4KE6A

Crystal structure d196n mutant of monoglyceride lipase from bacillus sp. h257 in complex with 1-rac-lauroyl glycerol
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
249
structure length
247
Chain Sequence
MSEQYPVLSGAEPFYAENGPVGVLLVHGFTGTPHSMRPLAEAYAKAGYTVCLPRLKGHGTHYEDMERTTFHDWVASVEEGYGWLKQRCQTIFVTGLSMGGTLTLYLAEHHPDICGIVPINAAVDIPAIAAGMGGELPRYLDSIGSDLKNPDVKELAYEKTPTASLLQLARLMAQTKAKLDRIVCPALIFVSDENHVVPPGNADIIFQGISSTEKEIVRLRNSYHVATLDYDQPMIIERSLEFFAKHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational plasticity and ligand binding of bacterial monoacylglycerol lipase.
pubmed doi rcsb
source organism Bacillus sp.
molecule tags Hydrolase
molecule keywords Thermostable monoacylglycerol lipase
total genus 92
structure length 247
sequence length 249
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2013-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ke6A00
2CEKA 2JGMA 1D07A 2W6CX 4H77A 2HM7A 3IB3A 4J0KA 1ZGCA 5HK8A 3CN9A 4EY5A 3B5EA 2G5TA 4PSCA 3BIWA 2WM2A 1B41A 3BXPA 1QIJA 1JI3A 4KAJA 3G0IA 1K5PA 3M81A 1XZIA 2D0DA 2WUDA 4P93A 4J0GA 4EUSA 3PDCA 1XZEA 2HDWA 1A88A 1P0IA 1SCIA 4H7EA 4B80A 3CXUA 5ISMA 3QPDA 5DLPA 3AINA 3NOXA 4RNCA 2IIVA 3G8YA 3OTQA 5ALHA 1RP1A 1MX1A 4HAIA 2RHTA 4U2CA 2HA6A 3RLIA 4QLOA 2PKYX 1ZI8A 1BCRA 1H23A 2BKLA 4BTVA 1MAHA 1A8QA 1ODSA 3C6YA 1BU8A 3H1AA 4AO6A 2WG1A 4E11A 1PJAA 4J3JA 4GECA 3K9BA 4WDRA 4MEAA 3L1HA 4L0CA 3WWOA 2PX6A 1ZIXA 4H0CA 1C7JA 4LXGA 3WA7A 1SC9A 5JZ9A 4U2EA 3SWWA 2RIPA 2XUAA 1USWA 4M0FA 5AI4A 2OGSA 2VTVA 3W04A 1GXSA 3ZLUA 5DYWA 3V9AA 3QZUA 4D9JA 2XLBA 2BCEA 1VOTA 1CQZA 4MQMA 3M82A 2WUFA 4W9RA 4J0CA 3FLEA 5A6VA 1T4MA 4A5SA 2QR5A 5AH0A 4PQEA 1GGVA 2HFJA 2D5LA 1EX9A 3IVMA 1P0PA 3SK0A 1YS2X 1VE7A 3VDXA 1PV1A 3PF9A 3G0GA 3HRHA 4FOLA 2QOEA 1A8SA 1AUOA 5JARA 2WHPA 3KOOA 3C87A 1CUWA 1IMJA 5EHZA 2PSDA 3WJ1A 3QM1A 2HA0A 2HFKA 3AIMA 3MUNA 1MNAA 3I2JA 4P9NA 1K6EA 1XZCA 1CEXA 2WHRA 2RGUA 3FSGD 2B20A 4EB0A 5HFAA 4DSAA 5FXMA 4H35A 3GBSA 5HQ3B 4X6YA 3A2NA 3HABA 4OD0A 4K5QA 3MUOA 1BRTA 4H18A 4X3CA 1VXRA 3ESAA 1CUDA 3ESDA 3B12A 4C87A 1O6FA 5CTAA 1VA5A 5CW2A 2WFZA 2XUQA 3AZPA 4QLAA 4B0OA 1C4XA 1YR2A 3AILA 3HYSA 4N5HX 3O4GA 3H2KA 1EI9A 3PICA 4AN0A 4J0JA 1AC5A 3ZWQA 4JEIA 4TVKA 4FLFA 3DS8A 3QPAA 5CH3A 2OGZA 1ZI6A 2C0PA 4XWGA 2CKMA 1N8SA 3LIPA 4C01A 4G4JA 3WQHA 4BRZA 5JIBA 4HS9A 3BDVA 5HKBA 1NX9A 3BDIA 3C5WP 1R4ZA 4M0MA 1QFMA 3AUKA 1GQRA 4UBNA 5K3FA 4ZREA 1MAAA 1HQDA 2DHCA 1EDBA 2I03A 3D59A 4W63A 4BCDA 1N1MA 3PF8A 1M33A 5ALEA 3DLTA 4F60A 1UK6A 1QIEA 3DYVA 3C43A 2JIDA 4A23A 3MGAA 4BBZA 2O2HA 3O9MA 4G9EA 4DGQA 2QT9A 4BDTA 3PFBA 5BWBA 5AJHA 5ALVA 3BL8A 4Y2TA 2Z8XA 1ZICA 1K8QA 1A7UA 1NU8A 4BTLA 4WJLA 4UBMA 3OURA 1BEZA 5C7YA 3L1JA 4MWTA 2WJ6A 4UHFA 1SFRA 4C6HA 5ALLA 5AIAA 2DCMA 2AJCA 2IX9A 5JADA 4CCWA 2HA5A 4QZVA 2AXEA 3D3NA 3R41A 4DNQA 3ZLTA 1QJ4A 5FV4A 2HIHA 5LLSA 5AKGA 3WWDA 1ACJA 5I7UA 3I6MA 1JJFA 2WG2A 1WPXA 3F8SA 4H7IA 2VJBA 3ANTA 1LPPA 5JAPA 5CT8A 4X90A 1CUHA 5AO9A 1UK7A 1CUEA 5BWCA 4LIPD 2AJBA 1YCDA 5D7BA 1H2YA 4G8BA 2VAVA 4E14A 4CG2A 3TRDA 4Y2UA 1JMKC 4O08A 1OCEA 5J3JA 3UUFA 4NS4A 4OB7A 2I3DA 3S2ZA 2XUIA 1IVYA 2OLEA 3FSGA 2VEOA 4INZA 4Q3LA 2ZSHA 5JASA 1CUVA 3STVA 2WIJA 3ZV7A 2H7YA 1DQZA 2C5GA 2AJ8A 4BVLA 3ANSA 2PL5A 1JU4A 2BGRA 3R40A 1XLVA 2K2QB 5CH5A 3C6ZA 1GQSA 4HRXA 5CMLA 2X76A 3AIKA 3WL8A 2CUTA 2VQ6A 5JD4A 3D2AA 1SCKA 1SCQA 4HXGA 1QIMA 3D2BA 1CUXA 3AFIA 2UZ0A 5K5EA 1R88A 2I3ZA 5JAUA 1CUIA 5E4JA 1TCBA 1Q84A 1XZBA 2BUCA 1VLQA 1GPNA 1YAHA 2RI6A 1K4YA 5FPQA 3ESCA 3HLKA 2WLSA 1BE0A 2Q0XA 2ZJ7A 4CG3A 3QMVA 3JYHA 4JYMA 3AJAA 3BJMA 4FHZA 1CFJA 5FP0A 3ICVA 3OG9A 4B6GA 5AM3A 1ZD4A 2HA2A 3FYTA 4BYMA 3I6YA 2XE4A 4WFKA 1UZAA 4AXBA 2XUHA 3IUNA 1YA8A 1F6WA 3WZLA 2ZJ6A 4P92A 4FWBA 1GT6A 2OCLA 1GPKA 1QO7A 3I2KA 1IZ7A 1XZMA 1FFBA 2QS9A 1LLFA 2JGLA 1W4LA 1CUZA 3IDAA 2QUBA 2XUDA 3W05A 5AHXA 1YB7A 1JMYA 3W06A 4DMKA 1N5RA 1XRLA 3WK8A 4U2FA 4KAFA 4BDSA 1G5FA 3B3QA 1QIFA 1VJ5A 3IULA 1LZLA 5AI6A 2PVSA 4FFWA 2XMSA 1DU4A 1CPYA 2GBIA 1VXOA 4BE9A 3H18A 2FJ0A 1CRLA 3ESBA 4I3FA 4KJXA 3EQ7A 1EVEA 3C45A 3WL5A 4BAZA 1YS1X 4GLBA 3G9ZA 1QIIA 3HEAA 5FKJA 1XRQA 5JD6A 3A70A 3WKEA 2EDCA 1FFCA 4KRXA 2HA7A 5A71A 4EA6A 3CCCA 4H7FA 3H2HA 3D5EA 4BC0A 1XKTA 4QA9A 1DX4A 4BAGA 2Z3WA 4BP8A 5AK4A 3VKFA 3WZMA 4BCCA 1FFAA 5H3HA 4N5IX 2VF2A 3QMWA 2WIFA 1WHSA 3A2MA 1L7AA 1WPRA 5T4EA 4Y2XA 4P08A 5IVKA 5D3KA 3D7RA 4GEGA 4UHCA 4HXEB 3ILSA 4PW0A 5LZ5A 3IURA 1CUFA 2VJDA 1ETHA 2PSEA 2VJCA 1TK3A 1QTIA 3O4HA 1THTA 1YASA 3KSRA 4FNGA 5KREA 1WB5A 5C81A 5ALOA 4KRYA 5ALGA 5LKRA 5ALQA 2LIPA 2WJ4A 3BF8A 3LLCA 2YXPX 4LYDA 1EB9A 4UUQA 3S8YA 4TGLA 5EGNA 5DNWA 1X2EA 2ACEA 4X6XA 2DQYA 3DYIA 2QUAA 2OG1A 3LIIA 2GBGA 4LXHA 3TEJA 3STYA 3DL4A 4WY8A 4FLEA 4H7JA 3UMJA 4J0DA 5A7GA 1ZD2P 4IH4A 1FFEA 2PU7A 2DSNA 3H2GA 3F97A 5CT6A 2CBGA 2XDWA 3VVMA 4Q1VA 4G4GA 5SYNA 2JGKA 4H7HA 1T2NA 2WIKA 3QBJA 2XUGA 5LP1A 5ALIA 2QRUA 1UKCA 2RHWA 3H04A 3KDAA 1YSCA 4FTWA 4QDTA 3V1LA 2GYUA 2HA3A 4E46A 4EBBA 5AK6A 4Y7DA 5ALFA 2WUGA 1H22A 5FRDA 1J07A 4W1PA 4LHEA 2QM0A 1E5TA 5AM0A 1DWOA 1QIDA 2HADA 4BZZA 1HBJA 1QE3A 4HTAA 5AKLA 4BVJA 2E3JA 1AKNA 4GXNA 2IITA 2GBFA 3R3WA 4UHDA 2BJHA 4KEAA 5E2IA 2H7XA 3PUHA 4UFPA 1DX6A 1H2WA 4MYDA 2XUJA 1ORVA 5HFNA 3EQ8A 3WWPA 2WKWA 5ESRA 3I6ZA 2WQZA 1J2EA 3WMRA 4Y2RA 1R1DA 2OAGA 4IH9A 1ZJ5A 3DDUA 4XVCA 5HCUA 4DNOA 4YASA 5AOCA 4PSUA 2O7VA 5C8XA 1LPBB 2PSFA 1LBSA 1G66A 1HLGA 5JALA 4GDMA 3GELA 2OPHA 5K3BA 2PSHA 5DNVA 4ARAA 5AKKA 3LCRA 4Q05A 4Q3KA 3T52A 1VZ3A 2Z8ZA 2XMDA 5SYMA 4DSZA 4KE8A 4I19A 3OPMA 1CR6A 3R3YA 3STTA 4UBJA 2C5FA 1MU0A 4EY7A 4UHHA 4FKBA 3X3HA 2ACKA 2GYWA 3EQ9A 3F98A 1PFQA 2GYVA 3SC2A 1DWPA 4AO8A 5KBYA 1BCSA 1DWQA 1W1IA 4JH0A 5DYYA 1A8UA 2QXUA 5EIHA 4FDMA 1LGYA 1ZD3A 4B0PA 3ZLVA 3G9UA 3E1GA 1THGA 4DMFA 4ZV7A 5LZ8A 2XB6A 3R3VA 4C4YA 2XQFA 4CI9A 1LNSA 1ZD5A 2WTMA 3VISA 1MX5A 1IUOA 4DYHA 1CUSA 3HC7A 1RWQA 4G4IA 1QGED 3I2GA 2VAXA 1KU0A 5ALWA 4DMHA 3DOIA 3HXKA 3BIXA 3CN7A 3OOSA 5ALDA 1GKKA 2H9YA 5D6OA 1XZKA 1R9MA 5AK5A 2XMBA 3YASA 3QPCA 5LYYA 4DNPA 1VA4A 3R0VA 1AX9A 1UXOA 3G0BA 1E3QA 3G0CA 3I2HA 2XI4A 5CURA 5AM4A 1GPLA 5DYTA 2AJLI 4Y2YA 4YPVA 4G8DA 4OYYA 3Q8WA 4MEBA 5A7HA 2JGFA 2PUJA 2Y2VA 4BB0A 3E3AA 3FWHA 1WHTA 1Q83A 4DM7A 5D3ZA 3WI7A 5HF8A 3EIOA 1UK8A 1BROA 2C4HA 4S0XA 1W75A 2WFLA 4QEKA 1XZJA 3R3UA 3G0DA 4UBKA 3ZI7A 3WKDA 2PUHA 5CT9A 3V1KA 4AO7A 5LIPA 4B83A 5ALNA 4FBLA 4J7AA 4GBGA 5ALYA 2QZPA 3ED1A 3RM3A 2VT6A 4Y2PA 4X94A 4ARBA 4GWLA 1XZHA 2WU3A 3U1TA 4QWMA 4QDZA 2CZQA 2Z3ZA 1TCAA 1XZGA 3WYNA 5CXXA 3W9UA 1ZOIA 1MN6A 3F9CA 4L3WA 4HVTA 3ZPXA 3PUIA 4QDOA 4RGYA 5DTIA 5AM5A 2JGJA 5JYCA 5EHXA 1EXWA 3AZQA 4W1QA 5AI9A 2G5PA 2J3QA 5K3FB 1U65A 5C8VA 4AMZA 1N5MA 5F4ZA 3L1IA 1CUUA 2WU4A 1Y7HA 3EF3A 2EEPA 1FSSA 4Q34A 1HL7A 3GFFA 5T4BA 2DR0A 5ALRA 2JGEA 4KE9A 2DFPA 5AKYA 4X7BA 1EINA 2PPLA 2JF0A 2WJ3A 4ITVA 2ES4A 2RONA 1YA4A 4CIBA 3WK5A 1HDEA 3WIBA 4QNNA 2YH2A 1QIGA 2GBCA 2ZVDA 5K3EA 3I28A 5E4TA 1MPXA 1R50A 5K3CA 4B85A 1UOOA 3LP5A 1CUBA 4N8EA 4C4XA 1XZLA 1LPNA 1UKAA 3VJLA 1AQLA 3DJYA 5A2GA 2WHPB 5AM2A 1BS9A 4X6UA 2XUOA 1QIHA 1DQYA 3F96A 2VT7A 4KR0A 1Q0ZA 3E4DA 4F5ZA 2AJDA 1Y37A 1VZ2A 4U2GA 5DWDA 1CUAA 3GROA 1MNQA 5YASA 1CUCA 5DNUA 2QMQA 4WDQA 4CG1A 4UBLA 5AOAA 5JAOA 4OB6A 3VXKA 4QE3A 3WLAA 4GI1A 4ZV9A 3FYUC 4ZI5A 3RARA 3WJ2A 4EHBA 4YX9A 5BV7A 1W6RA 5ALTA 3IBTA 4ZRDA 2XT0A 1E8NA 3H17A 3HACA 1XLWA 1DT5A 1R9NA 3H1BA 2OGTA 1H2ZA 1UFOA 3N2ZB 4FBMA 5AM1A 3G9TA 4M0EA 4UFOA 4DIUA 3E0XA 3PFCA 1TRHA 3GA7A 4B84A 4UBIA 3W2TA 4ROTA 3C6BA 2XMQA 2H7CA 4I4CA 1L7RA 1FFDA 4PF1A 2Y6VA 2FUKA 3JWEA 2WSLA 5AKXA 4J03A 4W1SA 1XQYA 3IUJA 2O7RA 3T4UA 4U2BA 4Y2VA 2OQIA 1VE6A 4K6KA 1P0MA 5ALZA 3WL6A 4Y2JA 4WFIA 5HKAA 5AOBA 3HZOA 2OQVA 1R3DA 5LZ7A 5IVHA 4RE6A 5FOQA 2X8BA 2Y6UA 2JEZA 1JJBA 3V1NA 4JNCA 3V1MA 1CUJA 2W22A 1F0NA 4Z49A 2X5XA 3W9BA 4H7KA 2JBWA 3TJMA 3O95A 4MXDA 3O9VA 1W52X 2CMFA 4AZ0A 2XMRA 2XUFA 2XQIA 5CT5A 4PV7A 2ZJFA 4B9AA 4BZWA 4OUKX 1WB4A 4X97A 4AMYA 2B4KA 3FOBA 1LPAB 1G4HA 3DOHA 5EHQA 4B9EA 1RYYA 5I9IA 3A2LA 4EY8A 5IVIA 1IUNA 1XZDA 2I78A 1AURA 2V9ZA 1NU6A 3D4LA 2XQGA 2V96A 2QKYA 4KE7A 1LZKA 2DQZA 4F0JA 5FLKA 2GZSA 4KE6A 1MT3A 4BRSA 1XRPA 1EB8A 1B6GA 2WFMA 4X91A 1I6WA 4G1FA 4GHWA 1MO2A 4L72A 4X00A 2OXEA 1OILA 3OC0A 3FAKA 4F21A 2OAEA 5HF9A 4JUIA 3G9XA 3WL7A 3D0KA 3RK4A 4IH1A 2DHEA 5T4FA 5JAHA 3BF7A 2VSQA 3NGMA 1LBTA 2Y1KA 5EIAA 1X70A 5E4YA 5A62A 4EY6A 4K2AA 3NWOA 4UHBA 1U4NA 3R3XA 4PSDA 5JZSA 1XZAA 1UT6A 4QDXA 2JEYA 5CH8A 3STWA 3FCXA 3OM8A 4DNFA 2NW6A 5FPPA 1WOMA 3VJKA 3WWCA 1KU6A 3BWXA 4NZZA 4AB1A 5ALXA 1XQVA 4XJVA 1BN7A 1BEEA 4DLNA 5EI5A 3IA2A 3KD2A 5IKXA 6YASA 5FDFA 1EK1A 3V48A 4OB8A 5HZGA 1ZIYA 5AIBA 1UOPA 4BC1A 4HRYA 1O6GA 2HRQA 3QH4A 3VJMA 1EK2A 4KAAA 4ZWNA 3KWJA 3UUEA 1EH5A 4W1RA 4G5XA 1U2EA 3KWFA 3WIOA 2EDAA 3R3ZA 5IH7A 2QVBA 2XUPA 1CUGA 4J0IA 4RE5A 3K2IA 1MX9A 1UKBA 4B81A 1L7QA 3HJUA 1E8DA 2WG0A 4LKOA 3F67A 1XZFA 3FLAA 3SX4A 3PI6A 4PNZA 5ALSA 4BE4A 4E15A 2WIGA 3QITA 3C70A 2RAUA 2VA9A 3M3DA 1CV2A 3C8HA 1Y7IA 3QMMA 2ECFA 5AKJA 3FNBA 1ODCA 2CJPA 5BOVA 4AX4A 1LPOA 4UPDA 4U2DA 4WFJA 1EDDA 1MJ5A 1JFRA 4FLMA 1F0PA 5K3DA 2ZYIA 1J1IA 2QTBA 3I1YA 2P8SA 1CVLA 3BJRA 3IIIA 2QJWA 2WUEA 1WM1A 4N8DA 5JZBA 4C89A 4X95A 2Y2UA 2G63A 3ICWA 5LKAA 1E66A 2FJPA 3WKAA 3LS2A 4UHEA 1LPSA 5JATA 1TAHA 1WB6A 1QTRA 1CIJA 1EDEA 4Y2QA 4OCZA 5CXUA 3FBWA 2YASA 5AKEA 3AIOA 4H7DA 1C7IA 4NVRA 3DNMA 2WILA 1ACLA 3GUUA 3STUA 3FYUB 1QOZA 1JJIA 3WKCA 4G8CA 3WK6A 1ODTC 3O4IA 2H1IA 4G9GA 7YASA 3O4JA 5EHNA 5AICA 4MWSA 1QIKA 3C6XA 3FYUA 2B61A 5T4HA 5ALUA 5DTJA 4XIIA 4X85A 2ORYA 2VJAA 4XX1A 1AZWA 3C8DA 1YB6A 4FNMA 3O0DA 5LZ4A 4V2IA 3MVEA 5AI0A 4CCYA 4ZGBA 5AI5A 1QFSA 2ZYRA 5K3AA 1X2BA 1K63A 1JKMA 1ORWA 2CB9A 4B7ZA 3RKSA 1SOMA 5FUMA 2PM8A 2QXTA 2WIDA 3AZOA 4IQ4A 2PBLA 2V97A 1E8MA 1HKHA 2Z5GA 1AMNA 1VKHA 5AI8A 1TQHA 4IHAA 4RPCA 4EY4A 1U8EA 4LXIA 1J06A 4QWWA 1CUYA 3WKBA 3WK4A 2BFNA 5JD5A 1XLUA 3WK9A 4CIAA 1CLEA 5AKIA 4HZGA 1H2XA 1XKLA 3M83A 1YAJA 3FLBA 3JW8A 4AZ3A 2FX5A 2R11A 3N0TA 5JANA 4OU4A 1G42A 5HF5A 2HL6A 2OCGA 5EFZA 4KYVA 3IUQA 1UWCA 2HA4A 3DKRA 2PSJA 3DL7A 1XRNA 3GZJA 2C7BA 4Y2SA 2XMGA 5A7FA 5CBKA 2HRRA 1QONA 1UK9A 5EIEA 4AQDA 5DJ5A 4UBOA 4LYEA 1JU3A 1LPMA 2XQJA 2OCKA 2HU8A 1CQWA 1S8OA 5HK9A 5KWJA 3I1IA 4OU5A 3DEAA 4WCVA 4DMCA 3FCYA 3G7NA 2HU7A 1ZGBA 4JYPA 5ALKA 1HPLA 5KWIA 3DKKA 1OXMA 4OYLA 4IO0A 1BN6A 3DQZA 4J0HA 4EZIA 2OCIA 4GW3A 4YK7A 1JT2A 1Q0RA 4FMPA 3KXPA 5LZ2A 1AGYA 2C0QA 1F8UA 3FVTA 4X93A 2G4LA 4BATA 1IUPA 1EHYA 4X92A 1XRRA 5ALJA 2ONCA 4BVKA 4MYSA 1XROA 2HHAA 1QZ3A 4C88A 3P2MA 4N8SA 4CFSA 1W76A 4KACA 4DTCA 4AN1A 4MQLA 2O2GA 2PU5A 3HSSA 4Q82A 3K6KA 2BAGA 2ZYSA 1EVQA 1DTEA 4OSEA 2C58A 2WTNA 4HXFB 3BE8A 3H2JA 5CT4A 1ISPA 2J4FA 4WY5A 4BP9A 4PO3X 1XQWA 1GZ7A 2JGIA 2XMZA 5ALPA 2BUBA 1MTZA 4MJ3A 3TGLA 1DINA 3IUMA 2XUKA 5LZ9A 2YYSA 4BCBA 3WA6A 1P0QA 3D2CA 5HQ3A 3DD5A 1UOQA 3WK7A 1QO9A 2ZYHA 4Y9SA 3FVRA 1ZJ4A 5ALMA 1XRMA 3VVLA 4OPMA 2R8BA 4FFVA 1TKRA 2GZRA 5I8PA 1XQXA 4C4ZA 3CCBA 5AKHA 2VATA 4A16A 2XLCA 5CRIA 1QLWA 1EA5A 2HU5A 4BAUA 2XQKA 3A6ZA 2DHDA 1TCCA 1FJ2A 4X71A 4L9AA 3Q0TA 2ROQA 3C5VA 4B82A 1XFDA 3PE6A 4K6HA 4QDUA 2J3DA 3QVMA 5AK3A 1GKLA 1E89A 1ZI9A 4K6GA 3H19A 1KEZA 4CCYB 5AP9A 4NMWA 3WWEA 2O2IA 2B9VA 4Q3OA 3STXA 5C8ZA 4TPKA 3U0VA 2BUAA 3DCNA 2ZSIA 1WCYA 5HF6A 3HI4A 1IZ8A 3H2IA 5AKZA 4UFNA 3WYDA 4ZXFA 3NUZA 3G02A 3I2IA 2J4CA 3EBLA 2WFLB 3I2FA 1Z68A 2XMCA 1DT3A 5IVDA 2V98A 1TIBA 3H0CA 2QJRA 2BGNA 3QYJA 2WHQA 4ETWA
chains in the Genus database with same CATH superfamily
4OGFA 5AUNB 1DQPA 1P1IA 3K1TA 1SXJA 1X13A 2LV8A 1STOA 2C92A 4IIJF 4WCDA 4KMSA 3GY0A 1H5NA 1IWPB 2PSSA 2VXBA 2QD3A 3K05A 4RY8A 2W6CX 2RHBA 1G3UA 2IJGX 1A4RA 1H9AA 3GAFA 3KUKA 2B1RA 2GHTA 4J6FA 2CN1A 1OWNA 1K86A 2HM7A 4LZNA 2D1FA 1H1DA 1C30A 1XVUA 2UZ1B 4G84A 2C2HA 2FZKA 3ICQB 4FWIB 1ZWKA 2QR3A 3URKA 2YMQA 5IW8A 5IWAB 3BIWA 3BXPA 2I7TA 3E9RA 4Q93A 1JI3A 4U7TB 3WX0A 2FVXA 3BD9A 1JKXA 3OETA 1NF9A 5BVHA 5FHQA 1WR8A 2AYXA 3EOBI 4N6NA 3AU9A 4PLVA 1P6QA 2YIJA 3GJ3A 3JD3A 1I2BA 1QUEA 1Z4JA 4J9UE 1FFSA 1P45A 2P79A 1GCIA 4P93A 1ZRNA 4R54A 4DMMA 3UMFA 3OFNA 5EMHA 4ZVNA 1SXJC 1B8VA 1NVGA 3Q40A 5B1HA 3TQFA 1S2LA 1SCIA 1F5NA 5MHTA 4QPPA 4Z51A 5AVXA 4DG8A 3WHPA 1BWSA 3ACBA 4RD3A 3HO1A 3QOYA 4LDAA 2X6RA 3LBYA 4Z0TA 4M9XA 3TNLA 5C1BA 5ALHA 1T1JA 1NMSA 4NYJR 4JLMA 3VSDA 1D6SA 2SCUA 5LXTB 3RJMA 3HYRA 3C15C 2RHTA 3L8EA 4ZD6A 1UQRA 1XVIA 2BMEA 4PAGA 3AL3A 3H5RA 3TGWA 1P6UA 2QTWB 3LP8A 1ZI8A 3ZY5A 4ARVA 3GD7A 5E9QA 2BKLA 4BO9A 2BGLA 4BTVA 1ODSA 3C6YA 1JA9A 2A4MA 1OLSB 3FFAA 5I7OA 3CRW1 1CR0A 1JR2A 1B93A 2DUJA 2X8JB 3G8AA 3K9BA 1UWKA 2HY7A 4LHXA 4HPXB 1QJCA 3K0AB 4FOOA 3J81k 2B2CA 3L1HA 3V4VB 2O8FA 3KU1A 4GPBA 4NJOA 5T3YA 1JL3A 4XLZA 5GJCA 1KL7A 4YT2A 1C9DB 3W7AA 3TJRA 4KO3S 4C1BA 4S0ZA 4D9IA 1Q0HA 1G19A 3IDOA 1FB5A 3HA7A 3LXMA 2WEKA 4ABYA 2RIPA 1UDXA 3DO5A 1FFHA 1OAOA 1USWA 2BMJA 2I4TA 4HUQB 3U3DA 4D56A 4S1TA 2WF6A 5AI4A 3OT5A 2FXVA 4WAUA 1Z5OA 1ZD8A 3LY7A 5DT9A 3S8MA 4CKXA 3K0FA 3O2QB 4MS1A 1JDPA 2HWYA 3OOWA 3WYCA 4IIXA 2ODTX 5DYWA 4A6XA 2D1RA 3FFWA 1U7HA 2H4FA 2QN7A 1ZM7A 1XWFA 2GTIA 2WWGA 3QZUA 4HBGA 1UBFA 4LE2A 4X63A 1E6LA 3BXXA 1W8DA 1TVEA 4KXMA 1VOTA 1F38A 3IV7A 3QTLA 4P3OA 1G21A 3E9DA 3JRXA 4QICA 2JNWA 4YRIA 1IBLB 3DVAB 5AJYA 1G0NA 1C80A 5BR7A 4KWHA 1XDSA 4W9RA 1W5AA 2H85A 4OLJA 1Y98A 4PSKA 4TM8A 3ETLA 5B58C 3FLEA 5A0FA 3K0EA 2B1IA 3KT6A 3EAQA 5TF4A 5BSKA 1JP7A 1JG2A 5T3UA 3Q5GA 4AS3A 1L5NA 2NN3C 5K0LA 4ZYWA 3BRSA 5KWSA 3RVPA 2AF3C 2VHZA 4QHTA 1ORHA 5CAEA 4P0TA 7AT1A 2W2LD 1UR5A 2IHJA 3D6MA 1KI8A 4RCYA 4J90A 3G0GA 1POWA 1ONBA 4ZT7A 3A1NA 5EE0A 2WZDA 4TXLA 1DKUA 1T3LA 2MHCA 2OAP1 5BUQA 2QF7A 4FP9A 4I4IA 4BFWA 4LHYA 2W2XA 1HOXA 4NG5A 2ZTHA 1EQAA 2PMDA 1WAMA 3OIGA 2PRYA 1F1JA 1YQ9A 3IHLA 4OP2A 4YJ2B 3F71A 1LLDA 2YVUA 1CUWA 3F78A 1LDNA 5GGYA 3QSYA 2IU6A 3ITEA 1OYOA 1T2FA 3EXHB 4XSGA 2PSDA 4G0XA 2CHFA 2FA9A 4MS3A 1Z47A 3RAFC 3G2PA 1SCDA 2PX3A 5CEFA 3FMVA 1Q91A 1L7VC 4G37A 4KVZA 3DZ8A 4C7KA 5HIJA 5GP1A 3WSVA 2O3TA 2PUGA 3GCGA 5BV2P 3NV9A 1JUDA 3JZIA 3ROKA 4QJBA 1L0BA 1MNAA 3OEEA 3I2JA 4IR7A 3LQRA 4KQXA 4EW2A 2J6CA 4RTOA 4UE3S 5GZ6A 3WWZA 1D6JA 2Z9DA 4MP3A 4D4MA 3BL6A 3PUJA 2V7UA 5A02A 5HVNA 1I6MA 5FPTA 3P9PA 4RO0A 4S1NA 1ZVMA 1SGWA 3O2SB 4WKGA 1E58A 2RGUA 2JAOA 1EWKA 4WOJA 4B87A 4DQXA 1UJ6A 3KDPA 4RESA 1N6IA 4BIIA 1Y9JA 2IHBA 2R25B 4U1RA 4KH1A 2C9BA 1IMOA 1KI6B 1M2JA 4K26A 2D74A 3SJCA 4DSAA 2GKOA 1HFKA 1TUEA 1HG0A 1NP3A 2ST1A 4FZVA 1YZYA 2P9TA 3CX4A 2YHUA 1C9MA 1E1YA 2XOXA 3DHYA 4I3GA 4CQLB 2VOJA 3STHA 2GEUA 3NBQA 3RFFA 1R00A 2OOKA 3P97A 3MUOA 4F2DA 3IR5A 1TVMA 3W2IA 2FN3A 1XDWA 4WXRA 1W5BA 3COVA 4L5JA 2C95A 4FUQA 4P3XA 1IRXA 1EHCA 1UP7A 3DDHA 3N5KA 2V6GA 4GMGA 5JNTA 4GLJA 3OIWA 3ESQA 3VFDA 2Q7XA 2I22A 1QGOA 2GCGA 3OSUA 4KXFB 4D9EA 3MTGA 3HUEA 5K6TA 1BDIA 3VR5H 3FI0A 1O6FA 3WR5A 1N2EA 1CZOA 1DUIA 2WFZA 4FC6A 2E2WA 3G23A 4OQXA 4PGGA 5CW2A 1OLXB 4NCAA 3ZE1B 2DR3A 2VF5X 3K5PA 3QEMA 4HDMB 4QLAA 3VH2A 2VLBA 4F72A 3K5HA 4CI0B 1U8AA 2FSFA 4I6JA 5HRCA 2M6RA 4ARZB 2XA1A 5ELXA 3UXEA 3ELWA 1Z5ZA 3LHFA 4RKEA 1QVRA 3EXG1 4TQ9A 5EC8A 1KZHA 3KVYA 3RVKA 4AS2A 2JAUA 1U0JA 1XDBA 1QFYA 3DW3X 1EX7A 1YACA 2VBCA 2O5VA 1LTHR 3T94A 1Q3KA 3WOHA 1DL5A 4QIHA 3PICA 1EI9A 2Q2NA 3THYB 2BBSA 2ZS9A 4QQRA 2HMWA 4C03A 1WL8A 1E0KA 1G8YA 1S0UA 1YQEA 2FETA 1SAYA 4MW5A 3IHKA 2W8BA 3RYCA 2GEJA 5KX5F 2I99A 5K4AA 2ENWA 1TTTA 1J4AA 1DMSA 4EW3A 2I29A 1VQ1A 4TVKA 5KYUA 1T5SA 3M6AA 4A0SA 4EUHA 2VK1A 1KZ4A 3PKIA 1O7JA 3DGFC 4AKEA 2EW8A 1VPDA 3T0GA 3DULA 1NNUA 3HNPA 5DWVA 4YRZA 2CLDX 3FTQA 4C4RA 1PI3A 1XK7A 2CHQA 2D7DA 3CWZA 1T15A 3LIPA 5G3YA 4C01A 5JSHA 1RVDA 1LI5A 4EBFA 1CP2A 1RXSA 2BFAA 3V3TA 1VBKA 3WQHA 4QM7A 2A1IA 3PJEA 4RH0A 3IBYA 4HI0E 4Z0NA 1I13A 2NVUA 4G67A 4NNPA 3ZE6A 2EG9A 4E2XA 5AHOA 3KAPA 4LC1A 1DRJA 3K7EA 1CDOA 1U1FA 1H85A 3BDIA 2H4YA 3LLMA 1ZLXA 4MV5A 4MV6A 1WW2A 5IN4A 2Q4OA 3C5WP 3SF8A 3CUYA 3FWKA 1QQ7A 2CHEA 4G0VA 2CYCA 2A6PA 2QAGC 4W7HA 3WFJA 1UAAA 2ADMA 1P17A 2GSWA 3BRWA 3IPYA 1E2NA 1B7GO 3KFLA 3A1VA 5SZJA 3OESA 2VP0A 2QT1A 3RRBA 1JDBB 3UA3A 4RQAA 4B6OA 3WGVA 4CTMA 9LDTA 5K6AA 3QA3E 1R8XA 1M7BA 3BWYA 3O4FA 4OFWA 3FTPA 3J81A 5FHRA 4DR7B 2PWZA 1WXWA 1WQ1R 5IPFA 3NDPA 3WNQA 1C3XA 1O08A 1UK6A 4GLFA 1RI3A 5DYNA 4CYMA 5L4NA 1FDWA 2PUDA 3IAHA 3DYVA 2BSAA 2OK8A 1NURA 2ZCVA 2W2NA 3C43A 3PC2A 4RTQA 2V45A 5HJ7A 3IJEB 3R5TA 4PYMA 5H82A 1WV1A 5J5CA 1RM0A 2QT9A 4RKQA 4ZTBA 3V7WA 4N3NA 2DCUA 1A9SA 4FXOA 4MCAA 2QAGA 1Q17A 5BPHA 2ZRNA 2F2TA 2Z8XA 3GFPA 3BFJA 4JOQA 3UC5A 1K08A 1IHXA 3BX1A 1A7UA 1JR3A 1OJLA 3I32A 1E18A 2OFPA 4K7JA 2O8NA 2VPIA 3CBQA 4B8YA 4MVWA 1UPTA 4BTLA 2HC9A 4E09A 1JA0A 3G1UA 3K1JA 4WIAA 5C7YA 2Q6TA 4YAJA 5IFKA 4XYLA 3L1JA 4OIMA 1AHIA 3FCEA 4ES6A 2IS1A 3NBMA 1FP1D 2REXB 5HFJA 1BE8A 2RBEA 3WGJA 1HFJA 1T5HX 2V7EA 2C4TA 3WLSA 3AJ8A 1MENA 3WLJA 4FGJA 4KU4A 5AIAA 2JH9A 3IJPA 3CRMA 3K0FB 4C4SA 1KO5A 1SWWA 1WW8A 3L92A 2J3KA 3D81A 2WSBA 1ZY2A 3LWBA 1FW8A 1HDYA 1TRKA 3AF4A 1JI0A 3N0RA 1F8FA 4GPD1 2PS1A 1V5GA 2Q8QA 3HA2A 1SD5A 2IELA 4LYGA 5ARBA 2BKEA 2GO1A 2FPOA 4M9SA 1EFDN 2NUAA 2P9YA 3D3NA 4ESVA 2NTEA 2DTXA 3ZLTA 5B3JA 5CBPB 4RA6A 2I3AA 3DZGA 4JN6B 4PNPA 1VL8A 3WDMA 3HB4X 1M1NB 1FW6A 4C05A 2ZBQA 2AB0A 1ZIOA 3I6MA 2EW1A 1LKZA 3AJ9A 4LXUA 4IXDA 1WPXA 4O02B 4EUFA 2GJ4A 2OXFA 3KKKA 2O2EA 4H7IA 3ER8A 3L41A 3QVXA 2F3QA 1TK2A 4CMCA 3IV6A 2Q07A 2VO1A 3F90A 4NU8X 2CF5A 3IAEA 1JG7A 3T1YB 4DJJA 1PZFA 3CJRA 3USES 4P0QB 3R7AA 3H3FA 4HDAA 3I6IA 1TO1E 2R7KA 3AMVA 2IXTA 1L5FA 3QEKA 1UK7A 3HO8A 3PR2B 3SF8B 1M5UA 2IUSA 4MPJA 3SS8A 1ND6A 1L7EA 2JW5A 4D3DA 2W6PA 2C4WA 4J1NA 3TRDA 3V7UA 3DE5X 4QTTB 4HNUA 2VOEA 2FR0A 3ZY2A 4BLTA 3KV3O 2WZQA 3P0RA 5BUZA 5J3JA 3RW9A 1U1DA 3CF2A 3IE1A 4OB7A 2ZIEA 3X44A 1OPRA 4ZPXA 1MH9A 4EB6B 3S2ZA 3ASUA 4W5RA 4I2NA 1S2GA 2PQMA 1SG6A 3ZVLA 1IVYA 2QIPA 3P4UA 1EP1B 1KH3A 3VI4B 1JJAA 5G1NA 2FK7A 3O4RA 1YJAA 3EXHA 1ZW1A 3ZNQA 3RYTC 4Q3LA 5F1KA 4B3CA 1E9AA 2WIJA 5L3QB 1V4NA 1Q95A 3ZDBA 2NWQA 1KS2A 1KEEA 2UUBB 5UKDA 2V7QD 5BMVA 1DQZA 2HKIA 4OAQA 5K4HA 1BVHA 5FOVA 1JB1A 3L7NA 2XZDA 4K8OA 5BYAA 4O2AB 1ESNA 1QKIA 3L82B 3FYDA 3K1YA 1RAFA 1ST3A 4FR2A 5K51A 1YE5A 3GRFA 4NCXA 4ZU6X 4BVLA 4NY1A 1WKCA 3NUQA 5B6JA 2NZUG 2CNNA 4LYFA 1Z34A 4OLHA 4PLTA 1E63A 3BB1A 2F8LA 3M7IA 3W6ZA 1ABEA 2DBRA 2OBFA 3A4VA 3EVGA 4IGKA 3RKRA 4ZYYA 2WY2D 3CG4A 2BJVA 2F17A 2I2CA 4TRMA 1FTNA 1ILEA 3AIKA 2VJYA 4R6XA 4Z86A 3RSGA 1P80A 1W9HA 2R751 2XDQA 4D9KA 3KQUA 4XJSA 5I5GA 2CUTA 2VQ6A 4A5OA 1PL6A 1NTRA 3FKQA 3KLOA 2IWHA 5JLJA 3THXB 3ZCQA 1H1LA 3WQQA 5F9HA 3GMIA 4EGSA 1E64A 3L18A 4UULA 1F2UB 1MB2A 3OTHA 1CUXA 2I9PA 4TMFA 1NG1A 5IFLA 2OO5A 2O8EA 1FEZA 3ZN2A 1CKEA 2Z1MA 3HR4A 4I9HA 5JXWA 1ML3A 4EEXA 5HZKA 4R2HA 4GVLA 4GYYA 1GNPA 3P0IA 2WU1A 4ZQEA 4YV1A 1EXDA 1PX2A 1YU9A 4TWIA 4MRNA 1TCBA 4JB0A 4GS5A 4F7DA 3G13A 1XZBA 4ZRNA 3PFKA 4R8LA 4RV4A 5JU6A 1G5HA 1G8HA 1TW3A 5AJXA 4ZAZA 4B09A 1JLHA 1R8YA 1VLQA 4BMSA 1NNSA 1CCWA 1RC1A 2WP0A 3JD0A 3R0IA 1DKRA 3TZKA 5F77A 1K4YA 1ZC4A 4W6QA 1DG3A 3VNSA 3D3KA 3C98A 1SVNA 4MKIA 1AZLA 4AYWA 3HLKA 4W5JA 2CXSA 3DE7X 3EEQA 2YR0A 5E6SA 1FNSA 4G65A 2O2YA 2WJYA 2ZJ7A 1J9ZA 1Z2PX 3FUVA 1RNLA 3MTIA 4RFSA 3WDSA 3K1AA 3X2EA 5EY5B 1J2TA 1ORIA 3PUWA 3I4LA 3JYHA 3L7DA 1E9SA 5FP0A 2BDTA 3QUSA 3EA5A 2DFVA 4Q21A 1FLAA 3QF4A 4O8CA 1IFXA 4PX9A 1E1NA 4QRHA 4HWTA 3UZUA 4LFAB 4UMVA 5I47A 5FI0B 2GVNA 1ZD4A 5FEMA 2HA2A 2A9VA 1U3WA 2AD1A 2GH1A 4BYMA 1GAXA 2J3MA 3I6YA 6ABPA 3QW2A 4JB3A 4A26A 2JCVA 1C0PA 3A6EA 2AG5A 2FEKA 3A1UA 1PZXA 4ZVMA 2P67A 2XUHA 5JHHB 3IUNA 1YA8A 3W1WA 1CZLA 1ZRHA 3ZZTA 3HY3A 4YRTA 4P92A 1JEDA 4UE6A 3B6IA 1GTMA 4IIHA 4OHWA 4FWBA 1GT6A 2IYXA 1ISSA 2GF0A 4OM8A 5F5XA 4CLOB 2GUGA 2QK4A 4RKWA 5CPBA 3TLBA 4F5YA 1CZRA 1H6CA 1JVNA 1MVOA 2P3SA 4LTNA 4CJXA 1G59A 1PHPA 1EGVB 1BOOA 2JDID 4S24A 2QLMA 2FN4A 2DVMA 2IXFA 4QFDA 1JQKA 4PX2A 5JW6A 3VC7A 4PN3A 1W4LA 1YKFA 4QGHA 5IYZF 1P2VA 1V3QE 4CIXA 3IILA 4KMRA 4YAGA 2H1WA 4ENVA 4BKUA 4BUCA 2CNWD 2PXAA 3HRKA 3PTZA 4LAFA 2ZRQA 4RJLA 4A2WA 1DKNA 1YR3A 3UOAB 2WWIA 1Z38A 2HK9A 4PGMA 3W06A 5LPNA 2O2JA 4DMKA 2HQSA 3OE4A 1ZSYA 3RG2A 5I4CA 1KJZA 1NF3A 3EUAA 2CDNA 3WK8A 3O7WA 1TYZA 3KEOA 3LPNA 4B45A 1UPXA 3R75A 5C7IO 1G5FA 3B3QA 4J7XA 3P9YA 1ABBA 4C1NA 4EHAA 1LZLA 3H9BA 3CH7A 4FGKA 4K87A 2PVSA 3SHQA 4CQMB 1M2OA 5JROA 2GPTA 4Z6KA 2PT9A 3HB9A 3LT1A 4RY0A 3SEQA 2CXXA 3CF0A 3U3KA 1F8GA 4UTXA 5KINB 3FMIA 3LQFA 1FMTA 3UOGA 3LDHA 3H18A 4NPHA 2X3YA 4LK3A 2FDCA 3EDRA 2PRIA 2OFFA 2GR9A 4M87A 3AUYA 3U60B 3KP1A 4RL4A 3AT1A 4P7FA 5IAKA 2QYSA 3DT8A 3E61A 4PN7A 5JAUA 3QOFA 1AKRA 5LOVF 2CKDA 3ENNA 1EVEA 4XI9A 2BFBA 4PLZA 1K3TA 2HBYA 4BAZA 1EKXA 2FYTA 3N6VA 2R84A 4BMNA 1RAAA 2VXCA 2WAOA 4U5QA 4ZTUB 1QGUB 4WA8A 2EBUA 2G72A 3MINA 3UWPA 3ZY3A 1A8HA 1L5GB 4IIEA 3MBIA 3QKUA 4UXJA 1IG3A 1XRQA 1ZGAA 5KHAA 2EDCA 4QUDA 4LY3A 1U7PA 2EW2A 4WXPA 5IT0A 4OJTA 3FNFA 4A0HA 3UH0A 3AB7A 3ZVMA 1KP3A 4KRXA 4YHBA 2C9ZA 5DCYA 3WXBA 3DBRA 1UODA 2IYYA 3GR6A 3H2HA 3OM1A 4OMDA 4QEDA 3JVEA 2JB9A 4JR1A 2AOXA 4HMQA 5DNCA 5K4GA 2PKEA 5B2FA 3NO4A 2YHIA 2Q4TA 1DX4A 3LM8A 2IP1A 3NXSA 1CS0B 4G01B 1Z45A 4XOUA 1G17A 2PXXA 5BQ5A 1CR1A 2IF2A 1N9GA 1ZIDA 5AK4A 1RQ7A 1NLMA 3KKZA 3NIFB 4BP8A 3IT2A 4C0XA 4EG3A 3MPUA 4Y18A 3WZMA 4B35A 4BCCA 4YAIA 4FI3F 1SN7A 1T9BA 1HQYE 2NO9A 4YT8A 1NP7A 3VR0A 1IWOA 1ZDMA 4N5IX 5D84A 1G2OA 1VSQA 2HMSA 3LHDA 2FMUA 1WHSA 4C2AA 4V24A 4EJ6A 1RT9A 1XTJA 2E4ZA 4JCOA 3LUPA 1F14A 1Y6ZA 4JQCA 4TT3A 5JOQA 2P40A 4DA9A 5LDDC 1JMVA 1QV6A 4P08A 1VPVA 1UC9A 3M89A 1RRCA 4UHCA 5A3SA 4TKVB 2XZOA 2I67A 2OV8A 1GITA 4MV9A 2KS6A 5LZ5A 2PFKA 3H4IA 3C8UA 3KB6A 5J2TB 2VJDA 1X42A 1ETHA 1YIOA 2Q2VA 4DUZB 2PSEA 2VJCA 4MVJH 3BMCA 3AHCA 3RIMA 1IHYA 4JP2A 4B6RA 3I1JA 1BHO1 1YQWA 5B3KA 2AI2A 2ZYAA 3IELA 5IT4A 4M9QA 2IBMA 1B8UA 2A4KA 2QRZA 1HDCA 3ZKWB 5CB8A 2ZUVA 2X14A 1KWGA 1S4QA 2FQYA 2MMCA 4OO3A 3NM4A 1WB5A 3I01A 2ZDQA 2QRNA 4WVLA 2TSYB 5ALOA 6AT1A 2FRVA 3DVSX 3ULKA 1G21E 2R1TA 4UATA 1QTNA 1TI7A 1BD3A 2GX6A 1Y1SA 1ID8A 3KCNA 4FMCB 3TLXA 3NV7A 4TVBA 2RGWA 3BF8A 3LLCA 4PC1A 2VRCA 2PJRA 2CXTA 4LYDA 4F9EA 5LR6A 3RS5A 1IN8A 4TGLA 4ZT5A 4UPVA 1U0SY 3WADA 3S8YA 4MARA 5D8DA 5EGNA 5IAOA 2X1LA 3NATA 4FHFA 1MR3F 1Z9BA 3AUXA 4DLZA 1X2EA 5DLQC 1GCGA 2XZPA 4RHXA 3QEAZ 2DQYA 4KFUA 3GDFA 1ZAKA 2E0IA 5JEEA 3WGQA 2ZUFA 2OG1A 2NQ2C 4LJ8A 3ZE0B 3AJDA 3EWSA 3LIIA 2YJ4A 2GBGA 3TEJA 2JI9A 4JGBA 1M1UA 1H8HA 3JQFC 3MG9A 4J9VA 3AL2A 5J9FA 5ESDA 4DA7A 3OUTA 5CCEA 4WECA 1L4LA 4CTNA 2EL7A 2WDZA 5DGTA 5EZYA 2IYUA 4F4UA 5EMKA 1QRTA 1GTZA 3N0XA 4FFSA 4PXYA 4ZYXA 4FE3A 4HO1X 5EG5A 3B3FA 1HX7A 3HQ4O 1ZM4A 1FFEA 4MJXA 1QFZA 1NYLA 2PU7A 4GPZA 2YOGA 2W42A 3EUWA 2HWWA 5JR3A 2YXBA 3H2GA 3T3DA 1RHRA 3DDCA 1NMZA 3BSWA 3K0CA 3LVBA 1EVIA 3H4VA 4YCBA 4CEIA 3DYBA 4Q1VA 1SWVA 2A33A 4Z0HO 5SYNA 1RS0A 1T2NA 1ZONA 4PYJA 4U8GA 1RKXA 2EFGA 2IUEA 3DEKA 1JYSA 4KVFA 1M2GA 4C6TB 3ETEA 2FCAA 3MCUA 3S7ZA 4QOIA 1AV6A 2HDOA 1UKCA 2QRUA 4QXAA 1N6RA 2X9LA 1SQFA 2J3EA 1GUAA 1P62B 1F20A 2PMBA 4GF5A 2K5UA 1Q0LA 4K9NA 4EBBA 4ZJPA 4IV5A 4KR6A 2QZJA 1NRJB 3ZBUA 2FTKE 3QFHA 5L7TA 2D1YA 1C9NA 5EXTA 2IIBA 5AXCA 3Q6IA 1T1IA 1C7ZA 3VRHA 2W90A 3BA1A 1NMXA 4TTRA 4WK6A 1EFRD 4AG3A 1CQIB 3ETCA 4UUNA 5AM0A 3V97A 4M0DA 3C4JA 2QROA 4ND7A 1E3IA 4BZZA 1QIDA 3G49A 2ZRKA 1QE3A 2ADFA 4HTAA 4LISA 3K5WA 1P7CA 3CV3A 4ZA2A 5B7PA 3GPLA 4QYTA 2D6FA 4CKCA 4BVJA 4EO7A 2Z5FA 3EGDA 3HDGA 2IITA 2W43A 2GBFA 5K8CA 3EBPA 4XZ3A 4UHDA 3VU9A 4DC1A 2JANA 3IL2A 5AYVA 4KEAA 3EGOA 2H7XA 3PUHA 4WV3A 1QGAA 4PBTA 5CDYA 3PWKA 3PKJA 4O29A 1XJ0A 4O5OA 1ZN7A 2AWNA 3CIFA 5LN1A 2ZUUA 3L2OB 4BO6A 4L6CA 1WP4A 2XUJA 2I8CA 2ZT5A 2NVUB 3AW9A 3GT0A 5I7HA 3AV0B 3ANXA 5IKMA 5G2OA 4DLKA 2VDJA 1WDMA 2PL3A 2Q3JA 3HWRA 4ZARA 3GLUA 3SJAA 4BGVA 4N41A 1HZZC 1UM8A 4NBWA 1I33A 3CZQA 4XWKA 5K6RA 1QG6A 2A1TR 4NENA 1IY2A 2ONZA 4MW2A 4JEHA 3A26A 2H08A 1P8JA 2IXGA 3QE0A 4KXWA 7MDHA 5IJ0B 1KK3A 2ZBRA 4XDYA 2LCQA 4PSUA 1ZXBA 3LNCA 1BVYF 1E3EA 1IXSB 2ZIFA 3FOEC 3T6KA 1LPBB 1ES9A 1JDZA 1X1DA 1X38A 2PSFA 3UJAA 5HKKD 3JZMA 3QHQA 2QM8A 1GNQA 5EPEA 3TE7A 3A05A 3FYCA 3E18A 4YP6A 3FGPA 3K3PA 3LX4A 1JQ3A 1SQ6A 3NM6B 4GSYA 5CBPA 1JX6A 2W6ID 1OH8A 1ZK4A 4F1KA 2IOHA 2O7QA 1IHUA 2YV4A 3QFTA 4AYXA 1VMIA 1DV2A 2A8YA 2PSHA 4EPXA 5DNVA 4ARAA 5KNDD 3LCRA 3OKPA 3UMYA 3CSSA 3T52A 2C9MA 2ZE8A 4MQ6A 4GPIB 1HZZA 2QX9A 2VPTA 1PWYE 5COBA 2GNAA 3KSUA 3GYGA 4YJFB 1PTJC 4KE8A 5KX5A 4I19A 3IBSA 5JPIA 2D5IA 1PEAA 4G1VA 2K2WA 1TNDA 4A4DA 1CR6A 3O92A 4PZLA 1KPIA 1ZJYA 3OIUA 4DRXB 5D3MB 2H48A 4B7XA 4GM1A 4PINA 1RYDA 2E5LB 3BHMA 4XPIB 3IA7A 5LD2C 4FS3A 2IH4A 1NI5A 2XE8A 3QKRA 4UHHA 3KJHA 5IBRA 3RDPA 4AJEA 4AUEA 4FJ2A 4I36A 4F3RA 3EB9A 5DEOA 3PRHA 2WD8A 3T15A 3IQWA 1QHHB 4JP5A 4RJKA 3HADA 4DBZA 3QNUA 3AGQA 2GYVA 3OT4A 2ILVA 3WWYA 2C7RA 1P77A 1BCSA 3IEKA 4XGNA 3IQFA 1B26A 3ABSB 1RMQA 1U0GA 4I1IA 4LGCA 5EMMA 1W1IA 4I5IA 2O2XA 4TV9F 1QZXA 3I0ZA 5B58T 5B4UA 1TU4A 3RYFB 4OBWA 3PXAA 1U5AA 4R2LA 4X0EA 4B8ZA 2IPNA 1OTYA 2MSKA 2PH3A 3JARA 4L8LA 5EIHA 4BP1A 1J1ZA 4IDQA 5IXJA 3V4ZA 1SXPA 1LGYA 3OZEA 1ZNWA 3CUKA 4ZALA 2VUUA 4DCNA 5JSZB 2HWXA 3S40A 4QASA 1THGA 1G2PA 1K6XA 3JRNA 2Q5LA 3F74A 3I5UA 1SHKA 4C7MA 3R9KA 1FTQA 2ODEA 3R7WB 1GL3A 2PN1A 2XB6A 1NIJA 4PZEA 4FFDA 4UASA 4C4YA 3QWIA 1EHIA 5EJ8A 4CI9A 3ZGNA 1OH7A 4N7JA 1LNSA 1ZD5A 3G2JA 2Y99A 4LVCA 2R2AA 3LYLA 1PFYA 2DQ4A 2WTMA 4RDXA 3KOWA 3L93A 1AD2A 2ZPUA 3KZCA 3NBZC 4AKIA 5IF9A 1H94A 1TB4A 4PLYA 2OC9A 5KNDH 3LGSA 1TLLA 4XIFA 2VJKA 5L9AA 3HDYA 4NPAA 3VISA 5AW6A 4QTYA 4KZPA 1YZTA 2QD2A 1PQPA 2KI5A 3IE2A 1QYCA 4JGIA 5TVKA 4RSMA 4DYHA 2DOKA 3D8TA 3DXXA 5LCXA 4DA8A 4L4SA 1IIRA 4QYIA 4U8HA 1QGED 1TE2A 1ZQ9A 4PPYA 2VAXA 5CNMA 3IQHX 3PEFA 1VSVA 4L51A 4YEDA 4YALA 1KU0A 5KMGA 3WL4A 4M83A 2B0JA 5ALWA 4B71A 1NUAA 2H16A 5IS2A 3GLFB 5IDWA 3U7HB 3RBXA 3ZCSA 4KO2S 3CN7A 3OOSA 3OD1A 1QHXA 3B7PA 3PFNA 1ZVQA 3A10A 4PTYA 5FYQA 2C4MA 3B6JA 4MMYB 2VQSA 2WYVA 4EAQA 3YASA 4L0MA 1D4ZA 1GHTA 2B82A 2RKBA 1TVKA 1YONA 2QTVB 2YJNA 4WBXC 4KOEC 4Z1MD 1KI3A 3UA4A 1DEOA 4DV6B 1GRQA 5AMXA 4CMAA 1SUCA 7ABPA 2RGXA 5BNTA 5BRJA 3GJRA 1J8DA 3SYKA 1UXOA 3AEZA 3GA5A 3G0BA 3L8GA 4HDSB 1VJCA 3RSFA 4AJJA 3AY6A 4B46A 4ZEWA 3THYA 1BXRB 2XI4A 4YMLA 4O4IA 5CURA 5AM4A 1ZAYA 1PV2A 4TLEA 5BRAA 5IJ9A 3RASA 2DPXA 2VHUA 4II3A 2QLFA 1JJ7A 2DG2A 3VZRA 3PTLA 4G8DA 3CPHA 1HDRA 2OWDA 3BK2A 4NDNE 3UHFA 3OQIB 4OYYA 2Z8YM 4RHEA 4OQYA 3RF6A 5C8DA 1U7TA 4CUZA 3AKYA 4FQ7A 4YLEA 3CYFA 4LRSB 3H7IA 1MQ8B 1PR5A 3JQPA 2PUJA 4PC2A 5TQ2B 2DB3A 1VIAA 1HTTA 3K9HA 3OIFA 5EP3A 1I32A 4YAUA 5LNK1 1NVWQ 5B7GA 1KEUA 2VAWA 4K1XA 1ZXLA 3SQLA 1KZGB 5TNXA 3WI7A 4IGIA 1PSZA 1CHDA 1ESZA 4LW8A 3N8IA 1OX6A 4B2YA 2JA1A 2OEPA 2PS9A 3EMDA 3C7KA 2MSLA 1DARA 3VR4D 4A0FA 2O4CA 5HM8A 4CEHA 1W9MA 4BX2A 5JFGA 1VCHA 1NX6A 4YMHA 5LBIA 3F7NA 1K7SN 4GKKB 3DEHA 5AVJA 3U3XA 4XWOA 1G20B 3WKDA 3I4FA 1OZAA 2PUHA 1TUIA 4X3OA 1SKBA 4FILA 4MVJP 4YREA 1NQOA 2FCRA 3AHFA 1P1FA 4MW0A 3NS7A 5CNJA 3OMXA 4TRNA 5GWXA 1EAYA 2ZRMA 1EJBA 1V8ZA 3C1UA 1E5DA 2CE2X 3GCZA 5A04A 5LIPA 4CODB 3HG7A 3WLHA 1Z4MA 2VDQB 2QNIA 4B33A 1QG2A 1D5CA 2E37A 1X7DA 1TOAA 2PKQP 3AEXA 3CBGA 3FX2A 4BWFB 3QGMA 3A4MA 3PC6A 1A1VA 3HH8A 5CLGA 4GGMX 4HP8A 4BNGA 2XCOA 4Y2PA 1TO6A 1W0JA 1GARA 5EHIA 2FW0A 2QP3A 3GLRA 4O2AF 2YY5A 3AB3A 1Y8ZA 2WB4A 3LRPA 1Z6TA 4F8EA 1MPTA 3CVYA 3HP1A 1JHZA 3EPPA 3RVSA 2CZQA 4RHCA 4JX8A 2ZZKA 1MCZA 4JITA 2RGRA 1A2KC 1EVYA 5CXXA 3L8ZA 3PK0A 1XZ8A 1AGPA 2XAUA 3TLKA 2F90A 4ATNA 3V5NA 3ETNA 4X8HA 1O6CA 5IG2A 3U4QB 2W8BB 4HVTA 4J75A 5K0EA 2X3UA 2BEVB 3EZ7A 1NATA 4J07A 3RABA 3PQFA 3UICA 3ZJ4A 4AZ0B 1OKKD 2I2DA 5ADWA 4CTOA 1O94C 3ER9A 1DEHA 2FWNA 4JIMA 1XDDA 2FUG1 5CDSA 3MRSA 4RGYA 1UINA 5DTIA 2JGJA 1E9FA 1WZCA 1V1MA 4NBKA 3RC9A 1VBNA 5J4LA 3AZQA 4MVJA 4BMVA 1TF7A 2YZKA 3MOSA 4OJNA 5CW1A 4DGSA 2YHAA 3DDNA 4FEGA 1JIJA 3ABOB 1FCJA 1QCZA 3RWBA 4URVR 5AI9A 5FWNA 1VL1A 3A3OA 4EAAA 2OLJA 2XGJA 1YWGO 2J3QA 2Z2IA 4K28A 2PFGA 4AMZA 1PJ8A 2OQRA 4MI6A 1YV9A 4A2PA 2FPIA 1MXHA 2YC4C 4LQCA 3RSOA 3N7UA 5J4HA 3D02A 3S70A 2HJ9A 1CUUA 2PPVA 3H13A 4B6JA 1ZEJA 2WU4A 4FYHA 4GGOA 3OHMA 2I9KA 1LFAA 5HOQA 5TVGA 4YC7A 4DA4A 5CP8A 2EEPA 5J63A 1N0IA 2N42A 4Z5XA 2BMDA 2KW5A 1TQ2A 5EP1A 1YFJA 1FSSA 1RE0A 3JQBA 1E2PA 2Z3VA 3GFFA 4CQLA 1Z88A 4EFLA 5T4BA 1RM3A 1U5BB 5JWHA 2II6A 4BJ6A 1P73A 1XO1A 5A5GA 1S96A 3BGVA 4KE9A 2GN2A 2H2WA 4EFKA 2YMLA 5EWLB 1XQ6A 2J08A 2G28A 3OQBA 5AKYA 3X1KA 2NQTA 3ANMA 1EINA 2PPLA 4GAEA 1NXVA 3USZA 2JF0A 4BJ3A 4EJSB 5EQFA 2XV1A 3NOQA 2J33A 4PFQA 2JFGA 2LKCA 4KO4S 1JU9A 1HT2E 4C3UA 1U02A 2AG8A 1N5IA 1Y80A 4ZXPA 2P9CA 1FE8A 4MPDA 4RS3A 5FR1A 4FGUA 4KLAA 3DMFA 2CXNA 1YZNA 2C1ZA 4LF7B 4TS1A 1NDQA 5L3RA 4IFBA 2EEZA 2G7MC 3GGSA 3JRWA 3CMCO 3GLHE 4PAWA 5BWOA 1H2FA 2CHGA 3WIUA 2ZVDA 1GQ2A 2RJNA 1MPXA 3C3AA 3DZCA 3KHSA 1R50A 4PE5B 4US0R 5E4TA 3ZS9A 4W6ZA 6NULA 1T6ZA 1U0RA 1RJ9B 3BTOA 1G5RA 4P2BA 1OKKA 1ZJJA 4N8EA 5HE8A 5KYYB 4C4XA 1AUPA 2DT5A 1MA3A 1A97A 1UKAA 1NUPA 2C9YA 1T4GA 4HR7A 4O4IF 4C5CA 2PMFA 5KSWB 2NPFA 3MYRA 2WHPB 4REOA 5JBNA 4FFNA 4NMHA 2INGX 3E5MA 3GH3A 5EUCA 4N3BA 3THSA 4CZ2A 4L4ZA 1BS9A 4EWLA 4Q16A 4AF8A 2PLNA 3BBPA 5ICCA 1DQYA 4LI3X 3RREA 1DUVG 3C3MA 4DL9A 5LP6B 1MG0A 2A30A 4YRFA 3L8YA 2VT7A 3QF4B 1V8OA 3DDOA 2UZ3A 3E4DA 4UUMA 4MUYA 2J0EA 5JNVA 2AJDA 2IW1A 1WX1A 1SQSA 1VPLA 4N3CA 2NXJA 3LKDA 2FSPA 2QN3A 5L95A 2O3JA 3C6QA 2P9HA 1Q7GA 4F04A 1BFUA 2VNJA 2FAXA 4KYUA 5YASA 2I4IA 821PA 3DV9A 3UKDA 5DNUA 2QMQA 2NSLA 3E27A 2ODQA 2H1OA 1D9XA 3A6HA 5EPUA 6REQB 5DTMA 5LWHA 1GSIA 1ULBA 4ZI7B 3AI3A 1OZFA 1S02A 5LXTF 3UHPA 4A0QA 4NC9A 3QUAA 1Z6ZA 2ZS7A 3HB1A 3M5PA 5AUPB 2GS9A 2DU8A 2NUPA 4OB6A 5KOYA 4JXKA 1TZKA 4KMMA 1OIVA 3A3YA 4OREX 4U7GA 2QLTA 3H5VA 3MEQA 1RDFA 4OJQA 1UJ2A 2BP7A 2ERYA 2R6AA 4HB3A 3GLKA 3OT1A 4PRZA 1C0EA 5ULLA 4CFZA 3CS3A 2JHFA 3FJYA 2W00A 4GI1A 4XH9B 1LRKA 3MMZA 1RKBA 3FYUC 1E9CA 4HH1A 4LBWA 5DVZA 4ZV9A 3WJ2A 4YX9A 2JGNA 5D3QA 4BVHA 1IN5A 3EG5A 4Q9IA 1P60A 3NEJA 1LLQA 3KZNA 3LI2A 2EHDA 1E8NA 1SOVA 3HVIA 4U0KA 2M6SA 5NULA 3VYWA 4R2MA 1GG9A 1UPBA 5C32A 1XLWA 1R9NA 3H1BA 3FKSD 5FWYA 5FAKA 2P6MA 4WOBA 1KF0A 1UFOA 2VDNB 1PEKE 5DK6A 2QTMA 1SUFA 3RVQA 4R2XA 4RA6B 2BGIA 3PDJA 1DC3A 3WLNA 1ZMOA 4DCOA 4X1YB 1TLTA 2CF6A 3IIJA 4OHRA 4J1TA 5KX5B 3PFCA 2JFVA 2IYPA 3VH3A 2VSFA 4HNAB 4DCTA 2IT1A 3ZIAA 3CZRA 4UBIA 4RY9A 4D97A 5INTA 2RK6A 2BSQA 3AWIA 4P5DA 4NFYA 2R6DA 3PLAE 1QHYA 3OJWA 4CKBA 1OLXA 4HNSA 1WU8A 1XF1A 5BQ3A 1JHXA 1ZCBA 4MUKA 4CLRA 2Y66A 1ZMXA 3RC3A 4WNIA 1CRWG 3AESA 1P1CA 2H2HA 2FUKA 4R41A 4YCAA 4CKZA 3SDZA 3OQNA 3O7MA 3ZUGA 2JH8A 1CRQA 3N05A 1P44A 3H9CA 4DJTA 2PH5A 1PJ2A 3OF3A 4J03A 4I1YA 1Q7RA 1VLZA 1XD2A 2ZI7A 4P80A 2J85A 4BO8A 5HQTA 2ZVQX 5TY0A 2DE0X 2CSUA 4ZOLF 4HNQA 5IABA 3EMBA 3EMVA 3JAMA 3A2KA 1YL7A 1LK7A 2O7RA 4JODA 3V8PA 2YBDA 4PYRA 3DBVO 1I2ZA 4LKRA 3RBAA 1R6AA 3TQCA 1CF4A 4JBWA 5DYIA 4FBGA 3K4PA 4NRDA 1GR1A 1XPOA 1GGFA 5C9ZA 1SBNE 1XPJA 2J4DA 2WP8J 3TYXA 2RKWA 1LS6A 1D2HA 2VQ3A 3WL6A 4QKQA 5H68A 5DNDA 4B7UA 4JLPA 3M3PA 4M4SA 3LDGA 1HURA 1PR1A 2IXEA 1JFVA 2ZJZA 2PIDA 2HT6A 3DHWC 4G5RA 4JYBA 4QAQA 5AOBA 1U7UA 4KUGA 1P1RA 1R3DA 3SQWA 2PH1A 4OL0A 1MDBA 3KSZO 4BN4A 4KH0A 1GUDA 2X8BA 3R0ZA 4G2TA 5CIQA 4QPNA 5L51A 4P33A 5E9WA 1WS6A 3LU1A 2C78A 2GN4A 2H4JA 2F6RA 3V1MA 5JY6A 4UDXX 2VDPB 1YU6A 2C5AA 3ZIDA 4GXQA 4MR9B 3T5GA 4F71A 2FR8C 3U26A 4DLRA 4TMKA 3LY9A 2IV2X 3C3PA 3HHPA 5J1TB 2WYWA 3I04M 1Y8QB 1GQYA 2QW0X 4H7KA 3AKDA 4KIGA 5FCDA 3T9CA 2R60A 4EJFA 4F12A 1QF6A 1LQUA 5LB4A 5CFQA 4MXDA 1QHEA 2BKAA 2RHCA 4L27A 1VRCA 3HJCA 1OGJA 3AR4A 4AZ0A 3BMQB 5CDFA 1JSRA 1JVSA 2AN3A 2WOOA 4JSYA 4Z4EA 2J7KA 4KQ6A 1L5HB 1TVCA 3J7TA 1Q16A 2DC1A 4RLSA 4MKRA 3ONFA 4HB2A 4RVDA 4X97A 4AY3A 1L8QA 1PW7A 3Q7IA 1E1KA 4HAWA 1PDVA 2X4LA 1PV4A 3JQGA 1A7KA 1L2TA 2Z4TA 3G2HA 3FOBA 2Q6LA 3RUEA 2YJGA 2PR7A 2RHJA 1GOTA 4JVNA 3W78A 5EHQA 4BIMA 5FA5A 1BDMA 4YMTA 1XMXA 1UEJA 1XTBA 2GPYA 1IBKB 4E1AA 2X4DA 1C1XB 4ZJZA 1DBVO 3IT1A 1NI3A 1JAIA 4B6FA 1XZDA 3CB4A 1VIYA 3PL1A 5DHRA 4DIFA 1GG8A 3BH6A 4XIGS 1U7WA 1NU6A 3ZDQA 1G8SA 2AI3A 2BE9A 1IZYA 2EBWA 4UM9B 1SCNE 3PU6A 3BMXA 1EUCB 3BM5A 4B3IA 5LQNA 4URUR 2YC2C 5FUVA 1N5DA 1HL3A 2AK2A 5MFPA 2IK8A 4JI5B 1JWBB 13PKA 3ZG6A 4C4OA 2B4RO 1N33B 3E35A 1BA3A 1BXGB 1X9HA 5HJEA 2P6PA 3NAGA 1IK6A 1H2EA 2HCBA 3V1TC 3NBFA 3SC6A 4CR8A 5JZVA 3P9QA 4AI6A 1V9CA 1RTTA 2P9BA 4FDVA 2SNIE 3LF1A 3QKIA 4Y1RB 1DOAA 4D99A 3ZHYA 1E5VA 5AVTA 1XPUA 1EUYA 3G7UA 3PHGA 1U2SA 2DPYA 1RXCA 2XB4A 5JO0A 2ZM6B 3MS2A 3S27A 2JFFA 1MXFA 2R7MA 4I9GA 1V11A 4F4FA 5B55A 1C8KA 3K9CA 4FHDA 2YHSA 4L72A 4X00A 5GJWC 4RYLA 3M6XA 2HXSA 3VYRB 2Z6AA 1Z6AA 1PT9A 2BVNA 2PAFA 4B31A 2GEFA 3UYKA 1E2QA 2JGRA 3F7OA 4HAZA 3F9IA 1O2DA 1QM5A 4I1UA 3G9XA 3IHTA 4JY7A 4MGZR 2WMNB 3DMNA 5H16A 5KKAA 3D0KA 2I6QA 3RK4A 1ZZGA 2N3ZA 3MTAA 4XVHA 2YQ5A 4L4XA 5G4LA 2VSQA 3F6BX 3ICEA 5H3CA 2YDXA 5H8WA 3VC2A 4GNRA 2Y1KA 2QQFA 5EIAA 1Y3HA 3EVBA 3QWAA 4EELA 4FFMA 1E9BA 4IOLA 1ODIA 4EB8A 3GGOA 1Y81A 2FSIA 3W2GA 2IY9A 3EXIA 1U4NA 3R3XA 3B1ZA 5KOHA 1QQBA 4WE3A 3JVIA 4N03A 1ORTA 1ZKDA 3H05A 1LTKA 1QH8A 2J31A 3A32A 1SXHA 1UT6A 2HJVA 1RIFA 2QP4A 1U0BB 4JBIA 4DHEA 4DIBA 3OZRA 5CH8A 4XD2A 3HJHA 2YINC 2ZLBA 4G25A 4R1PA 2Y0EA 3IPXA 3T5BA 1R8JA 1ZHHA 4IG9A 1QF9A 4ESHA 3GN1A 5FPPA 4L08A 3MJCA 1EBUA 1CYDA 2GD1O 4LDJA 2VHTA 4WNAB 1KU6A 1KYIA 1U28A 1K0FA 2I6UA 4NCHA 4NZZA 4POAA 3ROZA 3ZHBA 3IPAA 4DRZA 4GRDA 2GDJA 4MJLA 4RVOA 1FNBA 1A2BA 1B8OA 4BYGA 5JDIA 2MSEB 1ZUD1 4FYWA 3N2KA 1IPHA 2PTHA 2QZ4A 1BN7A 2OB1A 1R0WA 3H97A 4GP6A 4EP1A 4Y0VA 3E5NA 3HLYA 3H7AA 1J21A 4JSRA 5H81A 1CXZA 1HK7A 2PYDA 2VHVA 5FDFA 1SQ0A 2K4MA 1D5WA 1Y4ZA 4KN8A 3VR5D 3VR2A 3F7MA 1UMBB 2D0PB 3IIMA 3BEOA 1YZGA 4X5OA 3WL3A 4AIRA 3G88A 4ZK2A 5KTYA 1Z08A 1ZGGA 1O6GA 4LTMA 3QLVC 5LQAA 3VJMA 1F60A 5DGIA 1XAJA 4Q1BA 4KAAA 4ND2A 1VHQA 4WBSA 3LYAA 3RSZA 1BNCA 3S2FA 4DSOA 2BTEA 3AVVA 4HTFA 4JI3B 2F00A 5CX4A 1MJHA 3KWJA 5AJTA 3UOWA 3DOEA 1XIVA 1EH5A 3BICA 4LPSA 3B7WA 4W1RA 1XT6A 5BN5B 5AVRA 4JLVA 1U2EA 4RACA 4RK5A 1RMTA 2AFIE 5DNYB 3IQZA 1WZNA 3TLCA 5I7VA 1AK2A 2ZSFA 3T5AA 1NQVA 1CUGA 3MW8A 4W8HA 4P98A 1YUNA 1PUIA 4L8VA 5CDFE 4OQQA 2G70A 1BCSB 1ULZA 2Z0MA 3AK4A 3QBDA 1X80A 2WV7A 5DI3A 2IZ5A 1ZM9A 2Z4SA 3PI7A 1JHUA 2J5QA 4JBYA 5H1YA 1I4OA 1T35A 4TSFA 3RSLA 1E8DA 1V16B 4L3OA 3TKLA 3R7FA 4IRXA 5H7XA 1XZFA 1B8PA 5I8WA 1QZZA 1RLMA 3KUXA 3SX4A 1KIFA 2F1KA 2GN9A 1F3LA 4RK4A 3FNHA 3WIEA 3ZDZB 1R9GA 3TSYA 4TTIA 3B8EA 4CM7A 1LWOA 3A7DA 5E4FA 3U3ZA 4F3TA 3QITA 4RHTA 3C70A 4B1FA 3FKJA 1N2SA 1A1SA 4IDAA 2AOTB 4MLDA 1J8QA 2KQUA 3WRYC 3IO5A 3QMMA 4QO7A 4P32A 2HHCA 4A92A 1EFPB 2HSEA 3ER6A 4EECA 4EFMA 2QPTA 3JQDA 4AY5A 1N2GA 2P9EA 2CJPA 3MT8A 1JR3D 1Z0JA 3JQ8A 1A27A 3EARA 1R4NA 4FR0A 2AN4A 3PFFA 4G85A 1W0CA 4FLMA 3K20A 1IBSA 5TPZA 1VMKA 3MFQA 2X1MA 3N2NA 3IX7A 5EXXA 2P8SA 3W5SA 1W73A 4NCKA 3ZHRA 2AF4C 3R74A 4XCXA 3NZEA 3UIEA 1U1GA 1ZH6A 1OROA 3JXEA 4A2QA 2G6BA 2VJOA 2WUEA 4M37A 3CE6A 3NB0A 1WM1A 5EUMA 3ZQJA 5J2UB 1L7BA 1YMUA 4NQRA 2ZW9A 4LXYA 3RVBA 4C89A 3FMFA 4RSRA 3SJBA 4B6EA 2G1AA 5TMEA 3BZUA 1SUAA 4N18A 4DJ5X 4HQOA 1EBFA 1V8FA 4FMDB 1K27A 2E48A 4Q66C 4ZDJA 1O58A 2FJPA 2D62A 2F64A 4EJ2A 1KI7A 4TOIA 4BNKA 1PWEA 1TA9A 4YDSA 2H6EA 5HIMA 1T9GR 1ECJA 1W88B 4GX1A 3CX3A 5I9SA 5L6MB 2DKOA 3C5HA 5JATA 1MVNA 1L5ZA 1T2UA 5IT9A 1EDEA 4G5YA 1UJBA 2UXBB 1D8TA 3D8SA 5F9MA 2AQHA 2YHBA 3P9NA 1YS9A 1G6Q1 1FUYB 4RMIA 3ONNA 5MN6A 2OPBA 1WKBA 5KYWB 3EIXA 5TXGA 2FG5A 2WA1A 5KJ6A 1VPTA 2Q50A 3ECCA 2AFHB 1JIKA 2B4TO 2IEIA 4XR4A 4WXEA 3UWDA 3BAZA 1R10A 2OMKA 1EQUA 5TDHA 3GUUA 2HTFA 4S2UA 2A5FA 1GPMA 2C77A 2Q1XA 1QOZA 3FYUB 4YONB 2ZJ3A 4P54A 1FRFS 1O57A 5CITA 3NVMB 1T36A 2VHYA 3C41J 2H1IA 3PPVA 4WZAA 2WJIA 1U4SA 4G9GA 4N82A 4WW0A 4UU0A 5GM1A 5IBQA 5BQPA 3SXUB 4E1BA 1ZUNB 4P0PB 5AFSA 3PUVA 1NMQA 3QY0A 3NASA 4IG4A 4KN5A 1IL0A 3KYCA 3QV1A 5AICA 1EAMA 4R1NA 1QIKA 2GAOA 1AHPA 3PENA 4D8VA 1IK4A 2B61A 4HGZA 5TR9A 4HV4A 1ITZA 4BB5A 5ALUA 1HQKA 3CE9A 4LRTB 5DN6A 4ZGWA 1FYVA 1K66A 4PTZA 2PYZA 2YJZA 5B1DA 5DM60 1TM3E 1Z4NA 2ORYA 4MHSA 2VQFB 2PD4A 4MQUA 4TV8F 3G5LA 3PSAA 1DC6A 1QRAA 2BI8A 4IMPA 4BWGA 4L3VA 1XU4A 3GDWA 1FVHA 2AZDA 1HYGA 1V5WA 3DR3A 2B1JA 1AZWA 3WDKA 1SC3A 1YB6A 2JLBA 1VL6A 2OD9A 3E9CA 5ESWA 3O2NA 4LHZA 5LZ4A 3LPDA 1JQLB 4M98A 1B6SA 3MVEA 2DFDA 4WNAA 1WSBA 5AI0A 2QTVA 2NZWA 4EG7A 3RO7A 3PQEA 3GIWA 2PJDA 2FOLA 2PIAA 3H84A 2I6XA 4I1SA 1QFSA 4AULA 1IHOA 1Q1EA 2PKQO 1JKMA 1FUIA 3UK2A 2CB9A 2B8EA 1OBVA 2AOUB 2OL4A 4UOZA 4B7ZA 2FHSA 3UJNA 1Y8CA 2WSSD 3DMTC 3GJZA 3ZWWA 2XVMA 2YTZA 3TNYA 5KMGB 5FUMA 1ZGHA 2QLLA 3Q3VA 1VHDA 2IOFA 1SY7A 1HI9A 3Q3CA 4QOHA 2VS1A 2PM8A 3UT5B 1ADJA 3B20A 2ZRDA 3OCUA 1P91A 2V97A 3U3RA 2K6GA 1L6RA 2YDYA 3K73O 2PQ6A 3RB8A 2VXOA 4FT2A 1K5HA 3FZGA 4DR4B 2JLZA 4AK9A 2FJUA 2RGNC 4G63A 4ZAGA 2G0AA 5JSFA 2OO5C 2Q1WA 3KLMX 5CTJA 1CUYA 4BKMA 1MDFA 1P1HA 3LF2A 1OC4A 3ISVA 2JFBA 1BMDA 3FPHA 3R5KA 4X1IB 4YMWA 5FO0A 5IK2A 3WK4A 2CLLB 5TQJA 3ZJTA 2BGGA 1VRVA 4QQ8A 1M66A 1FF9A 4CIAA 3FF4A 3E7FA 3AERB 4YP0A 1GFIA 1U3TA 5EEGA 1TJNA 4FGSA 1Z2OX 3DMTA 1I6KA 1JHMA 1SKAA 5CJPA 5GJBA 2HJSA 2G36A 2J7PA 1K5DA 2CUNA 2O1WA 1JBKA 2GCOB 2Z5VA 3PNOA 3V32A 4LOKA 3D3WA 1CR2A 1WXXA 3H9QA 1CY6A 5TEWA 4HDNA 1OTHA 5HMLA 4JUCA 2UYYA 4EL5A 3CB2A 3TXYA 2WNIA 3QI7A 4L6IA 3K2QA 4LJ7A 4NJEB 5FTNA 2A9KA 4OMCA 1G98A 4CR7A 5A3RA 5JANA 2RGNA 1G42A 5FOXA 3BQNB 1Y5IA 2JFHA 5HF5A 1CVIA 1HC7A 2OCGA 4O4HF 5EFZA 3JZFA 3TI9A 4B3FX 1Q2XA 4MIYA 2X5OA 3DKRA 2VHEA 2UKDA 2PQ0A 1PZHA 1JEYB 2JLXA 2J30A 3T0IA 1N5LA 3H1FA 1MABB 4H6XA 1ULUA 1IJBA 1Z8FA 2R6CA 1WPQA 4WXMA 4ZAXA 5AVQA 2M2IA 1B74A 1H3FA 2Q6KA 4MHOA 5TV2A 3HJBA 1IM2A 3ZGVA 3L1KA 2DLDA 4CLHA 2RARA 2Y1OA 3R6TA 5CBKA 1YH3A 1EJ0A 2FEXA 3OJFA 2HRRA 4F4CA 1WF6A 4GI3A 2Q2OA 4IJVA 5ERXA 3SQDA 5AW8A 1E3MA 2AG6A 5CGQB 4K1LA 1JQEA 2QTCA 1X14A 1W5SA 3NANA 5F7XA 3JPWA 2X6TA 5ILOA 1U6JA 2Z5LA 1HWYA 3DBIA 3DFKA 4D26A 1VYTA 1DXHA 2HB6A 3ONEA 4CN9A 4G23A 5DJ5A 3TX2A 4RY2A 3LZDA 4HHEA 4UBOA 5E8RA 4JI0B 4LYEA 4LSMA 3FOFC 1JU3A 3D8UA 5DISB 3PUKA 4MVXA 2H1VA 2PGXA 3MHPA 3P71T 2J0SA 2VG8A 1GFWA 1ZK2A 3MQ2A 3N2IA 3UAXA 4GI2A 1F48A 1KQPA 2XRZA 3FMOB 3NEYA 1E2IA 2C98A 4RD2A 2IRWA 1XCLA 2PRSA 4TWJA 4OU5A 3DEAA 3KKEA 2FZVA 3H5TA 4JS0A 2H17A 2JD1A 2HRZA 4LVNA 2O0HA 2B2NA 3EDYA 4FD3A 2A67A 2C5LA 1PJTA 4I1PA 5KQLA 4INAA 1NDUA 1ZGBA 4E2YA 4P5PA 2FOXA 3UCXA 2P5UA 3WGYA 1XNQB 1NF8A 3NBAA 1HPLA 1RI1A 2JIZA 4IWYA 3FPEA 3DKKA 1JIVA 1ULSA 5I7RA 1IQUA 2VT2A 4RVHA 3TB6A 4D9FA 1IN7A 1OXMA 3DE2X 4IQ8A 4W99A 1C9EA 1P7VA 3N6XA 4RJJA 4B7CA 5A06A 1HNNA 3AVWA 1XXHB 4JUBA 2ILTA 3U4HA 1YFLA 4XXHA 4CTKA 2B78A 2EQ5A 3PJFA 5BYBA 2ZQ5A 5F1OA 4RFLA 2QV0A 4D44A 5K0FA 3P0EA 1WIWA 1WXHA 1OXXK 3INGA 4JYCA 1KETA 4DN6A 6REQA 4EK9A 1NONA 2QN8A 4L75A 2IYFA 2Y4OA 4FONA 4ZO9A 1IUPA 1EHYA 3MLAA 5F2NA 5I7SA 4PZUA 2EX1A 3Q9LA 4DARA 4IHJB 5BP7A 1XRRA 3FE2A 5DGHA 5ITZA 1DDOA 3ZQ4A 4F3CA 5IM4A 2JIQA 4EYSA 4YRBA 3S2GA 1R5JA 1RZUA 3RUAA 2J9FA 1C8LA 3RHZA 2XWBF 2ZR0A 3RRJA 1UADA 3N59A 4BRUA 3D6TB 3I9NA 3U1BA 2ZZMA 2A5DA 4RKFA 1ZWLA 1DAOA 1GTVA 1VL0A 3M4XA 3OMLA 2NG1A 3B51X 2OV3A 1JXAA 2HWUA 1T0HB 4PLCA 1ZH8A 4L5AA 4UMFA 2P1ZA 3NT5A 1KZ1A 4KW7A 2QY6A 3IGFA 4DTCA 5C4IA 1MORA 1L8AA 2J41A 1XZQA 4R8RA 5F23A 1YR1A 1A7JA 2JLVA 4HQKA 4CIVA 3WRWA 4ZYZA 1ZIPA 4F3KA 3UYLA 1GZ3A 3WP0A 3M4YA 3UAWA 5JCJA 2WHEA 2ZRJA 3CR7A 1DTEA 3CX8A 3OCVA 4PHHA 4E33A 4KHPB 3IAS6 3BBLA 1Y3CE 2QUZA 4NJMB 2ONJA 1ENYA 2A9QA 3LQQA 5DNAA 3U81A 3A0UA 4C6TA 1V41E 7REQA 1FOEB 4Z4QA 5CT4A 3DEFA 1TO2E 4WY5A 1MA0A 3AEQB 4LYHA 1HOTA 1SIOA 2ORVA 2Q4RA 3N0VA 2QU8A 3QU4A 5DX8A 4TV9B 3W3AH 3TECE 2GPBA 2VRCD 5SYAA 5L45A 1PT5A 1XL1A 1IDOA 1Z56C 1MTZA 3VDMA 1T36B 4MJ3A 3CH4B 1SD1A 2QRVB 1RJFA 1XFAA 1DINA 3TGLA 3D1JA 3PCXA 2BGTA 5DM70 2XUKA 1VKNA 1C1XA 2P2SA 1M2KA 3D5QA 1MABA 3Q7EA 4NAVA 3PNQA 5LZ9A 2EBHX 2YYSA 3W1VA 4Q19A 4KWIA 3WA6A 4ER5A 4WKCA 2P2GA 2H1FA 4O3MA 3L7LA 2Q5CA 2XRFA 5BMOA 1UOQA 3JU3A 3K15A 3WK7A 2BGWA 3DTNA 4OHKA 2XDAA 4MS1B 4QVKA 4Y9SA 4JLOA 2OM2A 4MHTA 1ZJ4A 4F93B 4YP5A 2VC2B 4ED9A 2R44A 3FWPA 5T41A 2GXAA 1RI5A 1WVGA 3D6VA 3DL2A 3KJGA 5D2CA 1VYHA 4QD3A 3WY9A 1A2OA 2PZFA 4L0QA 2SECE 2DPLA 4AZ3B 5DHPA 3V2UA 2CW5A 5G1OA 1YE3A 4OTZA 1WDTA 5ARDA 1KE2A 4BFLA 3KEGA 2AR7A 1OFUX 2VATA 4JEMA 4Y6OA 4A16A 5CRIA 4D8TA 4F96A 1F51E 5L4SA 4BN0A 4HVLA 3BHJA 4G1CA 5CA1A 4B3RB 1RHMA 3BMOA 4RUKA 1QKKA 1G9SA 1KJ8A 3JSXA 1WXGA 3N0WA 3WYBA 4BAUA 1CLUA 3OZWA 1TAGA 2Q62A 3GDHA 3JQFA 1K92A 1DBSA 1WMSA 3HM2A 3P0FA 2ZR9A 3PC8A 4E6EA 2BOVA 1N32B 1BCRB 1V2GA 1ZKMA 3TMKA 2DT8A 3NRJA 4YJKA 4FD2A 4FK8A 3JWHA 1PJCA 1HE4A 2CFRA 2SHKA 4QYMA 3MBOA 1GEEA 1ISHA 1PR9A 1WCWA 1XMIA 1YB5A 3SYRA 4LOHA 3N76A 4F2PA 2GEDA 2WSSA 4BLWA 3N9IA 1P7YA 2EJBA 4YLYA 3AY0A 1G5TA 2XYRA 3PC4A 2Q8NA 1A8IA 4R1TA 1XFDA 1DBIA 3A9SA 2VP9A 3W3AD 4PSAA 2VJNA 1XOIA 1RADA 1W2WB 1IQRA 3QVMA 3IEVA 4HAUA 1QCCA 1V45E 5A05A 3ZV6A 4M7RA 1GKLA 3R5XA 1SXGA 5I48A 4YHHB 1V2HE 1E89A 1QCDA 3O8OB 1NUUA 3HJTA 3HXTA 1K89A 3PC8C 1AKMA 1JG1A 2X8WA 3LY5A 4E46A 3H19A 1KEZA 3OBIA 5KOHB 2R6HA 1MTOA 3O8NA 4JSTA 2HMVA 5BVHB 1V9SA 2PCJA 4NMWA 4WZBE 4MUEA 5AP9A 3LVRE 2GD6A 4OQ4A 3WNCA 3AX6A 4CV0A 1GADO 2WDPA 4HSEA 1R6TA 4J6EA 3STXA 3HKDB 2V3CC 4CKEA 1UIMA 2F1HA 1PGQA 2E89A 4M21A 1SKYE 3C2QA 5JTUA 2XYHA 2YRFA 4OV6B 5DCWA 1U1IA 4PCUA 5CCBA 4L16A 5L8VA 1U63A 1J25A 2OHJA 3DMRA 4HB4A 4Q1DA 3PJRA 4KXNA 3ZVRA 1IZ8A 1FP4A