4KE6A

Crystal structure d196n mutant of monoglyceride lipase from bacillus sp. h257 in complex with 1-rac-lauroyl glycerol
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
249
structure length
247
Chain Sequence
b'MSEQYPVLSGAEPFYAENGPVGVLLVHGFTGTPHSMRPLAEAYAKAGYTVCLPRLKGHGTHYEDMERTTFHDWVASVEEGYGWLKQRCQTIFVTGLSMGGTLTLYLAEHHPDICGIVPINAAVDIPAIAAGMGGELPRYLDSIGSDLKNPDVKELAYEKTPTASLLQLARLMAQTKAKLDRIVCPALIFVSDENHVVPPGNADIIFQGISSTEKEIVRLRNSYHVATLDYDQPMIIERSLEFFAKHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermostable monoacylglycerol lipase
molecule tags Hydrolase
source organism Bacillus sp.
publication title Conformational plasticity and ligand binding of bacterial monoacylglycerol lipase.
pubmed doi rcsb
total genus 92
structure length 247
sequence length 249
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2013-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ke6A00
3MGAA 2QJWA 5J3JA 5AKEA 5ALZA 3D0KA 5AIBA 5AKXA 2HA5A 4PSUA 4EHBA 3G9UA 1U4NA 2WFMA 3EQ8A 4BTLA 3LIIA 4QZVA 2XUFA 4X00A 4C4ZA 3I2FA 3WYDA 1R1DA 5LZ9A 2Z3ZA 3BF8A 4BE9A 1K6EA 2QR5A 3PICA 2HA4A 1GZ7A 4G8CA 5A71A 3DL4A 2ZSHA 3MVEA 4FWBA 5A7GA 3H04A 4Q1VA 5IVIA 2DQYA 2CUTA 1CUJA 4IHAA 3BIWA 3STUA 3YASA 4L3WA 1LPMA 2OGZA 5ALQA 1YASA 3IUMA 3VJMA 3ZV7A 4GXNA 2XQGA 1ZD4A 5DNUA 1AX9A 4Y2JA 4BP9A 3K6KA 5JAPA 3ZLTA 3R3ZA 2X8BA 1EDEA 1MO2A 3DL7A 1BEZA 1Q83A 4J0DA 5CH3A 4M0FA 4QLAA 4H77A 1MN6A 3NOXA 2CJPA 4B6GA 2DSNA 1XZEA 1M33A 5CT8A 3QPAA 3VJLA 1OCEA 4UHCA 4X91A 1IZ7A 4BTVA 5FRDA 3F67A 4K6GA 3WI7A 5ALOA 3DS8A 2HU7A 5KREA 1J06A 2Y2UA 2QT9A 1WB5A 3WL8A 1SCQA 5CH8A 1XZAA 3DDUA 3FSGD 1GGVA 4Y7DA 4W1PA 5AKZA 1CUGA 3VVLA 3FYUA 2PKYX 3I2HA 3G7NA 4DGQA 1MX1A 4KE9A 3EQ9A 1VZ3A 1UK6A 3D59A 4H7IA 1EDDA 4P9NA 1U2EA 2VATA 4C4YA 3WK8A 2C4HA 4DNFA 2VAXA 2XMRA 3I1YA 4MWTA 4UBMA 2XLBA 3WWEA 3D4LA 3AIKA 3K9BA 4YK7A 2OGTA 4P93A 3H2HA 2BAGA 3I2JA 5ALTA 5CRIA 1VE6A 2XMSA 3IUNA 3STVA 1BN6A 2HA0A 4WFJA 2BKLA 4OB7A 3O4GA 2VAVA 4IO0A 4BB0A 4OCZA 5BWCA 3WK6A 1EK1A 3OOSA 2ZJ7A 5EHZA 4BCCA 5JANA 1AURA 2W6CX 3PI6A 5AM3A 3AUKA 1QFMA 3LP5A 1RWQA 2VJDA 4LKOA 2XI4A 1XZMA 2JEYA 2XUOA 4BVJA 1CRLA 3A6ZA 4FDMA 1K4YA 5H3HA 4GWLA 4PW0A 2WUFA 1VJ5A 3S8YA 1EB8A 4PNZA 5AO9A 2VEOA 5DJ5A 1BCRA 4QLOA 4BBZA 3ESDA 2HU5A 2I3ZA 1UT6A 3O4IA 1NU8A 1GPKA 1GKLA 4HS9A 2JGKA 3D5EA 3BL8A 4EY8A 3R3XA 3WL5A 2JGLA 2J3DA 4BAUA 1XZIA 3QPDA 3WKCA 1DT5A 1F0NA 2JGFA 2R8BA 3DYIA 2AJCA 3BJRA 3KD2A 2HL6A 5CMLA 3KWJA 4A16A 2VA9A 2HRQA 1X2BA 1MNQA 4J7AA 4XJVA 1LNSA 1IVYA 3OG9A 3G02A 2XLCA 1A8QA 2OCIA 5JZSA 3R3YA 1RP1A 1G66A 4QE3A 3STYA 4EZIA 3AJAA 1BN7A 1P0QA 1FFEA 4BAGA 3GUUA 5FUMA 1E3QA 4QDZA 4Y2QA 2JEZA 2EDCA 1L7QA 4BAZA 3V1KA 1ZICA 5HF9A 1R9MA 2VJAA 2Z8ZA 1EK2A 1IMJA 2ORYA 7YASA 2PUHA 5KBYA 2HADA 4N8EA 3I6YA 1PV1A 3BWXA 4GDMA 4F0JA 2OXEA 2QVBA 1GQSA 4B83A 3R3VA 3QYJA 5JATA 2G5TA 5ALRA 5DYYA 5FKJA 2PM8A 3R41A 1QIIA 3W9BA 1XZJA 4FTWA 3H2IA 1TCAA 3GBSA 4S0XA 4JEIA 1LZKA 4TPKA 2WUGA 3E1GA 4DM7A 5D3ZA 1VKHA 2ROQA 4F60A 4WFKA 4G9GA 4Y2YA 1TQHA 1T4MA 5HK9A 1FFDA 1TKRA 1ZI6A 2O7VA 3B3QA 4QDOA 2Z8XA 3IUQA 1AQLA 4CIBA 3ZLUA 4XX1A 4BE4A 3BDVA 4K5QA 1LGYA 4AN1A 1LPPA 3BE8A 3W06A 3WKEA 1J07A 2YXPX 1W52X 1IUOA 5EI5A 3UUFA 3K2IA 2RHTA 5T4BA 2WQZA 3WWPA 1EX9A 2FUKA 1QIKA 2CBGA 5CBKA 3ESAA 1LBTA 4X97A 1CUVA 4HRYA 1I6WA 2FJ0A 2ZVDA 2QKYA 4B84A 1XKTA 5AKHA 1A7UA 2QUBA 3M81A 5HF6A 1HBJA 1VA5A 5T4HA 3IB3A 1ORWA 4UHFA 1YAHA 1CR6A 3WMRA 2XMDA 1NX9A 3WA6A 1N8SA 5DNVA 3ILSA 4KE8A 5KWJA 1N5MA 1BE0A 4L9AA 3SX4A 1CPYA 1A8UA 3WWDA 4JUIA 3ZLVA 4ZWNA 1QTIA 1KU0A 1JFRA 4K2AA 3W2TA 4YPVA 4JYPA 4EY4A 1AC5A 2QRUA 4U2GA 5A62A 5HZGA 4B81A 4O08A 2XMZA 5DTIA 5EIHA 3MUOA 3AZQA 3G8YA 3T52A 3N0TA 1FFBA 3TJMA 3OTQA 2WFLA 1UKAA 4X3CA 3GA7A 1DTEA 3D2CA 2WU4A 3NWOA 4UBNA 2X5XA 4MJ3A 3KDAA 2XUHA 3I2KA 4QDUA 1MX5A 4BC1A 3BIXA 1XZLA 4HRXA 1E8NA 4CI9A 2HDWA 4FBLA 2GYWA 2G5PA 1E89A 3PF9A 1GQRA 2RONA 3D2BA 5ALIA 1AMNA 4I19A 3I1IA 4K6KA 4GBGA 3FBWA 1DT3A 5D3KA 2IIVA 4Y2VA 1WM1A 4WDQA 1MNAA 3BF7A 2DFPA 5AI5A 3O0DA 3D7RA 1G5FA 1JJFA 4H7FA 4B9EA 1ZGCA 4MYSA 5JIBA 1ZI9A 3ANTA 2H7CA 4AZ3A 2DHEA 5JD4A 5JARA 5ALWA 1JU4A 1QIFA 2DR0A 4EA6A 2OCKA 1LPNA 4FMPA 5CTAA 2C5FA 3GELA 1SC9A 2PX6A 4WJLA 3ZI7A 2WJ4A 2ZYHA 3LCRA 2VSQA 5E4TA 1GPLA 1XKLA 5CXUA 3AZOA 4LYDA 5ESRA 1YS1X 4DLNA 4BDTA 4FKBA 5LIPA 2V97A 3C6XA 5HKAA 1W75A 2GBCA 4Z49A 4OD0A 5K3FB 4QWMA 4H0CA 2JGMA 4IH9A 2ONCA 1GXSA 3STXA 3PUHA 5AICA 5FLKA 1UXOA 4HXGA 1QONA 3T4UA 1TCCA 5ALKA 2BGRA 2XMQA 1ODTC 2E3JA 3DQZA 5AH0A 5LYYA 1Y7IA 5E4JA 3EBLA 2JGEA 4KRXA 4X93A 5JAUA 2OQIA 1EHYA 3NUZA 3PF8A 4B85A 2XQFA 1XLWA 2ZYIA 5A6VA 5ALMA 5BWBA 5A7FA 4LYEA 3ANSA 4DNPA 3FYUC 5C7YA 2BUCA 2WIDA 3HXKA 2HA2A 4BCDA 1E66A 2XUKA 2WSLA 3BJMA 1XZDA 3C70A 1ZGBA 1EB9A 5FOQA 2BJHA 1LBSA 1HDEA 2OQVA 4ZV9A 3QM1A 2RIPA 5JAOA 1CIJA 1X70A 4KAAA 2OAGA 2AJLI 1TK3A 3BDIA 5LKAA 1XROA 1HL7A 5D7BA 3SC2A 4QA9A 5FXMA 4MQLA 5JD5A 1YB6A 3H17A 1P0MA 3CXUA 2GYUA 4N8DA 4DMCA 1XQVA 3OURA 2QS9A 3H19A 2HA6A 5C8VA 4ARAA 2JIDA 4UBKA 3VVMA 1SFRA 4IH4A 4Q34A 1QFSA 2DHCA 1J1IA 4Y2SA 1IZ8A 1CQWA 1VA4A 4Q82A 2QXTA 3FNBA 4CCWA 2EEPA 2WKWA 3HLKA 2WG2A 5FP0A 3C8HA 2VTVA 3NGMA 4WFIA 2AJBA 1EVQA 2C0PA 3ESBA 5LZ2A 3E4DA 5F4ZA 5AKGA 1H2ZA 4LXHA 4MXDA 1AGYA 4OUKX 2PU5A 4Q05A 3I6MA 2I3DA 2GYVA 1JMKC 5ALHA 5ISMA 3DOHA 4OU5A 3HZOA 4C88A 3TRDA 5AM0A 5JD6A 5EIAA 1S8OA 4EB0A 4QWWA 4KRYA 3MUNA 1Q0RA 4QDXA 2XUGA 1Q84A 4D9JA 1Q0ZA 3G0GA 4HTAA 2Y6UA 2HFKA 4J03A 1WB6A 3UUEA 2PU7A 2YH2A 1JI3A 3EQ7A 1MAAA 3HJUA 4FFVA 1XZGA 3QMVA 2XUAA 1AUOA 1H22A 3IIIA 4B0OA 3L1IA 2W22A 1XQXA 1LPBB 4W1RA 5AOBA 2H7YA 4LXIA 1ZIYA 1XZHA 3V1NA 1B41A 1UOOA 3WQHA 5ALPA 4OSEA 1C7JA 2BUBA 3W9UA 3R40A 2OAEA 3IVMA 2HFJA 1BROA 4E14A 1OXMA 2HA3A 2WJ6A 1CUFA 3CCBA 5JADA 4DSZA 2LIPA 5EFZA 4DNOA 5AM5A 3RARA 3HI4A 4B80A 2HA7A 2CMFA 3QH4A 3U1TA 5JZBA 2Z3WA 2WIJA 3W05A 3D2AA 4NMWA 5LZ4A 4JH0A 4H7EA 2OPHA 4UHHA 1DWOA 2PSFA 2XMCA 1UK8A 3QITA 2PPLA 1DINA 2BUAA 2ZYRA 4C6HA 3FAKA 4JYMA 4ZV7A 5DLPA 3E0XA 5ALSA 5A2GA 1X2EA 1EINA 3WIBA 3PFBA 1CUHA 3IUJA 1O6GA 3CN7A 1ACJA 5CH5A 4QDTA 3AIMA 2QZPA 3IULA 3PDCA 3FVRA 4G8DA 5AKYA 2RGUA 3VXKA 4W63A 5JYCA 4GLBA 1UZAA 2DCMA 5FPPA 3ED1A 1KU6A 4AMYA 2HM7A 2C0QA 3A2LA 4BVLA 2CZQA 5A7HA 4H35A 1DX4A 3D3NA 4K6HA 5LZ8A 1CV2A 1DQYA 1VE7A 1ZJ4A 2CB9A 3R0VA 5AOAA 1JT2A 1VZ2A 3DKRA 4OU4A 1ZOIA 3H2KA 3W04A 1XZKA 4G1FA 1QJ4A 4J0GA 5ALLA 4DIUA 4CCYB 3WK4A 2VT6A 4UBJA 1RYYA 4FNMA 5ALVA 2AXEA 5BOVA 1HKHA 4C4XA 3LS2A 5CW2A 3CN9A 4L72A 4DMHA 2GBIA 1XRNA 4PO3X 4FFWA 4X6XA 1H23A 3WWOA 2AJDA 1UFOA 4ZREA 4EUSA 1JJBA 4YASA 1EDBA 1MT3A 5K3DA 1YAJA 3VISA 2XUIA 5FV4A 5JAHA 3V48A 2UZ0A 2OGSA 2B61A 2WG0A 4AMZA 5K3BA 3WL6A 3FVTA 1EXWA 4B0PA 3DNMA 1XZFA 5ALUA 2WIGA 4IQ4A 2QJRA 4I3FA 1SCIA 2R11A 4Y2UA 4FLEA 5HF8A 4QNNA 2I03A 3IDAA 1JKMA 3R3WA 3IA2A 4UBIA 2WFZA 4MWSA 1MX9A 5AI8A 5IVKA 5SYMA 1A8SA 4CCYA 2O7RA 4X6UA 1CUDA 5JZ9A 3RKSA 3G0DA 3KWFA 2IITA 3HSSA 2BFNA 2JBWA 5EHXA 4W1QA 1MPXA 4MYDA 5DTJA 3C6ZA 3KSRA 3AINA 1Y37A 4M0EA 4E11A 3R3UA 5I7UA 3QPCA 1H2YA 2OG1A 4OB6A 3DLTA 1GPNA 3F8SA 4GEGA 2JGIA 1WHTA 4G4GA 1ACLA 4Q3OA 5CXXA 4Y9SA 2NW6A 4C01A 5ALXA 5AM2A 2ZJFA 4W9RA 4DNQA 1BU8A 5IVDA 2VF2A 3PE6A 2C5GA 4UHEA 3LLCA 1ODSA 5CT9A 2AJ8A 4A23A 1ZI8A 2H1IA 4AQDA 1THTA 3WZLA 1SCKA 2QOEA 3DOIA 5AOCA 4KYVA 3C8DA 5T4EA 1XLUA 3M82A 5AK5A 4UFOA 3JYHA 4PQEA 1Z68A 4E15A 3UMJA 1XZCA 1MU0A 1XRLA 2RAUA 4OB8A 4TVKA 2FJPA 3RK4A 1BS9A 2Y2VA 3WKAA 2XQJA 3AIOA 2QM0A 1WPRA 4FHZA 4KR0A 1YB7A 2HHAA 3QBJA 2IX9A 3RLIA 4H7HA 5CT5A 4ZI5A 4BRSA 3O9VA 3KXPA 1AKNA 4LHEA 5D6OA 4YX9A 1Y7HA 1XRMA 5EGNA 2O2GA 4TGLA 1K63A 3U0VA 1EI9A 4AB1A 4CG3A 3Q8WA 4X94A 1UOPA 4CFSA 4DMFA 4WY5A 3WZMA 4RE6A 4C87A 3O9MA 5HQ3B 5KWIA 2B9VA 4BZZA 3C87A 3QVMA 3WJ2A 3I2GA 2PVSA 4AO6A 2ECFA 1ZD5A 2OCGA 3HYSA 1F6WA 5I8PA 1QIHA 4NZZA 4KE7A 4U2EA 1E8MA 2CKMA 1CUUA 1R88A 3WL7A 4NS4A 4UHBA 4J0CA 3HC7A 3IURA 3DJYA 3L1JA 5HK8A 4ZGBA 1YS2X 4P08A 1CUYA 4N5IX 3VKFA 1CVLA 4FLMA 3SK0A 4PV7A 5AJHA 6YASA 3OM8A 4UFPA 5AIAA 3V1LA 5DNWA 3KOOA 4HZGA 2WTMA 3I2IA 3F96A 2XDWA 1CLEA 4ZXFA 1R50A 3IBTA 3H0CA 1K5PA 2K2QB 4CG1A 2ZYSA 4BDSA 1H2WA 4INZA 4BP8A 4GHWA 1KEZA 1U65A 2J3QA 4PSDA 1UKBA 1CUBA 1XFDA 1TCBA 2XQKA 3M3DA 4BVKA 1HQDA 1U8EA 2O2IA 2VJBA 4ARBA 1MJ5A 4UBOA 3H2JA 4H18A 3OC0A 1R4ZA 4AZ0A 4PF1A 3LIPA 2VT7A 2ZSIA 3FCYA 3FYTA 4BYMA 4Q3LA 1TIBA 3A70A 1QIEA 4AXBA 3AZPA 1CFJA 2GBFA 4H7KA 4PSCA 5AKJA 1CUEA 3I28A 3FLEA 1W4LA 4AN0A 5AKLA 5C8XA 1G4HA 1CUWA 5ALJA 1VLQA 5BV7A 1LPAB 4N5HX 1UWCA 2WLSA 2B20A 3C6YA 3AILA 4RE5A 3WA7A 4FBMA 4UBLA 5ALNA 2D5LA 1GKKA 4BC0A 5CT4A 1TAHA 3GROA 4HAIA 2GZRA 4M0MA 1LZLA 1H2XA 2DQZA 3V9AA 1ODCA 1J2EA 3O4JA 4GI1A 3DD5A 2WHQA 4GW3A 4X90A 1ISPA 2QTBA 3JWEA 4P92A 1K8QA 3RM3A 3TGLA 2WILA 2C7BA 4WDRA 5JASA 5IKXA 4KACA 1PJAA 3AFIA 1CUAA 2C58A 2XMGA 1R9NA 2XMBA 5AI9A 5JALA 2WM2A 1IUPA 3O95A 4ZRDA 4Y2PA 2EDAA 1IUNA 4BATA 1LPOA 1T2NA 4DTCA 3H1AA 5EHNA 4G4JA 1QO7A 3TEJA 4H7JA 4CIAA 3C5WP 1ZIXA 5C81A 2V9ZA 4X6YA 2YASA 3M83A 2GZSA 4EBBA 3FOBA 4U2FA 4AO8A 4E46A 3B12A 1C7IA 4RNCA 3HEAA 4LXGA 2WHPA 1ZD2P 4LIPD 3WK7A 3FLAA 5K3CA 5AI0A 3S2ZA 1QOZA 4MQMA 4UUQA 4BCBA 5K3EA 4HXEB 1F0PA 1DQZA 5SYNA 3G9ZA 1FSSA 2PSEA 2WFLB 2XUDA 2H7XA 4CG2A 1QTRA 1EVEA 3EF3A 4Y2RA 1YA4A 3HACA 1QIMA 2JGJA 3V1MA 5ALEA 2B4KA 3C43A 3L1HA 1NU6A 1VOTA 4EY5A 1WOMA 3N2ZB 4ITVA 4MEBA 3PFCA 1UK7A 3G0BA 4N8SA 3X3HA 5C8ZA 4XWGA 4U2BA 4XVCA 5AM4A 1CUSA 4G8BA 3B5EA 3EIOA 5AHXA 5K3FA 3WKBA 4RPCA 1QIDA 5I9IA 1O6FA 2PSHA 4RGYA 2WIFA 1ORVA 4ROTA 2QUAA 5EHQA 5HFNA 4Y2XA 3GZJA 2WIKA 1CEXA 1G42A 3FLBA 5ALYA 3WYNA 1F8UA 1GT6A 1N5RA 1QZ3A 1A88A 4IH1A 3JW8A 5LZ7A 1BCSA 1XQYA 2QMQA 2PSJA 2RI6A 2XUPA 4W1SA 1HPLA 2Q0XA 5AM1A 2DHDA 4J0IA 1FFCA 1JJIA 1XRPA 4I4CA 2XUJA 4OYYA 1CQZA 4KAFA 3SWWA 1QIGA 2VJCA 1WPXA 4Q3KA 2XE4A 4X95A 1ETHA 4EY6A 1AZWA 4MEAA 2QXUA 4J3JA 4J0KA 4HXFB 1DWPA 5AI4A 4ETWA 4X7BA 4J0HA 2WUEA 3G9TA 1SOMA 2YYSA 1N1MA 4GECA 2XQIA 5DWDA 1W6RA 3GFFA 3ZWQA 4JNCA 5AP9A 4B9AA 1QO9A 1D07A 4DMKA 3STWA 1OILA 1CUIA 1ZD3A 3E3AA 3G9XA 3WK9A 1P0IA 2ZJ6A 4WY8A 2FX5A 3OPMA 5AKIA 2V98A 2PSDA 4H7DA 5K3AA 2V96A 4B7ZA 4UHDA 4HVTA 2HU8A 2PL5A 3P2MA 4WCVA 1FJ2A 3I6ZA 5EIEA 3Q0TA 4UPDA 5T4FA 4KEAA 3H2GA 3BXPA 3WKDA 4DSAA 2X76A 5FPQA 5DYTA 1WCYA 3DEAA 4G4IA 4C89A 3C5VA 5HKBA 4UFNA 4B82A 1QIJA 2WTNA 3VDXA 1USWA 3A2MA 2Z5GA 2WJ3A 4KAJA 1FFAA 2HRRA 3A2NA 1R3DA 1EA5A 1HLGA 3WLAA 1DX6A 1E8DA 1XRRA 3WK5A 5AI6A 5AK4A 5AK6A 3CCCA 2O2HA 2P8SA 1VXOA 5LLSA 5LP1A 2PUJA 3C6BA 1W76A 2WHRA 2BCEA 2XUQA 4V2IA 3FYUB 5ALGA 1LLFA 4BRZA 1VXRA 1E5TA 2JF0A 3FWHA 1BRTA 1DU4A 4AO7A 1P0PA 4OPMA 2BGNA 3G0IA 5HFAA 1XZBA 2CEKA 3ICVA 4FNGA 4F5ZA 4FOLA 4X85A 1C4XA 1MTZA 2PBLA 1XQWA 2I78A 2G4LA 1L7AA 2ACKA 3H1BA 5AKKA 3QMWA 1UKCA 1QE3A 2G63A 4Y2TA 4AX4A 4DYHA 1XRQA 2XB6A 1UK9A 3STTA 2ES4A 3FSGA 4NVRA 3C45A 1WB4A 3ICWA 3HRHA 3WJ1A 4EY7A 1CUXA 3F97A 3WWCA 4U2DA 3F9CA 5CURA 1UOQA 2VQ6A 1YSCA 4G5XA 2J4CA 2WHPB 5YASA 3WIOA 5HF5A 1XLVA 1ZJ5A 1YA8A 2XT0A 3O4HA 2J4FA 1YCDA 2GBGA 5LKRA 3F98A 1QLWA 4U2CA 2WUDA 4KJXA 1BEEA 3HABA 1JMYA 2Y6VA 4OYLA 1JU3A 3DCNA 4X92A 1PFQA 5ALDA 4QEKA 1B6GA 4A5SA 5IVHA 2WG1A 3VJKA 3DYVA 5CT6A 2D0DA 1EH5A 4L0CA 3PUIA 5E2IA 5HQ3A 3ESCA 1DWQA 1WHSA 3FCXA 5FDFA 1TRHA 2WU3A 2Y1KA 5LZ5A 4G9EA 5DYWA 1LPSA 4F21A 2H9YA 4BZWA 4X71A 4J0JA 4KE6A 5AK3A 2OLEA 2OCLA 3QMMA 1MAHA 4XIIA 5ALFA 1W1IA 3QZUA 1L7RA 2ACEA 1THGA 2HIHA 1YR2A 1CUCA 3ZPXA 3DKKA 2RHWA 5K5EA 1CUZA 5HCUA 3G0CA 5IH7A 4FLFA 1QGED 5E4YA 3H18A
chains in the Genus database with same CATH superfamily
3AETB 3EIUA 3M5CA 1MOPA 2QJWA 2P65A 3GRPA 3L82B 4N82A 3Q7EA 1JRLA 4B71A 5J3JA 2AZDA 3JZAA 4H3HB 3R7WA 1GNQA 3B6JA 3VSEA 2WD7B 2NTJA 1EESA 4OJMX 3GJQA 4R2IA 4P6VF 2AOUA 3VMFA 3ZOZA 1CEYA 3D6TB 2QN2A 2HA5A 3PCXA 4MRVA 2FEMA 4PBTA 4PSUA 1Q1AA 5H0IA 3TOVA 5K9ZA 5KNCD 1DRWA 2JD0A 2WFMA 1KDPA 3EQ8A 1OWOA 1U4SA 1PFUA 1QXSA 3CZPA 3LIIA 4LHWA 5J2TF 3B6KA 4X00A 1A8HA 5C4GB 1OLSA 4F4FA 4TKUB 1JPVA 3NKFA 4ZP1A 4F56A 2Y71A 3WYDA 1LDEA 3CYFA 4XGQA 5IDQA 2RHOA 3MINA 4R8LA 4JYZA 2UUOA 5LYJA 3V46A 1FXSA 1I4DD 4G0OA 1RSZA 3MLAA 5BN5A 3DO8A 3EHEA 3AM3A 3E8SA 4JOBA 1B2LA 2DCUA 4NL4H 1P3DA 3BA6A 1HE1C 1U5BB 5A71A 3K9CA 3EQ2A 2H2FA 4N0QA 3GLGA 3QEAZ 4QUDA 2OFFA 4U5QA 4JI8B 1HX7A 1P44A 2RHLA 3TDNA 3ROGA 2VJYA 2MSEB 1PHRA 4KO8A 1Z12A 2VBGA 3N2IA 4X3PA 1CUJA 4ARZA 2HF8A 3WXMA 1ADJA 5SY4A 3GBPA 3STUA 3YASA 4L3WA 1NATA 5AVZA 3N0WA 4MQFB 1LPMA 5ALQA 5LPNA 4LK2A 3R1IA 4OBEA 4XQCA 2ZBUA 1ES9A 2JZNA 3ZV7A 3H4TA 2EFEB 5C0OE 1QYVA 4FQ8A 1I1NA 4I1YA 3SZRA 2DHQA 3SXJA 1TTHA 1AKYA 4LRWA 3REOA 1BD3A 2FSHA 2H1FA 2HREA 3K2EA 3MJRA 1SKYB 2HR1A 2W8BA 1V11B 1KQOA 3E22B 1JTFA 3NHWA 3ZLTA 1KI8A 1R6DA 4QTXA 2ZCJA 1KS9A 1WUTA 3R3ZA 2FPPA 5T67A 3QBTA 1VG1A 2W4QA 3OWOA 4KQ1A 3WE7A 2O1SA 3OJWA 4IPTA 4MS4B 1BEZA 4OM8A 2ZJOA 5EXDA 2BHNA 2NUPA 3IP3A 4LOAA 4JA2A 2O8VA 2ST1A 5LMNB 3DDZX 1T6BY 4EITA 3K1ZA 2ZYAA 4YRZA 3L05A 4V0QA 4B6GA 5GP1A 4ZT3A 1DAPA 1EM8A 2GCPA 2R1UA 3KJGA 4N7BA 1PEYA 5A5FA 2ACVA 5CT8A 2HF2A 1NY5A 4LDNA 3KL4A 1E1DA 4D6PA 1J9ZA 4K6MA 2ARKA 1VYUA 4NBUA 1KS2A 4Q3EA 4WZBB 4MKHA 1LK0A 4GX1A 1CWUA 3G13A 3FNRA 4Y1FA 2AOUB 1AD2A 3F67A 2E6KA 4FYPA 4NU8X 3K72B 3P2OA 2GPTA 3DHYA 2C5LA 5JI2E 3M3HA 3GFQA 4V0SA 5KREA 2VHZA 4A5OA 3I61A 2YNMD 4OAPA 1J06A 2PCLA 3CW2A 1WB5A 5CH8A 1LSUA 1T2EA 1OLSB 1XZAA 4AMBA 5J40A 3WGNA 5ENZA 5JSZB 1DKRA 2VAMA 4UZSA 2X4IA 3EMDA 3FYUA 3GPIA 3GO4A 3HJBA 3FVWA 2B1RA 3G8DA 3OHPA 1LDYA 3D3JA 4YGXB 2R5WA 3DAHA 5K7SA 4JX8A 4Q4AA 1C9YA 3K4PA 5DT2A 1JSLA 4H7IA 2OHOA 4AS3A 2WUVA 4PIMA 2ZR7A 2ETXA 3B5JA 3QVTA 5TPZA 1JJVA 3MMSA 4AKEA 1V8PA 3JASA 3A1DA 4GKKB 1U2EA 1UBNA 2QL7A 4DSUA 1SH7A 4ZRNA 3WK8A 3K2BA 1JHOA 3I92A 2O8FB 4WN9B 2QRKA 2DWOA 4NNOA 4GBED 1EZZA 3AKCA 3T38A 5FHRA 3DCIA 2VAXA 2PTGA 3D9QX 3E9YA 3MK31 1JJ7A 1GPAA 1N5JA 1E6KA 2WKPA 3BRCA 3AESA 4ZCTA 1UADA 4G0UA 4CL3A 4IW3B 1ZAYA 3AIKA 2WNIA 2WYVA 1F4VA 1VTKA 2FSFA 4M76B 4BFSA 1KK2A 1CDZA 1XP5A 1UL1X 2OGTA 3WGYA 2QY6A 1CRQA 1ZCZA 2XAAA 2X41A 1WD7A 2H4WA 2H1RA 4EUHA 1HYQA 2BAGA 3I2JA 2QB5A 1KDRA 1LCIA 3E22A 3G17A 2X22A 3W4KA 5CRIA 4BO6A 4KR7A 2IYFA 3BJEA 3BSFA 3A58B 1W4RA 3IDOA 4P4NA 3IP9A 4YMWA 2F55A 4ZZIA 2EBHX 4DUGA 1QGOA 2OD7A 2BKLA 1F7VA 4OB7A 1R8QA 3EPLA 2A94A 2JS7A 4IO0A 3E8XA 4BB0A 4MS1B 2VQFB 5K0LA 4OCZA 3WK6A 3OOSA 4Q0MA 5EHZA 2GZ1A 4JEHA 2TMYA 1UJ4A 2V7QD 2FUG6 3JCZA 1TTQB 3G5MA 3MCAA 4G0NA 4YRCA 3RTCA 4LMAA 4ETNA 1PZNA 2ZJ3A 4RSHA 1SVUA 4LYYA 3I23A 5JS1A 4JIGA 1U2ZA 1YCHA 4CQJA 5GV7A 1BGVA 1KZYC 4TTJA 1HFEL 3E58A 1E6EA 2HLPA 4FZRA 4TZ0A 3GLUA 4HUJA 4D8YA 5DCYA 5DMHA 3B3FA 1GAXA 4TRJA 2PPVA 5IT0A 2YYZA 4ZARA 1S4MA 5IEBA 1RWQA 2XE6A 2VJDA 3U9LA 1N0IA 4LKOA 3AUAA 3NDRA 4QG7A 2AFIB 4DKXA 2EEZA 3P4UA 3ZTTA 1J9GA 1D2EA 3OM1A 2AF3C 2AF4C 3A6ZA 1GZ5A 3DZFA 3L8FA 4O1HA 5CHYA 5C2JB 3TVTA 2CY0A 3IERA 2DPHA 4Z86A 4RZHA 4EJSA 2GZ3A 5HQTA 4W5RA 1E4YA 3CF4A 2D2FA 2UYGA 1USVA 1R7RA 4R1OA 3U19A 3GWZA 3C98A 4ZICA 2I34A 4LF6B 4RK0A 2AJTA 1VJ5A 2WUFA 1FP2A 3WSVA 2EXXA 4HGPA 1EB8A 2DFKB 4GYYA 1JX6A 1M83A 4P31A 2I2BA 2ERYA 4Z1OA 4QLOA 1ZXXA 3SDZA 1CEEA 1YQUA 2HU5A 2OMEA 2ZEJA 3KS9A 4JUDX 3KJZA 3E81A 1C30A 2J41A 2Z2YA 4B2YA 2I3ZA 3ZLBA 1YQWA 4N5LA 1IL0A 3JQ8B 4RESA 1KJNA 1GPKA 4PLGA 1QKJA 1P2DA 2XVYA 1G9SA 4HS9A 5F5LA 5FI5A 2JGKA 4P7FA 9MHTA 1ZNXA 3LOPA 3PLRA 2ZI4A 3FUVA 3L93A 5CX1B 1X9IA 3WL5A 4TMWA 3EVTA 3M5DA 2JGLA 2X5OA 3NDBB 1IJEA 3E5NA 4EECA 1XZIA 3Q3IA 3QPDA 1E9VA 5JSKA 3OPXA 1PQUA 2TSYB 2R8BA 1WTAA 3MIIA 1YR3A 1LS6A 4D8TA 3L6BA 1J21A 4WN3A 4ND8B 1E2EA 3ZE9A 1ARZA 1WR8A 5D1HA 1W2GA 3RSOA 1ODIA 5ER9A 2QD5A 2H65A 2HEIA 3AR9A 4X1IB 1UEJA 4KWEA 4RU1A 4ZZ3A 1T35A 2CGEA 3COZA 1RLOA 4XM1A 3ZHTA 2WYUA 4PU0A 4C4TA 1F9AA 4Y9UA 4RTMA 4ZYYA 3BMQA 1V45E 2D4AA 5FI1B 3UWMA 1G3RA 3KTAB 1VQ1A 2ZU0C 4C04A 1UJMA 4BO1A 2OSVA 3FGZA 3HXOA 1Q91A 2XYRA 3LJKA 4HUQA 3G8CA 2ZUSA 5AUOB 3DTVB 3L1VA 1TQ8A 4KVFA 5EYPA 1A8QA 1HYBA 4ZOBA 5IP5A 1MZVA 3KDPA 1COWA 5B2FA 1G6HA 2FPIB 3AVQA 3EZGA 3GDWA 3CG0A 3QA3E 5ILOA 1O9GA 5FFMA 1Q0TA 3R3YA 5GY7A 2O0JA 4DA0A 4YMGA 4KI0A 3MSCA 1ZN9A 1AUXA 3GAMA 1X9HA 2C7GA 3O84A 4UDOA 4B6RA 3QEOA 1G64A 1AKVA 1QORA 3AJAA 1UT8A 3GEBA 4JR1A 4PWZA 1RYFA 2WMDA 3MTGA 1N7GA 1P0QA 4TQGA 5H9WA 5LXTF 4PO1A 1SUPA 3GARA 5FWNA 5CD9A 3LU1A 1DQRA 4I50A 3GUUA 4P3NA 4Q15A 4UDNA 3W2GA 1I3KA 1LY1A 2PA3A 3GP5A 5FUMA 2J0VA 1W0JA 2C07A 2Z09A 4QPNA 4D9EA 4DLYA 1OFTA 4ZYZA 3WGVA 4YR7A 2PMCA 1EP1B 1QH0A 2EDCA 1MC8A 3V1KA 1JE1A 4PLHA 5I7VA 3DB1A 1ZICA 1NFRA 1W44A 3O2NA 4KH0A 4MVJG 5TEWA 1VJTA 2VJAA 3JAMA 4RMJA 1OTXA 1ILWA 2OHGA 1DHTA 2EQAA 1E7WA 1BS1A 1IMJA 1Q5PA 2ORYA 4I9GA 4CI0B 4C0KA 7YASA 3W5CA 5KBYA 3CH6A 2BFCA 3SZ3A 3TD2A 4N8EA 1CRPA 3LPAA 3ZCTA 5IAJA 3UHOA 3EIEA 3ZZ1A 1NAIA 3SZOA 2VPTA 6AT1A 2EKPA 4F0JA 5FTLA 2OXEA 3HM9A 5CBPB 1G2QA 1RM0A 3IBSA 5SYAA 2Q0SA 3T3MB 2HSWA 3QE4A 2JASA 3HO8A 3GVHA 2BVNA 1N0UA 2OHJA 1JFFA 3R3VA 4JZKA 3QYJA 1WJGA 3SJCA 1WMSA 2FPRA 2A3RA 2QT1A 2IK8A 5JATA 1RRMA 3QVSA 4FBGA 3RVNA 4PNEA 2N42A 3O82A 3T0GA 1Z17A 2EZ9A 2DWQA 1QHHB 3KEQA 3ZJ4A 3R0JA 3TPCA 2PM8A 5HE8A 4F46A 2GAJA 3UW3A 1WF3A 4OLBA 1Z3IX 1XZJA 1IEXA 3QE3A 5IAGA 4X3OA 1Z4KA 3U3OA 4OMCA 1LW6E 3P0IA 1XEXB 3C7AA 2DOKA 1LZKA 4Q6WA 5JFOA 4DG9A 4F5EA 1RZUA 4YAEA 1LH0A 4CU2A 4DM7A 4UAGA 1A2KC 1V41E 3CVWA 1J8YF 1NGSA 2CLLB 4WFKA 4GPZA 2IBSA 4KMSA 4N41A 2M6SA 1NVGA 2ZE6A 1L3CA 1JDTA 3P2KA 4NYIQ 3OLVA 4IGKA 4AFNA 2JL1A 2GMWA 2PRIA 2XOKD 5KYGA 5KNCA 1NMSA 2EIHA 1NMEA 1TKRA 2PX5A 1WCV1 3NC1C 1LUAA 2C8JA 3B3QA 4NOMA 4RYDA 3S2GA 4QDOA 1NF3A 5IAKA 1P8JA 4CKEA 4DXAA 3IUQA 4OGWA 1E3SA 5DTQA 3QXGA 3B48A 5DBIA 4ZVKA 1Y8AA 2WZQA 1GNLA 1QH9A 4JI1B 4EW6A 1UBKS 5DRTA 4JMLA 1EJ2A 2EVWX 4Z9YA 4EI9A 4E5SA 2IUTA 2XTNA 5JH7B 4TLBA 1S1CA 2L17A 3ODGA 1SUDA 4AN1A 5CFZA 2VYVD 1EZ1A 5ETJA 4GGPA 4L51A 2CMHA 1P1HA 2HTEA 4LQLA 3WKEA 1RRKA 4JGIA 2XDYA 1U11A 3NV7A 4CQMB 4AWBA 4IWNA 1FNSA 2YXPX 5EI5A 1T9DA 2RHTA 1QDEA 5DGTA 3WGZA 4B7XA 3LLVA 3JQBC 5EEGA 1XAIA 5DBGA 3RU3A 3I62A 5K1ZA 4G0PA 3LX4A 4I1RA 6CHYA 2X0IA 4DAOA 1YWGO 1EX9A 3BT7A 5F1OA 1Q44A 3VVCA 2V0GA 1VCHA 2W0MA 1QIKA 1S6YA 2G71A 5EERA 2FG7C 2QHXA 1M2GA 1NULA 1VKNA 2EHJA 3SOZA 4ARVA 2H31A 2JJ1A 3FJ1A 4NTZA 1PTJC 2VHWA 4G5GA 4LCBA 1UZNA 1T3TA 1YIDA 3HKEA 3HL4A 1DXOA 4OYRA 1CUVA 2OA0A 1Z25A 4HRYA 1I6WA 4OM7A 1FEZA 4RFLA 2K7FA 1RRGA 2E49A 1B0AA 2R66A 4HMPA 3E70C 3J80A 1SKMA 1P9RA 3ZTWA 1PCXA 1XKTA 2O2DA 5HRCA 1WP4A 3IVXA 4GOOD 5J2UF 5AKHA 4GICA 3M1LA 4BQPA 4R9SA 1YRWA 3SXUB 3LLUA 2FEXA 2WTBA 4Q7KA 1RAEA 4GYWA 4E0BA 5F3DA 2IHNA 3JU3A 5F2OA 4RXMA 3ZNPA 5EEHA 5C8YF 3IBCA 2C1XA 4G5SA 4XR4A 4DJJA 2D5BA 3SSMA 3GLIE 1AGRA 1HBJA 1KKMA 4OIMA 4RLHA 2BZGA 3AH8A 2YXEA 4QJ4A 2NVUB 3WJ7A 2XOXA 2RD2A 4LVOA 4YV1A 1WMBA 4ZZ1A 4RTJA 1ZMOA 3TRFA 3COJA 3K9WA 3WMXA 1CR0A 3NANA 1IY9A 3X2EA 4NCAA 2ECPA 2ZPTX 1IVSA 4PYRA 5FUVA 1N8SA 2R8RA 4UU8A 4I1VA 3NBQA 4KE8A 5IM4F 1VE9A 1H05A 1N5MA 1CZUA 1BE0A 1AHNA 1ISJA 3CZQA 4Y2HA 3ZYZA 2PZEA 4RCVA 3SX4A 1U3CA 2VPPA 3WISA 2CLEB 2GWRA 4CIYA 2XWQA 4W7SA 3ZLVA 4QM7A 1LQTA 5IAOA 3PC3A 3ZKWB 2QRQA 3V2GA 3DKVA 3L7YA 1GZVA 3QYPA 3C3WA 2ECOA 4QODA 3W2TA 4EEXA 5EXSA 4ENWA 5GZ3A 5LSAA 5J4KA 1T9KA 3WYEA 4F4DA 2WF9A 3I72A 1V6AA 2CLFB 3UT5B 2CLCX 2SECE 1AJEA 1RRPA 1SC1A 1OH6A 4U2GA 3TLMA 1QGDA 3NORA 1Y8RB 3HXLA 4HRAA 4QBTA 1TVCA 1U7WA 3BB4A 2P3LA 3QLVC 4PGGA 4CCAA 3HJTA 5HZGA 2HWKA 3HWWA 5EIHA 3GEPA 3HJNA 3AZQA 4MO9A 5FV4A 3LDFA 3T52A 3N0TA 4YT2A 1FFBA 1VL8A 3N8KA 1USGA 4Q93A 1TJPB 3SEFA 3L18A 2OBLA 3EJWA 2NAFA 4M53A 3TW8B 4GOND 1JIQA 3L4EA 5BT9A 2XVAA 2NM0A 3ZDYB 1PJ4A 1FVXA 5EJGA 3G23A 1T1RA 1J0BA 2OECA 3I58A 4Q00A 4WLUA 5BWNA 1I94B 3R7NA 3ZWAA 5KJ6A 5KYYA 4TRNA 1PRYA 1YRAA 2B8EA 1PGPA 2RG7A 1GGFA 1PL6A 3FZGA 4N12A 1SUSA 2HSEA 5EUQB 5AJUA 1XTJA 3BIXA 4KNWA 1XZLA 4FE4A 4HRXA 1O1YA 3FUCA 4F06A 2X1LA 4JP8A 2VCYA 2HDWA 1P5FA 2G5PA 4HGRA 1TK9A 2OHIA 3IDFA 1IHOA 4X64B 1GQRA 1XPOA 2V7QA 1WUIS 1QHYA 1T1IA 5T6MA 3SIRA 1B26A 1XNGA 5K99A 2FQXA 1G16A 1RWNA 3D2BA 2H51A 4R1SA 2REQB 2G9RA 3T0FA 4IHKA 1Y8QA 4B5LA 5L45A 1T0IA 1NJGA 5H1YA 4L4SA 4RF5A 2WAXA 1JG2A 4I19A 3UF0A 1XTPA 3WQRA 4ANFA 1CY8A 1V16A 4CODB 3AVWA 1GQQA 3QXCA 4NPHA 5IARA 3ZY6A 1IEVA 3IOYA 3TFQA 2Q2OA 3OU6A 1TZ2A 1ZO8A 3FBWA 1IWBB 5HGJA 4DA6A 2P3OA 4AROA 3BXZA 4L08A 4Y2VA 1FYDA 3R0IA 1FJHA 1O95C 1RWMA 4LWZA 4BXOA 4B73A 3DG9A 2XSZD 4MX8A 1UR5A 5I9SA 5KOJB 5K8CA 3AQIA 2DFPA 4FSXA 1JJAA 3HU5A 1ABBA 3D7RA 4IDQA 2B8NA 1T2DA 4UEKA 1ZHOA 4W82A 4R84A 1Z2AA 4ZVMA 1AO3A 1EGAA 2NXJA 3AF2A 1RBYA 1A5AB 3KIPA 4OJTA 1JDUA 2NADA 2H7CA 1CCWA 3GU3A 4M88A 4NOLA 1Z2CA 5FA5A 3TNDA 4DIMA 1SC3A 1XU9A 4P7GA 3KC2A 3TH5A 1LSOA 1JAHA 1F8YA 1PJTA 2W6NA 3FG9A 4R40A 3X2SA 4GDFA 3AGPA 1MQ9A 3RU2A 4A0GA 3QFSA 5EKXA 5JARA 4Q7MB 4I99A 3F3MA 1LF5A 3DWGA 4G8JA 1KVQA 1QIFA 2DR0A 2H1CA 4A8HA 1UPBA 2BR5A 4LF5B 3I9NA 4G25A 4IDAA 5CDGA 3QHAA 1YDGA 2RI0A 3L7LA 4FMPA 3GT0A 3IQIX 3L0IB 3D7KA 4UMDA 4W9NC 2CV2A 2V45A 4C4RA 3D8TA 4RKRA 2PX6A 3ONFA 2Z2JA 3UMCA 4S0ZA 1JG3A 4FDUA 4YRLA 2C9YA 2WHYA 3VH1A 3IYLW 1EUYA 3TD6A 1HNWB 2VSQA 5E4TA 1JIVA 3GVPA 3N87A 4KP7A 5AW6A 2UYCA 1OXSC 4HDSB 2HK6A 1EDZA 4AUMA 5IK2A 4LZZA 3FYCA 4ITUA 1SCAA 1GHTA 4TLLB 4BV3A 3WX0A 3GLKA 1OFGA 3PEUA 4DLNA 4BDTA 4FKBA 4E1BA 1WXGA 1S9DA 3O8NA 5FWXA 3TSCA 5HKAA 4ZAVA 2JGDA 1WW2A 1W75A 1WW8A 1Y1SA 1DKPA 2O52A 3H87A 3I3SR 3L6OO 3DDWA 3PKJA 4GX5A 5DPMA 2W5UA 4QWMA 4GX2A 4RK1A 3E3NA 2IZ6A 1JAYA 3EFEA 3FPHA 3FR8A 1DJOA 3ROTA 1CNMA 5AVQA 3AFOA 4IMJB 5GADl 3MQFA 2ODNA 2RBGA 3K5WA 3M0EA 4LJ6A 3T3EA 4PZ0A 3AP3A 4M9RA 1A9XA 4C21A 2JIBA 1VBNA 3DZDA 3MQ4A 4QG3A 2CUNA 5MHTA 2GHTA 3E9QA 1U2PA 1QONA 1R2QA 2HH9A 2NQ2C 4D0RA 1B76A 1TCCA 1Y3HA 1QCDA 2Z83A 3PUKA 4JXXA 2IS2A 2D54A 1B14A 4L9SA 5IUJC 4CEIA 2WJIA 1TX4B 2JK1A 3KLBA 5AHOA 3TW6A 2IYEA 4C78A 1Z5WA 3TZHA 4CMCA 2M32A 5H8WA 1E61A 4DEXA 1WZNA 3A6PC 2WMOB 1E2PA 4YA6A 1KP3A 1ML4A 1J7KA 4MYTA 4PGMA 5FOXA 2BR4A 1OW3B 1N6LA 5K4GA 2PUVA 4I8DA 4KX5A 4OQDA 4UD2A 4DDKA 4S1TA 3BB3A 1N34B 4KRFA 4ZMSA 3H2BA 5BQPA 3J81k 1EHYA 1W7AA 3CRW1 3BSSA 2BN4A 2ZYIA 4OOFA 4WW0A 1CR1A 1TM2A 3FHOA 4B43A 3N75A 3IR5A 4XKJA 4YAUA 1HG0A 2EG5A 4OV6B 1WX1A 1ECJA 1YRLA 4LX8A 3Q9LA 5DVZA 2BUCA 4JBNA 2HA2A 2R1TA 2X6QA 3EXEB 3R6LA 4S1NA 1XTZA 1DGQA 3BJMA 4EL5A 2ZSDA 3GEGA 2IVZA 3VZQA 5SV2A 1PBTA 1I14A 3S1AB 2GD6A 3BERA 3SD7A 4JGBA 5FOQA 1LBSA 1YR1A 1HDEA 4OGGA 1R12A 1TEXA 3K0AB 3SNHA 4IIFA 3K35A 4JX9A 2RIPA 3C7TA 2YHUA 3L07A 5JAOA 4B7UA 5JVDA 3RS7A 1S96A 2XNDD 1Y1KE 2AXNA 4GMXA 2OAGA 1SXQA 1U2RA 2AJLI 2SICE 4IIDA 3ROFA 2X0JA 1TK3A 3TCNA 6GPBA 4MZXA 3T8YA 3L0DA 3A05A 3S2EA 1GP2A 1HL7A 1P39A 2YHAA 2TMKA 1NYLA 2WC1A 4FYHA 5FXMA 2EFHB 1Z5UA 1P2VA 2LXNA 3V3TA 4B7CA 2QAGA 1FDOA 3QEMB 3KYIB 3HRIA 4DJFC 1GARA 1YB6A 3D31A 3H17A 4Q01A 5EMHA 2BTEA 3NYWA 2PGAA 4O8CA 1P0MA 3CXUA 2J07A 2AB0A 2QSJA 3EA0A 5JBQA 2WKRA 4M6WA 4N8DA 1HDCA 1W4BA 3OLZA 5JHGB 3BC1A 3B1JA 4HDCA 4L02A 3HDVA 3DR3A 4JUAA 4E08A 2EW8A 2QS9A 2W71A 2J8ZA 3KUKA 1WB9A 3W5VA 2IXDA 1KJZA 1HK7A 1C0KA 3FDXA 3OIFA 4LJ5A 4WRRA 1E9CA 1EPUA 1XD2B 1DKLA 4MGIR 3RVBA 2DMRA 2JIDA 2OFOA 1H85A 1QX3A 3Q7QA 3IP6A 1J33A 4GPIB 1FLDA 4Q34A 2Q3BA 2V7XA 2IXEA 3EPPA 4UPEA 2BTQB 1IZ8A 1GGHA 3TQQA 4NMLA 2XVXA 1Y63A 3PNBA 2GR9A 2J9RA 2Z9DA 4CR7A 1J7JA 3AHGA 3GEEA 3O2SB 2EEPA 2R2GA 1VYVA 3CZRA 3P2IA 3NFYA 2Q27A 5H68A 1U1IA 1E9EA 1VG9B 4KYUA 2WKWA 1XVIA 5REQA 1Z5NA 3PX2A 2YZNA 4NCJA 1T0PA 4TWBA 3RC3A 3ZHSA 3NGMA 3HDJA 2GAOA 2YWBA 2OCBA 1JTEA 1W88A 1WSAA 2W6ID 4UCXA 5CLGA 3HKDA 5LP6F 3T5AA 3U0BA 3VNAA 4P3YA 3HXQA 1CT9A 3X1DA 1FMTA 3ESBA 5A04A 5KMGB 5LZ2A 5IH3A 1G4AE 2EJVA 1A8IA 5F4ZA 9LDBA 3GDOA 4IGAA 2CUZA 1RM3A 4AP6A 4MXDA 4OUKX 1CJUC 2D59A 5B58T 3TMAA 2G88A 3I6MA 4FFLA 2CDCA 4PIVA 4GNRA 1XTUA 2XKKA 3RFCA 3A04A 4IQ0A 1OAOA 5ALHA 2VC2B 2REXB 3G9QA 5EXXA 1GPUA 5KX5F 4NULA 5ISMA 1J39A 4QEZA 4C88A 1X94A 3EIHA 4GOJA 2YWGA 3I73A 5JD6A 5EIAA 5FAXA 1ONNA 4HL6A 4M9SA 4LAFA 4XW2A 3LK6A 2XRFA 1AUPA 3FHLA 3TJZA 3R9WA 5E6SB 4MNTA 4QGGA 4BNKA 2ZSEA 3ISTA 4L4RA 4A6XA 4BU1A 4UU0A 3IPLA 1TC1A 2ADFA 3O1IC 1EG2A 1F51E 1LS1A 4FGKA 4W99A 1R16A 2V1UA 2QMYA 1VIMA 3I32A 4MV8A 1P31A 1WU8A 1S1MA 2JATA 4O2RA 5JCOA 4J03A 3TIIA 1NVXQ 1KFJB 4HAUA 2R68A 1KF0A 3WLSA 4YRGA 1NWHA 3PQEA 3WV4A 3O47A 2NVOA 1U8TA 5IRCD 2I54A 1TXGA 1AXEA 4XA8A 1V3UA 3CX6A 3DPUA 2JLZA 3N1UA 2AQHA 3HEMA 3D8BA 1OI4A 1VMKA 4OHFA 3E2PA 1GZDA 3HJUA 3U16A 1RAHA 4PLWA 5K6AA 3BJIC 3C5EA 2BRUA 3SKVA 1AUOA 1WXFA 3GAAA 1CR4A 2NUAA 2ZPAA 1U9ZA 4QNMA 4MKZA 5J4LA 1RXEA 2DFDA 4LOLA 3NRBA 4B0OA 3HDHA 4BWFB 1HT3A 3BQMB 1TNDA 1XB2A 4BQOA 1GGMA 4ZK6A 2PUDA 1HDGO 3IPRA 5KAPA 3T5TA 3GMSA 3BGDA 4YROA 1VPVA 1L1EA 4HPJB 1T4CA 2OKCA 3H3XA 1O95D 2HU2A 3N7AA 1MH1A 2PRKA 3S2FA 5KAMA 4G63A 3IAHA 3M6FA 3IIEA 3KZCA 1ZIYA 2X9GA 1RABA 3I05A 5E9QA 5G0UA 2Q8NA 5HMLA 2EZ4A 3VZRA 1UPAA 5IZ4A 4FMDB 3VNSA 3FPAA 3OE7D 4TX1A 4PHTA 1DUSA 1YBFA 2VJKA 4MGZR 4XYBA 5ES3A 1ZDMA 3ZJTA 4JDUA 3ICCA 3JWPA 1JSZA 4REQA 4RD6A 5EPUA 2ZE8A 3TQIA 4MB2A 3RRZA 2M98A 3TXYA 1BROA 1Q7RA 1Z0FA 1OQAA 3BQNB 3ASYA 5EIFA 3H16A 5F73A 4F93B 4O4IF 1O8CA 2IPOA 2DRIA 1L4FA 2WJ6A 1HT0A 2HOQA 3EJ6A 1CUFA 4KLRA 3UH0A 4A0SA 4EBFA 1RYBA 1A95A 3WLIA 1UMBA 3KPVA 3V8EA 1JDZA 2Y9MB 1H6AA 3GJ6A 3C48A 3LQ2A 3VU9B 2M9MA 1LC0A 2BZSA 1EA7A 3JVEA 3BAFA 2HA7A 3A7DA 5FCDA 3EWAA 3QH4A 3CLUC 2REQA 3U1TA 2Z1NA 2JCYA 3PENA 1N3IA 4GPEA 2WIJA 5IZCC 1QTNA 4WPGA 4IVPA 3OQNA 4C7OA 4H4EA 4TUYA 2HIGA 4LECA 1FJXA 2O59A 1Q0HA 3OE1A 4BMYA 3CWZA 1XVUA 4PPFA 4L75A 4B87A 2DR3A 1RAIA 3VR5H 3HCEA 5IG2A 2C7QA 1U6JA 2HSZA 5DLYA 2EYUA 3ASVA 3QWHA 4JB2A 4CYMA 5HXAA 2R3SA 3HY6A 4N65A 2PWYA 2GA9A 4ZCMA 1N6NA 4DUPA 1JDVA 1N3LA 3NATA 4WZZA 2D62A 4GC5A 4NOJA 5JVDB 3GPLA 2YS7A 3K0CA 3X0DA 4PPQA 2PPLA 1YK1A 1HKUA 2UVDA 3CC8A 4GYJA 3BCRA 3WGGA 1HEUA 3VUEA 3AI7A 3IX7A 1GTZA 1HZZC 1XUOA 2NVBA 4JI0B 4POAA 3R74A 2WE8A 4K9PA 1OY1A 1EBBA 2WJPA 2ZYRA 1WMFA 3TXXA 3L0CA 5H83A 3MF4A 4DLPA 1RNLA 4QO8A 3AGQA 5CGQB 3NDIA 4YAOA 2JFPA 3FAKA 3OPYA 4ZXPA 1FRNA 3SZGA 2WV9A 3NG1A 4V03A 3G2QA 5DLPA 3OQJA 1B0PA 4FFOA 2DR2A 4IDPA 4A2PA 2H4ZA 5IT9A 4E88A 1SUFA 3DZIA 2B36A 3ZVKA 2ODTX 2H2AA 3EH2A 1EUZA 1EINA 1Q11A 2C2MA 4I5GA 4MIEA 2QUIA 1W9HA 3T3NA 1ID8A 1QKIA 1GLGA 2W6MA 4N0MA 1P1KA 2GT1A 4YUVA 1N2CE 1ZOOA 3LHFA 1E0KA 3PFBA 5EMMA 1YIOA 1TCVA 3KG2A 3EUAA 4MMZB 2I71A 3VR6D 2AD1A 1O97C 1K3UB 2ZRIA 1BO6A 1EE1A 3CRNA 3TI7A 4ABTA 4PS0A 5KNBH 3E18A 3QVUA 4LQDA 1ZU4A 2FEOA 4G85A 5T64A 3KVVA 3AEYA 2FI1A 5CH5A 1M72A 2HWWA 4NK5A 1U8XX 4C6TA 4U9IS 2D8AA 4NR0A 3AK4A 2R47A 2X0EA 1XXHE 4DW8A 3TYXA 3I0MA 4DG8A 3VO1A 1U7HA 1ISHA 2QZPA 1AA9A 1KY4A 4XI9A 3WQSB 1Z2NX 2BGKA 1E1CB 2FZWA 3A6JA 2QBYB 2ZAOA 3IULA 3PDCA 2WPNA 5J2TB 4FQ7A 4POOA 5AKYA 1J2JA 1G55A 1K6XA 2RGUA 1XYGA 4MUIA 5TS3A 2IHVA 4OY3A 4YHHB 4LQCA 1K3TA 2YIJA 4W63A 3MUFA 2I4IA 5C1DA 1R00A 2JAWA 1K7CA 2JFNA 3GJ0A 1IEQA 5F7XA 3T3IA 3IJ5A 2DCMA 3U7QB 4RSRA 4E1VA 2Q1WA 3L7JA 1S8FA 1I4LD 2Y68A 3JYLA 4IDFA 1K1EA 5EINA 3WLEA 4MQFA 5BXYA 1TMOA 2PMKA 2OXCA 2C0QA 3A2LA 4ADSG 2PJDA 1YGPA 3B38A 2PX3A 2HQOA 2P9JA 1NBWB 1TF7A 4LC1A 2HHCA 4HQ6A 3O73A 1I4WA 3HJHA 5ELLA 3RYHA 1UP7A 3D3NA 2FPWA 4Y9TA 5KYYB 1QHGA 3B8EA 1DQYA 2DGDA 4XB2A 3KOUA 3V8MA 1QQ5A 4EDFA 3DW3X 4TWJA 2P7HA 3BE6A 1ZJ4A 3R0VA 5LQDA 5EFOA 1FU8A 3Q98A 3W5BA 1HI9A 5EGSA 4R2LA 1YR7A 1A27A 2WD8A 5TQ2A 4I5IA 4C22A 1M1NB 4DLRA 2PKRA 5FF9A 4EFLA 3RUFA 3DNPA 2ZB8A 3DB2A 1U04A 3AF1A 2RDMA 4RZ3A 4EEZA 4HDRA 4FCCA 4HG2A 2YFYA 3SHQA 4CCYB 5CVUA 2FQWA 3OQIB 1U8AA 4JJIA 4A73A 4BGVA 1E6UA 1JI0A 4NV0A 1L4GA 2V0CA 4GU5A 3VZDA 3MLEA 3WDMA 4AZTA 1X9GA 4JP5A 5EE9A 1JEAA 1X7YB 2P9BA 3NX4A 1KFCB 5TJ9A 2VG8A 3K8ZA 5JSQA 2BSQA 1KAEA 4MW0A 4EFDA 1MRSA 4J1NA 3G2KA 1TM4E 5E3JA 2X8WA 3N8IA 4OK3A 3GGJA 1KYIA 1VECA 1NL3A 1XGKA 2LD4A 2OE2A 3O8OA 1W8DA 3HZRA 1YFZA 4RUKA 4WTOA 3WWOA 3ZQKA 2IKSA 3DP9A 2FQYA 2IY9A 2QTAA 2IV7A 4IRMA 3UV6A 5KB3A 2Y0EA 1C29B 4MB0A 1MT3A 5KPJA 3Q9NA 1YAJA 3D8SA 5A2QA 5BNTA 1IQPA 3NBKA 4R1QA 1KERA 5JAHA 1UDAA 1ATZA 1V4NA 1NJFA 3FXAA 3V48A 3L40A 3ZDRA 1DBRA 2C8VA 2F1RA 3C3MA 4JR2A 1YACA 3FYDA 4HDQB 1A98A 2VT3A 1PL8A 2XF2A 2B61A 3WGQA 4B5KA 2X8JB 3FIJA 4H9GA 3U60B 1J2TA 4D25A 1ZGHA 3DNFA 4HDNA 3MQ2A 1RM4A 3UHPA 3LC7O 4DGSA 3FVTA 1EXWA 3NM5A 3DOOA 5G0WA 3LQFA 3G2HA 3PQ7A 3AONB 4YCMA 2EQ5A 1K7FB 3RR2A 1DO2A 4Z4FA 3FIUA 3M4ZA 2JI9A 4IJMA 4ZO4A 1PWZA 2AZMA 1V16B 1SCIA 1PR4A 1O77A 4KN9S 4Y2UA 1G63A 1NMYA 1U3UA 2VDRB 4K9DA 4RMHA 3LP6A 4QNNA 1JKMA 2WWVD 4MP3A 2YZMA 3R3WA 2Q5EA 4AICA 2FN3A 2IDMA 3CTPA 4G0XA 4L4YA 4RELA 5EQTA 5AI8A 1TTPB 5FHQA 1GR1A 1Z7WA 3LT5A 2DBRA 3CBGA 1NQTA 4ZQIA 4ZCIA 5L4LA 1P73A 1M8KA 1BS2A 1D5WA 1AGXA 4IS3A 5K8VA 3LWBA 2VR1A 3T4EA 1Y9DA 2EFJA 2ZR9A 1ZPDA 3DMTC 2XRMA 4CLOB 4WLNA 4JLVA 3MWJA 4MUEA 4EX7A 2P3QA 2IGTA 3TW8A 3WTBA 5JQGA 5FORA 3KWFA 3HSSA 1A2QA 3PGKA 2JBWA 2CE2X 2SKCA 1V8ZA 1KHTA 3P9CA 4MYDA 1QP8A 1CJCA 4J8PA 1M34A 3CEJA 2BI4A 2WTEA 5GONB 4M0UA 3T5PA 1VL6A 2OP0A 4DE5A 1H4SA 4M0EA 2FDXA 1LDNA 1MDFA 5I7AA 2D8MA 2F4NA 3N39C 5I7UA 4DJAA 2JIOA 2Y99A 1AXGA 5T41A 3ZHXA 2VDUE 4ROSA 3IL2A 2MR6A 1C7QA 2WT8A 1YQDA 4MTLA 4OHXA 3FKQA 3TSYA 3RC8A 4PX5A 4DLZA 4UEWA 5FOVA 4G4GA 1ACLA 3TOSA 3EVDA 3GY0A 2KB0A 3U4QA 4WKBA 3UH1A 4Y9SA 2EKZA 2P2LA 1MBZA 2QG6A 5EUCA 3CSUA 4PG6A 4F7DA 4DF3A 2G5GX 2RHGB 2CCJA 4KBYA 4FIZA 1AQUA 4C01A 4EX6A 1FLAA 1GSAA 1Q17A 3TSZA 4ZO6A 2ZWPA 3MYYA 2PGXA 1G8MA 5JAMA 3M49A 5MGNA 3HEBA 4ZT4A 4QL3A 4PRYA 5DSXA 2ZG6A 1IK6A 2IZ7A 3CR7A 2C5GA 2E5WA 3DE4X 2GXUA 5FOWA 3C8ZA 4DIDA 1SBIA 1YOVB 4GGMX 1C1DB 2B7LA 2AJ8A 2WF8A 4QEDA 4EMSA 4JJZA 2Y4NA 1ZI8A 5TQ0B 2NMVA 4MGYR 1CY6A 1NLYA 3GMTA 4TXLA 4Z7OB 1G8JA 4M9UA 4EIWA 1P60A 1UBSB 1A7AA 4TMTA 3WBBA 4YV0A 3RVDA 1I3NA 1SVNA 3ZZNA 1DJLA 3DOIA 5HR5A 2NZYA 4V39A 8ATCA 3PFIA 4FI3F 4YP5A 5A9SA 5LIRA 1ZRMA 3KK0A 2P2DA 2DQ4A 1SIOA 5IS2A 4CM9A 4E51A 1QE5A 3KLNA 1T2VA 4UOQA 2UDPA 2Q2WA 5LCXA 5CA0F 4ENSA 2P9TA 5JTTA 1RHMA 1NMXA 1XZ8A 4RQBA 3U81A 4ITRC 4P4LA 5KYTA 5AK5A 2PUWA 3U4GA 4RY2A 1LWOA 1Z68A 1II0A 5AYVA 3ISJA 3HV0A 2Q3EA 4G67A 1B2RA 4QAJA 4WZAB 1TD1A 2FZCA 3RJ5A 5LOVF 1OXKB 4Z6KA 4DJ5X 4MWOA 4FMCB 4PC1A 3TIGA 1XZCA 2IXBA 1K8XB 3AY3A 2ZB2A 5CFOA 4Q1EA 2NG1A 1NVAA 2EERA 4AQ7A 2FMUA 3C7DB 1NXPA 3D1JA 4C4SA 1MGPA 1V43A 4QU0A 1E4OA 4YDHB 3CNBA 3LW8A 3MGGA 4MV9A 1IPHA 5KNBA 2WWRA 2IA5A 2Y2VA 3PUXA 4HO1X 3KNZA 3RAJA 1BDMA 2NP7A 1NN5A 4XVRA 3COSA 1N6OA 1I2CA 3FGOA 4ZOEA 3BOSA 2XQJA 3IQDB 3QSGA 1QMPA 4BWYA 4X1YA 3LQ4A 2C20A 3K5IA 3H84A 5GVSA 1WPRA 4C4AA 5JI3E 4EVRA 1HOTA 2VP0A 4Q9AA 3GEMA 1LDGA 2I2AA 3LKDA 4O4IA 2YN0A 2VP6A 4LGMA 4QTZA 1KI2A 1VJGA 3OEYA 5C1IA 3W77A 2PR7A 3RLIA 3E2MA 3W90A 3ASZA 4LJLA 4WESA 4KN8A 3GXBA 1KSGA 4RTOA 2DBQA 4GIBA 2GILA 2VJLA 4YX9A 1UBFA 5FADA 3M4NA 2QJTA 2PTHA 5IJ0B 3R8CA 2QP3A 3E7DA 2J3LA 2O2GA 2X2OA 4UUAA 3HLYA 3ZXIA 3FN4A 3Q8WA 1WL8A 4ESEA 1F60A 1I3LA 1CQPA 3GUCA 3NWEA 4I4TA 4L95C 1V8BA 1NRXA 4I55F 4WY5A 3C5CA 5JYEA 5IM4A 1CZOA 3JATB 1UC5B 1B8VA 2IYLD 3C3AA 3NGLA 3RG2A 4PC2A 3NKLA 3JYOA 2QENA 1YOBA 4Q18A 1NR5A 2GZMA 3QLVA 3QVMA 2JJYA 4N0PA 1R4AA 3WJ2A 2P2YA 4MQ5A 1KXZA 3I2GA 1A72A 1U98A 5LLDA 4GC9A 5DASA 3ROPA 2FWIA 4LN1A 3MT8A 2OFWA 1MZPA 4JL5A 2WMYA 1EHIA 2BM9A 4AY6A 3KQUA 2OCGA 1KO8A 3Q41A 4HAXA 2HAEA 4LOIA 2PRJA 3H5NA 3PHGA 1F6WA 4J6EA 1PD0A 2YVLA 3P71T 4B31A 2JIZD 4WCFB 4JYAB 4LMBA 1XV5A 4OIFA 3W0LB 2PGNA 1IQRA 4AF7A 2CKMA 1QX4A 3GL9A 1CUUA 1MG0A 1R88A 1SKBA 3FYSA 4TMXA 2V1XA 3VNRA 3RTDA 3HGQA 4Y67A 4NS4A 2VZLA 1OBFO 1VYTA 2MR5A 4UHBA 3FJOA 4HAZA 1U80A 4RKYA 4D4HA 3KT3A 3T4PA 1D6NA 1JEEA 1GL9B 3QX9A 4KGZA 1ZVJA 4GE3A 2DETA 2XB2A 1BWQA 4N48A 3SC2B 1FY2A 4M7RA 3IURA 1IRIA 2HRDA 1P2FA 2QJOA 2V3VA 2VWPA 3KKZA 3ZVLA 1M1XB 1YS2X 1ZOLA 3GDFA 4P08A 2P5TB 1VM6A 4OHRA 1K5DA 2B1JA 4CMIA 2RE8A 1N33B 4IMPA 1EFAA 4F3TA 3UJ7A 5J5VA 4FFBA 4KCGA 4FLMA 3SK0A 2A9QA 4F3YA 3EGVA 3AJDA 3D3WB 4HB0A 1EFHA 1L7MA 2B1GA 1KJWA 2JAUA 3TE7A 3RBXA 4UFPA 6YASA 2H7VA 5AIAA 3AR5A 3EGEA 5IUKC 1TB4A 4RENA 2GM4A 3OZ7A 2VLBA 3RV4A 2P2CA 4EJSB 3HU2A 4KNYA 1EP9A 2FW6A 3FF4A 1SZJG 1IN7A 3DTTA 1YS7A 2YN2A 4X1KA 4D43A 1QZUA 4KFRA 5AMXA 3TO5A 2P11A 4BUZA 4K3VA 2GFQA 2IYPA 4ZI7A 1UBEA 4YALA 1XDBA 4YXWD 3A9VA 1R50A 4REQB 1G0NA 1WF6A 2CLIB 2Q45A 1OXBB 3IBTA 4I50F 1BG6A 3X1KA 4PZAA 1RW4A 4RM3A 1UAYA 1KMHA 2RGGA 3KPJA 1K0UA 1N2EA 1T2CA 1XTSA 1XSEA 1GTL1 2K2QB 3NOOA 4MDFA 3IVRA 4G0WA 1RJEA 1K27A 2J5KA 2VNKA 1U3FA 4D98A 1KORA 1Z39A 3QY0A 4J3NA 4NE7A 3ZCSA 1EVZA 3JAKB 1Z88A 3VTKA 1X13A 4Z9XA 3BJZA 4ZK2A 5DO9A 2R7KA 4B33A 2J3QA 2P5YA 3A4YA 4P36A 3LCUA 1UKBA 1B73A 1M10A 2YXNA 3R4VA 1E7YA 1OYVA 1V39A 1TOAA 3LECA 1XFDA 3IE2A 4K3UA 3WB0A 4ER6A 3CUEF 3I34X 3TZEA 3ROQA 1UBRS 1HQDA 2VJPA 5LP6C 1YNOA 4BNDB 4IV0A 2YMMA 3FCUB 3DPSA 3PPWA 4YRKA 5EWLA 1BNCA 1GN8A 1BWRA 1NJ5A 1Z2PX 2XOKA 3BE4A 4NQRA 3DF7A 1WQ4A 4NYJQ 4C7BA 2HXYA 4HQLA 2IYWA 3GUVA 1R4ZA 3HN7A 3HBLA 5AJYA 3ON5A 5FR2A 3AHCA 1E5DA 2D0OB 2V4MA 2VDLB 4PF1A 3LH5A 3LIPA 3WADA 4BP1A 3H6KA 4JBHA 4HYTA 3PLNA 2C4KA 2WA1A 1LKZA 2Z8YA 3GR6A 3E8MA 2ZIZA 4RVOA 2X7JA 1W9MA 3H3FA 3ZHQA 1KRWA 2O50A 2QIOA 3DEFA 5KDLA 1R4MA 2Q4BA 1K75A 1CHNA 1TIBA 1BTOA 5COAA 3FGPA 3K6JA 3INTA 1NLUA 2WHXA 4D26A 5E7IA 3UEOA 5D2CA 2EG9A 1XO1A 3AESB 3FI0A 4HKTA 1LSJA 4JLWA 4OGFA 2FSUA 4H7KA 4NENA 1K5HA 5IJXA 3TL2A 1ZM9A 1CUEA 4I1OA 4CM8B 5CG1A 4LYAA 1OH8A 4NAUA 4L16A 2C29D 3FLEA 3NTQA 1W4LA 3ZVRA 2VJMA 4AN0A 2N0SA 4A0HA 5C8XA 1G4HA 2VHJA 1T3SA 1NF2A 1CUWA 3E5HA 4QLBA 4UJ3A 1SBCA 4Q7JB 3SHTA 3IEXA 3B20A 1VLQA 4OP3A 2I7VA 1NIJA 2GA8A 4OJNA 1LC3A 4TLCA 3HR4A 3AP2A 3GI1A 3NHRA 9LDTA 4INAA 2IE8A 5E8RA 1FUUA 1XU7A 4RE5A 6ADHA 4XIGS 4C0SA 4FBMA 2WJAA 5K3SA 3B1KA 2NTEA 2GPSA 5ALNA 5FWAA 3AM5A 1L4KA 1XF1A 1GKKA 2V7VA 3I6BA 1YI1A 3SJBA 7REQB 1C4WA 1P3JA 1LEHA 3HR7A 2ZVJA 3OEEA 2FR8C 1EBFA 3AKEA 1NI5A 3EZ2A 4KXQA 3LZCA 4HX2A 3TQSA 3IUPA 4D96A 3KSBC 4JP1A 5D7NA 2DQZA 5EN4A 3H97A 5HUHA 4R16A 1ODCA 2K87A 3K1AA 3WO1A 5FX2A 2DPMA 4GI1A 3GQBA 3DD5A 2WHQA 3HUFA 2YHIA 2H2WA 3A1NA 3ETNA 3PWKA 2AX3A 2BFDB 3TTTA 3QPVA 3A26A 1EKXA 2DUMA 4EO4A 1H9BA 2R97A 5JZVA 5K2MA 2B1QA 1ZR4A 4KACA 1NI4B 4ZCSA 4Y6GB 5DMXA 1RYNA 1S2MA 3AFIA 4Y1RB 3ENWA 2ACWA 4BQNA 1GQFA 3D4NA 5I9NA 4I3HA 2PKXA 5J59A 1H0RA 3PGLA 5CGZA 5KSZA 2K2WA 4RY9A 1RWBA 1KYQA 3OLYA 3PT9A 4B2IA 3N7TA 5M7EA 2WM2A 4AMVA 4URYR 1IUPA 1TIPA 4QT0A 3O95A 4Q4HA 4QHSA 4G97A 3I3OA 5BV0A 2EDAA 3BWYA 4HF7A 2FGJA 4JLDA 4LRQA 3AHEA 4UPVA 4B46A 3DBRB 4BATA 4ZYVA 3S28A 4Y30A 2QX6A 3OEWA 4C3OB 1Q22A 3QHQA 4NAVA 4BASA 5BSMA 1J00A 1I10A 3K9NA 2Y93A 4C4OA 3FHTA 3DUWA 3PFHA 5TJHA 1H1LB 1GUDA 3QEKA 4D5EA 5I7WA 1JLHA 2NZJA 5ICCA 1NNEA 1JEQB 3VVLA 3PEWA 3U56A 2B4AA 4D79A 5FH9A 3ENQA 2H4FA 5EP1A 4CPDA 2VUIB 1ZIXA 1MR3F 5A05A 2C3YA 3ZWKA 3K6SA 1UDWA 4PZCA 4TROA 3W3AH 3B53X 2DFNA 2PH5A 4X6YA 5DI3A 2PLFA 4YCBA 4MICA 2XA2A 1X6VA 3LNCA 1D2RA 5BVGA 4IIYA 1KAHA 2YOGA 2Q6TA 3IXMA 3OWHA 4AO8A 4AZVA 3KQKA 2BHLA 3CVUA 3B12A 3K09C 1RBZA 1GTSA 4QAQA 3ZTYA 4LFAB 3IKTA 2FPKA 1ZMBA 4DCGA 1IULA 2JHAA 1SBHA 5LBIA 1YB5A 1MRZA 1Z83A 4H16A 4JI5B 2P4EA 2WWWA 4D9IA 4DQ0A 3F6CA 4LIPD 2C9MA 3WOVA 2GSWA 3MBIA 3FLAA 3PCTA 1TA0A 2CNOA 3KFXA 2VHYA 3NBUA 5K3CA 3T1VA 1AS0A 4DLAA 5F2EA 4CM5A 4YMHA 3OU2A 2XZTA 5BT8A 3I37X 2GK6A 3VFDA 1TZKA 4MGKR 1R6VA 4HXEB 1F0PA 3H8VA 4MVJI 3ZQUA 1FSSA 1SVKA 2PSEA 1IPEA 2AOVA 2R8PA 2WFLB 2WZBA 4K9RA 4Q9LA 3BKXA 2JK0A 3GHHA 1Q92A 1E3WB 4O4HF 5DYGA 1GUZA 2JLRA 1DO8A 1YKGA 3G2JA 1NQOA 3I5MA 4WZBA 2H63A 3LSTA 1SVWA 3MILA 2JGJA 5FA8A 3RNLA 2Q3LA 3R6TA 5AXDA 3V1MA 1JDBB 3VSAA 3R7DA 1Z6YA 2HWXA 3UJ8A 4D4JA 2JAPA 3QXXA 2P5UA 3GCXA 1BXZA 1EDOA 1NN3A 1OLOA 3C43A 3JQQA 1XCBA 5F3WB 3N2KB 2WNHA 3L1HA 3GNLA 4Y0NA 1VOTA 2BKXA 2EJCA 4EABA 3NIFB 1I3MA 1IZ0A 1K7XB 2JAHA 1UWVA 2OZLB 4RXTA 5E9AA 4WKGA 1Y8ZA 4JXKA 2GASA 2ZSUA 3EDRA 1KRXA 2AD5A 1NXSA 4OQLA 4PY2A 3SXUA 1B43A 1PSZA 2RC6A 1PSDA 9GPBA 4US2R 3DKIA 1P4HA 1UK7A 3G0BA 4DWOA 2AK3A 4U9UA 1K4MA 5C8ZA 2FQQA 3NHAA 3COYA 3D7MA 1PWYE 2YNMC 3CJQA 4NI5A 3HV2A 3TZCA 2D1YA 4IVNA 4EW3A 2MDTA 1ZYUA 2PXXA 4R51A 3EBOA 3S44A 1H5QA 1N5OX 2ZGVA 3HA2A 3HFJA 1OLXB 3AR3A 3HCBA 3L3BA 2FNAA 4OKIA 3WS7A 2ZM5A 4MWEA 4O1IA 3LDHA 2IZ0A 5K3FA 5BSKA 1D5CA 2WJWA 2JRCA 4RPCA 2R8XA 3Q7PA 5KYUA 2F1KA 3ER6A 5JRJA 3RVJA 5BVHB 1H94A 2YC4C 3KP1A 1T36A 3UXEA 5B3JC 4PX3A 2C88A 1A9PA 4H6XA 3V7UA 1W85A 2B7BA 3FPJA 2A35A 4QPDA 4RTLA 1I4TD 1DXQA 1N9KA 3EXG1 1YE5A 1AY0A 4BVGA 1SUAA 2WIFA 2WZCA 2YW2A 2XXJA 3RT9A 4U7FA 5EHQA 3R2JA 5F1KA 2PJZA 1DFGA 1ENOA 2WIKA 3CURA 4R81A 3JQPA 4BMSA 2XQVA 3FLBA 3U5ZB 3ONWA 4ZA2A 3WYNA 4DHEA 5BVHA 4CMIB 3AHDA 2XGOA 2JNWA 5HDBB 2YUIA 1E69A 1E9RA 4XCVA 1E77A 4H0FA 3U09A 3RYIB 1TPZA 2V54A 4U00A 1KAGA 1E2MA 3H0KA 3PD1A 2BM8A 4EB8A 1MOSA 3DVSX 3ADDA 5D51S 3R6WA 4JQYA 4MJLA 4WBNA 4EO9A 5FBVB 3TWOA 4Y6PA 4Z2AA 2QMQA 2SCUB 1VL5A 1WV0A 3QRWA 4IUBS 2RI6A 3Q1LA 4OI1A 3T34A 3TW4A 4CDMA 1CS0A 4QO7A 3DAOA 3KVRA 3D1VA 2QTCA 2I4MA 3I9JA 3O83A 5FL3A 2ODWA 4ZEVA 4CIDA 2DHDA 4J0IA 1AUVA 1QH1B 1OGIA 1V6CA 4OLHA 3A31A 4V0NA 4XEHA 2MSDB 4ECAA 3SGLA 1P33A 5B57C 3O21A 4RHEA 3OECA 2VNHA 2GPJA 2W6OA 4FOSA 3VR4A 1NW5A 3MMPA 2VDVE 3HVIA 3ZHBA 4EHNA 3AEXA 1R6AA 2WM8A 1MIHA 4JN6B 2QBYA 4GVXA 4Y3UA 3QNMA 4ZQHA 2LCQA 1K8RA 2K5UA 5DHPA 1A7JA 1H65A 1P62B 2YR0A 5JY6A 1NN1A 3I04M 2QUKA 2YVAA 4OXXA 1WXIA 3EGDA 3BWBA 4OJYA 5B6IA 4R83A 3GJSA 3ENVA 4YWJA 5DX1A 1RFLA 1PKXA 4M1QA 2QVZX 4Q7LA 3FNQA 3LUFA 2OVFA 4DILA 1M6NA 1AZWA 2QN3A 1GSOA 5GWXA 1H66A 1RWOA 4HJXA 1C9JA 1KI4A 3NXSA 2BH2A 1YR9A 3DM9B 4KPYA 4TMYA 2XWPA 4M0DA 2IYYA 1ZC4A 1KZGB 1DWPA 3I8OA 2AUNA 3V5NA 4M49A 1KOGA 2RI1A 5HS6A 3B51X 4BHTA 4EUFA 4HDOB 2PEYA 2J6CA 3FUWA 3VMMA 4CTJA 4V1CA 3DLBA 1B6RA 3LK7A 3FCEA 4DHWA 4JUBA 1SOMA 5BR4A 1N1MA 5B2ZA 1J0EA 3RKUA 4F12A 1AZLA 3BGVA 4ZQGA 5B7NA 4L9WA 5HUQA 2WM9B 4GECA 2CNWD 121PA 3FKSA 4TWRA 5GAJA 2XQIA 3L8GA 2PRZA 5DBFA 1B74A 2FFQA 2G76A 3LHIA 4YFVA 4JT9A 1X7ZB 4GP7A 5FFNA 3U5TA 1LTQA 5ELXA 3WDLA 3DF9A 3ITDA 1K6MA 1NDHA 1G1MA 4R0MA 5D1NA 5CPFA 1EM6A 2C96A 5AP9A 4B9AA 1POWA 5JLAA 3FPCA 2FX3A 4I36A 2QE6A 1PJBA 1KHHA 1LX6A 1JECA 1MC5A 3LTEA 4G37A 4HYQA 4BN4A 4CKXA 5DI9A 3TF5A 1RTKA 4IZOA 5FEMA 1BFDA 3ORHA 2G6BA 5B4UA 3GV0A 2A4KA 3IT2A 1D2NA 2B2XA 2ZJ6A 4WY8A 3JD1A 4N0EA 4N7MA 1OGJA 1R5NA 2JA1A 2GQ0A 2A92A 4DRYA 5L7TA 4J07A 5BSRA 2ZTLA 1SQGA 2HPAA 2EP5A 4B7ZA 3MSXA 1IEWA 1OXXK 4HMOA 1CDEA 1KJJA 3M4XA 4MUBA 4RL6A 2ZRFA 5EWJB 1Y3IA 1LBQA 1L8AA 1Q1NA 2F67A 2J4DA 2ZUDA 4GVPA 4HVTA 2DJ5A 4NZYA 4OHKA 1ZFNA 4P82A 4OHYA 1RVV1 2PL5A 2DKNA 2QLBA 4FFPA 1PHPA 4PRLA 1ULBA 2I6GA 4TLDA 3MGCA 3QK7A 1GTMA 2B3DA 3QUQA 4BMVA 3V9PA 4US0R 3TKLA 3Q0TA 2G08A 3HBNA 2EBFX 4TTVA 2W2VA 4NCBA 1Q3KA 4XYMA 1SK9A 4OMUA 4UPDA 5F4BA 3WNVA 3KZOA 5A4JA 4KHZA 5A0TA 3PR2B 3NIGB 3OX3A 4QHYA 2GRJA 4RABA 5DIZA 5I5GA 3U37A 4ZOLB 4CUJA 3A9UA 4WMLA 1EVYA 4OBWA 2ZROA 2JAXA 1S2DA 4MVCA 4DSAA 4JBWA 3BXFA 5E0OA 1EX1A 5CLIA 2FWBA 5FPQA 1SXJD 1NW9B 2DWPA 1GNRA 3DEAA 4G4IA 4LJKA 4YC7A 1KARA 2HMVA 2DP4E 1RQXA 3KCNA 4A0RA 4B82A 4NYMR 5C5CA 1WBBA 2W6IA 3HKCB 1M3SA 1JAZA 5FBWB 4C9BA 3VDXA 2R2AA 4AG6A 1U99A 4EJ6A 2J5BA 4X45A 1SXHA 3T1YB 1GVHA 4RADA 3LAWA 5F1YA 2Z4RA 3F9RA 4L78A 1U0NA 1YC5A 3PSAA 2WJ3A 4DREA 5L3ZA 1GITA 3ZWBA 1SHUX 2AW5A 5EJ2A 3SM3A 1Z5VA 3ITNA 1COZA 1MVLA 3QWFA 3N8GA 4BB5A 2BLNA 4HLUA 5LQNA 1RTTA 4GI3A 3LA6A 4QUAA 4B3CA 4CFZA 1WMAA 1U3TA 4KKXB 4V2UA 1FP4B 2H08A 1AU9A 3IQHX 1RAGA 4JL6A 1DX6A 1E8DA 4RPKA 4CM8A 4GP6A 3BGOS 2LGJA 5AI6A 5TDHA 4IX9A 3PDIA 3QIAA 4MB6A 3MJ4A 1H4VB 4CV1A 4DQLA 4NIMA 3AUFA 4OXNA 4Q4AB 5EJ5A 3F6PA 3BH7A 1JLKA 2OYRA 4B3JA 4YJHA 1N7JA 4EB6B 1VCIA 3JQDA 1BA3A 4F5DA 4G0VA 4ERXA 4OSPA 3RHSA 2ISQA 1NF9A 1IRXA 3FYUB 3IA7A 4RF4A 2CLSA 2WDZA 3P1JA 4R1PA 4ZCLA 4COOA 5LP6A 2A2ZA 1JA0A 1U8FO 5EJ6A 1UQTA 5A5EA 1SZPA 4F1JA 5JHHB 3CUTA 2HYIC 2YJZA 4DPLA 2JF0A 4YRBA 1SCBA 1NQ5A 1NTOA 3L5OA 4FFNA 1ZQ9A 5CYPA 1EXDA 3BBPA 3A1WA 3D5TA 5IW8A 4AO7A 1P0PA 4OPMA 2WP8J 5ECYA 3RCBA 3RGWS 3NDJA 1AKQA 1S8AA 1XZBA 4OATA 5KZMB 2FTKE 2VDWA 4FNGA 2QM7A 2BFEB 3S5JA 3FDFA 1VBMA 4O8ZA 3KOYA 3ZH2A 4S1PA 1UZMA 1XQWA 3KQQA 4IHJB 2I78A 1A96A 5TX7A 4U39A 5GONA 1CKEA 3KSDO 2ZIXB 1H2FA 1EWQA 3EXHC 3SE7A 1L7AA 1EFPA 1L7OA 1OWMA 2C98A 4IG4A 4PBSA 5DOVA 2PMEA 3SFTA 2ZUTA 3W9SA 2FWPA 3E9DA 2PNJA 1DP4A 2CXXA 3QF7A 1ZN2A 3I4CA 2PUGA 2PQ6A 4LMRA 1ICEA 3ZWPA 1L4BA 1Z2EA 3VKVA 5CB4A 1AVTA 1Q0QA 2HNBA 3M34A 4MAFA 4DCVA 4PR0A 1MB2A 3A3PA 2PZGA 2ZAIA 1CNFA 5SICE 5NLLA 1BRMA 2XB6A 3RYCA 3S7TA 5C3MA 2IU6A 1E2UA 4KB5A 2J9XB 4CM7A 1TZBA 2D5CA 2RKBA 2QPTA 1G8PA 4TKZA 4X1KB 1QP0A 1WB4A 2PR2A 5JDCA 3ICWA 4Z8XA 3BZWA 4WVFA 3SVLA 1OFUA 1KC3A 4QNRA 4YRFA 5EZ6B 1L4NA 4EY7A 1ULTA 1NVDA 5DYIA 1EUCB 2RK3A 4DQKA 1DIHA 2FW7A 1RC1A 4C1BA 1M1YA 2QGZA 3OZAA 1FF9A 3ZS8A 3EW7A 4YRSA 3T1OA 2Q5CA 4KLAA 3F9CA 4J16A 1HY3A 4OHUA 3M2PA 3MGKA 1P80A 4AI6A 2G1UA 3PVSA 1UOQA 3C74A 1OE0A 1TGYA 4G5XA 3KKEA 1ZN8A 1WXEA 5HKBA 2X0KA 2E5FA 2IEIA 3PDIB 3W8FA 1JTVA 3WG9A 2O4UX 3WIOA 2AR9A 1OBVA 1NN0A 1YA8A 3OI7A 2XT0A 4OQMA 2NO6A 3NIBA 1Y1LA 2X7HA 1DKUA 2FDRA 3NP7A 5BORA 2ZVPX 4D4KA 5JO0A 4AULA 2VXOA 2ID7A 4JVOA 4MR9A 2G0TA 2FWAA 4OK5A 3ZNOA 1MC1A 2C3PA 5ED0A 3R7BA 1TYZA 4R71A 3VYUB 3EIXA 1ZJYA 2VYFA 3ET5A 1CJVC 4OG2A 1Y6QA 3HABA 4RGQA 1XK6A 1YVRA 3GT3A 3OEED 2ERXA 4R9VA 4PG4A 1NW3A 1F3OA 3N53A 5KC9A 5ALDA 2NZWA 3KQYA 3OZBA 2RHHA 4KQ6A 2YJNA 4A92A 1A0OA 5EJ7A 1SHKA 3KT8A 1VHJA 2EX4A 4ZI3A 5CT6A 1ZHF