4KE6A

Crystal structure d196n mutant of monoglyceride lipase from bacillus sp. h257 in complex with 1-rac-lauroyl glycerol
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
249
structure length
247
Chain Sequence
MSEQYPVLSGAEPFYAENGPVGVLLVHGFTGTPHSMRPLAEAYAKAGYTVCLPRLKGHGTHYEDMERTTFHDWVASVEEGYGWLKQRCQTIFVTGLSMGGTLTLYLAEHHPDICGIVPINAAVDIPAIAAGMGGELPRYLDSIGSDLKNPDVKELAYEKTPTASLLQLARLMAQTKAKLDRIVCPALIFVSDENHVVPPGNADIIFQGISSTEKEIVRLRNSYHVATLDYDQPMIIERSLEFFAKHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermostable monoacylglycerol lipase
publication title Conformational plasticity and ligand binding of bacterial monoacylglycerol lipase.
pubmed doi rcsb
source organism Bacillus sp.
molecule tags Hydrolase
total genus 92
structure length 247
sequence length 249
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2013-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ke6A00
5EGNA 1YASA 4K6GA 5F4ZA 4QEKA 2Y1KA 4G8CA 3ICWA 2QRUA 2ZYHA 5DNUA 4EBBA 4F60A 1ZI6A 4H7JA 2Z8XA 1GPNA 4UFPA 4B9AA 2O7RA 2OAGA 4BE9A 2WUEA 1ZGBA 5ALNA 3E3AA 4ZV9A 4BC0A 2OCKA 4W1RA 4RPCA 2GYUA 3QZUA 2XQIA 1HDEA 1FFBA 5AKEA 1MX5A 3DYVA 1P0MA 1PJAA 5C7YA 2OCGA 4WY5A 1SC9A 3RM3A 4GDMA 4PSCA 4PQEA 2H7YA 3HACA 1VE7A 3WQHA 4EY8A 2ZYRA 3WA7A 3A6ZA 5ALEA 3RKSA 3IDAA 2HU7A 3CCCA 1H2YA 1K8QA 2V98A 1K6EA 4UHEA 2PSEA 3QMMA 2OAEA 4CIBA 3C6XA 4OU4A 5EI5A 4FWBA 4ZGBA 1QTRA 3WL6A 1ZOIA 2WQZA 3LP5A 3M83A 1N8SA 4JUIA 4Y2VA 3KSRA 2JGIA 3FBWA 1UKCA 2QS9A 3WIBA 5ALRA 4BAGA 4P93A 2QT9A 3HABA 2JGFA 3WWCA 1JMYA 4I4CA 3I2HA 4FFVA 1AZWA 1RWQA 2WU3A 2PU7A 3A70A 1YSCA 5AKXA 5C8ZA 3GELA 4BVLA 4BRSA 4H7IA 1LGYA 4LYDA 1XZLA 4XWGA 2O2GA 3F67A 1LBSA 5JZ9A 2IX9A 1X2EA 5AI6A 4UBNA 4WCVA 3DJYA 2XUHA 3F98A 4EZIA 4HAIA 2V9ZA 3H2KA 2QOEA 4YPVA 3O4GA 3VJMA 1UZAA 1XROA 5HQ3B 4X71A 4U2BA 3ZI7A 3VKFA 3G0BA 4JH0A 3I2GA 1G66A 1H2ZA 2C5FA 5E4TA 1XZEA 2VJCA 3I6YA 3CXUA 4F5ZA 3STYA 3DDUA 4J0DA 1VA4A 5KREA 2ZVDA 4H7FA 1XRNA 1QOZA 2FUKA 1K63A 1VLQA 2GZRA 1QIJA 3H2HA 5BOVA 4GI1A 4MQMA 3WK5A 4ETWA 1JKMA 5JZSA 4PO3X 5A2GA 3FCXA 4FMPA 4NVRA 2CB9A 2WSLA 1THTA 3AFIA 3BIWA 2VJBA 3ESDA 2QKYA 3MUOA 5CT4A 5YASA 2J3QA 2EEPA 1DX4A 1ZD3A 4HXGA 5JADA 3D2BA 3STXA 3L1HA 3IBTA 2QUAA 4G9GA 1EDDA 1CLEA 2B20A 5HF8A 2J3DA 2YYSA 2OGSA 5ISMA 1AC5A 4HS9A 4DNOA 2XMZA 4UHDA 3CN9A 4X3CA 1DQYA 4BCCA 1IZ7A 1XZGA 4GWLA 1TQHA 3TJMA 4EY5A 1BN7A 1ETHA 5T4EA 2B4KA 5ALXA 4JEIA 3PDCA 3G0IA 4DMCA 2C0QA 1HQDA 4G4GA 2FJ0A 2AJLI 2CJPA 3QMVA 3OURA 5EIEA 1ACLA 4QWWA 2OXEA 2PUJA 4N8SA 5JANA 3ANSA 5DYYA 2I03A 1A7UA 3I2IA 4C01A 3WZMA 1G42A 5CT5A 2C0PA 4N5IX 3DNMA 1VXRA 4BTVA 2XLCA 3DD5A 1SCIA 2WKWA 1T4MA 3AZPA 1RP1A 1ZGCA 5D7BA 1JJIA 1LPAB 2HADA 3JYHA 4GLBA 5C81A 3S8YA 2QZPA 2VSQA 1WHTA 3D59A 4J0GA 2O2HA 1EK1A 3QYJA 4AZ0A 1OILA 1LPBB 4KACA 5ALDA 5LZ5A 5HKAA 2RONA 5JZBA 3TEJA 1E5TA 5HQ3A 1BROA 5E4YA 4UBLA 1FSSA 1YAHA 2HA5A 5A7FA 3C6YA 1VJ5A 1VZ3A 2CMFA 4FNMA 1K4YA 5AI0A 3K6KA 5T4HA 3VISA 5ALZA 2VJDA 3WI7A 2BUAA 1IZ8A 1GKLA 2XUDA 4ZWNA 3A2LA 1R50A 1ORWA 3FLAA 3PI6A 4XX1A 3PF8A 2RHTA 1DWOA 2QTBA 1EVEA 1SCQA 2G4LA 4WDQA 5JAHA 1CRLA 4LXIA 2LIPA 4P92A 4J7AA 3DYIA 3FLEA 4ARBA 4OPMA 3I2FA 4G9EA 3WJ1A 5CTAA 5A71A 2HA0A 3VJLA 3FLBA 2ZSHA 1FJ2A 5CH3A 5FRDA 3V1NA 4AQDA 4ZI5A 5JAUA 3BF8A 5DYTA 4B83A 3QH4A 3WK4A 2WLSA 3ZV7A 1BEEA 2XQFA 1Y7HA 1J2EA 5LZ4A 1QIFA 1MNQA 5CW2A 4DTCA 2BFNA 1E8NA 4I19A 1XLUA 4KE9A 1UK8A 2HA6A 3ZLUA 1XQVA 4RNCA 4X7BA 1EINA 1QIIA 1A8QA 2HU5A 3ESBA 5K3BA 3F9CA 3H17A 1A8UA 2BCEA 1WM1A 3WZLA 2HDWA 3V48A 1CUXA 4H7HA 4ITVA 4FTWA 5T4FA 5AI8A 3WYNA 1W76A 1BEZA 4TVKA 4KEAA 2OGZA 3NGMA 4Q34A 2WIFA 3EF3A 3EQ9A 5JD5A 4F21A 4UHHA 2XUKA 3G9UA 5DWDA 4BB0A 1CV2A 3WWDA 4UHCA 4AB1A 4Q05A 5ALIA 3C5VA 2QM0A 3QMWA 1AX9A 3SC2A 4FKBA 1XRMA 4DLNA 2B61A 2G5PA 5JALA 4JYPA 3R3VA 1FFCA 1CUSA 3I28A 3C5WP 2WFZA 3OOSA 2CKMA 2JGJA 1P0PA 1QFMA 1W75A 4CFSA 1YB6A 1VZ2A 5H3HA 4C6HA 4BBZA 2PSFA 3AIOA 1TCBA 4OCZA 2HHAA 1CQZA 1UOQA 3H2JA 1SCKA 1TRHA 5JAPA 2C4HA 3R3WA 4D9JA 1C7IA 2YH2A 2WUFA 3QPDA 4EY7A 3WL7A 1QLWA 4B6GA 1J1IA 4MXDA 4LYEA 1Q84A 5ALYA 1AKNA 1ZD2P 2PPLA 2ZYIA 2RIPA 1QIKA 2C7BA 4HZGA 5IVKA 3LCRA 5KBYA 4E11A 2XLBA 2RAUA 4UBOA 1QO9A 4W1QA 3R41A 1EB9A 2QJRA 5LZ7A 5JAOA 2X5XA 1UOPA 2D5LA 3NOXA 1C4XA 1WPXA 1EB8A 5SYNA 4C87A 2O7VA 1N1MA 1CEXA 4B85A 1LNSA 3WKDA 3SX4A 5ALFA 1EHYA 3DOHA 2XUPA 3DL4A 1ODCA 3MUNA 4LXHA 3WKBA 5EIAA 2WHPB 2C5GA 3OTQA 5ALPA 1NU6A 4UBKA 2J4CA 1ACJA 4K6KA 1HKHA 1XZCA 1JT2A 5AJHA 3WWEA 3R3YA 4ARAA 4C89A 1CUDA 6YASA 3I2KA 4DMFA 4J0KA 2WG2A 2OGTA 2XT0A 2HRRA 1TCAA 2HFJA 2OPHA 1MPXA 5AKJA 3T52A 2VT7A 5AK4A 1ZIYA 4W1PA 3S2ZA 4B0PA 1MN6A 4M0MA 4RE6A 3FYUC 1TIBA 3E0XA 2XMRA 5C8VA 3GFFA 3BJRA 3L1JA 2ROQA 1U65A 3H0CA 1BS9A 4W9RA 4IO0A 2B9VA 2GYVA 1YS1X 1Y7IA 3G9XA 5LZ2A 3G0GA 1Q83A 4K2AA 5EHNA 5LKRA 4AMYA 2R8BA 1ZJ4A 2PSDA 5K3CA 1RYYA 4AN1A 1XLWA 5AKLA 5ALUA 4E14A 1BCRA 3H2IA 1EI9A 2GBIA 1U2EA 5HF6A 4A5SA 1HPLA 2WFMA 1E66A 2AJBA 3VXKA 3O9VA 2X76A 4OYYA 1XQWA 2HL6A 4B80A 1R88A 1EX9A 4X95A 5A7GA 5CURA 1X70A 4QDTA 3B12A 4IQ4A 5AICA 3AIMA 1BE0A 1E8DA 3HC7A 4Y2XA 3H18A 2W22A 2OQIA 3OG9A 4HVTA 4N5HX 3HLKA 4PSUA 2XMGA 1K5PA 4UFOA 1AUOA 3LIPA 4BCBA 2VEOA 3YASA 2ZSIA 4N8EA 4X97A 2HA7A 4KR0A 4EUSA 1E8MA 5HCUA 2JBWA 4AXBA 3OC0A 4DGQA 2JGMA 1YA8A 4BAZA 2CEKA 1XRLA 3BL8A 1MX1A 3PE6A 3I1YA 2WHPA 4B82A 1UXOA 1HLGA 4G5XA 2DHEA 5DLPA 2QXTA 4WFKA 5FOQA 1GXSA 5AIAA 3BXPA 3D2CA 5HFAA 2VAXA 2C58A 1WHSA 4XIIA 2IIVA 4FFWA 2QXUA 3KDAA 1MO2A 4G4IA 3H2GA 4Y7DA 1P0QA 3AJAA 3WKCA 4B0OA 3SK0A 3B5EA 1M33A 4LHEA 1H2XA 2VQ6A 2WFLB 5J3JA 4DSAA 3WWPA 4Y2UA 3TRDA 3KD2A 5AI4A 5AK6A 4C4XA 1QTIA 5HZGA 1YS2X 1NU8A 2EDAA 3M81A 5ALWA 4WDRA 1QIEA 2DR0A 1JU3A 4NS4A 4AMZA 4AO7A 2EDCA 2G63A 1QIGA 2VATA 5KWIA 5AHXA 1GPLA 1ODSA 5AO9A 1JU4A 2WIDA 3R3UA 2VA9A 2XMSA 5AOAA 4ZXFA 3BF7A 3BIXA 2WTMA 1ZJ5A 5ALJA 1WCYA 2E3JA 4H18A 3H1BA 1LPNA 1CUEA 2XE4A 4Z49A 5JATA 4OB8A 4IH1A 4H77A 1BRTA 5IKXA 2J4FA 3GUUA 3D0KA 1HL7A 5EFZA 2QR5A 3WK6A 5HK9A 3D7RA 3RARA 2PKYX 4Y2PA 2WIGA 5AKKA 2I78A 2RGUA 4K5QA 5DJ5A 5C8XA 3FCYA 3G02A 4NMWA 1DWPA 4UBIA 3KXPA 3HSSA 3G9TA 5I7UA 5A62A 3FSGA 3V1KA 1TKRA 2FJPA 2Y6UA 1KU6A 2WG0A 4LIPD 3G7NA 3O9MA 4KE8A 5AKZA 2HRQA 3G0DA 4Q3LA 4X91A 1IUOA 2Y2VA 1U8EA 4YX9A 1EXWA 2PX6A 3F97A 1UT6A 4KAFA 1R9NA 3O0DA 4Q3KA 4N8DA 1GKKA 5K5EA 1XZDA 3VVLA 1FFAA 1WB5A 2WTNA 1LPMA 1N5MA 1XZKA 2JGLA 3FVRA 2WUGA 5JASA 4I3FA 4KJXA 1W6RA 5FP0A 4DNFA 2DFPA 3DKRA 3ICVA 3PUIA 1F6WA 1CUZA 2WFLA 1N5RA 4AX4A 4FDMA 1PV1A 5DNVA 3WKAA 3OPMA 4EHBA 4BDTA 2GBCA 1MAAA 3W9UA 2WILA 4OB7A 4GEGA 3BE8A 4MJ3A 1I6WA 3QPAA 4BYMA 3R40A 2ZYSA 5DYWA 1YB7A 4IH9A 5BV7A 2OCLA 3E1GA 1IMJA 1ORVA 1UOOA 2DQYA 3L1IA 4J0HA 5CH5A 5T4BA 3FYTA 1CUAA 1U4NA 2VAVA 4X94A 5DTJA 5EHQA 1E3QA 3WLAA 1JI3A 2XB6A 4H0CA 1FFDA 2X8BA 1CR6A 3LS2A 1GQSA 4QDZA 1J07A 1MNAA 3D2AA 4EB0A 4GW3A 3WK7A 4HRYA 4KAJA 5HFNA 3PF9A 5AI5A 4H35A 1UKAA 3GA7A 3STUA 4HRXA 1MX9A 3C8HA 3CN7A 4H7KA 2WM2A 5CXXA 1QIHA 1CUYA 5AI9A 1Q0ZA 5AM1A 4QDUA 2BGNA 4DM7A 3UMJA 5I9IA 2Y6VA 2W6CX 4UBJA 3VJKA 2XUOA 1QIDA 3DQZA 1XRRA 4FLFA 2FX5A 4CCWA 2OLEA 1ZICA 3CCBA 3W04A 3I2JA 4O08A 5FKJA 5SYMA 3C8DA 4Y2QA 5AOCA 3SWWA 5BWCA 3C6BA 4CCYB 4G4JA 3AINA 4DMHA 5KWJA 2D0DA 3W9BA 1WPRA 2BKLA 3JW8A 4WJLA 3EIOA 4Y2JA 2CBGA 4FBMA 5AM2A 3K2IA 4M0EA 5D3KA 4FOLA 1XZJA 1ZI9A 3K9BA 2XQKA 1R4ZA 1DX6A 4DSZA 2Z3WA 2I3DA 4F0JA 3PUHA 4HTAA 1VA5A 2QJWA 3DLTA 1D07A 2JIDA 3WKEA 1QE3A 5CT8A 3D5EA 3F8SA 4NZZA 4Q3OA 3WWOA 5DTIA 5D3ZA 2OCIA 4L9AA 4QDXA 4PF1A 1XZHA 2XMCA 3QM1A 3RLIA 4U2EA 4AO6A 1AQLA 3D3NA 2Y2UA 4X00A 3N0TA 4RE5A 3B3QA 2GBFA 4IH4A 3DKKA 5AK3A 4BCDA 1QZ3A 2NW6A 2BGRA 4BVJA 4B9EA 1ZIXA 4G8DA 1R1DA 1OXMA 3DL7A 1CIJA 5AK5A 1LZLA 3ZLVA 4QZVA 4DIUA 1YCDA 1NX9A 3FAKA 1CUWA 1ODTC 4MWTA 3MGAA 3WL8A 5K3EA 4U2FA 3STTA 1H2WA 3IUMA 2DHDA 1TAHA 3EQ8A 2UZ0A 4TGLA 3WA6A 4EA6A 1MT3A 1R9MA 3BDIA 1GZ7A 4IHAA 3HZOA 5CT6A 4J3JA 4YK7A 1FFEA 2ZJFA 4DMKA 1A88A 4KAAA 3D4LA 4BP9A 3IUNA 3O4IA 5CH8A 4X92A 3IURA 3PFBA 5JIBA 5EHZA 5ALKA 1VE6A 2WUDA 5AKYA 3GZJA 4MEAA 1CUCA 5IVIA 1H23A 1B6GA 2HA3A 2WJ6A 3IUQA 3P2MA 5A7HA 1BU8A 2XUGA 4DNQA 2PBLA 4FLEA 3E4DA 2O2IA 3MVEA 1S8OA 1LPPA 2PSJA 3WIOA 5LIPA 3ZPXA 1X2BA 3FSGD 4QLAA 5AKHA 4A16A 2DCMA 4C88A 3KOOA 1CUIA 3STWA 1L7RA 4X6UA 4CCYA 4OUKX 1UK7A 4U2DA 1PFQA 4U2CA 2HM7A 2OQVA 5ALHA 1YAJA 1MJ5A 5AM3A 5K3AA 4AZ3A 3O4JA 1XZFA 1CPYA 2XMQA 1QIMA 4PW0A 4Y2RA 1LPSA 3WK8A 1Q0RA 4L72A 1F0PA 3IA2A 3VDXA 4HXFB 4H7DA 4PNZA 4C4ZA 3QBJA 5ALTA 2JGEA 2WU4A 2HU8A 2HIHA 2JF0A 2VT6A 2JEZA 1ZI8A 4Q82A 3V1MA 2V97A 2R11A 4C4YA 2QVBA 1XFDA 4X90A 1F8UA 4BZWA 4X6YA 2XUAA 1JJFA 2PSHA 3X3HA 5HK8A 5CXUA 2DSNA 5LZ8A 1ZD4A 2Z5GA 4V2IA 3Q8WA 3M82A 3EBLA 2XDWA 2V96A 5I8PA 3I6MA 3ILSA 4Y2SA 4A23A 4UHBA 5CBKA 1GPKA 3GROA 1CUBA 2PM8A 5EHXA 5IVDA 1XLVA 1WB6A 2DHCA 3ED1A 2H7CA 1CFJA 4B7ZA 3V1LA 1AURA 1JFRA 1AMNA 2AJCA 1EDBA 2K2QB 5AKGA 1T2NA 4FBLA 4XVCA 4UHFA 1G4HA 5FXMA 5JD4A 3LLCA 2BUBA 3WL5A 4WFJA 2VTVA 5CRIA 3ANTA 3ESCA 1SOMA 4L3WA 5ALGA 4ROTA 3V9AA 2ZJ6A 2XUJA 4Q1VA 4P9NA 2WIJA 4U2GA 5AIBA 2H9YA 2XUFA 1QGED 2RI6A 4Y2YA 3IIIA 3W2TA 1JMKC 1WOMA 4INZA 2GZSA 3C87A 1XKTA 4TPKA 5AM0A 4MQLA 3QVMA 3IVMA 4DYHA 4OD0A 2Z8ZA 4KYVA 1A8SA 4KE6A 1DQZA 5LYYA 4X93A 5ALVA 5HF5A 5E2IA 1HBJA 4BAUA 4K6HA 2ES4A 1CQWA 4OU5A 1O6FA 4HXEB 1UWCA 3A2NA 1UK9A 4KRYA 1BCSA 2WJ4A 3Q0TA 4UUQA 1VKHA 1YA4A 4QE3A 3R3ZA 2QMQA 2PVSA 1QONA 4G1FA 2WHRA 4YASA 4UBMA 1UFOA 1W4LA 2ZJ7A 2XUQA 4MEBA 3QPCA 4M0FA 4FLMA 1MU0A 5K3FB 4GECA 4Y9SA 3TGLA 3C70A 2BUCA 4L0CA 1L7AA 2YXPX 4J0JA 3W06A 2WHQA 4WFIA 3BJMA 3FYUB 1F0NA 3FWHA 2HA2A 2CZQA 4W63A 1W1IA 4FHZA 4CI9A 2JEYA 4E46A 5AKIA 1GGVA 4JNCA 3N2ZB 3U0VA 4OSEA 5IH7A 4B81A 3GBSA 1XZIA 1IUPA 3AIKA 1KU0A 2XI4A 3HRHA 4BZZA 2H1IA 4CIAA 5A6VA 2ACKA 3IUJA 1GQRA 3UUEA 2PL5A 1CUHA 1H22A 5E4JA 3HEAA 2P8SA 2PU5A 2VF2A 1QFSA 1CUVA 2PUHA 5K3DA 3DEAA 3H1AA 2GYWA 2XQJA 2G5TA 4BATA 4JYMA 3M3DA 1CUJA 1MTZA 3ESAA 4QNNA 3STVA 3LIIA 1DINA 5JARA 3AUKA 1G5FA 1CVLA 1XRQA 4X6XA 4QLOA 1EVQA 4UPDA 5JD6A 4MYSA 2BJHA 3VVMA 1SFRA 2XMBA 4GBGA 4QA9A 4PSDA 2GBGA 4CG2A 1XQYA 1LPOA 4GXNA 1ZD5A 3R3XA 4LXGA 3OM8A 2YASA 5EIHA 4J0IA 1B41A 1XZMA 2RHWA 5D6OA 1CUGA 5AOBA 5AM5A 4QDOA 4E15A 2CUTA 2WG1A 2JGKA 5HF9A 1GT6A 2WIKA 1C7JA 4DNPA 4S0XA 2VJAA 4KE7A 4P08A 5LKAA 4BP8A 3BWXA 4BRZA 3FVTA 2ONCA 5AH0A 3U1TA 3WMRA 2AJ8A 4H7EA 1XZAA 5K3FA 1J06A 5FV4A 4RGYA 3A2MA 4UFNA 2DQZA 1MAHA 3UUFA 3FYUA 1VXOA 3WJ2A 3PFCA 2OG1A 5JYCA 7YASA 3WK9A 1AGYA 3FNBA 4QWMA 2H7XA 3T4UA 2WJ3A 2ORYA 3C6ZA 4FNGA 3ZLTA 3F96A 2XMDA 5FPQA 3ZWQA 1XZBA 1L7QA 4PV7A 3NWOA 2HA4A 3QITA 5CMLA 3PICA 2XQGA 3AZOA 1IUNA 3I6ZA 3W05A 4BVKA 5FPPA 5AP9A 2Z3ZA 5DNWA 4AN0A 5ALMA 1KEZA 1EK2A 2I3ZA 3JWEA 3WYDA 3HXKA 4EY4A 5LLSA 1CUUA 4J0CA 3DOIA 3DS8A 1QO7A 1O6GA 1CUFA 2BAGA 1DTEA 3KWFA 4ZREA 3C43A 3G8YA 1LZKA 3RK4A 2AXEA 5IVHA 3I1IA 3BDVA 3R0VA 2HFKA 1DU4A 1W52X 5LZ9A 4Y2TA 1USWA 1BN6A 3O4HA 3HI4A 5FLKA 5ESRA 5ALQA 4EY6A 1UK6A 1EDEA 3FOBA 2XUIA 5FDFA 1JJBA 1Z68A 3AZQA 4BDSA 3H04A 1DWQA 5HKBA 2ACEA 2QUBA 3G0CA 1LLFA 1Y37A 1P0IA 1DT3A 1XQXA 3IB3A 5BWBA 4LKOA 4MYDA 1TK3A 1EH5A 1UKBA 5LP1A 3H19A 3C45A 4KRXA 3HYSA 4AO8A 1XRPA 4CG3A 5CT9A 5ALSA 1OCEA 3DCNA 1E89A 3IULA 1EA5A 3O95A 1IVYA 1XKLA 3NUZA 4BC1A 4J03A 4OB6A 4BTLA 4OYLA 5ALOA 1YR2A 1DT5A 2IITA 4WY8A 4ZRDA 4G8BA 4BE4A 1VOTA 1THGA 4ZV7A 4MWSA 1ISPA 4X85A 2ECFA 3KWJA 1R3DA 4W1SA 2AJDA 3HJUA 4GHWA 4XJVA 5ALLA 4CG1A 1LBTA 1WB4A 5AM4A 5FUMA 1TCCA 3EQ7A 1QJ4A 4B84A 3G9ZA 3AILA 2Q0XA
chains in the Genus database with same CATH superfamily
4K6GA 4UM9B 3IUYA 5F4ZA 2HW8A 4HNSA 4QEKA 3U7FB 1NJ6A 4OQ4A 4R8LA 5CNIA 4C4SA 2OFOA 3JASB 3ZR4B 2FI1A 2CV0A 1FXWF 2QRUA 4LTMA 3L8FA 4E1VA 4EL5A 5M3BA 3H3XA 1OIWA 1QAOA 2LZ0A 2ZYHA 4RJ2A 3DTVB 3P4UA 1I5EA 1M2OB 4O2AA 5DNUA 3BWYA 3I9JA 2R1VB 4UFPA 4K9MA 4RGQA 1VL6A 3LBAA 2XNHA 4BKMA 3R6LA 5HX7A 2HNAA 1ZO8A 2GXAA 3TQHA 3EGCA 2HAEA 3LKBA 5ALNA 1HMPA 1YD7A 3BJEA 3H5WA 3KOWA 2BWJA 1F12A 3ER9A 4OGFA 5JY1A 5TIIA 2DSTA 5G4KA 2GYUA 2ID8A 3GEPA 4U8GA 5DN6A 2HD4A 4EG3A 2TS1A 2P9FA 1FFBA 3D1LA 2ZRKA 3OTHA 1KRHA 2GGSA 1S3GA 4U7TB 5FOVA 2PMCA 3H7AA 3PENA 4R31A 5FWYA 1U8FO 4NP6A 2QE7A 1MX5A 3DYVA 5BT9A 3G2JA 4Z99A 5LMZA 2W43A 4O8ZA 4ZZ3A 1PWXA 1XO1A 3SP1A 3UA3A 3A6DA 4G84A 4PYLA 1SC9A 2W48A 2Z2KA 3C5CA 3KQYA 2Z6AA 2A0XA 5C0OE 2D3WA 2B8JA 4IUYA 3REQA 3N74A 1GJRA 4GEKA 3D6TB 2HMWA 3AM4A 3IO5A 2GHIA 4TVOA 4AP9A 2CXTA 2GCOA 4PAGA 2GUWA 2AL7A 2ZYRA 4F3RA 3NYWA 3WA7A 3ZU4A 3OD5A 4KN8A 1SCAA 3A6ZA 1VKOA 4OBWA 4IOMA 2HU7A 4B35A 2EW1A 5LNK1 2WVGA 2BI8A 1BWSA 2DFLA 2VCEA 4XB6B 4H4DA 1Y4DE 2D5BA 4CTKA 4R69A 1WXHA 1SVSA 2P7HA 5DPMA 2PSEA 3QMMA 4Q3AA 2OAEA 2VP3A 4KNWA 1OZHA 3C6XA 1N33B 1OXXK 1BFUA 2V6FA 1KK2A 1QTRA 3L07A 4JJEA 5BYBA 3ZNOA 4EYQA 2P3QA 1ZOIA 1X1QA 1ZIPA 2WQZA 2NX2A 1K8ZB 4BGEA 5M04A 1NUAA 2IVZA 3AJ9A 2Q6IA 3DVSX 3HR4A 3PL5A 4RYLA 2RH9B 3DVAB 5FR1A 2J3KA 4Y2VA 5FWXB 5I4IA 4Q16A 2GZAA 1UKCA 4CGYA 3QEKA 3Q2KA 4KB5A 3ORQA 4E2XA 5C32A 1QZZA 4N7JA 1I4TD 1EWVA 3ORHA 2RCYA 2PUTA 1ABBA 1TYEB 2QLJA 1KMHB 3R0IA 2HLPA 4G65A 3TK1A 5E3HA 3FUUA 5CDFE 2XNDA 4CEIA 2IA5A 1NBAA 4WTOA 2AZ4A 2XMPA 2R7LA 4QLBA 2JLBA 1YZHA 2PU7A 1BVHA 1G18A 2XB9A 3I61A 3OP4A 5AKXA 3NDIA 3OX2A 2CLKB 4QAQA 1XHEA 3QVTA 4BRSA 2ZBVA 2ZUEA 2FWPA 2IGTA 4F8JA 3OY2A 4E0BA 4H7IA 1YR9A 1O87A 1T8UA 4KQHA 1LGYA 1L1EA 4JB8A 5GTDA 4TV8A 3D1JA 4GPD1 3TLMA 3THOA 5JHHB 1T1JA 1OASA 4MLZA 1Q1ZA 5TJHA 5A4IS 3AR7A 2OESA 2C4VA 3TM5A 1YO6A 3QOFA 2B7BA 4TWJA 3IALA 5BN5B 2O8FB 2VA8A 5LUAA 3E2MA 1LTQA 5AI6A 1QNFA 2FB9A 3OEHD 1DARA 2ADFA 3CINA 4Q1DA 3F98A 2BFCB 2OMEA 4FKMA 4EPRA 2VQFB 1IVNA 5J47A 3ZV4A 4LDQA 1IQRA 2QRHA 4MA0A 5E9JA 3B78A 3ZD7A 2I6TA 3O7WA 4UVHA 2VCHA 4BPBA 1CF2O 1SUFA 1TTHA 2JFUA 4KQ9A 5D3ZA 4FEAA 1HO3A 3CW8X 1RJGA 5A4JA 4X66B 2CHUA 1GPWB 3L06A 4LGMA 1E3TA 4RADA 3ZWMA 1RI4A 1U5BB 1YKSA 2C2GA 2Z58A 4RF5A 3W5UA 4HFRA 2O23A 1VGVA 3G0BA 5TEVA 3WHIA 1UXIA 1E1QD 1OXUA 1T0HB 1TOAA 2FOIA 2X42A 3L8ZA 5AUQA 4KU4A 2GHRA 5D1HA 1XT6A 1R6TA 3OEED 4RD4A 4YCDA 1ZR2A 3BC1A 4N7BA 1XMIA 2R2AA 4MZXA 1NWCA 4TTQA 3GLSA 4B4OA 4RLQA 4IQFA 4EOGA 3C5HA 1SK9A 2WUWE 4FHFA 3FPAA 1Y1TA 3DDUA 2PKXA 2ERXA 5DNEA 4MCHA 4OLHA 2BHRA 3QLJA 1R0YA 1XRNA 3T54A 1GUDA 5L4NA 1N3BA 1K63A 1LQUA 4PNHA 4G23A 3H2HA 3H5TA 3NPMA 3T3HA 4D9CA 4MIYA 1ZONA 5BOVA 1KJJA 1DQPA 5KQGA 4ETWA 3FFWA 1A77A 1JKMA 5GZ3A 1FS6A 2XJ4A 2HBQA 2YV2A 4O0LA 1VIMA 2H3HA 2W2OA 3PC6A 2CSUA 3UJ3X 3D7NA 1E9AA 3W5VA 3ZEAA 2J6HA 4NVRA 1SG0A 3DE3X 3ETJA 2MSCB 1TLLA 3AFIA 4C7JA 3LW8A 2BMJA 5TC4A 1PJCA 3ESDA 3SF0A 4CUKA 3FCOA 3RSHA 1G3RA 3OETA 4IIFA 3VR4D 3ZWDA 5CA0B 4W7SA 3FLMA 3V1YA 1J8FA 4AK9A 3CPEA 4J6FA 5I3CA 3NWJA 1DV2A 1DC4A 2Y92A 3AX6A 2J3QA 5LMNB 5EIWA 2EEPA 2VWHA 4Y67A 3L02A 1IN5A 4DUYB 2FKNA 5IG2A 1WZ2A 3AB7A 2ODNA 1WQ1R 3DHNA 3L1HA 4BP1A 2GR9A 2OLJA 5CB8A 3C7AA 1D09A 3DEZA 3EAGA 3FTCA 2F90A 2VSFA 3MB8A 4ISCA 1R8SA 4ATNA 2R4QA 3ZNNA 1CLEA 1QPGA 4CQLB 4BQIA 2FPUA 3L7YA 4ZAFA 4UOZA 5HF8A 2J3DA 2R66A 2OGSA 3S2UA 3J80A 4U7WA 3VZRA 2ZK7A 1VBKA 4GPBA 4CMEC 6CHYA 2NPOA 3KQUA 1Q1NA 2LUOA 3VX4A 1JQ5A 4IDGA 4LJYA 1XE3A 1WKVA 4UHDA 1ZAKA 3HCPA 3E1KA 3RK0A 3SPXA 1DJOA 3HO8A 1EVZA 2C8KA 3O75A 5HPYB 5LU9A 5FBZA 3RTCA 3EGIA 1CC1S 4L27A 4D5EA 1LBIA 1NVVR 4ETMA 2YZ7A 3KJFA 4BNJA 4AYXA 4OJKA 4IVNA 3ZUGA 3EDRA 1XEAA 3GAZA 4CYMA 5LYJA 1T9GS 3AF0A 3Q1LA 2YXLA 1SR8A 2P2YA 3E7WA 4CR7A 1BN7A 3RFTA 5BUQA 2XCQA 1NI3A 5T4EA 2B4KA 3EVZA 1ISIA 3GX1A 3I83A 5JNSA 4XM2A 3T1OA 2AYXA 3AI7A 5C1IA 3C24A 1MB9A 3F2VA 2IH4A 2G9QA 3A9WA 1ZA1A 2Q3EA 2FK7A 3UXYA 4OHZA 3V33A 2AJLI 3KFLA 1X80B 3QMVA 3QLTA 3OURA 4GM0A 2GDJA 3ACBA 1DRVA 2J3EA 3MIZA 4N8SA 3R7SA 5JANA 2A0YA 1D4FA 2GPBA 3KHTA 4KFTA 4PINA 4RMHA 4LUCA 2I03A 4F4DA 2XZTA 3I0ZA 3U4DA 1KEEB 221PA 3DEHA 2XVMA 1YBMA 2YQ5A 3M6LA 1W4CA 4DUGA 1CZNA 3U3OA 1E64A 4MRVA 2C0PA 4ZIRA 5LFAA 1FSGA 5DW3A 3W5SA 1WVMA 4GOXA 1KY4A 3H5VA 5E1MA 3E18A 1AN9A 2UYYA 2IX3A 2CLEB 2EKLA 3DD5A 5D1NA 5DOZA 5E8RA 1SCIA 1UPUA 4WI1A 4D4LA 1P5FA 2FA9A 5L3QB 1C9EA 4ESEA 1JJIA 2FPOA 1A76A 1IBCA 3HP4A 3IJ5A 3TCKA 2OFWA 1UPTA 2HADA 4ZYTA 5CVJA 5DSZA 2NYVA 1P9LA 3I5YA 3OZAA 2FFHA 4GLBA 3S8YA 2W2MA 3C3BA 2VSQA 1JQDA 3AEZA 3QYPA 3D59A 3KTAA 1HUQA 1F17A 1ZGHA 1ZH2A 2ZWIA 3S2IA 1ZJJA 5AJUA 4LZZA 1EK1A 4Z9XA 1M34E 1MQ8B 4NARA 3I4LA 3F3KA 2C2KA 1JHVA 1ZHHA 3Q88A 5LC1A 4RJLA 2JCBA 2M2IA 1MJGA 4RTMA 5ALDA 4YRIA 3T3OA 4AKIA 5JCXA 2WA2A 3TXYA 1MQAA 3K1AB 2CL0X 4TWIA 1XZ8A 2MMGA 2EQBA 2V7EA 2YY6A 3FVVA 3L0IB 4GOND 4UVEA 1KI6A 1LKZA 2GZ3A 3PNVA 1KO4A 3TEJA 5IJ9B 2ZT7A 1W85A 3R7WA 3TO5A 4WESB 2XDQA 1YDEA 2A1IA 1T2DA 2GERA 2MIIA 5HQ3A 5IDXA 3D8RA 4MKIA 5JXIA 3A05A 3ONFA 2W6ID 3G88A 3KDSE 3RFXA 1E2FA 1YAHA 3AFMA 5KTTA 3C6YA 4DR3B 3M4NA 1VJ5A 2IYZA 1GSOA 1G2OA 5EZYF 2JG3A 3UWPA 5C5IA 2BM0A 2VVTA 4PS0A 1XF1A 4R6WA 3K6KA 1ZVVA 1OI7A 1PZHA 4D6PA 1KMCA 3EA5A 3NC1C 2Q5EA 1P7WA 2VJDA 4Q01A 2CY0A 1MH1A 3CLTC 1KZ1A 3HMQA 4LWPA 5AT1A 5FUBA 4YAGA 1GKLA 1KZ6A 2XUDA 1QDUA 3HBJA 5FT9A 4ZVTA 5FO0A 1RU3A 3R09A 1V7ZA 2PX3A 1YQWA 3K0KA 2W2LA 3FLAA 1JU9A 3L0YA 3PI6A 4KYIB 2AN1A 2AOWA 4MRNA 4U6SA 3IP1A 3PF8A 4YAJA 4MUMA 3CZCA 4ND8A 1PLLA 4UCXA 3T9CA 3V7NA 4PNPA 1DWOA 2HSDA 1X39A 4WT7A 1RJEA 2PMEA 1EVEA 1JDVA 3QVWA 5A4DA 3HI6A 2BOVA 5FYDA 3BDAA 3SD7A 1AOXA 3VR3A 2Q2VA 3JQCA 5KSZA 1NJ5A 3GEBA 3AU8A 4LXIA 5A5VA 3MXOA 2ONYA 4D26A 4P92A 1Z8DA 4CFYA 1YZNA 2XA2A 3BX1A 2PS1A 3CG4A 4A27A 5BSWA 3DMHA 2J0QA 2KW5A 4NH0A 3DYIA 3BXXA 2V3WA 4PPQA 3PVZA 3Q72A 1WUIS 2C2MA 2D7CA 4IF4A 4KL8S 2WSIA 4WZAE 1FXUA 1BDHA 1F2UA 3WJ1A 2EHDA 2QD4A 1RVDA 4MUGA 1FYFA 5A0VA 2BMDA 3VJLA 4DFDA 1DO0A 1P7ZA 3FLBA 3DZIA 4NNJA 5EWMA 2VDJA 1OGIA 1Y6ZA 3SVLA 1P5ZB 1TYCA 1L4LA 1WPGA 3GFBA 2M6KA 3V1NA 2CKDA 3BF8A 2D62A 3SSAA 4HLQB 4W8OA 1TQ6A 3TVDA 3P32A 3IRUA 2QE7D 1TZBA 3KYCB 3BMXA 2ZSDA 3RFFA 4S1TA 1PI3A 1M7GA 1V8BA 2HCFA 3EWAA 4GXTA 2P2ZA 2OBLA 4HLUC 4ZOBA 3K0FA 4CM3A 4HNUA 2WLSA 4MCJA 1J5EB 1JYFA 4E30A 1BEEA 1QJCA 2C77A 4BLPA 5J2TF 3OCVA 3KTFA 5EGSA 1RI1A 5DNAA 3OPYB 2RD2A 4TUYF 1XQ6A 1MJNA 2NSJA 2VDPB 4NENB 1W47A 4LXXA 2OGWA 5A1JA 1GP2A 9GPBA 3CF0A 1YJ5A 4URFA 1W6UA 2WHEA 2AT1A 3GVPA 4I19A 2OV4A 3ZI4A 4ZT3A 2IPAB 4AU1A 5F9MA 4ESOA 3LHIA 2ODAA 3O31A 4KLZA 4MR8B 3RTDA 1YA6A 3LX5A 4F46A 2QUIA 3OZWA 1BFKA 2BDTA 2VI5A 1A9ZA 4DEXA 4EGQA 4GVLA 4URWR 5EMNA 3MWJA 1J8VA 2BISA 4HUQA 1E6LA 4XW2A 4OLBA 2HU5A 4FOTA 4K28A 3GCXA 3MTIA 4QICA 5SICE 2Z56A 1MO6A 3U9TA 4HNTA 3SQMA 1AQ6A 3F6SA 3H17A 1WM1A 4GRIA 1NN0A 1SHLA 4H59A 1M1XB 3V48A 3WGNA 4B75A 4F3KA 4CF7A 2GA9A 4JX9A 4ZRMA 2LNDA 3HXQA 2B78A 2GETA 5T4FA 1V11A 3L6CA 3KQVA 1FXWA 3RNLA 1E5VA 4G8JA 5JLAA 2OV1A 2WIFA 2ZI4A 2VDLB 2YC4C 4B31A 3L4BA 5BUZA 1JG4A 5DTQA 1HG0A 1O4VA 2PIDA 5EJ4A 3DZJA 5BVGB 2XNDD 2FDCA 2PRKA 4I55F 2A9PA 1HDCA 3G9UA 5BR4A 3A1FA 1G19A 1R0BA 3GYBA 4TWZA 5DWDA 2D06A 1KVSA 4QPCA 4EO4A 4W5NA 1T35A 4UHCA 1IOVA 2VRNA 1PR9A 1V1RA 4GG1A 4M7RA 1E2PA 4OATA 3DEIA 3I04M 4QUAA 4TLEA 5DT2A 5BMVB 4NG4A 1NJ1A 3U26A 4ZVKA 1G6HA 1BQEA 2F1JA 2ZATA 3UGQA 1AX9A 3UH1A 1L7MA 4O3MA 5NLLA 3NC4A 1VE9A 2CVFA 2I8LA 2NT4A 1Q11A 3QVVA 4FKBA 2H2HA 4LDZA 4Q7KA 4ZVLA 5I8WA 3TDKA 5LR6A 3BMQB 2VDNB 4PG4A 3OLQA 5IBPA 1PJ8A 3IAS1 4RQAA 4UXHA 4X1YA 3FCSB 3LD9A 1RJDA 3MZ0A 1TM7E 1K4MA 3RVJA 1XTSA 2C9MA 5JSZA 4DIDA 2M98A 4FGZA 1CUSA 4NZPA 3L7IA 1NM5A 4DMLA 1Y8ZA 1S96A 5DOVA 3WLEA 4MEJA 1VDMA 1Y1RA 2K7ZA 2JGJA 4OHCA 1P0PA 2I76A 1QFMA 3ZG6A 4MYCA 2A5DA 4G09A 3GGCA 4OP1A 4DF3A 1C0KA 1CDDA 3IMKA 4CFSA 3IGFA 1YB6A 1YULA 1QS0B 1X1TA 2W93A 5C80A 1VZ2A 1O94C 1XMSA 1SVWA 2B8EA 2BZGA 1TFRA 3WDSA 1KWKA 3LQYA 1I3KA 2HCTA 4K86A 4WJZA 2OD7A 2W0SA 3O47A 1F6DA 2M6LA 2JKZA 4MVJE 3RRFA 3WLOA 3T1TA 3E23A 2G36A 4ZZ0A 4V0KA 4PRYA 2MOKA 5K01A 1PX0A 2QW8A 1SRRA 4PAQA 3P2YA 3EIHA 4JS0A 4YXWD 3OESA 1XV5A 2AI3A 2Q4EA 3DHWC 5BOSB 2ZRNA 3QNWA 3VNSA 1JVNA 3MWEB 4H1VA 2I7XA 1C7IA 1NY6A 2CW5A 2GPAA 2N75A 3LGXA 3MFYA 4Q4LA 4EY7A 2IODA 1ZYUA 4G25A 5EEHA 2ZBGA 4IUCS 3P52A 3SNKA 4EF6A 1DDGA 1U7HA 2Q5IA 1LDMA 3OUTA 2O3RA 4L50A 4ZQHA 3RANA 1H85A 1LC3A 2ZBRA 3RWOA 3EZ6A 2ZUFA 4RPHA 4S0ZA 4RJIA 4D3DA 1Z2EA 1GO2A 2PPLA 1K6JA 1KAQA 1QIKA 3MJEA 4P53A 5BSMA 2V6MA 4EG4A 3FHOA 4YAKA 3TGPA 1JB9A 2DBQA 4AJPA 4BNFA 4NRDA 1QK4A 4FT4A 1WETA 2WJHA 2XLBA 3ZH2A 2LIVA 3ORRA 4KWHA 2AFIA 1SU6A 4LBVA 1DJQA 1EB9A 4AMZA 5K45A 3GVHA 5CFPA 2QHXA 3ZXIA 4KVAA 3GLKA 5FOUA 1Y42X 4V02A 4EAQA 4R7TA 1PWEA 3SJUA 1BDJA 4LC9A 2IWRA 3OMXA 4DN6A 6REQB 4H1TA 1Y7TA 1JIIA 1KZGB 2BFFB 2C7GA 4D46A 4V0MA 2X5XA 4CMIA 2EFGA 3K7EA 4BNGA 5AW1A 1M2JA 1JH9A 4Z4QA 1Z5PA 2Y67A 2EFDB 2HQ1A 2OY0A 2Q21A 1IFXA 5B3JC 4XGKA 5IT9A 4OVKA 4V0LA 3UH0A 1JAHA 2REQB 3H42B 3GLIA 2O7VA 1N1MA 3P0HA 5JCZA 1EUCB 2HX1A 3I72A 3Q7TA 4OAOA 4OFXA 3JPYA 1S5PA 1G3UA 4K9OA 4HDAA 1M8JA 1UBJS 1WBJB 4QFBA 1B23P 3RAEC 5F3RA 5HIIA 3DNPA 2QDKA 1SBTA 2RCNA 4IF6A 4D9BA 2CYBA 4A2CA 4M76B 2ZREA 4YV1A 3PEYA 2IL1A 1XU7A 1G16A 1NPYA 3D8NA 4LXHA 2RHDA 1C3OA 2PKQO 4IJMA 4JOBA 1H3FA 4Z0TA 1OWOA 3CKKA 2IV3A 4GFDA 3WLRA 3CZAA 1NVFA 4XQEA 3GEHA 1MJFA 2PCLA 2VTBA 3ZEIA 4AWAA 1RM5A 2J4CA 2ONKA 4POAA 5GIOE 2V7WA 1FDUA 1H4VB 1VPDA 3DMRA 3I05A 1P44A 3QXGA 4IPTA 1ZVKA 4BFLA 4D56A 1GN8A 3PTZA 1M1YE 3U49A 1YGYA 4B6QA 4E7PA 1PIWA 3S7ZA 5DTIA 2QV7A 1NW8A 3UBMA 1D7OA 3QOWA 1XZCA 3J81A 1RRMA 3DPIA 4C3OB 1YONA 3NFYA 4RD6A 4HPWA 4H17A 2JHFA 4TRRA 3SF8A 5IKEA 1M8GA 3GLTA 2FPMA 3GFTA 2NUAB 2F17A 3OQIB 3GLFA 2ZYUX 6YASA 1RBZA 4PHCA 2FPXA 1MJHA 1QB7A 3QKIA 4KIJA 3ROQA 2LKDA 2OV3A 3KZ1E 3STHA 2CT8A 4B8YA 1KERA 2XT0A 2HRRA 5SY6A 1HG1A 1BVRA 5B1EA 2VPXA 1VI5A 1TCAA 4M89A 4DUGD 2X7JA 1KI2A 4K6OA 5T8KC 2IT1A 4UNRA 3MGGA 1TL7C 1XDBA 3M5CA 3NRBA 2VT7A 4NQRA 3T52A 4KHPB 3FPCA 4HN2A 3RGWS 1VIAA 1DRKA 4IG4A 4KBGA 4E6EA 3CNHA 4Y1FA 3CC8A 4X65B 1PW7A 3JZFA 3PXUA 3Q40A 4B0PA 3M7IA 4XWTA 4CM9A 1SOUA 1CP3A 1TIPA 1RXSA 4JBIA 2XE6A 4PR3A 4XGIA 3N8DA 5EMHA 1IN4A 1SXQA 3RU2A 1DJMA 1FNCA 2VTEA 4AKHA 3BJIC 3FYUC 3QU4A 3O4FA 1FMLA 1M0WA 2CLMB 4LQDA 4YC7A 4OMDA 2XMRA 2P9JA 1LSOA 2O3JA 1Z4IA 1FRNA 1A72A 1H8EA 5CYFA 1L5LA 4RIFA 3NBQA 5E6UA 3BJRA 2GKOA 5E6SA 3H9JA 3SYTA 1SXPA 3P26A 4D3ZA 3LZ6A 4WLVA 1GIAA 3NO4A 2WTAA 3MCZA 3SDZA 2FP4A 3E81A 4HTFA 4C0HA 3TIVA 1VQ1A 3D6VA 1BS9A 4EPWA 4QTYA 2VF4X 2AUMA 1I3NA 2A1TR 1C81A 1F5SA 3TAHA 3TW6A 4IO0A 4Y0AA 3ENKA 4PZAA 4AWBA 2WWHA 2QGNA 5J9FA 1OFUA 1BVUA 3BREA 4A1FA 5B12A 3MT0A 1Z75A 1CXZA 3BIOA 3G0GA 1NT4A 2F2TA 4QQ8A 5EHNA 5AXAA 1C0EA 3QI7A 3EX7C 1XPJA 5LMUB 2ZRMA 2Q8NA 3JARA 5TQ2B 5IT4A 1TEZA 3I6BA 5ITSA 3NBFA 4FYVA 4NJOA 4FK8A 1ZKDA 4PLCA 1UT5A 5AKLA 4WFQA 3SS7X 1QG4A 1I1HA 1EVKA 1PSDA 2CD9A 4HPXB 5AVWA 1RCUA 4DCTA 4QSMA 1E3IA 1L4GA 5DE3A 1L5NA 3TRIA 3O8DA 3L6EA 5AVZA 4L5IA 3TUZC 4QT4A 4TV9F 4P31A 3TLKA 5HF6A 1J0XO 2GN4A 3L8MA 4DJFC 4L02A 3DH0A 1Z35A 1NFQA 3SM3A 2AJBA 2H3EA 2W2LD 3U44B 1D2NA 3TVYA 2X76A 5KDOA 4XB2A 5JOQA 3UHOA 1JHOA 4BGUA 1QWOA 2P69A 4ZOEA 1N9ZA 3NRJA 2CUZA 3K9GA 2E89A 4F5WA 2FSSA 1EX9A 2Y3IA 3P9SA 2IS1A 4E32A 4KXYA 3VR3D 1X70A 2RBEA 4QDTA 4GBED 3GT7A 1UBRS 1A5AB 1N8KA 2NV6A 3D6AA 1K68A 1ZW1A 2RKBA 3Q3HA 1Y3IA 2QK4A 2WF5A 2JCYA 3TBHA 1PNTA 3IBSA 2HU2A 3ZV5A 1FBNA 5KVCA 3RSGA 3E3OA 1E8DA 1IWPB 2VHUA 2FWRA 4PG7A 4XIGS 1ICIA 3G2IA 2OQIA 2AZMA 3SY8A 4A8HA 3DO8A 13PKA 1C0LA 1E32A 1G291 5DHFA 4DVJA 1K2WA 1YJBA 3D31A 4WMLA 1H94A 1NC1A 2X6RA 2FSGA 4Z7QB 4BNZA 1ISGA 1GSAA 1VECA 3Q10A 3NHZA 5U1PA 2P4HX 5KVVA 3H2ZA 3SE0A 4N41A 4NKRA 5KSOA 1K5PA 2XITA 3MEQA 2FPIB 4PG5A 3BZUA 2J67A 4AD8A 2VEOA 3LV8A 4KPUA 4MS4B 3TUJC 3MUEA 1MC8A 1U28C 2QY9A 2R62A 4ND4A 3YASA 1E1LA 1C30B 2OR3A 4JJ4A 2HA7A 1O0SA 2G06A 4ISBA 1U2ZA 4QYIB 2QVYX 1CDEA 1YS7A 4NCNA 1XTIA 1E8MA 2DFVA 1I8TA 2JA2A 2VHCA 3NDRA 4XDGA 5HCUA 4CJXA 2JBWA 1NQUA 3IAUA 4CXMA 4IFTA 4DGQA 1PTJC 4R1OA 1ULSA 4MVYA 1JS1X 3PXGA 2PUGA 2OLKA 4QREA 3ZDAA 3BL8A 1MX1A 3PE6A 2WHPA 4XVQA 2G83A 3OSUA 1FLVA 1HE2A 4MP3A 2YY7A 3BEOA 3ZY2A 1GGKA 2O4CA 3KR9A 1WXGA 2R6JA 2HT1A 3GMTA 4LE0A 1V3QE 4LMAA 4LX0A 3N53A 2BRUA 1Y6RA 5EZYA 2PX0A 3IT3A 1ODIA 4U7DA 4N9WA 1R4NA 1UJCA 2FPGA 3QU7A 2GRAA 3O3MB 4J0QA 5B3AA 1WU7A 1MABA 4HJRA 4JNKA 4JASB 5I9SA 2H4JA 1CY7A 3ZH9B 2WWFA 1GAJA 4AMVA 2VJMA 1RXVA 1SMKA 1WTCA 1XTBA 2HRDA 3FMOB 1P2DA 1WHSA 2PAAA 1X7HA 3P71T 4FFLA 2H52A 1PGOA 1EBUA 2DKOA 2IIVA 3HCOA 2QXUA 4UQPA 3PFGA 3AEKB 3G49A 4GPTA 2WWGA 5BXYA 2P2NA 2HJRA 1HGXA 2Q9UA 3ELYA 4EITA 1X38A 4Y7DA 3TMKA 1M6WA 4RPLA 1L5HA 4B0OA 4C76A 1FMFA 3OP1A 4ZCPA 3B60A 4XEHA 3RUHA 5IHPA 1OVMA 1OFTA 1U0GA 3LUFA 2NO7A 5D3MB 1KQNA 4DPKA 1EE1A 3OZTA 3KR0A 4FMDB 1RLMA 1GFSA 5JR3A 3KZCA 4J91A 2OO3A 4NZYA 4DUPA 2WJJA 2WWYA 1EFCA 2PBRA 1KSHA 2IF0A 4BKRA 4D97A 1MB2A 4C4XA 3NJRA 4AY5A 4MGHA 1QTIA 4I14A 3WTCA 1LX7A 1RBMA 3MCUA 1TT7A 1PJLA 3DV2A 1A82A 1PZNA 1UR5A 5BSEA 1C9MA 2QTTA 1W30A 4NMHA 1KJWA 1MTOA 3JSAA 5COBA 3C3KA 1JEYA 4B4KA 5UKDA 3QHAA 1Y4UA 4UZEA 3G8BA 2QZZA 2BFPA 1LRLA 4NBLA 2XKBA 4LVCA 1PQYA 1W88B 1EGMB 2VT3A 1OWNA 2WLTA 1X1RA 1UDBA 1T3ZA 3AWDA 1GAWA 2EDCA 4MKZA 1YCFA 2CVZA 2JLCA 3PKZA 2VATA 4YAIA 4KWCA 4KO4S 5CM9C 1ZNWA 5AHXA 4DUZB 4HQFA 3VKUA 4DEVA 2ZRIA 5L3RA 2W2VA 1CB7A 2HHHB 2P4SA 2WJGA 2YWEA 1J7JA 1GGFA 2F43B 2ZRAA 3H9GA 4QUGA 4LNHA 1W46A 1SIWA 3B6IA 4RD1A 5J2TA 3L77A 4DG5A 2XMSA 5AOAA 1NLUA 4KRGA 4ZXFA 4HDKB 4EG6A 1KNQA 4Q1FA 1K5DA 4TUYA 4BO4A 2WZDA 2Y05A 2ZFUA 3ABSB 4HEA6 4DCGA 5EJMA 1EUQA 3OTWA 4M7OA 1KYYA 3UPTA 5AJZA 2QD1A 4HGNA 4MI1A 5CHYA 5JBNA 1WXIA 1Q3TA 1JSLA 2YR0A 1DRWA 4Q4JB 1JIJA 4B3RB 2G7ZA 1G8KA 4HX9A 3SXUA 3GVCA 4COOA 7GPBA 2V6BA 4URUR 1AK1A 2XE4A 3E9QA 4Z49A 2DB3A 3ASYA 5HQJA 5KDDA 1SWWA 3K1YA 4R7GA 4Q4HB 4UM5A 1OTYA 3R5XA 1XK7A 4HKTA 1CR1A 2ZIUB 3D81A 2C8VA 1GR0A 4OB8A 3U0BA 1P9NA 5JATA 2FZEA 1PR2A 3DL2A 1BRTA 3PQ4A 3R0XA 1M34B 4TXNA 2ZS8A 3D0KA 3DKIA 5KNDH 4QGGA 1SQ6A 2VHYA 4RPIA 1IRIA 1GZHB 4IJQA 3NHKA 2QR5A 2V7PA 1DAMA 2V7XA 3C2QA 2FXVA 3L6BA 2E1RA 3E7PA 4KXXA 2CGEA 4LTDA 3ZU6A 3N9IA 3TCXB 1OIXA 2CDRA 4MV4A 5AKKA 4K5QA 5FTWA 5DJ5A 2IQIA 2PQ0A 2OG2A 3FCYA 2IUUA 3U4QA 4H6WA 3PP8A 4B8ZA 4KQIA 1FUKA 2CC2A 4FFBB 2WQ6A 2W58A 1BO6A 1Y5NA 3HSSA 3KXPA 5ILGA 1Y6JA 1YI1A 2EF0A 2ZSKA 4I55A 5A5EA 3FF1A 3LQ1A 2BGJA 3V2GA 4XPIB 4PNEA 1DBQA 2G08A 4CQNA 2YW2A 5DB4A 3QWIA 2FFRA 1Z9BA 2W4IA 1JEJA 1BXKA 3VR6H 5KSYA 3SC2B 4LIPD 4K6CA 3U40A 5PNTA 4B17A 2L69A 4LJ6A 1EM8B 1Z45A 3OCYA 5I8ZA 4CMBA 4KSCA 3SNHA 2HBYA 1U8YA 2ODBA 4X24A 4Y6QA 5CDGA 1XXLA 2XB2A 4NJEB 3LVFO 3ZD6A 4EELA 3GNTA 3F71A 4DJDC 1IUOA 5DFAA 2B30A 5HNKA 4WUVA 2XD9A 3O83A 4YRDA 4DOMA 1RDFA 3E70C 4EJSB 3I0NA 4G6ZA 5BR1A 2Q2WA 1M67A 2A1UB 3Q15C 4I3GA 4BNWA 4WOBA 1ZSNA 1NFFA 1YQEA 5DLQC 3DM5A 2YX1A 2ENWA 2V54A 1ZM7A 1UXKA 2EX0A 3F97A 1N3YA 1Z4OA 2FR8A 2JZOA 3UCFA 5GQSA 1UT6A 1TYAE 1E2BA 4Q00A 1LXCA 2CUKA 1S3SA 4UMVA 2SECE 1JG2A 3R5TA 1BWQA 2BFOA 4Q3KA 4WZAB 5CU7A 2DPXA 3H1TA 4YRFA 5K0NA 4B6EA 4D8VA 1Y1KE 4WXEA 3KU4A 1MVNA 2HIMA 2OCDA 3ZE6A 3VVLA 4HVAA 1FFAA 2GEVA 3DFZA 1WB5A 4IINA 4JY7A 4XVHA 1H1LA 2ZYDA 2ZBUA 1J8MF 3ET5A 4G0NA 2GLTA 2JFVA 2AMVA 4PICA 1VYUA 1HWYA 1T15A 1WULS 4OUDB 3B9QA 2JGLA 5EJ7A 1CR0A 4S05A 2ZIXA 1OWLA 3NAQA 4X63A 3C3YA 1Z73A 2QX8A 3A25A 1ZCZA 2I1QA 4ID3A 3JX9A 4ITUA 3EDYA 5FP0A 1U7TA 3LPCA 4DCOA 5CBPB 3H3FA 4G0UA 5LBTA 3DKRA 3CMMA 1L7XA 3OJEA 3HBAA 4MV6A 1OA1A 2BJWA 4J7XA 2Z2YA 5EZ5A 2H48A 1F6WA 1K5HA 2R1ZA 4HN4B 4R9RA 3TE6A 2CFTA 4M83A 4BB5A 4LOKA 4B2LA 5C4MA 4UC0A 4OQFA 1T43A 2WFLA 1R18A 1BMFA 2Q5CA 3AXTA 3CPSA 3UJ9A 4AX4A 1E7QA 1K89A 3N8IA 4ZO4A 3NTVA 2ZIEA 3RCBA 4LDJA 2JAPA 3AH8A 2QTFA 1YH3A 4FDMA 2JGAA 4PLTA 3WQSB 2ZE6A 3N07A 3VI3B 3HDTA 1CG6A 3H1FA 1C7EA 3KJZA 4TN1A 3I01A 2PFGA 4BDTA 4LF5B 1YQXA 1MAAA 1M6EX 1TW2A 4FUQA 3SEAA 3ZWXA 3O3OB 4MJ3A 1YZLA 1I6WA 2JFYA 4RA9B 3U39A 3R40A 2IU3A 4XFJA 4BYMA 3JXEA 4EGAA 4F6RA 2ZYSA 2PGAA 4L15A 2TRSB 1S4QA 2EFEB 3UGKA 5KWSA 4IH9A 2HV9A 2BTOA 2YJGA 2ZBPA 5BV7A 3E1GA 4G26A 1T8YA 2BEWB 4CM9D 3RREA 5DCLA 3L1IA 1F4VA 5CFMA 4MH0R 5EWLB 1QQ6A 3OWOA 2R8RA 5CH5A 1AKWA 5CYGA 5T4BA 3FRJA 5HBRA 5D00A 1IZZA 5DX1A 5CLJA 1QP7A 1JAYA 3MA0A 3HYCA 3BHNA 4U7GA 2SKDA 4IMJB 5C7LO 2EG9A 2ICAA 2B0JA 3Q1KA 1XD9A 2D54A 4KXLA 2VNIA 2EL9A 5M34A 1EWKA 2OHFA 3LGAA 3N8KA 1O6CA 3PPYA 3R5KA 3VFDA 1U11A 4DA0A 1SKAA 3G23A 2IC5A 5DTJA 3UHFA 1H3EA 3PQ2A 3W6UA 1A3CA 1WQ3A 3C3PA 1Q0TA 5HR5A 4DLXA 1PL6A 4ENQA 5B7PA 5CGZA 1C1XA 1GPMA 2AEEA 3QBVA 3W1WA 3LXMA 1U1IA 3IYLW 4MW5A 3EVAA 2FHPA 3A6KA 2X4IA 2IP2A 4D2IA 3CWQA 3K2QA 4BECA 2X8BA 3VBEA 1RPZA 4QL3A 3LS2A 1GQSA 3CPHA 1Q1QA 3LDFA 2QBYA 5CVUA 5K6AA 1XJCA 1D8AA 4IIGA 3EEFA 5H16A 2R2GA 1TM1E 2ZKIA 3C7TA 1LW6E 4D98A 4YT2A 2PYDA 1NY5A 2I6QA 3UV3A 2NAPA 4OP3A 2I34A 2A9VA 3HN6A 1V6CA 2DCUA 4R1TA 4MA5A 4EB0A 3NQ41 4NY1A 3PA6A 1YZTA 1AGRA 3RBVA 3WK7A 821PA 2JBHA 1ZUIA 3EXFB 4WXHA 4YECA 1Z6XA 4DR2B 2XIJA 3FAZA 5LLTA 3UMSA 1YKGA 2Q41A 4KP7A 2JGDA 4URHA 4QGSA 5G0WA 1FJXA 4CBVA 2DBVO 2HJSA 3A14A 2JB9A 1XELA 3PF9A 2BDUA 2BM8A 5B2EA 1GM5A 1EFPA 5CFLA 2VSYA 3UOWA 5FTMA 5CDHA 4H35A 2G88A 1IHDA 1UKAA 3GA7A 4HRXA 3OT1B 5BP7A 4YY3B 3EEIA 3QBTA 2I91A 1CNMA 1GCAA 3IDOA 4F92B 1H05A 4U4AA 7REQB 1QIHA 1CUYA 2FQXA 1B16A 2WYUA 4QTUB 2BMAA 3BK2A 2JVKA 5ES3A 4Z0HO 2I9PA 4US2R 5KTKA 4LRQA 1UM9A 1DG9A 4FDAA 4GGPA 2CD7A 2PWAA 3IQGX 5EUBA 5FBLB 5GVRA 3QXJA 4PGAA 2BGNA 3AESB 4YJHB 2ZRHA 4MP8A 5F76A 3U56A 4C0JA 4A10A 5I9IA 2HSGA 3C98A 3FYCA 4C0SA 2DY0A 2ZYTX 3A26A 3GZNA 2OCYC 2J5BA 3ZBTA 1KNXA 4MGZR 2ACWA 1QIDA 2RGNC 1HT0A 4FN4A 4X61A 1S8AA 1L4BA 5TMBA 1NJ8A 3DQZA 2QRLA 1M2KA 4QTZA 4CZ2A 3HQ4O 5F2OA 2P68A 4CQMA 5KNCH 3HB4X 4MUAA 2JI6A 1PZMA 1OT3A 1N7HA 2JBAB 2HHLA 3O93A 3VU9B 1IDN1 3I2JA 1QYRA 1WZUA 4ER6A 5CM2Z 4XVUA 2VUIB 1E6MA 4IXMA 3IP5A 3L43A 1NG9A 1J23A 4GOLD 4PCUA 3R0QA 5BWLA 5C35A 2C2XA 4G5QA 1GVHA 1JDZA 3EVDA 2GD2A 4ZPJA 4G4JA 1N5OX 5BSHA 4FFNA 1IOWA 4XFDA 4J49A 4CM4B 3A27A 3W6PA 4OX9Y 2YZKA 1FTQA 3WLLA 3Q12A 2X2EA 3TJZA 2VDQB 5JSUA 1KDTA 1QF9A 3L01A 3G6KA 4BFUA 4GX5A 3GPLA 2PT9A 4MHTA 2VAMA 2WPDA 4DRZA 1PZXA 3NVDA 5DP2A 1M5RA 1OREA 4CKEA 3SCZA 1VE3A 1T0UA 1Z5OA 1GYRA 3IQEA 3FFAA 1P1JA 4ZZ1A 1U0RA 5H4GA 1TEXA 3KB6A 1FJHA 2PH7A 5A9TA 3GRYA 1BYIA 3VSDA 4HZUA 5NULA 3B3FA 1Z25A 2VP4A 2X0EA 4NBSA 3K2IA 3PNBA 1A9PA 4OSPA 5HGJA 1NI4A 1YQUA 4KN9S 4KO2S 3F3SA 1LCIA 5KNLA 2DE0X 2R7MA 3PCXA 3Q7EA 3HKEB 3RVNA 2HF8A 2XQKA 4JLDA 3DR5A 3VDRA 1R74A 4Y9DA 1Y4AE 3QA3E 4F04A 4LCJA 4WGGA 4RMGA 1FW6A 4HC4A 2A88A 1G59A 3D0QA 1TEHA 4TV9A 2AN9A 2QX7A 3HCEA 1UL1X 2D74A 3ELBA 4DCSA 3IQIX 2HUPA 3ANNA 3ED5A 4OQDA 3QVXA 3DLTA 1DPGA 1D07A 3VO8A 5G53C 2CL7X 2ESRA 4TXHA 4XLLA 1QE3A 2IXTA 5EAIA 5CT8A 2H1OA 2GB4A 2QGZA 4G0OA 5BN4A 3OT5A 2UYCA 4NDNE 4L74A 4NZZA 1S2NA 4P5EA 4RF4A 5JNTA 3WWOA 2BSQA 2B82A 1YVDA 3K94A 3DMPA 1N8TA 2WKRA 3LX6A 1J0DA 1L1QA 2FN9A 4PX2A 1U0BB 1VPLA 2XE7A 3EVGA 3RLIA 5KYTA 1XCBA 1YOBA 2CF5A 3G2OA 1QHSA 5JSQA 3THYA 4ZGWA 3HK2A 3TI7A 1W7AA 5P8WA 5EPOA 4U9HS 3EYAA 6ABPA 1R12A 4J1SA 4RAOA 1QH1B 9LDBA 1M1YB 1GU7A 4XAQA 3ICCA 1UAYA 1GUFA 3LXXA 3K2BA 2HRCA 4IH4A 1YUBA 3T3GA 3L84A 2PX2A 5DDIP 4JI2B 4IKPA 2ON6A 4A5OA 3NWPA 4R2LA 5G41A 3R2JA 1DEOA 2CF6A 3CJQA 3JPWA 3QKSA 1DEXA 5DHPA 2QLTA 1GTRA 1OI2A 4WN9A 1JKXA 2QA5A 3A6EA 3IPCA 5J2UF 3AM3A 4OQXA 1DZIA 5FH9A 5C53B 4FP9A 1N2XA 4LJAA 3C4QA 1SKUA 3W5CA 5JC8A 1ZIXA 3KJNA 2CHFA 4HB4A 4G8DA 3VV3A 1R1DA 2W2TA 1R10A 1YBAA 2YHBA 4ZA2A 4D02A 3DL7A 4MARA 3FDZB 4POOA 1CIJA 3A1SA 3F73A 5AQEA 1LZLA 3ZLVA 1RYFA 1VHDA 2V7BA 5DM2A 1FU8A 1YCDA 1M1ZA 2J07A 4KH1A 4OQZA 1N2GA 3ASVA 3FAKA 3QLUA 1M2VB 1XIVA 4AIRA 5KTYA 1KI1A 1OBFO 1L7BA 1JG3A 4MV8A 3CLSC 4N03A 3STTA 5JDIA 5K9ZA 3HV0A 4WBNB 2VQSA 3R3JA 1A96A 2V4ZA 3B13B 1TAHA 3EGXA 4EA6A 2IYPA 1EXMA 1MT3A 1U9JA 3CH5A 3EXHB 3F8WA 3ILHA 3M5PA 1Z4QA 4YMUA 1GZ7A 2G9UA 1MRZA 3OUZA 1YVEI 1Z5GA 1FTWA 2CXNA 2H2FA 3O5AA 5I5EA 3TG8A 3U61B 4FILA 4RF2A 4J3JA 1I36A 3M6XA 1FFEA 1Y33E 2YZMA 4TLDA 5F5NA 3C1TA 4QUIA 3WO1A 4EG1A 1GNSA 2YFHA 2NXNA 1A88A 5AMXA 5JYDA 4P3NA 1SKMA 3BN3A 4BGIA 1ZJYA 1QQTA 2GCGA 4PXAA 4WECA 3E3NA 3UNXA 1UP6A 2GJ9A 4DY6A 5A4MS 4X92A 1LX6A 4X3OA 1C8LA 1EE2A 2Q9CA 3UMRA 1GV0A 4BNDA 3LYUA 5EHZA 5ALKA 1E3MA 2WUDA 2YN2A 4UOQA 1RC8A 3C1AA 5TRTA 1FC0A 4HWPA 4MEAA 1HQCA 2ZRDA 3K0EA 3ICPA 4MKRA 2I4MA 2XUZA 3OQVA 4WACA 5A5FA 4R2WA 3H5LA 2O1XA 5C9ZA 1OFHA 4CDMA 2H00A 1CKEA 3AUYA 4LRUA 4DR7B 3ZIUA 1KC1A 5JI3E 4YV2A 1NHGA 1XTZA 2F4VB 4F71A 4CNBA 1Q77A 2PUWA 1BU8A 1EA7A 1ORTA 1L6IA 2QMZA 5DHTA 3C6KA 4DNQA 8ATCA 4DV1B 2PBLA 1ODLA 2EIHA 3OJLA 1T9KA 1S8OA 2P6UA 4K40A 4G85A 4MQBA 1VPVA 2JPDA 5H80A 1Z62A 1OAOA 3QEJA 5E95A 4ZANA 3R0JA 1IONA 3L1KA 1X2BA 3M6VA 2DBZA 4NATA 3N76A 4MZDA 5AKHA 1POXA 1QGUA 2RKOA 2ANBA 2DCMA 2JI4A 4D9GA 3PRHA 1FRZA 1SCBA 1A2OA 1RHQA 4IAOA 3USCS 4IFIA 2HQOA 4IIXA 1VM6A 1EK5A 5CUQA 1KYIA 1I10A 4KQFA 4AKSA 4CCYA 5BR8B 4LF9B 1BW9A 4J90A 5THXA 2CLOB 3IAHA 4PLYA 1UK7A 4XGNA 3V32A 3I30X 3QPUA 3GDGA 1ESMA 2HM7A 2UDPA 1H66A 3LJKA 4FHCA 4U2CA 3H9EO 1CZHA 4HBGA 4IYJA 4R1QA 5KWEA 3ZI0A 3AVXA 4M46A 4PYNA 1NOJA 1C4OA 4EUFA 1C1HA 4CIXA 1MJ5A 2UXCB 4KO1S 5AM3A 3L4JA 1RSZA 1ESDA 4AZ3A 3DJFA 4ILEA 1E77A 1B8VA 3H9BA 2JLYA 1CJCA 3A3PA 2D7DA 3GGOA 1SCUA 4F5DA 4QPJC 1ECLA 1BHO1 3KQPA 3JQAB 4L72A 4NBVA 4XOIA 3WK8A 4YR7A 2ZIAA 1M54A 1F0PA 3OM9A 2HO5A 1T8RA 2QJTA 1DKOA 3GOHA 3IA2A 1OB5A 1WCIA 1II0A 1T25A 3B89A 2Z2ZA 4JR1A 1L1RA 4REQB 3I23A 3A4VA 1X0VA 4GNRA 3AOEA 4L4SA 3MXTA 2W6MA 3KQQA 3QBJA 1F20A 3OTIA 1K7CA 1YCHA 1SXJE 4PO1A 2WU4A 3N7UA 1MJGM 2HU8A 4HH0A 2AEMA 3RJZA 3LX4A 2EP8A 4KXMA 4LYAA 4RHUA 1C7QA 1ISHA 2ECOA 2R00A 3NUQA 2IK8A 4LTNA 4Q82A 5EXTA 4JI3B 2J3LA 1O96B 2FEMA 2QVGA 4TLLB 7MHTA 3MOGA 3DFFA 1PL0A 3KEQA 4I6JA 3BCHA 3K9CA 1LV7A 1PR4A 3KR2A 4LOIA 5EXEA 3NHAA 1QZTA 3S55A 3UT5A 1FBTA 1NA5A 2VK2A 1USGA 4X6YA 2XUAA 3QELA 3U1BA 5KJ1A 2D5AA 3QVKA 3X3HA 5C7IO 1RLIA 2CLCX 4L9WA 1ZOPA 1T5IA 5TF0A 3WNVA 1KOFA 2KB0A 5L3ZA 5JLJA 5LZ8A 2H08A 2QLMA 1SO8A 4MPPA 3KG2A 3SZOA 2PXHA 2PYZA 3Q8WA 4QBTA 1G8PA 4Q7QA 1D2EA 2QG6A 3U9LA 1AO0A 1T9GR 3L7DA 2UKDA 1QYVA 5DIZA 2YCLA 1N2IA 3ZCQA 2V96A 1KJNA 4B44A 3MT9A 3NAGA 2OT3B 4E1AA 1M83A 5I8PA 4NE9A 4FFDA 5JPIA 5BVHA 1XF9A 4EGCB 1ZJ6A 4JBLA 1DJPA 3ILSA 4I1RA 4OMCA 4TKZA 4Y2SA 5EUQB 2EJWA 2QRVB 4LGCA 1PWZA 5CBKA 3R9XA 5CM8B 3HYRA 1Z5UA 2OSVA 1C9NA 4OHXA 3WYFA 5AW8A 1TQDA 3JZIA 2J08A 1YE5A 1KJQA 5EHXA 3QUQA 4IHKA 1H0HA 5DGDA 2NXCA 2O7SA 1SUIA 2OO7A 4OXNA 4GZ6A 5EE3A 1VKZA 3ED1A 5IVDA 2DOKA 4HAVA 4QBFA 4F5YA 2XZOA 1CFJA 4Z1MA 3V1LA 4B7ZA 3DMYA 1HY3A 1UKYA 3MFQA 1DTWA 1RAGA 4H08A 5EXDA 3ZK9A 1K7FB 1M2GA 4NNPA 3KPWA 1PJZA 1VCNA 1N2SA 3AHCA 1IM8A 2C2OA 3HA7A 3OA0A 2FPPA 3PQCA 5AKGA 3O1HB 4C7BA 4AF8A 3ZJUA 1S4MA 4JJFA 2F1HA 4P4SA 2VQDA 4FBLA 1W4ZA 1RZRA 4JLJA 4UHFA 3KJEA 4GM4A 4BZQA 1G4HA 1TGVA 3DAHA 1TVEA 1RC1A 2KBEA 6NULA 2A9KA 4PTYA 2JFQA 3M49A 3IP9A 1HNZB 1D1SA 3PLRA 3B1YA 5HIKA 2BSXA 4YT5A 3ANTA 3ESCA 1NKSA 4W6ZA 5K8LA 3HY6A 4XH9B 2A86A 2JDIA 2RAFA 2B3TA 5FBVB 4B45A 2O14A 2X4DA 1VMKA 1U63A 2AI2A 4NPAA 1VJCA 2NO0A 5CG1A 4CF5A 1IN6A 1HFKA 3TF5A 1VBMA 2O54A 4MIKA 2NUTA 2QSZA 5DWVA 1F4LA 3LYAA 3FH0A 3TL6A 1T8PA 1D6JA 4GPIB 4BFXA 4LQLA 3AVWA 1RYMA 4HV4A 1PEYA 5AIBA 3RAFC 1OMOA 2XUFA 4WA7A 3SZUA 3WRYA 3ZKWA 3W8DA 3K0AB 3S70A 1AKTA 5IASA 1A4XA 1T6XA 3BRWA 4G4SP 1V8FA 2HGSA 2O8VA 1PR1A 2VPPA 4Q24A 1PDOA 3WFIA 3JSXA 4XSVA 1VI2A 1JTEA 4D0RA 5F52A 5IUNC 2O6LA 4HDRA 1YNSA 3ZU3A 4PFKA 1XKTA 4TPKA 4DDMA 5CEFA 3EEOA 2AF3C 3L0DA 1NZDA 5DLEA 4DYHA 1DBPA 1U0SY 3PWZA 2E48A 2R87A 4NULA 2B35A 1TAGA 2PXXA 2VXYA 2Y1EA 4GLFA 2J7PA 1F9AA 3MJTA 3MTEA 5DGCA 5F1YA 3DO6A 4CNQA 1GILA 1N78A 2XOXA 1T5LA 4KIUA 4KE6A 2DUJA 5I9BA 5T7BA 2C78A 1X94A 2HLHA 3P20A 4LXTA 4N65A 4X1KB 1D9ZA 1JR2A 4CQMD 4K2HA 4FWIB 3G82C 3ND5A 1E3WB 4NFYA 5JFTA 2B6NA 3LH5A 4X93A 5HIAA 1MHTA 3T7DA 3RVSA 1SUCA 4OSOA 3FM9A 2ATVA 3N58A 2DQKA 2EGHA 4F86A 2PA0A 3N0XA 3PUWA 3VKGA 1KS2A 3ET4A 1KMIY 3X1KA 4A0GA 4CU2A 1VP9A 4FJ2A 4H1HA 1VPTA 1E79D 2XTNA 4MULA 3NHLA 2LGJA 1UWCA 2FWBA 3GJ6A 3GLGA 2WPDD 3GD7A 2RAPA 4K26A 2IXBA 2JHCA 3KOYA 4C6TB 1OFUX 3CZQA 1BCSA 1DBVO 1HF3A 3CIOA 1CRPA 5K0ZA 1VRCA 2I3AA 3OIUA 1A7KA 1XDDA 4CN8A 2XQVA 1L7DA 2WF8A 1VSTA 1Z12A 3COYA 3GEEA 2PUDA 1BWRA 1FSZA 4UUQA 3F3YA 3TBFA 4PBRA 2PNJA 3NGXA 3HSYA 3DUFA 4NHOA 1AKRA 3IT1A 3R3ZA 3BWMA 1LDYA 1VLVA 2UVQA 3C3EA 1IVSA 1JQBA 1QRDA 2YUTA 4EUKA 1QONA 1ZW6A 2XIQA 2ZU0C 3K70C 2G4CA 1ZG3A 4K46A 4TWBA 4MKHA 1XWWA 2IW3A 1Y8AA 1UFOA 5SZHB 1W4LA 2NTNA 3D5QA 1GZ4A 2ZE5A 2P3OA 2XUQA 3CUKA 4JOQA 2R6R1 3OMWA 4US1R 1V8PA 2R1TB 4JJ8A 4Y9SA 1X7XA 1FP7A 1XOIA 4OLFA 3QU5A 4YRMA 3Q85A 1XKQA 3HA2A 3HXOA 2ZRGA 3NTOA 3MILA 5EG5A 2Z8YA 4L0CA 5EMMA 3R20A 3RVLA 4BMSA 3TFWA 4R83A 2FRVA 3NV7A 4QPZA 5JWHA 1AD2A 3CRW1 1T9DA 3DA8A 4DDKA 3EPJA 3PNLA 5IW8A 1UPXA 3B1WA 1EJ6A 4ZT2A 3LM8A 3WMFA 5JMOA 4ZTZB 1XJ5A 5CX1B 2YN0A 3BJMA 4FD3A 1GZ6A 2D00A 5ELLA 3WXBA 2BONA 2WFAA 4YCJA 5AHWA 2XEDA 4MK4A 2GEKA 2QYHA 2GUGA 2A8YA 5JRJA 3RVBA 2I3BA 2Y0PA 3L41A 3MB5A 1MV5A 5DIFA 1O8CA 3HJBA 4JEMA 4FHZA 5T64A 4MDHA 3FJOA 3RS4A 1EG7A 1JZQA 1NVKA 3CNNA 3NHJA 4O25A 4MQFA 2JIRA 4G67A 2Q6LA 3CB4A 3GZ4A 2CNDA 5FORA 1FX0A 3OF3A 1O54A 2AX3A 3RRXA 4OOFA 1K0FA 1G5TA 3VJRA 1SBZA 5E7QA 1H0KA 5ENVA 3LTNC 2BH9A 3HCRA 1VGQA 3JAWA 4GLOA 4KQXA 3U0VA 4A82A 1JR3A 5IH7A 5IPFA 2F64A 3AHHA 1TA9A 4Q6BA 3M9XA 1F3LA 3K4QA 4C04A 2VNSA 2EJUA 4JC5A 3WS7A 5GM2A 4REMA 1Y7LA 2YDXA 3AIKA 1L4FA 1UADA 2YVQA 3A9UA 1JDJA 3TMAA 4EG0A 1UC9A 4IILA 1ISRA 3AERB 3G1UA 1B0ZA 1KYVA 4E03A 4FW9A 4CIAA 1BKSB 1IY0A 1EJ2A 2QF7A 2H8GA 3QLEA 5HMMA 4DAEA 5A9SA 1NYLA 3HU3A 1H65A 2EARA 2IHTA 3HEAA 2IP4A 621PA 1N2JA 2ONJA 1C50A 2ETVA 4MNTA 2ZLBA 3AB8A 4JHLA 1TZJA 2VF2A 1KI8A 3KZVA 3W7AA 2PUHA 1NBEA 1W94A 4M21A 1M6VB 2QLFA 5A4AA 1OX5A 2B4TO 3HWRA 3NANA 3F5MA 4FIDA 2H1HA 4XA8A 3G3EA 1AGXA 4KTVE 1VCMA 5IP5A 2NPIA 4BJHB 3L92A 3C15C 4NOJA 3RJMA 3URKA 3WLPA 3QUAA 3K15A 3NH6A 2GA8A 3DT8A 3EAFA 3EGDB 4KW7A 4UUBA 3RHFA 2IHZA 2JJ8A 4FS3A 1W36B 3KD3A 4HD8A 4BATA 2P67A 4ZI7B 4JYMA 1CERA 3B5IA 4GLLA 4MUNA 1YK0A 5DBHX 4R71A 4P33A 2BFEB 2G25A 4PC6A 2X9GA 1JKFA 4S1OA 3STVA 4PXSA 3C8UA 5IVPA 1DINA 4WKOA 1UPFA 3HYNA 5ESDA 5LQSA 3RNOA 5HUJA 3GHYA 3WIUA 3COSA 1DMRA 2O8CB 3KUDA 2GZHA 1FXSA 4ARZB 2ZI5A 5IKOA 3BFVA 1V45E 5A0FA 4R05A 4Z1OA 2WNSA 4I36A 5FTJA 3M6WA 4L78A 2JCXA 2LCFA 1M72A 1W5BA 3OLXA 5TVKA 1A9XA 4TSKA 3E03A 3WICA 3A9SA 4GOMD 2RGEA 2MSDB 4HUJA 1OAAA 3I92A 3SSNA 1QPBA 2C5HA 4V1CB 4JBYA 1ZD5A 5FAXA 4I2NA 3OM8A 2IHYA 2YASA 3I6IA 3QE4A 4KODA 1Y89A 2RGGA 2GF0A 1B41A 2C9ZA 3F47A 4OAPA 3UFXA 1GITA 3GBPA 3UKDA 3EAQA 1G21A 1WDLA 1U7WA 4HQ0A 2RHHA 3IH5A 5DULA 1PLJA 3H05A 4JJAA 3A4MA 3WBKA 2YDYA 3PXAA 2JD2A 5DBGA 1RAHA 1Z0DA 3WDKA 5AVRA 4MAAA 3R24A 4G5SA 4YXFA 5J2UA 4MJ7A 3DO5A 4JP2A 4B4UA 3KQKA 2V8OA 1CK4A 1R6BX 4PLFA 3UQZA 5KYKA 2WG1A 1AKMA 5F2EA 1NBMD 2EJTA 2IEGA 4MCIA 1NJGA 1WY7A 2AOUA 3B6ZA 4MICA 2RI1A 3O73A 3N3BC 1QB8A 3BKXA 2HJVA 4M88A 4O0MA 4B3GA 4O29A 2JK1A 3FHJA 3LLVA 3DGFC 4LV6A 1B6RA 3HKBB 1YFKA 4OXYA 1HM5A 1ATIA 1NQWA 1S9DA 3GRZA 3ROXA 2J59A 1KR5A 1YBFA 1BOFA 5CPFA 4KITB 3BWXA 3LYHA 3O3NB 5B2FA 1QV9A 2ONCA 5EUMA 3U1TA 2WAXA 5ITVA 2NYUA 2HH9A 5CNJA 3KHKA 4WOCA 5KTSA 4UUOA 2EU8A 2OZVA 1OVGA 4L5AA 3ONEA 3AR9A 1YOVA 5FV4A 1KPGA 1HEYA 2L82A 3LCUA 3DZCA 3JQ8B 4F5EA 1VJTA 2IJGX 3KUXA 1Z4PX 4BLSA 2Y93A 1FDRA 4BV2A 3LK7A 4XXHA 2DAPA 4X8OA 4QU8A 3MJSA 5HILA 2I7VA 3A2MA 4G2NA 4TTVA 1MAHA 1RI3A 3VYTB 5KZMB 2CBZA 3KKOA 2VK1A 3ROGA 4BASA 2Y1FA 2ZTVA 1MV8A 3NBUA 2ZBQA 3RHTA 2FW9A 3OY7A 4ZQFA 3SC6A 3GPIA 1F38A 4DPLA 4QKQA 2ZM6B 1UBGA 4PZZA 4DY4A 1WDTA 4WXMA 1JLLB 3DC2A 1OU0A 3IKMB 3II6X 4GOJA 3GRKA 2XF2A 5LOVB 2H7XA 4IJVA 1B6SA 2OILA 5H3CA 1Z5NA 2V0NA 4LI0A 3ZLTA 5LM3A 1OX6A 4KQEA 1N6PA 4FE7A 4XUDA 4C22A 1WY5A 5ILOA 1Q3KA 2AMYA 2Q5FA 2WE7A 3H3JA 3MYYA 4FKZA 4NU5A 3OU6A 4WAUA 1KQ3A 3DDHA 4CKWB 2AD5A 2HREA 3QTBA 2PXCA 2FJUA 1PNVA 4KOAA 4TS9A 4WADA 4XGRA 3FW1A 4E4TA 4TTJA 5A5GA 2G1PA 2UVDA 3PICA 4N76A 2ISQA 1NASA 2J0UB 3F5QA 2JFWA 3PYMA 1HZZA 2ZE8A 3D5TA 2PZJA 4JXXA 2DPYA 1I1OA 4JLMA 3OQOA 3RT9A 2E37A 3F5FA 4NABA 4N0DA 3URMA 3B9RA 4Y1EA 3G2QA 4BVKA 4PN3A 4D41A 4AN0A 4WE3A 3TDMA 3RHSA 2J85A 1T24A 3GFSA 3L82B 4EVIA 1ZQ9A 2QYTA 1Z4NA 1ZMRA 2I3ZA 2G40A 2WHYA 5AYVA 1NKVA 3AQ4A 2K5UA 3TXXA 4DV5B 4EY4A 4JT8A 4E22A 5LLSA 3HKCB 3OAAA 4EA9A 4P4GA 4KDRA 4NQZA 3ABOB 1PV2A 3OFNA 3E6AA 1L9XA 4JB3A 3OD1A 4BO1A 5ARBA 3TPFA 1Y6GA 2PUVA 2JW5A 3C4VA 4Q7JB 2VDRB 4ZREA 2ECPA 3FDIA 1U4SA 2C42A 3G8YA 2ZQ5A 1EQAA 1LZKA 1MA0A 4B09A 2DR3A 1ZD8A 3OJXA 2ODPA 1C14A 5TVGA 1C4KA 3I1IA 3HVJA 3P9KA 4IKEA 1OI3A 4MPRA 4Q9KA 1UAAA 4TYYA 2B92A 3LUBA 3M1LA 1OU4A 1XVIA 3MINA 3C3WA 1XL1A 1WXEA 1UEJA 2JDID 1CE8B 3GRPA 1LSUA 1Y9DA 3OSZA 2R6DA 2G70A 3BE4A 3T06B 2XJ9A 3D7LA 1NW6A 5AW3A 4LAFA 3ND6A 2X22A 4OQYA 1UK6A 4EYKA 1EDEA 3OQHA 4TQUS 3HVRA 5G40A 2GS9A 3ROKA 1D1PA 2RBKA 2YYYA 2OFFA 4MSUA 3C5EA 2OAP1 1EFTA 4KK4A 4LYYA 1UFKA 2WE8A 3AYZB 4OTZA 5HIMA 1XA3A 3H5AA 2JAHA 4RIGA 4NEQA 2P5YA 1OHHA 1ST3A 2WP8J 5JFGA 2P9CA 1DBWA 3EULA 4XM1A 5BV0A 5HKBA 5CA0F 4JI5B 1FVXA 1IK6A 3G0CA 3JCZA 2IEBA 1UFRA 2IBMA 1OROA 1BEUB 2X19A 5FA5A 2XB8A 3ZS8A 1P0IA 5BW8A 5HUQA 5JASA 4JSYA 2FRDC 4MS3A 3N6XA 4AKTA 2WT8A 1ZITA 2X6TA 4IZ6A 3PPXA 3I12A 4OJQA 3T6KA 3ZCPA 4RFSB 4XE5A 1U81A 4IJKA 4OHUA 4MYDA 1OWPA 2I8CA 2ZW9A 4X7MA 1CEYA 4K9RA 1RQNA 2J7PD 3W4JA 3T3EA 3R44A 4HBZA 1EH5A 4DADA 3H19A 4A0HA 5AW7A 1AE1A 1YZFA 3C45A 4KRFA 4KRXA 4CV3A 4W8GA 2ZSJA 1T8WA 3HYSA 3ADBA 4JYAB 2VZ9A