4G2TA

Crystal structure of streptomyces sp. sf2575 glycosyltransferase ssfs6, complexed with thymidine diphosphate
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
384
structure length
356
Chain Sequence
HMRILVIAGCSEGFVMPLVPLSWALRAAGHEVLVAASENMGPTVTGAGLPFAPTCPSLDMPEVLSWDREGNRTTMPREEKPLLEHIGRGYGRLVLRMRDEALALAERWKPDLVLTETYSLTGPLVAATLGIPWIEQSIRLASPELIKSAGVGELAPELAELGLTDFPDPLLSIDVCPPSMEAGTTKMRYVPYNGRNDQVPSWVFEERKQPRLCLTFGTRVPLLLQALSQELPKLGFEVVVAVSDKLAPEGVLAAGQFPLSAIMPACDVVVHHGGHGTTLTCLSEGVPQVSVPVIAEVWDSARLLHAAGAGVEVPSVLAACARIRDDSSYVGNARRLAAEMATLPTPADIVRLIEQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SsfS6
publication title Crystal structure of SsfS6, the putative C-glycosyltransferase involved in SF2575 biosynthesis.
pubmed doi rcsb
source organism Streptomyces sp. sf2575
molecule tags Transferase
total genus 104
structure length 356
sequence length 384
ec nomenclature
pdb deposition date 2012-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase
A PF06722 DUF1205 Protein of unknown function (DUF1205)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4g2tA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4g2tA02
4AY6A 5HXAA 3D0RA 1L5WA 4RIGA 9GPBA 1Y6GA 2QLLA 4YUAA 1F0KA 3E3NA 2ATIA 1NLMA 2FF5A 3BCUA 3WAGA 2R68A 1JIXA 1Z6PA 3MS7A 2BGTA 2QRPA 2BISA 3CX4A 1H5UA 2R4TA 4BFCA 1GFZA 3L01A 1FU8A 3CEJA 1L5VA 2IV3A 1B4DA 2SKEA 2F3SA 3H4TA 3MS4A 3IAAA 3OY2A 2ECPA 5BNWA 4L22A 4NEQA 1P4HA 5JTUA 1GGNA 1C8KA 1WUTA 3IA7A 3DDWA 3RSZA 3BD8A 3CUUA 3T3DA 4N39A 1GPBA 3MQFA 3L7DA 1M5RA 4XI9A 3O3CA 1BX3A 3EBPA 1FTYA 1XKXA 2VCHA 1HLFA 3T3EA 3OY7A 1WV0A 2O6LA 5D00A 1PNVA 2GEJA 3C4VA 3S29A 1FC0A 2JJMA 3RT1A 3PE3A 2PYIA 4GZ3A 2XMPA 2IEGA 4EL5A 3MT9A 5IKOA 2P6PA 4M7PA 5IKPA 1FS4A 2X6QA 1A8IA 6GPBA 4PQGA 1XOIA 1C50A 5JTTA 1GG8A 3MT7A 4X7PA 3MTAA 2G9UA 3ZCUA 1LWOA 4EKEA 1FU7A 1L7XA 3HBFA 2GM9A 5LQDA 4X7RA 2IYAA 1ABBA 3S28A 2QRGA 4CTMA 3GUHA 3RHZA 2XGOA 2GPNA 4AY5A 3OT5A 4RBNA 1O6CA 1XV5A 4YI3A 2C1ZA 1Z8DA 3T3GA 2YJNA 2R66A 2GT1A 2C4MA 1UQTA 3G2HA 2PQ6A 3MS2A 3ZCTA 3HBJA 4M83A 5C1DA 1XL0A 5DU2A 4EL0A 1L5SA 3E3LA 2GPAA 7GPBA 2QLMA 1XC7A 3CV3A 3MTDA 3NPAA 1QKJA 2VCEA 2XGMA 2QLNA 1L5QA 2GPBA 1P2BA 1RZVA 1VGVA 4KQMA 4REMA 4X6LA 3MRXA 1JG7A 4AN4A 3EBOA 2QRHA 1P2GA 4CTOA 2H1FA 1GZ5A 1V4VA 5TMDA 4HWGA 1P4GA 2SKCA 2BGUA 2FETA 3DD1A 4RIFA 2QN7A 3H4IA 3UYKA 1UQUA 3NC4A 3T3HA 3ZCRA 2PYDA 4FZRA 5I45A 3BCSA 1UZUA 3OTIA 3C4QA 2X0EA 1NVKA 1NZFA 2G9QA 1IXYA 1YGPA 3G2IA 4EJ2A 3CUVA 3VDMA 3WADA 1Y8ZA 1NOKA 2F3UA 3Q3EA 4N3BA 2IW1A 2VSNA 2FFRA 2X0DA 3MT8A 3VUEA 5TMEA 1QM5A 2AW3A 2X0FA 3FROA 1GPYA 2GEKA 3Q3IA 1P29A 4GYYA 1NOJA 3MTBA 1WW2A 1FTQA 4RELA 4MI3A 2QN1A 5D01A 5TVGA 4MI6A 3NCHA 2F9FA 3G2NA 3ZCPA 1L5RA 4MICA 4WADA 2XGSA 1Y6FA 1K06A 4FKZA 4F97A 4WHMA 3BDAA 3ZCVA 1KTIA 1C8LA 3NAZA 4KQ1A 3CUYA 4RIEA 4RENA 3OKAA 2OFFA 3S27A 3NB0A 2QN8A 4EKYA 1J39A 2XCUA 1GPAA 3G2LA 2HY7A 3SYMA 1AHPA 3OTGA 2QRQA 3C48A 2IEIA 1L6IA 2BFWA 3BEOA 3RSCA 1JIVA 3L7BA 4RIHA 2AMVA 4LEIA 2VG8A 2XA1A 2F3PA 4RIIA 3HBNA 3SYRA 1JEJA 3TOVA 2ASVA 2Q6VA 4F96A 3T3IA 3ZCQA 5GPBA 5TMBA 1WW3A 2C9ZA 2IYFA 2KS6A 3CEMA 3QKWA 2JZCA 3L7CA 2XA2A 3T5TA 3MRTA 1WV1A 4BQFA 4NC9A 3MRVA 3G2KA 2QN3A 2ZB2A 2G9RA 3TAXA 2QN2A 4MHOA 1Z62A 1F6DA 2GJ4A 2AV6A 3DZCA 3E3OA 2X6RA 2SKDA 3Q3HA 5DLDA 4BQIA 3PE4A 1SXQA 4W6QA 2IUYA 1P4JA 2AZDA 2ACVA 4LDPA 4WACA 2XCIA 3D0QA 2QN9A 3VDNB 3AMVA 1PN3A 3CEHA 3G2JA 2VSYA 4N3CA 4F9FA 3T7DA 3BD7A 1YA6A 1JIUA 1Z6QA 3OKCA 3MSCA 4GZ6A 4X7MA 4GZ5A 3L7AA 2F3QA 5DXFA 4CTNA 4MRAA 4CDRA 4HLNA 4N3AA 4MI9A 4G2TA 4N9WA 3S2UA 2QZSA 3VUFA 2R60A 1PYGA 3GPBA 1AXRA 3CUWA 3OKPA 3D1JA 1FTWA 4QLBA 1PSWA 3MBOA 1E4OA 3WC4A 1E1YA 1NZDA 1IIRA 4GPBA 2QRMA 1RRVA 3DDSA 1WUYA 1XL1A 4Z5XA 1JG6A 3CUTA 3L79A 5ENZA 3NP7A 2G9VA 2IV7A 3BD6A 3S0JA 1EM6A 4MHSA 3BCRA 1C3JA 3HBMA 3ZCSA 2ACWA 4KQ2A 3NP9A 4AMBA 4XIFA 1SXPA 1P2DA 4M60A 1LWNA 1FU4A 4BQEA 2C1XA 2JLBA 3TSAA 1FA9A 2XA9A 2PRJA 1RZUA 3UYLA 2R4UA 4YI5A 2H1HA 2PRIA 4GYWA 1K08A 2WTXA 4AMGA 1NOIA 1EXVA 4NESA 3OTHA 8GPBA 3QHPA 2QNBA 3COPA
chains in the Genus database with same CATH superfamily
2B5VA 1T5TA 2F8MA 2PGLA 1TM3E 2FN9A 2QUIA 3KQOA 4XD7D 5IAJA 3RWMB 3WICA 4B4WA 1L1FA 4EHKA 5C7IO 2JASA 1BCRB 1BYUA 4IXTA 3Q72A 4M46A 3ET4A 2EARA 3WRVA 1KMHB 1KI3A 2OBMA 3NHPA 2CMFA 3HCRA 4INZA 1LQTA 2WW8A 2G5CA 3C45A 4ALIA 2IF2A 2O0LA 5IFKA 5EUCA 3C74A 3GPLA 3H5NA 3L43A 2QM3A 3PUYA 2GKSA 1QO0A 1NLMA 3BJZA 4UPDA 1R5NA 3GYBA 2FF5A 3QBTA 2R5FA 4YP6A 2HU5A 3ILVA 3W9YA 5HX7A 5THKA 3GAAA 1HDRA 3KFVA 1YNOA 2YVUA 4AS3A 2ZSEA 4DKXA 8MHTA 5L7TA 4EDFA 2JL1A 3NBUA 4DRXB 1OSNA 1YR8A 3GMDA 4EHNA 3V4LA 4JR1A 3W0LB 1E2EA 1HMPA 2HK6A 3EZ6A 2ZWAA 1P4AA 3TW6A 1KJQA 2JLSA 1L5VA 2ZE5A 1UANA 1NJ5A 5ALWA 1XTIA 1RC0A 3TPCA 3TR5A 1MVOA 5KOJA 3OHPA 1E79A 1CERA 2O7NA 4KWCA 1FX0A 4F46A 1AM4D 4HVAA 2ZRDA 5FF9A 2WP8J 2I1QA 4BVBA 5ADWA 3EXEB 1W94A 3KKOA 4GUAA 2JGEA 4A6XA 5EP3A 3H17A 2AJLI 3RG8A 3SR0A 5EZSA 2HLNA 3N75A 1T4CA 2I4TA 4YS6A 4EG0A 4EENA 2YVQA 4NE7A 2NYVA 2NU6B 2PX6A 3N1UA 2UVPA 3E5HA 2FR8C 4WZBA 4U9IS 1IMJA 3VSEA 1ZC3A 2G8LA 4MW2A 3K72B 1ZOSA 1E7RA 4ALNA 4QTYA 1JXOA 3ZC3A 2UUCB 1QTQA 3R7BA 3SU8A 1OX4A 2WJWA 5A02A 2I6XA 1ZCAA 1G3QA 1SUSA 2OXFA 3AXTA 3NHAA 3PSAA 3R3ZA 5TF0A 1W25A 1OGYA 2H18A 2Q0SA 4OHFA 4YIKA 3SZGA 1PFUA 1CZOA 3IUQA 4XI9A 2JGDB 5D1NA 1KJJA 4ZVVA 3OPXA 6ADHA 5DCLA 3WFZA 6YASA 2O7VA 3R3JA 2DWQA 3DAHA 4BUJA 4DC1A 1C14A 4UVIA 3OO1A 3LKBA 5IT4A 5LLTA 1KDZA 4WA7A 5DYWA 1DBVO 3ZW7A 2RGRA 2HT6A 1NIJA 4EHJA 4HNTA 1Z12A 5AW2A 1V43A 3Q40A 1TZKA 4CKEB 2XDAA 2Z2ZA 2XCLA 3TOSA 4F4CA 1UWLA 1VPVA 4JVMA 4ILKA 4HNGA 2O8FB 2ZB3A 1DKQA 3FWNA 4NJOA 2P90A 5LPNA 1OXSC 1UPBA 3DYIA 2BZ0A 3D8SA 2P2SA 3ND7A 4X20B 4R8VA 1TEHA 3MAJA 5A3JA 4IEEA 4DSZA 3I4CA 3P9IA 4MKHA 4MV3A 3U7QB 3B48A 5IKOA 4URWR 1VTKA 4TS4A 3UOGA 4AICA 4E07A 3VJRA 2UU9B 5REQB 1H6AA 1T0HB 2C9MA 2PSSA 4B7AA 4Z7JA 2ZYAA 5CA0F 1D2RA 1YE5A 4QATA 1UKVY 3RYHB 4YPVA 2Q62A 1UOEA 2R79A 2LCFA 1E2UA 3GDHA 3PVSA 1T4MA 2CXTA 2ANCA 2J5BA 3IUMA 1IJKA 4R3UC 2VQDA 3KBOA 5JTTA 5AXAA 2W4IA 2PSFA 3EUAA 3MJHA 4N0EA 5HZHA 2X2EA 3LT4A 1OKKD 1XKLA 3PPIA 1QNFA 3LM8A 3L0CA 2FMTA 3ZXUB 1BIFA 1GV0A 2CXOA 4YO8A 5HTOA 2Z4RA 3AI2A 2Z1DA 4IJQA 4ZCPA 4AZ3A 3KXIA 5DEIA 3RTEA 3PWKA 3E3AA 2IYAA 4FI3F 2XKAA 4UVHA 1X1BA 3IP8A 3DPIA 1KTVA 4BQPA 1IPHA 1AIPA 5BN5A 5HKKA 4QYIA 4L51A 2FAXA 3C16C 1FVHA 4FYMA 2BBOA 3HLTA 2IL1A 2Q6LA 1U8XX 4HAXA 3S5JA 3SJBA 2N0SA 4FHEA 4IO1A 1DUVG 4KVFA 4NFLA 5GONA 1NMXA 3VH1A 4GZMA 3FJOA 4O0LA 3R0IA 3DP7A 4LOLA 5T4FA 2W71A 3NATA 2ODAA 3D3KA 4L9WA 5FFNA 3KB2A 3R77A 1R8JA 2RDMA 4P5DA 4URHA 5LQUA 5CM8B 3K09A 2DG2A 1LNZA 1FSGA 1CUBA 2J6IA 3ABZA 1IN7A 1BW9B 4TMTA 3KKZA 1OCEA 2PQ6A 4PNEA 5JDIC 1U04A 1W85B 1OIVA 2SCUB 1RPZA 2NXNA 4JS0A 1XVLA 3SS7X 5HFAA 2WU4A 3DZ8A 1QZXA 3SC2A 3WISA 5EEGA 4P2BA 2XADA 3QU9A 4UJ3A 2A8YA 1DFGA 1WE2A 3DDOA 4ZO9A 5BQXA 2HRBA 4L6IA 4JXXA 3SJAA 2AI3A 2YYZA 4AS1A 3AHEA 1IFXA 1TGVA 3LHFA 2CY0A 2R4QA 1O4WA 4HWKA 1RYEA 2PZ8A 3MUNA 3KYCB 1LPAB 4GBED 1FQWA 3RUHA 4A10A 4XWKA 3HR4A 4MLDA 1G0NA 1NF2A 3AXSA 4RKQA 5JEDA 4TWBA 4TTTS 2XRZA 3L41A 1DRJA 2WJ6A 4NK5A 3KJQA 1VMKA 2DB3A 1CWUA 3ORSA 3QV1A 1W581 4E5UA 3HVIA 4J0GA 1E6EA 3LHSA 1NBAA 1YDFA 2XB4A 3TZEA 1L5LA 4Z8XA 3K1ZA 3O94A 3OF2A 4LTMA 1V4NA 3PCTA 2R6JA 4FW9A 4JB3A 3U60B 4AKSA 1ZGAA 3G6WA 4Z9XA 2CJPA 5EZYF 5BSHA 1WVMA 3MMNA 5AI5A 3TB4A 3U5TA 4N48A 3GLHA 3KFLA 2AG6A 3Q8WA 1V4VA 2XSZA 5AHKA 2JGRA 4XDHA 3G9TA 1DAIA 2RD2A 2WG2A 1OX5A 3W4JA 2QWXA 2IF0A 1A9YA 2CMHA 3E35A 5FX2A 2QT1A 4NX2A 3K92A 2FV8A 3TUJC 1Z6AA 1KC1A 3BB3A 1LS1A 4IJMA 4XTCS 2CFOA 2CLKB 3H4IA 4QIHA 1SC6A 3K1AB 3JCZA 3Q8XB 3KTAB 1SOVA 2XWSA 2ZVPX 4QBIA 5DYGA 3NC4A 2W2OA 3IJRA 4H15A 3LCJA 2ZG6A 3UUWA 1CDZA 4G6ZA 4EX7A 2BRUC 3E03A 3EFHA 4D97A 4EUKA 4JSRA 2QTMA 2GWHA 3MINA 3ROKA 2CJYA 3R7DA 2BZSA 1S02A 4K9SA 4KRGA 2J41A 1WB5A 4I46A 1NUQA 1G8SA 3WRXA 4CMEA 1TNDA 5HVNA 2ORIA 3ZOKA 1XJQA 4B34A 4P4LA 5M7EA 1F38A 4R7ZA 5EIBC 2OL4A 4OB8A 2KSQA 4D9HA 5LWHA 4FGSA 3FTNA 3RYIA 2C5BA 1XDDA 2KPOA 4EITA 5LQKA 4DSNA 2C95A 2AMLA 4IIDA 2Y1GA 2VDRB 2ZAOA 4UTZA 1E0DA 1RYBA 5A4IS 3VR6A 2CLMB 3JVIA 4QEZA 5FD8A 3ANMA 5K20A 1GGJA 1LPMA 2MSKA 2W2KA 3K20A 3T3PB 3GBVA 2J0UA 1LUAA 2QTGA 4PV7A 2CV0A 2XCTB 1E2PA 3INYA 3OP4A 1PV1A 1H85A 2VPPA 4OJKA 4RKWA 1AB6A 3A6KA 1EDZA 4B33A 521PA 1J09A 3OHSX 5D01A 2NZXA 4A1FA 3STVA 1HZJA 3VKHA 3E84A 3PFKA 4BNJA 1KY5A 2JIOA 4PANA 1NUUA 4WH0A 1Q0LA 3OCCA 3TFQA 2JLQA 5DBIA 1DB3A 1N2GA 2WPDD 2C2MA 2P8JA 1GVHA 4US1R 2GR9A 3SR4A 2XBMA 2QQEA 4M76B 4O2RA 4BVHA 5IT0A 2CDAA 2YN4A 3QUSA 1C8LA 3JD4A 1PUXA 2ONKA 4LC9A 5AM1A 4JLMA 3GRZA 2FSSA 3RE1A 1MJ5A 2WRZA 1J06A 2C3PA 2V1XA 2Y1XA 1B0PA 2I22A 4NU8X 2RGWA 1H2HA 4RJJA 3X1KA 4BGDA 3HGTA 3WJ2A 4DCNA 2DOKA 2XCQA 1B1CA 3CT4A 3SFVA 4HK4A 4L3WA 3HHPA 4IQ0A 2C8VA 2J67A 1MRSA 1CUDA 4ZARA 5T67A 3OTGA 4IKEA 1F60A 5A5DA 2XV1A 3JASB 3ZW8A 1E9EA 2EJBA 2JGAA 3WIVA 4G1FA 2QN6A 3LKDA 1LX6A 3ONDA 4CM8B 2JF0A 4HUJA 1GAWA 4B0OA 1H3NA 2P1DA 3VH3A 3ZEIA 1A1SA 3L7BA 4R3WA 3ZI4A 3E1KA 3TH5A 2UXDB 4LE2A 4I9NA 2ZS7A 3VOBA 2UVDA 2DY1A 2ZANA 2D1FA 5F1PA 5DX0A 4ZT7A 4X64B 1BQ4A 4DUGD 3EIHA 1QIIA 4RAQA 1JDBB 3MPUA 4IUCS 5EY5B 4BB0A 1SOMA 1FP2A 4MW9A 1GIAA 2D5IA 2WE8A 1N25A 2JA2A 4XYEA 3CJTA 3U1VA 5B36A 1SVSA 5JSZB 4ZRDA 3H0EA 2R87A 1Z0AA 2PVSA 1IAQA 2ZWIA 4B81A 1CKEA 3ZCQA 5J4KA 2BM8A 3NETA 4UE6A 3LYHA 3ECCA 1Z29A 1I6WA 1RXCA 3QYJA 2G1KA 4HL6A 3RSOA 3QPWA 3SFTA 3THXA 2YYAA 1XEWY 5FWYA 1Y8CA 1QP0A 1YE8A 2UV8A 4WE3A 5DX8A 5EERA 1II8A 1EXNA 1WHTB 5I9BA 2WNHA 2PO7A 2VTEA 4NBLA 2OHVA 3AONB 2Q0XA 2X15A 5AVUA 5T4EA 5DNDA 4C08A 1WETA 3PICA 1KHHA 4BLSA 1DU4A 4XWWA 4C7OA 1SIBE 2ZIEA 3NC1C 1A9ZA 3HFGA 1WMDA 1U0SY 2PX4A 4J3JA 3TAXA 1U3FA 2ZRGA 3UJ3X 4L8LA 3VHLB 3O0TA 4NDNE 1RE0A 2WJPA 3O0DA 3GLVA 4L5BA 2VAMA 5KQMA 1RRCA 4L75A 2HF7A 4ER5A 1OOEA 1IBLB 4FHGA 3AF4A 1ZVJA 4Y2GA 5I7RA 1Q0UA 2XHZA 3B13B 5LA6A 2PKRA 2VSFA 1TJPB 4RADA 3FH0A 3H84A 4WZ6A 4CEIA 3OE5A 2AYYA 3PEVA 4FWIB 2BSQA 4QBGB 2NVWA 1FIUA 1TMKA 1W5TA 3AMVA 5JMOA 4TRRA 5L53A 2OV6A 4BNFA 3LQYA 2YQ4A 4GU5A 1YVDA 4V39A 1KO4A 4JFRA 1ZVQA 1O6ZA 4TQGA 4JEUA 5B1IA 1LC0A 4HT3B 1H1DA 2I2AA 3A1EA 3AP2A 3HDTA 4MQMA 5AHRA 1YA6A 4QXOA 5FLXA 4F5DA 2V45A 2K7FA 3MSCA 1T24A 5FKJA 3MTGA 3B1FA 1XSEA 1AA9A 1XNGA 5F5NA 4JJKA 3UK2A 1I32A 4YVFA 4I9HA 4QVKA 2CYCA 2P68A 4FS8A 1EAMA 1VMDA 2QE6A 1VRVA 1UMBA 3Q5EA 4L85A 1VFNA 5HJ2A 2VH1A 1NNI1 5SYAA 1N2IA 4H6VA 1D9XA 2H2DA 3HPQA 5H9WA 2HL6A 4OK3A 4EX6A 4RY9A 3LBNA 4KUGA 2DHCA 1QIHA 3A4YA 1C9JA 1AK9A 3GJ4A 2ID8A 5KTKA 1E5XA 5B7PA 2FSVC 2P9QA 4YFVA 4POOA 4OIMA 4NCJA 2C9BA 1G63A 2QDKA 4C22A 2ZUFA 1FTWA 1I2AA 3MGCA 2O14A 5HQJA 4B40A 2YZMA 3GJQA 4LKOA 4DXHA 4UREA 2ZP1A 3OA2A 4G4JA 3K5HA 2G67A 1DPGA 4GX2A 5L4NA 4XGNA 2VJQA 3KKLA 1JPVA 1JDZA 1C4OA 4B6FA 2REBA 3ANYB 4WJZA 4RF3A 1KOLA 5CFLA 5IUNC 4AZWA 5IHXA 1S8NA 1RQNA 1G291 1S2MA 2E49A 3O3MB 4JT8A 4ZHQA 1LSOA 1A9OA 2D1SA 1V8PA 2P79A 1XEXA 3HWX1 4L28A 2IS1A 2XZPA 3C6YA 2ACWA 2NT3A 4NJEA 1PV2A 4XIFA 4RTSA 1XP8A 2I4NA 2B37A 2WF8A 3KUXA 4TRMA 5J5VA 1P2DA 5FNVA 2AFIE 1B8VA 1U3UA 2HUNA 4ZD6A 2WK1A 3A6PC 3ES9A 4IXWA 4KR3A 4J1TA 1YCGA 121PA 4Q1DA 3WK8A 1L5MA 5JO0A 4LMAA 4WFIA 1JHPA 3O4IA 1A8SA 1GVNB 1RIIA 3TQFA 5JZBA 2FRDC 1EGMB 3AHCA 3DE2X 2XA9A 4U9UA 4W9NA 3CB2A 2FMXA 4RDCA 1XEWX 4IV5A 1UXGA 3P2JA 2C7VA 2ECKA 4JLWA 3SLRA 1K92A 2FWJA 2JGLA 2QJRA 2CE2X 1DCKA 2P9FA 2PL9A 1JYFA 3Q2OA 4M0CA 2BV3A 3QVJA 2YNMC 3R7SA 2BEWB 4MSUA 3ZHBA 1FFYA 1YR9A 2OBFA 2R1TB 5AVXA 3CLSD 3HEAA 2ZRMA 4PVCA 4WKNA 1DAPA 4AMGA 2C5FA 5KVCA 4U6QA 5JJCA 1IB6A 1E0SA 4OHWA 4G56A 2D5AA 1USVA 5DO9A 3OTHA 4OA8A 5ECGC 2PZFA 4YCCA 1ISJA 1O94C 4RVUA 2DMRA 1G5FA 1ZI9A 2QJWA 3DKPA 3EDYA 5TC4A 2OQVA 1VPEA 4O4LB 1CFJA 2OCXA 4QTXA 3L0PA 4JLJA 1Z4IA 4GE3A 1M34B 4JUFA 1PZGA 4W7IA 4EAAA 1TA4A 3NHKA 2NAPA 3HM9A 1Y1PA 3Q4GA 2AHRA 2IYEA 4MIKA 1QPGA 1KVUA 2CNOA 4INPA 3PDJA 5DGXA 5EIOA 2DR2A 2IOFA 2PUCA 1DX9A 3N76A 2PZLA 2YXBA 2COEA 2DGDA 3R0JA 5C5DA 3E9MA 2H2WA 1Q0TA 1FDRA 3SZUA 1QIDA 3BH7A 1O03A 4I4TF 2JG3A 1MO5A 3AVYA 1AE1A 2QTZA 5JQGF 3X1ZA 3E9QA 1L8QA 2TMKA 4I19A 3U4MA 1ZL0A 5ITZA 3ZHZA 3UJNA 4KUEA 3GFPA 2JFVA 1UF9A 4U2BA 2FTKE 2P0AA 2V6IA 1UFQA 3FETA 4MYDA 4ETIA 1AHHA 1ETUA 2QAGA 3ZD7A 4H7PA 4O3FA 2I99A 2CJXA 1TZJA 1XQ1A 4XUDA 4YJGA 5LOVA 1L0BA 4GI2A 1AUPA 4RJ2A 3Q7PA 3VHXB 3CX4A 1V47A 4A8TA 4D96A 2R4TA 2VKTA 1BCSA 4JYBA 2BBSA 2X5JO 3IHTA 2QT0A 5JD6A 1EFHA 4UZSA 3QQ5A 2IWRA 3QOXA 4B5LA 1O5TA 2XKBA 2V5VA 4QFDA 2QRLA 1O9BA 3BL6A 2IITA 4Q4AA 3KQVA 1PK8A 5ALFA 3BXPA 2PS9A 3H83A 3QI7A 1DIBA 1JHVA 4CM4B 4IDHA 4PG5A 3FPEA 4D8UA 1LY1A 2IUTA 2AC2A 3CYFA 5TF4A 4DLZA 1IZ8A 3D1LA 3D6HA 3WYNA 4D6XA 3V8RA 2BTEA 1TVMA 4D0NA 2C77A 1CR2A 3H8VA 3IYLW 5BR4A 5F98A 3ADBA 3RU3A 3RSZA 1QVZA 2E2WA 2HRDA 3IUBA 3RTCA 1CF4A 3KV3O 4ZPJA 2Z1NA 4C87A 3AR6A 4JP8A 4TVKA 1ZMBA 4Y98A 3LUPA 2ZRFA 2F1HA 4RD1A 2RGAA 1QIGA 1RXIA 4UCXA 1XZCA 5B64A 5DNEA 2ODEA 4MW7A 4B87A 1Y7LA 2C2XA 4TVOA 3QPVA 5KX5A 4UAGA 3U37A 5AVRA 2ZBUA 4CCYB 2RHTA 3UICA 4WZAE 3EEFA 5IJ9B 3V34A 3ZEAA 1TYBE 1XKXA 1KYXA 3PXAA 3UXEA 1Y48E 4JI1B 4JOBA 1G8PA 3V1MA 4NCIA 1C9MA 4KOEC 4KPUB 2HHHB 3PCRB 1LBEA 1X0VA 1PJAA 2Y0EA 4KV7A 5DE3A 5GMOA 3VYRB 3TZ6A 2BFBB 3DUWA 5DP2A 4M0LA 1ZLXA 3HL4A 4WKOA 4LDJA 3RODA 1M0EA 1PLKA 2PYIA 1PGPA 2NVUA 2R7KA 4MJ7A 5KYVA 1GT6A 3GVXA 1UBLS 3COVA 2PQ2A 2QJFA 2ZJ6A 2HB6A 1MCZA 3WHLA 2I4RA 4EL5A 4Z9AA 1HGXA 3CJRA 2NO4A 2P6PA 2PTGA 3CX8A 1UIMA 3N2YA 5IYZF 4FHCA 2JDID 2BFNA 1OLUB 1PR6A 1JEYB 1MG0A 3HGMA 1TPYA 2G9NA 1LVUA 3T34A 2J5KA 1EZZA 3B3AA 3BEDA 3M9XA 3E5NA 2ZRQA 1XD2A 3PHJA 3QFCA 4RHEA 3H3JA 4FKMA 5KOIA 4E21A 1PDOA 3AUAA 4K6KA 1TYZA 2ZE7A 1P62B 4H7EA 1HOTA 4B48A 1E1MA 1VHLA 1CUCA 2I80A 3D31A 1XMPA 4WZBE 1C7QA 3TQCA 4Q6BA 4C07A 4DV6B 4OGKA 1HZZC 3GROA 1M6EX 1UC4B 4E13A 2O2DA 4ARCA 5TQ2B 3EZLA 2OB2A 1OUMA 3EGEA 4H3KB 3LBAA 2CSXA 1DG9A 4Q24A 1C1DA 2Q1SA 2Q8NA 3ZHRA 1CQIA 2WUWE 1E9CA 3I76A 4RVDA 1JWBB 4MXDA 4GOMD 1YT5A 3BE5A 5K51A 4ANFA 4QUIA 4CF4A 5G0TA 1IZ0A 4GLFA 1T43A 1M54A 3P9XA 4FHFA 1C0LA 4LSWA 4QOSA 3V32A 3ZGNA 1BHSA 5SYMA 4YI3A 3AY7A 2EEPA 4EARA 3CZAA 5FPQA 4B2LA 4KNVA 3TM5A 4JBLA 4W9RA 2VVTA 3AEUA 1MEEA 3DVRX 3FJYA 1Y3DE 1U9JA 3EMBA 1XMIA 3GFOA 3I6YA 4WY2A 4EZEA 1HQDA 4QXMA 1UQTA 1YJXA 1LVHA 4LWPA 1ZRNA 2W93A 3N7AA 1KERA 2ODWA 3SZOA 3OCVA 1E9FA 5KJ1A 1JDVA 3OQIB 4KMRA 3G8CA 1XN1A 5ES4B 3NO4A 3VAYA 2FSPA 2DUJA 3DMTC 3RGGA 2I33A 3A9UA 1RM3A 3CZMA 2XTJA 3PRYA 2RSLA 4OQPA 5IS2A 1N0UA 2JEZA 4BGIA 2GPAA 5DTEA 3AM4A 3T5BA 1LCIA 3IDFA 2R3SA 3WLTA 1L4NA 3CV3A 4ME6A 2B4YA 3ZHTA 3PG5A 3GRKA 3OBBA 4V0RA 1XZMA 1H2FA 3P45A 4BNXA 1N2XA 1XTBA 2YN0A 1OA0A 4MGEA 2JEYA 3HYRA 3IALA 3LI2A 4PYKA 3REQA 3L93A 2W90A 4H3SA 4WY8A 1TCBA 1RPJA 3E9DA 3O83A 4IMJB 3WIDA 2JGKA 1M5TA 3PIRA 4IEFB 1EXMA 1PVVA 3GOQA 1GR1A 4WD3A 5FWDA 4J2OA 3CW2A 3LY9A 3MRXA 3OC6A 3A6JA 4HNAA 3JZAA 4B6RA 3L8HA 2VYCA 3MCVA 1T34A 3Q9SA 2BOVA 1OBHA 1U6JA 3BWYA 1JIQA 5JCOA 4B3GA 3JVDA 2CXRA 3K8ZA 3JZIA 3SOPA 4RZ2A 4HEA6 3AIOA 2E4YA 2IHKA 3NV9A 4AO7A 1N0VC 2R8RA 1WSWA 4J9UE 2XE4A 3QG1A 3T99A 3IIKA 3TO5A 3OF3A 1N6HA 4BNGA 4ZZIA 3G7SA 1Q1AA 3UJAA 3RVKA 2YCBA 3LWDA 5G4KA 1CLEA 2ERXA 4EAQA 1JJAA 4K88A 4V0LA 4Z4HA 5IBCA 4I50A 5B1YA 4HI0E 4UUQA 5F2NA 2I62A 4Q9LA 1HX7A 5JMWA 4IVQA 1PG2A 1V3UA 5DW3A 2M6RA 5C7LO 3L46A 4NEHB 4YB8A 2P5SA 2R6R1 4GT1A 1A7UA 3VZDA 2X2PA 3PQ2A 2OYCA 3QH4A 3H1TA 4DADA 4CLRA 2QNIA 2YJTD 3M6MD 4J03A 5LD2B 1UPAA 1RKXA 2GLTA 1ZLYA 3QE0A 2VUHB 3RBVA 1BOOA 2PZGA 1DXHA 1IUPA 3DGEC 3FZEA 3TSZA 3V2HA 2C5LA 3AKYA 1Y8ZA 4OHKA 1E3IA 1H66A 4BLPA 3BT7A 2OHOA 2QIOA 3KR0A 1G5TA 1Q20A 4UVEA 3TGWA 3W2TA 5JH7A 2HEGA 3D7RA 2ODTX 1H5NA 3AI3A 5BVGA 1T3TA 1X39A 2HF8A 2ZI4A 3C15C 3AVWA 4D9FA 4LHXA 2WIGA 4OLFA 2JCSA 5TDHA 1N3LA 3U26A 1J2JA 4XCQA 5C4GB 2X0FA 5IT9A 2RGCA 2G72A 2YJ5A 5AUOB 4GYYA 1E1RD 2D0IA 2VYFA 4OOEA 1C0KA 4D9JA 3MTJA 4AL4A 3WK7A 2D1QA 4C3UA 4OUKX 2Q2OA 2R2AA 4RDHA 4WAUA 5E7QA 4X60A 2CUTA 1KK1A 4RZUA 3TSWA 1SVUA 4CCAA 2O8BA 4ARVA 5BMVB 3T7RA 1GU1A 3LX4A 4ZO8A 5DK4A 4JMLA 1T0BA 1C4XA 1OFUA 2IE8A 3EGVA 4WN9A 3TECE 3ERCA 3UAXA 1V1MA 1QVRA 2RK3A 4MUNA 1RSZA 5B3AA 3SEAA 3UMCA 3LLUA 3W3AD 3ZCPA 3DT9A 2DETA 4YWHA 4C29A 4MVJP 1NW4A 4ZT3A 3KAKA 3M81A 5DVZA 5JI2E 3KQUA 1YVEI 1K06A 3LUAA 1MGPA 2PU5A 4HP8A 4F97A 3NHMA 1EVKA 3I9V1 1A4XA 4G5FA 4WJLA 4IH9A 4I55A 4KQ1A 1XWIA 1ULHA 2PQ0A 1Z25A 2QTFA 3DTVA 3ODGA 1AUOA 2XTZA 5DGCA 2Q1XA 3RC1A 1JE1A 3E9ZA 4HC4A 3SQNA 3V3KA 4GS5A 1VM6A 4BX9A 3UHAA 4BYGA 1K7EB 1ZIDA 2IWHA 3TXXA 2X7HA 4RL6A 2HY7A 1SKUA 2IZ0A 3COZA 4HPXB 3LL4A 4R8LA 4E5SA 4JXZA 3CO0S 3OPYB 4O1IA 1MB2A 4RH1A 3SQXA 1YAJA 3FFBA 4ENUA 3TL2A 3P9YA 1TF2A 4N12A 1QNLA 1L6IA 2YC4C 2C4WA 4BVJA 3AO0B 4A4DA 1N2SA 3JQBC 3VISA 5K8CA 1JLRA 1MJGM 4ZCRA 1KQPA 4NY1A 3AOEC 5CHYA 4J3FA 2ZSFA 3L1UA 2DECA 2Y71A 2DBZA 4GI7A 1FLAA 3DCYA 1ZP6A 4N7BA 1Y63A 4D8YA 3DO6A 5KYUB 2KBFA 1P1JA 1TYDE 4J7UA 3D6JA 2YQZA 2J9YB 3D02A 3HFSA 5K03A 1SIOA 5IUKC 4XH9B 5JNTA 5JU6A 4V1CI 4BKMA 1KORA 1CNMA 3OJWA 1TUBA 4JI7B 1WW3A 1JFRA 4LPKA 1UXOA 2BAGA 3ETEA 5HE8A 4R8RA 3FDJA 2FG7C 2I8CA 3CCBA 4YA6A 3UT5A 9LDBA 3DE3X 5K8UA 2HU2A 4GI3A 4L8VA 3OCUA 5F5XA 3LPCA 1H4TA 4UDYX 5LJLA 4F3KA 2YJGA 1K8YB 4O4IB 4QDKA 4WBSA 4NC9A 5E4YA 3ZD8A 4JD5A 2I3AA 4YRPA 3ZZ1A 3K70D 4Y1RB 4AUNA 3AUTA 2XPCA 4R6XA 1M73E 3F49S 4QE3A 4YJ2B 3TQHA 1YFLA 5TRTA 2OM6A 4M1TA 1UL1X 4R16A 1SBQA 5M29A 2R5WA 5BN4A 1VLQA 3I23A 3KR2A 3L1IA 4X54A 4YHHB 1TM1E 2GJ4A 1U9IC 3GJSA 3VPCA 2H4FA 2IOHA 3KNZA 2ZYGA 3C3BA 1IQRA 1HF3A 1ORHA 2XD4A 1ZK4A 4OJTA 1XCLA 1KYYA 3T4EA 4RFSA 5K5EA 1ZNQO 2X9LA 4RNDB 1D2GA 1ULZA 2QYSA 3HKEA 1DZ3A 5G1NA 3E8XA 5TPZD 1KNXA 3SOZA 5LU8A 4H7IA 3AL0C 2H1IA 3ESAA 1PL8A 1SUAA 4RSRA 4Z3OA 5ECYA 5JBQA 2FUCA 4H1UA 3WJAA 2Q50A 1Q16A 3IKTA 3FY4A 2I9KA 2W2NA 3Q8KA 2I65A 3HQ4O 3IAXA 1Z0DA 1DIHA 2AK3A 2XZTA 3MA0A 4IIYA 4IQ8A 3HJTA 1Z4KA 4LJ6A 5BT9A 4OGWA 1WU7A 4FNGA 1Q17A 2IZ6A 3DAPA 4RVHA 5JSQA 1GTZA 1RWPA 2MINA 3I3OA 3GMSA 1B2LA 2B61A 2NSDA 5AYVA 4YH1A 4WJKB 2WYHA 1HG0A 1W1WA 4PX5A 5CW2A 4EI2A 3LZDA 4B3CA 1EDEA 1QR6A 3FYUC 1KY2A 2YZ7A 3L4SO 3M1YA 4WERA 2I2XB 2OAGA 2RKOA 4FD2A 4CHTA 3A1UA 2X6TA 3NC0C 1BJTA 3KELA 4JA2A 1COZA 2PSHA 2HHAA 3THSA 5KTOA 1ES9A 2BF4A 2GEUA 1TK9A 2RI0A 2VT6A 2A67A 3M5CA 4JUIA 4KKXB 4MRAA 1MORA 4BFXA 4KRXA 5CDSA 1X70A 5K05A 1THGA 1WX1A 3I32A 1R74A 1MQ9A 1U2EA 3VUFA 5BSRA 2XUQA 2HLPA 4YXFA 4DR1B 2HIHA 1U28A 3N59A 3QFHA 5GIOE 2I8LA 1UC5B 2OM2A 4DLTA 2V74B 1E4EA 4F7DA 1A7AA 3MBOA 4DY6A 2C7GA 1FSPA 1XXLA 3U40A 1WBJB 4BNVA 1G9SA 1SAYA 3Q5DA 1DEXA 1DRWA 1QRDA 3VGJA 4P98A 4URXR 2M1XA 4A8JC 1HTTA 4QYTA 3R76A 1COWD 2X8WA 3HXPA 1B6SA 4LNUB 4M0UA 1H2XA 1DG3A 3JQAD 4YN3A 4KBYA 2Y2UA 4QLOA 2JAWA 1S7CA 3HL0A 1YKGA 5IVDA 2VAXA 5ERXA 4FWBA 1RAFA 3S0JA 2YL2A 4MHSA 1AGPA 1FS6A 2PH1A 4YJHA 5EE1A 5F1YA 1EUYA 4IJ5A 2FOIA 2AR0A 1KS2A 1MA0A 3SF8A 1NVUQ 2II6A 1ZWLA 3KXLA 1MC8A 1BSVA 1BWRA 3G23A 2AMFA 4UPVA 3N2NA 3ORHA 1UBKS 3EFBA 4ZYYA 10MHA 1U31A 2GZAA 3F8WA 2RBKA 4QL3A 2QP9X 4XCXA 3OLQA 4IDGA 1O3YA 2CVZA 1JQDA 3G0DA 2P9CA 2G1UA 1FK8A 4ML3A 4ZGBA 1D8TA 4EUEA 5HF6A 1H6BA 1XKQA 4DMKA 4UFOA 5CA0B 5E0OA 3PGKA 1CIVA 1UT6A 2ZYSA 5H83A 2CXNA 3UN1A 3A1WA 4JVLA 2HSDA 3D8UA 1E1LA 3ZI7A 4DLNA 4EG1A 1UUFA 3GJ5A 3I2YX 2NPFA 3RRFA 1ZRHA 5A6SA 2HMYB 4ATNA 5AW6A 3OECA 3R0XA 1WXFA 4M1WA 4C89A 3I92A 2QGNA 3QTBA 4BZZA 3SXJA 3DHYA 3MERA 4MUYA 4KK4A 1IK4A 1I1QB 1FRVA 2D3WA 3Q3CA 1FYFA 3H8WA 4C30A 1WD7A 2CEAA 3MJCA 1IOVA 3T8YA 1XCOA 2LPMA 1UEIA 1ONPA 4KUHA 5ELMA 4Q3NA 4OREX 1ZNWA 2PS1A 3DLIA 4UNPA 2DU8A 4LWOA 3ZHVA 9LDTA 9GPBA 3VAZA 3GBPA 3OJCA 2C5EA 1D2AA 1V1RB 4WW0A 5SY6A 5I8PA 1MVNA 1XNHA 1TMYA 4OQMA 3AYXB 4D92A 4ESVA 4HGRA 2IXEA 3Q1KA 4XRGA 3CH7A 3NV7A 4RTOA 5HK8A 5BSGA 1JG1A 1L9KA 4DIOA 4UE3S 1NU6A 1YBHA 1YQUA 2I3GA 2P4SA 2NYAA 3RC8A 1NBME 1TRHA 3FIUA 3MS7A 5U4XA 3RJ9A 5BV8A 3CZQA 2BJVA 1H0KA 3QJGA 2EBUA 2QXTA 2RHOA 2DR3A 1TYCA 2C94A 3C98A 4XR9A 3SVZA 4F3YA 2ZXUA 4RESA 3A1DA 1NJFA 1HSZA 3CKMA 1V8FA 2RH5A 2W8BB 3REFA 1QU2A 4F4IA 1VCHA 3D0KA 5FWAA 1Z0UA 2AN1A 1EBBA 3IAAA 1NQAO 1AXEA 4ZVSA 1XNJA 4TLMB 3DUFB 4L22A 4FFSA 3OWXA 2AWOA 1M1YE 1RAGA 4I99A 3ZXSA 3BYZA 3GIDA 1OXMA 1C1YA 2FLVA 2YMLA 3CX3A 1FZTA 2DRIA 1G18A 4DIKA 3WZLA 1ACJA 1SKQA 1RHJA 1Z2EA 2B7BA 3IHWA 3ABSB 2FEPA 2BFEA 1B16A 4TL6A 1DAOA 3MBIA 2OHGA 1TQ2A 1EA7A 4KFSA 1DBWA 1KO1A 2NNLD 1K75A 5DMXA 5CNIA 1C7IA 1MABB 2VUSA 2RHMA 4ZDWA 1A8UA 2JVIA 4FYWA 4P4SB 4CQMB 3IB3A 4ZYLA 5J2TA 4NI5A 2GF9A 4B2IA 1QFXA 3OCXA 2R0QC 1I30A 1VLVA 4W8HA 4YTEA 5HG0A 3SSAA 4MQFA 1L5HB 5EZYB 4HRVA 3H13A 1AKWA 1FTYA 1Y8QB 5M2QA 1D2MA 3IEXA 3PXBA 1HLFA 3ACDA 3WO1A 4BATA 4DLVA 4W1QA 1G8YA 4E31A 2JFXA 3QLVC 5YASA 1RYNA 1IB0A 1KEKA 4R2MA 1OXVA 1M1NB 3HSKA 1J0XO 2H0RA 4MRRA 4TKUA 4KO3S 4MR8B 4MMYB 2Q41A 2IYSA 1Z35A 3KXKA 3RLFA 3BDVA 4HXFB 4YJDA 2OQ2A 4W63A 1S3IA 2Z6QA 1BG6A 3QHQA 4GZ3A 1SG9A 3LFHA 4LMRA 3T1OA 2AN5A 4GR5A 4PG6A 4UW9A 4WLOA 3VH4A 2ZTSA 3R7NA 1K9VF 3QVGB 1S3GA 2Q6KA 3AJ8A 4NZPA 1OY1A 3WNVA 4B6JA 4LXQA 2OO5C 1F51E 3IV9A 3Q85A 4LCBA 2C92A 3FKJA 4IDNA 1V5WA 4C04A 3AM5A 4KRFA 2C54A 3GG9A 3GLGB 4I3GA 3RADC 3QI2A 2ECOA 3ZWBA 4IR7A 3MWLA 5JH7F 3DZHA 3U4QB 2Y92A 2G04A 2GN0A 4NK4A 3AYZB 4O08A 4MDEA 1KJIA 4G0NA 4MQ6A 3AHGA 3HO8A 4C7VA 4BP1A 2Q3BA 4X7PA 1R0RE 3CURA 3MTAA 1QB7A 4G9EA 4QXAA 4IV8A 4ECEA 4JX9A 3DDCA 5HM6A 3F9CA 3O4VA 1XVVA 2CSUA 1FUIA 3D64A 3VZSA 4ZK6A 2AFIB 2B30A 4BVEA 1KAQA 1UPUA 4JBWA 2GM9A 4P5PA 4PN7A 5JVDF 5AW0A 4EPYA 3U6BA 3R7WB 3K6KA 3MK31 3OETA 4QOJA 2B8JA 1M83A 2EQAA 5CDTA 4MEJA 5F9HA 1LPNA 2Q5HA 2QRGA 4RAOA 4V24A 1U7DA 2FPIA 3JTEA 1X8KA 3JALA 1L5KA 1T2VA 2H51A 3K0FA 4OGFA 4WINA 5GGXA 3RTGA 4CR6A 1JEQB 2FY8A 4EGCB 5JC8A 1YHNA 2WD8A 4KO1S 2EJUA 2FVYA 3I9JA 1LBQA 2X8LA 1KDTA 2ZJOA 3OLYA 1RBMA 2N9UA 4ITVA 1SC3A 4J49A 4MVJD 4TXHA 4UQPA 4ROTA 5FR1A 2HMSA 3R4CA 4I9UA 1I1OA 2QGZA 1ZU4A 2R5NA 3RS5A 4W1PA 2EG5A 4YRSA 5K4AA 1VSUA 4ZOLF 4HTAA 2XR1A 4PNZA 2ZUCA 2F3RA 2GBLC 2C97A 3I64A 3V4PB 2YJNA 3DSRA 3AX6A 4Q9HA 3EPKA 4I55F 4JL6A 2IYTA 3IA2A 1EFAA 3KO8A 3NIBA 5DNYB 5JPDA 3MWDA 4EGJA 1N8NA 3KCNA 3SS8A 3M3HA 3ZV7A 4YONB 3TLMA 3DJFA 4ZXPA 3IHLA 4CF5A 1SELA 3JQFA 3BMOA 3OBIA 1QONA 4OM8A 1VLHA 2NPIA 3QUAA 4OUDB 5G40A 3UJ6A 1WCV1 2QPAA 2O5RA 3L0OA 4GXRA 2Q1UA 4JN6B 4WCVA 3SI7A 2I6SA 1GTMA 5CVUA 4QASA 1ZDMA 2P8SA 3L8DA 4IGIA 4DYHA 4BIIA 1UJMA 1KAHA 4UTOA 3UENA 1DIOB 3GUYA 1ACMA 3KPWA 1UK6A 1DEHA 4NICA 1W76A 2P5TB 4DDHA 5ES3A 1RZVA 1Z4NA 3IODA 3KL2A 3UPTA 2Z6VA 2QM7A 2GEFA 3E9NA 2JJ8A 4MV9A 5TQ0B 1MAAA 2DBQA 1Y82A 3PC8A 5DGDA 5AIBA 1LTHR 3A3PA 3CF4A 4DA4A 4B47A 3L3BA 3LIIA 1QANA 2VPYA 4L3VA 1Q3TA 1OFGA 2GZDA 3FNBA 3K05A 2OCKA 4QUHA 3G79A 2UXCB 4KQ9A 2J7PD 5CM2Z 1R9NA 1GRCA 2EKBA 3E18A 3GPIA 1P4GA 1PL7A 1K2WA 3WSTA 4BTLA 4EG3A 4XWTA 4R2HA 2XXAA 5H4HA 3F74A 1VYUA 2H07A 4JMPA 5KSPA 2HMAA 4HNRA 3IESA 1ISMA 2QP3A 1ZZGA 2LXNA 4CMIB 4EJSA 2FWIA 1WHSA 2ZSKA 3T9AA 4D74A 1MZPA 3MXTA 4BKQA 2PL3A 2WM2A 4U3JB 3HH8A 1UQUA 4ISBA 3QWBA 1K3FA 4AK9A 4IGAA 1X3LA 5IT5A 1A9QA 1YZVA 1U2DC 2K7ZA 5JJ5A 2VPQA 1H1LA 3COSA 3MOSA 1VL6A 1DUSA 3AETB 4PTYA 5EOVA 2KB0A 3BXEA 4BMSA 1EA5A 3C4QA 3QLTA 1JBEA 5DLEA 1QXSA 3KOZA 1NW7A 4YDRA 4YLGA 3VYVA 4PGGA 5EVJA 4BFWA 3S55A 1N4DA 3OX1A 1Y9JA 1TXGA 2SNIE 4QUBA 4GX0A 3HO6A 4MS1A 3GAMA 4K26A 3WADA 1A50B 1VKZA 2N3ZA 5IUJC 3GCGA 2P2DA 4JROA 3GEBA 4TWRA 3MEQA 2F4NA 3PNOA 3Q3EA 4WZAB 2AJ8A 2FJPA 2HTEA 2PH3A 3BIXA 4F2GA 2IK8A 1DDIA 5AW7A 5LYYA 3UT6A 1VBNA 3JQDA 2J07A 2VF7A 2HLDA 5AW5A 4Z6KA 3FROA 1DZIA 4B3IA 5F1KA 1K4KA 1QDUA 2NW6A 5B58T 1N32B 2JZOA 4XWGA 5GJWC 3DPUA 4EB0A 1NJSA 2VYNA 4ZWNA 4NV3A 1D09A 1SBHA 1XAJA 1P19A 5IFLA 2ZU6A 3JQEA 1HE4A 1IIBA 4F3RA 1ZQ1A 1IY9A 1GYRA 1M74A 3VH2A 3PD0A 2DQSA 3GEDA 3PPXA 1IBKB 1C9EA 1KZ9A 4AF8A 3D4NA 1G6KA 2AYZA 4EGQA 2GN8A 1YZ3A 4JOSA 1DKLA 4E32A 1TAGA 3UB2A 2C2BA 5TJ9A 1EUDB 1RJ9B 4HDOB 1L5RA 2EZ4A 5DGHA 5TS2A 1BEEA 3OFND 1S96A 1KSJA 1BU8A 1JRLA 3FCEA 3K6SB 5BWBA 2OUKA 4G9GA 1NP3A 2XGSA 3WX0A 1RM4A 4PZUA 1BNCA 1IM8A 1NUAA 1P9LA 2OSVA 4L8FA 3U3MA 5ISMA 3VKGA 4G0UA 1QIFA 5H0IA 3P32A 5FL7D 3RJTA 3H11A 2XDYA 3F2VA 3AF3A 4WZBB 1C1XA 2HO5A 5AKEA 3TR6A 1JSZA 3ENVA 2PKEA 4HGYA 4ZU1X 4U00A 4DILA 2FK7A 1W36B 3WTBA 2VHWA 2C83A 2VAVA 1OXTA 4IGEA 3ASVA 4NIMA 5M3BA 2IEIA 1K8XB 4XQCA 2R1VB 4K2AA 4U7PB 1KAEA 3HXOA 1I24A 2GPJA 5HBRA 3UMMA 1UFRA 3BORA 3ETDA 2O7QA 3OZAA 5DT2A 3ZCXA 5FYQA 2JI6A 3DF7A 2ZJ1A 3K0KA 4HD8A 4PLWA 5L51A 1Q83A 3GLSA 3H19A 3KCQA 3QVMA 4Y8VA 3ZDXB 2V8OA 1YQEA 3N2EA 1IWPB 1N6OA 2EAUA 2OAQ1 3L1KA 1NTOA 3PIIA 3ZGYA 4NZNA 1HI9A 2LRHA 2WKWA 3IGFA 5AVWA 4BO8A 2BKUA 3C85A 1ESEA 1O97C 1P0PA 3O8OB 1FNNA 2ZI9A 2DFVA 2ZBDA 1OX6A 3E2IA 3LA6A 1XQXA 4ZT2A 1RAEA 2A94A 3GEPA 3LQKA 4OFXA 1PHPA 2JCXA 3KKKA 2RK6A 4JBNA 4Q3DA 4Q0MA 3FSRA 3BWBA 3KUDA 2C5SA 3OZ7A 3IIEA 4EY7A 5C5CA 5GPBA 2Y77A 4G9BA 5A0TA 2IHVA 4LZAA 3ZJUA 3GPCA 1WDLA 2RK4A 3P9KA 1D2HA 1PZEA 3G2OA 1TIPA 3L4EA 3P7MA 3EFOB 2CL6X 4JLUA 1GA4A 4P53A 3LXRA 2BM1A 4JQOA 2IY8A 4ZMRA 1E9RA 3FGOA 2AUNA 3PDWA 3P9RA 1X2EA 3E22A 2OP1A 4DV3B 3DA8A 2JBAA 5C34B 3NIFB 2BGWA 2DFTA 3JD3A 2H1WA 3T1TA 1WUHS 2VJNA 3AFOA 3IP9A 2WU3A 1P9NA 4IJVA 2C31A 4KR9A 3THOA 1P0CA 3R44A 3U39A 1DKNA 2HJ9A 1CY4A 4LG1A 1YJAA 1HUQA 4Z1MD 5BV2P 2SKDA 3S5UA 1QQBA 4BC0A 2XB6A 4MWOA 5LNK1 3IT1A 1DBIA 3BE8A 4GLOA 1DWPA 3EXIA 3VYUB 4F9GA 4K9PA 4PYOA 3USZA 3GMIA 1LI4A 5C1PA 3EG9B 3SJZA 3WXBA 1ZL2A 2P9TA 4I4TB 4BASA 5JAZA 2PUGA 3GNSA 3HYTA 4REQA 3PTAA 4OG2A 3T4PA 5AK0A 5JQGB 3VRHA 4HDNA 2XXBA 4Y6GB 3KRTA 4I8XA 4J2TA 2V4ZA 2V7EA 4J0FA 1YE3A 3PWSA 4PONA 5EQTA 5J23A 3EC2A 3UOAB 1IPFA 2BHNA 2GPWA 4DSTA 1KKLA 5AVYA 1JX6A 2WBLC 3BMNB 2W9XA 4ZAZA 2HUPA 4H1VA 1TADA 2RHLA 2PX3A 2YWBA 2REQB 3RM3A 1DQZA 5KTYA 4W5QA 1YZNA 1YZUA 2L17A 2XUKA 2VDOB 1WULS 2HA5A 3KKEA 4GECA 1VIYA 2C04A 4NU5A 3FDZB 4XQEA 1HETA 2P7HA 2YOGA 1E0AA 4NBKA 4HKTA 2CL7X 1P31A 4D2IA 1TQ6A 2D00A 4CM5A 2P6MA 2VH2A 5LZ5A 1Q0SA 4A1OA 1ARZA 4PSDA 1N5JA 1EFLA 3ZV6A 3B52X 3CW9A 4N9WA 3M33A 4ZEXA 5CDGA 3AVUA 4X92A 3WGUA 4MV6A 4FR5A 3TIVA 1VE6A 2Y4NA 3ZJ5A 1GQ2A 3GPBA 3OM8A 4NPAA 3LC7O 1DJMA 2A5YB 3HZHA 3P4YA 4QFMA 1OV4A 4ZDIA 3ZKWA 2VP5A 4X93A 1RZRA 5IASA 3KSUA 4KXMA 4Q4LA 5CCEA 4E7PA 2F2TA 4BLRA 4K6FA 4QBFA 3NOVA 3EPJA 5C8VA 1SZDA 5GVRA 3ROPA 4NS1A 4CL8A 5AESA 3TTYA 3ZU4A 1EX9A 1EUCB 1N3YA 1S8OA 2E4VA 5KCZA 1DIRA 3GJRA 4N03A 1MP0A 1MAVA 4UEOA 4XD7A 1D0VA 4AJEA 1Y3BE 3ABRB 1EH5A 3QFRA 1XTPA 3HLKA 1ZNZA 4NECA 3T7KA 3BD6A 2OA0A 2GPYA 4I4NA 3PRHA 1Y3FE 3BILA 4KQ2A 4RSGA 3GIWA 4E08A 1EX1A 2E9SA 3WP0A 1PBTA 4I81A 2BI7A 5IZCA 2OYRA 3OMLA 3DAGA 5A9SB 4HN2A 2DY0A 4DWVA 4OY3A 4TWAA 5C37A 1RTKA 2GJSA 4UOEA 4Y1GA 5DWQA 4MWTA 2ERCA 4P92A 3Q7RA 4I8IA 2X3YA 3KB6A 4KAJA 1SQGA 3LWNA 4P22A 3IE2A 2D2IA 3C4JA 3FSGD 4HXEB 2RKBA 3ZWXA 4F86A 5JSHA 4BJHB 4YI5A 1B43A 1K0FA 1E2IA 2WSIA 2X4IA 3I52A 4LA4A 4DRZA 5IYZB 5JZ9A 4CKXA 2PVPA 4HWSA 4XDGA 2EEZA 5SYNA 1RPAA 2ZBQA 2IUUA 3TGLA 1ADFA 1GCUA 1QORA 4GW3A 4Q66C 1GQRA 3IAHA 1VJ5A 3MWEA 3T1NA 4AZTA 3HCNA 4LYEA 4DMLA 3VSAA 4RQAA 3C5CA 4CIAA 2H29A 3OZWA 1E1NA 2DFPA 5IJXA 3H2ZA 3KJEA 1F48A 4OB7A 3B1KA 5HKLA 1NVVR 1WZEA 4HO1X 2I2FA 1NYLA 2XTNA 5LP6F 1QH1B 2YWGA 5D86A 4XQ9A 3L0IB 2IC5A 1O9GA 1S9HA 5A4JA 1ODFA 4ZDJA 2H63A 1QYDA 4LZNA 4ARSA 3GVCA 3R41A 2E1PA 2WF9A 4H0NA 3WB2A 2XUPA 4Z9FA 1DAMA 5ALGA 2HF9A 5HJ7A 2VHYA 3USCS 2RJOA 2QI9C 3O9MA 2CFSA 2VNKA 5JJIA 5C8YA 3ZY6A 4CLDA 3WGNA 2WE7A 3JQ8A 1VYVA 4HEHA 3T61A 4PYRA 2A1UA 2IDZA 3PCXA 1NRXA 3V7FA 1H65A 5ED4A 2ZUWA 1I2MA 5EXPA 1SBYA 1WB9A 1EGHA 4FBLA 2A9QA 3OZXA 4CTKA 1YZHA 4EH1A 1U1CA 2IPOA 2AVNA 2R11A 2AR9A 3IAS6 4PY2A 3QE4A 3ZWCA 2WMYA 4C05A 5BRNA 3K5IA 3SG0A 4GMXA 4WK2B 1OU0A 1JTVA 1GFZA 3WIBA 2QZ4A 2Y1OA 3ZVNA 3FIJA 3W8FA 3TOCA 2Q3EA 1OIWA 1L7BA 3N6RA 1OV6A 4OH7A 3HUUA 5HCUA 1VPLA 5CEEA 1WOYA 4XA8A 3SN6A 4CMAA 3K71B 2OZLB 4DPMA 3GW8A 3K0HA 1JKJA 1GSIA 1JIJA 2O52A 4RYLA 4R84A 4JZYA 1R3DA 3I45A 3X1JA 4PWZA 3ZV4A 2FEKA 1Z08A 1GILA 4K9DA 1KQNA 4PCLA 1WUTA 1T26A 1UQRA 4UNQA 3SQMA 4F3CA 1IOWA 3B8HA 2AWNA 3TPFA 2RIRA 4CQLB 2A35A 4CMHA 5HMLA 3BJRA 2PO5A 1QVWA 3F0TA 1X7WB 5SY4A 2B8NA 1R88A 2DUWA 1DQSA 4QXRA 3ET5A 2G0TA 5EWJB 5ALKA 4U8HA 2UDPA 1M2OA 1DIGA 3SKVA 4TKVA 5LIRA 3DW1X 1THMA 3VPAA 2CN1A 1OT5A 5CB4B 4C6SA 4DA7A 1LRJA 2PZJA 4F6RB 1M6VA 3EFEA 3E5MA 2XMZA 3FVWA 3LX8A 3OQJA 3JS5A 4DLUA 4J2HA 3SPXA 3SXUA 5EYPA 5JEEA 4KXQA 2I76A 1XVUA 4YK7A 2YWFA 3OX2A 1CUHA 1RKQA 3TE7A 2SICE 2JIDA 3X2FA 2IEBA 5FPTA 4OFBA 3HKBA 5K0NA 1SC9A 2DCUA 3CSUA 1LNQA 4AO8A 1TQDA 1IUKA 4CWAA 3VYWA 4FB4A 3ZBTA 3HB9A 1BRMA 1P61B 1OBCA 3TEJA 3HDYA 4PC6A 4XPIB 1Z5OA 2CD7A 1B3RA 1ESMA 4FGWA 3MT9A 4S12A 1PL0A 3B70A 3T7EA 5JECA 3KT3A 3GD5A 3PLNA 2H4HA 4KX3A 3FCCA 2F3TA 1N7JA 2FPOA 2HCRA 2QZPA 2XMGA 4M7PA 4NAHA 1U1IA 4Q01A 3T9FA 3WGZA 5C1BA 1BYIA 1UH5A 4HS9A 4XVCA 2R00C 3K5PA 1SXJC 1C50A 2FPSA 1MC5A 4KYVA 2VPZA 5FOUA 3RASA 4AB1A 2RHHA 4U6SA 5KQSA 1UDAA 1C30B 1P0QA 1X80B 5E6RA 1DDGA 3VMMA 3WXMA 5KOHB 3BCHA 4X65B 2WLSA 3DE4X 3DHNA 4L27A 3TW8A 5CG1A 2QDXA 3Q7TA 4LJRA 1JQLB 3KJIA 2JVJA 3K9HA 2G4LA 2W2LD 1J56A 4PPGA 4FCCA 5ADUS 2O0JA 2ZM6B 1DHRA 1UC9A 3PGLA 3DHVA 1AX9A 2D2XA 3UG7A 1A5TA 2GERA 1EP2B 2VWPA 3NBQA 1HRKA 4DR6B 3S7ZA 1ABFA 4RPHA 2BF7A 4CTMA 3ZLJA 4LOJA 4F21A 4DSUA 3H1EA 1MJGA 1TKBA 1UP4A 2HQBA 2KWIA 1XVIA 3BF7A 3R5FA 3RSLA 1WP9A 2PX0A 4OHVA 4BKUA 3QEBZ 1YTUA 2H3HA 3E9RA 2VYQA 4ALJA 4MVJF 1KVQA 3DVLA 4G63A 2FR8A 3TRJA 2Z04A 4X66B 3X1XA 2D5CA 1SHLA 3PUVA 1GQYA 1K86A 4AWAA 2ZB4A 1YONA 3OURA 2CVQA 4JP1A 4QFCA 4BMVA 4QULA 1FP7A 2QRKA 3AW8A 2FP4B 3BGVA 1ID1A 5D6OA 2FSFA 5L95A 4WEOA 1D03A 3DZJA 3SGLA 4NCBA 5TPWB 1ZNXA 2ZLBA 4N7JA 5FOTA 1V1JA 4ETWA 3CVUA 3B5EA 2GT1A 2PUTA 2R97A 3IQIX 4QC2A 3AF1A 4R41A 2A4KA 5IC6A 5GJBA 1Z47A 4X90A 1XL0A 4IIGA 4B4UA 4DCCA 5AQ1A 2IDMA 1LSJA 1PIWA 3DS8A 4EO9A 4EFMA 2OKGA 4I5DA 5L40A 5L3QB 1G8JA 3COJA 4DBLE 1TA9A 5J1SB 1TMOA 2GAAA 3CWQA 3AJRA 3GJTA 2VS1A 3ODPA 4XD2A 5FV7A 2WVAA 3PXDA 1YK0A 3GPDG 3V5NA 1NPDA 1Z37A 4O8ZA 4ZI3A 3SS9X 4OXIA 4YMWA 4MARA 3TIXB 1JHRA 2PQMA 3SC3A 1P77A 1QFJA 3BAZA 4TLAA 3TQTA 2FG5A 1U11A 1YS9A 2DWUA 2C7RA 1E2BA 4HDMB 3O8RA 1VIMA 2Z9BA 2ZYHA 3F4LA 4UBIA 4GX1A 4AJ9A 3OT1A 3TVDA 3ZNNA 4BNZA 3PPVA 3NTRA 4H6PA 1GZDA 1U02A 2JH9A 4GG1A 4MWEA 2O8EA 3U7EB 1XDGA 1UZNA 1QF6A 1JTEA 3DOIA 1WEHA 3LECA 5SZJA 1A2QA 2EJCA 5IC4A 1DXYA 2H1FA 1S2DA 2CB0A 2VHZA 1Z73A 2OG1A 3AC0A 3DDZX 1G9XA 1WCIB 2XNKA 3HNOA 3M89A 3Q2KA 2Q5LA 1BVRA 1L8OA 1AKVA 4MRMB 3EUFA 4DLPA 5HP4A 2JD1A 1G2OA 3BWMA 2XD9A 3ZIAD 1UFVA 1FSZA 4FSXA 4NATA 1U5BB 4C5BA 1KFCB 1I7LA 3Q3JB 1A2OA 3U09A 3H4MA 3V00A 4IS2A 1GNTA 1M1YB 2GBPA 1ZH6A 2QN7A 2WWTA 1KEPA 2OCDA 3GOHA 1F2TB 3NONA 3WWCA 1ADGA 4D9GA 4QQNA 5KHAA 3SWWA 2HXSA 4MRSA 4RTKA 2FPPA 4DDVA 3CNNA 1IM5A 1NVFA 2RGBA 1E69A 3VYTB 3ZLBA 3ELBA 5D3ZA 3PXCX 5KI6A 1AMNA 4FZ3A 2EL9A 3LW8A 3PWTA 4MRVA 1A1VA 2WPDA 3OTWA 5J2UA 3FOZA 1Y8AA 2F1IA 3BH6A 1I6MA 4UTPA 3O3OB 1HYHA 3UW1A 3RYFA 1LW6E 2C0CA 4E2XA 2RHBA 4GQAA 4HJRA 1BQEA 4RZHA 3MM4A 5LU9A 4X8LA 3UWDA 3N87A 4DV1B 4EI8A 2C96A 3BZWA 3H2YA 1CVIA 2QV0A 3L18A 1X19A 5LQCA 3KL4A 1T3HA 3NVMB 4CF3A 1RWQA 2O3SA 4PG4A 2AE1A 4DCMA 5JDIA 5BW4A 4YUZA 1U0EA 1DDOA 4JLOA 5AT1A 3K35A 1KJ9A 5FQOA 4P7JA 2HFJA 3LLSA 2ZPTX 5TQJA 4TPKA 4DL9A 4C0JA 2PAFA 2V7VA 1JR3A 3U0BA 4CKCA 1PX2A 2UZ1B 3JWJA 3C3KA 4AJ2A 3CIFA 4IX1A 5U1PA 1CY2A 2ZIXB 3RIEA 4CEHB 2DHDA 2GNPA 2IOFK 3QVTA 4NYIQ 2XBUA 2O3JA 2NZWA 1GGEA 6PFKA 1U0HC 1OYWA 4ZIRA 1VCIA 3PNQA 2W43A 1YR7A 3H6KA 4XYMA 2VCYA 3N0VA 2QENA 4OPMA 4U1RA 1ZGGA 2ALJA 2Q5EA 5D2CA 5ITWA 5ER9A 4PTLA 3F6CA 3RT7A 4M8IA 3M6AA 4ERXA 4XLLA 3OIFA 4GYJA 3P9ZA 1WUIS 4II2A 3S8MA 6LDHA 3K9FC 2EW1A 1CETA 3KWFA 1HL3A 1DTEA 1CULC 3LFUA 2YY5A 5D5QA 1T6XA 1CC1S 3SF0A 4OLAA 3VU8A 3EXHB 3W8DA 3NDJA 3S2FA 3KR9A 1QHHA 4EKYA 5DASA 2CCGA 4DHWA 4K9NA 4FYPA 2HCBA 1AKEA 3WYGA 4TMWA 4L15A 1GUYA 1UOPA 4IHJF 2QB5A 4LCJA 4XQ0A 1ORVA 2X0RA 3H42B 4KAXA 5DM4A 5HIJA 4Z4IA 3RFCA 2IEZA 2UVQA 4P6VF 3BEOA 3RK1A 1RWOA 3OOJA 1GGVA 3L0BA 2XZLA 3IIIA 3KQSA 4HGNA 3FTEA 1KHTA 3NS7A 1ULAA 3AI1A 4XB2A 2JIPA 1YOVA 2BRUA 4RK6A 3OF5A 1KAOA 3IO3A 2W6QA 4UUAA 4CNQA 3CJQA 4L50A 4B6QA 4KKVA 4JI5B 3IVRA 3FLAA 4HB0A 4CR8A 4PN3A 4GC5A 1QO7A 2QYHA 4EUFA 3HWWA 4CETA 2CCKA 4RIIA 4UD2A 1HM5A 3KHKA 2AJTA 3R74A 1Z36A 1NASA 4YCDA 3C3CA 4TV8F 2WD9A 1GKLA 3PENA 3K5WA 4FQ8A 1NG1A 1H69A 3TTVA 5BSVA 4K9OA 1EWRA 2Z2XA 2JLAA 1UZMA 4LDRA 2C9ZA 4UNNA 1N6IA 4MVJE 1LTQA 1ISRA 1V5GA 1EJBA 1QHIA 2VJMA 1RRGA 2Z43A 5DTIA 2BMFA 3A6GA 5ARCA 4X85A 3T7CA 1I0LA 3Q5GA 5NLLA 1F7VA 2JAQA 5HYVA 4KZKA 3QIVA 4R8KA 3IMKA 3KQPA 5E9WA 3WKAA 3X43A 2PUEA 1GUDA 1J22A 1XCJA 1AO0A 4LDNA 4C4YA 3G2KA 3RS3A 3W2IA 5HGXA 1FZQA 1WAMA 1ZESA 3I6IA 2PKYX 1K9SA 3ZYCA 2GF2A 4PSAA 4EF5A 1RWWA 1S4MA 4JOQA 2AZXA 3RS0A 4ZU6X 4DWOA 2Q2QA 3SNKA 3W5BA 1B73A 3DV0A 3TX2A 2VK1A 5HJ5A 1TF5A 5HKAA 1SXQA 4BU0A 2GM4A 2Y9MB 2ID7A 1Z68A 3WYAA 3NYQA 2AIRA 2DE0X 5F7OA 3KZ1E 3FPHA 1ZZEA 2YKGA 4ZV7A 1SBTA 1SC1A 3FHLA 1Z7WA 4M88A 3PGA1 5HDQA 1D6MA 1PNQA 3ESRA 1RM5A 3E6AA 1PN3A 1X86B 3R6GA 4L16A 1YVPA 3NASA 1C8VB 1CUYA 4N3CA 4RQUA 2FKAA 1CEYA 1NPYA 2KW5A 1ZINA 2QK4A 1H2AS 2G6BA 2YZGA 1VZ2A 2VUUA 1BXRB 1D07A 1Z5GA 1SQ6A 3DONA 3EZFA 2AMJA 2X9GA 1T5OA 3DVAA 2MT9A 3OKCA 3OZFA 3IQXA 1X7ZB 3B85A 4Z99A 2EXXA 2YV4A 3FOWA 3FYCA 1KY4A 3L02A 4GZ6A 3M9WA 5CUQA 2WHRA 5HFJA 3VO9A 3W2HA 2FR0A 1CTQA 4ND5A 1L1EA 3PFFA 4LQLA 5I9MA 5KNBD 1AS2A 5AVSA 2GASA 2WT4A 2ZZMA 3B82A 1VHJA 5CIQA 3NBMA 2BP7A 1WW8A 3NCTA 4ODIA 1TZ2A 1I5OA 3K30A 5BORA 5AVOA 1YR3A 4JDUA 1JEDA 1Z2CA 2HMUA 3DT6A 3H0KA 3JYLA 4KXUA 1A97A 2G82A 1QH8B 2CF6A 4LJ7A 3T06B 3C7AA 1KOJA 3ONNA 4R0MA 2WMNB 2XNSA 3GJ7A 3IDZA 2BFCB 5K0JA 3UAYA 2CK3D 3AERA 3AUXA 2KLBA 3I4FA 1OILA 4Q4DA 4D5GA 2P67A 3EY9A 3D3WB 1BO6A 2WFAA 1S7GA 3VI3B 3REOA 3LLVA 4KOAA 1SUEA 4DDKA 3VU9A 4A91A 1L9XA 4TTVA 1YWGO 4IH1A 5JNVA 2PWBA 4EBFA 3O4GA 1XPOA 2FQ1A 4PHHA 1XTVA 3D7KA 3OD5A 5KJCA 1AUXA 2CLEB 1YS7A 5LDGA 4M8KA 2ZULA 1C9DB 4CM9D 1DVRA 3RSHA 3DP9A 4HH1A 1H2YA 4L5YA 1F4VA 1G20A 4MVJG 4AMBA 4LBYA 4WOBA 1Z4OA 1VGRA 4JB0A 5CNMA 2NZ2A 3BMQA 5EJ4A 1HE1C 4QYWA 4UQOA 3ZE2B 2JCVA 3WNDA 1VP3A 3I9FA 4FJ1A 4IINA 4MTCA 2VP4A 4E4RA 1HLGA 2C84A 1E5LA 4Y6RA 2OTCA 2I6TA 2KE5A 2WAMA 3GR6A 3WY9A 1ECFA 3DKVA 1SN7A 4Y7CA 4RKRA 2N75A 3EDCA 1NW5A 4JXKA 2WSLA 3I39X 1QV7A 3DVSX 4UARA 4QHSA 4C6HA 4DB4A 1OYYA 1ZD3A 5GJVC 1N2EA 3EDQA 4QA9A 3NDPA 2BY4A 1G60A 5D5HA 2PRIA 3KPUA 2W6IA 4FC7A 3G5LA 1ZBQA 3F7NA 4QTUB 4BO4A 4B3RB 2G80A 3IAEA 5TR9A 3QF4B 2CL5A 2I0FA 4G84A 1RCFA 1TL7C 2H4JA 4FOPA 4DCTA 4HX9A 3ENWA 3RREA 3TD9A 3KYDB 5CFZA 5KNCH 4CMEC 4ZC1A 2IHJA 4JYCA 4WA8A 4B85A 2PANA 2P40A 4JEHA 4MCIA 4EOGA 1G4UR 3QM1A 5E6UB 1QF7A 2C2WA 1X9HA 3FHOA 1N2OA 4Z4QA 1N75A 1LS6A 2ZGVA 1RHQA 1YQQA 5AOCA 5CA1F 5HXAA 4RD0A 3TKYA 3D0RA 1MU0A 1L5WA 1Q7TA 1Z6TA 5E1DA 4FFBB 5JVDB 3VU3A 1OXBB 1TQ8A 5F76A 3UO8B 2RIPA 3LUHA 3N9IA 5FLEX 3BGWA 4IMRA 2A84A 2A30A 3Q6IA 4AYTA 4YUAA 3UMGA 3GFGA 1QVAA 2FSVA 4CLOA 1HSOA 3S68A 5BYKA 2Q3JA 1PL6A 5EMLA 1ZA2A 4CM7A 1JE0A 3WL3A 1Q77A 2NPOA 5CGZA 4WCFB 5COBA 4MVCA 2I2WA 3O26A 4C03A 1C3OB 4G5QA 3TRIA 3FPLA 1NFFA 2BGTA 1XYGA 3HP1A 4ZOLB 2GN4A 5FWXA 4YUXA 3JRWA 4N3NA 1SCKA 3KPJA 4KACA 4B46A 4BB5A 3DYVA 4URZR 4EVRA 5JSFA 2IV3A 4RVNA 3E23A 1JR2A 1MH1A 4R1QA 3AW9A 4H0CA 1ZEJA 1YNSA 5FJJA 5BW6B 3MS4A 1AQLA 1LDEA 1HXHA 1R8XA 1Z45A 3L0DA 4HQFA 2ECPA 3C6MA 3KIPA 4FCWA 1O95D 2O50A 3LBFA 4RFVA 3WLJA 4B45A 5ECWA 4MVXA 1ZYUA 1IK6A 1TVKA 2IJGX 4PM4A 1JEYA 2ONJA 1ISFA 1H0HA 4ARZB 4H17A 3G5TA 4OX9Y 1TW2A 3LGXA 3TKLA 2Q4OA 3LQ2A 1JLLB 3F7MA 4PEVA 2WU8A 2VNHA 3SD7A 2G25A 2OV8A 2B6HA 2RGYA 3B1YA 1NKSA 3KQYA 3LFTA 3NALA 4MKGA 1BFDA 4UUBA 1J7KA 1G5RA 3HKDA 3MJ4A 1Q0QA 4FT2A 4LDQA 3T3DA 1VKJA 3L6BA 2C61A 3NUQA 4KXLA 1SPXA 4FFMA 2AT1A 5IMSA 4ZI7F 3IEPA 1XVAA 3ICOA 2IYXA 3V4FA 3I2GA 2CNWD 2K6GA 3GRFA 3WWOA 3QPAA 4IEIA 2YNMA 5AJHA 1U8TA 3EBLA 3QMPA 3EIXA 3QEMB 5FOQA 3ZX5A 3DTNA 5K3OA 3RRZA 2H65A 4KHZA 1FFXA 5F73A 3NHYA 3VBCA 4EUNA 1YZQA 3JWGA 4MUHA 2IZ1A 1O94A 2QTTA 5HM8A 5EP1A 3RYCA 1JU4A 3BXZA 4UJ5A 1D0IA 4FHDA 1DAGA 1OBVA 4ZQEA 2F55A 1WXGA 2RBGA 2GDZA 5DMHA 3RJ5A 4IW3B 2YJZA 3BKWA 4ND8A 2VDPB 3OU7A 1ZOPA 1V16A 1KA9H 1WTAA 2DH6A 2IU0A 3PE3A 3F5DA 4GX5A 1HL7A 1KJWA 4UVGA 1PG5A 1DI0A 1USWA 2N46A 4BTVA 3IEMA 3ZWWA 3LP6A 1Q7CA 1UBRS 2O1XA 5AKZA 1YQXA 4DC9A 3CE9A 3E70C 3WNCA 1X1TA 1YRWA 2HRZA 3RHSA 4DMHA 4D42A 3QW2A 2ZZNA 2ATCA 1FS4A 1XZDA 4ALMA 3ZDBA 1ILEA 3IRUA 2R6HA 1K2VN 1P5RA 2A0WA 2ZVQX 3MGAA 4MS3B 3X1DA 1T91A 1V8BA 1P2FA 3MJDA 4P34A 3TQQA 4IIJF 5EPOA 2R8OA 3VBEA 2QBYB 4KGVA 4G0YA 2HA2A 2VJLA 3BZUA 4G5HA 4KQHA 3SBEA 2QTWB 4P2GA 4KWIA 1CIPA 4TSRA 2LNDA 1YA4A 2PPLA 2ZIGA 2VH5R 2PMKA 3O1LA 3QEAZ 1FP4B 1CU1A 2ZJ7A 4MP8A 1FU7A 1D2CA 1X13A 3W5DA 3EVFA 1Q84A 1CUUA 1VE1A 2YR0A 1Z38A 1KDYA 1OGJA 4O63O 3AGQA 2YWCA 1RJGA 4KYTA 5FO1A 4HEA1 4YRTA 3G0GA 4NR0A 4WRRA 3ZWMA 4V1CA 3I61A 1OTXA 4G81A 4EW6A 2FW6A 2PEZA 4YECA 1SNYA 1KOFA 3VTZA 4KITB 1G8HA 3W77A 4Q7KA 4D9MA 1PQWA 3KR1A 3TWOA 1JP7A 5KTMA 3OSUA 2Q3HA 1I7DA 1TB4A 4BN4A 1DRKA 1GNQA 3TAUA 2WWWA 5ERYA 3EAFA 4R1NA 3QNWA 1JDBC 3EN0A 1MG5A 4ESHA 4ENTA 1G16A 4KPYA 2R66A 1SQFA 2JFHA 4I08A 4BO2A 2G07A 3F6YA 3NOXA 1FP6A 2GCOB 1YBVA 3QUTA 4BNDB 1NN3A 1E3JA 2FPGA 3MS2A 3RANA 1DMRA 3ZVRA 2JGIA 1JHMA 1WMAA 2A33A 3HMKA 1QZUA 4OGGA 4RXMA 2QVZX 3A4NA 3M5PA 1AQIA 1RRKA 2B36A 1W88A 2OG2A 4G1EB 2OLEA 3FSJX 3JU3A 2TRSB 3BQMB 4YAWA 1KYQA 1QTIA 2B8WA 2PTHA 2W0MA 3AUSA 4W9MC 4I1PA 4G0VA 5T3YA 2CJFA 2YHIA 1ZHHA 2DBYA 2HXGA 4ZI2A 1Z6ZA 4PAGA 1U7WA 4V0KA 3L7LA 5C80A 1VJGA 4FM9A 4D79A 1DQPA 2LZ0A 4BMYA 5DCWA 1U8FO 4L02A 3TSOA 3BXGA 1QKKA 4NVRA 1L5QA 1QHGA 1QLJA 1ILWA 1RMYA 2ZSUA 4TLEA 2R96A 4C7MA 4C21A 3AINA 4TS9A 7REQA 1P2VA 1DTSA 1ADBA 2FPMA 4KDEA 2HU8A 2OHIA 2OKCA 2VTVA 2WIDA 1G21E 1IY2A 4ENVA 3EJ6A 2CWDA 4FDMA 1E4VA 4BECA 4IZOA 4U0JA 3HDJA 3LOUA 4PR3A 4PICA 3ITEA 4UDOA 1L7EA 1JG7A 3BZBA 3O4HA 3L4BC 3R5KA 4I1YA 4W1SA 1QYWA 4UMEA 3PEWA 2JLZA 1E5TA 3DD5A 4MVYA 3QVOA 2XWBF 1E1RA 1TD1A 3P9CA 2W83A 4G36A 1YI0A 2YYYA 5JSKA 3N8DA 3C8MA 2OZPA 4D5EA 2CLSA 2FQWA 2SKCA 2ODPA 3BK2A 2VWQA 3C8ZA 2FETA 3OQHA 2Q4BA 4YT8A 1V26A 1HZZA 4GIBA 4BPRA 1ZSYA 3RVDA 4LE0A 1VCNA 2V5UA 2ZRJA 3TK1A 1XZJA 3ICQB 4FCVA 3H1GA 3PNLA 4DABA 3TBHA 1P2UA 1FQJA 5KWJA 2Y76A 3OZBA 1U3GA 2YUIA 3N5KA 5A7FA 2XUOA 2Z8ZA 3D7NA 4ZZ3A 1ORRA 4PZAA 1E2HA 3ETCA 2COKA 1J21A 4W5JA 3CG0A 4XIIA 2BZ1A 3SIPA 3U3KA 2P0YA 3M1AA 3GZNA 3P2YA 4LC1A 2OFOA 5DHRA 1R8QA 3F1KA 4D99A 3C0KA 4KE6A 2B0CA 4OSEA 4OMFG 1UINA 3JARB 1YRAA 1NUTA 3L1VA 4QBKA 2R85A 5E9AA 1KC3A 3WGTA 4B9EA 3W5UA 1HNWB 1HEUA 2O57A 1E3WA 1JHUA 2DC1A 3F98A 4TLBA 5HE9A 1E32A 1EP9A 1HV8A 2CDRA 3KZKA 1IL0A 2IW3A 3O1IC 2WYVA 4FEEA 2X0DA 1OC2A 4Q9DA 2WZDA 5ALJA 4HYTA 1F6WA 1N9ZA 1XHFA 2JH3A 2YVLA 5KSWB 3UAOA 1VGQA 2GHIA 4JDPA 2DWCA 2Y0BA 5MFPA 1Y42X 1J8MF 3LQRA 1USUA 2H06A 2P1RA 3V46A 1RVDA 1X1RA 1Y33E 4N7RA 1ZJJA 3HB0A 1K8QA 4KQFA 2QAGC 3ZBUA 3S99A 3PA6A 1F9EA 4V38A 1NURA 2V7UA 4D9EA 1GU7A 4N5LA 5HW0A 2D7DA 2YV2A 2ZVDA 4V02A 1A3CA 4J16C 2BCGY 4WMLA 1IY8A 3F5MA 3SXPA 1S5PA 3TPZA 2QD2A 1U0BB 1E99A 2PUHA 4YJ3B 2IHYA 3O6VA 3QPDA 3OFKA 4JCCA 2PGOA 3ZLVA 5B58C 5HUQA 1P6XA 1PZNA 3PUXA 5P8WA 2RJ3A 3HXLA 1EE1A 3QWHA 4OHMA 2FEAA 3MJTA 3NAZA 2JLRA 2B4KA 1CS0A 1K7SN 1GOTA 4MWSA 5AVJA 2ZETA 4L4YA 5FTWA 1BX0A 1YMVA 2IIPA 4CM6A 3IQHX 2QN8A 4Y0AA 4ZOEA 4DQUA 4G1CA 2DF8A 2OT3B 2QLBA 2J30A 4KJZA 5T8KC 2VK8A 1CG6A 2QVGA 3W5CA 4EMSA 1E96A 2WNIA 3DFUA 2UYYA 2O0MA 1KI1A 3BX1A 4B2YA 5C8XA 4KSYA 3RUEA 2VRNA 5FOVA 4IWXA 3ANSA 2WIAA 3K9CA 5CXSA 5ILQA 4NLLA 4M9RA 1A9RA 4AX8A 1A69A 1AMUA 2JHFA 4DR3B 3GA5A 4B3TB 3PLRA 2ZYWX 4H6XA 1AK1A 3MLEA 3OOHA 5TPZA 1MPXA 2VG8A 4YX9A 3EGDA 4ZQFA 3WOVA 4B80A 1GPDG 1C7JA 2VP0A 4HDRA 4TTAA 1JSRA 4FS3A 2F3PA 5TE9A 1ZJZA 3CSDA 2BFAA 2FF7A 2GVDC 2W6OA 3LBIA 4HLUC 5EJAA 2QSJA 4G4SP 3E1SA 1OFHA 2GX6A 1D1SA 3A3YA 2VZ8A 4U2FA 2DQYA 2F90A 4OYLA 3HZZA 1US8A 3M82A 3G0HA 3NTXA 1T4DA 2B1QA 5K3FA 3L1JA 1VL1A 4N6NA 3R3WA 4PLTA 1EBFA 1UBSB 4RMJA 1E20A 3NVDA 1U8YA 4LJSA 1Z7GA 1XXHA 1AUVA 2ZJ4A 3AEKB 5A4MS 3S1SA 2ZT7A 4YAGA 3EQ2A 3RVJA 1R7RA 1ZN2A 1RM0A 3C8UA 4YUVA 4TYWA 1H05A 4FYIA 3UKJA 5CH8A 5JROA 1CLUA 1FDSA 2A1TR 5B7QA 2LIPA 2HK7A 3D4OA 3E8MA 2H00A 3QWFA 4ZMSA 5IN4A 4XGIA 4COKA 2X4LA 2PN1A 3R1IA 2NSHA 1YZGA 3NUGA 1TPZA 5H68A 3WWDA 3RS7A 3X1WA 3ZXYA 5LP6B 2OXEA 4HS4A 4EUHA 2X6RA 2JIZD 3Q3HA 4O4HF 1RXYA 1UBTS 2H0QA 2FEOA 1T9DA 5I01A 2HA7A 4JITA 2JCGA 2V8BA 1GTRA 3P20A 4Q1VA 1UAYA 5F4BA 3K4HA 1QX4A 3D5EA 4URYR 4MR7B 3C24A 3D0QA 2IX9A 4KQ6A 2BELA 3EZGA 3L0YA 4DJFC 1COWA 3RRNA 3M5WA 4MQEB 1WDWB 4TKZA 3F73A 3FW1A 3WNBA 2A57A 3CEHA 4NONA 1R27A 2GBCA 3G59A 2R1ZA 3GX1A 2C20A 3JQAA 4P3YA 4ZGGA 4EMUA 2YRWA 4EF4A 1RI4A 1JSCA 1SCUB 2JFNA 1NTRA 4XRRA 2ZUTA 4F04A 2ZR0A 3U31A 4YHBA 1P2SA 4YT2A 1GPLA 1XR3A 4IMPA 4F85A 2EERA 2DXIA 1TLLA 1MF7A 2VP3A 4L07A 2I54A 2Q1YA 3QX8A 4QJBA 2WOOA 3WKBA 2A0XA 3WLEA 3KP1A 4QOHA 3GEIA 2RCYA 4HSGA 4KYUA 3K94A 4ADSG 2WA2A 3VHQA 4BRUA 5JV5A 5KNCD 4MGHA 3KZMA 1SCQA 2RHDA 2NZUG 3ROGA 3SK0A 1F14A 1YXMA 3AOEA 4IIHA 4YNBA 5CYPA 3T95A 2GOYA 1GG5A 1H9CA 2QZZA 3U44B 5EQJB 3B2EA 1YI8A 3LQ1A 3FHCB 1JFFB 1CZUA 1N7IA 1IHOA 3SZMA 1ZSNA 4WBNA 3F67A 3LUKA 3PD1A 1Z0IA 5DTJA 1EI9A 4PZPA 2HWYA 2XUHA 3ADCA 1PSWA 3J7AC 2PG3A 2YJ4A 4NQRA 1E4OA 2Y1EA 2NNWB 3DMNA 1ISSA 1U5CA 1P7YA 4WKGA 2AXPA 3PNVA 2WSBA 1IIRA 2RAFA 1Z4JA 2DLDA 3AVOA 3GNQA 4NJMA 1QS0A 1XTKA 2YHBA 4CI9A 2J9ZB 4R3NA 1V41E 5J40A 5BRAA 3BICA 3K9LA 4WX2B 4NBRA 4YRRA 1QR2A 4FYJA 5EJ2A 3VFDA 2GK6A 3E3MA 2J5QA 4B4VA