3OIYA

Helicase domain of reverse gyrase from thermotoga maritima
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
407
structure length
407
Chain Sequence
AEFWNEYEDFRSFFKKKFGKDLTGYQRLWAKRIVQGKSFTMVAPTGVGKTTFGMMTALWLARKGKKSALVFPTVTLVKQTLERLQKLADEKVKIFGFYSSMKKEEKEKFEKSFEEDDYHILVFSTQFVSKNREKLSQKRFDFVFVDDVDAVLKASRNIDTLLMMVGIPEEIIRKAFSTIKQGKIYERPKNLKPGILVVSSATAKPRGIRPLLFRDLLNFTVGRLVSVARNITHVRISSRSKEKLVELLEIFRDGILIFAQTEEEGKELYEYLKRFKFNVGETWSEFEKNFEDFKVGKINILIGVQAYYGKLTRGVDLPERIKYVIFWGTPSGPDVYTYIQASGRSSRILNGVLVKGVSVIFEEDEEIFESLKTRLLLIAEEEIIEEAEANWKELVHEVEESRRRSER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords reverse gyrase helicase domain
publication title The latch modulates nucleotide and DNA binding to the helicase-like domain of Thermotoga maritima reverse gyrase and is required for positive DNA supercoiling.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 152
structure length 407
sequence length 407
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3oiyA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3oiyA02
4Q47A 2G9NA 1I4TD 3LFUA 2W2VA 2ZQ5A 1E9DA 3DM5A 3GLFA 3VNUA 1CJMA 1W47A 3VAAA 2YHSA 1ZINA 2Q0HA 1XU4A 4MUBA 2JLXA 1T6NA 2V1XA 3DHWC 2REBA 2YINC 3DMDA 2B92A 3OAAA 4PC1A 1Z6TA 4ZCMA 2OV2A 1IJFA 3AF3A 1N6KA 4IHQA 2BBTA 4JMPA 3U3RA 4JT4A 2ZUBA 3C7KA 1FTNA 2GA8A 1BS1A 2GVZC 3LAWA 1GL6A 1NLYA 3NBXX 4WXRA 5AJZA 4Q4JA 3S1AA 4B48A 4TQ9A 2YC4C 5EXXA 5FL7D 3VNVA 1DAKA 1VYVA 3K0AA 3MMPA 4M9QA 2OFWA 1SXJE 3ZLJA 3NC0C 3NHBA 4RKEA 3JVUA 4V0NA 4LC0A 2WJGA 3U44B 2DFLA 2W6IA 1G18A 4HLUC 4Q7JB 4EKDA 3LA6A 1UAAA 2ZTSA 3FB4A 4FWIB 1SZPA 3B1YA 2IWHA 4A0FA 1E2DA 4DZZA 4NHOA 3LH5A 1IXZA 1PZNA 3TW4A 5DI3A 1KDRA 2SHKA 1FOEB 3IBYA 4GMDA 4Z54A 3AVQA 4M1KA 2C03A 4YLGA 3WP0A 1SKYB 3SOPA 2XNSA 2FMXA 4BFXA 2D2FA 1EXMA 3CX8A 4UXHA 4EUNA 2WWWA 1UFQA 3W5JA 1N2CE 2F6RA 4AY2A 1E32A 1FX0B 3SE0A 1GIAA 1ZM2A 2OBLA 4DUGD 5FH9A 5KNBA 2B7CA 3IPXA 2WPDA 1X3SA 2NZJA 1QHIA 3SBEA 2CVHA 3RNLA 2FWRA 3THWA 1KZGB 1CR2A 4PFSA 1JI0A 4L4UA 1P9NA 2NPIA 2RMKA 5HCNA 3TQFA 4WZAE 4RZ3A 1WP9A 1Z3IX 2WJHA 4PANA 1KKLA 1NP6A 3ADCA 4D26A 2Z4RA 3WXMA 3PENA 1HV8A 4AYWA 4GL2A 5CYOA 3ZZ0A 2QENA 3Q5DA 5AWFC 3H4MA 5C2JB 1G8HA 3CNOA 3U7EB 2FZ4A 1IM2A 4TN1A 5FBVB 3RS0A 3W5IA 3BXZA 3JZMA 2ZSEA 4JLPA 1MR3F 3R7WB 5KYKA 2GK6A 1YZKA 4BFUA 3WYGA 2O8FA 4H1UA 4DT1B 4BEBA 2D62A 4Q7KA 1G291 4IFEA 2GZAA 2MSDB 4AC9A 1PVOA 1YJ5A 1FUUA 2IYUA 3W6OA 1ZAKA 4JBYA 3TIFA 4ZDIA 4G5OA 5J4HA 3VR3A 1X8KA 4NPHA 1U8YA 4B3DA 2WKPA 2AKYA 5BN4A 1HTWA 4Z8XA 5D3QA 3VR6A 4P31A 4HUQA 4Q7LA 4RZXA 2XX3A 1XJQA 3DKPA 3OEHD 3GLGB 1W36C 4LPSA 3UMSA 2F7SA 2A30A 4KCGA 3EPJA 1S8FA 1NI3A 3OFNA 3ASYA 4US2R 3SQWA 3B9PA 2ONJA 4FCTA 1QHXA 1NSTA 1JEDA 3EAQA 4JKYA 1F3OA 2BEJA 2QT1A 3NH9A 4YMWA 4IRUB 3EZ6A 3CRRA 3I8SA 1RYFA 4NMMA 2V55B 2QAGC 4Q00A 3AP3A 4IVQA 1R0XA 1TL7C 1X1SA 4MYUA 2OEPA 3QEJA 5LBIA 2GCOB 4BECA 3Q8XB 5TY0A 2ZANA 1VG0B 2DFTA 4DCNA 4OBEA 2W00A 5CB6A 4Z8YA 4UKDA 5EP4A 2YC2C 3AGPA 2QGNA 2RGDA 3AGQA 4RZ2A 2RHMA 4KLNA 1YKSA 5FPYA 3R8CA 1XD2A 1VDZA 4A2PA 1DEKA 1HH4A 1LB1B 1OV4A 4CF7A 5J4VA 1W36D 1M8PA 2FFBA 2HJGA 2Q9BA 1KSJA 3CW2A 2P67A 3P27A 4LV6A 2LCFA 2BCGY 2JJ8A 4Y0AA 4OHYA 4BFWA 5FOTA 2J41A 1KK0A 2JASA 2AX4A 3AVUA 2C9YA 4BQSA 1DO2A 2RAPA 2CCGA 3KJGA 1Z0JA 2JGNA 3GJ6A 2XZLA 1G17A 2WKRA 1II8B 5EE9A 5AJXA 1LS1A 3K0FA 4MYCA 2WIBA 4N3NA 1LVGA 3WMGA 1UJ2A 1GL7A 5C18A 2BV3A 1TEVA 2FE4A 2PMKA 2V1UA 3QY0A 3I5XA 2AL7A 1RKBA 4NYMR 2MSEB 3GPLA 1TF2A 1ZP6A 2KE5A 3BFVA 5DN6A 5FTLA 3I92A 1XTIA 1Z6GA 2ORIA 1W49A 4O2LA 1E4YA 4US0R 2ZSAA 1TF5A 2CCKA 1NY6A 3DZDA 4TMZA 4RD2A 5GJCA 1CR1A 1GILA 1NJFA 1D6JA 1NIJA 4NYIR 4B6FA 2BM1A 1EX6A 4LUCA 2HT6A 3SJAA 1CEEA 3R20A 4DB2A 4P0TA 1I2MA 1UF9A 5F2EA 5CDFA 4LDJA 1Z0AA 3X1YA 4GI7A 3UWKA 1LTQA 2J7PD 3VHXA 3MWKA 1E0KA 4D4JA 2C2HA 3TUZC 1Z2CA 3TRFA 4BRWA 1ESNA 3SJCA 3PEUA 4W7SA 1TTTA 1AZSC 5IDVA 2J7KA 2FSHA 2RCNA 4LBYA 1VHTA 5CM9C 5GJWC 5CB8A 2WTUA 4A15A 5IK2D 4CDGA 2ZI5A 3QG5A 3NDBB 4PSKA 1WB9A 4FWTA 3QKRA 2A78A 1HE8B 2AN9A 2ZI4A 1GL9B 4Q01A 5FOUA 3GEEA 4O25A 1TQ6A 1KI1A 2I1QA 1GAJA 2IWRA 2AK2A 2ZR0A 1YQTA 2PH1A 3K70C 4PR0A 1Z2AA 1VCOA 1XD9A 5ANRB 4DLWA 4D4MA 4Q02A 3VMFA 4KAXA 1UKYA 2ATVA 4UNQA 1N5LA 1FQKA 1G9XA 2C96A 1JB1A 1BKDR 2GHIA 2OT3B 2PZEA 1W0KD 1TF7A 1NSFA 2FFHA 1D5CA 1K5GA 3NBFA 2RGNC 1KJZA 1UEIA 1UBEA 4XD7A 2W6ID 1OB2A 1AS2A 1E4VA 3MFYA 3K9GA 3CRQA 3KFXA 5B64A 2ZU6A 2R65A 1QHNA 4M9SA 3U61B 1W2HA 2G1JA 4OK3A 1U8ZA 2OBMA 4NYJQ 5LDDC 3ZDQA 1M74A 1OFIA 2BBOA 2PL3A 1R6BX 3K8YA 2QA5A 4P4TA 5LD2C 1DG3A 2E87A 3CR7A 3QF7A 2ODEA 2FG5A 1P9WA 1IN4A 1U2RA 4OQMA 3PR1A 1OW3B 2DY1A 3F5FA 2C9OA 3AF0A 4TYNA 3KXIA 1OFHA 1ELOA 1P2TA 4MGYR 3U60B 1AZTA 3RHFA 1UKZA 2HF9A 2YOHA 4MRRA 1A82A 1DADA 5JSZB 3LX5A 2J9RA 2NO9A 1EFTA 3LD9A 4A8JB 3OE7A 2GK7A 1KMHA 2N46A 1JR6A 2WPDD 4YMSA 1GKUB 4JSTA 1UADA 2BDTA 1DPFA 1MABB 3KQKA 1SVOA 4GPTA 2ZYVX 3UANA 5HPYB 3I8XA 4QXAA 3DM9B 1KY2A 1S0UA 4DLYA 4C4PA 4V0LA 3C16C 3MWJA 2WJIA 1SGWA 4PAOA 1DE0A 1DAFA 1KKMA 2PX0A 5KPDA 1O3YA 1F60A 4YC7A 4UJ5A 2RHDA 2GWHA 3DVLA 4OI4A 2OHFA 1BH2A 3OIYA 5HE9A 2XSZA 1NN5A 2O8CB 1Z08A 4PQFA 3C14C 4JL6A 3RRNA 5AUPB 1AIPA 1SKYE 3C5HA 2WWIA 2WSMA 2DR3A 3ZYCA 2FEOA 4V0OA 3G0HA 3CRMA 4WZBE 5CIWA 2DCUA 4LRWA 2IUTA 2J3EA 2KBFA 4TL9A 1WA5A 2GBLA 3UMFA 1GG2A 3E2IA 4DB4A 2IYQA 4F92B 1E2PA 4G1UC 3CUEF 2ZITA 3AP1A 3QJYA 1YU9A 2CK3A 1KIMA 4Q1FA 3B1ZA 2JIZD 1E1RD 4TWZA 2WV9A 3KDSE 2IUSA 3RSLA 2ZI6A 3FTQA 3LVRE 2R2AA 1Z29A 4WZ6A 1KI4A 1R5BA 1Q1BA 1Z0KA 1TQDA 2GEDA 2VO1A 4F4CA 3U4QA 5H68A 1E9EA 1DAHA 4PC7A 2J87A 2JLZA 3BGWA 2ZJ8A 4M53A 1WCV1 4POAA 4KITB 4C0QC 1XJ0A 1Z07A 3NVAA 3KFVA 2J0UB 3CNNA 2V9PA 1Z63A 2JLRA 1R5OA 1XXHE 4RZUA 5E4FA 1T3HA 1NBME 4AG5A 4PQYA 5FL7A 5JECA 3VR2A 2GNOA 4YDHB 1D2EA 1U0HC 3SNHA 1RRFA 4LPKA 1R0WA 2QM7A 4XIGS 2QE7A 3EA0A 3R9XA 2IYRA 4E03A 1XCMA 4LBZA 2ASEA 3OZXA 3GEIA 1CR4A 1R2QA 1XCPA 4BRUA 3L0PA 4QGHA 4TL6A 2CL7X 2PZFA 1SVWA 5C46F 3TH5A 1JR3D 4EPTA 4NCJA 1NVWQ 4QOSA 1P9RA 5HCIA 3PUZA 3OHMA 4S35A 2R6FA 1SVIA 1AN0A 1XWIA 4IXNA 4W9MC 3BORA 1DTSA 2HCJB 1KO8A 4TZ0A 4ZKEA 2C99A 3KQNA 4QNMA 4QJ3A 3D3QA 1FP6A 2ZE7A 5JI2E 3KXLA 4F91B 2V7QD 2OILA 4W5JA 1TU3A 4KFUA 3N70A 1NRJB 3ADKA 3B5JA 1DELA 3SJBA 3A37A 3MGCA 2ZI7A 4M9XA 4Q4AA 4D0GA 4Q4JB 2VSFA 1T3SA 1Y3AA 4HLUA 5DN6D 1BMFD 4C0KA 3THXA 1NL3A 4IDPA 1OH5A 4BFVA 1JQLB 5J40A 4BLQA 2C04A 1FNMA 4MITA 3MAAC 1T9HA 1V43A 4M9ZA 4TMKA 4R9UC 5HE8A 2E1RA 3LNCA 1II9A 4NDZA 4BZXA 2B8TA 4QKQA 5DISB 3V9PA 4LJ6A 2BMEA 4ASUD 4ABYA 2WAXA 4DLTA 3T12A 4URZR 1YZGA 4DLSA 2AK3A 1E94E 2Q3MA 1KJWA 2F43A 3WBJA 3ZVLA 3O47A 3B8HA 3Q9LA 2P6NA 2ORWA 2VP0A 3GJ7A 4US1R 1G4UR 1M6NA 4QL3A 1US8A 5EE3A 3G5UA 3LX8A 1VKJA 2OAQ1 1AKEA 1E69A 3RWOA 3UATA 2OG2A 3OEHA 1JALA 3QXHA 2V4ZA 2XXAA 2CNWA 2W0SA 2VHCA 1AQUA 3K9NA 1G7TA 1ZD9A 4DBLC 4EJSC 1AGRA 2OCAA 3THWB 1GP2A 3QVVA 3ADDA 1MRSA 4QBHA 1ZJ6A 5BYJA 5C1BA 1GTVA 3M0EA 3EZ9A 5BQ5A 1CJVC 3ZD7A 1NIPA 4FMCF 3KJEA 4ZCIA 4TL7A 4GZLA 4WXPA 4MYTA 3T61A 2QTHA 1Z5ZA 2JLYA 4PSAA 1W5TA 1OSNA 3ND9A 4PTLA 3UG6A 4Q9JA 3T15A 4TT3D 4R2IA 1W4RA 1XCGB 3NEJA 5FPKA 2BBSA 2J45A 4Q7MB 5E3HA 2IF2A 2O8FB 3PG5A 4YONB 3T5GA 1DVRA 3CM0A 4G01B 3CF6R 2NO0A 4NYIQ 5FTMA 1WF3A 2GTPA 1OT3A 3ZIAD 2H1LA 2WWGA 1G21E 3C41J 1N25A 1IY0A 2GEUA 4PZYA 2WVJA 1OYWA 3SHWA 1KI6A 3HU1A 1KJYA 2HF8A 1P3JA 2G3YA 1E2GA 1EFUA 3VKHA 4TSFA 2QGZA 1ZUHA 3BD9A 2QN6A 2ZJZA 5FI1B 3D6TB 4JVNA 1QRAA 2IYYA 2XTNA 1KO1A 2QAGA 2VH5R 3M4YA 4XSHA 4KHZA 4EFNA 1D9ZA 1K6MA 5AK0A 1KI7A 1G8YA 5GJVC 1P2UA 1KDTA 1OLOA 1UKVY 4MKIA 3Q3JB 5AR1A 1XTSA 1H65A 4PPGA 5BN5A 2BCJQ 1TU4A 1M7BA 1OKKD 4ITRC 1GITA 3KUDA 3M1IA 1QHHA 2N42A 1ONBA 3F3YA 5EUMA 2ZU0C 5JBQA 2QMHA 2H5EA 4IDOA 3A1WA 2CL0X 4PHGA 3W6NA 1KI9A 2VP2A 4OYHA 4S2EA 3EIEA 4GP7A 3SEAA 4RCYA 1XTJA 2CMKA 4LJ7A 3CPHA 1XD2B 2QUZA 2XAUA 2EFDB 5BN3A 4B76A 3KKPA 2C78A 2V8OA 2Z43A 3OF5A 4PO1A 3GLHA 4UQOA 4E07A 2NG1A 2FJUA 4Q1AA 3SN6A 3ZZUA 2G88A 3A8TA 5JFGA 2WIAA 2EFGA 2OXRA 2ZR7A 4QGAA 5CM8B 2QMOA 3LWNA 1D8TA 3U7GA 5KDLA 2CK3D 4YQFA 1MO6A 2J7PA 3D31A 1TADA 4L9SA 4QM7A 3LBNA 1MRNA 4GSYA 4KYIB 4W5HA 3KKMA 3T1VA 1EFCA 3QKSA 4HATA 1LF0A 3K0FB 4OI2A 5IK2A 4D25A 1PLJA 3LVQE 2CLSA 4AK9A 1KTVA 3CLVA 1E2EA 4OKSA 4Q21A 4A0GA 3H2YA 4LHWA 3PUYA 1M1YE 3W90A 5JHHB 3HYTA 4MA4A 2QEQA 3NWJA 4AKGA 1E2MA 4C0SA 1CBUA 1GWNA 2HDNB 4A2QA 2BEKA 4AD8A 4KSBA 2W6JD 3QOFA 1UM8A 1Z0DA 4C7OA 2EFCB 3FDIA 4JLOA 4DLUA 1AKYA 5AJVB 4IOKA 1WRBA 2AR7A 4ZIRA 1E9FA 5LPNA 1W0KA 2GF9A 1D2MA 1R8QA 2ZRMA 1LV7A 2QRZA 2GJAA 2ANBA 1R0YA 4B73A 4D82A 2QE7D 5TDHA 4TL8A 3QPVA 1T3LA 4DSUA 2A5DA 2IXFA 3SR0A 3TW8B 3WRXC 4A0HA 2DYKA 1AGPA 4PPNA 4M2LA 4BLSA 1MO5A 4EDHA 1H8ED 2QP4A 1ZU4A 4OQFA 4CEHB 4PO9A 4D0NA 3VFDA 2ZYWX 3D8BA 2J0SA 4LHYA 5FOWA 3SHFA 2KI5A 3LY5A 4URXR 4MH0R 2JLWA 4URYR 3LW7A 5KSPA 3ICQB 1Z0IA 4KFSA 2QL6A 2WICA 4L8GA 3RANA 1F2TA 1RE0A 1XZQA 4XVRA 4Q4HA 3AM1A 2BHRA 2HT1A 5B58C 1LS6A 3QKRB 2QQ0A 4NU0A 2EQBA 3R9IA 1RZ3A 4JT2A 1N5JA 3GLIE 3QE0A 2C95A 3LXRA 4PZLA 1Z47A 3U2QA 5FPTA 3QUSA 1PJRA 3ZH9B 5IRCD 2VTKA 1G3UA 2QU8A 1ANKA 1KY3A 4B3XA 2A7QA 3H0KA 3NG1A 5KSOA 4ACAA 4C9BA 4EPWA 3ETLA 1DOAA 3QPWA 3GCGA 4JVLA 2DFKB 3SZRA 2ZUDA 4ZCLA 3L82B 1YHNA 3UIEA 4KV9A 4B35A 3N5CA 5EZ5A 2CBZA 1FPMA 4X8HA 1OXTA 3X1DA 4CEIA 5B2ZA 5K8IA 3GFPA 2XB2A 1XBTA 3PUWA 4HAVA 4NBSA 4UXIA 3IIJA 3AVTA 4URUR 121PA 1VMAA 3GLFE 4UNRA 3AQ4A 2ZAOA 3CF2A 1NMYA 1MO4A 3WYAA 4F38A 4NH0A 4GNKA 4G5QA 1HT1E 1XXHB 5L3SA 2NO6A 2IYSA 2FX3A 1FQJA 2EYUA 4KBGA 1RIFA 2PBRA 5B57C 4I1OA 2XZPA 2REOA 1HA3A 2FPLA 3DEFA 3DKVA 4ERNA 4JLAA 2VP5A 2ZJ2A 4PC6A 3GD7A 2O8EA 2ZRDA 4GT1A 2J0QA 3A1TA 3L0OA 4IJMA 4V03A 3IGFA 1TNDA 5EJEA 2JIZA 4MGZR 1E1RA 2GXQA 1CS4C 5J4KA 1G6HA 3IIMA 2CNWD 1ZIPA 2WWFA 4NKRA 4QHTA 1XPRA 4C2TA 2F3RA 3U7HB 2OCPA 4QHSA 4LK2A 4M21A 2B7BA 2C77A 5DYIA 1B23P 4GMXA 3ND8A 4PO8A 5H8WA 1FP7A 4CRWB 2JAQA 1T5IA 4URWR 4K81B 2FOLA 2C9CA 2ZAMA 1G5RA 2H17A 4DLXA 4ZDKA 3NIBA 1TQ2A 4X8MA 5A5GA 1W7AA 1E3MA 4U00A 1GOTA 4TQUS 4JZKA 4EPXA 2BVNA 2VSXA 2CCJA 2Z0MA 1YR6A 2CHGA 1P7CA 2FSGA 3LBIA 3WNBA 3TUJC 3LLMA 4M1TA 3IEVA 4HZUB 4DCVA 1ZC3A 3MUFA 2A5JA 3PQCA 4Z1MA 2ZRLA 5CK4A 3QXXA 1SXJC 4TMVA 3FWYA 3GJ3A 3EPLA 1KK2A 3P32A 1XPOA 1T8TA 2O0JA 3ZJYA 4FCWA 1E9BA 4F93B 3X2SA 1G7SA 1K8RA 4YDSA 1XF9A 2AXPA 1E9RA 2XTZA 1DARA 2WMOB 5C4MA 1L4YA 4TLAA 1YZLA 4D80A 1N0WA 3HWSA 4TSFD 2GCNA 1KO5A 3CRW1 3EW9A 2QAJA 5AUOB 5GVSA 1JR3A 1VYTA 2D4HA 1U98A 1CULC 2OESA 3A4MA 3FFAA 5A0FA 2ZI3A 2ERYA 3FMOB 4IFBA 4B2LA 3FMPB 1P2SA 2IYLD 3RLFA 4JLMA 1CF4A 1PLLA 3HDTA 2OAP1 3AVWA 4M1OA 1II0A 1VG8A 2QI9C 4QGFA 3SC3A 3W6PA 5J4LA 1IBRA 3AEZA 1W4BA 3QF4A 2V7QA 1KI8A 1SXJD 2FDCA 4MDFA 2ZS7A 3BK7A 4V02A 2QBYA 1A2BA 3MJRA 2EYQA 4Q9HA 4YXWD 3PV0A 4LJAA 1PUJA 4LC1A 2AFHE 4A6XA 1BMFA 4L16A 4IDQA 2NPFA 3EWSA 2AXNA 4MRNA 2OCBA 3CX7A 3V00A 3X1ZA 1OH8A 4RD1A 4ZV4A 2O8BB 3BERA 4A1FA 3TNFA 2XZOA 1EFRD 4K46A 3KQUA 2Q9AA 3CZPA 3Q85A 4EPVA 1JPNA 2H16A 1JXMA 2F1RA 3VHLB 1TX4B 4V0KA 1LNZA 2QORA 3V4FA 2HUPA 2H7VA 2HYDA 3SI7A 2RGCA 1NG1A 2JJ2A 2ZJYA 4G3XA 5KNDA 1F6BA 1G3MA 1F2UA 5FOVA 4ASUA 1UBGA 2WWHA 1JPJA 5HZHA 2JDIA 1RYHA 2PMDA 1FUKA 3QKTA 5FBLB 4X8LA 5JWHA 4Q48A 4DLZA 4YMVA 1KZ7B 1UEJA 2FFQA 3UPUA 4JLKA 1IAQA 2EFEB 1U81A 5K8TA 1U9IC 2X2FA 1YZTA 2WWXA 2BIFA 2PT7A 3IUYA 3QG1A 4OI1A 1EWRA 1TUEA 2W0MA 4IEIA 5AUQA 3WNDA 1P73A 1TMKA 2CVFA 1HEIA 1E2JA 4I1VA 4KO8A 5JS7A 3EARA 5FTKA 4FD2A 4GOJA 2IX3A 2RGGA 3I1FA 8OHMA 1G7CA 2IYWA 4DLVA 2W83A 3CWQA 4KLZA 1NN0A 4BLOA 4Q4AB 5KPJA 1XEWY 1OIWA 2BBWA 2PLRA 3CO5A 2VF7A 4L9WA 1PLKA 4DCUA 2UKDA 1CJTC 3THXB 1UBFA 5KDDA 2YWEA 3I3SR 4DDUA 5IF9A 1IOZA 1GZSA 5F9FA 4BLPA 2XGJA 5F98A 4JYBA 2ERXA 2R6CA 3CX6A 2O52A 4FINA 2IHYA 4QBIA 5KDOA 1SVLA 4XJXA 2X19A 2QNRA 2HEIA 3FVQA 5DHFA 3IKJA 2IEYA 3EPKA 2IS6A 1IXRC 1S1MA 4TT3A 2HYIC 4DJTA 2H18A 1E0JA 1UPTA 1E9SA 2WJYA 4ACBA 2BM0A 3B82A 4AI6A 1T0HB 1Z6YA 2D2EA 2ZJBA 2QPOA 4FN5A 4A0RA 5K8UA 1R8SA 2VLIA 1KK1A 3ZIAA 2E9SA 2F43B 3PEWA 2Q9CA 5L3RA 4MKGA 3VKGA 1S1CA 3GMTA 3WHKA 3K70D 1U8AA 1VHLA 4EJSA 4O0MA 5SZHB 4B6EA 3CZQA 3GJ4A 4C0HA 1US8B 4TYQA 1CXZA 4PHTA 5EZ6B 1J8YF 4V0MA 2IBMA 2UZ3A 4NCKA 4KSCA 1G5PA 4DCSA 2XXAB 1AS0A 4KFRA 1Q21A 3D7MA 4BASA 3VR1A 821PA 4Q1DA 1HQYE 2CJWB 3RRYA 3TGPA 1NG9A 2DWOA 3OIVA 2VHJA 4IW3B 2O8DA 1X1RA 4HLDA 3A1UA 4LJ5A 4EFMA 4EPRA 1KDPA 2VA8A 1KOFA 4OQLA 5DI9A 3K9HA 2TMKA 1DO0A 3ZD6A 5EQTA 1EWQA 2IS1A 4CEJA 2D7CA 1DAGA 4OHXA 1BIFA 1YRAA 2R8RA 3LBHA 3W8RA 1OHHA 1BYIA 4NP6A 1OKKA 1ZVQA 3UKDA 5CDFE 4BFSA 1WBBA 3B9QA 5CLLA 2CL6X 2Z4SA 4ON9A 4RD4A 4MYHA 2F1JA 5UKDA 5JHGB 3CPJB 1FW6A 2PZGA 4B47A 2CHQA 3GLGA 1E9AA 1GFIA 3B1XA 3SFZA 1ZM3A 4OL0A 2IYXA 3VU9B 3WBKA 1G7RA 1S2MA 3U6BA 3DPUA 1NJGA 1RRCA 4IOJA 2C8VA 5TXGA 2QT0A 4E22A 4I1UA 1W36B 4PSVA 3PITA 1E98A 1N6RA 4HAXA 3UXMA 4B3BA 1IN8A 2ZYTX 4B71A 1AJEA 1JECA 3THYA 1X8JA 4R7ZA 3FHTA 2V6IA 4XWAA 1OXXK 5HKKA 1VIYA 3W3ZB 2HJVA 4BLRA 2GCOA 1R4AA 1XEWX 1ZM4A 2NMVA 2BMJA 1N0UA 2JEOA 4U7DA 2ZE5A 4GZMA 1NNEA 4NE2A 3SYNA 2QAGB 2V3CC 4ZKDA 4TYWA 2X8AA 4I99A 5KOYA 3TAUA 1S9DA 3OIWA 2JLUA 4FMCB 2HCBA 4D81A 3QXCA 4EFLA 1J7KA 2FU5C 3LLUA 3MD0A 1OH6A 5JJLA 3MCAA 4KODA 1SVKA 3CRVA 3QI2A 4UXJA 5EE0A 1QHHB 1G8PA 3U3KA 4DXAA 1BYUA 3KJHA 1L7VC 4M1YA 1SHKA 2W6JA 4TTPA 3SQXA 5F9HA 2ONKA 4N0DA 3AH8A 4RD3A 3GLIB 4M1MA 3A1SA 3B13B 1F5NA 2IHBA 2X2EA 4Z1MD 1II8A 1VCMA 4MRVA 2OM2A 2XEXA 4M4SA 3VQTA 5FBQB 3W34A 4DDTA 5KSYA 1G20E 1E2IA 4BZPA 2WZQA 2MMCA 3SYKA 2IYTA 3GLHB 3DOEA 1IXSB 1YZQA 2QTFA 1QZXA 5G40A 4QHYA 1HYQA 2H92A 3TSWA 1XPUA 5AJYA 4BE7B 3WP1B 2P5SA 3X1WA 1XMVA 4BFZA 1HUQA 4BGDA 2KB0A 2QMEA 3UG7A 1RJ9B 5E7IA 1H8EA 2PJZA 4LV5B 3PJRA 2OFOA 3U3MA 4A82A 3CBQA 1OFTA 1GM5A 1GRQA 2BWJA 3QKSB 1XD8A 3A58B 3GLFB 2EWWA 4I1SA 2IXGA 4LGMA 2ZXUA 2O0HA 3PUXA 3KL4A 4OK6A 4H1VA 2G0NA 3RSOA 1T91A 1GRRA 3PEYA 2IT1A 2X77A 3LDAA 2ZE8A 5JEEA 1P62B 4JSYA 5JCPA 4RKFA 3KB2A 1FTSA 3H84A 4MKFA 4ZDJA 1E2KA 2AWOA 3I72A 1GNPA 1GNQA 3CH4B 1ZNXA 2Q6TA 3EZ7A 4HDCA 3SS8A 1G8GA 2FA9A 1Q0UA 1Z6AA 3S1AB 2F55A 3NHAA 3WYFA 4ZIRB 2QM8A 3FKQA 2FZLA 5DE3A 1OB5A 4LJ8A 1TUIA 2ZRBA 3K0AB 2A5FA 1Q3TA 1AM4D 3LO5A 4LJ4A 3TAHA 2ZJAA 4I4LA 4B44A 5K8LA 2AHOA 4AIIA 4JJZA 4UNPA 3NTUA 2DB3A 2QTVB 2QY9A 1CU1A 2JJ2D 5G3ZA 4DIDA 2ZREA 2XTMA 3RYTC 4QC2A 2DWPA 3EIQA 4DIEA 5C4GB 5DI3B 2JDID 4MGIR 2J1LA 2OFXA 1M7GA 2VSOA 3KXKA 1EX7A 5CITA 1EK0A 5F3WB 2QPAA 4KI0A 4F4JA 2CE2X 4W5WA 1F2TB 5FOXA 4Q4HB 4KJZA 2VRWA 1HY3A 3AUXA 2IK8A 2RB4A 4NONA 1JQJC 1IN6A 3DZ8A 1G64A 2KSQA 3KJIA 4XSGA 1GSIA 1K5DA 3K53A 2GCPA 3BH7A 4Q4LA 3F8TA 1E0SA 2P6UA 4UJ3A 4JL8A 4RY2A 5HR5A 3B6EA 5AUNB 1KO4A 1W5SA 2NQ2C 4A4DA 3GJ8A 4EAQA 1FZQA 1QVRA 2UZIR 2GJSA 2WM9B 1KHTA 4DRZA 2DBYA 1W48A 2BMFA 1CRQA 4C3ZA 1HE1C 5JLJA 4WIAA 3HYRA 2GILA 4K8OA 4NYMQ 3DL0A 1ZD8A 3B1VA 4CEIB 5DHAA 2J0VA 4XWOA 5JSZA 1Q3HA 1X6VA 3QQ5A 1P6XA 4BZQA 2PT5A 4URVR 4OK5A 3TR0A 5JMTA 2RGAA 4DSOA 2YV5A 4B75A 2P5TB 4D0LB 5LB4A 5L3SB 3MG9A 5G3YA 1IY1A 2XJ9A 521PA 1XDBA 3HP1A 3B85A 3H86A 2B21A 4RCZA 1UDWA 3BAFA 4GRAA 5EXSA 3TSZA 4Y0VA 3BRWD 1ZBDA 2Z83A 2CLCX 5DGXA 4ARZA 4BPBA 1W0JA 3ICEA 2Q21A 1D9XA 5H70A 5JJKA 1Z83A 3RABA 4B74A 2ORVA 4HUQB 1Z6XA 4N0EA 1KAOA 4MGKR 3MLEA 3BB4A 4FMBB 3RC8A 3NBZC 3KB1A 4KXFB 3BC1A 2OO7A 5E7MA 3TVTA 2QSYA 4II7A 2XJ4A 3C5CA 5JRZA 3EX7C 3NKVA 2GRJA 3GJXC 3I32A 2ZE6A 1PV4A 1NBMD 3EC2A 3AKEA 6Q21A 3THOA 3QKUA 5JRJA 1N6LA 2ZM5A 3QENA 2XOKD 5G53C 4QM6A 1I2DA 1G6OA 1OHHD 1SXJA 4Q03A 1IHUA 3K9LA 3P20A 2AD1A 2R6DA 2GESA 2ZPTX 4YXWA 2PX3A 1MV5A 4JLDA 2EW1A 3BWDD 1W4AA 4XTCS 4HAWA 4PPFA 1OFUX 1G3RA 4M8NE 4JJKA 4DVGA 5BW8A 3J81k 1XTRA 1EFRA 2FGJA 3L8YA 2VL7A 2X1VA 3I73A 3QXSA 2CDNA 3QIAA 2NIPA 3I62A 3TE6A 1P5ZB 3AP2A 1N0VC 1RPZA 3U6KA 1SQ5A 2P3SA 1N3BA 2BOVA 2JCSA 2ZI9A 3NH6A 2ZS8A 1KYIA 4G5SA 4Q19A 2EVWX 5H1YA 5BXQC 2FH5B 5HKKD 3GJ5A 3SJZA 2CLDX 3UK6A 1VYUA 4C0BA 2J0UA 3P4XA 1J90A 2GXUA 3A1VA 1NLZA 1HQCA 2ZROA 2MMGA 1RC8A 1VECA 2Q3FA 2Q3HA 3K09C 3JVVA 1OF1A 5FUYA 5GVRA 2MSCB 1E79A 4OQNA 1ZNYA 3ONWA 1XZPA 4NYJR 2VHQA 5EE1A 1Z22A 4CIDA 1SVSA 3O8BA 1Z8FA 3KQHA 3CWZA 3HR7A 3AKYA 4B43A 1D2NA 3K1JA 4LYAA 3I61A 3PFIA 4ZPXA 1U90A 1VPLA 4P4SA 1E2HA 4L15A 4LYFA 1P4SA 2UVQA 4TMXA 3ZGXA 1YVDA 3B7GA 2R44A 2VHTA 5JWRA 5KO2A 5JZVA 4AKIA 2OBNA 2BMDA 2ZEJA 3EXAA 1NVUQ 1JAHA 1FL9A 5JJIA 3QEOA 1W4CA 3CB4A 3O8CA 1KO7A 2GZHA 3ZQJA 4JBXA 2VPPA 4OHWA 5L3QA 3AVYA 4NCIA 4LJYA 1CIPA 1U9IA 2N1BA 3FGNA 3W8NA 2QQEA 4MKHA 5FTNA 3HJNA 5J47A 1F2UB 2CE7A 3CKLA 1Z28A 1OXVA 2H57A 4O2RA 3EWAA 2VF8A 4HLQB 1CP2A 4HSEA 3ZQ6A 4PHHA 1JJ7A 1NMZA 1Q12A 4IVRA 4IXMA 4B32A 3KQLA 4WVFA 1WQ1R 1X86B 2GZDA 2HLDD 4IDNA 1IN5A 5EXTA 4BFYA 421PA 3L2OB 1XB2A 2YOFA 2XNDD 2BJWA 1N6IA 3K0EA 5CYPA 4ZI2A 5ELXA 3WMEA 4CVNA 3K0SA 2AD5A 3IO3A 1ZRHA 3WNCA 3U3JA 2IEZA 1KNQA 2QRNA 3O8DA 4TLEA 3IIKA 2ZRHA 4TYYA 4RD6A 2EU8A 1Z06A 3N2IA 2NTYC 3QPUA 3VX4A 2F9LA 2ODWA 3TLXA 1A4RA 2Y8EA 4CZ2A 2P65A 5DIFA 4DC9A 1RVDA 2RGNA 2FFAA 2J5XA 4QJ5A 2H8KA 2ZRCA 3KKNA 2A3RA 3GLHE 3TK1A 5JS8A 4DDVA 2WOJA 4LBWA 4C30A 2YWFA 2PCJA 3KUCA 4TTRA 2G6BA 1ZM7A 1GKIA 1XEXA 2A5YB 3AF2A 4B34A 4LCBA 2D3WA 1XFAA 1E2NA 5DNYB 4TYPA 5CJ2A 2ANCA 2I4IA 3X1XA 4FMDB 1E0AA 1U0LA 4RFSA 3Q7PA 3QXJA 3HPRA 4LJ9A 4KYUA 4C0LA 5G41A 1CTQA 2HV8A 5E7JA 2I1VB 4G0NA 4RFVA 2EWVA 1ZC4A 2QG6A 3A4NA 3K0CC 4P33A 4BUJA 3FOZA 3PIRA 4HZIA 4QBGB 1H8HD 5SZKB 4AKEA 3FE2A 2ZR9A 4IOMA 3T1OA 4LHZA 3TR5A 4DHEA 3EZ2A 3MSXA 4EJSB 1V5WA 4TZ6A 1NN1A 1G4AE 4A8JC 2XB4A 5KSZA 4X8OA 4ESHA 1NKTA 3DOFA 3HU2A 4TMTA 1A2KC 1JEEA 1G41A 2YVUA 1NVVR 5P21A 4IVPA 3A6PC 2JA1A 1YR8A 2W58A 3B60A 1KMHB 4Q1EA 2O8DB 1PUIA 3Q72A 1VG1A 3CNLA 3GQBA 4HAUA 4EQ6A 4OJQA 1AS3A 3TMKA 2ZVPX 3EG5A 5KNCA 4CEJB 4WA7A 1SULA 1U94A 2V54A 3IILA 5AJWA 4D4LA 2R6AA 5CJPA 3AB3A 2I3BA 1E2LA 3CR8A 4OHVA 2FPMA 2GDJA 2FPKA 4HB0A 1E9CA 1TAGA 4OQXA 1COWA 4KFTA 4LOAA 5EP1A 4LHXA 1XMIA 1P2VA 2QZ4A 4WBSA 4B3FX 2ZSBA 1M7HA 2YYZA 4WAUA 4BLTA 2A9KA 1KSHA 2KJQA 1Q1QA 1E1QA 1NF3A 4MRSA 3L8ZA 2WSSD 2NGRA 5BWMA 2FGKA 1G5TA 1OYYA 4B2PA 1DAEA 4ZI3A 3THYB 1SVMA 2ZJOA 3KTAA 1JBKA 2CHVA 5D3MA 1Q57A 4M22A 1W0JD 3UWOA 1OE0A 2BKEA 2JJ1D 2VBCA 3VX3A 1Z0FA 3ZVNA 4ZO4A 2BJVA 4JLVA 1GDDA 2VHUA 1KSGA 3SFVA 5E95A 1U0JA 3G82C 2WHXA 4LYJA 3U4QB 4C2UA 3RVBA 3GEHA 3GFTA 2YZ2A 5TMPA 3U5ZB 4GBMA 3GFOA 1CJKC 2C98A 4DKXA 5FL3A 1KSFX 2F9MA 3L0SA 4KBFA 4A6PA 1KK3A 1NN3A 5L3VA 1XRJA 721PA 3B1WA 4JS0A 4Q9KA 2AFIE 3BB1A 3IEUA 3WRYC 1AA9A 1WBDA 3FMIA 4AG6A 3PXGA 4A92A 1ZCBA 3HU3A 4BWYA 2Z5FA 221PA 3CIOA 5DYGA 4DCTA 2ZRAA 1N5KA 4A9AA 3NC1C 3C4JA 1G8FA 4QFMA 2DPXA 1YRBA 2YWGA 1QVAA 3CONA 4R71A 3ZZTA 1ODFA 3PUVA 5CK5A 1Q22A 4OJKA 4RJLA 3CF0A 2ZRJA 3RDPA 1JXOA 1XJCA 3WMFA 2IL1A 3KKQA 4FMDF 3WHLA 3QSYA 2WWYA 3T34A 2A5GA 1QHSA 3OEED 2NO7A 4PZZA 4B3CA 4CW7A 1P61B 2IC5A 4PQRA 1YR9A 1E79D 1Q1ZA 3EZFA 1CRPA 1JJVA 1M34E 3ZVRA 5SZJA 4Q9LA 3AKDA 3BOSA 4ILEA 4JVMA 2GXAA 2QP3A 4BFTA 4PC2A 2AWNA 3U44A 1FNNA 3WY9A 2KWIA 3OIUA 1FMLA 5SZIA 3T1QA 4XH9B 4AYXA 3FHOA 3U7FB 1GUAA 3GJ0A 3FKSA 5FUXA 1OH7A 1ZD1A 4JL5A 2GXSA 4UNSA 2OLJA 4QJ4A 3TKLA 4Q9IA 4CEHA 1OIXA 1LF5A 1JAIA 4DLRA 2FV8A 4JBWA 4J0QA 2ZYUX 2BKUA 1KI2A 2ZIAA 4G5RA 2CXXA 4LY6A 1NKSA 3A4LA 2VIIA 4MQBA 1EGAA 5DSZA 3OAAD 5KU1A 1SHZA 4D4KA 1FX0A 4KVGA 1N5IA 4LX0A 1N6NA 1C4OA 1JR3E 1G3QA 3AF1A 4GP6A 4XWKA 1XNJA 3RS2A 1GRNA 1OJLA 4AWXA 2R9VA 3BH6A 2OE2A 1UBCA 2VP9A 4PAMA 3M6AA 4XOIA 5M04A 2QSZA 5DLQC 2AKAB 5GADl 4N1AA 3IPYA 2WBLC 1KNXA 2JLQA 4FXPA 1OXUA 3SYLA 2IS2A 2VYFA 5TVKA 3SBDA 5A4JA 2FNAA 2V6JA 2ZS9A 3NDPA 1XMSA 3F0TA 4P32A 2WAYA 4TLDA 1T4GA 1RFLA 4DEXA 3R7WA 3RS4A 1XTQA 4QG7A 1UDXA 4XTRA 3NXSA 1QDEA 3MRSA 4U02A 2D74A 2YJTD 4DSNA 4YMUA 2ZRNA 1ETUA 3B2EA 4DT1A 4HB2A 2YKGA 3EIHA 1J8MF 1XXHA 4F7WA 4TTQA 1NBMA 1I4LD 4OI0A 4JIMA 2OXCA 1R5NA 2XOKA 3PCRB 4BEJA 2O0KA 2RGXA 2IYZA 3LXXA 4XVUA 2IYVA 3E70C 2RKOA 2XITA 3TJZA 4P3YA 2G83A 3B78A 1WMSA 3O8RA 3FHCB 2P6RA 2YNMA 4CYMA 2FSFA 5IHPA 5IT5A 2OZEA 1G3IA 2B8WA 1E6CA 4M1SA 1DAIA 4QGGA 3REFA 2D06A 621PA 1XMJA 3IHLA 3T1TA 2OUKA 1L2TA 3CPEA 1N6HA 3EPHA 3L0IB 4HYYA 1Q44A 5KUTA 1S9HA 4NCHA 1O87A 4WOPA 1KI6B 3RS3A 1QF9A 1QG4A 4UNNA 2HXSA 4ARZB 5DH9A 4IEEA 1N6PA 3I4LA 1I4DD 2J46A 5EXPA 4EPYA 3TBKA 2GF0A 2PLFA 4MUAA 4IDHA 1CR0A 4LWZA 4P4UA 4PPQA 4QBFA 1QHYA 4HZUA 4R2HA 3R8FA 2GEVA 1FMJA 2DFNA 3C8UA 3KZ1E 2O5VA 2LKDA 2GJ9A 3I5YA 4HEJA 1S96A 1QG2A 5TB5A 1P75A 1W2GA 1DAMA 4LYHA 3DO6A 1GKYA 2DHRA 2GAAA 2PEZA 3SU8A 4CT4B 1WXQA 2KBEA 5JI3E 2D7DA 1ZYUA 3KKOA 5JWOA 1SXJB 5FUWA 1Y63A 3LRPA 1RRGA 2BC9A 1KI3A 1VTKA 5FUVA 2ODBA 2B6HA 1NMXA 5EP2A 4B2IA 1E99A 1COWD 2G77B 5FPHA 2OCYC 3Q5EA 3AVPA 3HPQA 2ZETA 3T5DA 4ZDWA 5BYKA 2YOGA 4NCNA 3OFND 4E5UA 2RGEA 4IKEA 3EASA 3BS4A 3RRMA 5J4YA 2IA5A 4LBVA 1E1QD 1Q20A 1J70A 4XVQA 4V0ME 4TMWA 3K09A 1EFHA 3A36A 3AV0B 4GOKA 4DWJA 1A7JA 1KGDA 5EP3A 4AURA 4GOXA 3OESA 3TSOA 2IUUA 4IOLA 4JYCA 1J99A 1YE8A 1XP8A 3BBPA 1VIAA 1XEFA 1CKEA 5EE5B 4B33A 3TVDA 4DEYA 3ZS9A 2ZUCA 1Q1EA 4RSGA 4HUTA 3BB3A 2Z6VA 3RRZA 1G19A 2HLDA 3L43A 4A2WA 4HLCA 2ZSDA 1T0JB 1MO3A 2GVDC 2LWIA 2VP6A 3H1TA 4Q1BA 1C9KA 1OIVA 2XNDA 3MJHA 4F4IA 2O8BA 4Q5IA 3RS7A 2FN4A 3P26A 1NVVQ 2K5UA 3BFKA 4I81A 3P1JA 3FFBA 3AVXA 1F48A 1B0UA 2LKCA 3GLGE 4GFDA 4EIWA 2RH5A 3E5HA 1ZUIA 4P4SB 5EUQB 4DDWA 2ECKA 1QBKC 3VR4A 4PC3A 3RS5A 3IQXA 4JLBA 4Q66C 4DSTA 3MWYW 1KMQA 1FFHA 1C1YA 5FR2A 3CH5A 1TQ4A 3V4RA 2P0EA 4PXAA 3VKWA 4C7OB 3AKCA 4C0AC 4TLCA 4WW0A 1IJEA 3Q7QA 3LQQA 1T5LA 3RC3A 1T8UA 5FPSA 4HB4A 2WOOA 1ZU5A 4FIDA 3RWMB 1MH1A 1IQPA 4CT5A 2QPTA 5L3QB 4L5BA 5FOSA 1ZW6A 4GDFA 3UMRA 3ADBA 4Z51A 3AVVA 3FPAA 1ZIOA 4U5XA 1W46A 3DMNA 2HXYA 4RD0A 4DUGA 4PAQA 4AYTA 4NTZA 2QROA 3U3OA 1W44A 4FW9A 4H9GA 4NZYA 4LV8B 5CIQA 2EFHB 2YWHA 4R98A 3W3AA 1EG7A 1H8HA 3K70B 3T35A 5HZKA 1CJUC 4A36A 2ZJ5A 1LFDB 1A5TA 3PEVA 5TARA 1HT2E 1LY1A 1S4QA 2PCLA 1L8QA 2JLVA 4E09A 2VP4A 4LSGA 3JZAA 4FI3C 2RGBA 1E96A 2NZ8A 1ZMXA 1LW7A 2ZRKA 2P2LA 3IDQA 4JLNA 4JVSB 4LZZA 1J2JA 1BOFA 5FI0B 1VG9B 3QVUA 1ZNWA 3T06B 5JEDA 3FKSD 4M0LA 2GKSA 5FTJA 1AQYA 5KHOC 1MT0A 3GP8A 4MRPA 1G1MA 1ZNZA 1VCIA 3N2EA 4PHFA 1A1VA 1NY5A 3IQWA 3ECCA 1XEXB 5FR1A 3KX2A 1DS6A 3TQCA 5LD2B 5J5CA 1BO6A 2GAOA 3K0CA 5B30A 1S3GA 2IF0A 3LW8A 5LB2A 4TQAA 1P72A 4HI0E 4RFSB 2WJVA 4LHVA 5KTYA 4ESVA 2CJWA 4A8JA 4YMTA 4CGZA 4C0JA 2F1IA 3QNUA 2C5LA 1NVXQ 2VEDA 2VQSA 4D2IA 1ZUNB 2GJ8A 4G5GA 1MABA 1SKQA 1DBSA 2F3TA 2IXEA 1DG1G 2WSSA 2PJRA 4HB3A 1WDTA 2A2ZA 4HAYA 3HR8A 2REXB 1N6OA 3ZVMA 1WE2A 1MOZA 3PVSA 3IBGA 3NBYC 2O8EB 2JJ1A 1P60A 2FSIA 4XD7D 4QRHA 2ZSFA 1R10A 2G1KA 2IW3A 2O8CA 2G0TA 2OLKA 2QP9X 2OSBA 4NL4H 4HAZA 3BE4A 5TV2A 1R7RA 3VU9A 2NO1A 4QNRA 4KU4A 2J59A 4EQ6B 1IN7A 2WJJA 1IY2A 2R6GA 3LQRA 1L4UA 2WMNB 2NOAA 2ZRFA 1OXSC 2ODNA 3BFXA 5DO9A 3IHWA 1CLUA 1XTKA 3AUYA 1S3SA 1UKEA 3QBVA 4PX9A 3EA5A 5JCZA 2CEAA 1ZCAA 3AVOA 5FBWB 3IO5A 2ZRPA 3RAPR 2GJKA 4RVCA 1XX6A 2DWQA 1E2FA 1OPXA 3FYHA 5FFMA 4KVAA 2W2TA 4MDEA 1YZUA 4LI0A 4OHZA 5FBRB 1RW4A 1MKYA 2R62A 3AF4A 2GBLC 5CLQA 4D6PA 1X8LA 3LV8A 3OE7D 1M2OB 1KDOA 3MWLA 1YR7A 3W9YA 3DDCA 2L0XA 1JNYA 3E1SA 3EC1A 4HDQB 1YZNA 1HURA 1NLFA 3SDZA 1ESMA 2ZRGA 4FCVA 3BJIC 3KTAB 2ZVQX 1VCNA 5D3MB 3QBTA 2ATXA 1U99A 2XSZD 2ZRIA 3GLIA 1ZM9A 3NEYA 3OEEA 3BH0A 2JLSA 1E2QA 1IONA 1KAGA 1GVNB 4JLJA 1G16A 3R9WA 3REGA 2JATA 3TUIC 1RRPA 1R0ZA 2IS4A 2QMUA 3VR5A 1AK2A 3ZS8A 3VTKA 4TLBA 4Q1CA 3BIFA 5GJBA 5HTKA 4O3MA 3ASZA 4HDOB 2FEMA 1QHGA 1W1WA 2PEYA 3QF4B 4M1WA 2W2XA 3C15C 3FMFA 1EESA 4AKHA 2FF7A 1TPZA 2F1HA 1TEXA 4JKIA 5L8VA 4Q18A 2QBYB 1RJ9A 4B3GA 2GETA 3P4YA 1GNRA 2WKQA
chains in the Genus database with same CATH superfamily
4YP7A 2HQBA 3WYDA 1I4TD 3A11A 3LFUA 3U3XA 3A6FA 4G37A 4C2AA 2INGX 3DM5A 3O3MB 3GLFA 1W47A 2A9JA 2QAIA 2YHSA 3H75A 4PGGA 4M38A 4FDVA 4EB0A 1YVPA 4FDTA 1JKMA 2G5PA 4NEHB 5HCUA 3BJRA 2X4GA 1Z7YA 2YINC 3GRUA 3PDWA 2JIDA 1UJ4A 4D3SA 5LOVA 1WOMA 1E5QA 5HM6A 1IJFA 5CH8A 2WHEA 1N6KA 3FPSA 1Z12A 3C1TA 3DMRA 4GMKA 4MICA 2ZUBA 1FTNA 1JQ5A 1YJ8A 2WV7A 3FPFA 4UEKA 3A70A 5GM2A 3HB1A 4B2YA 4XX0A 1GL6A 3NBXX 1AXEA 3HSSA 5AJZA 2IU6A 2W2QA 2HJWA 5FJJA 4HNGA 2P9CA 4CCWA 2YC4C 1L5MA 1MEOA 1MX3A 5AHWA 1WMEA 2I8CA 4RL4A 3L6OO 3TPFA 2RH9B 4DC0A 1SXHA 2OFWA 4IFTA 2EKZA 1SXJE 2QJTA 2Z8ZA 3CINA 3NC0C 3JVUA 3NHBA 4RKRA 4V0NA 1FVFA 4D9EA 2WM3A 3U44B 2DFLA 4EB3A 2P78A 3TZQA 4Q7JB 4OH7A 1QFXA 5KYYB 1UAAA 1M3SA 3FB4A 3THRA 4M86A 4N8SA 3AHDA 3FPLA 3M2TA 2VJMB 3R3YA 1AKUA 1PGOA 3B1YA 2IKQA 1LJ8A 4LWQA 2IWHA 3S2YA 3WQRA 3WFZA 1IXZA 3MD9A 5JVDF 3HADA 3KSBC 2A9FA 1EAMA 3V8VA 4P7JA 3N5KA 4MV3A 5EHNA 3M8KA 5BUCA 1QPBA 1K4YA 1ZK2A 5K01A 3UWPA 3N2NA 2COUA 2ZYHA 1IPHA 5KC9A 2PA3A 3IX7A 2D8AA 3SSOA 3LPNA 3I3OA 1XLVA 2CUZA 3BFJA 4NRDA 4UD6A 4UU7A 1IZ7A 4W99A 3BCSA 3H7IA 4BFXA 5IXSA 4HNHA 3WRWA 2WWWA 2X86A 3RFXA 4R1OA 3W5JA 1N2CE 3N8HA 3TLGA 1E32A 2JZOA 3PYXA 1E1MA 1DJOA 1FX0B 4JC0A 3UUEA 3NOQA 4OLBA 4IWNA 1XJ5A 3QJ5A 1ARZA 2RGRA 1D6MA 1UEXC 2JFPA 2WAMA 4IDDA 4Y2SA 4Y2XA 5ADWA 4QVIA 4RPKA 3IPXA 5FA6A 1X3SA 2DCMA 1QHIA 1RBYA 2NZJA 2HWWA 3H11A 3AR5A 2FWRA 3K20A 3LFHA 4KW7A 1KZGB 3U9TA 5B4UA 2DWCA 2QJWA 2HHAA 4Z86A 2FOIA 5H4HA 3NHYA 1JI0A 3HUEA 1P9NA 2HRBA 1RLIA 2NPIA 1GO2A 4WZAE 4K9LA 1WP9A 3ADCA 2WJHA 4PANA 4TS9A 4O3FA 4D26A 2Z4RA 1YDEA 3KQQA 2RIRA 5ALSA 2I6UA 1B26A 4IMRA 3WXMA 4CQLB 3PENA 1JLKA 4AYWA 1M2EA 3TM5A 5JSUA 1V16A 2W98A 2FZ4A 4I9UA 4D46A 2QX8A 3JARB 3EXHA 3RS0A 3UHOA 3W5IA 2ZUWA 1Z25A 3OUTA 4LS3A 4KNWA 4S2UA 3BWEA 1JKFA 3CW9A 4R1PA 3K9FC 2K6GA 3HJFA 2I99A 1M66A 1SIUA 2Q3EA 1I6KA 3WYGA 4WY2A 5HWSA 2O8FA 3SM9A 4IFEA 1NQTA 3AQIA 4TTTS 4PINA 2Q45A 2IYUA 4BMPB 1ZAKA 1NW9B 1ZKDA 4G5OA 2I80A 3EW7A 1X8KA 1EG2A 4ZJPA 2QZSA 2AKYA 2H2DA 2QRLA 3PX2A 4OHKA 3OPYA 4BEVA 1XRNA 1HTWA 4Z8XA 5BN4A 5IAKA 1C2YA 2H65A 2DQSA 3WLKX 4CF6A 5JIBA 2KYRA 4P31A 3F97A 5C2JB 3V4SA 1H3EA 3OEHD 4QQNA 2VUHB 3RG8A 5ALOA 1O94C 2AG5A 3P2IA 4ZAXA 4BVBA 4HNTA 4ZQEA 4KCGA 5A06A 4EJ2A 1S8FA 4KVFA 2NXNA 5EHIA 2QYTA 4C89A 1OMOA 1GPUA 3B9PA 1ADCA 1O6BA 4FCTA 1QHXA 1FS5A 3AIIA 2HZBA 4P3KA 4YJ3F 3ZIUA 3LC0A 2PE5A 3TIIA 4DMUB 1HG1A 4G1BA 4IRXA 3NH9A 1FDUA 4YMWA 3ORSA 1RYFA 2JG3A 2CVPA 1QANA 1N3YA 3RYIA 1L8OA 4IVQA 2CBXA 4IWYA 3K94A 3V97A 5HXAA 1X1SA 3OQ1A 4OFZA 2XV1A 1NNSA 3IR5A 2NUPB 2PRKA 1PEDA 3B1FA 1JWAB 3M2PA 4MWZA 2P1RA 3OQNA 3PT5A 4UKDA 3CEPB 4EJMA 3L0CA 3OWHA 1GUFA 3G2IA 4RZ2A 8AT1A 2Y2VA 3U0VA 4OA8A 1BD3A 1XD2A 2A57A 3H2SA 4E51A 1RHRA 4A2PA 4GYJA 2I2DA 2HJRA 3DZCA 1LB1B 5J4VA 1W36D 1T0PA 5T3UA 4C6TA 4JNCA 1X38A 1CFJA 1KSJA 2Q9BA 3IA7A 1A50B 1A88A 2V74B 2I67A 2WM8A 2X5NA 1CJCA 2BCGY 2JHCA 3K5PA 4XDGA 1R18A 2CLLB 4OHYA 4JC4A 2VK8A 2MDTA 3M9XA 1KK0A 2E6UX 2IIBA 2AX4A 2JASA 1D4ZA 3SYTA 5ALWA 5IASA 3QK7A 2YFYA 1DO2A 4JJGA 2G7ZA 3JX9A 5ADVA 2GN9A 1TI7A 4RY8A 3WFJA 1W87A 2YMLA 3GJ6A 3TKYA 3OQJA 1ZK1A 3RTBA 3O3NB 2ZT5A 4BO2A 4EWLA 1M6WA 1C30A 1XCJA 2H08A 3NNNA 1QGDA 1SHUX 2BV3A 3HVIA 1TEVA 1GU7A 3DZFA 1PJAA 3DWGA 2ZM6B 4BIMA 3R9KA 3IB6A 3QY0A 4IMPA 1WPGA 1KC3A 2MT9A 4F71A 1VSVA 3QUBA 4IY1A 4QRDA 2Y1WA 5IULC 3GPLA 4FYIA 2JK1A 1WV0A 3MK31 1E1CB 2FQYA 4W7HA 2FHSA 4DQ0A 2R66A 3HCBA 2FUG6 4L1KA 3D5QA 4RPLA 3EIUA 2I33A 2GEKA 4B82A 5JTTA 2VRNA 4NS1A 1QWOA 4DQUA 1NY6A 4MVJD 4ARCA 3CXUA 2EOAA 2O6HA 4GZ6A 5E6UB 5EESA 2I4NA 4PTYA 1ILWA 4B6FA 3W4KA 2NU9A 4FDUA 1EX6A 3LYLA 2WJWA 5C7OO 1S6YA 3OQOA 3SJAA 1NR7A 1U3DA 1L1RA 2GZSA 4ND8A 5EHZA 1GY8A 1I2MA 1UF9A 5ENZA 2R3SA 5F2EA 3O4RA 4YK7A 4LDJA 4RXMA 5DM0A 4E5NA 4ZV9A 2OCKA 4GI7A 3UWKA 1H22A 2QN2A 1H0RA 1M33A 3A9TA 3I1IA 3IP3A 2WP8J 4QYMA 2OY0A 3DPSA 3QUQA 3IIIA 1RD4A 2VUUA 2L69A 5H0IA 4BRWA 4BNXA 4R05A 4KAAA 4X63A 2UUBB 2OL4A 4LRUA 3AY6A 1PG5A 4ZWNA 3W6ZA 5E1DA 1RYDA 4M54A 2FVYA 4L07A 2BF7A 3HJUA 1HT3A 4PSKA 4FWTA 5AOVA 1QKIA 4Q93A 4D96A 4INAA 2AN9A 2UXDB 1GL9B 3A6KA 2C2BA 1OWOA 1SIWA 4F11A 1TQ6A 2XWPA 3HQ4O 4E6PA 1IBCA 1MF7A 1DBQA 1E1YA 4PR0A 1IWPB 5ANRB 1O03A 4JC5A 4WXHA 1SVNA 3G7UA 4C5CA 2C5GA 4ZOCA 4BNKA 3URMA 1NXXA 4C3UA 2P9EA 2Q3BA 2R1UA 1L5OA 1UKYA 2WG1A 3F4LA 3UMCA 1TK2A 1G9XA 2PZEA 4HX2A 2OT3B 4TUYF 5HMLA 3VBCA 2VYNA 3TRDA 5CCEA 4KC0A 2HF7A 3AB8A 3HCAA 2OECA 2NT3A 3JR3A 2XKJE 2IP4A 1KJZA 1UEIA 2RGNC 1J8FA 3D3WA 3N9IA 1SCKA 2AW5A 3NATA 3VSCA 1AS2A 4KPUB 5FWAA 1EH5A 2C20A 4TVOA 3TRIA 1CVIA 3KFXA 5CDHA 4M9SA 4G4SO 8ADHA 2FY8A 2CLOB 5BWOA 2JI6A 5JCOA 4F56A 4NYJQ 3SIRA 3E18A 5F23A 4PX3A 5LDDC 3DC7A 4BN5A 1DKMA 1OFIA 1RNLA 1XXLA 1X9IA 2H31A 2X9LA 3W8FA 4E94A 2Q4OA 1U1GA 1OBOA 2BFMA 2FR1A 3CMCO 1Q0SA 4NI5A 3NOVA 4KQXA 4TRMA 1INLA 5KNBH 2A14A 3ELWA 2J33A 2ODEA 3JRNA 4MO9A 4O1MA 3KETA 3PR1A 2C4VA 2DY1A 3F5FA 1JU4A 2QU7A 3EUEA 4TYNA 5A0VA 5T6BA 3KXIA 1PZXA 3S55A 1G20A 4ZOEA 3E3LA 1AZTA 3S8EA 4KRXA 2Z6QA 1UKZA 2HF9A 1OI4A 2JLCA 1DADA 3UBTA 3LX5A 2WWTA 4NATA 1WB5A 1U3WA 4FZJA 4HWTA 2QVBA 3ER9A 5JATA 3LD9A 4FNGA 3WGIA 3KV3O 2K87A 2OGTA 2HPHA 2JFUA 2Y1DA 1JR6A 2HEGA 3D4LA 4YMSA 4E30A 2I65A 1Z4QA 3IDOA 3NCHA 5B5SA 1QP4A 2FRDA 3PC3A 3QNWA 5DBHX 3TCXB 4BB9A 3S28A 4C3VA 5KJCA 5FUMA 3UANA 1RWKA 3AFNA 4CQJA 4EA9A 4GR4A 4ED9A 5LZ2A 4K6OA 5ELMA 1KY2A 4R81A 3VO1A 4EKNB 1LZLA 3V8BA 1KEEA 4V0LA 2FZEA 3GLUA 5BV2P 4OMCA 1HZZA 4LG1A 3AU8A 2PX0A 5KPDA 5K99A 2NZVG 4YC7A 2AXEA 5LP6A 3JATA 5HDBB 4FUTA 2LVBA 3GUVA 2BZ0A 4MVXA 1Z08A 2IXAA 3C14C 3G7NA 2O3QA 2XD9A 3HBAA 3IP5A 1AIPA 4IZ6A 2ZXFA 1SUWA 3DE1X 4QFDA 4TX1A 2IV2X 2RJOA 2ZBPA 2HGZA 3OTWA 4A0QA 1QGZA 1W75A 4QPDA 4UDXX 5FA8A 3G0HA 5KYGA 4OB7A 2GPWA 3JAMA 5CIWA 4PONA 1BWPA 4TL9A 1E3DA 2GBLA 3UH0A 1RCFA 4DB4A 4QUAA 2VPIA 2B98A 3AZQA 4PRKA 4QA9A 1E2PA 4BLUA 1NMQA 1F7VA 1ZOPA 1L5NA 1U9YA 2CK3A 1KL7A 1C8VB 4RCVA 4I3FA 3E7DA 1E1RD 4QICA 3LCJA 3F3MA 2GPJA 3WQQA 2CKMA 2WFLA 1SJ9A 2H11A 1BGXT 2ZI6A 3FTQA 3LVRE 4YBZA 2R2AA 1GZ3A 2YIDA 2GDZA 3L8EA 1WSBA 4G8CA 4WESB 5EJ6A 5K0CA 3U4QA 3UJHA 3HCCA 4OQDA 4PC7A 4WK0B 5SV2A 3OKAA 3S2FA 4BVJA 4D41A 5BMVB 2JLZA 1EFPA 2QQGA 1EFVB 3FYCA 3IEIA 5DXJA 6CHYA 3WGUA 1JEAA 4M53A 4UZEA 1MDBA 1OI7A 2CZCA 2FFJA 2WWRA 4B09A 4C0QC 1IHXA 1NUSA 4MROA 3FM9A 1UKCA 3LQKA 4M0KA 2A0WA 2YXNA 3FCOA 2XGSA 4RIGA 4W6ZA 3CNNA 1WDKA 3UAZA 3Q9NA 2WD8A 3R0ZA 4CGYA 5MHTA 4HNUA 4AUNA 4RSMA 4ZYVA 2FCAA 3I5UA 1SHJA 5HRUA 1D2EA 2ZIUB 1U0HC 4EA7A 3OLZA 3L77A 4F84A 4ZZ3A 3SNHA 3B51X 1NJ2A 1I3MA 2Y1OA 1MA3A 2QM7A 2QYOA 4XIGS 1XYYA 1HNXB 1RM4A 5FHRA 2C8LA 4Y2TA 2BJHA 4FT2A 5H7XA 2QD5A 4QVKA 1C9MA 2AEJA 2XCQA 3G2NA 3BZUA 4L0CA 5K0JA 3VNRA 3AL0C 3GPBA 3JQ7A 3R0JA 3OQBA 3IAUA 1L4HA 1QGUA 2WAAA 3KQTA 4ISBA 2YHIB 2PZFA 1NP3A 1W59A 1O9HA 4G8DA 5FDFA 2JCXA 4MR8A 5JO9A 2WF8A 1LBTA 2IIPA 3N07A 1JR3D 3T7JA 1NVWQ 3THSA 3V7FA 2I8AA 1P9RA 2IOFK 1K4MA 5HCIA 2JI4A 1XWIA 4R8LA 5EEGA 4W9MC 4OXXA 3BORA 2XB9A 4YASA 1KO8A 4TZ0A 2QN3A 2HPAA 4ZKEA 2C99A 1A2OA 4QJ3A 3WIEA 4DF3A 3UN1A 2O54A 2CJYA 2FXVA 4MAAA 3KXLA 1TU3A 4MQFB 3ZJ5A 3PE4A 3HBLA 3EXEA 3N70A 3OU7A 2R7LA 2VF5X 3U4IA 4H15A 3CUWA 4LKRA 3CZ4A 3SJBA 1DKNA 3GOHA 4Q4AA 5EWJB 3WSTA 4D0GA 4M0FA 4EYOA 3M1YA 5ALUA 1NZJA 4AS1A 4YCBA 3TI9A 3THXA 1C9EA 4CN8A 1CUDA 3AHGA 4LE2A 1Y42X 3AR3A 3CNBA 4QG3A 4M6WA 2XQGA 1A5AB 5HUHA 3S68A 4RJIA 1JPUA 1T9HA 2PGIA 4I5FA 4OM7A 4OJNA 1XZHA 1RJGA 2E1RA 4R9UC 2AC7A 1L1QA 3LNCA 4J0CA 5NULA 5DPMA 3RRFA 1EZ4A 1IK6A 1II9A 3Q3VA 3DEZA 4TSKA 3RHSA 3Q0IA 4IXTA 1OXKB 4Y3UA 4R2JA 2WAXA 3V34A 3PTZA 2Q3LA 4NV0A 4DLTA 4KR0A 2XQFA 4K86A 3AR2A 3EVEA 3IV6A 2J4DA 4BOYA 1QNLA 4XIYA 4NQZA 3SKVA 2HA0A 2H1WA 4F2GA 4LXQA 1YZGA 2EQ5A 3BWCA 3I2KA 4L8FA 2C57A 2PZKA 3FCCA 2FHPA 2WC1A 4HOYA 5JMOA 4I1PA 2XY4A 3V7NA 2WD7B 5AW7A 3B8HA 3Q9LA 4J6EA 1PR0A 1U65A 1YI1A 1QONA 4LRTB 1GT91 3CRZA 1G4UR 1U7UA 4GBJA 1M6NA 4QL3A 1Z8NA 1US8A 1E8NA 1SQSA 3GELA 3I9V6 3C45A 1QNFA 1JALA 4OO3A 5MDHA 1DFGA 5CGQB 4JT8A 3K9NA 1MNQA 3VNQA 3JR7A 4DBLC 2WHPB 1ORHA 1X77A 3C3KA 3CUTA 3MQFA 3PS9A 4QODA 3REOA 3RUFA 5B7QA 5JDIC 2GM4A 4EHNA 2CLEB 1TTPB 3CNEA 3JASB 3M0EA 2WIKA 3OCXA 3SXJA 4R2WA 3EZ9A 1GPAA 3JV7A 5F9MA 3V4LA 2QMYA 1IHYA 3DVSX 4TL7A 3PI7A 2YYYA 2ZTLA 4L51A 1UBKS 3QWIA 2QTHA 4GQBA 5AKGA 5DTIA 3ZTYA 3RT7A 5L6MB 2JLYA 1W5TA 1OSNA 1WCXA 4LF4B 3ND9A 3UG6A 4Q9JA 4ZI7F 1Y8QA 4YCCA 1YBFA 1XDSA 4D9CA 3W05A 4ZK2A 1XCGB 1RKXA 1V1RA 3NEJA 1MEEA 2XCTB 3TZHA 4RHTA 2BBSA 5I4CA 1FFSA 5D01A 2IF2A 2VTBA 4YONB 1FYWA 5HF6A 3GQBB 1Z6ZA 2ZSUA 3STTA 3LX4A 1FJHA 3CF6R 4NYIQ 1IY9A 2EKDA 2PZMA 1WF3A 3R76A 3OJCA 1LH0A 4RV9A 3R41A 4DV3B 2Z9BA 2NV2B 5G4LA 2WVJA 3PNMA 1X39A 3UV7A 3HU1A 5YASA 2ZB7A 1P3JA 2HWXA 1S2LA 1QH9A 3R6GA 2W2KA 1VL5A 3FWKA 1PL0A 1DU4A 1KF0A 2WJPA 3HXKA 4ZAGA 3UB4A 5L4SA 2FMTA 3ABSB 4J4TA 4O5AA 5HF8A 4JVNA 1QRAA 3II6X 5CD9A 2QAGA 4MAMA 5JS2A 2R84A 3FMVA 4QSHA 1NVMB 3F3KA 5BR1A 4KHZA 3K4QA 1LUAA 2HSDA 3ID6C 3GWGA 3FUUA 3QTTA 1H2RS 4GEGA 4II2A 2C4NA 4HTFB 1N3LA 3I2GA 3MWDB 3LDHA 5AR1A 1YS7A 3KUXA 3FUWA 3Q3JB 1EM6A 2ZWOA 4I9FA 4FM9A 3PC4A 1MB3A 1WCIB 4YRKA 2GM3A 3EISA 4DMHA 5BMOA 1KH3A 3O8OB 1VKHA 5LOVF 5F1KA 1PWXA 2N42A 5JBQA 3L7CA 1MENA 1WTAA 1TM1E 2H5EA 3ELUA 3ELYA 4IF4A 4NAHA 4PHGA 3T3OA 3RC9A 4OYHA 4S2EA 1MB2A 3OTOB 3I2YX 2W22A 3EIEA 2PWBA 2JVIA 3W5SA 3HI4A 3Q9SA 4LJ7A 4C4AA 3L7DA 2XAUA 5IBQA 5CFMA 2EFDB 3WKEA 1RFGE 1YONA 1A71A 2OV1A 5IJ0A 1HYBA 1NVEA 2XDYA 1UL1X 4B76A 5HIJA 3GLHA 4UM9B 2BZ1A 1CZHA 2PBLA 2X76A 1XYVA 4Q1AA 4D9BA 1T8RA 3ZZUA 3C3WA 5IFKA 1VKRA 2OXRA 3EFEA 2YJGA 4MB0A 4WDRA 5COAA 2VT6A 3S99A 4FYJA 2HMAA 2O2EA 3KTFA 4R9SA 4RE6A 1YR3A 5C8YB 1MO6A 4Y2HA 1U31A 5K4HA 2BEWB 4YY3B 4GR9A 1GEGA 4WBNB 1TADA 4CM4A 2XUDA 3VJKA 3VOTA 4QM7A 4KYIB 5DCLA 3RUCA 5KOJB 1SBHA 2AI1A 4K9OA 3RHZA 3PXEA 2BKLA 4MEBA 2QLLA 5WRFA 3K0FB 3DOJA 5EIBC 3ITEA 4X6UA 4BCBA 3LPDA 3M3HA 2ZSIA 4CR7A 5CX1A 2Y0DA 4OKSA 4Q21A 3T5MA 1W88B 3W90A 3DTVD 4MA4A 1D4AA 3ZLBA 3ZHRA 2C4WA 4DJJA 4Z0TA 5HIMA 3RYCA 3FOFC 2UYGA 5IWCA 3I37X 3QOFA 4IHJA 1PT6A 4FHDA 4IHAA 4JBNA 4BKOA 1H0HA 2HWYA 4JEIA 4ZO6A 4CDMA 1NDQA 3ZWPA 3FDIA 3LNTA 1AKYA 4DLUA 3QP9A 4C01A 4QYTA 1Q0LA 3HMQA 3CF4G 2AR7A 3TZCA 1E9FA 4ZIRA 1DXOA 5LPNA 1TPYA 1MC5A 2FPGA 4KE9A 4BE9A 1W0KA 1QIEA 1U02A 2IHZA 3E9EA 1Q16A 3HZOA 3STYA 5HK9A 1JFSA 1FIUA 4UE2A 2PUCA 2RHGB 4YRLA 3HGQA 5A3VA 2Q5LA 4MS3B 2EX1A 3ZE6A 4R51A 1LBSA 4RDXA 2HLNA 2B94A 2IXFA 3SR0A 4ZXPA 4OF4A 3QX3A 3TW8B 4A0HA 4RDIA 3TI7A 1TK3A 4HQLA 3L6CA 5CFLA 1X8XA 4UU1A 3RK1A 4L78A 3DLPX 4JELA 4BN0A 2QL9A 3OY7A 2I3GA 4B81A 1VKOA 2HA2A 1ZMTA 4MUEA 3V8MA 4F45A 3CW8X 4UTRA 5AW1A 1VFPA 1UFKA 3FN4A 4MH0R 9ATCA 2OMKA 1JWLA 3ICQB 4IR7A 5SY6A 1DIBA 2YJ3A 5C7LO 1TOAA 1P5HA 4PR3A 1K1EA 3L8CA 3AM1A 3PL5A 3QJGA 4XVRA 1DQZA 4HK4A 4PFJA 4IIUA 3GJQA 2UYHA 4MJLA 3CLHA 4BL5A 3ZGLA 1JSCA 3EIXA 1RAHA 4ZCRA 2AI2A 3GLIE 3O26A 3BCUA 3IBCA 2VDQB 1F6DA 1Q5PA 2Q1TA 3I64A 3QE0A 2WSIA 3TJMA 2VXBA 2XMDA 4AQYB 3U2QA 3ZXYA 5JJBA 3JQRA 3DCIA 4HDKA 3R4VA 3TN7A 2PD3A 3NDRA 2XE7A 4X71A 4QUDA 2FI1A 3KD3A 1VJ1A 3OZCA 1ANKA 3IUNA 2QTBA 2PGOA 2QZZA 3V4PB 4UDOA 4B3XA 1IZ9A 3D0OA 1LJLA 4OY3A 1JFRA 1XAHA 3ORYA 1P1IA 2WKQA 1U7OA 2XUKA 3BULA 3UO8B 4ES6A 3DEKA 1HBJA 3M82A 3UAGA 1EWTA 4QOHA 5IUNC 2C07A 4NH4A 3UIEA 2AMVA 4BTLA 1B8PA 5TT0A 4A3SA 3TB6A 1P5RA 3N5CA 3P52A 3JQGA 4J2HA 5EZ5A 2Q2OA 1FPMA 1IQ0A 1O5TA 1NRWA 4L76A 3OF2A 2Y93A 3PKZA 1MVLA 3GFPA 5B2ZA 4CF4A 3IULA 1V11A 1XBTA 2JIBA 1SK8A 1JJAA 2W7TA 3KKEA 3Q98A 2QLBA 2P30A 4MW6A 4XUDA 121PA 2Y68A 2ZIVB 3PJDA 4N5MA 1YASA 3WL7A 3A0UA 1AXRA 1ZRSA 5AHOA 5B4TA 5L51A 2Q29A 4F38A 4Z4HA 3LOPA 4NH0A 3TLMA 4F72A 5JO0A 4GNKA 1HT1E 4YH1A 3PA6A 2YJNA 5EMLA 4DJDC 3ROEA 4LQDA 1ADBA 1YTLA 2AN4A 1PR6A 1XA0A 2EYUA 4K6FA 4C76A 3UXHA 5B57C 3O2NA 4KP7A 1V7QA 5AW2A 5JQGB 1N8KA 1PBNA 3GZTB 3P9PA 4JLAA 4TV9A 3WGVA 3H05A 4ERNA 5CD1A 3LHIA 4UASA 1CHNA 1L5FA 1PK9A 3C2QA 3ROQA 4GT1A 1YVRA 4LN1A 4IJMA 1BCSA 4ZV7A 1PTJC 3DONA 4YGYA 2JIZA 2P8JA 4MGZR 3V46A 4C4ZA 4F9GA 1X9HA 2PX4A 2HU8A 3D8TA 3GARA 3O8QB 2XUGA 1QKJA 1BXZA 4K9KA 1TMGE 4V3BA 3WSWA 3DDWA 5J4KA 1EUYA 1K98A 4CQMA 4QHTA 1SU6A 1OFGA 3KUKA 1YOVA 2OCDA 3F9IA 3PB3A 4LK2A 4DNQA 3AT1A 2C3PA 3PHLA 1R4ZA 5DYIA 1VZ3A 1ZMOA 2BFEB 2HB6A 2M32A 4GMXA 5AKYA 4ESEA 1POWA 1RKVA 3EF0A 4XWWA 3D6HA 1U1FA 2B2XA 3FRJA 1R27A 1WUJS 1POXA 3W5DA 3PDCA 3GG2A 4HJXA 1M34A 3HA2A 3SIWA 1I32A 2BGUA 3WL4A 5A5GA 4DR2B 4OBXA 4JP2A 3TG8A 1V2HE 3DFUA 2VXCA 1VPEA 4JZKA 4QXMA 5T57A 3TFQA 4EPXA 4KPGA 3NBUA 2FSGA 4ZYYA 5HUQA 4CKZA 3A26A 4I0WB 1NM5C 1R9NA 3LLMA 4L2IA 1EP2B 3IEVA 1ZC3A 4JJAA 1U3TA 3VC2A 4CKXA 5EHXA 3FSJX 4C0WA 2A5JA 3NWPA 3GZNA 5DSTA 2XW6A 4MEJA 2H2AA 1SXJC 3GJ3A 1AUXA 1UBJS 2VJNA 3ABOB 1XPOA 1RQXA 3INYA 2TRSB 4FYWA 4HUJA 4UVIA 1SBQA 2J9GA 1C29B 2A58A 4F93B 1KOGA 1H3NA 4KQCA 4UEWA 2VAXA 1ISJA 4Y2JA 3MN1A 3SY8A 3ETEA 1RQNA 2IPOA 3E7PA 3NUQA 4YA6A 1DKLA 3W7BA 4D80A 4XRGA 1XNHA 3JALA 1Z17A 3C6MA 5LC1A 3J80A 3MAJA 2R8PA 3L6EA 5B1HA 4F46A 3LYHA 4YRMA 2QUIA 3DQQA 2H4XA 5A0FA 2D4HA 3LUAA 1CDOA 2F64A 1QWSA 3FMPB 2PPLA 2AXQA 5D86A 1FSFA 1V8OA 4JLMA 5BYAA 2UUAB 3L9WA 5SY9A 5D87A 4RQUA 4M1OA 1II0A 3W6PA 3SC3A 5J4LA 3ZDXB 3JU3A 5L3ZA 3AEZA 1W4BA 5DXAA 3HKBA 3UV6A 2V7QA 3K16A 4UUMA 2R8ZA 1EGVB 1W9HA 1M0SA 3CE6A 3MBKA 3ZY5A 1H0KA 1WSWA 2GR9A 1MQ9A 4X7BA 4UFPA 3EIFA 2QBYA 1M6VB 5LQAA 4YV0A 1I2ZA 3K2QA 4N03A 5CXQA 4YUXA 1MW9X 4YGXB 1PUJA 5H3CA 3L8DA 4LC1A 2AFHE 4FTWA 4FI3F 1FU4A 1W93A 4BNFA 4M1ZA 1L8AA 1I1HA 2DC1A 4JZYA 3D4IA 4OQEA 3EWSA 1L6IA 1QJ4A 4KAFA 4MRNA 4D97A 2E4ZA 2OCBA 2YVLA 1KZ4A 3CX7A 2VZLA 3RFFA 3D7RA 4OSPA 2O8BB 3OPXA 3HXMA 1XZDA 3A1FA 2J5BA 4S1PA 4UVHA 5FYDA 3FYUB 3MJCA 4HQ0A 4MS4B 2DMRA 1D1QA 2QX9A 5CURA 2DZDA 2HWUA 3H1FA 4LYDA 1ZH8A 2AQKA 2YCBA 4OV6B 5AK3A 2RGCA 3HBFA 3O1LA 1XE3A 4TKLA 1NBEA 1F6BA 1G3MA 2GGSA 4B5LA 4FB4A 4ZHQB 5A4DA 2YV2A 1UBGA 2YV1A 1JPJA 1PNOA 4E2WA 4X8LA 2PM8A 1LQUA 4MI6A 5TVGA 4C03A 1PR4A 2V03A 1YIDA 4LXIA 5E1MA 1EXWA 1YDGA 2HIHA 3OJOA 4KQKA 2YN4A 3P9XA 1Z73A 5K8TA 1B7GO 1P0PA 2DFPA 1YZTA 1QH1A 2H8GA 2PT7A 2H06A 1TUEA 3DXFA 3K5IA 4HS4A 4PNZA 2FQWA 4QFBA 1I1QB 3QA9A 5EGSA 5M3BA 1Q0TA 3HO1A 5FOQA 2GARA 1QF7A 4L57A 4Y6PA 5FEUA 1Y4UA 1T35A 2JKZA 2IX3A 1UDRA 2ECOA 2VJMA 2ZG6A 3ZGNA 1KAHA 1B8NA 2W83A 2B1QA 3WHPA 1Y4DE 2D6FA 2O2XA 3FPBA 1MA0A 1ZXLA 1X1AA 4GOND 5AM2A 5A7FA 4C22A 3VJRA 1PLKA 3DLIA 4FFMA 5C1DA 2BLLA 1UBFA 4PLYA 2R8BA 3ZHSA 1H66A 3V4VB 2O3SA 3EBLA 3U09A 1IOZA 5F9FA 4L6CA 4GC5A 4LAFA 5F98A 3S2IA 2ERXA 1OBVA 4I2NA 4R8RA 3CX6A 1USGA 1VSTA 2HO4A 3GUYA 1W36B 4PYIA 4QBIA 5A3RA 4MCJA 2WU0A 4GQAA 1Z2OX 5T4BA 2Y6UA 2HEIA 2QHXA 3MERA 6ADHA 2IEYA 3DKRA 4ALKA 3ZDRA 1IXRC 1S1MA 2QN9A 5LP6F 1RTKA 5HJEA 3GPIA 4B9EA 2F62A 4FE7A 1E9SA 1SOAA 2VTBB 3DMFA 4EO7A 1R64A 2DH6A 1IB6A 4AI6A 5DEOA 1JDTA 3PA8A 2D2EA 2G6TA 3OU2A 2QPOA 2OR3A 4FN5A 3ZI7A 2JVJA 3SLRA 1P5JA 2GTHA 2HDOA 1RJDA 5CT6A 3R0VA 3GY0A 4F8EA 2X4DA 2BGJA 1KK1A 3PNBA 4QATA 3U4CA 2Z2IA 5J23A 3B2NA 4BY9E 1S1CA 3E15A 1I7SB 4ITVA 5AK4A 3K70D 1VHLA 4N7BA 2WHQA 3WHIA 1RJEA 4C0HA 4MGHA 4OFWA 4ZAYA 5AVOA 1CXZA 3BQNB 3ZDBA 1VHDA 3U19A 4V0MA 1U6IA 4WASA 4NZNA 2UZ3A 3HDVA 3I0ZA 2OWDA 4ODIA 4DCSA 1BSVA 3CSSA 4WV3A 3SZLA 3KU1A 4EMSA 1XNQB 4MUKA 3D7MA 3OD5A 821PA 1HQYE 1UK7A 3DE4X 3RRYA 2DWOA 5KKCA 2VHJA 5DZSA 1E92A 5ALRA 4KSYA 4EFMA 1O96A 2DQ4A 3KYCB 1P4JA 2Q9UA 2VA8A 3CA8A 2BKVA 3GP3A 1A9TA 1MXHA 3ZD6A 1C7EA 1B6SA 1H9BA 3NV7A 3GB9A 3ONDA 1HOTA 4OHXA 1GL3A 1BIFA 1YRAA 2R8RA 4Y9DA 4CIBA 1T24A 5DDIP 2BY4A 3SOZA 1M8JA 1BYIA 5CYGA 1OKKA 4UBNA 2WB2A 3KXPA 5DW0A 2X1MA 1DEXA 2FMFA 3EUFA 5CLLA 2CL6X 3CEJA 1RSZA 4ON9A 5CCDA 2F1JA 3CE9A 3UAOA 1R9JA 1FW6A 1U2DC 4B47A 5CBPA 5FXMA 4QBTA 3TO5A 4R68A 4EGFA 2DETA 3O31A 4Y6QA 1ZM3A 4OUDA 1A98A 2OLEA 2FSSA 2ICAA 1ITZA 3C48A 4PYRA 3DWFA 1DEAA 4QTUB 3GIDA 4UFNA 2NTJA 4FBLA 3FTEA 2E5WA 4IOJA 5TPZA 2A9RA 2QR3A 1P33A 4I1UA 4EMTA 2NADA 1HDXA 3MTIA 5HBGA 1E98A 2FK7A 2H2WA 1RI4A 1W1IA 2Y67A 1DZ3A 2ZAGA 3C24A 1IN8A 4PFKA 1AJEA 1TTHA 2Z09A 3OLXA 1SU4A 5CEEA 1LPPA 3D4NA 2OORA 1E7YA 1ACJA 1OXXK 4XWAA 2PZAA 2I76A 3H5NA 3RAJA 2HJVA 2WIDA 4FSXA 1WXXA 2WU3A 3UTCA 1LTKA 2QYHA 4X91A 2NMVA 2GCEA 3G2KA 2JCYA 4U7DA 4FNMA 2ZE5A 5B37A 1E62A 4KQ6A 3BM5A 5SYAA 3I28A 3T1HB 1PF7E 3ESRA 3UMVA 4ZXFA 1BROA 4RV4A 1FSSA 4P7GA 4TYWA 1ATIA 5KOYA 1S9DA 4UEOA 3WIBA 4LRXA 1CPYA 1BNCA 4G84A 3KU4A 4FMCB 1DX9A 4YMHA 4F6RB 1LLUA 1U1EA 3BHJA 4R5HA 2FU5C 2XA2A 3TTWA 1OH6A 2EARA 5ENVA 2BAGA 1RPNA 2GT1A 1WWKA 1Y6ZA 3DZGA 1UM9A 2CHEA 4M60A 3GEMA 3CEAA 4KODA 5BN5B 5I8WA 1T1GA 2AZMA 4UXJA 1DBWA 2P6OA 4CN9A 5BNZA 5HQ3B 3A6HA 5KIAA 3ETCA 3JZDA 4RPJA 5EMHA 4R31A 3WOVA 1EPUA 2WFZA 1PDVA 3QE4A 4M1YA 3F47A 4E31A 2O1SA 5CTJA 3NIWA 5F9HA 4CCSA 4M1MA 1C7FA 3WO1A 4PS0A 3RAEC 4IIXA 5BN3B 2OM2A 2XEXA 3VQTA 4DDTA 4ZMBA 4PZCA 5KSYA 1QIMA 3O9VA 1E2IA 5JOQA 4REMA 4QX6A 2IYTA 4MYRA 4JEMA 1OLUB 1E7QA 4LF6B 1QZXA 1IEXA 4YS6A 3VSAA 1W76A 2H92A 3TSWA 5A4IS 3MOIA 5I3ZA 3SQNA 4F0JA 5AVVA 4YECA 1EQUA 2P5SA 3ODPA 1TRKA 1L5VA 4BFZA 1HUQA 1O6CA 4X7PA 1EHYA 3RV4A 2QMEA 5C5IA 2M9MA 5AH0A 4ADSG 2XH8A 3H7AA 1RJ9B 2B20A 4OHMA 3ZCRA 4RTLA 2PJZA 3RIMA 4J90A 2OFOA 4JWKA 1QP7A 2I4RA 4P93A 3PNYA 2VT7A 1PJ4A 1Q84A 1JVBA 4EVIA 4JI6B 2FWMX 5D3ZA 1K2VN 4R6WA 1I2CA 3QI7A 2EWWA 3H4TA 1ABFA 1R6DA 2Y6VA 5BVGB 4MNTA 1EDOA 1Y4AE 1E59A 1RR6A 4RVDA 5H80A 3PHGA 4RGQA 3PEYA 5JCPA 5JEEA 1P62B 4JSYA 4RKFA 3KB2A 1QAMA 3H84A 5LZ5A 1HNWB 4DJ5X 1GNQA 4HDCA 1ZNXA 2JBHA 1V39A 1G8GA 2FA9A 3LUCA 4H1WA 2IYAA 1NMEA 1ZD4A 3S1AB 2F55A 3NHAA 3D6VA 1T3TA 1DXHA 4A26A 1HO3A 1L7OA 3IE2A 3OWXA 1SUEA 2AMJA 3FKQA 5DE3A 3WRXA 4AJPA 3FF4A 3ZDYB 4CR6A 1T2CA 1TUIA 3Q2OA 4EL0A 3RIGA 1A5SB 4JI1B 4G0OA 4HWOA 1HYHA 4LJ4A 3TAHA 3L3BA 2PV7A 3KOWA 3UHFA 3MILA 1W29A 2BL4A 5KHLB 1NJ5A 4JJZA 3NTUA 1ND5A 1FRFS 2G9UA 2QTVB 4S24A 3WISA 3WR5A 4D8VA 3RYTC 1C2TA 4BO7A 1N2HA 2DWPA 2B0JA 3RFVA