4ZI2A

Bart-like domain of bartl1/ccdc104 in complex with arl3fl bound to gppnhp in p21 21 21
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
185
structure length
185
Chain Sequence
LLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRSYFENTDILIYVIDSADRKRFEETGQELTELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKKLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ADP-ribosylation factor-like protein 3
publication title The Interaction of CCDC104/BARTL1 with Arl3 and Implications for Ciliary Function.
pubmed doi rcsb
source organism Mus musculus
total genus 69
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4zi2A00
1E9CA 4TN1A 4Q1DA 1M8PA 2AFHE 2GRJA 1AA9A 3SDZA 5HZKA 2F1IA 2GCPA 3WNBA 3GJ0A 2GVDC 4ZKEA 1Z2CA 2Z43A 3MG9A 4HI0E 3OZXA 4A6PA 4DT1B 4ZDIA 1GUAA 5TDHA 1LVGA 3NEYA 1XTRA 1D6JA 4LK2A 2X19A 2FU5C 3DOFA 4L5BA 4AKHA 1XPUA 3EARA 2DCUA 2NTYC 1B0UA 3K0SA 3SHFA 1RRCA 3CRMA 4R2HA 5C4MA 2NO6A 2A3RA 4CRWB 2ZJ8A 5E3HA 3RRYA 1XRJA 2AX4A 3IHLA 2QAGB 4Q19A 2FFAA 4HAYA 4HSEA 3ZVMA 1EK0A 1MO6A 1VHTA 2E9SA 1XTJA 3AVQA 4GOXA 5JECA 3MAAC 4AY2A 1Z6XA 3CRVA 3KDSE 4LHYA 1N6OA 1ZAKA 3C41J 4FINA 4JJKA 1VCNA 1E0SA 2J5XA 2H57A 1G17A 1OIWA 2QPTA 2BDTA 2IXFA 2OILA 1JXOA 2V9PA 4QC2A 2ZI9A 1G6HA 1T91A 2GZAA 3V4FA 1VYTA 1Z6YA 1KO5A 4X8HA 4ON9A 2R6FA 4DJTA 4FIDA 5E95A 4D0NA 1FPMA 3C16C 3BWDD 3WMGA 2ZANA 1EESA 3PR1A 3BERA 4P4SB 1IJFA 3LBNA 3FYHA 1HE8B 4NL4H 2FPLA 3DHWC 4CEHB 4CEJA 1DO2A 2REBA 3NC0C 4DEXA 2VPPA 3CR7A 1KDRA 1NIPA 5E7MA 2ZETA 2ZUBA 4BFZA 3THXB 2REXB 3CNOA 2G0TA 2GK7A 3G5UA 4HZUB 3ICQB 3ADBA 1US8A 2REOA 1E2JA 4L9WA 4G5GA 4JL5A 2DFTA 2WICA 4OQNA 3S1AA 4A1FA 2IYVA 3CX6A 2QU8A 2ZJYA 3B9PA 3M0EA 2ZRFA 2X1VA 1GM5A 4B32A 1U90A 5DHFA 2AL7A 3TIFA 4NCIA 2JJ1A 4I99A 3PUVA 1OXVA 4QRHA 2J0UB 8OHMA 4Y0VA 2DR3A 2QEQA 2UZIR 3GEIA 4Z54A 2ZXUA 1XEXB 4GFDA 1R0ZA 2GEVA 2QENA 3F8TA 3CRQA 2ZJAA 1GVNB 2JLVA 2BC9A 2NGRA 4WZAE 3ZQJA 3NBYC 5CLLA 5AR1A 3EPJA 2WOOA 4MRNA 1OHHA 1UBFA 4V0KA 1SXJA 5J4LA 1Z6AA 3AVPA 4HAZA 3VU9A 4OL0A 2EWWA 4N3NA 2IS4A 1G7SA 3VR1A 5C1BA 2OEPA 4V0ME 4PSAA 3QXJA 1E2LA 3B82A 1PLJA 4UXJA 1NY6A 3GD7A 1WP9A 1UDXA 2IWRA 2VHUA 3EASA 1LS1A 2ZYTX 3VKHA 1TUIA 2CBZA 1AN0A 4NYIQ 1NBMA 3GJXC 5HPYB 2C9CA 4EJSC 1KDOA 2OAP1 4POAA 4RZUA 3GLFB 5FOUA 4P31A 2CLCX 1TQ4A 3EIHA 3LRPA 4Q1EA 1UAAA 5LB2A 4R98A 4XWOA 3MFYA 4LI0A 1P62B 1HH4A 2QE7D 4TL9A 1X8JA 1AKYA 2OFOA 3UK6A 5FBLB 3RRMA 2ZREA 4HLCA 2WTUA 2H17A 3OEEA 2Q3MA 1QDEA 1KMHA 3L82B 4M1TA 4EPYA 2XXAB 4LJ8A 1XMJA 2RH5A 3B85A 1F48A 1EXMA 3C7KA 5JLJA 1QHNA 2C77A 1W0KD 1NLZA 2FGJA 1AQUA 3QVUA 5CM9C 1XXHE 4QOSA 4NPHA 2FPKA 1T5LA 4Q9JA 1P6XA 3E1SA 3CNNA 2F6RA 3U3MA 1G5TA 2VSOA 2RGCA 3L0SA 2D2FA 3U3JA 3Q72A 1GNQA 2QTFA 2R6CA 2H92A 2OLJA 3BB3A 4YMUA 1JR3E 1W36D 4Z1MA 1XEFA 4FWTA 5EP1A 1WBBA 2HT6A 4Q4JB 3RC3A 1YKSA 4TL7A 3RAPR 3DZDA 4US1R 5C2JB 1ZBDA 1CLUA 1KO1A 3PEVA 4FXPA 3ZH9B 1IN7A 4EAQA 1VG8A 1H8EA 1UKEA 4M8NE 1OE0A 5L8VA 1YR7A 4JMPA 4YMSA 5EXSA 1CJUC 1R5BA 1KK2A 2FFBA 2VP5A 4PO9A 5HTKA 4U02A 3GCGA 4ESHA 5J47A 5CIWA 1XEWX 1N6HA 1RYHA 3A8TA 3ZD6A 4F4JA 3OAAA 3QENA 1F3OA 3VQTA 1PLKA 3TQFA 2ZR7A 1M2OB 3LX8A 4M21A 2W0SA 5JJLA 2XEXA 1S4QA 1WMSA 4OYHA 4DC9A 2BBOA 5FTLA 1M7GA 5KDLA 2ZVQX 4PZYA 1W4BA 4JLKA 1OXXK 4KVGA 3CBQA 4OBEA 1MABA 2JJ2D 3AF4A 3IPXA 4N0DA 3CLVA 5ANRB 3RDPA 2AHOA 2IK8A 4U5XA 5L3SA 3U3KA 3REFA 2OFXA 4HAWA 4NH0A 3QEOA 4GMXA 2DFNA 2ZYWX 1M34E 2BHRA 1QHXA 2OG2A 3GLHB 1DAKA 4C2TA 1IM2A 1JR6A 1DELA 2HDNB 4Q9LA 2Q0HA 3GLGE 2WOJA 4DLZA 3OFNA 2OM2A 4XVRA 4BZXA 3I72A 1XFAA 4Q1FA 4C0JA 1WRBA 2QMHA 4L8GA 5L3QA 2QBYA 2OXRA 4JSTA 3R7WA 2IXEA 3RWOA 5CB8A 3SFZA 2XAUA 5KDDA 2J59A 2CVFA 3C5HA 1II8B 1YHNA 1U9IC 1IXRC 2YJTD 4TQ9A 5DN6A 2N46A 4LHXA 4AC9A 2HJVA 4CT5A 1XPOA 3K70B 5GJBA 2ZRLA 1W46A 1LB1B 2Y8EA 4L16A 5EUQB 1CULC 5KNDA 3D31A 3PFIA 2JJ1D 2NZJA 2B21A 3JVVA 4HLQB 3RSOA 4B74A 2WJVA 3CM0A 4Q01A 2HF9A 4Q4AB 1OYWA 1UKZA 3U7GA 4M0LA 1VCMA 4DLRA 3B60A 3ZVRA 3IBGA 2P6UA 1FOEB 2OCBA 1FTSA 2CE7A 1JXMA 1SKYE 1ZC3A 3TR5A 1YZGA 2QAJA 1SXJD 2HV8A 3TKLA 4IFEA 1RFLA 1P72A 4KSBA 2OO7A 4ARZB 2GBLA 3ZIAD 1ESMA 1NRJB 1IOZA 2GJAA 1P9WA 4C0LA 2FA9A 2R8RA 3ND9A 3ZQ6A 1D9XA 2VIIA 1JQJC 2V6IA 2MSDB 1G7RA 1DPFA 1I4DD 1GL6A 5GJWC 4URZR 3RWMB 1NBMD 2VP2A 2EFHB 1AGRA 4DT1A 1NVVR 1DARA 3BH0A 1VG9B 2FX3A 2A5JA 4IKEA 5CDFE 1TX4B 3W5IA 3B1VA 4EFNA 3KX2A 2ZQ5A 4Q4HB 2EVWX 1UFQA 1E2NA 1K5GA 1QVAA 1EG7A 4UXHA 3TRFA 2I4IA 1KI9A 2C9OA 1MKYA 3SQXA 2JLYA 1FZQA 2HYIC 4TMWA 2YWEA 1W2HA 1C9KA 2WMNB 2F7SA 5EJEA 2K5UA 2FZ4A 3NIBA 3PITA 2W2TA 1QHYA 2QAGA 2XJ9A 4TQAA 1Q12A 2A5DA 1Z0JA 3MWLA 1FP7A 4B3CA 3NDBB 2A5GA 5HE8A 3CX8A 1G3MA 4B2LA 3CPHA 4MGKR 1NLYA 4KO8A 1U2RA 4EUNA 1BMFA 2A9KA 1QHGA 2EFGA 4Z1MD 4ZI3A 2D7CA 2VQSA 2WVJA 4BFYA 1XCMA 4HATA 4Q7MB 1M6NA 3T12A 1P4SA 3CF2A 2P6RA 3LBHA 3IIMA 1U8YA 1T3LA 1UM8A 1SVKA 2F43B 2RHDA 4HAXA 1H8ED 4NTZA 3UKDA 1J90A 2A7QA 5L3RA 4OHVA 3BORA 4EJSB 1AQYA 3B1ZA 4AG5A 4P4SA 2YINC 3DL0A 4LDJA 4UNSA 5J4YA 2DBYA 2FSFA 4O2RA 4IDQA 4GT1A 4CEHA 2VF8A 1CR1A 4P3YA 4EFMA 3OAAD 4TL8A 1XJ0A 2YWGA 4TT3A 3L2OB 3LX5A 4TLEA 4Q9HA 4LJ5A 3I1FA 1OB5A 2CLDX 2F3TA 4B35A 4IOJA 4MYTA 1ZM3A 2HCBA 4JSYA 4HZUA 2ZI4A 3FMOB 1NF3A 5FOWA 3D3QA 4TYPA 4LX0A 4L4UA 1UJ2A 2GZDA 2WKRA 1T4GA 4M22A 1KGDA 3LD9A 1NN3A 2DFKB 4IDOA 1P9RA 2NO7A 1TUEA 2GNOA 4JIMA 1D2EA 1MRSA 4IXMA 3OF5A 1E2HA 3QF4B 2WKPA 1S8FA 4OKSA 3KQUA 1A7JA 4IOMA 3U7EB 3KZ1E 2BCJQ 5KOYA 1MT0A 2J0UA 1X6VA 2O5VA 2X77A 1K5DA 4M1OA 4TQUS 3R9XA 4OI2A 1XEXA 3RNLA 2NO1A 1KDTA 2C99A 1U94A 1A5TA 4IEEA 4BFUA 4AYWA 4TTPA 1WDTA 3ASZA 2PH1A 5KUTA 2JLZA 2QL6A 2QM8A 5EXPA 4NDZA 3OFND 1GAJA 1EFUA 2WWYA 3VNUA 2ERYA 4FMDF 3DPUA 5FL3A 4DDTA 2EFDB 1Z5ZA 5JWOA 4C0HA 2QQEA 1A4RA 1ZNWA 1PVOA 4TSFA 4IDNA 4Q00A 1Z2AA 1E6CA 1ZM4A 1WE2A 1HQYE 4PC1A 1DAIA 2DWPA 1CIPA 1DADA 4WAUA 3EZ2A 4LHZA 4QG7A 1IY2A 1OF1A 1R5NA 3GLIB 3I61A 1YZUA 3ZYCA 1E2IA 1T0HB 5EQTA 1EFRD 5DN6D 2O0KA 4M1SA 3GLFA 3JZAA 1P2SA 4HDQB 3MRSA 3TW8B 3HYRA 3VKWA 1R6BX 3B1YA 3IQXA 2FH5B 5DI3B 1ZM7A 2BM0A 3FTQA 4GOKA 3W5JA 4AK9A 2O8DB 1D8TA 5D3MB 1OXTA 2MMCA 3JZMA 2XXAA 1KI6B 2IT1A 2ZR0A 1P5ZB 3EWAA 3BOSA 2BBTA 3MJRA 4K46A 3QOFA 3OIYA 1NN1A 3TW4A 4H1UA 3CH4B 4B3BA 2ZUDA 3BFKA 1Z0AA 2KJQA 2AK3A 4V0NA 1FNNA 1T6NA 2J7PD 1EX7A 1ZC4A 2A2ZA 3U3RA 4UQOA 4EKDA 4KAXA 1ANKA 5CK5A 1OKKD 4V03A 3QKRB 1NKTA 1Q1QA 4M1WA 421PA 4Q4JA 3U61B 2AK2A 1CEEA 3K09A 4XTRA 4RKFA 3T5GA 3DDCA 3UMRA 2BMJA 4PR0A 2LWIA 4H9GA 1Z47A 2N1BA 4LHVA 1ZNZA 2XTNA 5JI2E 2JLUA 4D0LB 3THWB 3VHXA 3W9YA 4KI0A 3FOZA 2IF0A 2ZS8A 2KBEA 4A8JC 3PIRA 3K53A 3PJRA 3FB4A 4Q66C 2RGNC 2V7QA 2AXNA 2W6ID 2ZSDA 5BN4A 1OT3A 2PLFA 1ZD8A 5DYIA 1CF4A 2IHYA 5FL7A 4B34A 4MQBA 3TR0A 3KXLA 4JJZA 1MO5A 1TU4A 5TY0A 5F9FA 2JA1A 2ZS7A 3W6OA 2UVQA 4LHWA 3HU1A 3GFPA 4PFSA 4PHFA 5LBIA 3UG6A 4YMTA 1COWA 4G5SA 5UKDA 3SZRA 1ZMXA 2EW1A 1YR9A 5B2ZA 1GIAA 1S2MA 1BMFD 4QGHA 2H8KA 3BBPA 4JBXA 1XCGB 1FQKA 1CBUA 1CJTC 4E03A 3X1WA 2BCGY 2EYQA 3UWKA 3IGFA 5JRJA 1FW6A 3PEUA 4TYYA 1ZRHA 3VNVA 3TAUA 3BB1A 4UXIA 1RJ9B 3Q5EA 4E5UA 1XBTA 2PCJA 3BD9A 1R5OA 4EPTA 1HEIA 3PEWA 3OE7A 2ZROA 2OSBA 2RAPA 2CMKA 1EWRA 4DLSA 1S3SA 3EPLA 4NYMR 4DDUA 3KXKA 4R71A 1Q22A 1WXQA 2ZRJA 1NSTA 3K0FB 2WBLC 3QKSB 2ONKA 4HUQB 4MYHA 3CX7A 4Q4LA 5KO2A 2IF2A 2J41A 4FD2A 4OK5A 4FN5A 4DUGA 1G8PA 2LKCA 5J5CA 3AP1A 2FOLA 4O2LA 4PAQA 1AZTA 2EWVA 5K8UA 1R7RA 1SHKA 1G4UR 4M4SA 4KLZA 1II8A 3CZQA 2D06A 3IILA 1MOZA 4MKFA 4GPTA 5CITA 1GWNA 3N70A 3AKCA 4I1VA 3RHFA 1WQ1R 1O87A 2IBMA 5HKKA 4KFRA 3RYTC 1GSIA 3GFOA 4Q4AA 4A4DA 1E96A 3AKEA 3K0EA 5FOVA 2ZI3A 1DAEA 1G4AE 3N5CA 3AVWA 1CR4A 1NG9A 2IYYA 2WWHA 3KJGA 3AVUA 2MSCB 4Q7JB 1G41A 3GJ3A 3R8CA 1QG2A 2ORIA 1AZSC 2FMXA 3KJEA 3AP2A 3CRRA 4GP6A 4GMDA 1N0VC 1KKMA 2HLDA 4RZ2A 4JKYA 3I3SR 4LBVA 4ARZA 2W0MA 4RD3A 5CJPA 4TWZA 2QORA 5JCPA 2GHIA 5BQ5A 2ZITA 1E0AA 3WXMA 1TU3A 2HCJB 4QM6A 1RC8A 3LQRA 3K0CC 3BGWA 1CKEA 2WPDA 1S1MA 1P75A 3DKPA 3DOEA 4NCNA 5TB5A 3TAHA 5JEDA 2VLIA 3MUFA 1OFHA 3HDTA 4QJ5A 2PJZA 3SR0A 1RZ3A 2CK3D 3LW7A 3WHKA 3SYLA 2IYXA 4PXAA 2O0JA 4LBZA 5TXGA 1DEKA 4Q4HA 1HYQA 1R0YA 3O8RA 3TQCA 1GDDA 1GOTA 3H0KA 1TQDA 2W83A 3EZ9A 4HB4A 2RCNA 3WBJA 3RLFA 2QI9C 4M53A 1B23P 4CVNA 1U81A 2BM1A 3LVRE 4LJAA 4EIWA 5BXQC 2ZS9A 2P2LA 5DH9A 1Q0UA 2PZFA 2BOVA 2GXSA 4XVUA 4NYJQ 1L4UA 1ZM9A 2ERXA 1KO7A 1QHHB 2OE2A 4KBGA 3T34A 1N6RA 2GAOA 4PC6A 1ELOA 3IKJA 4OJKA 4RCZA 3LDAA 1N3BA 5DIFA 1XMVA 1YU9A 2WJHA 2YOGA 2G77B 5C46F 1MH1A 4JVSB 1Q1EA 4KBFA 2JEOA 1V43A 1E9EA 4ACBA 5J4HA 1OYYA 2QMEA 3D6TB 4LYFA 3CW2A 4C2UA 3RS5A 1GRQA 1IONA 1JQLB 3QNUA 3B1XA 3G0HA 3K9HA 4JKIA 3SYKA 2CNWD 1ZCAA 2N42A 2AKAB 4TTQA 1G6OA 5DNYB 1E2PA 2ZI6A 2GCNA 2F43A 2QGNA 3KB1A 1P61B 3LH5A 4RKEA 3EW9A 4QNMA 2JLSA 1OPXA 1F2UA 1ZJ6A 2ZJ5A 4OQLA 2HXYA 4HDCA 2D62A 2VYFA 3AKDA 4MGYR 4XTCS 1L4YA 4TMVA 4ZCIA 2B92A 4DBLC 2O8BB 2EYUA 5KSPA 1WBDA 5FR1A 5FL7D 4X8MA 4BLRA 2ZJBA 2GJSA 2R6GA 1BIFA 4QFMA 3W3ZB 1XXHB 4HLUC 4OJQA 4OI0A 4C0SA 4PQFA 3VAAA 2F1HA 1E2FA 1D9ZA 3BS4A 3IQWA 3U3OA 5JHHB 3GMTA 2G1KA 2W6JA 1CR0A 3WMEA 5LD2C 2JAQA 4A15A 4ZCMA 1XD2B 1Z08A 5BN5A 1W36C 2X8AA 4B33A 2G88A 4MRRA 4QGGA 3BFVA 3QF7A 4W5WA 2VHJA 3ECCA 3KTAB 4GL2A 1QF9A 1S1CA 3QF4A 4BLPA 5DISB 3N2EA 2FEOA 1E2KA 1NSFA 2YNMA 5KHOC 5TV2A 4B6EA 4CF7A 4BLOA 3F5FA 4MRVA 3MMPA 5KTYA 4B75A 1E2DA 4D80A 2W00A 4DXAA 3LNCA 2HF8A 2ZRIA 2OV2A 4JVLA 1UDWA 4M1KA 2TMKA 3VR2A 4ZCLA 3ONWA 1OXSC 4UKDA 3RABA 3SU8A 4A8JB 4IJMA 1BOFA 1E98A 4DSNA 3K9NA 2IUUA 4IRUB 1EWQA 4DB2A 2GJ8A 3A1UA 4YDHB 2Q21A 2QMOA 1T3SA 4UNNA 1PZNA 3KJIA 2Z0MA 4XSHA 5JZVA 1XMSA 3TUJC 1ZVQA 4OK6A 4CGZA 4C7OB 1IXZA 2JLRA 3P1JA 5GJCA 2V1XA 3U4QB 4A0GA 2X2EA 2W2XA 1X86B 3ZJYA 1U98A 2XZLA 2AD5A 2F1RA 2X2FA 2ZAMA 3SYNA 1Q21A 1H8HA 5G41A 5CM8B 4ZI2A 3WMFA 1CP2A 4NMMA 1U0JA 3L0IB 2P0EA 3NBXX 5G40A 1KMQA 2QROA 5DI3A 2F9LA 1FX0B 5HKKD 3ADCA 1YZQA 2CDNA 2IUSA 2J1LA 2O8DA 2VRWA 2CE2X 4DLUA 2D2EA 2C98A 4QBFA 5D3MA 3TSZA 2WSSD 1UF9A 4JLOA 5AUNB 4ASUA 5FPYA 4U7DA 2QRNA 4FMCF 1RRFA 3TE6A 3GLGB 1DVRA 3IPYA 2IC5A 3JVUA 3P32A 5JCZA 2ZTSA 1W4RA 4OI4A 4M9ZA 3HR8A 4KCGA 2NO0A 1G3IA 1DG3A 4AI6A 4OK3A 4B76A 1P2VA 1XU4A 2HLDD 3W6PA 4JLPA 2OCYC 1XTQA 3D8BA 1RPZA 1SKQA 3QKRA 2NIPA 2XNDA 3D7MA 2R9VA 1XDBA 5HCIA 2B6HA 4QM7A 2ZSBA 4HB0A 5ELXA 4KXFB 4B73A 2RB4A 2VP4A 2ECKA 1J99A 5EE1A 2WPDD 1XB2A 2VHCA 1FMLA 1MRNA 3VKGA 4JVNA 1WCV1 2Z4RA 1KAOA 2FFQA 4PPGA 1LW7A 4KVAA 2ZUCA 5EE9A 2FG5A 2KB0A 3AF1A 2HUPA 5BYKA 3THWA 2OT3B 1HTWA 2ZSFA 2GXUA 1E79A 4RZXA 4TZ6A 3U5ZB 3U7HB 1TF2A 1YQTA 1YZTA 4TZ0A 4TMTA 1IBRA 3VMFA 1ESNA 1DAMA 4BFTA 3IIKA 3VHLB 1SKYB 3A1SA 2AR7A 4JLDA 2NPFA 3HPQA 1SXJC 3IO3A 4NCJA 4XSGA 5EUMA 4UNQA 2ZU6A 1NI3A 2ZRMA 4KFUA 3EPKA 1OV4A 1F60A 1U8ZA 2OESA 3W8NA 1SVMA 4DWJA 1KTVA 3B13B 3NH9A 4RD2A 1N5LA 1W2GA 1IAQA 1NVXQ 2H18A 3GFTA 2VF7A 4G01B 1UBEA 3IBYA 1E0JA 2GF0A 3UXMA 4Q9KA 5DYGA 4BQSA 4QHSA 1E2EA 1H65A 1RJ9A 4NP6A 4WZBE 2DWQA 5FH9A 4PSVA 1CTQA 5EZ6B 3TJZA 4GZMA 4G5RA 2C03A 1LV7A 3NKVA 4ACAA 4BWYA 5K8TA 2DFLA 2IYUA 3KQHA 3CPJB 1K6MA 3QKSA 521PA 3AQ4A 4HUQA 4EPVA 2CL0X 1KI1A 1W5TA 4RZ3A 1SVIA 2LCFA 3E5HA 3GEEA 3KUCA 4DSUA 1PUIA 1QZXA 4RD0A 4YLGA 1OSNA 1A2BA 3MCAA 1KJYA 4M9XA 1AS2A 1KJWA 2W6JD 2XJ4A 4Y0AA 2JATA 2FPMA 4PPNA 1E9SA 3I8XA 5FPKA 2LKDA 2ANCA 2C2HA 2WIBA 4RD6A 2OLKA 4YXWA 4G5QA 1E3MA 4TYWA 3NHAA 5KDOA 2G3YA 2HXSA 5KYKA 1WA5A 3CRW1 3EX7C 4B3FX 1SVLA 3H86A 1T5IA 5DHAA 5HCNA 4O0MA 3WHLA 5KPDA 4BRWA 3KQNA 1GKUB 4WW0A 3W34A 1RE0A 4M9SA 5SZIA 1GRNA 4HYYA 4WVFA 1KY2A 4BFWA 4DDWA 1CXZA 4F91B 2GK6A 5TARA 5AJYA 4P4UA 3V4RA 2KSQA 2R6AA 2AKYA 5FI0B 1OHHD 1Q57A 4LWZA 2ZVPX 2Z5FA 2C95A 3LQQA 3CIOA 1HV8A 4QBGB 5EXTA 4NCKA 3LAWA 2QRZA 4DLVA 2P6NA 5FTNA 2O8CB 4FCVA 1RW4A 3B78A 2IEYA 5KSZA 3FMIA 1P60A 3Q8XB 1Q1ZA 2C9YA 4AD8A 2G6BA 2FGKA 2UKDA 3OIWA 4B71A 3EC2A 3CZPA 2GTPA 4PO1A 2RHMA 3A36A 2J3EA 2FSGA 4G3XA 5AWFC 1R2QA 4JT2A 3BC1A 4TL6A 1N0UA 3LO5A 4RCYA 3U6KA 2ZJ2A 1ZU4A 4URYR 4V0OA 4WA7A 4X8OA 4E22A 1G16A 3QUSA 2JCSA 1W36B 1LF5A 2ZEJA 2QMUA 4MGIR 5JI3E 4WOPA 2CCJA 4BFSA 2SHKA 1G8FA 3BXZA 3C5CA 3U44B 1P3JA 4D4JA 3OEED 1L2TA 1S9DA 1HUQA 2NPIA 1ZYUA 2VA8A 1KZGB 4KJZA 1ETUA 2WSMA 2IYSA 4LV8B 4B48A 3AVTA 4D6PA 1CJMA 4OHWA 4URUR 4XJXA 4D4MA 3TH5A 1J8YF 1F2TB 2WIAA 1OH7A 1FFHA 1MO4A 4JLJA 4V0MA 4PAOA 4US2R 5E7JA 2YOFA 3EAQA 5D3QA 2H1LA 1VTKA 4HLDA 1II9A 1RKBA 1NJFA 5CYOA 2GXAA 3THYB 3AKYA 3B1WA 4ZKDA 4LJ7A 2IHBA 4CIDA 1DE0A 2CJWB 2IEZA 4B2IA 4DCTA 4QKQA 3CR8A 4DRZA 3FKQA 3TLXA 4PC3A 4PQRA 3WNDA 4D2IA 3TVTA 1VG1A 1OH6A 1AKEA 3RRZA 3SHWA 1UBGA 4MYUA 5FOSA 1GITA 1CU1A 1G3RA 3OEHA 4EFLA 4BUJA 2EU8A 2F3RA 1XMIA 2QZ4A 2D4HA 4PC2A 1X1SA 2RGDA 2QTVB 2O8BA 2ZRPA 3BIFA 4HB2A 3TUIC 1KO4A 1G1MA 4NBSA 1D2NA 2QSYA 3F0TA 2OBNA 3THXA 4FMBB 1XNJA 3CUEF 3WP0A 1XXHA 5CYPA 1VPLA 5AJWA 3AVXA 5G3ZA 2W58A 1FTNA 4PPFA 1DAGA 1GKYA 1I2MA 5DLQC 4BZQA 1Z0KA 2I3BA 4GSYA 1N6KA 1JR3A 3FFBA 3GQBA 1XD2A 1R10A 4CEJB 2J0QA 2GBLC 3QKTA 3SE0A 2OCPA 3AF0A 3EXAA 4LV5B 2E87A 4Q48A 1XZPA 1OB2A 1HT2E 2D7DA 3KTAA 1IN5A 2QN6A 3HYTA 4LCBA 3WRXC 5FBVB 1Z07A 3CH5A 2HEIA 2YWFA 5BW8A 1NVVQ 3AB3A 4HDOB 2YHSA 2H5EA 5FPHA 721PA 3DM9B 3ZGXA 4F38A 3QG5A 3CKLA 3FE2A 4I1SA 4Q03A 4P0TA 3EZ7A 4M1MA 5F3WB 3H2YA 3K8YA 1SQ5A 3BB4A 3M1IA 3PXGA 4O25A 3A4LA 2GF9A 1OIXA 2RGNA 2OUKA 5M04A 1BS1A 4IVRA 3SN6A 1GL7A 2XSZA 1LS6A 3VX4A 4XOIA 4CEIB 1BO6A 3NDPA 4EQ6B 2CHGA 2Q9BA 1SVSA 4C7OA 5FPTA 3B9QA 2QAGC 1LFDB 3AF2A 4R7ZA 1I2DA 3TK1A 3U4QA 4IFBA 4NONA 3CWQA 4IEIA 5A0FA 4C0QC 4FMDB 5H70A 4URVR 3IDQA 5DO9A 4YXWD 4AIIA 3VU9B 3TUZC 2YKGA 3EC1A 4LC1A 1HA3A 2ZYVX 5EXXA 3X1DA 2BMFA 3FKSA 2AFIE 3AUYA 1Z3IX 2F9MA 4G5OA 3I92A 4G1UC 4KSCA 4LY6A 4QGFA 3A4NA 3T5DA 2KBFA 3VR4A 3X1XA 1FX0A 4R2IA 3KKMA 2BEKA 5J4KA 2BKEA 1UBCA 1N6PA 3X1YA 4D25A 3GLGA 4MGZR 1KK1A 2ODWA 4OQXA 4U00A 1HY3A 1DAHA 2CL7X 2PEZA 2WV9A 4H1VA 2ZM5A 3U60B 1E99A 1SVWA 1SULA 4PANA 1AS3A 2YC4C 821PA 2OHFA 2VP6A 1TF7A 1XCPA 3MJHA 2ZRHA 3B8HA 4B3DA 5JWHA 5FTMA 2XITA 3T1TA 1XX6A 5F9HA 2WMOB 3F3YA 4UJ5A 2BMDA 4B3GA 1FNMA 3AVVA 1R8QA 3B7GA 4JLBA 1A1VA 2QGZA 2GETA 3U2QA 3NBZC 1E32A 2R62A 3E2IA 4EPWA 1GKIA 4LYHA 3TGPA 4DIEA 2QSZA 4NE2A 2GA8A 2G0NA 3CONA 3O8CA 1P73A 4FI3C 3DVLA 2VP0A 3FDIA 1W1WA 2IS6A 3EZFA 2V3CC 4NCHA 2QP4A 3DO6A 2FSIA 2PL3A 5CIQA 1CS4C 3WY9A 2ATVA 1EFTA 4BASA 3K0AB 3MWKA 2A5YB 2JIZA 1KSJA 1SXJE 4DZZA 1NVUQ 5JS8A 1W48A 2Z6VA 3SJZA 1TEVA 1II0A 3KKNA 2CCGA 1YZLA 1KIMA 1IQPA 3ICEA 2HYDA 3WBKA 1E94E 4CT4B 3MWYW 4M1YA 4XVQA 2G9NA 1KDPA 2J7KA 3TSOA 5BN3A 1PLLA 2PBRA 1KY3A 4II7A 3GLHA 3K0CA 3MGCA 5FUWA 2O8FB 1GNRA 1WF3A 1FUUA 1GILA 2GEUA 2YVUA 1E0KA 1RRPA 1NBME 4UNPA 2IXGA 1OFTA 1VYUA 2JDIA 5CDFA 2V55B 4KV9A 4IDPA 4MKIA 4I1UA 1JALA 3HP1A 4DCVA 1DS6A 1C1YA 1FUKA 3AVOA 3IIJA 1XEWY 4W5JA 5B64A 2WHXA 5FUYA 2XOKA 4TT3D 2ZAOA 4A0FA 3LV8A 3EA5A 4RJLA 5H8WA 4W7SA 1IHUA 4LC0A 5KSOA 2PX3A 5IT5A 3DEFA 2IYQA 2NZ8A 1CJVC 3SEAA 2G83A 2DHRA 4IOLA 2ZSEA 2CEAA 2C04A 3FGNA 1JR3D 4Z8XA 2FE4A 2BV3A 4QXAA 1T9HA 3R7WB 2WJIA 2H16A 3Q9LA 1FL9A 1AJEA 4BLTA 2OCAA 2PX0A 5KNCA 2NG1A 2PT5A 4CYMA 1XTSA 1I4TD 1TF5A 2H7VA 1YRAA 3ADKA 2MMGA 1LY1A 5FBWB 3AGQA 4JLAA 4XWAA 4DLXA 4RFSB 2QM7A 2ZSAA 1UEJA 1JEDA 1N5KA 4F4IA 2VHTA 4MUAA 1PJRA 5DGXA 2XTMA 1EFHA 1JEEA 1AGPA 3PEYA 2DY1A 4D82A 2GAAA 2QE7A 3THOA 3FFAA 2A30A 3PQCA 3Q7QA 2O8EB 2QP3A 4TSFD 2O8CA 1NJGA 3VFDA 2QTHA 2GCOB 4M9QA 4TLBA 5KSYA 2PJRA 1ZD9A 2ORWA 3L43A 5EP3A 5IK2A 1KI3A 1W0KA 4GOJA 4A0RA 4N1AA 4URXR 4ZPXA 4TMKA 4HB3A 2ASEA 2RMKA 3EA0A 4E07A 3QXCA 1GNPA 4R9UC 4AWXA 4KFTA 3FKSD 3P4XA 4YMVA 2GILA 4Q7KA 4WXPA 3KKQA 1AM4D 2ZE8A 5CK4A 3U44A 3PUWA 4YC7A 4D0GA 5FUXA 1JPJA 4KFSA 3T35A 3AP3A 4DCUA 2YZ2A 4LJ6A 4DIDA 3DZ8A 1OIVA 2A78A 4PC7A 4DLWA 1YR8A 4IDHA 4C0KA 2ZIAA 3LVQE 3SBDA 4LSGA 1JNYA 1JAIA 1EX6A 2MSEB 1Q20A 2FSHA 4KU4A 4NYMQ 4IHQA 2YWHA 5AK0A 5TVKA 1Z0IA 1W4CA 4DEYA 2P5SA 4HAUA 3C14C 1QBKC 3ASYA 2ODEA 1AK2A 4JL6A 2ONJA 5JSZB 3BRWD 1Q3HA 1SGWA 5P21A 3LFUA 5EP2A 3REGA 1VCOA 4ITRC 2F55A 4LUCA 2C78A 1F2TA 3BH7A 2XB2A 3P26A 3RC8A 4OQMA 2VTKA 2OXCA 1E9BA 3QG1A 2Z83A 4GNKA 2WWGA 1ZINA 4LGMA 1NP6A 1UPTA 1FP6A 1E9AA 5JMTA 3THYA 2AD1A 1ZUIA 3AM1A 3QBVA 1T8UA 1BKDR 3HPRA 4A82A 2CJWA 1IN6A 1Z06A 1LNZA 3AF3A 3K70C 1N5JA 3P27A 4EJSA 1L8QA 5B58C 1KNXA 1W44A 4NYIR 3UG7A 1NIJA 3I5YA 2JJ2A 1JB1A 2IUTA 4MKHA 2V7QD 4BECA 1G18A 3QE0A 1F6BA 4L15A 3UMSA 1RIFA 3QY0A 4GP7A 3X1ZA 3QXXA 3T06B 3ZZUA 4Q21A 2CHQA 2GEDA 1D2MA 2V54A 2JLWA 5IRCD 1NG1A 2QQ0A 1JI0A 2V8OA 3KFXA 1GP2A 3FHTA 3NTUA 5FUVA 1Z0FA 4Q7LA 3ZVLA 2ZRCA 1COWD 1UKYA 1YJ5A 2FF7A 2GKSA 3AGPA 3DMNA 4F92B 4Q1CA 5GJVC 2JIZD 3KL4A 3UIEA 1XWIA 4N0EA 3UMFA 4A2QA 3QJYA 3EG5A 4MRSA 5EE3A 1KNQA 2Q3FA 5JWRA 3QIAA 3DM5A 3FVQA 3A1TA 4BE7B 5GADl 3K9GA 3QPWA 4D26A 2DB3A 5HR5A 1DG1G 5E7IA 4K8OA 4ERNA 2VO1A 5JEEA 1ZIPA 4J0QA 2NO9A 5BYJA 4QBIA 4RFVA 3DKVA 4C0BA 1Q1BA 4BLSA 3OE7D 2JDID 4C0AC 1P9NA 5FOTA 2XZPA 5C4GB 1ZNXA 3A1WA 2WWFA 1E1RA 2C5LA 2QPAA 1KSFX 3AV0B 2DPXA 1IY1A 2IYRA 3BFXA 4ZDJA 5AUQA 4DHEA 2XOKD 1WB9A 3I8SA 2WJJA 4LJYA 1TQ2A 4DUGD 3FMFA 3SJBA 5J40A 2RKOA 3KQKA 4CEIA 5EP4A 4EQ6A 1MV5A 1M7BA 5FR2A 1Z6TA 1AIPA 1NLFA 1KYIA 5FTKA 3GLIA 3Q5DA 4NHOA 5G53C 2ZRKA 3RS0A 3NVAA 4YQFA 5JJKA 4CW7A 1GRRA 1KI7A 2WAXA 3K70D 2FEMA 2XTZA 2J87A 4HEJA 2PMDA 5JRZA 3WYGA 5AJVB 1GZSA 1DO0A 2ZRDA 3LA6A 1G3QA 2IA5A 3ZIAA 4RVCA 1NN0A 2GWHA 4PX9A 1DOAA 4LPSA 1YZKA 4XH9B 5JJIA 2IL1A 1ZP6A 5F98A 3LBIA 3C4JA 4JYCA 1NMZA 3P20A 1KI6A 4CDGA 5K8LA 4QGAA 4OHXA 3OESA 2OBLA 3OIUA 5JS7A 4JLVA 2IYWA 5EE0A 3Q85A 4PQYA 1W5SA 2J0SA 2V4ZA 2V1UA 3KJHA 3EIQA 3EIEA 3W8RA 2Q3HA 2XZOA 4A92A 1TPZA 3FHOA 1QRAA 2FFHA 1X3SA 1IN8A 621PA 4OQFA 4FMCB 3GJ7A 3R8FA 3NEJA 5FOXA 2R6DA 4KHZA 5IK2D 4YMWA 5AJZA 2B8WA 1JAHA 2V6JA 2A5FA 4DLTA 2ZPTX 1OLOA 1N2CE 1G8GA 1IN4A 1U9IA 1KOFA 4GRAA 1ZCBA 1RYFA 2CCKA 2D3WA 1N0WA 3RS4A 1T0JB 1N6NA 2PCLA 4W5HA 3DMDA 3BJIC 3NXSA 3QSYA 1VKJA 3KXIA 4XIGS 2O0HA 4A2WA 1QHSA 2BJWA 4YDSA 5FTJA 4A6XA 4OHYA 2IWHA 2WJGA 1XF9A 3KKOA 2QUZA 3SNHA 2GESA 4QL3A 3LLUA 3HJNA 2ZU0C 3T15A 4DSTA 4PPQA 4AKEA 4EPXA 3SBEA 3OIVA 4P32A 2IX3A 2ATXA 1JJ7A 2P5TB 3K0AA 4DCNA 4B3XA 4DB4A 3NC1C 1CR2A 1OJLA 3EZ6A 1MR3F 2PT7A 3T61A 4FCWA 1A2KC 1PUJA 1VYVA 4Q18A 3QVVA 3LW8A 4Q02A 1XZQA 5HZHA 221PA 2Q6TA 3L0OA 4RD4A 3O8BA 1NKSA 3AH8A 4EPRA 2J46A 3H84A 3WYFA 2C8VA 3I5XA 4L9SA 4WZ6A 5JBQA 1KKLA 1XTKA 2O8FA 3L8YA 4V0LA 2AWOA 2D74A 1MO3A 3TBKA 4F4CA 3W90A 1NMYA 1ODFA 1VIAA 2JLQA 2FN4A 1KO8A 1R4AA 1E2QA 3GLFE 2R2AA 1PV4A 3SI7A 1GL9B 1S0UA 1XD9A 2PMKA 3T1OA 4BEJA 2OBMA 2Q9CA 3ADDA 3K0FA 1ONBA 4M2LA 1OH8A 3WYAA 3MD0A 3AUXA 4C30A 4UNRA 4QNRA 3I62A 3A58B 1LTQA 1ZW6A 3PENA 2F1JA 2ORVA 2QP9X 1ZM2A 1BH2A 4OHZA 2AN9A 2C96A 4PZZA 4KITB 1ZUNB 3W6NA 3CB4A 4URWR 3NBFA 1SVOA 2KI5A 2EQBA 4C3ZA 6Q21A 3HU3A 2AWNA 5CLQA 1BYIA 3V00A 1KHTA 1Z29A 1Y3AA 3B2EA 5F2EA 2IW3A 1EGAA 2PZEA 5FFMA 2IYTA 3FWYA 5FPSA 2QG6A 1NL3A 3WP1B 2IS1A 2EFEB 4K81B 3A6PC 1VG0B 2E1RA 2NOAA 4V02A 3QPUA 2JGNA 3QXSA 1E9RA 1U0HC 4WBSA 5IF9A 1E69A 3RS3A 1EFRA 4CZ2A 1J2JA 1J7KA 4RFSA 3WRYC 3UWOA 4ZIRB 1VECA 2DWOA 2ZE6A 2NMVA 5FBRB 1D5CA 1E1RD 2OFWA 4Q47A 1RRGA 1TEXA 3CWZA 3RS2A 4X8LA 4BLQA 4PTLA 2O8EA 2AXPA 5JHGB 4TLCA 5LPNA 2GCOA 1LF0A 3RS7A 3PUXA 3GJ5A 4EDHA 5TMPA 1FQJA 3I32A 1JJVA 1YVDA 3K1JA 4JLNA 3C8UA 4LRWA 2ODBA 3NG1A 3SC3A 4GDFA 2RGEA 1H8HD 1UKVY 1VMAA 3W3AA 5LD2B 1TMKA 2BKUA 1I4LD 1N5IA 4BEBA 1L7VC 2J7PA 3H1TA 1O3YA 4TYQA 4KYIB 3VR5A 3A37A 1UADA 1OKKA 2RGXA 3E70C 4OI1A 4D81A 2RGBA 2YC2C 5LDDC 2KWIA 4GBMA 4ASUD 2XB4A 4O3MA 1IY0A 4JBYA 4XD7A 2WKQA 3NHBA 4FCTA 4LBWA 4QHTA 5L3VA 3SJCA 1SHZA 3TNFA 3GJ4A 3GLHE 1QHHA 2YOHA 3SS8A 2XGJA 2GJKA 2PZGA 2YYZA 4IOKA 1CJKC 4RD1A 3FMPB 3CO5A 4ZDKA 1RVDA 2IYLD 5JSZA 3ZLJA 1G7TA 1TADA 3QPVA 4ZDWA 2BMEA 2W6IA 2CHVA 1AS0A 1QVRA 3L0PA 1SZPA 1U8AA 1M1YE 1DBSA 1W0JA 3J81k 2XNDD 4RY2A 2G1JA 2VP9A 3PUYA 4TYNA 3HR7A 3ETLA 1W47A 5DSZA 1CRQA 1E2GA 1Z0DA 1TTTA 1VCIA 1M74A 4YONB 1YR6A 3T1VA 1XP8A 2ZI7A 4A36A 5CB6A 1GFIA 3VR6A 2QY9A 2XX3A 2L0XA 4A9AA 5C18A 1G8YA 4AURA 1E79D 1Z22A 1E4YA 4LOAA 1Z83A 2RGGA 3QXHA 4PSKA 1XPRA 5A5GA 3RANA 1K8RA 5IDVA 5GVSA 1OH5A 3PVSA 2BEJA 2WWIA 3MLEA 1NN5A 2OZEA 1IXSB 1JBKA 1XTIA 3K9LA 3ND8A 3R20A 3N2IA 1HT1E 4IXNA 3OHMA 4F7WA 1IJEA 1E9DA 3GPLA 1R8SA 5E4FA 3A4MA 4KYUA 2UZ3A 3BK7A 4LJ4A 2YV5A 2J9RA 2P67A 1F2UB 3U7FB 3GJ6A 1E1QA 4IW3B 5AUOB 3IO5A 3QQ5A 4GI7A 1X8LA 4RSGA 2QA5A 4Z8YA 2BBSA 2BIFA 3IHWA 3AEZA 1YE8A 4JVMA 3B5JA 3NH6A 1XJQA 2FWRA 4JT4A 2I1QA 4BFVA 1P2UA 2VBCA 1E4VA 1S3GA 1DAFA 1KK0A 4DVGA 1G19A 1US8B 4E09A 1BYUA 4AYXA 1M7HA 3X2SA 1Q3TA 1NY5A 3S1AB 1QG4A 2CVHA 2BJVA 4BRUA 1A82A 2BBWA 4I4LA 5K8IA 3QI2A 1VHLA 2Q9AA 2PLRA 1NNEA 4PHHA 2ZYUX 3FHCB 1KJZA 2P3SA 3SFVA 2R44A 3LXRA 5HE9A 4A8JA 3V9PA 5DE3A 3CF0A 4DCSA 1V5WA 1N25A 1Z6GA 2WWWA 2ZRAA 4NU0A 1VIYA 4MRPA 4TMXA 4C4PA 3MWJA 1G64A 4I81A 1XJCA 2QPOA 4WIAA 2ANBA 1U99A 1TAGA 2WM9B 3UATA 3PG5A 4PAMA 2BVNA 4ZV4A 1Z63A 1VDZA 5AJXA 1ZIOA 3BE4A 2QNRA 1DTSA 5BWMA 2Z4SA 4S2EA 3SJAA 4W9MC 4LYAA 2VSXA 1SXJB 5JFGA 5GVRA 1F5NA 2FNAA 3KUDA 4Q5IA 3RSLA 2WJYA 1EFCA 2CXXA 1R0WA 2B7CA 2ZI5A 1G8HA 3PCRB 4C9BA 2GDJA 5B30A 4Q1BA 4AYTA 1OFUX 2DYKA 4Q9IA 3TVDA 1G21E 3QKUA 4JBWA 3PUZA 3LY5A 2FV8A 4PO8A 2P65A 3EPHA 4KODA 1XD8A 3NWJA 4B44A 5H68A 2QT1A 4LV6A 2CK3A 5SZKB 3AVYA 5CJ2A 1KZ7B 1T3HA 5SZHB 3UANA 1KK3A 1N6LA 2JLXA 3TMKA 4QHYA 2W2VA 1KMHB 4BPBA 5KNBA 2R65A 3G82C 1TNDA 2I1VB 3IEUA 2XNSA 3KFVA 2OAQ1 3IEVA 3EWSA 2WAYA 3QBTA 5FBQB 4BZPA 121PA 4JZKA 4MYCA 3QEJA 5G3YA 5LB4A 3U6BA 3Q3JB 5EE5B 4B6FA 1GG2A 3UPUA 1G20E 3LWNA 1GTVA 1KI2A 2ZRGA 1HE1C 4DDVA 3C15C 3CF6R 2J45A 1X1RA 4MH0R 1X8KA 3BH6A 3KKPA 1KSHA 2KE5A 3GEHA 3CPEA 4XD7D 3I4LA 2CNWA 3O8DA 4B2PA 1Z8FA 4HZIA 5FI1B 1U0LA 4JL8A 4FW9A 4KLNA 1YZNA 4ESVA 4US0R 5A4JA 2GXQA 4I1OA 2FDCA 2GJ9A 2GVZC 4A2PA 1ZU5A 2HT1A 2O52A 2WZQA 1ZNYA 2WWXA 1NVWQ 4NKRA 2HJGA 3M4YA 4TMZA 2ZRNA 1G5RA 3HU2A 3LXXA 3IUYA 3ZD7A 1UEIA 4WXRA 4DLYA 1KI8A 2ZRBA 5AUPB 1W0JD 3R9WA 1FMJA 5DI9A 4QBHA 3ZS9A 5B57C 4HUTA 3I73A 1Y63A 4MDFA 4DSOA 4JLMA 2CLSA 4P33A 3ZS8A 2VSFA 1G3UA 2ZJOA 3O47A 4TTRA 3SQWA 1Z28A 3RVBA 2ZE5A 3P4YA 1CRPA 1TL7C 4AKGA 4FWIB 1S96A 4LPKA 5EZ5A 3KB2A 4QJ3A 3GLIE 2J0VA 3OEHD 2JASA 4TLDA 1MABB 4LJ9A 4AKIA 5IHPA 3R9IA 2BWJA 3PV0A 5L3SB 3T1QA 2EFCB 2IYZA 4ABYA 1OXUA 4B47A 2FZLA 3GJ8A 3ZVNA 4PHTA 1KAGA 3KQLA 3B6EA 4BFXA 2ZR9A 4A0HA 4HAVA 1S9HA 1R0XA 4MUBA 3H4MA 4JS0A 1J70A 1E1QD 1C4OA 1E9FA 2PEYA 4NYJR 3ZZ0A 4Q1AA 3GP8A 4GZLA 1N6IA 2JJ8A 1TQ6A 4MKGA 5L3QB 2QBYB 1E2MA 2GZHA 5J4VA 4PZLA 2ZJZA 1KSGA 2B8TA 3VTKA 1W7AA 1P7CA 2VHQA 3K09C 2CL6X 3HWSA 1P2TA 2VH5R 1YRBA 1G7CA 4LYJA 3L8ZA 2QT0A 2ODNA 1W4AA 5SZJA 4NZYA 1G9XA 4ZO4A 3RRNA 4LBYA 4IVQA 3ZDQA 1ZD1A 4MITA 3BAFA 4ZIRA 3ZZTA 4G0NA 4D4LA 2ZE7A 1Q44A 1QHIA 4D4KA 2B7BA 4DKXA 5H1YA 4MA4A 4Z51A 1OW3B 1OFIA 3SOPA 1KI4A 1NMXA 2NQ2C 4ILEA 4XWKA 1ZUHA 2FJUA 1G291 4S35A 3VR3A 4BGDA 4MDEA 2XSZD 2WSSA 1G5PA 3Q7PA 4P4TA 4AG6A 2RGAA 4PHGA 3M6AA 4LZZA 2IS2A 3FPAA 1W49A 4UJ3A 3VX3A 4TLAA 4HLUA 4B43A 1JECA 3TSWA 5KU1A 4QJ4A 2VL7A 1HURA 3LLMA 4IVPA 1T8TA 4JYBA 1HQCA 3CNLA 3MSXA 4F93B 5KPJA 2VEDA 1J8MF 3A1VA 3WNCA 1JPNA
chains in the Genus database with same CATH superfamily
3R6WA 1RM5A 5IAKA 2Z1DA 1E9CA 3LT0A 4OFXA 1AQNA 4H7KA 4IY1A 5WRFA 4EVQA 4LYDA 3NU1A 3SDZA 2GS9A 2F1IA 2F00A 3QY9A 3ZZNA 1TA0A 2V7PA 3GJ0A 4BPRA 1FDIA 2GVDC 3HG7A 3ED1A 3M4NA 2PKCA 1IRIA 2XQKA 4DCJA 3G9ZA 5JQGA 2C7OA 1MF7A 1A5SB 2OMEA 1K8XB 1XJ5A 1OFUA 4H1WA 3PK0A 1SXIA 1Y33E 3DXFA 4UDYX 4DT1B 3SQMA 4ZDIA 1LVGA 3CF4A 1AX9A 2XWPA 2ZK7A 3T7AA 3DPSA 3OOSA 1Y48E 5DBOA 3SC6A 4ENWA 2L19A 3E61A 5E6RA 3PI7A 4AKHA 3DKKA 4R2KA 4JHLA 4KK3A 3DUWA 3U1BA 3QVJA 1QNLA 1RRCA 2RGUA 1M2JA 3NBQA 1J2TA 2VCEA 3MIZA 4OAPA 4MW0A 3L6EA 3IB6A 2JGIA 4CRWB 1W88A 1K2WA 1NQWA 1DINA 1JG1A 1XRJA 3B3JA 5DN9A 5GZ6A 4QQ8A 4IV5A 2QAGB 4Q19A 1KU0A 1NBOA 4H0FA 3ZVMA 1UBTS 3ILVA 2WIKA 3P0JA 1DTEA 2AQHA 2H7YA 2R1TB 3MAAC 4U2GA 3SHOA 3CRVA 3CLSD 3L6OO 4LHYA 1DCFA 1VRWA 5GGXA 1PGPA 1E0SA 2Z98A 2VDNB 2QPTA 2XCOA 4LRYA 4O4JF 1C81A 4M8SA 1W19A 2B2NA 3G2QA 4M46A 2OILA 2ZYIA 4MI9A 4U1RA 3MMSA 5JDCC 2H54A 2ZI9A 1G6HA 4EJFA 1GNTA 1DQZA 1GT6A 3EWIA 5DNUA 1WXDA 4BCBA 4X8HA 2J3HA 2VXBA 3NHWA 3Q6IA 4FIDA 4WXEA 5E4TA 3A2MA 3SE7A 4KPYA 1VE5A 5A02A 5JUWA 1VKOA 5IDXA 3HVRA 3HJUA 2XF8A 3L8DA 4GEKA 1EBBA 3NW9A 1L3IA 1C0PA 3LBNA 4HQKA 4RPJA 1NR5A 2AOVA 2Y4OA 4OFWA 4TWRA 2BFPA 3ZWCA 3DHWC 4CEHB 3N0VA 3GRRA 2QV7A 1PFGA 3LA8A 4DEXA 2VPPA 1YHYA 3T94A 3BWMA 1UBHS 1FJXA 2COUA 1OVGA 5K8CA 4K2HA 2JD2A 2NV0A 3AFMA 3RTGA 2REXB 3CNOA 3D2AA 3KZVA 4IPTA 5JG7A 3ICQB 4W9NA 1J22A 3ADBA 1ZGJA 5AO9A 3KVNA 1P17A 4KDFA 4NU8X 4YMHA 3FZEA 4Z4IA 1Q1NA 4UAUA 4I46A 5CHEA 3RW9A 2ES4A 4MUHA 5KTKA 1UBLS 1UWCA 4MARA 3ZKWA 1T35A 4A1FA 4GX1A 4PRYA 2X5NA 1T13A 1VC2A 1UBUS 1TD9A 5CTJA 2HLPA 1Q50A 1NBAA 2F4VB 1P3Y1 2GFQA 1PG0A 2X1LA 4I99A 4KLRA 3DH0A 3PL1A 1OXVA 1CB7A 1JQAA 3LZ6A 4QRHA 5L95A 1I3KA 8OHMA 1JIQA 3ANMA 3CUYA 2I3GA 3NV7A 3GEIA 2UZIR 4II2A 3GJRA 2ZXUA 2DT5A 3F7NA 4GFDA 1R0ZA 2GEVA 2XY4A 1FXWF 2ATCA 1TU0A 4FC7A 1DZ3A 3P9IA 4IF4A 4M88A 4QELA 4Z0HO 2UZ0A 3BICA 1QGUA 1SBYA 3FI9A 2PU5A 3UCXA 1WTCA 1F3LA 2ONCA 1NI5A 2OAEA 2X41A 3HNPA 4GOND 1QIJA 2WOOA 3EPJA 4OGGA 1VL2A 4HAZA 2FPPA 3VU9A 2PN1A 4MVJI 4OL0A 2EWWA 2M6SA 4L0CA 3IVCA 1YE3A 4L28A 5HJ2A 2B94A 2HMWA 4QUDA 4YV0A 4YVFA 4V0ME 2PXHA 3L1IA 1SCAA 5KNCD 3OD1A 1JJFA 3G2MA 3JQ6A 4UXJA 1R4MB 3GD7A 3L1KA 4RHTA 3RSZA 2IWRA 1EZ1A 4MXDA 2OBFA 4TMFA 4YR7A 3I2KA 2CBZA 4G0VA 1PFQA 3QYAA 2XE4A 3HACA 2C9CA 2OAP1 5C1OA 2CNBA 5FOUA 4Q1EA 1XHEA 1QQ5A 3M89A 5E3IA 1GG5A 3N8HA 4LI0A 1YU6A 3PT5A 4FGZA 3G5MA 4MPTA 4X6LA 5LP6A 3LCRA 1YQEA 4AQ7A 3UK0A 1WMBA 2WTUA 4HLCA 2VCYA 3L82B 1QDEA 1KMHA 3BCHA 3B85A 1F48A 3LY7A 1QHNA 2WUWE 1ZIDA 5CDHA 4PPYA 3P94A 3IFSA 4G6ZA 2FWJA 4H31A 5CM9C 2JLVA 2XMDA 4MKRA 4QOSA 4NPHA 1DQNA 2WUEA 2ZIFA 4D96A 4DJDC 1JG7A 1R1DA 5EIAA 5H5JA 1UM9A 2ZPUA 3LZDA 4O1HA 4RY8A 3V48A 5DHTA 4PXSA 3HM2A 3VNQA 4FR0A 4PWZA 1VIDA 1QPGA 3L7DA 2Z1NA 3FRIA 3LPLA 1JR3E 3QVXA 5A04A 1W36D 4DL9A 4R1QA 1E58A 1XPJA 3U4IA 5HFJA 1FPQA 4FWTA 4L5JA 5IFLA 2HT6A 3IAS6 5CA0A 3A6EA 1Y42X 4IR7A 4TL7A 4WK6A 3S29A 3NS7A 1IQ0A 1TOAA 4JJ8A 5FEUA 5PNTA 5JYEA 5IABA 1ZONA 4YV2A 3U17A 3ZE2B 1EX9A 1L7NA 5EIFA 4M7WA 2B2CA 4B8YA 1GQQA 4OX9B 2CVPA 3N7UA 5T4HA 1ORTA 1TJPB 4OMDA 2EZTA 4JMPA 2BH9A 4DMUB 3AEQB 5B37A 3SLGA 1IVSA 1UT5A 3U4HA 5EXSA 5ALIA 5SY9A 2C97A 5LBTA 5CIWA 1N7IA 3R0VA 4ND4A 1TM1E 2PSJA 4K9KA 1RYHA 3WB0A 3ZD6A 3EGVA 2IDJA 4RQTA 3QENA 3IESA 5G4LA 2I4LA 3O7WA 4P92A 2I55A 1DV2A 4QUIA 2P8JA 4M21A 4YXFA 3KPWA 2W0SA 5FYDA 3QU4A 1S4QA 2RKWA 2VKQA 3OA0A 3HNOA 5LN1A 1F7UA 5J2TA 1JJAA 1P7VA 1WO8A 3PQDA 5EEGA 2O1XA 4AJOA 1YAHA 2G71A 5B1IA 1M7GA 3EIFA 2GZRA 3VMMA 4AKTA 3NHZA 3V1TC 2PMEA 4FQ8A 4JLKA 4OBEA 1AZWA 2JJ2D 4N0DA 4MK4A 3CLVA 1N5MA 4UM9B 1IZ8A 3CJQA 4KE9A 5K0LA 4U5XA 1E7YA 3JWGA 5J9FA 1I80A 4BRZA 3EK2A 2AXEA 2OFXA 1IEWA 4GMXA 2HSJA 1IC6A 3D2LA 2QRJA 2X8JA 4JJIA 1M34E 4R1MA 1Q0TA 1WSWA 3P2MA 2BHRA 3QV2A 1SCKA 2OG2A 4TKVB 5BW4A 2O2XA 2PXAA 1DAKA 5AVRA 4C2TA 2HDNB 2IZ0A 4Q9LA 4L1KA 1GNVA 3GLGE 1NPYA 3TDKA 1X94A 2O2ZA 4K6HA 5A0VA 4DLZA 1R9NA 2XA1A 2YICA 5ELMA 3G13A 3I72A 3H05A 4Q1FA 3NRBA 1NI4A 4C0JA 1KVQA 1M1YB 4TKLA 5KOJB 4ARCA 4K9LA 3LT1A 2Q3BA 4YO7A 1WUTA 3ZW9A 2PWBA 4QA9A 2K2QB 3SFZA 1H2WA 1Q84A 2F90A 3O7MA 5CGZA 5KDDA 4OGWA 2J59A 3GIDA 4EBFA 3DEYX 4E70A 4GMGA 5LNK6 2NSHA 2CVFA 2LIVA 4B40A 3FUVA 3GI1A 3OIFA 4LFAB 1YHNA 2HLNA 1U9IC 4PG4A 1J33A 2AOXA 4AZ0A 2D2VA 1NJ2A 2QTGA 3LO8A 5H81A 3OQNA 3MIIA 1W46A 2P4EA 1RT9A 2Y8EA 3KTFA 3CVJA 4FNMA 5EUQB 1BCRA 5KNDA 4UASA 5HKLA 2NZJA 2Y1CA 3UFBA 1RQLA 4B31A 3H7IA 4X20A 2CF6A 2PO5A 2WJVA 1C3OA 1V39A 2HF9A 2J4CA 3KVYA 5EWJA 2CUTA 3RVSA 1SBCA 3NASA 4CHGA 4RK1A 3I9V1 1GTSA 4KAJA 3H0EA 4RSRA 1L5YA 3C5EA 1VCMA 4HVLA 1YB1A 1K5PA 2EKLA 1K5HA 2JFFA 2QQFA 4FOPA 2P6UA 1DQYA 4PZEA 4EVIA 5L40A 3AEXA 4DUYB 3A10A 3F1KA 3KV1A 3KYJB 4UVHA 1THZA 1YZGA 2CN1A 2QAJA 3LX6A 3NAMA 2HV8A 2Q6VA 3F7TA 4C06A 2P5UA 4IFEA 4CM9A 3KXDA 1WUYA 3DMGA 3ZIAD 1MEEA 4HUJA 1PF7E 1ESMA 3BMNA 3H9JA 3Q2OA 4XM2A 4X60A 3FSRA 2ZSKA 4UZEA 3ND9A 3TYXA 4ZYWA 1B8PA 3WRXA 2YVQA 1D9XA 3B3AA 3N0TA 5IYZA 1I4DD 2ZAGA 4UVDA 1CUGA 1FUIA 3TOSA 1GL6A 3BE8A 1ZK2A 2VHWA 4J0IA 3RWMB 1R12A 1OREA 2A1IA 2B2XA 1QU3A 2FPIA 3INNA 4UOZA 2IDMA 4K9QA 1IQUA 3PDWA 3FTPA 3QVMA 4KQGA 4O5OA 4KZKA 2WT8A 3DBHA 1CETA 4HXEB 4J0HA 3B1VA 4LZWA 5D6NA 4GYJA 3W8DA 3WGMA 3ABSB 4WLUA 2EVWX 2WNIA 1K5GA 1GU7A 2ZB7A 2VWQA 3HVHA 2PGNA 1EG7A 5AP9A 1BDJA 4UXHA 3SHTA 4CM7A 4E1BA 4UEOA 2NV2B 3VU8A 3JTMA 1XVTA 3L4JA 1GY8A 1H5UA 2LDBA 2JFWA 4KGXA 4ZGBA 5AD1A 2EL9A 2OZPA 2WMNB 4BNDA 3CEJA 3O83A 4JH0A 3L8GA 4JUCA 3WGVA 3W06A 2FZ4A 2FX2A 1JAZA 2G6TA 1TA4A 2IYFA 1CY0A 2O2SA 3PITA 5EPUA 1W87A 4DRYA 4AUNA 2IIQA 3F96A 3CCCA 4JWTA 4RM2A 1NONA 2BCEA 1Z0JA 1EA7A 4QAQA 1QLHA 4B3CA 1HSOA 2A5GA 4CL3A 3CX8A 3TOCA 1G3MA 1IULA 4C87A 2TMYA 2ZWPA 4MGKR 4KO8A 5BR8B 3EE6A 4EUNA 3O3MB 1BMFA 2A9KA 3C45A 4Z1MD 4ZI3A 2WVJA 3I6QA 1K6JA 4NENA 3IL2A 2CVZA 4HATA 2ON6A 2YJZA 4J1TA 3DFFA 4G85A 3C3JA 4FEEA 1P4SA 2Z3ZA 1KZ9A 1XQ1A 4FLEA 3V8QA 3VV2A 2P6RA 1ISSA 3WADA 1U8YA 1ICEA 4MUKA 1T3LA 1UM8A 4KIWA 1GGFA 1H69A 1QTIA 4OQZA 2HMTA 3T9EA 2OVBA 4HAXA 1H8ED 3V6MA 3VUEA 1B4DA 3HM9A 1LXCA 1FTYA 3N5KA 2A7QA 4AO8A 2Z8ZA 1WR8A 5F1PA 5DWQA 2I33A 1XAIA 4K9OA 3T34A 4EJSB 3GZNB 4AG5A 5FT9A 1HTBA 3GLTA 1DMSA 1YOBA 4GT1A 4COOA 3ZNOA 5ICCA 2ZLBA 1LPPA 3UWSA 6ADHA 3WLPA 2I1WA 4TT3A 2C3MA 4MUXA 1USIA 2JGFA 2VDQB 3LX5A 4P80A 4UZFA 3RHTA 2PT9A 3U49A 4E08A 2UV8A 1M2EA 5IXSA 3P5BA 4J7UA 4RESA 3CNQS 2YFKA 4HZUA 2FLVA 1NF3A 1GAQA 2J85A 1M8JA 3D3QA 3IMCA 1YR1A 2AOWA 2IZ5A 4L4UA 5D85A 1LUAA 1Y3HA 2ZIEA 1G20B 4M22A 2I4MA 4OCZA 5JC1A 1L7RA 3LD9A 1ZKDA 2FRXA 1E4EA 2GCIA 4EYSA 2J9FA 5TLSA 4JIMA 5E4YA 2Y0DA 1D2EA 4Q24A 2AEEA 1G1AA 3NP9A 5FQNA 4BVKA 1J25A 2RIRA 4LYGA 3FKJA 4RQAA 1A8PA 2YV1A 1GLVA 1L9XA 4RO0A 4COKA 1S8FA 2V96A 2NQ8A 4FFBA 3P0RA 1A7JA 4OHPA 3U7EB 2H1OA 1WCYA 4CKCB 1HQKA 1UJMA 4MV9A 1MT0A 2J0UA 2ZIZA 3S7ZA 4M1OA 1K5DA 4M9CA 3KT6A 3R9XA 2MOKA 1W96A 1KDTA 1U94A 4UUOA 3F73A 1G9TA 1GARA 1W52X 4AYWA 1ZEMA 4TTPA 3EFOB 3ASZA 3UJ7A 2ACKA 5C7YA 5KUTA 3AKZA 2QL6A 4YK7A 2JLZA 1TUBB 4M8KA 3WOHA 3OFND 1GAJA 3M1YA 4EUHA 5EIBC 3W9BA 3Q3HA 4F60A 5LCXA 4DDTA 5DBGA 4MW7A 5EJAA 3THSA 4I1IA 2EFDB 2N0SA 4NX2A 4BNKA 1FMFA 2IHNA 1K8QA 4C0HA 1A4RA 1F8YA 1ZNWA 4Q4CA 1A4IA 2PMFA 2EDCA 1FTQA 1WXGA 4PC1A 1HQYE 2IDZA 2RH9B 1IATA 2GHRA 5TEVA 3W8FA 2MINB 3RODA 1GPMA 1MAAA 2BRUC 2X3FA 4FKBA 1G5HA 2XLBA 5EC8A 3GLIB 2E85A 3G2JA 3ZYCA 4BMXA 1E2IA 5A0TA 1ECLA 1KJ9A 3AF5A 3V3KA 5DN6D 4RHXA 1EGVB 3EEFA 1MMFB 4G8JA 4CTNA 4W5OA 2NLOA 1K4KA 2DP4E 1OWNA 2EX4A 2P4HX 5BR1A 1YZ3A 1WU7A 4AK9A 2WD7A 3W5JA 1YB6A 4R0MA 3WIBA 1KEWA 1RD4A 1D8TA 1U7UA 3R3VA 4MPPA 4BV2A 4QT0A 4LZJA 3VZDA 1T9KA 1NRWA 3EWAA 4RVUA 3BOSA 2MSNA 3MJRA 4EJ2A 2XRMA 1VJCA 2O20A 3OIYA 1NN1A 4GBGA 4MW6A 1LTKA 1KKUA 4LTDA 3JAMA 4W6ZA 3D8RA 5AM1A 1VBNA 3EC7A 2P3LA 3R5HA 1XRMA 4FFRA 2OV4A 3J81A 3EUAA 1FFBA 1T6NA 2QNIA 2J7PD 1EX7A 1N8SA 2XADA 4ND6A 3U3RA 2B34A 2ZDQA 3UMBA 1HK7A 4YNBA 3E9MA 3JR7A 2H63A 3ZCUA 3CMMA 4JOCA 3QKRB 4W1SA 2IEIA 3BWCA 3HJRA 3JX9A 1Q0ZA 4MWDA 4Q4JA 4X7RA 3W3AH 1YVRA 3OE1A 2FXIA 1K68A 3K09A 1NXXA 4H59A 3HCEA 4F5WA 3KHUA 3DDCA 1K8ZB 1ADYA 1NUHA 4MLPA 5L53A 2LWIA 4H9GA 2RGRA 3NX4A 1T0IA 5HQ3B 3F5SA 4YT2A 2W90A 1BXKA 2JLUA 3PYMA 2P2SA 3THWB 2FN3A 2FETA 4KI0A 1NXTA 1B1CA 4ZOCA 2H8GA 2A92A 2KBEA 3TR6A 4A8JC 3PIRA 4E2XA 3CIFA 3PJRA 4Q66C 2W6ID 2V7QA 1UODA 3RO7A 1T6XA 1NOJA 2YHBA 3H9UA 1GO2A 2IHYA 4H7JA 4ZANA 3WK5A 4H3VA 3ILXA 3X43A 4MQBA 5ALOA 1VJRA 4FFSA 3WDSA 1JLLA 1I33A 1TM7E 2QNBA 3KLNA 2NZWA 4QDZA 1L7AA 3KKLA 4RU1A 1SJ9A 5FCDA 5JS1A 5IVDA 1MO5A 1A8HA 4WI1A 1FK8A 1R37A 2ZS7A 3TJRA 3EXFB 1QTRA 3BXHA 2BFBB 4LHWA 3C8DA 4PFSA 4BN5A 4YGXB 1COWA 1GPUA 3OLZA 1HEUA 5UKDA 2VDOB 1VJTA 5HMLA 3TXAA 1CQJA 4ZEMA 1YR9A 2IPNA 1Z62A 5BYBA 1DEHA 4C08A 5C8YA 1IB0A 1TAHA 4OSEA 4LRSB 3KB8A 3A0RB 4HDRA 1GTJ1 5B1YA 2BFCA 1D2AA 3EULA 4J0DA 3JQ8A 5AVJA 2HH9A 3WLIA 2L69A 4U7WA 1YSCA 2VDRB 3CKKA 4YPFA 3PGMA 2AOTB 1NPTO 3IYLW 5JRJA 4IDFA 4Y67A 2RK3A 4I4IA 3TQQA 2C00A 5A5EA 3VNVA 1T8PA 2XE7A 5EQJB 4G2TA 1FRNA 1YL5A 2YZKA 3K9BA 4I4TF 3SIRA 2PUBA 3H5VA 4F3TA 3N0WA 1U3DA 5F7JA 3ZHYA 3U13A 2CMKA 4DLSA 4BCCA 4NYMR 3SAJA 1XQYA 2DETA 1WXQA 3LQ4A 3QKSB 1K7CA 4HUQB 4BU1A 4Q4LA 4YDQA 4J2HA 3M6VA 1QV6A 3T6KA 2AH5A 2V6BA 5B3LA 5J5CA 4OU4A 3AP1A 3BXGA 3P52A 1RC0A 2FOLA 1P1FA 2GTHA 1A95A 1ODTC 1W0CA 2H1CA 3H87A 1D6SA 4PAQA 4QWMA 4CIVA 4BP9A 1N2JA 1R7RA 4TXLA 2VXYA 5KYUB 4P81A 1CZKA 4M4SA 4UARA 2XYGA 3CZQA 2IV2X 3SHQA 3X2EA 1WKCA 1J23A 4YWJA 2J6HA 3CLSC 2FN9A 1BHJA 3O2QB 5CITA 2Z2XA 5KHAA 5A4AA 1USVA 2P9ZA 5TS2A 3AKCA 3MJEA 2PUJA 3NGMA 3N6XA 5JIBA 3O4HA 4CKZA 2IBMA 4R3NA 1U0RA 4KFRA 3UZUA 3STVA 3H2KA 4A4DA 1L1RA 4F3RA 3ZDXB 2E37A 2W37A 5BV0A 3K0BA 5HTOA 2QVCA 5E3JA 5JO0A 3SZGA 4H4EA 4DGSA 1ICIA 3VPAA 1G4AE 2YN4A 1JKJB 2RGYA 4C22A 3AVWA 1C7FA 1JEQA 1SRRA 1QP4A 4R8RA 3OLCX 5AI6A 3AVUA 1SU4A 2B98A 2MSCB 4Q7JB 4XYGA 2JBWA 3H1GA 2FWAA 1JFRA 1R8YA 1U7XA 1Y5RA 2HU5A 3NYWA 2JGKA 3Q1KA 4EKIA 5HRUA 4E5PA 3E15A 5C1PA 1DDGA 4GMDA 1T0PA 3GBPA 2HLDA 3OOYA 3ZCVA 5DM60 3BF8A 4RD3A 2QAIA 4HDMB 3CZCA 2QORA 5CJPA 4ARZA 1E7WA 1YWGO 5JCPA 2ZITA 3TRIA 1YMUA 1I5OA 2NQTA 3ADOA 1YFKA 4HCJA 2HCJB 1VJDA 3FWZA 1FLAA 4Q3DA 1CKEA 4NCNA 3VR4H 3C6ZA 9ABPA 1QYRA 2VT6A 2Y93A 4YFYA 1R0RE 2HHJA 3DMFA 3H2JA 1OFHA 3M9LA 1COZA 2PJZA 5ALZA 3F5MA 3LCMA 5JC8A 1AF4A 3LW7A 2FSSA 2LDXA 5G1OA 5A3QA 4UVIA 2IYXA 3E58A 3X1JA 3E22A 1YGPA 3ZNNA 2WE7A 5DNDA 4LBZA 5TXGA 1DEKA 4B83A 1UOOA 1R0YA 2ZWIA 3O8RA 4BNFA 3PPXA 3TQCA 3OQIA 4HB4A 1TQDA 4E4TA 1B23P 5DBHX 1MC8A 1GKLA 4M53A 3RLFA 3RVLA 4CVNA 2BM1A 3QYPA 4H77A 4EIWA 5BXQC 2CGEA 5DH9A 2II6A 3OJFA 4AULA 5TPWA 2YYYA 1CUIA 1UJNA 4LDPA 2EZUA 1IPFA 3HCAA 3N2ZB 5EJFA 3STUA 3ZCQA 4KBGA 5EJ9A 1JJIA 1YJQA 1RXVA 4PC6A 1ELOA 1MZVA 3PPVA 3RSGA 3SX0A 4IGKA 4EG0A 1NW6A 2GPNA 1YU9A 3C5WP 3CZMA 5IJAA 4CFZA 2VPYA 1RYDA 2AT1A 1EK6A 3AC0A 3ANNA 1HDGO 2YMLA 3FNRA 3JYLA 3CW2A 1X74A 3CG4A 3RS5A 2ZBPA 1GRQA 1IONA 4WD3A 1FRFS 1JQLB 2BGRA 2J3QA 2YBEA 4PYRA 3U3DA 3K9HA 3ZJ4A 5BMOA 1IBLB 1YDHA 2JI8A 4O4LB 2CNWD 2FPUA 3ZNPA 1NVAA 4EVRA 3SYRA 5EJ8A 1A71A 5DNYB 4EX6A 1KZYC 4XYMA 3SMVA 1VSQA 1PWHA 2P0YA 2JAWA 2QGNA 3KELA 3LH5A 4Q12A 2O1WA 4RKEA 3EW9A 3ZJ5A 2XGOA 4AP5A 1YQQA 2VXCA 1AV6A 3RFUA 1GV1A 4BP1A 4HDCA 4O4JB 1WMEA 3AKDA 4HX5A 3VJKA 2EIHA 1L4YA 2IE0A 4FNAA 2W8BB 2R7NA 1IXKA 1R0CA 3HO6A 1N5OX 3WGLA 4C3UA 1WBDA 4ALNA 1PGOA 4TTVA 3B6JA 3JQ9C 3MF4A 1EFVA 2ZJBA 2RSLA 3AHCA 3WLSA 3S1SA 3SEFA 3A6LA 2GJSA 2FYTA 1BIFA 1H2RS 2NXCA 2P9EA 2JHPA 4QFMA 2X42A 5TF0A 1XXHB 2PUHA 1P0PA 1JL3A 3GRZA 4GR4A 3PFCA 3UJCA 4DTCA 4NHEA 3GMTA 3WBBA 2HSWA 3TS1A 4X1OA 5FHQA 2Y2VA 3RT7A 1YMQA 4MWSA 5I4BA 3KAQA 3L06A 2FTKE 1LBHA 1VIVA 2JAQA 1QFXA 4AO7A 5ABPA 2XNJA 5AVYA 3GQBB 1LFAA 1XD2B 1OZGA 2Y66A 5T5QA 2ZUWA 1BWSA 2WDPA 1XF1A 1W36C 3OZWA 4I1RA 2X8AA 3OPYI 4LOIA 1E89A 2WF5A 3RS8A 5CT4A 3W4KA 1UP4A 3EG9B 4LN1A 2YJ6A 4MRRA 4RTPA 2VHJA 3KTAB 3FCYA 1GUYA 3OX1A 4WMLA 2DBZA 1S1CA 4DIKA 3QF4A 3FYUC 1YH3A 3JD2A 2BEUB 3D7RA 1NSFA 3ELWA 3UMCA 5F23A 4DV4B 4MRVA 2B1JA 1AUXA 2GH1A 3ZU2A 5KTYA 4OQPA 4CKWA 4B75A 2R6JA 3R3JA 1E2DA 1MXHA 2PBFA 4YUWA 1VI5A 5TR9A 3KPUA 4ZCLA 5LDHA 4N41A 4UKDA 5KTNA 3K9NA 2OXIA 4H3HB 2G25A 5CX4A 2KLBA 2LP4Y 4HNRA 2GZ3A 2Q21A 4UNNA 4X1KA 3S2SA 3T7SA 3U0VA 1PZNA 1Y5NA 4P3NA 5K3OA 3MT9A 1BHQ1 2GM9A 3FUXA 1XMSA 1U8CB 5JZVA 5KEIA 1ZVQA 3X1KA 2HF2A 2AN1A 3FVRA 2PUGA 1I0LA 2V1XA 2XHEA 1LK5A 4QYMA 2LE0A 3GYBA 4NE9A 1I4WA 2EP5A 2Y1LA 2X2EA 2J9XB 5CVDA 4HF7A 3W1VA 3DLBA 1GGHA 2AD5A 2F1RA 4ZYTA 1WUKS 4FNGA 5I8WA 3TQOA 4DIOA 3MT0A 5FPQA 4YJGB 2IKQA 1CP2A 2Z09A 1A9XB 1UR5A 2P0EA 3NBXX 3A3PA 3IOBA 4OJMX 1PTJC 5CNMA 1Y8AA 2F9LA 1FX0B 3E9RA 1XTPA 1YZQA 2CDNA 2IUSA 3LLSA 3TLBA 1JDNA 2NVOA 2O8DA 5IPFA 3TSZA 1L4BA 1UF9A 2YMQA 3NTXA 4QU5A 4JYAB 4U7DA 1OI3A 5B2FA 1E4OA 1RRFA 4NPAA 3OQMA 4KUHA 3TE6A 4HN9A 2VZLA 2XWJI 2IC5A 3P32A 3Q7TA 2BF7A 4QTZA 1AB5A 2OORC 3SDSA 1KE1A 2HQSA 4MYSA 2PSSA 4KCGA 2NO0A 4RXUA 5JAQA 4DRXB 1PL6A 1G3IA 4MI1A 2X0FA 4G5FA 5BNZA 1P2VA 3IA2A 5EHZA 5LZ4A 3BWXA 3G1TA 5DTIA 4JLPA 2H08A 4BWGA 1GG8A 2ZT7A 3JQAB 1PDVA 4UBKA 2BGLA 3DE5X 3LGXA 4WKGA 2W4IA 5IVKA 4LXHA 1USWA 2CSUA 3TRJA 3COYA 4HB0A 3QLVA 1BGWA 1E0DA 3I9V6 4M83A 3GJYA 2FW9A 2O2JA 1C1XB 4KXFB 4WJZA 4DPMA 5EE1A 4HTFB 3FVTA 4TV8A 1U2SA 4NBVA 4RPHA 2Y92A 1FMLA 1MRNA 2QX6A 2CB0A 2P6MA 4UBMA 4JVNA 1WCV1 3D1JA 4CI9A 3JAKB 1POXA 4ZO6A 2IHKA 3IXQA 2NZUG 3O4IA 1IVNA 2WG2A 2OT3B 1SPXA 4C4SA 4X45A 1LPOA 1NZDA 5MDHA 1E79A 2AF4C 4Z9FA 4OXKA 1U2PA 4M7RA 4Q3LA 3U5ZB 4IIXA 3KT0A 4EY5A 2D0PB 4ZZ3A 1RABA 3H3JA 4UHJA 3WKEA 2YXPX 3R7LA 1LRKA 1DKMA 4DY4A 1C1DB 5K6RA 1E63A 3EVAA 1DAMA 1JUDA 5JMPA 2VUHB 5E1BA 5THQA 1YKFA 4ALIA 4K6KA 4KR2A 2I6TA 2X1HA 3CCBA 3DDHA 1ZHOA 5IUNC 1HYGA 2AR7A 3A1SA 3F9IA 3VPBA 3S3TA 2O3JA 2NXNA 4ZJYA 2FUCA 3QIVA 4NCJA 3IO3A 2DQ4A 2NPFA 5JZMA 3IE1A 4O2AA 1GGVA 1P81A 2ZRMA 3USES 3WLAA 2CDCA 1OV4A 4D9HA 2PAAA 1F60A 2OESA 5AVXA 1X1TA 5BRAA 1IL0A 1QH8A 1ZGZA 2WUGA 4LWQA 3QW2A 4OOFA 1JHAA 1KTVA 3CTMA 2IYPA 1WMDA 3NH9A 1W2GA 1C4WA 4X84A 4LF9B 3AY7A 4WFQA 4QSMA 3EGOA 1A5AB 1OA0A 2XVXA 4KXLA 1BU8A 4BV9A 2EFYA 3CZAA 3EGDB 1Y1QA 2QI9F 2WZCA 3HL0A 1W73A 4F7DA 5FH9A 2RARA 4Z3DA 1CTQA 1V48A 5EZ6B 4E7PA 4QYTA 4G5RA 3W8EA 3H9CA 4MWTA 2IW1A 2CLMB 3H8VA 1X92A 4GH5A 2IHZA 4KLAA 4WACA 1BRMA 4IDGA 4MV6A 1QB7A 1G66A 4KN6A 4R8SA 4Z3OA 3G8BA 1YJCA 4J16C 1V9SA 521PA 3OZDA 4A8TA 1HZZC 4RJ2A 2Y1GA 5GZ1A 1KI1A 3KL2A 2IOFA 4J07A 1T1SA 1ZSYA 1U2DA 2LCFA 4ZCRA 1YXMA 1QZXA 4ZODA 1OSNA 3U56A 2IYOA 3O2SB 2Q8PA 1BFDA 1KEEB 1AS2A 3KFLA 4Y0AA 1Q77A 1VGQA 2FPMA 2P7IA 1IN1A 2PZKA 3V8EA 5KQPA 4UDXX 3LHDA 2ANCA 2C2HA 3T9FA 4BO0A 5GQSA 1T29A 3U48A 4G5QA 3NHJA 2B0CA 1Z4PX 4RPLA 5KDOA 5KTRA 1SU7A 2HXSA 1XQ9A 3CRW1 3HHPA 5D01A 3VPGA 3FPCA 5EWMA 1SVLA 1X1AA 1J0CA 4WHMA 3R9KA 1T5IA 5DHAA 3ROEA 4B17A 5KPDA 2AXQA 4AJ1A 2WM8A 2Q2WA 4HXGA 1WB4A 4L8LA 3TQIA 4WW0A 5P8WA 1EAMA 4EO4A 2XUAA 4M9SA 4HYYA 4Z53A 1RQ7A 2WZBA 1XNGA 3R3SA 4HH0A 4CLXA 5CX1B 2Y1EA 1XZIA 2SICE 2ZIUB 1RPJA 1K9SA 5TARA 4RTRA 3HXOA 4MPJA 4GI1A 5FI0B 3L4BA 1QV7A 1V4NA 2P9CA 3DB2A 1PG2A 2Z5FA 3ZTWA 1HV8A 2OZKA 4NCKA 2QRZA 1N4DA 3LUCA 5F2OA 5KCMA 5FTNA 1C5KA 2QTMA 3AEUB 1SD1A 4KXYA 3WLFA 2O8CB 3B78A 4CKBA 2P27A 3DR5A 1P60A 3FMIA 3GBSA 4MIYA 4AD8A 2H1HA 3OIWA 4CF3A 5KMGA 2AG6A 1N1DA 3CZPA 2H2DA 3QMPA 4PAGA 1UIMA 4PO1A 4BQPA 4GIBA 2O59A 4RVOA 1MB0A 1U1IA 1ZICA 2J3EA 4L2IB 5CT6A 4DGQA 3QX9A 2FSGA 3WZ2A 5AWFC 4ZV9A 4KR9A 3W7BA 2FZGA 1IHDA 1BE1A 4MQEB 1GEEA 1YF3A 1STOA 2GPBA 2JFUA 2NUPB 2V4UA 1DFHA 3R40A 5EVCA 4RTMA 4QX6A 2I0FA 2YQZA 5E9AA 3ZZMA 3H8JA 3PYLA 1LF5A 2ZEJA 2QMUA 5HS4A 1PEAA 1ETHA 1Y3FE 4L8VA 4CXMA 1G8FA 3BXZA 1AKTA 1P3JA 3OEED 2DERA 3EMDA 4Q05A 4ER7A 3IUMA 1I7DA 1S9DA 2GYVA 1QE3A 2Q3JA 3QUAA 3E2PA 2I6GA 1XP5A 4N47A 3U7RA 2W2KB 2HRCA 3C87A 1ETUA 2Z2YA 4N8EA 4D3FA 5ULLA 1X7HA 4L07A 4OA5A 4M1EA 2NU7A 4BNXA 2R79A 5I4KA 1ZMRA 4DG5A 2V0CA 4HDNA 1MIOA 5EMLA 3E1KA 3UFXA 2I8LA 2J8ZA 1MGOA 4PAOA 4V0MA 1REQB 3PPYA 1JF8A 4LVCA 5G4KB 5E7JA 3UHJA 4CUKA 2IU6A 3EAQA 3KJXA 4M99A 1DJPA 2R6HA 2J32A 2VJQA 4MMXB 4RHCA 3HSSA 3R3HA 5CYOA 4LJ7A 1GSHA 3JYHA 1JLSA 2WVAA 2V97A 1WDKA 1FS6A 2Q1XA 3NOOA 5J5VA 2ZBFA 2G80A 4BLUA 1Y8RB 4Y8VA 2X9VA 3HLYA 5CFQA 1VG1A 3PWTA 1JG4A 1GITA 2HPVA 2N3ZA 1P1BA 1Z34A 1Z75A 2EU8A 2PA3A 1FSPA 1ESCA 1JIUA 3U7IA 3PQ2A 4AJNA 1V5EA 2ATEA 2QZ4A 1PRYA 3U9TA 2NVUA 2WSIA 1H5NA 3AFOA 2ZRPA 1YDMA 1ZO8A 3I2HA 3C3XA 3JS5A 1D5WA 4P22A 1C8KA 1L5NA 5AVUA 1R8JA 2XCQA 4NBSA 1D2NA 1W4LA 2QSYA 5K6AC 4YAEA 3MJDA 3THXA 3CUEF 4KQWA 4E31A 3FR8A 3ZY2A 5FLXA 5BVHA 3OH8A 2X9NA 4U7JA 1VPLA 3ZQ4A 4M0UA 3AF6A 4BLWA 3AVXA 1Y6ZA 3L6BA 1I2MA 4Z5XA 1DXHA 3NOXA 4MW5A 3W5HA 1ECFA 1JR3A 1HKUA 3GN2A 5KYVA 1Z2PX 4U7FA 1ODJA 3QKTA 1TK9A 2OCPA 2D6FA 3N6RA 2WFMA 3QE2A 3ES9A 3CNEA 2XTAA 2ZXFA 4Z7NB 1IN5A 3HYTA 1EWKA 5BSKA 2XDQA 3QVGA 1ZIYA 3C1UA 1P0FA 3BHIA 2H52A 4NJEB 3CH5A 5G0SA 3VOAA 5I3ZA 2YWFA 2RFLA 4MB6A 2H3EA 1NVVQ 4UUMA 3IV7A 2YHSA 2H5EA 5FPHA 721PA 4HNSA 3DM9B 3OLWA 5K7SA 5AQ1A 4O2BF 5EOVA 3HY3A 1AJEA 4PYLA 4I1SA 5F3WB 4II3A 2DBQA 3M1IA 1XC7A 3PXGA 1N2XA 1WCXA 3UJHA 5C1DA 3KQSA 1PVDA 3LHIA 1UBOS 3GFGA 4UVGA 2JS7A 3JQCA 2OBBA 2I71A 3AIKA 1UZNA 3IPAA 4G86A 1EGHA 1E8MA 2ZWOA 4L73A 4KKXB 3D6MA 4EQ6B 2CHGA 2C84A 3C1OA 1JDVA 4RVHA 1QRTA 2PA0A 5CA1B 1L4MA 4C7MA 2QAGC 1LFDB 2YZNA 2Q4EA 4D74A 2RI6A 4IFBA 4NONA 4QYWA 5F52A 4C0QC 5H70A 2O2IA 2V7WA 1HE3A 1U4SA 1M2WA 2KLHA 3VU9B 5G1PA 4ZVQA 3AJAA 3X1DA 4EKGA 2ECQA 5EXXA 2CJPA 2G1AA 1O4WA 1QF7A 3LSTA 3ZCSA 5IKMA 2PUTA 3AUYA 1KQGA 3DNFA 2OQVA 3ZU4A 1E8DA 2MHCA 3X1XA 2BEVA 1E2UA 4RZSA 4GRDA 3MWFA 4E5VA 2I99A 3FOCA 5JCJA 1M34A 4L57A 1C3XA 4S05A 4WXHA 4M0PA 5J4KA 1C80A 1RCTE 2P7HA 2YDXA 3B53X 4D25A 1NT2A 3GLGA 3BMCB 4MGZR 3UHPA 4ADSG 4D43A 4RKRA 2ODWA 4QVGA 2O7VA 2F8LA 5JLAA 4BTVA 2ZM5A 4H1VA 5AKJA 2I65A 4KIUA 3GGCA 5JZBA 1EVIA 2VBGA 2P2YA 4PANA 3G2HA