1M10A

Crystal structure of the complex of glycoprotein ib alpha and the von willebrand factor a1 domain
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
199
structure length
199
Chain Sequence
b'HDFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMEQLRISQKWVRVAVVEYHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRIALLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVLSSVDELEQQRDEIVSYLCDLAPEAPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords von Willebrand Factor
molecule tags Blood clotting
source organism Homo sapiens
publication title Structures of glycoprotein Ibalpha and its complex with von Willebrand factor A1 domain.
pubmed doi rcsb
total genus 64
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2002-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1m10A00
1TYEB 2IUEA 5KYYA 1V7PC 4WJKB 1QCYA 1N3YA 5E6UA 1XDGA 5E6UB 3K6SA 1U0NA 5KYYB 1M1UA 2I91A 1RRKA 1PCXA 3HXOA 1BHO1 3GXBA 1OAKA 2NUTA 1QC5A 4XW2A 4WFQA 3IJEB 4FX5A 4NENB 1IDN1 3ZQKA 4WK2B 2WW8A 1LFAA 5KYUA 4C2BA 4C29A 2NUTB 2VDOB 3M6FA 2VDRB 3TXAA 3VI3B 3K72B 5LN1A 1MQ9A 1ATZA 3BQMB 4WK4B 2ODPA 4IGIA 4C2AA 1UEXC 4BJ3A 5KYUB 3EOBI 1MQ8B 3K6SB 4IHKA 1BHQ1 3EOAI 2VDMB 4CN9A 3EGXA 1MF7A 2NUPB 3EGDA 3V4PB 1JV2B 1QC5B 3QA3E 1L5GB 3V4VB 4UM9D 1IJBA 3N2NA 3EGXB 1U8CB 3EGDB 1N9ZA 4G1EB 4G1MB 3ZE0B 4A0QA 5E6SB 1AUQA 5HDBB 2XWBF 4CNBA 1MJNA 3NIGB 1DGQA 1NA5A 1SQ0A 1YVRA 4UM8B 2VDPB 4WK0B 1M2VB 5KYNA 1XDDA 4MMYB 3VI4B 1PD1A 2O7NA 3ZDXB 3EG9B 3ZDZB 4JDUA 2VDKB 2QTVA 2X5NA 1T6BY 1FNSA 1AO3A 1ZOPA 3NIDB 3HI6A 1M10A 3EG9A 4HQFA 3FCSB 3EFOB 3NIFB 1SHUX 4Z7NB 3F74A 1XUOA 3K71B 5HJ2A 4UM9B 5KYWB 1JLMA 2I6QA 4CN8A 3EFOA 1M2OA 3HXQA 1RS0A 4F1JA 2I6SA 4HQKA 1PD0A 1FE8A 1U0OC 5KYXA 2ICAA 4M76B 1MHPA 4HQOA 5ES4B 4Z7OB 1RD4A 1M2VA 2M32A 1SHTX 3ZE1B 3PPWA 4Z7QB 1YVPA 1IJKA 3BN3A 4O02B 3EH1A 2VC2B 5KYXB 1DZIA 2B2XA 4DMUB 2NUPA 3PPYA 1IDOA 3TVYA 1CK4A 1M1XB 4HQLA 2NVOA 4MMZB 3E2MA 1AOXA 3F78A 4IXDA 1ZONA 2VDQB 3Q3GE 5KYWA 2ADFA 3IBSA 1JEYA 1JEQB 1T0PA 3BQNB 3TCXB 2XWJI 3TW0A 3ZE2B 4PN7A 5E6RA 5E6RB 4F1KA 3T3MB 2VDNB 1CQPA 1Q0PA 3PPVA 1JEYB 1JEQA 3ZDYB 2ODQA 3RAGA 3EH2A 4NENA 3PPXA 5BV8A 1MQAA 4NEHB 5E6SA 3FCUB 2WINI 1RTKA 2XGGA 3T3PB 5HGJA 1ZOOA 1PT6A 4MMXB 2VDLB 4HQNA
chains in the Genus database with same CATH superfamily
2C3UA 2H9IA 3OHPA 2RHMA 2OXCA 2FPWA 3NHLA 2JLCA 4HDRB 2FWJA 1DIHA 5EY5B 4PHHA 5LBIA 1QVVA 2OYRA 4DF3A 4IR7A 1TQ2A 4L4RA 4M6WA 5JVDA 2X7HA 3KV1A 5H68A 3TM4A 2VBCA 3K6JA 2I91A 2V65A 4JUCA 4I14A 1ZWKA 2NUTA 4U7PB 4MOWA 2QW1A 5EL0A 4F06A 1XLWA 1Y9EA 2QP9X 4MWSA 4OL0A 2C00A 3SSMA 5CAEA 1HE2A 3AEKB 2YN0A 4LSMA 5IUNC 3HPRA 4ZCPA 3HY3A 3EPKA 3L5KA 5JRDS 4W1PA 1E5DA 1XQVA 5C52B 2RH9B 2AK3A 3B20A 2QGFA 1T1GA 1N5DA 1Z26A 3IELA 1NBME 2H63A 3BJMA 3MXTA 1XZJA 1MVOA 3W6ZA 4DILA 1TCCA 3BILA 8GPBA 3MB5A 4EEKA 5JAQA 1NP3A 1YI0A 2PCJA 2Y1CA 4U9IS 3TJMA 2DFKB 4HYTA 2I3GA 2JJ2D 4ZGGA 1DHRA 1CZRA 1W0JA 1HT1E 5LOVF 4X7RA 1SK8A 4IUDS 2R9VA 2A59A 1OZHA 1WE2A 2VQ3A 3JQDA 1NE2A 3I6ZA 5CPBA 4BTLA 5BR4A 3HSSA 3OE7D 1A8QA 1U8CB 2WSBA 3GQBA 4NARA 4D3DA 3QA9A 3JWGA 4YRLA 2CXXA 3UUGA 5BV7A 1V96A 2YS6A 2ZAMA 3T52A 2ZOSA 2PKQP 1KDZA 3FCCA 3GAMA 3VOSA 5DSXA 5BOSA 3B6MA 4COOA 3LE8A 3RVPA 2XCLA 5JZMA 1WY7A 2XYQA 3D3EA 1Y1TA 1RRPA 2RBGA 2P9EA 5E4TA 1UCFA 4P4SA 3VHXB 5ALNA 4LF8B 1SG9A 3M5PA 1JU4A 4TZTA 3DWIA 2MIIA 4AJJA 3G8DA 4GE3A 2FEXA 3CEHA 3WRYC 3GLFA 3QVKA 3ZXUB 1W44A 5BPHA 4CIAA 3I28A 1E66A 2G4CA 2WRZA 3VXKA 4A8HA 1KI3A 3HJAA 2IJGX 4KK4A 4PYNA 4U5XA 4XUGB 2COUA 4F92B 1J0BA 3ZPXA 4CCYB 3MCVA 1XD2A 3I9LA 1U0TA 3IAUA 1U7OA 3OFVA 2GS9A 4WIAA 3N86A 4HO1X 2VHUA 4C3UA 3F9IA 3O4HA 3PQ4A 1GXSB 3PXEA 3IP7A 4RKYA 4X61A 2FR0A 1BXRB 2IPMA 3EWSA 3KE9A 2C04A 2GEFA 2F43B 1M1ZA 2OBMA 3HDHA 2VC2B 1B0AA 1UMCA 3MSCA 4ZP1A 2B2XA 2OYCA 2O2DA 4LTMA 4QXOA 3WWDA 4CG1A 1O08A 4GPZA 3RJZA 2IBSA 1NYRA 2BM9A 1ZSYA 1QRRA 3A4VA 5G4KA 4RXUA 5NULA 2NU9B 2ANCA 1AOXA 3T61A 4BECA 1RYMA 2APJA 2ZBFA 2I7DA 1B76A 2CBZA 5E38A 3WFZA 2HSZA 4PEVA 1GDDA 4WFJA 1W36C 1OXXK 3EEOA 3H3XA 3OPVA 1QFYA 1XMVA 4KH0A 4HBGA 4NAVA 5DCYA 3RSOA 3SC6A 2I71A 3LHDA 3PDHA 2G9QA 1C41A 3K9LA 5IANA 2JBAA 3IPAA 4JLSA 4MROA 4URXR 5IX8A 2YRWA 3AONB 1L1RA 4R8RA 4RVDA 1GGHA 4ZCQA 1LPSA 3J7AC 3RH0A 2YNMA 3EQ6A 2IS2A 2I7VA 2JIOA 6REQB 3SBEA 5FV4A 2GBLC 1KI4A 1YMQA 3T1OA 5CCDA 1P45A 1KSGA 4IEEA 1N0VC 2NO9A 5KTMA 4JROA 3L04A 3GPBA 1KH1A 2Q7OE 3R8CA 1U9IA 2PX3A 4GW3A 3C16C 1PFQA 3GBVA 3JCZA 3D54D 5EXTA 2H2HA 1DKRA 2GD6A 3OE1A 5EJIA 2GZHA 2EL9A 2W6ID 5I4KA 1F0PA 1SHZA 3V1TC 2XMQA 1SRRA 2B1GA 4TQAA 4F2WA 2RGGA 3S8EA 3KAKA 2IF0A 4ZVVA 5JT1A 4FWBA 3M6VA 1GL6A 3FUTA 3G2JA 1FLDA 1UBCA 4CR6A 2ZI6A 3K4HA 4CRWB 2WD7B 4WW0A 4JVMA 5LR6A 4A8JA 1YU9A 2RHJA 2VUHB 1XKXA 5L45A 5AVUA 4P2GA 1EGVB 1BS2A 1M2FA 3VTKA 5CH5A 2JBWA 5J9FA 1UJNA 1DOAA 4ON9A 1CUZA 4OYYA 1OLXB 4GOLD 1VHDA 1Z7BA 4I1RA 1N5JA 3LDFA 4MI6A 2Z3ZA 4IF6A 3J81A 3OMLA 1JKJB 1XTSA 5CT9A 3AKZA 4WHMA 5HJEA 3E48A 3E9MA 3I32A 1GKLA 4D96A 5BN3A 5KS2A 3I6YA 4S3MA 3OEHA 4E2XA 2HD4A 4LRWA 1WTAA 5KI6A 3PX3A 4V0MA 1I4OA 4F2HA 4QUKA 3A4YA 2QX8A 3I45A 4AFNA 3MTEA 1YIDA 1Z36A 2ZIAA 3PE6A 1ZUNB 4U4AA 3CPJB 3F6SA 5TPWB 1F2TA 1GQQA 3AR2A 4I8IA 3DT8A 3TTVA 3AL3A 1G3MA 4JC8A 3IPXA 1HTBA 4BUCA 3FLAA 1PQ4A 2HQRA 4MK4A 2O1EA 3LL7A 1H6BA 3LUAA 5T67A 3NIDB 1DBPA 5KQMA 2B1QA 2B5VA 1YUNA 5FUQA 2AHRA 3Q3CA 1PYDA 521PA 2J7PD 4GKAA 1W581 2OLKA 3BSFA 1XJ5A 1VLVA 3L9WA 3O03A 4RFLA 5TQ2B 1SBIA 1HDYA 2OPHA 1MFPA 1LK5A 4WZ6A 5JHGB 13PKA 2X6TA 6PFKA 2HWKA 5U9CA 1KEWA 3NGMA 1Z6XA 1E2DA 1JZTA 1WD7A 5EJEA 3KKKA 1EUDB 1GPH1 1NULA 4FOLA 1V16A 5ES4B 3WXBA 3JD1A 3OEEA 4I4TB 4R01A 3I6BA 4X8HA 3AKEA 1IY1A 3R0JA 2II6A 2YWHA 1T8SA 1XQWA 4J0QA 2BKUA 1W2HA 4X6UA 1YB4A 1IXRC 1MKYA 1T5OA 1PLJA 4WY2A 3OETA 1MW8X 3E15A 1PR4A 2ZIXB 2NUPA 4YP7A 3BE5A 3ZGXA 2HY7A 5AWFC 1FDRA 5B30A 4KQJA 3CKMA 2ZANA 3AERA 4YCBA 4W5OA 2P67A 3EXG2 5FO1A 3PJFA 4D3SA 3VVBA 3V97A 4PXYA 2EIHA 3OJXA 4G0PA 3R3XA 3A3OA 4E5YA 4GMXA 4DUGA 4RVNA 1D2MA 2JH8A 3EFHA 5GZ6A 4BLUA 1COZA 1M8FA 1KRHA 1T2EA 1T6ZA 3K2EA 2ERCA 3M0EA 3F47A 4G5RA 4MWDA 1D4FA 4NTZA 4O4IB 2A1UA 2UU9B 3R23A 3A1WA 3LT0A 1Z6ZA 2ROQA 2W2LA 3G0BA 3UG6A 4MHTA 5EJ6A 2YIMA 1HBJA 3NJRA 3ZVKA 3PCXA 4QA9A 4AP5A 2R6ZA 4FT4A 4KTTE 5COQA 3HYLA 1RWWA 3A3PA 3BC1A 1E96A 1ACJA 1ETUA 2NTYC 4CJXA 2VXCA 4HGPA 2P9FA 2C3YA 1I3CA 1SFRA 2AGVA 1JDVA 4Q3LA 1D5CA 1LTKA 5KSPA 3U3OA 2GEDA 4B6GA 3NB0A 5G3YA 3Q7SA 3TQTA 5B3AA 5JNVA 5JXWA 2AJ8A 2IUYA 2X13A 4DA7A 3L7BA 3QVMA 4O2AF 3EIEA 3BAZA 4AG3A 1Q0TA 2YWFA 2O3RA 4POAA 5TR9A 3HVIA 2K6GA 3MXOA 4RKRA 2Z6AA 2PIDA 2QLMA 4LMRA 1W48A 2QTLA 2R65A 3G9UA 4TV8A 2C61A 3HCDA 2QY6A 4TZKA 1UADA 4TMFA 2XLBA 1LD3A 3RK0A 4NHOA 4B3JA 2CLSA 2HZBA 2NUTB 4ZT4A 4IV5A 2J3DA 3C7TA 4ZQBA 1ZHFA 4FMPA 4L7VA 2VP0A 5IH3A 2ASVA 2EZUA 3DR3A 4FGLA 1GPKA 5HMLA 2JI8A 3VJKA 3ETCA 4NK4A 3ZWMA 4CKCA 1FU4A 4CDMA 4ITUA 1PVOA 4REQB 4I50B 5EXSA 4A8JB 2ZKLA 1T0JB 3THWA 1PN3A 1UMDA 1LEHA 1I3LA 5C81A 5K8UA 2RH5A 2DFDA 3FF1A 3P71T 2XIQA 3T06B 2WTAA 3B7GA 1U8ZA 2CYBA 2OGWA 4H7IA 3BIWA 1XRNA 4RY9A 4FHCA 3EZYA 4QVGA 4RANA 3KKEA 1G5TA 2ZROA 3HZZA 4A2QA 3FYUB 5KDDA 1MPXA 2P30A 2KB0A 2QMOA 3RJMA 4EGJA 1QXSA 2AK2A 5LU8A 2IHZA 2WABA 5ALEA 3SJCA 3V8VA 4AWAA 3QBJA 4HTFB 1TF7A 6CHYA 2OHJA 1VXRA 3W2EA 1ZEJA 1FSSA 3V9AA 1DBSA 2JD2A 2PCLA 3L43A 1CR4A 1JZSA 2WU8A 3LGAA 4I3GA 5IJ0B 4PC6A 3NIFB 5K99A 3DD5A 4IHAA 3PGKA 2X0EA 4QPNA 2P4EA 2ECOA 1KPGA 1ZM4A 2FRVA 2X8WA 3UOWA 4F1JA 1BGXT 1W4CA 2HH9A 3RWMB 1A5TA 2QUZA 2BFDB 1MEJA 2R6AA 4QGFA 4QNMA 1QQBA 1C3EA 1PK9A 2IHKA 2P2GA 1BVYF 3AU8A 1UAYA 1XTVA 1YI1A 4GRAA 2WOJA 4P93A 4FYYA 4ZXFA 1IXSB 3B7WA 3WK6A 2H2FA 2PA3A 3KYDA 4CYMA 5K6AC 1B0ZA 3N75A 1FJGB 1ISMA 3I83A 2DRIA 2BHSA 2VXBA 3HBAA 3N53A 4QRDA 3FKJA 3ACDA 3TQHA 5KZMB 1Z38A 1H0HA 2HFKA 1QMGA 2I66A 2WILA 1KJWA 4HPXB 4IO0A 1FTNA 4M8SA 5TMDA 5BV2P 2EV9A 2AEJA 2GJKA 1XB2A 3I09A 3JQAD 4UAVA 4IDGA 4ZAGA 1PFYA 5SYAA 3AVQA 4KWCA 1XQYA 2X15A 2ADFA 1JHYA 2LCIA 1EXWA 1JEQB 2X86A 3K05A 3QWBA 4GMFA 4TTVA 1RCUA 3ELYA 1HYHA 4PHCA 5K3CA 3RTCA 3RWOA 4QZVA 2NPFA 4C0HA 1ZRSA 5B4TA 4KO3S 4JL5A 5E6RB 2ZXUA 5IBPA 4G41A 4XWKA 3GRKA 4PV7A 3IJ5A 5JZSA 3DV2A 3A27A 2FMKA 2R8ZA 4Z9FA 3TE7A 3ZZ0A 1KI7A 5JVDB 2V7GA 2W48A 2I80A 3L8GA 4AURA 4Z51A 4L7QA 1XJ0A 4YCLA 4O0LA 3DLIA 3EF3A 1H5QA 5LYJB 2PQMA 3T3OA 2ZE5A 1YR3A 3EW7A 5LLTA 2GN9A 1HK7A 1LC3A 3EVGA 1YMUA 5BT9A 4R2IA 2ZRBA 3RVRA 4OHKA 5D1NA 5DW3A 3RUDA 1M5RA 1VHTA 5TS2A 1FX1A 1QU2A 1VPEA 4XWTA 4QUDA 2GA9A 1IN7A 1N1GA 4OHVA 1RW4A 4RYDA 3FPHA 1KOLA 2H51A 3FJYA 4FOPA 4LDPA 4WK6A 3H9JA 3ZBTA 1T5LA 5CEEA 5JR3A 3S3TA 3Q40A 3O8QB 2ZTLA 5JMWA 1ZBQA 2GN2A 3J7TA 2WJHA 3EF1A 3FFXA 1G42A 1JYFA 1K5DA 3AY7A 4HADA 4NCHA 1QUEA 5HRUA 4MR7A 3F8TA 1T3ZA 4Q9LA 1FOEB 4X95A 1DDIA 3M3HA 2H11A 2VDUE 2Q1WA 3O3NB 3OTOB 4R31A 3GLIA 1FBNA 2EKPA 1K7CA 3R0IA 2O8NA 2O50A 4QFCA 5EWLB 2EDCA 2NU6A 2ZDHA 3HTXA 3H16A 3MWGA 3ZHQA 4C4AA 1OWMA 1T8UA 4G07A 1M0TA 1ODFA 2WYIA 2XE4A 3Q3EA 1VA5A 4FZVA 5IBRA 2A3RA 1BD4A 5IK2A 4AL4A 2C2YA 4DMKA 5JZ9A 3M33A 1FTWA 3L1IA 4RK7A 1H2EA 3C3JA 3RYFB 1AMUA 1SOVA 3EGXA 4KWEA 1IM8A 1I5RA 3C3YA 4FONA 3RS7A 2Q1XA 4UBNA 1RKXA 5JS6A 4Q9JA 4YX9A 3WYCA 1N5MA 2HRZA 4DL9A 3MTDA 1YAJA 1BGVA 3IOBA 1QCDA 5EOVA 4U6NA 4AZWA 3DAYA 2E4VA 3DJYA 3OJCA 4DEXA 3D8UA 4PY2A 4DKJA 3PXBA 4EG0A 1RZRA 2AUNA 3K15A 4F8JA 5FNZA 4ZOQI 1W96A 5F9FA 2RK4A 1VE9A 3EG9A 4FC7A 3K1ZA 4XZ3A 5E1BA 2O54A 2L2QA 1LX7A 2ZZKA 5ENZA 3M3DA 3W8RA 4W6QA 1T5HX 4O1MA 4B7CA 4CKXA 2NXEA 2M98A 3MRTA 3REQA 4TYYA 4KQ1A 2IYRA 3H9BA 2PE5A 1GV0A 3NWOA 4UHKA 3PHLA 4FLMA 4RF4A 3JAWA 3G82C 1W6RA 1H23A 1OKKA 3Q12A 4PZDA 5CVCA 1D2HA 3UAYA 3W4JA 1NXQA 4TQ9A 1JR3D 2ZM6B 4R8VA 5BR8B 3D8BA 4OLBA 1I7NA 1OZ0A 2IKSA 2AG8A 2R00A 3KRTA 3OIYA 3MLAA 4O02B 5DYNA 1FNDA 5EKSA 5AW6A 4KITB 5HE8A 1EVEA 4JX9A 4DJFC 5LJLA 2BFDA 3DKVA 1BW9A 4R3NA 4WASA 1EWRA 5DN6A 1N0UA 5LU9A 3ZE8A 5HCIA 4WOCA 3GRUA 2AG1A 3UGTA 1BFUA 2GCPA 4WY5A 3JR3A 1EZ1A 3QE3A 3M5WA 1Y8RA 4PGMA 3D7SA 5HFAA 5A05A 2BGGA 2ZJ5A 1J39A 3MWDA 2BOVA 3T9AA 5K09A 2NU7B 1M9NA 5DSTA 3T3MB 4B7UA 4GMHA 2HX1A 4RZXA 1HT2E 5BSTA 1Z22A 4X1IB 5BNZA 3I9V1 4G1FA 3RFVA 3DL2A 4U2KA 5LNK1 1A77A 1LI5A 3ESAA 4LV8B 1F06A 1JIIA 3BDIA 5DEOA 1HTWA 3AR9A 1Y4UA 4YXFA 1J20A 1G291 2GJ8A 2QK4A 3EAFA 3RVNA 3RSSA 3OQOA 4D4IA 2WJWA 4MWBA 3VVMA 3FUUA 2CVHA 4NMWA 1CW2B 1UBEA 4WGGA 4IJQA 3ER8A 3VR5A 3PC7A 1G5HA 3LHIA 4MINA 4I66A 4JJGA 2Q3LA 4EY4A 4YDSA 1NLYA 2XTZA 1GZDA 3U13A 1UBUS 3PKJA 3NM4A 1R0SA 3H1FA 1G6KA 1PJCA 2YFHA 1HE4A 3ENNA 1ML4A 3H5OA 5AK5A 2XDQA 2PM8A 2PUHA 4DIEA 4LQ4A 4XGNA 1WP4A 5IS2A 4ER3A 1L7DA 1TT5A 1KSHA 2XWPA 5A3VA 3PRJA 3FNBA 1Y4DE 4PLWA 4WPGA 4FMCB 1FDUA 2IPLA 4RMNA 1OTHA 2GN8A 3MZ0A 4WZBB 5ER9A 1THMA 3C24A 3JQEA 3HDYA 2B1RA 1P2GA 2AR0A 4I08A 1ZPDA 5AKZA 2H59A 4AB1A 5E1MA 3S28A 3PEUA 1E18A 2IA5A 1TCUA 2WIAA 3HLYA 2IEBA 3HCBA 3NHKA 3SSAA 1GQ2A 4CM9A 3OBIA 2O5EA 4GP7A 2PUFA 2QT9A 5EWJB 4JGIA 4Q6WA 3A2MA 2ABWA 2I3BA 2YX1A 4Q3BA 3C3MA 3P19A 3IP3A 2ZYAA 3CR7A 1M72A 2OBFA 3N2EA 4CMJA 4EW1A 5DHRA 1EGMB 3Q5GA 3KK0A 1YL7A 4DG9A 3THWB 1TTPB 4F9EA 5DX1A 4U7WA 1Q17A 4ZI7B 2GT1A 3KSZO 3OX1A 1E3LA 3S2ZA 5K0EA 1EUDA 1L8OA 2EC5A 2O8BB 2BJHA 1R8SA 4HLQB 4MX8A 3H87A 5MDHA 2I8AA 4NG5A 2EJWA 5JCZA 4K8OA 4GL2A 3VDQA 3NUZA 5JJCA 5D3ZA 1GGEA 1GOTA 3C41J 3F2IA 3I9OA 1GZSA 2P3LA 4H35A 4QUHA 4D8WA 4R0NA 4FNGA 4TM7A 1EAMA 3PNMA 1FVOA 2GRUA 3DBRA 3K8ZA 2HPAA 3R3ZA 3VOAA 1PT7A 1J8YF 4X92A 4XKJA 1CB0A 2AKAB 1LLQA 5LXTF 3QBVA 2ZUTA 1E1RD 1N2SA 3LNCA 1OIVA 3W5DA 3S1AB 1V3VA 3DCIA 1RHKA 4YAJA 3Q5EA 5BN5A 3EMVA 2X0DA 4ZVQA 2VQEB 1LWNA 4RIFA 3NDJA 4OXYA 1JXQA 2XCOA 4L5CA 1V5GA 3PX7A 4LVNA 1W87A 1RVDA 4HDSA 4LK3A 3IDFA 3TD9A 2WIFA 5IDWA 1ENOA 1KZ4A 1RJDA 1YZQA 5F5LA 2W11A 4NE9A 1LVHA 2FR1A 2H2IA 2WA1A 4FR0A 3I4FA 1W85B 3H4MA 4P32A 3PPYA 3UQZA 2XDYA 1VIVA 1GP2A 3E4CA 3F8WA 2CLFB 1A82A 1RJEA 3GJXC 1DG9A 3TX2A 1EPUA 2CDNA 2GETA 2PS9A 2BR5A 1Z4LA 4GRDA 5FBQB 5HA5A 2QTFA 1S2IA 3AR8A 4J3JA 1DUIA 1RXIA 4C76A 2ETXA 3E0XA 5E0OA 3A1UA 2BMAA 4FHZA 1QIHA 3WWZA 5A6SA 1J97A 4DR6B 1KYQA 1YACA 1DLIA 4ANFA 4QAJA 1LDBA 3B3AA 5ANRB 1Q5PA 1RTKA 4X93A 3TRJA 4IY1A 4ZYTA 1I80A 1SPXA 2CVPA 1QGED 3R8FA 2R5NA 3RS0A 4QQNA 4L16A 2P7IA 3GOHA 3SYTA 4DCCA 1Z73A 2ATXA 1ORTA 3KSMA 2GUWA 1Z34A 3RFXA 5JVDF 3S99A 1UT8A 1TVEA 1M1UA 2NT3A 3NU1A 4JASB 3H04A 1I7LA 3OT1A 4M99A 2ZCJA 4J9VA 5GV8A 1XZKA 3O1HB 1EK5A 1QFSA 4OA8A 1GUBA 2EFEB 4C7OA 3T41A 3R5FA 4PAMA 5AW9A 5TGDA 4D45A 1DXHA 4UNSA 3F73A 1L5WA 1O0BA 2WD8A 4IMRA 4M0KA 2QVLA 3O2NA 4R9VA 5A3QA 1RI3A 3NNDA 3A11A 3LUCA 2CV2A 3NBAA 4G3XA 1SUSA 3IDQA 1FMLA 3YASA 2DQSA 2HYDA 2LXNA 1IPFA 3IILA 5A5EA 3JYOA 1ZK2A 1JYEA 4DUZB 4TT3A 1ORDA 3EWIA 3FOFC 5FNVF 4WX2B 4AN0A 2GERA 1B8UA 5LQNA 5LOVA 3DNMA 4KWIA 4QPCA 1B26A 1VHJA 2GBFA 1SXJB 2HU2A 3NBFA 4EQZA 4UM9D 1AO0A 3ZEIA 2ZRMA 2B9EA 5I9TA 2QZ4A 4CLRB 4WAUA 2EXXA 2Z0MA 4ATNA 1ZR4A 1QBGA 3ORSA 2E1RA 4GC9A 4FW8A 2PS3A 3JYPA 5HJ7A 1NKTA 1GLVA 1NUHA 3N8KA 3P9PA 3TNFA 3FDXA 1WUJS 3V1YA 3LCCA 5B5SA 3QEMB 2BY4A 2FR8A 1GZ3A 3N76A 3OFNA 1C1DA 2GUGA 2IS4A 4KO8A 2QMZA 3ZXYA 1B43A 5CFLA 4RF3A 4C7MA 1N2IA 2JLAA 4FR2A 5IM4A 1E9DA 2G5CA 2H65A 4X1YA 1AJEA 2BR4A 4DLYA 4I9UA 3CVXA 2SECE 2I2FA 1XRSB 5TQJA 3TQIA 2FMTA 3UH1A 3TSYA 4MKZA 2SKCA 2PRYA 3A3YA 1L5RA 4JI3B 3ZWDA 2ZJ6A 4M88A 3IOCA 3MJSA 2OV4A 1UBFA 4HTFA 4INAA 4IVNA 3OJWA 2YWXA 1CBUA 2DC1A 1E0DA 2GF9A 4HQOA 1HDCA 2AE1A 3WKDA 1E4OA 1JHVA 5K6AA 4LF7B 5FP0A 4EI8A 2Q1SA 4BCCA 2XDAA 3I53A 1PIWA 3GVHA 2LDBA 3Q1KA 2A9QA 2NSJA 2QAGB 3SHOA 1U2SA 2AG6A 4GD3Q 1R9MA 1M5TA 2AI1A 1M6VA 3BA6A 1H2AS 3K30A 4LJ9A 5LQDA 3RAEC 4ILEA 2AEEA 2PGNA 1VZ3A 4LZZA 5PGMA 3WP0A 4C7VA 4D0NA 1C8VB 2JIMA 3BERA 4IIEA 4MGIR 5A6VA 1DRVA 2OKGA 1V1MB 5AIBA 2W4MA 1U2EA 3L7JA 2OECA 3QUCA 4KYTA 4WFIA 3G8YA 3M4JA 2OZEA 5EXDA 5J58A 1FTSA 2FPKA 2P7HA 4XYMA 3NETA 5EP4A 3VSEA 1TAQA 5C4IA 3VH4A 2D0PB 3UK0A 2I22A 2VWQA 4V2IA 1E6KA 3NNNA 4MDHA 1HRDA 1KIMA 1G6OA 2FUG6 3BGSA 1JDJA 2V4ZA 3RAGA 3TOVA 4C0KA 1IONA 3M34A 4OSEA 1YJXA 1QKJA 4IDAA 1XHFA 2O1SA 5K20A 1ZCBA 1A96A 2Q5LA 2IDKA 4DA8A 3X0DA 4MA5A 3ZGYA 1FU7A 3OH8A 6YASA 2PXCA 5LD2C 4MS1B 2G5GX 1MG0A 3REOA 1CZOA 1NUAA 2XY4A 4GNRA 4KR9A 1K6XA 1Q15A 1U0NA 5DBIA 1DCMA 2J45A 3UNXA 4BNFA 5KJFA 1S2NA 2HKIA 2FH5B 3B5EA 1ZNWA 4Q5IA 1KEZA 3AUTA 1EA7A 1NM5A 4Q3NA 5A04A 2W71A 3PQDA 1IN8A 4ABYA 2OCLA 4Q4AA 3ZWKA 3QU7A 1C4WA 4CKYA 4QJ3A 5CFOA 1L9XA 3PFIA 1SB9A 4MGYR 1QKIA 3LKZA 4YV7A 3ASZA 2H29A 1DO8A 2RCNA 3EBPA 5BVHA 4BXOA 3DFKA 3C5EA 3JWHA 2AJCA 4Y9SA 3PXCX 4IH1A 1JAIA 1DC4A 1P1FA 4IIHA 3TMAA 1GGFA 4CV2A 4FOTA 1VCIA 1MQ9A 3U1VA 3TKLA 3PITA 3RYFA 2E4WA 1EX7A 2IU3A 4R51A 3SKYA 3C70A 1WBBA 4BTVA 4PRZA 1XVTA 5BUQA 2G6TA 3GAZA 2J30A 5KOIA 3HS3A 2P11A 4W8HA 4WV3A 3DVAB 2IGBA 2G0TA 1BEUB 5HILA 5HTKA 4CLOA 1S2LA 1CRPA 4JK3A 5F7ZA 1R6XA 4A9AA 4YB8A 4F3TA 2YXDA 4IGAA 4MRAA 2NUAA 1Z8HA 1RAHA 1BE1A 1G20E 2IYOA 3BKWA 3E84A 3FLBA 1M1YA 1V4NA 3X2SA 1GTJ1 4AKHA 5KOHB 1GILA 1NJ5A 4NCAA 1FDTA 1XX6A 3V7YA 5KYGA 3L6EA 3SEQA 1QH8A 3DL0A 3LD9A 4G0OA 2ENWA 3WDKA 5MF6A 5KU1A 2PX2A 2JLBA 2HXYA 3GLUA 3QY9A 2H4FA 4QU0A 5I51A 1ISPA 2OESA 4NJMA 4DJ5X 4F5YA 3VHXA 1SRQA 1Q7CA 1MEOA 2J0EA 1OIWA 5TJ9A 5KX5F 3DQZA 3ZC3A 1HXHA 5G0SA 1TU0A 1G98A 3BCRA 2HO4A 2W8BA 4TV9B 1JECA 2Q8QA 1FVFA 5JJKA 3X1DA 1G5IA 3F3MA 4LJ5A 3EASA 3PD7A 5KOYA 2XMZA 3P4UA 1JQ5A 3B6ZA 1XD2B 4FD2A 2XECA 2I87A 3JYLA 4I5GA 3AIMA 4HZGA 4BNTA 4PYJA 1M0WA 1K7EB 3HCCA 4OSOA 1RNLA 1QVRA 4D8YA 2B0JA 2VKQA 2QXTA 3P0HA 4UBLA 4V0SA 4NV1A 4YJ3B 5F77A 5A3JA 1TKCA 3LTNC 3ZYCA 2VG8A 5TT1A 3G7SA 1QX3A 1PZFA 2UVQA 4AG5A 3DTNA 3LU1A 3GJTA 3Q3GE 4HMOA 4JEUA 4BX3A 3WYNA 1WSBA 4EK9A 2XZOA 4UOQA 3OZTA 3T4EA 1VHWA 4LSZA 2IYQA 4LBZA 3RNOA 3ZE2B 1E2UA 4BO0A 1E9RA 2O3UA 2GEBA 4H6XA 5ELMA 4ZN6A 4DC1A 5EJ5A 3SVZA 2XX3A 3VYWA 4XPZA 3HKDB 2R48A 4W63A 1Z6AA 1D6JA 1P5HA 1UL1X 2CF5A 3FPGA 1VMEA 2JGDB 1U6JA 3QEJA 3R7LA 4D5GA 3HO1A 1AC5A 1CJCA 3DJFA 4TYQA 3N6VA 1M2WA 4G9BA 1XA4A 2TECE 4MLPA 1SPBS 2VDLB 4EKNB 1X7WB 4RKQA 2FEKA 2YNMC 3EZNA 4G9EA 1O03A 4TLLB 3RUEA 3TLAA 2XTNA 3PKZA 3G8CA 4BTEA 3E22A 3MGGA 3U6BA 3LX8A 4L2IB 2CNOA 5AHKA 3JPWA 2IYVA 3UUWA 2ZDGA 5I47A 3LZDA 2ONJA 3L7KA 4FNAA 1ZSNA 3R41A 1TTTA 5LXTB 1BTOA 2FFQA 1A7UA 2OB2A 3EEFA 5AQEA 2DKOA 2I76A 1MO3A 3CC8A 3K35A 5DGTA 3OU7A 1Z0KA 3DULA 4QLOA 1AHIA 1PJQA 3U9LA 4NRDA 1SUDA 3NYRA 4YN3A 1EKXA 3UFBA 4OHYA 4LWQA 5BQOA 2DUWA 4XEHA 1G9SA 4XIGS 3DZDA 3L8EA 2YINC 1AUVA 3OQVA 3A9VA 4JKOA 4UUMA 4EWLA 4ENUA 1RJGA 2OT3B 1O4WA 3DZBA 2VFAA 4IVPA 4Z8XA 3VR3A 2W9XA 4K9SA 2EL7A 3AILA 4N49A 4DVGA 1MOQA 4OIMA 3R7WA 2IEIA 2QP4A 2CDRA 3HCNA 3VC3A 4YUAA 5B2EA 3DDNA 5DP1A 1QO0D 3HNOA 5I45A 1YA6A 1O4VA 1ADFA 2JFBA 2J08A 1KZGB 3T1TA 1FFBA 1IBLB 3WWYA 1J2JA 2CMGA 5HM6A 3EC1A 2P9BA 4P3YA 2YV4A 4MGZR 3ZIDA 1MIOA 3ODPA 3MMNA 4FUTA 3UV6A 4CQMD 1RACA 2D1YA 1J8FA 1CJMA 1NJ2A 4G5SA 3C1UA 4GPBA 2W6CX 4KHZA 3SICE 3UWKA 1JDTA 5BP7A 3NV7A 2QTVA 2X5NA 5CJPA 5JTTA 3MCWA 2BMJA 1J99A 1I1QB 3ZJYA 1C9JA 1WMBA 3OTHA 2CZQA 3P0RA 1O0SA 1X77A 1SVLA 4KIGA 4Y9RA 4HFJA 2GA8A 5C1BA 4CIWA 3ENZA 3QX8A 5KTTA 2GD1O 2KMLA 1JW9B 1N2ZA 2W2QA 2ZXFA 5JAOA 5L4SA 5I8PA 3PWZA 4KIUA 4PNZA 5FI0B 3ZHBA 4AVYA 4EA9A 2EF1A 3OPNA 4GZLA 2H1WA 4OKNA 3LUPA 1SO8A 5JCJA 3M9LA 2TSYB 2XUQA 3RTAA 1GTRA 1A9TA 5AI4A 3U37A 3KEOA 5THKA 1UBOS 4ZAFA 4RTNA 3ILSA 2JJYA 4TMWA 1S2OA 1T10A 3D8TA 1X8KA 4AUMA 4BV8A 3FE2A 2OAQ1 4BP8A 3FNRA 4Q4DA 5F12A 1N0HA 1KJ9A 2FSVA 1MEEA 3H6GA 5K3EA 3U44B 1RHRA 2F7SA 2PT9A 3LHKA 4IW3B 3U0VA 4OSPA 2QDXA 4HNUA 1TUBA 1RP7A 3I2HA 2VZ8A 2Y05A 5A03A 4YAGA 1PR0A 1RMQA 4TT3D 1E3QA 4UOZA 4XYLA 5A4KA 3U4QB 3LUGA 1R18A 2F1OA 1R4AA 3BQ9A 4TKUB 2VDNB 2VCHA 2Y0PA 4URYR 2GCEA 1E6LA 2DBVO 3AEKA 4L57A 4LE2A 4PWZA 2WY2D 2QY9A 4DBZA 5AM4A 5DGXA 3LIPA 1ZI8A 4W7SA 1BDIA 4DR7B 3F5SA 3CRVA 1CC1S 4JX8A 2V55B 2D1QA 1E7YA 3R6TA 4M1OA 3CUUA 3VOBA 3BFXA 1P77A 3OF5A 5JMPA 2PX5A 5KYYA 3WBFA 1TAHA 2IZOA 1KDRA 4EA6A 1CDOA 2CMFA 1MJHA 3JWEA 2DPGA 3FOWA 2HWWA 1JHDA 5K3BA 1GNLA 1QRAA 4GLOA 2D5CA 4BP9A 3L0ZA 4I8DA 5JQGF 1E9CA 1PCXA 2BFCB 4RLHA 4WJZA 2GKGA 1CIPA 4MEJA 3TNLA 4ADSG 4FTWA 5JAIA 3VKHA 1P2VA 1TPYA 1P6UA 2B4KA 5KC8A 5DLYA 2WJZB 4IIXA 1QO0A 1R4MA 1Z63A 2YN4A 3LWZA 5A5GA 1SK9A 2HADA 1L1EA 3AUUA 2QROA 4UUQA 2C9CA 5BNIA 4AK9A 2VYCA 3IHWA 4JC4A 2GESA 3CCBA 3ZWPA 1TX4B 1PVDA 2FSFA 4IDDA 4LYDA 5F5XA 3U7RA 3W5BA 3QE0A 3ABZA 1W36B 3MGKA 3C8MA 2PKRA 1E99A 1WVIA 4NBUA 5CT5A 2M6KA 2PBLA 3T12A 3BK2A 3MG9A 2HLDA 4N0EA 3TFQA 4BLTA 1KZ6A 4ILKA 2CJPA 4FYIA 1LSUA 2P1RA 4L0QA 4XM1A 2W93A 3USZA 3G5UA 3Q3JB 1HGXA 5J59A 4MCAA 3SDBA 1I0IA 1EBBA 2YIVX 2XGSA 3ASVA 3DTVB 4Q4AB 3I62A 2QJWA 3FTEA 3IO3A 4RIGA 1TM3E 4RPGA 1SXJC 2HQBA 2GPBA 3E35A 4PQEA 3NIGB 3OF2A 3GIWA 2D13A 3TXYA 3KQVA 1W5TA 2YN2A 2FWAA 3B2EA 3ANMA 4NMHA 2AVDA 3DMGA 5JSUA 4LF9B 3H2IA 1Y1QA 3ZVNA 1TAUA 5C2JB 5FYDA 3KLBA 2VDKB 3D6NB 4DSUA 5CIWA 2BDEA 4HQFA 1MA0A 2HMUA 2LVBA 4QARA 1XL0A 4EKGA 3OWOA 4LYHA 1GVNB 4D56A 1UK8A 2VYVD 4RF2A 5ICGA 5J4KA 3C3DA 3WLKX 1K6IA 4Q1BA 3PZRA 2P4HX 1JXAA 1P39A 3D59A 2XRZA 4BQEA 2J67A 1QH8B 3E9NA 3M1AA 4MPTA 4DRXA 1V8ZA 2R62A 2F3PA 1E0SA 4R6WA 5IARA 2ICAA 3DOEA 3H4TA 2PAFA 2CHFA 4K1LA 1YVEI 4G8BA 4H7DA 3ZU6A 4ZV7A 1E60A 1L6IA 1O58A 1EQUA 1Q7RA 3FVWA 5JIBA 1RJWA 2WZQA 2V9CA 4GR9A 4UUAA 5ALVA 1JG2A 5BORA 3WLMA 2F9LA 4N5DA 1BROA 3B3FA 4YR9A 3EZ2A 4MRVA 1N3LA 1FNCA 4I5FA 3WLAA 1WU7A 1UMBB 3A1DA 3C6YA 3HCWA 1W73A 2J7KA 5HCNA 1J5PA 1TCAA 2PZKA 3P9YA 4FS3A 2GVDC 4EBFA 3MGCA 3PK0A 2BTQB 3IBSA 1AQLA 3IIEA 4FYVA 3MMPA 2COKA 4EF6A 3QITA 3BCSA 4N82A 1QHSA 4KO2S 2DH5A 2NP7A 1GPUA 4X1OA 3I9NA 2PQ2A 2XADA 3BB3A 2CMHA 1U1GA 4NC9A 2NXWA 2OFFA 3UPDA 4Z0PA 3OSZA 2WK1A 3CNOA 3ESQA 3UXMA 3L4BA 1BE6A 1J22A 2CDCA 2YJGA 3L0OA 1LWOA 1T15A 4PLTA 4BZWA 5LPNA 3KUCA 3RSZA 1WUTA 1XLTA 2CVFA 3FYUC 2WU4A 1TD1A 3G5LA 4EHJA 1KY4A 2XUDA 4P7FA 4Q3DA 3W6OA 4NSNA 2ZRFA 4ER0A 4E09A 1Z37A 5DBFA 4FQ7A 4K88A 5K1ZA 4QBIA 1K8ZB 5B1EA 4GS5A 1XAHA 4YGXB 2R5WA 5FI1B 4GBED 4WFKA 5LUBA 3SP1A 4ZVUA 1NR7A 1ZMBA 2JFNA 4G26A 3VGPA 2C8JA 1ODIA 1PJZA 4JSYA 1JG3A 5EPEA 3T9FA 4EQ6A 1VJCA 2O48X 2ZBEA 1RPAA 1EUCB 1M2JA 1TF5A 1ZL2A 1ZM9A 4NG4A 4TV8B 4CQJA 5FOWA 4F93B 3KFXA 1KEKA 3OUZA 1W36D 4C2BA 4TMXA 2Q45A 5EKTA 4U8HA 2XWQA 1G7SA 3K96A 1I3OA 5EIAA 3CRQA 1NT4A 3OLZA 1MC5A 5HE9A 3CLHA 4J16C 4ENTA 1HDGO 4UTRA 4UDXX 2O1XA 3KEFA 4KW7A 1N2BA 2BGLA 2ZYDA 4XCXA 1SXGA 1QH1A 3RS9A 3FNGA 4PVDA 2AR7A 2P2CA 2QLNA 4Q93A 4EUEA 1N4DA 4I81A 3GDFA 3JQFA 4QWMA 3WWEA 3QHAA 4BFXA 5HIJA 2VPWA 1O94C 2DKFA 2KBFA 4N7BA 1E1KA 3BJZA 2WP0A 2D7CA 1JX6A 4ZYYA 2OXRA 1M8KA 1NTOA 1DX4A 4DBVO 4U39A 2XGMA 4YJFA 5EIBC 4FGZA 5F35A 2FPSA 4A2CA 4ABTA 3RYHB 4II7A 3IOEA 3AFGA 3O38A 5GADl 4R54A 1CFJA 3PNOA 1BXKA 4GG1A 2IU4A 2V7WA 1FL9A 3KR2A 4K8RB 4L07A 1NLMA 5ALPA 3MPUA 1TFRA 4MR8B 4ZOCA 3PCTA 1YB1A 5K8JB 3QK7A 2ZI4A 5I7SA 3FX2A 2CHVA 4CI9A 1XZIA 3DMRA 1TI7A 3TGWA 1JAXA 1M2OA 3IGFA 4KLZA 4PLZA 1O6FA 1EINA 1NZDA 4RD0A 4G24A 3PUHA 2QN6A 3ABOB 3IUQA 3VR2D 3SNHA 3ZW7A 1GSHA 5FQNA 5HVNA 4DDMA 4MIEA 5LM3A 4RTSA 2JLWA 4X1KA 2WTMA 1LF5A 3DTYA 5ALRA 1W35A 3EHDA 4YXWA 1EBUA 1NPDA 4JUBA 1PEDA 3LJKA 3L46A 1ILWA 3SF8A 3OM1A 5CFMA 4QREA 4KCGA 2FDCA 4LRYA 3EXFA 3HYRA 1LBQA 1YH3A 3HM2A 3GLGA 3E9ZA 2GCGA 4V2UA 3JYQA 1ZXLA 1UXJA 3C3EA 5H4HA 3ZW8A 5B57C 1P61B 1U7ZA 2C83A 3A3KA 1DCFA 3LK6A 4M37A 2AMFA 2CE2X 2C2WA 2N9UA 4CKEB 3H2JA 1G0NA 2QV0A 3TW0A 2OKCA 4HGYA 2P6UA 1NN3A 4K6HA 4YBRA 4C30A 1D1TA 3E3MA 3JRXA 3THXA 1OASA 5AXCA 3PI7A 4YDRA 3C1OA 1TUGA 2VWHA 4E5SA 3QPBA 4EL0A 5DHPA 3T15A 4F21A 4OFZA 2P2DA 4BQOA 2RH4A 2PKXA 3BZUA 2H1SA 1LPNA 2IODA 4RHCA 4BQQA 3A06A 3NVKI 2PQ0A 1SQSA 2PQ6A 3QYJA 4HEHA 3RUCA 2MYTA 4XLTA 4BB5A 3H2KA 3EN0A 2C9OA 1ESMA 2PTGA 1JAHA 1KL7A 4HI0E 4BJ5A 1KGSA 2JI6A 2E21A 2OBXA 1N3YA 3IBYA 2VYFA 1KJNA 3MEQA 2GHIA 2JAOA 3H42B 5MGNA 4IXWA 2CXSA 5GM2A 2H4YA 4G4GA 2CWWA 5LVAA 3F6BX 4KQ2A 1P2UA 3W79A 3QX9A 1EUQA 1L7PA 2IYXA 4IQ4A 3W7VA 2XBUA 4M36A 3KLPX 1GUYA 1NWHA 1KDVA 3VDMA 1ZAKA 1DU4A 3H2SA 4X60A 1CEYA 5D5QA 3TTTA 1FCJA 2ILVA 1YZHA 5MN4A 1YI8A 4BC0A 2GZMA 4MV7A 4E08A 2YYZA 1ATZA 1MC4A 4G8CA 4IGIA 1N8KA 3L6UA 3HJBA 5AM1A 3ISJA 3P2KA 4KFSA 1C7QA 3QEOA 2ORVA 3IT2A 2ZB2A 4ENVA 4HD8A 5CM9C 3RC3A 1JMVA 1F2VA 3WX0A 4EUHA 1EYZA 1YOBA 1XTBA 3WSTA 4P3KA 4MHOA 1L7BA 1GR1A 4G1EB 1JKMA 1KWGA 2WF7A 4A0QA 4TVSA 4K6KA 5I7HA 1ZGZA 1BMDA 2EJTA 4HDRA 3U3JA 1JDZA 2QUAA 4C7XA 1KEEA 1NLFA 4G0WA 2EKBA 3L8YA 1SN7A 3ZK9A 2V9PA 1R0WA 1D2GA 1ZJ5A 3FDJA 1Z29A 3CNBA 5CNKA 3R8XA 4NYIR 1DP4A 3SJZA 3U61B 2I67A 3ORYA 3CLRD 2C8VA 1T4GA 4HGNA 5KWSA 3AEZA 5CCXA 5J2UB 1SD1A 2HCRA 5C8YF 5CG2A 3L0YA 2HZ7A 5I8ZA 4GYWA 4UU8A 1KMCA 2H2GA 3TKYA 4CN8A 2HCTA 5C8ZA 4BO2A 1AQJA 2IHNA 1HZZC 2GSWA 4BMNA 4JT4A 5IAEA 1PNOA 4B7AA 5I3ZA 2HYIC 4DNOA 1S4QA 4C4OA 3I52A 3AR4A 2OGSA 2BF4A 4LI0A 1EJ6A 2F8LA 3FNQA 1A9RA 1HG1A 2XZDA 4JS0A 4P4GA 1Q84A 3FPEA 3WSWA 1MPTA 5DXJA 1L5ZA 1SD2A 2NSDA 3DXXA 1YDHA 1KEUA 4KBFA 4YAOA 4GE0A 3VX4A 3IB3A 4QXQA 4ZHSA 5AUOB 3R3HA 5I6DA 3H5VA 1C3VA 4IJUA 4PSKA 4BFWA 5A5FA 5CB8A 4H1UA 1U0SY 1R5BA 1Z0JA 1WPQA 4M0FA 4DBLC 3D5QA 2P35A 3HN7A 2DTDA 2A1IA 3NHMA 1RHUA 2DLCX 2FJUA 1TO6A 2PX4A 3CLTD 3PICA 4KMSA 1JA1A 4Q9KA 5ALUA 4MRNA 4AMVA 2HJ9A 5IBQA 4CV3A 3P2YA 3REGA 3WB2A 4BNLA 3JQ9A 2HC9A 2Q5FA 4PX2A 3IAM1 2QLBA 3HZOA 3U4CA 2ESRA 4KXVA 2QNRA 5J3JA 3BMNA 3JQ7A 1O8CA 3Q8WA 4MVWA 4UNRA 1JEQA 4IDFA 5P8WA 5AKEA 4ZYZA 5E9QA 3STYA 3VPCA 2C7QA 2IS6A 4QATA 1E2NA 1ZXBA 4UASA 2QNBA 1OE0A 1JT2A 2HA2A 1EG7A 1TVCA 2JCSA 9ABPA 5J4YA 3ZDBA 1GZVA 4H4EA 2HJRA 1SKAA 4HNQA 4N7MA 5ADUS 1U0HC 5EFZA 4C87A 1S8NA 4RUKA 5LYJA 1U2DC 4L4SA 1INLA 1VKJA 3IURA 4R8KA 4BJ6A 2O2HA 4GXTA 5K45A 5TMPA 2VP2A 1DVRA 3RVQA 1Z5NA 3N2YA 1HT0A 2NPIA 3LHFA 5AI9A 1PG5A 1G21B 3QTBA 3LM8A 3OO1A 4DCPA 5L8VA 2CXRA 1RMYA 1OAKA 3E23A 4WZZA 2HGSA 3FYDA 1URPA 3AHEA 1QOQB 4RCZA 3WMXA 4B83A 1XEWX 3WA6A 3G2IA 1L4MA 2D7JA 2DE0X 3EW9A 3RU3A 4OHFA 3BZWA 4YPFA 5A02A 2CK3A 3GJYA 1UBKS 2PVPA 1G59A 5CNMA 1V9LA 3DO8A 4X0EA 3KPVA 3HVJA 3WMFA 3GA5A 1U8YA 2JIPA 1F6DA 2ZSDA 3TI9A 1Q12A 1D2CA 1A76A 1SCUA 2AW3A 3EOAI 3VR5H 5C8DA 1XTUA 2FG6C 3U62A 3JWIA 3RI3A 4I5IA 3MB8A 1AIPA 2WUEA 2HRCA 3CBQA 3SZOA 3C7AA 3ESRA 1E8DA 1GCUA 3A1VA 4MICA 2X9LA 3TOZA 1ZVJA 1PFVA 3E7XA 3EGIA 3QVVA 3MWFA 4HAWA 4Q39A 3ZOZA 1SXJE 1LVUA 4R5HA 2P6NA 4Q66C 1N1EA 3ZEAA 2IV7A 1MB9A 2HF9A 3FSGD 4Y2RA 4MJ7A 3N87A 4TYNA 1RSZA 5AT1A 2KYRA 5AJVB 4IKOA 4CL3A 3H1TA 1YOVA 2Z83A 3SBXA 1ONNA 1WXIA 2NX2A 2AUMA 5C8YA 4AC9A 1KERA 2CJFA 1M5UA 1PWEA 2PR2A 1DPFA 3P9RA 3KWLA 3IAS1 1Q1BA 4F7DA 1ND6A 1DT5A 1TM4E 4ND8A 3AW9A 3CRW1 4B6JA 2AZXA 1PS0A 4LZPA 1X1SA 4BFTA 2JLSA 1A72A 2YS7A 1O89A 3C7KA 3QVGA 2ZRHA 2IYTA 5FWXB 4UVDA 3EDYA 2FPPB 1YS1X 3E1GA 3I39X 2P27A 1T5DX 4NR0A 3RGGA 1OHHA 1IAQA 4RPJA 1WOYA 2LZ0A 1G5FA 2PJDA 4XE5A 3UFXB 3HRKA 2B8WA 1KVSA 1RQRA 4XM2A 4UKDA 2PRKA 1OU0A 1FEZA 4MH0R 1N57A 2RE8A 1NUSA 5EUQB 4AP9A 1I9CA 3CRNA 4C06A 4I3FA 3TBHA 5F7XA 2X2PA 1MJGM 2GRAA 5G4LA 3I5YA 4BY9E 3FBTA 4UHJA 3FOZA 1OX4B 5ADWA 3CF4A 2CLKB 1BO6A 4A8JC 3FRIA 4TMKA 4BRUA 5JNLA 3QEAZ 2DQYA 4BO4A 3HUUA 1P2TA 1RQNA 5CX1B 4HLDA 3WZMA 1F0YA 1KO8A 3WGHA 4BFUA 2WVAA 2HRDA 1H5UA 4H7PA 1UEJA 2GYWA 1Q22A 2GDZA 1ZJYA 3PENA 2XNHA 2OV6A 4RS4A 1M76A 2QVYX 2Y1GA 4MYRA 1RKQA 3D6AA 2ZR7A 3OZUA 4X3OA 1EXNA 1YS6A 2X22A 2ZSKA 4YAKA 3KTAB 1EMDA 3W9UA 3S0JA 1B14A 4W5RA 1ZH6A 2GFQA 1PEAA 2HGZA 3MRSA 3OEED 4MS1A 1WCYA 2IELA 1X7YB 3OLVA 1Z4QA 4HB3A 4QYIA 4ZCMA 4ZQCB 3LQFA 5BNFA 3LQKA 2V3CC 1A8HA 5B2ZA 1DDOA 2OBYA 2WUFA 2CD9A 4QOEA 5LIPA 1VSUA 1MGPA 3P0FA 4RESA 1PSZA 4G6ZA 4Y2QA 1NAIA 1RYNA 4OLAA 3CU5A 3VYRB 1NVMB 5IK2D 4CEJA 1KP9A 2ZREA 3R5TA 2Z5LA 3SXUA 3VR0A 1BX3A 1Z9BA 2XE6A 5FI5A 3H0EA 1HYEA 4QOJA 5JSHA 4ETNA 4NV3A 3LLUA 1XR3A 2V7PA 2XXAA 1GYRA 2NLOA 3UWMA 4PAQA 1TMYA 4C5CA 4EY6A 3TZLA 5CRIA 3OZVA 3B60A 5ALDA 5IYZF 2ERYA 4LWPA 5AP9A 1XTRA 4MVJA 5LQJA 2GAFA 2IHYA 4E11A 3K1TA 4E2YA 4GVXA 3Q1LA 3QNWA 5CDHA 4WVFA 2YXNA 3EB9A 4OXKA 1IQUA 4HEA1 1A7AA 2WZBA 4HAIA 1MRNA 3BUSA 3T4PA 4ZRNA 2QHXA 1G2OA 3HP4A 3HABA 4WD3A 2AIRA 3D2CA 1ANKA 2DPHA 5F4ZA 3LXRA 2DUUA 3NTRA 4KSCA 4IDCA 4L22A 1CQZA 5CD9A 1U2ZA 3MTJA 4KBYA 4X1KB 3AVYA 2CXPA 4ZTZB 1OLSB 3QFRA 3DOHA 1A3CA 1CEQA 2J09A 4BEWA 3H19A 3T9DA 4ROTA 2ERXA 3Q41A 1JEAA 2ZEJA 3OP1A 2H7XA 2CNBA 3DPUA 1V7QA 4Z86A 2WIKA 5E3JA 2JJ1D 2UDPA 3TRFA 4FFRA 5FUVA 4B3GA 1UPFA 3E9RA 4W5WA 4URHA 5BVHB 1ITZA 1NW5A 3G0IA 1U9YA 2XKKA 4AN1A 1YKFA 1KKLA 3K94A 4K9DA 5IT0A 3LC7O 1FYXA 2ZT6A 1LLUA 3DW3X 3GCXA 4BS9A 8ADHA 2AMLA 3EOZA 3C3BA 4QVIA 3KJGA 4REQA 5J23A 4PSVA 4M46A 4XTCS 1ZK1A 2A5GA 2B8EA 2HJWA 2QL7A 4LWOA 2WHRA 4QJBA 2VJOA 3IP6A 3S2SA 2OCDA 4PQRA 3QBTA 3BHNA 4JENA 3L6DA 1N2CB 1QHXA 4LRXA 2J6CA 2P9TA 1M2OB 3JVUA 5KDLA 1H3FA 5HUJA 1JDNA 3KOXA 1NI4B 3LXXA 1D4ZA 1RYBA 1SVNA 2YXBA 3QOWA 4ALLA 3TIGA 5DLQC 1AXRA 1W25A 4PBSA 3RHTA 2C99A 1Z35A 5DJ5A 3VPSA 3VVLA 3WNCA 2ZTSA 1EVZA 1U2QA 4MV8A 3WXMA 1F8YA 2A0UA 2FXVA 2HNBA 3T7SA 4JAVC 3TDMA 4D3ZA 3QYAA 3QVJA 1ADBA 4EX6A 3M81A 3QVLA 4D8UA 2FZEA 1KKUA 3M6XA 2IVFA 3CUVA 2COEA 3F6CA 5CLLA 1TZMA 5EZQA 4DJJA 3CONA 3KTFA 2R87A 3PPXA 4UMEA 1SBZA 2J9YB 3H2HA 4G63A 4NICA 4CDRA 5AVTA 5AESA 1EFVB 2IX9A 3O2JA 1SG6A 1AGXA 1UBJS 2HPZA 3I5UA 1HDIA 1J8MF 5JSQA 1Q3TA 1T3GA 2V1XA 4ZQGA 3WLRA 1P3DA 5IJZA 1OI7A 1ZL0A 1Y1PA 2AYYA 4EMBA 2LDXA 4OMUA 3OZCA 3TZCA 2HDNB 2QD3A 2QE7D 2Y4NA 1I3MA 4UAJA 1J00A 1QH1B 3LA8A 2VK8A 4U2GA 3WHKA 1DKQA 2WZDA 2HA0A 1TJ5A 3AEQB 3EPRA 1K5GA 2WJIA 2VT7A 3B53X 3RO7A 5JQGA 4JODA 1G63A 4RABA 1IY0A 3MJ4A 1P2DA 5K5EA 3LWBA 2PGOA 4J1QA 5FL7A 2X0FA 1HDXA 3I1YA 4FMCF 4O3MA 4YUWA 3WAGA 4KIFA 4H7FA 2OORC 4DWJA 2DB3A 2ARKA 3KJHA 2X23A 1W4LA 2VZ9A 4TZ6A 4LHXA 2ZUWA 2AYXA 1AUOA 1WW3A 1DCKA 2ZUVA 2XZTA 4YQYA 1K98A 2FEMA 5FEUA 2IXGA 4AMGA 1EM8B 4IUCS 4Y2UA 5CB6A 3UICA 2ZB4A 4HY3A 4Y6PA 3Q8KA 5GJWC 2QXUA 3G9XA 1UEXC 3TF5A 3OT4A 4I4LA 2V7EA 2CHQA 3H5LA 2AV6A 2QN1A 2OGUA 3ESCA 4FFLA 2RHHA 4FPXA 5GMOA 3SMVA 2RGDA 2KPOA 3HA7A 4LJKA 1UAAA 4IWXA 4LHVA 1MW9X 2X42A 1QHEA 2IPNA 4PU0A 2R25B 4WMLA 1WZEA 1L4UA 3SDSA 1CJBA 3V5NA 1WJGA 2HNKA 4BE9A 4L75A 4P31A 4FW9A 3KYIB 1RWBA 1T1JA 2JIQA 4PS0A 4N7RA 1XZPA 2AXPA 3NC4A 3L4JA 2N1BA 4BRZA 3PCRB 3HNRA 3HU2A 3TZHA 4WCFC 4E5UA 2IV2X 2WQ6A 1XLUA 2PS0A 4PGFA 3KWFA 2ODAA 4N8DA 3F7NA 2RJOA 3G02A 4TLMB 1XRRA 1YONA 2B4QA 1A27A 3JATA 1RADA 1EFVA 3E9CA 5A0FA 1AM4D 3OCYA 3VRHA 4B2YA 3QVUA 4H60A 1M6HA 1UFVA 4L4UA 1CNMA 4D8XA 1E1CB 2XRMA 1D4AA 1CB7A 1J7KA 1QVAA 1XU7A 2BW0A 1U5CA 1TNDA 1YRHA 2J31A 3AI3A 3EEBA 2G80A 3FUCA 2R8RA 4MYSA 1CSEE 2ES4A 1NVBA 1X19A 3Q9SA 1ZJWA 1L4FA 1HNZB 3KS9A 1Q1AA 3JASA 4IOMA 3AEQA 3DLBA 1CR6A 1F6BA 2E5WA 1WCIA 3ORQA 4MNTA 3OQ6A 5FORA 4RPKA 3UW1A 1FRZA 4KRFA 3MTIA 5K4HA 2HJVA 2Q6OA 1SC9A 2NNWB 4P86A 1JKJA 1MCZA 2C4NA 3VR2A 1L5MA 4K6FA 3ELBA 4LPKA 2E85A 4JITA 1J42A 2HCBA 3BMQB 3K20A 1WMDA 1XPRA 4WKNA 2I7XA 3TEJA 2HLHA 2QU7A 2FX2A 1QM5A 1OFTA 2FUKA 4RPIA 2AI3A 4WOPA 4CE6A 3TG2A 4H18A 1FQWA 2FW7A 2QQFA 4D79A 5JDCA 1IMJA 2FVXA 3NO4A 4LDQA 4KJXA 5FAXA 3UPTA 4OXNA 5C4MA 4U3JA 3IE1A 4D9MA 2HSDA 3BEDA 3DV0A 4DIOA 3WI7A 1RXUA 4NJEA 4UAGA 1YS4A 1Z2AA 2ZYVX 1K9VF 3D2AA 1VZ2A 2YMLA 1S01A 3DMTC 3DT6A 3QUAA 2WUGA 5F9MA 3PRYA 3E5NA 4Z3DA 1N78A 4MRSA 1KFJB 1G8GA 2L82A 1V6CA 4KVFA 1LSJA 3PTAA 2G0AA 3IODA 2F48A 3UAWA 2ZBGA 4HRYA 1GTSA 3K8YA 3MD9A 4J4HA 5A3SA 2ZSFA 2CC2A 1Z8NA 4PNEA 1E5QA 3LQRA 1F12A 2E4AA 4KQEA 1XCMA 2VTDA 1L4HA 3JTEA 3FZGA 4N0MA 2CCGA 3VZQA 4LF4B 3AH8A 5D2CA 1A7KA 1ZUWA 4PZCA 4DT1B 2BGKA 1PG2A 1CTQA 5ENVA 2JW5A 1DFIA 1WSAA 2NUBA 2AFHE 3AJRA 4LNHA 4UU0A 5DM4A 3HXOA 3PGJA 5GONB 3RU7A 2CDBA 2CLIB 2W42A 4JR2A 4CM5A 1FP1D 3QELA 5AVYA 5IZ4A 3B1VA 3UK2A 1YBVA 3FDZB 1XZCA 2BTEA 1YQGA 2XYHA 3WV5A 1F7UA 3P9IA 1GQRA 3R5HA 5FHQA 5DRYA 3G2KA 4AJPA 3K73O 2EERA 1FTGA 1FPQA 1IEXA 2C9DA 4H4CA 1A8IA 3PUJA 2BUAA 3HADA 3KSBC 2BBWA 4B3RB 3LLCA 1U63A 3SBDA 1GNVA 4QPZA 1S1MA 1PV1A 4GFDA 1MAVA 1BN7A 1NN5A 5LZ8A 1KR5A 1Y3BE 2HHJA 3LYHA 3NASA 4RPCA 4RJJA 1JG1A 4TTJA 2P0EA 4IIYA 3WKAA 4AJHA 1QGUA 1RZ3A 4LXIA 2DBYA 1QUFA 3WAKA 5BN1A 1CUHA 5DU2A 5F7OA 1XA0A 2C5LA 3O5AA 5B4UA 1A4XA 1DO0A 4MYTA 1R10A 1VE3A 4MB6A 1QGYA 2B34A 3ONEA 3HN2A 3NWBA 4R6XA 2XXAB 2XHZA 4RM3A 2UYCA 3S2IA 2ST1A 4N3BA 4YJGB 4JYZA 4WBNA 1NONA 3AV0B 3GG9A 3HBJA 1ULUA 3H9UA 1KTIA 3CLSC 3WNVA 2FP4B 1QIDA 3AW8A 3BWMA 3TSWA 3WHLA 3WMRA 3K71B 1EX6A 4K26A 5JAZA 1OTXA 1DBWA 1T6XA 4E33A 1D2NA 1VKHA 1QNFA 2QPOA 5CA0A 3O73A 2QD2A 2CJWB 4ZHQB 3QF4A 3HA5A 1AUXA 1ND5A 2LR0A 1B0PA 1LLFA 2GZDA 2JFUA 2P9GA 2WQZA 2FQWA 3H2YA 4B8WA 3KETA 1RYZA 4G0UA 4IMIB 4UUOA 3ESYA 1FQJA 2IXBA 2QTNA 2YMMA 3GUVA 3N6RA 2VNKA 4OQZA 5IFLA 3GEGA 2LRHA 3BK7A 4P6VF 1JTFA 4GU5A 4CM3A 3I61A 2IH5A 4TVBA 5FOSA 4YMTA 2W5UA 5K51A 4M22A 2OORA 4CMAA 3CG0A 1XF1A 2EW1A 3EQZA 1N6IA 4N6NA 4P54A 4XGQA 5DN9A 1NMEA 4Q4HB 3CV3A 3KCQA 3ROQA 4CMHA 4V1CA 1O9BA 5CDFE 3SD7A 2OAGA 3JZIA 1DWPA 2A88A 3B1WA 2Y0EA 2J0QA 3KR1A 2XWJI 5KYKA 1J21A 4Y2YA 3VPXA 1PRYA 3R5JA 1QE5A 1XZEA 2AC2A 5BVGB 4DQVA 3U4QA 1G21A 4MTCA 5EZYB 1PK7A 1EK2A 3V4ZA 3FWYA 1A8SA 4JC0A 4K3UA 1E2QA 1AQUA 3RT9A 4AULA 4O4LB 3EJWA 4QUIA 4XB6B 2RGRA 3QKUA 2IY7A 2P9YA 2RGAA 4LBYA 5FLKA 4ONEA 3VKFA 3JRWA 3LT2A 2Q5IA 1W4AA 3TPZA 2PZJA 4YO7A 3OPYA 1K5HA 4FFDA 4BOYA 3CX3A 5TPZA 3HEBA 5TARA 3NP7A 3TBFA 4RCYA 3RRFA 5DOVA 4N3NA 1EM6A 2W6JA 3DH0A 3I2GA 4YUYA 1C7FA 1E32A 4R2HA 5JO0A 1H4SA 1Y9DA 3AV3A 3DMFA 3MTQA 1EFKA 2GTHA 3HL4A 1YSCA 3CZRA 1F7VA 1KDTA 1W88B 1A4UA 1CRWG 1G3QA 4II2A 2BYTA 1NJ6A 1U1DA 5U4XA 1JNXX 3RHZA 3FSJX 4M9XA 2R3SA 4FDTA 4IJ6A 5E7JA 3GMIA 3UGKA 1NMXA 2GEKA 1E2EA 3QEKA 4EPTA 3PLNA 2VYNA 2PHZA 4PC1A 4I2NA 5G1OA 4FNOA 1SHJA 3U3RA 2HHHB 3WQQA 4OHBA 3CISA 3BXEA 4RCVA 2FUNB 2G40A 2WA2A 3U6KA 3GRVA 3JVIA 5LA6F 1STOA 3IL2A 4TSKA 4ODIA 4QELA 1JQKA 3KFVA 2KS6A 2IH2A 1KMHA 1WZIA 4X8LA 1ZIDA 2QUBA 2F64A 1P4RA 2PEZA 4DM3A 1ULBA 1RR6A 4F3CA 2PYZA 4EHKA 3QUTA 1DFGA 1JHMA 2JFQA 2X6QA 2YJ3A 3CS3A 2J5XA 4PE5B 1V43A 5FWAA 3HR8A 5AKHA 3D2BA 3JSAA 3TH5A 2H4JA 2F3TA 3CPHA 3V4RA 1R74A 1H2RS 1OBVA 1XEXB 5C5CA 1G1MA 4S1WA 4TS9A 1CCWA 2GMWA 4DABA 5FHRA 4DCSA 4FT2A 1FRNA 3VI4B 4X8OA 2OK7A 4OP3A 4EVIA 1Q1ZA 1R9GA 5IN4A 3TL6A 3UMSA 4KC0A 1ZP6A 1XKLA 2W37A 1TQ6A 4NAHA 3T4XA 1T2NA 1CF4A 5EIFA 2GLXA 4UATA 2EOAA 4YVFA 2ZDQA 3R76A 4V38A 5BN4B 3AMVA 3U44A 1SWWA 4P35A 3VV3A 2QX6A 3OU6A 1Q2XA 1G16A 2B7LA 2W7TA 5E8JA 3MN1A 3S68A 1ZJZA 2O3SA 1ENZA 3H18A 1MVLA 3DDOA 3TRHA 1DLJA 1NW3A 1USKA 1SIBE 2Z5FA 1UUFA 4HFNA 3G59A 5I7RA 3N0RA 1YZVA 1ZD2P 3PRKE 1FMFA 1C3LA 1XRLA 3M2TA 2HFJA 4Z0TA 1K6MA 2ZYRA 3K0HA 5AD1A 3DFMA 1S8AA 4PO8A 3TEFA 2BHNA 4N5HX 1MABB 4B47A 3G17A 1HLFA 4MAMA 4XX0A 3G79A 3E7FA 5HZHA 1IJEA 3ZCXA 2WFLA 1U1CA 4YWHA 3AF0A 2VZ0A 3H9QA 2C4MA 2O2CA 3KKPA 2P5SA 1Z4PX 2HPHA 1A2KC 3FMOB 3NX4A 3D4PA 1U6KA 3E05A 4K5QA 4KPFC 5DGCA 3STUA 3VR4A 2AG5A 3UPUA 1BAPA 2UXCB 3IAS6 3MJHA 1EEXB 4AKEA 2DFTA 1M6NA 2QJFA 2C42A 4RA9B 4UW9A 3SIXA 4FZRA 5M2QA 2CLOB 3GWZA 4BN0A 4BAGA 4Z4HA 3OLQA 4RA6A 4N65A 2H07A 3I1FA 1W2GA 4O25A 3UAGA 3QHQA 2V4MA 5IAOA 3D02A 1XQ9A 3DAOA 1EFCA 1KQPA 3JSXA 2G9ZA 2G83A 3GLIE 1IN6A 3OPMA 1SUIA 3T3PB 1R00A 3OT5A 5ALYA 3K31A 5EJAA 3H4VA 2ZXEA 1WOMA 3L9XA 4ER7A 5TNXA 5JYEA 1EIZA 3C5WP 1U2DA 1OCEA 1WW8A 3WRVA 4KEAA 3GLKA 4O4LA 5IEBA 4B84A 3HDVA 3HKCB 2JIZD 4TYWA 5HNKA 4Z4QA 3CB4A 3OPYB 3Q0IA 2CXOA 5ALTA 3ZVRA 1XZGA 3PFGA 5AO9A 1J5XA 1XMSA 2PLWA 2YYSA 3FW1A 4IVRA 1CUUA 2BGMA 1Y33E 2BEJA 1NDQA 1R64A 2WR8A 3U3ZA 3A04A 5LMUB 2G77B 3SFTA 2E6UX 3AFNA 2YHUA 3FPFA 1WUHS 3IDZA 3GUUA 4RK5A 5K3AA 3QG5A 1BRMA 1KORA 1CUWA 2IOFA 2W2TA 3L7YA 3IR6A 4RHUA 4RVHA 3ZD8A 1NFRA 3CEAA 4PR3A 2LP4Y 2Y1DA 3P96A 3QFTA 4KZKA 4MPRA 2X0JA 1R88A 1AG9A 3AFHA 4JQZA 2C94A 5IW8A 5LLSA 3L2OB 4J6EA 2VP4A 4YTEA 1XDWA 4D0LB 1T8RA 4R9SA 4LE1A 2PL1A 5ILGA 1ISSA 2CJWA 3OJ0A 4K86A 4R2KA 3DOOA 4ZHQA 4L8LA 1KC1A 3BE8A 3S2YA 4NYJQ 1F4LA 3NIWA 1PEKE 5JD5A 1ZXXA 1O6BA 4BLPA 3Q9UA 1A88A 1LUAA 2XKAA 3AG5A 2WV7A 2OK8A 2VDVE 1WEKA 4HDCA 1K2VN 4MQUA 4BVAA 4DIMA 4TKVA 1GGVA 5EE1A 3WOVA 3HHEA 1JHOA 2C5AA 2YZ7A 1JJFA 3IT0A 3E3NA 3LC1O 1E2LA 2ZJ4A 4HRAA 4RVGA 1JHUA 1W5BA 1FNSA 2HI0A 5FH9A 1W2WB 3V1MA 1C80A 3C6ZA 1BEZA 1G8FA 1UWKA 2LWIA 4FFOA 1V1MA 4D43A 4BXOB 4CFSA 1C5KA 1YR8A 1X39A 2FXIA 1F5SA 3PFFA 3AVOA 4M1MA 4YRCA 4RJTA 2FPIB 3FR7A 4WXMA 4YCJA 4K9NA 1QH0A 1J0CA 2X5XA 3PA6A 4L6AA 5E2IA 5FADA 1USWA 1NV9A 5HKKD 5I7EA 1BFKA 5REQB 1RABA 5F64A 1UXHA 1U8AA 4L8YA 2WWTA 2K7FA 4ID3A 3E3AA 4ZYVA 5ADVA 1JLSA 4JLUA 1YIOA 3VU9B 4BNUA 2HF7A 1MU0A 4KRGA 1OJLA 2ZRNA 4Q16A 3U3DA 1K68A 1P60A 1VKRA 3FZYA 4P80A 3UHJA 3UHOA 4DSZA 3OLWA 3QF4B 1OUMA 3PGLA 5J4VA 1XEAA 1EFPB 3ZQ6A 1ZHOA 5IC5A 4UTNA 3WSVA 3N8NA 3EULA 1UODA 4XYBA 1FFGA 1KU0A 4A8TA 4DLTA 4FFVA 4F5WA 1JWAB 1CR0A 2AC4A 1R4NA 4PX9A 4DY6A 5F51A 4OK3A 5CXQA 3D7KA 4H2DA 3WR5A 2D2IA 1V5IA 2LKDA 2QYSA 1NNSA 3EBOA 3IEPA 3KUDA 3VHRA 1U31A 5KWIA 2B4YA 2YHAA 2F1IA 3PQFA 2EHDA 1KJYA 2F3UA 3VPFA 4BNVA 1PJ2A 2I4NA 1WPGA 2DM6A 1H2FA 4X62B 3L4SO 3IR5A 3OCWA 3ROPA 1AQIA 3AB7A 2UXBB 2YHIB 3D3WB 4G8DA 1C8BA 5JWRA 2C57A 2L18A 2YTZA 3G0DA 3MGAA 1WL8A 2H2AA 2Q07A 3DDUA 3PDIB 5ERGB 3TIVA 2XUIA 4AZ0B 4MI9A 5IHXA 2W2VA 1I14A 2ZQYA 3PUKA 4KMRA 1K9SA 1WHSB 2OENG 2NZWA 2IZZA 3EFEA 3NW9A 2J5QA 4ZTBA 1JSLA 1HLGA 1TZJA 1U7UA 1XDGA 2PMEA 4ES6A 4U0KA 2ZJ1A 4MUAA 3ZIUA 4DA0A 3WL4A 2CUKA 3PFCA 4C0SA 3HU5A 4BKMA 2QTHA 3G9ZA 4QYWA 4Y6GB 2A9FA 1Y8ZA 1CLEA 2JPDA 2GGSA 5FPSA 1X92A 4Z4EA 2DLNA 1XTKA 4US1R 1JFSA 3KKLA 4R1LA 4UNIA 1JT9A 1OV6A 1ZM7A 2ZQ5A 2D5LA 3PSHA 1G7TA 3NXKA 2B20A 1R8QA 1F2UB 1U1FA 1R16A 4QDZA 2OYSA 3U39A 2YR0A 2I54A 4IZ6A 1DJLA 2EG9A 1K7FB 1OIXA 2FLWA 2YZNA 4IBOA 4M0EA 1OXTA 3KTOA 4YJ2B 1QP4A 4FOSA 2RGCA 1KSJA 1PE0A 1QP8A 4Q4JB 3ZHOA 2BEWB 5B2FA 1E7QA 3RNLA 1OILA 3P5SA 2J87A 3PS9A 4JXJA 4G09A 4LIPD 4D80A 1XMQB 3QELB 2JI7A 3DTTA 5A71A 4WZBE 3AR7A 1VPTA 1V39A 4HMPA 3DEAA 3HEMA 1Z8FA 2I4LA 2DPXA 1RAGA 2OO7A 1B41A 4IIFA 5K3SA 1WDWB 3WP1B 4P4NA 4OHOA 1UC5B 5TEWA 1GXSA 2D1TA 1QYCA 5FLYA 1ZH4A 2AE2A 2HTEA 3P2OA 4URVR 4LXGA 4IXNA 3R7DA 3ZWWA 5I7OA 4Y18A 2OBNA 2VSFA 3H6HA 1N77A 2DUNA 3DHYA 3WQHA 2QUIA 3NH6A 3WNDA 1ZD5A 4B9EA 4F12A 4CKWA 1ZOPA 4O59O 2WM2A 2QUJA 1SHUX 3H97A 2ET6A 4BMCA 4QG3A 3SY8A 4EFKA 1DIRA 3PUVA 4L85A 2XNJA 3ND5A 2PT7A 5AIAA 4BMYA 3VPHA 4BO1A 4LMBA 5LLDA 3RHFA 5EHZA 3DO6A 4C6TB 3WL5A 5KX5A 3JVEA 1W4BA 4FMBB 4GWLA 4MUGA 2Y2UA 1NQVA 2E37A 4PRKA 3SJBA 4A2PA 3ESZA 2UAGA 1MHPA 1KDYA 1X7XB 4RTLA 2YJ6A 3U7QA 4I2VA 2FFRA 1GO2A 1FW8A 2EWWA 2G8NA 3QBEA 3UMJA 4HWKA 1XJCA 2DULA 2YVUA 3INYA 2QBYB 3K3PA 4MVJG 4ZVTA 2DWQA 2FVYA 2VJAA 3RROA 2WUDA 1A69A 4EJSA 1PJRA 1DPGA 3CSUA 3BFKA 2QLLA 4CL8A 3V48A 1ESNA 1EBFA 4UM7A 4RK0A 2FP3A 2P9JA 4N8SA 3HXMA 1OVGA 1GHTA 4HR7A 3QH4A 5FWNA 2GBCA 2O2YA 1WETA 3H8JA 3QFSA 2PH3A 1QJ4A 2J9ZB 3CUSA 2D00A 4KGXA 1NZFA 1T26A 4RL4A 5T64A 3KYCB 2O5CA 1Y6RA 3W2HA 3TAUA 3RQSA 2I1WA 4DM7A 3M9XA 4N6GA 1T0UA 2NYUA 3IHTA 4K03A 4MJXA 5FYQA 2JFOA 2DYKA 1VLHA 3PDCA 3HB0A 5A0TA 1Z4JA 1N6HA 1O96B 3I9V6 3U3MA 2FU5C 4R1UA 4MJLA 2WHPA 2XODA 4NBSA 4UHDA 3A05A 4YRNA 3WK7A 1M34A 1N5RA 5JSFA 3HJCA 1H6CA 5BR1A 3GT4A 1VPLA 3MBIA 1V6AA 4HNAA 5DI3B 4ZAWA 4C14A 5BT8A 2TYSB 4GLLA 3ZU3A 4QQRA 3OC6A 5KU7A 1R7RA 2VRWA 4IH4A 4RFSA 4EOGA 1T8TA 3A37A 1OLUA 2FX5A 2BBSA 3KQOA 4NI5A 3D43A 1FP7A 4IPTA 4WT7A 4B6RA 4BLRA 1JPNA 1OU4A 3BHIA 1E2JA 1PYOA 1N5LA 1PJAA 3WC4A 3ZQKA 5FOQA 1AY0A 2Q5QA 3HDGA 3W77A 3L1HA 1QRUA 1BNCA 3EDRA 3ABIA 5EPOA 2JLXA 1EVKA 2MU1A 1AZWA 2CY0A 5EGNA 1KJIA 5DHQA 4FCTA 4I36A 2FGKA 5EIWA 1PNTA 4U02A 1WPRA 3TIFA 2QSZA 2J5RA 2V0NA 2O19A 3CTPA 3T6KA 5IKMA 2HAEA 3HCPA 2RGXA 4FM9A 3HB9A 3JWJA 2DY0A 1ISIA 1MX1A 3GEHA 3F2VA 3NWJA 3IKJA 4Q6BA 3R74A 3T38A 4GOOD 2QW0X 5KQSA 1ICIA 3A2KA 3RVSA 5JC8A 4LVUA 1U3WA 2Z4RA 4PICA 3TSOA 3FCOA 3N2NA 5I3CA 1AQNA 3GJ4A 2H48A 3VAYA 2H1OA 1M2HA 2NO0A 1B0UA 5FF9A 1NA5A 4AXXA 5BWLA 1BA3A 3AP1A 4PN3A 4FJ2A 4YCNA 3K0KA 3AU9A 1I9GA 3L7DA 4V0ME 5TQVA 3U4AA 4C0AC 3M5DA 2V6JA 4XYGA 2UUOA 1L5QA 3U4IA 3T7EA 3WLPA 4EARA 1FW6A 3KJNA 3WYFA 4HEJA 5BR7A 1UOEA 1S3GA 3G1UA 2ZYTX 1R4NB 1OT5A 3MFQA 1XUOA 3OCCA 4NFLA 1L7MA 1WDKA 3TVDA 3OKCA 1KBOA 2RB4A 4Q4HA 1H3EA 3IKMB 2WOOA 1NL3A 3D5EA 3DUWA 3EUWA 4GKKB 4RJIA 1G8AA 3DE0X 3LRTA 2HF8A 4BO6A 1G2IA 1RQ7A 4ND4A 2WQ7A 2EQAA 2WKPA 1XMJA 1KYXA 1BDBA 1N3BA 1X7YA 2B35A 3BWBA 3R6LA 3TI7A 3IP5A 5A7FA 1JHRA 1GEEA 1T35A 4KWTA 3VZBA 1Y4AE 5ICCA 2Z2YA 4AY6A 3MRVA 4LISA 4V39A 3H86A 4GYYA 1K8QA 1GQFA 3WLQA 3C3PA 3NTXA 3BGOS 2UZ0A 1M34E 4OQ4A 4R1QA 2WG1A 2GXSA 2O3JA 4QVKA 4W8OA 1ZUHA 4LYGA 4UAUA 4DJAA 5F23A 1Y81A 2GLTA 2SCUA 1HM5A 4PZYA 3UV7A 3SXUB 3E4DA 3ZUGA 2PXHA 4AYXA 4B73A 2H9YA 1BU8A 3CW2A 4NS1A 4GDFA 2NSLA 4Q1CA 2GNOA 4L51A 3ZK8A 5FOVA 1C2YA 2WFMA 3F9RA 3ZGLA 4BFCA 4FU0A 3ZCTA 1QCZA 1XRJA 4BNDB 2C8KA 3TRIA 1D3AA 1ZNYA 2PH7A 4ZVRA 5K6RA 3A58B 2FMFA 4WXYB 5CLJA 1Z25A 3O4JA 3CZAA 2PSFA 1AX9A 5H3HA 1Q77A 1GSOA 1Z5GA 1OREA 2G04A 3D2LA 1R5NA 3U7JA 3QVWA 3ZNPA 4GVPA 2RAVA 4CMEC 4XFJA 4D9NA 5A4JA 2YWGA 2YHSA 2BSQA 2OWEA 3LQ2A 2IWHA 3RK4A 2X5KO 2VF4X 2WJVA 1VJDA 3ZY2A 1I3KA 1KTVA 3QBDA 3AF3A 2OTCA 4QAQA 2XUHA 5EQDA 4DV7B 5TXGA 1KHTA 3T0FA 3WV4A 1Z2NX 3GP3A 4DHWA 3SBOA 4Y6LA 1CERA 3C3WA 3ONVA 4XWYA 4YXWD 4B3DA 4QOHA 4J7UA 4UFPA 1G55A 1L3BA 2Q6TA 3KJZA 1U7DA 2W6JD 4KPUA 5AR1A 3UJCA 4JJAA 4AQYB 1AK9A 1SUBA 3FTPA 3EODA 3MVEA 5TV2A 1U0LA 1Z88A 3FA2A 3EEYA 4MVJP 4WK2B 5KAMA 1KEVA 3PDJA 1C1HA 1LPAB 4N5NA 1EG2A 3KAQA 3WLEA 1GAEO 1CUJA 1C4XA 1UF9A 1U65A 3K7EA 3NHWA 4XYEA 3VI3B 5J1TB 2ODPA 2CFRA 1UPXA 1NYQA 2C7GA 4GH5A 3UWPA 5A3RA 3KEQA 4MPDA 4U2EA 4JLOA 4TTRA 5HIMA 3KUKA 3M2PA 4AROA 3ZXIA 4Y2VA 2EX0A 3CKLA 1V47A 1EFAA 4GL4A 1DAMA 3NI2A 4UU1A 1Q3HA 1PT9A 1MF7A 1I5OA 5EKXA 4XVCA 3TRKA 1NYLA 2IFTA 1W29A 2DTXA 4LHWA 4FSXA 4H6PA 3SHVA 1CZLA 5C32A 2HT6A 4HNTA 2B69A 3EGEA 3FYSA 4C6HA 4EVSA 3F46A 3UK7A 2HA5A 5CX1A 3X1YA 3ZTTA 5F9HA 1AKNA 1M73E 5MHTA 1AS2A 3U1BA 4L9RA 3UAVA 1C81A 1MC8A 1FZQA 3DFIA 4Z3OA 3GFRA 1JR2A 1YVUA 1VBKA 3QKSB 4EG8A 1DOZA 2OSVA 1N7GA 5AK4A 3ZI0A 4BV9A 3BXPA 4UFOA 1EWYA 2DGDA 4XAQA 4CDNA 4K05A 4KYUA 2C4HA 4D1YA 4H7HA 1H65A 3BB1A 1QQ7A 2OLEA 3D6HA 4RDXA 3GX1A 3SOPA 2OGTA 3DW1X 1JPJA 1FS5A 1C8KA 2P77A 1JLHA 4HNSA 2JA1A 4EECA 1OLUB 4FMDB 4OI1A 4ZI2A 3LP6A 1TYDE 4G0NA 2JCBA 1FQOA 1Y34E 3WA7A 2JLYA 2VP6A 2C1XA 1DG3A 2JBHA 3RYCA 2G09A 1XXHB 1Y1KE 1IULA 3B12A 1U3DA 1M54A 3K9HA 4N0PA 4W4TA 3ZQ4A 5DZSA 1V9SA 5L6LB 1ZQ1A 2AYZA 2VT6A 4PYLA 1QJCA 2ZJAA 3BRSA 4XWGA 4NEQA 4YJ3A 4C7KA 2UVPB 3EZGA 3FPKA 2P5YA 3LL4A 4ARUA 5JFGA 4RO0A 2R7KA 4M89A 2PVCA 3V3TA 1E3WA 1EE9A 1O3YA 2O4CA 4Q4LA 4RAQA 1TZBA 1UBTS 1Y5NA 3MWEB 3BKXA 4RQAA 3Q2IA 3TIIA 4NK5A 1MTZA 3MF4A 2EFGA 3RRZA 2J4FA 4B40A 3E70C 2H52A 1G8JA 2ZR0A 4QBGB 2CKDA 1TUBB 5CTJA 4M9QA 1E5TA 1THGA 1QX4A 2BEVB 2X2OA 4P81A 3W90A 5DNYB 3DWFA 3DD1A 1KZ7B 1BJTA 1UZLA 2QLFA 2ODQA 3WIOA 1SUCA 3GH1A 3L92A 4YK7A 5F7JA 3W3AH 2Q28A 4X54A 1L7OA 2BFFA 4XRGA 3KZ1E 5LKRA 2QSYA 3BICA 1XNQB 3R1IA 4TYPA 4J2TA 2NMVA 4Y3UA 3LYLA 5BOVA 1TC1A 2A9PA 3WICA 1DDGA 2HIMA 3TLMA 1O95D 2V03A 4RZ2A 3VAZA 4WA8A 3LQQA 4MQBA 4Q0MA 5KCMA 3KB6A 1X80B 2YJZA 2VF8A 3PNYA 4OTZA 4PYOA 5DHAA 3VV2A 2H08A 5FQOA 4PHFA 1UBRS 1RAIA 1DTWA 3MJFA 3H2BA 1RRMA 4KODA 4CPDA 5EWMB 3NMUF 2ZVQX 5HSGA 2GN0A 1QGOA