2X3YA

Crystal structure of gmha from burkholderia pseudomallei
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
202
structure length
202
Chain Sequence
ENLYFQSMENRELTYITNSIAEAQRVMAAMLADERLLATVRKVADACIASIAQGGKVLLAGNGGSAADAQHIAGEFVSRFAFDRPGLPAVALTTDTSILTAIGNDYGYEKLFSRQVQALGNEGDVLIGYSTSGKSPNILAAFREAKAKGMTCVGFTGNRGGEMRELCDLLLEVPSADTPKIQEGHLVLGHIVCGLVEHSIFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PHOSPHOHEPTOSE ISOMERASE
publication title The Structure of Sedoheptulose-7-Phosphate Isomerase from Burkholderia Pseudomallei Reveals a Zinc Binding Site at the Heart of the Active Site.
pubmed doi rcsb
source organism Burkholderia pseudomallei
total genus 83
structure length 202
sequence length 202
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 5.3.1.28: D-sedoheptulose 7-phosphate isomerase.
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13580 SIS_2 SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2x3yA00
2PUVA 1NRIA 2ZJ3A 4S1WA 4TOIA 4B3RB 2CVPA 2CXPA 1IBKB 3OOJA 2DF8A 4DV3B 4NXMB 3G68A 3I0ZA 3C3JA 5BY2A 1N32B 4JI6B 2UUBB 2XHZA 2F4VB 4KHPB 4DR1B 1VI6A 4DV0B 4LF6B 4LZJA 3J80A 1HNWB 1JLHA 3J81A 3QKIA 4JI7B 4DV6B 1DQRA 2WU8A 2UUCB 2YVAA 1IATA 2CXQA 1Q50A 5IWAB 1VIMA 4EM6A 4X66B 2UXBB 5LMUB 1XMOB 4JI2B 3CVJA 2POCA 3FF1A 4YHHB 4JI5B 1GZDA 4AMVA 4LF9B 5A2QA 2E5LB 3HBAA 1G98A 4DR4B 1VIVA 4LF4B 2O2CA 5LMNB 4X62B 1U0FA 1T10A 2VQFB 4DR5B 1B0ZA 1XTBA 3BCHA 3BJZA 3J7AC 4B3SB 4JI0B 1MORA 2VQEB 1KOJA 3KNZA 3T1YB 1JXAA 5FLXA 1TK9A 1U0GA 2HHHB 4NXNB 2CXTA 4OX9B 1XNRB 1TZCA 3FKJA 2Q8NA 4LFAB 3PR3A 2V4MA 5IT9A 1XNQB 5LL6P 4JYAB 1C7QA 3ETNA 4DR3B 5BR8B 4GKKB 1JEOA 4S12A 4JI3B 4K0KB 2UUAB 2UXCB 2J6HA 3JAMA 4IVNA 4DR6B 2VF4X 2ZJ4A 3TBFA 1MOQA 3JX9A 4DUZB 1MOSA 1X92A 1XMQB 1I94B 4JI8B 1TZBA 4U6NA 3Q7IA 1M3SA 1WIWA 2PUWA 1N8TA 2PUTA 3M5PA 3IFSA 4DV7B 4B3TB 1N36B 4DV5B 4X65B 4JI4B 1FJGB 4YY3B 3UJHA 2CXRA 4DV2B 3SHOA 1HR0B 1IBMB 4LF5B 4LFBB 4AQYB 1VI5A 2AMLA 2DECA 2CXSA 3FXAA 3FJ1A 3Q88A 2O2DA 1IRIA 4DV1B 4DV4B 2I2WA 1X9IA 1HNXB 1JIQA 4JV5B 2X3YA 1U0EA 3NBUA 2XBLA 3HJBA 3OTOB 1HNZB 1J5EB 5I01A 1ZZGA 2ZM6B 1NUHA 1HM5A 4M0DA 1N34B 4LF8B 2I22A 3T1HB 2UXDB 2CXNA 2CXOA 4GKJB 1C7RA 2PGIA 3LJKA 3TRJA 4X64B 2UU9B 2VF5X 4B3MB 2A3NA 1X9HA 1N33B 2CB0A 3EUAA 1X94A 4DUYB 4DR7B 1HOXA 2CXUA 2E5FA 4DR2B 1J5XA 4LF7B 4LFCB 3ODPA 1GZVA 1IBLB 4JI1B
chains in the Genus database with same CATH superfamily
5IAEA 1V16B 4YAGA 1JSCA 1IHPA 1LB1B 2DF8A 3GXBA 5HFJA 4I1UA 4ETWA 1CLUA 2JBAB 4F45A 3AEKB 2WHXA 1Z38A 3L8EA 5AD1A 2ECKA 2DHDA 5FWDA 4P7GA 3C6ZA 2O2GA 3J80A 5D86A 5BYAA 1J7JA 3J81A 1TEZA 3CBGA 4CLHA 3CSDA 3FYHA 3PR1A 2BFWA 1G2OA 2YVAA 1A7KA 2VUIB 1VPTA 3ZS8A 4CQMB 1E7MA 2II6A 2CEKA 2NX2A 4NBLA 4ALNA 4I5IA 2YWEA 3GL9A 3NH9A 2Z58A 4FZVA 4JJIA 5AJUA 4DQVA 3W9SA 1J0DA 3FF1A 2SCUA 3RHFA 4M76B 4OBBA 1W46A 2PMDA 4XH9B 3WGKA 2IU6A 3K0EA 3CLSD 1LBHA 1N2CE 1C14A 1GPAA 4FINA 3H9QA 3SZMA 2RG1A 1H6AA 1ZS9A 1ZM4A 2FZWA 3N6XA 2DLNA 2VDOB 2VBIA 1ZK4A 2M1XA 2P2ZA 2X9LA 3IMGA 3LH5A 3N8NA 4J0HA 1UMBA 1IG0A 4F46A 1LEHA 1JWBB 1UBUS 1GSHA 3GFFA 2OMEA 4LRSB 4UUPA 3HU5A 3SGLA 5LFAA 5I7OA 5B4TA 3LQQA 3KNZA 3OAAD 4RM2A 5AICA 3SBEA 3UV6A 4Y0NA 1WVGA 3U7EB 3NX4A 4BO6A 1TJ4A 1SD2A 5ICSA 4HZGA 5G0SA 1DIRA 1Z7GA 2O4UX 4KIFA 1H0RA 2CLKB 1JRLA 3SCZA 5LOVA 1DAFA 1ZPDA 4D02A 1Y37A 1VG1A 3RYTC 3N7TA 5CCEA 4GNRA 1A4IA 1HEUA 5BNWA 2LKDA 2GF2A 9MHTA 7ADHA 3AR8A 3EA4A 3H05A 3H2SA 5HUQA 2OGWA 1PCXA 2XCRB 1KK1A 1TPZA 5J43A 3TOZA 4OYRA 1KWKA 3CRRA 4QBHA 3RASA 4FS3A 5K6RA 5CP8A 2GN1A 3REQA 2BMAA 4P33A 5JCOC 1I7DA 4MEAA 1TU4A 1XEWY 3GMTA 1SG0A 5FA8A 3GHHA 4CG0A 4KE8A 3JY6A 5AM1A 2ID8A 1CVRA 2EJTA 3SD7A 4RXMA 2O0KA 3HYTA 4KWEA 5D7BA 1E7QA 3PPXA 5DHRA 5JSKA 3ZQ6A 5KQRA 3EW9A 1YRQA 3I5YA 2PH3A 1JDBB 1Y4DE 1FTWA 2AW3A 1LPMA 1USKA 2V96A 3CIFA 3LXMA 3P2YA 3R2JA 4PHCA 5JCJA 4ZYZA 2HHLA 4PSCA 3WGYA 3Q8LA 1RQXA 1ZIOA 2VQDA 1NLYA 1QV9A 2PBRA 3HSSA 4MW4A 5DW3A 3HZRA 4G4GA 5C8VA 2DE0X 5KHOC 5LXTA 4H7HA 5FJIA 2X0JA 4MPTA 1YHZA 4NV0A 3SC2A 3FOEC 5AUNB 1WV1A 4O63O 5ICEA 4C0AC 3MWLA 1E1CA 1MQAA 4HWSA 3VHXA 3H5IA 5DH9A 4E46A 5JANA 2VHVA 1UXJA 3R3VA 1J9ZA 3HJBA 3PFKA 4CVNA 3RU2A 3TPZA 2HSGA 4IR7A 1ZRMA 1GG5A 3GX1A 3DV2A 2AR9A 2CSXA 1L7VC 1XK7A 1S89A 4OQYA 3FBGA 1YMUA 4BVEA 4H6PA 3JQGA 3OF5A 1XDUA 3UK6A 5J2TB 2IDKA 4P3XA 2X5KO 5DSZA 2WKPA 3QKWA 4YCNA 2QR2A 4ZVRA 1YOVB 3L4EA 2JFZA 1HZZC 3T1TA 2WF8A 3CIOA 4J0JA 4KWCA 1JQLB 3WHLA 2W2PA 1P7VA 2CL0X 1UXOA 1YR8A 1SHKA 5AHKA 4TYMA 4D4HA 2CV0A 2B7BA 4JKOA 2PZEA 3VDMA 4TOIA 5I9TA 1Q0SA 4PFKA 3ST7A 4MVXA 5C4MA 2R8ZA 4PLGA 3E5HA 5AJHA 3EDOA 3R6WA 3U4DA 3PE4A 3TW4A 3V8VA 4D4KA 3AL0C 3ABRB 1NBIA 4GPZA 1I1HA 3T35A 3KR9A 2CUNA 1H8HA 4G67A 1FDRA 3G0GA 3Q9SA 4Q00A 2R4TA 1ORRA 2R66A 2XNDA 4Q4AB 5AJZA 3GA5A 2V74B 3UANA 2W0SA 2NGRA 1UKEA 1ENYA 3EA0A 3QSGA 2WJAA 3URMA 4DFDA 1ZR2A 2I91A 5GJBA 3CUEF 3FFWA 4Q3NA 5I8WA 2AHRA 2WWRA 4RTSA 1TMGE 3MLBA 3T3EA 1L5HB 3DOUA 4TMZA 3HM2A 4U3JB 4LJRA 4M0LA 4BX2A 2BMFA 3SMVA 4KN6A 3DLAA 1QBGA 1VJGA 3H6KA 5KNCA 5KWVA 2BSAA 4L72A 4AKGA 1KC1A 1NBMA 3MCAA 4Z9AA 3S8YA 4NCJA 1TX4B 3P0IA 3PGLA 1LF5A 2L82A 4D25A 3ZC3A 4U5QA 2V54A 4K26A 1G1AA 1F8UA 5LA6F 4QTTB 5KOJA 1SNYA 5G4KA 1TADA 3WMEA 2JANA 2V7PA 4HNTA 2QGFA 3OJOA 1HT1E 4GDMA 2BMVA 5FO0A 4IVPA 4OIMA 4AN0A 2RKOA 4JJAA 1P1IA 2IGBA 4R9SA 4NXNB 2C57A 4I2NA 1XTTA 3A9CA 5CLIA 1QKIA 4MUNA 4A8JB 1WCWA 4R8MA 4QREA 5IVHA 1ESMA 5IFKA 2QUJA 1E2DA 2O05A 1R0YA 1C8KA 2Z6QA 3IOBA 4OXNA 3C39A 3E8MA 4D6YA 2INGX 3SR0A 4AJIA 4DNQA 1XEFA 2NU6B 4PG5A 5EUMA 4A16A 1LQUA 3MWJA 3ZGOA 2PS3A 3B7PA 1FTGA 3M8KA 4KIGA 5GY7A 1ATIA 3CGWA 4MIOA 5DVZA 3WKEA 2BMEA 1X80B 5COAA 3KVVA 3TL6A 1ZNXA 4A8TA 2SBTA 3BAZA 1UKAA 5K3FA 4IQ4A 1JV2B 3U56A 4LRYA 3VNQA 1ZVKA 3QX8A 1K6IA 1U3UA 3LFUA 5BW8A 3BWDD 5EP1A 5C34B 4PC6A 4BLPA 1UJ2A 2E49A 2MR6A 3V1YA 4C0XA 3BQMB 1EHYA 2PH7A 3L4BC 2CL7X 4DBLC 1GCGA 1JSXA 2D62A 4IIDA 4LRUA 2EERA 5D5QA 2RHOA 1YK1A 1ZVMA 2ZWIA 1L8OA 5HCNA 4Y1GA 2W98A 1IUOA 2QL6A 2PWYA 4KXLA 4Z1MA 2V3WA 4QQNA 4F21A 5L4NA 1QV6A 1I4OA 2BGJA 5K8CA 2ZB7A 4D81A 3FUWA 2QQGA 1HNZB 3QQ5A 4ZJYA 3ITKA 2C03A 1E69A 2QP4A 3PP8A 1OTHA 2GRUA 5TQ2B 4DM4A 4WVLA 4KO8A 5FA5A 5K3SA 1IOZA 3MA0A 1QB8A 3FG9A 1CDZA 5DF1A 3QI2A 5BUZA 1XTJA 2F1JA 4YT4A 4RVDA 1N75A 1NVWQ 3OIWA 2XMBA 2Y1GA 2OE2A 1GLVA 3NT5A 4FLEA 3V2UA 3L7IA 3L06A 5EPOA 1JFRA 4KK3A 3O8QB 4K9PA 1P80A 4TLDA 5K2MA 4LMPA 3TAXA 3H3XA 2DY0A 1I5OA 3HDVA 1Z82A 3L46A 1M6VB 5CM8B 5FBKA 3QFSA 2W2NA 4Y2SA 3ZWBA 2VP5A 2NPOA 1E1RA 3E1KA 4C4SA 4DZRA 4ENUA 3L40A 1G5TA 3DCYA 3ESBA 1M33A 3QE3A 5TQ0B 4CIAA 4MKZA 3TGLA 2PUFA 3QFFA 3MJ4A 1IEXA 4AKSA 1KBZA 4B9EA 3EGIA 2ROQA 3H9EO 4C88A 1YR7A 3KLNA 3X3HA 1RRFA 2JGDB 4ZI2A 2I8CA 3RW9A 3ZBUA 4PZAA 3QHPA 5LSAA 2GYVA 3OETA 4TVKA 3IAFA 4EGQA 4QUGA 1MO3A 1GKKA 1NRXA 4DQLA 4J0CA 2XUHA 3MWFA 1DKUA 5B6PA 4KYIB 4RTOA 1B76A 1MEEA 4YJGA 3TNYA 2QL5A 3AUKA 4BLTA 1ISRA 1TF2A 3UBTA 3C8ZA 1PIWA 2JI6A 3NALA 3DDSA 4Y8VA 4DABA 2PX0A 1SXJA 3ONEA 1Y6FA 4DCCA 3UENA 1C9YA 3PNYA 5LB2A 5E95A 1Q12A 4BNYA 1A9ZA 4WCFB 2G63A 2IEBA 2VJOA 2Z8YM 1IPEA 5C35A 1JH9A 5MGNA 2PL3A 4GG1A 2P2DA 5LU8A 4WLNA 5LZ8A 1RAAA 3WL8A 2V3CC 2HX1A 3L1KA 2O8FA 3FETA 2NXNA 1S2LA 2AG0A 3QEJA 4B75A 3QPBA 4OM8A 1U3FA 5FI1B 3O8DA 1SPBS 4M8IA 3GROA 2XTZA 4WBSA 1E4VA 4MGIR 2Z4TA 3QLVC 4UHFA 5LBUA 1NONA 1M0TA 4ZGBA 1V96A 2PTGA 1K88A 4KXQA 2IYEA 4D57A 4P4UA 3FUCA 3INTA 2HIMA 1G5FA 4N9QA 4C21A 2TS1A 3GUYA 2NUAB 2Y1XA 2DMRA 5JXIA 4CV1A 3WGIA 1NW7A 6PFKA 4JY7A 1UQUA 4Q1FA 4F8JA 3RC3A 2FB9A 4WLUA 3HCCA 4X85A 2X7XA 2WG0A 1MIOB 4GRDA 3QX7A 2H1SA 4V0ME 3EQ6A 1VXRA 3K72B 5AKEA 5JPIA 2G3YA 5JAMA 5JNWA 5K3EA 3S3TA 4EUEA 4WINA 1JJAA 4U7FA 2FK7A 5KTSA 1GJRA 1F4PA 2GYYA 4EMSA 4LE0A 4O25A 5K0CA 4L5AA 5E9JA 4JUDX 4NABA 3EIEA 3ILSA 2C0QA 1HKHA 3EG9B 1IN1A 3DL0A 4NQZA 4QNNA 4RVUA 3IUJA 3BBPA 1M0EA 4C22A 4U9UA 2ORVA 3S8EA 1ZRHA 1Y3HA 4YS6A 2Q1SA 3DXXA 4A27A 1AUQA 4B4VA 4MQ4A 4ES6A 2HCJB 5DU2A 3I58A 2P7IA 3QU2A 3U4QA 3D2CA 4DR7B 1K8YB 3E53A 5B3JA 1L5FA 3JD4A 5EXXA 2AF3C 2D8AA 1Z88A 1R3UA 2I3ZA 4AKEA 4BLQA 1KTVA 5DK4A 5LUBA 2B4TO 1DT5A 2HWYA 2YBEA 4KXXA 1R8YA 4B8ZA 3UJ6A 3NM6B 1EDDA 5AVJA 2OVBA 1AK1A 4LDRA 4A23A 1DJMA 3BHJA 1HQYE 2VUSA 1RXCA 3TI9A 1SUSA 4ARZB 1Q92A 3FPAA 3HR8A 4P7KA 3C5HA 5E8RA 3GLGA 5ED4A 1DMSA 3DZJA 1U28A 1VKOA 4U0JA 3TTSA 3CN7A 3HB0A 5IT4A 3U5ZB 1QQBA 3IGFA 4XLLA 5JH7F 1P1BA 3H13A 3O0TA 2JHFA 1R6UA 1T8TA 4PAMA 2E4VA 4TWRA 4N3GA 3UGTA 2C5HA 3IEKA 3R0JA 4MS4B 2H63A 5F2NA 3U1BA 3A2KA 3L1UA 2BZ1A 4B09A 2XH8A 2C3PA 2OC4A 4OU5A 2F90A 3E9MA 3D2LA 3DGFC 4HDMB 1SWVA 3EFOB 4NNJA 4PNZA 3O6VA 4HDKB 1ONSA 1R9JA 3KK0A 3SP1A 1WD7A 3OQVA 3R7WA 3TTYA 3D3JA 3IMFA 4GOJA 4WY2A 1UPFA 4KFTA 3TB4A 3ZI7A 3NRBA 3BN3A 3QWIA 2ZIFA 3ZWVA 5ITSA 2J07A 3H1FA 4J91A 4UDOA 1O77A 4LOHA 1E3EA 3HA7A 4LOAA 5DNAA 5FWYB 4ZCLA 4DNPA 4EG5A 4UEOA 1QUEA 2Q5JA 2V7XA 1P6UA 4MP3A 3O1IC 2FZKA 4LJ7A 4ND6A 5LKRA 2BFFA 3HP1A 3AJAA 3QV2A 3PNVA 1WUHS 4OQQA 1EFDN 4I3FA 5BN4B 3K6SA 1MMFB 1KJQA 3JAKA 5EOVA 3KYJB 1AUVA 3DAOA 4J76A 4XLTA 4BMXA 4XFKA 1NVFA 2PZMA 2XQVA 3KKNA 3R4CA 4RFVA 4PYRA 5HUHA 1Y9JA 3EVZA 3T54A 3UOGA 3BMQA 2OG2A 1AQ6A 1EWVA 1AMUA 1KO4A 1TVEA 4Q7JB 3U7JA 2GZ2A 1WBBA 2PZJA 2F43B 5AM0A 1XZJA 3GEMA 1NG9A 3CLUC 2C9MA 1U1DA 1A88A 4IFIA 3MWGA 1PZNA 5DFAA 3DLIA 1UBSB 2G77B 3L3BA 4DA7A 5C9ZA 1XMXA 5K7SA 1R6AA 1LXCA 3UATA 3IBGA 4EDHA 1G9TA 1LX7A 3QJGA 3IV7A 3QP9A 3BE5A 3AERA 2PMEA 2OCIA 4RK0A 2C58A 2SKCA 1D4OA 1NJGA 3ONFA 3ZWNA 2HN9A 2ACEA 1DKRA 4QOGA 4ZO6A 1WCIA 2W2XA 1MJHA 3D3WB 5BPFA 1YQUA 2DPXA 3DR3A 3SJAA 5K8LA 4US2R 2BMWA 2GO1A 3I9LA 4WSOA 3WJ7A 4EJSC 4GWKA 1LDMA 4MDFA 1MJNA 1VPLA 2YCLA 2X0NA 5COBA 5CT9A 1ML3A 2B2XA 4ZQEA 3R9KA 3ORHA 5JV5A 3KWJA 5JI3E 1SK9A 1ZZGA 3VI3B 1ZK1A 3LT4A 4INJA 2AUTA 2DQ4A 3E1GA 3FCSB 2ZS7A 4BECA 3LIPA 1KA9H 1GRCA 2A84A 2P2NA 3NKVA 5DBFA 3TOVA 3ZXUB 2WWHA 3G9UA 3IAM1 1I2CA 4RL4A 4DBZA 1BXGB 4DLBA 3E3NA 2QX8A 2YBDA 1P74A 5HDQA 2V6MA 5DHPA 1LBIA 1BMFD 2IS6A 2QTTA 5CDTA 5T5QA 2OG1A 4L8YA 3W77A 3I9V1 2O4CA 3IEXA 1GP2A 1IG3A 1GPKA 3DKIA 1CUVA 4IZOA 4X5OA 1UBGA 4DCNA 1C3VA 3S7ZA 4PC7A 1H2AS 3GRCA 2APJA 1IMOA 2BD0A 3E0XA 4A3SA 4V0KA 1HORA 3HDTA 3OCJA 1GQYA 3R76A 1ZOOA 4G37A 5AUPB 4IIFA 2IYFA 1B3BA 1D9ZA 4MRPA 4YJDA 4BU1A 2HQOA 1ZGJA 1EHIA 4TT8A 1XTUA 2KPOA 1PBTA 2BEVB 2CBGA 2OESA 5C32A 3IUSA 4F86A 3VGPA 1AKQA 3SIXA 1Y98A 2PWAA 4NZYA 4OHZA 4AUNA 3IAHA 1N6KA 4UHCA 4W5NA 1QK4A 4O2AB 2COKA 3C7CB 1C8VB 1G1MA 4LF9B 1H4SA 2ZBVA 2XF8A 3MWEB 6REQA 1HE1C 3NTQA 4TYNA 1I5RA 4YCAA 3EF3A 4MYHA 5L8VA 2GCOA 1JT2A 3KB2A 2DUJA 2GA9A 4JJ8A 4URYR 1D2CA 3K09C 3IERA 1NXSA 1M8PA 1XKLA 3OI7A 3B1FA 5ERGB 2Q2OA 4N5MA 1JZQA 1XTSA 2QLJA 1P72A 2MSWA 2WU1A 5MN4A 1B0AA 1ESNA 2RHRA 3MGGA 2LW7A 1XQ1A 2JKYA 4XWTA 1J7KA 4YMHA 5JDIC 1E3JA 3HY4A 4H1VA 4WOPA 4KOEC 4DR3B 3SQNA 2JB9A 2FPWA 4RKWA 4S12A 5FOTA 3RROA 2J6HA 1VC2A 5EIWA 1UBJS 1SXIA 1FJHA 2CJWA 2ENUA 4UTOA 2H0AA 3OT4A 2PR7A 3K53A 3NHZA 3NT4A 4TQUS 5AYVA 5IT0A 1KDZA 2MSDB 1C4XA 1RKVA 1K6EA 2NZ8A 3BRWD 5TRTA 1DT3A 2QVGA 5JJCA 3JYLA 2WTXA 4J0GA 3ROPA 5JXHA 4Q3KA 1XAIA 3CH4B 4W9RA 2H3EA 4XIYA 2QEQA 1KE2A 3RJ9A 4E6EA 1Z15A 4URXR 2GZ3A 2G36A 1U2SA 4GI7A 1ABEA 3HKCB 4KFUA 2RI1A 4NYMQ 3LE8A 3QMWA 4CCAA 5FUBA 5KQPA 1XE3A 1XRLA 2FMHA 4TWIA 2G0AA 4YA6A 4F3NA 3FXAA 3FKSD 3DPIA 4D7AA 3SEQA 4ZVTA 2YN2A 2XVYA 4UVDA 3PLAE 1FOEB 2WUVA 5BQPA 1FFCA 1QH8B 4B9AA 1T2DA 4KI0A 5DHFA 4ZU1X 2OCBA 3QH4A 3SFVA 2C1XA 4N0MA 3SWWA 3L7AA 3F3SA 3O7WA 5BURA 4JP8A 3JSAA 2PA0A 3C7AA 3U1TA 3RFCA 3AR2A 4BVLA 8ABPA 2DP4E 1UIMA 1NAIA 1BX0A 3TTWA 1JYFA 1FP7A 2PXCA 2QYHA 1TCAA 2VF5X 1T1GA 3PZRA 2K87A 4TL9A 1RT9A 2PBLA 1U9CA 4DIUA 2PSJA 2H31A 4GM4A 3U31A 3PDUA 1FRQA 4LF7B 1AT1A 3N39C 1GZVA 2ZS9A 1TC1A 4LXUA 2N75A 2IIPA 2O8EB 4V0SA 3W04A 2C5SA 2BFDB 1GYQA 3T5TA 1X7ZB 5JD6A 1VYVA 3O47A 3PUYA 4PPYA 3BGOS 3PQ6A 3LDFA 2AKYA 3LL7A 1QHFA 4QGGA 1RLMA 2B35A 3STTA 2R00C 3W9UA 4PQFA 3ZZ1A 1KFJB 2F4VB 3MCZA 4ZCPA 3STUA 1A9PA 1XTQA 5DXJA 4N5IX 4UZEA 3K9FC 4IKEA 3AWDA 4JLNA 1YBHA 4LRWA 5JMTA 4MYSA 1ZUHA 4GMFA 4O6VA 4HDCA 4HDAA 5D51S 5CCDA 4JEUA 1Z8NA 3SHTA 3BWMA 1ZD2P 1M7GA 2E4ZA 5TGDA 3G49A 4F2HA 3F7OA 1NUSA 2PGNA 3H6HA 5KTPA 2Z95A 3HCDA 3OIFA 4X54A 3CX8A 1N9ZA 2ZJYA 1IN7A 4IF6A 3T3PB 3ADPA 3ZQUA 2IEGA 3AIMA 5B2EA 1PEYA 5HOEA 4TTJA 5JXJA 1DOHA 1E62A 1KGDA 1JLKA 1JNYA 5K51A 4G0YA 2RHDA 2ZIGA 4BO2A 2C0CA 3HYNA 2VP2A 5FOSA 5BQOA 5A1JA 4ZVVA 1FMTA 1K1EA 3SNKA 3GLVA 4FCVA 3IV9A 4YP1A 2ZIWB 3ZCXA 1GKUB 3C6KA 3DPSA 2RBGA 4LNHA 1OLXB 1JLLA 4C30A 5B55A 1H9CA 4YUAA 4O2BF 5JVDB 1Z0DA 4UTZA 1N5IA 2Q41A 1NP7A 3MSCA 4H17A 4UCFA 5ANRB 4EPRA 5I7VA 1G6KA 3FDIA 4XIIA 5H80A 1P3DA 3RYIA 2FUG1 3BMXA 3DZDA 3JAMA 4QLAA 2C8JA 3KYDA 4RPKA 3KKLA 4PGAA 1SU7A 2PKEA 6Q21A 1YFJA 3P9NA 3QUBA 3NV7A 3CX6A 5CT8A 3QHAA 4EY6A 4WDQA 3WLKX 3K9LA 3MJDA 2AVDA 5FPTA 2KM1A 3IP1A 1LRLA 2IUSA 4DL9A 1MG5A 4PTZA 2LTAA 1VHTA 3W5JA 3RT1A 1S3GA 1DKMA 3KUDA 5KPDA 2WVAA 4MUXA 3VJMA 4BJHB 1WLYA 2AXNA 3BE8A 2EHJA 3BL5A 4LOIA 4D96A 4DV2B 4K8RB 1B73A 3VTKA 2WT4A 1AXRA 2MSKA 1WEKA 2ZWOA 4M1QA 3WNQA 3D8BA 4RM3A 1XTZA 2L18A 3O31A 5JNLA 4KREA 1RAHA 1W48A 4WLVA 1RMQA 3NGLA 1Y8AA 3DWGA 2LCIA 4ERXA 2EFYA 3O2SB 3O3MB 1S8AA 2B83A 1NPYA 3C2QA 3FPKA 1CZHA 1GV0A 2ZYHA 4EWLA 1IJKA 4ENRA 3IIMA 4QD3A 2YRWA 3V6MA 4E2YA 3GT0A 5TX7A 5BV1A 4YRNA 5BSHA 4BMYA 1WCYA 1VGRA 3UWKA 5G4LA 3WNDA 2JLXA 1IBCA 3H8VA 3Q7EA 4MH0R 3PRHA 2JFVA 3LJKA 4XR9A 1ODSA 4WERA 5CMLA 1O6ZA 2HHAA 5DKFA 3LUKA 4B4UA 2VZ9A 4QYMA 3LRPA 1S0UA 4LJ6A 3GRUA 4W8OA 2E9SA 3H2GA 2VXCA 2XMQA 4MS3A 4Y9SA 4YVFA 1H8EA 1KFCB 4XE5A 5T4FA 2H7YA 1KQNA 4CKYA 4L2IB 1H6BA 1Z68A 3L1VA 4G24A 5EHXA 1IU9A 1N2SA 2RK6A 3JASA 3SYTA 2JGJA 5CBPA 5KTYA 4UNSA 3LQFA 3B5JA 4QGHA 2VCEA 3G0OA 1XPJA 4BPBA 4QSHA 3HJTA 3DV0A 3O95A 2JCXA 1U8CB 3DBVO 2RI6A 1F20A 4UPVA 1LPOA 1J9EA 1HE5A 1MVOA 1MV5A 2B8TA 4HZUA 4W1PA 3WLTA 4EQ6A 4JWKA 3K4QA 5EE5B 5JSZA 1OWMA 4JOCA 3OQIB 3BFKA 2WU8A 4QFMA 3F8WA 3JARA 4M1YA 3KELA 1YFZA 3F4KA 4YLYA 2HK9A 5IWAB 2JIBA 3N2IA 4IZIA 3TLEA 3VRHA 2AR0A 1UBEA 3GT7A 3AR6A 3OJFA 2XUIA 1VYUA 3CVOA 2PRJA 3DGEC 1AM4D 3D6NB 4EKNB 3AF6A 1HT2E 2V03A 4WN9A 1Z2CA 3AVTA 3AI3A 3B6IA 3D6TB 4P5DA 2H9AA 1GHTA 4PSUA 3FD8A 5K3BA 4CRWB 1X39A 3UMSA 4P4SA 2I3BA 2LIVA 5KYWB 4UHHA 1RJ9A 5E7MA 2HREA 4Q6WA 3FCYA 3Q5GA 1SRRA 4KV9A 1GPJA 1YO6A 3H1TA 1KDRA 3P94A 4YIKA 4WLEA 4FZ3A 2BFCA 4NBUA 3VHQA 1ENPA 5CA0B 3L0CA 4MTLA 4ZO9A 4EI8A 2BR5A 1PJ4A 1UBMS 2AQHA 1P9LA 3DD5A 3JQ9A 1LTQA 2CXTA 4AZ3A 4Y2UA 4KI7A 5IJXA 1L4GA 1XU9A 3WY9A 2NACA 5BYKA 3SYMA 4L4RA 1VIYA 4BN5A 5CD9A 1KIAA 2Z2YA 3EWSA 4B84A 4MXDA 1XELA 3QG5A 3AEQB 4CPDA 4KPGA 2XBUA 4KFRA 4X45A 1ZM9A 1UXIA 4BAZA 4G0WA 3D8UA 5DHTA 3DE4X 4GAEA 5L7YA 3VPBA 5KAPA 1ECLA 2ZT5A 2GN8A 3QRWA 3S4YA 1TIKA 1RKQA 4LTNA 1Y1RA 4L02A 5A3VA 5GZ3A 2OV1A 1CJMA 5I6DA 1I0ZA 1RJFA 3GT3A 4GI1A 4J9UE 5FWXA 5HF8A 4EGCB 1LSOA 2R6GA 3IQIX 3UK1A 1FXUA 2PUWA 2XZLA 4K2AA 4W8HA 4GXRA 1M2NA 2AI3A 2FLWA 2PZAA 1BG6A 1JU9A 4YJ2B 2EC5A 3H2BA 3KXLA 4DDHA 5JJKA 4I1SA 3AEYA 5K2OA 3QLJA 3H5LA 3QXHA 4N7BA 4NZOA 3RSCA 1FF9A 1W5TA 5DGXA 4V0LA 4RVFA 5FUQA 3HRKA 1JXOA 1YR9A 2PXHA 4C7JA 3KT3A 2WF5A 2FX5A 1I2MA 4KMSA 4NU6A 3AR9A 1RP1A 2QV7A 2VJBA 3TNDA 5C7YA 2C3OA 2YVLA 4IIGA 1RM5A 1X1TA 4AU1A 2ZQ5A 3AVQA 2ZATA 3GZ4A 3KE9A 1ZIXA 4M4SA 4JHLA 5DT2A 5CDYA 5AW2A 5BQ5A 5KNBH 1PJTA 3L8ZA 1XGKA 1U0JA 4ZCIA 4K05A 4F11A 1NQXA 2PX2A 3IBYA 4WJLA 2GT1A 3C1OA 3MSXA 2JBAA 3OG9A 2XUFA 3KD3A 1HNNA 2PPLA 1MTOA 4FLFA 5EPUA 1OB5A 4CQLB 3OCVA 3B1KA 4ZA2A 3PGVA 3QVKA 1F1BA 1R6XA 5CAEB 1I6MA 1SB9A 2E5FA 2PU7A 4P3YA 1U2ZA 4IFBA 4B4OA 1PJBA 3ZW9A 3JQFC 5EMLA 3LTNC 1QRDA 5COQA 3V4FA 4A26A 1W96A 2JLWA 3K0FB 3JQQA 2VAPA 2ZIVB 1DO8A 3RJ5A 2CE2X 4QO7A 3QLUA 3VO2A 4IUCS 4MWSA 4YB8A 3T4PA 1FFDA 1G63A 3NR2A 4PLHA 4PZCA 1ZQ9A 2I3AA 2R97A 1ISJA 1RZRA 1M66A 2IYRA 1T8RA 2C4UA 3AESB 3KS9A 3N9IA 2FH5B 3QXSA 4GLLA 1ST2A 4TYQA 3ORFA 1JLHA 3WIUA 5FPHA 2IEYA 2YFQA 1ML4A 5DYWA 3DHNA 4E30A 4HN9A 1CBUA 1C3OA 1T3TA 1GPNA 1UBOS 4J07A 2NWQA 1LDGA 1PNVA 1J5PA 2OHHA 2YJ3A 4N65A 4US0R 2GN6A 3KPJA 3V42A 1XCLA 1II8A 2WF7A 3S2UA 2DKFA 5DOVA 3M82A 1XX6A 1NM5A 3OX2A 3F74A 4H15A 2OGZA 1TM5E 2HJSA 1N0IA 1CJSA 3KD2A 4P34A 3RC7A 1QYRA 5C52B 1Z25A 3N0XA 4B73A 1O97C 2VJNA 2RC6A 1OH6A 1ZY2A 1HT3A 3R3ZA 4AX4A 3PDCA 4AJEA 1K86A 1L7RA 4UM7A 1XTBA 3IMEA 3QELB 2Z9BA 5K3AA 3WQHA 4U7TB 4AJ9A 1SCNE 1BC5A 3CCCA 3HLYA 5CM2Z 5CLQA 1NX6A 4QJ3A 1CYDA 4Y2JA 4OXYA 2UYOA 10MHA 1SUEA 2J0SA 1DDGA 2ZB2A 3AYZB 5I7HA 2VEDA 5TJ9A 3VU0A 3BF7A 4QPJC 5HFNA 2ETVA 2X58A 3FGNA 3GGOA 1F3LA 1Z0KA 1ZW1A 2XMDA 3IQZA 3ZG6A 2BGKA 4LKRA 4HG2A 1UJMA 1EGHA 4BZPA 5LN1A 3GJYA 4Q4JA 3ETNA 4KNYA 2VA8A 1SU6A 1U5BB 2J09A 2P78A 4MI6A 3D7SA 2DFDA 5IDWA 4MQBA 3OZTA 1TJNA 5IPFA 4FN4A 2JEYA 4OB8A 3UGKA 4NBKA 3LWBA 3WJ1A 5B7NA 3HNPA 4N12A 3AO0B 3HGTA 1XCOA 4LHVA 3SX4A 3WLFA 3SBDA 5JOQA 4BNGA 3KLPX 5E4TA 1IM8A 3GP8A 2Q5FA 3PXUA 1JG3A 3MMXA 3FCEA 1N8TA 4F2PA 5F23A 4ZHQF 1SVLA 2R44A 2XCLA 4OA5A 3GCGA 5EZSA 3TJZA 1CEYA 4IXNA 1OGJA 4EL0A 4EZEA 3OE7A 1IRXA 1RBYA 1WXXA 3R3UA 3QU5A 4RTKA 1Y1PA 2A5JA 1OX4A 1H1TA 1OW3B 2YOFA 4IZ6A 4FFMA 4YP7A 3GGPA 3BB1A 2JDIA 1GG8A 4IWXA 4UBIA 3CH6A 3D4LA 3CCFA 4XKJA 5JS6A 4IHQA 2WDZA 2YVKA 1OKKA 1EM8A 1M0WA 3ASVA 1BEZA 4JBXA 1F06A 2PU5A 4GRIA 5BSMA 4DPMA 2BFMA 3GLFE 3LS2A 2DJIA 1VOTA 1DG3A 3LL4A 4GBMA 1SIWA 5DI9A 2KWIA 2AFIE 3S1AB 4GYYA 4UQLA 4J49A 5EJ9A 1E2JA 2Q5EA 3GDFA 1MQSA 2JJ2A 4YRCA 5K1ZA 1BXZA 4RK4A 4CFSA 4DLKA 4JQYA 5GTDA 5C4GB 5CDGA 4ZTZB 1JQAA 2O3TA 3ANTA 2ZVPX 2B36A 2WU0A 1REQA 5EHQA 3ZHYA 2HHCA 4ZEOA 4YRAA 5C3MA 1HTWA 4OXKA 1CX9B 3ULKA 1KMNA 1DAOA 1LLQA 5EGNA 2C3MA 1E2FA 2GNOA 2PRYA 1TPYA 4J1TC 5DEOA 3ZR4B 5HIMA 3CYFA 1T1JA 3AEZA 2I6FA 3BH6A 1FNBA 1M5UA 1NRIA 5J59A 5TEVA 3VV3A 3U4MA 2GZMA 1Z36A 4P0TA 4LYGA 4ZCSA 1ARZA 1QMPA 2CLCX 2DT8A 3C0KA 3GZTB 3GUHA 2OXTA 3RS7A 3TLGA 3VJKA 4AM8A 3H8JA 1BGWA 5CM9C 4TXMA 3FB1A 4DLPA 2HYDA 3RRMA 4O8ZA 1U8XX 4OHVA 3DB2A 2J3DA 1HRDA 1UKVY 3JQPA 4ICIA 5A62A 1GGHA 5J5CA 4GO1A 2YUTA 4A82A 4ABTA 1CFZA 1JR2A 2H54A 3SOPA 1ZHOA 1VG0B 3EVTA 2ZYDA 1ORDA 5CCXA 2ODQA 2YOHA 4BYGA 3DE2X 3LZ6A 3U13A 2GTHA 5AXDA 5FBRB 3A6JA 2WA2A 4X95A 2JA2A 1GILA 4N5LA 3ZBPA 4X66B 4J4HA 1VKJA 2BI8A 4QHSA 1BDIA 3W9YA 4AUMA 1GGNA 1R6VA 4Q15A 2DFPA 3MQ2A 5HQ3A 3PZBA 4NU8X 4H0FA 4KE7A 3WLOA 1JHQA 3R8CA 2Z6AA 1EESA 3KJGA 1W94A 2H65A 1C4WA 1CJUC 4MVJH 5CVVA 3D5EA 3WWCA 5SYMA 4IJ5A 4GW3A 5KNDD 5LMNB 2FPXA 2J3EA 1T10A 1VPVA 2WKSA 4L4XA 4NCNA 5C5DA 1L0BA 2I2AA 3D2AA 4M0PA 5A4AA 1VZ3A 4B3SB 1PSDA 1JJ7A 1NGSA 1HDGO 1U7OA 1YB7A 1OBVA 2LBPA 3LPMA 4OEHA 1EWRA 2GMWA 4PZYA 1Y4SA 4J90A 4XEUA 5A3JA 2EJVA 3PXEA 5CFRA 2NU8A 4PZZA 5A7FA 1BWQA 4DA6A 3UZUA 4GMXA 1AGYA 1NVKA 3CBQA 3PA8A 5E7IA 3AI2A 4Q4HB 1C7FA 1CP2A 1DC6A 1JEOA 5F21A 3ERCA 1K98A 3U9SA 3SDBA 5K3CA 2IV3A 1LLFA 1YS9A 4RPHA 3RUIA 3VZBA 2R6HA 4MWBA 4PBSA 4NFSA 3GLFB 4N5HX 1Z6AA 1EFRD 4UEWA 5HTOA 2XGJA 4U6NA 2BISA 2EFJA 2AFIB 3UJDA 5JAOA 4G9EA 1M6EX 1XZMA 1UKYA 2V9PA 4GZ5A 1WU8A 2JLAA 3KZOA 4KTTE 2QMYA 3I1YA 4NCIA 4R3UC 3LK6A 5JAUA 5JAIA 3UAVA 3FGZA 5E6RB 5BN1A 1NPDA 1NUTA 2C7RA 5AI9A 2IYWA 3VDNB 5TQ2A 2EGUA 1I6KA 1U0LA 2P0EA 4WIAA 2F00A 3AZQA 1XVIA 4A6PA 3VA7A 1HFWA 1RWVA 4N7JA 5E3JA 4LUCA 3VBEA 4K2HA 4W5TA 2YW2A 4ZVSA 3CQ9A 4DYHA 5AK6A 3ER6A 4G5QA 3MAGA 4EENA 1CYEA 1B93A 2CMHA 3V4PB 1EFLA 2C88A 4UMDA 2PIAA 4MHTA 1PD1A 5H3HA 5JRJA 3E6AA 2C2HA 1T36A 4TTQA 1N1GA 1HMPA 2HA7A 3HE3A 2YFHA 3H5RA 2QNIA 1YU9A 4P7JA 3N76A 1Y3AA 3JWIA 1ONNA 1UZLA 3JRNA 5JZVA 3T1HB 4MCHA 4ZRMA 1AF7A 1RSZA 4MWOA 3HXPA 3HJCA 1ZSVA 5GPBA 2FSVC 2ODAA 3E05A 3KFXA 1PSWA 5LBIA 4ZI7A 4E5UA 3NEJA 4HBZA 4QGBA 5TQ0A 3IS3A 2BE9A 3QVGB 2MSCB 1DC7A 3N5KA 4MI1A 3TEJA 4CF7A 3EEBA 1SFRA 2PUCA 4L9AA 1VHJA 2QJOA 4K28A 5BMVF 4IPTA 4BGDA 2JGDA 1TEHA 1I10A 4O08A 4YLEA 4ESEA 3WISA 1MW8X 1CULC 1VLLA 3GDGA 1G5QA 4OBXA 4C08A 1RQ7A 4DA4A 4BKUA 4V1CI 1O3YA 4CM4A 1C3EA 3CG4A 4JUFA 4AQ7A 1H2YA 2OOKA 2CJFA 3F0TA 1OLUB 3QIAA 3S0JA 5B3KA 5LLTA 3TQOA 4RFSA 4G0VA 4FDVA 4HAZA 3QUQA 2ZJ5A 2QTMA 2XCSB 1YS2X 1NL3A 3H04A 3GP3A 4MV1A 2P8JA 1E4OA 2DPYA 3KUKA 4CEHB 3G2OA 3H83A 4TLBA 2WWFA 4LJSA 1T25A 1AIPA 4GR9A 3PEUA 1FMCA 1Z4OA 2HW8A 4DCOA 4LSMA 4PY2A 2CJPA 3C3DA 4QM7A 3LIIA 4D0LB 1F4LA 3AY7A 3OT5A 2VHYA 4BLUA 3WMRA 2ZYVX 1F5SA 3VMMA 3AVXA 2IY8A 1N6LA 3OZCA 2ES4A 2TMYA 4E31A 5JNVA 3CW8X 4H1UA 3AZPA 1RJGA 5F5LA 2O2IA 3LUJA 3ZH2A 4AK9A 2FNAA 2HD4A 2HIAA 4P4GA 1M7BA 3AINA 4TLCA 2WI8A 3W3AH 2LPMA 1C0LA 1JJBA 1EVZA 1NF9A 3JD2A 2YRXA 3D81A 2I3DA 2ZBQA 4EI9A 2FSHA 3BEDA 4AXXA 4MP8A 5FOWA 2BZ0A 1FP4A 3ROTA 4QGSA 2IZ5A 1KYWA 3SPXA 2QAJA 3EMDA 2LWIA 5BR8B 5JC1A 1Y63A 2QDXA 5A9SB 1PFVA 2YS7A 1E64A 1ENOA 1XDWA 4ONEA 3UBMA 1MIOA 5IH7A 1FL9A 2IHNA 1VHWA 4ZTBA 4KRGA 5SZHB 5J4LA 1RPZA 1NE2A 4OP3A 4MYDA 4MPDA 1JN0A 1SZCA 1XMJA 3FUTA 3DFMA 4IDFA 4DBLE 3ZY5A 3NYQA 2R5NA 1AKYA 2P11A 2FPOA 2ATEA 2A88A 5CFQA 3ROXA 4R7ZA 3MCWA 1UK7A 4KQIA 3GUZA 1ZESA 4BJ1A 5IXSA 3ZNPA 5FUXA 3D9QX 1KPGA 5E1MA 3UWPA 4E33A 5JE8A 2REBA 1X7DA 4Z4HA 5GZ6A 3U7GA 2WMYA 5DLEA 3WNZA 4Q1AA 3UAOA 1U0RA 1DJLA 4QU5A 4CMEC 1E9VA 4H4EA 4OB7A 1XQYA 5C5IA 1JYEA 3QYFA 4MARA 2IXGA 2B8JA 4DG9A 1NBWB 1SIOA 1LW6E 4LYYA 3VGJA 3MQ4A 1K97A 1M2EA 2DJ5A 4AJHA 4IG9A 1R5OA 1JGTA 2X76A 4DQKA 4JLJA 1UPXA 4R2WA 3JQ8B 4GM1A 1J6UA 2V7QD 3GFTA 4TTTS 3WQQA 4XYEA 1Z56C 2ZWMA 3PC6A 4G5OA 3T12A 3QKSB 1X8XA 1ADBA 3PLNA 4P32A 1SKBA 3BDAA 1O87A 3L7KA 2IOQA 4FFBA 3PKJA 1AUOA 4LVOA 5FNVA 1VYHA 5KYXB 1TJ5A 4DSUA 1BRTA 3QENA 1PR4A 2B4RO 4TMVA 1ZNQO 1KAMA 4KQEA 4XA8A 1U2GC 1BCRA 4HDMA 2B7LA 5JQGA 1A96A 2FPIA 2Q50A 1CXZA 3LO8A 1GCAA 2XHZA 3EHEA 4JSYA 2HI0A 5JEEA 2IODA 4UARA 1L5OA 3FR7A 4MUGA 4RPCA 5K3DA 3P0JA 3CZ5A 4Q82A 2LCQA 2C5LA 4RAOA 1C80A 3UJAA 2C9DA 1ND6A 3I2JA 3LOUA 1EU1A 1M34B 5AP9A 5ILGA 3T6KA 2D1QA 5FWYA 1EWKA 2HDNB 3UWOA 3GYBA 1TKBA 2ZJ7A 5LMUB 4IDEA 2P9CA 2XCIA 1SCUA 3LCRA 3IAXA 4MW9A 4UE2A 4JI2B 1Z74A 2WHEA 2Y2VA 5IN5A 1T43A 4P92A 2QE6A 3RF7A 1U11A 1ZN9A 5BT9A 3T9CA 2O8FB 3DTVD 3F4BA 4KO3S 3CJQA 2WR8A 4P53A 5DHQA 1DC8A 4P38A 4TKVB 4ZP1A 1UWCA 4QHYA 4YQYA 2DFNA 1WTCA 5BSVA 4EF5A 1MPXA 4M3NA 4PNEA 3E58A 3OQPA 4RETA 2OVFA 5IDXA 4EARA 3DEKA 1HE3A 3K9CA 2F43A 3B3FA 4Z0PA 3DH0A 3TZHA 3U7QB 2HHHB 4PRZA 1Z2PX 3LAWA 5M2QA 3AF2A 3W5AA 3UOWA 4FX5A 2O0MA 3GJ6A 3E5NA 2XOXA 2O5VA 3TDKA 3LCUA 1WY7A 3FLMA 4C3OB 1K6JA 2FUCA 2WHPB 1USVA 3V4ZA 1RP7A 2NZUG 3AILA 1A8QA 4P2GA 1JQJC 3PENA 4R4JA 4YDSA 5FX2A 3P4YA 3Q0EA 3ZDFA 5A9TA 2JIPA 3MG9A 1SBHA 1PR1A 2GWRA 2AYYA 2GVNA 2YHBA 1YB6A 3D3WA 3E9DA 1XMQB 1TYAE 3MM4A 4DIBA 2Q99A 5LXTF 2TMKA 4M36A 1KJNA 1SK8A 4X1YA 2YMQA 3L9WA 1TIBA 4O4IF 3ZYZA 5LMCA 5U9CA 2FMIA 1P4HA 4OJMX 4YDHB 3IP6A 1MJ5A 3FPBA 5CFOA 3KKOA 1NVAA 2BGLA 3SBXA 4MUHA 2DWCA 2D00A 2HQBA 1JIJA 3FRHA 5AJTA 4OAOA 3T38A 1RXYA 4AUEA 4C3ZA 1FFWA 3OO0A 4BAGA 4N3CA 3DZGA 1ZMOA 1FYWA 1QCCA 1DBVO 1R3DA 1WZNA 2FVXA 1DAMA 2C8KA 4UUMA 4WK2B 3IXMA 2VDWA 1FRZA 2ZR9A 4GI3A 4J1SA 3WRYC 4NRDA 3TECE 5CB4F 1WP4A 2ACVA 1W0JA 3TSCA 5C2JB 1AHNA 2QT9A 2XXBA 1W4RA 3KTOA 4GKAA 5ADWA 1RWQA 2EYQA 2Z9CA 1EK2A 2UZ1B 4KO2S 5L7WA 3UMVA 1FFEA 2ONZA 3RRYA 3DFKA 4PR0A 2RCYA 5HJ5A 3Q7RA 1P2UA 1GTG1 3LY8A 3LUFA 4FHFA 5EZYB 5KSYA 2C2ZA 2QLMA 4O4LF 3HCRA 4JLDA 3V2GA 1SKYE 3IBSA 2A5LA 3G82C 3PNQA 4IIBA 3EULA 2A0YA 1H9BA 3X44A 2PPVA 1EUQA 2XW6A 3OZRA 5A04A 3VNUA 3WWDA 5HP4A 1EYZA 3M4XA 2RH9B 2QP3A 4JZKA 1VJ0A 4RHFA 1DO0A 3WDLA 3NM5A 3T3NA 4RF5A 1GTMA 3E3AA 1A5ZA 2Y1KA 4OHWA 3IUQA 3SY8A 1U7WA 3MWEA 4DUGA 2ECQA 2DWUA 3L7DA 1XZDA 4RELA 1CIJA 4YJKA 2CFRA 3U3JA 4RHUA 4P80A 4CF6A 4YCJA 2FSPA 4IWYA 1AA6A 4K6GA 1MHTA 2Z09A 2I9PA 5JAQA 4MCJA 1TMYA 1ZQ1A 2WBLC 3QM1A 5ETJA 5KTNA 4V0QA 3OQMA 4RTRA 1TAUA 1OGIA 1C3XA 1J2YA 1F2TB 1TAGA 2BHSA 4Y2VA 3R5TA 2PV0A 2Y92A 3F3KA 2WWTA 4LAFA 2XSZA 4PPFA 2M1ZA 5JAHA 1MXFA 2IPMA 2JKZA 1SCAA 2PXAA 2QHXA 3KYCA 2ZSEA 1EXMA 4J0FA 4C0LA 4EK9A 1FS6A 1H1LA 1K7CA 3AEXA 2FJUA 4YWJA 5FTWA 1AQIA 1JBEA 2HU2A 2IF0A 2JLBA 3V80A 3UTCA 3VVBA 1G7RA 4IFEA 5IZCA 3CLVA 2CK3A 3D6AA 1DJQA 1KYYA 3EIFA 4KKVA 2SKDA 2O2HA 1XMSA 2J0UB 3SFZA 2Q3CA 4KIJA 2CLFB 1Q3KA 4M49A 3HRHA 4BFWA 4AY5A 1NVVR 2JRCA 2F64A 2P90A 2W22A 4FBLA 5CJPA 3RUPA 1MJFA 4ZOEA 3H9BA 5DM60 5B30A 3W1WA 3P9SA 4E32A 2XYRA 4HAUA 5BN5B 4BE4A 2OPBA 3KT0A 3T5GA 2H2WA 2UV8A 4OFWA 1CR1A 2EZ8A 2WC1A 2BJHA 3V1MA 2HGZA 1WY5A 1XAJA 3CINA 2KBEA 1NI5A 1GKIA 3HWWA 4HS9A 2VTEA 1PT6A 2PUHA 4X1KA 3VC2A 4B2YA 5IXYA 1L5SA 4J16A 4DCTA 1US8A 2WIBA 3PTLA 3D8NA 2B82A 1BMDA 3VYVA 4UCXA 2AMJA 1ACJA 1XZGA 2DHRA 3P4UA 1NMQA 4LBYA 1T9CA 1ZK3A 2JFYA 2PSSA 3BERA 1QH8A 1E7RA 3HBNA 3I2IA 4ZQBA 1K3FA 2OFPA 4D4LA 2XKKA 2M6RA 5H82A 1T91A 3Q7PA 3SFTA 5FI3A 1B8UA 3MOSA 1JEQB 3A32A 4G1UC 4ZEXA 2H11A 2OD9A 3T61A 1KI6B 4MPJA 2ZJBA 2VJCA 1ORTA 3NHKA 2W4MA 2B21A 4HNAB 5CX1B 1MTZA 2XMZA 5IANA 1D09A 3CISA 1J09A 4PCVA 5T4EA 3S55A 1ZYUA 3EDQA 4CL0A 2FWNA 3DBHA 1WKBA 1SKYB 3INGA 1EFPA 2W48A 2JH8A 3ZJUA 2EFEB 1WBDA 3Q15C 2X4IA 4G81A 4YJ3A 2C7QA 2GD6A 4M87A 4WA7A 4HDQB 3I0MA 1FQJA 1VKZA 3RF6A 4NBRA 3VR3A 4WGFA 2IYPA 4LDNA 4OAPA 5DGDA 1KJZA 4C6HA 3QTBA 3PKZA 2G5GX 4BUZA 1EWYA 1FE8A 3VVLA 1AKRA 2C07A 2GXSA 1MJGM 3AF4A 3EPRA 2ZDQA 3KCNA 4TQ9A 2AOVA 5T8KA 3NJRA 2AYXA 1OC4A 2WM3A 4MIEA 4UTNA 1PSZA 3ICCA 4ARIA 3DB1A 4QUIA 4R1OA 1CUFA 1ODCA 2GCNA 5J58A 1T35A 5JY1A 3NW9A 5EJIA 4FVTA 2VATA 3P5SA 3WLEA 1FSPA 4TXNA 1KKUA 5J4VA 3Q72A 4Y1FA 3T9DA 1JTEA 2CE7A 3KR1A 3VSEA 3G5MA 2QNBA 2CZQA 2Z56A 4RYLA 5HS6A 3RHSA 3AP3A 4HR7A 5GWXA 5K99A 5DSTA 3IESA 1E1YA 1J99A 4NJOA 4KRFA 4W6ZA 3KPWA 3OOSA 1SXQA 1QIHA 1BXKA 1C9NA 1QPBA 3F67A 5EIBC 5KX5B 2CY0A 1Y3BE 2I4OA 3HU2A 3OC0A 4U9HS 5EXSA 1L5KA 4IRXA 2O8CA 2EVWX 4XSGA 5F98A 4TUYA 3QXJA 3CNQS 2BYTA 1QGYA 2PY6A 5TS2A 1MC8A 4H27A 4LWOA 1JPJA 4OQXA 3L1HA 2Q7XA 1OLXA 4WNCA 3AWIA 5BSFA 4GX1A 2EV9A 4JDUA 4DLUA 5JVDA 5KVQA 4BGIA 3OKCA 3ZHRA 1EE2A 1U8EA 1KEVA 1VIVA 3HPRA 1E1QD 2YYSA 1Z35A 2ZROA 2B5VA 1KAQA 5CFZA 1CU1A 4LRXA 3KEGA 4E11A 2X8JA 2BKLA 3GDWA 3OKPA 5FYDA 1W44A 1GA1A 2D7JA 3HADA 1I9CA 1DBIA 2IYLD 2NYAA 2JPDA 4DLTA 3Q1LA 1M1NA 4HGYA 4HRXA 4ZOLB 4AW9A 4QYTA 4CYMA 4RQBA 1QP4A 2HWUA 3S2ZA 3CM0A 1CUWA 4FC6A 1KTIA 3GPLA 1P5HA 1WOYA 3F47A 4AP6A 4EJSB 3D64A 3TM4A 1TO2E 5FD8A 1EDOA 4JU9A 2WKRA 1D0VA 2YR0A 1MBZA 4RE6A 4O4HF 5JPCA 1XNQB 1O94A 2RHWA 4U8GA 4ML3A 1OD6A 4Q4DA 5BOSB 3V8RA 3ANYB 3EG5A 4EITA 2CL6X 1FQKA 4H3VA 2VSYA 1RHUA 1WZUA 2HDWA 2NW6A 1QTQA 1EDZA 2VSXA 2XXAA 3WGQA 4HQFA 1GCOA 2CNDA 2R0QC 1NG1A 1P2VA 2YWXA 1ECBA 2EX1A 4KLNA 3SXPA 5L6MB 1XQ6A 4PZUA 3DWFA 3UJ3X 3THWA 1X70A 3LBAA 2Y6VA 4BBJA 1E7WA 1M6NA 3CZ9A 3M2TA 2YQ5A 1NFRA 2JD1A 3RUCA 5INTA 2WJVA 5GONB 2ICAA 2W58A 3VHRA 1D5CA 1OXVA 2JK1A 3PIDA 4IYRA 4LF5B 3U4IA 4YCMA 4RX1A 1GQFA 3IOYA 3NVAA 4G1BA 3OM1A 4CT5A 4KV7A 5JROA 4BNWA 4DV4B 3NS7A 3PD7A 5GJCA 4KK4A 4NH0A 5FL7D 3CKYA 3AM3A 3V55A 2HMVA 2RH5A 2O8NA 3K0AB 1BKDR 3QWBA 5A05A 1GPBA 1W2GA 3KVOA 2CYCA 2JHPA 4HLQB 2YZ2A 4H0CA 3DTVB 5AOVA 1DKLA 2A3RA 2JGLA 2PS9A 4YN3A 2MHCA 2BEUA 2M32A 5HR5A 1BMQA 1DRVA 3PKIA 2J0EA 1N4DA 3HCBA 4NE2A 5DMHA 4BO0A 1LGYA 1QB7A 1X7XB 5AKYA 1FUIA 1AN9A 1G5PA 3GJ5A 3LRXA 4JC0A 5E3HA 1RYZA 2GAAA 3CF2A 4LC1A 2WIKA 3NBZC 3RYFA 2PGAA 3FJOA 2A3NA 5IG2A 1PGNA 2I7DA 3C6YA 3RS2A 2VP4A 3R20A 5DWQA 1GQOA 2CVOA 2ZRLA 4JFAA 3BFXA 1UPUA 3BFPA 3TW6A 2Y1DA 1XD8A 1DLIA 1NMSA 2YV5A 3E9ZA 4B0PA 4D1YA 3KSMA 1MQ9A 1YQQA 4ENWA 1X3LA 3MTJA 3JVIA 1B16A 1LSJA 1JA9A 5I4KA 3BD7A 4BXOA 1ZH4A 5AW5A 5KNBA 3HKEB 1I36A 4LYEA 1ZGCA 2J4FA 3SS7X 2JCBA 5ESWA 2BN4A 4I3HA 5KC9A 3IOEA 3KTFA 1YCDA 3LNCA 4G0NA 4DT1A 4KQXA 2PKCA 1P0QA 3KLOA 4QPZA 2I6GA 3MK31 4BB6A 2YWCA 5CA1B 1RC0A 4UOQA 3T0FA 4EA9A 1H23A 1MA3A 3IP7A 3TZCA 2R6FA 3SJBA 6LDHA 3V7FA 4G1FA 5C80A 2H51A 3NHYA 5ILQA 1T2AA 4WBNF 2RE8A 2XEXA 1E9CA 4P1ZA 1TOAA 5AKGA 1ZL0A 1Q17A 4BJ6A 1FDUA 5G40A 1NURA 1RHRA 2EL9A 3FVQA 4Y6LA 3IR7A 3KJHA 3RS9A 1KR5A 1XZEA 1IOVA 2QRVA 2ZG6A 3D1JA 3FOCA 3DE5X 3I4CA 3R0ZA 3BCHA 4WBXC 1UOOA 2PQMA 3KBOA 3OIDA 1YJBA 3QW2A 5TY0A 3V00A 1H4QA 3L05A 4FGUA 4ZAZA 3JSXA 5FXMA 3AV3A 3PGKA 1SBNE 1WXWA 1KQFA 1O97D 4RTMA 2PH1A 4IF4A 4P9NA 3KSRA 3OFNA 5JISA 3K71B 4ZYTA 5BW5A 2VRBA 1PS8A 2X4GA 3OWXA 4TMYA 3UMCA 4JJGA 3AW9A 2E3JA 2IXEA 3V7UA 4D0NA 3DFZA 4OM7A 3R3YA 2BV3A 2ZPTX 3WOHA 2EBUA 1H9AA 3CH5A 1T2UA 1Y6JA 1I80A 2PWBA 2XMGA 2XWJI 4WJKB 1GU1A 2A0KA 5LQUA 3FAKA 4KKXB 4QWMA 1OWNA 4DDTA 3BGDA 5BQ3A 1JFFB 5AK3A 2NQ2C 5I4BA 4DUZB 3NBFA 1GUFA 3JZDA 3FCXA 3TW0A 4CKEA 1LPAB 4RIGA 4LNAA 4DXDA 4AS2A 3RWMB 1Q1EA 2CNKA 1XR3A 4RZUA 1V45E 1KF0A 1ICIA 3B8EA 1KRXA 4EW6A 3UJ8A 3U7HB 5CVDA 1LJ8A 3F3MA 1XJQA 4B43A 3C3EA 3ZGXA 3B2NA 3DKRA 3U6BA 3AUJB 1ZFNA 3GBVA 4KSCA 4MCIA 1KAOA 1NY5A 3RRFA 4CQLA 3FYUC 1NVBA 5BVHB 1E1LA 4Z9FA 1N6RA 3QV1A 1WABA 3N5CA 2Y1OA 2B4AA 3RI3A 3SHFA 1SC4A 4H1WA 2Z98A 3ECCA 1UC9A 3K0FA 1DEAA 4AMBA 1NXVA 1E6CA 4RKYA 1QF6A 2I1VB 1EX6A 4GKJB 1KK0A 4OMFG 4TV8A 1H0SA 4X6YA 2NVOA 1D8TA 3HNRA 1FFXB 3FBTA 4A2WA 4CI0B 3QF4B 2I78A 3A3PA 5HA5A 4ACBA 2BZGA 2CZGA 2I55A 1PE0A 2O48X 5BNTA 5A03A 3OHSX 2HF7A 1D2AA 1NJFA 1UODA 2PIDA 3AP2A 3IYLW 4ZV7A 5I7AA 4LFCB 1GL9B 3L9XA 4KXMA 4C43A 1CSEE 2FPSA 2ZRPA 3SEFA 3OLXA 5JMWA 1G7TA 3D0OA 4R9RA 2DLCX 3G5TA 4DMKA 3GMDA 3RC1A 5LIRA 1IB6A 2A1TS 2BCEA 3KPYA 2DY1A 5P21A 5T4BA 1ZM3A 4WJZA 4E22A 2Y1LA 2L42A 4R9NA 4RZHA 4I1OA 2XTJA 3GARA 1KQPA 5F12A 1RYEA 1S3SA 4BVFA 1ABFA 1P9OA 2FR1A 4L07A 1VBFA 2QZJA 3E84A 4EKYA 5LYJA 3I9JA 5EC8A 3SIPA 2P6UA 2LD4A 1GZ3A 2HJVA 3OQ6A 3JALB 4JKYA 4KQ6A 3INNA 3IHLA 1WVMA 5E7JA 5EQFA 4NL4H 3EF0A 1LBSA 4MW5A 2CVHA 2V4UA 4L0MA 4R1PA 1K06A 2H06A 2YHIA 4K9QA 1QGDA 4PFQA 5FTJA 3JVEA 3CRW1 3E03A 3E8SA 1W75A 4LJLA 4N3BA 4CKCB 1OXXK 5L3ZA 1I8TA 5DM1A 1K92A 4JJ4A 3ABQB 1KOLA 3STYA 3GCXA 1B8PA 1EUCA 1NJ6A 4ZYUA 4KACA 3A05A 4BWGA 1U6IA 1CE8A 4GLFA 4ADSG 1XZHA 1Q1QA 3IA2A 4GPIB 4QOJA 3HVIA 4YIHA 2RI0A 1VGQA 1S7GA 4C0SA 5C37A 4JODA 2HLPA 1YJ5A 2RJNA 4V03A 1DRWA 3JWJA 3RRNA 2J6CA 4B71A 1KZ9A 4M8SA 5KQSA 1Q1ZA 1WW3A 2ZEJA 5IT5A 2VUHB 4JLUA 5C8YA 3AHIA 4RNCA 4IHJB 4GKKB 2V0NA 3EY9A 1OC2A 1TMKA 3G2KA 5ESDA 2X40A 4Z4EA 2AUNA 1QFYA 4OG2A 2HSWA 2FW7A 3DNFA 4GMGA 1E7YA 5LCXA 3THSA 4V2IA 2FP4B 4MVJA 4RF3A 4CIVA 3OQBA 4K46A 2XAUA 1IUPA 1G3RA 2Z8ZA 3I01A 2QBYA 1QLJA 5AVOA 2UZ4A 2RGNA 4XRRA 1VL6A 1SKUA 1E2BA 1R8SA 5ALMA 3GR6A 1CUEA 1KEZA 4R98A 4JGGA 3IQFA 1HDIA 2PUAA 1N5OX 1ZD4A 4M8LA 1ULSA 3PFFA 5PGMA 2Z2IA 2EJUA 3I1JA 4ASUD 4H6VA 1H2HA 3CE9A 4DMFA 3P96A 5HZHA 1E6EA 3A0RB 1ZGHA 1P2SA 2XDWA 4RD1A 4TN1A 1FYXA 3Q88A 4RS3A 2LDXA 5DNYB 2IYXA 5EEGA 3NOXA 4PYKA 3ZIAD 2C4TA 5KDDA 1GUAA 1TFUA 4WAUA 2GPYA 1WXHA 4Y67A 1QYCA 2BKXA 3GYGA 3PYLA 3QXGA 5AI0A 1GG2A 3MTEA 1CF2O 3F5DA 4WCVA 5I9BA 4B7CA 4WNAA 1J23A 2OP0A 2QD3A 1AGXA 3GVXA 3QVVA 5D85A 3HDJA 4OQNA 1ZNWA 4U4AA 3VZDA 1NUHA 3OPYB 2XUKA 3X1DA 4NECA 4B80A 1EXVA 3G2IA 4QQKA 4LF8B 1KP2A 2FY8A 1T4CA 1GT6A 2GB4A 4ZYVA 5K6TA 4D9JA 1C0IA 4GH5A 1SVIA 2YJ6A 4Q7QA 3EXIA 4BEWA 3JATA 3ANLA 4R7TA 2CFOA 9LDBA 4V02A 3IHWA 3RADC 2NIPA 2Y76A 3UK0A 1O0CA 4NLLA 3EXFB 1CZLA 1QG6A 5CTJA 2V7BA 5D1HA 4GOLD 5EYPA 3IP9A 1IBLB 1S96A 3ZUGA 1MC5A 2AN5A 2Q5IA 1KQOA 1RHQA 3JQCA 3NC4A 3QTTA 2WKQA 3UEOA 1P3JA 3OMXA 4ZZIA 1JNXX 1W2HA 2IV2X 2PGLA 2H07A 2XMCA 3B12A 1P33A 4FR2A 1HYEA 2HJRA 3PJEA 4OP1A 2B8NA 3KSBC 1N2ZA 1CDOA 5CH8A 4HAYA 1QIFA 4HY3A 3V1NA 4FD2A 2W00A 3WMGA 4ARUA 2Y4NA 4CR7A 5PNTA 3GLUA 4EG6A 4WFQA 1T5IA 1NR7A 1P17A 3IUMA 2BFBB 2VRNA 4BMNA 5L9AA 3P20A 2IH2A 1D1SA 4RY9A 4BO5A 4YRZA 1QIIA 1RTTA 4I1YA 3N2YA 4KH1A 3ZWAA 4BCBA 1KH3A 1XZ8A 5CD1A 4TVBA 4DAOA 5F2OA 2AOXA 3LX8A 3ONNA 4OHCA 1XT6A 4RIFA 4NQRA 2QMZA 5D3KA 1U1CA 4FYKA 4XYMA 1W19A 5HJEA 1OYOA 3BVPA 4N54A 2I0FA 5AWFC 1PZHA 4BAUA 4C7VA 3VNSA 2P8SA 3F6PA 2OBYA 1AY0A 2RG7A 3B6JA 2PLNA 2V7GA 2VZ8A 3WYGA 2ENWA 2ZXUA 2GF0A 1B6GA 5U4QA 3UPDA 1F2UB 2R8RA 4Q21A 3HWSA 1CG6A 3LSTA 2NSLA 2WQZA 2EW2A 3LW7A 2W2LA 2NADA 1JTVA 1B7GO 1MW9X 1E2KA 3CRNA 4PZLA 4F7DA 1AO0A 2ZU0C 4C4XA 2KI5A 4JK3A 4DMRA 2FFJA 3LHDA 1JS1X 2W6JD 3MUFA 1PUIA 1JZTA 3EGCA 1E9RA 5AXBA 2DQYA 1ZH8A 4P86A 3VR2D 4HT3B 1CZUA 5IVDA 1KI7A 4B3HA 4PIPA 4UBOA 1IK4A 3C85A 1YMQA 1UMCB 2PKRA 4CCSA 2D2EA 2E5WA 1R5BA 4EBBA 3A7DA 1P39A 3O82A 1SULA 1CY1A 3K2BA 2WQ6A 5LWQA 3T7IA 3MMPA 2B2NA 4I4TA 1N9GB 1QZTA 3W3AA 4FMCB 1CR6A 4DLYA 3DMTC 3I6QA 3U19A 2VHTA 2VXOA 3EEIA 2M2IA 2CXRA 1QF7A 4YRJA 2CYAA 2FWIA 3V1TC 3WK8A 4OKIA 1I6WA 2ZT8A 4D8YA 2RB5A 2XQFA 5I4CA 2IS4A 3KHUA 1R4NB 3A6EA 5F7XA 1GYPA 1G8JA 2EARA 4DREA 1U1GA 2AX3A 1Z4LA 2MU1A 3I32A 4GVPA 1BDMA 2IL1A 3BZWA 2HQSA 1NXPA 3LLMA 4UOEA 2Q49A 5IBCA 2EZ4A 2VDNB 1QHXA 2XOKA 2P5TB 1KYXA 1VHQA 1E5TA 3TQCA 2G80A 3UMGA 4NCXA 3NWPA 2COUA 3CKMA 5I8ZA 5C1IA 1KEKA 5K6AC 2TRSB 3LC7O 1T2FA 4U02A 1L1EA 1PBNA 2B1JA 2A5GA 2XQKA 3PUVA 1RZUA 1CW2B 2IKSA 3OESA 4L6CA 1MVNA 4MYUA 3D6VA 1I14A 2FP3A 4HXGA 4LBVA 4E3ZA 4R9VA 4EIWA 3P26A 3PIIA 2ARKA 1A2BA 2I99A 1UOPA 1FK8A 3I09A 4XWOA 3IBCA 1AVTA 1V3VA 1S4MA 3HJHA 4KXUA 5TMDA 4QBGB 2NZ2A 3TFWA 2CMDA 3N6RA 1GPWB 2ZUVA 3PI7A 5CIYA 4HN2A 4TZ0A 2FWRA 3UWSA 4LY6A 3V7WA 4BNLA 3NI2A 2P4EA 2R8EA 1HNXB 4BCCA 4ARBA 2BRUC 3O4FA 3AOEA 4L3VA 1UK6A 5ES3A 3I9OA 2J87A 5BSWA 1CRZA 4YNBA 4YYZA 4NP6A 1YBMA 3KQOA 5TSDA 3A1SA 2WT9A 2QAGA 3I1IA 3PNLA 1JE0A 3HWX1 3ILYA 2KB0A 3DQQA 3A70A 4G26A 2RIPA 1FDSA 2YN0A 1W25A 5E1DA 4BEBA 3DM5A 5LIPA 3NYRA 2KBFA 4K9SA 1H6DA 2XT6A 2IHZA 4ALKA 5BUQA 1VFPA 4GR4A 2Z5LA 1HL3A 2EKQA 2ODPA 4G8CA 2VNSA 3EBPA 1IY0A 1RAFA 4HBGA 4XVQA 3VI4B 3EUFA 4I50A 3ICVA 1C1DB 1QH9A 1GU0A 2EWVA 4X90A 1QK5A 4AP9A 2F9LA 1GADO 2CLEB 3A9WA 3B70A 4TROA 4AO6A 5A9SA 4ZKDA 4CQNA 5KINB 2Y0BA 1FFHA 1JKIA 5FDFA 1UEXC 2YWFA 3PE3A 3GH1A 4OP2A 1QJCA 4FXOA 4YAEA 2IUFA 2OYRA 3C4VA 5J1SB 2NU9A 5FLXA 1V8ZA 2JVJA 4NX2A 4AF6A 4GS5A 1YE3A 4YMUA 2VDQB 3M6AA 2XDQA 2VF2A 1EK5A 1P62B 2AJDA 3K1AA 4EZIA 4EYEA 2G7MC 5KYTA 3N53A 3R3SA 2W6NA 2AQ8A 3K9HA 4ER0A 3K1TA 5AT1A 4A2QA 4GQIA 4WKBA 3LVQE 4FCCA 4I0WB 3EZ9A 4LSZA 1VI2A 3L6EA 4WOJA 2JVIA 1Y4UA 2QXTA 1DB3A 3BSYA 4R2HA 3NRJA 5JYBA 1L7PA 2OFXA 1NW9B 3SZOA 1U3CA 4ZPJA 2JA1A 3ENZA 4NHOA 4WKOA 4DPLA 1U2DA 1VLZA 2F3RA 2EX4A 3CNOA 1DIOB 3DULA 3ZKWA 3KXDA 3I39X 3CJRA 1UZAA 2G9UA 5MFZA 4DTIA 5U4XA 3K20A 3U3MA 4X7PA 5ABPA 4DILA 1PHRA 1VGVA 5C1PA 1E2EA 4M7WA 4RF4A 4DCPA 1NJ1A 3GN1A 4QTUB 4XUCA 1T8WA 4LVUA 1JTFA 1TCUA 1WCXA 4E88A 1ETHA 4DLRA 4YCLA 4WNIA 2X3YA 1BQ4A 2D74A 4KAXA 1F3OA 1BXRA 2ZREA 4KE9A 4L8GA 1AXGA 3E9CA 4EL5A 2ZKLA 2J9ZB 3O0DA 2QVLA 4WZBE 3IR5A 5DBGA 1B2RA 3WA7A 5KYXA 4S1PA 3VPDA 4NVRA 3WRWA 3ZZNA 4TT3A 4J1NA 4Y6QA 4LDZA 5LQKA 4O4JB 4J3JA 2J59A 1V6CA 4R0VA 2GI4A 3R9IA 1OSNA 2PFGA 1D04A 1YACA 3EN0A 521PA 2O6LA 4KYUA 3T7JA 3MMSA 2I2BA 4KN5A 4Y9UA 3DMNA 1Z5VA 1AF4A 2Z83A 4DR2B 1FRNA 2EATA 3LZDA 4HVTA 4LHSA 1C41A 1Z5ZA 3KV1A 3L6DA 4WASA 2JG3A 4IILA 4GYKA 5A06A 4R2MA 5H59A 2HLHA 1ZI9A 4HRYA 5CYPA 5F51A 6CHYA 2IRWA 3ENQA 1J20A 4GPEA 3LDAA 1N5LA 4ZV4A 1CB7A 2QL9A 3BD6A 1GN8A 2PS0A 1JJVA 4I5FA 4O5OA 4IGFA 2I8AA 5EERA 1P45A 4PINA 2JAOA 1V43A 4CM5A 3IT0A 4TKVA 1T9AA 3T7DA 1HK7A 2OSVA 3HJRA 3NOOA 2GPNA 3BL6A 1B42A 2BP7A 4WXMA 3UXYA 1DQRA 3D43A 5D8DA 3DVAA 4V1CB 3O7MA 3MUEA 1J97A 3PNPA 1AKTA 4Z4QA 1N77A 1YRWA 3UB2A 3RWBA 2AFHE 3SEAA 5CURA 3ZXYA 2J41A 4FFVA 4N6NA 4RK6A 1JQEA 4NJMB 2OHJA 4CEIB 2H0RA 4QUJA 3FNRA 1YONA 2JRLA 5GM2A 2E5LB 3ZLBA 1KPHA 2ZB3A 3KTDA 3LPNA 1TCBA 2GXQA 3OZWA 4PYIA 3PNBA 2R9VA 2ZBRA 3FNEA 5B37A 2WHPA 2PL1A 2PNFA 3A1NA 3PXDA 1LH0A 4RVNA 3RVPA 4MLCA 4XD7D 5HKLA 1O4VA 5JBQA 3QKRB 4RLQA 1HYGA 1YZKA 2C7BA 4FEYA 4ZT4A 2BM0A 1U2EA 3AJEA 4FFSA 1ADJA 4LQ4A 3ZJTA 4YAKA 5KHLB 4ZN6A 1RCUA 3SYNA 2IELA 1Q1GA 2QE7D 2R1TB 1DWOA 3U9TA 1OBOA 2FRDA 3PUHA 1W6RA 1PR2A 3CRZA 4COKA 3ZWPA 5JSHA 3IQHX 1KVSA 1G5HA 3KZNA 3W8EA 1D1PA 1NBEA 3NV9A 3QKTA 3C98A 3MRVA 5J2TF 4OU4A 4CLOA 3B9RA 4ENVA 1ZM7A 2CL5A 4JLOA 1E63A 4YASA 1CEQA 4KLRA 4N40A 4L75A 3WIOA 3Q7IA 3ORYA 6ADHA 1WZEA 1XA4A 1K5GA 3SMQA 4P4TA 3MINB 1O96B 5CJJA 4FXPA 5GV8A 4BZXA 3JR3A 3M0EA 1IIBA 4XWAA 1LZKA 1WB4A 4HMPA 3AKYA 4MI3A 4JI4B 4JXZA 3FDJA 2CMKA 2J33A 2PL5A 4HLDA 3O93A 1OZ0A 1TRHA 1M83A 4CXMA 2O3SA 5EE9A 3RSLA 4EELA 2G28A 2JS7A 3UGQA 3UMRA 1HFKA 2C42A 5FBZA 1KEEA 1IULA 1K7EB 1T8YA 2OILA 3QZUA 4UTRA 4Z4IA 1BJTA 4S04A 3ICEA 3A1VA 3VC7A 3WYFA 1P0IA 2AR7A 2ALJA 1EI9A 3KEOA 4C1BA 1ZUWA 1AMOA 5BSEA 1J5EB 3JQBC 1QGUB 3PIRA 5JO9A 3OUTA 4DKXA 4D0RA 4DUPA 4F7WA 1VECA 3FLEA 1ZCJA 4AJ4A 1FLVA 2XOEA 3HKDB 5F52A 4RA6B 3QWHA 4TMKA 4EI2A 3NXKA 2HMTA 4NBVA 4XVCA 1PR3A 1Z0SA 3WKCA 1EFRA 1IUNA 2QLBA 3BWCA 1FNNA 3QVUA 2H1WA 1WUYA 3H5AA 4GC9A 3HXKA 1PX0A 1YV9A 1MDFA 1MX1A 2XTMA 3I9MA 3UK2A 2Y0DA 4M9CA 2AFHB 3IX7A 1Z6GA 4EB3A 2G6TA 3CLRC 2ODBA 2IOYA 4LC9A 5DYGA 5KCZA 3QEKA 1OZFA 3SAJA 2RHHA 5LJIA 2HA3A 1UINA 3G68A 2CHEA 3IKLA 4QEDA 2D6FA 9LDTA 4ZAGA 2FRVA 4ILKA 5E9AA 4Q05A 4F12A 4K1XA 4LXYA 5EP2A 1XTPA 1F38A 1YXMA 1QP7A 3ANXA 1UJ6A 1RLJA 3GQBB 2QRPA 2LIPA 5KYUB 3BJEA 5FTLA 2P9YA 2R7MA 1ZI8A 4RENA 3C41J 1XDBA 3AV0B 1A4RA 1HO3A 1GSAA 1WHSA 2VWPA 3EWNA 4LZPA 2OPHA 2Y1FA 4ZXPA 3TCKA 3WLAA 1Z0ZA 2IY7A 2RJ3A 4L50A 4QECA 3WRXC 2WDPA 2QK4A 3RT7A 4EYOA 3CKKA 4K0RA 1KO1A 4F1KA 1CFJA 5EIBD 4LKOA 3WWOA 1L4LA 1AHIA 1FYVA 3H3FA 3R09A 4HDNA 1DXYA 1U0FA 2E85A 3EYWA 4OJYA 2JFBA 4PGGA 1GCIA 3DLHA 4KAAA 3RFUA 2EIXA 1XPOA 4P54A 4JL8A 4P4LA 5D3ZA 3R7SA 3MCVA 2GRJA 3DZFA 4EHKA 1X42A 5JS8A 1UAAA 1VKHA 1GG9A 2FMXA 3RU9A 2VYNA 1IXRC 3AY6A 2XF2A 1I1QB 1E59A 3AM4A 3H1BA 3UW1A 4MICA 3O21A 4GX2A 1O08A 4ZJUA 3HFJA 5FAXA 4L4UA 2JGNA 1KI6A 3LDUA 1R0RE 4FX2A 4XTCS 3WGLA 1OZHA 2XLCA 3PFIA 1V1MB 2O5EA 2REQA 3KZXA 4PNPA 3E48A 3RTGA 2GBFA 3BMNB 3Q8MA 2QT1A 4R0MA 1YFKA 4RS4A 3RG8A 3K0HA 1EHCA 1WUTA 3CN9A 4AKIA 3AC0A 3DXZA 5DTRA 1JLMA 3A4LA 5HTKA 3NQ41 4QUBA 1A9TA 1BNCA 2JGRA 3WAKA 1EK0A 1RLIA 5ALRA 4BNVA 1I2BA 4EFKA 1P61B 1QXSA 3DKPA 3WAGA 4MLDA 4G63A 1TJYA 1ZOSA 2BLNA 4XYLA 3B5EA 5YASA 4TV9B 1X9GA 4FWIB 3GLHE 3OLZA 2AYZA 3GPCA 4Y2QA 5CNIA 1MH9A 1E9EA 1A5AB 1EXNA 2FOXA 2HSDA 4JOQA 1NKSA 1OFHA 3ZHCA 2R8PA 4ZYLA 1PWYE 4NULA 2C54A 5FL3A 2E4YA 2HDOA 1E77A 1OXMA 3RBXA 4I55B 3E7FA 1DP4A 4TPKA 2J31A 4PBRA 2VAVA 3RR2A 1PZGA 3B3JA 3BIJA 3CRVA 2D5AA 2AMFA 2G4CA 4IHKA 4ZCRA 4RW0A 1TYBE 4MKIA 2VXBA 4AG3A 1A7UA 4EPYA 1JQBA 4P3PA 4BVAA 3EXHA 2FHSA 3NGMA 4HDSA 3TKAA 5JWOA 3VX4A 2OQ2A 1P91A 3CSSA 5CRIA 5KX5A 4EO7A 4C2TA 1PFWA 4EX7A 1M1YB 2VPQA 1HGXA 1JEYB 4PX5A 4WADA 4HN4B 1M2VA 3FNIA 3KV3O 1PL8A 2VPPA 4JI1B 1UXKA 3RTAA 4EP1A 4FFLA 5FOUA 1JL3A 2GM5A 4MITA 1L1QA 2EBFX 2G83A 4E7OA 3U09A 4MK4A 4DA0A 3BRCA 4E5MA 4FDAA 1BA3A 3AX6A 1TKCA 2AG5A 2WPDD 4PYLA 5DNDA 1FS5A 3P0RA 3FPGA 5ERYA 2GPAA 4JR2A 2ZAOA 3K0CA 3QU9A 3B36A 1HURA 1VE3A 4NR0A 3CZAA 1PZEA 1UP7A 4AMZA 5KVCA 1IN8A 3A0UA 4WZAE 2J5KA 3PT9A 2A9RA 4KLZA 4DIEA 1MP0A 1GUYA 4LISA 4EM6A 4FN5A 4GPAA 3QVMA 4N8DA 2D7CA 4QPPA 5EMKA 3KVYA 2PXXA 3ZX5A 2VYCA 4DYVA 5IVKA 2N1MA 1RWBA 1X14A 2H5EA 1KYQA 4PCAA 3ZIDA 1SH7A 2RDMA 2A0XA 4RV9A 3H3JA 1NUAA 4NZNA 3IP5A 3B1WA 4XI9A 2J3IA 4RH0A 3GLTA 3GNSA 4WVFA 4XWYA 4B31A 1LVUA 4D9BA 2R85A 5LYJB 1UBFA 2Q45A 2DPHA 3F9CA 2E1RA 3HQ4O 1WKCA 2OA0A 2E4UA 2MSEB 2VTBB 2VBFA 1Z45A 4BP8A 1M0SA 4GLBA 1A82A 2FR8A 1MB4A 2WG2A 2GZ1A 2IXTA 4ARVA 5K8JB 4IEEA 3L8HA 1YDHA 1J2RA 7GPBA 2P2GA 4OKNA 1E2GA 1RD4A 1QPGA 1C1XB 2B25A 4PHFA 3SZUA 3SDSA 4XIJA 4NAHA 1AZTA 1RQNA 3GLQA 3GLHB 3HYCA 3KDAA 4QC2A 3TSWA 4A7PA 1BO6A 1YIOA 5KIAA 3RVLA 1SY7A 3PC3A 4IWNA 3ZBTA 4YMTA 2IIVA 2O8DB 4XFDA 3A6LA 4DGQA 1LV8A 5JIBA 4FP9A 3IVMA 3FVRA 1M1UA 3K0AA 3U80A 2GS9A 1KMHB 3DOCA 3EVEA 3JRXA 3VHLB 3AFOA 3VYUB 1OWPA 2Q5HA 4CE6A 2ZSJA 4KP7A 1DAIA 4LSGA 1OY1A 4RD4A 2R7AA 2FJ0A 5AQ1A 3LUGA 3BGIA 1GNRA 4GWLA 1JDVA 1N3YA 2PT7A 5ARCA 4EJMA 1SQSA 1IOWA 1DV1A 1X7XA 2P2CA 2XCUA 4IINA 5B36A 1RCTE 2Y9MB 3OJCA 5JS7A 1L1RA 1UMDA 1V5FA 2I6QA 1NE7A 4NZ9A 2HMAA 4RHTA 3AGPA 4F4UA 4YFVA 1PZFA 1E0SA 4KPUA 4LBWA 1SEPA 4LHEA 5LQRA 2GAOA 5CW2A 3NTOA 2NV0A 1VRVA 1N2OA 1UT5A 4UHJA 1ZM2A 3ICWA 3BICA 2CWWA 4REQB 4FILA 2PRIA 3IRVA 3KOYA 1ZCAA 3OX3A 1ZU4A 4BS9A 3NFYA 2IPXA 5HF5A 1NLUA 3W5UA 1RXVA 1CUAA 2FN4A 4XB1A 3IDSA 1KFEB 1CUGA 2VDVE 2W2MA 3LHIA 5FLKA 4C4AA 2W11A 1N33B 4JBNA 4QPCA 5LP6C 1L9XA 2ZZMA 1F8GA 1R0ZA 1ZAYA 2AG6A 3SXUA 4CM6A 4DLWA 5B6IA 2C7PA 1SXPA 2FW0A 5CA1A 4JC8A 4NFLA 1F2VA 1S1CA 1MEOA 1Q16A 4QTXA 4I81A 1O95C 3F98A 4PQYA 4PN7A 1Z13A 3ZN2A 1W0CA 1A50B 1OIVA 4UUNA 4H31A 1O57A 2B20A 5JT1A 2XB8A 2IXDA 3ETDA 3AI7A 2QG6A 2R8YA 1UQTA 3U1VA 3D4OA 4TLLB 3VH2A 2WJYA 4JEMA 4OK3A 4DV0B 3W4IA 3OM0A 2P6MA 5K4AA 3ZTYA 1U6JA 3UXEA 1R0BA 3KALA 3IJEB 1W5FA 3N7AA 2BEWA 5SYNA 3RS4A 1P5RA 5JC8A 3CPSA 3K5HA 1LI4A 1VCMA 3WJAA 2ZRJA 4F0JA 2J45A 1NW5A 3CVJA 3K30A 2JFXA 4GMKA 3EVNA 1OI7A 3NUGA 4Q9HA 1NUQA 3NATA 2OK7A 2ZYRA 4XAQA 5EP3A 1RI1A 5JMOA 4FZJA 4JT8A 1V9LA 4FYMA 2DBYA 3FE2A 2NO4A 5G02A 3TRIA 4UCQA 1NW6A 1OLSB 4QARA 4EW3A 1XEXB 4U39A 1GNLA 2N1BA 1VJ1A 2FPPB 4ZPXA 4RIHA 1TE2A 3KKPA 1U31A 4TGLA 4IIJB 3KT8A 4L5CA 2EF1A 4MROA 1EINA 4XX0A 3OUZA 4YRLA 3SIWA 3DG9A 3ETEA 3FOBA 1LY1A 3CB2A 1ZIPA 3K94A 5KTTA 3BJIC 3EUWA 3L93A 4P3KA 4B6SA 4O8CA 3PGMA 4W5WA 2BC9A 5TEWA 2DPGA 2E6KA 4PS1A 1IXKA 3LT1A 2JI8A 5FUWA 3RTCA 4EUNA 2IYOA 2UXCB 4KXFB 4OH7A 1T4MA 1NW3A 2QS9A 1VZ2A 1L8LA 1IB0A 4OQEA 3SQOA 5D5HA 1UC4B 3Q9UA 4R8RA 1QFMA 2IHBA 4NBTA 4BO7A 1HXHA 1TVMA 2JGEA 3BIWA 4XLZA 4D79A 2PQ6A 3EJ6A 3E2PA 1OAOA 4EF6A 4BEVA 5ITZB 5DM0A 1XFDA 2H29A 5ENZA 4C6SA 3N59A 3E4CA 5AVRA 4ZC1A 2WE7A 1EWQA 3P5BA 1KYTA 4JVSB