2X3YA

Crystal structure of gmha from burkholderia pseudomallei
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
202
structure length
202
Chain Sequence
b'ENLYFQSMENRELTYITNSIAEAQRVMAAMLADERLLATVRKVADACIASIAQGGKVLLAGNGGSAADAQHIAGEFVSRFAFDRPGLPAVALTTDTSILTAIGNDYGYEKLFSRQVQALGNEGDVLIGYSTSGKSPNILAAFREAKAKGMTCVGFTGNRGGEMRELCDLLLEVPSADTPKIQEGHLVLGHIVCGLVEHSIFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOHEPTOSE ISOMERASE
publication title The Structure of Sedoheptulose-7-Phosphate Isomerase from Burkholderia Pseudomallei Reveals a Zinc Binding Site at the Heart of the Active Site.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Isomerase
total genus 83
structure length 202
sequence length 202
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 5.3.1.28: D-sedoheptulose 7-phosphate isomerase.
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13580 SIS_2 SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2x3yA00
2CXTA 1HNWB 1JIQA 4IVNA 1M3SA 5LL6P 1U0GA 2CXUA 5BR8B 4JI2B 1VI5A 1GZDA 1GZVA 2ZJ4A 3FJ1A 1HNZB 1C7QA 1X9IA 2CXRA 3HBAA 4JV5B 4B3MB 1KOJA 2DF8A 2VQEB 2XHZA 4YY3B 1IBKB 2CXSA 4OX9B 4DV7B 3BJZA 3SHOA 2V4MA 5BY2A 4JI8B 3J81A 1IBLB 4KHPB 1NRIA 1X92A 1VI6A 3G68A 1I94B 4LFBB 5IT9A 4LZJA 1NUHA 3FXAA 3OOJA 4K0KB 4X66B 5I01A 1IRIA 1VIVA 2AMLA 4S12A 4M0DA 1JLHA 1FJGB 1VIMA 2VQFB 3QKIA 3J80A 4DV3B 1N34B 4JI0B 4EM6A 4JI3B 5A2QA 2E5LB 4LF6B 2VF4X 1J5XA 4DUZB 2CXPA 4NXNB 1HNXB 1N32B 1XMOB 1HR0B 3T1YB 3BCHA 1JXAA 4AQYB 1XNQB 2UUAB 4JI6B 1IATA 2ZM6B 1IBMB 1N33B 1N36B 3FF1A 1TZBA 2UXDB 2O2DA 5IWAB 4X65B 4DR3B 2A3NA 1MOSA 1Q50A 1TZCA 4JI7B 4DR1B 1XNRB 5FLXA 5LMUB 1TK9A 4LFCB 4DR4B 2XBLA 3Q7IA 3C3JA 1B0ZA 4GKKB 2PGIA 1JEOA 1G98A 1U0FA 2DECA 4DR2B 4B3SB 4LF8B 1C7RA 2CXQA 4LF5B 3FKJA 2Q8NA 4LFAB 4DV2B 3JAMA 4DV5B 2E5FA 4DV6B 1XMQB 1X9HA 4B3TB 1MOQA 3JX9A 2CVPA 4DV0B 4DUYB 4JI1B 2UUBB 3OTOB 2O2CA 3UJHA 2WU8A 2X3YA 4YHHB 4DV4B 3PR3A 1ZZGA 1T10A 3TRJA 4B3RB 4DR6B 1WIWA 4DR5B 4AMVA 3NBUA 2UU9B 1HM5A 3ODPA 5LMNB 1J5EB 4GKJB 1XTBA 2CXOA 2CB0A 2CXNA 4S1WA 3T1HB 2PUVA 3I0ZA 4DV1B 2PUWA 4U6NA 2YVAA 3ETNA 4LF7B 3KNZA 2VF5X 4TOIA 2UUCB 4LF4B 1U0EA 3EUAA 2I22A 2I2WA 3CVJA 1HOXA 2J6HA 2F4VB 3Q88A 2HHHB 1MORA 2UXCB 1X94A 3M5PA 3HJBA 4NXMB 4JYAB 2ZJ3A 3TBFA 3IFSA 4LF9B 3J7AC 4X62B 4DR7B 2UXBB 4X64B 4JI4B 1DQRA 1N8TA 4JI5B 2PUTA 3LJKA 2POCA
chains in the Genus database with same CATH superfamily
5FA5A 5BN5A 1IJEA 4RU1A 4ADSG 5JNUA 4J2TA 3UJ8A 2NO5A 3CX7A 4LCEA 5BN4A 3ZLJA 1NFRA 4MYDA 1Q7BA 4DEVA 3ZD7A 1Y8RA 4BO3A 5A5FA 2ZXEA 3D6FA 4ZEOA 4NF2A 1UPFA 5LYJF 1QO7A 3EGIA 3W6OA 4WKCA 5CA1B 2O5EA 3FUCA 3IDQA 1KARA 3JWIA 4II7A 2E6UX 1OIXA 2LCQA 3BJZA 3UOAB 4B32A 3ZZ1A 1PS9A 3FYUC 2VJNA 1IBLB 1V0JA 1DINA 5KQLA 3GJ4A 1FRVA 2J4CA 1KH2A 4PC1A 1UXOA 4AF7A 5JQGB 4MGEA 3Q9NA 1Q2XA 1CQWA 1WXDA 4F04A 5F9FA 3L4BA 3W8RA 4D81A 3EXEA 3VR5H 3DT9A 2E4YA 1UBCA 3SJ7A 4BU1A 3L0IB 4QHTA 3GC6A 4DA0A 5JRZA 1V9CA 3I9NA 2VP3A 3PI7A 2C59A 4KX5A 1RAEA 1YK0A 3PJDA 1MC4A 1LX6A 3DNPA 4MWSA 3PLAE 2QM7A 4WKPA 1VA4A 3ET5A 3L5KA 1H5QA 3DMDA 4K7JA 1N2EA 2IYYA 3KZVA 4I8IA 1C0PA 1O94D 3WWYA 1IXRC 5HP4A 1RXIA 3BWCA 1RPAA 1YV9A 3QUSA 3FM9A 4FZRA 4G8JA 5LB2A 4R0NA 3ZY6A 1D2NA 1CQXA 3HB7A 3LGSA 5K7SA 3OD1A 1DJOA 3WKAA 1R8QA 1JR4A 3A1NA 4IMJB 3MJCA 2IXDA 4Q3DA 1I4LD 1QLJA 2XBLA 5I7RA 4K9PA 1XLWA 1WG8A 4KN8A 3FPFA 1L5KA 2CZQA 3DDNA 1N2CE 4PFKA 5HJ7A 1IXKA 2RHJA 4FDTA 2RH5A 4BBPA 2NVUB 4TRNA 3R9XA 3DPIA 3G89A 1VKJA 1SXJA 4M9CA 2ABWA 2PV0A 2P8SA 4PONA 5C1PA 1AKVA 1V35A 1XVTA 2BMDA 3EGEA 5J2UF 3TX6A 3M1YA 5BN5B 1QTRA 3MUEA 5AESA 1RQXA 5AIAA 1DP4A 2YQ4A 3DTYA 5TS2A 5AVVA 2Y1GA 4JI1B 4NZ9A 5IKPA 2W43A 2GH1A 4QPCA 3DE7X 2RGUA 3K6KA 4MPPA 5EKSA 1Y8RB 5DCLA 3UYKA 2G1AA 1F2TA 3WHKA 2PSEA 1QIIA 1IEVA 2PSSA 1PGPA 1L6RA 5LIPA 3GMIA 4JL6A 3TRJA 1G16A 4XYLA 3G17A 4DTIA 1IM5A 1ZIOA 3LRTA 4Z4HA 2PL3A 2POQX 3EOZA 4N48A 1Z9BA 4E2XA 2BH2A 1PGJA 3N58A 5KNDH 3OEHD 2G04A 1MXHA 3MAJA 2KBFA 2R6FA 3FSRA 4P54A 1QKKA 2HI0A 1YCGA 3W7BA 3DCNA 3DBHA 4H60A 4EHBA 5JS7A 4LQDA 2FKAA 5CGZA 1MH1A 3CINA 3EXEB 3LAWA 3CX6A 4MV1A 3EOBI 3V34A 3QW2A 4V2UA 1GXSA 2C3PA 5F7ZA 5CA0F 1FNSA 4M98A 1X70A 1RYNA 3GD7A 5J9FA 5JAIA 2OHJA 1SBCA 1VFNA 3OTGA 3O31A 4KN6A 3RFCA 1M66A 3O8OA 4OAPA 2D5BA 2JF0A 2YH2A 4Y2PA 3K6SB 4RK0A 5DM0A 3UQZA 3ED1A 5D6OA 1UKVY 1T1IA 2JGRA 4KLAA 4O02B 1ADBA 2GLXA 1A98A 2V58A 2XVMA 4PLFA 1G8PA 1X7GA 2WWHA 3I5UA 4H08A 4E08A 4F6CA 5BNWA 2YV5A 2D8MA 1MIOB 4FFLA 1RHUA 1J25A 1PW5A 3LQFA 1SOWA 5FTKA 2ZRPA 5EKXA 5HDBB 2X6RA 2OAGA 1JGTA 2R00A 1FUEA 2WMYA 2OBXA 2EG9A 3TLGA 3R9XB 2GR9A 3UHPA 5A05A 1QC5A 1SXJB 1HDRA 2AF3C 3Q2KA 5K1ZA 1KFCB 1Z8NA 4FJ2A 4CTKA 3Q8LA 2BSAA 3AHJA 5C18A 3HO8A 4LI3X 2A6PA 3LX4A 2P62A 3WGIA 3AEYA 1DDIA 1E3QA 1IAQA 4EB0A 4PYNA 4UAUA 1KC3A 1AMOA 1J8QA 1VIVA 3MYRA 4X66B 1LD3A 4KQXA 16PKA 3M4NA 4PXSA 1OV6A 4TKZA 3H1GA 2GK7A 4OY3A 4O0MA 2NTJA 2Y1OA 3F5MA 4HYQA 2VF4X 2OD9A 3PC2A 4LAFA 2JGLA 4R8RA 4W82A 2GN1A 2W00A 2P7HA 5K45A 3H3XA 3ZWVA 4FZJA 3WJAA 1LQ2A 1XR3A 1BCRA 2UZAA 4HRAA 1XZQA 3Q8XB 1J8MF 1Z0UA 3CLTC 1I13A 2XCOA 5BOSA 1XZKA 2C92A 3NAMA 2QUHA 3GGDA 3TMAA 3RS9A 2JCGA 1X1RA 3L41A 4JBHA 2WE8A 4INJA 3DBHB 4QQFA 4QSMA 3K0FA 1A9QA 3QE9Y 1X1TA 1ZJ5A 3KPUA 3FBTA 2D0DA 1E1CA 1G5HA 2OCBA 3QF4B 4BEJA 2CB9A 1CUCA 2B61A 4PRZA 1ULUA 3ZWCA 2IEYA 1A5ZA 1M1NB 2JL1A 3EVZA 3LXRA 1Z5UA 3VNQA 3PPIA 2GF9A 3UJNA 2P6OA 3BQNB 3H8SA 4FGKA 3ZCQA 3U61B 3L1IA 1TMYA 3OKCA 4NZZA 2JS7A 4MS4B 3WYBA 1BS1A 1Q0ZA 2C8LA 4NPAA 3RJMA 4ZJYA 3PDHA 3KJFA 4DV6B 2PY6A 1VCIA 1CETA 2Y1DA 3DVSX 1CJBA 3A26A 2K2WA 1HYGA 3HFSA 4GP9A 4NMLA 1K8ZB 4Y6QA 1HQKA 2ZJOA 5EZYF 1O4VA 1PE0A 4D56A 1XXHE 3N0TA 1XCJA 2Y0CA 5KX5A 2IZOA 1W59A 4IGEA 4PPNA 2CNKA 2FW8A 2MSLA 4S3MA 1YR1A 2B20A 3KU4A 1WS6A 1TAHA 3LUAA 1FDWA 3QFFA 3QRWA 2WWGA 4GWKA 3T35A 3TLGB 3C3DA 1OA1A 4GZ5A 1DBVO 3HYNA 2KYRA 4XIJA 5L95A 1PAUA 3QFSA 3DE3X 3Q0TA 4FGJA 3G59A 4GMKA 4H0FA 1I3CA 1XC7A 3GARA 4KLRA 4LRYA 4NCHA 1FW6A 4AXXA 2BFCB 3KCNA 4KQWA 1FFXA 3MB5A 4TOIA 2XE4A 3QKSA 1AX9A 2DFTA 4QBFA 4HWOA 2C77A 3X1MA 1QO9A 2HHHB 5B30A 3DEIA 1U0OC 1IN8A 3HJGA 3ZLTA 3CPEA 4O3MA 2E55A 2KHZA 4MRAA 5TMBA 4MX8A 4NQZA 1SD5A 2A86A 4HB2A 5CLHA 3CLTD 4W5NA 5CW1A 1C7IA 1KEPA 2BOVA 1I2AA 4PIMA 4RD1A 1JR3A 1DAPA 4DA6A 1BCRB 4O33A 2X1MA 3ICQB 1PZHA 4D4JA 4II2A 2POCA 4LDPA 1VJ1A 4Q6WA 3IQEA 2ODPA 2BGGA 3CGGA 3UJ6A 4TWRA 2C4UA 2OBBA 2R8PA 2YZ2A 2RHDA 3EBLA 2FAXA 3HSKA 4BP3A 2A5DA 3MJVA 3G0BA 4NMWA 1DRJA 3GA0A 1QUEA 4IGKA 2C95A 5CEFA 3PFWO 4A91A 4EAAA 5AR1A 3GRCA 1AKTA 4FWBA 1RACA 1IBKB 3GT7A 4BBAA 4B8ZA 5DHPA 4OX9B 4COKA 1BFDA 1Z4KA 1MT0A 1P2TA 2PRIA 3BSSA 3K7EA 4LHZA 4Y6OA 1CTQA 1KOLA 3Q12A 5A9SA 4UTOA 2I7DA 5EP1A 1L4BA 3N5KA 5H1YA 5EKUA 1AURA 4PZLA 4Y7DA 3O2JA 3RFUA 1YASA 1T1SA 4CHGA 4L8WB 1T5DX 2BGRA 3LC0A 3T3OA 1KMCA 2VTBB 2IX9A 4E1BA 4JI0B 1BIFA 1AKNA 3ETEA 4V02A 4JP3A 2ZWVA 5FFFA 3VTZA 4OFXA 1U7PA 2J3LA 2QNRA 3GJXC 3EVCA 4YCAA 5HF6A 2M6LA 4DCOA 3H5OA 1HDOA 1JSZA 1VRWA 1P2SA 1WMEA 2GAOA 4MVJI 2JRCA 3ZWPA 4AN1A 4DC9A 3H2JA 5EKDA 1TXGA 3PU6A 1IG3A 1YI1A 2Y99A 1M2GA 4RVCA 2VAXA 1AQUA 4PSDA 5AXCA 3QELB 4DEYA 2R5NA 2IXEA 4NDAA 1XZCA 4QQNA 1OWNA 2IKQA 2ZB8A 4V2IA 3VISA 3WWDA 1NPTO 3QKSB 3HSSA 4RMGA 3BH7A 3F3SA 3OZTA 1MA3A 2MSKA 3R40A 4DDKA 2EBFX 3C7KA 1FLNA 5DU2A 2XJ4A 1ECPA 3V7UA 1HYEA 1N8NA 3L4SO 1A5TA 3OZVA 3EA5A 5FI3A 4UDXX 5HUQA 1PN3A 3P20A 1XX6A 4M83A 5HJEA 1V9LA 3ILSA 1D2CA 1NX9A 1XZPA 2WHYA 4MA4A 1LA2A 4GSYA 4X97A 4OGLA 2HF7A 1YONA 3X1KA 5DE3A 4CG1A 2R8EA 2WUEA 1KE2A 3DSRA 4A0SA 2XDQB 1T2FA 2JLYA 1SHJA 1XELA 2VHYA 2ZP1A 3EFHA 4P35A 4KXWA 5E2IA 4A7PA 1NW3A 3OFNA 1KP3A 3AUUA 4MW4A 4R1MA 5HKLA 2Z0MA 4EF4A 8ABPA 1CEYA 1K9SA 3PR3A 7REQA 1OWMA 3AEQA 3DYVA 1V4BA 3AQIA 2X0FA 4C88A 3ED5A 3HXOA 3DDSA 2V9ZA 5CCBA 3ZCVA 1RQLA 1E99A 1GV1A 1NJGA 1TAGA 2B4KA 2QRKA 3IV7A 4YRQA 1XBTA 2D3TA 4Z9FA 2AVDA 1NW5A 3RTDA 3U3XA 2ODNA 1NXQA 1RCTE 2P9QA 1QV9A 2D2VA 1KERA 3CLHA 2MYTA 5EMNA 2R87A 4MOWA 1CZRA 2NUBA 2JLCA 2HM7A 4U7PB 4ER7A 1V6SA 4FQ8A 4D3ZA 2AEEA 1RXCA 4BZWA 1DZ3A 2OV8A 3LUBA 4F60A 2FVYA 4HYTA 1JHDA 1KNQA 2H4ZA 2J32A 4C0SA 3N7AA 4LVNA 1AN9A 4PIVA 3PQ6A 4YRJA 4EITA 4F8JA 1MC5A 2IYSA 4ZVNA 3KB1A 5ALFA 4WJZA 4YJ3B 4G5OA 3U3MA 4DCMA 2PKEA 2V1XA 5F5XA 2WT9A 3CSSA 5AW9A 1U0SY 1X2BA 4KFTA 4MR9A 1BCSA 4LWQA 1YF3A 1Z75A 4S1PA 1MIHA 1HNZB 1JF8A 2JARA 3L2OB 2XF2A 1N75A 3CNLA 5FNZA 3T0FA 4R1NA 1C2YA 4D6PA 1Q92A 1SU8A 3L5OA 1VPTA 4FDAA 2YMLA 3NM5A 1F9AA 4HF7A 1VB3A 2W4IA 3QXGA 3A1VA 1W4AA 2HV8A 3BH0A 3H6GA 3FFTA 4V1CA 3AIMA 1T3SA 1LJLA 1M6EX 1Q5PA 1E96A 2GZDA 4NJMA 2C00A 2HA0A 4BMYA 3ETHA 4BX0A 5I5GA 1QLWA 1YBVA 2ZEJA 3KB8A 3LFUA 4B3IA 2PJRA 1RSZA 1NW8A 3AJDA 1LLQA 4B35A 1GTSA 1W1UA 1DIHA 1L6IA 5CNJA 2A9JA 2AFHA 2PYZA 1QZ3A 3BL5A 1Z5WA 3DP9A 5IVKA 4BIIA 3WMWA 5JH7A 5AKEA 3IUJA 1JQAA 4ZPXA 3U7QB 2C0PA 7REQB 2WTAA 1R9MA 3Q5DA 2AYYA 4W9RA 3X1DA 4RKYA 4EHJA 2W83A 5EXEA 3TJRA 4OFWA 2G28A 2PA3A 1OASA 4OXRA 3TR0A 5G0WA 3HVJA 2R8XA 2J3IA 3PBKA 3S3TA 3UT0A 2HMSA 2XGJA 1XWFA 4XUDA 3S2FA 2WQ7A 1UIRA 5AOAA 1KYYA 2WIAA 3I1JA 4UUBA 1NLMA 1N2BA 2XCRB 2PZBA 2ZIWB 4ROTA 5LYYA 4F84A 1R6UA 3ANMA 3CKMA 2BFFB 3PX3A 2X7JA 2C4VA 4GX0A 5CT8A 5HKAA 1KP9A 2ZSDA 4LYYA 4R1PA 2J4DA 1O6ZA 1SKYB 2W8BB 3OFSA 4UTZA 4L2IA 4WGGA 5ILGA 3V4VB 1NI3A 2Q0QA 3KSDO 1QE3A 1N8SA 3TM5A 4BVHA 3IV9A 2C3MA 1ACJA 2HMUA 2VSNA 3IQHX 1H9BA 5JD3A 4M0KA 4KE7A 1L7AA 1PV1A 3DL0A 4MYCA 2X2EA 4JNKA 4W9MC 3KOYA 1YJBA 4DGSA 3LC1O 4LXQA 4MR9B 1BCSB 4DJFC 2X1HA 4PQRA 2RH8A 1R50A 3DO5A 1N5JA 2OORA 3NEAA 3O90A 3VZBA 5A0TA 4J1QA 2JEOA 5KINB 3IEXA 5DULA 5JNLA 2QMOA 2FFAA 1ZI8A 2WG0A 2UZ1A 2XKAA 4WFQA 1NM5A 4DQLA 4MVWA 4MW7A 4RESA 3ZV6A 5HM6A 3RAFC 5HGJA 1KJJA 4FW9A 4ZTBA 4Z3DA 2IHYA 2ZWOA 1UFKA 1Q22A 1WDKA 3AONB 3R3SA 4BB5A 1M2JA 4FXOA 1FQWA 3DO8A 1YJCA 3OZDA 1CQZA 5THKA 1NG1A 1LTHR 2ZI4A 3RQSA 4DEXA 1UXKA 1D2RA 1GZ7A 2PEYA 1KI8A 2PH7A 2J1LA 3KKNA 5ESXA 1FFSA 2QROA 3O73A 3KE9A 5LOVA 1YI8A 4ZRMA 4ZDIA 4MQBA 3K72B 1CX9B 3RYTC 5GADl 1H22A 4L4RA 1IY9A 1OFUA 2V3VA 1R6BX 1TUGA 2HNKA 3NKFA 2A1UA 4DLKA 1WOMA 4JI5B 5BWNA 4J0FA 4MR8A 3R7NA 4Q15A 1U90A 3UN1A 1LFDB 1YHYA 2A9OA 2VHTA 4JYMA 3I83A 2GZHA 2JFPA 5HJ5A 4DGQA 1CY6A 2G83A 5P21A 2R66A 3G8DA 4F72A 3CUEF 1W581 3PUKA 2LUOA 3T3NA 5JCOC 1Z74A 1PYGA 1OY1A 1SQ5A 4Z0TA 1DIRA 3ZHZA 4H18A 4BNYA 2WLSA 1SG9A 3FOZA 1CVIA 1HRKA 3KUCA 4D0RA 5LB4A 4KIGA 3N1UA 1O77A 3PQCA 2F64A 1PO7A 1COWD 1NJ8A 3LBNA 3OZXA 4UDOA 3EIQA 1J99A 1UK8A 3P0JA 4OQMA 3WYGA 4A1OA 4RF5A 5KU7A 5LU8A 1FFAA 5AOVA 1EUDB 1ZUHA 4B4OA 2PCLA 1O6GA 1IC6A 4WLNA 1BD3A 3SVTA 1BJKA 2MSCB 3ZCXA 5ITZB 1ZA2A 2MU1A 2ZKLA 4TVBA 3GG9A 2AG1A 3HV0A 4GVPA 2G8NA 3KZXA 2GPJA 2JD2A 2JLSA 1E2NA 2ZTLA 1QRSA 1G7TA 1WUTA 1I1QB 2TMYA 1GQQA 2MSNA 1AGNA 3FAKA 3SY8A 2ZCJA 3NPMA 4GGOA 4HAYA 3FF1A 4IW3B 2GO1A 1GA1A 3HWX1 3HBMA 4QJ3A 3AR9A 2PMKA 2QX6A 3G8CA 3KQKA 4N4AA 5FTWA 2TYSB 4FOSA 5IAOA 1T8TA 1NF2A 4DNFA 5JXWA 1J0AA 2WIDA 1J00A 3OE4A 1SEPA 3P27A 2P41A 2IWRA 1RHMA 3VPFA 4DIUA 5C51B 2LXNA 7MDHA 1J2UA 2IZ0A 3GEDA 1E6LA 2AK2A 1Y4SA 4NKRA 3RJZA 2UVQA 1J20A 1YQDA 1CXZA 1H65A 3RVNA 2C7GA 4JLAA 2JIRA 3N2NA 3EWNA 3M82A 2J3JA 1D0VA 1VL6A 1YU6A 4MR8B 2WJYA 1GCOA 3EHDA 2F1IA 2EJWA 1DBWA 1B1CA 1EP9A 4ZZ0A 4BVLA 1ZD8A 1ESEA 4O63O 4QELA 4PCUA 1Z2CA 3EZLA 4XRRA 2X8WA 4JSYA 3PT9A 3V2HA 5HFAA 1Z12A 3O4VA 5BXYA 4KQGA 4N41A 4Q4DA 4N6GA 2NO0A 5KX5F 2X19A 2HMVA 4IJVA 4I8XA 3KWJA 5AKKA 3IJ5A 2C4HA 3MWGA 1FDIA 1M2KA 3D4NA 3O6VA 2F1OA 3GLIA 3G1WA 1ENOA 2UYQA 2VNAA 3LW7A 4JZKA 4BLRA 5E6SB 3H1TA 2HU5A 2CC2A 2PQ2A 3DXYA 3MB8A 4ZQGA 3FRJA 4M7WA 2O52A 4BLUA 3MUOA 3ETNA 1I6LA 4QU0A 1MQSA 1H94A 4NV0A 3PL5A 2QX4A 1NLUA 4CTNA 4E5PA 3X1YA 4QVKA 1JDSA 1LRLA 1AN0A 1AS2A 1KI2A 2AEFA 3MIZA 1OROA 4P38A 1IQUA 3E58A 2OE2A 5CGQB 3U3RA 5AW7A 2BHTA 3TNLA 1OQAA 2ZSAA 3HP4A 4IQ0A 3Q8KA 3DAPA 3ESDA 3FPCA 1G60A 4A0RA 2DHEA 4F93B 1TVCA 4QXQA 4DREA 1QO0D 3VKFA 1KJQA 2FF7A 3FMFA 2GYWA 3NO4A 2PANA 2W11A 1R3UA 4N54A 1A72A 3VZRA 1T5BA 1KEEA 3FTDA 4I5FA 1H2FA 2X4IA 4IDCA 3AFOA 2I8CA 3HXLA 1M34B 2Q3EA 3EAGA 3OPYA 3ZE7A 5EP4A 4E6EA 2AJCA 1SVMA 4N7JA 2AC4A 4WK4B 3CW9A 3WWZA 2VZ9A 5K6AC 5I9NA 5TF4A 5ENVA 3MMSA 2HU8A 3CX3A 1FRFS 3CISA 1XD2A 5J1TB 2DJ5A 1DG9A 3T61A 5DYWA 2B94A 5DX1A 4EG4A 2E0IA 1TCVA 3G8BA 4U2KA 2CL7X 1Z45A 1R18A 2OBYA 3EZGA 1RW4A 3DOIA 3JCZA 2EC5A 1KQGA 2P3OA 1DNPA 2NM0A 1PNVA 2B1QA 1PT9A 3L8MA 2OOKA 4LRQA 1CZNA 2GO7A 3IOYA 2VDLB 3HWWA 3EZ6A 4XI9A 1M2VA 1NRJB 2WEKA 1VRCA 3T52A 5HOEA 1WXXA 5IC4A 3DGFC 1AUPA 4FFBA 4OHFA 1GRCA 1XCGB 3L7CA 3SX0A 4MP3A 4D99A 5IT0A 1IH8A 5I6DA 2BM1A 1Y37A 3H9JA 4H27A 2J3QA 1HNXB 2ZREA 4P1ZA 1RLIA 1TZ2A 2DUMA 4ETWA 2ZB3A 2NWQA 2ZDQA 3A1WA 3IAHA 2HK7A 3PFCA 5FORA 3T7EA 3WDMA 1FUUA 2EIHA 2JANA 2RI0A 4ND1A 1RR6A 4EDFA 3PXDA 1XNJA 1EVKA 3GFRA 4WLUA 1BN6A 1BEUB 1KDPA 2VOJA 2VSXA 2CNWA 5K0GA 3LUDA 3KKKA 5A4JA 2O1EA 4GAEA 2NQ8A 2XCTB 1KSGA 1XCOA 2C04A 4U02A 4LWOA 4NU5A 2ZIXA 3O92A 1GA6A 1OGYA 2OGSA 2XZTA 3I8XA 1SGWA 4HLCA 4Q1DA 4A2QA 3S44A 4WA7A 4KXMA 3H2SA 3N07A 5JECA 4U7TB 2KI5A 2W2LD 4M37A 4MB0A 1EIWA 2CEAA 1BFKA 3D4OA 2B0CA 3PC3A 5ELXA 3P4XA 4P32A 2YY6A 1QH1B 1ICEA 3D6UA 3DKKA 4URHA 3CWZA 3EPJA 1KI7A 1L4NA 4OXXA 3MYYA 1BQEA 1KO4A 1U94A 2G72A 2XYQA 3CZAA 5B6IA 2YKGA 1ACLA 3OM8A 4ZQEA 3OCJA 4G0YA 2BCGY 4KQIA 4OH7A 5HMMA 1NC1A 3ZJ5A 4Y1GA 3Q7SA 4E6PA 1KL7A 1WSDA 4BPBA 2VP4A 4ZT3A 2CJYA 1PR4A 4L8YA 1LBHA 1GDTA 1X1DA 1JBEA 3CC8A 4OI4A 5D01A 3UAYA 4AKSA 2AMYA 3HYRA 4I5IA 1WX1A 1LH0A 1XLTC 2ISSD 3KHSA 1Y8QA 4M8IA 5K0JA 2FPWA 4ZAXA 1BXGA 1S2DA 5EMJA 1JU3A 4FZVA 4F6LA 4IV5A 4CODB 1BGVA 2R2AA 4B2PA 2WP8J 4R2LA 3PC4A 5LUBA 1T9DA 2YWEA 2QBYA 3ER8A 1GPAA 4HYYA 3PTZA 1Y7HA 1F8GA 1RAAA 3DVRX 4J0CA 4CEJA 2DHRA 4RLSA 2DFVA 2H8GA 5AXAA 3O7MA 3QVMA 3G2MA 4MI3A 5CYFA 4RTSA 3NT2A 3K6RA 1EWVA 1Y89A 3F0TA 3L8HA 4RMHA 3UJDA 4CE6A 3D3JA 3M2TA 5AW1A 2PDAA 1EXWA 4BQFA 3G49A 2HSDA 3OZUA 2GF2A 5GVSA 1A9TA 3V4ZA 1G20B 2PG3A 2PGAA 2PZKA 2CL0X 1K7EB 2WSBA 4HWPA 1LVUA 2VTVA 3C98A 1U8FO 1NVTA 2ZYRA 3CGWA 1XVUA 5EQFA 3BIJA 3RFFA 1NRIA 2PX8A 4JJ8A 2RHGB 3RTAA 2IPNA 2ODTX 3K9QO 3U37A 2G9NA 3KT8A 4Y2XA 4L5YA 2B25A 4WLEA 4IO0A 5E6UA 5I4CA 5KYXB 2V55B 2X9LA 2X3UA 4P5PA 4EL5A 2IHNA 4LBVA 1P18A 3DE6X 2OXTA 4RCZA 2I4LA 5IJXA 3BGSA 2IFTA 3DMNA 3IMKA 1TAUA 1TRHA 3PXBA 3VVMA 3T3HA 5JH7F 1SH7A 2AI3A 4IR7A 4IYRA 3F3YA 4AL4A 1LCIA 2IUTA 1AT1A 3DFIA 3KBOA 3GLGE 3KTDA 3LC2O 4RGYA 3SQOA 3L8EA 1UAYA 2OB1A 1GAWA 1W88B 2P67A 1KTVA 3DOCA 2ECFA 1D6SA 3P9RA 4HSEA 4EA7A 1BMTA 4O2AB 2IV7A 1QDLB 3TQRA 4RKRA 1YZ3A 4B85A 1WPGA 1M5RA 3WB1A 2I3ZA 2P7IA 5D1NA 3LBAA 1Z29A 1YE5A 1IONA 1W34A 3OM0A 2MT9A 3GLRA 4GKBA 2PJUA 3D4PA 4PAOA 4A9AA 1XJ0A 1PL0A 3NM6B 4RHTA 3A58B 3WIBA 2NQTA 3RVMA 1UJ6A 4PGHA 2FRVA 1DE0A 3JWGA 4OYYA 1W93A 3K16A 3MUFA 1G3MA 4F92B 3VH3A 2DBZA 3QVJA 3C6QA 3F8WA 2C2KA 1R16A 1CFJA 2A0WA 3UA3A 1MENA 4ZRDA 2EP7A 3G7UA 2I4RA 3CZCA 3K8YA 2WF5A 1MGPA 1DB3A 1VG1A 5HCIA 3F9IA 2GGSA 4HNTA 4HS4A 1DTSA 5KTSA 4G4SO 3DZ8A 2FN4A 2FJ0A 2H18A 1ZIXA 3IELA 3F96A 2YJTD 3PPXA 1YOBA 1LPAB 3SZMA 1SK9A 2QYTA 3R8CA 5GJBA 2HMTA 5EIAA 1YJAA 3KSRA 4HDNA 4PLGA 3ASYA 2O50A 5DM2A 3AIOA 4O4HA 3GEBA 3GEEA 3KKOA 1H1DA 2YC2C 1PK7A 4URZR 3UBMA 1VIYA 4PRYA 4R1LA 4E09A 2PWYA 2NO9A 1WVIA 3HDQA 3KNZA 3PFFA 4YRGA 1PQUA 3EGDB 2XMDA 3EVFA 3I1YA 3KTAA 3RDPA 1TEHA 2RHOA 2EL9A 3IUPA 3LD9A 1HFJA 5A5GA 3KJNA 1R66A 1IZYA 2ZBPA 5KOHB 4JB8A 4YT5A 4F38A 1FB5A 5E9WA 3WGZA 5KTMA 4RVFA 4NZOA 5LOVF 2EQAA 2BE9A 2X0JA 3PUIA 3FJOA 3HN7A 3QTTA 2BBWA 4Q47A 2DPHA 4AF8A 2AA3A 1NUAA 5K0LA 1XRJA 5DW3A 3SYMA 4MW9A 3BHMA 3H4MA 1MP0A 1NLYA 2RHLA 4MUBA 2W8ZA 4B4KA 4RNDB 1CUFA 2Q46A 4B83A 3MJDA 5BYKA 2YS7A 5JANA 3CZ4A 4V0OA 1GN9A 1P5HA 3E2IA 3NWEA 4M1EA 4AMGA 2GHTA 5ALGA 3DG9A 5EXXA 1J70A 1CRZA 4Y6LA 2ODQA 4HO1X 2EQBA 5T6BA 4R0VA 1C3EA 1R37A 2CXRA 4X61A 4L51A 5GJWC 1FMFA 3E7FA 1LJUA 3IKMB 3TDMA 3WJ2A 4RH3A 5CBPA 4LKOA 1LNZA 3EA0A 4DJAA 2BFBB 4GPD1 3RUHA 1H9AA 4DCPA 5DGIA 1TF2A 3T7DA 4H1WA 1W48A 5KQRA 4F4HA 4UVHA 1BROA 1PUXA 1P3JA 1T4DA 4G85A 1LPPA 1PJTA 1F06A 1GL6A 1QYXA 2AN4A 2BFNA 3BCUA 2VI5A 1KZHA 2G6TA 3UV7A 8AT1A 3WLEA 4DPLA 5FWNA 2JEYA 2JGDA 2V7PA 1T8UA 3DT8A 3HXTA 2D6FA 3PRJA 2R48A 1AB5A 3QIAA 3QPBA 1XHLA 1F2UA 4R8VA 4FP9A 4URVR 1XL1A 2RSLA 2VSFA 4I9GA 1GILA 3AEKA 1FYVA 2W2PA 4HMPA 3EQ8A 3F7TA 1JHQA 3ABOB 4E2FA 4HDNB 1HX7A 4FZ5A 3CEPB 2ZRGA 3TPCA 1Q0UA 3KJXA 2ORIA 4UULA 4OYHA 4WBXC 4ZVUA 3LV8A 3HU3A 4QM6A 2BI7A 3DD1A 6PFKA 3G2LA 5AMXA 3UOGA 3P2IA 1EI9A 4YASA 5IKOA 4L3OA 1DKLA 4ZTUB 4UM8B 3KTAB 3R41A 4MKRA 4DUPA 2DR2A 4UHHA 2EFJA 4NRDA 2WTBA 1NVWQ 2QL6A 3COPA 1IQRA 1NHWA 3EEFA 3SZGA 5K4GA 5LQKA 4XJSA 3IVGA 3G5LA 4FOTA 4J07A 1FMCA 5EIBC 4LIPD 3I01A 3ZY3A 2H1CA 1YRLA 4ON9A 2FZCA 3KSMA 1OYOA 2HLDA 4WVLA 3BFVA 3RS2A 1QIGA 1YB1A 3C5VA 5L7TA 4KGZA 4G4JA 3V1KA 2GAIA 3BMOA 1BS2A 1QHHA 4BZXA 2WIKA 3IO5A 4OVKA 3W3AA 2APJA 3FE2A 4BVJA 3KKZA 2QAGA 4PNZA 1CQPA 1HPLA 1TMKA 3KC2A 3CLKA 4Q4JB 4X1YB 1DJPA 2B4QA 2QT1A 4XOIA 5JNWA 3IILA 4KR0A 1FDTA 1TCCA 4I1RA 1SB9A 1JG6A 3ECAA 5DO9A 3CNBA 4EHIA 4G0VA 1OAKA 1E18A 1E62A 3MERA 4NSNA 3IJPA 1KI6A 1XB2A 2R8YA 5CNMA 2W4MA 2AIRA 3EXHA 4JH0A 5L7WA 1G5TA 4CQMA 1JDTA 4LEIA 4ID3A 4HKTA 4Y0AA 2VDVE 4CKXA 3D9QX 2PUWA 1L3BA 4YUWA 3KJQA 1WW3A 5EQTA 1H6AA 1Z06A 4JCOA 5CG2A 4Z54A 4DNPA 1B42A 3AZPA 1HTBA 3SX4A 3L0OA 4LRSB 4XQ9A 4QSHA 1J7KA 2ZS8A 5D3MA 4LY9A 1IN6A 1I7PA 4EYSA 1VDZA 3ZPXA 1KY2A 3KUXA 1ZHOA 4BB0A 2OVBA 4A0QA 5EHXA 2FHSA 3B3FA 3MJHA 5AOCA 4ZAYA 3DMRA 4GRDA 1QR6A 1ZSYA 5LIRA 5TRTA 2P75A 1DEKA 1EZ1A 2VWPA 2MINA 2IV3A 1XJ5A 5EUMA 1N2XA 1NC3A 3D1JA 2BKAA 1G0OA 1REQB 1IB0A 3GLQA 4J6EA 1Z0IA 1L5LA 5IH7A 2XLBA 4JZYA 2F62A 5EWLB 1V6CA 1AZTA 2MIIA 2ONKA 2WWFA 2CY0A 3E9DA 3OKPA 5EIBD 3WOVA 2CVFA 3ZS9A 4BL5A 1Y3CE 4YK7A 2JC3A 4RJTA 2H07A 4NYJQ 3JYQA 4U9UA 3WP1B 2CHVA 1UWLA 4BNVA 5IJ0B 4FLFA 4QTTB 4HQLA 1P4GA 4U2BA 1OZHA 3QV2A 3I4LA 5I7AA 2Z04A 2FSSA 2KE5A 3NHAA 4L9WA 1T9ZA 4UM7A 4DG9A 1E8MA 4CLOA 3CR3C 4PC3A 5IW8A 4ZALA 4CR6A 4QDJA 1M8PA 5KWJA 3U2QA 3WX0A 1V1JA 3N8DA 1XRNA 3N8GA 1JSCA 2CYCA 4DLUA 4R2WA 3FNQA 4CMIB 4G1CA 3V5NA 3J80A 3W9BA 1QZTA 4GP6A 3CVVA 1W4BA 1Z2PX 4CGZA 2B98A 1A96A 3QG5A 5KCMA 3QOYA 4EY5A 2FZVA 2RKWA 3ORSA 1ZYUA 5HPYB 2WI8A 2AMJA 2I4MA 4TWZA 1S3IA 3W8DA 4L74A 3BG5A 1E9SA 1GSOA 2QRUA 3FCSB 4B4WA 1Z83A 1VZ2A 3GUZA 3OCCA 5H5JA 4TRJA 4YAIA 4OH1A 2VJQA 5ER6A 4XDZA 3VGPA 2IITA 1MDBA 4L6CA 3EFOB 1EWKA 4HBZA 2X5NA 4YJHA 3QGMA 4N39A 4QPNA 4TMTA 5AHRA 5D3MB 4J9VA 4BKRA 1AU9A 1F4VA 2JFXA 3FHLA 1O96A 1PG2A 2I4NA 3CUVA 3NIDB 3EPHA 4L75A 2NU9B 3V1UA 2P3SA 2ZYIA 5KIAA 4NZNA 4LVOA 2WSLA 3IMGA 4CTOA 1W85A 3LRXA 1BA2A 4YJ2B 3N2LA 3HWRA 4DUGA 4GBGA 3UFXB 4CU2A 5GJCA 1FC0A 1P8AA 4KK4A 3CRNA 1GT91 1T9HA 3W3AH 2GN9A 1ZR4A 4AQ7A 3WDKA 4CU5A 3TQHA 4LKRA 4NTZA 2JJ8A 2NN3C 3MAGA 2XMGA 3OPNA 5L45A 5AK0A 1JIIA 1CDZA 2EFDB 3O83A 3PE6A 3LQ4A 4WY2A 4CUKA 5CVCA 3D7LA 2G0AA 3CBQA 4DMHA 2J5KA 3CBGA 1FU4A 3PHJA 1K6EA 2R6R1 2ZYSA 4JA0A 1YFZA 3MNFA 3PYMA 4LWPA 5IYZF 3VKVA 4JT8A 4AP6A 4ZWNA 3QA9A 1VE7A 2Q3DA 2VUTA 4P9NA 4HDKB 4D3FA 1Q0LA 4N82A 5LKRA 2B8EA 4IRMA 1D0SA 1RE0A 4WBNF 4CLOB 1EZZA 2P9HA 4DNXA 1QF7A 1T5HX 1U3FA 3M9WA 1YHNA 4CDGA 3EC2A 4B09A 2DM6A 1VXOA 3QTBA 1JYFA 1H2ZA 1OLSA 2IP4A 2QUBA 3DW1X 3EG5A 4DJEC 2JKVA 2RH9B 4D57A 3EF3A 3W2HA 3ZDFA 3ZU2A 4W6ZA 2LCIA 3QHPA 3P8ZA 1B6TA 1NXPA 4Y0NA 4MW0A 1GQOA 5JS6A 1CYEA 4IS2A 1G4HA 4K28A 2EKPA 4CG0A 2H08A 4MB2A 2MOKA 4QVGA 3ASVA 3R0QA 5IF9A 4IM7A 4JJKA 2IKSA 5DLPA 4YJHB 1G4AE 3CWCA 2F3SA 1WW8A 4WXPA 1X1QA 4XFJA 4MKIA 5CFMA 1LBIA 3ID6C 1RLJA 2EW1A 4RTNA 1EFHA 2NUAB 3KKPA 1QVRA 3L6EA 3WMRA 4K3UA 5JWRA 5HRCA 5A0FA 3UMMA 2D4HA 1MJHA 1LU9A 1Z08A 1T13A 3A9RA 2Y8EA 1YA6A 2PSFA 2R6HA 3OJEA 4JLOA 1ZSNA 2XBUA 3W9YA 1N3YA 2BD0A 3Q87B 4DWJA 2OAEA 1FDVA 3OPMA 4EHAA 3NATA 1FZQA 2BF7A 2BT4A 1E2LA 3B70A 3C8DA 2XT0A 5MGBA 3BMQA 3PP8A 4XWWA 1QIDA 1XEWY 4KKVA 1Q1QA 4PBSA 2NV6A 1CK4A 4JDUA 2BTEA 1WMDA 3CO0S 2GCEA 1HG1A 1X38A 3Q3VA 5DYYA 1FYWA 1F48A 1T9KA 4LHSA 3R6WA 4OF4A 3SR3A 4EG7A 1E2PA 4NAHA 5EWMB 1YB6A 4BQEA 1NQAO 2Y2UA 3TLMA 1Q1BA 1QYRA 3AETA 1XNHA 3SIRA 1FJ2A 1NR7A 1G21E 2ZSJA 3MIIA 2VDNB 1P9OA 3GA7A 3T06B 3N8NA 4DR3B 2JJMA 4ZMRA 2A9KA 2QTNA 4GYKA 4M22A 4OIFA 2QSUA 3HYLA 5I9MA 4R51A 2ZE8A 1NKSA 2J85A 4MVJA 1R8XA 1F20A 1SZJG 3KR2A 4G1FA 1QIJA 3R7SA 2ACVA 1OLSB 2RHHA 3HY4A 3Q1LA 3H2IA 1U0FA 2FDCA 1NZDA 3EF1A 3JSXA 1VLJA 3U4QA 1NN5A 1P77A 3CLUC 3UHFA 1UF9A 4OATA 3RUPA 4KPGA 1QX3A 3DE4X 4GSKA 4DA9A 1UAAA 4DXDA 3QF7A 2QYSA 3BERA 2ZDGA 2GAAA 3U44A 4KHZA 1ARZA 4KFUA 4G4IA 3TKLA 4N0DA 3KVNA 4NFHA 4RJ2A 1GPJA 3Q41A 5JDIA 3SDZA 2JAHA 3SP1A 4CMHA 4UNPA 2Z2YA 1PLKA 3KL4A 3ADCA 3LTEA 3ZV5A 4FMDF 1KAHA 3I52A 3WGNA 3THWA 1ZZGA 3PCRB 5LA6A 2EZ9A 2PRKA 4TZKA 3HM9A 10MHA 4P3YA 2HYDA 4GGMX 4GX1A 1WZNA 2O1WA 2VEOA 5GM1A 1EYZA 1XK7A 4CEIA 4OKSA 2F3PA 3E0QA 1F5NA 4C22A 4JJAA 4O4HF 1BDHA 5HQ3A 2VATA 2ZIFA 5LR6A 3FZYA 4DYVA 1QRDA 1BDJA 3OQBA 3HDTA 1SU7A 3JQRA 4B46A 1UFQA 3A05A 3KB2A 3RAPR 1JRLA 1QF9A 1RQGA 2FMXA 1VSVA 1Y1PA 1YJQA 3B2QA 3C87A 5ALNA 2G9QA 3B1FA 3RAGA 1A5SB 2GZ1A 4QGFA 4TTVA 3UGKA 2LD4A 1WKVA 4XPIA 2PM8A 4OQDA 1N8TA 3NWJA 2IS2A 2HK6A 3P1JA 3PNSA 2AHRA 2X4LA 4GT1A 3TQIA 3AG5A 2QZSA 3FLMA 3OSUA 2RH4A 3D5EA 1NT4A 3ABRB 3G9ZA 4LJAA 4JUFA 2DJIA 3R7WA 3UMSA 4BMVA 2F3QA 1X8JA 4YMLA 3VNUA 3L7IA 1A2KC 1OT5A 4N5LA 2JIZD 4RIGA 1VI5A 2RGRA 3G2JA 2X6QA 2WUVA 3FTNA 4RA6A 2GARA 2P2ZA 1HE8B 2VXYA 4QARA 1R4MB 3CLUD 3CZ9A 3SJZA 4F1WA 5KNBA 1NVDA 4QM7A 2B82A 2P2CA 2CXSA 1B0PA 2A67A 2B30A 2CHEA 3QM1A 3TK1A 1GM5A 1JQJC 1SAYA 1Z8FA 2H1IA 1S0UA 2VJPA 3G5TA 2ZK7A 1E77A 4IG4A 3DWGA 1NLZA 3HABA 3TNDA 4EJMA 5IDYA 1FIUA 4NU0A 4D82A 5AVSA 2ZSFA 2VZ0A 5U1PA 1WABA 2O8FA 4M0DA 2WU4A 3BH6A 4IUDS 1KFJB 4Y2RA 4XASA 4BKMA 5CDHA 3I8SA 2H7XA 1WCYA 2NZUG 3EXG1 1Z25A 4WKNA 3WHPA 4EG6A 3TTYA 2YFQA 4LF6B 4GH5A 3OHSX 2IEGA 3P2MA 4XKJA 3GPLA 5IJ9A 3THWB 3M6AA 3BGVA 4FSDA 1OE0A 4E2ZA 1SZCA 4QEDA 1DV2A 2Q5LA 3Q7EA 3KHTA 4C7JA 1G42A 4CKCB 4B81A 4B1FA 5I4KA 4QNMA 4MWOA 1T2NA 5BVGA 3IX7A 1NMSA 3LE8A 5HIKA 3L0YA 2NW6A 4J2HA 1V1RB 5IN5A 1A7AA 2X22A 2UAGA 5BV7A 1CBUA 1E92A 3U3ZA 3C48A 4Q03A 4Z0PA 4UPEA 2RG1A 5K2OA 5F3WB 1GUDA 5EESA 4IWNA 4UEQA 2FSVC 2FWJA 5M29A 2ORVA 3UUGA 4EQ6B 1C50A 1XAJA 3ZZMA 4RULA 2OYSA 4N65A 3N2IA 3BD7A 3BFKA 5AVKA 4E5UA 2GEJA 1D2HA 2IIPA 4NYIR 7GPBA 4BWYA 3GU3A 3F5SA 2EW8A 2R7NA 1OR8A 3MS4A 1NUUA 3TUIC 4L6AA 4XPIB 3RS8A 4E33A 4XWGA 4UBJA 3ZHVA 2P6UA 2YIJA 3ASZA 3ROZA 3TGPA 2XKJE 3FGNA 2GD0A 3JTMA 3PHBE 3VAYA 1Q0TA 3WL6A 3JX9A 3R7WB 5JSFA 1AA6A 1DQYA 1XO1A 1R00A 2YIDA 4ZGGA 4FXPA 4F9FA 2FFHA 4MYUA 2W2NA 5EYPA 1QHYA 2O2HA 3QPWA 2F00A 3FHJA 5CIWA 3ICEA 4QJ5A 3LQ1A 1UZLA 4OQYA 4ZAFA 1KVSA 2JLXA 4B5KA 5BW4A 3U4AA 1NLFA 1OMOA 2CB0A 4CIBA 4ENVA 4J1TC 5HILA 5SYMA 1U1CA 3I32A 1X6VA 3U7FB 1XFAA 1WB5A 1G8JA 1Z4QA 4DC1A 5IBCA 1VMKA 2LRHA 2QQ0A 4ABTA 1G6HA 4C03A 4HPJB 2H16A 1S9DA 3LVFO 3TLBA 4LJ4A 3AJAA 4D9KA 1D6MA 2VDKB 4HWKA 4BGVA 1JDPA 2GD2A 4UM9B 5GZ1A 1PZFA 3MPUA 3U9LA 4EGQA 3VI4B 2ZJ3A 4I9UA 3P96A 4CR7A 3B5IA 3QITA 2C2XA 1ZWLA 4FYKA 3WVNA 1BSVA 2XYHA 4PRLA 4KV7A 2ACWA 2PIAA 1E79A 1EE9A 3DKPA 2G76A 2Q3MA 4QYWA 1JDBB 5BVGB 2I3DA 5EHZA 4R2IA 2ASEA 2KPOA 2KLHA 1JVNA 3C39A 1O97D 2W2TA 3OT1A 1JLKA 5AJZA 2IHJA 4QDOA 3QWBA 4HX2A 4Y18A 3MBKA 2C7OA 5FAKA 4WZAE 2NXCA 5KNBH 5FO1A 4AWXA 4BQSA 1T2AA 4JX9A 3BIFA 3X1XA 2WIFA 4CF7A 4XTCS 3V4SA 1I4DD 1R2QA 3DZBA 1A2OA 3JYNA 3MGAA 1RXYA 2DBQA 3DZJA 3DTNA 2J7PA 3BWVA 4JJ4A 4REOA 1N7JA 2OLEA 3T5CA 4AJ9A 5JCXA 3RJ5A 2ODAA 4BLQA 1RZVA 4QE3A 1ZOOA 1J0DA 1L4MA 2FLWA 4RVDA 2BHSA 5MN6A 3B6MA 3AB7A 4FHZA 1IY2A 2RGAA 1DIBA 3ZH2A 1VIMA 1YQ9A 3H7IA 5BSHA 4OHWA 3O2SB 1HTWA 3U5ZB 4EM6A 5CX4A 2G06A 1UDWA 1RPZA 5JRDS 3VXKA 1NMEA 3ILYA 1L9XA 3C1AA 1M76A 2CDRA 3L1HA 3PA6A 2B7LA 2ZRJA 3U7RA 5CLJA 4CTJA 2A5YB 1E7SA 3HJRA 3IE2A 4QDXA 1U0HC 4H7DA 4JXKA 3GT0A 1W5BA 3RQIA 4KXYA 1RMTA 1GTMA 5C46F 1PFVA 3SE7A 3VPDA 3LYUA 1JEQA 2AW3A 2QD1A 1DS6A 3CF4G 3PGA1 2QQGA 1JKJA 1GVHA 5JSHA 1DAEA 1BKSB 5LMUB 4L72A 1OYWA 2ATVA 3I9OA 1P0IA 3E53A 3EYWA 1EWYA 3OLXA 1SC3A 1YQUA 4M7PA 5IP5A 1ZD1A 1F8UA 3B89A 1B7GO 4P3NA 4KR2A 1VG0B 1TJPB 4E07A 2I6UA 2B8TA 1N6RA 3LQYA 3AVWA 4MPTA 2OWDA 3A3KA 1VYHA 4XWOA 2VNIA 3C8ZA 3OUTA 3QMVA 2WQZA 3HS3A 1SIWA 4YXWD 4LXHA 5C8YF 2O8CB 4H3SA 4D79A 4DRYA 1UKEA 1KI1A 2B1JA 2AG5A 3DDCA 2YDXA 3P9NA 4HH4A 2PLRA 3NBQA 1WU7A 1D8TA 2RGNA 1SVLA 5LBTA 3VC2A 4C4YA 4D9IA 5TIIA 2QV0A 4BNKA 2IODA 4CFZA 1A7UA 1DSSG 3MTDA 2GPTA 1VYTA 3IAXA 4P3PA 3WGTA 1B8PA 3BBPA 4IJKA 5TJ9A 1QH0A 3GMTA 4ARCA 3DBRA 5LCXA 1P0PA 3PXGA 2BY4A 3ER6A 3INRA 1G59A 2G1UA 1TCBA 2CNNA 4E0BA 2OFOA 4RELA 1QIEA 2GNPA 1FK8A 3NKVA 2PKCA 5CJ2A 3DZDA 4MEBA 2FPPB 1XCMA 2XOEA 1GFIA 3E5RA 3RYHA 1X8XA 3M5DA 1YB7A 1GD1O 4AS2A 3PA8A 2D2EA 3HR4A 4QKQA 1CUGA 4XX0A 3RYIA 2ZI3A 4UE2A 2DY1A 1HYHA 3LLMA 3HJBA 4TRRA 4U3JA 2QM8A 1DKUA 3FKQA 3OTHA 2W9XA 3A6FA 4FD2A 3DGEC 1BWRA 4R83A 4HWTA 5AJUA 1W75A 1N6LA 1U2PA 3LUGA 5KYKA 3ERCA 1M2OA 5I7VA 1Y5IA 5BQXA 1MJGM 2D5LA 3RIXA 1XAHA 3LJKA 4Q3CA 3OESA 3A1FA 1Z28A 2AC7A 2BKEA 1IBRA 4DLSA 5BMVF 3O9MA 1H2WA 3D8HA 3GJSA 4WECA 1E0AA 5HDQA 1RXEA 2P6MA 3GZTB 1U5BA 3JYLA 5FBWB 1RXWA 1LWOA 4GLFA 1QVVA 1J90A 4UEWA 5CVVA 1OFGA 3TXAA 4BCBA 1ISIA 2VN8A 2PK3A 3LVBA 4H0CA 1I2DA 4MZXA 4PZEA 4Y1FA 4C14A 5MF6A 4X7RA 2QTHA 1O94A 3NBYC 5ICCA 2PGOA 1KZ1A 2E7ZA 2G63A 4S2UA 5A71A 4CN8A 2VK2A 4W4TA 1SUFA 1YBMA 3R9IA 1OW3B 3QVVA 1DO2A 2R4TA 2WW8A 3AYXB 5EXTA 1M73E 5LDDC 4DCVA 4WK0B 4YV7A 1HT0A 1T2CA 3W7VA 1C9JA 3ROTA 1TMOA 4L9RA 2X9VA 2SICE 2C0CA 1C3OA 1YMQA 3B3AA 4QFMA 5DHTA 1LQUA 3OY2A 1A69A 2J5RA 4NK4A 1H23A 5CLIA 4YDRA 3KZKA 1H05A 1Z4PX 2CFIA 4GW3A 3FNBA 4DPMA 3Q7TA 3FWKA 1II8B 1NZFA 3VU8A 1X7XB 3A3OA 3CZMA 3ME5A 1FU8A 3A3YA 3W06A 4RTQA 5FOQA 1XNQB 1TM3E 3LKDA 4KPEC 4PC2A 2JIOA 4PYRA 2VHEA 4DIEA 5CM2Z 1T8PA 3AI7A 1UJ5A 4PGMA 3VHQA 2PX4A 4MJ3A 2GZ3A 2JFNA 3RYHB 3JQFC 4F3RA 3NOVA 2XUJA 3F2VA 1VECA 2QT9A 1VG9B 3CE9A 3KQMA 4R2KA 3RYIB 3BJIC 3HYTA 3HVKA 1QHXA 3DQZA 5A7GA 4G0XA 3F6SA 4MVJF 4HZGA 4TTIA 1WHSA 4X90A 1Q6YA 2BKUA 2IRWA 3A1DA 4IFBA 2XMCA 2FG7C 4WOKA 3U0BA 2Z95A 3OEHA 1UOQA 5K05A 1RM3A 3L92A 5KUTA 2H0RA 1CRPA 1G6OA 3C3WA 4DVGA 1P7PA 2ZITA 3HLYA 3W8FA 5JEDA 3S1SA 1AQLA 2X42A 1I32A 2OOSA 3LX8A 1QWSA 3RHTA 3NHUA 3IDZA 1VLZA 3AHHA 3NTXA 5GOZA 1HC7A 1EFPA 1Y1TA 2OFFA 3TDKA 4EUFA 1A82A 2QP3A 1OIWA 5T3YA 1XZEA 5BT9A 3EQ2A 4C0XA 1T2VA 4G0MA 3ZGXA 1VCOA 4RKFA 1HDEA 3V1LA 4BWVA 4EBBA 3IMFA 3CMMA 4IFEA 5H81A 4PBRA 3UHOA 1PVOA 4FSHA 2O6LA 4AMVA 3ZC3A 4O4JB 5FI0B 2VPWA 1HMYA 3DVAA 3MQ4A 5LA6F 3COVA 1Z2AA 2IBMA 3BEDA 5T8KC 1MX3A 4ZYYA 1KMQA 1FPQA 4YONB 3D02A 4JOCA 3LHSA 3ODGA 4L78A 3ZWNA 1R5BA 3EVAA 1B4DA 2G9ZA 4DLTA 1CZLA 3NMUF 4DBLC 3ETDA 3O0DA 3O95A 2I22A 5LLSA 2XMBA 5DT9A 4CMAA 4O5OA 4JLWA 4AK9A 2DBYA 1TE2A 1KOGA 1ULAA 1MX1A 4L57A 1PYOA 3RHSA 3ZV4A 2Q45A 2XKKA 2REQA 1NF3A 5G4KA 3O8DA 4MUYA 2XB6A 3OH8A 3ZCRA 5KYWA 4IH4A 3EIEA 3F3MA 1AF4A 1SKBA 1QE0A 4UNQA 3HXMA 3M8KA 3A4TA 1VSQA 1RJEA 5EWJB 4A6EA 1J24A 2IH2A 4H6PA 2J4FA 4F6RB 3AOEA 3KR0A 4REQA 1PJAA 2D1SA 2RK6A 3I6MA 3LVRE 4KXUA 5ALKA 1QKJA 2XA9A 1RI3A 1WZCA 3A9VA 3AESB 1T9AA 2P2YA 3H6KA 3SN6A 2ECKA 1XZHA 4YX9A 3HACA 1SELA 1GGVA 2MYPA 3KE8A 4XARA 4BRZA 2ZYAA 5KYTA 2A5JA 1G8HA 2V59A 4KOAA 1EEXB 1FQKA 2Q29A 4BLOA 3UKOA 4TT3D 1U1IA 2ZQ5A 3EARA 5FQNA 5F4ZA 2HT1A 4RFVA 2I80A 3V4RA 3A7DA 5ETJA 1D07A 1HF3A 2ZOSA 3ZBUA 2IHKA 3PSHA 1P81A 2Y1CA 1PTJC 5BO5A 4A36A 3KV1A 1BEEA 1TEVA 2AMLA 1L1RA 2JJ2A 1V8DA 2NV2B 3W6PA 2PR7A 2J0UB 3L07A 3ZHXA 4D42A 1SXQA 2GDJA 3B78A 1T29A 3JQ8A 3RVLA 1GARA 3TCNA 3ASUA 4J0IA 1JJBA 4PG5A 1VHJA 2I6QA 3IALA 4BFZA 2FWIA 3S2IA 5DNCA 3QQ5A 3WRXC 3PQEA 4OB6A 3S2ZA 3R8XA 1S3GA 3MQ2A 3U7HB 3ZQ4A 4MAMA 4BFXA 4IL5A 3DVAB 1KXZA 2VTEA 2RB5A 1E9CA 1O5TA 2G07A 2GI4A 4TYMA 4YRKA 4I3HA 3WA7A 1GG8A 3HKDB 1IMOA 4I4NA 3N6RA 4MGYR 3MN1A 5GOTA 5H70A 1RXVA 3L01A 4TLAA 1UPTA 4G5SA 3WRYC 4ZHQA 4C7OB 3NVDA 2O0JA 4QO8A 1XJCA 3IO3A 3BHNA 3ANXA 5HZGA 4H4EA 3KB6A 1F1JA 4TV9A 4D5EA 1Z6ZA 4IIEA 2FHPA 1WE2A 3M4JA 2PXAA 1C9KA 4F91B 5EJ6A 1VP3A 1AQNA 2ZRFA 3NIFB 2CSUA 2HXGA 2IS4A 5BP7A 3OT5A 4RFSB 1IN5A 1ZD4A 4U7JA 1N3IA 1X39A 2YOGA 1U9CA 3BWBA 1Z2OX 2JA1A 4KQFA 3EGXA 4HTFA 2KX7A 1K5GA 4RJJA 3KUDA 4R3UC 4Y1RB 3OTOB 3ZY4A 5FPYA 1MQ9A 4FBGA 3W4JA 3BB4A 4REQB 4FMPA 3OQOA 3D2BA 2IZZA 1B41A 2ZUWA 1L4YA 1VTKA 4UXIA 2FQWA 5FBHA 1NE2A 3K4PA 5DX8A 4WN3A 3NHSA 4QOGA 2IIVA 3WLHA 2FMFA 4KN5A 4O4LB 3H1BA 3C3KA 2F6RA 1VHDA 4C9BA 4MR7A 2ONCA 5C52B 1TPYA 1U6IA 1LDEA 4IH9A 3HNRA 5TV2A 3PUVA 2PMFA 2LZ0A 4TLDA 2FPKA 5BPFA 1QMGA 2XMSA 3U13A 3UXHA 4A2CA 5DK6A 3THOA 4C2UA 2NXEA 2WJJA 2G5GX 1SCIA 4IEIA 2C9OA 3BS4A 3EIHA 2GLTA 4ESEA 5IX8A 1DAKA 2DXIA 3HXKA 3EVEA 1QGYA 1JLLB 2DQZA 1WMBA 2FKNA 2NVOA 3D8BA 3FDZA 2NT3A 4NU6A 4IDPA 4KR3A 2RMKA 1P73A 2EEPA 2W7TA 3UB4A 1NVAA 1W35A 4QPZA 3RF7A 3ZGZA 5AUNB 2C4NA 1JTEA 4HN9A 1UMCA 2OFXA 2X2OA 3DJFA 1BKYA 1D04A 2J3KA 4LX0A 5EJ4A 5HTKA 5IFKA 3EEOA 1GU1A 1G2OA 1L5QA 3LX6A 1TA0A 2V1UA 1DHRA 1RBYA 4RTJA 5A1TA 2C8JA 1P9RA 4NCNA 4TV9B 4MAAA 4I9FA 2HLHA 2CF5A 4CF4A 4FBMA 1TOAA 4ID9A 4RS4A 1BO6A 5DLDA 1GQRA 1Z88A 4P98A 4QYTA 1HEUA 1IVYA 4AWBA 1COZA 3ACDA 3C8UA 5JBNA 5JAHA 4I50A 4IHKA 5FWAA 1M6VA 5DB4A 5H68A 2J0QA 1GQYA 2JVJA 3VI3B 1Y9EA 4HEHA 4U7GA 2NU6B 3LK7A 3ZCUA 3D3QA 5TNXA 4P4LA 4G2NA 3P9ZA 4JGGA 3OSZA 3SXJA 5AVXA 5INTA 4OEHA 1NYQA 4JLVA 2XWBF 1SC9A 3K53A 2YJ5A 2NSYA 3LL7A 4AG6A 1N34B 1OZAA 3KOXA 4LVCA 3EVNA 4HDOB 1N0UA 3SEFA 1EWQA 4AIRA 5THXA 3ND5A 1PV2A 2OZLA 2WJZB 4LPSA 5KYVA 4CNQA 1L5GB 3K9GA 4ES6A 2OM6A 4URWR 3JQAB 4GNRA 3UY4A 2XIJA 1DOAA 5TMDA 3K1AA 1H4VB 1NURA 4NE7A 2R79A 4RSMA 3AQ4A 4LJSA 3BD9A 3ZDRA 2QGNA 5CFRA 5F9HA 2QR2A 1XHEA 4HH1A 1I8TA 3NCTA 2PVSA 3GL9A 3R5XA 2M6SA 1A2BA 2A7QA 2IOFA 3QNWA 1D4FA 1LY1A 2QJOA 1BKDR 3WLIA 2FG5A 2G25A 1EM8A 1G98A 3ELBA 1C8VB 2ONYA 2Y05A 2IY8A 2P6NA 4LK3A 3ZIUA 3OJCA 3RRFA 4RE5A 2Z08A 4TQGA 1DX6A 5EHQA 3ZWKA 4TQAA 4D45A 3D3WB 4MUGA 4OLAA 2JKYA 2BMJA 2NZWA 1THGA 3N74A 5FA6A 2ZRKA 3VYWA 3NX4A 5JUWA 4RHEA 3CUSA 4TVSA 1UMCB 2I71A 3M3HA 3NS7A 1HE5A 1N2CA 1QAOA 2H1WA 3AUJB 1EAYA 3K5WA 4BQNA 3GZ4A 1NMZA 2KM1A 3Q6IA 4K6OA 3AB8A 1N7IA 5B3AA 3GEHA 2PWPA 1P80A 2G09A 1YR2A 1GAJA 1NNSA 1PQYA 3IJEB 3KQSA 8MHTA 2PS1A 2FX3A 1L8LA 1Z26A 1R0KA 4HLUA 1G3UA 4WDRA 5KTOA 1K6MA 2D0IA 1MXFA 5JJCA 5F2OA 2WJHA 2XXBA 3AU9A 3LMKA 4JJ7A 3B60A 4IHQA 2V98A 3IPCA 3LT4A 4AROA 4MHOA 2DKOA 4PQYA 4LWZA 2MHCA 3P5BA 1VKZA 4OU4A 2Z9DA 4I50B 1NW4A 2A58A 2ANBA 4TPKA 4R41A 3OMLA 3U60B 1PVVA 3SYLA 1G2IA 3QYFA 3NJ8A 3FMIA 4ZT5A 4YYEA 2RI1A 1JA9A 4WINA 4GOLD 1F9EA 5EE9A 3JD3A 4Y9TA 4EW1A 2G7ZA 4ZIRA 3RSHA 2WDPA 5ALHA 5CFLA 3O8LA 4TWBA 1DEAA 3B9RA 4Z99A 2QM0A 3B9BA 3BE6A 3KD3A 4Q9KA 1JIXA 2W2QA 3QX3A 1E5XA 4KO3S 4E21A 2VOEA 2C61A 3K1AB 1RCFA 2J9XB 4ZCRA 5F64A 4LXGA 2Z43A 4OMDA 5JNRA 1RVV1 2ZRAA 4IO1A 3SC3A 1H8HD 1KHHA 1SXJC 2JW5A 2WM3A 3QSGA 3DLCA 4GNKA 4U4AA 2O8VA 1XTZA 2XDYA 5EC8A 5ALMA 2AG6A 4V0SA 1F4LA 2H7VA 5EERA 1ESZA 1IRXA 1ABFA 2QX7A 3BD6A 5K6TA 3PX2A 2J5QA 2R1ZA 3L7MA 1E9AA 2HXYA 3OF5A 2Z2JA 1QP4A 2G5TA 4N0PA 1ZP6A 2FWMX 2AE2A 1ADJA 2FPGA 2XNJA 5CT6A 4H7KA 3MTAA 4ILKA 5BOVA 3DAGA 4YDSA 2WUFA 3JVUA 1ZI9A 4P3XA 4WEOA 3TLXA 4EI7A 1QG0A 2WPDA 4C6RA 2PUCA 1PK9A 3K5IA 3S1LA 4CLDA 1JHMA 2CVOA 2VDWA 2DWPA 4RE6A 3GGJA 3MCAA 1GFSA 3WICA 4FFDA 3GVPA 1ZRNA 1G38A 2Q2WA 1EH5A 4G1EB 3EFBA 2AK3A 3HY3A 5EHIA 2ZUEA 4CKBA 3OU2A 3CRRA 1E7MA 1VHWA 3WO1A 2Q41A 1QGOA 5ES4B 3JATB 4H1HA 1HDCA 5H83A 2W71A 1ILWA 4B8WA 1VE5A 1XALA 4W5TA 2QRGA 2V6JA 4H59A 1Z34A 5CPBA 3M3DA 5KB3A 3N2ZB 1IUOA 1FVHA 3QWHA 4RTLA 3WOHA 4FS3A 1Z38A 1UKCA 3OCVA 3GFBA 2FW1A 5BSGA 2XXAA 1FNBA 4M0EA 5FLXA 4Z1MA 1JFVA 3SIXA 2H51A 1VYVA 3H9EO 1QVWA 4IVRA 2XVXA 2WFLA 3WLLA 3I9JA 3JQ7A 4DAOA 3TINA 4ZV7A 3I72A 5AK5A 1H8ED 2PT6A 2IUYA 4MVXA 1KMHA 4KTVE 2ERXA 2VPIA 2NUTB 3MS2A 1IY1A 1SXJD 5FADA 4C2AA 3OKFA 1L5NA 3ITNA 2R00C 4QGBA 4RV9A 3OF2A 4FWIB 2VUSA 2W98A 3MVEA 3GUVA 2XCLA 4XSGA 1XTRA 3EZ7A 4G67A 5NULA 1VPWA 4MLPA 3NC4A 2NYUA 4QPDA 1TAQA 2C1ZA 3LUKA 1Z6GA 4WERA 1G2PA 1CEQA 1A9OA 2IEDA 3FWHA 4ZOBA 2W2XA 4DLWA 1GLNA 4NBUA 4CCSA 6NULA 4I1PA 1V26A 5I3ZA 1LRJA 1Q1ZA 2VLBA 2H4WA 1X0XA 1GZ6A 2YZGA 2DTDA 3RB8A 4BV3A 4BX8A 1TRKA 4FSXA 4UBLA 2OV3A 1KQFA 1HDIA 4HQOA 2ALJA 1I2MA 1XDDA 1KGDA 3GH3A 1IY8A 2YY7A 2AQKA 3MK31 3K0KA 1XXHA 1Q1EA 4PY2A 2O23A 4KYTA 4RZHA 3I9MA 2ZSEA 1EK2A 3ANTA 3GRYA 2WWWA 1FF9A 3ZK8A 4D3YA 1OJLA 1XZAA 1XZNA 3D3KA 3HRIA 4U7HA 4W1QA 2VDWB 2B1RA 4G0OA 4DXAA 4M46A 1KYZA 3A6PC 4P7JA 4I19A 4E5YA 2A3RA 4G0PA 1F3LA 3BTSA 3HEMA 2ZRLA 3I2JA 1RJDA 3RAEC 1QP8A 1COWA 2XW6A 2Z9BA 1XZLA 3U4DA 4I7EA 3FSEA 2HSGA 4BNXA 5KZMB 4E11A 3WKDA 3OPVA 1CJUC 3RIYA 3RC2A 3LG2A 5EKTA 4E5SA 1GO2A 3MLAA 1EU1A 1P60A 1ISRA 1LW6E 2IU6A 3BA1A 2IPAB 3ECSA 3OZ7A 4XD7D 5BV8A 1F8XA 2VPQA 2V0CA 4EGSA 2WQ6A 2XXAB 2DPGA 9MHTA 5CITA 2E37A 3VDQA 2XRMA 4OUDA 2B8JA 2XUIA 4O6VA 4P93A 2GRJA 2WFLB 4G01B 2QMEA 4BCDA 5K0EA 2E89A 3AILA 1ZC3A 3KOOA 4H0NA 3U1BA 1DAOA 3TB6A 1E2BA 1EFCA 3IHLA 1Z0DA 5J58A 5JZSA 5CH5A 3WYCA 1U5CA 4CM6A 3FY4A 2ZBUA 4YTEA 2PGXA 5IHPA 5CHEA 3M6VA 1XSEA 5CLQA 2QK4A 3WADA 3QEKA 1EVEA 1OFIA 4RFLA 4BLTA 3ZQUA 4ZVTA 3HSYA 3RG8A 3AV0B 3W9UA 1BDBA 2JAPA 1PJCA 3AR5A 1SPBS 1DOHA 4ITRC 2YS6A 4M6WB 3EN0A 1J23A 1ZHFA 3IAFA 5ALDA 1IHOA 2PPVA 3ZH9B 2Q0HA 1EEHA 3AJ8A 3PUJA 1CF9A 2YR0A 2O2IA 4X93A 3T1QA 2DSTA 5T4FA 1WMFA 3TTSA 2R7KA 4IWYA 3GLFA 1XPRA 1CWUA 5KBYA 2QEQA 4HQRA 3UMRA 1J8VA 2EJBA 3W6ZA 1T6YA 3KJZA 1GIAA 1PL7A 2BFEA 1XXHB 9ATCA 2A14A 4EKYA 1XP8A 3VVCA 7ADHA 2FVXA 1PBNA 2EP8A 4F97A 3S8EA 3DMPA 4BBJA 1QZZA 2F9LA 3A6JA 4I14A 1AD2A 2BTOA 1BDMA 4ZHQF 3WGJA 1TTPB 3OWXA 3A27A 2WJPA 2QI9F 5F3RA 4HAIA 1USWA 2FDXA 4UBMA 3WG9A 5CMLA 2Q3FA 1J06A 2PKRA 3VQTA 4GMFA 2G9RA 2P2DA 2ZR7A 4E4TA 4Z4GA 4CV3A 5LNK6 2OG1A 3CXUA 1LDBA 2PE5A 4TV8F 4C4TA 4LS3A 4J29A 4ZYVA 1UC8A 1E63A 3HKEB 3ANNA 1CIVA 4UCQA 1ZEJA 3VNRA 2XBMA 1J56A 5IZ4A 1YE3A 1CEEA 2VJCA 1SU6A 2EGGA 3RROA 1W96A 3ET4A 2DR0A 1QO0A 1UDRA 1WMSA 3AY3A 1HK7A 4QXMA 4JMPA 1L0BA 1QHNA 3FSGA 4HPWA 1DIAA 1SWWA 2BP7A 3A4VA 3CPHA 3HBJA 5ECWA 1TDJA 3DDZX 2XF8A 3CKKA 1DL5A 2FEMA 3FFBA 3NU1A 5TQ2B 1R12A 1BVHA 5ICFA 5I9BA 2VQ6A 2IGTA 5JWHA 1RYBA 1YI0A 2PIDA 1K8RA 3GT3A 3KKEA 1GLGA 3FDFA 3LP6A 1FYXA 4HRXA 3NORA 4LYGA 5AM5A 1MAVA 2JI8A 1I3MA 3TLYA 3MAAC 4H9GA 2O8EB 3DLHA 1ZEMA 5B1IA 4BNDB 3FZNA 3GAFA 1L1EA 4ZICA 1SRRA 3WRVA 4FKMA 1ZH2A 1NL3A 1DEXA 1XTKA 1NW6A 1ZLYA 5JNTA 1QPZA 1UXJA 4KZPA 2FPOA 1VXRA 2FQQA 3G3EA 2D1TA 3NC0C 2Q1UA 3O7WA 2AF4C 5ISMA 3A3PA 4LRWA 4P4UA 3PRKE 3CJTA 2ESRA 2PT5A 3D43A 1NVVQ 4BNNA 2X6TA 3VV3A 4KR6A 3HO1A 3RHFA 3BRWD 1QNLA 2ONZA 3PXXA 4BVBA 3FOCA 5C5EA 3CEAA 4N0EA 3ZE1B 3IPRA 3SICE 1Z8HA 3D81A 4BNUA 1TKBA 2IOQA 4I5DA 4OA5A 4DYHA 3H8WA 2VVTA 2WSIA 1NNLA 1NVXQ 2ZRCA 5HHTA 3TD2A 2ZYGA 5JSQA 1G66A 2K7FA 2A5LA 4KNVA 1AM4D 4LTDA 3ZHBA 2J9RA 2O7QA 2WAAA 2PKWA 3CUUA 3KIPA 4GOXA 1TJNA 3RUCA 2J87A 3H8JA 3KELA 3N0XA 4HAZA 4JLSA 2HLPA 2NSJA 4M9SA 4D8XA 5H8WA 4XDGA 4DPKA 2WD8A 1XT6A 1U8XX 3I09A 3IC5A 3R3JA 4HMQA 1Y34E 2FMHA 3EF0A 2NNLD 4HNAA 4D3SA 2VQFB 1KEWA 3BRSA 3MWLA 3DBOB 2UZ0A 1R4AA 3BL8A 3KKLA 3L8CA 4GBJA 5ALIA 4JVLA 1I7DA 2ZCUA 4MWDA 1JKMA 1P1FA 3DXXA 3LVQE 5EMLA 1MZVA 1E7RA 4IV0A 4ML3A 1DUIA 2BZ0A 2KS6A 1YHZA 4WLFA 4KIJA 3ZD8A 2W2LA 2O07A 5K6AA 1GL7A 3VSCA 2OBMA 4CL3A 1JWLA 1DKPA 3DOJA 4GC9A 4JIGA 4PHGA 1BHQ1 4Z0NA 3RC3A 2QD3A 3MCVA 3T3PB 3G1UA 1YB2A 3A6LA 4LQCA 3EEBA 3IBYA 4KFSA 2IXGA 1NVBA 2W2VA 4M8NE 2PRSA 3CEHA 4PPFA 5ELLA 5F12A 3RH0A 5JISA 4DR4B 2D00A 4N3NA 3LCUA 3V3TA 4KBYA 4AP5A 5HWSA 3AP3A 5BYAA 1QK4A 5DNAA 1IWPB 2YC4C 4NP6A 4JBXA 1E89A 4PW0A 1FTQA 2NXJA 4JXXA 1GJRA 1SU4A 2Y1LA 3MRVA 1QQ5A 4W1SA 4RHXA 3ZTWA 2EP5A 1P4HA 4D44A 4B2YA 3KZ1E 5F76A 1JHXA 1RXSA 4QYSA 1UPXA 4AJEA 3TZEA 3PEEA 4NCJA 3LDAA 1H2EA 3OFND 3QPCA 4V0KA 3ZOZA 3AF3A 4DXHA 2X0KA 1Q77A 1V6AA 2GUWA 4R69A 1ZD2P 4V0ME 4B4DA 4IJMA 1NSYA 3ZLBA 1E1KA 3F6RA 4PYJA 3WL8A 2I03A 4BFVA 1L5MA 5U9CA 2X3FA 1WD7A 4F1JA 1EA7A 3FFAA 4GPTA 2JGAA 3B1JA 4LTNA 3VZQA 5EJEA 1FCJA 4RVUA 2X13A 1CY8A 1PNQA 5CDUA 2X8JA 2CSXA 1WTCA 1QFZA 1Q1NA 2XCUA 4MYRA 4DLRA 1ZM9A 1MPXA 3F98A 4JLDA 3W2EA 3KSAC 5E1DA 2BDEA 3R2JA 2GCOB 3G0IA 3ZI7A 3IUBA 2VP5A 2O14A 2BIFA 1X2EA 2I34A 3Q2OA 4DIKA 1ZCZA 1OWOA 3D8TA 3MOIA 3RKUA 4KGVA 2ZZNA 3Q9SA 5D5QA 1KRWA 1KAOA 3U19A 2C7VA 2PGJA 2Z8XA 3TF5A 3DL2A 1Z7YA 4AN4A 4HX5A 2H1LA 4GEGA 4GOND 3GNSA 4N5IX 3ROPA 2CLOB 3CH4B 3JAWA 2QRJA 4K6HA 4C7KA 5ILOA 4KL8S 4QWWA 4MYTA 4M9XA 3PJGA 3TL6A 2ZJ4A 2YV1A 3DB2A 3N0WA 4JV5B 3HCFA 1MAAA 1TKAA 2BMFA 3MPOA 2PQ0A 3H5VA 3RD5A 2WRZA 4F11A 1NP7A 3PENA 4F06A 2WILA 2A57A 1JR6A 4OGWA 4BO1A 2H2FA 2A78A 2BZSA 5HBGA 1HFWA 3LCMA 3NGLA 4XUCA 3E27A 4Z9YA 4NARA 3RRZA 3S2GA 3SJBA 4B3CA 1UC5B 5ARCA 1XG5A 4YQEA 2AL7A 2IP2A 4E5MA 1W87A 4F2GA 2NO1A 4WSOA 2PUBA 2GKGA 3B82A 4NWIA 4TTPA 1NQVA 5F21A 4YRMA 3NDPA 1NASA 5HRUA 3FUVA 1P5JA 1FVOA 3V33A 3V1TC 2P11A 2Z2XA 4EECA 2QMUA 4K9RA 4J4BA 2YNMC 4MUAA 1Z2DA 1RRFA 2ZLBA 1F2VA 2G71A 5LBIA 3KQVA 5F5LA 4EFMA 3W8EA 1P62B 2ES4A 2QLMA 1Z6YA 1GSIA 4EG3A 1IVNA 3IA7A 3FROA 1AVTA 1EP3B 5D5HA 5JPCA 4DCJA 4LSWA 4AUEA 1GUAA 3L1UA 4ND7A 5JSYA 4W7SA 4UREA 4QGAA 4GI5A 5GONB 5B1HA 2DBVO 2ZTHA 2B83A 4FOOA 4DCGA 3L77A 6REQB 1GKYA 4AKEA 3L0PA 4MS3B 3V2GA 3MTJA 3QVKA 3KX2A 2BGUA 3D8UA 3FWYA 1A76A 2R68A 2ZAMA 3DD5A 4LZAA 1O4WA 5J63A 2DBRA 3DHYA 3E8XA 2O2SA 3KKMA 4TL7A 3CN9A 4HDSA 1THZA 1DRKA 4XIIA 4HQFA 4K9QA 4YVFA 4N7RA 3CX4A 1PT5A 2JLBA 4Z4CA 5JAPA 5KYNA 4GPBA 4S0XA 3NM4A 4MS1A 1NW9B 3QPVA 4PSKA 3Q0EA 3GEMA 3RNOA 1ZPDA 3V4PB 1TO6A 4GL2A 1SVKA 4WTOA 5BSEA 2YFKA 4UARA 3JAWB 6LDHA 2QQEA 2FSGA 4A26A 1ZVJA 2FE4A 3IVRA 4DJ5X 5BWLA 2AD5A 4J0EA 3GIDA 4RQAA 5DN6D 4X44A 1O6FA 4YMVA 4I4TA 3P0FA 3EJ6A 5L6LB 4QX6A 4BNHA 1XOIA 4FGLA 4V03A 3LWZA 1C1DA 1Q7GA 3UCXA 4EGAA 4ND2A 1SURA 1FXWA 4TM7A 4MO2A 3Q8WA 3TZ6A 3E1GA 2VL7A 3BREA 4HDRB 1K7YA 3GLKA 4BIMA 2IEBA 5BSTA 3T9CA 1P7ZA 4JELA 3K1ZA 5M2QA 1CVRA 1T3ZA 4LV8B 4RUKA 2HKIA 4NG5A 1V3UA 1HO3A 2XWPA 1QWOA 2HZBA 2XB8A 5DPMA 3F1LA 4CMCA 5JEEA 4HTAA 5L4SA 3EZ2A 2YNMD 2GN8A 3U4CA 1HSZA 1JZTA 4C0QC 4Z7JA 3CRW1 3GZNB 4L4UA 3BE5A 4LE0A 4LQLA 4LC9A 1TTHA 2QTWB 2HHLA 4WY5A 4BQIA 4CWAA 5HM8A 4XCVA 5C4MA 4FCWA 2UVDA 4PWZA 1D4ZA 1AGXA 2AD1A 2WM2A 4R4JA 2V3CC 3KBBA 1ZM3A 1GCGA 1U02A 1Y6JA 4WHMA 4ZAWA 3UV6A 4XIYA 3UWPA 1I9GA 4XA8A 3HCWA 1H2YA 1MOPA 4Q12A 3RS3A 4DDWA 5FNVA 1JPVA 2JFHA 4CIDA 1MA0A 3COJA 4M1MA 3K5PA 3NANA 4PAQA 2E49A 4EYKA 2GJAA 1ZK4A 3EYAA 3DZIA 4IYJA 4CM4B 5EXDA 1N1MA 2W37A 3SQXA 3ZLVA 2VAMA 2NZ8A 4NZMA 3PXCX 2DUNA 4F2PA 2ZBEA 2WIJA 1ZITA 3P0IA 4BN0A 1GY8A 1EE2A 3TEMA 3QYPA 4ILEA 2G4CA 1TYZA 3NASA 4DZRA 1CUAA 4DCUA 4N47A 4D43A 3IEPA 4EY4A 4KOEC 4FONA 2YHSA 4QAQA 1KVRA 1OBVA 4X60A 1YNOA 4MWTA 4R68A 1MJFA 2F67A 2ZYVX 3IXMA 3NWPA 4CFSA 4FLEA 5JFTA 1TADA 5SICE 2BJHA 2ZRIA 5A5DA 3RUDA 1QM5A 4F4UA 2NZVG 4HK4A 5FLYA 3NNDA 2ZSKA 3AKEA 1UDXA 2FNAA 2LNDA 5ALJA 2XX3A 5LQUA 2UXDB 1C1XA 4YPVA 2R1UA 1CQIB 4AJJA 1Y63A 3KPWA 2JIBA 3L05A 5JROA 2HRBA 3K92A 1GZ3A 4FT4A 5KQMA 2OC4A 3VNBA 4JNCA 4C4SA 2DFDA 5CM8B 1DCFA 3HV2A 3QVUA 3SD7A 3OBBA 5AW3A 3HRKA 4MWCA 4X20A 4G0ZA 1YZQA 4IIJA 1C7RA 5CXQA 1OBFO 3I45A 2EZ4A 2Q9AA 1TJYA 1VL5A 1QMPA 2HSWA 3KAQA 3M89A 1ABEA 5SY9A 1MEEA 3OIGA 3NONA 4CKWB 4PNPA 3IQDB 4RD3A 2BR3A 3CZ5A 4PNHA 4X6XA 2GQ0A 5DTIA 2G5CA 4BUJA 2RCYA 4CM3A 4IFTA 2UUBB 2NAFA 3UH1A 1UP4A 1OU4A 3E84A 5ERYA 2P40A 5C8YB 1FNNA 5IF3A 5A04A 2I87A 1KSFX 1OHHD 2I7XA 4OQLA 4YJFB 4RL6A 2QXYA 3KKQA 4AD8A 2BEWB 3IPAA 1YFJA 5CEJA 1OUMA 2R25B 1E3LA 1Z56C 2XSZD 3G13A 1P0CA 3P26A 5BYJA 3UT5A 1BW9A 1HDGO 1NI4A 2NZYA 4H3HB 3NG1A 4RZ3A 4ALKA 4EHKA 5JY6A 1RWVA 3U4IA 1F6WA 4N76A 2N46A 2JAOA 4I55A 3SKVA 3HA7A 3UIEA 4RD6A 5BW5A 3QBJA 1PS0A 5A6SB 2IDJA 4D2IA 5GVRA 1MAUA 1CRLA 1R8YA 2IUSA 3DDWA 4O4IB 4QRDA 4D0LB 3ZCPA 5LXTA 3G7NA 2V7EA 3GK3A 3OQIB 4LXUA 4WBSA 1TVEA 4MNTA 4BNJA 4BRWA 4XUEA 1U5AA 4RLFA 1ZGCA 3JASB 4ZQCB 4YAOA 1QPGA 3QI7A 5H80A 3FNEA 3VO2A 3SBXA 5G41A 5LC1A 1GNLA 3C2QA 1AK9A 1V8PA 4TXMA 4OHCA 2FCRA 5I9TA 5TPWB 2F43A 1UL1X 1WHTA 3MT7A 3ZVNA 2ODEA 1V1MA 3A6HA 2WYOA 2IGBA 5BV1A 2QD5A 2ZPAA 1N8KA 4JB2A 4R01A 5BR8B 4BMDA 1Y3IA 2CJWB 2EFHB 3K8ZA 4GE3A 1W6RA 4ZVKA 1APBA 1YKGA 5FWXB 3AM1A 1U4OA 1YRWA 2HPHA 3OZSA 4FR0A 3WLSA 3AT1A 3IBTA 3K0HA 4F21A 2JCBA 1JSLA 4KQEA 3QENA 4KH0A 1RYDA 1Z63A 1DG3A 3CLRC 5JD6A 4B3BA 2BRUC 3KLBA 5KSZA 4I1IA 3N6XA 3Q98A 1EJ6A 2X23A 3R5TA 4QOHA 1CLUA 3K0CA 4DQ0A 4P83A 3FPLA 5D3ZA 4E88A 3I5YA 2W42A 4NU8X 4K0KB 1ZMTA 5A4DA 1SXHA 4KRXA 1WULS 4JAVC 1EDZA 1JHOA 3SFVA 1ZNWA 3RABA 3T5MA 1OILA 1FP7A 2GX6A 2P5UA 3IBCA 4BWGA 1KORA 2C5EA 3NYIA 1XTVA 4WOCA 4CIAA 3TPFA 4D9NA 3KM0A 2YV3A 4I81A 1LKZA 1M33A 4P7FA 5CT5A 4AS3A 4G0UA 3CNNA 3A4IA 1DAHA 1AOXA 2IYPA 2K87A 5K0ZA 5LNK1 4GPEA 2CMGA 1T4BA 2V0NA 1E1QD 1RJ9B 1BW9B 1FLVA 4A2PA 2D2XA 1IHDA 3EZNA 2QTGA 4KXLA 4J90A 4O08A 1HLDA 3RRJA 3BSFA 4F8EA 4JOBA 1B6SA 2AUNA 1ZOIA 1NJ5A 1PJ8A 2WKQA 1P5RA 1FFGA 2Y3IA 4S2EA 4UAVA 2Z5VA 4QUKA 2FK8A 1KO1A 3L6BA 1Z2EA 4RC9A 1UZUA 4QIHA 4EG0A 5LXTB 1BQ3A 4GMHA 1Q0PA 1HT1E 5CXSA 4RHYA 4E51A 1ODCA 1Y8AA 4HB3A 3RWMB 4B9AA 3TLAA 1JR2A 1P2VA 1CUWA 1SQ6A 2QKYA 2WJ6A 2H0QA 3I05A 5HKOA 2VJMA 4LNAA 5IFLA 4QGSA 4IZHA 5H3LA 5K3DA 1M1YA 1V1MB 2V8BA 1GA4A 1O08A 2GD6A 2X0DA 1U3UA 4JOQA 5DYNA 5JE8A 3UG6A 1N5KA 1JECA 2GVZC 1DIGA 4YA6A 4LJ7<