4G2TA

Crystal structure of streptomyces sp. sf2575 glycosyltransferase ssfs6, complexed with thymidine diphosphate
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
384
structure length
356
Chain Sequence
HMRILVIAGCSEGFVMPLVPLSWALRAAGHEVLVAASENMGPTVTGAGLPFAPTCPSLDMPEVLSWDREGNRTTMPREEKPLLEHIGRGYGRLVLRMRDEALALAERWKPDLVLTETYSLTGPLVAATLGIPWIEQSIRLASPELIKSAGVGELAPELAELGLTDFPDPLLSIDVCPPSMEAGTTKMRYVPYNGRNDQVPSWVFEERKQPRLCLTFGTRVPLLLQALSQELPKLGFEVVVAVSDKLAPEGVLAAGQFPLSAIMPACDVVVHHGGHGTTLTCLSEGVPQVSVPVIAEVWDSARLLHAAGAGVEVPSVLAACARIRDDSSYVGNARRLAAEMATLPTPADIVRLIEQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SsfS6
publication title Crystal structure of SsfS6, the putative C-glycosyltransferase involved in SF2575 biosynthesis.
pubmed doi rcsb
source organism Streptomyces sp. sf2575
total genus 104
structure length 356
sequence length 384
ec nomenclature
pdb deposition date 2012-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase
A PF06722 DUF1205 Protein of unknown function (DUF1205)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4g2tA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4g2tA02
3D0QA 2BGUA 4M83A 1C50A 3T3IA 3L79A 2QN3A 1K08A 2GPBA 3WAGA 2JLBA 2HY7A 1WW3A 5TMBA 2X0EA 3NB0A 1XL1A 2QLNA 3MT9A 1FU8A 1K06A 3G2KA 5TMEA 3NPAA 1M5RA 3S0JA 2IW1A 3DDSA 3PE3A 2QRHA 3T3DA 1UQTA 3IA7A 4CTMA 3CEHA 1WV0A 3PE4A 2H1FA 2FETA 3GPBA 4WHMA 1L5SA 2IV3A 1SXQA 3T7DA 3T5TA 5JTUA 1FA9A 2X0DA 1C8KA 2P6PA 1Y6FA 4EL0A 3L7DA 4EKYA 1YA6A 3UYKA 3S28A 3BDAA 3OTIA 3HBMA 1AXRA 1JG6A 4MHOA 2AMVA 3MT8A 3VUEA 2SKCA 4LEIA 3NCHA 2VG8A 4MHSA 4CTOA 1XC7A 1Y8ZA 1F6DA 5JTTA 1L5VA 1A8IA 3RHZA 2XCIA 1WW2A 3E3NA 1P4HA 4MI6A 1P29A 1L5WA 4RELA 3VUFA 5DXFA 4RENA 3SYRA 4BQFA 1V4VA 3CEJA 3CEMA 4N3AA 1RZUA 1Z6PA 9GPBA 3MSCA 3BEOA 4AY5A 3BCRA 3DDWA 2F3QA 1BX3A 1L5RA 2GPAA 3C48A 3H4IA 1NLMA 3ZCTA 3GUHA 4YUAA 4RBNA 2ACWA 3ZCSA 4M60A 2R60A 3O3CA 2XMPA 4X6LA 3MQFA 3ZCUA 4RIIA 5I45A 8GPBA 1EXVA 1SXPA 1Z6QA 2VSNA 3ZCVA 4N9WA 2IEIA 5D01A 3ZCQA 2QLLA 2XA1A 4AN4A 5LQDA 2C1ZA 2QN2A 3ZCRA 3BCUA 4CDRA 2PRIA 1LWNA 5D00A 3G2HA 3HBFA 4GYWA 2QRQA 4X7MA 3DD1A 3UYLA 1KTIA 2JJMA 1XKXA 3L01A 1NOJA 1P4GA 2QN7A 1NOIA 4RIFA 2IV7A 4W6QA 2ECPA 3VDNB 2QLMA 3RT1A 1FU7A 4EL5A 4FKZA 2G9RA 4F9FA 3HBNA 3NAZA 3G2NA 3G2IA 4YI3A 2X6RA 4GZ6A 2VSYA 4AMGA 1JG7A 5IKPA 3G2JA 3E3LA 2XCUA 3BD8A 2C1XA 3T3HA 3OY2A 5GPBA 1QM5A 3MRTA 2F3SA 2X0FA 1B4DA 3MBOA 1NVKA 4X7PA 2AW3A 2QN8A 4RIHA 5TMDA 3MRVA 4PQGA 2BGTA 5DLDA 2QRMA 1PYGA 1FS4A 2KS6A 3QHPA 2R68A 4KQMA 2XA2A 3S29A 2X6QA 1RRVA 3OTGA 1C3JA 2IYAA 3SYMA 1GFZA 2IUYA 1Z8DA 1NOKA 1ABBA 1UZUA 5IKOA 4GPBA 4WADA 1FU4A 4MRAA 1GGNA 5HXAA 1L6IA 2GPNA 2XA9A 3FROA 3T3EA 3T3GA 1P2DA 3TOVA 1GPBA 1JIXA 3MS2A 3MTAA 3NP9A 3L7CA 2H1HA 4YI5A 3Q3EA 2IYFA 4N39A 2GT1A 3CUUA 3OT5A 2QRPA 6GPBA 2ZB2A 3C4QA 5ENZA 2IEGA 4MI9A 2VCHA 3MTBA 3OTHA 2FFRA 1LWOA 2F3UA 1QKJA 4NEQA 1GG8A 1GPYA 4GYYA 4BFCA 3DZCA 4WACA 3S2UA 1XOIA 2G9VA 3TSAA 1O6CA 2BFWA 1Z62A 3RSZA 1EM6A 1FTWA 4Z5XA 3NC4A 1WUTA 2PRJA 1L7XA 1FTYA 1JIUA 4KQ1A 1IIRA 4GZ3A 3EBPA 3OKCA 2YJNA 2QRGA 2ACVA 2XGOA 4XIFA 2QNBA 1WV1A 3MS7A 1GZ5A 4F96A 3EBOA 2GM9A 3CV3A 4NESA 4BQIA 1VGVA 3CUYA 4QLBA 2GEKA 2R4TA 2FF5A 4AMBA 1GPAA 2G9QA 3Q3IA 1JEJA 5C1DA 3H4TA 2Q6VA 3AMVA 4HWGA 3D1JA 2XGSA 5TVGA 2AZDA 4L22A 3S27A 3HBJA 2SKEA 1UQUA 4RIEA 2BISA 3E3OA 2WTXA 4MI3A 5BNWA 2SKDA 3TAXA 3NP7A 3L7AA 2ATIA 1IXYA 7GPBA 1XL0A 3VDMA 1L5QA 1F0KA 4RIGA 4NC9A 1RZVA 3WADA 4M7PA 4EJ2A 4MICA 2QZSA 3IAAA 2O6LA 3ZCPA 3C4VA 1PSWA 4LDPA 3BD7A 2VCEA 3CUWA 4GZ5A 3D0RA 3BD6A 2PYIA 1XV5A 3MRXA 3WC4A 1NZDA 4XI9A 1FTQA 1NZFA 4N3CA 4G2TA 1JIVA 2PYDA 4AY6A 2C4MA 2GEJA 4BQEA 2PQ6A 4HLNA 3COPA 3L7BA 3Q3HA 1E4OA 1HLFA 3OKAA 4REMA 1H5UA 3OKPA 1J39A 5DU2A 2F3PA 4F97A 4EKEA 1PNVA 1P2GA 2AV6A 1FC0A 4N3BA 2GJ4A 2QN9A 3CUTA 1P2BA 1E1YA 3CX4A 1PN3A 3QKWA 4FZRA 1C8LA 2QN1A 2C9ZA 1WUYA 3MS4A 4CTNA 2XGMA 3BCSA 3MT7A 2R4UA 3MTDA 1YGPA 1P4JA 3CUVA 4X7RA 2G9UA 3G2LA 2OFFA 1Y6GA 1AHPA 2JZCA 3OY7A 2ASVA 4KQ2A 3RSCA 2R66A 2F9FA
chains in the Genus database with same CATH superfamily
1WKBA 3BJRA 2PWYA 3E7WA 4HZUA 1ZKDA 3WB9A 1Z17A 1HFJA 3GAAA 4GPEA 2FP4A 4U02A 4EHKA 2X8AA 1QJ4A 2HIGA 5TF4A 4MEAA 1E77A 5EN4A 4ESOA 1K08A 4UUNA 2JLBA 1WB5A 1BGWA 2HY7A 1C7JA 5B64A 3B12A 3OZ7A 2ZTUA 1KI6A 2RG7A 1OFUA 2WTAA 4W63A 3S2SA 4DDHA 1U2GC 1Z6ZA 2DX7A 5FPYA 1VPWA 4R9SA 3VC7A 5HF6A 4B47A 2KX7A 3KS9A 3KOZA 1K06A 2FUG1 1KEEB 1O2DA 2GXSA 4D96A 4F6LA 3EFOB 2GBGA 3NLLA 4ZHQA 3H4MA 3LDGA 1HI9A 5LD2B 1J6UA 4LYHA 2H1FA 5FOXA 1X92A 4L9SA 1G5FA 2PH5A 5KHLB 3MTQA 2ZFUA 3Q40A 2EJUA 3G2OA 4QT0A 2D3TA 5EWJB 5T67A 3U4DA 4B1FA 5TMPA 2O5CA 1IRIA 3N8GA 1NGSA 4MWGA 4G0WA 4I4TF 2BP7A 2ZT6A 5ISMA 4MPJA 2BM8A 4C07A 2HFKA 4KODA 5E2AA 3ZBPA 3B85A 4N7BA 1HDYA 3U1VA 4F21A 1Y4DE 4RHUA 4UFPA 4EVRA 2FDRA 1JV2B 1IG3A 5IT5A 1GPDG 5BWOA 4AJPA 4NE9A 3TAHA 1M2WA 4C2UA 1C3EA 3LHSA 2PZEA 5DYGA 1I7QB 1JFTA 5GJBA 1SKUA 1MNQA 1E7SA 2DPGA 1GADO 1T1RA 4Z9BA 4EGQA 1G8SA 1JG6A 1L7DA 1D2GA 2JKVA 1LRJA 2AJ8A 1OSNA 3AJRA 1J06A 5CEFA 4DNOA 5JNWA 4MHSA 1REQA 4LDQA 4YFYA 4JB0A 4J2OA 1UMCA 4R16A 3O2QB 1I2DA 5T6BA 1YJQA 3QF4A 2ZI9A 4IO1A 4UVIA 1W5SA 1Y9DA 1E3TA 2Q5QA 1RAAA 4ZGBA 1RCUA 3CLUC 2PGOA 2QSYA 5F7OA 4GC5A 1XRPA 4NEGA 1UMKA 1OXKB 1P29A 1L5WA 4MPDA 2VEOA 5AVQA 1T3TA 4NG5A 4GQAA 3L1IA 3IMFA 2VXYA 1D07A 2H1CA 1LI4A 2J4CA 3OMWA 4JX8A 2Z0MA 4FQ7A 2NU9B 1BXGA 3TR5A 1ZHHA 2IIBA 4N40A 3IBSA 4L3OA 1T3ZA 4MV1A 4OP3A 2PJDA 1M5TA 5AICA 2BFNA 5FPPA 3DDWA 1KO8A 5ER6A 3RTBA 4Y6OA 5T3YA 4Q15A 1JJFA 3DULA 4COKA 5L4NA 1KI3A 1L5RA 2CLSA 2OXIA 2XZOA 1GCAA 4QTUB 4BC1A 1OV6A 4UOEA 1NP3A 1ZI9A 4HDSB 1GYPA 1NULA 2OCPA 1JDNA 4GNKA 4JBLA 2BWJA 2V7XA 3U3RA 5B6IA 3TUZC 3FPBA 1T6NA 1T9GS 3IKJA 2WJVA 4LVNA 4MIEA 4W9NC 4XDYA 3ZCSA 1NC3A 2WMDA 2G06A 3RHTA 3O3CA 1NBHA 1Z39A 1B6GA 2E4YA 1ZGZA 3STWA 2OK8A 4YXWD 2G6TA 2NNLD 5REQB 2O8EA 1H2WA 4F06A 4RDCA 3EQ6A 3FY4A 3WGOA 2W6MA 4ARSA 5CFPA 1AV7A 2VSNA 3WSVA 2JCBA 1HKUA 3SQDA 3Q72A 1RAHA 4F9TA 4BVKA 2K2QB 1IY0A 3MRSA 5CBPA 4ZVMA 3EZ6A 4P92A 2PMEA 3QUTA 3SSNA 3HO6A 2FF7A 2PSEA 3DBIA 3G9UA 4X85A 3X1XA 2B6NA 2IYSA 2GSDA 2HQSA 1CLUA 1ZUNA 2OCAA 2VZ0A 2ZJOA 5KTPA 5HVNA 5G3ZA 2FSSA 1EYZA 4UUAA 4DNXA 7AT1A 1P4SA 3Q9NA 4H7PA 4DR4B 2JBAA 4UJ3A 1ZD2P 4M0LA 1GNLA 4BUCA 1COWA 4L5IA 5AW3A 3NGXA 3T3OA 1VLVA 5JG7A 2FEKA 4OHXA 2CJYA 5GZ1A 3BHMA 2EJBA 2QAJA 2ZB4A 1R7RA 3VV2A 1UPCA 4LHXA 5DGDA 5P21A 4DHWA 4EGFA 1XF1A 2SHKA 3WL7A 5KSOA 3CXUA 3H7AA 3K8YA 3R3YA 4LOAA 3SU8A 1DIAA 1DO2A 2FFHA 2PLAA 4F11A 3MZ0A 4B6SA 4DT1A 1UINA 1NOIA 4LY3A 3C5EA 1SJ9A 2CHUA 1BNCA 1UBJS 1ENOA 1U9CA 2H29A 4WCDA 4ZAXA 5BSGA 1RQRA 3OZFA 1RACA 2IV7A 1WU7A 3H1EA 4JBGA 4R1MA 3WHLA 3IKTA 5A5GA 1JG3A 3LVFO 1RYDA 4CMBA 1SCIA 2DQZA 3OZIA 2G83A 3IAHA 1KEUA 1N8KA 1T3LA 1VJTA 2ZIXA 2QLMA 1DWQA 4CF5A 1M8JA 4EL5A 4FZJA 1R9JA 4O1MA 3DOIA 3WFIA 5D3QA 4CODB 1GQYA 4NMHA 3FFXA 3KKMA 5BV7A 6CHYA 2AK3A 4IJVA 2WFZA 3RANA 3KQKA 2BDEA 1IY8A 2B8TA 2W2OA 1IBSA 2RGEA 3HQ4O 5J43A 1ZOLA 4GECA 4KJXA 4HTAA 1FNMA 4U63A 3DNPA 4QO8A 4JK3A 5ER9A 5EJMA 1FMJA 1WEHA 1PT6A 4CU5A 5ALQA 1RXUA 5KDOA 1J5EB 4LDZA 4URYR 4DXAA 1W1UA 2V9CA 1XU4A 2NUTA 4EAAA 3AG6A 3ETDA 1XZDA 1XCGB 2XQIA 2WQ7A 2IHUA 1QTNA 2VYNA 5EKDA 5EWLA 1OI4A 1R9NA 1T5DX 3CX6A 3IS3A 1P0MA 5IKMA 3EVEA 4QAQA 2I4OA 4OUDA 3T5MA 4I6JA 5IH3A 3KOOA 1NWHA 2GN8A 4R5HA 4YJKA 5DOVA 2O2XA 4KLCA 3M82A 4J0IA 3KOXA 2F3SA 1TADA 3CR7A 1LDNA 4FN5A 3ZVNA 4KPYA 1MFPA 1E92A 3QLUC 5ESDA 3OT1A 1VP9A 2OMEA 1ULBA 2WAXA 4DBVO 4ECAA 3OEHD 1TAQA 3CW2A 4FGZA 2RGCA 1WPXA 4AYTA 2I0FA 4HDRA 1RE1A 4C6HA 5JAOA 4P5EA 2ZM5A 4O4HF 4LRYA 3VR5D 3I01A 1X9IA 3T94A 5B1EA 1N78A 3KQUA 4RTJA 2JFUA 2BMVA 3QENA 3MWEA 1DAFA 1Q50A 1M2EA 1YIDA 2G3YA 3FKSA 1N2GA 1E2FA 1ZI6A 3N0VA 1SD1A 4KPUB 5CVJA 1N5KA 1LFAA 3SVTA 3HWWA 2ZJ1A 3IC5A 2CFIA 4HC4A 4ZVOA 1J25A 1T2FA 5JDIA 1MA3A 2BOVA 5IXYA 3BMNA 5ICGA 3QHPA 1BN6A 1L5HB 2BE7A 3E8SA 1KMHA 2X6QA 1T3GA 2HW8A 4C4AA 2FU5C 1VYTA 1DEXA 4OMUA 1GT6A 2QBYB 1V4BA 5MDHA 4ISBA 3SJAA 5BT8A 3QW2A 2BFEA 3HVIA 5C7IO 5IDXA 2CZCA 5CFMA 2PD4A 3WDMA 5BNIA 4ARUA 1G8YA 1K2WA 4FB5A 3B3GA 4YAKA 1Z8DA 4JEMA 4DSZA 3UGQA 1N34B 2HL6A 2N47A 2VBIA 1P0FA 4OXNA 4BIIA 1N2IA 3AR6A 3RQIA 3CPHA 3TQHA 1ULTA 2FKNA 1OWOA 1OC2A 2YVQA 4NFHA 3WP0A 4BNWA 4HNTA 5JD6A 2O2DA 3OD1A 3TQCA 2R6AA 2JGJA 5H80A 4JA2A 4NOMA 4DQLA 5HCIA 1MGOA 4UQOA 1P6QA 1YUMA 4C0LA 1S2GA 5D3KA 1P2DA 3B1KA 1JVBA 4BFXA 4TLCA 3JCZA 3ONEA 2DC1A 1W2HA 2RC5A 2B0CA 1H2EA 2KSQA 3RVKA 3T34A 4LZZA 4DLPA 1EP9A 4QHTA 1SHTX 2H1HA 2PRYA 4IM7A 5DV9A 4WXPA 3LXMA 2EX4A 2VF4X 1QIGA 3OQ6A 4F4HA 2XXBA 3GDHA 2B2NA 1T6XA 1UIMA 3M6AA 2FP3A 1N8TA 3GZNB 1WXQA 1M2FA 4G85A 3WOHA 2WTNA 4WBNF 2PX0A 4WZZA 2Z5LA 3GRRA 4Z2AA 2GETA 4NDAA 1RYZA 1NR7A 4FE4A 1M0WA 1R6VA 2EHDA 2NVUB 5LB4A 2DMRA 2XNDA 5ITVA 2AH5A 1JFFA 1XOIA 5IC6A 2FNAA 2EFEB 3FKJA 2XKBA 4TWBA 1R37A 1KYXA 3CZ5A 1H23A 4N6NA 4X1IA 2XUAA 3CPSA 1HE2A 1I6MA 4GOOD 3SIPA 5ALYA 2GUWA 3KZKA 4YMLA 4JIMA 4INZA 3QKRB 3UMJA 1P2TA 1WXHA 4IJ5A 4WCVA 5JMWA 4LJ5A 1KYVA 2PV0A 2IS2A 2X8LA 4HO1X 2QXTA 2R96A 4H4EA 2JFGA 1S01A 1NX9A 2C04A 1IIRA 3O21A 4K0RA 4A1FA 3VTFA 3SZ3A 4RPJA 3TPZA 4FYYA 5AVUA 4IX1A 1WTAA 4YMUA 5D1HA 2XXJA 3ZLUA 3SR4A 1YF3A 4G5XA 1QZZA 3L0IB 4I4LA 4NRDA 3THWA 2ZYDA 2OM6A 3N0RA 3NJ4A 1Z26A 4W7SA 3HADA 2I3AA 4O0MA 2PMWB 3OHPA 1AQIA 1VGVA 4HB4A 1G64A 4LF5B 1POWA 1WDKA 3MGCA 4Z8YA 3UMCA 1RQ2A 1FY2A 1ANKA 3CIOA 4K9PA 1ES9A 3C4JA 4NOJA 2W2TA 2ZR8A 4P98A 1SKAA 1FLDA 2JFVA 2RCYA 3GRZA 1UFRA 3K0KA 4BLPA 3CTMA 5A9SB 5H68A 3QITA 5HIMA 2GXUA 3T06B 3PLAE 2Z2XA 2P1RA 3QLJA 3WK8A 3L4BA 2WKWA 5AJYA 4Y67A 1OZGA 4FSXA 1AOXA 4OFZA 5ALIA 4Z4CA 3INRA 2HXSA 3IP5A 2QRLA 1J24A 3CWCA 3L7JA 4KQ6A 1HOXA 2J3IA 3GIDA 1OBVA 1SU4A 3E53A 3HBJA 4L07A 4RDXA 1YL6A 1WMDA 2HJ9A 4RZXA 1NJSA 2HHJA 1E20A 3JRXA 4BLUA 5A06A 5K3BA 2LIPA 2JHGA 1A96A 4XCQA 4EG8A 1J2EA 5GM2A 4CNBA 2NIPA 3W9BA 5E8JA 3RVOA 4QXRA 4TVBA 4ZIRB 2SKDA 2JIPA 2OWDA 2ZEJA 3AL2A 2Y99A 1A4RA 3KJFA 2MSNA 5EE0A 3VU9A 3SM9A 2FUNB 2GYVA 1COZA 3PUHA 4EPYA 3UNXA 1NW8A 2DY0A 3QUQA 1XUOA 5LA6A 1IUPA 1JA9A 2VQDA 4J4BA 1K3UB 2FX2A 2QUKA 1HDRA 1KAMA 1T24A 2BGWA 4LI3X 3AVTA 2X2PA 4PLHA 2XGGA 2YXBA 4ZVPA 1D4FA 2EU8A 3GOHA 4KXLA 4F6CA 1FP4A 1KZGB 3GXBA 3DG9A 1D6SA 4NOLA 3AU9A 4O4LF 1I4WA 4RZ2A 1EUYA 1NHGA 1VHTA 4P5PA 1GTJ1 1J70A 2XWBF 3SVZA 3TPCA 5B4TA 2PL5A 3K9QO 3EXEB 4RVOA 4YYZA 4CM3A 1XPOA 1W1WA 5D8DA 3EPPA 1WSDA 2YWXA 3LX8A 4PLVA 5SZHB 2FWAA 4L73A 3MAJA 1J42A 3QIVA 3AO0B 4JI1B 3I2YX 3OSZA 3TW6A 2ZIWB 1K8XB 5JCZA 1SRRA 1C4XA 3QPWA 1E3JA 1I4OA 1FP6A 1MT3A 1X2BA 2WWWA 3KEQA 5A6VA 1P1RA 3PTZA 5FL7D 2C7PA 1F38A 1EFPA 2JGLA 3A6HA 4HDAA 1I94B 5L6LB 1GV1A 2V6GA 1AA9A 4Q37A 4UE2A 1MOQA 1GDTA 2NYRA 3I45A 5KSWB 3W5HA 3FJOA 3TBFA 3PYMA 3OCZA 4OIMA 4GZMA 1G8GA 1BJKA 3COPA 3HGTA 3L8YA 3DXYA 4GX5A 3PJDA 1I36A 1HLFA 2XY4A 2NW6A 3AFMA 4O3MA 5BW8A 4CUKA 3U9TA 2JAWA 5C1PA 3TMYA 2H7CA 1KJQA 1WPRA 2P0YA 1VCMA 4BCBA 4AJ1A 1H4TA 2QMEA 4KXUA 4G97A 4PC6A 3CUTA 2O06A 1MB4A 5KAPA 3OCXA 2A9FA 2VJDA 1H94A 2W4IA 3CX4A 4I46A 5IN5A 1MC8A 2OXEA 3VX4A 3WA6A 3TGPA 4HXEB 2VUHB 3DQPA 3GUCA 3EIEA 3FRIA 2QN1A 3K53A 1Z07A 3RU3A 1U0JA 5IK2A 4DQXA 1SHZA 2OO7A 3E3AA 4Y1RA 4G1BA 1R6AA 3CZMA 4L5BA 4OAOA 4OF4A 4NV1A 5BVHA 1AC5A 4P9NA 3IALA 1GD1O 2QVZX 4PN7A 2HA5A 3DP9A 3F6EX 1IUOA 3M9XA 1QYWA 4X8MA 4C7KA 1J22A 4KSCA 4IV5A 2VDJA 1GJRA 4GF5A 3OQHA 1AGPA 4OLJA 4BNFA 3L4JA 1L5MA 1SC1A 1E3LA 4LXTA 2ATEA 3RIMA 1DSSG 2VJMA 3LY8A 2VT6A 3QHAA 2FWJA 3EQ8A 3CB2A 4B2PA 4OA8A 5I7WA 2JIMA 1RBYA 1EJBA 5H5JA 4CM9D 4UMDA 3VXKA 1Y4SA 3RHSA 3IBYA 2EHJA 2ZIEA 4PBTA 4MUJA 3FYUB 1PT8A 4F5DA 2HNKA 4JJ4A 2WWHA 3ETCA 1JAIA 1DKNA 5FBVB 3O73A 2C95A 4XWAA 3OZXA 1EHCA 2QX9A 2AR0A 5B53A 2RSLA 3UJNA 2XE6A 4UE3S 5BQPA 1T5SA 3J81A 4MV9A 1J2YA 4LQCA 4CMIA 4Q19A 2CWWA 1E9VA 3A6EA 3F71A 3R4VA 1JHPA 3PE3A 3S0JA 1MB2A 2QLJA 2VH2A 3ZLVA 1K0FA 1UZLA 1MBZA 1WZUA 3NYIA 4R2KA 1DIRA 1XKTA 1LRKA 3MXOA 1P81A 3KX2A 3KQTA 4UD2A 1V16A 5A03A 3KZNA 4GX1A 1UBUS 3QKUA 3S8MA 3T5TA 1LSSA 5IN4A 2JGFA 3JWGA 3PNSA 1MQ9A 4DUGA 2OC9A 3R9XA 1ORVA 1HEIA 2TSYB 4ZKEA 1VKJA 1KSJA 1UKCA 3L7DA 2VFAA 3PGMA 4G9GA 3U40A 4QO7A 3BZWA 3EG9A 4QWWA 3WJ2A 4LV5B 1BE0A 3M6XA 5IHPA 4EUSA 1K7SN 2OCGA 1AUPA 1HDXA 2GN6A 3NC1C 4B7AA 2EJCA 1T10A 1V4NA 2VP0A 4G0YA 4WESB 3VMMA 1ODKA 3COZA 4NBNA 3VPDA 1N92A 4ZWNA 5BV1A 4K9NA 3DLBA 4UEJA 4L4ZA 5LMZA 3R3ZA 2QW0X 3HB1A 4LF7B 2BUCA 2XMBA 1XXHA 4OHOA 5BQFA 1VSUA 4U9UA 3C6QA 5HKAA 3WKEA 1TM7E 3HY4A 1GDDA 3O95A 5JLJA 4BLQA 2I7CA 4J7UA 2LZ0A 4E6EA 3GCZA 4L7QA 1Z63A 5BMVA 4FXPA 2VOJA 3AU8A 1OE0A 3P4UA 4X95A 1XEWY 2OB2A 2W6PA 3FWNA 4GRIA 4BQFA 3W34A 1R64A 3X0DA 1T34A 1DTWA 4S2UA 4E5UA 4EGJA 4ALIA 1GRNA 9GPBA 3RVNA 2W2PA 1ZLYA 3CHYA 1BX3A 1YZUA 4KN8A 4BKOA 3HXTA 1F2TA 3C48A 4HJRA 4L8FA 5BMOA 3HWRA 4A0RA 5JISA 2BFCB 2IU6A 3GUHA 4OQEA 1CQZA 3V7WA 2XDAA 4YJ2F 2PHZA 3OLQA 4F93B 1IQPA 3VGJA 3T5CA 2KYRA 4HD8A 4PINA 5C35A 5TGZA 2IODA 1D2RA 4XDZA 4KIWA 3ZDQA 3EGCA 4XJSA 3P2OA 2BGLA 1DG1G 1E9EA 4O1HA 2HLDD 3W5IA 4BRZA 4NECA 4TWJA 1CERA 1DV1A 2GRUA 5I9IA 2DR3A 3U3JA 4P4NA 1NM5C 3BWXA 1Z6QA 1A5TA 2ZI5A 4IUBS 4UNRA 1O3YA 1MQSA 3ABQB 5LLSA 3HN6A 3BK7A 4AMYA 1G2QA 1K6XA 3D5QA 3NV7A 3T99A 2VP3A 3FOBA 4CFZA 4OK6A 3W6OA 2PUEA 1IN8A 1GGFA 1R3UA 2N1BA 5KJ1A 5L4LA 2WUVA 4WOCA 3BXEA 3GP5A 5IBRA 4CM4A 4PGMA 2PZMA 1ODTC 4IDGA 3DFIA 5FHQA 3W8RA 5M34A 3LGAA 2DU8A 3WGZA 2VXBA 3C3YA 2CXNA 3HFGA 2O0LA 3PA8A 4BKMA 3RAPR 1Z25A 2CXXA 2OHJA 3TRFA 1DE0A 1IBMB 2ADFA 3ZQKA 3ZXYA 1IYZA 3SDBA 4GYWA 4BX9A 1G98A 3UYLA 4J76A 3N75A 3FGNA 1U5CA 1JKJB 1V1RA 1O94A 1PL0A 1T5LA 3EXAA 2VDQB 3G8CA 4XLTA 4EB8A 5K0FA 2FV8A 1BAPA 2ACKA 5C1OA 4ZREA 2FEXA 1GL3A 3L8CA 2A94A 1MV8A 3NOVA 4KYIB 2YRFA 4XJVA 4YRIA 4RPKA 2WJ4A 1GUDA 3NBMA 1F2DA 2HA3A 2DYKA 4W6QA 4EZEA 1QRTA 2BH2A 4B2YA 1I3KA 1E1DA 3JAWA 1PZEA 1LSJA 1XTIA 2XUJA 5AIAA 3I01M 3UANA 5DK6A 3DOJA 1WPGA 5JO9A 4A8HA 4BNLA 4HQKA 2FY8A 2JAPA 1NAHA 4NCIA 4URHA 4F9FA 5ADWA 3A2LA 1KY5A 4O4IA 4YAFA 2Y68A 1J20A 4UREA 5AHWA 2PBFA 5DP1A 4YRAA 2B25A 3Q6IA 3QKSB 3LG2A 3EDOA 3VPFA 4H3VA 1AHHA 1P7YA 1U0RA 1OILA 1VRCA 1B8NA 1GNQA 2C5SA 2WA2A 3LX6A 4JP2A 1TL7C 2VSYA 4H1VA 3PD7A 4EHIA 5HGXA 3RV3A 1H5QA 1H8HA 1H0HA 3PBKA 3N05A 1SZCA 4TMZA 4ZARA 1LC3A 4EF5A 1I3LA 1O4WA 4OREX 5TRTA 5FEMA 2JLCA 2CLHB 4AKIA 2EGUA 3QI2A 4TGLA 1U4NA 3M5PA 3WGIA 3BBPA 1DS6A 1KJ9A 2V3VA 3WGNA 4A10A 4H16A 4W5JA 3NDIA 1YNOA 2PZJA 3QUSA 3U3KA 1U6JA 2MSCB 3WYNA 3N59A 1CX9B 4C3VA 1E63A 2MCFA 1QDLB 1ZONA 1MB3A 3C43A 2XNDD 1NXTA 4F3KA 1U1DA 1CQIB 2FPGA 2PS0A 3KKKA 4MMXB 1NW3A 5H9WA 4GHWA 4C4TA 4IIJA 2YRXA 1CHNA 1U3VA 3LT0A 3PQDA 4PQGA 2CJWB 4BNIA 3F9CA 2W6CX 4IIXA 3T15A 1TT5A 5EUMA 3PEWA 4JI0B 4CV0A 5K4AA 1T1GA 4K03A 2Q6OA 1TGYA 5KTRA 1I10A 2V9ZA 4EJMA 2J3JA 3UAVA 1IMOA 1PT9A 2B4KA 5FUXA 4BP8A 1KERA 1CR4A 1W6RA 4FNAA 2Q4OA 3WGGA 2FMTA 1VA4A 4KQMA 3IDZA 2XA2A 4FGUA 1SKBA 2EF0A 4J4HA 5ALKA 5LOVF 5CTAA 3GGOA 1OXMA 3C3MA 3GGPA 3VZCA 3ACCA 1OX6A 1NVBA 1BHSA 1RRVA 1F8YA 1UFKA 3K09C 5EAIA 2ZI4A 1T2UA 1QTQA 5LXTA 1N3LA 1O8BA 1Z5WA 1ZHFA 1GNPA 1KIAA 1U9JA 2GF2A 4XB2A 1JS1X 3QVVA 1IEQA 2JPDA 3HUDA 3C16C 3ADOA 4MYRA 3W2IA 1RWQA 4HGPA 3B1YA 1SVIA 4X91A 2YH2A 4BOYA 2PY6A 1G9XA 4P38A 4Y1EA 1I13A 1NOKA 2IYOA 1Q15A 3BXXA 4H6XA 1II9A 2P77A 1E1CB 3GG2A 3PPXA 5CR9A 5ALPA 3T6KA 2PQMA 2O7SA 3QMPA 4HRVA 4LCBA 4QPCA 4S0ZA 1VYUA 3MJSA 1RYBA 4OB6A 4Q4JA 3HZHA 3GOQA 3ZXXA 2PZGA 1MLDA 2AMLA 4TVKA 2JLVA 1Z74A 1ADGA 3ADKA 3DBHB 3LD9A 4NNPA 4EHHA 1FBTA 2Q3BA 3BDVA 1UK9A 3QX7A 3FMOB 5HR5A 1SBQA 2HSDA 4EB6A 1FVOA 1LPBB 3R6TA 4ZTBA 5LNK1 4N8SA 2X0JA 2OGWA 5G0VA 2WJPA 4TL9A 1T6ZA 4HNAB 1BS1A 1VIYA 4ZV9A 3UFXA 4AG3A 5A3JA 1R4MA 5LP6F 3PZRA 1CBUA 1D8TA 1RAIA 2ZU0C 3OQIB 5CT6A 5JNRA 3I28A 3OQOA 5C7LO 3WHKA 5A2GA 4QTXA 3FOCA 2YASA 1OLSA 3EZYA 4QT4A 4GWGA 3ZY2A 3GJTA 2Q46A 2JK0A 4YB8A 4ZT6A 1XHLA 1DOHA 2WYVA 2XQGA 2C8JA 3ZW9A 2YMQA 5IZCA 3GLFE 2Z9DA 5LYJA 3WICA 3L7NA 5FF9A 3CURA 3P32A 4I9HA 4GPTA 4HDNB 5AWFC 1DG9A 1W30A 3K4QA 1GG8A 4FWBA 1JYSA 1EGVB 1B8UA 1I80A 1G4HA 1TYBE 3CSUA 2JI6A 3CX8A 3W8EA 3F73A 2IYNA 2P2GA 5DDIP 1XT6A 2HMAA 2Z09A 5F21A 3REGA 5EC8A 3S40A 3UF0A 3ZX4A 2W9XA 3MCVA 2BFWA 3ODGA 2WU0A 4LXIA 1Z5ZA 4E3WA 2F1KA 3OJ0A 5KDDA 2RGRA 2JCYA 3B8HA 4R3UC 3VR4D 3S4YA 3WVNA 5EIEA 4I36A 2PLNA 3EVZA 1JR3A 1WM1A 4G01B 3WBKA 4D0NA 1USIA 2CJFA 2CHFA 3BA1A 2QKYA 3AP2A 3LM8A 3QPVA 5HQ3B 4Y6LA 5CIWA 3AOEC 1CEEA 3OKCA 5G4KA 4BNDB 5TQ0A 1ENYA 1VBKA 4E03A 1ST2A 5B7GA 4BFSA 2IXAA 5AVZA 5LIRA 3SEZA 4RLSA 1RABA 2W8ZA 3RIYA 5DI3B 4BKRA 2O52A 1SXIA 2YZNA 3E9CA 5HCNA 1PQ4A 5KWEA 1DUVG 5TGDA 3ZS9A 2F48A 2PU7A 1R0BA 3H18A 4F3NA 4Z4IA 4LZLA 4YONB 2E21A 1YVDA 3LOPA 3N7AA 2N0SA 5DHAA 5J4VA 1OXBB 2BI4A 4BQRA 3FN4A 1MZPA 1C2YA 2Y6VA 4J0JA 4R69A 3AF1A 2GEKA 3JQPA 5E9JA 4DYVA 2WU1A 3UMFA 4JH0A 1N7JA 2AFRA 2BHRA 3ABOB 3MK31 5DNCA 3LRPA 4KV9A 4Q3AA 3ZHYA 2H5LA 2O2GA 3NTQA 4E5MA 4JC8A 3RUDA 5C1DA 1DX9A 4FCTA 5EERA 2P3LA 3CF6R 4H59A 1QUEA 1SOWA 5TVGA 3FB1A 2ALJA 1DFHA 10MHA 4NS1A 4DARA 2FVXA 2BUBA 1E5XA 2V7VA 3EODA 3QBTA 4PHTA 1GZ6A 2GCEA 2ZQ5A 4ROSA 2JLWA 3ICPA 4MVXA 4HQNA 1MT0A 3VKVA 4E09A 4IGFA 1U0EA 3BH7A 1BCRB 1NMEA 3GA5A 4OIFA 3EXHB 1R74A 2OXFA 1C9JA 3NP7A 2JFYA 1BW9B 3JYQA 3EN0A 3NGLA 3QJ5A 4F85A 4X20B 1CUUA 1Z6XA 2Q2NA 4KL8S 1E3WA 4P8RA 5EFZA 3VR5H 4K6CA 4WINA 3PRKE 2ZRIA 3GQBB 1TAHA 4IIEA 4PRKA 4XSVA 2NVOA 2WAMA 4QX6A 4A23A 1Q1GA 5BY2A 2I6UA 3HKDB 1HO3A 2CC2A 4REOA 4RFVA 4AX8A 1U0GA 2FJUA 2QD3A 2AKYA 2G5GX 4GXTA 3LHDA 2BMAA 5DX1A 3W90A 1UXOA 1WTCA 2A1UB 2CLEB 2I3GA 1W76A 2RBGA 3FG9A 3PCXA 2B7LA 4QYIA 3ZDZB 5JAIA 1XQ1A 2MYPA 1WF6A 5M04A 4IQ4A 2CLDX 5EE5B 2WWIA 1TEVA 3ICOA 4XVRA 5I9TA 2YR0A 1UBCA 3NHBA 2EATA 3K4PA 3ZCPA 1KIFA 3ADDA 4G6ZA 1EBFA 4X61A 5KX5B 2PMDA 4KO3S 4R40A 4II7A 4ZPXA 1XAHA 2BSAA 2OHHA 2VCEA 3WLRA 4G65A 1MHPA 2GVNA 3WRYA 1W36D 2V74B 5CJPA 3AINA 1J0XO 4MI1A 1JG1A 2HJWA 3BD6A 1A27A 3TNJA 1QVAA 1ZGGA 1ZZEA 2EP5A 3KUXA 3L05A 4N5HX 4QFBA 4QU9A 4RZUA 4XGRA 1MRSA 4G56A 1YS1X 4OQDA 4QULA 2ATVA 4LOKA 5LZ2A 5KYVA 3BB4A 4NPAA 4EKDA 2CLKB 4IGIA 2A4KA 1P7ZA 1ZIXA 1U8CB 3IAS1 5D5QA 3DFZA 4ZVNA 5ADHA 5K3OA 3LXXA 1ZGAA 2AC7A 1Q91A 2SCUA 2FRDC 4DEXA 1K6MA 3FUXA 4OL0A 3IL2A 2AOUA 2OAGA 4OMCA 3TLXA 5FPHA 3PXCX 3DPSA 5LJLA 3I58A 3ZWBA 3BFPA 5IT0A 2WTEA 1UBHS 1Z0SA 3LPLA 1DOAA 1VKZA 3HP4A 4RLHA 4HLNA 1EVEA 3OIFA 1E4OA 3BGWA 1GGVA 5AT1A 2X2FA 1YQGA 1XMOB 2ZE8A 3E0XA 4QOEA 4AM8A 4MEBA 2WF8A 2YOGA 4J2HA 1W4CA 1WVMA 2YZ7A 3R3HA 4B3DA 4BY9E 4BFZA 1FFXB 4JUIA 1P2GA 5JECA 2O8BB 2HWWA 2YXLA 4CEJB 5G40A 4YS6A 1ZD4A 4ICIA 4KRYA 1ZOOA 1C9DB 1IIBA 4HGQA 3A1DA 4FZRA 3F5FA 2DG2A 1P74A 3OIVA 1Q57A 3URMA 4H1WA 4Z51A 1XEXA 4K1LA 3IOCA 4EMUA 1BD3A 1QV6A 4NTZA 1QE0A 1NF3A 2Q21A 3KEFA 1U2SA 2GQ0A 1DQSA 2FN8A 1E2LA 1DADA 3I05A 1ZR2A 2VP2A 1UDRA 3K9NA 3FPGA 3IP7A 4MUGA 4A92A 2G9UA 3FHLA 1T29A 2PDAA 3TJZA 1IUNA 3UT5B 4IKOA 4ZRDA 1FBNA 1CUIA 3O4VA 1RJ9B 3HGMA 4RTPA 2HUNA 2XT0A 3LNTA 5EJAA 7MHTA 4PYJA 1R12A 3CE6A 1B76A 1XEAA 1JIQA 1YB1A 5AOAA 3TLMA 4Q3LA 4AS2A 4DMUB 2ZI3A 5L40A 1EB8A 2B98A 4H18A 4U1RA 4P0PB 3V80A 3N0XA 2R8YA 3JR7A 2VJNA 4FR0A 1Y63A 3G2QA 5KYXB 3KHTA 2VQEB 3FHCB 3WMGA 1SKMA 5TPZA 4ZVSA 3IEUA 4PONA 4EFMA 1F2UB 4QNNA 5DHRA 1OI2A 3RS7A 4LBVA 5BSWA 3VZRA 4KE6A 2IYTA 1KSGA 4DAOA 3R5TA 4FEEA 1DDOA 5ALOA 2GOYA 3TRDA 2QRHA 4S0XA 2WNIA 1ICEA 3DXFA 1RLUA 3R75A 4YCNA 4M98A 3MGKA 2LR0A 4D81A 3GDWA 4GKJB 3FIJA 2Q5FA 2YWDA 3BXHA 3KLPX 3L7LA 1WHTA 2IC5A 4TKUA 3FMPB 2WV9A 1BU5A 3VH2A 2CXRA 3PI7A 3DMPA 3G5UA 2P3OA 2KM1A 3QLEA 3R6DA 4FMDB 3D4PA 1IHXA 3NWBA 3ZTWA 1QDUA 5AUOB 3MG9A 4EENA 4WCFC 3W1WA 4RD1A 5LWHA 1ID1A 1PJ2A 4PX2A 4UKDA 2XVYA 5KNCA 3R9WA 2ANBA 1GU0A 1C2TA 3AL3A 5ITZA 1KVSA 3A3KA 4ZT2A 3LYLA 2DJIA 3QU4A 4M37A 2FZEA 2EL9A 3CZ9A 4PZEA 1SQ5A 3RC2A 2RKBA 2D1YA 1Z8FA 2QJRA 1Q0TA 3ETJA 1ZNXA 3DXZA 4FFPA 1QYIA 3OWOA 1UJ6A 1DZIA 3V8EA 4D02A 1BDBA 3EEOA 3S2GA 5BNFA 1EGHA 2YWRA 2H1WA 1QIHA 2H8GA 4XFJA 5FHRA 3C24A 2HJHA 3TZQA 3A9CA 4A8PA 5IXJA 2VTBA 3U7HB 1NN3A 2O3QA 3NVAA 5HKLA 4KO1S 3BSFA 2ZIUB 2RK3A 4UULA 3P0IA 2HKIA 5HW0A 2GM5A 4XXHA 3R3VA 4B76A 2XTAA 2G8NA 1DXHA 1E5DA 4LN1A 1CETA 3V3KA 5JNVA 4Z0NA 2PSDA 3ID6C 4IQ8A 5DTEA 2WYHA 4FDTA 5HS4A 3BM5A 1XMPA 2RG1A 3LZDA 3OM0A 4OQXA 5DLEA 3ZWVA 3I2KA 4W1QA 3WQSB 4U2FA 5D2CA 4AB1A 3OF2A 4F9GA 1RZUA 1Z6PA 5EEGA 1K7YA 3GJRA 2VBGA 3JD0A 2DUJA 5L51A 2ODNA 4GZLA 4MYDA 3OQVA 3D64A 3HDTA 1IATA 2CVQA 3LIPA 3PEYA 3VHLB 3K71B 1EI9A 3DVSX 5FOSA 4U8GA 5C4GB 3ZCTA 1QBGA 2H2IA 2OZLA 2XPCA 3PNVA 4HVTA 4HAIA 3OVMA 4MKXA 2IXTA 4QA9A 3OCCA 2YHIA 4PGFA 4QUHA 4BV9A 2F1HA 2JJ1A 4RPLA 2MTBA 1E3IA 4WXYB 1M6EX 4JFAA 4N6OA 4N7JA 1C7EA 1BXRA 1H8HD 5H9VA 1IULA 2PL9A 2D5CA 2XMQA 3T0GA 3AONB 2Q7DA 3OO1A 3MD9A 4KFTA 4KR0A 4AQYB 4PYOA 5KI6A 3E35A 2XNSA 3TZKA 1TCBA 3LWDA 1J2RA 4E2XA 4TS3A 4BNJA 3QE9Y 4FOLA 2NZVG 4QZVA 1XVVA 3HB0A 4DA6A 3BL6A 3TTYA 4UZSA 1E4EA 1GITA 1Q7RA 1JLRA 1A8QA 4U4AA 2BEUA 2I34A 3EXG1 2ZDGA 2WK1A 3NEJA 4IVPA 1H3FA 4ALKA 1GL9B 2PUVA 3AUXA 4XSHA 1TK2A 4GI5A 2NMVA 1G2IA 1AM4D 1STOA 1R8YA 1VKHA 2NTVA 3BWEA 3QE4A 2V0GA 5ELXA 2QR5A 4B3SB 4YAEA 1S89A 3F7OA 2A9PA 1PLJA 4YMIA 3KSMA 5MGBA 1Y6ZA 4IXMA 1JDZA 1ECFA 1JB9A 1BDJA 2R00A 3TKYA 5A6SA 3UBTA 5D7NA 1LKZA 2O3TA 3BILA 5B57C 2H5EA 4B45A 4IHQA 5F1OA 5JYCA 1KK2A 5FBWB 4Q6BA 3HBFA 3ITEA 4AYWA 4BO8A 2IY9A 1I3OA 1YBHA 5F35A 4IMRA 4Y9SA 3SDSA 2REQA 1PUJA 1O87A 4C4OA 3F1LA 1JH9A 4BVGA 3B82A 2IZ6A 1KDYA 4DKXA 5ULLA 1Y8QB 4ZICA 4G09A 3O5AA 5IAAA 3F3MA 5CX1B 2X0RA 2LPMA 2QVBA 1NQUA 2IEBA 2ZE7A 3EOAI 3W8NA 4ZOLA 4F2PA 1H6CA 2DFPA 1RAFA 4UCXA 4DCPA 3DLHA 3PDIB 4R1SA 1RKXA 5IBPA 4ZZ0A 1UK6A 4F71A 4JEHA 4A91A 5DWVA 2JFWA 2IV2X 4I9NA 1G16A 1FQWA 1MDBA 4J0CA 1IXKA 5HOEA 1X42A 1ORDA 2GTHA 4WN9B 4B73A 3EZXA 4OGKA 2HH9A 2B61A 2G25A 2XMGA 3IEPA 4NZ9A 3QEBZ 2C5GA 2WWFA 3HHEA 1Z29A 3PVCA 2HSGA 4FIZA 4URWR 4GT1A 4YRQA 5CB4B 1M1NB 3ZR4B 1GQOA 1JQ3A 1N3YA 1KMQA 1XNJA 2WWRA 3CG4A 2JDID 3V42A 3VHXB 2MHCA 2PXXA 1NI5A 3AEQB 3BOSA 4CEHA 3RVSA 3TCNA 4FI3F 5B55A 3RTCA 2XNJA 1JDTA 5J63A 1AKWA 1QIJA 5DYNA 4KWTA 5T4EA 5LMCA 3L77A 4DCVA 1ZWKA 3EAGA 1Z4NA 4OMFG 1R4NB 2W58A 3LSTA 5JSKA 5I47A 2CMGA 2QENA 1HDIA 3RG8A 1CSEE 4ER7A 1ZRHA 1HMPA 4NJMB 4UEQA 4KMOA 4UUPA 3AFGA 2XRMA 2P4UA 1NI4B 1UZNA 2WP0A 3M0EA 2PH3A 1ZNYA 2ZRCA 3TQIA 3BQMB 3FNEA 5HM6A 1Q84A 3MW8A 1E6MA 4EOGA 4LS3A 3HS3A 3M3PA 1S6YA 2D4HA 4J16A 4AIIA 3TTWA 3R7SA 3VU8A 1WVGA 2CB9A 1TA4A 2IZ0A 2R86A 3FETA 4K9RA 3MD0A 1NXSA 1QO7A 3KU4A 2XQVA 3HCRA 2GBFA 1NIPA 3AM4A 2XHZA 2V45A 3GX1A 5T3UA 4JIGA 1EXWA 3WJ7A 3IELA 3FTCA 1TRKA 2C98A 4JLSA 1SUDA 1YQDA 4CKBA 1RCTE 4AP5A 2CDNA 2V4MA 3OOEA 3R7LA 2IY7A 5A3RA 4KH1A 1G8FA 2NU6A 1QGOA 1U2DA 2CKDA 1GFWA 2H4ZA 1NNI1 3Q2IA 4LYGA 2G4LA 2WDZA 2B82A 3KPYA 4HAZA 1EGQA 4TYQA 4IGEA 1M2NA 3M2PA 2OTCA 4UAUA 1KP2A 3WGVA 2H16A 2NT4A 3KJEA 4MK4A 4WZ6A 3BIFA 3CSSA 1Z9BA 4FZ5A 5FTJA 1N32B 5JY6A 3Q9SA 1B2RA 4IUYA 3PLNA 1ATIA 3W7BA 3DBRB 4CMEA 2IFTA 1VLQA 2EZTA 3KYIB 2QD4A 3LDHA 3A8TA 5U1PA 4DR7B 2DERA 5C8YB 3FSRA 5DBEX 3PL5A 1KDRA 2XKKA 1AU9A 3P45A 1N2JA 4NV0A 1US8B 4L57A 4K7JA 5CM2Z 3L06A 2WMOB 4F60A 2FPKA 2DFTA 3AGPA 4O29A 4E22A 5SYAA 2JLYA 5BORA 1Q6YA 3MPOA 4TLMB 2GJAA 4CMCA 2IH2A 2YL2A 5BXYA 1K0UA 1ISJA 1CDOA 1W4RA 2LW7A 2Q0SA 3I6YA 1ZQ9A 2BFFA 1VG1A 4Q7LA 1RXSA 2NXEA 1JAXA 2DWOA 1XFDA 1XZJA 3ETEA 5C80A 1MHTA 3VV3A 4ZCLA 2V4ZA 2XF8A 3UTDA 4LXGA 4YHBA 3VYRB 1N8NA 5BV2P 3I9V1 4BTEA 1L9KA 3M3HA 4RU1A 2N42A 4CL3A 3AZPA 3QBVA 1MB0A 3P7MA 4LTNA 2B37A 5LP6C 4CFSA 1XTKA 3M6WA 2XZDA 5CURA 1IDN1 3D3WB 1H8EA 5EZYB 1E1RA 2QVYX 3D59A 5KMGA 2L69A 3A9UA 3KQPA 4IFBA 5GJCA 4A5OA 4CNQA 5C37A 4C4YA 1I7NA 1X9GA 2WUWE 1KMIY 4N39A 5ECDA 1VLZA 1H4VB 1WXDA 2C78A 3DZJA 2D4AA 2R6GA 3I9LA 4QXAA 1P2VA 2HQBA 4K28A 5EZ6B 1QX3A 4CLXA 3C4QA 1TA0A 2C3MA 5BSKA 5JS2A 5JVDA 1NPYA 2HADA 2HUPA 4JL8A 3WLEA 2EGHA 2WKQA 3T4PA 3GJ8A 5FADA 3T3NA 5JZSA 1A9QA 3W6ZA 4MWBA 1WQ4A 1QKJA 2CMFA 4Q7EA 4IWNA 2PS3A 3W5JA 3CMMA 5THKA 1ZM4A 4LJ7A 4US2R 1T1SA 1Y80A 4BVFA 2A6PA 3AGQA 1XPJA 4PWZA 1IY2A 2ST1A 1UMBA 1P8AA 4OG2A 4XYGA 3VZQA 3H4VA 1Q1EA 4G5SA 2Q0XA 1RWWA 4JVOA 2UZ4A 1NN0A 2NO9A 5HA5A 4B3BA 4S1PA 2RMKA 1FVXA 1PR1A 1QZ3A 4IDBA 4JI2B 5M7EA 3HNPA 2LRHA 2ZT8A 2C88A 2G1UA 3AHEA 5EXDA 2QY6A 2WZBA 4C0AC 4CU2A 3DOHA 4MCIA 1Q6ZA 4YO8A 1C41A 1TIPA 3VO8A 3OCWA 1VGQA 4YJGB 4EI2A 1ULSA 3GEDA 4UXHA 4CCWA 3ANSA 4DM4A 1QX4A 4O3FA 1CDDA 4HSEA 4DDTA 4CLRA 3VZBA 4EG0A 3QFRA 1EBBA 2ZM6B 5I48A 2CL5A 3PWSA 3CV3A 3EMKA 1Q0UA 1Q7CA 3M89A 3KVOA 4ER0A 2I6SA 5GZ3A 3AUAA 1QH8B 3P4XA 3E81A 1XPUA 1OW3B 1KGDA 3K05A 1NXXA 4GM4A 2OMKA 1HV8A 1M1YB 4FBGA 2V6IA 4J6EA 1ZCAA 4RZHA 5BR8B 1JQJC 1JZTA 1OGIA 1T9KA 1VLJA 4W5TA 2G5TA 2ZUEA 1D5CA 4KZPA 1XZMA 1YBAA 1E5QA 2IT1A 4IAOA 5JJBA 2NSHA 2V0NA 2ZUVA 1QLJA 1TPYA 2J5KA 2OG1A 2DUUA 2Y1DA 3ANNA 1SOUA 2Z58A 4D9IA 1KL7A 1O08A 2QD5A 3DAFA 5BN4B 1DDGA 1J33A 3O4FA 4BLTA 3DLIA 1GUAA 3KE8A 5BWCA 2Y1KA 4EWLA 3GHHA 4RIEA 1LV8A 4WL0A 3PXDA 4QOHA 5KJEA 3QVUA 3B3QA 3RUFA 4U9IS 5AKZA 2YC2C 2IBSA 1NNLA 4BN5A 3EAQA 1WY5A 4FYPA 4QYSA 5DSTA 1H6BA 1FJHA 1Z2DA 2YN0A 2ADOA 1JYEA 2O2EA 2RE8A 4AKHA 5LQKA 4MDHA 4LHWA 4ETWA 3FFBA 1LU9A 2ADMA 7REQB 3PQ7A 3SF8B 1UK7A 3FSGD 1FTSA 3SZOA 4IIFA 2NP7A 2ZSUA 4UVDA 2YOFA 1UJMA 5JJCA 3AVVA 2BZGA 3PXAA 5JWHA 1AS3A 1QH9A 3GN1A 4BB9A 1WUJS 4IZOA 2JFOA 4DRXB 5ESWA 3UWKA 3IKVA 4EUEA 4YQZA 4CIYA 3NVKI 2DPYA 3DHWC 3KZMA 4TTIA 3TIGA 3WGTA 2WD7A 3EEIA 5J4HA 5LIPA 1RKQA 1XRJA 4DIFA 4F3YA 4MUAA 2G80A 3TXXA 2WG0A 2R6R1 1FPQA 2CK3A 4TT3D 3RW9A 1I9CA 4R01A 3U37A 4E88A 1MOZA 1GAQA 3AR9A 5T8KA 3AL0C 5ECGC 4YBRA 1I5OA 3KTOA 3LQYA 4KYUA 3LNCA 3ZUPA 4NYJQ 3OOJA 2P0AA 3G85A 4JL6A 1RIFA 1RJDA 5ILGA 3NHMA 1PTKA 4TMWA 1OFGA 1R9MA 4GPD1 1QHFA 1GCOA 1NJ5A 4YR7A 5EIBC 1JEYB 1Z7GA 3KSBC 1OT5A 3PT9A 3MILA 3FPJA 1GAWA 4MV4A 4ZMSA 3GLFB 5DBHX 1DAGA 3RJ9A 4NZMA 4AMVA 8OHMA 1RI5A 4YUYA 1MX3A 3C3CA 4GGPA 5FUVA 3ZZUA 3AXTA 3EGWA 3VGPA 3FVRA 5J47A 2FPIB 2P2SA 1O4VA 1GQRA 1UBFA 2V97A 3I0NA 3AERB 4RANA 1TOAA 1Z4QA 4DV0B 4NJEB 4X3PA 1OKKA 5F9FA 1KO5A 3NG1A 1X87A 4GVPA 4LQDA 2D5IA 1PRYA 2DB3A 5ES4B 5K4GA 1M8KA 1C4OA 2ODPA 4M6WB 2ZPUA 3GJZA 5E3JA 2O2ZA 1E5LA 4Z7JA 3L8FA 3N2LA 5DYIA 5EXTA 3L6RA 2GO1A 4YRDA 2VN8A 3DS8A 4QJ5A 4XRGA 5IX8A 4B75A 1Y1SA 1TZMA 3TB4A 5TSDA 1VP3A 2CNKA 3B1WA 3TB6A 1PR0A 3JALA 4CV1A 1N2CA 4R6XA 3TXYA 4DCNA 3HJRA 3QBEA 1W48A 3IUQA 4HL6A 4I9GA 5BQXA 4EO4A 3I6IA 4W99A 4MS1A 2DHDA 5HM8A 1ZRMA 5J3JA 1QH1B 4TXNA 2OESA 1JR4A 4RY0A 4ALMA 2FXIA 3K9GA 2A5DA 2ETXA 3VR4H 1UPTA 4JN6B 4RYLA 4Z3KA 3PCTA 4AXXA 4BMNA 1TVEA 1D2CA 1P6UA 2BKEA 3AR3A 4ZYTA 3U0BA 3KT3A 4MCJA 4LY6A 1UC5B 2OZVA 5FORA 1AJEA 2VDLB 4UJ5A 2VK1A 2BGUA 2DQYA 2Z9CA 4ND5A 3ZE7A 4IL5A 2JD0A 1O95C 5DVZA 4AZTA 1DJLA 2AG0A 1Z4KA 3I0ZA 3H8WA 2JFFA 2QN3A 3L79A 3GVXA 4MXDA 3FFTA 4D9JA 5T4HA 3S68A 5A3QA 3DL7A 4NIMA 1NUPA 1U0FA 1RP1A 7MDHA 4ND8B 1YO6A 3R7FA 1PG5A 2YVLA 3LC2O 4I4NA 2AOTB 4IHJA 4P4SB 2EGGA 1Y7TA 4XR9A 5EUQB 3GQVA 1XD2A 3FVQA 4BWFB 3K94A 4NMLA 1C3XA 2VPIA 4HHEA 4MNTA 4PIPA 3ELDA 1N0IA 1ZJJA 1RPTA 3EULA 4LRQA 4MIKA 4Q6WA 3SYNA 4I9UA 4C9BA 4W1PA 1OVMA 2VK4A 3AP1A 4OH7A 2YQ4A 1U7HA 4Y2HA 1RJGA 5D5PA 3ST7A 1ADBA 5FAKA 1M2VB 5IJAA 1UXHA 3H83A 3K0SA 4U0KA 1RQGA 3PUXA 4G26A 3PENA 5IC5A 1NVWQ 3IUSA 3W2GA 1HXHA 2R5NA 2O3RA 4GD3Q 4NCJA 5BMVB 3KR2A 4MW9A 3H3XA 2VF8A 4ZXFA 2X0DA 4F12A 1S96A 6NULA 2F17A 3M5DA 4OGGA 3STTA 1NRJB 4X92A 1UKZA 1CYEA 4RQAA 3SC6A 3CLUD 2QJTA 5A71A 2CE2X 1IPHA 2LDXA 3HY6A 1B2LA 5H3CA 4H6WA 4H1TA 2GN9A 2X3UA 1Z83A 3EOZA 3IPCA 3RUIA 4YXFA 1MXFA 3HR8A 1GG2A 4WWHA 5DNDA 4AAYA 3FOEC 1AXRA 4YK7A 3WGQA 4D3FA 1BOOA 3D7NA 3SIWA 4EG1A 2XQFA 2GA9A 1U7ZA 1G21E 4ITUA 3TLGB 4V1CA 3GLRA 3THYA 5DJ5A 1GTZA 4O4JA 2AFVA 4G4IA 2QL5A 2ZYGA 3R7WA 2IHNA 1L5VA 1KJIA 1QZTA 1RTTA 3BXGA 4PLFA 4I4IA 4KRGA 1HC7A 5IBCA 1EP1B 1AO0A 2P3QA 2W0MA 2QX8A 3PCRB 2GAJA 5GM1A 2OLJA 2IA5A 3T1HB 3ZGOA 1KAHA 4I4TB 2AE2A 1HTBA 4DCSA 1CVLA 1R9GA 2YIJA 2ZJ6A 5AP9A 2B9EA 2QTAA 4ZI5A 3U44A 1IHYA 3HRHA 3KZOA 4DQUA 4AU1A 4N3AA 3BRCA 1MH9A 1FDRA 3FPEA 4LWOA 1CU1A 2HT1A 4QUIA 4S1TA 3HMKA 5D6OA 2G4CA 4H4CA 4B4VA 5DSZA 4LG1A 3UXYA 3PHLA 2XYHA 2ZBEA 5GZ6A 2QUBA 4LRUA 3C1UA 5A4IS 4C4PA 2JIRA 5KWSA 2VQFB 1CUGA 4QSHA 3DBVO 5BR7A 3UWMA 3COWA 3DKPA 1NUUA 1U3CA 3S1LA 2YYSA 2HYDA 2VHUA 1MVNA 3ZBTA 2OLKA 4D3XA 3RYIA 2I4NA 4U9HS 1Q0PA 1RQNA 4IG9A 3DVRX 4JP5A 4CR7A 2V3CC 2C20A 5JFTA 5EHIA 2Z95A 3GP3A 1CJUC 1SBTA 2G71A 8GPBA 2BF4A 2BGIA 1Y5NA 3PC6A 3ZK9A 5ED4A 1NUQA 4N5DA 5JI2E 1D1TA 3CJQA 2P68A 3N9IA 4BO3A 5HRAA 3DT8A 4TUYA 3NXKA 1YDFA 2GZMA 4KDCA 1NQVA 1PS0A 3BMOB 3S8YA 2FQXA 3OO0A 3REQB 2ZSIA 1KBOA 1Z4PX 1H2AS 2FSIA 3EY4A 1TQ6A 4KO8A 4TMTA 5JEDA 1ZN7A 1O58A 3ZCRA 4DNPA 3GU3A 1VL6A 2CNLA 1KVUA 4TTPA 1RPAA 4CKEB 4EVQA 4UPEA 5BSFA 5DX0A 1FP2A 4MZDA 3ZHCA 4HAXA 3FGPA 4TTQA 5JAUA 5KINB 3U7IA 4EARA 5KYYB 4K1XA 2C0QA 1UBOS 3BL8A 5C0OE 5A3VA 4LJ6A 4MIYA 1C7FA 2OZEA 4XWOA 2PGNA 3CMCO 1NBWB 3IQZA 1OIVA 1UANA 2GPJA 3EW7A 3OFND 1WDWB 1Q20A 3NONA 2X1VA 4CG2A 1U2TA 2AFIE 2ZR7A 3VOTA 1SKYB 5CFRA 1E1LA 4BVAA 3NBAA 1F5SA 3JAKA 4HBGA 2D54A 1DUIA 2H65A 3M4NA 5F2OA 3WX0A 5EXXA 4DE5A 4BX0A 2Q3MA 4RA9B 1A9OA 2I55A 3R5FA 4L4UA 2W71A 3EFBA 3RBVA 1TQ8A 2H92A 2LD4A 2IZ1A 5EA2A 2IGTA 3CNHA 1R8QA 4IO0A 5CP8A 2XYQA 3LBAA 3PC4A 3MOGA 3HB7A 1JKIA 5DZSA 1GM5A 3O91A 3QA3E 1NVEA 2FPUA 1ZOSA 2O1XA 4WDRA 1X7ZA 1VHDA 1NDHA 3F9IA 1E6EA 2G9RA 2XXAB 2GN4A 4NMMA 2IP2A 1IM2A 2NO1A 5JALA 4FYHA 4GXNA 4JXZA 1XTVA 1OXUA 1QC5A 1NVFA 1ZK0A 3FPHA 5ICFA 4C05A 3O8NA 4K6OA 3P2IA 3WL3A 2LBPA 4RX1A 1UCFA 3RS9A 2FQ1A 4V0KA 3ENKA 2IPAB 3H8JA 4FI3C 2OD9A 3M5WA 1EMDA 3LKVA 4O5OA 4ZODA 5LQAA 3WLSA 3LS2A 4O63O 4GZ6A 3HCWA 3IPLA 2FN4A 4EHAA 1U1EA 3L6DA 2MINA 3PR3A 3A4YA 5F77A 4TL7A 5CDFE 3T7CA 2R7MA 4ZAWA 4LC1A 1JHMA 4NKRA 1EVZA 4RVSA 4RY8A 4YUXA 1ZHOA 1SFRA 1M6VA 4LQ4A 4QSMA 2WQ6A 3FTFA 1B3RA 2Q6TA 2HHAA 1ZICA 1EEXB 2GEFA 4OHPA 5DEOA 1F14A 3D2AA 3OF3A 3BK2A 1GAEO 1I4TD 2WIAA 3W2TA 2O5RA 4B3TB 2AX3A 1CPYA 4ZAZA 2FW6A 1AUVA 2WSBA 2H9YA 4UVEA 4FTWA 4AY2A 3EAFA 2OBMA 4DM7A 3O8DA 1FYVA 2J3LA 2Y1LA 3SN6A 5J5VA 3QEKA 3AUUA 4PZCA 3OC0A 4B31A 1OH6A 5BSHA 3DDHA 2NU8B 3LLVA 4EPRA 1JWAB 4LJ4A 2OXTA 3RRNA 3PIIA 2B94A 1T15A 1DCTA 3L6EA 3JQRA 2IYRA 5CITA 1VB3A 2WB4A 4C0KA 2D00A 4WZAE 5TE9A 3TM5A 4HS4A 4EM6A 5HJ2A 2QNIA 1SXJC 3H6GA 5GTDA 1KYIA 4Q0MA 5TIIA 5JPDA 1GPLA 1UAYA 2JVIA 4MV7A 5F9HA 5EVCA 4D3ZA 2X3FA 2X8JB 3WYFA 4EW6A 4MYCA 1YCGA 1SBHA 3SHFA 4F3CA 1HZZC 1USVA 2OGSA 3DE7X 2C61A 3NFRA 3ZDAA 1V25A 1EFUA 1U0OC 3TSYA 2OM2A 4I8IA 5FP0A 4BDSA 3QU5A 2DTEA 4D9HA 3AF6A 1D6MA 3LUBA 4DPKA 3OT4A 4CM7A 3CUEF 3C8UA 3TZLA 3SQNA 4V38A 1XQ9A 4O4HB 3O75A 3UFBA 2J08A 3EVDA 4E5YA 3IEVA 1F1JA 1YL5A 5K0EA 4V1CI 3HZRA 4YJ3A 1TYCA 4B5KA 5BVGA 3CINA 1C1XA 1U4SA 3IULA 1L8XA 4EI9A 3A1EA 1QO0D 3M33A 1VE9A 2C4TA 2FFJA 1E66A 3LYHA 3M2TA 2ZJYA 2BFBA 3ZWDA 4BEJA 1ISSA 1AHIA 5FX2A 2XUIA 4MB6A 5IAKA 1FFDA 3G3EA 3WOVA 3CLSD 3GLIA 4BNKA 1UBGA 1W5BA 2HF8A 1YS7A 2Z2JA 4P31A 3VA7A 5C81A 4L4XA 4LNUA 1O8CA 1W34A 3RJMA 1PU2A 3CIFA 1KAGA 4G4JA 1B6SA 2PUTA 3TRJA 2IS1A 4EECA 5IAOA 5KHAA 3IKMB 1JTFA 4DAEA 1GGKA 3JQFC 3I23A 2AEJA 3WMRA 4TKVB 5TGTA 2FZ5A 3N0TA 2RHRA 4ILEA 1VE1A 3N2GA 3DVAB 5FNZA 1LX7A 2I54A 4HB2A 3D8BA 2JIZA 2PLFA 4IOMA 1GL6A 3OFJA 3WAKA 2HRDA 1TTTA 1JALA 4BVJA 2XNKA 1TYEB 3KP1A 1YQEA 2D74A 1OPRA 1OUMA 2J3HA 2P9YA 2O5VA 2QV0A 3CH6A 1UKEA 3IMKA 4OK5A 3S2UA 1TF2A 3GPIA 1TVKB 3D6TB 1KWGA 4UQLA 3GP8A 2W6JA 3MMNA 5EJIA 2IS4A 2VAMA 1A2OA 4GNRA 2JA1A 4LE1A 1IOVA 2CK3D 4WI1A 2I78A 5A1TA 4JKOA 1LJ8A 3ILVA 4ECEA 1LFDB 1XTZA 1P3JA 2PGAA 2QRNA 3OSUA 3Q3VA 1S7CA 2A4MA 3D6AA 1C80A 3ZHTA 4LKRA 3WDKA 1Z0FA 1U3FA 2OD7A 4FOTA 3F97A 4W5HA 2YHUA 2BI7A 3M6FA 1O6ZA 2HTEA 4ZK6A 1NONA 4EHJA 4P34A 4LRXA 1H4SA 1WV1A 1RHUA 3D3JA 1YMUA 1GZ5A 4G63A 4RH3A 2Z6UA 1SUEA 4FFMA 5DGCA 4LJAA 4WBNB 3L0OA 5GJVC 1A9PA 1JHYA 5E6SA 4BO5A 3NYWA 2YJ6A 4C0JA 3IEKA 4PM4A 2QXUA 4H60A 4EFNA 1RXWA 5SZIA 2EFDB 1E9AA 2CNNA 4EYSA 1SZPA 1PFVA 4KO2S 3TOCA 1G3MA 5GVSA 3F8WA 3MMXA 2FPSA 1D9XA 2G9QA 2VUSA 2DWQA 1F9EA 3ILSA 4S35A 5BXQC 2Q3LA 1EDEA 1Y7PA 1UPUA 2GO7A 5CJ2A 3WISA 2NO6A 3D8RA 4PZ0A 3GAFA 4I1VA 4B6QA 2QI9F 2GWRA 1CY0A 4D5GA 5LQUA 4QBKA 3S27A 1RXVA 1CJVC 2OILA 4YPOA 3TOZA 3I9FA 1IBRA 2HA6A 4PYIA 1G4AE 1PNTA 2QUAA 2QTVA 2C94A 1E0SA 3LDFA 5FUBA 3BQ9A 3USES 1YU9A 2A14A 2H1RA 1QS0B 2W83A 2XT9A 3CPEA 1KJYA 3AFNA 3C3PA 1PE0A 3IILA 3DE0X 4BLWA 3CW9A 1FUUA 5JWOA 1EJ6A 4QXMA 3ICEA 1WG8A 1PUIA 3PWKA 1N7HA 4CIDA 2JKYA 2W93A 1I7SB 1CUXA 1BU8A 5BUQA 1I7PA 1XU9A 3VDMA 2C5AA 3I04A 5K8UA 2VLIA 4L5CA 5K6AA 4Q93A 3AY6A 1OH5A 1KR2A 2WVJA 1Y3HA 4WFJA 1K8RA 5FWAA 2OCLA 2Q3FA 2GJ9A 3U60B 4PX9A 3THOA 1RM3A 4HH4A 4LF6B 2REOA 5BRNA 3V8VA 2XEXA 1BE8A 4NONA 1TJNA 1PDOA 4XUDA 4BECA 1P1BA 1V8FA 1DXOA 2X4LA 4G5OA 5CVUA 3MCUA 3DDZX 2HJGA 2IOHA 3JYNA 1X7YA 3B36A 1CQJB 4XCVA 3REOA 1KY4A 2ZB8A 3P9PA 1BKSB 1J7KA 1L4HA 3S7TA 4E5KA 2BI8A 3G1TA 4GRAA 3TE7A 3WC4A 4RTLA 1XX6A 3R5SA 3CY6A 2D6FA 2PUBA 3GH1A 3AEKB 4ZU1X 4J3FA 4BPBA 3ZV3A 5CYFA 2QD2A 1H66A 2O2IA 3L8MA 3QLVA 5CA0A 3WHIA 2DPHA 4RK5A 1B3BA 3UHAA 4EF6A 4JUFA 4CL0A 3K2BA 4KXXA 1E5VA 1AF4A 1P80A 1FW8A 4D8WA 2A5YB 4YV2A 5JZMA 1D6JA 1AKTA 3CWZA 1U90A 4GMDA 3W9UA 2J9RA 2QYTA 1X80A 3P9CA 1AK9A 2QV7A 2ZJ7A 3DLTA 5IABA 5AUPB 3R0VA 4O4LB 3A3OA 2Y0EA 3AB7A 4AJJA 5CFNA 3OKAA 4BATA 4KVFA 1LZLA 2J6HA 2WDPA 4QJBA 3TJRA 4BQSA 1ZR4A 3V4RA 3OKPA 4Y6SA 1CFJA 2B2CA 4AMZA 3DE4X 3INGA 1TDJA 3VPCA 2CHEA 3N87A 3R09A 1YMVA 2VJCA 2P27A 3GD5A 4NBSA 3RVMA 4AJOA 4F2HA 4XYBA 5AI6A 4KMSA 2BGMA 5HK8A 2VPTA 4R9RA 2OLEA 1FJXA 2DFNA 5FO0A 3K9FC 1TCAA 2FEOA 3PFFA 3TI7A 1A8UA 1CLEA 3NU1A 2WJ6A 4B43A 1B0UA 5C7OO 4JYBA 1M1UA 1ZJ5A 2XIQA 3G68A 4U0JA 4Y0VA 3F7TA 4MW0A 4QDOA 3EARA 3TZEA 1H1LA 2O0KA 3FMGA 1XLWA 2HSZA 1GFSA 4EPWA 2RHCA 1EVIA 821PA 3K6SB 4EABA 1VXOA 2H1IA 5JS6A 4B4KA 4E15A 3PQEA 3RS2A 1IQRA 1EFTA 3UWSA 1WL8A 1NYRA 4XW2A 3SY8A 1WKCA 3DTVA 3WQHA 5KOJB 3RSCA 3T54A 1AGYA 2F9FA 3O84A 2R6HA 3R5KA 5COBA 3O26A 3QNUA 2UKDA 4QPZA 1LF0A 1NP6A 1NV8A 5BP7A 2C2OA 1KFEB 2W6IA 1NXOA 4J3NA 1QQAA 3N58A 4IDOA 3DDCA 5EHXA 5JCOA 2AC4A 3ELUA 1WW3A 4Z2YA 4ZI7A 1VECA 3DMNA 1KBQA 3E0QA 3T9AA 4AJKA 2C5LA 3H16A 2IDZA 2QLNA 4PFSA 1NJ6A 2IEYA 3TL6A 4CRWB 1GZ4A 3P96A 2LWIA 2IYXA 3Q7SA 3CN7A 2AR9A 3UK2A 3EH2A 4NU6A 1W47A 4BFVA 1ZN2A 5DHSA 3NKVA 3WDSA 1Z7EA 2VIIA 4XTCS 1UDAA 1UQTA 2H4JA 4U2GA 4Y2YA 4QDTA 4AUMA 4L75A 4YCSA 4PXSA 3NOOA 3EX7C 2D3WA 2FETA 3HLYA 4PC3A 4X1KB 1AV6A 3TQQA 3RFUA 1L5SA 3E7DA 1EH5A 1ZM3A 2WMYA 3RTDA 4FVTA 2IV3A 2A33A 4OKNA 4FGSA 2ZUFA 3ORHA 1M3SA 1K6JA 4JLVA 2Q7XA 4JQYA 3FOZA 1GGHA 1OIWA 1OFTA 2PM8A 4PG5A 4NENB 2OB1A 5EKXA 1S2NA 1R1DA 4OGWA 3W9SA 3SD7A 4HEHA 3OICA 4TV8A 1XE3A 2Z98A 4EDHA 5FLYA 2OQVA 4LMBA 3JVVA 1QG4A 3MEQA 3UYKA 5KYNA 1F6WA 2GF0A 3NYRA 4KG7A 2IHZA 3SM3A 2CMDA 5FBHA 3WP1B 3Q8MA 4EGAA 3TTSA 1KYYA 4RL6A 3CWQA 3G8BA 4UTOA 5K3EA 1QCDA 1Y34E 2JBWA 3NZEA 2M9MA 4LMRA 5EKUA 4KR3A 3LQQA 3NHJA 2HCTA 1W0JD 2O20A 2PZAA 2VJOA 3K0FB 4Y0NA 1DBWA 2G08A 5CK4A 2FK7A 4E5DA 5ALVA 1U8AA 3ESAA 4KFCA 4OBEA 2C9OA 3BS4A 4NE7A 5AOCA 2GNPA 2L42A 1HPLA 2Q2VA 4Z1MA 1E4VA 1A2BA 2IXBA 2A0XA 2P90A 2PKRA 2B7CA 4HDKA 4DJAA 5IJ9B 4GLLA 4MQLA 4JSYA 4DABA 3N8DA 3UQZA 3EXIA 3MELA 1I2BA 3SJBA 3VNQA 1X86B 1T4CA 2GBPA 2ID9A 3RNLA 5JI3E 5JRZA 2OBLA 4E0BA 2PX8A 1GRQA 1U31A 4JITA 5DN6A 3VYUB 2O8DB 3DV0B 3N2EA 2GK6A 5BSTA 3BAZA 4YRMA 4DLVA 4LGCA 3GMSA 3GZ4A 1V5WA 4RD6A 3N3BC 1ZMRA 3CEMA 1VE3A 2PWZA 2OV4A 1P1HA 3JQGB 4WCFB 1NW5A 3H3JA 3V8RA 5JH7A 3IHTA 3BEOA 5EESA 1MAVA 1K7CA 4D0GA 4AO8A 5DHPA 4IKEA 4F4CA 4YMWA 4PBRA 2QVGA 5K45A 5MFZA 2JS7A 3F74A 4YROA 4I66A 5AW6A 3HM9A 1DKOA 1NL3A 2AEEA 2ZBUA 3TNLA 4DLRA 4YUAA 4FMPA 4NCBA 5FOWA 3O47A 4PHCA 2LXNA 4EELA 1N2BA 3DGFC 1P4RA 3AR7A 2EIHA 1HDCA 2ZR0A 1Q5PA 4GPZA 5AJTA 4AD8A 5SYNA 4JQZA 5CB6A 2RONA 3JYHA 5F78A 1BEUB 1P31A 1D04A 1JW9B 1KVRA 4HLDA 1FMCA 3IUYA 1E2JA 3ZXSA 2QA5A 3CSDA 4W5RA 3ZDDA 1K2VN 2ZTVA 4I08A 3UXMA 4B85A 1Q1QA 2C00A 4G8CA 4UAGA 4Y9UA 4HDMA 4RKFA 4XVQA 1Y1QA 2C9CA 2PSFA 2ZSFA 3ZCQA 5AVXA 1ZGCA 5C32A 2DH6A 4NQZA 4LC0A 5A7GA 3RKUA 1YDWA 3IOBA 2IYVA 3LUHA 2A92A 4J7XA 2VJKA 3IQFA 4P3OA 4MVJA 3K8OE 2XWSA 5GOZA 4MIOA 4WLVA 3SFTA 1ZEMA 3CRQA 5EIHA 3ADBA 2O8FA 4U2BA 1I0LA 4ZVLA 1CUAA 4M3NA 4I55A 1C3OB 3DL4A 3ITNA 2PKXA 2ZCUA 4EFDA 2N1MA 3GNSA 1J4AA 4YJ2B 4PZDA 1ISHA 2BFOA 5KU7A 1DKUA 2I6FA 3ZH2A 3CLTC 1P1CA 1RRKA 3OWXA 4RFLA 1FIUA 2PKEA 4P3NA 3L04A 1KKUA 1X13A 3D7KA 3HUFA 3BWDD 3C3BA 3D0KA 2GZAA 3KUCA 1RS0A 4QOIA 2VWHA 5E8RA 2FFAA 4II2A 4FHEA 1TT7A 1SXJE 2ILTA 3ZVMA 4M8NE 2C57A 3QPBA 3IOYA 1I30A 4NH4A 3B60A 2R0QC 5BOSA 2Q5LA 3L02A 2IJGX 4QGBA 4R7ZA 1I0IA 1EXNA 4UM9B 1HYQA 3WLTA 2OBYA 3W9YA 3GRAA 3P0RA 2WAOA 2YMPA 1Z0IA 3OE7A 1D4OA 3PC8A 4P2BA 4X1OA 2IKQA 5FA5A 1JG2A 1U94A 2W2VA 3R0QA 2IL1A 1T3SA 3ENNA 1OU0A 3COYA 5ABPA 4DJ5X 1EX6A 1P62B 3D8SA 2ZBQA 2HSWA 3GGJA 4NYJR 4PZLA 2J8ZA 1AGNA 3ANTA 3BMCA 2ZJBA 4TMVA 1S2IA 2ZPAA 4DJDC 2G82A 5EHGA 1F60A 3KVNA 2HIMA 3P9RA 4JJZA 3UUFA 5IDWA 2WP8J 3LBYA 4U2DA 4XQGA 1YR7A 1Z18A 5DTRA 5F33A 1RHRA 2DWPA 2LP4Y 2VCYA 4L02A 1PJLA 1VJ0A 1XTQA 2VPYA 2X6RA 5A02A 4WKCA 3H0KA 3JQ8A 3C7DB 3KKEA 2JB9A 1G5HA 1G21B 2XUZA 3M8KA 4NOKA 2XTZA 4IQ0A 5ALHA 4EB0A 3JQBC 2COEA 4CKCA 2WIJA 2JATA 4QXQA 4N65A 3PEVA 4ZCPA 1OT3A 2NVWA 3BD8A 3IVAA 1HDEA 4LX8A 4K2HA 3KTAB 3BERA 1EFVA 5JAPA 1M6NA 4X8LA 4LOIA 2OWEA 2G1PA 1NFQA 4RSMA 4U2EA 1MOSA 4BPRA 4MUYA 4ENVA 1QM5A 4Q4HA 4E4YA 2H08A 3MRTA 5E4JA 3O83A 1Y3AA 2OHFA 4CEIA 3DOUA 4O33A 5FWXB 3OOSA 1L7NA 1AN0A 3LK7A 2OFXA 2AJCA 3SHVA 2P6MA 5E7JA 2I65A 3E05A 2EKBA 4R1NA 1WCXA 1P75A 3IV9A 2W6JD 2NQ2C 2RGUA 3L7YA 3HABA 3VBCA 2ZBRA 5K8LA 1U8ZA 1BYIA 5IEBA 1KRXA 1SBIA 4MQEB 2IUUA 1ENZA 2R7NA 1A50B 3K0CC 1YZQA 1JJ7A 3AVPA 4FE3A 1YJXA 4TZ6A 3ZI4A 2VRBA 4YCCA 4CE6A 4DC1A 1W0KA 4KXFB 4DLYA 1BCSA 2A2ZA 3HFSA 2IBTA 4PHGA 3H13A 2ZS7A 3HKBA 2JAOA 4WNIA 1VJ5A 2FR0A 2NXCA 1R8JA 5B2ZA 3S29A 4DLLA 5GWXA 4II3A 2OGUA 3DAHA 1E99A 1TK3A 3GNTA 3IGFA 3JSAA 5B37A 3BIJA 4F4IA 2RH5A 2F2TA 2JJ2D 2G7MC 4JDUA 4BEWA 2IYAA 1RHJA 2CNWD 2ZSHA 4Q1DA 4A0GA 1ITZA 1E5TA 4ZEVA 2DHEA 5TT0A 3DKRA 4CCAA 2J85A 2PKCA 2P4SA 4FDMA 1PEDA 1ABBA 4JASB 3LBHA 2A88A 2I3DA 5HKKD 3T52A 1KYWA 3F46A 2NVBA 3A9VA 4QYXA 3ESQA 4U7PB 3LE8A 1RW4A 1NU8A 1GVHA 1RVDA 2BZSA 4EO7A 5SY6A 1XYGA 1W94A 4OHYA 5GQSA 5IYZF 1Z33A 5AOBA 1VKRA 2J5BA 3DUFA 3O3OB 4JQSA 1FU4A 6PFKA 3R7AA 4FIDA 4B4DA 1X94A 3SOZA 3KWFA 1L6IA 5CAEB 2BSQA 4CCYB 3TZBA 5JBQA 1CF9A 3D6UA 1C0IA 2J33A 4ZQCB 5HZMA 1R0SA 5EQTA 2OQIA 5KUTA 1JE0A 3I2FA 1GPBA 3AESB 1JXQA 3CRMA 5HUJA 2ZUWA 1E4YA 2HDWA 3OCUA 5LOVB 4Y6PA 3EF1A 1YS6A 4ILKA 5ITWA 3QVGA 3WLLA 2GT1A 5G41A 3TL2A 4CFYA 4IOLA 3CVVA 1A88A 1L8QA 4IV0A 1P3Y1 3SE0A 6GPBA 1JB1A 1TUGA 2AFIA 4I1UA 1J2UA 4QUJA 2REXB 1TUBA 2PA3A 2FFRA 2ET6A 2BFDB 1W5FA 3HDQA 1CZHA 3AKYA 3KL4A 2C2WA 4GI1A 4NEQA 2ZQYA 1YOVA 4G36A 4OLHA 1AXGA 4XAQA 1BJTA 3DKVA 3UMGA 3LI2A 5C8DA 1UH5A 5JJ5A 2OV2A 3DZCA 2E37A 5AVJA 2Q27A 2I8LA 3LU1A 4FP9A 5T41A 1G7TA 3QXHA 5E95A 1QFSA 3ZVLA 2VA8A 2D0DA 4KVGA 1EM6A 4C2AA 3BRWA 4NNJA 2FPXA 1MENA 5E9QA 4PSUA 1QK4A 1WUTA 1KARA 4FOPA 4QUEA 1L7XA 4RSRA 3CB4A 1KQOA 4LHZA 1FTYA 4MITA 4QG3A 3BE5A 2HZ7A 5KNDH 1KF0A 4FZ3A 4JVLA 5THXA 3V34A 1IZ0A 5LP6B 5MHTA 1M74A 4GOXA 1Y9JA 1Z73A 2QT9A 3TW8B 1ZNWA 2IZ7A 3V4PB 5J2UA 3F6PA 3DF7A 4LUCA 4R1OA 3GRPA 3R40A 4RAQA 3V46A 4L28A 5DE3A 4B3XA 3PHCA 2HU5A 1SIOA 4MVJI 2BCGY 4NYIQ 5F5NA 4WXEA 3I04M 3RYFB 4B34A 4C2BA 3E1KA 4IQGA 1Q0LA 5CDFA 3SAJA 2CXTA 4HWPA 5K09A 2Z8XA 1B0PA 2V8BA 4BRSA 1JTEA 2E2WA 5F12A 2G9NA 1JKMA 2OENG 2QTFA 3L8EA 9ATCA 3L1HA 1GCIA 4TMFA 5IJ0B 1RHMA 3ZDEA 2R87A 1V1MA 2F7SA 3AHCA 3LHKA 2AG5A 2FR8C 4D9NA 4OATA 2W8BB 3D54D 4QD3A 1C1HA 4D46A 4OQYA 3Q3IA 2UUBB 2DQSA 1C9EA 2YHBA 3O9MA 3R0ZA 4WOKA 5EHNA 2GCOA 1N1EA 1BKYA 2QI9C 3AMVA 3ZW8A 5HNKA 2JGDB 1IBCA 2ECOA 2COUA 4UARA 5KB3A 4ENWA 4MTCA 1MA0A 3JS5A 4WNAB 1L8AA 4JP1A 3HJNA 4R7GA 3E3OA 3DLAA 3ENZA 4M9SA 5DGTA 1ZL0A 3L1KA 5K99A 4S04A 3EZFA 5FBZA 4KNVA 4Q1EA 3COVA 1MW9X 3G5TA 1H0SA 3KQVA 2WRZA 4FEYA 4N03A 4BL5A 2UYHA 1IXYA 2NU7A 3IQGX 4WZAA 4J3JA 4WLOA 4YP6A 2BEWB 1CZUA 1H9BA 2GNAA 2AFHE 1J0CA 1UWKA 3MBIA 3UAOA 2A0YA 5BYKA 4BWGA 1KJNA 3FSJX 2BMJA 1TX4B 1OBOA 2DBQA 2H7YA 3SP1A 3DWEX 1F0KA 4S1WA 3MIIA 4DWOA 3RKRA 3I76A 4ZYXA 5I7VA 3DBLA 5FPTA 1U8XX 2B34A 2QHXA 5J2TF 3FMIA 3RFXA 2JFPA 2OR3A 4PX3A 3SLKA 4CQLA 3GUYA 3FXAA 4DBLC 5HFJA 4LGMA 4MKFA 4V02A 4OX9B 3BWCA 3LTNC 1O5OA 1MEOA 4WZBE 2A8YA 2AYXA 1SC4A 1JI3A 1BEZA 4M0EA 1ILEA 3KPUA 2YDXA 2IXEA 1SCAA 3PR1A 4BXOB 4J9UE 4DLXA 1Y7IA 2O4CA 1FXUA 1NYTA 4QUGA 4JB8A 2C7OA 4L2IB 3FKQA 2LE0A 3L6UA 4JNKA 4E32A 4KWIA 5JOQA 5EP2A 1E9DA 5B4UA 3DTNA 3D3KA 1DELA 2GR9A 3QEJA 3H9JA 1T0HB 3QFHA 3NH6A 4ZZ1A 2BONA 4G2TA 4HRYA 2GAFA 1HQCA 3EEYA 4YR9A 3H87A 3KT6A 4XCXA 1Q0RA 4C7OB 4JYZA 3DE1X 3DLPX 4RA6B 2FDXA 3MTEA 2X1LA 3FB4A 5DNAA 3NWOA 1KWKA 1UPAA 2E49A 4AJ4A 1DC7A 2CDRA 3H5RA 3CCCA 5WRFA 2W5UA 1ADJA 1G3IA 2XUFA 1FYWA 2Y9PB 2Z3WA 3H9BA 3N2KA 4YAWA 3C3DA 1SQ0A 4A4DA 2WHYA 1GNVA 3GC6A 4YDHB 3V8MA 4ESEA 1R8SA 1DTEA 4MOWA 1BS9A 5AVYA 1NIJA 1OI7A 1YFKA 2ROQA 4X0EA 5G1PA 3K1AB 5A2QA 4WQMA 2FDCA 3T1OA 1ZCBA 2YFKA 1FC0A 4L5AA 4PRZA 4R41A 5NLLA 4RPGA 2AG8A 4A26A 2GTPA 3SE7A 1ACLA 1P2BA 3OQPA 2AUMA 1QUFA 3DE3X 3HEAA 5JV5A 5DBOA 2ARKA 5F98A 1Y7HA 1NNEA 2I2DA 3VPSA 1X7XA 3RNOA 4WN3A 2X4GA 4HAOA 2ISSD 3IAFA 4N12A 4JBXA 3UAYA 4E1BA 2V7QD 4ZJZA 4DPMA 5JAHA 4X63A 2XQKA 2UYOA 3PUZA 4HFNA 5IT4A 3KT0A 1YB6A 2GK4A 2J59A 4B6JA 5IF3A 2RKWA 1A76A 3RIXA 5JNUA