4KE6A

Crystal structure d196n mutant of monoglyceride lipase from bacillus sp. h257 in complex with 1-rac-lauroyl glycerol
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
249
structure length
247
Chain Sequence
MSEQYPVLSGAEPFYAENGPVGVLLVHGFTGTPHSMRPLAEAYAKAGYTVCLPRLKGHGTHYEDMERTTFHDWVASVEEGYGWLKQRCQTIFVTGLSMGGTLTLYLAEHHPDICGIVPINAAVDIPAIAAGMGGELPRYLDSIGSDLKNPDVKELAYEKTPTASLLQLARLMAQTKAKLDRIVCPALIFVSDENHVVPPGNADIIFQGISSTEKEIVRLRNSYHVATLDYDQPMIIERSLEFFAKHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational plasticity and ligand binding of bacterial monoacylglycerol lipase.
pubmed doi rcsb
source organism Bacillus sp.
molecule tags Hydrolase
molecule keywords Thermostable monoacylglycerol lipase
total genus 92
structure length 247
sequence length 249
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2013-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ke6A00
3PE6A 1WB4A 1WHSA 2XMGA 1TCAA 2RONA 2DFPA 5BV7A 4X93A 5C8VA 4WDRA 4H7DA 2G5TA 4DMFA 4PF1A 5EFZA 4FNMA 3BL8A 2PVSA 2DQZA 2EDCA 3NUZA 3C6XA 4IH9A 4W1PA 3AFIA 4ARBA 1XQWA 1UOPA 2QTBA 3PF9A 3WL8A 3STTA 3VJKA 1E8DA 3H2KA 4TVKA 5FKJA 4FNGA 3V1MA 4BVKA 3O9MA 4UFOA 5DJ5A 3H2HA 5SYNA 5LZ9A 3QYJA 4ZV9A 3DD5A 4NZZA 3F8SA 2H7XA 2HA5A 3MVEA 1XFDA 5AKXA 3HJUA 1DT3A 2JGEA 2V97A 3IA2A 7YASA 1ZGBA 3G0GA 3PICA 4Y9SA 3QH4A 2ES4A 2ROQA 3DDUA 3R3WA 2JEYA 5AK5A 1W6RA 3EBLA 2JIDA 4LYEA 1HDEA 4Y2SA 5SYMA 1MAAA 4CCWA 4QNNA 2JGLA 3FBWA 2JGKA 4TPKA 3F97A 4C88A 4WJLA 4G4JA 1NX9A 4Z49A 3PDCA 2OXEA 2HDWA 1YS2X 3STVA 4AN0A 4C01A 5AK3A 5HF8A 1T4MA 3EQ7A 3L1IA 1E89A 4F21A 4AZ3A 5AM2A 3S8YA 2VJBA 1U4NA 4J0IA 2QJWA 1UK8A 2O7RA 4H18A 3G8YA 5T4BA 5AKEA 3BIXA 3DS8A 4DYHA 1UKAA 1MNAA 4BP9A 4FDMA 4FMPA 5LZ8A 3WL7A 5FDFA 1Z68A 1A8QA 3WWPA 3DOIA 1CUBA 1XKTA 4FOLA 1WPXA 2XUHA 4E15A 2XMZA 1FFEA 2WFLA 1TKRA 5DYYA 2G4LA 3FYUA 3M3DA 5A6VA 2WKWA 3FSGD 1QFSA 2QM0A 1WHTA 4H7JA 5AP9A 4OCZA 5IVIA 2QXUA 4DNFA 4BAGA 3UUEA 1NU6A 3BJMA 4N8DA 5ALTA 1LNSA 4G9GA 4KRYA 3FYTA 3HRHA 2ZSHA 2JF0A 4AXBA 4DIUA 1USWA 1ACJA 5FUMA 4Y2TA 1OILA 4Q05A 4MWTA 4QWMA 4HRYA 2BFNA 4C87A 5AKKA 1G4HA 2QUAA 2HU7A 3EIOA 4HXGA 5JATA 3O4GA 4BRZA 2BKLA 2OPHA 2WIJA 1C4XA 1WPRA 1Q0ZA 4BE9A 1MX9A 3ZWQA 1XZLA 4JNCA 5LZ5A 5ISMA 4UHDA 4G9EA 1JU4A 1GPNA 3UUFA 5JALA 4BYMA 3WI7A 4WFJA 3A6ZA 2HA7A 3V48A 2XQKA 4JUIA 2ZYIA 1S8OA 3IUJA 2WFMA 1ZGCA 2XQJA 1XRMA 4ZGBA 5CURA 4CIAA 2ZJFA 2IIVA 2Z5GA 4FTWA 1Y37A 4M0FA 5DYTA 5H3HA 4PSDA 3WK4A 3AINA 3R41A 1QLWA 2OCKA 4J0KA 5EHZA 1IUNA 1ZOIA 4U2DA 1XRPA 2J4FA 2V96A 3AZOA 3GA7A 5JIBA 2Y2VA 1W52X 3D2AA 3LP5A 4F5ZA 3HYSA 5AKGA 4FHZA 4BC0A 1G5FA 4DMHA 1YAJA 3LCRA 2QXTA 4G8DA 1CR6A 1EXWA 4HAIA 4G5XA 1ZD4A 3PFBA 4BBZA 4HTAA 5AICA 4A16A 1DTEA 4IH1A 5CT9A 5HF9A 3ICWA 4OD0A 2WIKA 4MQLA 1EVEA 1K5PA 3I6ZA 1SCIA 4DSZA 5JAPA 1DWQA 4FBLA 1A7UA 3KOOA 2WUDA 4RNCA 4BE4A 1CFJA 4PSUA 1R9MA 4LXGA 5IVHA 1Q84A 2PBLA 5IVDA 3TGLA 5AHXA 2QMQA 5EHXA 5AI9A 4X97A 4MYDA 3DL4A 3V9AA 4KE8A 4MJ3A 1YSCA 2HRRA 5EI5A 3I2FA 4OYLA 1ZIXA 2WJ3A 3G0DA 5ALNA 2RGUA 5LIPA 4U2GA 5HF6A 2PUJA 3LLCA 2AJCA 4J0JA 1YAHA 1KU6A 2C4HA 4UBMA 1F8UA 3OOSA 2EDAA 2VJDA 1MX5A 2XUAA 4O08A 4B9EA 1ISPA 1XZDA 3C5WP 1FJ2A 2G63A 3WYDA 1R4ZA 2CZQA 3BWXA 4EY5A 2I3DA 1EX9A 1JKMA 5ALLA 2RHTA 1VE6A 2ACEA 4UHHA 4X90A 3WWDA 3A2LA 2PL5A 4E14A 3BDVA 1JT2A 2WM2A 1ZI9A 1XZGA 2WLSA 4BP8A 1FSSA 3EQ8A 1HL7A 1L7AA 1QJ4A 3QITA 3ZLUA 3QPAA 3IUNA 4L72A 2WILA 4X85A 2EEPA 3OC0A 1EB9A 3GUUA 2HADA 4G8BA 5FLKA 3ANTA 1N8SA 5EGNA 1UWCA 4Y2VA 1H2ZA 2PU5A 1YASA 3G9XA 2WG0A 1XZKA 1H2WA 1JI3A 1IUOA 5JD5A 2HA6A 1P0QA 4AO6A 4FLEA 2BUAA 5AOCA 2OGTA 4X6UA 5EIHA 3HC7A 1RWQA 1A88A 2PPLA 2WU3A 4OSEA 4OUKX 4JH0A 3WL6A 1PFQA 3D2BA 2Z8XA 3QZUA 4H0CA 3ZLVA 1X70A 3PI6A 4BDSA 1CLEA 1QGED 5DNUA 2AJ8A 2XQFA 2LIPA 1GT6A 2Y6VA 4ZREA 3D2CA 4WCVA 2WJ6A 4D9JA 3LIPA 2Z3ZA 4W1SA 5ALGA 5DYWA 4E11A 4AO7A 1DQYA 1ODTC 2E3JA 4BCCA 3C43A 4RE6A 4IHAA 3IUMA 5AK6A 5JZSA 2XMSA 5DLPA 3V1NA 4QWWA 1EK2A 2OG1A 1E8MA 2HFJA 2VAXA 2DR0A 5IH7A 2XB6A 4BTLA 1HLGA 2AJDA 3HLKA 5HCUA 3WKAA 4MQMA 2PKYX 1QONA 5A7GA 4QE3A 2XLBA 4N8SA 5HK9A 2DSNA 1VZ3A 4J7AA 1Q83A 1LPBB 5HFAA 3F67A 3M83A 3WL5A 4WDQA 5I8PA 4A23A 5K3DA 3WA6A 5T4HA 3RKSA 3T4UA 4C4ZA 3H17A 1VJ5A 3VXKA 1B6GA 2WU4A 4ROTA 1BEZA 3AZQA 1XZIA 4H7KA 1CVLA 4HS9A 4I4CA 2B20A 5E4JA 3PF8A 4QDTA 3RARA 4QLAA 2VQ6A 4Q3KA 4G4GA 3IVMA 4B85A 4HZGA 5AM5A 4XVCA 4UFNA 3JW8A 4OB7A 4B0PA 2V98A 4JYMA 1YCDA 4P92A 1XQXA 3E1GA 4Y2QA 2VJCA 4DTCA 3AIOA 1ACLA 3VVLA 2ZYRA 3W2TA 2XT0A 3GELA 2QJRA 4LXIA 1QZ3A 1YA4A 2HA2A 4UHBA 4FWBA 3RLIA 3OURA 1AMNA 4XWGA 1Q0RA 1BCSA 1TCBA 1WOMA 4B83A 1CUEA 3B5EA 1XQYA 3D4LA 3RK4A 4KE7A 1CPYA 4PNZA 5AI8A 4KAFA 2PX6A 3FCYA 1XZCA 4AMYA 1FFAA 2C0PA 1ORWA 3E3AA 3ED1A 5K3FA 4ITVA 1GKLA 3I1YA 4OPMA 4WY8A 5AM0A 1CUCA 2I03A 1SCKA 4QDUA 2HL6A 5DWDA 1XROA 3AJAA 1G66A 3L1JA 3T52A 3FLEA 3HABA 5KBYA 2VA9A 1MO2A 1XRRA 4Y2UA 5ALUA 1HQDA 2OCGA 4BCBA 2QZPA 1XZAA 1JJBA 2WUEA 1CIJA 4RGYA 3ESAA 5KWIA 5LLSA 2QRUA 4U2EA 3C6ZA 1QIMA 5CT6A 1BU8A 1XLWA 3DYVA 2O7VA 3ANSA 3H2IA 4Q3LA 4ZWNA 2QKYA 1ZJ4A 5HQ3A 2ZYHA 1I6WA 1LBTA 4C6HA 3R40A 2D0DA 4ARAA 1EH5A 1GQSA 4K5QA 2NW6A 3HI4A 2CEKA 4FFVA 3G0BA 2X76A 2XMRA 4A5SA 1F6WA 1BN6A 5CT4A 1O6GA 3B3QA 1GPKA 2DQYA 2ORYA 1N5MA 2HA3A 4KAJA 3I2IA 4OYYA 3EF3A 2VAVA 3FOBA 4X94A 3DEAA 3MGAA 3JYHA 2BJHA 3V1KA 2WSLA 2C5FA 1QIGA 3NGMA 1XZFA 1XZJA 2K2QB 4FBMA 2Z3WA 2XQGA 3QMWA 2ZSIA 1MPXA 1UZAA 2IX9A 5LZ4A 3WZLA 2YXPX 5ALHA 3IIIA 1A8SA 2ZJ6A 5JD4A 4OB8A 3C5VA 4H7EA 1P0PA 1MX1A 5CRIA 3HSSA 4P08A 3G9ZA 4H35A 4C4YA 1J1IA 5I7UA 1CUGA 4J0DA 5J3JA 5A71A 1U8EA 4DLNA 2CMFA 4Y2YA 5AJHA 1N1MA 2XLCA 1ZIYA 2O2HA 3LIIA 3QMVA 1QFMA 1TRHA 4UUQA 1VA5A 3BF7A 2OCIA 3IB3A 1LPOA 3WK9A 3NOXA 3C8HA 5D6OA 4M0MA 2DCMA 5AIAA 2WJ4A 1O6FA 3E4DA 1QO9A 3A2MA 2WHPB 5EHNA 3I2HA 1L7RA 4B81A 3N2ZB 4GWLA 4GBGA 2GZSA 3C45A 4Y2PA 3HEAA 1BE0A 3CXUA 1B41A 5JZ9A 4X7BA 3FVTA 4RE5A 3D0KA 4BCDA 1C7IA 3H04A 5JASA 1CUXA 3FYUB 2GYUA 5JZBA 2PSJA 1VKHA 1VXOA 1AZWA 3ESDA 3VVMA 5FXMA 4EHBA 1W1IA 3KD2A 3D3NA 1LGYA 4FKBA 4G8CA 2AJBA 2WHPA 2XMDA 2BGNA 3FNBA 3R3VA 3MUNA 4GI1A 5K3FB 1IMJA 3OG9A 1THTA 5JYCA 1XZEA 2RAUA 1SCQA 4TGLA 5D3KA 1MN6A 3PUHA 5KWJA 2WUGA 5HQ3B 3IUQA 1R9NA 1BN7A 5ALIA 3ZPXA 3DLTA 5C8ZA 5AK4A 4KEAA 1CRLA 3KDAA 1UK7A 5EHQA 1EA5A 4B82A 1EDBA 2WHQA 1JMKC 2HM7A 4C89A 3STUA 5BOVA 1LPAB 2VATA 3HZOA 4CCYA 4WFKA 2J3DA 1OCEA 1X2BA 3I28A 2OGSA 3R3UA 2H7YA 4G4IA 1VOTA 2BUCA 4QLOA 1W4LA 4KE9A 5D7BA 1LPMA 3IULA 5CXUA 4F60A 1PV1A 4X71A 3SWWA 4BB0A 4Q34A 5C7YA 4ZXFA 4INZA 3CN7A 4HXFB 5FRDA 5K3AA 4CCYB 5CT5A 1HBJA 2PU7A 5AKYA 3VKFA 4YX9A 3WK6A 1KEZA 4J03A 1AKNA 4DMKA 1QE3A 3H19A 5JD6A 4CFSA 2AXEA 6YASA 4B9AA 3G9TA 5K3CA 5AKJA 3W04A 2JGIA 1CQWA 3U1TA 4P9NA 1CUAA 1AGYA 2G5PA 1F0PA 4HVTA 2BCEA 3O95A 4PSCA 1EI9A 2O2IA 3M81A 3BXPA 5LKRA 1X2EA 1QTRA 3DCNA 1MJ5A 1YA8A 1QIKA 3OM8A 1CEXA 1N5RA 3CCBA 3K2IA 1WM1A 3WK8A 2UZ0A 3GROA 3RM3A 4AMZA 5HZGA 4B84A 4DNOA 5AKHA 5CH3A 3V1LA 2HU5A 4PO3X 4U2CA 3O4HA 1UT6A 2H7CA 1G42A 1FFBA 4Y2RA 4CG3A 3WKDA 4ZI5A 3WMRA 3O4IA 1JFRA 4X91A 5HFNA 2VF2A 1JMYA 3QPCA 4DM7A 5E4YA 5K3EA 1D07A 1R88A 4L0CA 1E3QA 4I3FA 3SK0A 1OXMA 3NWOA 1BEEA 2OQVA 4P93A 2GZRA 5ALXA 4W9RA 2AJLI 1EHYA 4K2AA 2R8BA 2RHWA 1XQVA 5EIEA 5HKBA 4EBBA 5CBKA 1TQHA 2OGZA 5HK8A 4M0EA 5CTAA 5FV4A 5AM1A 2O2GA 5CH5A 1EINA 2VSQA 3ILSA 5AM3A 2Y1KA 3WIBA 4UFPA 4WY5A 4GECA 5DTIA 2CKMA 4KE6A 3SX4A 3D59A 3A70A 3BF8A 1A8UA 5ALPA 2GBGA 1K63A 5ALZA 1KU0A 1VE7A 5BWCA 4UBOA 4X00A 1CUYA 1XZBA 3KWFA 3R0VA 2WTNA 4UPDA 2XUOA 1IUPA 4Q1VA 5JANA 2HA0A 1ORVA 3G7NA 1CUUA 3CN9A 4G1FA 4I19A 3DL7A 2OAGA 1QIIA 1ODCA 4BAUA 3WJ1A 4EY8A 2VT7A 4K6GA 4BTVA 3STYA 1MTZA 5K5EA 1NU8A 1DX6A 2XDWA 1QO7A 4KYVA 2XMBA 4B0OA 2QOEA 4ETWA 3WKEA 5C8XA 3WKCA 1ZD3A 2YH2A 1DX4A 3WWCA 3B12A 3LS2A 4X6XA 3STWA 1LPPA 2IITA 4AX4A 2GBIA 4BAZA 4Q82A 2QS9A 3DKRA 2VJAA 3KWJA 2XUPA 1CUFA 1TIBA 4X95A 5JAUA 3C6YA 1IZ8A 3C70A 3OPMA 5LYYA 1YS1X 2QT9A 2QVBA 3WLAA 1H2YA 3D5EA 3DNMA 3IDAA 4J0GA 1QIEA 2PSHA 3VJMA 1F0NA 1QOZA 4BZZA 2WG2A 5AI6A 5LZ2A 4XIIA 3R3YA 1EDEA 4FLMA 1UOOA 4BVLA 1WCYA 2FUKA 5E2IA 5JAHA 4BZWA 4K6HA 1MAHA 5I9IA 4H77A 3K9BA 4CG1A 2QUBA 1SC9A 2XMCA 5AIBA 1W76A 5DTJA 4B6GA 1FFDA 3O9VA 3C87A 1YB6A 3I1IA 1XRLA 3UMJA 5FOQA 2GBFA 1VXRA 3PFCA 1LPSA 3FLAA 2DHDA 3QBJA 3M82A 4AN1A 4DNQA 3BJRA 3WZMA 3WWOA 2ZJ7A 2WTMA 2WUFA 3MUOA 1LZLA 3H18A 4U2BA 2DHEA 1JU3A 4PV7A 3QPDA 4EB0A 1R50A 2XUDA 1AX9A 4BRSA 5BWBA 5CT8A 3H1AA 2Z8ZA 2HA4A 3AIMA 4OB6A 1LLFA 2RIPA 3BDIA 2C0QA 3VISA 4N8EA 3ZI7A 4LHEA 4UBJA 4UBKA 3QM1A 1UKBA 2W22A 3I2KA 1CV2A 5AI5A 3DJYA 2JGMA 1FFCA 3F9CA 2OCLA 2XMQA 5LZ7A 5ALYA 2HU8A 5ALWA 2ECFA 4AZ0A 4L9AA 3DKKA 3I6MA 1TAHA 4NS4A 3WWEA 5AOBA 2HIHA 3BE8A 1ZI6A 2ZVDA 5ALQA 2RI6A 4DMCA 4J0CA 4RPCA 1JJIA 3W06A 4H7HA 4IO0A 2YASA 3F98A 3P2MA 3G02A 3IBTA 1Y7HA 2XUIA 1K8QA 5KREA 2HHAA 2P8SA 1ETHA 5LP1A 4AB1A 4BDTA 4UHEA 3QMMA 4HXEB 4KJXA 5AM4A 4EY4A 5ALDA 4XX1A 5DNWA 4YPVA 5CXXA 3WYNA 4AQDA 4QDXA 1JJFA 4QZVA 3FWHA 3W9UA 3WK7A 1BS9A 5FP0A 3AIKA 5AH0A 5AKZA 3O0DA 4UBIA 5YASA 4EA6A 1QIFA 4X6YA 2J4CA 3D7RA 1QIHA 2CJPA 1EVQA 4Y2XA 2BUBA 2ONCA 3GFFA 5HF5A 1PJAA 1DWPA 1UKCA 3TEJA 1VA4A 1J2EA 1ODSA 3OTQA 5A7HA 1J06A 4GHWA 2PSFA 4L3WA 1J07A 1DT5A 4CIBA 2ZYSA 3DYIA 1H22A 1RYYA 1CUVA 2WHRA 1CUJA 1EDDA 5ALEA 5K3BA 3H1BA 4WFIA 3HXKA 3G0CA 5CW2A 2C5GA 1EK1A 3DOHA 4KACA 2BGRA 1E8NA 3I2JA 1CUSA 1VLQA 3TJMA 1WB5A 2Y6UA 4QEKA 1AQLA 3WIOA 3Q0TA 1DQZA 1P0IA 2W6CX 5ALVA 2C7BA 3AILA 4MEAA 4X3CA 2R11A 1ZD2P 2JBWA 3CCCA 3H0CA 3WJ2A 2CB9A 4K6KA 1U2EA 1W75A 1E5TA 3K6KA 3N0TA 4Q3OA 4GW3A 4KRXA 4UBNA 1LZKA 4LYDA 1GXSA 3C6BA 1HKHA 4OU4A 1H2XA 3R3ZA 1TCCA 2I3ZA 5C81A 2VEOA 2PSEA 4E46A 1MT3A 3E0XA 3AUKA 5A62A 1SOMA 3DQZA 3PUIA 2X8BA 5A2GA 4ZV7A 2FJPA 3F96A 2HFKA 5ALFA 3G0IA 2H1IA 1DWOA 5AI0A 4IQ4A 2XUGA 4N5HX 4B7ZA 5AO9A 1CUZA 3VJLA 2FJ0A 5FPQA 3FAKA 3ESBA 4NMWA 1K6EA 4QDOA 2WIDA 1UFOA 1K4YA 4J3JA 1GGVA 4GXNA 3WK5A 1GPLA 3ZLTA 4CG2A 1CUDA 4U2FA 1ZJ5A 5JARA 4MYSA 5F4ZA 5ESRA 2JGJA 4IH4A 4BVJA 1H23A 1T2NA 4LXHA 3QVMA 2OAEA 1GQRA 2XUFA 2I78A 2VT6A 4EY6A 1ZICA 4HRXA 1UK6A 2WIGA 3FVRA 4V2IA 2BAGA 2JGFA 4JYPA 1L7QA 1BRTA 1QIJA 4PW0A 1DINA 1GKKA 3Q8WA 5LKAA 3HACA 1C7JA 4W1RA 2DHCA 4QDZA 1U65A 2GBCA 4PQEA 1BCRA 2XUJA 1QIDA 4CI9A 5JAOA 3FYUC 4MEBA 3S2ZA 1BROA 1CUWA 4DSAA 1XRQA 3A2NA 5ALOA 1E66A 1Y7IA 1CUHA 2PSDA 2XUQA 2X5XA 3WQHA 2WIFA 3ESCA 3WKBA 1HPLA 1UK9A 2D5LA 1SFRA 3AZPA 2GYWA 3W05A 2XUKA 3ZV7A 2YYSA 4MWSA 5EIAA 4EZIA 5ALSA 5ALMA 4ZRDA 4UHCA 2C58A 4W63A 3YASA 5T4EA 3WA7A 5D3ZA 4C4XA 2PM8A 5HKAA 4H7IA 5AKIA 4NVRA 3GZJA 1THGA 2PUHA 4S0XA 3U0VA 2CBGA 2H9YA 1XLUA 4EUSA 3L1HA 1GZ7A 3EQ9A 2GYVA 1CUIA 4KR0A 4BC1A 5ALKA 4GLBA 2WFZA 5A7FA 1DU4A 4UBLA 1TK3A 4F0JA 1MNQA 2OQIA 1AC5A 3KXPA 1AURA 5JADA 3TRDA 2XQIA 2HRQA 2VTVA 1VZ2A 4Y2JA 1YB7A 2XE4A 5AI4A 3I6YA 4EY7A 4BATA 1QTIA 3VDXA 5ALRA 4FFWA 2B61A 3FSGA 2WG1A 5DNVA 4DNPA 5AOAA 2Q0XA 4GDMA 3GBSA 1IZ7A 1YR2A 3FLBA 2ACKA 1UXOA 3JWEA 1WB6A 1XZMA 2OLEA 4Y7DA 5T4FA 4JEIA 1XKLA 4J0HA 1RP1A 2B9VA 1UOQA 3IURA 4B80A 2B4KA 3G9UA 3KSRA 1MU0A 5FPPA 1R1DA 3W9BA 2WFLB 4W1QA 5CMLA 4UHFA 5CH8A 5IKXA 3STXA 4YK7A 4YASA 4QA9A 1M33A 4OU5A 3ICVA 4LIPD 4FLFA 2J3QA 1EB8A 3SC2A 5E4TA 5IVKA 3H2JA 2WQZA 3H2GA 1XRNA 3O4JA 1LPNA 2V9ZA 1R3DA 2QR5A 2XI4A 1CQZA 4DGQA 1P0MA 4GEGA 4MXDA 4XJVA 1LBSA 3C8DA 2CUTA 4H7FA 1ZD5A 1XZHA 5ALJA 3BIWA 4LKOA 5AKLA 3FCXA 1XLVA 3X3HA 1IVYA 3I2GA 4AO8A 4N5IX 1ZI8A 2FX5A 2Y2UA 3R3XA 4X92A 1AUOA 2JEZA 4KAAA
chains in the Genus database with same CATH superfamily
3D31A 3PQ2A 3RG8A 2VNAA 1WB4A 4EYGA 3TRFA 2ZYVX 1FEZA 4GAEA 2JKZA 3L7LA 5JCXA 1TCAA 2I62A 2GM4A 2IFTA 4IEEA 3FRJA 4WDRA 5I01A 3K0SA 1OBCA 1OUMA 3I9V6 4QODA 2I4TA 2QSJA 4QXAA 4CQMD 4GI7A 2RCYA 5J1TB 3ISJA 3KELA 4TXNA 4XOUA 2ESRA 5THKA 1QBGA 2PVSA 1ST3A 3BL8A 1N5OX 3DAPA 3FTCA 4I5IA 4MICA 4PO9A 3AL2A 4D8UA 2DQZA 3FDZA 4ZD6A 5KQMA 1E98A 5ERYA 4GDFA 1II9A 3MWFA 1P7VA 1OH6A 4QPNA 1VPDA 2DPMA 4IH9A 2WWIA 4IXMA 4EI2A 1C9KA 4C05A 4OHOA 1NXPA 5JCOC 2D0PB 2Y0PA 1M6NA 2PYZA 2QTBA 1W5EA 4U5QA 3KLMX 3OM1A 1W59A 3GP3A 1DEOA 2RG1A 1OXVA 1ADCA 4KLCA 1E8DA 2A1TR 4QOFA 4BN4A 5G1NA 1FA9A 2NZWA 5FKJA 4RF3A 4BVKA 1JDSA 4EHIA 2JIMA 2E48A 2VHVA 1RWMA 3BC1A 3BWEA 1DP4A 4GP9A 3QBEA 4DA9A 3OQOA 4GPD1 1S02A 2B5OA 4B43A 1CNMA 1D4OA 4D4MA 2Q28A 2OV8A 1T4DA 4K3VA 1QG6A 1KRHA 1XQ1A 4II3A 3TSOA 2Q99A 2ZR0A 4IFTA 3QYJA 3BGIA 3BEOA 1XNHA 2AR9A 4MPPA 1VIYA 3JAMA 2P4UA 2G40A 1CEYA 3V2GA 1XMOB 2C31A 2H7XA 4TM8A 1XFDA 5AKXA 3EC7A 3IOEA 3U4QB 3O8QA 1N8TA 2OZPA 5F2KA 1NBOA 1T13A 5KZMB 1SUAA 1PNVA 1V35A 3DG9A 4Q5IA 2V7GA 2CZCA 5DGHA 3RSQA 5IRCD 1EP3B 1SN7A 2JFYA 2QRZA 2EZTA 1WAMA 3GWZA 3SDSA 1Z5ZA 4M83A 4ABYA 1N5JA 3T5BA 3U4AA 1OJLA 2IK8A 3B36A 3GL9A 4G0XA 2BKUA 1Q1AA 2ES4A 4O5AA 4I9NA 4P4TA 3EXFB 4ES6A 4RSGA 3WLTA 5HVNA 2GEDA 1EFLA 3RBAA 2KBFA 3SZGA 1OU4A 3WQBA 4OP3A 4AF7A 2TYSB 1C3VA 4GP7A 4AG5A 5M29A 2Z0MA 2BKXA 3JALA 2IV7A 5MGBA 1EMDA 2CXOA 2RGBA 3B89A 4QXQA 1AY0A 3BFXA 4FP9A 5TGDA 4ND4A 1QAOA 3DZFA 3EOBI 4X1KA 4KQKA 2OE2A 4CCWA 10MHA 2QQFA 4M46A 1JR3E 1T4GA 4FFRA 3FGZA 1UAAA 3EPRA 5ICEA 4GKBA 1C8LA 5AW9A 4PE5B 2RGWA 2NZJA 3K92A 5FL7A 3OICA 3L5KA 1PVOA 3GJ6A 3ASVA 4YA6A 1KRWA 4WJLA 2ZUUA 1WR8A 2HIGA 2Y9PB 3C7CB 5EHGA 1X1DA 4IXDA 2ADFA 1P5HA 4K26A 1R8QA 3U3JA 4W6QA 1F0KA 1NX6A 1NXQA 3PYMA 3NHZA 1U9JA 1P1JA 3Q15C 1AK9A 3VHXA 5AK3A 5HF8A 1FVFA 5KOYA 3CGWA 1GNTA 4B6RA 4X7RA 4JQYA 3PNOA 2Q29A 4L74A 4DT1B 1EUYA 1YC2A 2NWQA 3A3OA 4K0KB 4QUAA 2C54A 3UK7A 3MRXA 4BEVA 4HLUA 5AM2A 5L8VA 4D25A 4MV8A 2WV7A 3HGQA 3S2SA 5BO5A 4ARVA 3ABQB 3ZGNA 2V7VA 4J0IA 4RMHA 5TPZD 4BMDA 1XZQA 3AQ4A 4RA6A 3VO1A 4X24A 4HDQB 3RYIA 4BXOA 4UTOA 3EBOA 3G8YA 2JLVA 4PFSA 3TS1A 3BIXA 2KB0A 3WYEA 4IZIA 5L4LA 2PKEA 1YI8A 4E03A 3U7QB 1UINA 3MLBA 3HUFA 2O0JA 1E3JA 1GPAA 1NC1A 2P68A 3EY4A 4LJYA 4UM9D 2RHRA 2AL7A 4MAAA 1C3OA 2X9VA 4MR8A 1UJ2A 5G41A 1UANA 3LXRA 3WGYA 2QT0A 4WOCA 2P6MA 4A6PA 5LQAA 1JPNA 4TMTA 3OC6A 1N8KA 5FDFA 2A5JA 3MWDB 3D64A 4O2LA 3IKLA 3H11B 3PP8A 4Q21A 3WWPA 1FUIA 2MYUA 3GQBB 3RABA 2ETXA 2JGDA 4ANFA 2Q0HA 1XAIA 2R6ZA 4Y1RA 2YKGA 2B3TA 3RHTA 1KMMA 3TWOA 4C4RA 1RBQA 1V1MA 1YL7A 1PT9A 3CZAA 4IMRA 2V03A 3K9LA 1WPXA 1XTKA 2XUHA 3LQKA 4NOJA 4Z53A 4UDOA 3G5UA 2KI5A 4MDHA 1QYRA 1GNVA 2XMZA 3BM5A 2X0DA 5FUBA 3L0IB 3FMGA 2WFLA 3D8UA 1LVHA 2YV1A 3TX6A 1DJPA 2Q21A 1RJEA 1GZSA 5FT9A 3V1UA 1TU4A 1OT3A 1Q7EA 3GAAA 4IHKA 2P9CA 2DQ4A 3QKRA 3M3DA 2V3VA 3VR4A 3ZZ0A 4EPTA 4CEHA 3E7FA 4EQ6B 1T8YA 4B7CA 1Q22A 1AGNA 2QM0A 1YKGA 2R2GA 3TQQA 5JCPA 2I66A 2EXXA 5CM9C 1TVCA 4MIKA 4US1R 2VQEB 2PZGA 1N0VC 1TYZA 3DVQX 2ZSKA 3PYLA 4TL7A 5FPTA 4ERNA 2YINC 2AG5A 2PGXA 3FCUB 2JVKA 1HNNA 1Y3AA 2WOJA 2PRJA 3UOGA 1N6OA 2UVPB 3CWZA 1T9BA 1F4VA 4TTAA 5DASA 1VSQA 1U28C 4KXYA 4EVRA 3RS7A 4JVOA 2LCIA 4HF7A 3LTNC 2BHLA 1D1TA 2PFGA 1YVEI 1C0EA 4YJDA 1V3QE 4LV8B 4GMKA 3CB4A 2HWKA 2HJGA 3CRZA 4WNAB 1NTRA 2A9KA 1J00A 3H99A 1GKIA 2XOXA 3QFFA 4L51A 5JMTA 3G82C 1HQYE 3OZDA 4DDUA 4DCTA 4XX0A 1O96A 5JSUA 2CV2A 1EP2B 1UMBB 4F2GA 5AW6A 3VPBA 5JC8A 2FW0A 3R6LA 5BYJA 3T7TA 3L0PA 4C0XA 1RI4A 2WD9A 3CE6A 3F6EX 1ISIA 2CD9A 2IZ1A 3ETEA 3OF3A 4MRMA 2H5EA 3R75A 1U1GA 3WFJA 1HDGO 1VE9A 2I7VA 3BH7A 4PHGA 1XD8A 1YK1A 3LWBA 1KMHA 1KZ4A 3CGGA 3LVQE 1XE3A 1HL3A 2HU7A 4MKZA 5EYPB 3NHPA 1JG6A 3Q40A 1XO1A 4BMZA 1E2LA 3MUFA 3HBJA 3HR4A 4GT1A 3KT6A 3LM8A 1KS2A 1UIMA 1ZH0A 3D4IA 3G89A 4G2NA 5J63A 1HE2A 4WZAE 4JHLA 3RIGA 2WIJA 2AWOA 4C76A 3FUVA 1M75A 1QGZA 4EJSA 5DGIA 5JSYA 4WLNA 3LUPA 4ZOEA 2YS6A 3V42A 3G8AA 1Q0ZA 2EKLA 2GPYA 3FNRA 1S3IA 4ZT2A 3SSMA 2BP7B 4H0NA 3GPCA 1UC8A 3SYRA 3E3LA 1MC8A 1MX9A 4ALLA 1L4KA 4Z7NB 5JI2E 4TYNA 3LVRE 5TJHA 3I01M 4R9NA 1DE0A 1B76A 1XZLA 3BX1A 4FFLA 3EQ2A 3RK1A 1VMAA 2PT7A 4FI3C 3WAKA 1MPTA 5EXXA 3SHVA 2JLRA 2XNKA 5JHHB 2WP0A 5I4KA 1E2DA 1JU4A 4AUMA 2GEVA 1QCCA 1GPNA 5LMNB 4MGEA 3MN1A 4A03A 1VIMA 2OM2A 3A6ZA 3OQ1A 3IQXA 3M5PA 1Y3CE 2ZYIA 1IWOA 1G3IA 3LLVA 1R37A 1S8OA 2V6IA 4IZOA 1WWKA 3G1UA 2XQJA 4S35A 1YTUA 4BKUA 4HY3A 4IUDS 1EUDB 3PNQA 4G23A 3ZLBA 1M6WA 3RADC 2QRLA 5B4TA 1PCXA 2YIJA 3A06A 4ZVOA 4B44A 1QFYA 1NNSA 1CTQA 2Z5GA 4K28A 2IPLA 4Q1BA 2IZOA 4KKXB 2NVUB 3VBCA 1RYZA 3D3QA 4O4LF 4Q9IA 5BW4A 5KTRA 4PR3A 1W85A 4M0FA 4LNHA 3AHFA 4YJGB 4JHXA 2W48A 5F5LA 2D1SA 1MB9A 3ZDRA 3JS5A 3UHAA 2HLDA 1U3CA 1DARA 4XFKA 2VS1A 4IILA 3D6NB 4J49A 4NEHB 3T7JA 3C3XA 4JS0A 1I4DD 4UVHA 2D1FA 5P8WA 3I5XA 2CL5A 4V1CB 3ONEA 2DWPA 3RRFA 3WP1B 3N5KA 2GGSA 2X4GA 1SVMA 1WW2A 3CKMA 3IE0A 3OMLA 1KYZA 4MUMA 5I48A 1TIKA 1KEKA 1DKUA 2PD4A 3IBSA 3L8MA 3N8GA 5UKDA 2QZ4A 3JZMA 4ZOCA 5JYDA 2O8EA 1NNEA 4U2DA 2GPNA 5CIQA 1LI5A 1OZ0A 1DCKA 3GA7A 4ND7A 2Y2VA 1W52X 4NMMA 4B3GA 5KWSA 2ODPA 3CZPA 1D2HA 2D4HA 5FI5A 4ASUD 5JQGF 4RYLA 4NIMA 2XX3A 4FHZA 1KIFA 1C3OB 3B2QA 3OPNA 1MAWA 1UJBA 2HY7A 1LQUA 3AR6A 3JYLA 4GGMX 3LLMA 3ISTA 1NMEA 2J67A 4YRJA 4G8DA 1H3EA 2H5IA 3GJ4A 4B2LA 4G0WA 1PEDA 2UZ1B 4XSGA 5CW1A 4DIEA 4OEHA 2G9ZA 4HAIA 2B0JA 5EEHA 5LB4A 1E7MA 3V8PA 3ZD8A 1GFIA 3A37A 3QFRA 3WNDA 4Q4CA 2FR8C 4OFWA 2PX5A 5ENDA 3PXUA 1HORA 4DYDA 3OQNA 3DT8A 2OA0A 1CZLA 1FP6A 3PFGA 1DAOA 2IC5A 4HTAA 4YJ2F 1OTHA 3QF4A 1R8XA 1RLMA 1FX1A 1CU1A 3X1KA 1HT3A 5HF9A 1EE9A 1YHYA 3VSEA 1TCUA 3PK0A 2J3KA 3VR2A 3WRYC 2VDWA 4GLJA 1XHEA 1TXGA 3FHLA 2WK1A 4DE5A 5FBRB 3AIIA 4JUCA 4N7MA 4YUYA 2XSZA 1KJZA 4P84A 4M8NE 1PJ4A 3GVXA 1BJTA 2A58A 2H06A 1DOZA 3AEUB 3EEQA 4ONEA 1QKKA 3LHFA 1FFHA 4KQ6A 3SJZA 4DSZA 1B42A 1DWQA 2XYRA 1A7UA 4TWIA 2J1LA 1NZFA 2WUDA 3B48A 4PYMA 1CFJA 4I7EA 1E0KA 3C3YA 3FFXA 4PGMA 1O6CA 1WDKA 4D9EA 4BNHA 5LU9A 2W2KA 4KCGA 3A4MA 3M0EA 4R2WA 2DQSA 4MHTA 2GN4A 3D6TB 4IIJF 3U3DA 5IVDA 2RHHA 2DH5A 1UBKS 1WG8A 2BTQB 3BRWA 2XUZA 3W5AA 5BN1A 4TYPA 2OCAA 3A1CA 2NACA 3QEJA 3U7EB 5AHXA 1Y7LA 3RV3A 2O59A 4M2LA 1NSFA 1NV9A 3BE4A 3DMDA 1PFKA 3BB3A 1MB0A 1RKUA 2GWRA 4JLVA 4C0HA 2HMWA 1NRJB 3DBRB 4IFEA 1UODA 2BFFA 1GTMA 3FPGA 1Z4IA 3MSCA 2VPIA 4KE8A 1DVRA 3C6MA 4LUCA 4XUEA 4F4FA 1EU1A 1RQPA 2XOKA 16PKA 1DC4A 1FNNA 1SB9A 2BFDA 2UYYA 3NDPA 1P4JA 3QYFA 4MJ3A 4QT0A 4MJ7A 3DKIA 3QPBA 5EPOA 1DJOA 3U7QA 2ZAYA 5EI5A 2V7PA 3QWFA 3GPIA 1X1EA 2QA5A 4B35A 2A9VA 2WKRA 1NMYA 3JWGA 5LIPA 3HLTA 2G9UA 3NJRA 4QYWA 4RVOA 1P7YA 3MJSA 4RA6B 1O5OA 5HF6A 2PUJA 1BW9B 4ENWA 3UQYS 1N1EA 4R01A 1UDRA 1P17A 2VHQA 3AGQA 3KPYA 2WD8A 4M53A 3TLAA 4BLWA 2BH9A 1KU6A 3O73A 3ZK7A 4C7XA 2VP9A 2WJZB 1F8UA 3LWZA 3OOSA 2IH5A 2P5UA 3CF4A 2A0XA 3B3FA 3C0KA 1XEWY 4FJ1A 2C2BA 4RYDA 4FJ0A 4TLEA 1P4AA 5CPFA 3UXHA 2W9XA 2HHLA 3PQ8A 4MMXB 2HV8A 2IYAA 3L4BC 4LGVA 4ZAVA 3ZD9A 4BO5A 4RLFA 2GKSA 3BWBA 1BHJA 4C1BA 3FSEA 3OKAA 1W0KD 2FSHA 2VQDA 1NXTA 1R4ZA 3JAWB 2QVCA 3PNSA 4RJIA 2CZQA 3FETA 3U19A 3PNMA 3UMBA 3PDIA 1Z0AA 4YIHA 2DETA 2XHEA 2CFIA 2QUZA 2WQ6A 1TVMA 1LDMA 3ICEA 3TQTA 2IBTA 2WJWA 2FKNA 2BFCA 3GU3A 1APBA 4XSVA 3VAYA 4AFNA 4DUZB 1F7VA 3QENA 4O2AB 1J24A 3MFYA 3N76A 1Y0BA 3WWDA 2PO5A 2OHFA 3A2LA 2PL5A 5AVOA 3TVYA 1SGWA 2XRFA 4L8WB 1J97A 3BN3A 2WM2A 1JAHA 4D57A 1ZI9A 1RSZA 3RSCA 5IJAA 1OI2A 1MW8X 3ROZA 1ZGZA 3PXCX 4ZZ0A 2QN3A 1AUPA 2I99A 1R4NA 3PXGA 5D51S 2I87A 2A84A 3BMCA 4NJMA 4BGDA 1DXHA 1ONBA 2FN3A 2GPJA 3JSXA 4AX8A 1E32A 3F9IA 3U0BA 2Q0SA 1RHUA 4G26A 4C0AC 1SRRA 4K1XA 2JIZA 1ICEA 1L7AA 2Z83A 3ZLUA 1J33A 3OETA 1O9GA 3RVPA 4ADSG 3KTDA 3AHCA 1T8SA 4ZOLA 2WILA 2GFQA 3SYNA 4I4TB 1LNZA 2EEPA 3MMXA 5B5SA 1T3LA 2RH5A 3NGXA 4HNGA 2MYPA 5A04A 2H4HA 3DF7A 2FG6C 1U7WA 3A8TA 3KUUA 4G8BA 5FLKA 3U16A 3K30A 1N8SA 1JPUA 1NQTA 5EJ5A 5CB4B 3CRMA 1TU3A 3KQQA 5IXSA 3H87A 3CTPA 3Q7TA 5EJIA 3RNOA 1Y4DE 4CKBB 3EZFA 5AVVA 4EW3A 5F64A 1MENA 3G9XA 4D3DA 1KI8A 1PR0A 1F14A 4QG7A 5DP2A 2ID8A 1TQDA 2ORED 5FBZA 5IBQA 1ZVVA 2FWIA 3R3SA 3OZ7A 3UK0A 4CLOA 4WFQA 3T0FA 2B36A 2ZBRA 1E9EA 2O23A 1SZPA 1X19A 2ZAOA 1MR3F 3CX8A 5EYPA 5HILA 3FLMA 3K1AB 4OIFA 2X2OA 2IHVA 4JOCA 5AOCA 1TM3E 3HFJA 4RPHA 4QKQA 1NRXA 5EIHA 1FMJA 1Z2PX 3BD9A 4WXHA 4YB8A 5KTNA 3AVYA 3EULA 4QGAA 4NCJA 4FZRA 1EWKA 2OP0A 1B6RA 2VR1A 4HQLA 4O2BB 5G02A 3HVRA 4OHXA 3ZW9A 2FTKE 4OXRA 1O95A 1SQ5A 4OVKA 4RH1A 3Q9LA 5LUBA 1L1FA 5AVXA 4Q9HA 4B2YA 2QRGA 4C5AA 2W4QA 2PH3A 2XVYA 5JO0A 2ZJYA 2R8YA 3QZUA 3GGPA 1Z33A 1NQAO 2KM1A 2PKRA 1NOIA 1Y1TA 2FX3A 2Q5QA 1H5QA 2YY6A 1JEQB 3L4SO 4HH3C 4PAMA 1OI3A 2FVYA 1QGED 3BBLA 3TAUA 5LM3A 4UREA 4JMLA 4CLDA 2DG2A 3AVXA 1MZPA 4L5CA 3D2CA 2YRWA 4QOHA 1YB4A 1RLOA 2E0IA 1CJMA 1LNQA 3W34A 3WB2A 5F7OA 1N0IA 2BM9A 4MS1A 4C78A 4HVCA 3UTCA 1DQYA 2EP5A 2W83A 5B7NA 3IOBA 3WADA 3OZAA 3INTA 4P0PB 3GLIE 4A82A 3MJHA 3C43A 5CYOA 1J2RA 1IBLB 2PUGA 1H9AA 4RWZA 4IIDA 4E5VA 5ADVA 1TUBA 1U6JA 1Y63A 2I4OA 4UJ5A 2XMSA 5FEMA 4CVNA 1Z4OA 1TD1A 4E2YA 4MAFA 3OCJA 1DIHA 2HLPA 1Y1RA 3QEBZ 1E60A 4EMUA 4RAQA 1Z5GA 5EP3A 1P75A 1VLLA 5ITSA 1A3CA 2HFJA 2VAXA 2DR0A 5DNCA 4URZR 3N58A 1H4TA 1V4NA 4BTLA 4GYKA 3SZRA 1SBCA 1RTTA 2FZWA 5FOTA 2A9JA 2AJDA 3DO6A 1ORIA 3PUVA 2JBAA 3W8EA 4R6WA 1ECCA 4H4DA 2O3SA 4GBMA 4PYKA 2Q62A 2HSWA 5DWVA 4JSYA 4NMHA 1IPEA 1H5NA 2Z2ZA 2FUEA 3UMFA 3UT6A 3ZI4A 1QAQA 4AULA 4D98A 2Z08A 4HEHA 2P2LA 3U3XA 3TTYA 2WW8A 4EEXA 4I1SA 1VZ3A 1NMSA 3CY6A 3WL4A 1PGJA 4RD0A 1W2WB 5FNVB 3GLKA 3IPYA 3WL5A 5LQJA 3L1UA 2NYVA 1A4RA 1WF6A 4WDQA 3VR5D 4BV8A 5DYNA 2AFHB 4A23A 3SBXA 4INJA 4DJDC 1C2TA 1DUSA 1KZ7B 3UA4A 4G3XA 1GUAA 1N6RA 1T0BA 4Q9AA 1TYBE 4IIGA 1NKTA 5LL6P 4KO2S 4O02B 4H31A 2D1TA 4GPAA 1Z4JA 5A1TA 3HN6A 1P80A 2I3GA 4C4ZA 4LC1A 1G8AA 4TS1A 1FRQA 2IT1A 3H97A 4ER7A 7REQB 1RZVA 2PUAA 4EGSA 4ZT3A 3VDXA 1ZGGA 1JZQA 1ZX1A 4DIBA 1BEZA 3U4DA 2WMYA 3PE4A 2FPPB 1X7ZB 1JYSA 3QFTA 1XZIA 2AA3A 1P61B 4JN6B 1PK9A 2AQ8A 4QYIB 1WJGA 4H6XA 1FF9A 3PF8A 4HAWA 3CPJB 3C3EA 2QP3A 4D80A 1F9AA 2R4TA 4D0GA 1Y1KE 5T8KC 1ZQ1A 1RLJA 5EJEA 1UBCA 3IVMA 2BIFA 2DWQA 4FYPA 4MS1B 5AM5A 1DL5A 2NN3C 1RXVA 4KSBA 4D5EA 5B53A 1Q0LA 1DV1A 2OO5C 1IEXA 1TNDA 2CDBA 3K0CA 4H17A 3DKPA 2FSFA 4JODA 2VP6A 1VIVA 4JX8A 1SM4A 5EIFA 3V97A 4TMYA 4M60A 4DG8A 2X1HA 2C5EA 4GH5A 1SD5A 4OM7A 5IDXA 1EXVA 4OB7A 4BEWA 5CLLA 2V98A 4B0PA 2H2DA 1KJQA 1LX7A 1O3YA 2D54A 4JIGA 4JYMA 1RWXA 4P0TA 4XD2A 1XQXA 5CDSA 1E1RA 4KYIB 1RC1A 3ELUA 4EW6A 3GDHA 2GZHA 3SJUA 4F5YA 3OJFA 5LMCA 4NE9A 2FEKA 1VCNA 1IATA 1MG5A 1X7HA 1DRJA 2EW1A 2QZSA 2ZT7A 4Q02A 1Y81A 3O75A 2XCUA 4D9HA 1GADO 2ZSUA 1OWMA 1YR1A 3I23A 3VVLA 4B48A 1PO7A 4ZO6A 1WQ1R 1X0XA 2NZYA 1GGHA 2WBLC 1T4CA 3W2TA 4C0LA 1FTQA 1ZW1A 3MQ4A 3SNKA 2XE7A 2J0QA 4LTMA 5A9RA 5HJEA 1GDHA 1USKA 2FFQA 3AHGA 3ESZA 4UHBA 4YP1A 5LPNA 2YV5A 3N8HA 3OURA 1AMNA 4KO1S 1EUCA 2E4AA 3W0LB 2IU4A 2QLBA 4H1WA 1BCSA 3S68A 2VXCA 5ADUS 4LX8A 3L7NA 1PQ4A 4Q15A 3B5EA 3S5JA 1HT0A 1XVTA 3RK4A 1WVIA 4AXXA 1XPRA 1CPYA 4JITA 4V0QA 1Z2EA 1K7SN 4LXXA 2J9FA 2CDRA 4CMCA 1E1YA 4RWEA 1FXWA 4W7IA 2ZPTX 3OZVA 4AMYA 1GQ2A 3KHUA 1U7ZA 4N41A 2KQUA 1NJ6A 4HAYA 4QOIA 1YU9A 1JF8A 1VP3A 3E3AA 4RQBA 3VNAA 4Y1EA 4N3GA 1KYWA 2RD2A 3L49A 1E59A 3D4NA 1TTPB 1XU4A 2FCRA 4G84A 1GKLA 5LOVB 1Y5NA 2HTEA 3I1YA 4JEMA 1Z13A 5C0OE 3VH3A 4B4OA 3GDOA 3ZDEA 2C3PA 2M6SA 3G6KA 4GMFA 3DZIA 3RVRA 5JS2A 1KQGA 3CRW1 3Q8MA 4QDUA 2O8FA 3UW3A 2VUHB 1YR7A 1XYGA 2D1QA 5I9NA 1FE8A 2V45A 5DIZA 1AKTA 2GAIA 1RMTA 2ZAMA 1KARA 5C34B 2HK8A 1E1LA 2HZBA 3QGMA 4MW1A 4QOJA 3SEFA 5AESA 1PNQA 1G66A 2ACVA 1W4BA 2CHGA 3KZMA 3DHWC 1SIOA 1VKJA 4BX0A 3FLEA 3HABA 3HM2A 1LH0A 5EJFA 3IEVA 2JKYA 1XNGA 2LP4Y 4Z3KA 3UH0A 4XYLA 3ZGOA 4YJGA 3QWBA 5ALUA 6GPBA 3HGMA 1TX4B 1HQDA 3FPJA 1D0IA 3IUSA 3UB2A 2QZPA 3N6RA 1JJBA 4TMXA 4ZU6X 3X1WA 2QY6A 3DVAA 1J39A 1XHLA 4RGYA 2CZGA 5LLSA 4EABA 5HE9A 5DE3A 1T4BA 3FUUA 3NBXX 2ZWPA 4U0KA 4JDUA 5F2NA 3DYVA 3SS9X 4BUZA 4K9QA 1IEQA 2QN7A 3I83A 4BMCA 2Y1FA 3EZ2A 4K9OA 1DJLA 1NBWB 2WU0A 5EE1A 2WHXA 3SE0A 1K2WA 4C0SA 3ZJTA 4MDFA 4F86A 2I80A 4GI2A 1K75A 1ZJ4A 2NUAB 5CJJA 2PXXA 1NR7A 1PS8A 2ZYHA 4P38A 4GQIA 2PUEA 1FU8A 1RVV1 2BZ0A 3EIFA 2OBFA 1QP0A 3R40A 3MC1A 4MDEA 3GLFB 2BY4A 3DV9A 2ZZKA 1JG1A 3AQIA 1J09A 1Z2OX 3EFOB 3ONVA 5CJPA 3F0TA 2GO1A 1F17A 3GLRA 1V6SA 3EEIA 4CE6A 4EJSB 1EG7A 4QM6A 3CT4A 3CEPB 3LFHA 1C3JA 3PHLA 1R74A 3N8IA 5G0TA 2XMRA 3H9QA 4TLMB 1BN6A 4ZZ2A 5KOHB 1X15A 3B3QA 5BR1A 4FNOA 5A02A 3Q10A 1GPKA 4ZMRA 4PZ9A 2IUYA 2ZT6A 1II8A 1N2CE 4HN2A 1HYGA 2X9NA 3KVOA 2VYND 3AKYA 4R05A 3ZV4A 5J2UF 3KKEA 4ICIA 3RUCA 4HNVA 2AJTA 5KTMA 3IJ5A 3QX8A 5IF3A 1PYOA 1E92A 3WSVA 3WMFA 3PX3A 3I61A 1N2IA 1F9EA 3HHEA 4JZYA 5ESXA 3K9FC 1N0WA 4JB3A 1JXOA 1CY4A 3ZZ1A 4AUKA 1ZSVA 1DO8A 3WRXC 5ADHA 3SVTA 3DEAA 2C00A 1SA0B 2BSXA 1FCJA 4LWPA 5KU7A 1KZ9A 1SUCA 4TTJA 3WG9A 1V0JA 2BJHA 2FQQA 2OXIA 3ZUGA 4TLBA 5GP1A 2BGMA 1Z2DA 3ABSB 3EC1A 4GIBA 1OIWA 2FW9A 3RBXA 4F11A 5CLJA 6ADHA 1NNLA 3WB0A 2W42A 4ND2A 2WSLA 1VKNA 5E1DA 1EFPB 1QIGA 1T5TA 2C5FA 2AHOA 2C9MA 4IJWA 3JYOA 4PBSA 4TS4A 3WNBA 1JLSA 4D0RA 4O2AA 4OK3A 1I5RA 3DPIA 1VJ0A 4MV6A 5IU6A 5ER9A 2VDJA 1LQ2A 3C14C 4KO3S 2AN9A 3EE6A 1WZCA 4C2TA 5I3CA 4QJ5A 2IBSA 2W2KB 2HCRA 3TRKA 5I45A 2YZMA 1DJQA 3LXUX 5LZ4A 1MXHA 3GEMA 3SQWA 1ZHOA 2X0KA 2VUUA 3NHFA 3EY9A 4RVDA 4QG3A 3NBKA 3QA9A 1ZUNA 3NIGB 3IMKA 1M9NA 4LZLA 1U1CA 2HSEA 3FPFA 3PIRA 1WOYA 5CRIA 1BE1A 1FFXB 3KU1A 1GEGA 3HCAA 3TLGA 5HIKA 3QE2A 4GPIB 4QXRA 4EG4A 1AMOA 1KEEA 3MM4A 5HA5A 2CB0A 5KVAA 3OM0A 1Y3IA 2QG4A 4A8HA 1J8FA 3HR8A 3PC4A 4C4YA 5IJWA 5LNK1 3SE7A 2YJZA 1J1IA 3JWIA 1WKBA 4Q7EA 4PLYA 1ODLA 2GBPA 4MVJG 4J0DA 4R40A 5I7UA 1HH4A 1OZGA 1RPTA 1U8EA 4D82A 4ARUA 1MAVA 4YONB 3AV0B 3A9CA 2OCYC 3OQIA 5CAEB 3G59A 4BWGA 2XLCA 1ZIYA 4PLFA 4OGGA 2PGIA 1KVTA 4TYMA 5CEJA 2WJGA 2VRCD 2ZJ5A 3LT4A 2F9LA 1DCFA 2HSGA 3NTXA 5F12A 1NSYA 5BN3B 1VCOA 2G7MC 2OCIA 4K6CA 4QJIA 1LPOA 2OUIA 3ABOB 2JVJA 1KTVA 3E1SA 5GOZA 1SXJB 3VSBA 5SY4A 1A9XB 5D6OA 1MG0A 2Q5LA 2Z1MA 1IXZA 2DCMA 5AIAA 5IM4A 2H1SA 2JDID 3Q4GA 4XIJA 3GLIB 2ERXA 3UA3A 4OAQA 2YV4A 3V7UA 2C7QA 4LDZA 2W90A 2DAPA 3NTUA 4F6RB 3TGPA 3HKDB 3ZOKA 1GZ5A 1QGUB 3I5UA 1UC5B 2O0LA 2SHKA 2E6KA 3QUSA 4IJVA 2NO9A 4OH1A 3JVUA 4MUNA 1O5IA 2ATEA 2D5BA 4CEJA 1SU4A 4B81A 2PGLA 3N2ZB 3L82B 4PIMA 1UMKA 3KOMA 3S3TA 3COJA 2H0QA 1MJFA 1A98A 3DXFA 4ZAGA 1MKYA 3C5HA 2PJRA 3HEAA 1Q0QA 2Q8NA 3ABRB 1WV0A 3GAFA 5H1YA 1NLZA 3IJRA 3IOYA 3WOVA 1B2LA 3I3OA 5JZ9A 3RVSA 2I8AA 5B64A 2H0RA 4LMRA 2FXIA 3FVTA 4UOQA 3LUDA 1PD0A 2BI8A 4NU5A 4RVCA 3IVCA 3M4XA 1RCUA 1QCDA 1FDIA 3WIVA 4H4CA 4TLLB 5JASA 2GYUA 1OTYA 4KODA 4NJMB 3O1IC 1KI6A 1TUGA 1VSVA 5K01A 1AZWA 2FOXA 4WAUA 2NPOA 5FXMA 4QPDA 5JI3E 4DV1B 3F4LA 1FW6A 3ZCTA 1A7KA 5F33A 1M8JA 1OFHA 4GNKA 1IHPA 3HYCA 1W1IA 2NYRA 3T94A 3AEQA 4GE0A 3SJBA 4LFBB 4YUVA 4RMJA 2XNDD 4FKBA 2VPXA 4G8CA 2QM3A 4TTSA 2AJBA 4TVSA 5TQ0A 4FK8A 2BV3A 3BBPA 4KZKA 4X1IB 3MJFA 3ZWVA 3R3VA 4FEEA 1SG6A 4M3NA 2X40A 2IHTA 3U3OA 3TK1A 1XF9A 1JVNA 4MS4A 4P86A 3EC2A 1NXWA 5K3FB 1VG8A 1IMOA 3FHJA 3PNVA 4QUHA 3AR3A 2QE6A 3ADDA 3O82A 4UZFA 2AFHA 1MLDA 1S2IA 4TV8F 4H16A 3HVJA 3OD1A 4MR8B 4EO7A 1YVRA 1NVFA 1L5FA 5IF9A 3GZNA 1X1BA 1W35A 4TGLA 1DFHA 5A03A 5D3KA 2D7DA 4YMIA 1MN6A 1AE1A 5BT9A 4LZZA 3SM9A 3UMGA 4Z4HA 1DBPA 1NW7A 3GJ3A 2QN2A 2CCGA 1FQOA 3D7MA 3CPSA 4FOSA 4N54A 5HQ3B 2FFAA 2IEAA 2TMKA 3GO4A 4RV4A 4D99A 1HFEL 2WLTA 3KTAB 2Q6IA 1R27A 1PFGA 4E6PA 3L84A 1BJRE 4EGCB 2E4YA 3O94A 1KSFX 1UWLA 4BLVA 1R5JA 4IDHA 2YDXA 2ZSJA 1UK7A 2HEIA 2E4WA 4HMPA 4IKOA 4RTMA 3OCWA 3FVQA 3V8EA 3T1YB 3PIDA 3BUSA 2B83A 3DHNA 3IXMA 3LYLA 5KOJB 4NFHA 1P73A 5EJ7A 1YBFA 3CVUA 1ETUA 2WHQA 3NC0C 2QTTA 1GHTA 4GVLA 3VPAA 1V11A 4GSLA 5B2FA 2ZI3A 5D3QA 3UAYA 1MP0A 2J9RA 2ZSDA 1V96A 1EAMA 2GSWA 4F2HA 3CXRA 1LPAB 2G1PA 1P81A 4GOXA 4JUFA 1T24A 4UULA 3KHSA 1YULA 3KCQA 1TF7A 3EXEA 3A14A 3ZU2A 2W2LD 2K6GA 4F4DA 1GSIA 3VC7A 1JKFA 5JJ5A 4HBGA 1X2BA 4M55A 3C7KA 3P4UA 1FIUA 3GB9A 1QV6A 3CZ5A 3O3MB 4K6FA 4BB9A 4KE9A 1DTWA 4JLOA 4ZPJA 1UBJS 1DTWB 2R2AA 2HNKA 2Z9BA 4JJKA 1Q20A 3USES 3ZWWA 3TL3A 1K06A 3SWWA 3TNFA 3GEDA 3RFUA 1HF3A 1IN6A 3H3JA 2N1BA 4INZA 4MRRA 4OIMA 5C1BA 4DZRA 2YXEA 4MRPA 4JP5A 3O92A 4CKZA 1LC0A 4CCYB 4TKVA 5B3JC 2ZT8A 4J2HA 4F4JA 1PL7A 2QEQA 3DBHA 1V25A 3N0XA 3WYBA 3LE8A 5DRTA 1FQKA 5FPSA 1Z4PX 2WM3A 4O3MA 3AVUA 2J7KA 2BGLA 3JQBC 1VLVA 5EKDA 1E7QA 1QE3A 5JD6A 4BO9A 1DRKA 3PRJA 3SXUA 2G9QA 3T3GA 2GZMA 3P9RA 2QUIA 1IN1A 1ZCZA 2QSZA 4QYSA 1O6BA 5CUQA 1HDRA 4LYGA 1C7EA 1CD5A 2KW5A 1OYVA 3LV8A 4YRKA 4L27A 1RBZA 2W2VA 1YWGO 2OAP1 5C51B 1D8AA 1AGYA 5I9MA 3BH6A 5CB6A 1VFNA 1A82A 2VTEA 2BCEA 2NNWB 1YRAA 2V5AA 4D3YA 3KQHA 2PNJA 5JMPA 3K2BA 2ZSAA 1SUBA 1VRWA 2XWQA 3PCTA 2AE2A 1V5EA 2CLHB 5BQOA 4PSCA 3NP7A 1EI9A 2I2AA 4IW3B 1IAQA 3LWDA 1HGXA 3ET5A 1K6XA 2G07A 5K0SA 1M74A 1C1HA 1O54A 2CBZA 1U9CA 4PZZA 3A26A 5LKRA 4QBTA 3K0FA 2BEVB 4AW9A 5C8DA 1WX1A 1O97D 4KR9A 3D6FA 3BD6A 4NICA 5U1PA 1NVUQ 2EQAA 4ODIA 3OM8A 2F8MA 1L8AA 3QHQA 4L16A 3K73O 4IWXA 2QBYA 1L5QA 1O6ZA 3CCBA 1WM1A 2QTMA 2J5RA 4IJQA 5D3MB 2UZ0A 1I5OA 3WWZA 3PVZA 3V4VB 4Z6KA 3QJ5A 4WESB 3WRXA 3FOCA 3BKWA 1W96A 2HDNB 1S1MA 1L0BA 3N2NA 3H4MA 4GM1A 3WE7A 3RTCA 3CLRC 4DNOA 4L73A 1YU6A 2Y3IA 2YQ5A 1U5AA 4PSKA 4OQDA 5C4MA 4FMBB 3BHMA 4M89A 3BOSA 5A0TA 4M4SA 1SIUA 1C14A 2VP0A 2WUVA 3CVOA 4Y1GA 5T67A 4B09A 5GVRA 5C18A 2MR6A 3O4HA 4D3FA 1UT6A 4WWHA 4RHEA 4ZI3A 2H7CA 2YZNA 1FFBA 1UUFA 5DM2A 3SLGA 3T3PB 4RHFA 4LECA 4RJ2A 2QPOA 2HYDA 1H8HA 2CNWD 3MCZA 4X91A 1QYIA 1KI1A 1UPBA 1YS6A 2XIQA 4N03A 4AJEA 1KAMA 3ROPA 4F8JA 3UIEA 3T9AA 1EVIA 1CR2A 2QRMA 2JIRA 2Q1TA 4A1FA 1GQQA 5TQJA 1WULS 4HK4A 5GY7A 4RPGA 2QW8A 3NWBA 5H0IA 3M1YA 3EYWA 3MCTA 1I4WA 5HW0A 1J0DA 5TS3A 3UFXB 2V3WA 1RT9A 1U7UA 1NTOA 3IUYA 3UO8B 3BTUA 1A9RA 3FF1A 2OXFA 3OJXA 3A4LA 3LQRA 4Q3DA 1P2TA 2PCLA 2F67A 3VNSA 4MNTA 3SSAA 1BJKA 3LLUA 5TS2A 1G9TA 3EK2A 1AUQA 1HM5A 1I0ZA 1OWPA 4QECA 5ALXA 4K2AA 4RHCA 1KFEB 3IT1A 2EGGA 4J75A 4Y2GA 1YUBA 4WZBB 3UANA 4W8OA 3WS7A 2OILA 4EHKA 1WBBA 1W6UA 4M1KA 3MWDA 1E2NA 3GEGA 5FNVA 3AESB 4G0PA 1JAYA 4NS1A 5CBKA 1ZCBA 5HK8A 3CX3A 5CTAA 3WIDA 5FV4A 5IEJA 2C7PA 3WLJA 1CQIB 4CIWA 4ZVVA 1ISFA 3K8ZA 4JLDA 2E6UX 2FAXA 3HG7A 4FB4A 1XMXA 2P0EA 1ZW6A 4OMCA 2YY7A 1G9XA 4JV5B 1XU9A 3KVYA 4XB1A 1KJWA 1AG9A 3BGSA 2ZYGA 4JLWA 1HDYA 2XE8A 5BQPA 4NK5A 3NJ8A 4IXTA 3DDSA 1Z3IX 2JGNA 1P5RA 3IQFA 3WSTA 3ZZTA 5A9SA 5DTQA 1RI1A 3UUWA 4R0NA 3BF8A 1GZ6A 4ZV4A 1RLUA 2PO7A 5CNMA 1K63A 3R6GA 1K66A 4K0RA 5ALZA 4F2WA 3S1SA 5BSTA 2HO4A 1O57A 2W6IA 1SKAA 2ZE6A 3DQPA 2I7CA 4MRSA 3U49A 2Q3FA 3LPAA 2B94A 2AUTA 2GK4A 3O4RA 1NRIA 3PEVA 4FFPA 4GX1A 4L9SA 4UBOA 1A1VA 2B82A 3AKZA 2O8CB 4L2IB 4EATA 1P2GA 3T41A 1RHRA 1G291 1JW9B 4DW8A 3KWFA 5CA0F 5CDFA 4RVSA 1BU5A 2WTNA 1RRKA 4WNCA 3GUYA 5C37A 1TTHA 3INYA 1ZD8A 2VHUA 2TS1A 4O5OA 1JP7A 4RIFA 5CDTA 5L45A 4YDHB 2VJKA 3SFTA 3WGNA 4UPDA 5IN5A 3T3EA 4ZHSA 3U37A 4LGCA 4XWAA 3W8FA 1E4VA 3W5VA 5ERGB 5JCOA 2E82A 4ZIRB 5JANA 5DN6A 1Q15A 1MUUA 2ODAA 2DH6A 2XADA 3ZNOA 3L8HA 1N92A 1ORVA 1OWNA 1U0SY 1L5WA 2NXWA 1OF1A 2R6JA 2J8ZA 3G7NA 3GD7A 1AK1A 3RS9A 3IBYA 4PLPA 3ZWXA 1A5BB 2BEUA 3IKMB 4OHUA 3QQPA 4NKRA 4YRLA 3WYFA 4EMBA 4I2VA 4F6LA 4I14A 2OAGA 2UYOA 4RVFA 4JI6B 1QO0A 3CLVA 1G98A 1VJTA 1ECBA 4QATA 3USCS 4AZVA 5BSKA 3BQMB 3FZEA 1Y6GA 2XDQA 2QVZX 4LF8B 1QZTA 1H1DA 3OUZA 2JJ2A 5KQRA 1D2AA 4TWZA 5B1YA 2QM7A 4OJQA 3PR2B 4YI5A 5J4HA 1YBVA 4YMHA 3KBBA 3CJRA 1NOKA 5JSKA 5K03A 1UBTS 2GJ9A 1I3KA 2JFQA 2XDWA 2Q3MA 4O59O 1KJNA 1HTWA 3DZHA 4B0OA 3P0HA 3N7AA 1FL9A 3GJ7A 4G63A 3T4PA 1MQSA 1B43A 5C8XA 1OLSA 1QHHA 1NFFA 2Q3BA 3Q6IA 1PZXA 3VUFA 4GKJB 3DC7A 3DLIA 4INOA 4W9NA 3MAGA 1WP9A 1T1EA 5D86A 1VPLA 3IAM6 3OQJA 3B12A 4B7UA 3GPLA 5HE8A 2YFQA 4AX4A 1XWFA 4DN6A 4JFAA 4POAA 4BAZA 3Q9SA 1VL1A 2IS4A 3DMNA 2V1XA 2IPMA 3PQ7A 4E4TA 1AKEA 2BJWA 2AOUB 1TU0A 4IIVA 5JG7A 5JAUA 4X65B 2V3CC 4JI3B 3P20A 4U7WA 1U3DA 1G1AA 3C3BA 2K5UA 1X74A 2AC7A 2MR5A 2FWNA 3BXEA 3C70A 3EGDA 1PJRA 1JX6A 3OPMA 4XLLA 5EGSA 3TOZA 3VQTA 1YS1X 5HJ5A 3UWMA 4DANA 2JFNA 1B8NA 3N2IA 1HLFA 2G1KA 1FNDA 1SNYA 2QT9A 4MUEA 3CYFA 3EGWA 4JIMA 1K9VF 4MUFA 5DTRA 3DBLB 3WLAA 4HG2A 2XSZD 2OHJA 4MKXA 3OMXA 5TSDA 3DNMA 1TC2A 3IDAA 3PZRA 4CZ2A 4EM6A 4M76B 1DX9A 1G19A 1YZHA 3NEJA 3PCXA 4I9UA 4QYTA 4V3BA 4XVUA 2PSHA 4IJ6A 4RTKA 4W5JA 2HJRA 1QOZA 1K7CA 2B1GA 4B40A 1Z2NX 4EMSA 2MSCB 4EA7A 2YWGA 2JGAA 4JJ4A 4N5LA 4LGMA 3TPZA 3WTBA 3S44A 1I1QB 1BFUA 4LJKA 3JVDA 3EIWA 1WDWB 3ENNA 5EUQB 3QU7A 1NQVA 2R86A 3R3YA 4X3OA 1G8HA 4BJ6A 3VH2A 3FSJX 3W6NA 4PZAA 5D7NA 5AYVA 3ICCA 4U7DA 2XCRB 5LOVF 4ON9A 1DCMA 3DR5A 4D4JA 1ZP6A 1CS4C 3V4ZA 1WCYA 1K5DA 3TQOA 1QE0A 4UE3S 4C3ZA 1NE2A 2QYOA 4PO1A 3HSKA 3PGXA 5E2IA 4K6HA 1L5YA 3SLRA 4BLSA 5AW7A 2AG0A 4W5HA 5H02A 2GZ1A 2EFGA 3COPA 2W6MA 1VMDA 3K72B 1SHLA 2RJ3A 3CIFA 3LI2A 3I8SA 4YNBA 4D6PA 2ODTX 3T12A 4ZCMA 4NCNA 1U7XA 2O3UA 3OESA 3SGLA 2GKOA 2GCOA 2ATVA 2RIRA 3NM4A 1AZSC 1SC9A 2I1LA 2IV3A 2H4JA 3HEBA 1SHKA 1RS0A 1ZQ9A 1RBYA 3F5SA 4A73A 1KKMA 3L1VA 4HOYA 4QTYA 2OECA 3KTAA 3NPMA 4NI5A 3GI1A 3CLTD 3O9VA 3N07A 1GZHB 3H65A 4V39A 1J0XO 4H3KB 3SSOA 4X20A 2IE0A 3R9XB 4HQ0A 2R7NA 2FKAA 3NX4A 2VRCA 4XTCS 2AI1A 1I2MA 4EZEA 1DHRA 1GRQA 1UQRA 1R4MA 5F7JA 1OAOA 4EL5A 1SMKA 1N9ZA 2LD4A 4PCLA 3PFCA 1H4VB 2JBHA 3VFDA 1LPSA 3FLAA 3ZI0A 2IEDA 1UXHA 4II7A 3IAFA 4EAAA 3M82A 2UXCB 2EYQA 3L7JA 4AN1A 2QYTA 4DNQA 1RAEA 1X39A 5K6AC 1GAWA 5JISA 3BJRA 5INTA 1U1EA 3WZMA 3WWOA 1QTNA 4X8HA 1XCLA 1XU7A 1TM1E 2ZJ7A 1FSPA 4D79A 1HEIA 4PPQA 1OIXA 4ZQGA 3MUOA 3RYCB 1YTLA 3NWEA 4U2BA 4WEOA 3D43A 1KO8A 3O8OB 2FMTA 3KR1A 3R24A 3BXOA 1EHIA 1PR3A 5C35A 3R9IA 2BTEA 4BKQA 2EU8A 2ZS8A 1CQXA 4JOQA 1TO6A 4XD7D 2OK7A 2EWMA 4P81A 4EQ6A 1R50A 1QFJA 2MINA 2PUWA 2XUDA 1O4WA 1XLTA 2JCXA 2C95A 3OP4A 3X1YA 1LRKA 4YRTA 4HDKA 3RAEC 3MQFA 1JMVA 2BMFA 2P90A 4KHZA 2QTFA 4GFDA 4AZSA 4RELA 3TSCA 5GJVC 4OB6A 3UHOA 4B8ZA 1F20A 2RIPA 4HX2A 2IELA 3BDIA 4S1PA 2VCEA 1QWOA 3VISA 4FSDA 4JYZA 2V6JA 3DULA 2P6PA 1HI9A 1UKBA 2W22A 3ESXA 1Z15A 1CV2A 4EHHA 4PNPA 5AI5A 3I5MA 1E79D 2HQ1A 2J6HA 3DJYA 3OZUA 3RI3A 4LE2A 3TCKA 2HSJA 1CEQA 2X1VA 3F3SA 3OT1B 1L8LA 4DM3A 3Q6NA 5ES3A 3PPWA 1XX6A 2VQSA 5K8UA 1FFCA 1QDEA 2HF9A 3DV0A 2OCLA 3F9CA 4CU5A 2CY0A 1NXOA 3I9FA 5LZ7A 4QNRA 5L51A 3RTDA 1T3GA 1O77A 4DLTA 1D9XA 1ZK1A 3THOA 4AZ0A 3RUEA 4K9SA 3TBFA 3I53A 5JAIA 4XCVA 3QI2A 4WSOA 1LFDB 1T3TA 5E6RA 1E9FA 1IH8A 1EQ2A 1RZ3A 3WWEA 2IGTA 4PRYA 1OX5A 1XXLA 4OHWA 5EWJA 2QU7A 1B3BA 1GZDA 1HSOA 1G7SA 3BE8A 1RQ2A 3BS4A 4V2UA 3H1TA 1E6KA 1KDRA 5KYTA 1NSTA 2ZVDA 3D9QX 2RI6A 4RDXA 3L4JA 1W36D 4ZI7F 4RPCA 3DEIA 1I2BA 1IOWA 1GCOA 2X2PA 2X0IA 3JQ7A 5DMHA 1H1TA 3C3KA 3VPDA 3W06A 2Y1EA 4H7HA 2PMDA 1EGQA 2XGMA 2YASA 4IO0A 1GNQA 3D2LA 1THMA 4TWRA 4ZT5A 4DMMA 5JBNA 1Y7HA 2XUIA 3NOOA 2WKQA 2Z04A 1P19A 3LOUA 4L5IA 1V16A 1Y5MA 1Q1ZA 4MR7B 4CR7A 2XRZA 2HHAA 1U0JA 1ETHA 3HHPA 3JQEA 3MYYA 4MHSA 1ZWKA 3CMCO 2ZIFA 4AJ1A 3HXTA 5JHGB 2R3SA 3LC7O 3E9ZA 4BDTA 4YAIA 5H3LA 2ZTSA 1NI5A 2FR1A 3SFZA 2ZUFA 5DT9A 3QMMA 1G7RA 1NNUA 5KQPA 3OD5A 4HXEB 3OWHA 3QY0A 3FCCA 5ALDA 5DNWA 2IU0A 4YPVA 2CNDA 5K4HA 2GJKA 4O3FA 2PUBA 2VT2A 2EZUA 3LQQA 3KYJB 3AWIA 4QZVA 3B1WA 1ST2A 4EFNA 4H3VA 3TTVA 2WHEA 3RVLA 5CLIA 1Y4ZA 3A9WA 2ERYA 4MK4A 3NVDA 5KNLA 3AUUA 5JXWA 2GNAA 3A1NA 3WK7A 1SUPA 3HK2A 2V4ZA 3DEHA 2QPAA 1QGYA 4GS5A 5FP0A 2ZRLA 3C6QA 2F3PA 5AKZA 3FMPB 3O0DA 3TW0A 1G21E 4EOGA 4JOBA 3QLEA 1SWWA 1RAFA 3B9PA 3PQDA 2EBWA 4ZEVA 5A3JA 1I7DA 3DMFA 1UXIA 1M6YA 4TXMA 5CFZA 1ZN8A 2J4CA 4LXUA 2FH5B 4JOSA 2BLNA 4MQ4A 4Q4JB 4D8XA 2Q1XA 3LU1A 4U6SA 2R00A 1V9SA 1H9BA 1P0FA 2CJPA 1GZVA 4Y2XA 1NJ8A 2ABWA 2ONCA 3KQWA 1LB1B 1MH9A 3GFFA 2P1DA 4NH4A 1BQEA 3JTEA 2AF4C 3LY5A 4EYSA 3UAGA 1J2EA 3SP1A 4S12A 3E8MA 4HATA 2XIJA 3OBIA 4RPJA 4RZSA 4ZEOA 4LQDA 2FYTA 2W4MA 1DKOA 2WKPA 3I34X 4NDZA 5H4HA 3ROMA 1H4QA 1YKSA 5DLEA 3MTAA 3U3MA 1QU2A 1F4PA 2YVAA 4CUKA 1LRJA 2X5OA 3IIEA 3KKZA 2P4EA 3EXHA 2OCBA 1ENZA 4CIBA 4OHFA 2EARA 4LDPA 2ZYSA 2M2IA 1H22A 3ZNPA 1F38A 3E3NA 1NULA 2GRUA 5PNTA 3NFRA 3ROKA 2IS6A 1CUVA 2PQ2A 1M8KA 1C81A 4MLDA 4F6RA 3SPXA 2FZGA 2IPXA 5AD1A 4MLPA 4V24A 5F77A 1L2TA 3OKCA 1N0UA 3K1ZA 1EDDA 3TCNA 1YUNA 3T7RA 4UD6A 4XAQA 5K3BA 2RGNA 4RKWA 1I14A 1MB4A 4GR4A 4PG7A 1EBUA 4US2R 1E7RA 2QLTA 1TKAA 2WWWA 3IAS1 2GCGA 3SOZA 5FORA 3WMEA 2CVQA 3LKDA 3N8KA 4EUKA 1XTTA 4LHVA 2JRCA 3FCOA 4KACA 3S2GA 1T9AA 5CVDA 4FQ7A 1VL5A 5LXTB 5JYCA 3C1TA 2I6UA 2A1UB 4KC0A 2PFSA 1R4AA 1M2EA 2CCKA 3W7AA 2FSSA 3L8EA 3MD9A 4PHCA 3PT9A 4X61A 4RTPA 1GAXA 1RWWA 3MJRA 4JC4A 4DLAA 4PHHA 1SBQA 3TJMA 1WB5A 2YZKA 4E5PA 5C2JB 3A6JA 2ZDHA 2ZB3A 4WPGA 1D6JA 2WC1A 1RMQA 3GVPA 1YGPA 3AEUA 4W82A 5EE0A 3X1ZA 1Q16A 3O5AA 3WIEA 1UAYA 2HTFA 2O8VA 3PPXA 4IINA 4QYXA 1TB4A 1D5WA 2W6CX 2ADOA 4PLWA 3UGKA 3VR3D 5IT9A 3BD7A 2JG3A 2BMDA 5DN9A 3CUEF 5ALVA 3VKGA 2E7ZA 3DNFA 4Z0TA 1W87A 2C7BA 4QOGA 3KB6A 3GRYA 4MEAA 1HMPA 3TRIA 1IBCA 2C2YA 4LXQA 2R11A 3FNEA 3OFKA 3UT5A 3PWZA 1NASA 1IM5A 2AMJA 3PENA 5KC8A 3DV0B 2XTMA 4K6KA 4XUCA 4LSGA 3B52X 1U2ZA 4U7PB 5B6IA 2YIVX 3NHAA 1BD3A 3JAKA 2PKWA 4B8WA 3C2QA 4GW3A 2H8GA 4HHEA 4UXIA 1BX3A 3ZTYA 1WZIA 3H5IA 4KRXA 4DQUA 4MI1A 4YECA 1K98A 1QDLB 2Y71A 2YNMA 3HBMA 1N6NA 4JA0A 2HAEA 1GL6A 4KLAA 4BNKA 4YR7A 5HHTA 4JBNA 5HWSA 4DHWA 1HEUA 4OX9B 3M33A 2IYUA 4DWOA 3TF5A 1JKJA 1RYHA 4OU4A 3A0UA 3N6XA 5DZSA 1VHTA 4URYR 1JU9A 3RREA 4EGJA 1TCCA 1NUSA 2VEOA 4RKYA 1NP3A 1AU9A 1J0CA 3DFUA 1MC5A 1MT3A 2R8OA 3K0AA 2EJUA 3U4MA 2YIDA 1R8YA 4G01B 1RXYA 4TZKA 1YR3A 1OFIA 1T9DA 2GLTA 2H07A 2PL1A 3COZA 3HWRA 2WPDA 3OX4A 3ZHRA 2NNLD 4HPJB 3EXHB 1OX6A 1EVKA 3MINA 3P0FA 4DR3B 3I9MA 2Q2QA 2JFGA 4ZV7A 4EUNA 3ONNA 4NOMA 5GJBA 1E2UA 3L01A 3ZHCA 1Y80A 1SUSA 1SEPA 3MJDA 4EKNB 3GRVA 1FVHA 1U80A 4OSOA 4ZCTA 1UPFA 4IQ4A 4XTRA 3TG8A 1CYEA 1GA1A 4JLMA 1BQ3A 3RTEA 5JDCC 3VZBA 4F5DA 5LYJB 3M6UA 3F4KA 3ANYB 4OYRA 1AGXA 4A8TA 4EW2A 2Y27A 1MCZA 3VJLA 5JJCA 1KNXA 3CSDA 4EX6A 4NV3A 2VO1A 1K8XB 1KF0A 1YQTA 4WL0A 2WINI 4BKMA 2IY9A 3WGLA 1JV2B 2P1RA 2WIDA 1P9OA 1K4YA 1M1NA 4ZK2A 2FY8A 2YZGA 1JE1A 3WK5A 1C9MA 4F38A 3ZLTA 3IRUA 1FPQA 2PR2A 2A1TS 3K6RA 1JILA 4B4UA 4TQ9A 4LF5B 4Y6LA 1RJ9A 2W43A 1IONA 2AUNA 4BVFA 3WV5A 5JARA 3HI6A 2RGEA 1A4UA 4OQLA 3F74A 2P8JA 5FWAA 3N6VA 4HLNA 2JK0A 2X58A 1U5BA 3N3AC 2Z2IA 1H23A 3VC3A 2DJIA 3LWNA 2QRQA 4NYJQ 1D3AA 4U3JA 1AXRA 2OHVA 1R6VA 3ITDA 3O26A 4ZOLF 2H4FA 3JQAA 2GBLA 5E7MA 2G06A 4DOMA 2WZQA 1V7ZA 2YMLA 2PGJA 2VH2A 3Q98A 4EY6A 3M70A 1I7PA 4AKHA 3GRPA 1UK6A 1GU7A 4JLUA 4P58A 1BVRA 1DRUA 5HKLA 2GD0A 3GEIA 2H59A 2WIGA 1X1SA 2DT8A 3A58B 4WBXC 2JCYA 5EE3A 1IUKA 2F62A 2KE5A 1CDZA 4NENA 4RMNA 4G56A 1NHWA 4PZDA 2BAGA 2CFTA 2H3EA 3Q1KA 1ZNZA 3A7DA 4WOJA 1ZRNA 3FVWA 4PAOA 5E38A 4M38A 5I51A 5JDIA 3JD3A 4C2BA 3KPWA 4YQFA 3HCOA 5CA1B 4OGLA 3TAXA 1C7JA 3K0AB 4X1YA 2FPGA 3GAZA 3UICA 5K4GA 1WZ2A 1OLSB 3E9YA 3U31A 2NP7A 1DAIA 4E12A 2ZQ5A 3RSHA 3TI7A 4IZ6A 1CRQA 3RKRA 2Z6UA 1KDPA 2BHRA 4UOEA 3K1AA 4PQEA 3DWIA 4MP3A 4CW7A 1T10A 3K35A 2ISCA 2YFKA 4L02A 3Q7IA 2YYAA 5DU2A 1JGTA 3CC8A 3F71A 1W93A 3VMMA 4DCJA 2BBSA 2FPUA 4PFQA 3IEMA 2J9GA 4U7JA 1CNFA 1QIDA 4NHOA 5CCEA 3BZUA 1W8IA 2I3BA 2DUUA 2IKQA 3GMTA 4CNQA 1OREA 4ZARA 2R62A 1WMEA 5WRFA 1UC9A 3U1VA 4G5FA 1NQUA 1FJXA 2R8EA 3TSWA 1V8BA 1OY1A 4DSAA 3D3EA 4QL3A 4E94A 3HUUA 3TH5A 2B35A 5JNSA 5ALOA 3NG1A 2PKXA 5KYXB 2F8SA 3O47A 1G18A 5B55A 1DO0A 2CMKA 1CR4A 4QASA 2BR3A 1Z0KA 4J3FA 2ILVA 3UKJA 4FT2A 2Z43A 4RL6A 1LV8A 4WI1A 4D42A 4PWYA 3P2EA 2HD4A 3NVMB 3UMMA 4BRUA 2WT9A 3T1QA 1G3UA 4IV0A 3IIJA 1D5CA 1P1IA 2FZVA 3V1YA 3WKBA 4TUYF 2X0EA 2CK3D 1G20E 5BSUA 4QVIA 4F3CA 1GWNA 5TQ2A 2AK2A 3H2YA 2GYWA 3W05A 1UZLA 1NI4B 2B1RA 1MOZA 2BEKA 2IY7A 2P6OA 2XUKA 3FE2A 4N76A 5EIAA 5GQSA 5DT2A 1LW6E 1X9GA 4DBVO 1SKYE 4PAGA 5ALMA 4NESA 4UHCA 2IWRA 3DDCA 4W63A 3N2GB 3VOSA 4BNTA 4N3AA 4CTNA 4KVAA 1XCGB 1Y9ZA 3LKBA 4KNYA 3DOOA 3U5ZB 4C4XA 1D7OA 3T61A 1LK0A 2ORVA 1T91A 3GVHA 3IAUA 4H7IA 5HTOA 4PG8A 1E3IA 1N7GA 1SHTX 2V4UA 1ZUIA 4S0XA 1AM4D 2CV0A 1QPGA 2CUNA 4F9TA 1XLUA 5KYYB 1ZJ6A 2DJ5A 3F8WA 2C04A 4LXYA 3VPFA 3P9SA 1XELA 1MQ8B 1T2DA 1CUIA 2DQKA 1S2LA 1NBHA 1SIWA 3DPUA 3EXHC 4DR4B 2WFZA 1E9CA 2YNMD 2BGTA 3PD7A 2XOKD 3BULA 1XDZA 3HA2A 3IDSA 5CVVA 3WV4A 3COVA 3GP5A 1BCSB 3H9GA 5LQSA 4RHXA 3B82A 1RD4A 1P8AA 3LP6A 3U4GA 5C52B 5EIOA 2ZUTA 3OLVA 1MNQA 3CVYA 4ZYUA 1AC5A 3ETJA 4QTTB 1W47A 1SULA 4PYJA 5JADA 2FHSA 4H1VA 1RYDA 4RMGA 2GN0A 3LC0A 2FWMX 4I1RA 4BMYA 3GJYA 3N0VA 2H63A 2PD3A 5ECDA 4AI6A 3KX2A 1R8SA 2XB8A 4CLXA 4OTZA 3M9WA 4Y2JA 1YB7A 5JVDA 4I9FA 4KOAA 3ZWMA 3FM9A 3PHIA 5TF0A 3DZGA 3RU2A 1N0HA 1KWKA 1UBSB 5J58A 2D62A 4BATA 2EGHA 1FRZA 3AEKA 1L5HA 3TR5A 1XBTA 3PRKE 3KD3A 4MMZB 3AUXA 2B61A 3OE7A 4TT3A 5HCIA 4ALMA 1G5TA 4LE0A 1Q7CA 3PNKA 1KKLA 2EAUA 5DNVA 4J1QA 1YJQA 2QL5A 3IE2A 4DNPA 5AOAA 1H0KA 4PONA 2Q0XA 3L02A 5C46F 1FYVA 5KKAA 3M3HA 3GARA 1PZEA 3T6KA 2PUCA 1FB5A 3OOYA 1ZK3A 2ZBEA 4N4AA 3QXGA 3P9YA 4WZAB 2BE7A 2OFPA 4TL8A 2HF7A 4Q9LA 4AJKA 1OA0A 3U1BA 2Q50A 3FH0A 1FTNA 1TZMA 2O4UX 2C57A 5H9VA 2ACKA 3WSWA 1NN0A 2OLEA 2VH5R 2C1EA 3BAZA 3LCMA 5CLGA 2CC2A 4GR5A 3JR3A 1U94A 3GY0A 3KZNA 1YDFA 1G5HA 1M6VA 2JCSA 1UWKA 3IB6A 4UUBA 4ENRA 3HU5A 2XXAA 4YT4A 4J0HA 4R69A 3BMNB 3BRCA 4ZHQA 3UAOA 5HKKD 4YP0A 4LVCA 1GPH1 4WVFA 2NO5A 4IVNA 3P0IA 2ZETA 3QG5A 3TJZA 4HPWA 1L5LA 2XYQA 4CLRB 5AVRA 2B4KA 2H51A 2C82A 2OO3A 2VH1A 3OLCX 3OT4A 4CI0B 5CG1A 3G9UA 1KYTA 1WMDA 2IX3A 1J23A 4ZKDA 4RSHA 4D45A 5FPPA 2J09A 5EHIA 4ZQBA 5H82A 3S2UA 3W9BA 1GSHA 4KBFA 4OBEA 4PXAA 4RZIA 3M9XA 4UMVA 3UY4A 1W4CA 1MORA 2DMRA 1TPYA 4MVJA 4MWCA 5CH8A 3CQ9A 2IEZA 3D7LA 3MGBA 1QSGA 4YASA 3ZXUB 2M9MA 3ICVA 2JFFA 2J3QA 4XRGA 1W9HA 3DM9B 4G5YA 2HBQA 4Y1RB 4J0QA 3AEYA 1C1XA 3SJCA 3GFPA 3EFOA 3H2JA 4C1NA 2WQZA 5LD2B