2X3YA

Crystal structure of gmha from burkholderia pseudomallei
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
202
structure length
202
Chain Sequence
ENLYFQSMENRELTYITNSIAEAQRVMAAMLADERLLATVRKVADACIASIAQGGKVLLAGNGGSAADAQHIAGEFVSRFAFDRPGLPAVALTTDTSILTAIGNDYGYEKLFSRQVQALGNEGDVLIGYSTSGKSPNILAAFREAKAKGMTCVGFTGNRGGEMRELCDLLLEVPSADTPKIQEGHLVLGHIVCGLVEHSIFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOHEPTOSE ISOMERASE
publication title The Structure of Sedoheptulose-7-Phosphate Isomerase from Burkholderia Pseudomallei Reveals a Zinc Binding Site at the Heart of the Active Site.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Isomerase
total genus 83
structure length 202
sequence length 202
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 5.3.1.28: D-sedoheptulose 7-phosphate isomerase.
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13580 SIS_2 SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2x3yA00
3JAMA 2PGIA 4JV5B 1Q50A 4LZJA 2UUAB 4DV6B 4JI3B 4X66B 4EM6A 4LFCB 4YHHB 3QKIA 1NRIA 1U0FA 3JX9A 2E5FA 4JI6B 5IT9A 4X62B 4LF7B 1HNXB 2DECA 1JEOA 1MORA 3LJKA 2CXOA 3T1HB 5FLXA 4LFAB 4LF4B 2CXPA 2CXRA 1TZBA 5LL6P 2O2CA 4NXMB 4GKKB 4KHPB 2UUBB 1HR0B 2I2WA 1X94A 1N8TA 4NXNB 3IFSA 4JI7B 2F4VB 3J81A 4LF5B 2ZJ3A 2XHZA 1FJGB 1IBKB 4B3TB 4DV1B 3J7AC 4IVNA 2XBLA 3G68A 4DV4B 3I0ZA 4JI1B 5BR8B 4DUYB 4TOIA 1XNRB 1U0EA 3CVJA 5I01A 4LF6B 4OX9B 3FXAA 1C7QA 2I22A 1IBMB 3EUAA 4B3SB 1GZVA 1HNWB 1MOQA 1N32B 1DQRA 2UXCB 4B3MB 2O2DA 1IRIA 1N34B 3UJHA 3KNZA 4LF8B 4AMVA 2HHHB 3NBUA 4JI8B 2CXSA 3OTOB 3HBAA 3OOJA 3J80A 1XNQB 2VF5X 3M5PA 1N36B 4DR4B 1N33B 3Q7IA 3HJBA 4GKJB 4LFBB 2VQEB 2PUVA 1KOJA 1HM5A 2CVPA 4U6NA 4X65B 4DR6B 1XMOB 1ZZGA 1XTBA 1JLHA 1NUHA 3BJZA 2UU9B 1M3SA 1U0GA 2E5LB 3TRJA 1X92A 4M0DA 2CB0A 4JI5B 4DV0B 1IATA 4JI0B 1J5XA 1TZCA 5A2QA 3FF1A 2Q8NA 1GZDA 1G98A 5BY2A 4JI2B 4DV3B 3C3JA 3ETNA 4DR5B 1T10A 4JI4B 4DR1B 2V4MA 2YVAA 4X64B 1X9HA 1MOSA 4DR7B 3PR3A 2UXDB 3FJ1A 4YY3B 2WU8A 1I94B 1X9IA 4S1WA 4K0KB 2CXTA 4B3RB 5LMNB 2VF4X 1XMQB 1B0ZA 1VIMA 2A3NA 4AQYB 1VI5A 2X3YA 2J6HA 1TK9A 2CXUA 1WIWA 3TBFA 2VQFB 2UUCB 4DV2B 2CXNA 3FKJA 1VIVA 4LF9B 5LMUB 4DR2B 5IWAB 2ZM6B 3BCHA 1HOXA 2CXQA 1HNZB 2AMLA 3Q88A 2DF8A 1J5EB 2PUTA 1C7RA 3ODPA 3T1YB 1JXAA 1JIQA 3SHOA 4JYAB 2UXBB 1IBLB 2PUWA 4DV5B 1VI6A 2ZJ4A 4DR3B 4DUZB 4DV7B 4S12A 2POCA
chains in the Genus database with same CATH superfamily
5IK2D 5ISMA 1WOMA 3OUUA 4L3OA 2Q2WA 1KYQA 4IGFA 4IVRA 4JVLA 3ES9A 1OB2A 2X7HA 2A94A 5K0ZA 4LXQA 1A9XA 2WMDA 1NSTA 1MCZA 2VEOA 5TQ2A 3O4IA 5G4LA 4BQRA 4UOQA 3C3BA 3VTZA 1J2RA 1ZUHA 6CHYA 4RMGA 3ABSB 5DGDA 2RDMA 1WF6A 3F98A 2E87A 3VUEA 5LJIA 1HMYA 1T9BA 2ZI5A 3WIBA 1XQYA 4G5GA 3A3YA 1WQ1R 2IIVA 2XMSA 2W6QA 4ARZA 3AY6A 1XA4A 4QOSA 3VV3A 2HN9A 1E69A 1EFUA 3NNSA 5FWAA 3LVQE 4MQLA 5EFOA 4HQKA 4N9WA 5LVAA 4EQ6A 1TU0A 1U0RA 4U3JB 4DUYB 3IP5A 4R7GA 1GUAA 3U1TA 1T8TA 3ROQA 3B1FA 1SUEA 3SXJA 3TMKA 3OZDA 4QBKA 4L8LA 5DM1A 3UAZA 4HXGA 4BO5A 1N5OX 3F8WA 1Y5LA 2YJNA 4QOJA 1O95A 2OP1A 1IHPA 1Z4PX 1E0AA 1GFSA 3QG5A 2OCXA 5I7WA 4M0KA 3PDUA 2CXSA 4R2HA 2A0XA 2QMZA 1SPXA 1UJ5A 5AW1A 1U04A 4NV0A 2X19A 5FYDA 4BBAA 5ES3A 3L7LA 3RSOA 4NOKA 3GZ4A 4AICA 3HSYA 1DDOA 3AF3A 4X20B 1E66A 1TT5A 4LGYA 3PL1A 4QIHA 2QV0A 1YJCA 4EO9A 3V7FA 1Z35A 2WFZA 2VRCD 2XECA 3MRXA 3C3PA 3STWA 2Z2JA 4F96A 4HWTA 2HWUA 1RWPA 2OB1A 3T4EA 1GTMA 3EDMA 2JJ8A 2FN3A 1G0NA 2YCBA 3KQWA 2ZUTA 1V95A 3VR1A 2XXJA 4LOKA 1NWHA 1Y9EA 3Q2KA 2VWHA 3MMSA 2F7SA 4CKXA 1JDSA 4QD3A 2GNOA 2AYYA 3CPSA 3E9YA 3FD8A 4R8SA 3I3OA 1Z34A 3LPAA 3CW9A 3MLEA 4DCGA 4UOEA 3RJMA 3NC1C 2ZIXB 2IPMA 2BM0A 3QKTA 3PXCX 3G82C 2W2MA 6GPBA 3BWMA 4XSGA 4C2BA 1IN5A 2QN8A 2GN8A 1LDGA 1CHNA 1JXQA 4QPCA 3TZHA 2NVOA 3LT4A 3W4IA 4B7ZA 1CETA 3TZKA 1XDBA 1UAAA 4NJMB 1U2PA 4QARA 4K3UA 3GJ4A 3I4LA 5AR1A 3VVMA 1TRHA 4YAUA 2PGXA 5MN4A 1IH8A 4WNIA 1IUOA 3AFIA 3FNGA 3T9AA 4W4TA 2WTUA 3RRMA 1PLKA 1Q15A 1PR5A 1RJEA 1JPNA 3H2KA 3SIWA 1N0UA 2OP0A 1WV1A 5LNK1 3N0WA 2C7BA 3PXUA 3B53X 3I4CA 4QXQA 3QSYA 1TE2A 5FRDA 2G07A 3O4FA 3R23A 5HJ5A 3IB6A 3PLNA 4XLTA 2EBHX 2WP0A 4JMLA 1SEVA 3BICA 4F84A 1OKKD 4IIGA 1XSEA 4EA6A 5TEVA 4DIOA 4JLKA 2PVSA 5L95A 3I1IA 3NHSA 4YDRA 5B1EA 1XMSA 3IVCA 5JS7A 3DBHA 4RZXA 4IX9A 3QEBZ 4E4TA 3WOVA 4CQMD 1ZVJA 4AN0A 4NAHA 1GQ2A 3HN7A 4ZI5A 3OOYA 1QJ4A 2A59A 2GASA 2GJAA 4XGRA 1YHNA 4MRVA 5B4TA 4R16A 4HAYA 1EZZA 3K2EA 4WXPA 4MS1A 4RY0A 4GGOA 4YK7A 5L7TA 1P4SA 1TCVA 2NO0A 1XP8A 2R5FA 2UYYA 2BGWA 1JZQA 3SEFA 2WY2D 3HMQA 3EW7A 1ISGA 1TB4A 4WZAA 1EA5A 2XQKA 4EHNA 4EW1A 5LZ2A 5C53B 2I6TA 2PBRA 1YR6A 3PDWA 1VG0B 2KLBA 3WKCA 2VS1A 1K88A 1ISIA 4I50F 3PX3A 3RVPA 2WWXA 3R1IA 5JLJA 5ED4A 1G20E 3O0TA 3W7BA 4TM8A 4AS1A 4I5GA 5TGZA 1R9MA 5EWMB 3CURA 5A4FS 2O5RA 4GMFA 4NE9A 3SJ7A 2Y1CA 3DDWA 4EECA 2SBTA 2D2IA 3GRKA 4C01A 2IYVA 3VNSA 3PD0A 3V8EA 3QUTA 1DKPA 3GJXC 2O2DA 1JR4A 3AMVA 4Y30A 2E85A 2MR6A 2WAYA 4D4GA 1UOPA 4WL0A 4KQ2A 5ALSA 1ZQ1A 2XXAB 1Q44A 3EVEA 3B3QA 4ZICA 3ENWA 5EN4A 4EI7A 1CUXA 2G6TA 2LKCA 2QVLA 1WZNA 4KNVA 3T7AA 3PEEA 1MXHA 2O57A 4PZCA 1TCBA 2GN0A 2I8LA 1CHDA 3IT0A 4C9BA 2O7NA 5E3HA 3ZI7A 1WWKA 4EA7A 2P9ZA 3OMLA 4G85A 4NQRA 4B6EA 1E92A 3MEQA 1PWXA 1VZ3A 4KNWA 2NVUB 1I2BA 1DAGA 2GHTA 3IALA 5IJ9A 1T36A 2OKCA 4UQPA 2YHIB 1NIPA 2EEPA 3K2BA 3OVMA 5K8LA 3TZLA 3L84A 3L1IA 1KQGA 5JG7A 4DILA 1M8KA 3IUJA 5E9QA 3LWNA 3NBAA 6LDHA 4JI0B 2P4EA 3NHZA 1JHMA 3QU4A 3L7MA 3PUJA 5CDSA 2QTLA 1K97A 2I6XA 1DEHA 4PONA 2HA0A 1WXGA 3K4PA 1DEXA 3TN7A 1SIUA 3KVVA 3J7TA 5JFGA 3JQFA 3PGJA 4YP0A 1DC4A 1V1MA 4FR5A 3GFQA 4OQEA 4XWGA 3NC4A 2AOUA 1SCUB 4PSCA 2PFGA 2A86A 4MKZA 3ECSA 5C51B 3A4IA 1GZ3A 3FUXA 3L6EA 4WCFC 4ZJUA 3I9V6 2GTIA 3GNLA 4HWKA 2PY6A 3QEMB 4ARVA 4XM2A 3O2QB 3BIXA 4DOMA 3MB8A 3ZQ6A 4A0GA 1N7GA 4LMPA 2O59A 2IDZA 1LA2A 2FVXA 5KVAA 3ZQUA 4GUDA 1I6KA 4LYEA 5AXCA 3ZY2A 2VXYA 2F9FA 4G0MA 5HZMA 1JH9A 3OSUA 4Y18A 1RYBA 1Y4DE 2FPGA 3AHEA 4X3PA 1HYBA 4XD7D 3UB2A 4CLXA 3KZXA 1HE3A 4Y0AA 4D3YA 4DC9A 5I4IA 2FP3A 4BCBA 3CVXA 1IULA 2J6CA 3N2NA 4MDYA 1T4GA 1MG5A 4D98A 3VO8A 5AI6A 4H77A 1P2GA 3G8YA 2NSDA 3C6KA 3R7NA 3GP8A 4AZSA 1G38A 2YJZA 3C41J 4HY3A 3UMYA 4U7TB 4KQKA 5HEKA 2O8BA 4CUJA 3K05A 1IM5A 5BV7A 1OB5A 4H7IA 4C08A 4IWXA 4O3MA 1H2YA 1XTIA 3BTUA 3ZV4A 5JSHA 4BV8A 4D82A 5I7AA 1CB7A 4D8YA 2ZJOA 4Y98A 4BJ5A 1P5RA 1SURA 4DA6A 5KTYA 1DC5A 1J1ZA 3JVEA 1DO8A 5FO0A 4NBUA 4JVSB 4MAMA 3CW2A 3T6KA 4JLBA 4J1TA 2C4VA 4XQGA 1E3TA 2Q5IA 4GQIA 4HDNA 2PZAA 1QCCA 4GKKB 1VJRA 3HGQA 3TKAA 3W4JA 3UB3A 5JNSA 2Y92A 2YQZA 4OGKA 3KZCA 4G07A 1BJRE 5EIOA 3U3XA 3OZFA 1PJ3A 2XRMA 3L6CA 5DXAA 3GEGA 1KZ6A 3TKLA 1U1DA 1Z6TA 3OIFA 3AIMA 1LWOA 1SU6A 1L1RA 1MAVA 1RBQA 1UMKA 2NXCA 2FPPA 1SVUA 2O2SA 4BBZA 3PQDA 5C0OE 3PXXA 1LNZA 4I1RA 2YVKA 5DYIA 1FYWA 3GGOA 5JDIA 3OPYB 2QORA 3GRCA 1Y9DA 1ZH6A 3IJEB 5FA8A 1STOA 4NC9A 1KR5A 4B81A 3E9DA 1T0UA 1HPLA 2P90A 2I7CA 2ZS9A 4GAEA 4DRXB 1YHYA 4XYBA 3G0OA 1FP7A 2ZVPX 1U94A 4X54A 4BGIA 1D0VA 1VPWA 1AK9A 4PHCA 3D6TB 2ZBUA 2JHGA 4D3XA 4DLWA 2FPIA 1Q2UA 3CKKA 4YCDA 5EE3A 5FOSA 5LBUA 1NF2A 1WO8A 4MQ4A 2NLOA 2XCOA 3A27A 4R7ZA 2OZPA 3NETA 2H59A 5CJPA 4FOSA 1EG7A 2VHZA 4EI2A 2AG8A 1JEDA 3EXFA 1KYWA 2A9RA 2FHSA 3KE9A 3ZH2A 1Y8ZA 2XYPA 1DSSG 2WOJA 4PAMA 2O0JA 4RWZA 3ZWQA 1ULTA 4YXWA 1BSVA 4BVAA 3OZXA 3JQAA 3DOCA 1BRMA 3K1TA 2F3PA 2C7GA 1EFDN 5LA6F 4Y6PA 3BXXA 3WTBA 4CEIB 3W8RA 1SZDA 5ILQA 1KEVA 2DQKA 2IPAB 3HDVA 2H65A 4MPPA 3F9CA 5BY2A 2FQWA 1JQEA 5JZMA 1NXQA 5IFLA 4D42A 1EP3B 5JC1A 2GTHA 3HKEA 4NICA 1NVTA 3FDJA 1N2GA 3ACDA 4FLFA 3LOPA 2BMFA 1JUDA 1KI7A 1SQ0A 3ZLJA 3SLKA 3BL6A 1CEXA 3S2GA 3B5JA 1P18A 2AXEA 5CNIA 2V6MA 3RJZA 2JVJA 1J5PA 3UB4A 1C8BA 4A2CA 4L95C 3PCRB 1AXRA 3P97A 5CJJA 3RFVA 1NI4A 3BXHA 4INAA 2PCJA 4P83A 3DEAA 1NU6A 3V48A 1BN6A 2VDRB 3B12A 4M76B 1NZDA 2CXQA 3CSUA 2ZBPA 4UW9A 2XKBA 1A8HA 1NP3A 5HIAA 3CZCA 2QPOA 4A8JB 4L5BA 2ZG6A 4YR9A 2FRVA 4KDEA 4NNPA 1K3UB 1Q95A 2NQ8A 4MV9A 3KC2A 1RAAA 2GK3A 2I4OA 2P1RA 3CCFA 4HN9A 1GQSA 3RE1A 3TL6A 1N1MA 1R9GA 2OXEA 2EKLA 3GELA 1TZJA 1N5KA 1OX6A 2V54A 4OHRA 5D3QA 5AKGA 4C4YA 1VHQA 2OAEA 1JJ7A 1X19A 3IA2A 5TQVA 5EJ8A 3Q1LA 2Z09A 1SKMA 1TIKA 1Z3IX 1CD5A 3A9WA 1P7WA 2AOXA 4L22A 1MORA 1OFGA 2QTWB 2CHEA 3A2MA 1U63A 3U4IA 4Q4AB 1U02A 1D6MA 1NRXA 3N6VA 5EQDA 1I5EA 2EDCA 3NLLA 2P9GA 3S4YA 2P2LA 1GG2A 1XZIA 2OQIA 1Y7IA 1X3SA 2Y0CA 3Q5GA 3JD2A 4HB0A 4UVHA 3C5EA 3TLBA 3VVLA 2RK6A 4D8VA 2K2WA 3L41A 4OXXA 4M0MA 4R1NA 4FJ1A 4H7JA 1C9DB 1QYDA 3JARA 2HQ1A 5BOVA 3OZEA 1E2HA 2Z8YM 3GA7A 2VQ6A 1C30A 1F9EA 4OGLA 3DLBA 1ZIPA 2FPRA 2MHCA 4P2GA 4ZAXA 1MZVA 4HNRA 3S7ZA 1PK8A 3TVTA 3EVGA 3IAEA 4CL8A 1XL0A 4CT0A 2GXUA 3QE0A 3TTVA 1YBVA 4B2LA 3EWAA 1V2GA 2JIZD 1RIFA 3CE6A 3TGLA 3E53A 1JEEA 1E1QA 1SBQA 1IJFA 4W8GA 3FR7A 4V38A 2QTTA 1DLJA 4GVPA 2IZ7A 4WY5A 3LXUX 3KXKA 3PLAE 4JYCA 2KM1A 4R9NA 2GYUA 1P2FA 1I1NA 2GCNA 1XALA 5DLDA 4BVLA 3TVYA 2XVYA 3Q9UA 3LUHA 4HBZA 4QVKA 1ZBQA 1NOIA 3LRXA 4HUQA 4XRRA 5T3YA 3TUJC 4EG4A 2L2QA 3D31A 4AZ0B 3THSA 1EQ2A 1I0ZA 1Z06A 1X70A 3ZGXA 4KPFC 2X1LA 1ZUIA 4MVCA 1Y4SA 3ZDQA 4F71A 1UBCA 1D1PA 3HR4A 4DYHA 1QOZA 4IDOA 4C2AA 2RGAA 3HJCA 3P0EA 5EIAA 1W44A 3MIZA 2Q4OA 1QHFA 2SKDA 4D9HA 4E21A 3UZUA 3ZGYA 1QFSA 1V8FA 3ED5A 2IYOA 4X1YA 4RK5A 2NU8A 1QV9A 2HO5A 3ADOA 1MBZA 5IW8A 1FNSA 1HYEA 2EFCB 2WTNA 4UBJA 3CV3A 4KSCA 5IKEA 1C0PA 1KC3A 3FF1A 1OTXA 2ZBRA 4IRUB 2WWYA 1N78A 1G98A 3G8AA 2VZLA 3V8VA 4DHEA 3BE6A 4FGSA 4WNCA 2QR3A 2WSSD 3OE5A 2HWKA 1WUTA 3C8ZA 3F7NA 2IHTA 1SGWA 1TADA 1XU4A 3V2IA 4A92A 5BSHA 2AZMA 1E3JA 2NAPA 1H5QA 2OK7A 3WXMA 5EJEA 5KNLA 4AS2A 1VLMA 2ZS7A 4IDPA 4I66A 3ZZUA 1F5SA 1SBHA 1X13A 2MIIA 4F3TA 2NTEA 5EEHA 3MGBA 3NYRA 3QENA 1OXVA 4QUGA 1Z4KA 1FRZA 3WK4A 4X93A 2FR1A 1NQ5A 1R0SA 2MYTA 2XMGA 2FR8C 2ZOSA 3ROPA 1Y82A 4CW7A 2CD7A 4L8VA 2R87A 3R9IA 3EAGA 1M34A 1UBNA 2MYPA 4ILKA 4UKDA 4JYZA 2G28A 5KI6A 4PGFA 1MPTA 1RKQA 4MINA 2IUUA 1EX6A 2ZE7A 3UHOA 4AMGA 3NRJA 5E1BA 4C89A 3T41A 1WUKS 4I81A 4TS1A 4TXMA 4BNLA 1I6LA 2DH5A 4BVFA 1YCGA 2V9CA 4DDWA 1U8EA 1QH8A 1TUEA 5GOTA 3STXA 2BTQA 3AVWA 1H5NA 1T8RA 2ES4A 1A1SA 1XU9A 1G5RA 5ELLA 4RA9B 4NZMA 4PU0A 1Y6ZA 5DM0A 1L8AA 3W9YA 1EDDA 3P9IA 2GBLA 4DV6B 1N9ZA 2WC1A 1NBMA 1GGMA 2QQFA 5AW9A 3JX9A 3VZSA 4CN8A 1PDWA 4QQFA 4X62B 1MXFA 1CEYA 3P5BA 1U9ZA 2ECPA 3GGGA 5CVVA 3DNFA 1LUAA 4YYEA 1SA0A 4FOOA 2OOKA 2X40A 2VAVA 4D99A 1J6UA 3FLEA 3K9NA 5GJVC 1U65A 2HK9A 3A37A 4NBNA 1SKUA 3A6DA 4UBLA 1K0FA 1PLJA 1EAYA 3OD5A 1CX9B 2EJVA 1M0EA 1RLOA 4F5YA 5JQGA 3D5EA 1JVBA 5J2UF 3MSXA 3UWOA 3IAAA 3DMTC 4KRFA 2QX6A 5EE9A 3WX0A 4KBGA 1P60A 4OLFA 3ZNNA 5KWIA 1ORDA 5G40A 4HLUC 4JOQA 1F2DA 3MOSA 3WMFA 4M9QA 1P39A 1YTLA 2HLDD 3KR9A 4LHEA 1QTNA 2REQA 4PYNA 5TRTA 4EKEA 3M5CA 4QSMA 1V7QA 3A1TA 1MO5A 4QBIA 5HKBA 5GWXA 3W7VA 3U5ZB 3SZOA 3QOFA 3ND5A 2DBYA 4CDGA 1FQKA 5EQTA 4YBRA 1E60A 4QWWA 4Q9HA 4BUZA 4EUFA 3ANNA 3NTRA 3O8OA 3QYPA 1NXOA 4O2RA 1WXHA 2W11A 3OEHD 4MV5A 4NNJA 5D1HA 2E2WA 3T38A 4IXTA 1RRCA 4DA4A 1EWYA 2WE7A 1E7QA 3CMCO 3GEEA 3ILVA 1M54A 4IHAA 4IWYA 4ESEA 1HSZA 1FK8A 3VR6A 2C1EA 5HKOA 5DX8A 1CZNA 3KQVA 1NFRA 3BSWA 4CFZA 3PE3A 1L5NA 1X1AA 5TMBA 3ZGOA 3KIPA 4AJ2A 3M6XA 1V5IA 2TMYA 4NCHA 4OBWA 3NKVA 1B73A 4X8MA 1CEQA 1LWNA 1R8JA 4FXPA 2BH9A 1SC1A 1SHUX 4JDPA 3DMRA 3OZCA 4HQOA 1SXJA 4IS3A 3QX9A 4UVGA 4EAAA 1C9YA 2VWQA 1TF2A 5H0IA 4LYDA 3WBKA 1DZIA 3WV5A 3QELA 2HBZA 5DBFA 2OD2A 6REQB 4V2UA 4L16A 4D46A 1RAHA 1P62B 4X90A 3UK2A 2BY4A 1YB4A 2PXHA 2X77A 4PRLA 1BWSA 2YWRA 5JY6A 1EUZA 2IXGA 4H4CA 4PHGA 4TN5A 4JQYA 1VLZA 2DMRA 2JLQA 3NCTA 4NNOA 4MDHA 1E0KA 2B1JA 1PR6A 4MV3A 5AVQA 3V4ZA 3FHLA 3DC7A 1FFXA 1R0KA 4KAFA 1E2EA 1KFBB 2OCDA 1IZZA 1E9SA 3A1FA 1Z0JA 3KKQA 3NTQA 1PTKA 3FYDA 4FZ5A 4ZHQA 4DANA 1P7YA 4ZEXA 3AZOA 3R5HA 3HBJA 3RABA 2YRFA 3ODPA 1JIQA 4JB3A 3DBLB 1JYEA 1NJ2A 4NCJA 1BA3A 1RRMA 4N5LA 4TX1A 5K0FA 1YBMA 1W85A 2YHAA 3GJZA 3GH3A 4E11A 3U16A 2AIRA 4MKFA 3ESZA 3S68A 3ZXXA 4KU4A 3VSCA 4QEDA 3RRYA 4F56A 3F8SA 5HJEA 2XKJE 3PXDA 3B1WA 3L8HA 3LDGA 3T5DA 1X87A 5AIAA 3TR6A 1FTQA 3EPPA 3P2OA 1FUYB 4LPSA 4OFBA 4PSKA 4DM3A 5U4QA 4KO4S 2FXIA 3OQBA 3GWZA 3QUQA 2ZSJA 2B78A 2JD0A 1X77A 2LCQA 4QNMA 1T5SA 1PJSA 5LIRA 4MULA 2ONZA 1YCDA 4DUGA 5M5BA 2Z4SA 1R0BA 2NZUG 3M6FA 2PL1A 3R3JA 3QFTA 4D5EA 5I9LA 2H1CA 3ETCA 1WX1A 1JW9B 2VYVA 4CG1A 4Q1CA 2JIMA 3T7CA 5BYAA 5FYQA 4YRAA 2C7QA 1W25A 4EZEA 3UGTA 2ZVDA 1NL3A 1CY8A 3MMZA 4BMPB 4D6PA 4X7BA 2PJUA 4W82A 3M7IA 3WL8A 4KQHA 4QVGA 3STUA 3JXEA 3W90A 2O5EA 1Z8FA 1ECCA 3HCFA 4TTQA 3UJ9A 2B7BA 1QUFA 1U4NA 3HDYA 4WCVA 1IK4A 1BS9A 3ESDA 1X7ZA 4INOA 3D6MA 1BE8A 4O4JA 1DINA 3V33A 4JELA 2HBYA 2BRUC 3OP1A 3KETA 4YRPA 2WKQA 5AIBA 3H2GA 1CF4A 3THWA 4FE7A 3TD6A 5D5PA 5HK9A 4LPKA 1ULSA 1KAQA 3I09A 3L5KA 2H63A 2VIIA 3VSAA 4CM8B 1GGHA 1JFFB 2RKWA 3FETA 5EZQA 5FWXA 1Y80A 2PWYA 5EE1A 3LL4A 4K6OA 3ROZA 2PFKA 2PIAA 3CX7A 1GG8A 4MVJD 3U3JA 4AFNA 1THMA 3HKDA 1AGXA 4UEKA 4P36A 2FWMX 1GLNA 3IHLA 3LFTA 3SEQA 5DNUA 5KINB 4MWOA 2VOEA 5E3IA 2PUBA 3LO5A 1S2MA 1HG1A 1Q74A 1HT2E 3GQVA 1EHYA 4M0DA 1MUUA 4L4YA 5GM2A 4HWOA 3L7IA 5BSFA 1DCKA 1K7XB 3DNPA 4R8LA 3L0ZA 4ZVKA 5F33A 1F2UA 4A0SA 4AZVA 1U8ZA 1XQ6A 3MTDA 3BSSA 2BTOA 3F3SA 3FJOA 3M6VA 4L02A 3H5TA 3T15A 1J8MF 3EVDA 1H2ZA 1S5PA 1CUHA 1NPYA 1UEJA 2RHCA 3JQ9A 3LCUA 3QLVC 2PMEA 1IQUA 3PQ4A 1JDUA 1SCBA 4KMSA 1BTOA 3GJSA 2R6ZA 4H7HA 4J1SA 4JSYA 4M9UA 3UO8B 3VSEA 4G5OA 1NM5A 1IJKA 2IDKA 2RGCA 2J3IA 3HDQA 4XB1A 5IK2A 3FNRA 1L7VC 3ONFA 4JJ7A 3N9IA 4WZAE 3W1WA 5ICSA 4UFOA 1TGVA 3NWPA 2C78A 5CFMA 4CTNA 4YACA 3NP9A 2HSWA 3U62A 2I67A 3DO5A 4URUR 5BOSB 2WZDA 1JEQB 2J4DA 3U2QA 1WJGA 3K09A 5DJ5A 2UUOA 4YRDA 4EY6A 5JYEA 1FX1A 1ZI9A 1AGRA 2QKYA 4FBMA 3BXEA 4MUXA 4IQGA 2OV3A 3PF9A 5F35A 4OREX 1IC6A 2BOVA 3ZS8A 3OU2A 4KPUA 1JMVA 3IEUA 4KAJA 2PUTA 4FYYA 4UHJA 3LY7A 2V59A 4W9NC 1JIVA 4MICA 3FI0A 3RF7A 2ZCJA 3LC0A 3ST7A 2D00A 2ETVA 1TLTA 2QUBA 1E63A 2NYVA 2X76A 1GNLA 2IXEA 3ANYB 3FSGD 4A3SA 4X1IA 5EZ6B 3IBCA 3OFVA 1X15A 2X8AA 1SHTX 4RVSA 5BQ5A 4ZCPA 2MYNA 3RYTC 5K03A 3R76A 1U9CA 4RENA 3I62A 3VJKA 1QZ3A 1SCAA 4DMUB 4DA9A 2O2YA 1FTGA 4DYDA 1XAHA 4M53A 5A3RA 2AKAB 4U1RA 5JH7A 1TCCA 4WFIA 1V16A 1UMDB 4GHWA 1QFYA 1BU5A 1R0LA 2PYIA 3O90A 2DWOA 4GM1A 3UH1A 3Q8KA 1DGQA 1NBWB 2B61A 4CV1A 1JHVA 2HREA 2PWAA 3ZHCA 4JNCA 1JB9A 3MWYW 1IUKA 3WIDA 3SK0A 3B5IA 3DDUA 3M6WA 4BWVA 4B3TB 1OWLA 1N2BA 2O3QA 1WABA 2WVAA 4U5XA 4YV7A 2WG0A 3H19A 5ILGA 2GHRA 4Z4QA 1F9AA 2H2DA 5IN5A 4CBVA 2VJYA 4OH7A 3AOGA 4JBYA 5MDHA 4XJSA 1H4TA 3LQ1A 4E4YA 2XJ4A 3HXTA 1KPGA 1SIWA 2HJRA 2PD4A 1I7DA 1V8PA 2VRCA 2WQ6A 4IO0A 2CJWB 1N32B 1M0TA 3UT5A 1LQ2A 3G89A 2DHCA 1N5RA 2WQ7A 4AMVA 4QYSA 1JLMA 2R7KA 3L8YA 4MVJI 1CXZA 1AQUA 5HQ3B 4MI1A 3OIDA 1NX6A 3LUGA 2O8DB 2WM9B 2VF5X 4EJ0A 5F77A 2V97A 3T4PA 2QAGA 3MUNA 1P6QA 2ZGVA 3ZVRA 2H5EA 2AMJA 2IH5A 2BEWA 1RZ3A 4IKEA 3ZTWA 2J9ZB 4AJOA 1QRSA 5DBEX 1Y98A 3QWBA 4AK9A 2UYCA 1EMDA 2HR1A 4O3FA 3TTUA 2IYNA 3RS8A 3A2KA 3U49A 2EKQA 2AXNA 2DFKB 4WD3A 2C00A 2R1VB 4CMEC 2P2CA 1D4OA 4GWLA 1VKHA 3W2HA 2F6RA 4MHTA 1B41A 2YN0A 1Z7YA 3JR7A 5CX1A 1XLUA 2OM6A 1OXMA 2XEDA 1ESZA 3OICA 4PQRA 4EDFA 5JCXA 3W9SA 4ID9A 4R98A 3VR5D 4DVJA 2BZSA 5BP7A 3EXHB 2DB3A 1YR1A 4FI3C 1NW5A 1I0LA 3DO6A 4CMHA 2X8LA 3PFKA 4AJHA 2QGNA 1OKKA 2P2YA 2P6MA 5CAEA 1Y8CA 2VF4X 1B0ZA 2GK7A 4D1YA 4ZREA 3LZ6A 3EGDB 1NY6A 2ZKIA 5FBQB 1TAUA 3UIEA 3INGA 3CX3A 2VLBA 2AI1A 3Q3VA 5SY4A 2CL5A 3EB9A 5LQSA 2HMYB 4G23A 1E2MA 2I1LA 4IG4A 4RY2A 5CNJA 3N6RA 2CXNA 1RVV1 2IHVA 2K7ZA 4K3VA 4RHTA 4CQMA 4Q1VA 1DAKA 4JT4A 5FL3A 3S5UA 4RFSA 4JT9A 4K7JA 1CVIA 5KQPA 3I61A 1EVEA 1S9HA 3JZMA 2A5YB 4TS3A 2IE8A 3E23A 3D3WA 7REQA 3HVUA 3FG9A 4EY3A 4N1AA 2CFCA 3OLCX 3CRNA 3PPVA 5IT5A 4PXSA 3CF4A 4DV5B 2JCBA 2C83A 3CISA 4EKGA 4DUZB 3RC3A 4EX6A 1W30A 5ALVA 2P40A 3B7WA 1FRNA 1SOMA 3VKVA 4TL9A 5T41A 3LS2A 5CDGA 3WIUA 1RABA 2H2HA 4LFCB 4QFMA 3WL3A 4EB6A 4H6VA 1T6NA 3D6FA 2C2WA 3DAOA 3CW8X 3QHAA 3NWOA 1XRJA 3ZZ0A 4ZTUB 3WB9A 3MWEA 4C76A 2VC2B 3HRKA 5FLXA 1YL5A 2HWWA 3OMXA 2YFKA 3GJQA 2JFWA 3OLQA 4KK3A 4O4HA 1FX0A 1J07A 5JCPA 5EMLA 3ETEA 3SEAA 4RMNA 1AKUA 4F91B 4PYKA 4LY6A 3D5TA 4DF3A 5MGNA 3OT1A 1IHXA 5C31A 4QBHA 1C3OB 3KYIB 1FEZA 2W5UA 3WV4A 4M0PA 4RTLA 1HDXA 2P78A 2Q6LA 4HVTA 4B2PA 4ZI3A 4RACA 4ODIA 3I01A 4D4JA 4EF6A 1ZH0A 1FP6A 5K0TA 4RGQA 3TOSA 8LDHA 3PT5A 1NF8A 2PWPA 3WLHA 1XV5A 4TLMB 1RPZA 2D7DA 3FMIA 4J7AA 4MKIA 1J39A 4IG9A 4BRWA 2J0UB 1K06A 2ZBGA 4BO8A 4PPQA 4LXUA 1YDWA 3PDCA 4J2HA 1Q1QA 3VR6H 3P19A 4YALA 4ZIRB 4UM8B 5AKZA 4N76A 4BPBA 1EJ0A 3AHHA 1XMJA 1X3LA 1YDHA 2ZUUA 1IG3A 2QP9X 2H11A 4WADA 2HDHA 3CUTA 2P4SA 4RSHA 2FB9A 2A5LA 3VDNB 3GYGA 1ABFA 2EIXA 2UYOA 3QF7A 1PZXA 3BA1A 3I9MA 3GGSA 3E9MA 2VVTA 3R0IA 4LNHA 4YRZA 1NIJA 1UIRA 1XD2A 4O4IB 1JEYB 1NPDA 1WETA 2G1JA 1N6IA 1XMVA 3RBVA 1OIVA 1POXA 2PV7A 2QVGA 3DV2A 2ZI3A 2OZEA 4GXNA 4B3IA 3BGOS 4JFAA 2R1TB 2QN2A 5AD1A 1OMOA 5IEBA 4PQGA 5ICMA 1ITZA 3AFMA 2PSFA 4L0DA 1KY3A 1E1CA 3KFVA 5C81A 2P3LA 2Z5FA 4QOGA 5HRCA 1UR5A 1KO4A 5IH3A 3GLGE 3GLHB 1ZH2A 3OBIA 5FULA 1VHJA 4J16A 3COVA 4J75A 5KB3A 3RAEC 2HEIA 3FWZA 5KSWB 4FKBA 2J7PD 3GPCA 3B48A 5A1TA 4XD7A 5FPQA 3S2IA 4MYCA 4HDKB 4B79A 2AQHA 2VSNA 3PUHA 1NNUA 3HVJA 5JQGF 1I5RA 4JLMA 2OMEA 2BR3A 4I14A 4MYUA 2Q5LA 2X2FA 1Z28A 4A2WA 5ADWA 5F21A 5SV2A 5A3JA 3PFIA 2GK6A 3KPVA 5LYJA 5JJKA 3VHRA 2GSWA 3HY6A 5JI3E 4ND8B 1S2IA 1E6KA 4IH9A 4KXNA 2W8BA 3WGHA 1QMPA 2A5FA 3UOGA 4FINA 4EG7A 1CVLA 1X7XA 3N7UA 4NQZA 1E77A 2XTZA 4HTFA 1Q0HA 2O2EA 1IUPA 5T4BA 3TNDA 3AL0C 2E4XA 3CJQA 4AUMA 4FE4A 2DPLA 4OOFA 1S0UA 2PS3A 5AVOA 3HYSA 1HO3A 1DP4A 3S7TA 1E0JA 1ORWA 2WVHA 4WK0B 2PRYA 3KJGA 3HNPA 1DX9A 3VR0A 2J0EA 1DQYA 4R4JA 4REOA 2ZULA 3EAQA 3LP6A 4K05A 3HXMA 1F20A 2RH4A 3G9UA 3K0KA 3SR0A 1QGED 5ECYA 2BGJA 2E49A 3KKLA 3UAOA 5BSKA 4HUJA 1E98A 2QVXX 4C7JA 1TMYA 2N47A 2IY8A 4JUCA 4TROA 2IV2X 3T7SA 3BH0A 3AJAA 3GX1A 5K05A 5I45A 3C3MA 4PO1A 1W4LA 1D1QA 3CR7A 4V1CB 3G7NA 2ACKA 1YOVA 2MWMA 3PWZA 1IPFA 2GZ2A 1RJGA 2FPSA 4JP5A 2BSAA 4CG0A 2HA7A 1MJ5A 3EYAA 3HR8A 3CEPB 4BEJA 1CJCA 5AXDA 4ZRDA 4DB2A 4GIBA 3UG6A 2XCQA 3EVZA 2Q99A 3JVUA 1IVSA 3P0RA 2H29A 1DBIA 2QIOA 4MK4A 1UWCA 1DRUA 1UJBA 5LLSA 1ZH4A 5C1PA 4UTNA 4BLWA 4Q4HA 5FBVB 3ZD7A 2OXTA 2IS6A 4YJGB 3UCFA 4A0FA 2P3OA 4FB5A 1X80A 3C48A 4RDIA 5HUQA 4I7EA 4P4TA 5K01A 4UZEA 2XDWA 4O5OA 4LHZA 1LPAB 3HUEA 4WINA 2COEA 4M60A 4FYIA 5F9MA 1KSHA 4W7HA 1AQLA 3LHSA 5L3SB 1NYTA 3PS9A 5TSDA 4FWTA 2QB5A 4A5SA 2H1HA 3NALA 1NE7A 1E2FA 4IGKA 1QZZA 5TC4A 3G8BA 3HY4A 2PQ2A 2RHWA 3N2ZB 2EZ9A 3OM8A 2NZ2A 2VSXA 3CKLA 1V45E 1QDEA 1S4MA 4F9FA 2BKVA 3QHQA 1XQWA 1W2WB 1JA9A 2IYRA 4IDEA 2D8MA 3H5NA 1PV4A 2R79A 1YVDA 2HNKA 1V48A 3EXIB 2JGFA 3AI1A 4GP6A 3JD4A 4MH0R 3ZVMA 1YIAA 2CNNA 4D25A 5H7XA 1QQ7A 2H1WA 4ZOAA 3MXTA 4H27A 3N2GA 1MHPA 3FFXA 3IPAA 4IIJB 4D3SA 1TF5A 1NW6A 5HWSA 3ZDRA 3U0BA 2VFAA 1OAAA 1V9SA 3WLAA 2QRKA 3HZRA 5EG5A 2EHJA 5BQPA 1VJDA 5DTIA 4BNWA 4RVHA 5CDFE 3H84A 1L4GA 3W1EA 1A8SA 4CRWB 1U7PA 1B6SA 2Q8NA 4CUZA 3PD1A 2RBKA 2ODNA 4H1TA 1GTL1 2KWIA 4LRTB 4OQXA 1PR4A 1HE8B 4BFUA 4RF3A 1NBME 4JNKA 4BNNA 3JAKB 4TWIA 1TK3A 2V4MA 4UMEA 4RETA 4YONB 2H31A 5JCOA 4DBLE 1L2TA 1USVA 5C46F 2EHDA 1RXYA 2RBEA 3JQ8A 3BDVA 1O5IA 3OZUA 2DBZA 2WLTA 1CB0A 2PX2A 3G5UA 4WKCA 1NI5A 3T3IA 4ZYXA 1AHNA 3ZGLA 4C6HA 4KLRA 3BUSA 3EF1A 2AXPA 3G5MA 4RK4A 1U0JA 3L7AA 5AM5A 2ZAIA 2WUEA 2HDOA 1ISPA 2IW3A 3ND7A 3FDZB 2Z2KA 2QGZA 5AKEA 3SDZA 3FCSB 1P5JA 1S9DA 1OH8A 2RGWA 3BH7A 1OXXK 1Y37A 2RHBA 2HEGA 3FUWA 4MVJM 4Z0NA 3TZBA 4C7KA 1FFAA 4OMDA 3P4YA 4UDXX 4ZWNA 4MRPA 2NGRA 2HSEA 1PL0A 4ED9A 1DV2A 4AJ9A 2O0HA 2YTZA 4FDAA 1FDIA 2HO4A 4NDZA 3BD8A 4B4VA 3I6BA 2DFDA 3E70C 3QKRB 4YJ2A 4MIEA 1QFMA 4LYAA 1VPLA 3DVLA 3GUYA 3HU5A 5GONB 3PFGA 1VKNA 5J43A 5KYKA 1XTTA 2QLNA 1TIPA 2R8EA 1QYVA 1ZBDA 2WPDD 3WKBA 4CWAA 4MW9A 3TQQA 3C4QA 3GVPA 5CIWA 2JIZA 1A88A 1FUUA 4JUAA 4KQMA 4Z2YA 5K8TA 2BTEA 2LPMA 4CNBA 4FGJA 2ZT5A 3NORA 1MPXA 4TRJA 3DV0A 1RLTA 3MG9A 2XNCA 3RS2A 5B4VA 3JTEA 3WL4A 3GHYA 1EDBA 1Q16A 3LXMA 3PGA1 1V1RA 3IVXA 1IXKA 3DPSA 1VI2A 2GZMA 2FSVC 2AG6A 3DPUA 5NLLA 3WHLA 3A32A 4ERXA 1U2ZA 2ZYHA 2D5BA 1MZPA 1JHUA 3FYUB 4B3BA 2Y0PA 3EJ6A 3SP1A 2WJVA 3W0LB 3K32A 2XUFA 1T5OA 4P35A 5A1JA 3AEUB 4TXJA 4KDFA 3ONDA 3OPYI 5AVUA 1FMJA 2XE4A 2ZSUA 2B4TO 5K51A 5EGSA 3VA7A 1BQ3A 1WV0A 1DJQA 3FVVA 3PNBA 1ENZA 5E9WA 2JI4A 4WA8A 5FPKA 2QQ5A 3RFUA 2CF5A 2KI5A 4IZOA 1K92A 3MYYA 3VR2A 2JJ2D 2IBTA 3HWWA 1C1DB 3PV0A 1C41A 5K3AA 4H31A 4GMDA 3RK4A 4OIFA 3SC6A 5B55A 2X5OA 2YYZA 2WSSA 3TLJA 2DBRA 5CLQA 3PEWA 2Y1DA 3NAMA 3IDOA 2R7NA 5DHSA 1E1KA 5INTA 2ZJ0A 5TARA 2FX2A 2CLHB 4HEJA 3BMQA 5E0KB 4U2FA 5B3AA 3V1LA 4EO7A 3HO1A 4JHXA 3GOQA 5L4NA 3FBWA 2NTJA 1K66A 1R7RA 1ELOA 1XZCA 1R6BX 3AO0B 1HKUA 2VJDA 1AXGA 3I8OA 3JR3A 4FFLA 4HDSB 4ZRMA 1CWUA 3FPHA 1P5HA 1NVUQ 2QLTA 3FAZA 3HO6A 3S6JA 4BDTA 5CLJA 5EPEA 1NONA 2WUGA 4K6MA 4BVGA 3WXBA 5KPDA 1J8DA 2YVLA 1C81A 3F6RA 3AP3A 3I5YA 3NKFA 3LKDA 4RLHA 2MSKA 1FYEA 1WMAA 5BN3B 4C4ZA 4KQWA 1CF9A 3DCYA 3KFXA 4RO0A 4OQFA 3NTLA 4LDNA 4WDQA 3T5MA 2E1PA 4L9SA 4NG5A 4ZD6A 3RJ5A 1Q92A 1XCJA 5JSZA 2GJKA 1T6YA 3K6SB 1B26A 5EHXA 1DTEA 3TQSA 3E48A 1ZKDA 3IBSA 4CTMA 3ABQB 3DTVD 3FUTA 1WHSA 1VXOA 2I8CA 3QY9A 4EUKA 1ZWLA 1V43A 4WV3A 1FW8A 2NQTA 5ANRB 3MJVA 2IHJA 1V3QE 1HQYE 2ZZNA 1JU9A 3CUKA 4RPLA 4XCQA 1ZNQO 4L2IA 5IZCA 3TH5A 2VTBA 4NS1A 4QYIB 5GADl 1M8FA 2FY8A 1F48A 3DAYA 3I28A 3LX8A 4HFRA 3WJ1A 3OE1A 4WERA 3B7PA 4AZ3A 5K0BA 1E2NA 4R9RA 3ME5A 3F9RA 4LXXA 1OV4A 4DV7B 3WBJA 2AJCA 5COQA 1KMMA 4NMLA 5K0LA 3GDWA 1NQAO 5B36A 5FV4A 3PU6A 1CS0A 1XRQA 2A7QA 2AFIB 4PFJA 4RZ3A 3C6YA 1MO2A 2XX3A 4J0QA 5BNFA 1XGKA 2GZ3A 3PDIB 3P20A 3KLBA 3QPUA 1Q84A 4GQAA 1GGFA 4F4IA 5I9MA 1ZWKA 1NJFA 3CUUA 2VBFA 4UAVA 2HLDA 1E61A 1ZVKA 2YXPX 1M2VA 2Y2UA 3AVVA 4DVGA 3HKCA 4JROA 1XKLA 4RK1A 3DF9A 4UU0A 3LX4A 3WNCA 5B3JC 2FPXA 3GZTB 3OTWA 4Z3KA 4X6XA 2ZB3A 2XTJA 3ZD6A 2VQSA 1VSUA 4Q4CA 4LYGA 3ISJA 3G59A 5HRAA 3SVZA 2GAJA 4U2BA 3OEHA 2HPAA 4I8XA 1QO0D 1NT2A 4IVNA 1SH7A 1M7GA 4JU8A 3SD7A 3P32A 4GC9A 4WLOA 2QQEA 3RIYA 1K7FB 1YZKA 2CLFB 3LYAA 3D3NA 5LB2A 1AK2A 3E3MA 1T6ZA 4YECA 4E5DA 1C7QA 3DWFA 3E9QA 4FILA 1BYUA 1Z6QA 1ZY2A 1TVKB 1N2OA 4LBVA 4Y67A 5M29A 4ESVA 1IZYA 4GRIA 4G09A 2GUWA 3SHFA 3N05A 2C4HA 1Y1QA 3IUSA 4GMXA 2VHUA 1W94A 1YZ3A 1BE6A 3UICA 4F1WA 4PX2A 2IYFA 5AHRA 3IPYA 1HT0A 2EX0A 4TS4A 3JZIA 5ULLA 1WXDA 1GPDG 2QI9F 4KSYA 1WB6A 3M5PA 5TDHA 3WLNA 4ASUD 3NB0A 1RE0A 4YCSA 5DLQC 1NC3A 3BM5A 1US8B 2VBIA 1GUFA 3OWHA 5FAXA 2PKQO 1F4LA 1PX0A 3CLTD 3W2GA 5JY1A 1NI3A 1GO2A 1ZCAA 4Y6LA 4G6ZA 1E3WA 1QX4A 4L5IA 4V3CA 3RFFA 1EBUA 2ACEA 4B44A 1QIHA 3MUFA 4ZARA 1JIJA 2H0RA 3A26A 3Q3HA 4PCAA 1Q1NA 2HXYA 2N3ZA 2QHXA 1FDSA 2VDQB 4ZCQA 3CRVA 4BKUA 1NLZA 1IQPA 3C8DA 4YFYA 1DAIA 1X1TA 1YJAA 2IT1A 4NOJA 1VP3A 3USZA 1LDEA 2XAAA 3OHSX 2BM1A 3WQQA 3MS4A 4QHTA 3SZLA 2B2XA 3HB5X 3N2KA 4ZU1X 5BT8A 5CFNA 4YROA 1M1NA 1RHJA 2WJJA 4FC6A 4WBSA 1YIOA 1YRQA 1M8GA 3RF6A 3D4IA 1FLVA 1GVHA 1QO9A 1JB1A 4PLTA 5SY6A 3GBSA 4M86A 4C03A 1I6MA 1LK0A 4YEDA 3ZV6A 4ZYTA 1KI8A 2CXTA 4GOMD 1QOPB 2YN2A 2QGFA 1RM4A 3GEBA 3T3OA 2ZSEA 4AQYB 3I5XA 2IPXA 4I08A 3U4DA 3E15A 1JPUA 4NXNB 4G1FA 1FS6A 3PXAA 4Y2UA 2JARA 3UJ7A 2WD9A 3UWKA 4AO6A 4BLPA 4MTCA 1SVOA 2PMFA 3U3RA 1N5IA 2IZOA 4F97A 1P4GA 4JBXA 5REQA 3EFOB 4ENRA 4P98A 5HTOA 2NUPA 5LLDA 3FWPA 2IZ6A 4QT4A 4IQ8A 3A10A 4RF2A 5A02A 2YMLA 4D5GA 2ZUBA 2AQKA 1JVSA 3GJ0A 4Q4JA 4N39A 2V7GA 5A4JA 2FLWA 1ZD3A 3AUXA 4XSHA 3BFJA 5F1YA 2J9GA 3R7WB 3ASZA 3QLUA 3ENQA 2H5LA 3PLRA 5HFAA 1BX1A 2YY5A 2PKRA 4O1MA 5CW2A 1ORRA 5JSFA 4ENSA 3ITEA 1S1CA 4DA7A 4K26A 2HQBA 2QM7A 4MP6A 4M1YA 3U7JA 4BYMA 5JNUA 1U2EA 1BQEA 3IKLA 3MGAA 4PZYA 4C29A 2WYOA 1TA4A 1TDJA 2ORWA 2XVMA 5IF3A 1JKJA 1OWMA 2OCGA 2FZ4A 5ALGA 5DXFA 3TLZA 3UWSA 2FQYA 2J48A 2F64A 5ALWA 2HHLA 4DDTA 2A8YA 3GQBA 3EHEA 5EP4A 4RIHA 5DGHA 2QMQA 3SZUA 3B85A 4JB8A 3C39A 1W34A 2INGX 3FROA 3K4HA 2JFOA 3F7OA 2YW9A 2ZYIA 1PG2A 2I2WA 3WGGA 1W0JD 2CDRA 2ZYRA 3N74A 4LOHA 3S2SA 5K9ZA 1FFCA 2AG0A 2EQ5A 2IYUA 4QBTA 5DCUA 4JLAA 4R31A 2JAPA 4O2BB 2FSGA 5LYJF 1CPYA 1KEEA 1DQNA 4MVJA 2ONJA 4EY8A 1MLDA 1USKA 3KEMA 2B92A 4E22A 5BMVB 1IVYA 4FC7A 4CDRA 2OKGA 4OKSA 1NXPA 3PFHA 2WFAA 4XR4A 2ZYAA 4YCBA 3KWFA 1GZVA 2Q3JA 3H1TA 4B74A 3RNLA 1EUDB 2PUAA 3B6IA 4TV9B 2FSFA 4RD6A 3WI7A 2PX4A 4ZI2A 1GRNA 2JCVA 4KMMA 1BH6A 1WHTA 4KFTA 5EYPB 1KTVA 5KPJA 4N12A 1WXFA 3H8JA 2DJ5A 2OTCA 4Z9AA 1NHWA 1AX9A 3GNSA 4NJEA 3SPXA 3UF0A 1OBVA 1W1WA 1W96A 2DQSA 4TKMA 3GPLA 1ZGGA 2YV3A 4XDZA 4D79A 4KVZA 221PA 3LXRA 2HMSA 4MO9A 3DE6X 3OTHA 2JLBA 1RXIA 4XQ9A 3K8QA 2Q9BA 1YRYE 1XZLA 5KYXB 5KVCA 1BYIA 3FWHA 4B6RA 9ATCA 2HJSA 1HY3A 3V9AA 5ARCA 3LLUA 2R7AA 1TQ2A 1T3GA 4LRYA 1Q22A 3ZJTA 2EVWX 3GLKA 2PX5A 2SCUB 3EGXB 2PGDA 4ABYA 3ZE0B 5C8VA 2PHZA 3A6FA 4QREA 3VISA 5CITA 2JLUA 5B2FA 3C3XA 2EEZA 2B9VA 3FLMA 3KFLA 4R84A 4DMCA 3PC3A 2W2PA 2Z0MA 3UBTA 2IH4A 1XRNA 3V7NA 5T3UA 1CIPA 5HSGA 1KWKA 1T8SA 4QNNA 4XDHA 1J25A 1G3UA 2R11A 2XUAA 3CBGA 3FGOA 3R44A 1QORA 5JNTA 4WKOA 5EMJA 1XRLA 2RAVA 2EJTA 1RI3A 3RLFA 3H2SA 3Q5EA 4F86A 3EGCA 4N48A 1ZAKA 4ZVTA 4R1SA 3V3TA 3G9ZA 1YQWA 1U3FA 1GPKA 2C31A 3GPIA 3N5CA 3VZPA 4QHYA 4BC0A 4LBWA 4WI1A 1FFEA 2RAPA 2FRDC 2VYCA 2YWFA 5G3YA 1SN7A 1QK5A 3SYLA 3K35A 3V4OA 1MW8X 3ZGZA 1ESCA 5ENVA 1CDOA 4Q19A 1UAYA 3EQ6A 4ARSA 1XBTA 1F5NA 1DIRA 1W52X 1WPQA 3BKXA 1OLSB 2I3DA 3C6BA 4OAOA 4DLKA 2A9FA 4DW8A 1TF7A 5CT6A 5J40A 4PNZA 1ZHOA 1K8ZB 1N8SA 5J4LA 2JLAA 3EC1A 4PZLA 2Q0SA 1HX7A 1EXMA 1QH9A 1Z38A 4BMXA 4DQUA 3PQFA 1JLLA 2YOHA 3U40A 2ERYA 2ZZMA 2GCEA 3FRIA 3B9BA 2ZIVB 3M1YA 3VSBA 3X2EA 5DK6A 5EAIA 5K2OA 1CQWA 5JLAA 4YQFA 1CUJA 2V7PA 4F93B 3JWIA 4BB0A 4F72A 4YHHB 3AILA 3C1AA 3KXDA 1TT7A 3ZGNA 5JHHB 3KQNA 3E35A 3ZZ1A 2P0EA 3GIWA 3IH5A 1Z17A 3LDAA 4FVTA 4R9SA 1XEXB 1HLPA 1QNLA 2OBNA 4Z4IA 2AJDA 2JAHA 4UXIA 4QBFA 3CEMA 3K5PA 1IWPB 1VSQA 2GF2A 3Q12A 1B43A 1UOOA 1OX5A 3MSCA 4FNMA 4NX2A 4KLAA 1RYFA 1GUBA 3JVVA 1ACMA 2REOA 3FY4A 3F7TA 4XLZA 2WWRA 3AK4A 4G1EB 4JI7B 5E8JA 1E8NA 2B1QA 2VRWA 1LFAA 1DQSA 1MT3A 3KRTA 3L05A 4JL6A 4MMYB 5A4IS 3AUJB 4JBLA 2CMKA 1P33A 2A0FA 4PG8A 3UW1A 1VRWA 2XVXA 3TW8B 2J9XB 4E5YA 2CZCA 1KVQA 3DMNA 2FGJA 3IOCA 1PJAA 3EZGA 3P1JA 4JJ6A 4LY3A 4BZXA 3FPEA 4QLAA 1M6WA 4JAVC 4UUNA 3SVLA 1K89A 4LMAA 1BVUA 3KUUA 3R74A 3LK6A 3TCXB 3AB3A 4X00A 3UCEA 3R0QA 5FA5A 4X20A 3DXZA 1DARA 4OJTA 4RV4A 5EIEA 4X8HA 1W5FA 3TF5A 4GKBA 1T8YA 4FDTA 4BB9A 3H86A 1XU7A 1BMFD 2AOWA 1I7NA 1UK7A 2XTAA 1JQ5A 2XR1A 3N3BC 1Z6ZA 4E15A 4YJ2F 3VR5A 2RBGA 2ZIWB 2I0FA 2WU3A 3H4MA 4RF4A 4Z0TA 3ZWDA 4LCJA 4EKIA 5EERA 3RO7A 2QK4A 4PQYA 3R8FA 3BMOA 1XCMA 1Q1AA 3HK2A 2C5BA 3B9PA 1U6JA 1NYRA 2ZDGA 4H9GA 3UTDA 1VCNA 2ZIXA 3UYLA 5IJ0A 4ALLA 5JUWA 1QGYA 4HP8A 2XA2A 2NZJA 4ZZ1A 3DKKA 2XE7A 5ESXA 2XNKA 3S2ZA 3BMCB 1SC6A 5H5JA 1PHRA 4LQLA 3O74A 4NJMA 3RAJA 4RMHA 3LECA 3R7BA 4M9SA 1MB0A 3NQ41 3ADKA 1NURA 4MKHA 4RZ2A 1KKMA 2PZJA 1KVRA 2IOQA 3AF4A 2ZS8A 1XAIA 2WFLB 4NYIQ 3RHSA 2AN1A 4AECA 4EB3A 4C7BA 3QVMA 4OL0A 4TTPA 4Q9IA 1ODTC 5A4AA 3G1TA 3ON5A 3GMSA 3GUCA 4I5FA 3I52A 1E3IA 1KS2A 2IEBA 4GYKA 1G21E 1K0UA 2DPGA 3SZMA 4JOSA 2J6IA 3EZ6A 3H5OA 2I1QA 2ZTHA 3PC4A 4E08A 1V35A 4H7EA 2R8OA 5IP5A 1TAHA 2H1SA 3GN2A 3UAXA 2XF2A 3PXEA 1KNXA 2RHTA 3DT9A 1KBOA 4MV6A 3EIWA 3BD9A 3GNTA 4O29A 1OQAA 1VMIA 3X0DA 3Q3IA 1VL1A 3GRVA 4Q6BA 2V7VA 3SJZA 1N9GB 1NUSA 2EYQA 3KHTA 4RGYA 3WICA 3TRKA 4Z6KA 1IYZA 1Z0KA 1QS0A 2YVQA 4S04A 4LSMA 1XMIA 5K09A 1MO4A 1JJBA 3BEOA 5T7BA 2IZZA 4GXRA 1JV2B 5IVIA 4QRHA 3HWX1 2DUUA 3EBLA 5TIIA 1SKYE 2ZUSA 3GAMA 3MGGA 4ZVQA 2FWIA 3C7TA 4NMXB 2I2CA 1RWXA 1MB9A 3SOZA 5E0OA 3E7XA 1RJ9B 3O8DA 2V3WA 2BLLA 2OXRA 1OF1A 4RHYA 4BO2A 4L85A 1U5CA 1DO0A 4PZDA 1ZFNA 1UKAA 2D62A 2HZBA 2WHEA 1RTKA 4N5NA 4ZQCB 5EWMA 2O8CA 4WCDA 4KHPB 2R66A 4OV6B 4R81A 5IAKA 1UQTA 2FK8A 1H0SA 1C14A 3H04A 2AFHB 1A50B 2P6RA 2ZWPA 4FOPA 3E81A 3AETA 3OZWA 3C1UA 3BFXA 1TM3E 4RH0A 5KMGB 1Z07A 1J06A 2GAIA 1XVAA 3H5AA 4I9UA 1MAWA 4BGUA 4YRIA 1ULBA 4MLCA 4ZEVA 4Y0VA 4C06A 2XXAA 2OV8A 1GPAA 2J87A 2DSTA 4V0QA 3R6TA 1ADFA 1R0WA 2HNAA 5TQ0A 4B3SB 1L5GB 2G72A 5C8YF 3GA0A 1IQRA 3QOXA 4ZO4A 2UYQA 5CVTA 1MVLA 2QNRA 1MAHA 2GHIA 1DZ3A 2XT6A 4TQAA 3AP2A 4KP7A 4DCSA 3UVEA 2V0GA 3LDHA 4BLVA 1DBWA 3ENZA 4TYWA 1TAQA 2CJXA 1AN9A 4GPZA 1NRWA 2YHIA 1T0JB 3VAYA 2A9PA 3OLYA 4Y9UA 1BRTA 3AU9A 2D5AA 1J8QA 2J7PA 2SECE 3RSHA 1H94A 1ESEA 4GKJB 2P75A 3EEFA 1YQTA 1ZP6A 4YNBA 2G9UA 3CWQA 1FIUA 3C4JA 4AXXA 3R3SA 1PS8A 1GPMA 1W19A 5AJZA 2GR9A 5KSOA 1S3GA 4GS5A 3R7AA 4AJ4A 4DMLA 3N2LA 1HE5A 2XUGA 3OOWA 4OI0A 2YC4C 3T12A 3FVWA 4MUBA 4MW6A 3T1VA 5JYCA 2ZBEA 3R4CA 3E2PA 3PC8A 2AKYA 3NV9A 1T1IA 2OYSA 2JH8A 2J9RA 1Z63A 4QQ8A 1KAOA 4ZANA 4DB4A 2AI3A 2PDAA 1FL9A 3NR2A 2C61A 4Q1FA 1L1FA 4J49A 3RUHA 2JVKA 5BV2P 4LOAA 3L6UA 1TZMA 1VHLA 3H11B 4GOLD 1K8QA 2LCFA 1LK7A 3DAGA 1UKCA 1SU8A 5JATA 4BNGA 4KI7A 1PT5A 3V4LA 2OBFA 4C6SA 1CNMA 1SVWA 1M83A 1PR2A 1K6MA 2OAP1 1JL3A 1JE0A 3K6JA 3OIUA 1CIVA 4JASB 4ZO7A 4D56A 5J2TF 5IANA 2VL7A 4PG5A 4FD2A 3WGKA 2FR8A 3GEHA 1I1HA 1QE3A 4TWAA 3EN0A 3RR2A 3HN2A 4OPMA 1H6BA 3QU9A 2IPOA 1U9IC 2ZTVA 1R6UA 3BCHA 3R3ZA 4M1EA 4ENWA 1BEUB 3U7HB 1ID1A 1VPVA 2HL6A 2ZRDA 1RXSA 3E3LA 1E9RA 1USUA 2WINI 4Y9SA 4ZYZA 2DKNA 1TXGA 2CKDA 1HTBA 1XE3A 1T2NA 1ACLA 1O8CA 2FW9A 3KAJA 2BUAA 2IYLD 3GG9A 4I4TF 4LBYA 3E61A 3FVTA 3U61B 4G37A 1R0YA 4XWKA 1KK3A 1JKMA 1MC8A 2O7QA 2VJLA 5THQA 2OCIA 3WWCA 1REQA 3SHTA 3U81A 4C4SA 1I3MA 1E1NA 3IAS1 3IYLW 4CTOA 1QYWA 2QM3A 3DMPA 2JJYA 1O2DA 1E2DA 2UVDA 4PGMA 1B42A 1NQXA 4V24A 1M1ZA 4YS6A 1YVUA 2QTRA 2J7KA 5AQ1A 1U0OC 4KJZA 4PS1A 3FNFA 3ETHA 3E8MA 3IAS6 4BLRA 2GPWA 3D3EA 4MVJH 4EL0A 1ZJWA 4OQDA 3RRFA 4BNVA 4HR7A 3PPIA 2XAUA 4BQQA 5JMOA 4NXMB 5DSZA 2QSZA 3FZQA 4TYYA 1FZQA 1A8UA 1PJ2A 2ODPA 4C43A 4DIFA 4JLSA 1X94A 3NFYA 2QZSA 4ND2A 4MV4A 4EPXA 2A67A 1Y1KE 4MR8B 4PIMA 1Q11A 2NUTB 3AW8A 3ZLUA 4AMBA 4DRXA 2YBEA 4G36A 1EIWA 1ATIA 1QQ5A 3G5AA 4G8DA 3CLSD 1BGVA 1GL9B 2II6A 3T1NA 1VPTA 3PHCA 4JBNA 5DLEA 5TPZD 5JR3A 2BGMA 5I01A 5HXAA 2YQ5A 1AMNA 1PNQA 1YVRA 3ZW8A 3ICOA 5K4AA 2BFFB 2CEKA 1G7CA 4PQEA 3C1OA 4KN9S 2ROQA 1E1YA 1N34B 2OCYC 4NYMR 3F96A 1P81A 3EIFA 2Q3FA 1O96B 2H7YA 3B6MA 2B99A 4NMHA 2IEDA 4D0NA 1JDPA 1RC1A 4E14A 1S7CA 3UJPA 3P9KA 3EK2A 3CS3A 1YUBA 3HBAA 3CO0S 3Q7TA 4OM7A 1XDUA 1H8ED 4E5VA 1VKJA 2CNBA 4YC7A 4XASA 3V8QA 2GK4A 2AVNA 4JOCA 4NDNE 4Q3AA 3I73A 4UDNA 4AJPA 4E94A 1XNJA 4B46A 5BQXA 3VUFA 5JJBA 4OHXA 1KYZA 2X6TA 4JQOA 4I1PA 2AFRA 2WDZA 4R5HA 3ADDA 3ABOB 3WAJA 1WR8A 1F8FA 2Z6AA 1ADYA 4QEZA 3U7QB 4ER6A 3VKHA 1A9TA 3GT7A 3GMTA 4QJIA 5CRIA 1NYLA 5ALYA 4CF6A 4DV0B 4M1TA 1CEEA 4ZV4A 5IS2A 2GD6A 2R2GA 2V6FA 2ENWA 5CYOA 4IRMA 1TJYA 1OXTA 4L6IA 2G17A 3RS7A 4OXIA 2IE0A 5HBRA 3F3MA 4HAOA 4G8CA 5DE3A 2R62A 4LJ5A 1D6SA 3HP7A 1PWZA 4CKEA 1MP0A 2JEYA 4BZZA 3CJRA 2FUNB 3OCXA 4JYPA 3D6AA 3WLLA 4YIHA 3FJ1A 1G63A 2J07A 3MM4A 3FFWA 1GGJA 3RYCB 1QH1A 4MB0A 2JRCA 4RSMA 3OQNA 1HE4A 3O3MB 4LQDA 4KWCA 2VP3A 2X5JO 3KJQA 3OLWA 3WMWA 2J4CA 4O1HA 3D54D 3GLSA 1JGTA 5CBKA 2Z43A 1GG5A 2WPDA 1DKOA 3GJ7A 1QHHB 3MD0A 1W5SA 4KE6A 3HH8A 3KLMX 2C94A 1F2TA 2BHLA 2IYQA 4RY9A 1QOQB 3WKDA 4RXTA 1GKKA 1A9XB 1KK1A 2P77A 3IQGX 3WFZA 2CE7A 3FOEC 4M8KA 1R88A 3GGCA 4EJFA 1VTKA 1Z6XA 2OAQ1 3JYOA 3O38A 4B7CA 3BH6A 1YR7A 3H4TA 5CG1A 4XFDA 4DG5A 3QVKA 4BJ1A 3WQBA 5CURA 5AUOB 4Q4AA 2VH2A 1K86A 1DBPA 2H7VA 2JA2A 5EIBC 4M0LA 3AUYA 4ESOA 1VYTA 2WYVA 4DIBA 1EXVA 1ZC4A 1D2CA 2QG4A 2V7BA 1KH1A 4IXWA 1M8PA 4HPWA 3EQ2A 3NHJA 5ALKA 3WYCA 3RADC 4N7MA 1RWWA 2QOEA 3FPAA 2WF7A 4I1UA 4V1CI 3EPJA 4EQ6B 3K8OE 3A2NA 3HB0A 3DOIA 1QH0A 4OHUA 4P34A 4ZOQI 2GLTA 2O2CA 2RHMA 2F48A 3NHKA 3DE2X 3QPBA 5TV2A 3BB1A 2JJ2A 2Z30A 3BL5A 3OQIA 4KXFB 5IAEA 5F2NA 1UFOA 4HV4A 3S8YA 3H5RA 1TPZA 5DYNA 3WB2A 5CXQA 3ANMA 5D6OA 3IQEA 1UP7A 3RI3A 4LDQA 5AI5A 3I2JA 1OIWA 5DSXA 4NU5A 3L4SO 3WFJA 3ZJ4A 3HMKA 2JLSA 1LPBB 2OG2A 2OGTA 3NH9A 5AI8A 3J81k 4HPXB 1O0SA 4OD0A 1W2GA 3QM1A 1EWRA 2G04A 4FKMA 3SIRA 3DXFA 3N58A 4AZ0A 1D3AA 3AHIA 5BO5A 2FJUA 4F45A 1ULUA 1Y8AA 1Y3FE 3AJ8A 3HHEA 2CMDA 2BC9A 3GVHA 3NJ4A 2VJKA 2ILTA 3M6IA 4MGIR 3H6HA 1B76A 1G8SA 1RP7A 2BRUA 2A9OA 5DU2A 1YQUA 5CGQB 4LY0A 1E9FA 5EKSA 1Z2NX 1RLIA 4MV7A 4MI9A 5EVJA 1Y6RA 4PS0A 1WCWA 2GFHA 3ELUA 3PQ7A 1YZYA 5FOUA 1H3FA 4PLCA 2FCRA 1W5BA 4LTMA 3V8NA 1SVLA 3VH1A 4Z53A 1KZ7B 1SOAA 3QIVA 1KL7A 1CRQA 1M1YA 2E4ZA 3D2BA 1MENA 3MJDA 4JJ8A 3P2KA 2R751 3NTUA 1HFWA 2BFNA 2HKIA 1QQAA 4PV7A 3SYKA 5F9FA 2BD0A 3DTVA 4G5YA 4HZIA 4LJKA 5F52A 2CLEB 4PZUA 1OC4A 1Z9BA 2GVZC 1ZVMA 4HDOB 4KE9A 1KHTA 4AY4A 1EXWA 5ALUA 3M33A 3AR2A 4OJMX 4PO9A 5IN4A 5LN1A 1WW3A 4DR5B 2MDTA 4CTKA 2PRJA 4L9AA 2F90A 4QX6A 3ZE8A 3ZGVA 4DJEC 5B2EA 1DKRA 1QIEA 1MN6A 2WZCA 1LTQA 3QLVA 4AJNA 1C7EA 3TOCA 1J20A 2QD2A 1T1GA 1MMFB 1NZFA 3JQ7B 3S28A 6ABPA 4M88A 2AHRA 3NGMA 2IYYA 3PG5A 2XD4A 4DZRA 3ZV5A 1M1XB 1PDOA 2PANA 2QSYA 3COYA 3FB1A 2EFYA 2VKQA 1IJBA 3Q3GE 1DEOA 1XI2A 2H4HA 2EW1A 3CPHA 3D3JA 1PZMA 1G5QA 1KR2A 3JALB 1K5GA 3L9XA 3NOVA 4UNNA 1XTZA 2XD9A 1CE8A 1ZK0A 1RI1A 4LHSA 4OJNA 3W4KA 1NASA 2O7VA 5I5EA 2HU8A 3CB2A 1KA9H 3FPKA 5FLEX 3IEPA 1K3FA 5DF1A 4RA9A 3S1AA 3BK7A 4PR0A 4P3PA 3M3DA 2WJAA 1P2SA 1GNRA 1J99A 3K3PA 1JTVA 1VI6A 2RAUA 1Z2PX 4ZDWA 2VPIA 1UK9A 4MS1B 5F3RA 5TJ9A 1G8YA 2HJ9A 5DCYA 3CRZA 2P9CA 1WP9A 5AXBA 1YZUA 2OQVA 4A23A 1QO0A 1EHIA 1G3QA 4WZAB 4BKOA 1P9WA 1EG2A 1H85A 1JXOA 1RQ7A 3ZEAA 1C4KA 3BSFA 3HI6A 4G4GA 4D8XA 3M1LA 2HPZA 1JNXX 3QJGA 2OHJA 1BHJA 3ILSA 5TGDA 5ABPA 3RV4A 4H4DA 2WG1A 2A88A 2YWHA 2YICA 2WHPB 2XUHA 4HX9A 4J90A 8ADHA 1RXVA 1GTZA 4XDYA 1H2EA 4MOWA 3RH0A 2A3RA 4BMYA 2RGDA 4EF4A 1WKVA 2JIQA 3NOQA 1N2EA 1HLGA 4MA5A 3X1ZA 1UQRA 4LAFA 1WXEA 2OD7A 3F97A 4RVFA 2WJYA 2VK8A 3V55A 1T29A 2G6BA 4BN5A 4BNFA 1B8OA 1KOGA 4GI2A 4PSDA 3SQWA 4MROA 1KAGA 4WXYB 4ASUA 3FYCA 1QMGA 5KREA 2PT7A 4KW7A 4ZA2A 1ZK4A 3FAKA 5HIJA 4CODB 3KSDO 1DAOA 3TDKA 3LPMA 3OEED 3HR7A 2G5GX 3ESAA 3IO5A 2FHPA 3KJHA 5BRJA 1JU4A 1DAHA 3PUWA 5FI1B 4N6OA 1DRKA 4C7OA 3KZKA 2WJPA 1F6BA 1Q0LA 1TM7E 1TJ5A 4OHCA 1GRQA 1NBIA 3GEMA 1XB2A 4QATA 4PYOA 4RVCA 1U2GA 2JLZA 1P0QA 2FQ1A 2HHHB 1T36B 2H8GA 4XJTA 3M4ZA 2PQ0A 5DBOA 3OLXA 2W2NA 4ZJPA 4QO8A 1LBIA 2FN7A 3QMMA 1RI5A 1Z8HA 4U00A 1FDWA 3PHHA 3AIKA 1E2JA 1Z29A 1ZM7A 2H1FA 4XUCA 3TLKA 1XAGA 1QGOA 2G9NA 1NQOA 1UM8A 4YWJA 3UHPA 3V4VB 5LD2B 4FMBB 3KQYA 2MSNA 4K9PA 4GX2A 4WOPA 1E1DA 2O6LA 2GEDA 3C8MA 5A5FA 2AOUB 1OLXA 5D84A 1XNGA 1A9SA 4EYQA 4TXNA 6REQA 1MC4A 4PNHA 2IV7A 3KQPA 2YWCA 3MJ4A 3WA6A 3PB3A 3K70C 5C5IA 1KZ4A 1Z68A 3HHPA 2BZ0A 4NMMA 3QVXA 4LUCA 5HCUA 2AWNA 3QX7A 1ISJA 2CFRA 4YT2A 1UC8A 4BS9A 1IMOA 1WQ3A 3BWXA 1U0TA 4HDCA 4WBNA 3N07A 2BEUA 2CB9A 3K5HA 4EHBA 3AHJA 3F8TA 4YTEA 1AQJA 3NAZA 2VEDA 4Z1OA 1K27A 2E37A 1UPBA 3HJHA 4Q39A 2JASA 3IQHX 4RIEA 3ZWYA 2CV1A 5COAA 4BCCA 2G4CA 1YFKA 3KQTA 1EFCA 1UEXC 4G1BA 2RH8A 2RMKA 3DBLA 1VIVA 1I4TD 5JCZA 2R6DA 1GDDA 3O21A 4OAQA 1N1DA 3UAVA 1LBHA 5CT9A 1TEXA 2WE8A 3WYFA 2AMLA 2NSHA 2HWYA 2R4UA 4G5RA 3DE4X 3RS9A 2G80A 3I6QA 1UADA 1YRHA 2PUDA 3NJRA 4GQBA 4AI6A 1CSEE 3T5AA 4UJ3A 4DLNA 2WTAA 5A5DA 2ADOA 1W0JA 5LP6C 4DDMA 1I3CA 5KAMA 2NU6B 2CE2X 4OQPA 4R41A 4BN4A 1LSJA 4YP9A 4DWOA 2FMTA 4Q00A 5E9JA 1UBHS 1ZD5A 3QSGA 4GDFA 2AN3A 1B15A 5GZ3A 1NJ1A 4AG3A 3AF0A 4CF4A 3L0SA 1HLFA 5GGXA 2HZ7A 1IJEA 4R05A 2VR1A 4ZMBA 3FM9A 3CNLA 1GAEO 1RBMA 3G1WA 4IXNA 4OHFA 4U2CA 3O4VA 4G24A 3S2YA 3F4LA 2GERA 3O4HA 3TJRA 5IUKC 2QVBA 3MLBA 4QC2A 1T13A 3HPRA 1ZCJA 1PBTA 3R3HA 4B75A 4E1AA 3BWEA 4WESB 2H1OA 2XB2A 2FUEA 2NU7B 1MOZA 2YUIA 1R4MB 4K2HA 3CZRA 4EITA 3GROA 5ICFA 3UWPA 1CZHA 4EA8A 2VJCA 1SZCA 4O1IA 4A16A 2I3GA 3EQ7A 5IWCA 3C45A 2WRZA 1PK9A 2LIVA 2FPIB 3F5SA 4HYQA 4LDAA 5MN5A 2WT9A 3MD9A 4NCNA 4G26A 1L4UA 5IVKA 1NQTA 4L4SA 3BK1A 2QX7A 3MOIA 4CM8A 2L69A 4PHTA 3GEIA 3HABA 4N7JA 3TCNA 4ZPJA 4HDQB 2J4FA 1L4MA 4Q5IA 4EA9A 5HZGA 4BX9A 4NH4A 1MAAA 2W42A 3K53A 4XYMA 2YYSA 4V0OA 3RJTA 4O2LA 2P41A 3JQAB 4HWPA 1Y5IA 3ZWNA 5KNDD 2OO5A 1ZGCA 5AUPB 2AD1A 4Z9FA 2ONCA 3A11A 2EP7A 1OZGA 2B37A 1GZ5A 3UXYA 3MYRA 4HG2A 4I9FA 3F49S 4FT4A 2Z56A 1ZU5A 3UV6A 2DZDA 4M6WB 1GL6A 1Q3TA 4EEXA 3QNUA 3RT9A 5KCMA 2Z1NA 3HKEB 3B1XA 3KKEA 4NY1A 3BIJA 2PRZA 3H42B 1HFJA 3A6ZA 2X1VA 1UZUA 1XJ0A 4REQB 3ETJA 3BPSA 2I80A 4OLJA 2ZYVX 4GOKA 2A5JA 3CINA 1VE6A 4COKA 5DI9A 4RKRA 2O3SA 3A14A 2EFEB 2H0QA 3HV2A 4IJQA 1NVEA 2D2FA 3NBXX 3NWBA 4GBGA 4D9MA 4Z9XA 4DCVA 4H15A 1JEQA 1V5FA 2VK4A 1R4AA 2EX4A 3B60A 5ALLA 1P7VA 5IVPA 2QU7A 2RCYA 3A9SA 1M0SA 4YX9A 2CHUA 4PLHA 5J4YA 3WQSB 1EVJA 4EL5A 2ZYSA 7MDHA 1PT7A 1VI5A 1MC1A 3DJFA 4JJEA 1P6XA 1WMBA 2BFCB 3E4DA 4WGGA 3OM1A 4FMCF 4X61A 4C1BA 1Z73A 3GLFE 1VLVA 2RHOA 1GTJ1 4BJ3A 1EU1A 1Y1SA 2OUIA 1ZESA 3GLGB 1D2MA 1SUPA 4PYMA 4F5WA 2PA3A 2AA3A 4XYLA 5IBRA 4AUKA 3EY4A 3LGAA 1VYVA 3WLJA 4PLYA 3AKYA 4G1MB 3LQFA 3WGYA 3DFKA 1GQFA 1B6RA 3DE7X 4Q9DA 2ZIEA 4QUJA 3TSWA 1I3OA 5AVVA 2XCTB 1JQ3A 2D54A 2PUHA 4GKAA 4PE5B 1SUBA 2GZ1A 1OLUA 4P7JA 4UASA 3AM1A 2CK3D 3UXMA 1VL5A 3AV3A 4AU1A 2IW1A 5TEWA 3DE0X 3ODGA 1T9KA 2WUVA 4I1IA 1KYTA 3TNYA 5A9RA 1I8TA 4Y0NA 3I6MA 4GFDA 4RH3A 1SVSA 2CLSA 2GRUA 1RLJA 4FGLA 2R8ZA 4LEIA 1OA1A 2IU3A 3SWWA 1DV1A 1GPUA 2DECA 2EJCA 4FFWA 4U0KA 4B6PA 5GGYA 4RORA 1C30B 1QIFA 2EFGA 4MEAA 4UHBA 1KVUA 1USIA 3ZK8A 3LHKA 4JJKA 2YINC 1V1JA 3S55A 3A28A 1KARA 3TIGA 1D4AA 1UDRA 2VXBA 3Q4GA 1S01A 2MSCB 3ET5A 2QL7A 2Q7OE 4EW6A 3VTAA 2XMQA 5JZOA 2GGSA 3V7UA 4DCJA 3RRBA 4IUBS 5FFMA 1GU7A 4P58A 1VRCA 1RLUA 1WCIA 4K9MA 1BMFA 3GRRA 4P7FA 5FPTA 3TFOA 4ZVUA 2DPHA 5KX5B 4LE0A 2VPYA 5EIFA 1WMSA 1E8DA 2ETXA 1AS0A 4HUQB 3DQQA 2VAXA 1P5FA 2Y71A 3RK0A 1KYYA 1XWWA 1QPGA 3EZ2A 1O97C 3EHDA 4S1OA 5J59A 5BXQC 2PYDA 5C7LO 4RFLA 4BASA 3RLIA 3RTDA 3TK1A 4P93A 1URPA 4BNYA 1IN8A 3PHIA 1NP6A 1Z22A 2BFAA 4CLOA 2NM0A 1KJ8A 1MABB 4ZVRA 3MRSA 1CUWA 2AMVA 3NGLA 2CW5A 4J7UA 2G36A 3AYXB 2ZR9A 1MA3A 1NN1A 4X92A 5FBHA 4X1YB 3RU7A 4YN3A 3GD5A 4A6PA 2JFFA 2PRIA 1EJ2A 2H08A 5BXYA 4ZO8A 1DRWA 4X95A 3LCVB 1SY7A 3CBQA 3LA6A 5FUWA 3L6BA 5AVXA 4HVCA 1OW3B 3OKPA 3DLPX 4LOJA 2OSVA 2ZIGA 1K4MA 2O50A 3COPA 2EQBA 1OBFO 1QWOA 2XODA 5KVQA 4WX2B 4KVFA 1ZIYA 2ZYWX 5EQFA 3EGOA 3K92A 3H65A 1SVNA 1RBYA 3HXKA 4G0WA 4IILA 3H9EO 1KMNA 1HDEA 1R1DA 2PZFA 4KQIA 5ALIA 3NHAA 1GPLA 2BFOA 3KZMA 3U4QB 1FSFA 1B8UA 1KQ3A 3EGDA 3WNQA 4ENTA 2XKKA 3AVYA 3VPSA 1OAOA 4YRFA 1BU8A 2W6NA 5ELMA 2AZDA 3U13A 3GPBA 1ZR2A 3D4OA 1UWLA 5TS2A 1V4NA 3H16A 3SIPA 1DRVA 5IPFA 2VDWA 2PSDA 4RJKA 5IXJA 5KTKA 2Q41A 2VNSA 4M83A 5KJFA 1D4FA 2EFHB 4D2IA 1Z39A 3RUPA 721PA 2F3SA 4XCXA 4QG3A 1GTSA 3FE2A 2EV9A 5FB3A 2IY9A 3DZKA 3K0FB 5LQJA 4JBWA 3W8EA 2B94A 2W6PA 5A2GA 2FAXA 1I30A 1X8LA 2BTQB 3KD3A 2ZBVA 3EE6A 4MGZR 3S29A 1K4YA 2HIMA 3I04M 4KAXA 3QZUA 2W0SA 4EARA 1YI1A 3R5XA 4KWTA 4RYDA 3GRUA 3NT4A 1C7RA 2AB0A 2CC2A 2ZREA 3STVA 1AHPA 2Z6QA 2DLNA 3RS5A 4UM5A 2O06A 2E4UA 1W47A 3TIIA 3KB1A 5JHGB 1TZKA 5JRDS 5T64A 4P4GA 3S27A 3X2FA 1XLTC 1JAYA 4EI9A 1R18A 2G09A 2H18A 4WSOA 1I2ZA 2RONA 4MV8A 3RTCA 2X42A 2IX9A 2ECKA 1ZGBA 2OQRA 1XTKA 2VYFA 4LZZA 4C14A 5J47A 1U98A 2NVWA 4OB7A 4AF8A 1KYIA 4KBYA 5WRFA 5GTDA 5E1MA 5GZ1A 1JBQA 5EY5B 2TS1A 1MV8A 4MQEB 1C8LA 1QPBA 2W6ZA 1MVNA 1RP1A 4ITVA 3S44A 2B30A 3Q9NA 1T2UA 3NNNA 3PGLA 4LJ4A 1YE3A 2GM5A 1DC3A 4O5AA 2CLKB 2BAGA 4P7BA 4UTXA 5E6UA 4CMAA 4LTNA 3LFHA 6NULA 1ST2A 4LHWA 3UJCA 3UUGA 1WULS 1QP8A 2FDXA 1ZICA 1G8KA 1YMQA 1GUYA 1DO2A 1K7CA 2GPTA 3CEHA 1WMEA 1F38A 4ZIRA 3FZEA 3CYFA 1IDN1 1U9JA 4NBTA 2BLNA 2DT8A 1AC5A 1AQIA 3EIUA 3IP9A 3Q3JB 1ENPA 4K87A 3T3DA 3SZ3A 1IEXA 5G0TA 1U3DA 2FN8A 3BWCA 4MIYA 1JSCA 4XARA 2MR5A 2FFQA 1BFKA 1DJPA 4FHDA 4V3BA 1P0MA 4KV9A 4N5MA 4KFUA 1G66A 1RSZA 2LUOA 1ZRSA 4ND7A 2WQZA 2QL5A 4O4IA 1JEYA 4KYIB 2Q6TA 1J4AA 3ACCA 4PXYA 1DFIA 3FGNA 1GYPA 1SBCA 5AK0A 2WSLA 4BX0A 3HZOA 5DLPA 2VH5R 1JDVA 4CIYA 2PRSA 4TL6A 2R84A 5JV5A 2R1TA 4RBNA 4FDMA 1PYDA 2QN6A 4OHPA 5DGCA 2X0JA 4Y2HA 3AEQB 2JS7A 4KHZA 2Y4NA 3KCNA 5D3MB 4DY4A 4EY7A 4K8OA 2OHXA 3C5WP 1TO2E 3GLHA 2Q07A 3F6CA 4IZ6A 3BXOA 3UHFA 1QYIA 4N41A 2D1YA 2I66A 3QXGA 4OVKA 5F51A 1EVZA 1CR4A 1E9VA 3F71A 4HQ6A 4R2KA 4TS9A 4U7HA 4BJHB 5U9CA 2OORC 4HDKA 3FPSA 2GARA 5DWDA 3T4UA 3TMYA 3C16C 4B17A 5C32A 5CG2A 1ID8A 2ZUWA 1XVLA 5CXUA 1VKZA 3UTCA 2B69A 3RTAA 1J23A 1KRHA 2YCLA 2GCOB 1JSZA 1W87A 3C3JA 2PZ8A 3TXXA 3VOSA 1K2VN 2IGBA 2FF7A 3KXIA 2G82A 2Q9AA 4Z0HO 4RNDB 5TB5A 1J09A 1FFXB 4B48A 3RSCA 1VJ0A 4ZHQB 5JDCA 1ZRHA 2NVBA 5JXWA 3VAZA 3T0IA 4CM6A 2VP0A 1R6DA 3ZE6A 3A6EA 3WRXA 3DCIA 1YFJA 1YR3A 4OFXA 3R7SA 4W1SA 1JFLA 4JJAA 4GR4A 2OC4A 3WYNA 1Z3CA 3RVNA 1P9NA 2G9VA 3WZ2A 3ROFA 1C3LA 3BWDD 4Q9AA 4C4RA 5I7EA 1YZQA 4FMDF 5EGNA 3WP1B 1UXJA 2DQYA 3O0DA 2YZGA 4R54A 5FLYA 4KR7A 4F9TA 3HLKA 1FA9A 3PGXA 4CMCA 2B5WA 1EP2B 2BGTA 3MHTA 3E1KA 3CWCA 1U3CA 1DDGA 1WDLA 2OVBA 2VNKA 2ZT6A 1SHKA 4W6QA 1Z5WA 5DNVA 5IAGA 1LSUA 2CMFA 3D43A 1EFAA 3LT5A 2JG3A 4V1CA 3IAXA 3UANA 3ENVA 2IEZA 3TX2A 4QNRA 4IDAA 2WKWA 2FW7A 5A7FA 2QWXA 3NYQA 4EI8A 5JZSA 4JX9A 4QJBA 3CVVA 3KV3O 4QPNA 2P27A 4MR7B 3TL3A 4DSOA 2H48A 4RANA 1V9CA 1B16A 2QPLA 3CHYA 2WJWA 2YXNA 2JZCA 4FSHA 3UWDA 1BGXT 2NWQA 3VKWA 1VGQA 3CZPA 5TPZA 3T7DA 1IHUA 1P7PA 1XO1A 3FYTA 2CVZA 4C0SA 5JPCA 3ZDDA 1B0PA 3GRYA 1FNBA 2KLHA 2IS1A 3MGKA 3QMWA 5EL0A 3ILHA 1LBSA 3L0BA 4YJGA 2PQMA 4CI9A 3JQBC 1G4AE 4PX9A 3HCEA 1GVNB 3EPLA 2QRPA 2ISSD 2OESA 3DWEX 2C2GA 4Q3DA 3ZS9A 5LL6P 2YL2A 4A2PA 4MVJP 4QDXA 4BGVA 1ORTA 3CNEA 4EFMA 3DL0A 5JISA 2MTBA 2E9SA 3HI4A 1LRKA 4TMTA 2M6SA 2XQIA 1XFAA 4DWVA 2XITA 1H8EA 1GPH1 3QA3E 4FHZA 2VSOA 4KZKA 3T0FA 2RD2A 1VDMA