1M10A

Crystal structure of the complex of glycoprotein ib alpha and the von willebrand factor a1 domain
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
199
structure length
199
Chain Sequence
HDFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMEQLRISQKWVRVAVVEYHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRIALLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVLSSVDELEQQRDEIVSYLCDLAPEAPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords von Willebrand Factor
publication title Structures of glycoprotein Ibalpha and its complex with von Willebrand factor A1 domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 64
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2002-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1m10A00
3TXAA 2VDQB 2NUTB 1QC5A 3VI4B 1Q0PA 5KYUA 1JEYA 3TCXB 2QTVA 5E6RB 4M76B 4Z7OB 2WW8A 3EGDB 4IHKA 3RAGA 2O7NA 3K71B 1N3YA 3PPYA 4Z7QB 4MMYB 3TW0A 1FE8A 1PD0A 1IJBA 2ODQA 3FCSB 4CN8A 2VC2B 2IUEA 1UEXC 3PPVA 3F78A 1IDOA 4PN7A 1FNSA 1M2OA 3NIDB 5KYXB 5LN1A 1JEYB 2I91A 1BHQ1 1CQPA 2VDOB 3EGXA 5BV8A 1RRKA 1M1XB 2XWJI 4MMXB 1V7PC 3F74A 1YVPA 1ZONA 1SQ0A 3NIFB 4XW2A 2VDMB 5E6UA 4UM9B 3TVYA 5ES4B 4HQKA 1YVRA 2VDPB 4G1EB 1PT6A 3EGXB 1M2VA 2VDLB 3VI3B 5KYYA 1U0OC 4IGIA 3ZE2B 4WK4B 1XUOA 1AOXA 4JDUA 5KYWA 4C2AA 1ZOPA 3ZDXB 1N9ZA 2ADFA 1MQ8B 5E6UB 1ATZA 1QC5B 4BJ3A 3K6SA 2NVOA 5KYUB 1LFAA 4NEHB 2B2XA 2XWBF 3Q3GE 1MHPA 2WINI 2NUPA 4UM8B 5HDBB 3EH2A 1PCXA 1M2VB 1AUQA 1ZOOA 3PPXA 1T0PA 1RTKA 3QA3E 3EFOA 3EH1A 4F1KA 1BHO1 5KYYB 3BQNB 4C2BA 5KYWB 3IJEB 4FX5A 2I6QA 5E6SA 1T6BY 4O02B 3ZDZB 4WK0B 4DMUB 3K6SB 3M6FA 4HQOA 3ZQKA 3N2NA 4F1JA 2X5NA 2NUPB 3BQMB 2VDNB 3V4PB 4Z7NB 1XDGA 1PD1A 4WFQA 3NIGB 3HXQA 4HQFA 3GXBA 4G1MB 5E6SB 1JEQA 3HXOA 3BN3A 4A0QA 4CNBA 1M10A 1QCYA 1JV2B 2ODPA 1IDN1 1U0NA 4IXDA 4MMZB 4NENA 1M1UA 1DGQA 1TYEB 5KYXA 3T3MB 1MQAA 1MF7A 3ZE1B 3E2MA 4C29A 2M32A 2VDKB 5HJ2A 2I6SA 3FCUB 1JEQB 1AO3A 1RS0A 1XDDA 3V4VB 1U8CB 1SHUX 1RD4A 3EG9A 4HQNA 4HQLA 1OAKA 2NUTA 4NENB 1JLMA 1IJKA 3K72B 5E6RA 3EFOB 3HI6A 3EGDA 2VDRB 1L5GB 4CN9A 3EOAI 2XGGA 2ICAA 1CK4A 1MJNA 1MQ9A 3T3PB 4WK2B 4WJKB 5KYNA 1NA5A 1DZIA 3IBSA 1SHTX 4UM9D 3PPWA 5HGJA 3EOBI 3ZDYB 3EG9B 3ZE0B
chains in the Genus database with same CATH superfamily
3D7LA 3I1JA 4JUCA 2WKRA 3TXAA 2PLNA 1OLUB 4GPAA 4U2CA 1TT5B 4FD2A 5BN3B 5EERA 2NV2B 4D45A 4ZJPA 3IOEA 4YYZA 5FUMA 1TM5E 4P54A 2HKIA 2D00A 2PWZA 1FVXA 4F3CA 4TQAA 3HA5A 5BP7A 2QN9A 4I0WB 1T8RA 2YHSA 2P9HA 4WOKA 4AUMA 1NVVR 1SUBA 4EW6A 5FF9A 1E3DA 4M9UA 3ER9A 4PN7A 1BYUA 1IAQA 3D8HA 3EIEA 3FLAA 5B3JC 3MINA 5AM0A 1THTA 4CCAA 4GXNA 1RKVA 1XC7A 2UU9B 1V1JA 2W6IA 4CM9D 3RF6A 3FVTA 2XNJA 1E6CA 1XL0A 3CRNA 4L4RA 1KO4A 5F78A 1AKQA 1NVAA 1SZCA 3IKVA 4PBRA 2WHYA 4KQJA 4RHTA 4A4DA 5JZVA 1ZY2A 2XNDD 4JOBA 4QREA 1CRWG 4MVJM 2AJLI 3AHHA 4TWRA 5KB3A 3UMFA 3ORQA 1EIWA 1YDWA 2MTBA 4NTZA 1PFVA 2DPLA 1TUEA 3MWEB 3E3AA 3L3BA 2W98A 4JJZA 3H2YA 3AX6A 2V6IA 5CA1B 2J0UA 1U8FO 2J33A 5TPZD 2M9MA 2RHWA 3COWA 2YJTD 3V3KA 4LUCA 5KHOC 1V1RA 4EUKA 5CJJA 1NVXQ 2GN1A 3EBOA 3TL6A 2QW1A 2Q8NA 3UHPA 2ATXA 1Z06A 3CRW1 4EX6A 2NU7A 4JEIA 3EQ9A 3MRSA 4FS8A 4IHAA 5GPBA 1E6WA 1LJ8A 4PBSA 4WD3A 5KS2A 1A8PA 1PFYA 1ZHHA 3AXSA 2XPCA 4OF4A 1HDXA 2WF8A 3QPAA 3AVOA 3VXKA 4BZWA 4HH3C 5JWHA 1SAYA 4RLHA 4R7GA 4DDHA 3UGJA 3RSZA 5BPFA 5CVDA 2X7JA 3KVRA 5I7RA 1E3SA 1DEHA 1LDBA 4I9UA 1OZ0A 4NCXA 1QVAA 4F72A 3IRVA 1PZXA 4XGNA 1QYVA 1UC5B 1Z5VA 4YGYA 1I51A 3EF1A 1T34A 2CDNA 1LLQA 2NZ8A 5AK6A 3G0BA 2BJWA 3TW4A 5GIPE 5AVKA 1TKCA 3GJYA 3OHSX 1NQWA 3GN2A 3OJXA 2IELA 3EZXA 3RYHB 1DUVG 4X41A 2WD7B 4JSTA 3JRWA 4L5JA 3HM9A 5L9AA 4L9WA 5E3IA 2IXTA 2XYGA 4IZHA 1J49A 1OYOA 2O07A 3FBTA 4MUGA 5U1PA 3JQAB 3AQIA 2E4YA 4LOLA 4M83A 1CVIA 3G9TA 3SI7A 1O95C 4JD5A 5CYGA 2M32A 1C9JA 4ALJA 5BUCA 1PTJC 3V4RA 5F4BA 4TGLA 1E3IA 1PVDA 3NU1A 3UPDA 5HKKD 3QVMA 3RS0A 5DWVA 5MN4A 1KI9A 2SNIE 5FO0A 5AHXA 1QO9A 2B34A 1I7DA 4PZZA 3BWVA 3EGDA 4ARUA 1L5GB 2OPHA 5JFTA 3VOTA 2VXCA 3ONEA 5CLLA 1KQFA 3ROXA 3UGKA 1MX1A 1NA5A 1NL3A 3K0BA 4NJEA 2G9UA 5JISA 4MTLA 4AQDA 1RP1A 3CT4A 4JJIA 1YKFA 3O7WA 5CD1A 2M6KA 4NSNA 2I8LA 3GN1A 1NVBA 2Y4OA 1YBFA 4PRKA 3PEEA 3DBIA 4Y9TA 4ZHQA 1NBHA 3P2YA 3IQIX 4UAVA 3RJZA 3SK0A 2VHTA 1PJTA 3REQA 3DBLA 1C7QA 2J6HA 3QVUA 4QSMA 3ZHOA 3AI1A 3TFWA 1N32B 4R9SA 4PICA 7ABPA 3DUWA 3IFSA 3PNKA 4IO1A 1W1IA 2WOOA 3QVTA 4V0ME 3BIFA 1SCUA 3EMVA 1C41A 1LBEA 1BX1A 3P4XA 4PHTA 2RGCA 2ZSIA 4KFSA 1L4LA 4WZ6A 2HNBA 5BQFA 2OMEA 1BMDA 2F4NA 5JH7B 4DXAA 1UJCA 1U0HC 4BASA 2JJ1A 3CQ9A 3RF7A 4ZCIA 2X2OA 4Z4FA 1NI4B 4LJAA 3H16A 3QELA 1YCDA 4CU5A 1SUAA 1ML4A 2WWGA 5K0CA 4EUSA 1U0RA 1W9MA 3R4VA 4BNKA 4D46A 3GNSA 2GLTA 3W5UA 4PSAA 2H59A 1G2IA 2BMDA 3R0ZA 3TG8A 1K66A 4IY1A 3FYUC 4QX6A 3DOCA 1YOBA 4TWAA 1ZESA 2VQSA 3ZJ5A 1NNLA 2ZSEA 4JWKA 4TXHA 1UMDA 1OFUA 3VNVA 4D0GA 5KQGA 1P61B 4XPIB 5EQTA 1TCAA 3UJ3X 2JFVA 4GC9A 4UOQA 1CIJA 2D2XA 1J8MF 3ORRA 1G7TA 1N7GA 1RTKA 4FT2A 4PBTA 3O8OA 4WCVA 4XASA 4UU0A 4TV9B 1ZI9A 2G6BA 3U40A 2PQ2A 2YYAA 4CV2A 3KB8A 3P1JA 2O3QA 2YWXA 2Q49A 3G88A 5GONA 3TBHA 4RJJA 1QZTA 3K6KA 4L85A 3VV2A 2ZKIA 3K0FB 2NYRA 2QV0A 5EWLB 5AVUA 1ZN7A 2NN3C 4KO2S 4NHEA 4RLSA 4X1YA 4YV7A 2AI3A 3B1WA 1P1JA 3GFFA 1DJPA 3OTOB 2WNHA 1X19A 1NTRA 3SSNA 1FFXB 2N1BA 2Z09A 5AH0A 3ZHCA 1ZW1A 4JP8A 2OFOA 1XA3A 3CXRA 2OYCA 3U5ZB 1H0SA 5EN4A 1WSAA 1N6LA 4QDUA 1AK9A 2JG3A 1KAHA 4JXKA 2NTVA 3R8CA 2QM3A 2VUSA 1QOPB 1ORRA 1RI5A 3OOWA 5EZSA 4IMRA 4EF6A 1ZG3A 3KSMA 1SKUA 3E58A 5EESA 1X39A 4J3FA 1SCBA 2XNKA 4CKEB 1AF7A 1P9OA 4EI8A 2PKQO 3RS3A 5AUQA 5ALQA 3UB4A 1I2MA 4EJSB 3VX4A 2DPMA 4FYMA 2FCRA 5JO9A 1ECGA 1RKQA 1QVVA 3PFNA 4L4UA 4CQLB 1SKMA 1JLMA 5SZHB 4G41A 4QD3A 1XLWA 3LQKA 3MOSA 1UBEA 4N65A 5D85A 3L02A 2JLCA 4EYOA 1ZJWA 4DZTA 3VU1A 4AN4A 4QECA 5C31A 4B83A 5I5EA 4BU0A 5IS2A 2PVSA 1T4CA 2Y0CA 3EIXA 3NORA 5C8XA 1LV7A 1JEOA 3MTGA 4K05A 5DP2A 4JJ8A 1Z7GA 5HIAA 5TRTA 4IXWA 3MHTA 4LN1A 3ZYZA 1NI3A 1P1RA 2H9YA 2R7NA 2LWIA 1SUWA 3QU2A 4JLJA 5CG2A 4CEIB 2IZ0A 3AWIA 1K1EA 3MJSA 3GGDA 2II6A 5ESRA 3QTTA 2RMKA 4HJRA 4KIJA 1XU4A 5UKDA 821PA 3HSSA 3MB8A 4OXKA 5EP3A 3L7AA 4I9NA 4D6XA 1SA0B 3LK6A 3RHSA 3V97A 1N3YA 5FLYA 2PBFA 5TQVA 4P98A 2IPLA 4LNHA 1E60A 1R8SA 3MD0A 3JAKB 1SVIA 2Z2IA 1IJBA 3K0EA 4UE2A 3WLKX 5TC4A 4CM6A 3PX2A 3QX9A 5DN6D 1ZO8A 3AJ9A 4Q7QA 4X3CA 5DNCA 4KO8A 3ZWBA 4N39A 1TT7A 2XNCA 5AW9A 3T0GA 3SSOA 2CUZA 3CIFA 3O8BA 3OQ6A 1CZNA 4IDQA 2CK3D 1U8XX 4JCCA 2ZUFA 4S2UA 1X77A 1R9JA 1C9KA 2GAFA 4KPGA 5JAMA 1Q1GA 3UYKA 3W4IA 5KNLA 5CB4B 4MINA 5FOUA 3H7AA 4A36A 4MUAA 1Z26A 1K75A 4BJ1A 2ZAGA 3BULA 1NIPA 4WERA 4C4TA 4LWZA 2D0DA 4QPDA 4U9UA 3I01M 3OF2A 4MHTA 2JHPA 4Z8YA 2PT5A 1FRVA 4K6HA 1N2XA 3F6YA 1PRYA 5IUKC 2BEKA 2DFVA 1VDZA 4FOTA 3V6MA 3VZSA 4B76A 5ALVA 1JDTA 2AG8A 1GGNA 3AF6A 1ZRSA 2B94A 3EWAA 3VSEA 4FFLA 2AR0A 3PCXA 3DVSX 1U1IA 3OX1A 4RDIA 1XMIA 4ZU3A 4U39A 4LYHA 4B8YA 2BHNA 2VF7A 2QR3A 3DPSA 3M6XA 3A2LA 4H1HA 2QT1A 3M33A 4IQ0A 4PU0A 2H1CA 3C48A 2QUHA 1TVKA 2HRBA 4LZWA 3SJ7A 4LXGA 1YUBA 2V7TA 3U37A 3ZY4A 1EDOA 3P4UA 4KMSA 2IE0A 4NCIA 5IT0A 1BS2A 4UHCA 1PUXA 2D1TA 2EFJA 1GRVA 3HHEA 3N2NA 1CZLA 2NXJA 4PXYA 5TDHA 3RR2A 1SVKA 1H2WA 2GD0A 4IDGA 4UDYX 2J3JA 3S27A 1P1CA 1KXZA 1N0IA 1XLTA 4UPVA 1GCOA 4QZVA 3H2BA 4GXQA 2AQIA 1E1RD 3LO8A 1E5VA 4QE3A 1NXWA 2FV8A 1PYGA 3PVZA 4QJ5A 4WLUA 1M10A 1XQVA 2FKNA 2QOEA 2HR1A 3A04A 3B8HA 5F5XA 4WCFB 4DDUA 4ER3A 1RWBA 3HBMA 4C4XA 2HK8A 3AVVA 4CUZA 2CUTA 1GQQA 2PYIA 3NBFA 3OQHA 3TPZA 1KYVA 1Y9ZA 2BJHA 2HXYA 4P0TA 3AXTA 1UKYA 3GEPA 1LRJA 4IQFA 2VXBA 4JQYA 4YUZA 3GGCA 4ZP1A 4C0HA 3WNZA 1V9CA 2I5PO 5EIHA 5GM2A 1Z3CA 2BUCA 4AU1A 1G59A 4LHSA 4M0FA 1K5GA 1Q83A 3LUKA 1QGYA 4DUZB 2AFIE 4NZ9A 1O03A 4TYQA 2YOFA 4YO8A 3D59A 2PX4A 3RVPA 1G18A 1UKVY 5FWYB 1RXUA 4CL3A 3WQQA 3K05A 2ZRNA 4RTLA 3NHBA 5AM1A 2VP4A 4L5CA 5J59A 3RT1A 1UBSB 4D25A 3AJDA 3IV7A 5J1SB 4BO2A 1G60A 4QVGA 3A6PC 2FWMX 1BD3A 4B0PA 4LFBB 2QNBA 3J7TA 4N40A 2OB2A 4NPAA 4Z7OB 2P9EA 2BL4A 1ZD5A 2VF4X 4PLYA 1LJLA 2X4IA 2ZSAA 2QMHA 2WU1A 4DJ5X 4XR4A 1WW2A 5AM3A 3DV2A 2GBFA 1N3LA 1K9VF 2WP8J 1RHUA 1T5LA 2QEQA 2D54A 3W5CA 2XV1A 3N6RA 1IUKA 2AUTA 2DUMA 1RYFA 3O3CA 3EMKA 2IYRA 2WKPA 3FUVA 1XP5A 2Q9CA 5LYJB 1P0PA 2XR1A 2XQIA 3OCUA 2PX0A 1BHQ1 4HB0A 1EAMA 1SD1A 3A3PA 3PYMA 4TRNA 4EFLA 1LCIA 4QTTB 5E1MA 2DPYA 2FUNB 3W3AA 3ADOA 1DTWB 3F74A 3U3JA 4ARSA 4B5KA 5K0LA 3CN9A 5L7WA 5DX1A 1M34A 1Z83A 5CNKA 4Y2PA 4Y0VA 4EQ6B 1FK8A 2JGKA 2NT4A 2FHPA 2NTYC 2A9FA 4N18A 5CDUA 5JXJA 2Q6IA 5DCLA 2BUAA 4AF7A 3N76A 2WB4A 1C7EA 3D6TB 1CY1A 4KC0A 3EF0A 4KG7A 1A97A 4P5DA 5A7GA 3DE3X 5FLXA 2JAUA 3ZN2A 4FONA 5LU9A 3WLFA 4JSYA 3FCOA 1DKNA 1X1SA 1YASA 4W82A 2BI4A 2ADFA 4OIMA 1QV6A 1Y9EA 1OFGA 3X1DA 1COWD 1P5JA 2DP4E 2LD4A 3HKBA 5JROA 4RD4A 4HGNA 3TW8A 2A59A 4LZJA 5HE8A 1CR2A 2EYUA 2C4WA 3AP2A 2E4XA 1IXKA 3U60B 4MKXA 5DNVA 4LRSB 5TJHA 1I3CA 1I36A 4OPMA 4U1RA 4A5OA 2XKAA 1ZK4A 2I6QA 1GNVA 3OE7A 1VSBA 1I4EB 1MA0A 3K9NA 3N8IA 4RPJA 2VO1A 4IV5A 1EP3B 3GIDA 1BQEA 2JVJA 2RGDA 2WG0A 2CFSA 4DHWA 1ZH2A 3DF7A 3D3NA 5C8DA 1Z2NX 2QY6A 2QAGA 3SBXA 5IN4A 5J4HA 5IKPA 1RLMA 2XQJA 3OLXA 3VNBA 2F3UA 2DY1A 2OCGA 3A2MA 3P2IA 4YMVA 5KJCA 2XE8A 3E9CA 2C5FA 2NZWA 2QN2A 3FPEA 4LBWA 3IEIA 4TMWA 4W9RA 5JG7A 2BFPA 2I67A 2WVJA 5ERXA 3ELWA 2HZBA 4W5RA 1CUZA 4DSTA 3S4YA 4EEZA 1E94E 2DLNA 3K2QA 1V16A 3TRKA 1QG0A 2VT7A 4BKQA 2Z9BA 2G4CA 2IHYA 2PGIA 5KWIA 4HTFB 4BVLA 3VKUA 1JR6A 2Q7XA 2JI7A 5JANA 3WR5A 1XNGA 3IEVA 2R44A 2WMDA 2VZ0A 3IERA 1E58A 1EDEA 1IATA 1LBIA 2PKQP 1IN5A 1GLVA 2Q1WA 4MJ7A 3LDAA 4LYDA 4MQEB 5K0GA 4DV5B 1DKPA 1KH3A 1Y42X 3GNQA 1NQXA 3FI9A 1ULUA 4DIEA 2A30A 4HMPA 2QN6A 3WYFA 1RAFA 1WB6A 3LT0A 5BYJA 1OI3A 2CHUA 4AL4A 5A3QA 3GLHE 3DOIA 3CEAA 1M2EA 1TRHA 2V7EA 1YZNA 2B8TA 2R8EA 3FPCA 4P4UA 3W7VA 1BCRB 2ZBVA 4KAAA 2NTEA 3KT0A 3ZOKA 4W5NA 1T0UA 3HVHA 2ZR8A 1VIDA 3DF9A 3PVSA 4JP2A 5FA5A 2HBZA 3CVVA 3UB3A 3CXUA 1KC1A 3BRCA 2JBAB 1PJLA 2PT9A 4PZDA 3K70B 4YUVA 3FJYA 4BDTA 4L6CA 4C0KA 1ZBDA 1Y1TA 3NEAA 4ZZIA 4DANA 3R9XA 5SYMA 3R8XA 1Z37A 2XRZA 3WICA 3G68A 3JALA 3RYCB 4FDAA 3EDOA 3KWLA 1H3FA 4MWZA 4LF5B 2IYOA 1XTBA 3EXEB 2FN8A 4QATA 1O5TA 2AXPA 5LP6B 4AMVA 2FXIA 3PFKA 4DZRA 5HSGA 1GPMA 5I48A 3TGLA 3Q3CA 1PR5A 2VHZA 4QUAA 4BRWA 4ZI3A 1J1ZA 3C6KA 3DTVA 1MU0A 1E59A 3UOAB 1DFIA 3W8RA 3NEJA 4HBZA 3V1KA 1MOSA 1QB7A 2DBYA 1N57A 3HB4X 4RA6A 4UNQA 3GGOA 4UPDA 5FIUA 1FFEA 4JI8B 4KXLA 1HFJA 2O8FB 3WV5A 3N3BC 3KR9A 4EDFA 3MFQA 1P81A 3WK9A 4X8MA 3OKFA 1TPZA 4WY5A 4D92A 4I5GA 1YCHA 3VZQA 5ICFA 3VSCA 2H2IA 3JQ8A 1NKTA 4XD7D 4MUEA 3VVBA 1BNCA 2BZ0A 3ZHTA 1YZLA 4RK1A 4KXWA 3TGPA 4GC5A 2ECOA 2EJWA 1WZIA 2GZ2A 2Q2WA 3G1WA 5T7BA 2WJZB 2O3SA 2G77B 1AGXA 2GS9A 2AF3C 1YR6A 3R3VA 1DJNA 4IQ8A 2WG2A 1B73A 2XCRB 1Q84A 3F9CA 1NNSA 1CZKA 3FOEC 3U7QA 3ANTA 4I55B 3HY3A 3U44A 4EWLA 5IC6A 1FXUA 4KIFA 1DKOA 3G23A 1J56A 5G0VA 4IJWA 1DUIA 3DMRA 3FDJA 2IBSA 3PXEA 1R8XA 3PSAA 3R9IA 3KPVA 1THMA 4NFYA 3EE6A 4FSXA 4ZAWA 3TR6A 1C7IA 4WK0B 1QX4A 2RJOA 4BAUA 4CXMA 2OFXA 4C06A 2LIVA 2WWYA 2CMGA 3FHTA 3L79A 1L8LA 4RM3A 4P83A 1M72A 4DNOA 1GQOA 3MERA 2IE8A 1WO8A 3BMNB 3GFRA 3JYPA 1EGMB 1EXMA 1NXPA 1TT5A 1ZW6A 2IHVA 5BN3A 2CNNA 5AM5A 5ENVA 2CKDA 2FQYA 2YIJA 4YRTA 3S2IA 4NCJA 2ZJAA 4GYYA 4PC3A 2X9LA 2R7KA 3I2FA 4WHMA 5T67A 3WOHA 4XB1A 4UHFA 4X3OA 4DADA 3QFRA 5D5QA 1MV8A 1WSWA 4HGZA 1OPXA 3QF7A 2C83A 4M0DA 1EA7A 1FLDA 2B61A 3NH9A 2HA2A 4HAOA 1UEIA 2WMNB 4NYMQ 2B98A 4IMIB 4H7JA 2FPSA 3OBIA 3BWEA 4H3VA 4QDJA 3RQSA 2Z56A 4GX5A 5AJUA 4CTKA 4AROA 4DNFA 2GCGA 4BUJA 3HNOA 4DBZA 4A6PA 1QGUA 2P9CA 3OF5A 3QFFA 4EHJA 1IRIA 4XJSA 3FMGA 4HAUA 5CVUA 3U7JA 1K4YA 2Z8YM 4OQPA 1ZM2A 3RASA 1GCGA 2P3SA 3VUFA 4BY9E 3MWFA 1W88A 1V8FA 2XECA 2WHXA 2ZJ8A 4MIKA 3SLRA 2CVZA 1HM5A 2BDUA 4JODA 4LRUA 4OMCA 1BJRE 5FBLB 3SZLA 1ZITA 4JH0A 1RPAA 1Y48E 1KY4A 1Y98A 2YWFA 4JEMA 4GI2A 1BMFA 3WL8A 4TWBA 1OE0A 4KO4S 1Z68A 1NP6A 4LHZA 1ORDA 4IFEA 4EA7A 5AOVA 2CLOB 3GU3A 5AKYA 2FVXA 4P33A 3BGSA 4KQIA 1MDBA 4JGGA 4EGFA 2JJ2D 2XI4A 3IL2A 3U7FB 2D2IA 4L5AA 4QDZA 5BN5A 2FX5A 3SY8A 5H02A 4AS1A 2DUUA 3C1UA 5AK3A 3O2QB 4KRXA 3ZD8A 1W44A 2QRQA 1H6CA 1I4LD 1UAYA 4FWIB 1H5NA 1S0UA 3N59A 4RZ2A 5ELMA 1K5PA 3GY0A 2QL7A 1F2UB 2HA3A 2LGJA 2ZCUA 4IEFB 4MYDA 4KN8A 3CRMA 2DETA 2F43B 2H8KA 4IDDA 4BRZA 5LDHA 4C2UA 4M0KA 5J2TA 3DBRB 5BW5A 4GPZA 4FD3A 4HWPA 5TT1A 2MCFA 3ZWCA 4RJTA 1KVQA 1OH6A 2XGOA 1O0BA 4XDZA 2ZIVB 1P74A 2A1TR 1ISSA 3RODA 2VYVD 3ABSB 4LGVA 1E7RA 4M1ZA 1PEKE 2G9QA 5LZ8A 2KPOA 1FC0A 4C0XA 2AK2A 3W2TA 2V9CA 3E0XA 2PAFA 1E0SA 1KFKB 3QE3A 4DQVA 2W7TA 1EJBA 3FHJA 3G2MA 4FU0A 1KPGA 4PS1A 2WLSA 1VSUA 2VSFA 4JT2A 2YVAA 4FR5A 1GQYA 3PC8C 1QRRA 4JBYA 2QYHA 1JR3A 1HETA 3ISTA 4QQFA 3LL4A 2F9LA 3UAOA 1CHNA 1EEHA 4CR7A 2KHZA 3GEDA 5DHPA 1MV5A 3EEYA 1J0BA 5DHAA 3BQNB 4LF8B 3LAWA 1I4OA 4B8ZA 5JH7F 1PIWA 1HMYA 4KIGA 4FX5A 4G1UC 5E6SA 4OL9A 2BELA 3LS2A 2PZJA 3I8OA 4WOBA 4EYKA 1R00A 2FFQA 2IOFK 2NVUA 4YJGA 4KTTE 2Z6VA 4NFSA 5DWQA 1UUFA 2GFQA 3F6PA 4N6NA 4E03A 5DOZA 3CH4B 2OGZA 1ZUIA 1U6KA 3GAZA 3HKEA 3L4BA 4WZBB 5GVRA 4ZVOA 2I62A 5I9NA 3X44A 1UPAA 2XMZA 1F8UA 1R64A 3GPCA 3VVMA 1L3BA 3B3JA 1RQGA 2IRWA 5I7HA 2XVXA 1LRLA 4HP8A 4PG7A 2I1QA 4FILA 2Z1NA 3QXGA 3KQHA 3KLNA 2UXBB 4KI7A 4U0JA 1BXGB 1Z34A 3JWJA 5I3CA 1GP2A 3HWSA 1U3TA 4M9SA 2DT8A 1VGQA 4MWBA 4TKMA 2Q0XA 4I50B 2WIDA 4CBVA 2C2OA 5JLJA 3C7KA 4FGJA 4DCSA 2A67A 3I1YA 1S1MA 4TV9F 1IZ9A 2FPPB 4NR0A 5IBRA 4C7BA 1XD2B 4I66A 4ODIA 3GAFA 3AIOA 1FYWA 4O0MA 5GWXA 5D86A 1YF3A 2VEDA 1V3VA 1NI4A 4YIKA 4M36A 2JIZD 4OFBA 4NBRA 3ZCVA 4FQ5A 4I9HA 1SIWA 2UV8A 1A8HA 4Y6OA 5AKIA 1W5BA 1I6LA 4X7PA 3V4FA 3LLSA 2BCGY 3A9SA 3G49A 1Y81A 1W8DA 5K8VA 2Q4RA 1T9DA 1JLHA 1V4NA 2UVQA 3O2JA 4FLMA 3ORFA 2YJ5A 3GJRA 1WNTA 5E1BA 2V7GA 3ZS8A 4RGVA 1GPAA 2VDQB 1W7AA 1GSHA 1MORA 1XK7A 4AJHA 3B53X 3BJIC 1GKLA 3KZMA 2I4TA 3LTEA 4NDAA 3ZCTA 3IR5A 1H4VB 2GM3A 3FNBA 3ZW9A 1QRDA 5KOJB 2Q2NA 2O0JA 2R97A 2W83A 3M4XA 4XTCS 1V7ZA 4ZXPA 3SS7X 1RQLA 2R6CA 2GKOA 1KNXA 1BYIA 2LCFA 1GUFA 3BFVA 1TU3A 5FL3A 2NXWA 1OX6A 3LHFA 3H9BA 2DQYA 2JEYA 2F67A 4G0UA 2GVDC 4PZEA 3GJ4A 4KK4A 2BIFA 3U2QA 1C30A 1P9WA 3C7AA 3K0FA 4Q7KA 3MT7A 4AULA 1KOLA 2ZATA 4MUYA 4ZOCA 2A7XA 3T9DA 5DMXA 3ZI0A 2G8LA 4LWQA 2I2CA 3UW1A 2N47A 1N0WA 3O8DA 1GQSA 1H42A 3Q7SA 5J43A 1YS1X 2MU1A 3IHWA 3EQZA 3V1UA 2CLSA 2DE0X 3V8QA 2ZRAA 5I01A 1U2GC 4CM3A 1WKVA 1KQGA 5FEMA 3H99A 3ND5A 1I3OA 5KQLA 2BFWA 4EOGA 3HCRA 4QYWA 1O77A 5CNIA 5A2QA 3AVYA 5FOSA 2WOJA 1W85B 1E66A 1XCMA 4ZTBA 1SWWA 4CKEA 3HUEA 2PUFA 2PEYA 3FPGA 4MP6A 2CMDA 5LSAA 3M89A 5LZ9A 3IR6A 1NURA 5IKOA 1S3FA 2D1FA 4BZQA 3IPYA 4IDBA 5HG0A 4QXOA 1CZOA 4F3TA 2IU3A 1E89A 1TCBA 3FPKA 3S55A 3GMIA 2CE7A 4LI0A 4CQLA 2QK4A 1E9SA 4IV8A 4XSGA 4CF6A 3WLMA 2CD7A 3IEXA 4A8JA 4D26A 4NAHA 4YTEA 1F0YA 5HZHA 3AVQA 4G81A 5IJZA 2CGEA 1A98A 3H9UA 1Y7LA 4JLPA 4MVJD 4YAWA 3T9BA 4XKJA 4FR2A 1IQPA 1T8UA 3MCVA 2H51A 3AONB 4I3GA 2FPIB 1AGRA 4DNQA 2PMCA 4B71A 4LYEA 4JCOA 9ABPA 4CEIA 1VKZA 4DLPA 1NFRA 2P5YA 3TQQA 1JB9A 4J7AA 3E8MA 2YHAA 1WNFA 1Y4DE 1HR0B 3R77A 1SA0A 3RSCA 4F5EA 4LY0A 1YS7A 2TRSB 3SQDA 4BNHA 4D9BA 2F9MA 2CJWA 1N6KA 4PY2A 1CT9A 2YHUA 4POAA 1V48A 4INOA 1T35A 4TTQA 1QDEA 1P5HA 1U0NA 4FEGA 1JG3A 1LX7A 2AE2A 2CJPA 5F2OA 1RPJA 3U6KA 5FB3A 1BSVA 1H6DA 1W5SA 1UFRA 2E85A 2EJBA 3M6WA 3OIYA 3UJ8A 3ZGVA 1CIPA 3UMMA 3TRJA 2O3RA 3L8ZA 2JDIA 2NLOA 3N3AC 4Q47A 5C4MA 1DBSA 5HCNA 4RULA 2RGRA 4J0DA 1QQBA 3LPCA 2G4LA 1P2DA 1XQ6A 1RCFA 1UM9B 1RE1A 1GG9A 3M4ZA 1KI6B 1KR2A 1XQWA 1F17A 2P68A 2GZAA 3QQ5A 1BA3A 1S8OA 4H1UA 4KVGA 1KTVA 3QLTA 2DZDA 2BM0A 2O57A 4RY9A 2EJCA 3L0SA 2H5JA 1AO0A 2O2IA 2QI9C 5J4VA 3RFFA 3P2KA 2VNIA 3AIMA 4PIVA 1B43A 1YI8A 5FOVA 4RSMA 5CFPA 3KYIB 4GMXA 4ZQEA 2DSNA 3EVBA 1GTG1 1YUMA 1KZ7B 3IKLA 2WUWE 4ED9A 1UL1X 3QU5A 2B4KA 4OBXA 1SVMA 2HT6A 4QWWA 2VZEA 2JIPA 3EIFA 3SXPA 5F1KA 4ZCRA 1WX1A 2OUKA 3DE7X 4D81A 1B23P 3CW8X 4HRVA 3GJ8A 1IZZA 4M76B 3DBOB 2VQFB 4ZZ3A 1WEHA 4RH0A 4ZPXA 9LDTA 4GXTA 2XA1A 1WDLA 2B4TO 1QFJA 2ZR0A 2OZEA 4BE4A 2AXNA 1ZMXA 1AURA 2ODQA 4BXOB 4CN8A 2QNRA 3EVTA 4HV4A 3W7AA 4AF8A 1GZDA 4JWTA 2CZGA 5IJXA 2GNPA 1XYVA 1YBAA 3L7DA 3AHFA 4IVQA 1UJMA 4CKXA 4DQLA 2VDOB 4RHEA 4RNDB 4CR6A 1KA9H 4FC6A 5B12A 2F9FA 3KV3O 3G0OA 4QTZA 1C3JA 1CX9B 1ZN2A 4CEJB 1HL3A 5DBFA 3E9DA 3LYLA 4OJYA 5DDIP 2L17A 2YOHA 3MTIA 1DX6A 1I5RA 4S0XA 2AG1A 1XN4A 3VOSA 3A28A 4AYTA 3WTBA 1W5FA 4JSRA 3RB8A 2ZM5A 1VRCA 5I3ZA 3RH0A 3EASA 4B6SA 3D6HA 1EFVB 3W6NA 2QYOA 2XXAA 2E49A 2RI6A 3GZNA 1NJ5A 3QX3A 1DHRA 5AFSA 2GJ4A 2AFRA 1YZVA 1O9BA 3UATA 3FYUB 3WMXA 4WVFA 4LI3X 3BJMA 5EMNA 1ZZEA 2XZTA 2ECQA 3QJGA 3UB2A 4D8VA 3KLMX 3DCIA 1ZKDA 4B1FA 1GCIA 1NX6A 3BD8A 2ZANA 4LXTA 2C4HA 1OUMA 3FR7A 1V26A 2BEVA 5LYJF 2XWBF 3AZOA 4ABYA 3BCSA 1RC8A 5GJCA 5JARA 5DYYA 4P6VF 1M2VB 1QUEA 4G1CA 2HUNA 3QVVA 4GDFA 2GN4A 3VR6A 5FWYA 2I80A 1KIMA 2ZP1A 1WMSA 1Z4QA 3RIGA 3ZTWA 1KRWA 3OICA 3JWEA 1UXJA 2ZE7A 3NVAA 5TB5A 2B4YA 2C59A 1GADO 3H5IA 3E3OA 4IIUA 4TTJA 1AHIA 5DI9A 4WI1A 421PA 2O6HA 4DCUA 3WGYA 1R8QA 3MRTA 3DAPA 1ENYA 2FLKA 2W6PA 2YV5A 3IEMA 2A5GA 3WIOA 4ME6A 1A9QA 1HSOA 2ZQZA 3GWGA 5KO2A 4OP3A 4HWRA 4RLQA 3PZRA 1KAQA 1TMYA 3JQGA 3RVOA 2F1IA 2K87A 2PBRA 4R8VA 1JHDA 5AKZA 5E4JA 3VKHA 4E31A 2XT9A 2WHEA 3VYWA 4YT2A 1PWXA 2NQTA 1ZZGA 5CCDA 3R40A 2XB9A 2JJYA 4KQHA 3O74A 5KSPA 1G16A 3SVZA 2CNBA 4RV5A 3WLEA 4B48A 4C1NA 4D9KA 4DTCA 2AH5A 3D3WB 2EG5A 5GV8A 5TQ0B 2ADMA 4YEDA 1OBVA 1QTNA 1DTWA 2W2XA 4JS0A 4FTWA 3ER6A 4MIYA 2QGFA 3KVOA 3OPQA 3Q9SA 3OOJA 2G40A 4ZIRA 3LT5A 3WIDA 3NEYA 1JLLA 1Z6ZA 3WQRA 4HT3B 1NU8A 4BFXA 4EQ6A 1E3TA 2CXRA 2NPIA 4LS3A 4A10A 4J1TC 3O6VA 1DAOA 1DINA 1G8PA 521PA 3GDWA 2IIQA 1T3LA 2WFLB 5FHQA 4C4SA 1KDPA 2YVLA 3N5CA 1XWFA 4A1OA 2DSTA 1VLQA 4WBSA 3TJRA 3JRXA 2ZSJA 1C9YA 5F2NA 1TTHA 2ZFUA 1KVRA 5EIFA 4MIEA 3TL2A 4ZHSA 1DFHA 2GARA 4R3UC 3A1DA 5JMPA 5LM3A 2JFNA 1WDTA 5LPNA 4ZMRA 1GQFA 1H6AA 1SCNE 4OAOA 3GNLA 2UZ4A 3V32A 1Z5OA 2WAMA 3VZRA 3FETA 1C3XA 4LVUA 1TAHA 4OQNA 1PU2A 2QYSA 2WIAA 3E2PA 3L7CA 1M76A 4G8BA 4PC6A 3F78A 1AB6A 1J25A 4OM7A 3GLGB 1EP1B 1HDCA 3OY7A 3FFAA 1MENA 5L7TA 2GK3A 4JI7B 3MAGA 4TV8B 1NWCA 1Z5WA 4KOAA 2XKJE 1JMKC 4GOOD 4HDSB 5AIBA 1Q44A 4ERXA 4XQ9A 1KIFA 4L57A 1SNYA 1CJSA 2CMKA 2CDCA 3ZXSA 2WHPA 1UJNA 3ONWA 1QHYA 3FD8A 3EIQA 2WTAA 5FYQA 2IPMA 5DM4A 4AO6A 4L3WA 2Q3JA 4O4IF 5CLGA 4B4WA 2HJWA 1KVSA 3X1WA 5CDGA 5J58A 4ILKA 3R76A 5KAPA 3TOSA 4FXPA 4TMYA 4GKVA 2EZTA 2VWPA 3PX3A 3HJAA 4KLNA 2V7QD 4MQEA 4CLXA 5LP6F 1FXWA 1I3MA 2X4DA 4GBGA 3L0CA 1QS0B 3BAFA 1JDPA 2AOTB 2R47A 4G65A 5HPYB 1FYFA 3ME5A 3Q3IA 2HNAA 3C14C 4BQEA 2ZSFA 2QR2A 1VA4A 3GUCA 3OSUA 2IYXA 1FCJA 1XAJA 1C7JA 2C4NA 5AI4A 3LY8A 1NBEA 3DS8A 1MC1A 3STUA 3SZMA 4NEGA 1K5HA 2DVMA 1XE3A 1N2CE 4MVJH 3KYJB 1FX0B 1CR4A 3DSRA 3WGHA 4U7JA 2QROA 2Q3HA 2ZRBA 3RADC 2VAPA 3PKJA 1WU8A 1TJPB 2MSCB 1X8LA 4K7JA 3ICCA 4O4IA 3OOSA 3EZYA 2YNMA 1PGJA 1AZWA 1VJRA 2IFTA 5FNZA 3UFBA 5LLSA 5T4BA 1OAAA 4LMRA 4R6WA 2XUIA 2V1UA 4B75A 4H6XA 3E9ZA 1GCUA 3NYIA 4JLBA 1YO6A 3G5UA 4MV1A 2HLHA 2PJUA 3DKPA 4Q05A 5LP6A 1LPAB 2JRLA 3E3LA 3FHOA 2ZIWB 4BN4A 3OA0A 1NOJA 2C7QA 1UXHA 4GOMD 2W00A 4EA9A 3MCUA 5KVQA 2DM6A 1DX4A 2ASEA 2CNDA 1BU8A 3I30X 2BBTA 2P78A 3R0QA 3TJMA 5IJ0B 1SO8A 1G8GA 1FSGA 1V71A 2R6JA 3CINA 3JZIA 1P9LA 1UBKS 4Z2YA 5C4GB 3ZX5A 3UJAA 4BKUA 2I71A 4WZZA 2JARA 4IFBA 3D0QA 1A2OA 2Q5OA 4FX2A 2EERA 2GZ3A 4OA5A 4C6TA 3UV7A 3HUUA 3MMSA 3IODA 2REOA 4GU5A 1QIEA 3WQSB 1QTIA 3HI6A 2DJ5A 3EK2A 3D2LA 3INRA 5ALZA 5DNAA 2Q99A 3PQCA 3RHFA 4DZZA 3P9IA 4G56A 4RTJA 1DUSA 2DWUA 4JVLA 1HQCA 1DZIA 1R4MB 3GDHA 1D1SA 4WLEA 2IOFA 5ALRA 5JNVA 4OJNA 2PL3A 3LKDA 1VLMA 2RHGB 5KQSA 3DNFA 1F2TB 2HUPA 3X2EA 4WOJA 3RV4A 5J3JA 4ENTA 1ISMA 1H1LA 3S1AA 2GI4A 5BSKA 5B1IA 3GT3A 4OTZA 3F4BA 2HK9A 1BGVA 1XTRA 4MKGA 2UYCA 1HE2A 2B2NA 4O6VA 4X1IA 2QMQA 4X94A 3HJBA 3TMKA 2A9RA 5H5JA 2R6FA 1XROA 1SVWA 1R15A 3GMSA 4H7PA 1U9IA 4YI3A 2D5BA 1XZDA 4ZI7F 1ZNWA 2O5RA 2QLTA 3CF0A 3IAUA 3ITNA 3LK7A 4CGYA 4G07A 3VO1A 3DYBA 1EHCA 2R5NA 5FULA 2PYDA 5FR1A 3CGGA 4BJ5A 4CMCA 5K3OA 5B4UA 1T3HA 1NQOA 3AK4A 3HV2A 4RVOA 1KVTA 4GUDA 4C0LA 4DLUA 2GLXA 2RHBA 4JXJA 4ACBA 4AKEA 2VHJA 3PTAA 5DVZA 4FHGA 4LV5B 1FOEB 2UUBB 1P1IA 4PCLA 1QO0A 4K81B 3TVYA 2E37A 3SJZA 2IBTA 5FKJA 1DDIA 4G0PA 1OAOA 3P9XA 3OPMA 1U1EA 3MJCA 1GFWA 2P2SA 3UJ9A 5D1HA 5K0SA 3L9WA 3UJDA 1W1WA 2EBWA 1R12A 2JD2A 4PLTA 4BWGA 3R5HA 2KWIA 5KPJA 1PG2A 3CJQA 1RWMA 2AN1A 3SIRA 4Q1EA 2OHIA 3Q5EA 4DRXA 1PGNA 5G4LA 4YT5A 1YAJA 3EAQA 3QV2A 5CT5A 5TS3A 4ZI7A 1Q0HA 3AC0A 2O2XA 5GQSA 3WHKA 5HOEA 3CMCO 2A9JA 5CDTA 2FW7A 1M8PA 2ZJ5A 3KQWA 2PZEA 3UPTA 4ITVA 1HE3A 4L78A 5C5EA 4UUQA 1M2JA 1MAUA 5CH3A 2C97A 3C8MA 2FXVA 3F4LA 4C6RA 1RYDA 4E0BA 2ZWMA 2KLBA 1K97A 1VHQA 3TRFA 3E7FA 5EHGA 5F7JA 4WA7A 4MPJA 3OZBA 3PI7A 3ZNOA 2HZ7A 3BK7A 4C2TA 1G9TA 1TYBE 3VU9A 1B6GA 4F9TA 4P0PB 2JFWA 3F97A 1PI3A 4U7GA 5KI6A 1F5NA 3RKRA 1NJ6A 1JHVA 4DLZA 1RPTA 2IU4A 4GYWA 3S2SA 4EI2A 4KRFA 3FYDA 2XUPA 3GC6A 2L82A 1I80A 4QRIA 4R7ZA 4BQNA 1G8AA 1XF9A 2NIPA 4RSRA 4YAOA 4FPXA 2FMIA 3FCAA 1X1RA 4H17A 3TXYA 3V8VA 4B44A 3EOZA 3VFDA 5K8JB 4KBYA 1MG0A 1PLJA 1NW4A 1G20E 3KXIA 3O75A 3PC7A 2APJA 2YVUA 3QBDA 4RU1A 4DG5A 3GFTA 2WVGA 1LBQA 1K7CA 2WYOA 5D7NA 4B34A 2QTLA 4Q39A 5CB8A 2XITA 3RRXA 2D2EA 2NGRA 2ZE5A 4O8CA 2H9IA 1UZLA 4W5JA 5FPPA 1E2EA 1SN7A 2F43A 3IUQA 1E2MA 3NUGA 2X0JA 1E5TA 5GADl 2X1HA 1NE7A 1HH4A 1F48A 4GMHA 3DBRA 1EPUA 3G2JA 3TAXA 1J42A 1TYDE 3T7RA 3KJZA 1UFQA 2WJAA 4P2GA 4IVPA 3DAYA 1BG6A 2QVCA 3AVTA 6CHYA 5EZQA 5ER9A 4AIIA 1DAHA 2VJAA 2BE9A 2HIHA 3V9AA 3ZLTA 4YJDA 1NQ5A 2YIDA 1NN5A 3IUJA 4OHXA 2A9VA 2VF8A 4TYMA 5KAMA 4A92A 4CHGA 3OEWA 2J3KA 1HGXA 1QAMA 1KS9A 4I50F 3A1WA 4P86A 5BT9A 5KMGB 3TAHA 1J2JA 2DKOA 2IZZA 3GRUA 1NV8A 3IVGA 3IXLA 4LC0A 4XVRA 4Q4DA 3UH1A 3PDUA 1M6HA 1PNOA 4RJLA 1GGJA 3KJQA 4N7MA 1IZ0A 4ZT7A 5C4IA 4E32A 1UFKA 4DEXA 3I1FA 1GL6A 1BXRB 3R5XA 3WL5A 4K86A 1J8FA 3IT3A 4B4OA 5IX8A 2DC1A 4CIAA 2R86A 3A7EA 2F3RA 4WJLA 2ZRIA 4YYEA 3NYQA 1P60A 3OHMA 4RVDA 4BE9A 4URVR 3T7EA 4RFVA 4WLOA 4A8TA 2JGLA 3QA9A 4IIJB 1SBNE 3EVDA 3CTPA 4HNRA 2EFEB 1L4HA 1XNJA 3COJA 4D0RA 5SZKB 4LDNA 1S8NA 2O5VA 1BXGA 4IINA 3LQFA 5H59A 3AYXB 3SM9A 4JBGA 5DNUA 4Y18A 2GZRA 1T3ZA 2VKTA 3FSGA 4QO7A 5F35A 4ZYUA 4DW8A 4HNHA 4FZRA 1H8HD 2EKQA 4PS0A 8LDHA 2QAIA 1NJFA 3ZE2B 4CGZA 5E0KB 4BTLA 1EUDB 4BO1A 1VFNA 1ZP6A 4IKEA 2UKDA 4X8LA 1Y7PA 5JDCC 1OC2A 1MP0A 2FJPA 4AW9A 2QPTA 2OLKA 4KO3S 3PNLA 1Y5NA 2IIPA 3F96A 5JVDB 4BNDA 3W8NA 1US8B 4Q18A 4MLDA 4R2MA 3WVNA 1SXJE 3HRHA 1AV6A 1I1OA 3EH1A 1RAAA 2Q1XA 2EWVA 3L7NA 3W5DA 3GYBA 4JC0A 2CNWA 2FQXA 2NO9A 2XJ4A 3MELA 3I0MA 2WD8A 2NNLD 4AG3A 3B9BA 4AKTA 2HAEA 3NETA 1A8UA 1QFXA 4D44A 3BYZA 3KOXA 1WE2A 2FK7A 3N2IA 2BMAA 3QEMB 1I6KA 4GOXA 4MVCA 4NCNA 4RCVA 2PNJA 2H52A 4PLVA 3VJKA 5IRCD 1OD6A 1VXOA 2YZGA 1D0VA 3O38A 4NKRA 3HBLA 1E2KA 4RUKA 2D4HA 1BVUA 2JASA 3BORA 2RB5A 3P0HA 2R48A 2NUBA 1XU7A 4KE7A 3OJEA 3DD5A 5DM0A 1K0FA 1FVOA 1PSZA 3DJFA 5F1OA 1X94A 4HNGA 5AMXA 4E1BA 1LA2A 4OLHA 3GYGA 4EO9A 5A4IS 2KE5A 1G2PA 4IH1A 3MAAC 4W5HA 5JZ9A 1EINA 5EXTA 3GLVA 5CU7A 3SIWA 1YS4A 4G1VA 2Q46A 1QO7A 3AV3A 3CR7A 1D03A 4LWOA 4QVKA 4TMFA 2X14A 2YRWA 2DT5A 1E2DA 3JQEA 3PRHA 4PRYA 2MWMA 4CMJA 1LI7A 3BSFA 2VDKB 5LFAA 2OAP1 2WJGA 2C99A 1VMIA 1H2RS 2IHKA 2VPTA 2AMLA 2VWGA 3AOEC 2H08A 2H17A 2PT7A 1QRAA 1RSZA 3OZVA 2ZWIA 3TQIA 3DHNA 5FAKA 1QH1A 3U0VA 1PBNA 2PX6A 1NF2A 4MS1B 5CA0F 5A4AA 4R5HA 2HQRA 4MUMA 5COBA 1RU3A 5I5GA 4ZAVA 3KCNA 5DWDA 1XSEA 5EZ6B 2C95A 1W85A 3PYLA 2FZWA 4HZIA 4IM7A 4MDYA 3FWYA 1VYVA 4UASA 1YOVB 4NF2A 3ABZA 3EIHA 1KI7A 1GPYA 2ZB3A 3CEJA 4G24A 3F8WA 4BYGA 4YDHB 4BUCA 1QQ7A 1CYDA 1F6BA 3O94A 1W93A 2HOQA 4YNBA 5D3ZA 4MHOA 3AESB 4YP7A 1X38A 1SBQA 2WWWA 2YWRA 4LDAA 1ISRA 1FU4A 2AYXA 1R8YA 2IZOA 2CZCA 3CX8A 1OVGA 1JRLA 3QPCA 3FCCA 4GDMA 5F73A 3TE7A 3TQRA 2J5BA 4H3SA 3UWPA 2HT1A 1ZIYA 1KMCA 3IQXA 1W5TA 4ISBA 4YJ3A 2WF5A 3H05A 3NYWA 5HMMA 2H2FA 3WKEA 5CD9A 2VP5A 5DKFA 4R4JA 4F97A 4G9EA 2BKEA 3P5SA 2F3PA 1ULTA 2JCBA 1NBME 4II7A 4KWHA 2Z9DA 3W05A 1YRWA 3WRXC 3WNCA 1DAKA 3HL0A 5CA0A 3C98A 2WB2A 3O3NB 3ZLJA 2CDAA 4MQMA 2Q62A 3OY2A 4P7BA 1ZCJA 5BXQC 4KQCA 1H8EA 3NX4A 4CHTA 3FPFA 3H3FA 4DV2B 3SFVA 1O6BA 2X58A 4E22A 1M0TA 1T1RA 1X9GA 1ZVJA 4MO9A 4M22A 4UBMA 1J9EA 3LIPA 1BX0A 4GAEA 2BFEA 2IYWA 3A9TA 1TVCA 1R6TA 3VPGA 1V9LA 3AEQA 4CM1A 2JS7A 4RJKA 4ZGWA 4X60A 5EGSA 2V6JA 2C7OA 5E4FA 2ZCVA 3LLMA 1UM9A 2Q4BA 3RVQA 3UJCA 2B1RA 2FPOA 5D5PA 3C3EA 1IB6A 2OWEA 5KIAA 4AKSA 4ZCTA 4LRQA 3U4DA 5JAPA 4EJ2A 3F46A 2V98A 1LWNA 2PNFA 4LJ9A 1V96A 5DTIA 4E09A 2WP0A 1FTYA 3U61B 1JJVA 1P2BA 2BLLA 1J6UA 3OMLA 3K9WA 4LEIA 5MGNA 1IVYA 4E7OA 1FS4A 1ECJA 5CJPA 5IZCC 3FXAA 4ALKA 4QNMA 4WQMA 3WFZA 2MSNA 4J7UA 2O3TA 3Q3HA 5HXAA 1VE7A 1E92A 2B20A 2H2WA 4L0QA 5DV9A 3RCBA 3CBGA 3F7TA 3K4PA 4KQ9A 4BXOA 2OGTA 1KYTA 4JX8A 4A0QA 2O23A 4Y0NA 1JHYA 1YMUA 1BWSA 3UK0A 1XZIA 2X3YA 3L8FA 1ZCZA 4B87A 4XJVA 3SS9X 2GEVA 3E81A 2YXLA 3CUYA 2VPPA 3ND9A 3E4DA 4MLZA 5ICCA 2QJFA 5EEHA 1EFCA 4DR5B 4LDQA 3BD9A 4R71A 3PLAE 1OWNA 3UAXA 3VV3A 5I6DA 5CURA 4X3PA 3LQQA 5AW0A 4N41A 3FCUB 2H0QA 5CMLA 1QKJA 5AVTA 2UZIR 3D7RA 4TYPA 2H0AA 3BIXA 4PZ0A 4WH0A 3SX0A 3WB0A 1YQWA 2Z8XA 3OX2A 5FBWB 1PL0A 2UZ0A 3ONDA 4NK4A 1Q7CA 4MCAA 3Q1KA 2GKSA 5ALPA 4Z4CA 1PV2A 4PQFA 3EDYA 1BEZA 4IDFA 5DNWA 3LX8A 4KGXA 5ALHA 1UK9A 2V1XA 1JB1A 4ZOLA 1KDVA 4D4IA 1KGDA 3H1BA 1Y80A 3TAUA 3ZQJA 2F1JA 2QQ0A 1H1TA 5JSHA 2NUTB 2WV9A 1HNWB 1VJTA 1FFYA 4YXWA 2MYTA 3MPOA 3KHKA 3VNSA 1FFDA 4ZQBA 5J63A 4YMHA 2J48A 4OXQA 1JSCA 4RW0A 4BWFB 1BD4A 1KYXA 4LDRA 3CLVA 2CF6A 3WLHA 1TTTA 4MV0A 4ZV7A 4IZOA 4GYJA 4D5GA 1L4FA 2NACA 4UNPA 1GGKA 3FRIA 2BHSA 4RZSA 2HO4A 4WFIA 4ZQIA 5G02A 3W0LB 4BNNA 4IR7A 5IARA 2ES4A 5BXYA 4MJXA 3TBFA 3LXRA 3BE8A 4PG5A 2R65A 3RC1A 3LBYA 1ZN8A 3IUBA 4H4DA 3SXJA 1X1EA 5E6UB 1R0CA 2IS4A 4CIBA 3M2TA 1C8LA 4RF4A 4MQ4A 5LDGA 2IXDA 3ESQA 4J49A 1MAHA 2JIBA 3I5YA 2E4AA 2P2YA 2Z58A 3FWNA 5K45A 2PKCA 4O2AB 2KM1A 1AA6A 1IEQA 2ORVA 4YRPA 1WUIS 3TXXA 5JZMA 3ROKA 1T0IA 2W90A 4S3MA 5M04A 5TQ0A 3A1NA 5HQTA 3ZCPA 5IYZB 5KX5B 4NFLA 1XRNA 1C80A 4X1OA 1CDDA 1PWEA 3C70A 3GCWA 4FFBB 3A9RA 4H08A 1PW7A 4H7KA 5JLAA 2P2NA 2WK1A 2XZDA 3RG8A 6AT1A 4PO8A 3IP6A 2Q2OA 5C7IO 1JQJC 4DWWA 1U6IA 3QA3E 2P4HX 1WU7A 3OQVA 3ZWNA 5M29A 1JFRA 3HB1A 4MZXA 4TV8F 3ROMA 3IP1A 2HLDD 3L7KA 3LCMA 3QUCA 2P3QA 3W77A 4D43A 2ZRQA 3EEOA 3V48A 4UVHA 3D8SA 1Z6GA 4OGWA 4EUNA 4WKOA 5JD5A 3LGXA 1DQRA 3AU8A 4PZ9A 4D98A 1U3UA 3ILVA 2BTEA 2H4WA 1Y3AA 2Y0PA 3QV1A 2N1MA 4JR1A 3S2GA 3EMBA 2FFJA 1MAAA 2Y93A 4K9OA 5DK6A 4FOOA 4EI7A 1W49A 1MTZA 2G1AA 2F4VB 2Y0BA 4BP3A 1J8QA 2JH8A 2ZE8A 2JANA 3GCDA 3T9AA 3NBKA 4YRDA 1TAGA 4Z3OA 2GPWA 4PFQA 3PFGA 5I9IA 3PUXA 1OF1A 2F3QA 4HDRB 3O8CA 3IPXA 3GLGA 1XMQB 3BBPA 1V5FA 4CLHA 3WWZA 2BEJA 2RIPA 2IWHA 4DNPA 3P32A 1Z5NA 2MR6A 2FWNA 4TV8A 3EPPA 5JNUA 2AN3A 1D0SA 2XD4A 1P4HA 1SHUX 4A16A 1YVEI 2OGSA 3K1AA 2GJSA 3WIUA 4AS3A 2UUCB 1WXIA 1CUFA 2WZBA 4M8LA 1LLUA 1A27A 1F4LA 1X8XA 1PFGA 2YN0A 3MJFA 4UXHA 1G8KA 1TJNA 2VFAA 4TKVB 3OZ7A 1NNUA 3QBVA 2EBUA 3TIXB 4E5VA 4NAUA 3TQTA 5K0FA 3H4VA 2VRCA 1VLLA 2WYHA 1P4RA 2B8NA 1Q57A 3IBGA 4NOKA 3F5SA 1BO6A 1QS0A 3K6RA 4X9XA 4JJAA 2LUOA 3WIVA 3JD4A 3SQWA 1OH8A 2COEA 4K9MA 4XWWA 1B6RA 2VSQA 1DG1G 4UFPA 1N6HA 4YUAA 1VJCA 1MH1A 2X9QA 2PGDA 3HEAA 4DDTA 2I4LA 1N5OX 2OQ2A 1KE2A 3KD2A 3VU8A 2WIJA 5HQ3B 2UXCB 3BGIA 4MQFB 1HK7A 2QRUA 2DHQA 3CZ5A 2CDBA 3ID6C 3MIZA 3NIDB 2R62A 5EYPB 2WSLA 4QHYA 3CMMA 2A9PA 2IUTA 5CIYA 3H65A 4EKYA 3AP3A 2HQSA 1JWLA 3OAAA 3PR3A 4ND8B 1SQ0A 4BO6A 2LCQA 3WA7A 2D0PB 1NRXA 4ITRC 4IV0A 1U2EA 5DM2A 3HLKA 3IV6A 3AHIA 1H23A 3H8SA 3I37X 1Q0QA 3LL7A 4A82A 1P2GA 3PNBA 4XH9B 3KPJA 1G2OA 1GAWA 1G63A 3D8RA 3FNQA 2QRKA 5C35A 1L7XA 2I7DA 5ERGB 3OT5A 2REXB 1YDHA 3AERA 2QTAA 2XYRA 5IVHA 5CT6A 3AFIA 1FMCA 2PA3A 3VZBA 3CRQA 1PR3A 3UGQA 4AZ3B 4BQOA 5KTMA 3H87A 2ID8A 3FLMA 1ISGA 3GARA 3PLNA 3MLAA 2PLFA 2Y6UA 1M2HA 2HM7A 1G5FA 2FY8A 3OEHD 4A73A 3U4MA 1BHO1 5BNWA 1XQ1A 1KKMA 4MGHA 3AY7A 3EAGA 1CYEA 2WAXA 4V0KA 2HCJB 2O2YA 2Q0HA 1T6BY 3GLQA 3RM3A 1N2IA 2X7XA 1U8TA 1M83A 5B1EA 1D1PA 2CLKB 1Q1ZA 1S2DA 1Z5ZA 4FMDB 3H5OA 2EW1A 5DCUA 5I8PA 1N0UA 4GICA 4YHBA 2O52A 3B60A 3EQ6A 2JGMA 5ALKA 5DM60 3ZE6A 4J4TA 2ZJOA 2V6GA 3OQJA 2IW1A 3Q87B 4M6WA 4WUVA 1PQUA 3A1TA 4PG8A 4HQFA 1Y4AE 1JS1X 1NW6A 1QKKA 6PFKA 4BUZA 1OTYA 1NC3A 1SRRA 5E1DA 4UCWA 3QXSA 3GPBA 1VHWA 2ARKA 5HIJA 1NN1A 3U49A 2CLIB 1MXFA 2XIJA 3FOCA 3OD5A 4DIKA 3A1SA 4H0FA 4KAXA 4U9HS 5FHRA 3USCS 2DWCA 4NE2A 4BO5A 3UMGA 2WJ6A 1RDFA 1U9CA 1EX7A 1B0ZA 2HB6A 5DK4A 2PG3A 5EQDA 4RF2A 1I32A 2NZYA 3LP6A 3H5NA 4EHAA 2WY2D 4S1OA 2W2KA 1SHJA 4ID3A 2JI6A 3ROFA 3BZWA 2NZVG 2ZI5A 3CX6A 1NF9A 1RRVA 4MVJE 4AFNA 2I4IA 4ZCPA 4BZPA 1JEDA 4QJBA 3AM5A 4ZICA 4MR9B 3O95A 1BAPA 3SKVA 5IULC 3VHLB 3GJ5A 4C03A 2B5OA 3PEUA 5TARA 1GSIA 4C3ZA 2GBGA 3CNHA 3QW2A 1IE3A 3KEFA 2QG9A 5LQSA 3V55A 1I9CA 2VTDA 2XVYA 1RHRA 5JD4A 3RKSA 3T61A 3U3RA 2YXBA 3H8JA 4AI6A 1KBQA 2ZGVA 1U4SA 1WR8A 1MOQA 1FW6A 2FUEA 3PFIA 1PAUA 3AUJB 1YR2A 4B7CA 1Y8QA 2AXEA 2QMZA 4KJZA 5CEEA 5JHGB 1RJWA 1GTMA 3MOIA 1UDWA 4IEIA 3ENNA 3RYFB 4EFNA 1F14A 1UEXC 1B00A 4LZAA 4PYIA 3PQ4A 1J0CA 4QULA 4BNFA 2HREA 2W48A 4RK6A 2QD2A 3EBPA 2MDTA 1A88A 3MUEA 2WAYA 2QTVB 2PMWB 5DNYB 3RFTA 1K27A 1Y34E 1YB1A 3S2EA 1RWKA 1VHTA 3VHRA 2G1PA 2YCLA 4I5DA 4U7PB 1W0JA 1PSWA 3G7UA 3PQ8A 3ILHA 3NHPA 4J03A 3PFCA 1NATA 1FP7A 4RESA 2JCSA 4YK7A 3HYLA 2J6BA 3RAPR 3ZZ1A 2FUKA 3PL1A 2VJMB 2R3SA 2ZI4A 3MJRA 4KYVA 4GRDA 3D0RA 1NVTA 4HYTA 2UZ3A 4KXYA 4XUEA 4QA9A 3JQ7B 4B8WA 3B20A 4FUTA 4WZAB 3U3ZA 1U0OC 5A06A 4J3JA 2W2VA 3I72A 1DC5A 3VVCA 3U4IA 2ZI3A 4JJGA 1RI4A 4NV1A 3LDHA 3PF9A 5CW1A 2QJWA 3R3SA 4ZEMA 3NDIA 1O6GA 2C82A 4ZO7A 4Q19A 2NP7A 5AKLA 2DBRA 1OYYA 4TT3A 5ICGA 3EPKA 4INPA 4LZLA 1VLHA 5I9MA 4MPDA 3S8YA 4HVTA 3GH3A 5FX2A 1OBOA 3PPXA 4DB2A 5J4YA 4N03A 1Q1EA 1V4VA 1ZD9A 4KW7A 1GFIA 1V8ZA 4G0XA 3ENKA 5JQGA 1VOTA 3LU1A 3SSMA 1RLIA 3HB0A 1ES9A 5JW6A 1XI2A 2OFWA 2YIVX 4KL8S 4JBXA 3D31A 4K6OA 3SMVA 1C1XA 1RZVA 2PKEA 4JASB 3FI0A 4AXBA 3V5NA 2J3IA 4DCCA 2F2TA 3DZHA 3KTAB 4QOJA 2Q1SA 2VVTA 4NRDA 3AFNA 4N3BA 2FDRA 1IOWA 4RL4A 2B25A 3CA8A 3R4CA 4RLFA 3TH5A 2XXBA 4C4PA 5IJAA 2I4RA 2EFGA 3KWJA 5K3FB 1NZJA 4LF6B 4QJ4A 2PGJA 4LKOA 5DCYA 4EFMA 3MUOA 4EW3A 1J1IA 4OJTA 3R9KA 2HF8A 5L6LB 2D5LA 1E2LA 3HWRA 1MQAA 2Z30A 3FZEA 3RFVA 3T5DA 3AW8A 5KTYA 2QZ9A 3E9QA 2HN9A 3G2LA 3NT5A 3K9LA 2GM5A 1JPVA 5JDIC 1XMJA 2ZZKA 2X22A 2O2HA 1MBZA 3TM5A 3DMNA 4HWSA 3FF4A 4BNUA 1B41A 4P3NA 1Z38A 4M60A 3ZGXA 3OTQA 2OEPA 3KSUA 3M7IA 3W6OA 1JBKA 3O4JA 3AEYA 2A0XA 1IYZA 3QBJA 4WJKB 1BMTA 4QPNA 3UNXA 1NR1A 1JHXA 4MX8A 2XSZA 3ZHRA 4JUBA 4LJKA 1ZRMA 4AO7A 1KWGA 3AHEA 1RM5A 1XRLA 3HGQA 3WB1A 4U3JA 2ZBPA 2WU4A 2C5SA 1FDIA 4DXDA 3ZDCA 1PQPA 2DB3A 2JGEA 3IDSA 4FI3C 1US8A 3QLUA 4FE3A 4TZKA 4EEKA 5DJ5A 4CUJA 3PRYA 4FYKA 4DLAA 2ZJ7A 4EUHA 2HPVA 3SZ3A 4ZGGA 1TA4A 3I05A 1M6YA 3KAJA 5E7QA 3C3CA 1NUQA 2ZWAA 3KKKA 2AFHB 3KPUA 3NO4A 1BN6A 2XYQA 3QEMA 3QUTA 4IGAA 5CTJA 3UV3A 2L69A 4JUFA 4CV3A 1MO6A 2PV7A 1CKEA 3DV0B 2HU8A 3HR8A 1PG0A 4OBEA 4D8TA 1TZJA 4WNAA 4D74A 1Z5PA 5A9SB 4FC7A 3ABQB 1Z6PA 2YZMA 3VPSA 1MRSA 1UDBA 3RVLA 3JQBC 3SC6A 2IYTA 1T15A 2ZJ1A 1L7PA 1O3YA 2NU9A 2ZRPA 2O7VA 5E6UA 3TIIA 3U4QB 2YJNA 1ZNZA 1UJBA 1MRZA 3WIEA 3SFTA 3FN4A 2LDBA 1Z0DA 1KZHA 5LLTA 1XFDA 4R2WA 4F92B 4YP5A 1XZNA 3NB0A 3RLIA 3WLLA 3CE6A 1CF2O 1LVGA 2DPHA 2A0KA 4JI5B 1ATZA 3SU8A 3KT3A 1A9PA 1Q0RA 2HTEA 3FWPA 5AXBA 2W2MA 4G63A 3NKLA 4BJ3A 4CM4A 4E4TA 4MA5A 1UEJA 4TTTS 4GZ3A 1E5LA 2K2QB 5FPTA 5FOQA 1ZL2A 5K6AC 3HJHA 4MS1A 3RJ5A 4ZI2A 2ZJ4A 2PRYA 3ONVA 1XIVA 2DX7A 1CEEA 1RZ3A 2XYVA 1XR3A 5IKEA 2PV0A 3ASUA 5GZ6A 4WRRA 2YMQA 1NSTA 5JJ5A 5LOVA 3SC2A 1YOVA 3JVDA 4FHEA 2AEMA 4MITA 4G09A 5IUJC 2WHQA 1PL7A 4Q4LA 3GJ3A 1GV0A 1ZK3A 2W4QA 3AESA 4PLWA 3I5UA 2PBLA 3A1EA 2GXQA 3H19A 3HCFA 2DULA 3IXQA 2PJZA 4MS3B 2OXRA 5CDFA 3UJ6A 1AVTA 2OBLA 1UPXA 1VBMA 5KBYA 1ZICA 2GJ9A 4FEAA 3R6GA 3VC3A 1FU7A 2GYWA 4Q1BA 4CNBA 5ARDA 4WINA 3C24A 4Y9DA 5DNDA 4ZCQA 5EQFA 2IGBA 4H7DA 1P7CA 1L4MA 1NV9A 1KNQA 2HQBA 2WIBA 4ALIA 5JSZA 5CIQA 2WTMA 4H77A 1AMUA 5A5GA 5EMJA 2J08A 3M4NA 5D3QA 4UMFA 1GL3A 4FFRA 5EPOA 5TMBA 2NO4A 1AO3A 4O08A 1HV8A 4ZVMA 1GEGA 4MVXA 4BQFA 1GR0A 3L05A 4DGSA 1CU1A 2QX8A 4M1WA 2VNAA 5EA2A 1K8RA 5EHQA 4HLDA 5CGZA 4C7MA 3OFNA 2BHRA 2PFSA 3DC2A 3EVZA 3VAZA 2HA6A 3E82A 3WV4A 1DIRA 1A8IA 2WM8A 3PC8A 4K87A 4JYZA 4OHOA 4RVNA 4CCWA 1YZGA 4WUTA 4JLMA 2WZCA 4WEQA 4YPOA 4LXUA 4LTMA 1MOZA 1JHRA 2OVBA 3DP9A 4HHEA 1M0WA 1ZJJA 4KACA 3VTFA 5BV7A 3B89A 3GUHA 5DW0A 2HF9A 1E2PA 3DUFB 3R5FA 2Z1DA 5EPUA 4BNXA 2OCYC 1OWLA 3N28A 5HS6A 3BXHA 1Q0SA 3RJTA 4LNUA 4RFSB 1PQWA 2QPAA 1KP3A 1TC1A 1JQDA 3NAQA 1T9GR 2H1VA 3K0AB 4NY1A 1V3UA 3JQFA 4LJ6A 5AI5A 4U63A 2Y68A 1CQPA 2FGJA 1R6XA 2IYEA 2OBNA 1R0BA 1V8DA 3FDIA 3G2IA 4TL6A 4ENPA 1NJ8A 3SF8B 4HPWA 4HMQA 5EE3A 3ESZA 3ESAA 5DSXA 1DC7A 3TD2A 4MUKA 4TVOA 1DIOB 4IOKA 4X7RA 3TZEA 1R4NB 1SUEA 1W4CA 2QLLA 5EWMB 3U1VA 4PNHA 4C20A 3GLFB 1K3FA 3M4YA 5DLYA 2EP7A 1BJTA 1SM4A 5TGDA 1JHOA 1TYZA 4TSFA 3T34A 5JS8A 4YQZA 3KSDO 3RAJA 1LH0A 2EZ4A 4BQSA 2VDLB 1KGSA 4LHYA 5BNIA 1W35A 1ZJYA 5LZ4A 2V3WA 1ID8A 4UBIA 1YU9A 4L75A 3W8DA 1IJEA 1R4ZA 4CL2A 1T5BA 1N9ZA 2UZAA 3PQ2A 2HNKA 2AMFA 4QOEA 5HYVA 1XWWA 4V2IA 1ZLXA 3RBVA 3ZXYA 4YBZA 4CT0A 2DECA 3JQAD 2OL4A 4LZZA 1GUDA 2IF2A 1MC5A 3O8RA 3V7NA 3PEFA 3GFQA 2DQZA 2FW6A 4ZT5A 1F4VA 1UMBB 1WMEA 1X2BA 4K9SA 5G41A 4CCYA 4YIHA 6NULA 1JTVA 5HZKA 1JR3D 2W11A 1YRYE 3ZIAA 4Q4JB 3AR3A 5F3RA 1DO8A 3RSLA 3VH1A 3U19A 1UBFA 3GCXA 1L4YA 1LPMA 4DCVA 4O2AF 5JT1A 4C7KA 3KB6A 5LQDA 1UPFA 2W2OA 4X1KA 3HJCA 5IM5A 3UA4A 4F5WA 4UW9A 1HT2E 2FFHA 4Q4AA 5EZ5A 2YWGA 5FYDA 3ET5A 4UAJA 3FDZA 2JZOA 3Q8MA 2XEDA 1XVUA 1JDNA 2OY0A 1RR6A 1UAGA 1IIBA 1D07A 2ZS7A 4N5HX 4OQQA 5IYZF 3IGFA 3TLJA 4BFYA 5LDDC 3PHCA 3WK8A 1HTWA 2DWQA 3DWIA 4AK9A 1L7EA 5A7FA 1RADA 2WFMA 1ABEA 4LYJA 3KC2A 1U04A 2H1LA 4PANA 5KCZA 1BOOA 2W0MA 4FFOA 4EF4A 1DOAA 3HK2A 3KKNA 2HY7A 2PWBA 4JBIA 5I7OA 4AP9A 1MVNA 1EH5A 1NUAA 4LRTB 4EB8A 1YR9A 2W4IA 1T2NA 3L49A 3U7GA 4TMVA 2JAXA 2ZAMA 4Y1RB 1L1EA 3KTOA 5L4SA 5AJVB 1XJ5A 3KYCB 3VRHA 1ISIA 1D6NA 1I7PA 2YC2C 1IJKA 2ZYTX 1MXHA 1TB4A 2ZIXB 3MUFA 4LV8B 1NVWQ 4JYAB 4EMUA 4O2AA 3ICEA 5GGYA 3ZWYA 2NVWA 2AGVA 1JI3A 3V7FA 3VBCA 3ZX4A 1OVMA 2Z3VA 1JL3A 3A4MA 1VE1A 5KYNA 1IM2A 4H7HA 5FOXA 3RV3A 4QBFA 3ZUPA 4KFCA 1FFSA 2Z4RA 1YRAA 3R09A 1N1MA 3RS7A 5IYZA 3EOBI 1P9RA 3B6MA 4AUNA 1EGQA 4I1SA 2XD9A 1GVHA 3BMOB 3CVJA 5E6RB 2PZAA 2F1KA 2ZPUA 1ZM4A 4H1TA 4WXYB 1O94A 2X1VA 4PZAA 1TYCA 2QY9A 3MA0A 3ML1A 1S6YA 3T7IA 1MMFB 4B6PA 1FP2A 4GPBA 4MW6A 3B1ZA 3PITA 4UEQA 2ETVA 1CJKC 1FNNA 5KC8A 3MGCA 4CE6A 4TWIA 1IVSA 4GNKA 2G04A 2OKCA 2PFKA 3QWIA 4EZEA 3MJ4A 4FN5A 3EVNA 4GI3A 3QVXA 3G5AA 4LQDA 3FTNA 4YXFA 3L7IA 3IT1A 5ALGA 1QZ3A 2C2KA 5AJZA 1NWHA 3W04A 1N2HA 4RAQA 4A8HA 2ZREA 1TO6A 5K99A 3RUCA 1EX9A 1YZYA 3QVGB 4PLPA 5AQ1A 3WAJA 1KJQA 1X42A 3QVLA 4I1RA 3PDCA 4LECA 4DIDA 1CSEE 1E0AA 1QHHB 4FGLA 2GESA 4D9MA 2HTFA 3GHYA 5B58T 4DDKA 2QRHA 1QRSA 3WKAA 3V34A 1IRXA 2EXXA 3A6HA 2M2IA 2YY5A 3H17A 1YBHA 1EGAA 2NV6A 3KD3A 5AK5A 3TWOA 1WTCA 4G25A 3H9CA 3P9ZA 4U7HA 4HUJA 2NO7A 4MRSA 2G9RA 1XMOB 1M8KA 3MQFA 3DT8A 3O84A 2QM8A 5H3LA 3ZS9A 2XCSB 1ZLYA 3JVVA 4QFBA 2O5EA 3IIMA 1C9NA 1P7ZA 4C43A 1X2EA 3K96A 4NPCA 1F8XA 3P9NA 4NABA 4PO9A 5J2UB 1E0KA 1AE1A 4MAFA 4RVFA 4UE3S 4ESOA 5C51B 5IKXA 1E5DA 1EX6A 1WPQA 2B1JA 3OM1A 4IEEA 1YD7A 4TKVA 3UXHA 2R85A 3NGLA 2IOYA 2QE7A 4O02B 4F2GA 1QCDA 4MV4A 2FW9A 5BSRA 3KEQA 4E5PA 3K1JA 1WLSA 3QBTA 4XGRA 1F6WA 1XKQA 3FWZA 1IG0A 2PJDA 3GROA 2UYOA 4AS2A 2O0MA 3CNQS 1MW9X 1XPJA 2HDOA 1U3VA 2HW8A 5G3ZA 1UZNA 3TTXA 3M3HA 2VP6A 3CVXA 2C2ZA 4J4HA 1AQYA 3D43A 1ZOLA 4NICA 5EKXA 3H6KA 2V7PA 4FCTA 1Q7BA 2CYBA 4ND1A 3L8MA 5H68A 3S1SA 3A06A 3DQPA 2CFTA 1J21A 1DG9A 3BIWA 3C3YA 3QEOA 4NENA 3HO1A 1LC0A 4A91A 2O8BA 1VG8A 2G1UA 3KTFA 2PGLA 1GRRA 1CJMA 5KNBA 3E1SA 1FDSA 2Z2YA 3BWDD 3IMCA 2G17A 3QY9A 4XOUA 3UWOA 4AJPA 5HF5A 1AXGA 1DC3A 3FNGA 4J6EA 4FMDF 4XLTA 3CONA 3M2PA 3JCZA 3K8ZA 1JZTA 1NVEA 4H2DA 3OJWA 4YRAA 3EFOB 2WTUA 1BH6A 1MABB 4RVGA 2XB8A 2VJCA 1C8BA 4Q9LA 2HBQA 4NU5A 4ZQCB 3DW1X 4HAIA 1OH5A 2QBYB 4WK2B 3UHAA 3CC8A 2F1OA 1ENZA 2GR9A 4EG0A 1OYWA 1GHTA 2GM4A 1RQXA 2Q3BA 2PH5A 1WVMA 1JQEA 3SNHA 1WXEA 2IUUA 1JIQA 2Z3ZA 3DL7A 1KMMA 1C14A 3FSEA 5L3SA 1Q92A 3ZIDA 2XMBA 2DH6A 3QVKA 4Q9KA 3SGLA 2P40A 4J2TA 3FKQA 4ZI5A 1TE2A 1X87A 1E7QA 3IVRA 1RJ9B 1R5BA 3IX7A 4QBTA 3DD1A 4GMKA 2NT3A 1K2VN 3M6UA 4LQCA 5TVGA 4UNRA 3PPVA 3ZU2A 3FNIA 2P75A 2WBLC 1M54A 1P5FA 2GEBA 1ZIDA 4IIGA 2P8SA 2HJRA 1P7VA 2R87A 3R7WB 2QRNA 4FZ3A 4KR0A 4NULA 5AP9A 5TMPA 2YYZA 3HRIA 4EL0A 2J67A 3BVPA 4W4TA 3DMHA 2R7AA 1L4NA 4CQMB 1PQ4A 1DKQA 3FMPB 4CMIB 2GN9A 2JIMA 3IOMA 5F64A 2P9ZA 1ZXXA 3TUIC 1YA4A 4C1BA 4BDSA 2F3SA 2FMHA 4GKAA 1TLTA 5JD6A 1E4VA 1XTJA 2VHCA 1YB6A 3C3KA 2EZ9A 2YV3A 3I4FA 3PSHA 2FRDA 4XGIA 4CMGA 2BY4A 3AR7A 3BX1A 5EHNA 5BMVB 3DVQX 3ORYA 3CGWA 3L43A 2Z8ZA 2NWQA 5SYNA 4BO9A 1BHSA 4TROA 4JLNA 3U26A 1YJXA 2G1JA 2INGX 1F5SA 3DZKA 4Y2JA 5DZSA 1XXHB 1JZSA 1I0IA 3H9GA 3KIPA 3O3OB 4IRXA 2ZUDA 4YFYA 3VU3A 3ND8A 4D4MA 4XARA 4AMGA 3JATB 4ANFA 4WOCA 2Q41A 2GYYA 2Z6AA 4HAXA 5THKA 2DRIA 4PHGA 4M98A 2YVKA 1Y1KE 1SB9A 1GKYA 3I2JA 4RVCA 3MSCA 4R01A 4D9FA 2C1ZA 5IAJA 3NP9A 1G41A 3QUBA 1HURA 1EFAA 4QGAA 3WSTA 4M1MA 3PGKA 3IUMA 3BA1A 4MPTA 4D4HA 2O06A 1QSGA 2WE8A 1XTIA 2XB6A 4NYMR 4UVDA 3GRFA 1AMNA 3RUDA 2CN1A 2O05A 1CR6A 3KBBA 1OREA 1IUNA 2FW1A 2PQ6A 3HHPA 3LG2A 3P8ZA 1FSFA 1CRZA 1DIAA 2E87A 2FW8A 3CNEA 4RKFA 4DMHA 1JQLB 1E63A 5EJ6A 5KYKA 1G8YA 1U80A 2HSWA 5H7XA 5A4KA 3THYB 3TBKA 2MSEB 2UDPA 3RYFA 3JYNA 1JIXA 1YZ3A 4OM8A 3DVRX 3GA7A 3QEJA 3TLZA 221PA 4GKBA 4B2PA 4EKNB 3G2KA 4G5OA 1YBVA 1GPLA 1JE1A 3RK4A 4AJLA 4ZGBA 4JR0A 4UULA 1IQUA 1UINA 1FSSA 1Z7BA 3LI2A 4PO1A 4BLPA 1IXRC 2CV0A 3ZI7A 4CMHA 5EP1A 1FTQA 1XLTC 1CNEA 1JEQB 4LBZA 1YMQA 4BTVA 4EFDA 4EL5A 2QL5A 5BQXA 4DM4A 1JJFA 2HD4A 3OPVA 4J0KA 2HHHB 3QGMA 4XYBA 4QU8A 4Q7MB 4BMCA 3HDYA 2DR3A 2GCEA 3EY9A 4GW3A 3ZY6A 4PYOA 4FOLA 4Z9BA 3WGMA 5DASA 2C4TA 1HQYE 1XZEA 3QTBA 2YHBA 3IAEA 3RSQA 4IQGA 4LBVA 1OFTA 3GD5A 4IX1A 1KJNA 4WZAA 4HGRA 4QGSA 4Q3EA 4Q9JA 1W0KA 3U3OA 3VR4A 4CFYA 4ZVPA 3WDKA 1EUCA 1YSCA 3AHCA 4HDKA 4BX9A 5JI3E 4TMTA 4KHZA 4H31A 4NJMB 4LYYA 2BF4A 1YR3A 1N6OA 1MB0A 1OJ7A 2ODBA 2RGUA 3IQHX 1LLFA 1Q3HA 4UUAA 4W5TA 1KYYA 1QJCA 3WGQA 3OLYA 1RE0A 1ZVVA 1XALA 3G2QA 2G83A 4WA8A 1E64A 2P9FA 3CNNA 3GEGA 4MB0A 4BNWA 2G08A 3LRXA 4AP5A 2BFDB 5K8UA 3B1JA 3PNSA 3LKVA 3A36A 2C2YA 2MYUA 3QP9A 3ZXXA 2QRPA 4XEHA 4X62B 2C8VA 3DCJA 4AZ0A 2J3DA 1JU9A 4Q7LA 1NXOA 2PSFA 3OJOA 3N2GB 4KCGA 3UY4A 2BGNA 2XUOA 2IPAB 2FB9A 4YRJA 3QFHA 3TRDA 4UEKA 1ZD1A 4AICA 4RQUA 4C3VA 5F1PA 4RXMA 4I3HA 3HKDB 4ENSA 1BKYA 3LCJA 5CXSA 5ALOA 3ZGYA 4JP1A 5CPFA 1G21B 5U4QA 5LQUA 1IBSA 2EP8A 4AWAA 2ZS8A 2R8PA 3HYCA 5EQJB 1NJ2A 2W2PA 4DM7A 4US2R 3TD6A 2EJUA 1KF0A 2HA4A 3A26A 1H5QA 3PBKA 3ZWXA 3ZVKA 3L8CA 2X4GA 1ANKA 1KZ9A 3ZU4A 3RRBA 2F3TA 3SYMA 5AKEA 3RUAA 3ZDDA 3KOMA 1W9HA 5A4MS 5KYWA 2ZDQA 1G8HA 1MB2A 2IEBA 3W6PA 2P79A 3PIIA 4LJ5A 3C87A 3IVXA 3KLPX 4TT8A 1CWUA 1DEAA 1LFAA 1XHLA 4CV0A 4RQAA 1FUKA 3OQBA 4K2HA 4REQB 3PC6A 4CM8B 4FFSA 2BP7A 3INYA 4QM6A 1MHPA 2VBGA 5BSVA 1O2DA 1QE0A 4KVAA 4JVMA 5COAA 1AUQA 5EY5B 1WMAA 5K3DA 3ESDA 1G9XA 2PS3A 2BEUA 3GJQA 4MICA 3KPYA 5C8VA 2HU5A 3EZLA 3ZC3A 1WM1A 3GFGA 4CUKA 3R24A 3ZDEA 8ABPA 4IDHA 4GLOA 1DU4A 5EIBC 2PXAA 5F33A 1OMOA 1WY5A 1ARZA 3GLIB 4LFCB 3N87A 1CJUC 2R7MA 5GZ1A 1NQTA 2D7DA 4N0QA 3JXEA 4KXUA 3SXUB 4AC9A 3SHWA 2IH2A 3PJRA 3UWMA 4XR9A 1KMIY 3W2IA 3TTVA 2IEGA 2X19A 1DP4A 3H1PA 5KYGA 3OVMA 1I6MA 2ID4A 3GQVA 3IAM1 4EP1A 1TRKA 3UK7A 3BC1A 4YAEA 3LP8A 1CW2B 4XZ3A 3IELA 5DH9A 2PXXA 2VT2A 3AW9A 4KO1S 2GPJA 2OHVA 3KEGA 2AFHA 1UJ6A 2AFVA 1DX9A 2VJOA 2BKUA 2YNMD 4PTZA 4R16A 2YXNA 4RIGA 4UARA 3DV0A 5I51A 4RMJA 2JFOA 2QAGC 1Y7HA 3D6NB 3NAGA 3OLCX 4KBGA 4KEAA 1QZZA 4R6XA 2H11A 5K8TA 1H4SA 2LXNA 5FTJA 4NMWA 2O8VA 3BHMA 4G0MA 4NZPA 5CT4A 5HTKA 2WMYA 1ACMA 3KZVA 4I1YA 2YICA 1AKNA 1V7CA 2XOKA 3PQDA 2XADA 5L40A 2WU0A 1L5LA 1QH9A 3BXZA 4LRXA 5LWQA 4MDEA 3T5GA 3P94A 2P0AA 1OWMA 1I1QB 2DTXA 1NMZA 2J45A 4IYJA 1XCBA 4FKMA 1XNRB 4DYHA 2H0RA 1VMDA 4XCVA 2UVPB 4Q12A 3TNLA 1L4KA 3QWBA 1DWUA 4DILA 1XDBA 3Q7EA 3ULKA 4YV0A 1W4ZA 1U0FA 2ACVA 4OHRA 4D8UA 1Z0UA 4RAOA 3BFPA 3BK2A 1EP9A 4RZIA 3TFQA 2Q5CA 1SU7A 3MQ2A 1MRNA 3WWYA 5IBCA 4MLCA 2C3OA 2DHCA 1SQGA 1GSAA 4LRWA 1I30A 5HUHA 3SQNA 1EE2A 3PUIA 3I64A 1Q1QA 2V7XA 4L8GA 5AM2A 2BFCA 3DEZA 3B7GA 1WD7A 1NU6A 1GAXA 2X9NA 1G3RA 2R1TB 4J3NA 1CUCA 1Z47A 5TPWB 1YWGO 3DLHA 4DLYA 1CUAA 3NXSA 1WB4A 1TTPB 4R1OA 5EEGA 5F7ZA 4MS3A 4HWTA 4GMDA 4QEKA 3VKGA 5JYEA 4JQSA 1O87A 1BN7A 1PNVA 1KEEA 2NVBA 3K9GA 2FWAA 1PR2A 1UXGA 5FI1B 4D42A 2XAAA 1XKXA 2GTPA 3R23A 4KHPB 4R3WA 2B4QA 1SC9A 2PT6A 3CUVA 1RCTE 1B42A 4F3RA 1HYHA 1KFJB 1U5BB 2GKGA 2V74B 5EWJA 5EFZA 1AHPA 1AQ6A 1QO0D 1XXLA 3VNUA 1I0LA 3I58A 4ZAYA 1IXZA 4JHLA 1ZCAA 1IWBB 2AS0A 3GFBA 2P41A 2ERCA 3P5BA 3FUCA 4Q9DA 4F2PA 1OV4A 3BJZA 3CM0A 3ONFA 4HXEB 1A9ZA 5IH7A 4DRZA 1BIFA 2QP9X 2GHIA 5ALMA 3ZJUA 4I8XA 4DR6B 3ZVRA 4D7AA 2HRZA 2ZU6A 2J46A 5SICE 1GRCA 1H05A 4TZ0A 2R25B 3SHOA 2ZBFA 3UT5B 3N0TA 1FDVA 1SKYB 1VBNA 1TZCA 4WK6A 1NUUA