1EXWA 1JFVA 3D43A 4X6UA 2P7HA 2QW8A 3TIVA 3T0FA 2Q28A 4E88A 2FQQA 4L3OA 4HLUA 4ZALA 1AY0A 5CD9A 2YWEA 5GZ3A 4X61A 1A96A 2JGRA 2Z2KA 3FI9A 4PWYA 1C1XA 2QYOA 2ENWA 2AVDA 3CINA 1BVUA 3HB1A 1J5EB 2XBMA 1OF1A 2AR7A 4DR6B 4WUVA 3E61A 2FMKA 5I7RA 2P2GA 1IN7A 2VJPA 2GD1O 1UJ2A 1Y8RB 3NNDA 2WMYA 3IHTA 4UE2A 1L5RA 1QF7A 1VB5A 2OAGA 1F3LA 4JP8A 3RC9A 4A0FA 3U9SA 3B7GA 5J1SB 4A91A 1FP4A 3ONFA 1WUHS 1TTPB 3D7KA 2OLKA 5BMOA 1WUYA 5AKKA 2OCXA 2VQFB 5JC8A 4G9EA 3BL8A 4Q1FA