4ZI2A

Bart-like domain of bartl1/ccdc104 in complex with arl3fl bound to gppnhp in p21 21 21
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
185
structure length
185
Chain Sequence
LLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRSYFENTDILIYVIDSADRKRFEETGQELTELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKKLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Interaction of CCDC104/BARTL1 with Arl3 and Implications for Ciliary Function.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords ADP-ribosylation factor-like protein 3
total genus 69
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4zi2A00
1U99A 3DL0A 3OIUA 2ZM5A 1Z3IX 2ODBA 5FR1A 2OM2A 2AKYA 2ZS8A 3CRQA 3MG9A 3U7HB 3OFND 5FL7A 3RDPA 1G19A 3GLHA 4TL7A 2WSMA 2B7BA 3L0SA 4TYPA 5DYGA 1LS1A 2ZRMA 4LV5B 1YZLA 3ZH9B 4HSEA 3O8CA 1HV8A 5F9FA 2WIAA 4C0AC 1OPXA 5HCIA 3CBQA 3SR0A 1G7SA 5C4GB 1GOTA 2AFIE 2NO6A 2VHJA 4MITA 3AP2A 4B33A 1G6OA 3IHLA 2FSHA 4TL8A 5J4VA 4M53A 5DE3A 2QMUA 3QKSB 3FPAA 1P9RA 1UKZA 5CYOA 1XMIA 2NQ2C 2QL6A 2G0NA 5JS7A 1SXJA 2Z0MA 3QG5A 2EWWA 3QF7A 2JJ1D 1OH5A 4EQ6A 5IT5A 4V0KA 3MCAA 4LHXA 3QXJA 2WWYA 4CF7A 1X6VA 1P2VA 3DVLA 4V0OA 4CRWB 1TEVA 2IXEA 3NKVA 1IXZA 1OXXK 2QT0A 3TRFA 5K8UA 3RVBA 4DCNA 5FR2A 4IOJA 2P2LA 3K0CC 5JWOA 4G3XA 4JLDA 4A0RA 1IN5A 2IUSA 4A36A 2NO0A 4AWXA 2D74A 3DHWC 2NGRA 1CEEA 5DIFA 4TYNA 5HKKA 1YE8A 3AB3A 3IBYA 3W6PA 3AVXA 2V55B 4PXAA 5AJWA 2F3TA 4A2PA 4XSHA 5HZKA 4IXNA 4LV6A 1M7BA 4MYHA 1CJTC 2IYYA 2YC2C 3BERA 4JZKA 4NTZA 5JI2E 2W00A 3NG1A 3KQLA 5TY0A 4Q1DA 2P5SA 1G41A 3V4FA 5FPTA 3B6EA 1KSGA 4LHZA 4AYTA 4LYAA 2G88A 1G8PA 2XAUA 3R9IA 1P73A 1T9HA 4L9WA 3T61A 4AKHA 4MKFA 2IUUA 1Z0AA 1RIFA 3KL4A 2VPPA 2BVNA 3DO6A 3L82B 1MO6A 3QBVA 3MWYW 5FL7D 2VSXA 4P32A 5FPSA 2QZ4A 2YWGA 2NO1A 1E98A 4G5OA 4HLQB 3TAHA 2DFTA 1YJ5A 5DNYB 1JEEA 1GL9B 1II9A 1XD8A 4B6FA 3I5YA 1US8B 1XTRA 3EXAA 1Q57A 2H16A 2RH5A 3K70D 1E0AA 2WWXA 2V1UA 2J1LA 4ZI3A 2JLVA 3SEAA 1X1SA 1VIAA 4BZQA 2XNDA 3VQTA 2A5GA 1SVMA 1TF5A 5KSPA 4UXJA 2NG1A 1DEKA 4WZBE 4EPWA 4QC2A 8OHMA 1OT3A 3NDPA 2EFCB 2GA8A 4E09A 4BGDA 1H8EA 1GNRA 4TMKA 1S3GA 3ADDA 2WOOA 3BK7A 3PUZA 3L43A 4OYHA 2XOKD 3VX4A 2ZRJA 5EE5B 3V4RA 1NBME 3K0FA 3K70B 1VG0B 4QJ5A 3QXSA 3LWNA 4X8HA 4LDJA 1ZRHA 3OFNA 4RSGA 4A8JC 4XTCS 2GVZC 3FOZA 5CIWA 1KKLA 1RRGA 3QKUA 5DI3A 421PA 3K9LA 3ASZA 1HT2E 4LBYA 3THXB 3BB4A 3QNUA 4DVGA 5EP4A 5FTLA 1RRFA 2AHOA 3W6NA 2IYRA 2VRWA 3PCRB 2WWHA 3PEVA 5F9HA 1OXSC 4HEJA 1H8HA 4EFMA 2ZVPX 5H70A 2ZSAA 3U7GA 4M9QA 4M8NE 3FGNA 3BWDD 4B76A 2YOHA 2HEIA 3EZ6A 4HZIA 2HUPA 4GMXA 5GVRA 2HCJB 2WPDD 4L4UA 4Q4AA 3NEYA 2BCJQ 1R8SA 2RCNA 2VP0A 2EU8A 4MYTA 4C0BA 3DOEA 5FPHA 2UZ3A 1JR3E 2D2FA 1JAHA 1SKYE 4KSCA 2JJ2A 3LV8A 3GLIE 1LFDB 2BHRA 3UG7A 1ODFA 5AUOB 5LD2C 1EFUA 3KJEA 4ESVA 5C1BA 4FWIB 4TN1A 2OEPA 5FBLB 2P5TB 3B7GA 2GK6A 3VU9B 1KI4A 1QHSA 1VHTA 1UBFA 3PUYA 3QXCA 1JR6A 3FMIA 3OIYA 3UWKA 4CYMA 5C46F 1OH7A 5HPYB 3K0SA 2G0TA 4D4KA 1ZM2A 4JMPA 4MRRA 3TMKA 3GCGA 3B1XA 3PEYA 1QHIA 2YV5A 1ZM9A 2H5EA 1M2OB 2QG6A 3SYLA 4G5GA 4RKEA 3R7WA 1IM2A 3NHAA 1OYYA 3BH6A 5AJXA 1AIPA 1XMJA 3LQRA 5E7MA 4DSNA 4Y0VA 4V0LA 4M1OA 4V0NA 2WJJA 4TT3A 1XPRA 3GFPA 5E95A 4H1VA 1G9XA 3VNUA 1WA5A 1MR3F 4BFXA 4AKGA 2BOVA 1JBKA 4BLQA 1MABA 3JZMA 2QQ0A 5GJCA 1YR8A 2WMNB 1D9XA 1VMAA 4Q1EA 3PVSA 4WAUA 2DWPA 1G291 3RRMA 3M0EA 3WNDA 4IDQA 4B2PA 1W4CA 1WMSA 2VSFA 4U7DA 1W0JD 4PPQA 2QMOA 5JJLA 2F1HA 3GLIB 3A8TA 3N5CA 2C98A 4X8MA 4YQFA 3QQ5A 2FJUA 3SYKA 1N6OA 3WHKA 1NSTA 5KPJA 4C0SA 4JJKA 3BAFA 4I1OA 1G8HA 4BFWA 1K6MA 1EFRD 2IL1A 2O5VA 3QEOA 1IN8A 1KI2A 2PEYA 2QGZA 5AJZA 2OCAA 1XF9A 3DZ8A 2QPTA 2OT3B 3W90A 3X2SA 4V0MA 2RGCA 1NN0A 1EX7A 1UPTA 3FMOB 5CJPA 2C95A 4D0LB 1OB5A 4G1UC 3OAAA 2P0EA 2QE7D 4BLTA 4UJ3A 1J8YF 2ZSBA 3GJ3A 2ANCA 4JBWA 2VHUA 4B73A 5AWFC 5DI3B 1KJYA 1EX6A 1SVIA 1XU4A 2ANBA 2FE4A 2OBNA 1Z0IA 1U81A 4D80A 4KODA 4NP6A 4D81A 5AJYA 1NVVR 3RS5A 4XVRA 2ZSDA 2ZR9A 3HYTA 5JSZA 1SVSA 1RZ3A 3T5GA 3UKDA 3RS0A 5TB5A 1UJ2A 2H18A 1XTIA 2BM0A 4MRNA 4JL8A 4B3DA 3B1ZA 5F3WB 1ZVQA 2N46A 5LB4A 1HUQA 4CW7A 3OEHD 2V4ZA 3AQ4A 4MDFA 1Q1QA 1FMLA 2IW3A 1EGAA 4OI4A 5G53C 3AM1A 4LHVA 1L2TA 4D4MA 4AIIA 4DLRA 4KHZA 3C16C 1GNPA 3RAPR 4MYUA 4TLCA 4RZ3A 1OF1A 1G64A 4Q66C 2DCUA 1AS2A 2ZI4A 2FU5C 1W2HA 2GXUA 4IDOA 3AF1A 4A0HA 5J4HA 5DSZA 1PVOA 3VHLB 1C9KA 2O8FB 1II8A 4AYWA 3K53A 4I1SA 4LPSA 1BYUA 2IF2A 3Q9LA 3A1TA 3FFBA 4URYR 5JMTA 1IJEA 2ERYA 3GP8A 4B3CA 4TQAA 3AKYA 3CO5A 3EPHA 2BEKA 1XRJA 3HDTA 3ONWA 1F6BA 1OIXA 1SXJC 1ZYUA 1E94E 2BKEA 2CBZA 2W6JD 1DOAA 3CPEA 4O2RA 2NPFA 5JHHB 3THYB 2V7QA 1E2PA 1G4AE 3DDCA 5E7JA 3I92A 4LY6A 3A4NA 4OHVA 2A5YB 1ZIOA 1J2JA 1U98A 1XWIA 4FMDB 1Z63A 2QNRA 4Q4HB 1OIWA 1E1RA 2WJVA 3LLUA 4P4SA 1A5TA 1KO1A 1W48A 2B8TA 2CL0X 2GBLC 4ACBA 1KHTA 1C1YA 4DDUA 2RGEA 3VR6A 3IUYA 5JEEA 1U8AA 1L4UA 1XTSA 1XXHA 3IHWA 4EDHA 5KDOA 2G77B 1AZSC 4PTLA 1LF0A 2IK8A 5EUQB 1YZTA 4EAQA 1KDRA 2PBRA 3MWKA 2QMHA 3K70C 2F43A 2IEZA 1TADA 4KV9A 4OI1A 1JECA 2BJVA 3A36A 1MT0A 1PZNA 3GEEA 2IYQA 3ZDQA 1NF3A 4B35A 4WIAA 2P6NA 1YU9A 3NVAA 2XZOA 1XD2A 4B43A 2QSYA 1E96A 2Q9BA 1GWNA 4DUGA 2IX3A 1I4LD 1LW7A 1FUUA 1P9NA 4BEBA 1EFCA 2O0JA 2WOJA 3C8UA 4BWYA 3EAQA 2A5FA 3C15C 1VG1A 2IYVA 4UNPA 2QRNA 2Q9AA 5JCZA 3CRRA 1W1WA 3EWSA 3U7FB 2IYTA 221PA 3OEHA 1E0SA 3BORA 3AVUA 5CLQA 1GSIA 3ZQJA 1RJ9A 4NHOA 3GLGA 4PZYA 2Q21A 2QM8A 1QHYA 1RPZA 2HYIC 1VG8A 1U94A 4WW0A 4JLAA 1JR3D 4M4SA 4RCZA 2DWOA 3CLVA 1BMFD 4Q03A 2ORWA 3IO5A 3LD9A 2N42A 5GJBA 4NH0A 4Z1MA 5L3QA 1MH1A 1P9WA 1PV4A 3SJBA 2V54A 3UMSA 5FBVB 5HE9A 2FA9A 4N0DA 4ASUA 2OO7A 4AKIA 1XEWX 4A6PA 2ZRNA 3ZLJA 1WBDA 5FOVA 2YHSA 4W5HA 4LC1A 3AP1A 4BFUA 1E4VA 1HA3A 4D4JA 1MABB 4EJSA 2AXNA 2CCKA 4JLMA 4N1AA 4R2IA 3T15A 2IYSA 4A0GA 2C78A 3UIEA 2NTYC 3R9XA 1IXSB 1UAAA 2FOLA 2ZSEA 2HYDA 2OFOA 4IW3B 4G5SA 2GK7A 2C99A 3L0PA 1GM5A 5JCPA 1G1MA 4WBSA 1J99A 4LYJA 3RLFA 2KI5A 1XB2A 2YWHA 4H9GA 3Q5EA 1Z8FA 2WTUA 1JPNA 2LKCA 2QGNA 1F48A 4P4TA 5AJVB 3JZAA 1S1MA 1QHHA 4BASA 1J7KA 6Q21A 1KY2A 2GDJA 4Q4JA 4HYYA 2B6HA 1DG1G 4Q1BA 3PIRA 1NMXA 4JBYA 3VTKA 1JNYA 4D4LA 4DLWA 1GL6A 2I3BA 4TMZA 2O52A 2RGNC 1OV4A 1S0UA 2GCOA 3LO5A 2PJZA 4KSBA 2O8CB 4PX9A 1FOEB 2QAGC 2Q3FA 1N5IA 2XB2A 3BGWA 4Q7JB 4OQMA 1DADA 3A6PC 2Z6VA 3W3AA 2N1BA 1ZNZA 2WKQA 5JEDA 4TMXA 2FFAA 4TZ6A 3O8RA 2ZI5A 4A15A 2VH5R 1W36C 1A2KC 4UXIA 3HU1A 5LDDC 4DCVA 2QBYA 2QEQA 3IIJA 3GJ5A 4D2IA 4ILEA 5BN5A 4QBIA 3IBGA 5CIQA 3RANA 2EFDB 2REXB 2ZETA 3U4QA 4HB2A 4DSTA 3DKVA 1OSNA 1LS6A 1FX0B 4IDNA 4AY2A 1N0UA 1JEDA 1OH8A 5CITA 2WSSA 2ZYVX 1EFRA 1E1RD 2D2EA 2W58A 4MQBA 1T3SA 4N3NA 3DPUA 3A1VA 3VR1A 3VX3A 1NN5A 1Z08A 3OESA 1ZCBA 5DHFA 1ETUA 4HB0A 4PHHA 4BFTA 2D4HA 4KXFB 1W2GA 2QROA 3JVVA 3WYGA 5L3RA 2ZI7A 2DHRA 2ZR0A 2FPLA 1H8HD 1HQCA 3I62A 2B92A 1WE2A 4LGMA 4Q1FA 1AZTA 3ZIAD 2JA1A 3QKRB 5J40A 2W2TA 4E07A 3TH5A 3B2EA 1IY1A 3NH6A 4P31A 5D3MB 5D3QA 1ESNA 5KSYA 3L0OA 3TVDA 1FUKA 3T1OA 3VR2A 1BO6A 2PLFA 1GRRA 3R8CA 4LJAA 1SVKA 5DH9A 4F7WA 2ERXA 5EXTA 5AUQA 5FOTA 3ZVLA 3T35A 3GQBA 2ZJ2A 2PZEA 4BRUA 4NL4H 2P6RA 3C14C 4U02A 1B23P 3B85A 2CHQA 2XTMA 4HLDA 4C2TA 3TSOA 5BXQC 3B1VA 4C7OB 1TQDA 1ZINA 1CULC 4LK2A 2J87A 2FFQA 4MA4A 5HR5A 1VPLA 2NPIA 2ONKA 3TGPA 3D7MA 3OEEA 1KY3A 1ZMXA 3PENA 4GMDA 3THYA 1DG3A 1UBEA 3REFA 2PT5A 2GXAA 4CZ2A 1CIPA 4D0GA 3ZVNA 1TQ4A 3WYFA 1ZNYA 4TZ0A 1WRBA 3C41J 2ZJBA 2CLDX 3I4LA 1WXQA 2V6IA 2ZROA 3CX6A 4QGGA 3ZYCA 4MUBA 1AJEA 1FW6A 3I61A 1Z22A 2GJKA 2D7DA 2CCGA 2DPXA 4EPVA 5M04A 2KJQA 3AKEA 4JL6A 4LYFA 1KO8A 2XOKA 1DO2A 3DKPA 1TNDA 3KUCA 4J0QA 4OK5A 3H86A 5EXXA 1EFHA 2AD1A 1AGRA 3EPLA 1E2GA 2BWJA 1WCV1 2EYQA 3LNCA 2VYFA 2CNWD 3MJHA 3AVWA 5KSZA 2BCGY 4PZZA 1AQYA 4Q4AB 4D0NA 1PLKA 1JQJC 2IYLD 2ZAMA 1ZNXA 3F8TA 1OFUX 1FTNA 2VLIA 4DC9A 4B3FX 4DCSA 5GADl 2GAOA 3MMPA 3WHLA 2HLDA 2YKGA 4KFSA 3A4LA 4GRAA 3SJCA 3OE7A 2FFBA 4G0NA 3VR3A 1YZKA 1W0KA 2DWQA 1QHXA 1PLJA 1Q1BA 2AR7A 3O47A 5L3SA 1F2TA 4JL5A 1Z6TA 1HURA 3ZIAA 2J7PD 4DCUA 4F92B 4TT3D 3VNVA 2OCPA 4UXHA 2JLXA 3CZQA 3GEIA 1HE8B 1KMQA 1CS4C 2OCBA 2Z83A 2IXFA 4DLSA 1XD2B 1DAEA 3B1YA 3NC1C 2DFNA 1FNNA 4CT5A 2CVFA 2FEMA 2QAJA 2OXRA 4GOKA 4TTQA 1XMSA 4H1UA 3FHTA 2WMOB 3UPUA 1SVWA 4PQFA 3EWAA 4WZ6A 5CJ2A 5CB8A 5J4LA 1Z28A 2WWIA 3GJ7A 4HAYA 2FPKA 3FWYA 4IKEA 4HAZA 4M1YA 1Z47A 1ZNWA 2ZUDA 3KXKA 1JJ7A 2XX3A 4PQYA 4RFSA 3K9GA 4I4LA 5JRZA 1B0UA 4M1KA 4TSFD 1G8FA 1R8QA 2GNOA 2IXGA 2ZRPA 4JSYA 4R71A 5AUPB 5BYKA 4DDWA 1SVLA 3SQXA 2ZI9A 5HKKD 2R2AA 2VHCA 3HR7A 4O3MA 4KVAA 2PL3A 4JLPA 1VIYA 1Q12A 5K8IA 1HQYE 1P4SA 3PXGA 4F4CA 1M7HA 3WRXC 2OCYC 1CXZA 2YJTD 3C5CA 1VHLA 2GTPA 2AWNA 1FZQA 2ZAOA 3AF4A 4MRPA 4C7OA 2CLCX 4DSUA 1YZNA 3UWOA 3ZZUA 1M1YE 2GAAA 2QAGB 1CJMA 4II7A 2CE7A 1E99A 4LV8B 5CK4A 2QT1A 2R65A 1OKKD 4PHGA 4ESHA 3RS4A 4OBEA 4HUQA 1DAGA 4ZIRB 4ZCLA 2H92A 1W36B 2ZE8A 4V03A 1D5CA 4B48A 2QU8A 5BN4A 1XD9A 3LY5A 5H68A 2GCNA 5TARA 3CH5A 5H1YA 4D6PA 1C4OA 3P4XA 3TIFA 2X2FA 1V43A 4EPXA 2GF0A 5JI3E 1N6HA 5K8TA 3GLFB 2OAQ1 2J0UB 1QG4A 3ZZ0A 2B7CA 1Z6AA 2MMGA 1G5RA 2J7PA 1G20E 1R0WA 3EIHA 1VCNA 4M1SA 3ZVMA 1X1RA 1TMKA 4LYHA 3LBHA 4Q7MB 1E6CA 2H17A 3IPYA 1EXMA 2QN6A 1VCIA 4C2UA 1XTKA 121PA 3LXXA 4UNQA 5AUNB 1W7AA 2RMKA 3BJIC 1F2TB 1N6NA 3CUEF 5EZ5A 1UADA 3FHCB 3I72A 2V6JA 4JLNA 3NDBB 1I2DA 2ONJA 1X8LA 4Q00A 1O3YA 5G41A 3QI2A 1D9ZA 2ZRIA 4TLEA 3KZ1E 4URVR 5FFMA 1NRJB 3S1AB 2I4IA 5ELXA 3LLMA 4FW9A 2X77A 2FZ4A 2WSSD 1N3BA 4JKYA 5IRCD 1GFIA 3T06B 1IN4A 4B44A 1NVVQ 2ZRGA 2ORIA 1HTWA 1R0ZA 2GF9A 2DR3A 4LHYA 4JIMA 3SI7A 3NBFA 4P4SB 1TEXA 1Z0DA 4NYJQ 2AWOA 3K09A 4MGIR 1DAIA 1OXTA 1YRAA 1U9IC 3KQKA 2ORVA 1JI0A 1EWQA 3GPLA 1P75A 5GJWC 3AKCA 3AVQA 1XXHE 1TF2A 3OEED 1A82A 4RFSB 2ODWA 2DBYA 2FN4A 1VCOA 3TQFA 2PCJA 4HLUA 3SYNA 1N25A 1OXUA 3TLXA 3I5XA 1IONA 3LH5A 4KAXA 3BH7A 3W8NA 3TW8B 3P32A 1I2MA 4OI0A 1TU3A 1ELOA 1ZM3A 5JBQA 4IVRA 4M9XA 4LHWA 3RHFA 2J0SA 1T0HB 4JLBA 1GRQA 4GP7A 4RZXA 3LVQE 1FFHA 2JDIA 5E3HA 2ZRKA 1NN1A 3BD9A 1IOZA 821PA 1UDXA 2EFHB 4A92A 1GDDA 1KSHA 3HJNA 3LFUA 5EE0A 3FHOA 2C9OA 2IYXA 4PC7A 2VTKA 1IN6A 3KJIA 1TTTA 3P26A 1OB2A 2I1QA 1NBMA 1LVGA 1ZM4A 2CK3A 2OFWA 3X1ZA 1VG9B 5TVKA 2WVJA 3HPRA 4RD4A 2RGBA 3JVUA 1OH6A 4BUJA 4JSTA 5JFGA 2GJ9A 1CBUA 1KSJA 4C4PA 2I1VB 4IOLA 1KO4A 4E22A 1G3QA 4KU4A 3A58B 4KFUA 3CZPA 1YR7A 4NE2A 2BIFA 3OE7D 4IDHA 4NONA 1Z2CA 3NEJA 1AK2A 2REOA 1NN3A 4DHEA 4BPBA 2ZS7A 1W4BA 2C96A 4HB3A 4B3GA 4C3ZA 4N0EA 1XX6A 2GJAA 4OL0A 1E9DA 3WXMA 5DISB 1TQ6A 2FGKA 2JJ1A 3CF6R 4C0LA 4DT1A 1PJRA 2KSQA 3MWJA 3R8FA 1MOZA 5H8WA 2FGJA 1XEWY 4FD2A 2AK2A 5BWMA 2QP9X 2DY1A 2ZUBA 5EE3A 4LJ6A 5F98A 1PLLA 4HDCA 1AKEA 3ETLA 5FPYA 1E2FA 2VQSA 1CJKC 1COWA 2F6RA 3NHBA 2CXXA 4IHQA 1FQJA 2A3RA 1D8TA 1SKYB 1XEFA 3KQHA 1SGWA 2AXPA 3Q8XB 3SHWA 3ECCA 3I8XA 2W6IA 1G3MA 4GZMA 5FOUA 2A2ZA 2XZLA 2BMFA 5JECA 4YDSA 2ZRAA 4BECA 4Z54A 3BFVA 1NVUQ 4RD6A 2HF9A 3MWLA 1ANKA 3GLHB 4OHZA 1NI3A 5KU1A 3NWJA 1XPOA 2ODEA 2R6CA 4DB4A 2HT1A 4L15A 3K09C 4ZV4A 2ZJ5A 5FTNA 1OE0A 4Q9LA 2CDNA 3Q5DA 5B30A 1KI8A 4EUNA 1Z2AA 1E9FA 2FSGA 4PC2A 4CEJA 3AUXA 3VKWA 2ZEJA 3X1WA 3KB1A 4B75A 1II8B 3SOPA 1KK3A 1X3SA 2CJWA 4QGAA 2P3SA 4PC6A 4QBHA 4US2R 3O8BA 3M6AA 1R6BX 1Y3AA 3U3KA 1ZD9A 4M22A 1GRNA 4A8JA 3EIQA 3V00A 4QXAA 3HYRA 5A5GA 1WDTA 2F7SA 1KK2A 4OJKA 5G3ZA 1UFQA 2NIPA 2G83A 4PSKA 3IPXA 3L8ZA 2QORA 3PITA 4DIDA 1NBMD 1Z6GA 2X19A 2Z43A 3F3YA 1M74A 3K9NA 3K0EA 3GD7A 5L8VA 1E79D 3QOFA 5JJKA 2NOAA 1LTQA 1GNQA 1GKUB 1R7RA 3ZGXA 2YZ2A 2ZS9A 3AVVA 5EP1A 4WXPA 1NIPA 1J90A 3CF2A 2QTVB 4B2IA 3CRMA 4QHYA 4PC3A 5J5CA 3QPUA 1BH2A 2XNDD 2BBOA 4B74A 2XNSA 3I1FA 4QGFA 1F2UA 1OKKA 2RGDA 3B9QA 1P6XA 2EYUA 1E2IA 1G16A 2C03A 1WBBA 1E9BA 2VHTA 3CR7A 1RRPA 3QPVA 4FCVA 2WIBA 3PUXA 4LUCA 1AKYA 1GUAA 2QAGA 4YMWA 5SZJA 5SZHB 3TBKA 2ZYUX 4IOKA 3PUWA 2BMEA 1R5NA 3E5HA 1FNMA 2RAPA 5BQ5A 3TK1A 4FMCB 2FSFA 5JLJA 1PUIA 1E2NA 4CEHA 3ADKA 2B21A 3HWSA 1G6HA 2JGNA 1K5GA 3ZS9A 2ZXUA 3ICEA 3D31A 3LVRE 2JLRA 4DLYA 3BB1A 5LBIA 2IWHA 1DO0A 2HJGA 2JEOA 1HE1C 3D8BA 3ZS8A 3GLGB 3U5ZB 3W8RA 3AKDA 5JJIA 2OE2A 3WMFA 4BLOA 2WKRA 1DBSA 2GZDA 2ZVQX 4MH0R 2QE7A 2RHDA 1XTQA 5FOXA 4C9BA 2KBFA 4NCIA 2F55A 1Z07A 1UF9A 2QTHA 4ON9A 3T12A 1YZGA 4QNMA 4GDFA 4Z8XA 1K8RA 1KJWA 4NCHA 2LWIA 1DAMA 2XSZA 5JRJA 3I3SR 4M2LA 3MGCA 4C0HA 3NBZC 1Z0KA 1T6NA 3E2IA 1GITA 3MSXA 1ZJ6A 1VKJA 1KI6B 3KUDA 5IDVA 1GKIA 3MJRA 1RRCA 5G3YA 2R8RA 1EG7A 4LBVA 2VSOA 2OZEA 2CHGA 4X8OA 5EJEA 4PHFA 1QRAA 2NO9A 2KWIA 4OQXA 5HCNA 1XJ0A 3H0KA 4P33A 2E9SA 2EVWX 4ZO4A 2CNWA 4GZLA 4OKSA 5FL3A 5GJVC 1P2UA 1GILA 4PAOA 3B82A 3LW8A 3KTAA 2OAP1 4FINA 4BLPA 2VHQA 4MGKR 2GZHA 4BRWA 4C30A 3ICQB 3X1YA 2CEAA 3CWZA 4S35A 1XNJA 4Q9JA 2XTNA 3ND9A 5JWRA 3WBKA 3AGQA 2J3EA 4B34A 1W36D 2MSDB 3T1VA 2YNMA 2JATA 3RRYA 4ZCMA 3CONA 1MV5A 4RD3A 1YRBA 4EJSB 3VKGA 1O87A 1GZSA 5J47A 4QHTA 3PV0A 1MO5A 2ZJOA 2O8FA 1DS6A 1MO3A 1XZPA 1II0A 3NIBA 2ZRBA 1E4YA 2ZU6A 3GJ6A 1TF7A 2QBYB 2V1XA 3LA6A 1NMZA 1P5ZB 3VR5A 2QMEA 3K0AB 3SFZA 3AP3A 4ITRC 3B60A 3K1JA 2Q0HA 2RHMA 3AEZA 1IBRA 4Q02A 4RD1A 4YMVA 1XTJA 1RC8A 3TSZA 1CR1A 1OIVA 1YR6A 3B13B 3RRZA 2EQBA 1RE0A 3RC3A 4IEEA 1EESA 1DAFA 3DM5A 3C4JA 3PG5A 2H57A 3EG5A 3B5JA 4AYXA 1VYTA 2GCOB 4TQ9A 4MKHA 4PAMA 2ASEA 2VL7A 4CIDA 1NLZA 3NXSA 2FFHA 1W49A 5DN6D 4U5XA 4RD0A 5KNDA 1R4AA 3ZD7A 5C4MA 3LX8A 4OQFA 1KKMA 3K9HA 4CEIA 4XTRA 2JLWA 1G8GA 2BM1A 2Q3MA 1L4YA 2VA8A 2XEXA 5DLQC 3VMFA 4O0MA 2WWFA 1S4QA 1YR9A 3VKHA 4YLGA 1DAKA 2QSZA 3WNBA 4A2QA 4PO9A 4B6EA 2GWHA 3TUJC 4EIWA 2FNAA 1KDTA 3LW7A 1S2MA 3QG1A 1D2NA 4FMDF 3E1SA 1NJGA 1AS3A 4ZDIA 3ADBA 1KI7A 4DWJA 4AI6A 4L5BA 3J81k 4URWR 5DI9A 1KGDA 4LI0A 4NDZA 3TR5A 5FPKA 1AQUA 1KI6A 4MUAA 3U7EB 4URXR 5KNBA 2QPOA 3B9PA 3IIKA 1XCGB 4DB2A 2IS4A 1RYHA 3EARA 1WB9A 2J46A 3FKSD 1E0JA 3H2YA 1A4RA 1E9CA 1OHHA 3DZDA 3QF4A 4O2LA 4O25A 5CYPA 1Q22A 1YHNA 3T1TA 1P2SA 4BE7B 4HB4A 4FMBB 2NZJA 4B71A 1UEJA 4HAXA 4LC0A 4QFMA 1GP2A 2WV9A 3KX2A 4FCWA 4GT1A 4TMVA 1Q1ZA 3QUSA 4HDOB 1NLFA 3F0TA 2JLQA 2CL7X 1NVXQ 1ZCAA 4BZXA 2YC4C 2ZPTX 3GJ0A 2J0UA 3A4MA 2PH1A 3PQCA 4WZAE 5FI1B 1IN7A 1VYVA 2O8EB 2A5JA 1YKSA 4RY2A 5KDLA 3W5IA 4TYYA 1ZW6A 4LRWA 2IWRA 1IAQA 2BKUA 4NKRA 4TL9A 1SKQA 4PHTA 3ADCA 1CU1A 3MD0A 3PJRA 4DDTA 4NYMR 2VP2A 5KO2A 3A1SA 4HAVA 1N6KA 3CF0A 3U44A 3BC1A 3BOSA 3P27A 4Q21A 4QG7A 3ZQ6A 4M1WA 3W9YA 1L8QA 2IF0A 1N6LA 1E2QA 4DJTA 1QDEA 4RCYA 2X8AA 3EPKA 3OIWA 1LF5A 1UKVY 2CK3D 2OSBA 1U0JA 4JLVA 2IC5A 4JJZA 4W5JA 2MSEB 5BYJA 3W6OA 5A4JA 3WRYC 3AVYA 2CVHA 1UBCA 4D26A 4R2HA 2ZJZA 1M34E 1QBKC 1XJQA 1N2CE 1X86B 2ZU0C 3I8SA 4XD7D 3CKLA 3GLHE 5ANRB 2HDNB 3KXIA 4Q9HA 2JLZA 4NCKA 3SZRA 4TMTA 2R6DA 4QM7A 5L3SB 1IQPA 4ZKDA 4EQ6B 3BBPA 5F2EA 3PFIA 2V7QD 4CGZA 3BXZA 1QG2A 1ZU4A 4JVNA 2BBSA 2C8VA 4Q9KA 2H7VA 1Y63A 1U90A 3UG6A 2DFLA 3AF0A 1IY0A 2EWVA 2UZIR 2O0KA 3CPJB 3A37A 1KIMA 1LV7A 2ZRFA 1BKDR 4Q5IA 5FBWB 3WYAA 3KB2A 2W2VA 5GVSA 1TX4B 2FSIA 1T3HA 2ZQ5A 4YDHB 4PZLA 4YMUA 1JXOA 2ODNA 1U2RA 4HAUA 4DCTA 1E9SA 4GFDA 1L7VC 3HPQA 4Y0AA 3RC8A 1KMHB 1HT1E 1ONBA 4BQSA 4Z1MD 2ZRHA 1R0XA 1JPJA 5KTYA 1R5BA 2ZJ8A 4GOJA 3IILA 1FL9A 1KZGB 1T5LA 1XMVA 2WJIA 2H8KA 4NYJR 4URUR 3Q7PA 2PMKA 3RABA 4OQLA 3QF4B 2R6FA 2SHKA 3BS4A 2O8BB 2QY9A 3EC2A 1KTVA 1BIFA 1UKYA 2QP4A 4QM6A 1OW3B 4LZZA 1EK0A 4MRVA 2FH5B 4KFTA 1LY1A 1XDBA 1ZC4A 3CNOA 2G6BA 3TW4A 4K81B 2IS2A 4MGYR 4FI3C 4AG5A 5KNCA 1XP8A 4CEHB 3BFXA 4GBMA 3RYTC 1S9DA 3VAAA 3F5FA 2A7QA 1YZUA 3MRSA 1G7TA 1UDWA 5E4FA 4EPYA 4HATA 2J7KA 4AC9A 3OIVA 2D06A 2MMCA 4CDGA 3G5UA 2BJWA 1CLUA 2KB0A 1XXHB 3RS2A 3REGA 2PEZA 2A9KA 1R0YA 3WP1B 1YVDA 4GNKA 1OFTA 2XJ4A 4BFVA 3NBXX 4TLDA 1N5JA 4YMTA 1CF4A 4NPHA 2QI9C 2O8DA 4OK6A 1Z0JA 2FEOA 3LX5A 3AH8A 3ASYA 2OUKA 2YYZA 3G0HA 4QNRA 1GVNB 3U2QA 3S1AA 1CRQA 2ZSFA 4K8OA 1NL3A 1OXVA 3T5DA 1PUJA 5FUXA 5J4KA 2DYKA 3ND8A 4TL6A 1AGPA 4B47A 4DIEA 2GBLA 1EWRA 5FH9A 3U4QB 3WY9A 2AK3A 3AGPA 1CJUC 2ZRLA 1SZPA 4F93B 3IDQA 1IY2A 4EPRA 2GCPA 1S9HA 3UATA 2R6AA 2ZTSA 1W0KD 3SU8A 2DB3A 2DFKB 1E2MA 3CNLA 3TNFA 3PR1A 4I99A 4PSAA 2HLDD 2WAXA 3R20A 2CJWB 2O8BA 3TVTA 5IK2D 1SHZA 1XJCA 1P62B 1BOFA 3DM9B 4XWAA 2GESA 2C2HA 4PPNA 4W5WA 1LB1B 2UKDA 3EIEA 3L8YA 4LOAA 3CRVA 2VP9A 4JT4A 3A1UA 3GLFA 4NZYA 4KITB 2YWEA 2R44A 3QEJA 5HZHA 4JLJA 2AL7A 1P3JA 4US0R 3U6BA 4IDPA 2REBA 3UMRA 1DE0A 1XCMA 4DRZA 2PX3A 4ZKEA 4B3XA 1KMHA 2X2EA 1KDOA 2XGJA 5C2JB 2RB4A 1X8JA 1W47A 3ZZTA 1M6NA 4ZPXA 3SBEA 1OLOA 3CX8A 2QM7A 4FWTA 2BMDA 3DMNA 2OXCA 1CJVC 4S2EA 1N6IA 5TDHA 4OJQA 3EX7C 5UKDA 4BLRA 1OYWA 3AVOA 3N70A 4TQUS 5IK2A 1G7CA 4PQRA 2HCBA 4IJMA 4PANA 4AG6A 1LNZA 2JLYA 2PZFA 3SNHA 5EXSA 2XITA 2P67A 4JYCA 4ASUD 2J0QA 2C04A 3B78A 3GJ4A 1ESMA 1DPFA 1Z5ZA 2KE5A 1Z83A 3RS3A 3SJAA 1QHGA 1Z6XA 3EW9A 2O0HA 3X1DA 2JIZD 1Q20A 4BFSA 3CIOA 4UQOA 2WHXA 1SHKA 1F3OA 1CR2A 4RKFA 2ZI3A 1F60A 2GJSA 3AUYA 3TKLA 2GEDA 1CR0A 3GJXC 4GL2A 4FMCF 1R2QA 4Q1AA 2C9CA 1ZD8A 2CL6X 3BB3A 3BIFA 3W5JA 4TLBA 4BLSA 3FYHA 2GXQA 2O8DB 3SHFA 4ZDJA 1E1QD 1KI9A 2GJ8A 5L3VA 1FTSA 2QP3A 1SXJD 3VR4A 4A6XA 3RWMB 3THOA 1E69A 1MKYA 1NJFA 1XFAA 2PLRA 2R9VA 2RGNA 3K0FB 1G4UR 4DLUA 3B1WA 2VIIA 4YC7A 1S3SA 1ZD1A 3HU2A 2GETA 4Q4LA 2IBMA 2J59A 1JAIA 2XJ9A 4JLOA 2RGGA 3LBNA 1YZQA 2ZREA 5A0FA 1VCMA 1TAGA 2W2XA 2QA5A 3H4MA 4DUGD 5HE8A 5K8LA 3SJZA 3U3RA 2J0VA 2GZAA 2Z4SA 1GG2A 3W34A 3THWB 4P3YA 1NG9A 5LB2A 4A8JB 4R9UC 3RWOA 5EP2A 3KTAB 1FQKA 1N6PA 4OI2A 2FX3A 2QPAA 4DLZA 3QSYA 4RZUA 3R7WB 2XB4A 1UBGA 2G9NA 2O8EA 2JJ8A 3NC0C 3IIMA 1A2BA 3K8YA 4RZ2A 2GRJA 1Q3HA 2OBMA 2ZYWX 4HLCA 4I81A 1E2HA 1Z29A 4E5UA 3SQWA 2W0MA 3CH4B 2Z4RA 1I4TD 2F3RA 2IA5A 2IYWA 3WMGA 3QXXA 4NYIR 4US1R 4V0ME 1BS1A 3K0CA 5EUMA 2FV8A 4UNRA 4KI0A 3HP1A 2GXSA 2LCFA 3G82C 3P4YA 4JVMA 1CRPA 4Q18A 3T1QA 3BRWD 4W9MC 2JIZA 3V9PA 2OILA 4XOIA 4WXRA 3IGFA 1OFIA 1Q1EA 3QE0A 5LD2B 1DARA 3CR8A 5EP3A 4B32A 1MRNA 4IVQA 3DEFA 4IVPA 3PEWA 1RJ9B 1IXRC 3H84A 2AN9A 2W0SA 4L8GA 4QHSA 4MKIA 2JDID 4LJ7A 2CCJA 4V02A 4DBLC 3EPJA 4PO1A 1WF3A 1W0JA 2VF8A 3QKTA 1KDPA 4KJZA 2WJHA 1X8KA 4C0JA 4OQNA 2V8OA 4JT2A 1H8ED 2GEVA 4XD7A 3LBIA 3LRPA 5L3QB 4QL3A 5DO9A 2ZYTX 4Z51A 3D6TB 1BMFA 2JAQA 5D3MA 4KBGA 4TSFA 521PA 5KPDA 1DELA 1Z6YA 4MKGA 1CR4A 2HV8A 3SBDA 4IFEA 5JHGB 4CEIB 4M0LA 4GPTA 1KOFA 1QVAA 1QZXA 4NMMA 4F4IA 4A1FA 5AR1A 1SQ5A 3O8DA 1TUIA 1FP7A 3MFYA 5FUWA 2IYUA 2W6ID 1T0JB 4XH9B 1E0KA 5KDDA 3KXLA 1N0WA 3MUFA 3GLFE 3TJZA 5CLLA 2PX0A 1ZP6A 2VF7A 4JKIA 2E87A 4LX0A 4ZI2A 2IT1A 2VP6A 3C7KA 3RS7A 4AKEA 4B3BA 3M1IA 4QBFA 3SFVA 1RYFA 1JXMA 2IHYA 2P65A 1E3MA 4I1UA 4TTPA 4Z8YA 5CDFA 4DLTA 1XZQA 3HU3A 1QHHB 4LJYA 2ZITA 1COWD 1ZIPA 3TE6A 2PT7A 3KKPA 3QENA 4HLUC 2XZPA 2D62A 1Z06A 4Q19A 2Y8EA 1QVRA 3EZ2A 5CM8B 1W44A 1IJFA 3FTQA 1RW4A 1UEIA 4GSYA 1G5TA 2IEYA 5FTKA 3TUZC 3KQNA 3EA0A 1D6JA 1QF9A 4XJXA 4LJ5A 3E70C 5KUTA 4D82A 1ZUHA 3DOFA 2P6UA 1YQTA 5DYIA 2E1RA 1KJZA 1SVOA 4CVNA 3CX7A 5CK5A 4ZCIA 4BZPA 3KJHA 3SS8A 4LCBA 4PPFA 3QKRA 2OFXA 1R5OA 1RFLA 2BMJA 2FZLA 3FKSA 3OHMA 4MYCA 5C18A 2D3WA 4JBXA 3QXHA 4KLNA 3WNCA 2ATXA 2PJRA 3ZVRA 721PA 4JS0A 1W5TA 2YVUA 1Q3TA 2W6JA 3BH0A 2F1IA 3FMPB 4WVFA 1NY6A 1A7JA 4DZZA 3AVPA 1G17A 2MSCB 5FTJA 3WP0A 2JJ2D 5P21A 2AKAB 2IHBA 4YONB 4AD8A 4ARZA 5SZIA 2VEDA 3GEHA 3VHXA 4TTRA 2J45A 4XSGA 1KK0A 1XEXB 2QQEA 1FX0A 3NH9A 3CM0A 4F38A 3U61B 1P61B 1KAGA 1XEXA 4Q01A 3ZD6A 5FOWA 1P72A 3GFOA 2QRZA 1SXJB 1SXJE 2C9YA 2YWFA 1BYIA 4AK9A 2VP5A 3KKNA 3EZFA 5EE1A 2L0XA 3IEUA 1N5KA 1KO7A 2WBLC 3FB4A 4ZDWA 2ECKA 1D2MA 2D7CA 2RKOA 3GLIA 4G5QA 2WJYA 1NSFA 1ZAKA 4BEJA 1Q0UA 4DXAA 2VBCA 2HXYA 3EA5A 1N5LA 1A1VA 1G21E 2Z5FA 5FI0B 4JYBA 5FOSA 1KSFX 5KSOA 2ZIAA 2WJGA 5TV2A 1J8MF 4M9ZA 4Q1CA 1KNQA 2G3YA 1HEIA 3UMFA 3U44B 3VU9A 3SC3A 4DKXA 4QKQA 2NZ8A 3NTUA 2AFHE 2F1RA 3U3MA 2AX4A 4RFVA 4PPGA 4HZUA 1JQLB 3Q3JB 4LJ8A 621PA 1NKSA 1JALA 2YINC 3B8HA 4EFNA 3FKQA 1G3RA 4W7SA 2FG5A 3TUIC 5DN6A 2C77A 1GL7A 1KNXA 3P1JA 3GJ8A 4KLZA 4MDEA 4XWOA 3CRW1 1J70A 4UKDA 4Q4JB 2CHVA 5KHOC 4QGHA 2V9PA 2WAYA 2XSZD 4PSVA 2OLJA 4FXPA 1NNEA 3MAAC 3N2IA 3OZXA 2GILA 4PFSA 4A0FA 2A5DA 4B2LA 1NIJA 5SZKB 2QENA 4A2WA 3KKMA 3W3ZB 4LSGA 2UVQA 5CM9C 1US8A 3Q85A 3M4YA 1KO5A 3CB4A 2ZE6A 4QJ4A 3EZ9A 1TUEA 3UK6A 1NVWQ 3QVUA 1JR3A 2W83A 4BFZA 4YXWA 4OHYA 1MRSA 1UKEA 3LDAA 2JCSA 1U0HC 4PC1A 3HR8A 2BEJA 3H1TA 3UXMA 1E9AA 1SULA 4M9SA 5TXGA 3AVTA 3C5HA 3FE2A 4P0TA 3IQWA 3T34A 3IKJA 2F1JA 4KYUA 2F9MA 5JSZB 1GIAA 4FN5A 5CB6A 5KOYA 5B57C 4L9SA 1GKYA 4M1TA 4KYIB 4R7ZA 3SE0A 1T3LA 2GEUA 1M8PA 3CNNA 3WMEA 4DDVA 3X1XA 4Q48A 3U6KA 1G5PA 4TWZA 2QTFA 4ZIRA 2F9LA 1F5NA 4Q4HA 1E2JA 2LKDA 1DTSA 5JZVA 4ZDKA 4ERNA 2GKSA 4E03A 1NY5A 4A4DA 2F43B 4HI0E 3I73A 3U60B 3KKOA 4NCJA 1G7RA 4NBSA 5FBRB 2EW1A 1XCPA 5EZ6B 4DEXA 3L0IB 4PO8A 1Q21A 1NLYA 2RGAA 1N6RA 2HJVA 3KQUA 3PEUA 3N2EA 1G3UA 2ZANA 3KFVA 3BFKA 3QPWA 1E79A 4KFRA 2JLSA 3FFAA 3SN6A 2ZRDA 2J9RA 1S8FA 5IHPA 2PMDA 1T91A 3A1WA 3QBTA 1EFTA 4NU0A 2Q9CA 1RKBA 3QVVA 1T8UA 4RJLA 1W4RA 2BBTA 2HT6A 2ZJYA 1ZU5A 4XVQA 1H65A 1E9EA 1KI1A 1CKEA 1NG1A 2GVDC 4QJ3A 4IOMA 1R10A 1WQ1R 4JVSB 1K5DA 4LJ9A 4AURA 5B64A 1ZUIA 2R6GA 4M21A 5JS8A 2XXAA 4X8LA 4UNSA 2FWRA 4KVGA 4CEJB 2KBEA 1OFHA 4URZR 3RSOA 1DAHA 3SDZA 2FDCA 1AS0A 3CWQA 2WICA 1FP6A 4GP6A 4KO8A 1Q44A 2K5UA 3GLGE 4A82A 4KCGA 2J41A 4KBFA 4EPTA 4OHWA 3IO3A 4NYIQ 4C0QC 3AF2A 1ZBDA 1U8YA 2ZUCA 3BE4A 3IQXA 4Q7KA 1KI3A 5JWHA 2WWGA 1OHHD 3CPHA 3RRNA 1GTVA 1KAOA 3GMTA 1DVRA 1HY3A 5G40A 2G1KA 5BW8A 1QHNA 3U3OA 2B8WA 2XTZA 4RVCA 3TR0A 4Q7LA 3LQQA 3QIAA 4IXMA 1N0VC 1P2TA 2BV3A 3QKSA 1IHUA 1KZ7B 4QRHA 5B2ZA 2NO7A 2WKPA 1T5IA 2OLKA 4TYQA 2V3CC 1F2UB 1HYQA 4C0KA 2ZE7A 2OBLA 3THXA 2JASA 4RD2A 4Q47A 3K0AA 4DSOA 2IUTA 4U00A 1T4GA 1U0LA 4ABYA 3KDSE 4ARZB 1UM8A 5CDFE 1FMJA 5FUVA 2BDTA 4LBWA 3TQCA 4F4JA 2BC9A 2FPMA 1ZM7A 3LXRA 4A9AA 1NP6A 1VTKA 4IFBA 3PUVA 2RGXA 4GI7A 3RSLA 4XVUA 5J4YA 1KYIA 5EXPA 3FMFA 4EJSC 3ZJYA 4D25A 3FDIA 4XIGS 4FIDA 3KJGA 2IS6A 1G18A 3OF5A 5EE9A 1S1CA 4LBZA 5DGXA 5TMPA 4GOXA 2WWWA 2EFEB 1VECA 3R9WA 4CT4B 2OHFA 2A30A 5HTKA 4LJ4A 3TAUA 4DLXA 1AA9A 3EC1A 2PCLA 4P4UA 4M1MA 1Z0FA 3TSWA 4MGZR 2QUZA 1E2EA 2HXSA 3P20A 4TMWA 3UANA 3QJYA 5EQTA 4YXWD 1G3IA 2YOGA 4HZUB 1W5SA 2Q3HA 4QOSA 2O8CA 1TL7C 1P7CA 1D2EA 1TU4A 2Q6TA 3KFXA 5KYKA 4K46A 4DLVA 4QBGB 1CTQA 2R62A 3CW2A 1XBTA 5FBQB 4F91B 2IS1A 5IF9A 1XPUA 4POAA 3LAWA 3Q7QA 2BBWA 2G1JA 2FMXA 2OG2A 3QY0A 1NKTA 1E2KA 4LPKA 4EFLA 2J5XA 4HDQB 4TLAA 4Q9IA 2TMKA 1MO4A 4R98A 4WA7A 1GAJA 1OJLA 1W46A 4G5RA 4IEIA 4WOPA 3THWA 1NMYA 5BN3A 3OAAD 1E32A 3VFDA 1FPMA 1CP2A 1HH4A 4LWZA 2ZR7A 4UJ5A 5DHAA 1I4DD 3EASA 2YOFA 2C5LA 4JLKA 1JB1A 5LPNA 3IEVA 4YMSA 3I32A 2ZE5A 2OV2A 2CMKA 2VO1A 1E1QA 1S96A 2X1VA 5AK0A 5E7IA 2OESA 4DT1B 4HUTA 3GFTA 3NBYC 1ZUNB 2CLSA 2WM9B 5B58C 1TQ2A 1M7GA 2WZQA 3AV0B 4I1VA 1JJVA 2VP4A 1T8TA 4PR0A 4JVLA 5FTMA 4MRSA 3EZ7A 3WBJA 4L16A 2H1LA 1E9RA 3KKQA 2CE2X 4NCNA 4HUQB 1U8ZA 1P60A 4FCTA 4PAQA 1W4AA 2ZI6A 2PZGA 2ZRCA 4UNNA 3Q72A 1VYUA 4TYWA 2EFGA 4BFYA 2ATVA 1E2LA 1WP9A 1ZC3A 3MLEA 1G8YA 4EKDA 4HAWA 3RNLA 2JLUA 2NMVA 4ACAA 1KK1A 3U3JA 2IYZA 4DEYA 3L2OB 1RVDA 1V5WA 2ZJAA 3D3QA 4NYMQ 1U9IA 2AD5A 4OK3A 3FVQA 4OHXA 2GHIA 1AN0A 2XXAB 4XWKA 4G01B 1AM4D 5FUYA 4IRUB 1VDZA 2WPDA 3AF3A 3DMDA 1TPZA 2HF8A 2FF7A 1E2DA 2A78A
chains in the Genus database with same CATH superfamily
3NX4A 3OIUA 3R5FA 2FRVA 3RFTA 3NT2A 3IBFA 2ZM5A 3C3CA 1DBQA 4AJ1A 4WUTA 3UK1A 1C80A 2HHJA 3O2NA 4OQPA 4XARA 3ZQKA 1CDDA 3FSEA 3PWTA 3R0XA 3OFND 3WGYA 4Y1GA 2YJZA 3GLHA 5DTQA 2WVAA 3L8FA 1RPJA 1R18A 2WSMA 2XRYA 4TL7A 3TTVA 3UMVA 5LP6F 1A9TA 4P4GA 1LS1A 4WBXC 2IV3A 4EY7A 4HEQA 4PIVA 2I6QA 1UMBA 3R7DA 2PIDA 4RV5A 5F9FA 4C0AC 1OPXA 4I6GA 2I2WA 5J23A 1U3FA 3HKBB 4M98A 4KFRA 4PCVA 3HN6A 5LXTF 1UM9B 3C7TA 3PQ4A 4XKJA 1SOAA 3SKYA 2O2IA 4Q7QA 2FSHA 2AE2A 3WLIA 3MELA 4M53A 5BSRA 4PW0A 3JAKB 3FPAA 1E8MA 4ZVMA 2CV0A 2NQ2C 5ICGA 1QG6A 5L53A 5TX7A 2G0NA 4X6UA 1WD5A 3S2UA 4EY5A 3DTTA 1KJ8A 1U7XA 2EWWA 3QF7A 1WCWA 4EQ6A 4KKVA 4V0KA 3M5WA 1MV8A 1LDBA 2ZVDA 1KYVA 3ANSA 1FK8A 3LUAA 3QXJA 1L5RA 2Y93A 3JQFA 4LHXA 4DJ5X 3JD2A 3TLAA 4REQB 4BO8A 1TEVA 4CRWB 3NKVA 4J2HA 1Z39A 2H29A 1MOQA 2IP4A 1WCYA 2W5UA 3D1LA 4PFKA 5K8UA 4IOJA 1D2RA 2P2LA 4WA8A 3MPUA 4L2IA 2J9ZB 3K0CC 2NZYA 2DLCX 2XGGA 2DJIA 4G3XA 4KC0A 1MN6A 3QLVA 4JLDA 4A0RA 1GCAA 2VTVA 4OHUA 5FHQA 2CLLB 2ERCA 4TTVA 4OQZA 4RLFA 1WW2A 1CEEA 2AXQA 5AM1A 4FFBA 4KGDA 5DIFA 3EXFA 1C4XA 4Q3AA 3RNOA 3VZSA 4TYNA 2QRHA 3W6PA 2RH4A 2XA2A 1CB7A 2PSSA 4WY5A 3M6MD 5BT9A 4WFJA 4H08A 4IUBS 4LV6A 3IMEA 2JBWA 4B6SA 2IW1A 1EUQA 2CDRA 2GERA 2BFMA 3HBJA 1N4DA 2P11A 4NTZA 1IHOA 4YECA 2YQ5A 3HCWA 3VAYA 1E3WB 1JEQA 1H22A 1KS9A 1Y7IA 4TRRA 4C3UA 2PGIA 3B6EA 1XQ6A 1Z34A 1U80A 3F6PA 1OA0A 1RKUA 3L9WA 4AYTA 4F72A 4GWGA 5FUQA 3T61A 1PEKE 2UYCA 2IUUA 4RDXA 4U8GA 5HUQA 4L4YA 1Z4KA 4LZAA 1PT7A 2VPPA 1GU1A 1OTYA 1U8XX 1MO6A 2BVNA 2CFIA 3ADPA 3L82B 4Q6BA 3MTAA 2NO1A 4M1ZA 2PL1A 5BSKA 2XGMA 1OTHA 1HG0A 2J9YB 4MMYB 5CX4A 2ZT7A 4YO8A 5JH7A 1YE5A 4RWEA 1YJ5A 3LWZA 2HJ9A 3M1AA 3V6LA 1OH6A 1L5YA 2HK7A 1XD8A 4HBZA 5HIIA 1QX3A 1B93A 3PE3A 1E0AA 3WISA 3I42A 4BIIA 5KBYA 2H7YA 4RJKA 1X87A 4ZALA 4V1CA 4GI3A 2JLVA 2X76A 4UPVA 2VPIA 1VIAA 3TKAA 2E2WA 2XNDA 2XQGA 4MI1A 4N82A 5EUCA 4J76A 5F7OA 1PJZA 1VFNA 1KS2A 3BRWA 3F5DA 2YQZA 3G9QA 3PD0A 2NG1A 1DEKA 1FLVA 8OHMA 4ZYXA 2VCYA 1GNRA 4WWHA 5GV8A 5KNCH 2V7WA 3EVCA 3JARB 2RAVA 3PUZA 3CLKA 4FONA 4L0QA 3V8VA 4L28A 4I14A 4RTKA 2NVOA 1WDKA 4IWYA 4C87A 2XOKD 4K03A 3A3KA 3V4RA 1NBME 2E4ZA 4LAFA 2VRBA 3KT0A 1VG0B 5CB4A 1I3KA 5TQ2B 4YPVA 3ZDFA 3R6DA 2A92A 2A4KA 3M6LA 4LDJA 3RSZA 3V2HA 3OFNA 1DI0A 5CNMA 4OM7A 4ZQGA 3RYIB 5C8ZA 1XROA 3FOZA 5CIWA 1IB0A 1KKLA 1RRGA 2YVKA 3QKUA 2I3ZA 1NNSA 2P9GA 2YVLA 4JJIA 5F5XA 4GQBA 4HYEA 4OQQA 1XV5A 3E22B 3QNUA 3V42A 2D2IA 1TW3A 4M36A 3KOZA 1DBVO 1DFHA 1XUOA 4YP5A 4FOSA 5F77A 4B7AA 1AHHA 1DC4A 1H8HA 1YMQA 4EFMA 3QPCA 4F5EA 2G72A 2B8JA 2WHQA 5AJUA 1UBJS 4BNUA 2X6RA 3BWDD 2QQ5A 3O94A 3KZCA 3G0OA 4X6XA 1UIRA 2IFTA 1TCCA 2PANA 3DTYA 4L4SA 3NT5A 1U65A 3OBIA 5DMXA 5A5FA 3HDVA 2RAFA 2HCJB 1LVHA 3FF4A 2BCJQ 3KZKA 4DEVA 2VP0A 2RCNA 3USZA 3TLYA 2YIVX 5HFNA 3ZUGA 2DKFA 4MYTA 1HXHA 4TXLA 1OPRA 3DOEA 3EMBA 1JAHA 2QQGA 2JJ2A 4KSCA 3GLIE 2AA3A 2EIHA 3DCIA 3LHSA 3R7FA 3CVVA 2KM1A 4JVOA 4ID9A 3LBAA 5AUOB 1HE3A 3BXOA 1P0MA 5C1BA 4FWIB 4TYMA 2PMBA 3SD7A 4IUDS 5EQDA 3QXCA 1LI7A 3TM4A 2BGJA 2P78A 3OIYA 5DGCA 2QM3A 5IVIA 3ZGZA 5HPYB 1IK4A 3I23A 4BBPA 3GCGA 2H3HA 4OP2A 5JBIA 3LQ4A 3WWOA 3L7MA 1TM7E 3D8RA 3SYLA 2XMQA 4U5QA 4EHJA 4YXFA 4UCFA 4RKEA 4FZ3A 4ZGWA 2XNKA 1A9ZA 1IM2A 2VDNB 3DVAB 4C1BA 1AIPA 1XMJA 2JHFA 2ZZKA 4Y0VA 2ZIGA 2WJJA 1UOOA 1PGPA 2EF0A 1Q50A 1ZMRA 4MW9A 1IUKA 1FU7A 3RCBA 2OO5C 3L6UA 5FWNA 4B2YA 1SCIA 2GJ4A 2MJLA 1AUOA 1MR3F 3SM3A 2VG8A 4BFXA 4AKGA 3HJGA 5DM0A 1YOVA 2AYYA 2OA0A 2H1SA 3EGIA 1MJNA 1VMAA 4Q1EA 1K6XA 2X8JA 4A8HA 3REQA 1RCUA 2PMCA 4IDQA 4TLLB 4HYQA 1Q6YA 1QLHA 1NQ5A 4YHHB 5FULA 3GZ4A 2F1HA 2P7HA 5JJLA 3QUCA 3P9KA 1E92A 1I3LA 3N5CA 1A77A 3TKYA 3JQAA 5EWJB 1ABEA 2RGWA 3SYKA 2C5SA 3IQEA 4D92A 4AJ2A 4IO1A 3DOOA 4JR0A 1FLDA 1NSTA 5KPJA 2A9JA 1GLGA 2Q5QA 4IRMA 3FBGA 3Q3GE 4BFWA 3BQNB 1K6MA 3AM4A 3R3VA 1VPWA 2Z6AA 1IBSA 2W90A 3SSAA 1H85A 2OCAA 1JGTA 4EHHA 2EDCA 3F5MA 3DZ8A 2G8NA 3CLUC 3IOCA 3KTDA 2OT3B 3C6BA 3W90A 3I9LA 3DEIA 4B4OA 5J3JA 2EKZA 1UPTA 4PR3A 1HE5A 5CJPA 3LXMA 3OAAA 1WZNA 2QE7D 2HPAA 4BLTA 1ZIXA 3OHSX 4PX3A 3GJ3A 1E6UA 1EFPA 2ANCA 3GA7A 4B73A 4JQOA 1Z33A 4BWVA 2OV3A 1JAYA 1XRPA 2OD9A 3ROEA 3AUAA 2ANBA 2B4KA 2GPAA 3HYLA 4TWJA 4GHWA 1U81A 4KODA 2ZUVA 2Z1DA 1YRWA 5EJFA 3TJMA 5CNJA 5AJYA 1F14A 3ZHZA 1K0FA 4FGJA 3RS5A 4CM5A 1ID8A 1C1DA 5KYXB 4A8TA 1G5IA 1E7RA 2A14A 1Z35A 3AY6A 1XZNA 1Q0TA 3TW0A 2FKNA 1A4IA 2IIQA 2LW7A 3OU2A 3Q0EA 2XVXA 5TB5A 3R7BA 1XTIA 2Q41A 2BM0A 3OMLA 4JL8A 3FFXA 4LOHA 5KAPA 5LB4A 5B36A 1GZUA 3EQ2A 4CUJA 1L8LA 3Q7SA 1Q1QA 4MDFA 3GUCA 4OI4A 2IZZA 4R3WA 3TLZA 5LL6P 2W98A 4J3FA 4M83A 5CTJA 3RAPR 4BLVA 1RC0A 5H0IA 4RZ3A 3OC6A 1OF1A 3T3HA 4D44A 1THGA 1NBOA 1AS2A 2KHZA 2ZI4A 2FU5C 4A0HA 3O93A 1SPXA 3L1VA 3KE9A 4QDOA 4Z5XA 4DA8A 3BKXA 1XLVA 3AIKA 1M1UA 3T6KA 1BYUA 2XDQB 1O58A 2PLNA 5INTA 5JMTA 1UZUA 4F6RA 3TG2A 4OB7A 3T3MB 3GP8A 3QJ5A 1QKKA 4KQGA 4ZHQF 4ZYWA 1Y6FA 3DC7A 2Q5EA 1QS0A 2CBZA 1OIXA 4G0ZA 4R98A 3BRQA 4ZFNA 2HA6A 4MCAA 3GRUA 2PPLA 5H7XA 1HYGA 5DXJA 4G4SO 1PG2A 4FX2A 3STTA 2ORED 3TTWA 4NZOA 3A4NA 1MAHA 1O9HA 4R1MA 4R9NA 4DFDA 2A5YB 3P5BA 1O0BA 4Q4HB 4P4SA 1A5TA 2JFXA 4TZTA 2RHGB 4TWRA 3SZUA 4ACBA 3DLIA 2P4UA 2HADA 3AR9A 1JBQA 2RGEA 3C4VA 2Q5FA 4O0LA 3GVPA 2PYDA 2Q1YA 5JEEA 4RIHA 1XTSA 4N01A 2EOAA 3JPWA 1QH8A 3R3XA 4PZAA 1QVWA 3KWFA 5HBRA 2YN4A 2PZJA 3WGTA 2GDZA 1RYMA 1YZTA 2PBRA 4WNIA 4EAQA 1XI2A 2QMHA 3MWKA 5G4LA 3AL3A 1Q3KA 2R0QC 2IEZA 1PJTA 4J4HA 4GKJB 4QE3A 4V2UA 1UXJA 3A36A 3T4EA 3L7IA 2EKLA 1B43A 2ZJ7A 3U0BA 4Z2AA 3BZUA 4MKXA 1SB9A 4WIAA 3NVAA 1KY4A 4IZ6A 2C3PA 3OEYA 3FPEA 3OPVA 1E96A 5EFOA 1GWNA 4UTRA 4MZDA 4AAYA 1VLLA 3WIBA 4BEBA 3H5WA 4JBLA 1EFCA 4M46A 2RKBA 4BWYA 1U28C 1A7KA 5F51A 3EAQA 2OQVA 2A5FA 3PZRA 3LG2A 2I8CA 3JYLA 3Q11A 5EMMA 2IYVA 1GCIA 4UNPA 4EVIA 1XDUA 3E9NA 3ILHA 2Q9AA 4EHBA 3PUJA 4B8YA 5LA6A 3TCXB 2MINA 1CP3A 1I1NA 1RWPA 2FPXA 4QIHA 2QM8A 5LYYA 1RPZA 3HN7A 4B5LA 4JDUA 2OV1A 4JLAA 4RCZA 4MJ3A 5C80A 4TUYB 3LPMA 2OOKA 3IO5A 1NASA 4NH0A 1FMTA 3ZWWA 1BXRA 5B2FA 5FQOA 2VEOA 2X0KA 4E5YA 2C3UA 3MK31 1PV4A 1BS2A 3SJBA 4FOOA 3BDIA 4ZARA 2KQUA 2OO7A 2SICE 4A6PA 2F4VB 1Z2EA 3E7WA 3GIWA 3QKWA 4IEFB 2H4YA 5EC8A 5FOVA 5A2QA 4TSRA 3L5OA 4JU8A 4GGMX 1MABB 5U9CA 4JLMA 4N1AA 4EP1A 2IYSA 3AI1A 1BTOA 5ARDA 2C78A 3M34A 1T9GR 2P4HX 4HY3A 3ZCSA 4AZVA 5LR6A 1Z2DA 2IVZA 2FSVA 4P5EA 3L46A 1WNTA 2ZSEA 4C3OB 3U1BA 2IHZA 1QF6A 1VC2A 2C4UA 2HYDA 1DU4A 2VUTA 3NRJA 4G5SA 4IW3B 4MUHA 2XDQA 2C99A 2NVUA 3L0PA 3GT7A 3EZGA 1G1MA 4BKMA 3OUTA 4MLZA 3ZY5A 3WLKX 2ECOA 3QPBA 5KVAA 1NVFA 2R8EA 3H9JA 3VJMA 3R3UA 2NUTA 2O1WA 3L5KA 3Q5EA 1Z8FA 5BQFA 5CDHA 2HA4A 4YJGA 1F48A 3WQQA 1JQKA 1WIWA 4RWZA 5AJVB 1ZL0A 4QTZA 4RH1A 4YN3A 1MIOA 1J7KA 1YRLA 1HTBA 2WIGA 3X0DA 6Q21A 1KY2A 4B3JA 3MD9A 4YRNA 1OYOA 2B6HA 3GUHA 4JA0A 4Q1BA 3U5TA 4DDKA 1QYWA 2VPYA 4F11A 3JQFC 4JBYA 3VR5D 3HLKA 1B74A 4DLWA 2I3BA 3IAEA 1M6WA 4TMZA 2RGNC 4X93A 1OV4A 2H2GA 4ZVOA 2A88A 3LO5A 1HL7A 1ONPA 4KSBA 4XUEA 1MC4A 4QGBA 3KJZA 4CTMA 4ESOA 4TVBA 4EI2A 4FDLA 5BSEA 3BGWA 2FHPA 4OQMA 1UP4A 1WUYA 2M98A 2AZTA 3OTQA 3UPTA 1TJ5A 2Z6VA 1V48A 1ZNZA 3TD9A 2WKQA 4TMXA 4CLXA 4EG0A 1XSEA 4W6QA 5L6MB 3DV0B 4UXIA 3NAMA 4RTRA 5LDDC 1YL5A 4BB6A 2I3GA 2QEQA 4CIBA 3UAYA 4ILEA 3V1MA 5BN5A 3P97A 5CCEA 2WU1A 4HYTA 1GN9A 3RANA 4BUCA 1N1GA 2ZETA 1XWWA 1PVVA 2Y1LA 4HB2A 2I9PA 1NXOA 4G65A 2VS1A 3RJZA 4LYEA 3RG2A 3EPPA 3QKIA 1EUZA 1FX0B 4YJFB 1QDUA 5JLAA 3K6SB 1WVIA 1T3ZA 3T9DA 1RLIA 2XVAA 1DXOA 2FKAA 2FWMX 3KV1A 4LMPA 3SMQA 3TBFA 1JHDA 5EVJA 1PFUA 1QRDA 1T3SA 4N18A 4CT0A 5FPQA 1RQ2A 3DPUA 4M3NA 4D9GA 3HK2A 1NN5A 5BUCA 1SXQA 1Z08A 3OESA 1ZCBA 5DHFA 3FHLA 2NZWA 4HB0A 1EP9A 4PHHA 5E6SA 1BMTA 1SWWA 2O7VA 4KXFB 1JG1A 2Q46A 3KLBA 4PZ0A 2QROA 1QC5A 1MFPA 3R3WA 1RKVA 5L3RA 3N2NA 4YV2A 2ZI7A 1FVHA 3COSA 3OKFA 3OMWA 3MVEA 2G9RA 4B6RA 2HMWA 4X1OA 1Z26A 3J81A 1AZTA 2JGDA 4BV3A 3EIXA 5JROA 3PFCA 3ZIAD 2ZB7A 4ZVNA 4DA0A 1P4AA 3G49A 4D7AA 5F23A 4GOND 4MUNA 1GLVA 1NX9A 2W2TA 3O8OA 4QPDA 4HO1X 3T9AA 4DMMA 1WEHA 3EEIA 4I66A 2AJCA 3DULA 3M1YA 3B2EA 3PZBA 5D3MB 2ID4A 4OHCA 3L0OA 3R7SA 4LG1A 2OXIA 3DPIA 3O91A 1XXLA 4YPOA 3T1OA 5ERXA 5KOJA 4Y6LA 1XL1A 1W6UA 3IX7A 1D2CA 4ZVPA 3DHNA 4LJAA 5EXTA 1UBUS 3ZVLA 3T35A 4BKRA 1OI7A 1KEUA 2F9FA 5JSKA 3B85A 5DLEA 5DXAA 4HLDA 4C2TA 1H1DA 2UYGA 1FSZA 1JX6A 4FCCA 5BXQC 2AFIB 4G56A 4D9EA 1AGNA 3OTGA 4HS4A 4EGQA 4F9TA 1J06A 4MWSA 4RE6A 1BN7A 1LX7A 1XZHA 1Y6ZA 1GKLA 5HR5A 1IL0A 1V8OA 1UMBB 3SIWA 4F56A 5IN4A 4HQFA 2JAHA 3PR3A 4W8HA 3OEEA 3GAMA 2PH7A 3BJMA 2QVCA 1VL1A 1J2UA 4TRNA 2B8NA 1ZK2A 1IM5A 2YUTA 2QVBA 1K8ZB 1CUFA 1MW8X 1MENA 2PT5A 2GXAA 4J9UE 3CE9A 3D2BA 5HKBA 1ARZA 4TZ0A 1CW2B 1NMEA 2EIXA 3JAWA 4PAGA 5BUZA 3GLKA 1RXIA 2JI9A 3FUWA 4WLFA 3IL2A 3QU5A 1BWPA 1NUTA 3CX6A 1ONOA 3NTQA 3N9IA 1IVYA 3FPHA 3I61A 1FW6A 2ZGVA 3A3OA 3RT1A 1MAVA 5AKHA 3ILXA 5AM0A 2VK1A 2DPXA 4GM1A 5EPEA 4UMVA 2KJQA 2C9MA 1KO8A 1H94A 1DO2A 2XOKA 2XIJA 3RIMA 4D3FA 5BW4A 1EFHA 2WSBA 4YI5A 3ZJ4A 4BDSA 3LNCA 2O1EA 2LBPA 2QD5A 2HSEA 4YROA 2FY8A 2WF8A 3ID6C 2FWIA 3KEOA 5EAIA 2JIOA 4D0NA 1PLKA 5BWNA 4ND5A 4Y18A 1YQUA 2XBUA 2ZAMA 3I2IA 4NDAA 4DC9A 4LRXA 3LQKA 2HLDA 5ER6A 3VYSB 1CY8A 3S0JA 1FRVA 2BAGA 4GRAA 4ZEOA 2PGNA 3JD1A 1K4KA 4BIMA 1YZKA 2H3EA 3VYWA 3L02A 1Q1BA 4BBJA 3TIIA 4CBVA 1Z6TA 2R79A 1FXSA 2ZDQA 3BXEA 6GPBA 2PQMA 2YHAA 4K86A 4ZANA 4E46A 4JJAA 4EX7A 1UMCB 2G07A 2IPLA 2WDZA 4UXHA 4TWBA 5JVDB 3CZ4A 4QREA 1PYGA 4IIDA 4ETMA 5EIWA 2IXFA 3ZY6A 1A2OA 3FOAA 3NC1C 5J63A 1FNNA 3QPDA 1ADYA 2CVFA 2CUNA 1TKAA 2FEMA 3RVSA 3VOBA 1LQUA 3S68A 3PKJA 4IXTA 3WL5A 4ZZIA 5ALVA 1GQOA 2TSYB 4GVXA 4J1QA 2WMOB 3GVHA 2CYCA 4TMFA 1SVWA 4PQFA 4CKBB 4WZ6A 5CB8A 5K99A 3QX3A 4NV1A 2ZUSA 3GJ7A 2NAFA 3FWYA 3HA5A 1EFVB 1MNQA 3KXKA 4YAKA 3EJWA 4QRDA 4FYHA 2AUTA 3ST7A 1J6UA 3K9GA 2R11A 4LYGA 3VR4H 1B0UA 4LFBB 5AI8A 4N3AA 5H82A 3PCTA 2W4MA 3FNGA 1SCDA 2ZRPA 4JSYA 5B7GA 3D6MA 3ESXA 4MV4A 4DDWA 1SVLA 4LNUB 4LK3A 2PSJA 3MGGA 1NU6A 4PVDA 2R2AA 4S1OA 3GBSA 3SYTA 2HGZA 4S2UA 1B2LA 2P4QA 5B3JC 4HFRA 1U6IA 5KHLB 4NULA 1IU9A 4LDZA 3WBBA 1CXZA 2YJTD 5LP6B 5K51A 5A03A 5ELLA 3V3TA 1YR2A 4MV1A 3UWOA 3H8JA 1BDBA 4A23A 3AONB 4II7A 3U17A 1U7DA 2XLBA 3BFJA 4XB2A 4RSMA 5AVQA 4YQZA 4RACA 2UUCB 3A6FA 4M38A 2B61A 3Q2KA 5CK4A 3MB5A 1FW8A 4OLFA 3A2NA 4FT4A 3U4CA 3WIVA 3ZY4A 4OP3A 1A8IA 2NX2A 2VJMB 3SYMA 4UMEA 5HTOA 3WGMA 2NPOA 1MO2A 4EF4A 4QLBA 1Z45A 2PVCA 4EYEA 4EH1A 1HLFA 3S2FA 2H92A 2BM9A 1FSSA 3KHKA 2DR0A 2JCGA 3QGMA 4KPGA 1QSGA 4B48A 4D5EA 1EA7A 4IGIA 1GKKA 1VJ1A 1HFWA 1IHPA 3LGXA 1ZRMA 3L92A 1MXFA 1L6IA 2Q0XA 1FS4A 3IYLW 3PXDA 2CVZA 3P4XA 1DIAA 2ZULA 4HQRA 4UMDA 1V43A 3HHPA 3I05A 1FDIA 1BGXT 1KP3A 1WXHA 2AVNA 3LBYA 4MP6A 4HXYA 4OY3A 3VSCA 7AT1A 1N6HA 5BWCA 1IQUA 2IHTA 5CVCA 3TM5A 4XWWA 2XQKA 2Q6OA 2J0UB 2JH9A 1R0BA 3L0DA 1R0KA 4CMCA 5FNVF 4X1KA 3C8MA 4HWPA 2B7CA 2MMGA 2I3AA 2FQYA 2J7PA 1R0WA 2PKQP 3EIHA 4P7JA 4BAUA 1TMKA 4QBTA 4Q7MB 5FNVB 1KYZA 3PRJA 3IPYA 1RI1A 3OQIB 5AKEA 3OPYB 2H1FA 2XF8A 1A7UA 5CA1A 4ZCQA 4C2UA 3LCMA 3E15A 4ZGGA 3VO9A 2D5LA 3LXXA 4MJLA 1V4NA 4UNQA 2BCEA 5ENDA 4XIYA 1F2TB 4V24A 5GPBA 2YCBA 4EB6A 4Z4CA 3T7EA 3I72A 2V6JA 4K9PA 3DOHA 3PI7A 1PGOA 1I2DA 3C48A 1M2VA 4KMOA 2L69A 5REQA 1DKNA 1JE0A 2R68A 2GAJA 3PE6A 3G6KA 5AI0A 4XOUA 5G41A 3ZLTA 5HQ3B 2ADFA 3NWPA 3HADA 2I4IA 5DYNA 3RC7A 2FCAA 4DIMA 2JFPA 2R4TA 4DMGA 1RADA 3T06B 1IN4A 4KXYA 1XNGA 4JC4A 4E15A 4IH1A 4NQZA 2Q50A 3VSDA 1SUBA 4M8KA 4TROA 2H54A 4UZEA 1BEEA 2P9JA 3EGXA 3NBFA 3L8HA 1LPNA 1Z0DA 5GIPE 4F8JA 4MGIR 1ADCA 1DAIA 3EQ8A 1YRAA 4XWTA 4XZ3A 3RHSA 1SOVA 3KQKA 2ORVA 1JI0A 3PPYA 1U04A 1P75A 3H2BA 1WEKA 1XXHE 2J3IA 1MB0A 2SCUA 3FCXA 4TXMA 1VCOA 2PCJA 3SYNA 1YOVB 1QIMA 1X77A 3WB9A 2W9XA 3TBHA 2PZ8A 4KQ6A 1IONA 2XH8A 3LH5A 4KAXA 4WNAB 3W8NA 3ZI7A 2PK3A 5GTDA 1ZR2A 2HI0A 2VNKA 1TU3A 1F5SA 3G8DA 3ZEAA 5L51A 4HLNA 2RHWA 5JBQA 4IVRA 4GD3Q 2ID8A 3KDPA 4HH4A 1THMA 4Y1RA 3JQAB 3RC2A 3RHFA 1OT5A 2ZIFA 3TW6A 4W5OA 4C4AA 4O2AA 3H2IA 1FFHA 2QV7A 5IP5A 1NN1A 3BD9A 2NM0A 5BRAA 1IOZA 2Z95A 4GEGA 2ADOA 821PA 2ES4A 1XTBA 1YASA 4PBSA 1QV6A 2GFQA 2CZGA 4L9AA 5EE0A 5CFPA 2IYXA 3GGOA 3ZWQA 3LUGA 4LFCB 1JIXA 3P26A 1E18A 2I1QA 1NBMA 4J8PA 1NVGA 2QUKA 2XGSA 3A3PA 4MA5A 1VG9B 4NIMA 2MWMA 3DS8A 3PE4A 4RD4A 2RGBA 4XASA 1ODJA 3L4SO 4U2CA 1RP1A 4JSTA 2HU8A 1CBUA 1KSJA 3TOVA 1KA9H 2XLCA 1KO4A 3WLMA 4C4PA 4KU4A 3A58B 3VDRA 4V39A 1GT6A 3MUEA 4TRJA 1XA0A 3OE7D 3ERCA 2VHEA 3QE3A 1AK2A 2ZWOA 2XYQA 2ISQA 3ENQA 4X71A 3W9UA 1R0SA 3B12A 3HSKA 1JF8A 1XX6A 4MIKA 5CHEA 2AJ8A 1TQ6A 4RHYA 3RW9A 3BK1A 3L06A 1PJRA 5ESDA 2BFDA 4DT1A 1U7WA 1Q5PA 1RAIA 1XEWY 4FD2A 5BWMA 1M6VA 3OICA 4GVLA 4TTIA 4LJ6A 4LGYA 4BCCA 3P4UA 1HK7A 4I8DA 2X8WA 3NJ4A 4LSWA 1XAHA 1Z4QA 3JU3A 4K6HA 2GZ2A 3NP9A 1H1LA 5HUHA 5IABA 1COWA 2AGVA 2F6RA 1C30B 3EFOB 5CDUA 1VIMA 3B7WA 4DBZA 2AXPA 3SHWA 2GN9A 5EWJA 5IG2A 1M10A 4B4KA 1NJ8A 1QIJA 4R8KA 3L6BA 4QNNA 2I80A 4YNBA 3T0FA 2JLAA 1AMUA 5K09A 4PZEA 1ORRA 2WI8A 3NBMA 4UBKA 1NVUQ 1TYBE 2AR9A 1X0VA 3GT0A 2BFNA 3I2JA 3MWLA 2EKDA 4YR7A 1E2UA 5KU1A 1XPOA 1XLTA 1C2YA 4IGAA 2BJHA 2FP4B 1W581 4YUVA 2HT1A 5BSUA 3V2UA 3K09C 1F2DA 3PR2B 4N5IX 5CEEA 4OAQA 1NBWB 4IV0A 4JQCA 4ZK2A 2AKEA 1GCUA 2CDNA 2JA2A 1Z2AA 1E9FA 2EC5A 3LUJA 4FDMA 3VKWA 4CODB 1KL7A 2WU8A 5E9AA 4XM0A 1F0KA 4F4UA 3BREA 1ZWKA 3KB1A 3MFQA 4ZZ1A 1II8B 2QX4A 1H2ZA 5BOSB 3MCUA 3WDMA 2CJWA 3UGJA 4PC6A 2C4TA 4QBHA 4YAUA 5KYWA 3N76A 3O8BA 5C8VA 6LDHA 4OLBA 5C53B 1R6BX 2CMHA 4HNTA 2WB2A 1PHPA 3DFIA 3MMXA 1ES9A 1DRUA 3NFYA 4U1RA 4RQTA 1GUFA 4Y6OA 5ALOA 1T0UA 3V00A 2ESRA 3HYRA 3EEBA 1SZJG 5A5GA 2IX9A 5G3ZA 4RMIA 4V1CI 4N7JA 2IBTA 4ZT3A 2G83A 1R5JA 1KH1A 2QORA 4Y9RA 4ID3A 1X7HA 2QR2A 3QP9A 1NBMD 4DIDA 1JU3A 1G20B 2EX4A 4UFNA 1E79D 1PNOA 3U3DA 5JJKA 2YZMA 1DKQA 4H7JA 5G0VA 4UM7A 1G0NA 2V0GA 2C83A 2HC9A 3ILVA 3MRXA 3I37X 4G1MB 4JOSA 3WIDA 1ACLA 3E05A 3TOZA 6AT1A 2W6NA 2ZS9A 3C7DB 4KXWA 2HBZA 3FWHA 3Q88A 2HWKA 5C1IA 2PRJA 2O3QA 3CRMA 3AEQB 4GI1A 5BR1A 4E5NA 1MEJA 4S1PA 3AEQA 4PY2A 3CVYA 2EW8A 3HUTA 1KC1A 1XG5A 1YNOA 3KZMA 1YQEA 4IIJB 1F2UA 2VT3A 1DCFA 2WTAA 2FSSA 1P6XA 2JAWA 4QQ8A 2EYUA 1G16A 2JD0A 2VNIA 1VBFA 4RIFA 3WIUA 1WBBA 1E9BA 3IP9A 3QPVA 4FCVA 4PIPA 2BSXA 3AV3A 4WGFA 1JQDA 1GUAA 4YMWA 5A3SA 3TBKA 4MS1A 4EG7A 2BE7A 3QV1A 1IOLA 1VSVA 1O95D 4O4HB 4REOA 4Z4HA 3QM1A 1PQPA 1NUPA 2IYAA 2W4QA 1H23A 1O5IA 3E5HA 3U7JA 2C7RA 1FNMA 2WNSA 4H7FA 1DRVA 4IXDA 3OTWA 3TK1A 2R6JA 4GG1A 3SZGA 5L4LA 1E2NA 3GNLA 5C7OO 2O1XA 3ICEA 1K5GA 4GLFA 3ZS9A 2ZXUA 2VQEB 3EUWA 3LVRE 4BWGA 2OQIA 2JLRA 3IOMA 4PHCA 3L40A 5F2KA 3BB1A 5FQNA 2GOYA 5B3AA 3D8BA 1HE1C 3EFOA 4LRQA 3GLGB 1R37A 3M83A 3AKDA 2B0CA 5JJIA 3JTMA 3GLUA 3NTOA 1NAIA 2XF2A 1DBSA 5I9SA 2C5HA 2ZVQX 2BZSA 1I0LA 2QE7A 3O2JA 3WMWA 3LC7O 3MN1A 4C9BA 4FLFA 4NCIA 2JVJA 3CLSC 5EIAA 2NQTA 4FWBA 4GUAA 4JUBA 2DVMA 3T12A 3IP5A 4MS3B 4I5GA 4Z8XA 1DIBA 1GPYA 4L2IB 1Z2OX 4O4LF 2LWIA 3TI7A 1RCTE 3DMFA 1DAMA 2IEDA 1UC9A 1BGWA 3SJUA 1B0ZA 2VLBA 3S6JA 4R0NA 4ZODA 5C9ZA 3E2IA 3MSXA 3WGKA 2PWAA 3NAQA 4L8VA 4JJGA 4HTFA 4WNCA 2VQ3A 2BHSA 2FPSA 5AKJA 4XB6B 5G3YA 2R8RA 2WSLA 5LQRA 1C1XA 1XDDA 1LU9A 4PRKA 2VSOA 4KRYA 5GM2A 5A6VA 3T5AA 1PD1A 1QRAA 4O1MA 4E1BA 3GGGA 1Y8QB 3ETGA 4HOYA 3W04A 3WGQA 3RH0A 4E0BA 3PNLA 2CXRA 4P33A 1D1PA 2E9SA 3GG9A 4GRIA 3DW1X 4JP2A 4WMLA 4Q3EA 4YJ3B 2FXIA 5CP8A 4I08A 3NOOA 1ZONA 3VM6A 1HTTA 2WFLA 3ESBA 3OY7A 4DJFC 1C0LA 1Y7LA 4WESA 3MXTA 3BCSA 4LNUA 1RZRA 2WVGA 4DWOA 1DWUA 1H3EA 2WT8A 1IM8A 4FINA 3WG9A 4DYDA 3ZBQA 3WJAA 4BRWA 3NNSA 3U4AA 4JQZA 3MJDA 2CEAA 1PG5A 2X0JA 3D4BA 1ZJ5A 4FX5A 4IMPA 4S35A 2XQJA 1C7FA 1U5BB 2CLFB 2X9GA 1E60A 1D07A 4I46A 4LDAA 3LFTA 2PN1A 1FA9A 3R4CA 4B34A 1W36D 2FPPA 2VSNA 5HK8A 3COWA 3ILSA 3OTOB 4BMPB 2PY6A 3OPYA 5A1JA 5LMZA 6ABPA 1GTG1 1YVRA 4NESA 4ZCMA 3CONA 1MVLA 3KSBC 3A70A 1UJNA 3AU9A 3CXRA 4AS1A 3E03A 2OXFA 4L5IA 4L78A 2ZJOA 1C29B 3RU3A 2O8FA 4NU5A 2BI7A 4Z9BA 3C8ZA 4EB6B 1II0A 1X7ZA 2OCDA 4L8LA 1J5PA 1XYVA 4DUPA 1TZ2A 1E4YA 3GJ6A 1IZYA 1RKXA 1XZJA 2CUTA 5FDFA 3LPLA 1P5ZB 1P8AA 3CW8X 2Z2JA 3K0AB 3DSRA 4IQ8A 3JQPA 5CLHA 1CQJB 4LOJA 3VHXB 4ITRC 5D7NA 4Z99A 2OSVA 1IBRA 3ZE2B 2XMZA 3IEPA 3O4JA 1SCKA 3CU5A 2YH2A 4XX0A 2VDRB 1OIVA 1YR6A 2PL5A 3B13B 3DQZA 5BR4A 5E1MA 2BFOA 3Q5GA 2R97A 3LK7A 4RAQA 3V8MA 5C32A 4CM4B 4IIXA 1ZJ4A 2JI8A 3EG5A 3LF2A 1P0IA 4Y2UA 3LPAA 3FNBA 4OSPA 3QEMB 3R4VA 1NF9A 4UEJA 2NVWA 3V1NA 3EVFA 3UJ7A 2GCOB 2J6IA 3NS7A 2VNJA 4MKHA 3LQFA 3Q7EA 1NBEA 3N2KB 4BPRA 2PH3A 3KT3A 3IAS1 4X90A 2VTEA 5KNDA 2PKQO 5C4MA 1KMCA 2GLXA 4OQFA 1KKMA 2G04A 1R0CA 2NXCA 1U3CA 5TS2A 1LZKA 2RC6A 1FLNA 2X14A 1V8ZA 1UJMA 2XEXA 1PAUA 4WZAA 4O0MA 5DLQC 4ARUA 2HV9A 4BQNA 1G8SA 2QMQA 4NNJA 3PDWA 3P7MA 2F48A 4FR5A 4JR2A 2E6KA 2GBIA 3O2QB 1DAKA 2C4WA 5CPFA 4PO9A 3SHQA 1ZLXA 3EN0A 3OUZA 1N9KA 1QRRA 3H1FA 3MYYA 2XRMA 5LZ4A 1S2MA 3A9WA 1D2NA 3QG1A 1JUDA 1R0RE 1AS3A 4JI6B 3DDOA 3SF8A 2JG3A 4Q16A 5HWSA 3WKAA 3SXUA 2CLIB 3ZDYB 4MW5A 4D9CA 4FHFA 4L5BA 2BTOA 3P45A 2VF4X 3GLTA 2WUWE 2BLNA 1ZN9A 2FRXA 3NOQA 4Z9YA 3TR5A 2BEWA 2ZPUA 3GJSA 4U7JA 1UINA 4WERA 4URXR 3AYZB 3UW3A 2QPOA 2GNAA 3RFVA 4R84A 1PJCA 1WB9A 3QTLA 3FKSD 1E0JA 4FK8A 4UE6A 4O25A 1RSZA 1YHNA 5CH8A 4YIHA 3X1KA 1NQAO 3GZTB 4ZJPA 1NVAA 4HB4A 3IQFA 2J3KA 2NZJA 3RVRA 4ALKA 1ISSA 1TLTA 2BGNA 3P0EA 1DXHA 4UBIA 4BNNA 4HDOB 1Z88A 2R5FA 2JLQA 3I39X 1H5QA 4BZXA 2YC4C 1OBVA 1Y1TA 2HSGA 1D2AA 1DPGA 3DB1A 2J0UA 2GI4A 2PH1A 5GGXA 5FWAA 2O8EB 3IR5A 1D0VA 1TTTA 2FMKA 1QGDA 4DR3B 1U28A 1BMQA 3HJRA 2Q6KA 4IWNA 5FV4A 2WJAA 4LRWA 4TYYA 3GPDG 8ADHA 4NKRA 2PS0A 3R74A 4CDRA 1SKQA 2Q27A 4WKPA 4C06A 4OIMA 3QU7A 1QZUA 4UHEA 5E0KB 5CA1B 3NGMA 3IHKA 2I29A 3LP5A 2ZTVA 5KO2A 3T3DA 3A1SA 4QYMA 4R1OA 3P27A 3T3NA 3J7TA 3ZQ6A 1J24A 3W9YA 3VH3A 1I10A 2LVBA 1TZKA 3VR3D 2IF0A 1E2QA 4C4XA 4DM7A 4N4AA 1L4LA 5A02A 3H5LA 4FMPA 1JFFA 4MW4A 2B4TO 3HGQA 2CK3D 3ORQA 1W4LA 3I5UA 4JLVA 5BYJA 2MSEB 3IBTA 5HDBB 5JJBA 1HQDA 1UBCA 4BKOA 5JAIA 1QUFA 1L5NA 4MK4A 1N2CE