4KE6A

Crystal structure d196n mutant of monoglyceride lipase from bacillus sp. h257 in complex with 1-rac-lauroyl glycerol
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
249
structure length
247
Chain Sequence
MSEQYPVLSGAEPFYAENGPVGVLLVHGFTGTPHSMRPLAEAYAKAGYTVCLPRLKGHGTHYEDMERTTFHDWVASVEEGYGWLKQRCQTIFVTGLSMGGTLTLYLAEHHPDICGIVPINAAVDIPAIAAGMGGELPRYLDSIGSDLKNPDVKELAYEKTPTASLLQLARLMAQTKAKLDRIVCPALIFVSDENHVVPPGNADIIFQGISSTEKEIVRLRNSYHVATLDYDQPMIIERSLEFFAKHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermostable monoacylglycerol lipase
publication title Conformational plasticity and ligand binding of bacterial monoacylglycerol lipase.
pubmed doi rcsb
source organism Bacillus sp.
total genus 92
structure length 247
sequence length 249
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2013-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ke6A00
2Z3WA 5DWDA 2WG1A 3PFBA 4LXIA 5H3HA 4U2DA 4ZXFA 1E66A 4ZV7A 4OU4A 1N1MA 2WFLA 4N8DA 3QZUA 3W04A 4Z49A 2I03A 4DNPA 3LCRA 4EY6A 4G8BA 1D07A 5AKYA 3HXKA 2XUQA 4YPVA 3WIBA 2YXPX 2J4FA 3V9AA 2RIPA 2UZ0A 1ACJA 3QM1A 4EUSA 1CLEA 3H2GA 2GZRA 3DOHA 1XKLA 5FDFA 2FUKA 4C01A 3ZV7A 1VJ5A 4X90A 1F8UA 1ZD5A 3RARA 1CUFA 3IUJA 1BN7A 1CEXA 4EY8A 4P93A 2BGNA 3H0CA 5FOQA 4LXHA 5ALEA 2GYVA 4BCBA 5A62A 1W52X 1R88A 1U4NA 1QE3A 2WJ3A 1HBJA 4BP8A 4CCYB 2AJCA 2HU8A 1CUHA 5HKAA 1YA8A 5IVKA 4ZGBA 5DYYA 3PDCA 3SWWA 3G8YA 3WK8A 1WHTA 3HLKA 1XLUA 3IUQA 5IVIA 5HF5A 3T4UA 1TK3A 2D0DA 5HZGA 2ROQA 1CUUA 2XUHA 3KD2A 5K3FA 3F97A 4UBOA 3DQZA 5AKZA 4MQMA 1XRMA 4ZWNA 3SX4A 5CH3A 2G4LA 2B4KA 4Q05A 2QTBA 3FNBA 3WKAA 2W22A 3CN9A 5BOVA 1ISPA 4FLMA 5FXMA 1F0PA 1AURA 3AIKA 5DYWA 4JYMA 4E46A 2OG1A 4X97A 3I2HA 3GROA 4B81A 2WU4A 1GPKA 1QIEA 5AKEA 2QXTA 1VZ3A 2WIFA 4I3FA 5AKXA 4MYSA 1XRLA 2V96A 2C5GA 1A8QA 3G0BA 3F8SA 4QDTA 1R3DA 3BXPA 1E89A 4BB0A 4FBLA 1GKKA 3E4DA 4KE8A 5AK6A 5A71A 1N8SA 4JNCA 3MVEA 1C7IA 3WWCA 2PL5A 5HFNA 4HVTA 4IH9A 2GYUA 5KBYA 3D7RA 3I6MA 2OGZA 4DNFA 2XQKA 5E4JA 2JEZA 1ZOIA 3RM3A 3A2NA 3NGMA 4MQLA 2DQZA 5AOAA 2Y6UA 3WYDA 3VJMA 2R8BA 3RK4A 1PFQA 1MNAA 5ALOA 3TJMA 2ZVDA 5FRDA 2CBGA 5LZ9A 5HF8A 4MEAA 2I78A 4KE7A 1T4MA 3HRHA 1SCIA 1TCBA 3KWFA 1AQLA 2WJ6A 1GKLA 2ES4A 5EHXA 5BV7A 1E5TA 3G9UA 1Y7IA 2HA0A 4YX9A 5CH5A 1EK1A 4WFKA 4X3CA 4BYMA 1TAHA 4H7HA 4RE6A 1XQVA 3X3HA 3V1MA 2CEKA 4UFNA 3AUKA 3IB3A 4JUIA 3TRDA 3FYUC 4FOLA 2WG0A 2XUKA 3PI6A 4H18A 5AM1A 2Y2VA 1THTA 5LZ8A 1G66A 3UUFA 3L1JA 1DX4A 1WPRA 2Q0XA 2QUBA 4J0IA 3SK0A 3H2HA 1AKNA 1BEEA 1CUDA 3C8HA 4OPMA 3G9ZA 3A6ZA 3WKBA 3WL6A 4Y2PA 4X6YA 2B9VA 4UHBA 1AX9A 1CUIA 2XB6A 1QFMA 4G5XA 1XZKA 1YB6A 2OLEA 5EI5A 3F96A 5I9IA 3C70A 3G0DA 5AK3A 3FCYA 1UFOA 5IVDA 1F6WA 3IURA 1XLVA 1XZGA 1AMNA 2HU7A 3VJKA 1H2WA 2JGEA 2OAGA 1AGYA 4DNOA 2W6CX 1SCQA 3BJMA 2H7YA 3ILSA 2ZYIA 5EFZA 3M81A 1IUOA 4Q3OA 3HYSA 4DMFA 2WUDA 3AZPA 1W75A 2DFPA 4PF1A 3CCBA 3ANSA 5ALPA 4EY4A 1UZAA 5ALNA 5K3DA 1JFRA 2XUGA 5HQ3A 3VJLA 4M0MA 5IVHA 3HEAA 3LP5A 3PF9A 4UHFA 4OD0A 2J4CA 5LYYA 5HF6A 3O4GA 4QLAA 3F67A 3A70A 3STUA 1LPSA 4U2EA 4FHZA 2QMQA 4HRYA 1Y7HA 4IH1A 3DKRA 5T4BA 1JJIA 1XQXA 5CW2A 4MXDA 1E8MA 3IVMA 3WK4A 3RKSA 4EB0A 1QIJA 3QPCA 5AI9A 2R11A 3WZMA 2G5PA 3WK7A 1G42A 5AI0A 1IZ8A 1H23A 5CH8A 1OILA 4MWSA 5IKXA 3KOOA 1UOPA 2C4HA 3QPAA 1CIJA 3LIPA 5FUMA 4DTCA 1K63A 3FLAA 4WCVA 5CT6A 3C45A 3BE8A 4GWLA 4QDZA 3JYHA 1Q83A 3CXUA 1VE7A 4RE5A 4P08A 1LZLA 3QITA 2VSQA 2QRUA 4G4JA 4QWMA 1HDEA 3WL8A 4KAAA 2Y1KA 3H17A 4BCCA 1RP1A 1GQRA 3EIOA 1XRRA 1XZBA 3AINA 1RWQA 5DYTA 2WIKA 4Q3LA 4BCDA 1ZI9A 3H1AA 3HABA 1XRNA 3UMJA 4Y2XA 3VKFA 3GFFA 3HSSA 4HRXA 3WYNA 4G4GA 2HA2A 1U8EA 5AI5A 5LZ5A 1L7RA 4E11A 4GHWA 3Q0TA 1CVLA 3OG9A 3MUNA 5AM4A 4BZZA 1MT3A 1ZIXA 1U2EA 3OTQA 2QJWA 3WK9A 4Y2QA 4QZVA 1E8DA 3GBSA 1CUYA 3VISA 5CMLA 5JD6A 2GBIA 4FLFA 4WFJA 2XUFA 4FMPA 3I1IA 4KRYA 2C58A 3E1GA 5JD5A 2Z3ZA 4Y7DA 1HLGA 2VAXA 3BIXA 1YSCA 1EXWA 5ISMA 3C6YA 1UKAA 1QIGA 3C5VA 5D3KA 2QM0A 3CCCA 1DX6A 5AI8A 1NX9A 2XMRA 2OGTA 4H35A 3HI4A 3D5EA 2OXEA 1BRTA 5CURA 1QIKA 2HRRA 2CJPA 1SC9A 1YCDA 3DNMA 1BROA 3FLBA 1QIMA 1LPNA 5ESRA 1YAHA 5SYMA 3DS8A 2JGMA 3D59A 4U2GA 3HC7A 1FFDA 4AN0A 5JAHA 5LKRA 2PBLA 1XRPA 4P92A 1QTRA 1Z68A 4RPCA 1EB8A 1CUVA 4UFOA 3DLTA 4PNZA 3O95A 3W9UA 4GBGA 4X6XA 1AC5A 3G0GA 3D2AA 1HPLA 1CQZA 3IULA 1R9MA 4H7DA 3GUUA 2OCIA 1UWCA 4J3JA 2WIDA 5CTAA 4H7IA 2VF2A 1GT6A 3K6KA 5KWIA 4UHCA 4Y2SA 3TGLA 2HA4A 5CBKA 1CPYA 2WFZA 3O4IA 2YH2A 3WK6A 1DQYA 2CMFA 4I19A 1H22A 3DCNA 4H7EA 4U2CA 2BFNA 1ZD2P 1FFCA 3B5EA 1MO2A 5CXXA 4A23A 1JU4A 2O2HA 1ZGBA 3UUEA 1VXRA 2PUHA 4J0DA 4AMZA 4F0JA 2RI6A 1K8QA 1IVYA 3V48A 4ETWA 1ZJ5A 1DU4A 1T2NA 3IA2A 4GW3A 2BUCA 5ALDA 5AP9A 1ZI6A 1XZHA 3STXA 3HACA 3OPMA 3GELA 1MTZA 2EDAA 4BP9A 1J06A 1XKTA 5A2GA 2BAGA 4CIAA 1EDDA 1HQDA 1O6GA 2WTMA 5AKHA 1A88A 3BF7A 4QA9A 2XE4A 1SCKA 3I6YA 4MYDA 2XUPA 4AZ0A 1E3QA 1QIIA 4YK7A 1QIDA 1CUSA 3ZWQA 4Y2RA 3QBJA 3R0VA 2OQVA 2DHCA 4DSAA 4X95A 3G02A 2WM2A 3DOIA 2JGLA 5LZ4A 2Z5GA 2OGSA 1A7UA 5AIAA 1AUOA 3FYUB 4NVRA 4HXGA 3LLCA 4EZIA 4I4CA 3QH4A 5DNVA 1LGYA 3C8DA 1AZWA 1ZD3A 3D0KA 4FDMA 1J07A 1MPXA 2WHPA 4MEBA 1C4XA 5ALKA 3WL5A 2VT7A 4UPDA 6YASA 5K3EA 2AJLI 3ZPXA 4HAIA 5HFAA 4BC0A 1WOMA 4LYEA 1ORWA 2DSNA 4UBLA 3WI7A 1XQYA 3V1LA 5C81A 4UHEA 4UBKA 4CFSA 1S8OA 2HIHA 3G7NA 2WSLA 3EQ7A 4ZI5A 3A2LA 2QVBA 5SYNA 2B20A 3WWDA 2PSEA 1TIBA 2QOEA 3EF3A 4S0XA 5LZ7A 5KWJA 2HDWA 4LHEA 4WY5A 1BCSA 3D2BA 2WFLB 5EIEA 4Y2JA 5JZ9A 4GXNA 1YAJA 1JU3A 3AIOA 4KR0A 2RONA 1B6GA 2JGFA 3JWEA 2PU5A 2E3JA 3PF8A 5K3BA 2IITA 4L3WA 2V9ZA 3AZQA 4EY5A 4ZRDA 4EY7A 4BAUA 3FSGA 4G8CA 1XRQA 2HA6A 5LZ2A 2VJDA 5DTJA 3O4HA 1QFSA 3QMWA 2HA7A 5A7GA 3S8YA 4GEGA 4AO6A 5FP0A 4AB1A 4RGYA 3QVMA 2QR5A 3R3XA 1JI3A 1LBSA 4Q3KA 1IUNA 5JZBA 5HKBA 4EBBA 3IIIA 1XZLA 1MJ5A 3E3AA 2DR0A 3ESCA 1UT6A 3NOXA 4HTAA 2I3DA 1NU8A 4PSCA 1XFDA 2PUJA 1U65A 1DWQA 1N5MA 4IHAA 3BDIA 3L1HA 4FNMA 4N8SA 1QIFA 3B3QA 2FX5A 3M83A 5ALJA 2O2GA 3STWA 1W76A 4K6HA 1JJFA 5FPQA 4IQ4A 5K3FB 5ALGA 3A2MA 1EB9A 2XMSA 2CB9A 4K6GA 4QDOA 5ALHA 3FOBA 2WUFA 2XQIA 1FFAA 1ODSA 2VQ6A 1Q0ZA 2XUOA 1EDBA 2C5FA 1XZIA 4W63A 5HF9A 4Q1VA 4BRSA 3O9VA 5ALSA 1EH5A 3EQ8A 2CKMA 2EEPA 1QIHA 2ORYA 5ALVA 2WILA 4WDQA 5A7HA 4PSUA 4DMCA 1USWA 2ZSHA 5CXUA 1DINA 2QT9A 3KWJA 1CUWA 3WMRA 4UBNA 2IX9A 1MAAA 2ZYRA 4YASA 1BS9A 3WKEA 2WG2A 1WB6A 2H1IA 1TCAA 5F4ZA 3AILA 5AI6A 1R4ZA 2ZSIA 2WHQA 5DNUA 1QO9A 5D3ZA 1LBTA 1LZKA 4X85A 2OCLA 5T4HA 1YR2A 2XMDA 4H0CA 3AZOA 2ZYSA 3C87A 4K2AA 3WZLA 1EI9A 1ZI8A 1BE0A 2JIDA 2QUAA 3S2ZA 2O2IA 4H77A 2V98A 1HKHA 3EBLA 4QE3A 4DM7A 1H2XA 5ALTA 4N5HX 1J2EA 1VOTA 1QTIA 1JMYA 4X91A 4J03A 1BN6A 1XZCA 3DYVA 4AQDA 1YASA 3N2ZB 2EDCA 3FAKA 3WJ1A 4WY8A 4KACA 3DL4A 3WIOA 1TRHA 1Q84A 4H7JA 1DTEA 3R3VA 4OYYA 4M0FA 1LLFA 4HXEB 5AOBA 2BUAA 4MJ3A 1XZMA 3VVMA 2ONCA 2ZJ6A 2O7VA 2QXUA 5AM0A 2XDWA 4LYDA 4QNNA 4J7AA 3QPDA 1CRLA 4X00A 3P2MA 5D7BA 1O6FA 5JYCA 4PSDA 5ALLA 1EHYA 3DYIA 1OXMA 4DGQA 3WA6A 1EX9A 4IO0A 3OM8A 1UK9A 2OAEA 1QGED 3K2IA 3FCXA 2P8SA 2XQJA 4H7FA 4NZZA 2XUAA 4X6UA 4GLBA 3ZI7A 2H9YA 2G63A 3WWEA 1W4LA 3QMMA 2BKLA 1CUZA 2GBFA 1GPNA 2HFJA 4X92A 1R1DA 3WA7A 3YASA 3EQ9A 4B7ZA 3M82A 2ZJFA 2O7RA 4C87A 4BAZA 2ZYHA 1K5PA 4QDXA 7YASA 1XZDA 1QONA 4ROTA 5DNWA 2K2QB 1X2BA 3PUHA 5C8XA 4KJXA 1FFEA 3BIWA 5K3CA 3OURA 3I2KA 4PO3X 4V2IA 2PSDA 2BCEA 2ACKA 3GA7A 1KU0A 5K3AA 3L1IA 4CCYA 3FYTA 4BC1A 4QDUA 4UBIA 3ZLUA 1KU6A 1I6WA 1RYYA 4B0OA 5JAPA 4G8DA 4CCWA 4KAFA 1N5RA 1EVQA 4N5IX 2XT0A 5JZSA 3I2FA 4M0EA 4LKOA 1JT2A 4KRXA 2IIVA 1LPOA 2X76A 5HQ3B 1BEZA 2X5XA 4A5SA 3FWHA 3K9BA 2VAVA 5CT9A 2Z8ZA 3VVLA 2QZPA 1X70A 2YASA 3DDUA 5LKAA 1DWOA 1P0IA 1W6RA 2DHDA 2I3ZA 2D5LA 3C6ZA 4PV7A 5ALWA 4BE9A 5ALFA 2NW6A 3H2IA 1MX9A 3NUZA 2OPHA 4AXBA 2QJRA 5BWBA 4U2BA 2Z8XA 2JGIA 3W2TA 4Y9SA 1YS1X 1UOQA 4C88A 2XLCA 2XMGA 2WTNA 4DMHA 3C43A 3WKCA 3C6BA 3DL7A 3STYA 4GDMA 5K5EA 4C4ZA 4WJLA 5A6VA 5AM5A 4TVKA 1XQWA 1MU0A 1E8NA 1LPAB 2FJ0A 3WK5A 2Y6VA 4C6HA 3KSRA 4FLEA 4WFIA 5C8ZA 3OC0A 1TCCA 2LIPA 1UXOA 4DNQA 4HZGA 1EINA 4OCZA 4N8EA 5YASA 3FLEA 1QLWA 4WDRA 4KEAA 1UK7A 3DJYA 3G0IA 3FBWA 4B80A 4B83A 3BF8A 4F5ZA 2PKYX 1K4YA 3D3NA 3IDAA 4BE4A 2JEYA 3B12A 1ACLA 5AIBA 5AH0A 3W06A 3G0CA 2B61A 3ICWA 4KYVA 4DSZA 1YA4A 5ALQA 3D4LA 5T4EA 2WKWA 4OU5A 1NU6A 1GZ7A 5E2IA 4CG3A 2VEOA 4AN1A 1X2EA 1FFBA 5EIAA 3WWOA 1SOMA 3H04A 3W9BA 1VZ2A 5JIBA 2XI4A 5AM3A 1YB7A 3BWXA 3ED1A 2GBGA 3R40A 1L7AA 2RAUA 3STVA 4X7BA 2DHEA 4G9EA 1EDEA 5T4FA 2RGUA 3FSGD 1GPLA 1MNQA 1GGVA 3PFCA 1XZEA 1FJ2A 1MX5A 3I6ZA 3QMVA 4RNCA 4ZV9A 1UK8A 3KXPA 5I7UA 3AJAA 1JMKC 2GZSA 2QKYA 1OCEA 1SFRA 2WFMA 1Q0RA 2OQIA 4W1SA 1CR6A 2X8BA 4CG2A 2JGJA 1R9NA 2WIGA 2PSHA 4J0KA 4B82A 2Y2UA 5A7FA 4UHHA 3R3WA 5I8PA 4AX4A 2PM8A 4DYHA 1FSSA 3ZLVA 2DCMA 1ORVA 2VJBA 3SC2A 5AK4A 3R41A 2XMQA 3U1TA 1TKRA 4AO7A 4F60A 4ARBA 2PU7A 5CT8A 1WM1A 4IH4A 4TPKA 2PX6A 1THGA 4XWGA 2HA3A 5FLKA 2AXEA 5ALMA 4K5QA 2JF0A 3E0XA 3I1YA 5ALIA 4XX1A 2XQGA 4UFPA 4J0CA 5JATA 1CUGA 4C4XA 5AO9A 4FFVA 5CT5A 5AKLA 1M33A 3RLIA 1EK2A 4OB7A 4XIIA 4C89A 5AOCA 2C0PA 4CIBA 5JADA 5ALRA 5CT4A 3WLAA 4OB6A 5AKJA 1UOOA 4Y2VA 5HK8A 4E15A 4OSEA 5DLPA 3C6XA 4FNGA 2C0QA 2WLSA 5CRIA 3QYJA 4XVCA 3T52A 4UBJA 2VA9A 2RHWA 3OOSA 4X94A 1VLQA 1UKBA 1CFJA 4X71A 1GXSA 3AFIA 5ALXA 2VTVA 3DKKA 5AKKA 1P0MA 1UKCA 2WUGA 4QLOA 1QJ4A 2PSJA 2WQZA 5JD4A 3O0DA 1HL7A 4F21A 1PJAA 2HADA 3ESBA 1PV1A 4NS4A 3STTA 4PQEA 1ETHA 1ZJ4A 1ODCA 5BWCA 1DT3A 1UK6A 4FWBA 1JKMA 4Y2YA 3TEJA 5IH7A 3G9XA 3I2IA 5DTIA 2HL6A 5AKGA 1CV2A 1G4HA 2HU5A 3BJRA 2CZQA 2XUDA 4XJVA 1R50A 5FKJA 4B9AA 5JANA 1CUBA 4UHDA 2AJDA 5ALZA 3KDAA 4E14A 4B0PA 4FFWA 5EHNA 2HA5A 1P0PA 3I2JA 2G5TA 1B41A 2DQYA 3HZOA 5LIPA 4AO8A 1WHSA 1CUXA 2V97A 3VDXA 3IUNA 4LXGA 1BCRA 3H2JA 1BU8A 4AZ3A 5LP1A 1VKHA 4B9EA 2XUIA 3I2GA 4W1QA 2HRQA 4UUQA 2WHPB 1WPXA 5AHXA 4MWTA 5LLSA 4KAJA 4BAGA 5AKIA 1P0QA 3H1BA 3C5WP 4HXFB 2JGKA 5EHQA 1CQWA 3H18A 4D9JA 4KE6A 4ZREA 4FTWA 3FVTA 2WJ4A 3N0TA 5EHZA 4W9RA 2ZJ7A 3O9MA 3ESAA 5EIHA 2HM7A 1K6EA 1IMJA 2VATA 2VJCA 2PPLA 3GZJA 3MUOA 4JH0A 3AIMA 5AM2A 4DIUA 1IZ7A 5EGNA 1XZFA 3PE6A 5J3JA 3U0VA 3IUMA 4BATA 1CUEA 5JASA 3D2CA 4L0CA 5C8VA 3LIIA 4BBZA 2PSFA 4AMYA 2WU3A 5HCUA 2XMBA 4J0JA 3CN7A 3ESDA 3F98A 3WL7A 4GECA 1MAHA 3V1NA 1ZD4A 3HJUA 4LIPD 1ZGCA 3PICA 2JBWA 3ANTA 5JARA 4ARAA 3O4JA 2HHAA 2XQFA 1IUPA 2CUTA 4P9NA 4ITVA 4FKBA 2HFKA 4X93A 4G9GA 2C7BA 1LPBB 4Y2UA 5D6OA 1A8SA 4G1FA 1DT5A 4BTVA 1XROA 1WB4A 3Q8WA 2ECFA 4G4IA 1GQSA 1QZ3A 1TQHA 2WHRA 1QO7A 2H7CA 1CUCA 5JALA 2BGRA 1H2ZA 3WQHA 3MGAA 4U2FA 4Q34A 3WWPA 4BVJA 2AJBA 4EA6A 4W1RA 1CUAA 4OYLA 4C4YA 1J1IA 1JJBA 2J3QA 3DD5A 4JYPA 4Q82A 4PW0A 1DQZA 2XMZA 1G5FA 4BVKA 3I28A 5ALUA 1VA5A 4EHBA 1LPPA 1ZICA 4BRZA 4QEKA 3W05A 5AICA 4BDTA 1MX1A 1H2YA 4KE9A 3PUIA 4GI1A 2GBCA 4OB8A 2YYSA 4Y2TA 4BTLA 1WCYA 3R3YA 4J0HA 4DMKA 3G9TA 4DLNA 1XZAA 3M3DA 1LPMA 1VE6A 4UBMA 1VXOA 1ODTC 4J0GA 2XLBA 5ALYA 3BL8A 3R3ZA 5E4YA 1XZJA 4QWWA 5DJ5A 5FPPA 3FVRA 1WB5A 2OCGA 2BUBA 3VXKA 2BJHA 4B6GA 3BDVA 4HS9A 3H19A 3V1KA 3LS2A 2PVSA 1QOZA 4OUKX 1ZIYA 2GYWA 3DEAA 4FBMA 5JAUA 1EA5A 1XLWA 2OCKA 2XUJA 1DWPA 4BZWA 4W1PA 2ACEA 3IBTA 3JW8A 3H2KA 3F9CA 3R3UA 2J3DA 1CUJA 4INZA 1VA4A 4TGLA 4NMWA 1YS2X 1EVEA 1F0NA 3WKDA 4JEIA 1W1IA 5FV4A 1MN6A 5HK9A 2H7XA 4H7KA 4L9AA 1A8UA 2VT6A 5KREA 4L72A 2XMCA 1Y37A 4BVLA 5AI4A 3FYUA 4K6KA 2WIJA 5C7YA 1C7JA 5AK5A 4O08A 4CG1A 1KEZA 2QS9A 1LNSA 4B84A 2RHTA 5E4TA 3ICVA 5AJHA 1L7QA 3WJ2A 2VJAA 3NWOA 4B85A 4BDSA 5JAOA 2WUEA 4CI9A 2AJ8A 3ZLTA 2FJPA 4A16A
chains in the Genus database with same CATH superfamily
3F5SA 3LCVB 1RBMA 2HBRA 5DWDA 2BCJQ 5J1SB 1HR0B 4Q5IA 2X0DA 1FNCA 5FA8A 4C3UA 5T64A 3ZYZA 2EG5A 2PLFA 2YXDA 2KB0A 2QLLA 1Z37A 2QTGA 4DKJA 1WVMA 3PFBA 4MLCA 4XGKA 4WXEA 1IATA 5L7YA 4FZVA 5H3HA 4ZXFA 5JXGA 1X19A 2MINA 1I0ZA 4BO1A 1CVIA 4J91A 4GBJA 3A36A 4FFSA 3RS5A 1AXRA 2TMKA 4MDEA 3HJNA 3QZUA 3ZWKA 4Z7OB 2Z8YA 4BMSA 1FS6A 1V6SA 2CLLB 4CIXA 3NDRA 2HKIA 1M54A 2G5CA 2I03A 2FG5A 5A9TA 3E48A 3GVHA 3LCRA 4J2OA 4M1SA 1HG0A 5EEGA 4UULA 3QF4A 3WIBA 4C3ZA 2YXPX 5J4VA 2J4FA 2ORWA 2BD0A 3BWCA 4PPFA 2ZR8A 3LA6A 4Q6WA 3V9AA 1WIWA 3DV0B 3O93A 3CCFA 2RIPA 1FQOA 7ABPA 2MSEB 1GCAA 4M9SA 3WLNA 1SUAA 4F9GA 1R8XA 3MB5A 1XKLA 3BM5A 1ZOSA 4EHDA 2ZWPA 5JD3A 2FUKA 1B2LA 4G36A 3UMMA 1OBHA 5IC5A 4N0DA 1PJBA 2REXB 4DXDA 1VJ5A 1VPLA 2ECKA 1J2UA 1ZD5A 1NSYA 3O2SB 4MMYB 1IHUA 4WTOA 4DMLA 5LVAA 1PD0A 2O8BB 4U9HS 5A5VA 4KC0A 4EKGA 3JZIA 4EY8A 5CA1B 3H8WA 5FA5A 1QVAA 2FZCA 2J9ZB 2FSUA 1O4WA 2JZNA 3KYJB 2FPGB 4HQ0A 4MDHA 1ZGAA 1C4OA 2QAJA 4X54A 4ZCSA 2Q0HA 2NSHA 4OP3A 4E88A 4LX0A 4V0LA 1LI4A 2GYVA 1Y6ZA 4I1UA 3V1UA 1H2EA 1DTSA 3CLHA 4BCBA 4AM8A 1C3JA 4LKRA 2H4ZA 4RD3A 1B3RA 1QS0A 3DLIA 4NONA 3T3HA 3GARA 4CM1A 4HHEA 1IHYA 5JMWA 4FP9A 4HWTA 3VR4D 3MJRA 3GJZA 1PZFA 3PXDA 1KWKA 4JBHA 2YJ4A 1XDBA 2D74A 4CQLB 4QFCA 2JIRA 3H9JA 1QE3A 2Y92A 2CXRA 4RV5A 2V0CA 2FN7A 3UA4A 3F6EX 4H3KB 4V0ME 3W5HA 2PIAA 4UPVA 1WW3A 4A2CA 3DZJA 2HU8A 4GKVA 3A6PC 1G7SA 3DOEA 5EPUA 2QUJA 3TZKA 1ZOPA 5JSZA 4EQ6B 1M6HA 1XI2A 2NYRA 4RTOA 5F5LA 2YRWA 3SWWA 2B21A 2ZIUB 1THMA 2WPDA 3WK8A 2F48A 2B8JA 1DAHA 3HLKA 2FCRA 5JWHA 2P4EA 2PXAA 1BA2A 3M1LA 3MJEA 2C5BA 2QP4A 4GMDA 1DIRA 1X8JA 2VYNA 4I5DA 3U7RA 1EXDA 2Y0CA 5IVIA 1Z15A 3PNSA 4A8PA 1KWGA 2D06A 1U0BB 3JZDA 1B16A 3RABA 3RIGA 1U8ZA 1XEWX 4I5IA 1N1GA 3SSAA 1IZYA 1G98A 3WVNA 1X3SA 4BB5A 4COKA 2JHAA 1CUUA 2XUHA 1YDWA 1OSNA 1WXQA 3KD2A 4YCNA 3ISJA 1L2TA 4OX9B 5KAMA 2A5JA 1P91A 2VNJA 3FNEA 1FYVA 3PVZA 3WDSA 1PZHA 2ZJBA 4KNVA 1NYQA 4MQMA 4TRJA 4ZKDA 1XRMA 1JPVA 5C1PA 5I4CA 3DGEC 3OZDA 4DCTA 2C2XA 3DTVA 4ZWNA 5AUQA 3V2UA 4CYMA 3DE5X 4PC3A 3SX4A 1P0FA 4WEOA 5CH3A 2QYHA 4TM7A 1EQUA 2PWAA 4FXOA 2QZ4A 2C7GA 4UVDA 1UINA 3BYZA 2QEQA 4HATA 3JYNA 1Q57A 3CE9A 3Q6IA 2C61A 1T3GA 1TYBE 1NNUA 1AURA 2YIVX 3WFJA 4ZZIA 3FKSD 3LDFA 3LT4A 5DYWA 5CYGA 5JJKA 3CHYA 3IXQA 1VE9A 2FSPA 4JYMA 3VOTA 3HJRA 4E46A 2OG1A 1PQUA 1UXHA 2AQKA 3OSZA 3QQ5A 4DQUA 2VLBA 3FDXA 1UZNA 4G01B 4FT2A 1A69A 2YZKA 3TFWA 3QVKA 3OKFA 3PR3A 4EA7A 1KEEA 3GROA 2Y1LA 4B81A 2HI0A 2X3UA 3ABIA 2HQOA 4TMTA 1RHJA 3TRJA 3WLHA 2H1WA 2VJYA 2XMPA 4CV0A 1FYWA 3B48A 1T9BA 4UMFA 4MARA 3OQ6A 2P75A 4A3SA 1EJ2A 1GTMA 1XRLA 1LW7A 4HQFA 2C5GA 4QTTB 4Y6PA 4HB0A 4JBIA 5LD2B 2GJKA 4MHTA 3HM2A 4RK4A 5IC4A 5C5EA 1KRXA 1E89A 2AG1A 4WZAA 2RK6A 4BB0A 2BFDA 4HLNA 3MWLA 4PSKA 1DRJA 1WUJS 1GKKA 4RK0A 4P7BA 1U7WA 2Q5HA 4E4TA 2ZIWB 1ZK2A 5CYPA 2GLUA 1W35A 2FP3A 2ZJAA 2PNJA 2C1ZA 1P72A 4NP6A 4JNCA 1BO6A 3HJTA 2ZDQA 2JFUA 5K6AC 2OUKA 4TWRA 1S01A 5HS6A 3QOFA 4I66A 4JP3A 1GV0A 2VYVA 2R6DA 2DBVO 1ZHHA 1ZZEA 2GGSA 2OPBA 3A05A 2FPSA 2W6ID 1QNLA 3MBIA 2UUCB 4O29A 3OT1B 5FOUA 5HFNA 1IB0A 1X0XA 2G28A 1VJGA 3B38A 5GQSA 2P6MA 3KCNA 1ULTA 4P4NA 3CNOA 5DP1A 4IH9A 2GYUA 4OIMA 5C1IA 3UMSA 5KDLA 4AY3A 4DSUA 2IEDA 5G3ZA 4ED9A 1BXGA 2JANA 3RFXA 5I7RA 1C0PA 2FMKA 1I7DA 2HO4A 4FDLA 3FFBA 4PM4A 1EQAA 4DLBA 4MS1B 3L2OB 3DEFA 3TBFA 3CUEF 4E4YA 2EX1A 3AY6A 3R3JA 4JDUA 3A3YA 5EJ2A 4Z9FA 3IUPA 3MS7A 3AGQA 4AIRA 4Q03A 2D5BA 2C8KA 3A2NA 4I9NA 4JROA 4JJIA 4OFBA 5DB4A 3ZCUA 4KHPB 1U0EA 2CMKA 4RVDA 3WYDA 5JFGA 1KS2A 1F4VA 3HGTA 1F5NA 4C7OB 2YVLA 2O8EB 5HA5A 3AKDA 5GOZA 5DCLA 2RSLA 1B0ZA 5REQA 5JPCA 2OCBA 1Q1ZA 3FBGA 4PEVA 4W5JA 2YHUA 3UMVA 1V48A 2FFHA 2QQ5A 4AP9A 2BLNA 2AGVA 2XB2A 1O0CA 3EEFA 1GYQA 1Y7TA 1TO2E 5EESA 2W6QA 1R0BA 1PYDA 1TYDE 3NAMA 2XEXA 4KUHA 3TKYA 5IJ0B 3GLHE 4PWZA 1K9VF 3IAS1 1UMCA 2I78A 3KL4A 3KTFA 3HYLA 2WMYA 4L2IA 3I09A 3EDRA 2P62A 3ZCRA 1T2CA 4FR2A 1DBPA 2NSDA 1T4MA 2C95A 3BXHA 3GYBA 4J16C 1KJQA 1SCIA 1D4ZA 4M1MA 4YH1A 2VXOA 3ZD8A 1J8VA 1GPMA 1Y4UA 2E5FA 2A1UA 1JEQB 3T9EA 3A14A 5I7OA 1RMYA 3FKJA 5AJUA 2GXUA 4UNSA 3LDUA 2C3UA 4RNDB 1HT3A 2IYTA 2VWHA 1Y1QA 3EZYA 4KN8A 1JPUA 3AXTA 4XLLA 3G8DA 1Y7IA 2I2CA 5JISA 4CZ2A 2BFWA 3TCNA 1TTTA 4MW4A 4L1KA 3TTYA 5KOIA 4YX9A 2OYCA 2V0NA 2ZWOA 3HWSA 2I8LA 4X3CA 3KLOA 3GT7A 1I3NA 1W29A 2P67A 4R1UA 1L8XA 4FZJA 4WHMA 4E5MA 2D2EA 3KQVA 4TTQA 1JFVA 2HRZA 4ES6A 3X3HA 5ICSA 3QHAA 1XVTA 4U00A 3GXBA 1GGMA 1K86A 2IYRA 3FTCA 2AEEA 3A4VA 3H6GA 4IEIA 4U39A 2JPDA 3PEYA 4DJDC 1RLUA 2ZUDA 1NUSA 3ZWDA 2IUUA 3VR2D 2PYZA 2YJNA 5DSXA 4FOLA 2CV2A 2VPTA 2RH8A 2XUKA 3FPLA 3T15A 2DUJA 1XMJA 1WUTA 4B3IA 4DWWA 4E94A 3GLFE 3ILHA 2AR9A 2IA5A 3WHIA 2G7MC 1K97A 1IM5A 4L51A 1P62B 3MN1A 4UREA 3UUFA 2GPWA 4U7JA 2YNMC 5DTEA 4M54A 1MEEA 2AUMA 1B1AA 3ANXA 4ZO9A 3RVOA 1UT8A 1DX4A 4L9WA 4F3KA 2AUNA 1VCHA 1YC5A 1V1RB 3H2HA 1FX1A 1OXXK 4DV7B 4B6JA 4BWFB 4H6XA 1AKNA 3VPFA 2N9UA 3X1YA 5IANA 4OBBA 1CUDA 3KDSE 4KXLA 3HDVA 4V24A 2OC4A 4EEZA 2R2AA 4DLUA 1G2OA 3PUYA 4BRWA 1JDPA 3C8HA 4OPMA 4P4UA 2BMAA 4IXMA 1JQEA 1T5DX 1XC7A 4KQ1A 4PE5B 3WKBA 3N8IA 2C7RA 1VIDA 1G2QA 4LYHA 4Q9LA 3BFXA 1EFVB 1NF8A 5GV7A 2CUNA 2MCFA 4EDHA 3ZDFA 1VCMA 1B8VA 4JA2A 3P9ZA 1M6YA 5DXJA 1T3HA 3O74A 2ZULA 2C5LA 1X6VA 1PUXA 3FAZA 4EKNB 1XMQB 1YNOA 3TSWA 4K7JA 1XTJA 4G07A 4EJSC 3GPIA 1XZKA 1GU7A 3L46A 4OVKA 1XRJA 1YB6A 2NSLA 2D13A 1P5RA 1TA4A 2WVGA 3NR2A 4JUCA 1YZFA 3NBFA 4MYRA 4NAUA 4ZCLA 5CBPB 1JFFA 1P2SA 2GEJA 1YGPA 2WSMA 3FPSA 1EEXB 1IOLA 3TW6A 2ZIEA 1PLLA 3TVTA 1HFJA 1JHPA 2WM3A 3ZVRA 2YFQA 5AK3A 1RRCA 2UDPA 2VF7A 1UFOA 3EPHA 4OAQA 4FFNA 5CCDA 1YU6A 1QYDA 3S1LA 1ZNZA 2IQ5A 3IH5A 3ENZA 3PHCA 4KYTA 1ISRA 4P98A 5DNAA 3UJ7A 3E8XA 3G1WA 2EWWA 5F7OA 1XZGA 2G72A 2I4LA 4G1VA 2ZRHA 3FZYA 3G5TA 1NDUA 1TQ6A 1N57A 4RFSA 2CXNA 3A1FA 2NPFA 3WE7A 4UATA 3BJMA 2CMDA 1XD8A 3EAGA 1MOSA 2ZZNA 1VIMA 3ILSA 4LZWA 5EMLA 3AFGA 3OFKA 1WS6A 3GEPA 4F2GA 2R6JA 4GVLA 3GGPA 1EFRD 2RK4A 2CBXA 4Q16A 4GC5A 4MPDA 4RF4A 1XLTA 1OGJA 4CL2A 2AR7A 1G59A 1H42A 4UM9B 2F1KA 1Q0HA 4DMFA 3S8MA 1UPAA 1D4OA 1L9XA 3BIOA 4BFZA 3I5XA 2PUBA 5EY5B 3KCQA 4YIHA 3CYFA 1U8YA 3WYGA 3GLTA 1JPJA 1MUUA 1VDZA 2PZBA 3AJDA 3JQ7B 4XLZA 2P2LA 5ALNA 4Y2HA 5K3DA 1JFRA 1T24A 1K3UB 2HCRA 4AJEA 5HQ3A 1IBLB 4M0MA 4ENWA 1KO4A 3LP5A 3V7NA 3C3DA 5ESXA 3MB8A 4DRYA 2X41A 4RVOA 1RZRD 5LYYA 4R8KA 1WW8A 3O4GA 3ERCA 2QR2A 4IMPA 2XPCA 3C6QA 4BNJA 5K9ZA 2IYUA 4DXAA 4QTUB 1J90A 1GPBA 1LPSA 1QB7A 2O2EA 1VCIA 3HB0A 2D1FA 4IP0A 3V55A 1J5EB 4L4SA 1NJ1A 3IP9A 4MMZB 3EISA 4IH1A 1I3KA 5GPBA 4Z4HA 5T4BA 3GPBA 3KALA 2POQX 1FRFS 1U8UA 1DG9A 3IEUA 3QVTA 4DOMA 2NZVG 1XF9A 3PJFA 4YUAA 4BUJA 1TCUA 5EJ6A 3O6VA 1LI7A 2W2KA 2FUG1 3LUDA 1HK7A 4MW5A 4V0NA 5AJWA 4MXDA 2BJWA 2VNAA 3IVMA 2ZU6A 2JD2A 4ABYA 2ZKIA 1ECFA 3QLTA 3RYIA 1NYTA 4MEJA 1E2HA 1SCDA 3QPCA 2R11A 4GYJA 3WZMA 2G5PA 4HNAB 1YQWA 2VPIA 4D96A 2HLHA 3PL5A 5AI0A 3WMEA 1DBQA 3NJ8A 1P2UA 1WZ2A 1G5TA 3DMTC 2GN0A 4L2IB 2J1LA 1H23A 2CLOB 3NASA 2HX1A 2XDAA 3IAHA 1T2UA 4B71A 4MWSA 3OA0A 2N47A 2PV7A 1CR1A 4LZLA 3VU1A 4QGHA 5ELXA 4MIOA 3NHFA 3TVDA 4AS3A 1S3FA 4JB2A 5MGBA 3QPAA 1I7QB 1CIJA 3EH1A 1V6AA 4J7CA 5TPWB 2IWRA 2F8MA 3TW8B 3LYUA 1CR2A 4OO3A 4DTCA 3MCTA 1GUDA 2AE2A 4NXNB 3I9V6 4LA4A 3VBEA 2X22A 3T1QA 3TQHA 3WS7A 4B4VA 4Q4HA 1SB9A 4MKHA 3B7WA 4C7BA 5FR1A 5AVQA 2H1FA 4HMOA 3JYHA 1E3SA 3PWKA 3FNQA 3OD5A 3RBXA 3OFJA 3T5CA 1K68A 1XNQB 1K89A 1VE7A 2Q1UA 2FSGA 4I08A 4PZDA 2UXBB 2ACVA 3QSGA 4ND1A 3MCZA 5BQPA 4F56A 5FTMA 1RZ3A 5BSVA 1LTHR 2VT3A 3QITA 4KXMA 5BYAA 1NR5A 3A9WA 5K0GA 4HZIA 1RZUA 5BYKA 2VSQA 2AF3C 4LK3A 1J5XA 1TM1E 2ZUFA 3FOZA 1WHSB 4RMNA 4BMCA 1DHTA 2QRUA 4G4JA 4QUAA 5E95A 1EG2A 3RG2A 2ZSAA 1T2EA 2JATA 4QWMA 4UE2A 3U5TA 4O4IF 3FFAA 1SVOA 1D1SA 3WL8A 5HQTA 3DXZA 5BSGA 3COSA 3DE0X 4H08A 3OP4A 4FN4A 5I5EA 1M2WA 1NDQA 3BMOA 2MJLA 5MN5A 2B1GA 1Z4PX 4NJMA 4CLOB 2YFYA 1SA0A 2YWCA 3HDQA 3PQ5A 2XQVA 2XSZD 3OCZA 4PWYA 4XSGA 5TX7A 1VI5A 3OM1A 2O14A 2WIKA 4Q3LA 5K8LA 1RXCA 4ITUA 3H1AA 4BU0A 1M1ZA 4IJWA 4O8ZA 3ADDA 4HEJA 2O8DB 4IRUB 2NOAA 4EYSA 5I7FA 5FOVA 2G9QA 3GFFA 2ZAYA 3T06B 1J25A 1L5ZA 3NLLA 3NV9A 3U39A 5LUBA 3LQ1A 3WYNA 3AM1A 1Q11A 2J4DA 4DFDA 5FNVF 5E6SB 3RWOA 1SBHA 3G8BA 1QHIA 1DGQA 3WLKX 2E4WA 3WJ7A 2IYNA 4BQPA 1KZ6A 3C3PA 3UKDA 3X2EA 5AQEA 3EUAA 3Q0TA 3ZUPA 1KK2A 2F6RA 4WACA 3SYLA 1JWBB 1ABFA 1YL6A 4RDCA 1OTXA 1AU9A 1Q5PA 2ZB4A 3EZGA 4YO7A 4AVYA 5KJ1A 4CRWB 3LT2A 4KGZA 1DO0A 1NKTA 5D6NA 4DR1B 3K5WA 3RC8A 3H11B 4PPNA 4BOYA 1XDUA 1XTSA 3BXXA 2NM0A 1XIVA 5BNIA 1U0NA 3OTQA 2QJWA 1A2BA 3G2PA 4Y2QA 4C7KA 4WNYA 1GA1A 4P3YA 6REQB 1QRTA 1E8DA 2WSIA 2I34A 2JCGA 4MVCA 3REFA 4AW9A 5F7ZA 2HDOA 2ZOSA 4HX2A 3VISA 2X4LA 5KQPA 5EXEA 1DHRA 4KAXA 1E6KA 4PFJA 5CMLA 1FBNA 4ZICA 4D9CA 1N9GA 5JD6A 1N7GA 1DUIA 1T6BY 1JDVA 4QTZA 2B1IA 1Q17A 3K5PA 5AJXA 2XUFA 2IE8A 4AMUA 4FMPA 3I1IA 2C58A 1TYZA 2VRNA 1LW6E 2R1ZA 5EUBA 5HBGA 1ONSA 3B52X 1C80A 3DZDA 4OF4A 3RR2A 1FP7A 2H52A 3PPIA 1MGPA 3N5KA 3BJEA 2IYQA 3SZOA 2VHYA 5ESWA 4DBLC 2XADA 4ALNA 3PD1A 4NECA 4Y7DA 3BIXA 1RKBA 4M0DA 3HZZA 3OTOB 1PFKA 2X9VA 4MB0A 1FYDA 2FPRA 2DSTA 3GDGA 5ISMA 1ZYUA 2PT7A 3RTDA 1I6MA 4QNMA 5A3SA 4KMOA 3KOXA 3CLTC 3X1ZA 2BMDA 2P0EA 5D3KA 3GOHA 4E07A 2ZM6B 1CDEA 1T91A 1VDMA 2C07A 1V8ZA 2YWGA 1NX9A 1Q6YA 5BO5A 2QLFA 1EWYA 1N25A 3RI3A 4ARZA 2HR1A 2WK1A 2WA1A 3D5EA 3D64A 3MRVA 4PS0A 3R8FA 2ZI3A 5FWXB 4EATA 3QEMB 1RRFA 3OCJA 3TTUA 4HGQA 4ZEMA 5BV1A 5CURA 5JJCA 1X7WB 1N3LA 1XHEA 3UW3A 4I0WB 2OLKA 1QFZA 3FMFA 4HF7A 1QWOA 3ZHUA 4A9AA 1ELOA 2KM1A 2TRSB 4R1SA 4FWTA 4Q12A 2XGMA 1O6CA 1KETA 4NBUA 3T4PA 5DI9A 4ALKA 3NIWA 4X1IA 1YRQA 1MV5A 1XRSB 3HE3A 3R3SA 4PLCA 5IJAA 4DSTA 4F7DA 1GGEA 4JBLA 2CNLA 3D59A 4LZJA 2HCBA 1NN3A 4JVNA 2WPDD 1A50B 4AS1A 1F7VA 1TUGA 1X7HA 3E82A 2O7QA 3B3AA 4WKPA 3W8NA 4DSNA 2IYPA 1PJ8A 3JQQA 1PS0A 5LKRA 4P92A 1XRPA 3KJEA 2VYCA 5FB3A 1X38A 4J1SA 3QE2A 4ZVVA 3DHNA 2GPYA 1JN0A 4D2IA 4E70A 2YQ5A 5IABA 1AKWA 4ZCPA 1CUVA 4KHZA 5HFJA 3O95A 1KMMA 5HZMA 2B35A 2CLDX 5IJXA 1VBFA 5H81A 3JYOA 4PAMA 4UNPA 3OQHA 4R8SA 3CF6R 3ZNNA 5A1JA 1M0TA 1S7GA 3RVJA 3DP7A 1NBME 5CGZA 1OX4B 4GGPA 4OHUA 3IULA 1FP4A 1TVKB 3DTVD 2LPMA 4FDAA 3UWPA 2GASA 2WSYB 2BMEA 4YR7A 3EPPA 4IS2A 1NBOA 4B32A 3FETA 4PZZA 3IDFA 3MWEA 2P1DA 1ZNQO 4H7IA 2VF2A 2Z8YM 1O95A 1BMQA 1GT6A 1CZKA 1L0BA 2WINI 4UHCA 1JIUA 3CW8X 1NMZA 3IOEA 3TIGA 2FHSA 4HBZA 5FO0A 4N6GA 1CPYA 1SUFA 2WFZA 3AONB 5E0KB 3QEAZ 2OD2A 5FLYA 2AYYA 4CV2A 4YMIA 1ADGA 5B4VA 4BV9A 4X7RA 2LIVA 3R44A 4F4FA 4I19A 3G68A 4FINA 4TWAA 1EBFA 3DCNA 3Q5EA 5HKKA 3WNCA 1EGVB 2BFNA 2OHXA 2JJ1A 3WHPA 4TLDA 1FFCA 3BMOB 1MO2A 3G1TA 1G3IA 4NJMB 5CXXA 3TWOA 2PUWA 1HO3A 2G8LA 3OIGA 2OD7A 4MHSA 4WKGA 1X7XB 2Z2YA 4XR4A 1JIVA 4ZJUA 2O2HA 3D8HA 4LSZA 1HQCA 3INTA 4LHXA 3K9HA 1VXRA 5G4KB 1E96A 3ZK8A 5DHSA 3SM3A 5H3LA 2FRVA 3IUSA 5B4UA 2GT1A 1X74A 2I99A 3GGGA 1NATA 3MEQA 3MTQA 3HKEA 4I2VA 3UK1A 2JLRA 3LY9A 1V25A 2PRYA 2F00A 3Q9NA 4M9UA 2F3QA 3O7MA 4JY7A 1ZMOA 2FI1A 3OZTA 4D3XA 4ETWA 2XXJA 1SG0A 3TOXA 4EJ2A 1K3FA 3RRYA 1SC3A 2F9LA 3PFNA 4OKSA 1VKZA 1I1OA 2CF6A 3JQRA 3NDJA 4GOJA 4BX3A 1S2IA 3A1CA 5AP9A 3R0ZA 3ZWXA 2IE0A 4A10A 1MFZA 1PZXA 4QYMA 4L28A 4BKRA 3I39X 5BW8A 5HOQA 9LDTA 5EZYB 4PYNA 3GLSA 4RXUA 3V1YA 1Z4KA 3Q6NA 2BONA 5FBHA 2HK7A 4BP9A 2R6FA 3ROZA 1NY6A 2EF1A 5H02A 4W5NA 2LRHA 3KSBC 4S2UA 3URKA 4H27A 4EKIA 1NVFA 2FK8A 3F49S 3O21A 1W581 2Q7DA 5ERXA 3RHSA 5FWDA 4PHCA 4QT4A 5HXAA 2BAGA 5IZCA 1RBYA 4MW9A 4H4CA 4BV8A 1FX0B 1WQ1R 2BM8A 5AFSA 4LECA 1TUBA 1E1CB 2HXGA 3A1SA 3F2VA 4U0KA 5FEUA 1O6GA 1A72A 1QAOA 2CD9A 5C7IO 5KZMB 3GNLA 5AKHA 1TJYA 3TRFA 5E1BA 3SEAA 2PL9A 5C46F 4L07A 2X8JB 4EMBA 2AVDA 1YKFA 1YS7A 3ZGOA 2Q2OA 1SC6A 3NTOA 4BNNA 1SNYA 3F5DA 4Q7MB 2JJYA 2LKDA 4I1VA 4LNHA 5CJ2A 5FPSA 3O2NA 1QQAA 4B87A 1P61B 5CLFA 3FOFC 5F9HA 2YS7A 1CUSA 2ORIA 4B33A 4XRGA 4QUIA 3KFLA 1IN5A 1B42A 1UDWA 2R85A 1FPQA 1PJ2A 3CM0A 3E9EA 3GUYA 4M9CA 3ZD9A 1MEJA 2HF7A 1Z7BA 1OI4A 2QRPA 2HV8A 1FDUA 3T5TA 4AG3A 1YJCA 4N4AA 4F96A 4X95A 4RM3A 1AOXA 2PGOA 4IIJB 1I6KA 4QFBA 4E2YA 5DSTA 1WVIA 3L41A 5LZ4A 2HSGA 3R24A 5IAAA 2OGSA 5IP5A 2OCDA 3OQOA 1A7UA 3TRHA 2OC9A 3GL9A 4Q3NA 3PCTA 3V7WA 3FYUB 3IPYA 3IPAA 2R0QC 4DR2B 1EA7A 4FZRA 4L95C 3GRUA 3O38A 1LBQA 4HGZA 2BV3A 2XWQA 4BO9A 1C8KA 4Q4AB 3RTBA 3CLSC 4YCLA 5KYWB 1ZH2A 2H5LA 4W99A 2P30A 5D3MA 1I6LA 4RSRA 2C5AA 4PC2A 1JXAA 2IUSA 3GUZA 3PR2B 3D0KA 4MHOA 4FC6A 3TOCA 2RBGA 5TJHA 4FDMA 5MF6A 4IOMA 3BREA 3VO1A 4V1CB 1C1DA 1F60A 5I48A 3FOAA 2R1TB 3W6NA 3B7PA 2PLWA 2VT7A 1PR4A 4DQDA 3RTEA 3D3WB 1WE2A 2OHIA 3F71A 3ZPXA 1V43A 4HAIA 1HX7A 3K20A 5HFAA 3PEFA 2JCXA 2XYHA 1RYZA 2Q5JA 3M8KA 5FI0B 3F9RA 3UJDA 4Q37A 1TNDA 2CY0A 2ZKLA 5THQA 3S28A 2CNBA 1AZLA 4AFNA 2IZ6A 3NRBA 5HE8A 3AL3A 1XQYA 2OMKA 5TS3A 1QO0D 4JCCA 4PNHA 1ZJYA 4A82A 1T36B 3LA8A 1ECGA 1SIOA 2BFEB 4LQCA 1Z0DA 4RCYA 4TKUB 5EIBD 2WD7A 3TLXA 2WVAA 2OK8A 4B3MB 5B4TA 2V7GA 3GT3A 4AZWA 4KQ2A 3ZXUB 3FN4A 4HFMA 4ZI5A 5LYJB 4HAWA 1GT91 3H4VA 2G1KA 3U4GA 4YJKA 2YWXA 2O2ZA 2IDKA 5A5EA 1FRZA 3WWDA 3IX7A 1TIBA 4LY3A 2CYCA 4INAA 5G0TA 2UZ4A 3AHFA 3OF2A 4JLSA 2AZXA 4KDFA 2PYDA 3ES9A 2UUBB 1FXWF 1OASA 2GWRA 5IBRA 1MLDA 4BO7A 1BCSA 5EXXA 1Z7WA 2WEKA 4RQUA 2AOXA 2EC5A 3L4SO 1UJCA 4CBVA 5EIEA 2R6R1 3NHLA 3RVRA 1ZIDA 5B57C 1MO4A 1X94A 3HA3A 1Y3FE 3K0CA 2E4AA 3H3FA 3ORSA 4BJ1A 2JK0A 3ZU6A 4BFVA 2JGFA 1SHJA 3TZ6A 4DLAA 4EPYA 3NTXA 2PHZA 4PX3A 3NGXA 2PU5A 4AAYA 1US8B 1Z28A 3FRIA 4I4LA 4RY2A 2E3JA 3LUAA 3TXXA 2AX3A 3L8ZA 4BLSA 2HWYA 4EG6A 1G18A 4L3WA 3O8RA 4DJJA 4RJLA 3HR7A 2ZQ5A 3TINA 2VTKA 4DY6A 2Q41A 4I6EA 3F6CA 2ZYGA 3SSMA 1JAIA 3UHPA 2DUNA 4G5YA 2BI4A 4ASUD 4G8CA 3NHYA 2HA6A 2OILA 1NVXQ 2I67A 3VVBA 1Q22A 3JQCA 4LDPA 5LZ2A 4RXMA 1TEVA 2OBYA 4H59A 3CNLA 3BEOA 2QZSA 1GR0A 3WGMA 4KLRA 3UAYA 4WKNA 1R8JA 2ZPTX 4EG1A 4CDRA 3GLGE 2Z04A 3PXEA 3PGVA 2A9PA 5HJEA 5AMXA 4RK7A 4XFDA 2HA7A 3HKEB 4C22A 1KH2A 2NV0A 4JQCA 2EW2A 5A7GA 5K0LA 2V9PA 1A7AA 1SOVA 4MVJD 5EWJA 2OORA 1FTGA 2XTJA 2XX3A 3LWNA 4WA8A 5E1DA 2XB8A 2J5QA 4TSFA 2ODBA 5FP0A 1TPZA 5I45A 5FH9A 1I2ZA 1YQUA 2C9YA 1R3UA 3ODPA 4F6CA 4G09A 3P26A 2ZPUA 3GCWA 1EFHA 4GPAA 1IEWA 2I80A 4LI3X 4B6RA 1LBSA 1HT0A 5ICFA 4FU0A 3Q1KA 4M49A 1IUNA 1WXGA 3KUUA 2P77A 5K6TA 5EQJB 3EEYA 5JNUA 4G3XA 2E6KA 3L0OA 4C6TB 1PVOA 4DDTA 1YO6A 1V11B 3RB8A 2XZOA 1QQBA 1YIAA 2JDIA 3JAKA 3WHKA 1UXKA 3QLJA 1U98A 1SULA 4CQMB 4GI5A 3KX2A 4D9EA 1V0JA 1DKUA 5K0TA 2XKKA 3AO0B 3DMDA 3HB9A 5ERYA 3HUTA 4IQ0A 3E15A 3JR7A 3NONA 4KI0A 4B4WA 2LE0A 5JH7B 4KFCA 5F64A 3A6DA 1OY1A 2Y71A 3AF5A 3KKNA 4P7JA 3I1FA 5HE9A 4DGSA 4F4JA 3OM9A 1M2VA 1NDHA 2H18A 1N5MA 3PQ3A 4RKWA 3NP7A 5JNTA 3BDIA 3F8WA 1GPDG 3CY6A 3L1HA 1P7PA 4ERNA 1QIFA 2CFTA 2F64A 3KEMA 1M74A 5ALJA 3H1TA 3W78A 2O2GA 4B75A 3DTTA 4OK5A 1HRDA 2AOTA 3B78A 4IEFB 2P4QA 4IQ4A 1ODFA 4XVHA 2P9FA 3USES 1AUXA 1C7RA 1RIFA 3BXEA 4UTZA 2RGRA 1WMSA 3DZKA 1AQUA 2ERCA 1ZXXA 3CZ4A 1YZNA 2PWBA 3QVXA 1J2RA 2CB9A 4GLOA 1W5EA 4K6GA 3CO0S 4M6WB 4W82A 3S2GA 3VZQA 2Q5CA 4BFWA 2Q1TA 2Q46A 3FOBA 4XYLA 3KVVA 3P0IA 1YUNA 1Z2NX 1ZN9A 1BGVA 2W2OA 1ZPDA 4G89A 1NM5A 3WLJA 5HVNA 5JBIA 3ZWYA 1Q0ZA 2REQB 3U2QA 1EESA 3UF0A 5E9WA 1AM4D 1EDBA 3HCPA 4IKEA 4TS3A 4JNKA 4MP8A 4ZODA 3WLMA 1NJFA 4EIWA 2H48A 1O03A 2BEWB 2ZT7A 5DMHA 2M6SA 1OWMA 3D1JA 4Q1VA 4BRSA 1JBQA 3O9VA 1UDXA 1T9CA 1ID1A 5ALSA 3CV3A 3OLVA 1XTVA 1HNNA 3EQ8A 3VR5A 1QIHA 2YMPA 4HWPA 1F06A 3UWKA 1BH6A 1CD5A 1D6NA 2P9YA 2WILA 4PSUA 5A7HA 5J2UF 2P9BA 4X9XA 2P9EA 4QARA 2B3TA 2ZSHA 4NZYA 3GLIA 4IJQA 5CPFA 1MEOA 2ZSFA 1LKZA 3GN1A 4UE3S 2KI5A 4EGSA 4NBWA 4L5BA 3DAHA 2VH2A 1GG9A 3T94A 1BXRB 3VYRB 2YRFA 4KGDA 4JENA 1WB6A 1H1TA 1TCAA 3AFOA 4DM4A 2UZAA 3AILA 2WWYA 3PQCA 1NNSA 1AKQA 2ZRGA 3DAGA 4GXQA 1FLAA 3H5RA 3H7IA 3LLMA 3NHBA 3PD7A 5DNUA 3TSCA 5D3ZA 3X44A 3I0ZA 3EVZA 3C2QA 5EJFA 3QOXA 3SE7A 4X85A 2H00A 2OCLA 1KGDA 1Y80A 1V8BA 1VLMA 1YR2A 1JZTA 1SUDA 1EI9A 4LZOA 3STHA 2X1LA 2J7KA 3G2HA 4XGQA 1Q6ZA 5JVDF 1FFWA 4YV2A 5AVJA 5FL7A 2BIFA 4DA8A 2GPSA 4D44A 1XXHB 1MP0A 3O8BA 3IVAA 4LYAA 1CNFA 3S2ZA 4XDHA 1DBWA 1DKOA 2BFMA 1SBTA 2GN4A 1C30B 1N9ZA 2YHIB 2PT9A 4W9NA 2XAUA 4QE3A 4BPRA 16PKA 4CFYA 1YVPA 3U6KA 1NVTA 1TLLA 1EWKA 5EXTA 2CF5A 3DCYA 4YAIA 4RO0A 1PD1A 3LE8A 3CWZA 4DJFC 2HT1A 3EEOA 1LY1A 1IBSA 3NBAA 4B46A 1NOIA 4YUXA 2GUGA 4K26A 2EFEB 4Q00A 4WN9B 3W8DA 5K0CA 1U3WA 1EBUA 2R62A 1JMYA 5E9AA 1M6NA 3TUZC 5I3CA 4CR7A 4XJSA 3UJ9A 2IZ0A 4FR5A 4G5OA 2HQSA 3Q2OA 4P4SA 3VC7A 2V3CC 2M6LA 1YOVA 4LSGA 5BQXA 1U9IC 2Z9BA 1P8JA 1X1QA 4P2BA 3R9XB 2R8XA 3CPHA 5HMLA 1JQJC 4WY8A 3WJ1A 3CPEA 2YVAA 1YL5A 4NDAA 5B36A 1JH8A 4KACA 2XV1A 4X0EA 4ZDKA 4ZALA 1S8AA 4LVOA 3UPDA 1VBMA 2BDEA 4ZVKA 3EF0A 3WIOA 5BXQC 1JEYB 2IY8A 1TRHA 1ORTA 2XF2A 3WO1A 4JI1B 2D6FA 2QTLA 1KDRA 2EJTA 5EUMA 2XKJE 5EMJA 3PX7A 3ZDQA 1PG0A 1W85B 2MWMA 3M2PA 4U7WA 5JY1A 4NMMA 3M5PA 4QYIB 3UPUA 2IY9A 3U0BA 4NC9A 4HXEB 5AOBA 2BUAA 4G4SP 1IJEA 3E7XA 4BP1A 4XM0A 4C7MA 3FB4A 5A5GA 4ZI3A 2ZJ6A 1B43A 1W88A 1QX3A 3RU7A 3USZA 2EFCB 1CJSA 3E1SA 4V38A 3WISA 1QE0A 4EMUA 5K0SA 2O7VA 5MGNA 3N6XA 1L7VC 1NIJA 4QNNA 5JHHB 5K05A 2A14A 5KWEA 1VE1A 5KYUB 2EQAA 4CV1A 2BHRA 4X00A 2ZE6A 3P2MA 1ZD9A 1OBCA 1PJ3A 2Q0SA 3CEMA 3Q5DA 4L8LA 1UEXC 2ODQA 4P31A 4R83A 4AUNA 5CEEA 5ED4A 1DDOA 3AEKA 2FPUA 4PSDA 2GPJA 2X9NA 4U7FA 4BGDA 4FOOA 4GNKA 3K4PA 3IVRA 5ICEA 1DPFA 2GS9A 3EDQA 3WC4A 4KPFC 5BN5A 1TEHA 3L0PA 3UHAA 4R5HA 3IXMA 1M8GA 3U49A 4A1FA 1I8TA 5AESA 2I8CA 4XTCS 2WYUA 4D3ZA 1YRHA 4IO0A 5FQOA 3OM8A 2D1SA 1UM9A 1T8TA 3MT8A 1RM4A 3FTPA 3LG2A 3B9QA 3K2IA 3FCXA 3JYQA 3LX5A 4C4AA 2P8SA 2KS6A 3SM9A 1ESNA 3AEQA 3KHSA 2XUAA 2ZE7A 3JQPA 3CZ5A 4Y0VA 1UJ5A 1T6NA 1P74A 4HDOB 4GYWA 4B2YA 2ACWA 4EF4A 3ZJ4A 1FFXB 4LMPA 4N3AA 4PQGA 2A9KA 2BY4A 3ZCPA 4DAEA 1OAOC 4ER7A 1YMQA 4OXQA 4NNOA 1BS1A 4GR9A 5B7PA 2VQDA 1ML4A 2QAIA 1H5UA 2EL7A 4XZ3A 3RRXA 1JHOA 3VPBA 1SKMA 2D8AA 3FVWA 4FEAA 1CUZA 3SGLA 2GBFA 1GPNA 4REQA 4MQ6A 1TD1A 2UVQA 1SXJB 2YQZA 3YASA 3EQ9A 1II8B 2ZJFA 1MABB 3PLNA 1D0SA 3M0EA 2B2XA 2LTAA 4WK4B 3MCWA 1H6DA 1K5PA 4HH0A 1UP4A 4XFJA 3FPJA 1SVIA 2WYVA 3RNLA 5CLQA 4JMPA 2QL9A 3KQKA 4FMDF 3MD0A 1AKTA 2QD4A 3BB1A 5DNWA 3RWMB 2WZBA 1E2QA 1K1EA 1X2BA 3PUHA 3KWLA 3THWA 1G9SA 2BGGA 1ORRA 2CVHA 1KBZA 2V74B 4Q9NA 2X5JO 4KXWA 1DSSG 2C97A 3BIWA 1IVNA 2DPGA 2FWRA 4V3BA 5LCXA 1T5TA 1R0CA 3U3RA 5ILQA 3I2KA 3SLRA 2QY6A 2W7TA 1NLFA 3IAAA 4MV4A 3MIZA 1WUKS 2PANA 3NETA 2PSDA 5DBFA 3IOYA 2DFVA 4MP6A 1Y1TA 1VYUA 2CUZA 4IG9A 4O3FA 2ZR0A 1QGUA 1E6MA 1XKQA 2ZG6A 3DBLA 3OEHD 1P73A 2HLDA 3EZ6A 4ZT6A 3VHXB 1X9GA 1JSCA 2GUWA 2JJ1D 1GRVA 3HVHA 1JB9A 3FYTA 3CUKA 4YECA 1NMSA 3OZ7A 4PFKA 1T5HX 1U2DC 2QN3A 3U09A 3D1VA 4UBIA 3IAUA 4ENUA 1UBFA 3QIVA 1W4AA 1MQAA 1WCIA 2WJAA 3O8QB 4PY2A 1IQ0A 4NCBA 4JXJA 2Y3IA 4L08A 2QORA 3SOPA 4E21A 3I92A 3CA8A 4CCWA 3EPKA 1K8ZB 5IKOA 3P94A 1TKCA 1GGNA 2IU3A 1D2AA 1ADBA 1RSZA 3C3CA 3H5IA 3KNZA 3QPBA 3EC1A 4JGBA 5JS6A 2PTHA 2XT0A 3E3NA 4WCFC 4KR7A 1GKUB 2J6IA 1V8PA 5TF4A 2AFHA 2DWQA 1PWEA 2N75A 1JT2A 2IIVA 2Y0EA 3L7NA 4GC9A 4KRXA 3CGGA 1QAQA 3QV2A 4KV9A 3TW0A 1G55A 2ISSD 4WQMA 1K7SN 4PX5A 3R7DA 1PYOA 2AQIA 2B7BA 2XYGA 3K1YA 3AR8A 4M8SA 2QN9A 1R64A 1X7ZB 2GZ3A 1UBUS 3OD1A 1SG6A 2Z8ZA 1WDKA 3LUJA 3PYLA 4TTJA 5F78A 5FHRA 5WRFA 1MF7A 4F4UA 5LOVA 4ND5A 1G8GA 1JWAB 4BGEA 5CFOA 4FFLA 4WXPA 4EYOA 3EVFA 1XPRA 2FUNB 2OV4A 2D5LA 4F11A 5BW4A 3QUSA 3E2PA 3JAWA 2B3DA 4RHCA 5JCJA 1OLXA 3QUBA 5KTSA 1ZN7A 3TVYA 3PSHA 1E3JA 5JV5A 1G4AE 3H2IA 1MX9A 2ASEA 4FK8A 5A6SB 3MGCA 3GT4A 4LDJA 4M22A 1KY3A 4AXBA 1E3MA 3D6AA 3LUPA 4FZ3A 1Z13A 3ZBPA 4W9MC 2QJRA 5BWBA 4JJ6A 5B7NA 1E60A 1UMBA 1YV9A 5FPHA 2ZB7A 3GU3A 2M6KA 2Z8XA 1M2OA 3P9SA 4X3PA 1X92A 4OHZA 3CVVA 4EFDA 1YJBA 4V03A 3V80A 1C9EA 1P9LA 1RACA 2EATA 3IDOA 3WG9A 3DMGA 3HNRA 2ZJ8A 3SDSA 3WYFA 5BORA 4RVUA 2SKDA 4G5GA 2XLCA 4EAAA 2ZIAA 4DMHA 4C43A 1ITZA 2BEJA 1Z6ZA 3KTOA 4GDMA 1T34A 4FOTA 1F8FA 1Y7LA 2VBCA 5JG7A 3UC5A 5K5EA 1J1ZA 1MIOA 2V7TA 1PUJA 5FLXA 3UMYA 5A6VA 1V6CA 3ORFA 5COAA 3GJ6A 2WVJA 3Q40A 1UMDA 4KFUA 1IY8A 121PA 1E8NA 4Q1FA 3MT9A 5AVRA 2R68A 3I6BA 2Y6VA 4CMEA 1M2FA 4EO7A 2O8CA 4KIWA 2ISCA 3ROQA 3UK6A 3W9YA 1QYVA 3W1EA 4LRUA 5KYYA 2LIPA 2PX4A 1XOIA 3OWHA 3KYCB 1JSXA 1MVOA 1XR3A 4LBWA 5L6MB 3ZG6A 1GFIA 3RTGA 3C4QA 4N8EA 3UCFA 3X1JA 3CB2A 1QKJA 2VQ3A 2J3LA 3I72A 4FSHA 4UM7A 5LDHA 5KYXB 3RS8A 5HJ5A 4BLOA 4JV5B 3G0IA 3FBWA 5A05A 1U8AA 1BGWA 4JJ4A 1II0A 3JASB 5D2CA 4S1PA 1JIJA 1T26A 2JGNA 3DO5A 1UM9B 5CNKA 5DISB 4BBAA 1XDDA 3A1WA 2X0FA 1YQ9A 2NQTA 4LWQA 2PKYX 3W5DA 3JQGA 3M6UA 2X5KO 1AO0A 1R7RA 4Y6LA 3VU3A 4B3TB 2DY0A 3OIUA 5TV2A 2I33A 1T6ZA 3IDAA 1SIUA 3W1VA 3QFSA 4DEXA 4JVLA 4UUBA 3KPUA 5AIBA 4MQFA 4ECEA 3CLRC 3Q15C 5AH0A 2P3LA 4JT2A 2P4HX 3PK0A 1M8JA 5C4GB 1JDBB 3G0CA 4US0R 2C4TA 4LJKA 5DX1A 3GDWA 4J8PA 4W7IA 2I4TA 3I9OA 4MI3A 4DMMA 3BL6A 4LUCA 2NUTA 4KQXA 5IBPA 4Q4CA 5J9FA 5ALQA 3LDHA 1D9ZA 3R0QA 4H6PA 4XB2A 1L4FA 5A0TA 1YUBA 1W1WA 3AI2A 1D2GA 4WNAB 5LXTA 2H3HA 3CZMA 2EX0A 2J48A 2J6CA 5JY6A 2OP1A 4TVOA 2JKYA 4LPSA 4S1OA 1WLYA 3AR7A 1NU6A 3MPUA 1EWVA 4OU5A 1LDYA 3QOYA 3PE4A 4O4LA 3UMFA 4EHKA 2EW8A 4KIUA 4LCBA 4KPUB 4CG3A 2VEOA 3OESA 3AF2A 4QVGA 4JI3B 3N59A 2C1XA 2V5AA 3FTFA 1UH5A 4RCZA 3DFKA 4IS3A 2Q4TA 3CW2A 1PWHA 1WG8A 2W4QA 3NHAA 1FFBA 1YE5A 2L19A 2ENUA 3LBNA 4Q9AA 4UJ5A 1GG5A 2Q49A 1L6RA 1B0AA 1SOMA 3IBYA 4G5HA 1S5PA 1VZ2A 4NFSA 1RBZA 5FWYB 3HR8A 1DOZA 1ZU5A 3IAEA 5GONF 2BBOA 1WUYA 3HKBA 4LDZA 4LEIA 1ZP6A 1RW4A 1L7AA 4OUDA 2RAUA 2V58A 2AMFA 4NU0A 2WV9A 1U4SA 4YR9A 1NI4A 1YMVA 3INRA 4F92B 5T8KA 4G9EA 1RM3A 2QLTA 4I50F 4IIBA 5BV2P 1HLPA 3ANNA 4XYGA 1U0FA 1EDEA 3GNTA 4BWGA 4Q15A 4HLUA 2OL4A 2RGUA 4L5JA 4YYZA 3K30A 1G8HA 1T3ZA 2BFAA 2W37A 3HUDA 5DXAA 2GRAA 1YVEI 4IWXA 1VL2A 2NXWA 4RFLA 5KPDA 1I2CA 2I66A 3ICCA 4AKIA 2OXIA 2A0KA 2KX7A 3RJMA 3D6UA 3F5FA 3CXRA 1KAOA 2FY8A 1OZAA 3NALA 5I7UA 4FONA 5SZKB 3AJAA 3JQ9C 1JMKC 1KR5A 3UOAB 3OMLA 4F3TA 5BY2A 1RHUA 2QKYA 2Y1EA 1RAIA 3CH5A 3D5TA 3IGFA 4ERXA 1SK9A 2WFMA 3ZX4A 3KT3A 2IYVA 5AHRA 4GOKA 4EHIA 4F04A 1JG2A 1N2EA 2PKEA 4LTDA 3ZD6A 4IJUA 2OQIA 5LIRA 2LR0A 5ER6A 1A0OA 1K6IA 1CR6A 2VJMA 3HS3A 4HYYA 4TSFD 1U63A 2X14A 1YB4A 3I53A 3LQKA 1T6YA 5CDSA 4RDIA 3DEZA 1URPA 4II2A 5TGZA 1N9KA 5F1KA 3UO8B 3OLYA 4GOLD 3ZGXA 2WIGA 1E1YA 2JGDA 3M49A 1U7TA 2PSHA 3DXYA 1W87A 4B82A 2Y2UA 5B5SA 2FDCA 4Q7QA 3ZHRA 5T57A 5A7FA 1GSOA 4NY1A 4UHHA 3WSWA 2D7CA 4TLAA 2W11A 3N53A 4C2AA 3AB3A 2K4MA 4DLRA 1KVTA 1JR3A 1Q0LA 3ROXA 1P5HA 1DARA 1FSSA 1IG0A 2DCMA 3PQDA 3TNJA 1OXUA 3W6PA 3OZXA 1CETA 1M10A 2Q1SA 1E7QA 5C2JB 3C3WA 4QUGA 4HYQA 4D43A 3HBNA 721PA 2RGAA 3EAFA 3SKVA 4CT5A 1K66A 1KXZA 4AO7A 1ZHOA 3X43A 4F60A 2QHXA 3L0BA 3ZDXB 2RGNC 3WGHA 1WM1A 4TPKA 5K0JA 4XWGA 1RMTA 1XCOA 2F3PA 3R0XA 2A88A 4AMGA 1TM7E 4F5DA 1KI8A 3K72B 4FD2A 3E0XA 4J1NA 1Y81A 2Y4NA 3P2JA 3C8ZA 3A0RB 4PQRA 4XGNA 5DHAA 1ZUNB 3HWWA 4NDNE 3A9TA 1K5GA 3UJPA 4RL6A 2WJYA 2PX8A 4LYGA 4XX1A 1LDBA 5FX2A 2R25B 2R2GA 4UFPA 4ZTZB 3E27A 4YXWA 2ANCA 2H1RA 1Z4JA 2QRQA 4P5DA 5KNBH 3RAPR 4MQ5A 3E0QA 5JJ5A 1A1VA 1QSGA 2H0AA 5EQFA 4O2LA 2GZ2A 3MXOA 1Y4DE 3WIUA 5HUQA 3JVIA 5LC1A 5IXJA 4JP1A 4HFNA 2W71A 1S6YA 2BWJA 5BRJA 2I7TA 1FS5A 1HURA 1G17A 3F3KA 3LCUA 5ALRA 2BMWA 2ORED 5JAQA 3SF8A 2ZRBA 3NX4A 3UXYA 3WLAA 4UQLA 5F7XA 1EFDN 4RVCA 1UJBA 4OB6A 5K6RA 2PVPA 4KZKA 4AWAA 2WJHA 2W2XA 1SXJD 1OOEA 1JVNA 2PMWB 4Y2VA 2FQQA 1Y9JA 3ZQJA 5IYZB 1CP3A 1NJ8A 2A7XA 4Y67A 2G6BA 2WJGA 1M34B 1PAUA 1Y0BA 4OSEA 2J5BA 4DCOA 1ISIA 1USKA 3THXB 1YS4A 1YS9A 3L06A 2VG8A 4ZC1A 3UG7A 4ZJYA 1Z3CA 2C0QA 4M1EA 4WESA 4ZVSA 1ZNYA 2HU2A 5KOJA 5CRIA 1TUEA 1Y1SA 2XA1A 3QYJA 4DCUA 1GV1A 5B2EA 3LU1A 2WY2D 2VA9A 4RA6B 5KVCA 1J0AA 3QVWA 1VLQA 2VDJA 1UKBA 2DECA 3ESZA 4ZD6A 1K3TA 2C98A 1SVLA 1W49A 1U2GA 1ZN8A 2IUEA 3OE5A 3TGWA 3SFTA 4PG5A 1PSWA 4TS9A 3DKKA 3HVUA 5BWOA 2PO7A 5IM4F 1P0MA 3MJHA 3LX4A 4QLOA 3LQYA 4QOJA 3C8MA 3NT2A 5EINA 3V7FA 1PW7A 5K3SA 4EVRA 2G70A 1KI9A 4Q1CA 4D3DA 4GZMA 1HL7A 4K3VA 4F21A 2FR8A 5TJ9A 5JYDA 1E0KA 1SD1A 2H4FA 3KXKA 1S96A 3ESBA 4YMTA 4Y6OA 1PV1A 4LS3A 1MAWA 3QY0A 4XGIA 4BKOA 1V3TA 1TPYA 4GQAA 1UANA 3EAQA 5BWCA 1BEUB 1HE1C 4JLMA 1QYIA 1L9KA 4UHKA 5GZ6A 4DLPA 4CKYA 5BSHA 3HU1A 2ZIGA 4IEEA 5ER9A 1J9GA 1ZRMA 3JALB 3TFQA 1BFDA 1KA9H 1OX5A 3E3LA 4LK2A 1NW3A 4PHTA 4PLWA 5DLDA 2NVUA 3G9XA 5IH7A 3OIYA 1EQ2A 4TV9A 1CRWG 1FL9A 3W7VA 2QL5A 3OHMA 3VAYA 3ZE8A 4DUGA 1DXYA 1I13A 9ATCA 4DPLA 2BBTA 4MR7B 1N75A 3L7JA 2FWMX 1RJ9B 2RIRA 4UDOA 4YUYA 3GLGA 3PGMA 1TQ8A 1Y8AA 1CUBA 2BEUB 1J5PA 3RGWS 3N6VA 4MWOA 2QRLA 3SEZA 4EK9A 1KQOA 1G6OA 3JWHA 4AZ0B 2PIDA 4GSYA 1SMKA 5ALZA 3I9LA 4QBIA 4FMCB 4XVQA 3RIYA 2VAPA 4FDTA 3UFBA 3TPZA 1JLKA 5EHNA 1Y3IA 3UK7A 4D9IA 3KBBA 2GQ0A 1CEQA 3RRFA 1NNI1 3ETLA 5LNK1 1VMDA 3I2JA 3WO0A 2W4MA 3CUTA 1XEWY 2Q5QA 3JARA 3KKQA 5KX5F 3INYA 3CVYA 3RCBA 1NBWB 2MYUA 2DQYA 4ZZ2A 4TKVB 5H82A 4KLZA 3UANA 5LIPA 1TAUA 5IC6A 1JT9A 2RJNA 2MR5A 4RVSA 4CW7A 3CB4A 3O92A 5I9LA 4RTLA 1SJ9A 2V97A 4IUBS 4M98A 3T7SA 2MSLA 3LY5A 3SBOA 4OK6A 4LXGA 1BCRA 4Z0NA 4MUHA 1UBJS 4Y6RA 1C8LA 2TS1A 3AEZA 5JU6A 1XN4A 1OR8A 1Y1KE 4EW2A 2WQ7A 4AZ3A 4O33A 1PL0A 3GGSA 2QSZA 1YI0A 4WA7A 4RDHA 4KWEA 4W1QA 2Z98A 3P45A 4DQKA 2JVIA 1KH3A 5C7OO 1FY2A 1TO1E 1VKOA 1KEUA 3VH3A 4AUMA 4UUQA 4AKTA 3L7CA 2E18A 1Y5MA 2VNHA 5CCEA 1Y6FA 5AHXA 1V71A 2GCNA 2OYSA 4R2JA 3L6OO 3QXHA 3V32A 2RAFA 5TQ0B 1OJ7A 5EQDA 4KAJA 2Z9CA 1F4PA 5CHEA 1U90A 4ARCA 4U5XA 2GJAA 3CZ9A 4PVDA 5LD2C 3DKPA 3EFHA 4KCGA 4CPDA 3U3KA 2PEZA 5J4KA 1DC6A 2EZ4A 3DWIA 2A30A 4B45A 3FCUB 4CMHA 4LY9A 2CL6X 3H1BA 4J7XA 1U0TA 1FEZA 1SEVA 3C5WP 4Q24A 2OFFA 2IZ1A 1D6JA 2JGKA 2EJWA 5EHQA 5FHQA 3H18A 3KIPA 4ENPA 2F3TA 2QENA 5DU2A 1YJQA 3K53A 2C54A 2OV3A 2XAAA 2IIQA 3Q85A 5D5PA 3CKKA 1V8FA 1IPEA 2I1LA 5B55A 3PGXA 4DANA 4RTQA 4TUYB 5EHZA 4DL9A 4EF6A 2H65A 1HE8B 2ZXFA 5IAGA 3RU9A 1XPJA 3TE6A 1UWKA 4OTZA 2G9NA 4ER6A 2C83A 1E0JA 4W9RA 2ZJ7A 4MCAA 4QULA 1Q3TA 1ML3A 3PPWA 3TQQA 3OUZA 1WO8A 2J0SA 4OHBA 2XW6A 3DOJA 3BMXA 1IMJA 5HOEA 3FNHA 3ND5A 5J58A 2VATA 3FXAA 3GG2A 3NXSA 4QUHA 1QHFA 2BEVB 2ZRLA 4G5QA 3JD4A 4HD8A 4DCPA 2XOKA 3DTYA 3PUKA 5IAKA 2GILA 2HZBA 2OHJA 4BQIA 1A9PA 3MUOA 1XCGB 3DEJA 3IR6A 2XT9A 2QNBA 3V9PA 1N5KA 1BNCA 1N6LA 3PE6A 4KLNA 1UBLS 1KNQA 2WP0A 4FYHA 3LZ6A 4P58A 3TLJA 4W8OA 5EIWA 3DAFA 3IUMA 1GZDA 5HILA 4QYXA 1F2TB 4PAOA 1DLJA 1R4MB 4BATA 1D6SA 2Z1MA 4DIBA 4IJMA 2IW1A 2I4NA 5JASA 3E81A 2XCRB 3D2CA 3ZW9A 1KO8A 1OKKA 2H4XA 3PA8A 2TSYB 4C0XA 1KEPA 3C7TA 4PXAA 3JZAA 2ZRKA 4BBZA 1PR6A 4YWJA 3LPNA 3I8XA 2ZI6A 2WYHA 4IFBA 5DHTA 3QBTA 4XQEA 3DC7A 1LJLA 1ODJA 4GECA 4WESB 4RTPA 1RYEA 4KQHA 4HNHA 4QBGB 1U3UA 1Z0SA 2WFAA 1W2GA 1W44A 1NE7A 1COWA 2N42A 3DE4X 3VX4A 4MRMB 5C35A 4KR3A 4U6NA 4CGZA 3AG5A 1D2EA 3DVAA 1CQJA 1M5UA 3Q3VA 3O4JA 3VR5H 4XYEA 2AF4C 1APBA 4REMA 4P9NA 1L5RA 1NRIA 4C5AA 3I05A 4ITVA 3AQIA 4IQ8A 3GB9A 4RIEA 4ZT3A 4ZEWA 3G5MA 5TQJA 2PH3A 3VNBA 1JMVA 4AK9A 2HLDD 3TAXA 1OTHA 4JP5A 1YACA 1JR6A 3ZJ5A 1G20B 5KJEA 5D6OA 3H8JA 4L3VA 4EGJA 2EWMA 8LDHA 4IKOA 1T0JB 2AT1A 4LV6A 1DT5A 4OJNA 3UT5B 2I87A 3I37X 2WJVA 3JQAB 3Q8WA 4DA4A 4XASA 3PEWA 3LVBA 2HREA 4L76A 1SHUX 2VEDA 2P1ZA 4E5KA 3N2NA 2GVZC 4P0TA 3RSHA 3COPA 4X84A 5JCOC 4H2DA 3QY9A 4HY3A 5JECA 3U56A 1QZ3A 1JKIA 3ZWWA 2IC5A 3ZJYA 4FUTA 4C4RA 3MOIA 1QUEA 4DQ0A 4MW2A 3GEGA 3QXJA 3ZW8A 5E6RA 3ULKA 2A92A 3SMQA 2QTFA 2ZSJA 2AN1A 4RELA 5DHPA 4C14A 4KK4A 3WWPA 4KN6A 1FDRA 1SPXA 4BVJA 4BX8A 1QQ7A 1WEKA 1VL8A 1R6DA 5TQ2A 5C8YF 5IAOA 2ZM5A 4C2TA 1FLDA 4OMFG 1CW2B 1HKUA 3OQJA 4CEIA 1P5ZB 1JJBA 3QGMA 5EJ7A 4NCKA 2IH4A 3WBJA 4C7JA 4QICA 4Y9TA 3SR0A 1P77A 4JYPA 4NHOA 1HLFA 5JCJD 1SVUA 2I2DA 2XTMA 1DQZA 4K87A 4GLJA 5KVSA 1E2NA 1HOXA 2GZMA 3I28A 1G5RA 1XTTA 2HDHA 3JARB 3N2KA 3WRYC 4NAVA 5L3VA 1M2KA 4X1KB 5K6AA 4BFYA 1GPH1 3TM5A 2QLNA 3KOWA 1TT5A 3NWPA 1WD5A 4LJ5A 3ZQ6A 4QEKA 2CXSA 3DHYA 5IEBA 4JYBA 1M67A 1QOQB 4NPHA 1WSBA 5JS1A 4QXMA 3SZLA 4BEBA 3A9VA 2OCYC 3RTCA 3HMQA 5IUNC 2QM8A 2JG3A 4D45A 2ZDHA 1EEHA 1USGA 4GI1A 1RAHA 4OB8A 3I5UA 2PUEA 4JR0A 4UCXA 4Y2TA 1FDOA 3U16A 1V9SA 4RIGA 2YWRA 1NL3A 2X7JA 4BTLA 1PJ4A 4GBMA 4HGNA 3R3YA 4J0HA 4TV8F 3B1XA 5T6BA 2VTBB 1P1FA 1TECE 1QMPA 1UJ2A 1XZAA 1LPMA 3LUHA 1E3WA 1R0KA 2BHNA 4UBMA 3SHOA 2QR3A 2FMUA 5KI6A 1ODTC 1SM4A 1ZD1A 3DR5A 4QECA 5DDIP 4EGFA 2XLBA 1RKVA 4KO1S 1SXPA 4EELA 1L4KA 1QHSA 1U1EA 3P0FA 1FMFA 1JHZA 3LOPA 3OOHA 3R4CA 5IWCA 2A57A 3LK6A 4BUCA 4QJIA 1XZJA 2ZE8A 1BQEA 4TT3A 4EL5A 2A9OA 3HKCB 1TK9A 3I73A 4PAQA 2A33A 3TNLA 2QRVA 1JA9A 3EASA 3AI3A 1UPXA 4QAJA 1T0HB 3DZCA 4WLFA 3LJKA 1WPQA 3P9RA 4JYCA 3EGXB 2VSOA 2QU8A 3PT9A 5JDCC 2BZ1A 2ZTMA 3ZWNA 1CQIB 1H0KA 1D0IA 1FTYA 1MG5A 4B6GA 4MWBA 4TL7A 4ZHQA 2VPYA 4HB4A 2WKSA 4RBNA 4AKGA 3LS2A 2UZ1B 5JRDS 4WNCA 5FFFA 1QGYA 3RYTC 1CF4A 2GYWA 4HYEA 1JNXX 1R5NA 1JQLB 1JDTA 1Z88A 2I62A 3MLBA 1RIIA 1Z4LA 1I3MA 4OMDA 4WXMA 1EA5A 2FPKA 3G5LA 1ZJZA 1RXIA 2ZQZA 3IVCA 4BGIA 4J16A 1V5EA 1DWPA 2JVKA 1RFGE 7REQB 2CFSA 1HE5A 1FA9A 3TLGB 3VZRA 2ACEA 1V7QA 3IB6A 2CKDA 5EMHA 2CB0A 3ZZUA 3F9CA 5K20A 3GMIA 4KGVA 3LV8A 4MVWA 4OP1A 1CUJA 1Q0SA 4KR2A 4XX0B 2JHGA 1TM4E 3NI2A 4INZA 5IM4A 4YWHA 3ZDCA 1ZNXA 3WGVA 4BY9E 3KKEA 4ZV4A 1VPWA 1RQLA 1CNMA 1GPWB 1RS0A 1PR1A 1XDZA 4FX2A 4TXNA 5I9BA 4D9KA 4KPYA 3PJEA 3WKDA 1L1FA 4IQFA 1PZEA 3BSWA 4JEIA 1GARA 1SD2A 3GP8A 1IIBA 4Z3KA 1W1IA 3NTLA 1Z8FA 2EP7A 3ADKA 2EZ9A 5HK9A 2C4NA 1F8GA 1QP4A 1BRMA 4LYFA 1LI5A 5KNCD 5CLJA 1AQYA 1A8UA 1T8WA 2HJ9A 1O6ZA 2CD7A 3K7EA 2GCEA 4LW8A 1PHPA 3GZNB 3I6QA 5KREA 4Z53A 4CMIB 1TM2A 4F8EA 4O5AA 4RD1A 4UHJA 4N76A 3ML1A 2XMCA 1NASA 3ZC3A 3EIFA 5KC9A 1U0HC 4C6RA 1G7CA 3LK7A 3WLLA 3FNGA 5C7LO 3KJGA 1LA2A 3MXTA 3Q8XB 2ZJYA 5KNDH 1U7UA 1FTSA 1JGTA 1C7JA 1JS1X 1MENA 2IXFA 4PYQA 4ZP1A 5AK5A 4O08A 3TTWA 1UPCA 3BAZA 3OIWA 1I5EA 1X1SA 4GQIA 3R8XA 4OLBA 4ACAA 3N8GA 2EFHB 2A9JA 1FVXA 3LECA 4IDDA 4OQ4A 1LNSA 2QG6A 2P5TB 1ZSVA 3HSKA 3JQBC 3