1M10A

Crystal structure of the complex of glycoprotein ib alpha and the von willebrand factor a1 domain
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
199
structure length
199
Chain Sequence
HDFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMEQLRISQKWVRVAVVEYHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRIALLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVLSSVDELEQQRDEIVSYLCDLAPEAPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords von Willebrand Factor
publication title Structures of glycoprotein Ibalpha and its complex with von Willebrand factor A1 domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 64
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2002-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1m10A00
4BJ3A 3HXOA 1CQPA 2XGGA 2VDLB 4WK0B 2WW8A 4WK2B 5KYUA 3QA3E 3IBSA 4IXDA 5E6SA 4NEHB 2VDMB 4M76B 1NA5A 4Z7OB 1QCYA 3EH1A 3M6FA 1IDOA 3Q3GE 3HXQA 1JEYA 1M2VB 1Q0PA 4A0QA 4Z7QB 3TW0A 1CK4A 3FCSB 3K72B 1DGQA 1N3YA 1PCXA 4MMXB 1ZOPA 1AUQA 5HJ2A 1DZIA 3V4VB 4CN8A 1AO3A 4WFQA 1L5GB 4C2BA 3EG9B 3EFOB 1M1UA 4IHKA 4MMZB 1M2VA 1XDDA 4UM9B 1U0NA 1ZONA 4HQOA 3NIFB 3ZQKA 2VC2B 5LN1A 4HQNA 1MHPA 2VDQB 1MQAA 1LFAA 1ZOOA 2M32A 2NVOA 3T3MB 3BQNB 3BQMB 1PD0A 2IUEA 3TXAA 1FE8A 1U0OC 1YVRA 3PPXA 4G1EB 3EOBI 1BHQ1 1M1XB 3T3PB 1T0PA 3IJEB 2VDNB 1JEQB 4PN7A 3ZDZB 1M10A 2NUPB 3BN3A 2ODQA 1TYEB 3PPWA 4C2AA 1RD4A 1SQ0A 4WJKB 2B2XA 5HGJA 1OAKA 3TVYA 4XW2A 1T6BY 3VI3B 3ZE2B 4F1JA 3F78A 3EGXB 1JEQA 5E6RB 2NUPA 3N2NA 2XWJI 2WINI 4NENB 3ZE0B 1PD1A 1JLMA 1M2OA 1AOXA 1SHTX 3FCUB 1UEXC 1QC5B 3EFOA 3EG9A 3EGXA 3VI4B 2I91A 4G1MB 5E6RA 1RS0A 1BHO1 4NENA 1FNSA 3F74A 3EGDB 2O7NA 3ZDYB 2I6QA 1QC5A 3HI6A 1JV2B 1IDN1 5KYWB 1RRKA 1RTKA 5KYYB 3EGDA 4FX5A 5BV8A 2VDOB 5KYNA 1PT6A 1SHUX 2VDPB 4DMUB 5KYUB 1MJNA 1IJKA 1ATZA 3NIGB 4MMYB 3RAGA 2X5NA 4CN9A 1V7PC 4O02B 3ZE1B 5KYWA 1N9ZA 5KYXB 5ES4B 3EOAI 2XWBF 1XDGA 1YVPA 3PPVA 5E6UB 3TCXB 3ZDXB 3K6SB 4HQFA 5KYXA 2QTVA 5E6UA 1IJBA 1JEYB 3K71B 4C29A 1MQ8B 2VDRB 1U8CB 3K6SA 2VDKB 4HQKA 1MQ9A 3EH2A 1MF7A 2I6SA 3NIDB 1XUOA 2NUTB 2ICAA 3V4PB 4CNBA 3E2MA 4UM8B 4WK4B 2ADFA 4HQLA 3PPYA 5E6SB 5HDBB 4F1KA 4UM9D 4JDUA 3GXBA 2ODPA 4Z7NB 2NUTA 5KYYA 4IGIA
chains in the Genus database with same CATH superfamily
3QTBA 4N0EA 5LOVB 2OHOA 1ZSVA 5EKUA 1CF9A 2WJPA 4ZT2A 3VNAA 3LWZA 2OVFA 1ENZA 5FOQA 2XRMA 4GOXA 1QE0A 1Y8AA 2IPLA 4MWCA 2VYND 5DNDA 2ALJA 3KNZA 2C5GA 4RMNA 3IALA 1TYCA 4KXWA 2DPHA 3IHTA 4A0QA 1VLQA 4P81A 2LDBA 3JQAB 2AUTA 1DG9A 3LC0A 1TM4E 4FHEA 5AVUA 1F8XA 3BWCA 1PRYA 2V03A 3ST7A 1SAYA 1WZ2A 2C0PA 2ID4A 1IY9A 4V0OA 3TEFA 1F7VA 3GFGA 5IMSA 2H2AA 4INOA 3TNJA 3O38A 3T5AA 4K6CA 3KVNA 3HXKA 2GA8A 4N7RA 4KR3A 4P7GA 2ZI7A 4O4HB 4P08A 3IB6A 5FADA 3GRCA 3ICOA 1N6OA 4PNPA 1DFGA 3RRXA 4Y6RA 2JFGA 4K3VA 2JKVA 3GOQA 3TZBA 1RBZA 1FP7A 2V4ZA 2C5EA 2JBWA 1SVIA 2IUEA 3B1XA 1U0OC 1G18A 4ZRDA 4R1TA 2IHYA 2BGRA 2ID7A 2C9YA 2YINC 4IGEA 1X3LA 4TRNA 4L3VA 4V02A 3VTAA 3GLGA 4Y7DA 5CNKA 3SEZA 3KU4A 2IZ5A 1FSZA 3G7SA 4BNTA 3IB3A 1F12A 5DCYA 3B1YA 5K4HA 2PUGA 3VJRA 4X1IB 3GJXC 2YCBA 1KYXA 1OX4A 3ESBA 4N0PA 4IDEA 2OXTA 5EKSA 2E5LB 2ATXA 4MYSA 2EFGA 2JLUA 2GHTA 4N39A 1DT3A 3F5QA 5HBRA 3U4HA 5KU7A 2Q6KA 3CF2A 2PRSA 1OZGA 4BHTA 1VG0B 3F4KA 4DV7B 3PDHA 3N1UA 1SCAA 3CE6A 2DTEA 3E15A 1ZEMA 4OM8A 2OAEA 2W0SA 4Q48A 3VZQA 1EK0A 4JWTA 1PFWA 3LCRA 2GZSA 2OHIA 1V26A 3FBWA 3LS2A 3VI4B 3UMRA 1NBIA 2NVUB 2ZUVA 1MJFA 2OGWA 1K6IA 4GOOD 5JFGA 3SJZA 2DBRA 5G4KA 1FK8A 1YDGA 1GADO 2CNNA 3C74A 4CMKA 2E6UX 1SG0A 3O6VA 3PF8A 1DJOA 2NYAA 1YA6A 2HRZA 5K05A 2WSYB 1YBAA 3I58A 1IWPB 1LTKA 1XQVA 3LHIA 4LC1A 4Q1BA 2IDZA 2JI8A 3D1LA 3NORA 4IFEA 5TSDA 3GWGA 1UC4B 3QE9Y 4K7JA 4NJEB 1V16A 3WDMA 1LJLA 4HWTA 3A26A 1XMSA 3DD1A 2E5WA 1ESEA 3FSGA 3K1YA 4Q02A 4BNDA 1B93A 3UHOA 2Q4TA 3WK9A 4BKRA 4B84A 4DXHA 4E51A 2NV2B 1NSFA 3LZCA 3PXEA 4E94A 1EFAA 1YJAA 3AONB 3HEAA 5FBVB 1K5HA 2YQ5A 5L3QA 3AC0A 3DTVA 3DBHB 2MYTA 5DFAA 4MH0R 1A50B 3FHLA 4OJYA 2AZMA 2QKYA 2C5FA 4XIIA 4RTKA 4K46A 1GA4A 4DLZA 2PR7A 4KVGA 1ODCA 3AUUA 4MIYA 3ZKWB 1NXWA 4MHOA 3GZTB 5JJ5A 1LDBA 1B3RA 1T4CB 1CWUA 2CEAA 1WD7A 3VDQA 2H92A 2WTEA 3M2PA 3EPKA 3OEYA 4CG1A 2DUWA 3CJTA 3GUHA 3V8MA 3ZBUA 4DDTA 5LOVF 4L16A 4BJHB 4PRLA 2AZTA 3LUCA 1RIFA 2N0SA 5DGTA 1IQPA 4KQFA 4QARA 5IX8A 3NGMA 4FVTA 1AKNA 3T0FA 1VMEA 4IZOA 3M49A 4PSUA 4CM4B 4B3MB 4KIWA 3T3DA 5CTAA 1KVUA 3NHWA 1V25A 2QG6A 4ED9A 1T4GA 1XELA 1T0HB 2BUBA 2Q9BA 2O4UX 2ORIA 2R65A 3DVRX 3IELA 3SSMA 3SZRA 3ZDRA 4BX2A 4YRTA 1EM8A 1YRHA 1ZNYA 1SB9A 3COPA 3P5SA 2PUCA 1H3EA 4UUAA 1IQUA 4L6AA 1M2OB 1VBMA 4YUZA 5E7IA 1JG3A 3D2BA 1Y9AA 1RLOA 3M3DA 1HQYE 3AO0B 1G59A 1UZMA 2WKSA 4FN4A 2FUCA 5I4KA 2GXSA 3CEAA 1HI9A 3ROQA 1P2TA 1JIJA 4BS9A 1U1IA 1CTQA 1I0ZA 4H31A 1PJCA 2EJCA 2CNKA 4QXMA 1W0KD 2CY0A 2Y4OA 1N5IA 3AJAA 3C5EA 3G49A 3CSUA 3BDVA 2J46A 4DRZA 1ADGA 1JNXX 4IZ6A 4OXXA 2NUAB 3EXFB 1KYVA 1DIHA 4S0XA 4D3YA 5JLJA 1PR2A 2O1EA 3BWDD 2BFWA 2Q6LA 3KJNA 2G5GX 2H52A 1BDJA 2IUFA 3AV0B 4TSFD 1PBTA 2D1SA 2HNKA 5KTOA 3W5VA 4D0SA 1N0VC 4M54A 5JR3A 2B5VA 3MNFA 2D4HA 3OQJA 3T54A 4EYKA 3GDGA 5JTTA 2A9QA 1OI7A 4YONB 5IXJA 1YDMA 1FFWA 3CX7A 2AN4A 3M4YA 1DKPA 1T0IA 1W5TA 3CKMA 2DUUA 1U3FA 3VU0A 5JH7A 4QDXA 2Z8XA 2X7HA 3L1UA 4KV7A 3TOXA 4Z2AA 2YL2A 3AP2A 2ZBQA 2MHCA 4OSOA 2MDTA 2R6FA 1U7DA 1KH3A 2CHVA 3NT5A 4JL6A 2IBMA 2Q0XA 2B6HA 4R9UC 4ZVVA 2FYTA 2C9BA 2VK1A 4B46A 1BWQA 5HUQA 5LPNA 3CRZA 1TQDA 2PUAA 1JBKA 1HFJA 1R8JA 1UXOA 4R8MA 5THXA 1JS1X 4JQOA 3V8NA 5JAHA 2BVNA 3T61A 1S9HA 4ZO8A 3FYSA 3QTLA 5COAA 4PHTA 4UHKA 1X9IA 5DKFA 4AVYA 2N1BA 4IS2A 3C6MA 3JYLA 1UOOA 2ZWMA 1SUCA 2IYFA 2AOVA 2VRCA 1XK6A 5LA6B 4NV0A 3MGKA 1U2ZA 4KFRA 2EW1A 5KWVA 4CEIB 1XCBA 1ATIA 2Y1OA 5CCXA 2HSZA 2Z2XA 2JA2A 3AEUA 2X15A 4DG8A 2Y0BA 3T41A 3ICQB 1LK7A 2R3SA 2CUNA 1SU4A 1XZBA 2EJWA 1B16A 3EVZA 1DTWA 3WGNA 4BFUA 3HS3A 2C4WA 1BE0A 1UK7A 4TLLB 2V6IA 1CFJA 3WWOA 1PNOA 2DBZA 4LHEA 1S2NA 1JA0A 4QFDA 4YB8A 1UIMA 2FE4A 4MVXA 1GZ7A 1K2VN 5K1ZA 3SKVA 1IBSA 1G0NA 1X74A 3GIDA 3C3CA 3OA0A 2QP3A 4BVLA 3X1WA 5AMXA 2F8SA 3D81A 4US0R 3AEQA 2YXEA 3A28A 5ALZA 3GCXA 1HQKA 3KAKA 1SBHA 2R5WA 2QTAA 4KSYA 3UTDA 4ZGWA 5LMNB 4AKSA 5IYZA 3R0QA 1GGNA 5HQJA 4PPNA 1E0DA 1ZGJA 4S1VA 1QCYA 2HLDD 4GI5A 1QF7A 1KE1A 3JPYA 3VYWA 1PUJA 4ZQGA 1N9KA 2NQ2C 4KWCA 3PUVA 1CK4A 1DRKA 3M89A 2E4XA 3FH0A 3EEOA 1SCIA 2J41A 3AEZA 2V0NA 4DV1B 2CL0X 1KDPA 1W75A 1YJXA 2C3PA 3D3WA 4RX1A 3ECSA 1VE9A 3FKSA 4R9SA 5DHSA 1P4AA 4C6HA 2GXQA 2JRLA 5B64A 4M6WB 4FYYA 4IIVA 4ENRA 3LV8A 3K5HA 1O58A 4DTIA 3R9KA 2AOTA 3BC1A 3EASA 1PVVA 1WPXA 3H6GA 2AFHE 3I2JA 3R6WA 4YT5A 3IA2A 5EUQB 4YRPA 3TAXA 1KXZA 1VHQA 2DU8A 1E2MA 3C6QA 3KJXA 3QLUC 3SHTA 3PFKA 1IBMB 3BMNB 4FZ3A 4LJ7A 3VVMA 2CLSA 1H4QA 1K8RA 1PTJA 1GGEA 1PO7A 3NEPX 5BRAA 5JATA 5MF6A 2HHHB 4TLMB 4YCSA 5BSVA 3BS4A 5ED4A 2X0JA 4WTOA 5CYPA 5D86A 4IGFA 4QEDA 1V3VA 4I3FA 5DSTA 1IUKA 2LUOA 3CMMA 3PQ3A 5TGDA 3IE2A 4DZZA 5KSZA 4CTJA 2QRZA 1JHMA 2ZXEA 4DARA 4XE5A 2OFWA 1XZPA 1UAYA 2VRBA 2XA1A 2YXBA 4UC0A 3ZY4A 2XITA 3V1LA 1QHXA 3GLVA 5CH8A 4X6XA 1HYBA 3IQZA 1TUEA 4OHMA 1T2CA 5DBEX 5KMGA 1LU9A 3ZHYA 1Y98A 1GSOA 1VKOA 1QR6A 2Y1LA 1RXWA 1NTOA 2FWMX 2W48A 1U2QA 3GFBA 3LY7A 2YBEA 5T67A 2JCYA 3VZSA 5IVPA 1F5SA 2A4MA 4KPEC 4UBIA 4A6EA 1AUPA 2J3LA 1DHTA 3FRHA 4ROSA 1XHEA 4V1CA 1RWXA 4PTZA 4DV6B 4PS1A 1IDN1 5D01A 4R8KA 3YASA 1P1KA 1YCHA 3FWYA 3K0FA 5IM4A 4BYMA 1IAQA 4AQDA 4MUJA 1C8VB 3OC0A 5CR9A 4G2TA 2HPHA 5BSFA 3P2MA 4ZT7A 3TRKA 3F97A 4NF2A 5AK4A 1AH2A 2JIMA 1IHYA 2H4XA 3LDFA 3VH1A 4PY2A 3WE7A 1RWVA 4PZPA 2EAUA 4DIFA 4LCJA 1PEAA 3DZDA 2XB8A 1B15A 2COUA 5K8TA 3AQIA 1GU0A 3QEAZ 1DC4A 5E1DA 3P9XA 3KTAA 4B43A 4CQJA 4DPMA 1B7GO 1WUHS 2YYYA 3E1KA 4QYSA 3NFRA 3W34A 1UR5A 4X95A 2Q1WA 3RT1A 3TKLA 4RKEA 2HLHA 3JRNA 5GTDA 2X22A 1EFVB 4LXGA 1L4KA 3AJRA 1YHYA 4WK4B 3SZ3A 3IAEA 3A4MA 3IAFA 4EJ2A 4J1TC 5G0WA 4D79A 1SU8A 1ONOA 4D3FA 1E6UA 2NM0A 3AHEA 3IR7A 4IMPA 1SUAA 5HKKA 4NV1A 2DQZA 2H5LA 4B7UA 4DB2A 4JR0A 4GO1A 5HS4A 2ECKA 3QI7A 2W0MA 1JLLA 4O0LA 3ZY6A 1JKJB 2QK4A 3K6JA 4CLOB 1NR5A 3FROA 4FT2A 3HFJA 5BRNA 1EE1A 3NEYA 3RANA 3VR6D 3TFWA 4Q6WA 3PD7A 1T1RA 1GNRA 1GPDG 4V3BA 1YRAA 4QULA 3CZPA 3DZFA 5AI6A 5TV2A 5BXYA 2P9HA 4H59A 1AUQA 4CN8A 2JI4A 2W2KB 1MH1A 2VDWB 2WG0A 3LCJA 4HLCA 4UHJA 4CUZA 3L1IA 1EK5A 3EZNA 4E2ZA 3LK7A 1SN7A 1A9RA 5LP6C 3HJBA 1H22A 1YO6A 4QSHA 4QOFA 5AQ1A 5ITZA 1FY2A 2GXAA 1MH9A 1A2KC 4C3ZA 3I28A 2IXTA 2O8DB 4NFHA 4I1PA 1UPAA 2RGXA 3Q7PA 4KXVA 1QTRA 3H13A 3T9BA 2WJ3A 3MINA 3PPXA 2C84A 3OIYA 3ZK9A 1N5KA 2P9TA 2HKIA 3E6AA 2OC9A 1G0OA 1YS9A 3E9MA 4Y6SA 4HGNA 4M1YA 5REQB 3ZDQA 1C4KA 4ZMSA 4BDTA 2PUDA 2WYVA 5DM4A 1ML3A 3STWA 3R9XA 4QNNA 4CQMD 1RM4A 2VF7A 1E1NA 2DQKA 4A23A 2ERCA 2EL9A 1Q2UA 3GCGA 3RRJA 4QXAA 2IUTA 2PAFA 1GT6A 1LC3A 3KYJB 4YUVA 4Y1RA 2J3EA 3THYB 1T0UA 2RG7A 2C7OA 3OE1A 4FFMA 4NZPA 4KN6A 4J3JA 3W1WA 4BFTA 4F2HA 4DUPA 1I10A 2XCLA 4MIEA 5FLKA 3UJDA 3W77A 1KGSA 4MGIR 1QUEA 2VTVA 3RRYA 2LIVA 4TUYA 4IJUA 1Y5IA 2FPKA 1V6CA 2PS3A 3QMVA 2AHOA 2ZS9A 3AVYA 2Z2KA 5AO9A 2AEMA 4P9NA 2HPAA 3TPCA 4WMLA 2QORA 1W4LA 3MD9A 3PXCX 2DFNA 1Y82A 1Z34A 4CWAA 4DIOA 3G2KA 3CX8A 1NY6A 1O7JA 5LDGA 3IE1A 2OV2A 3IVGA 5F1PA 3V1NA 4Q3BA 1Z6YA 4UQOA 1AUVA 1NU6A 1SUBA 2JLVA 4MO9A 4N65A 4ZA2A 3G85A 3VSEA 5SYMA 4DC9A 1N9GB 3PBKA 1ZKDA 3K0CA 3ZWMA 1B2RA 2GASA 2VWPA 4LIPD 5CX1B 2I22A 2GCOB 2QTHA 2VH1A 3G2JA 4ECEA 2VF8A 1N2CA 4XEHA 3TBHA 1YZUA 2XNKA 2P30A 2WWGA 2N47A 1JPJA 2PU7A 2ZAMA 2E85A 4U7WA 2R7MA 5ECGC 4EGCB 3PUHA 3MUEA 3OSUA 4WRRA 3QZUA 1SG9A 5A9TA 4HZUA 3J81k 3JWGA 3C4QA 2ZSAA 4EB8A 2Z9DA 4BZWA 4G0PA 5FNZA 4HEA1 3RADC 4MX8A 2JHCA 4ND3A 4KREA 3ONNA 1TLTA 1EXWA 2AXQA 3UHPA 4YRGA 1Q7CA 1EGHA 4ZMRA 1O9HA 1UQUA 5H83A 4Q24A 3A2MA 2PH7A 4TYPA 4U1RA 1Y6RA 2A5JA 3AM5A 3DV0A 4LV6A 3EPJA 3KKZA 2ZSHA 1R3DA 4U7TB 5SZJA 4KWHA 3N58A 4G07A 4R40A 2HU2A 3UC9A 5AJYA 1RQ7A 5SZKB 2GYVA 4OGGA 3ADKA 1P5RA 3WKBA 1GYRA 3LYLA 4OX9B 5D87A 4PRYA 4ETMA 4L76A 1U7WA 2YMMA 3E1GA 3VNSA 5ALDA 3WWCA 3PGKA 1HM5A 1RXVA 4RF4A 1EZZA 3QYJA 4OO3A 3V4SA 3I34X 4LTMA 4A8JB 4ZHQA 5CDTA 1F2TA 1U3VA 5DLEA 1Y1LA 4PPFA 3ZV5A 2W6OA 3KKPA 1DB3A 1AQLA 1NE7A 1RLMA 4JCCA 4UCFA 2FFBA 3S6JA 1DCMA 3FIUA 1ADYA 4BQPA 1KIFA 4E12A 1IC6A 4Q4AB 3EEYA 4EOGA 1Y8RA 5C81A 4OHVA 1J97A 3C7KA 4PAOA 5FIUA 1CHNA 2Q4EA 3FCXA 4IHKA 1RC0A 4GR4A 4YFYA 1GPLA 5EZYB 3U17A 4TWAA 1TOAA 1X87A 4ZAVA 3UC5A 1GQFA 3NVDA 5B2EA 1X1BA 3AL3A 4KQMA 1WL8A 5K2MA 3D0RA 2PWPA 4F86A 3ISJA 3A0UA 1H1TA 5HTKA 3ZY2A 4CCYB 1T3LA 3I6MA 4NP6A 2YOGA 3V4FA 1VYHA 3FPGA 3LRPA 4BQRA 2GK6A 1PL6A 1CR1A 3KVVA 4YPOA 2XCUA 1JDUA 1T15A 3DPUA 4PHCA 4V2UA 3VNBA 1YQEA 2GAIA 5LUAA 1ZHOA 3AVUA 2CJYA 1I0IA 3FZYA 1AN9A 4AO8A 3GT3A 4HVCA 4QYMA 1U63A 3AM4A 1L8OA 4M9SA 4PHHA 4L15A 3IEIA 2QU8A 4DIKA 2JEZA 3OAAD 2XJ4A 3STHA 1EUCB 1UANA 2O8VA 3FZNA 2F8LA 2GQ0A 2P2LA 4EHAA 1US8A 1IULA 2XADA 1YZHA 1IUNA 1XMQB 1YWGO 2G5CA 3W5JA 1MTZA 1H1LB 2AG0A 2JGAA 3BCUA 2MYPA 3DEJA 4N9QA 4KWTA 4UNSA 4DJAA 3IBGA 4JI8B 2J08A 3D6MA 3HP4A 4I3GA 4NYJR 4OLBA 4RD2A 3AW9A 2ZEJA 4R1SA 1V8BA 1OI3A 5B37A 1XE3A 2AN5A 3EMBA 1WULS 3RLFA 1PKEA 2H4ZA 3KOYA 2GZRA 4BLPA 1RJ9B 1W49A 1WQ1R 4HYTA 5B3JC 3IS3A 1QAQA 4JXZA 5FI5A 3CRQA 1QF9A 3DJYA 1CR0A 2V7EA 4Z9YA 1DTEA 1O8BA 1PT7A 2LKDA 1TRHA 3IHLA 4LJYA 3UMCA 4D2IA 3WWDA 1IJKA 1T35A 1V5FA 2C03A 2Q21A 5JCJA 5JSZA 1DQRA 5AW3A 4TXLA 4YC7A 1U7ZA 5BSKA 4QPDA 3E3AA 3EDYA 5KYXB 1OR8A 4IAOA 3KYCB 4TKUB 4C0LA 4D3SA 1ESDA 4XB2A 1NJ2A 1YDWA 1J2EA 4B5KA 1JHPA 3RR2A 4UDYX 1C30B 4NE7A 2PT7A 4EVRA 2F2TA 3WAKA 4QVIA 2F3UA 5DSXA 3F46A 4XOIA 5AWFC 4B3GA 2QXUA 3PDCA 4Q1EA 2OAGA 4J90A 2I6GA 1WKVA 2F43A 1KK2A 1YS6A 2F59A 3HNRA 5ED0A 5J5AA 3U13A 3ELYA 4UFNA 5JQWA 1IBRA 3O84A 2D0DA 3WHIA 2F17A 4OYLA 2BELA 1QWSA 3FM9A 4A2WA 4XD7A 3LECA 4MW2A 3TD6A 1TF2A 2VQ3A 2CV2A 1Z18A 2HQOA 3QQPA 1O4VA 3C0KA 1CR2A 3KB8A 1TE2A 5JPIA 3BICA 5FWYB 2OD7A 2CFIA 4REMA 5M2QA 3B6IA 3PDIA 3COWA 4L78A 1TVMA 4QGFA 4RGQA 2GPWA 5CFMA 1F5NA 2GD2A 4R81A 4OL0A 1FRNA 2WDZA 4EZBA 2FSFA 1CY2A 3IODA 5AHOA 1Z82A 2JLZA 4EYSA 5CK5A 3VAAA 1EDDA 5E38A 2RHJA 5CAEB 3BERA 3I45A 4LEIA 1E2LA 1MV8A 2R1UA 3V46A 5LBTA 4CT4B 3TSOA 4EY5A 4COKA 1XZFA 3NC1C 4Z2YA 3ZW9A 1O95D 5B7PA 5JPCA 1J0DA 1Z7WA 3LT2A 3QM1A 5G3YA 3VRHA 5LZ9A 4UUMA 3H8JA 1SIBE 2V74B 4GP9A 2P2ZA 1Q0RA 3DYIA 1VMAA 1FU4A 4HSEA 1GPJA 2YVAA 3K0KA 1Z73A 2J5KA 3ZLTA 4BFXA 5F7OA 2IL1A 5IBRA 3GH1A 5AVVA 1JQBA 4Z9FA 1DAEA 5JQGA 1EE2A 1V9SA 2ZBRA 5EP4A 4UHEA 1TIPA 3FOCA 3EA0A 4ZOCA 1AQYA 2JJYA 3LUPA 3EZYA 4GOJA 5EEGA 3LGXA 1BXRB 1OPRA 1PW5A 3JQGA 3S2UA 1V8PA 4H77A 3UMBA 3CLUD 5AIBA 4NEGA 5HW0A 1UBSB 1WCYA 5E4YA 2PZJA 3A05A 3FYUC 2GJKA 2EVWX 2HCBA 2QYSA 4BEBA 2ZIXA 3I6ZA 2G1KA 1M2GA 1OXBB 4WFJA 3F7OA 4W9MC 3ZGOA 1CPYA 1T5OA 2M9MA 3PUIA 3UK0A 3QEJA 1U2EA 3EZ2A 4JKYA 1CUHA 2OPBA 4KV9A 5FBHA 3KEOA 3ETCA 1QWOA 3C7AA 1E79D 1Z4IA 4E08A 4URXR 4HDNB 3M6LA 1EWVA 2GNPA 3A6DA 4FYMA 4EFLA 2FTKE 3KQTA 4F9GA 4UE6A 1N2BA 3ELWA 3CN7A 1JR3A 1ZN7A 3OIWA 1Q0LA 4WESA 4Y2PA 1L8QA 4XYGA 5EWJA 4F2DA 1LSOA 2ZG6A 3OCCA 2GXUA 3TE6A 2GZ1A 1NP7A 3MEQA 2GM9A 2PD6A 4X85A 1Z7YA 4Y0NA 3A1TA 2YIVX 3L4BC 3REQA 3P96A 3CBQA 3PE4A 1NVDA 2NUBA 5AVTA 2QRKA 4OX9Y 3L04A 4EY4A 3U2QA 5KQMA 2OTCA 2EG5A 2Q4BA 3A1SA 4D0RA 3PF9A 1OAOA 1RMQA 3U16A 2ZUBA 4ARSA 4BP9A 1ZK0A 4QOSA 4DSTA 2QBYB 1G20A 1K5PA 1KR5A 2ENWA 5AUNB 1E64A 2YHUA 2JIOA 4J76A 4F9FA 5JVDA 1P6UA 1T8TA 1QOZA 2O0LA 3ABSB 5LNK1 1NVXQ 1ORTA 2H2HA 3C3MA 3HA5A 4IDGA 1EINA 2I33A 1D8TA 3IOEA 2O8EA 2W11A 1Y4UA 5I9NA 2Q2QA 2OMEA 4LYDA 3D8TA 1IN1A 1AF4A 3DDSA 3TSAA 4UZFA 4X41A 1Z5PA 1M2EA 3Q9SA 4BMDA 4B6RA 2KWIA 4IJQA 5AHXA 5K45A 3NJRA 1JXOA 3ZH9B 1N7HA 5TY0A 1V39A 1T2VA 3HXPA 1MP0A 1YK0A 4K6OA 1X1SA 3P2JA 5FEMA 1ARZA 1Y1TA 1RI4A 1KAQA 1TZBA 5I48A 1CSEE 1QPGA 1GRRA 3D0KA 3QH4A 3HU5A 3BHNA 1ONBA 3NVKI 4LPSA 1W0KA 2WPDD 3PUJA 4G0XA 4FQ7A 4IDFA 4RSMA 1M8PA 1TD9A 1ZIXA 4MKIA 1E6KA 1E8NA 1WVMA 4F3KA 1A8SA 2OAP1 4HG2A 2OK7A 4MRAA 2BH9A 3JW8A 1RXUA 2HT1A 4ESHA 2IYRA 1WZEA 1M1UA 2QJOA 4INAA 4YAOA 2JI7A 2LW7A 3BJMA 2ONKA 3SI7A 4ARBA 1B43A 4RKFA 4I6EA 5AK3A 3SXUA 5L7TA 1OHHA 5J1SB 3SQWA 1YCDA 5AOVA 3KFXA 4G41A 4DVJA 4X8MA 4M0DA 1NW7A 2EWMA 2VJCA 1WSBA 2GFHA 2Y9MB 4N4AA 4RLHA 4ND5A 3K0AA 3P5BA 1XZAA 3SBEA 5H3LA 1YMVA 2W90A 1S4QA 2JFUA 5I4IA 3E22A 4KQKA 3ABRB 4NJMB 4B73A 2GM4A 3IV9A 5D3MB 3ELUA 2LTAA 3G0HA 2Q46A 1A8HA 1GL7A 4AQ7A 3PRJA 1YZGA 3DXYA 2C82A 5B58C 3KZ1E 3KQNA 2RGRA 2DG2A 4NECA 3HK2A 2C1EA 1MG5A 1L5OA 1T6BY 3GJ0A 3ND8A 1LLUA 1SC1A 1FXWA 2J1LA 2W93A 4HAIA 4IWYA 5T6MA 5TEWA 4LNAA 4D98A 2ZRIA 2I9KA 4I5IA 4OQPA 4RLQA 3BCRA 4CLEA 3S99A 2Y77A 5G4LA 2HXYA 4O0MA 3KR2A 2J07A 4YJ3B 4FEEA 1SA0A 1DIOB 1TMYA 3GEGA 3RVJA 1UEXC 1Y3FE 2IQIA 4UTPA 1IATA 3L7CA 5HIJA 1O0CA 4D9JA 4BMOB 2PL9A 4PRZA 4PR3A 4WBNF 1IEQA 1SQGA 1M9NA 2YJ3A 5BW6B 2ZUWA 2YV3A 1KJWA 4FMDF 4ZQEA 4DJEC 4JGBA 3G89A 4D8XA 3HI6A 5F1OA 2AG5A 1JV2B 2OO5C 1D2RA 4TVOA 2PWBA 4BFVA 1UDAA 1KTVA 1CDEA 3CNBA 2B8EA 3R0IA 1MAUA 4Y18A 2WR8A 2IU0A 2GHIA 1JWLA 1P3JA 2AE2A 2X1MA 1ISFA 4FD3A 4MS4A 5AKEA 1BHSA 3MJRA 1JFVA 2DULA 4B3SB 1GILA 1PGJA 3RIHA 3NMUF 2DAPA 4LJSA 1MAHA 4ZVTA 3RU3A 3VPDA 3F49S 2HIAA 2GPYA 3BBPA 1K5DA 1YDHA 2GJ4A 4BV9A 5GJWC 1EA7A 2B35A 4ALKA 2JGIA 1G6Q1 3L93A 3CZAA 3ICVA 1RBMA 1ZIYA 3O2SB 3AXSA 2PHZA 4OV6B 4PSAA 3RBVA 4BN4A 1C14A 2I6UA 5IVHA 1WF3A 1YB4A 1NM5A 3O1IC 3P52A 1E1QA 1QFJA 2QTLA 1T8SA 1UBJS 3CLVA 1X70A 1DBPA 3SHQA 1XFDA 2HLDA 3O1JC 4YJHB 1GAJA 1GSAA 4KNYA 3RTAA 4LSGA 2IYYA 3O47A 4TRMA 2HHAA 4FSDA 5SY6A 4QUIA 3AB7A 3PQDA 2IEGA 2P68A 2FX5A 3MYRA 4UJ5A 4D0LB 2Z6QA 3P9CA 2BEVB 1Q5PA 1U8UA 4FGSA 2CUZA 1J6UA 3DQQA 4ISBA 1D9XA 2RKOA 3H9GA 4MJXA 2ZJBA 4UXIA 5FI1B 1IFXA 1JFFA 4N7JA 1TA0A 2QPAA 2P8JA 4FHFA 2I7CA 3FRIA 3VYSB 4ZGGA 4CIAA 3KOMA 4TT3A 4Y9SA 3H4VA 2I1WA 2YH2A 2R97A 4ZAWA 1OBCA 2PXHA 3M4NA 4ZVPA 1I1QB 1QQ5A 2C9MA 2YN2A 4QTZA 3U80A 4BMYA 5KPJA 4GT1A 5FBQB 3FOEC 1OLSB 2XZLA 1L5GB 4ZI5A 1KQPA 5EZ6B 3D7LA 5SYAA 4JZYA 3EDRA 3ND7A 1AKUA 1LWOA 4FDMA 2XCTB 3BRWA 3ENKA 5JO9A 2J6HA 2PZBA 3QUTA 2VT7A 4G5HA 2CB9A 2F3RA 3AQ4A 3K6RA 1VL6A 2VDQB 4N8EA 1KFJB 4DPKA 5HHTA 5LYJF 3NATA 4DYVA 4WZAA 4UAVA 2BHLA 3DMYA 3HVJA 4CYMA 4JJ7A 3BQMB 4NBNA 3MCZA 2JCVA 5LMUB 3FWPA 4NONA 4XJXA 5HEKA 5SV2A 2ZBPA 1GGFA 3N74A 3U3DA 4ZV4A 4XJTA 1KBOA 3O8QB 2E1RA 4F60A 2J9FB 3H5LA 2XKJE 1RYMA 1P9OA 1YB6A 4K03A 1AXGA 5IUKC 5KYVA 1E6LA 1KI6B 1HG1A 1P2BA 2ANBA 2R751 2UAGA 1VRWA 3QWAA 2VHYA 4G81A 5F21A 1IEWA 4JJZA 5GOTA 5C1OA 5KVSA 1ZRHA 4IYRA 2Z5VA 4FR0A 1E20A 4MGKR 5LQUA 1VE3A 4NU0A 3ZWPA 5J4KA 1C0IA 4EO4A 2Q49A 2X76A 1SKQA 4J4HA 1FDIA 2X0KA 3L6BA 3UB3A 3B3AA 1KO1A 2P9CA 3FHTA 1I3NA 3T7RA 1QYCA 3FTEA 3CO0S 3ENVA 3T9CA 3BXZA 4TQUS 4YAJA 3FMPB 2W2PA 5B2ZA 4CM1A 1ZRNA 4W5WA 4CKCB 5K3SA 1JPNA 3BXFA 4CKBB 2YHSA 1XPJA 3UH1A 4QHSA 5MN4A 1AV6A 2J0QA 3DZKA 2QJRA 4HRYA 2DFLA 4BAUA 4RD1A 4R31A 1J2TA 3GA7A 4KYUA 1K92A 4LY3A 2B4KA 3OIDA 4IGKA 2VHTA 3IQHX 5AM4A 3UA3A 2ZQZA 1YQWA 4HAUA 4NCIA 1U8EA 1RQGA 4YT2A 2X3UA 2PZAA 2MR5A 2HU5A 5C4GB 4Q15A 4NFSA 1GGKA 1NLYA 1TKRA 3VR2D 4C0AC 3F3YA 2EQAA 2P4HX 1QIDA 2WVHA 1C7JA 3U5ZB 5HM8A 2CUTA 1CY8A 2FK8A 5AXBA 3TSYA 1KP2A 1QFSA 1LC0A 1T0JB 3CUVA 3QBTA 2JD1A 3KLMX 4OSEA 3VTKA 3ZK7A 1XU9A 2FPGB 4ZJUA 5JD5A 3WLEA 1HX7A 2G77B 4JVOA 4BKOA 4BNYA 2FZVA 3KYDB 3Q7RA 4P3XA 3SDSA 1E7RA 4Q37A 2XCQA 4NYJQ 2POCA 2NUTB 2BV3A 4NESA 3WIEA 3DFIA 2P4UA 2ATVA 3C1OA 4ND7A 1GEEA 4BCDA 4FCVA 4ZGBA 5AVWA 1EIWA 3HY3A 1UMCA 2PLAA 3IAM1 3RUIA 1J24A 1ZICA 4W1PA 4D8UA 1GXSB 1PFYA 1AGRA 4TQAA 3AFNA 3RYIB 3HJCA 2IEYA 1Q91A 1QZTA 2AN9A 5FOWA 1TEXA 2X4DA 2WAOA 4QDJA 4ZOLF 2AF3C 2EJTA 2QY6A 4UXHA 4CF5A 1Q0PA 4TN5A 5JXJA 1AE1A 3LP8A 1DELA 4AU1A 1K5GA 5IM5A 4KN9S 4TL7A 1ZBQA 3NGXA 1GITA 2WF9A 1LPOA 2C78A 1PJ8A 1TNDA 1ADJA 1W48A 2Z8YM 2K5UA 4HWGA 1R4NB 3C8DA 3NAZA 1W9MA 4NHEA 2ZE5A 4D4JA 2XNHA 1U6IA 1L3CA 3B3QA 1U0HC 2Z83A 2DC1A 2IRWA 3JD4A 4P4LA 4LF6B 1KNXA 3I2IA 1M6NA 3DF7A 5FAXA 1TFRA 1DEAA 1UK6A 3ZEAA 2JW5A 1HFKA 1HTWA 3KYIB 3UNXA 1C3XA 5I7EA 2WWYA 2GK4A 3B9BA 2A57A 1XV5A 4FBGA 3UXYA 2PWZA 4Q4LA 3NALA 2XYQA 2ANCA 3KSDO 1FW6A 3DOEA 1U1DA 3DEHA 1CZNA 1HQCA 4QPJC 2IPOA 5DLYA 2LCQA 3O3NB 2V5VA 3AZQA 2P9FA 4RXUA 4ZOAA 3LNCA 3PYMA 2O8CB 4BX9A 1PJTA 1C7FA 2VYVD 3VO1A 4N12A 4IIGA 2ZR8A 4E21A 2JLXA 2UUCB 1CP3A 5TVKA 1U0SY 4TRJA 5A62A 5I01A 3A36A 2H3EA 5ALOA 2HD4A 1BN7A 1QOPB 3EWNA 1E66A 2EG9A 3FPKA 3UJHA 1ZVKA 2O6HA 1FQKA 3MWLA 5HE9A 4IDQA 4G1VA 1ZZGA 5JJCA 4P0PB 4LHVA 3ZJTA 2FHPA 2BFFA 1Z26A 4C4TA 2VP5A 4MS3B 4PYOA 3LKZA 4HLUC 3WMXA 4BNFA 5JSQA 4LJ5A 4QQRA 4WLEA 2Y1DA 2EDAA 5JMPA 1BU8A 3G5MA 1FFXA 1Y7IA 2C8KA 3A06A 4MVJE 4YGXB 2I78A 3QKSA 2IEAA 2VP3A 3DUFB 3L6DA 3U44B 1G3UA 1CQJA 2YJ6A 3M83A 4YQZA 4B3HA 4MA0A 5BSEA 3VJKA 3EGOA 3HBAA 4ONEA 1M7BA 2DJIA 2OLJA 2ZR7A 2VPZA 3GEMA 4HPWA 1EP2B 4NOMA 4Q82A 4RJLA 4JR1A 3K4QA 1T8YA 2RJOA 4GL4A 1JQAA 2HK7A 2IDMA 2PKEA 3JQ7A 4DLLA 3PFHA 4CU5A 2AFVA 1CUVA 1PFUA 4L4SA 2J9GA 3H2GA 4GIBA 1NNLA 4WQMA 1IOLA 4NKRA 2XDAA 3ZU6A 3IUMA 4ECAA 1S8OA 1K7CA 1Y7TA 2X7JA 2ASVA 3JASB 2NGRA 3HLKA 1JI0A 2WBLC 4YDRA 3SK0A 3HN2A 4KMRA 4BEJA 4QBKA 3UXHA 2ZBVA 4ADSG 3GRKA 4CKEB 4H1WA 4ZI7A 5BMVA 4JLSA 4RVDA 1UOPA 4WLNA 3I9NA 1BH2A 2JI6A 4MV5A 5EINA 5GJVC 4F1KA 3ZOKA 1OWOA 2XNCA 4UREA 1CS4C 1JILA 3LVRE 4EHNA 3E1SA 1IEXA 3VGJA 1K68A 3G5LA 3LMKA 2Q3HA 1JDPA 4ZCIA 4EGAA 2XNDD 1SXGA 2ADMA 3RC9A 4C22A 1DXYA 2WTUA 4OYYA 4ZN6A 3GLIA 1KERA 4CMBA 1MOPA 4FCWA 2C2HA 1Z6XA 2X77A 4O4LF 3OZAA 3ZU4A 1CLEA 5IJWA 3BCSA 1NJ1A 3V1TC 3NHJA 5DV9A 4BXOA 1HLFA 3RREA 3AB3A 3EFOB 3AR6A 1Y8ZA 2QV0A 1NPDA 1EDOA 1C0EA 3G9XA 3RD5A 4HAVA 5H8WA 3G9TA 1Y4ZA 3CHYA 3LUGA 2PNFA 3EFEA 4M0PA 1LX6A 4I2NA 2N46A 3QXJA 1XXHE 5JMWA 3Q3VA 3EOZA 1D1PA 2O3QA 2PPLA 4RLSA 4EG0A 3W4IA 1FQOA 1OYYA 2VNKA 4MPDA 5JEDA 2V97A 1C8LA 1E9FA 4PAWA 1W93A 2F9LA 5F9HA 1KVRA 4IDCA 4A26A 1R0WA 2B4QA 1YA8A 4MVWA 2QWXA 3RJ9A 1ZITA 3NPAA 4WPGA 3U4DA 4UBJA 5F4ZA 3RGGA 3Q7QA 4MS1B 3R5HA 2AX3A 3CC8A 2FY8A 3G23A 2RHOA 3IQGX 4JELA 2ORYA 3VGPA 3RC8A 1N8TA 2R1VA 4FYJA 2QTMA 3GW8A 4FUQA 5JD3A 3ZVLA 5EMJA 2OWEA 2RI0A 2XOXA 3RS3A 4GMGA 2H0QA 1BW9A 1X8KA 1Q7RA 2BRUA 1X1TA 2IA5A 3PT9A 4G5FA 3U9SA 3VYVA 4EI8A 3WICA 1GD1O 3KT6A 3GO4A 1HZJA 1G8HA 3N7TA 3R5TA 4Q9DA 3PD0A 1YNOA 2BMFA 4GPD1 1UEJA 1IY8A 1NQ5A 3QKIA 3GCWA 2G4VA 3W5AA 1CZLA 1VYUA 5EJ4A 1YQTA 3BE4A 3RC2A 2MINA 1RAEA 1NQUA 1GQQA 2FRDA 4CF4A 1YZKA 3GNSA 3T15A 4BMXA 4LBWA 2PJZA 5IKXA 3A9CA 3DCJA 4ZAGA 4Z7JA 1X6VA 3EY4A 1YJ5A 3OOWA 2Z95A 5K20A 4P5EA 13PKA 2QYOA 3DBLB 5FOSA 5T4HA 3HI4A 4DAEA 3W9YA 2ILVA 2VTKA 1J8YF 2R68A 2JIPA 5K8CA 4XVHA 5G0UA 1YKFA 2ECOA 1WWKA 2B4TO 2VPIA 3FTCA 3G2QA 2R6CA 4BVKA 4BMCA 2PUTA 2A9JA 4ZAYA 4D4HA 3OHPA 3HDGA 1UZNA 1XJQA 4PFSA 3W04A 1NVFA 2BFMA 2RC5A 3LQ2A 2HXSA 3CFYA 4FGJA 3H05A 2OBLA 1OU0A 4WE3A 1S8NA 3ISTA 3MS2A 3K71B 4O4IB 3CLKA 5C34B 1I4EB 5DXAA 3Q88A 4OYRA 4EO7A 5CW2A 3FI0A 4RS3A 4JUFA 4MR7B 2HMYB 3H4IA 2OMKA 3EVGA 3WNVA 4R83A 2JGDA 3JRXA 2Q28A 4B40A 1R3UA 3LC2O 3BE5A 2P27A 3PC4A 4UM5A 4XRGA 1N32B 1IZ9A 4O4JB 4FJ0A 1LKZA 5TMDA 2DBYA 4ZVRA 5IDVA 3PICA 1J9EA 3HCCA 3MQ4A 1DIAA 4R05A 4HXYA 5CYFA 3CIOA 3RS4A 1G4HA 2TECE 3ZCSA 1FXUA 2FRVA 2Z8YA 4HFRA 2H18A 3T99A 4TVBA 2CK3D 4AN0A 5DM60 5IH7A 3Q4GA 1EX1A 1BN6A 1I6MA 2QM3A 3MBOA 2B30A 1AUXA 2IHJA 1Q15A 4C5CA 5IASA 5TLSA 4W63A 3ZLVA 1T9BA 4X00A 2E89A 1G6OA 1A8UA 1G66A 4LZWA 4OB7A 3E3OA 3JY6A 2XUQA 1JGTA 2HREA 2I3BA 3CR8A 1B74A 1QG6A 1RRMA 1OPXA 3UMFA 2WA1A 1KZ4A 1CP2A 4PLVA 1W0CA 1MT0A 2BKAA 2JLAA 3ZWVA 4BBZA 4ZJYA 1D5CA 3KQVA 3GZNB 3VMFA 2AN3A 3EMKA 2GPNA 4JUBA 4BV2A 4C7VA 4QGGA 3GLGB 1H2BA 5E7QA 2NVOA 4I08A 1MBZA 1AA6A 2B92A 2XYPA 1GV0A 4U2DA 4OA8A 3HCOA 4DSNA 1T8RA 3UAOA 1OFVA 4FS3A 4D4MA 1SJ9A 3CLTC 3H6HA 1GKIA 4RFVA 2OD2A 3PJDA 3MAGA 1P31A 1JHVA 3R8XA 2VN8A 1S0UA 1YACA 3VVCA 4DKXA 1WEHA 4P58A 2OFFA 2QGZA 4XDGA 2JHAA 3R6DA 1B8NA 4P3PA 4XW2A 4QJ5A 4YP0A 3GY0A 3B9RA 3MK31 1L5YA 3WYFA 4MV0A 4RTNA 4UNQA 3RLIA 1D7AA 1YFJA 3BCHA 2CFOA 2O2SA 2WG2A 5K8VA 1DBQA 2JLQA 1F0YA 3NASA 1CY7A 4PPYA 4E3WA 4BPBA 1E69A 2VUUA 1NTRA 2IW3A 1I3MA 2Z8ZA 3S81A 3D7SA 4OHRA 3LYHA 1WOYA 4X3PA 3ZBTA 4AUMA 3VKVA 1AQUA 3ESYA 3RODA 2I8AA 4DV2B 2QX4A 1INLA 4H17A 5HKBA 2YC4C 2IHBA 1TF5A 1MVLA 3HL0A 1SVKA 1F1JA 3SHFA 4DV0B 4QHYA 2CYAA 3PRHA 1F14A 2XX3A 5FUVA 2CNWA 2KPOA 1A88A 2Y0PA 2Z04A 2PMEA 1PSZA 1SEPA 4NIMA 3P20A 3SLRA 2JL1A 1O4WA 3BAFA 4M4SA 3UCEA 5JS7A 5HZHA 5H0IA 4LQDA 1RXSA 4MWSA 5AW6A 1M34E 1QFYA 5L3QB 5DNWA 3DTVB 4P92A 3R6GA 3ZYZA 4B75A 4BV3A 3DMRA 1IRIA 1W76A 2DETA 1M2NA 2XLBA 3SU8A 2Y66A 5IJ9B 1YOVA 1YRWA 5ALTA 2PXCA 1NULA 3C3JA 2P67A 5ADWA 4BASA 3EIXA 4R51A 1GTL1 3N7AA 3CRW1 4J0GA 4Y2SA 4BMVA 4DZTA 4F0JA 1N8SA 2BF4A 4M1EA 1ST3A 1X0VA 1EUYA 4WBXC 3ZHZA 4I9UA 1KA9H 4PLHA 4Z9AA 1BMFD 1CCWA 3KDPA 3Q98A 4P93A 1D2MA 2ASEA 5EUBA 1JRLA 4BWGA 1UPCA 5LXTA 2HB6A 1G2OA 2I1LA 2B61A 4D44A 1YR6A 5JAPA 3ADCA 3KR9A 3HFSA 4DCPA 1J20A 4AJ2A 2WPDA 4BGEA 4ZJZA 5L95A 3MJSA 3Q5DA 1HV8A 2DZDA 3CNLA 2SCUA 5IP5A 4H0NA 3O83A 1H9CA 2JLRA 4WX2B 3BK7A 2PS9A 5CUQA 4FWIB 4EQ6B 1D6NA 4IEEA 4RADA 3D5TA 5KEIA 5JPDA 3PNPA 2VAPA 1R8SA 1EM8B 5F78A 5MHTA 3L46A 4MI3A 1U0FA 5FBZA 4JBHA 2N42A 2F90A 3ILVA 5LP1A 1P77A 3S2GA 3T34A 5BSTA 4J7UA 1QZUA 3H8VA 2JF0A 4IHAA 1AZTA 4Z7QB 5ALIA 1QIGA 4NU8X 3GWZA 1GR0A 1USWA 2B7CA 3EXEA 2YWEA 4I1SA 4L22A 4UVDA 2C7BA 2QI9F 3NV7A 1X15A 3LHFA 5CVVA 4DWVA 1HZZC 4C2BA 5BNWA 1JWBB 4O5OA 1YGPA 3KJHA 4UTZA 4LHZA 5KS2A 2VHCA 4PLFA 4RPGA 1ZONA 1R27A 3NIFB 4HQOA 1KJYA 1FRVA 3MRTA 3WAGA 1KI4A 4GSLA 1NRWA 2IC5A 1ILWA 3GIWA 2FG7C 3HKCA 1A9SA 1B0ZA 1ZMTA 4HY3A 2IYPA 1FOEB 1G21A 5DW0A 5IABA 3BQNB 5IJXA 1EDEA 3LWDA 3BFKA 3M34A 4OXQA 1WKCA 2ACWA 1HMPA 3AWDA 3LA6A 1V9LA 2HL6A 3PWKA 3T7EA 1RJDA 2XVXA 4P34A 2QDKA 2I8LA 3MXTA 1ZJ6A 1OOEA 1MA3A 3F2VA 1XYYA 2BM9A 3I2YX 4MYRA 4NCXA 4RTLA 5JH7B 3TG2A 3Q7EA 4J7XA 4RKYA 4V39A 1EGMB 1FVFA 1NJ6A 3P71T 5E4FA 5B7NA 4O1MA 4UM7A 2EEPA 2P5TB 4FFPA 4G09A 3W5SA 1DLJA 4WCFA 2OM2A 3BDIA 4FFNA 1XRSB 3LXXA 2H4WA 4FU0A 4QXPA 4OFWA 2DERA 4D8TA 1NLUA 2H16A 3B1WA 3R5FA 3E7WA 1GU7A 5U9CA 3VAYA 2JVKA 4KRYA 3WLKX 5BRJA 5BWCA 2PGXA 4Q9NA 3JQQA 1CDZA 5LC1A 2DFKB 3HB0A 3GD5A 3W8EA 1TI7A 3EXIA 3I8OA 1I3CA 3D8UA 3ZX4A 2BL4A 3B6ZA 3AVVA 2VNIA 1X7YA 1FF9A 3QLTA 5FAKA 2ZATA 1UOQA 2J4FA 3U4AA 1E1LA 5DLQC 5ENZA 2JJ1A 4EW3A 3LYUA 2H1LA 4KXNA 3U4CA 5F1KA 4OBXA 3IMGA 4TZTA 4ETWA 3W7BA 4BRUA 3LT4A 4BZPA 4B80A 3NTQA 1Z8FA 3AEUB 3EF1A 2BDTA 5JCOA 1Z29A 3OTGA 5I5GA 2ZTUA 1Q50A 3W4JA 1DTWB 1JDBB 4FBLA 5BQXA 2WQ7A 1AGNA 4D4IA 2DR2A 3NZEA 2F1RA 1YB2A 2ZWPA 1FTNA 5T3YA 2YJ4A 2Z0MA 2HF7A 2ZWVA 4U39A 5BV7A 3QMWA 5DK6A 4HNTA 3G02A 2WSLA 4LE2A 4UEWA 3OQVA 1YI8A 5AK5A 1RZUA 1BQEA 2RE8A 4WOPA 1EZ4A 1WDLA 1DC8A 2PRJA 3ICEA 2Z98A 2YFQA 4Z3KA 2NO4A 2WD9A 2EZ4A 2OHXA 2HMWA 3R7DA 1T5SA 2WYWA 1KXJA 3AEQB 4KNWA 2PO7A 3DMGA 4L7QA 4XSVA 1I6KA 4B6PA 1FSPA 2Z57A 4B8WA 4TV8F 3DQPA 4TKMA 4BZQA 5GIPE 3ICWA 3ANXA 3WR5A 3MCAA 5FA6A 2VNAA 3CXRA 5H70A 2Y92A 1QHGA 3HNOA 4Y2UA 5LUBA 3DMTA 5KOIA 4RTSA 3OE7D 4PNZA 1UKVY 1XIVA 2O7SA 1H8ED 4XLLA 1UMDB 2XWQA 1IEVA 3NWPA 5AW9A 3HYLA 1JECA 2RC6A 4B45A 1ZC3A 3O26A 4P6VF 2AUNA 1P5ZB 2WFLA 2XKBA 2M98A 3TNYA 2P6PA 1GFZA 3D3WB 3E9DA 2HJSA 4LNHA 2A1IA 1DCTA 3FSRA 1UBGA 4LMBA 1U1EA 3KSRA 1G19A 3BHIA 2BIFA 2OE2A 3CB2A 4K2HA 4OQXA 3GMDA 1M2VA 3NVAA 2WTNA 4ZRMA 3W2EA 4ZAFA 2PG3A 2ONJA 4HXEB 1SCJA 2MSNA 4S3MA 3BA6A 4F4UA 5A5FA 3FJYA 3TTTA 5A06A 3SX0A 1UPFA 1TKAA 1H5NA 2PKXA 4HLNA 5KNCD 1SVLA 4PWZA 3DR5A 1DAIA 2ZPAA 1YTLA 3BPSA 4HX9A 2GEFA 1NJ5A 3BHJA 4BJ5A 4PG7A 5JC1A 3ZXXA 5KINB 1S2DA 1U0BB 1DG1G 4ZCPA 1CQXA 3IJEB 4KDFA 4OI2A 3GJZA 2IYXA 3RIMA 4OLAA 1Y9EA 2BYTA 1LF5A 3HY4A 4IDBA 1SULA 3U3ZA 5DXJA 4JVNA 7ABPA 1MV5A 2XTNA 4QNRA 2VSFA 5KMGB 3WGZA 4IVPA 4EZIA 3LKBA 4HTFB 1G8KA 3O7WA 3WRXC 4AIRA 1GGJA 4ML3A 4G23A 1ORIA 3MJDA 1E0KA 2C7GA 5AKYA 2XZPA 1ENPA 1BEEA 3MRVA 1CD5A 4AF7A 2NU9A 4BO3A 2UKDA 4J0KA 1JDNA 4RJIA 4V1CB 4P5PA 4OKIA 9GPBA 1EEXB 4KUEA 3PFNA 2PKYX 1DFHA 4TXMA 1CUCA 2PQ2A 4RH1A 3K0FB 4Y2HA 3FAKA 3K1AA 5A0TA 3PGXA 1Z07A 4W7SA 3RFVA 5JBQA 1O9BA 3LUJA 5AKXA 4TVKA 2Q3EA 3R3JA 4RA6A 1FDVA 2B9VA 1MC8A 1QE5A 3B6KA 4I9HA 4LKOA 3VSAA 1BJKA 4CTNA 1ZSYA 1WSDA 2JKYA 2ZB2A 3JQCA 3Q7SA 1EDZA 3A6GA 4LYFA 4O63O 4F38A 3DM5A 3LF1A 3DT8A 4GMKA 4IH9A 3BXOA 3KSBC 3WK8A 1KZYC 4D97A 4RIHA 3AP1A 6Q21A 4YECA 3TLAA 1X8XA 4QOJA 2GPJA 3KTAB 3O2JA 4IKEA 1Z0AA 1FVXA 2G9NA 4V0ME 3E4DA 2UYCA 2O8BA 1PT9A 1I30A 3PTAA 5U1PA 1E9RA 3M7IA 4N8DA 4RVCA 5IJAA 2VPTA 3F4LA 2V6JA 2AV6A 4OOEA 4R0VA 3PDJA 2JFWA 1UAAA 4IOJA 5JRJA 2IIBA 2LVBA 1F0NA 1MQ9A 4AY4A 4JP3A 1SHJA 3QVGA 4JLBA 1SU7A 4NWIA 4W5HA 4MICA 2BJWA 4AWAA 3VX4A 4JGIA 1PG2A 4EEXA 1P4SA 3RVBA 1MAAA 2Y05A 1DKOA 2ETVA 1L7PA 2A30A 2AK3A 5AVXA 4QOHA 5DGHA 3ORRA 2I99A 1GPWB 1QO0D 3SS7X 1E2DA 2XT6A 3OJCA 3Q2KA 2FMUA 3GLHE 1GRCA 4WASA 5EP2A 4MVJH 5JECA 1K7FB 4OU5A 1J25A 2WRZA 5FPSA 2QZSA 3O21A 4DXDA 4HYQA 3B1KA 3WB9A 3TSZA 1LRJA 1TM1E 2R85A 2NO0A 3LQQA 1JTFA 4BQOA 1UC5B 1RE0A 3C1AA 4L2IA 2OZEA 3QPWA 1XKQA 5ITZB 2BR3A 4EG4A 4L5JA 4LNUB 4LYAA 1BX0A 5E3IA 5G2OA 5AKKA 2H5JA 3AU9A 3NWBA 1QIJA 3MINB 3N0RA 4H7EA 4IQFA 1A8IA 4L6CA 2NQTA 1MJHA 1SD5A 3AWIA 3RS5A 3T3MB 1GQ2A 1NATA 1L5WA 4HAZA 3IIIA 3FMFA 4C08A 1TA4A 3E2IA 1OZAA 1YKGA 3L49A 4MHTA 3KT8A 4Z51A 2GHRA 4LDZA 4JXJA 4L57A 3T52A 3SYMA 4BE4A 2CLIB 2CFCA 5E1BA 3OF3A 5LBUA 3G13A 1BFKA 1DDGA 2NZXA 1XD8A 2Z5GA 4TTJA 3Q0IA 1IH8A 5K0LA 3KQYA 3PENA 4AF6A 1Q3HA 4HDAA 4EHIA 5JC8A 3KFVA 4TUYB 2FEOA 4NBVA 2ZRJA 3LUKA 1IHXA 3NHBA 4LC9A 1L5KA 1O9GA 3T12A 3AESA 1N34B 3L1JA 4R5MA 5ADHA 4YV0A 5BVHA 2QL9A 3BORA 3DCIA 3IAXA 5NLLA 4FFWA 2HEIA 3W5HA 4B76A 1AHPA 1Z2CA 4OBEA 3D4PA 3QVLA 4ATNA 3MJHA 4OGLA 4Y1GA 4RZXA 3D7NA 5CPBA 3ZDYB 2YV5A 2ZJYA 3ZV3A 4HJXA 5FX2A 1DFIA 3IKVA 1TJ3A 2FFQA 4NCNA 1NZJA 1SRQA 4PLZA 1J2YA 3SF0A 3WHKA 1MCZA 1SUIA 3EJWA 4EL5A 2WZQA 1ESZA 3AUXA 3DL2A 5INTA 1N2CB 1U8YA 5KYYB 2C2KA 5LFAA 3Q3HA 1IWBB 5CK4A 3Q85A 3UPTA 4DLTA 5LQRA 4KR7A 1E3TA 4NJOA 5C32A 3BJRA 4K8RB 3BILA 1M76A 3UFBA 1N2HA 1UT6A 1KS2A 2P9YA 2RBGA 3AUAA 4GZ6A 1M1YB 3MAJA 3OOJA 4HGPA 4MQEB 4UVGA 5TPWA 1QCCA 3WSTA 5I7FA 1V6SA 3VR5H 3HDYA 1QIIA 3GU3A 4G5GA 3EUEA 1BDHA 1ZGAA 3OZFA 2C4KA 1V1MB 5AI9A 3HSYA 4X7RA 2O0KA 4RQUA 5AKHA 2MWMA 3DV0B 4LSZA 4O1HA 2QE7D 1NKSA 4F5EA 5K6AA 1O0SA 1OFUX 2WOJA 3UAZA 4C29A 4D6XA 3AOEA 3N6VA 4G26A 2V7QA 1LD3A 2VQSA 1AURA 2ZYGA 4N3CA 3JTEA 3AJ9A 3DFUA 4LX0A 2J9XB 3FDXA 4HAYA 3OA2A 3L6OO 2IHVA 3QK7A 1TO1E 1N5OX 2HU8A 5AVQA 16PKA 4DLXA 3MOIA 3NHFA 4UXJA 1QFXA 4EG7A 2VSYA 4K9NA 4ZHQB 1F2TB 3LBFA 2YZGA 1NIPA 5JXWA 2ZSKA 1A9YA 1X7XA 2Z08A 5KIAA 4X92A 2JFXA 4Q16A 1CZRA 1ZH4A 1D4AA 5KWIA 1F4PA 2GO7A 2M1ZA 1A7KA 1G42A 2W5UA 3D3JA 3V9AA 2G1UA 1RM5A 1JJ7A 4JJ4A 2EZ9A 5EXXA 5DNYB 1KH2A 2A0XA 3WIUA 4XYMA 1UXHA 5DX8A 1QONA 1XCGB 3MMZA 3MBIA 5LJLA 1LS6A 1UF9A 5IPFA 4N8SA 4YMHA 3IJPA 3I9OA 3TS1A 3NBYC 4JA0A 1B3BA 4C9BA 2G1PA 5BNTA 4V03A 4PIMA 1U0RA 2DGDA 4PGGA 2ZFUA 1S2OA 5A03A 4GF5A 5EHZA 1T34A 3V1MA 1SXQA 2QX6A 1R0SA 3ABIA 4LZLA 1GDTA 4JV5B 1G4AE 2EWWA 1X8JA 2GN1A 2J3MA 2RH9B 2YQ4A 2GO1A 4K05A 4QTTB 2XWSA 4PSVA 2CJWA 4DA8A 2ERYA 2FZ5A 1YVRA 1UCFA 2QUBA 1QTQA 2Y71A 3UMSA 4GKAA 2ACKA 1TQ4A 2IYEA 1XAHA 2X5OA 4RE6A 2XGMA 7MHTA 3W2FA 4RK0A 1N7JA 2YDYA 1N57A 4Q1AA 2L69A 2VZEA 5E9AA 3DJFA 1RZ3A 2IYTA 1ZLXA 4J9VA 3QI2A 3RC7A 1PE0A 2GI4A 3VPAA 1OC2A 3CKYA 4LYGA 1QRRA 1TMGE 1NP6A 1U04A 2PUEA 1D03A 1SXJD 3GRUA 3H2JA 4L8FA 3J80A 1C0KA 2MYUA 2NNLD 4QDZA 3R7WB 3IDZA 5LQJA 4W5TA 4NXNB 4IFIA 3I12A 3V3KA 1MTOA 5CDGA 1IVSA 1FP6A 2WMOB 4N3GA 3CX6A 1TYAE 3OLVA 3D1JA 4URYR 4F3YA 3AHFA 3IHKA 2O05A 1WA5A 4RMGA 2HSDA 3E58A 1N92A 1XD2A 3X1MA 4HEJA 1SIWA 3HV0A 4ARAA 3TPFA 2DKNA 4MUIA 4R8RA 5AK6A 4RMJA 5JSZB 2GN0A 3Q3CA 5EMHA 3QFTA 2GFQA 2PGJA 2Z30A 1WAMA 3QE0A 2O7QA 2G36A 3G9ZA 3EGDA 1P4HA 3WGMA 4EG8A 2SICE 3NJ4A 4RIGA 4KACA 1WLYA 2O59A 5KTTA 3F6PA 2OBMA 3WLIA 2R00A 4LRUA 1E2QA 3UICA 1AKWA 1XTQA 5IJ0A 1M5UA 3DE3X 1NRXA 2D5LA 3RNOA 1GRVA 5JCPA 3RTCA 5L45A 4U6SA 2I7VA 4HB3A 4ID3A 5G3ZA 4BO1A 2C2XA 3CZ9A 4DWWA 4EITA 1H65A 4LRSB 4X94A 2DX7A 2WIJA 3OT5A 4W7HA 1O97C 3MILA 1HEUA 1W36B 4QVKA 3A4TA 4QL3A 2PLRA 4R0NA 1A4IA 4H0FA 5FPKA 2XMPA 1VA4A 3OKFA 2F43B 2JBAA 2QT9A 2X13A 3V00A 1FEZA 2WSMA 4IVNA 3GZ4A 3H5RA 2XVAA 4MYHA 1SBTA 1SQSA 2CZGA 4EBFA 5IDWA 2BGUA 2C3YA 2UUBB 4TWRA 2NXJA 3CW2A 1S2MA 3ENQA 5AXAA 3TIFA 1AQIA 4A8HA 4E13A 1SC6A 1HNZB 1IPFA 2QB5A 1II0A 3F7MA 3WLRA 5LQKA 1HDYA 1U1FA 1J56A 2GAJA 4JBXA 3TGLA 1KJ9A 4G0ZA 3SDZA 2GVZC 1V4BA 1NYQA 3QKRA 4U6QA 5IVDA 3PDIB 3KHSA 4K1LA 5EAIA 3C1UA 4TMKA 1KGDA 2IPAB 3QBVA 3RTBA 4MKHA 4ETIA 1ZJZA 4BFWA 5AIAA 3RSGA 2N75A 4MQBA 3JD1A 4QU5A 4F12A 5AVSA 4GQAA 1NV9A 4Q47A 2RGUA 3QU5A 1ISGA 4QQKA 3U26A 1RRGA 2JC3A 3IJ5A 3DOCA 3IULA 3FR7A 4NPAA 3OUZA 2H4YA 3D6NB 4YRJA 1W85A 2XH8A 3E9ZA 3ZE8A 2CVPA 3DT9A 2C29D 1VKZA 5B1IA 3VH4A 4C14A 1E5QA 3JYOA 4BRSA 2GKOA 2C0CA 4ZYVA 4J6EA 4I1OA 5DHRA 4GX1A 3TKAA 3EG9B 3W78A 1TJNA 1D9ZA 1F9EA 1R00A 3NHMA 1JDTA 3KWMA 5GONA 3MLAA 4HJRA 2VP0A 1L9XA 1RKUA 1MQAA 5KNLA 2GPAA 1GA1A 2YHAA 4Z4QA 4GKKB 3JQGB 3OE4A 2FFRA 3UXMA 3F8WA 1NUUA 2HDHA 4G5OA 5TGZA 1NYRA 1I2AA 5BOSB 3I0MA 4CDRA 4AKHA 4C4ZA 3FWKA 4GOKA 4LA4A 1Z6ZA 4P84A 2J67A 1D1TA 2Q7XA 3H9QA 1OIVA 3KEGA 1JHXA 1RD4A 3K2QA 4IBOA 2SECE 5HFNA 4IXWA 5JS2A 3N3BC 3T9DA 1LLCA 3GJ7A 3ZI7A 1H6CA 3M1LA 3ZZ1A 1ITZA 3BL5A 1IL0A 2RGYA 5KSYA 2IS6A 3RC3A 4AP9A 5BR1A 1LI4A 3GG2A 3NH6A 3T7IA 4R0MA 5DM1A 3JVDA 4CV1A 3WWZA 1H42A 2WJYA 3DVSX 2Q6VA 2WUEA 4XTRA 1SHTX 4Y2GA 3DNMA 2BISA 3A4YA 2NNWB 1O08A 4WESB 3VNQA 1NRIA 1VYVA 1JDVA 5ALEA 3GFTA 4L4UA 5TQJA 4EB6A 3PCXA 2NQ8A 2ZUTA 4NCJA 2BSAA 2BFBB 3FD8A 1NW8A 1I8TA 2VCEA 4B74A 1IZ8A 3REQB 1XTBA 1QC5A 2G8LA 1S2GA 3WTBA 5BN3A 4B4DA 2AE1A 1A82A 3ZW8A 1P9RA 5BSMA 4UATA 5C1DA 5L51A 3HJHA 4HH1A 4DIEA 1REQA 1M8GA 4YWJA 3L7NA 2ZB3A 1EB8A 4H7FA 3SZMA 3ZDFA 4BVBA 3GPCA 2OT3B 4IH4A 3GRYA 5BYAA 2V7TA 3EOAI 5JVDB 2Q4RA 2PSDA 1RU3A 1EVJA 2P2DA 4M49A 3HM2A 5I45A 3C3KA 3OQ1A 3QTTA 2J0UA 4IG4A 3H2KA 1C9JA 5DNEA 2R2GA 1YZLA 1I6LA 1RYZA 4OCZA 3V2UA 3PHCA 3H1AA 4B2IA 4D02A 4H60A 4UW9A 3DS8A 3GFVA 4YT4A 4EF6A 4MV9A 4RSRA 4I4TA 1PWEA 2WHXA 4PFKA 4OHFA 1A2QA 4DR3B 1A95A 4CG0A 4MVJM 4G9BA 4AP6A 1FPQA 1E3WB 1RC8A 2P11A 3DHWC 5CRIA 4B81A 4QC2A 4US2R 4KK4A 3C24A 5CDFA 4F4CA 3L6CA 1GM5A 4A2CA 2QRQA 3PFGA 3EYWA 1AG9A 1XBTA 3VC7A 4ACBA 3CBGA 4BJ3A 4DMLA 2YVQA 4FMPA 3QA9A 5K0CA 4AT1A 4WXHA 4C0JA 4EB0A 3UT5A 3AHGA 1I5OA 3PXUA 1T6YA 1EFRD 2A1TS 5H4HA 1QANA 4GLOA 1TCAA 3NHLA 3LYAA 4HL6A 1Z2PX 3P2YA 2ZZKA 4X8LA 3TBKA 4E11A 2XUZA 1PCXA 1TMKA 1Z5NA 1NP3A 4CMJA 2RI1A 3RTDA 1A7JA 1FZQA 3K20A 2PYZA 2O2ZA 1KKMA 2GCNA 3T3HA 5G1NA 1LSSA 2ZYTX 3KQHA 1VI6A 3R3SA 4ENWA 3K0AB 3L0OA 3NG1A 2CFTA 1H6DA 4D4LA 4EDFA 3E22B 5KVAA 5LIRA 3LOPA 1C41A 4JUAA 5K0EA 1V43A 2YWGA 3K15A 5FNVF 4TWZA 2O54A 1JLKA 3AGPA 1Q74A 1EE9A 4UVEA 3WMGA 4ASUA 1NSYA 2P5YA 4MW4A 1ZNZA 4MLPA 3D4IA 3ZCRA 4GD3Q 4RGYA 4R3UC 5TS3A 2VTEA 3SMQA 4C7OA 4ZQHA 4Q21A 2ZJZA 1JFRA 5T5QA 2N9UA 3UHAA 3WJAA 2JG3A 4ZTBA 3KTFA 4Q9LA 1GNVA 3DCYA 4OQYA 3BTOA 1Z6QA 1COWA 2AA3A 3N5CA 4LI3X 4ITUA 3EA4A 4CUJA 1PQ4A 1FLAA 4G0QA 4BMZA 1SCDA 4NCAA 4XJVA 5EIXA 1SA0B 2Q1YA 2HBQA 1TUGA 2BFDB 4ND1A 5CLGA 5DSZA 4BKQA 4DCGA 4NCBA 4DLVA 4FZRA 1NWHA 3ZHRA 3BF7A 1F51E 1EH5A 4QHTA 3DVAA 4NYMR 1WSWA 3PXDA 2IX9A 4EUEA 4YMLA 2OG1A 1AS0A 2OPHA 4Q00A 1I80A 3QEBZ 1HDIA 4F3TA 4BLTA 2QM0A 2E5FA 2FPWA 5HNKA 3ZWKA 2ODAA 4ZEVA 5ICGA 1Z63A 2V5UA 2J45A 4RJTA 3DYBA 3V8QA 1JQEA 1P0QA 3UV3A 1IZZA 5CCBA 3K96A 3D54D 4WXRA 2CXOA 4C0SA 4EYOA 1ZI6A 3EVBA 1N5MA 3WNDA 3DAPA 1PZFA 4JLUA 3KEMA 4AZVA 1CVLA 1BA3A 3VC3A 4TTRA 3WL5A 1EKXA 2JVJA 3JD3A 3GT7A 5AM2A 4P36A 4FYWA 1NUSA 1RRKA 2IP1A 3IDOA 3OM9A 4JENA 1N0HA 4OVKA 5I6DA 4NZYA 1LI7A 1NUQA 3QMMA 5J5VA 1A3CA 4S2EA 2P62A 3CTMA 4PC1A 5CFPA 5TQ2A 5CTJA 4HFJA 3F5FA 4FI3F 2B4AA 2ODNA 2PE5A 3I0ZA 2X5XA 1CEQA 1KARA 4G86A 4PV7A 4MB6A 1ADCA 3PCTA 1IOVA 1E98A 1YAJA 4CIVA 1QUFA 5EMMA 5E1MA 5KHLB 1JU3A 3Q11A 1UBLS 4PAMA 3NCTA 3VX3A 2RKWA 3INNA 1JQ3A 1JUDA 1PJSA 3GEHA 3AF4A 5E8JA 1KQFA 3L82B 1DIBA 2VO1A 1N6RA 2OLKA 3W7VA 2IOFK 3GI1A 4REQA 4RL6A 2A58A 4RUKA 1NURA 3LO8A 1VBKA 3KQSA 4KO1S 5GV8A 4UM8B 5IBQA 3U4IA 3OJLA 3BIWA 4ABTA 1PQPA 3I09A 3OSZA 4M8LA 1JFFB 4MAAA 2G76A 3HSSA 1NNSA 4KH0A 1KYIA 1U0LA 1S89A 4Y6OA 2QLJA 3JCZA 1U3CA 2WABA 5B57C 3V55A 5ICMA 1HKUA 4CM5A 1P0CA 4FEYA 4JJFA 3C6BA 3ZIUA 4PZDA 2GZHA 4POAA 3L5OA 3FZGA 5IMBA 4YAUA 2AXNA 1EP9A 2FWBA 5AHWA 1H2YA 2Q5HA 3AVQA 1XCPA 3WNCA 4HMQA 5JYEA 4C7JA 4KO8A 1F4VA 5EJAA 1A4UA 3HVKA 1TK3A 1VIAA 3LP5A 1C7EA 3M5CA 1LNQA 3PS9A 4GG1A 1P4GA 1T3HA 1Y4SA 1YBFA 4JL8A 4O2BF 4YV7A 2BFPA 3WQQA 3EQ2A 1GTZA 1H0HA 3TMAA 2XOEA 4MGHA 5EXDA 4A1FA 4ALLA 4C6SA 4UZSA 4CEJA 3H0EA 4KFCA 3IX7A 2XEXA 3HWWA 1NMYA 3DLIA 3RVSA 3A11A 3QU7A 2B5WA 3L02A 4MAMA 1RPAA 4GBMA 4MLDA 4C0HA 3AHJA 4IUCS 4B3RB 3EMDA 4ARIA 2VQDA 3EGIA 4L9WA 4RGBA 4RGVA 4P98A 3VZBA 4EY6A 1R6AA 3SS8A 3KLNA 4DQKA 1NNUA 2JZCA 5CJPA 5P8WA 2YTZA 2CHEA 2M2IA 2RI6A 2QVXX 3LUAA 5K8IA 2E49A 3OKPA 2PK3A 5CG2A 4GEKA 2L2QA 4KQGA 4WLUA 1F0KA 5CFNA 1SC4A 5J4HA 1U8AA 3AZPA 4RTRA 1RBYA 1KEPA 3OQPA 4KITB 4UDXX 4QG3A 3ME5A 3MCUA 2GBIA 3VHXA 1RACA 1TL7C 4ZOBA 2OBXA 5BP7A 3F6CA 4RU1A 5JZSA 3N28A 5BT8A 3GJRA 4GR5A 1GGMA 1MX9A 4JOBA 2GK3A 1QP0A 4DC1A 2NTNA 1EB9A 3BM5A 2YRXA 5LCXA 4LC0A 1Z2AA 4FFSA 5EQTA 1XZQA 2WFMA 3IR6A 4FNAA 1CULC 1ZU4A 1C5KA 2XXAA 1A77A 4AWXA 2ZR9A 1PT6A 1T6XA 1VM6A 2HHJA 2G9ZA 2VPQA 3BTVA 2GUWA 3K09A 4IYJA 2XMQA 4A6PA 5KZMB 1N36B 1TAGA 1R18A 3A27A 3QLUA 1HE1C 1PZGA 2WZBA 1EU1A 3W0LB 1KYTA 3QVMA 4U7PB 3U7IA 2QM7A 3VVBA 2G7ZA 4KQHA 4NQRA 4ZP1A 2IQ5A 5BN5B 1G9SA 5CURA 3RRMA 2F4VB 4S1TA 4MCHA 1WXXA 2ZBEA 1M0SA 3RF7A 1LQTA 3QG1A 2G7MC 1LGYA 3GUVA 1ZEJA 2BFEA 1Q21A 2JATA 4J1SA 3TRJA 1NC3A 4MXDA 3TOVA 3U1TA 3W05A 1BVHA 1JQJC 4YJDA 4RYDA 4G63A 4CGYA 5DTJA 4OB6A 1UMCB 4H7PA 4IILA 2NU6A 1W4RA 1FYEA 2ZAOA 4ENQA 2FGKA 3PQ4A 3IP9A 1BD4A 1KZ7B 3L77A 5BQFA 2MR6A 1WUTA 1TJPB 1YOBA 3WNZA 2ZBGA 3ESCA 2RK4A 3ZZUA 5DU2A 1LVHA 2CDBA 4TMZA 4ZT3A 1L4UA 4TLAA 3CF4G 1H66A 2UZ1A 1G60A 5H9WA 3I6QA 4X6YA 1JG4A 1W1IA 3OZVA 2H57A 5GPBA 1T9AA 3MJ4A 2R6ZA 2EFCB 2Y1GA 3A4IA 3P4YA 2WG1A 3Q3GE 3Q9LA 2Z6AA 3GYGA 3LBAA 2ZYHA 4Z3OA 3NM6B 1G5QA 3QKWA 5BR7A 2X5KO 2D1QA 2ZRFA 4P0TA 1QGAA 3RVOA 5C5DA 2H1WA 2P3OA 1IG3A 3UKOA 4ZARA 1U4NA 1TU3A 2W6JD 2IITA 4KQ9A 2RHCA 3MZ0A 1PZHA 2IGBA 1ENYA 2GK7A 4EYGA 2G4CA 3F4BA 3R0VA 3CX3A 5FCDA 2NXNA 4JI3B 5G1OA 4X62B 2G07A 2NPOA 3GF4A 3H4MA 1LFAA 4BBJA 2ZYUX 4F45A 1P17A 2VBCA 3RASA 4C4RA 1NN1A 3PR2B 1KMNA 4U2KA 4X90A 5HCNA 4YA6A 1T0BA 2JLSA 5C8ZA 1IZ7A 1Q7TA 3AI2A 3O0TA 4CZ2A 3I5MA 3KQOA 1PV4A 4KR2A 1Z4QA 4Q6BA 1UAGA 2XNJA 1CW2B 4JC5A 2M6RA 2W4IA 1VJ5A 5EJ9A 1XMIA 4DUZB 4TKVB 3SC3A 3FOFC 1JP7A 3C3WA 3OBBA 4YYZA 1SCQA 4CF7A 3J7AC 4DS3A 1XXHA 4J1TA 3PPWA 4L28A 1MJ5A 2AR0A 2ZROA 1AM4D 2PZ8A 1D07A 2CLKB 3A9UA 1JG7A 4D9BA 3LOQA 2ZTMA 5E7JA 1BMTA 1C3VA 5KTMA 1T2FA 1G6KA 1BDBA 4B8YA 3MA0A 4B6FA 5FEUA 1WP4A 2R86A 3SC6A 3ZE6A 3VR5A 4E14A 2J85A 5A1TA 3FVVA 2BFFB 5F73A 5HUJA 4FMCB 5FPYA 1PV1A 2IE8A 4OH1A 5F1YA 4XWYA 5D7NA 3UMGA 3ZXYA 1R9JA 1V7QA 2PSJA 3CRVA 3BMCB 3IPCA 3IRUA 5K0ZA 1N77A 3IEKA 4LXTA 3RSZA 3TEMA 1UMBB 4G85A 4LECA 2AI3A 3ACBA 4RIFA 5I5EA 3DFZA 1I0LA 2H29A 3QKSB 3W6NA 3WGVA 1GZSA 2XUPA 4UBLA 3WLSA 3JYNA 1CQJB 1X0XA 2I03A 4W6ZA 2Z09A 3LDUA 5LP6A 1O0BA 4D42A 4E5NA 2G5TA 3B78A 3DA8A 3T5PA 3LRXA 3SFVA 4NX2A 3GBSA 1D5WA 4CNQA 4FIDA 4RPHA 4HUTA 1BZYA 3AFIA 2VJQA 5EJ8A 1FP4A 3NYIA 1FFBA 3OZUA 2COEA 3AKCA 1EHYA 1K6EA 5LM3A 2C2GA 4HN9A 1BWSA 1XCMA 2C98A 3GD7A 3RARA 2G82A 1DJLA 5FP0A 4ZI7B 4Z4HA 2IEBA 2ODEA 4JH0A 3ZD8A 3LHDA 1EPUA 5BMVB 1WXQA 4RY2A 5E6UA 2PMBA 4V0QA 3PLNA 2QX9A 2D4AA 2BGJA 3PGMA 2JAPA 3BWEA 4CT5A 3KV3O 3L1VA 1ZG3A 1FDRA 3T7TA 1UXKA 1OT5A 2AC4A 2XTAA 2E4YA 4M0CA 2Q5CA 2DHQA 3NNNA 4G3XA 2FJUA 4RVGA 4WCVA 1P5JA 1X80A 1G1MA 1JT9A 1ZP6A 1NVWQ 5M04A 4CLHA 4M9RA 3ZE9A 3EW9A 2RJ3A 4CM9D 2DHCA 3AXTA 4K40A 1WTAA 1KU6A 1TCVA 3QF7A 3DFKA 3FX2A 5HILA 4A73A 3A2NA 4GMHA 2XUGA 1S02A 5KYUA 5CA0F 2V4MA 3WRVA 3A3PA 2FVXA 3WDSA 3PGJA 1KO5A 3V3TA 4O2AA 4RPLA 3M9XA 1JJAA 3I9FA 5FTJA 1P72A 4NBSA 1L5NA 4C4PA 3FR8A 5K3DA 5ITSA 3BWXA 4MOWA 4F21A 2V8OA 4II7A 4LJ4A 4B4KA 4I50F 5B5SA 5FFMA 3KM0A 3OPYI 2C2BA 3DO8A 5U4XA 5L40A 2C7VA 4XVRA 4GDFA 1LVUA 1KFCB 1K86A 2B1IA 2IZ0A 3EDMA 4M37A 4A92A 2GN2A 1J8QA 1XU4A 4UOQA 4DM4A 1T5DX 3M2TA 2Y1CA 1QBGA 4V24A 3MT7A 1Z4JA 2B78A 5A3VA 1Q0UA 3I6BA 4K28A 4NFLA 4C2TA 4LF8B 2V65A 3BE8A 4RXMA 4CV0A 5IU6A 3ZXIA 1MKYA 1K6JA 5FV7A 1X1AA 1TM2A 1E9VA 4B09A 1WKBA 2Q8NA 2JAHA 1U02A 2R1VB 3ND6A 4LGCA 5KNDH 4AIIA 3DB2A 5LQNA 2NTYC 3UOAB 3IQIX 2EX4A 4O8ZA 4PGAA 1JFLA 2A1TR 1JI3A 3E84A 2AOXA 2R5NA 1BW9B 4JKIA 1V45E 4PX3A 4NS1A 4Z8XA 5BV0A 1V7CA 1RWPA 2WB4A 3ZC3A 3E7XA 1QHHB 4DIDA 2X9LA 3D3KA 2BDUA 4WDRA 1N3IA 2XAUA 4MLZA 4TSRA 1WE2A 4UE3S 1KIAA 1LQUA 1SO8A 3VKUA 2G40A 1P1BA 5ARBA 1ULHA 1P7YA 1NUPA 2H11A 1XYVA 2MYNA 2MINB 2CWDA 3HO6A 3HR8A 3KOXA 4IHJA 4JOQA 1WBBA 3PVCA 1D09A 4RDIA 2DBVO 2JFPA 1RQLA 1Y0BA 1DRJA 3HYTA 1J99A 4HP8A 1Y3IA 4OQLA 4D9GA 1R6DA 1U2RA 2IU3A 5LMCA 3MWKA 2J33A 3WYCA 4KOEC 2A9VA 4CL2A 3EDCA 4DQVA 3U56A 1MT3A 1H0KA 1WZUA 5M3BA 4LHYA 3WOHA 4DXAA 5K0JA 5ILOA 3HUFA 1U81A 3DZIA 1ISRA 1ZQ1A 3W5BA 1NJFA 1XF9A 3B13B 1MJNA 2F3PA 2H0AA 2KBFA 1XKXA 2QUJA 1XAIA 4F2WA 5JUWA 1PNVA 4K26A 1EXVA 3FUUA 1P2GA 4TS4A 3Q6NA 2QAGC 5KJEA 4ZYWA 2PMCA 1EEHA 1HE5A 4IOMA 3IOBA 2AVNA 1YBMA 4HWPA 2VF4X 3DF9A 5C3MA 8AT1A 3FIJA 2C7PA 1KOLA 3DONA 1MC5A 3R76A 1I5RA 5DRTA 2PUFA 5IVKA 4HNGA 3Q8MA 1OVMA 5K6RA 1PLJA 4LMRA 1ACLA 4E5VA 1QJCA 2JGDB 3HRIA 4GLLA 3WFZA 5J3JA 1T6ZA 4HXFB 4PFQA 1SEVA 2VDKB 4NYMQ 4JFRA 1S3IA 4HEQA 1P2FA 5EJIA 1PEKE 5DNUA 2RHLA 1JR4A 2I6SA 3NIDB 3IA7A 4MVJG 4NI5A 4FCTA 4XB6B 5LBIA 2BEWB 2IVFA 2Q5FA 5EE0A 1QHEA 2YZKA 5C7OO 3EAQA 1KBQA 2ADFA 3PU6A 4LV5B 4MW6A 5B7GA 3F73A 4NMMA 1EUQA 1THGA 2Q9UA 2XEDA 1JIQA 2BHNA 2LZ0A 4CW7A 1E0AA 3FDZA 4J0CA 1G8PA 5F35A 5C37A 1T36A 3KKNA 1HOTA 1MB0A 3DMHA 3CV3A 1V0JA 3FYTA 1E5XA 4FE7A 2IWRA 3CURA 3ZDAA 2PIDA 3N2YA 2VP2A 3U7JA 3ZY3A 1JH8A 1XZMA 1RHJA 3G68A 2GCEA 3HZZA 2VA9A 3L8YA 2VHWA 2A3NA 1JG1A 2HHLA 3CB4A 4ZVUA 4F3NA 1GVHA 1QFZA 1YDEA 2IT1A 3C85A 2OGSA 3R7NA 3ZWAA 4CV3A 1NXQA 4LOAA 1ZR4A 4RBNA 3TLZA 5AXDA 1XFAA 3N2ZB 4JLKA 4AS2A 1XTSA 4KLAA 1OWLA 4GSKA 1WHSA 1V8OA 3FLMA 1Y1RA 3PHHA 4ZT5A 4EW6A 1RQ2A 1TZMA 1H5QA 1K27A 3OJXA 4CDGA 4JVSB 5D5HA 3PEEA 1UPTA 1KP3A 3UWMA 3EODA 2VLBA 1WDKA 3C4VA 4QD3A 2FQXA 3VR1A 2ZKLA 3WKDA 3EVEA 2J5XA 1LTHR 1G38A 2WPNA 1COZA 1W0JA 5K3CA 3D3QA 4E4YA 3DDCA 4OMFG 3TMKA 3I2KA 4G1BA 1TYDE 3WLHA 1YXMA 4F4DA 2FPMA 3ABZA 1G3IA 5EIWA 1R15A 2ETXA 1LPBB 4YAFA 5K2OA 5HM6A 5JI3E 3AV3A 3FRJA 3KYBA 4MUGA 1YB5A 3ZZ0A 4AQYB 1VKRA 3H87A 4HNSA 2WI8A 4AJHA 1BROA 3AR8A 3INGA 3UUGA 1IBKB 2IHZA 2I2CA 4RD3A 1QR2A 5LMZA 2O5RA 1IOWA 2PSFA 2WQ6A 1R5JA 5EGNA 1CR4A 4D4KA 2IE0A 1OWMA 3CCCA 3TVTA 4FKZA 4JT9A 2X8AA 3IO3A 4JMLA 5CITA 5IUNC 2Y93A 5JBIA 1YR7A 3PXBA 4EYEA 3MFYA 2X4IA 4AG3A 2J59A 1XSEA 3GLUA 1FRFS 1YQXA 3QFCA 4TMXA 1I2CA 2PGDA 4U3JA 1QE3A 1VKJA 4X91A 3ZD6A 5JU6A 5J2UA 4NU6A 4RF5A 2H7VA 4GNRA 1YOVB 3R4VA 4DL9A 4GC9A 4AUKA 3A14A 3HDTA 2ATIA 2JJMA 4E1BA