4ZI2A

Bart-like domain of bartl1/ccdc104 in complex with arl3fl bound to gppnhp in p21 21 21
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
185
structure length
185
Chain Sequence
b'LLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRSYFENTDILIYVIDSADRKRFEETGQELTELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKKLEHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 3
publication title The Interaction of CCDC104/BARTL1 with Arl3 and Implications for Ciliary Function.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 69
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4zi2A00
3W6OA 3AF1A 5DGXA 2VHUA 4C9BA 3R20A 2FGKA 2FSFA 1XXHA 1YRBA 2ZR0A 1L4YA 2REBA 2ZI9A 3RABA 4EKDA 1U0LA 4ZI3A 3CR8A 2QRNA 3ETLA 4OQMA 2BCGY 4D6PA 4EJSB 2QPAA 2VP9A 4XTCS 2CCKA 4KLNA 1DTSA 3RWOA 5K8TA 2ZXUA 4PQFA 1CU1A 1GUAA 4HSEA 3SBDA 5SZJA 1FX0B 2NZJA 2O8EA 1P9WA 3U60B 4ARZB 4D0LB 3HYTA 1XNJA 2CNWA 1VECA 4LV5B 4C0LA 3JZMA 2XITA 2BM1A 2WJYA 4TTRA 4B6EA 2CHQA 2CHGA 4GSYA 1E2PA 3IDQA 4A4DA 1R0XA 2FWRA 4Q4LA 4QOSA 4L4UA 3UATA 2WSMA 1W2GA 1UBFA 2WPDD 1XEXB 3BH7A 4IW3B 5L3VA 4M0LA 1TMKA 1FFHA 3CNNA 4KV9A 4B33A 5GJBA 1KI2A 4LGMA 3ZS9A 4Q1AA 4BQSA 2HCJB 3NWJA 1WDTA 2AN9A 3NH9A 3QQ5A 1HE1C 5JWRA 2HYIC 4PAOA 3TBKA 1W0JD 1NN5A 2IXGA 4QHTA 2JJ2D 1COWD 5GADl 1CULC 4DDUA 1SKYB 4HAYA 1XCMA 5CK5A 1DAGA 2ODNA 2WSSA 2WIAA 2GETA 2F9MA 2ZAOA 2ANBA 1ZCBA 2ZRBA 4CRWB 3QPWA 4FMCF 4TMZA 2W0MA 3G0HA 2IYTA 2ZJBA 3B1XA 5JEDA 1XCGB 2X2FA 5HR5A 3T61A 2YOGA 1DBSA 3DL0A 1IXRC 4N0DA 2VHJA 3LV8A 1KK1A 1H65A 1N5KA 2KJQA 3I32A 2YKGA 1X8LA 1QBKC 2CDNA 1E9RA 5L3QA 2F3TA 4IDQA 1D2NA 2DFTA 3TE6A 2XAUA 4IJMA 3EZ7A 4LYAA 3T5DA 3I72A 2G1JA 3BH0A 4Y0VA 3CRMA 3VR5A 2NGRA 1SVIA 2RGEA 1H8HD 3Q7PA 2IYSA 1FL9A 4QBIA 2ZYWX 5TY0A 1US8B 2GZHA 2YZ2A 3LLMA 3KQUA 2EU8A 2HF8A 2J3EA 3VNUA 3K1JA 2O8CA 1EGAA 3TR0A 2WWFA 1B23P 1IY0A 3LQRA 1U8AA 4GT1A 2GDJA 4AY2A 1UADA 2ANCA 4HZUA 1N6HA 3BIFA 2CNWD 3VKWA 1DO0A 2V8OA 1KZ7B 1BS1A 2IK8A 4IHQA 2ODEA 2OHFA 4TL8A 1W1WA 1G8HA 5HPYB 5KDOA 1NLFA 2VHCA 1OXTA 1TQ4A 3AVPA 2VSFA 4OHXA 4HLCA 1YR9A 4XVRA 4GFDA 3MJRA 4LCBA 4EPXA 2GHIA 1KSHA 2XB2A 3D31A 4LHYA 4GI7A 2WICA 3GLHE 2V1XA 2OCYC 4QJ3A 4KSCA 1RRFA 2F1RA 4O3MA 3DZDA 4CEIB 2WSSD 4D25A 1YZLA 2FPKA 2REOA 3L0IB 4LC0A 2ZROA 1XTSA 2DFNA 3DEFA 2CE7A 1KI8A 2ONKA 2IT1A 3HPRA 4KODA 1HUQA 1GWNA 3AEZA 4XD7D 3SJBA 2YWEA 3GD7A 1S1MA 1Z6GA 4XOIA 3LQQA 2PCJA 5JFGA 4FMDB 2R6AA 3D8BA 5AUNB 3NBXX 4KCGA 4NCJA 4B2IA 3C8UA 1G7TA 1GL9B 1FMLA 1W5TA 4PC1A 4QNMA 4YLGA 3GQBA 4ZPXA 4QGHA 1IQPA 2WAYA 4HEJA 3ZH9B 1CIPA 2D62A 4LHZA 4A2WA 1NP6A 3I92A 1Z0KA 5JEEA 2YVUA 1GSIA 1G6OA 2ZAMA 4IDHA 3DMDA 1E0JA 4HUQB 3NH6A 1P9NA 4LSGA 1NIPA 5CJ2A 3NDBB 1KO4A 4M1TA 3EG5A 3EZ2A 1XU4A 1YU9A 5IF9A 4A9AA 2XZLA 1M2OB 2Q21A 2ZI3A 5C18A 1IAQA 1R4AA 3ZQ6A 4AIIA 1G3QA 4ZCMA 3EARA 3K0EA 4JL5A 1ANKA 2FPLA 3WMGA 4GPTA 4PANA 3GLFA 1OH8A 5CB8A 5C4GB 1YR8A 1P7CA 5TMPA 1XJQA 3AM1A 4JBYA 3A6PC 4Z54A 1Z08A 2GESA 2ODBA 1YZNA 2H1LA 5DHFA 4F4CA 3IIJA 4OYHA 1R10A 3SC3A 4AI6A 6Q21A 4ESHA 1DAHA 2RKOA 4IOJA 4MKHA 2QAGA 4LJ5A 3DOFA 1R0ZA 4BWYA 2G3YA 3ASZA 3TKLA 4Q9HA 4JJKA 4OK5A 1MO4A 4K81B 2WWYA 3LRPA 3ZD6A 3P27A 1OT3A 3PQCA 2WWXA 4Q4AA 1GKYA 2ECKA 1TTTA 1DAMA 3QVUA 2OUKA 4A0GA 1MT0A 3W5JA 4BFWA 2G0TA 2J41A 3FPAA 3IPYA 2NZ8A 4M1OA 4K46A 5E7JA 2HCBA 4BFVA 2OILA 3NHBA 1Q44A 3MJHA 1Z0JA 1FTNA 4NYMR 1PVOA 5FI0B 2AD1A 2ZE8A 1QZXA 3ADBA 1YZUA 1C9KA 3B78A 4NTZA 1LB1B 2YOFA 3TAHA 3BERA 2VIIA 2OBMA 2VRWA 4HDCA 3GLGB 2ZYUX 1LNZA 4R98A 1I4LD 1J99A 1QHXA 4LHVA 4E5UA 2V6IA 2QT0A 1Z22A 3GJ4A 2KSQA 5IHPA 1R0YA 2BM0A 4JLBA 2G77B 3ZJYA 1E96A 8OHMA 2C9YA 2QUZA 1NN1A 1S1CA 1UBCA 1X3SA 2J1LA 3QXHA 1D2EA 5BYKA 1UJ2A 3X1WA 4OJQA 1XMVA 4HLUC 1X8JA 1HY3A 4B71A 2OE2A 1E2MA 4WIAA 1YZQA 4FCWA 1NSFA 1XPOA 1GRQA 1G41A 1IN5A 4BLRA 1FPMA 4MQBA 4NKRA 1E2IA 2REXB 2ZI6A 2ZJ8A 4DCTA 2Q9AA 3AKEA 5JZVA 2FGJA 5G3YA 2CMKA 1ZU4A 3LVRE 1H8EA 4URYR 4JLKA 3REGA 5J40A 3U7EB 3TUZC 1S96A 2GNOA 2QM8A 4HB0A 2AD5A 3IEUA 5K8UA 2KE5A 4LV6A 3ZLJA 3A58B 2XJ4A 2GJKA 1QHSA 2P65A 1W5SA 4EFLA 1ZM3A 2OLKA 4IFBA 2O8FB 3V4FA 3GCGA 4EJSA 4HLUA 3U44A 1EFUA 3EW9A 4RD4A 4Q4JB 1G291 1KIMA 4I4LA 1ZUIA 4M2LA 4Q21A 4B3DA 1FX0A 2ZI7A 1KJYA 3KXKA 3L8ZA 4ARZA 3QG5A 2F43A 2XGJA 2NTYC 1XBTA 3CH5A 1ZP6A 2IX3A 3MGCA 1M1YE 4QHSA 2XOKA 1EFHA 3SI7A 3L0OA 1U0HC 4ESVA 2W0SA 1UBEA 2ERYA 1JJVA 1XEXA 3H1TA 3K9HA 3LBNA 4B3GA 3IO3A 5HZHA 2WKRA 3SU8A 1RFLA 3UMFA 2IW3A 1WXQA 1LF0A 4B2LA 1EFCA 4XH9B 4FN5A 4UJ5A 5JLJA 1RYHA 1EFRD 2J9RA 4FCTA 5FOTA 1P2UA 4Q47A 4TWZA 4WA7A 3U6KA 4N1AA 2AHOA 2GZAA 3EIHA 3QF7A 1E0KA 4MKIA 4DCUA 2Q9CA 5KUTA 1CJKC 4GOXA 1SULA 1TX4B 2ZRLA 1BOFA 3CO5A 3WRXC 4ASUA 1Q20A 3V4RA 3VR4A 4DLSA 2ZRDA 4PZZA 5TV2A 2PEZA 2G1KA 2ZSEA 2EYUA 2R6DA 1KSFX 2ZR7A 3DOEA 5FI1B 4OI1A 3K70C 3EZFA 1JBKA 2OT3B 1TPZA 4JJZA 2MSCB 1PLKA 4OKSA 4RJLA 3CNOA 1CS4C 2Z6VA 3ZYCA 4EQ6B 3QXCA 4GZMA 1OXVA 3GEIA 1ZINA 3MWKA 5EE1A 2A30A 2OAP1 1CEEA 4FI3C 4NE2A 1U9IC 1XD9A 4IDNA 1F5NA 1TADA 2IYRA 4Q48A 3HU1A 4ACAA 1DELA 4B75A 2QNRA 3B82A 1US8A 2FMXA 1DS6A 1ZBDA 3CX6A 4MH0R 3EX7C 1TNDA 3GJ7A 4IKEA 2ZYTX 3FMIA 4KFUA 2JJ1A 5CDFE 1R7RA 3SQWA 1Q3HA 5F3WB 2ZJZA 4RSGA 1IXSB 2B8TA 2C9CA 4DZZA 3KTAB 3EPJA 3K0AB 2QP4A 4YDSA 3GLIE 4MGKR 3LW8A 5D3QA 1MRSA 1E69A 1UM8A 2ZS9A 1KO8A 2D74A 4CEJB 1M7HA 1TU4A 2WOOA 4JT2A 5FTNA 3Q5EA 3KJGA 1F6BA 2JIZD 2WOJA 1UKEA 5EQTA 3QE0A 2NIPA 1JNYA 3W3AA 4CEIA 2MSDB 3G5UA 4Q66C 3SN6A 2WMNB 3WY9A 1T5LA 4ASUD 3ICQB 2ZSDA 1G8FA 1AQYA 3QBVA 2B21A 2VO1A 2W2VA 4PO1A 1GL6A 4C30A 2RHMA 3KKNA 3KL4A 4WVFA 1UDWA 4RY2A 4M4SA 2A2ZA 4HLQB 1YHNA 4H1UA 4ZCLA 2IWRA 2VHQA 4BUJA 4NYJR 2VP6A 1OB2A 1ELOA 2KI5A 3CRQA 3NBZC 2D7DA 1IN4A 3SYLA 1DAIA 1NVXQ 4PFSA 1JR3A 1W48A 1GDDA 4S2EA 3FOZA 3KKQA 5E95A 1MOZA 1XZQA 4JS0A 4F38A 2FA9A 1TEVA 4QXAA 4C3ZA 1JAIA 3T1TA 2HXYA 1IN8A 4BZPA 1U98A 5J4VA 3T12A 3ZVMA 2DYKA 3CWZA 1XDBA 4KBFA 4OQNA 2ZRFA 2X2EA 2RMKA 5HKKD 5L3QB 4ON9A 1Z0FA 2F3RA 1SXJC 4EIWA 2QY9A 3K70D 4BE7B 4LHXA 4LYFA 4BFSA 3GFTA 4FCVA 2V54A 5EP4A 4RKFA 1JEDA 4UJ3A 3TUJC 3IHLA 1U99A 5JS7A 1ZD9A 2V7QD 2G88A 2W83A 4HLDA 4B3CA 4P4SB 4EPWA 5AUOB 2FFAA 3RC8A 5IDVA 4NBSA 3C5CA 2ZRPA 3CLVA 3I5XA 4TMWA 1VG0B 4CT4B 1O87A 3NG1A 4M1KA 3TSZA 2YHSA 1SXJA 4MRPA 4DCNA 1JXOA 1S9DA 5FBQB 3PUZA 2BWJA 2VSOA 3QENA 1OFUX 2J87A 3GJ6A 2PX3A 2OG2A 1EWQA 5LPNA 3WYAA 1NMYA 1OLOA 1XD2B 4MRNA 3RS3A 3ZZUA 1TEXA 4YMSA 4QFMA 4TT3D 2AKYA 5EE9A 4RD0A 4P32A 4BGDA 1YR6A 2DBYA 4IVPA 4TLEA 1F60A 3AF3A 4GZLA 4ZKEA 2FU5C 2HJGA 1DAKA 1HA3A 4LBZA 1NJGA 4RCYA 1G8GA 3RRNA 4Q1CA 4OJKA 5IK2D 4OHYA 4LBYA 4LOAA 2QMHA 1WCV1 3WHLA 3UWOA 3GLGA 3GJ5A 3NIBA 1E98A 2CCGA 1M34E 4FMBB 3BOSA 2H5EA 2B8WA 2PMKA 1TQ6A 1IJEA 3GPLA 1E2QA 1KKLA 2HEIA 3A4NA 4PPGA 2OLJA 2IYUA 3LW7A 4M53A 5EUMA 4DHEA 3AF4A 2AFHE 3KB2A 5FTMA 1GZSA 2YC4C 2C96A 4JSTA 3TRFA 1ZNXA 3JZAA 1ZAKA 4URZR 3UMSA 1UEIA 5SZHB 4MYUA 1KDOA 5AJXA 4N3NA 1AGPA 1S3SA 4B3FX 3BAFA 4YDHB 1PUJA 5IT5A 2B7CA 4JVMA 4G3XA 4HAUA 4PPNA 2R6GA 4XVQA 2ZIAA 4DJTA 1N6IA 3AVVA 1G8PA 4IXMA 4FW9A 1G16A 3GJ8A 2A3RA 4P4UA 2W6JD 1N5LA 3PVSA 4P3YA 1IN6A 1E9AA 2GJ8A 1CRQA 5JWHA 1SXJD 2EFHB 3ASYA 1AIPA 3W8NA 2OBLA 4GNKA 5J4LA 3FKSD 4FIDA 4ITRC 5FR1A 4PC7A 4Q7JB 3CPHA 5IRCD 1G3UA 1JQJC 1AS3A 1A5TA 2FFHA 2GK6A 2QQ0A 3AKDA 1RPZA 3ND9A 5EE3A 3OIVA 1RRPA 4C2TA 1N6NA 2A78A 4JL8A 1AKEA 1Z3IX 1DE0A 4OI0A 1P3JA 4V02A 2VP4A 3TNFA 3GLHB 3N5CA 2AFIE 4D4LA 2ZS7A 1AKYA 3NEYA 4PC3A 3CKLA 2JLUA 3E70C 3VX3A 2BEJA 3QPVA 4ZKDA 2RGNA 3IHWA 1IJFA 4RFSB 4L9SA 3KFVA 5B64A 2ZJOA 4II7A 4WAUA 1Q0UA 1RE0A 3Q5DA 4Q7LA 1I2MA 3SDZA 1VCIA 2A5YB 5KPJA 1N2CE 5GJVC 4URVR 3VKHA 2WPDA 4JYCA 3W34A 2P6RA 4GOJA 4TLCA 2OCAA 1WP9A 4UQOA 4MYHA 3CUEF 5AJZA 2GXSA 2FF7A 3CNLA 3DO6A 5BQ5A 3PV0A 5JCZA 2JLSA 3TGPA 3IBYA 4D4MA 3I8SA 1W0JA 3GJXC 1FOEB 1YJ5A 1ZM4A 2YOHA 1SHZA 3TIFA 1R5OA 3KKOA 4MYCA 2NO7A 1UFQA 1NVUQ 4EQ6A 2KBEA 4TQ9A 2QM7A 2FZ4A 4Q01A 4QGGA 1UDXA 1LY1A 1R5BA 1N6RA 5JI2E 3J81k 2XXAB 2I3BA 3U2QA 4EPTA 2NOAA 1HT2E 1KI3A 4FWIB 1KDPA 3O47A 3EASA 1G5RA 5KTYA 1OH6A 1PLJA 2FPMA 3P4YA 2VYFA 4UXHA 5KDLA 3U7HB 1HV8A 4Q9JA 3WMEA 3EAQA 1NSTA 4LK2A 3SYKA 4NL4H 1NBMA 5TDHA 4PZYA 1JB1A 3QI2A 4OHVA 5B2ZA 2X8AA 2CL7X 3BB1A 1H8HA 3KTAA 1CJVC 3GMTA 3W3ZB 3K0AA 2YNMA 5CYOA 1QDEA 3U44B 3M0EA 4Z8YA 3LX5A 2BMEA 3PEYA 4B73A 4CVNA 3QEOA 4CEJA 2IS4A 1Z6XA 2F43B 4MGZR 3P4XA 3AVWA 2BJWA 2WHXA 5FTLA 4EDHA 4H9GA 2PCLA 2JLYA 2ORIA 2ZJ5A 4NCHA 4GOKA 4FINA 4M8NE 4FWTA 3CZPA 1FUKA 1FNMA 1OXUA 2OZEA 1VHLA 2OXCA 1RRCA 1EX7A 4DIEA 1R6BX 4EPYA 4QBFA 2GCNA 4MRRA 3TMKA 2A9KA 5KSPA 3SJAA 3CZQA 1GAJA 4BFYA 4HUTA 2IS1A 1JXMA 1ZW6A 2A5FA 4Q7MB 2BCJQ 3SHFA 1CBUA 1NNEA 2Q3MA 2ZM5A 3K09C 4G5RA 5DI3A 1JJ7A 3B9PA 4TQAA 3U61B 5EZ6B 4LDJA 4FD2A 1JI0A 1X8KA 1XEWY 4XD7A 2GTPA 3KJIA 3U7FB 1X1RA 1KI6A 4FMDF 4KI0A 4TYPA 3MWJA 5CIQA 2IYVA 3I1FA 2QT1A 1N6PA 4TYQA 2CEAA 1XWIA 2JGNA 3I3SR 1HH4A 1GG2A 2IUUA 1CTQA 1N0WA 5KDDA 1NMXA 1G1MA 3IQXA 1S0UA 4CZ2A 1NBMD 5DH9A 4KVAA 1X6VA 1TU3A 5EP1A 1KDTA 5FOUA 4RVCA 1OXXK 1L4UA 1E2LA 2I1VB 2ZRAA 3U5ZB 3B6EA 1Z47A 1XB2A 1AM4D 1E2GA 2IHYA 2PJZA 4A2PA 4Q1FA 2RGBA 2DR3A 4RD1A 3A1VA 2HYDA 4LJ4A 1P6XA 4URXR 1F2TB 4P4SA 3VMFA 1E4VA 4PXAA 4HYYA 3VTKA 3K70B 1BMFD 2OAQ1 2H7VA 5DYIA 3BH6A 2BEKA 2YC2C 5BN3A 2FSHA 2R65A 3DPUA 1AZSC 2FNAA 3T1OA 3ZVLA 2H8KA 4E03A 521PA 1KJZA 4UXJA 2C77A 4G01B 1M6NA 2WIBA 4M9QA 2HF9A 1P2TA 4TZ0A 4A2QA 1JR6A 1DPFA 4UNNA 4P0TA 1XD2A 1OFTA 4R2HA 5KSYA 1KKMA 4O2LA 3KQLA 4I1VA 4YMUA 4DCSA 3B2EA 3O8DA 4LJ8A 4CDGA 2GZDA 5H1YA 2OSBA 4LY6A 5JI3E 4P31A 1C4OA 5G40A 1T5IA 5FL7D 1GM5A 2C9OA 3JVUA 1Z6AA 1CLUA 1HT1E 4DXAA 1S3GA 1NKSA 2AWNA 1DG3A 1I4TD 4KFSA 3RS7A 3VHLB 2FEOA 3SJCA 2J46A 5L3SA 3DDCA 1KJWA 5G41A 1E9CA 1UBGA 1KK2A 2OESA 4ZDIA 3KXIA 2IYYA 3V00A 4F91B 1E0AA 1AGRA 4NYJQ 1GNPA 3N70A 1W0KA 2EYQA 4X8OA 2C95A 3B7GA 3UXMA 3D7MA 3FHTA 1JAHA 1G7RA 2IYLD 4NMMA 1RC8A 2OV2A 3ICEA 3A8TA 4CYMA 1KSGA 3BFVA 3FHCB 1VKJA 3QKTA 3SR0A 3BS4A 1NL3A 3CWQA 3V9PA 4MRVA 5A0FA 3ND8A 2QENA 3FMFA 3HP1A 4MKFA 4KYIB 2WBLC 5JHHB 2IWHA 2P2LA 2W2TA 1CF4A 4JBXA 1SVKA 1NN3A 1M74A 1KGDA 2WM9B 2ZEJA 1NI3A 1S8FA 3WYGA 4GL2A 4F92B 3I5YA 1FMJA 4I99A 1D9XA 3FDIA 4MITA 3CW2A 4UXIA 3AVYA 1UKVY 1QHHB 4JMPA 4V0ME 2YJTD 2D2EA 4K8OA 2JA1A 3B85A 3GLIB 2R6FA 3GP8A 2JAQA 1QG2A 4LJAA 3EC1A 1G4UR 4PTLA 2EQBA 1SVMA 5FOSA 3QIAA 3K0SA 1W36C 2NPIA 2UZ3A 4XSHA 2B92A 1T3HA 1OHHD 3GLHA 4HB3A 4RD3A 4XWOA 2O8DB 1SXJB 4Q7KA 5FTJA 2OCBA 3AKYA 1KAGA 2WMOB 3EPKA 1FUUA 4JKYA 2O0HA 4RZUA 4D0NA 4NCKA 3PIRA 4I1UA 3U4QB 1SVLA 1EK0A 2ZYVX 3DKPA 2XB4A 4RFSA 1VYUA 5A5GA 3LD9A 4R7ZA 5H70A 2FSIA 2PL3A 2R2AA 2EFDB 3FWYA 2J0SA 2D3WA 1L8QA 1W0KD 1ZC4A 2IEYA 2IYQA 5EXPA 2QMOA 1UPTA 3PEVA 4U00A 1P72A 4JSYA 4A92A 3Q3JB 2H92A 2ERXA 3OF5A 2VP2A 4AK9A 1FP7A 1IOZA 1OV4A 3KDSE 3U6BA 3MUFA 4ZO4A 3SZRA 2GJ9A 3U3JA 5KU1A 1EFRA 1P73A 4IEEA 4B43A 4URWR 1DVRA 4OI2A 1KK0A 1MR3F 2C78A 2DFLA 4DDVA 2GAOA 1N6KA 3BRWD 4UNQA 4LJ6A 1L7VC 4TLAA 2X1VA 4KFRA 5ANRB 3LDAA 3AQ4A 3TW4A 2GBLC 4DLZA 5H8WA 4X8HA 3OAAA 4Q4HB 2XXAA 3A4LA 1Z07A 1IXZA 5KYKA 1E1QD 2V6JA 2P5TB 3MRSA 3NTUA 4MGIR 2FH5B 4PQRA 3VR2A 2CLCX 4NHOA 4PSAA 1S4QA 1E2DA 4XWKA 2IHBA 3ADCA 1N5JA 2W2XA 2RGXA 4MA4A 4DB4A 4A0RA 4F4IA 2AXNA 3E5HA 4BRWA 3O8BA 5GJCA 4C0SA 1MO6A 1K8RA 4IXNA 3VQTA 1KNXA 3FKQA 2ZI5A 1G17A 4M9ZA 4A15A 3SOPA 2BIFA 2PT7A 3WXMA 1OW3B 2OBNA 3P20A 1Z29A 3AH8A 2QGZA 4L5BA 1K5DA 5CM9C 1AN0A 2YWHA 4BASA 2IUTA 4QBHA 2NQ2C 1XF9A 5CIWA 2DWOA 4URUR 2CE2X 2XNDD 4C0KA 4QM7A 3CF0A 3RDPA 2RGGA 5JCPA 1TF2A 4JT4A 5FUYA 1W36D 5BWMA 1FQKA 1M7BA 3HYRA 4OL0A 3NXSA 5E4FA 2QI9C 2ONJA 5EXTA 1QG4A 2N46A 1MRNA 3T15A 3F0TA 1YKSA 2QRZA 2ZPTX 2JIZA 4WXPA 4TL6A 4GP7A 5DSZA 1P5ZB 1VMAA 2UZIR 3OIUA 1KO7A 3IUYA 1RW4A 2QGNA 2QTVB 3VR3A 2JLVA 3HR8A 1E2HA 4KHZA 3OAAD 4ZV4A 2G6BA 2A5GA 4IFEA 2DPXA 5JECA 2IA5A 2QPTA 5C2JB 1MO5A 5LD2C 4UNPA 1XTRA 1EG7A 3ONWA 3TQFA 4TLDA 4LBVA 4QGFA 4LUCA 2ZU6A 1EX6A 1A2BA 2NO0A 4V03A 5FPKA 4KU4A 2WVJA 3HWSA 821PA 1ZJ6A 1A7JA 3H0KA 1NY6A 1ZM9A 1E9DA 1UF9A 2P3SA 1Z83A 1OIXA 2VF7A 3SQXA 1GILA 1IHUA 1N3BA 3R8CA 1AA9A 3RLFA 3SEAA 1BYUA 4DEXA 4RZ2A 2ZREA 3QNUA 1F2TA 4AG5A 1BO6A 1KMHB 2V4ZA 3CF6R 5HKKA 2SHKA 4TQUS 3TK1A 2FN4A 2GEDA 2J45A 2ZS8A 1G64A 3PFIA 1K5GA 5FTKA 1KDRA 1KMQA 1HE8B 5EXXA 5UKDA 3AKCA 4WZBE 3IIMA 1E99A 3CH4B 2YV5A 3KJEA 4HDQB 5DLQC 3MG9A 4TLBA 1W4RA 2BOVA 2BBOA 4IOMA 1CR4A 1Q1ZA 2ZJAA 1U9IA 2V7QA 2IYXA 1CXZA 3O8CA 4U02A 2OO7A 3BFKA 4PHFA 4YMWA 4Z1MD 3C7KA 3FTQA 2AKAB 1WBDA 3OEHD 4QC2A 4ERNA 1R2QA 3B13B 4JVNA 4AC9A 4LC1A 1ZYUA 2KWIA 1E4YA 1NG1A 4E09A 1S2MA 2WJGA 4L15A 1GKIA 3N2IA 2RAPA 1Z0DA 3W9YA 1MABB 5FBWB 2JCSA 5TB5A 3X1YA 1RZ3A 4US0R 3T06B 4E22A 1KAOA 3KFXA 1OIWA 2ZU0C 1SZPA 2GEVA 4PPQA 4QJ5A 3RHFA 4CEHB 1CRPA 3FFBA 2QTFA 1N25A 4RZ3A 1ZIPA 4TT3A 1W46A 4IDOA 1SVOA 2KB0A 2VQSA 1F48A 1YVDA 2GJAA 2HLDD 3VU9A 1RJ9B 2F1IA 4KYUA 4R9UC 2CVFA 1IY1A 3EZ6A 2ZI4A 4WW0A 4MGYR 5DI3B 2FZLA 1W4CA 3DM5A 5IK2A 3UG6A 2AK2A 5J4YA 4UNSA 2PZGA 3RVBA 4ABYA 2MMGA 3FYHA 3FHOA 3QEJA 5FPYA 2F1HA 2R9VA 2ZSFA 2JLXA 3LH5A 3BC1A 2XNSA 1L2TA 1TAGA 3VKGA 1KI6B 1VG8A 1G20E 4YMTA 2ZANA 4KSBA 4M1WA 4DLWA 1N0VC 3E1SA 3KUDA 1DAEA 2CK3D 3ZIAD 5C1BA 5CDFA 2G83A 2VL7A 1NF3A 4TMXA 621PA 3QKRB 4PAQA 2O8BB 2AX4A 3OIWA 4C2UA 2GWHA 3LA6A 4DB2A 1HEIA 4CW7A 1SHKA 1ZD8A 5D3MB 4BLSA 4D4JA 3R9XA 1T4GA 1QHHA 3Q9LA 2C8VA 5HCIA 3UKDA 4BRUA 2DB3A 4PSVA 5LB2A 5CYPA 3GLIA 1Q12A 3PUWA 2RHDA 4XWAA 2N42A 5FFMA 4W7SA 5HE9A 4I81A 3WBKA 1GNQA 4CT5A 4MUAA 2W6JA 4PX9A 1ETUA 5FBRB 4LHWA 3REFA 3BGWA 2O8DA 1G3RA 1KZGB 1XCPA 3WP0A 4S35A 3X2SA 3FKSA 1D6JA 5H68A 1Y63A 4TTPA 2ZJ2A 3CF2A 1XX6A 3X1ZA 3U4QA 1XTQA 4ZIRB 2JLWA 3GJ0A 4DBLC 1RVDA 3CBQA 2GCOB 4Q5IA 2EWWA 3OEED 2IS6A 1Z2AA 3NVAA 4B2PA 1X86B 4BLPA 4DKXA 1XMIA 1QHIA 3B1YA 2D06A 1XEFA 3Q72A 1XFAA 4JLNA 5LDDC 2JATA 1Z63A 2BBWA 3DMNA 4NYIR 4U5XA 4DLYA 3B1ZA 3KQKA 1KYIA 1P2VA 3CONA 2JJ8A 1JEEA 3OHMA 1XTKA 2XZOA 1MH1A 3RSOA 4WZ6A 5JHGB 5JSZB 1E32A 5L3SB 3CR7A 1MKYA 3HU2A 5JJKA 3EIQA 1GP2A 4PO8A 2V3CC 2BBTA 1VCNA 3H86A 3ZZTA 2O0KA 2UVQA 1YQTA 2FDCA 3PCRB 4M1MA 4KLZA 2EW1A 1N6LA 2BMJA 2BVNA 3NBFA 3C41J 1R8SA 4Q4HA 1VIYA 1DADA 1VIAA 3QSYA 2XTMA 4Q1EA 1OH7A 4M21A 3B1VA 3HR7A 3C5HA 2ZRJA 5KOYA 4PHTA 2QZ4A 4C0BA 3BK7A 2QQEA 1YE8A 3UK6A 1SQ5A 5DN6D 2PZFA 4B32A 2R44A 4DLUA 4QM6A 4MDFA 3BFXA 5BN5A 3FE2A 3TSOA 4YQFA 5K8IA 4V0OA 4HAXA 1KHTA 1UKYA 4EFMA 3QOFA 3F8TA 4D2IA 5C4MA 2B6HA 2Y8EA 2VH5R 2O0JA 3HU3A 3RS4A 3W6NA 4C0AC 2IF2A 1Q22A 2ZRKA 1GTVA 2LKCA 4RD2A 3UMRA 5KNCA 4Q18A 2GF9A 3G82C 4L8GA 1XP8A 1YZKA 1T0JB 2GKSA 2GK7A 2O52A 2W6ID 3K9LA 3IKJA 2R8RA 2X77A 5JBQA 3CRVA 1E1RD 5FBLB 3QKSA 3T35A 3AGPA 1CR2A 4TL9A 1QVRA 4US1R 1NVWQ 1YRAA 4OHWA 4EUNA 1R0WA 5BXQC 3BJIC 4Q9LA 2A5DA 1OB5A 2QSYA 3B9QA 3X1DA 3KZ1E 4TTQA 2ZRNA 5EE5B 1W2HA 3PENA 2PJRA 2G0NA 2QN6A 4HAWA 4IRUB 2FJUA 1ZU5A 4DLVA 4MKGA 2WKPA 3QF4B 1G3IA 5KNBA 1QF9A 4NYMQ 1A82A 3BB3A 4PSKA 4QHYA 1XXHE 121PA 4JLPA 3T1VA 4BFUA 1UAAA 1OFHA 1WA5A 1D5CA 3AV0B 4PZLA 4AKGA 1J90A 3A36A 1YZGA 4F93B 1OFIA 1EXMA 4M9SA 1W36B 1KY2A 2WZQA 1U8ZA 1ZUHA 4TMKA 5DO9A 4Z8XA 1GL7A 721PA 2XX3A 4MYTA 3T5GA 1OH5A 4MRSA 3KXLA 1ZRHA 4DT1A 4XVUA 4DC9A 4EPVA 1XJCA 1T6NA 2FX3A 2N1BA 2ZE6A 1G5TA 1PZNA 2H18A 5B58C 5E3HA 3RANA 2NG1A 2E9SA 3MWLA 4JVSB 1TUIA 1HURA 3N2EA 5AUQA 3P1JA 3T1QA 5DNYB 4QG7A 3H84A 5JMTA 4NCNA 4OK6A 3IEVA 3C16C 1Q1QA 5FR2A 5F2EA 3A1SA 3OFNA 3RS0A 1OPXA 1T0HB 3FMPB 3CX8A 2MMCA 4Q1DA 1KMHA 2Z4SA 1Q1EA 1KNQA 4B47A 2Z43A 2ZRHA 4DUGD 3SFZA 2VP0A 2C99A 3L0SA 4GMXA 3Q85A 4TSFD 1PLLA 1M7GA 4I1SA 5M04A 4PQYA 1EESA 1G4AE 2RCNA 5A4JA 1TQDA 4OQXA 4KVGA 3UWKA 2AR7A 4JKIA 1KI7A 5FPSA 2RGCA 1UEJA 1FNNA 4QNRA 1D9ZA 2C98A 2ZVQX 3B8HA 4PPFA 1W4AA 1I4DD 1YZTA 4AG6A 2VTKA 2PBRA 4O0MA 1KSJA 4ZDKA 3KQHA 2V55B 1Z28A 4JVLA 1BMFA 4PC2A 3ZGXA 2JLRA 1NG9A 2DWPA 4NONA 4BZXA 2J7PA 4NPHA 3WHKA 3CIOA 1MABA 3TQCA 1JECA 2Z0MA 3BWDD 2ASEA 4JIMA 1CJMA 1G8YA 1RRGA 1CP2A 4XJXA 3SE0A 4C4PA 1OKKD 4TMTA 4CEHA 2GAAA 4Q19A 1Z0IA 5CK4A 5SZIA 3QXJA 4Q1BA 221PA 5KHOC 2FOLA 4Q00A 1J2JA 5E7MA 3VNVA 1MO3A 1KO1A 4BEBA 4TMVA 5FL7A 1RJ9A 1RYFA 3EPHA 4OQFA 3L43A 2GCPA 4WOPA 3M4YA 3S1AB 2J5XA 4D81A 3PUVA 2QE7A 2PT5A 3EIEA 1G19A 2Q0HA 3AP1A 4P33A 3PEUA 3W90A 3LXXA 4DIDA 4Y0AA 3BXZA 1R5NA 1AS0A 1II8B 3OFND 4D82A 1J8YF 1Q57A 1GRRA 3QVVA 3SBEA 4A0HA 4C0HA 3O8RA 1NY5A 4X8LA 1XPRA 1OE0A 3CPEA 4DDWA 5AK0A 3IQWA 4P4TA 1Z8FA 1U94A 2ZVPX 2O8BA 3QKRA 2P5SA 2LCFA 1Z5ZA 1OYYA 1LV7A 4AYXA 2K5UA 1XMJA 3LWNA 4GRAA 5D3MA 2GA8A 3QUSA 1TUEA 3K09A 1II0A 1T3SA 4YXWA 5TXGA 3R9WA 3QY0A 2RGAA 4B6FA 5SZKB 5JS8A 3GEHA 1DG1G 1G7SA 2WAXA 2Q3FA 3H2YA 3U3KA 4B3XA 1ZUNB 1OF1A 4AWXA 5LD2B 3KQNA 2F7SA 1N5IA 4M22A 2ORVA 1AJEA 3SNHA 3THXA 4V0LA 1E2JA 4B35A 4AURA 4AKIA 1LW7A 2JEOA 2J7PD 4Q9KA 2D4HA 5J4HA 3THYB 5AJWA 3DM9B 2QROA 2ATXA 2RH5A 2CLDX 2XEXA 3IILA 1N6OA 4ZIRA 5DYGA 2GCOA 2J59A 3PXGA 2IUSA 3FMOB 2Z4RA 2ZUDA 4BZQA 3LLUA 3LNCA 4JLJA 5BW8A 3TSWA 3MSXA 1OHHA 3ZD7A 4C0QC 2QP9X 4OBEA 4W9MC 1Z0AA 4JZKA 1V5WA 3GLFE 1WQ1R 1XZPA 3LBIA 3MD0A 3RRYA 2DWQA 2VBCA 2QE7D 5FH9A 2C04A 2GJSA 5JRZA 1XTJA 2E1RA 3BB4A 5JSZA 1W49A 3BORA 3OESA 2GVZC 3GEEA 3AVXA 2C03A 1TF5A 1NN0A 1V43A 2TMKA 3LVQE 2A5JA 3PG5A 421PA 4BECA 3PEWA 2F6RA 3VR6A 2PMDA 2NO1A 4JLAA 3C4JA 4XTRA 3VU9B 2FE4A 1TF7A 4F7WA 1OJLA 2ZJYA 3EWSA 1A2KC 1NVVR 4KJZA 4QGAA 2FFQA 2AL7A 2WJVA 1CR1A 3I4LA 4TL7A 4F4JA 5B30A 2HUPA 2OXRA 2FV8A 3RRZA 2VA8A 1GVNB 4JL6A 3KKPA 4FMCB 4V0KA 5HE8A 4YXWD 3UPUA 2WJJA 4X8MA 4EFNA 1IN7A 3I8XA 3SHWA 2HT1A 4BLOA 1G9XA 1G6HA 2MSEB 2I4IA 4A1FA 3R8FA 2XTNA 5GJWC 2CVHA 4NDZA 1QRAA 4JLVA 1E1QA 3DZ8A 2J0VA 5CLLA 3THWA 4PC6A 1OYWA 1E2FA 4LV8B 2R6CA 1KOFA 2D7CA 4QBGB 2JDIA 3W5IA 2GXQA 2OFXA 3RYTC 2F1JA 2F9LA 4O2RA 4DDTA 1EFTA 1PJRA 1KY3A 4JLOA 2XTZA 2A7QA 2QAGC 5L3RA 2HT6A 4AD8A 3EC2A 2QTHA 4HDOB 1KI9A 2ZUCA 4MDEA 3RC3A 1PV4A 5TARA 3AB3A 1HQYE 5CB6A 4BLQA 1BKDR 5FUVA 2WTUA 2FFBA 4N0EA 2ODWA 1DOAA 1QHGA 1SVSA 4PO9A 1KI4A 1J8MF 1VHTA 4HI0E 1ZC3A 2YYZA 1ZIOA 1ZNWA 2WJHA 1JQLB 3TUIC 3QF4A 2ZUBA 3UG7A 2VP5A 5JRJA 3WYFA 2VHTA 2QP3A 3OE7A 4NYIQ 4D4KA 3L0PA 1IONA 1GNRA 3B1WA 4LWZA 4OI4A 2XNDA 3FFAA 4DRZA 3TR5A 1S9HA 1WMSA 3TLXA 4JLDA 1HQCA 1QHNA 4DSOA 3PR1A 4LYHA 4Q03A 1LVGA 2LWIA 2IYWA 4JYBA 5DIFA 2QBYB 4YMVA 1UKZA 2PLRA 2OFWA 4AKEA 1Q3TA 2QA5A 1E3MA 2P6UA 2IBMA 4GP6A 5G53C 1ONBA 2BBSA 3R9IA 3Q8XB 3MLEA 5KPDA 1K6MA 3R7WB 2CJWB 2E87A 1W7AA 3OZXA 1DAFA 1ZNZA 2HXSA 2YWGA 2JDID 1P60A 4QL3A 3VFDA 4V0MA 3I61A 4B76A 1SKYE 1P4SA 1FZQA 4QKQA 2ZR9A 2BJVA 5F98A 5ELXA 1NIJA 5AR1A 1T8UA 2EFCB 3CX7A 3A1UA 3TAUA 5GVSA 3WRYC 4EJSC 3ECCA 3IPXA 2GBLA 1LF5A 2YINC 5FOVA 3RRMA 4FXPA 4KO8A 4DLTA 1E9BA 4XIGS 3WMFA 5EP2A 1WB9A 4A0FA 3QKUA 3DKVA 3AGQA 4RFVA 1GIAA 3NC1C 4KAXA 4KBGA 1E2KA 2QL6A 4EPRA 1FTSA 5KO2A 3I62A 2VLIA 4G5QA 1SKQA 2VEDA 2WKQA 3NBYC 5AWFC 4POAA 4ZCIA 4R71A 2C5LA 4RD6A 3IBGA 4C0JA 3QKSB 2EFEB 1FQJA 1JPJA 3CB4A 3OE7D 5DE3A 3NC0C 5HTKA 3X1XA 1AZTA 3T34A 3ZDQA 4UNRA 2EVWX 2WWGA 2DY1A 4Q9IA 5HCNA 4D80A 3FGNA 1EWRA 1CKEA 1E2NA 2ZRGA 5FPHA 1SVWA 4A8JB 4JBWA 3E2IA 2WWHA 3FVQA 4Z1MA 2W58A 3OEHA 2Q9BA 4MUBA 3K0FB 3UANA 4DSUA 4BLTA 4WXRA 2IXEA 1NRJB 2H57A 2BV3A 1IY2A 3L2OB 4BEJA 2ZRIA 5BN4A 2RB4A 1RIFA 2UKDA 4C7OB 2PX0A 2IS2A 2R62A 3S1AA 4JLMA 5G3ZA 2CXXA 2AWOA 4LRWA 1BIFA 1IM2A 5GVRA 4AKHA 4NZYA 2P0EA 5DHAA 4W5WA 1F3OA 1II8A 3Q7QA 5EZ5A 1AK2A 1OIVA 3HJNA 3ZS8A 5F9HA 4DT1B 5C46F 1WRBA 1RKBA 1NLZA 4PHHA 1Q21A 3F3YA 2ZRMA 1LS6A 5BYJA 2HLDA 4OK3A 3VAAA 1ZM2A 5K8LA 1Z6TA 3K0CC 1P61B 1T9HA 1F2UB 5KNDA 5HZKA 2QAJA 2G9NA 2J0UB 1NLYA 4ZDWA 3PJRA 3THOA 4HZIA 1VDZA 3RS2A 1E6CA 1G3MA 2ZSAA 1JPNA 1MV5A 1U81A 3NKVA 3P32A 5FUWA 1BH2A 4IEIA 5LB4A 2OEPA 4AYTA 3VHXA 4CF7A 1P2SA 1J70A 1NMZA 1CJTC 4HAVA 3AVOA 2CK3A 3ZIAA 4J0QA 2NMVA 1OSNA 1H8ED 5CM8B 2L0XA 4A6PA 4DCVA 5J4KA 4L16A 1FW6A 3QBTA 2QPOA 2VSXA 3K0CA 1JR3E 4LI0A 4ILEA 2WWIA 3BBPA 4DVGA 4ZDJA 4BFTA 5JJLA 2GVDC 1XJ0A 2QSZA 1P9RA 5FOWA 1CJUC 3THYA 2QMEA 3VR1A 2PLFA 2DHRA 4U7DA 2V1UA 2BKEA 4GMDA 4D0GA 3A37A 2AK3A 2YWFA 3TW8B 1O3YA 3AF2A 3CRW1 3PUXA 4Q02A 5FPTA 2JLQA 3K8YA 4NP6A 1KTVA 1WBBA 1OXSC 2D2FA 3QG1A 4IDPA 1X1SA 1YR7A 1VYTA 2Q6TA 4BFXA 3C15C 3SFVA 1XXHB 4LPSA 4GDFA 2XOKD 1LFDB 2WV9A 1E9FA 3MFYA 4WBSA 2XJ9A 3B60A 1A4RA 4E07A 3OEEA 3QPUA 2H16A 4L9WA 5EXSA 3WNBA 2O8EB 2JLZA 1ESMA 1Y3AA 2V9PA 3TH5A 2RGDA 1WF3A 3AF0A 3A1TA 1SXJE 1P75A 2CCJA 2GXAA 1WE2A 5JWOA 1C1YA 3L82B 1E94E 1FP6A 3IO5A 5LBIA 2XZPA 1VTKA 2ZETA 4DEYA 4M1YA 5AUPB 3RAPR 4HAZA 1M8PA 5CJPA 2CBZA 4B3BA 3HPQA 2Z5FA 2ZE5A 2BMDA 3KUCA 3BE4A 1VYVA 4G5GA 3MWYW 3LBHA 2CLSA 4M1SA 5CLQA 1T8TA 2WJIA 3UIEA 4TN1A 4H1VA 4D26A 1D8TA 3L8YA 4PAMA 4HB4A 1IBRA 2Q3HA 1HTWA 2EFGA 3NEJA 5KSOA 4PHGA 2ZRCA 2QORA 1GOTA 4RZXA 3WNDA 3GLGE 4G5OA 2ATVA 3AUYA 1J7KA 4DWJA 5JJIA 1VCOA 3F5FA 3VX4A 5FOXA 3M6AA 2F55A 3NDPA 2AXPA 2NO9A 5DN6A 4B44A 2QG6A 1Z6YA 4OQLA 2DFKB 3I73A 2ZITA 4HUQA 3SJZA 2FG5A 2KBFA 1LS1A 3SYNA 4G1UC 2IC5A 2JJ1D 3THXB 2JASA 1E2EA 1GRNA 1XPUA 2PEYA 3GJ3A 1R8QA 1VG9B 2XSZA 3IGFA 3W6PA 4QRHA 1KK3A 1W4BA 2EWVA 1ODFA 1T91A 1U2RA 1E79A 1W47A 1XRJA 1VPLA 1HYQA 1ZCAA 4B48A 2C2HA 2O8CB 3MAAC 2W6IA 4LZZA 4DSNA 1U8YA 2P67A 1E1RA 4TYYA 4HZUB 3A4MA 3SS8A 2FEMA 5FBVB 2ZSBA 2OCPA 3W8RA 1XD8A 4TZ6A 4I1OA 2PZEA 2BKUA 2H17A 4WZAE 2CL6X 3EXAA 3A1WA 4O25A 3U7GA 3JVVA 3CPJB 3K9GA 4TYWA 5P21A 3C14C 2QBYA 4A82A 1TL7C 1DO2A 3TVTA 1G21E 2B7BA 1QVAA 5AJVB 5J5CA 2BDTA 4EAQA 3IIKA 1NVVQ 2IF0A 4DLXA 4LYJA 4V0NA 3EPLA 3WBJA 1Q1BA 3KX2A 3LX8A 1AS2A 1TQ2A 2IL1A 2FSGA 2W00A 2CJWA 3EWAA 5E7IA 3R7WA 2Z83A 1E9EA 3B5JA 3MCAA 2DCUA 3RS5A 4US2R 1B0UA 3ZVRA 1BYIA 3PITA 4IOLA 1II9A 1E0SA 1JR3D 3KJHA 1LTQA 4RKEA 4KITB 3AP2A 4ZI2A 4LJ9A 5EE0A 3U3MA 3AVUA 4XSGA 5EJEA 2BMFA 4QJ4A 3EA0A 3RSLA 3H4MA 5AJYA 4NCIA 4IVQA 3WNCA 4A8JC 3THWB 4CGZA 3U3OA 3LAWA 2PH1A 4LBWA 1VG1A 3K9NA 2X19A 4G0NA 3NHAA 2I1QA 5DI9A 2GILA 2XSZD 5FL3A 1W44A 4W5JA 1GKUB 3BD9A 3AUXA 1E79D 2GEUA 5FUXA 2IEZA 4DUGA 3ZVNA 2J7KA 2LKDA 2O5VA 1T3LA 2ORWA 4TSFA 5TVKA 4AYWA 2IYZA 2OFOA 1D2MA 3OIYA 4DLRA 5EUQB 1A1VA 1CR0A 3LO5A 1DEKA 3AVTA 3TJZA 1XTIA 3FB4A 4M9XA 4A8JA 1KO5A 5EP3A 2O8FA 2RGNC 1G7CA 3GFOA 4ACBA 3GLFB 2QEQA 1ZNYA 4Q4JA 1NKTA 4UKDA 1XMSA 3RWMB 4W5HA 3U3RA 1ZD1A 4KXFB 3K0FA 2NPFA 2BC9A 1JALA 1NBME 1ZMXA 2P6NA 1SGWA 3P26A 3QJYA 1GITA 4IOKA 2WWWA 3ADDA 5DISB 1N0UA 1KI1A 3EZ9A 3CRRA 4LJYA 4C7OA 2QAGB 1Z06A 4YONB 2ZQ5A 1OKKA 3M1IA 2CHVA 2QU8A 1G18A 3ZQJA 4KFTA 3D3QA 2HV8A 2VPPA 3RNLA 2NO6A 1DARA 1I2DA 4Q4AB 4A6XA 1PUIA 1P62B 1ZM7A 4OHZA 2HJVA 4IVRA 3ZZ0A 5L8VA 1G5PA 2CL0X 1Z2CA 3HDTA 3GFPA 1VCMA 1F2UA 4RCZA 1XEWX 4LPKA 4DSTA 2J0UA 1U0JA 1NJFA 4LX0A 4HATA 4Z51A 5F9FA 3AP3A 1GFIA 2GXUA 3CM0A 1AQUA 2QMUA 3LY5A 5B57C 2HDNB 2ZTSA 4B34A 3EA5A 4G5SA 3WP1B 1ESNA 2JJ2A 1COWA 2BHRA 3MMPA 4BFZA 5KSZA 3LXRA 2GRJA 2ZE7A 3QXXA 5J47A 3DHWC 4LJ7A 1E9SA 3TVDA 3D6TB 4HB2A 4A36A 1QHYA 2VF8A 5CITA 4GBMA 2GF0A 3K53A 4B74A 3PUYA 2J0QA 2OM2A 4BPBA 3DVLA 4YC7A 1ZVQA 4NU0A 1U90A 3LFUA 3ADKA 4CIDA 2IXFA 4TYNA 3QXSA 3KKMA 3KB1A 4PR0A 4NH0A 3AVQA 4R2IA
chains in the Genus database with same CATH superfamily
1G98A 1QANA 3AF1A 4WLEA 2R4QA 3OKAA 4C9BA 4PG7A 2AFRA 1X7YA 2FXIA 4E15A 4WGFA 4UTNA 2ZR0A 3NBMA 3Q3GE 4QYXA 4H7FA 3A11A 5ALQA 3RABA 4IJ5A 4KQ6A 3BIWA 4NECA 2IZ7A 4OQMA 4EKDA 3ETLA 4ENVA 4ZI3A 3BE6A 4EJSB 4BNXA 1YNSA 2C8KA 4XTCS 3L46A 5K8TA 6CHYA 4H77A 4PQFA 1MW9X 5BNIA 2BEVA 4D6YA 1FX0B 4LYYA 4C20A 2O8EA 1P9WA 5CA0F 4FEGA 2ZCUA 4DCGA 2YVAA 4GECA 4LF9B 2CNWA 2Q2QA 3H0EA 4LV5B 4E5SA 1MTZA 3JZMA 2BM1A 2ZAIA 2WJYA 3PQEA 3ZKWA 4DSZA 1E2PA 1ZX1A 2WR8A 1WXEA 3IDQA 1Y5NA 2PUTA 4EYEA 1MO2A 1RQLA 2NYUA 1ZZGA 4NK4A 1KVRA 4REQA 3UATA 3K32A 4GMGA 1ZHFA 1HBJA 1KZHA 4LKRA 3ZGZA 2XI4A 1XEXB 3BH7A 4IW3B 4QLAA 5JS1A 2C84A 4CFSA 3BVPA 3RWBA 3VDMA 4LXHA 1DJNA 4PFKA 1FFHA 4KV9A 5CJJA 5GJBA 1KI2A 5JO0A 1SIBE 2FSPA 4U2KA 1W0JD 2JGIA 1TVKA 3OZGA 3AUKA 3PLRA 1LPPA 1V8FA 3B2QA 2J32A 2OCIA 3A04A 1JDPA 1SKYB 3FIJA 2EIHA 2Y71A 1XCMA 2GH1A 4FFNA 4I9NA 5CK5A 5IC4A 2F9MA 4BCCA 2QW8A 1OZFA 4UBMA 2ZRBA 5C8VA 2BFEA 4CFZA 3QPWA 3D2CA 3ONDA 3WE7A 4P4GA 1L7RA 2HUNA 4GRIA 5F78A 4BV9A 1DKPA 3B1XA 4QQFA 1GPAA 4U2CA 1TU0A 4P34A 5GM2A 4F8YA 4Y2PA 2D6FA 5J59A 2VQDA 3AHIA 4I5IA 5HOEA 3IBCA 4LSMA 5ELLA 5EHXA 3LDUA 4N0DA 5JCOC 1N5KA 2CNOA 3JSXA 4INOA 2OA0A 5I8PA 1QBKC 1YGPA 3E9QA 5L3QA 4YJFA 4ZQBA 3MWGA 4AMYA 4PLPA 3BSSA 3GPBA 3I72A 2G1JA 3NHPA 4TKVB 4K8RB 4ZYLA 1L1QA 5AI4A 2NGRA 3KUXA 3HMKA 2CLKB 2IYSA 4QBIA 4BKMA 4DNXA 5TY0A 4R2XA 2YZ2A 3MJFA 3IESA 1JDNA 2HF8A 2J3EA 2XUOA 3N0WA 3OZUA 3K1JA 1VL2A 3VNUA 2O8CA 3C7CB 3KBOA 3INYA 1IY0A 1PZFA 4LMPA 3K5IA 1P0QA 3VJMA 3X44A 5JAPA 5J2TB 4Q05A 4AY2A 1Z5VA 5H4HA 4AMBA 3HKBA 2OGSA 4YJHB 3PX7A 3N0RA 2CNWD 3TRJA 4DQVA 4F5YA 5U9CA 3I04M 2EOAA 1R0CA 1X7GA 1G8HA 5HPYB 3MOIA 3ABQB 3ANLA 3ZC3A 4DA0A 2GB4A 3VKFA 3G8DA 4DBZA 4KXWA 1S2LA 3MT7A 4O1IA 3GVPA 1RLUA 1ZZEA 4GSKA 4GFDA 4LCBA 4RTKA 4HWPA 3OTOB 3MBOA 1YL7A 1K63A 3OLYA 4TVOA 3SF8A 5BPHA 1AGNA 2VBFA 3PFHA 1SHLA 5HZMA 3FLMA 4LHYA 1SUPA 2WICA 4X92A 2EIXA 2V1XA 3OJFA 5IF3A 4C1BA 3BD8A 1QE3A 4P7KA 4W63A 4E5PA 4F2PA 2PNJA 3DBLA 5B2FA 3IKMB 1X7XA 4LC0A 1PQUA 1XTSA 4EO4A 2UXBB 2PS1A 3ZWKA 3DEFA 3FYCA 1V7PC 3EY9A 2IT1A 3HPRA 3SK0A 3NMUF 2NX2A 3B3GA 1HUQA 3DFZA 4RHTA 4FKBA 5E8RA 2H51A 3WDLA 4G0OA 4EBFA 3KS9A 3VHRA 4PCVA 4XD7D 5JSFA 3T1HB 4JITA 2QNBA 1USWA 3OCWA 4XOIA 3KSRA 1V16B 1BE1A 3PWKA 4FMDB 4LDQA 4XXHA 4F4HA 5BRAA 5EJ7A 3ZHQA 4W1PA 4KCGA 4GR9A 4NCJA 2BONA 2HLNA 1Y9AA 3GIDA 5T4BA 3F97A 3I52A 4YCJA 3GQBA 4EX6A 1KWGA 3VSBA 2G80A 2D8AA 3FTNA 1VHDA 4HEJA 4IXTA 5A1JA 1I5EA 3HP4A 1YS4A 4KKVA 4DWVA 2NU7B 3AZOA 2D62A 4LHZA 4E0BA 4ZVSA 5IVPA 2ZXFA 3ZH2A 1SU6A 4FC7A 2J6BA 5IT9A 1Z0KA 2CUTA 2YVUA 4LRYA 3ZUPA 1G6OA 1QGUB 2W22A 1A9QA 3E84A 3JQPA 2YZKA 1QGDA 5EWMB 2I4NA 3TTWA 4RTSA 4WADA 4M1TA 1QP4A 2WFLB 2XCLA 3EG5A 2OUIA 3T7IA 4A0QA 4Y2RA 3MILA 1BXGB 2Q21A 3U81A 2ZI3A 5JATA 1IAQA 3BSFA 5CLGA 4V1CB 4AIIA 3BFJA 1JQ5A 1G3QA 4ZCMA 4E6PA 2XW6A 3H42B 3EGOA 4IFIA 5E0KB 4DMRA 1OH8A 3MT9A 1UT8A 4GIBA 1O5OA 1P7CA 3R74A 1XI2A 3VPBA 3DBOB 1UDCA 1XO1A 3TEFA 2V6GA 1T43A 4G67A 5IVKA 2GESA 3N7AA 4F4CA 3KWLA 3SC3A 4Z7OB 4TKUB 4ESHA 4N12A 1GTG1 1JHZA 4IOJA 1E7MA 1YS1X 2H2DA 2C2KA 1K3TA 3BXFA 3DOFA 1R0ZA 1LPAB 2G3YA 3HUFA 3KNZA 1KP9A 1QMPA 3OJWA 1I0ZA 4OA8A 4YFYA 2X0EA 4QXOA 3L6UA 1QCYA 5K01A 3EMVA 4OK5A 1KMIY 4RJKA 1LA2A 1MO4A 3T7CA 5ICGA 3PQCA 2GZRA 1GKYA 2C3UA 2BY4A 1DAMA 3P2JA 4NEHB 1MT0A 2P6PA 4BFWA 3F6CA 1RTKA 2G0TA 2XF2A 3OLQA 1RQ7A 4K46A 2IKSA 2BISA 3T41A 4ZK2A 5TGZA 2E85A 3A2MA 4BFVA 3NHBA 5TX7A 5FKJA 3GF4A 3CBGA 4BQIA 4NJMB 5T57A 4W6QA 1PSZA 2XT6A 1PVOA 2ZYRA 5FI0B 5A04A 2ID7A 3DS8A 2AD1A 5JJBA 3Q7SA 2G25A 1YZUA 1YU6A 1C9KA 4LGVA 4PFQA 3B78A 4EAAA 4KOAA 4CG2A 4X45A 1GTMA 4FE4A 5F52A 5AICA 3WKEA 5LWHA 1QRSA 4XGQA 3FUCA 3M6FA 3NKLA 5ALEA 4EG3A 1GZDA 4FYXA 4LHVA 2WE7A 3ZUGA 4F2DA 4X90A 4AIRA 4FGWA 3GJ4A 4B7CA 2BM0A 3C5EA 3AG6A 4JLBA 2CLFB 3OM9A 3MJCA 2VTDA 2E5FA 1UBCA 10MHA 4HVCA 2CNBA 3CVWA 4KTVE 3AL3A 1D2EA 1ZGGA 3PJEA 1XKTA 2V74B 2ZTLA 3HU5A 5DCWA 4AJIA 1HNXB 3ZDDA 4G0QA 1X8JA 4KO3S 1HY3A 1PD1A 1TTQB 2OE2A 3E03A 1AB6A 4FCWA 3T54A 1GRQA 3IIIA 3BM5A 1WNFA 4NKRA 1FTYA 2J3KA 1DC7A 3O75A 4YLEA 1DFGA 1JMKC 1C0EA 4DCTA 1CUDA 4MKXA 4EHFA 2CMKA 3JWJA 4RE5A 3WVNA 2POQX 1L5YA 3LQKA 3F4BA 4DM3A 1M5UA 2QQFA 3M6VA 2YUTA 2PGOA 4RM2A 5KVQA 5TQ2B 1VSQA 1VXRA 2NUTB 3T9EA 1KZ4A 4MARA 3PQDA 1T9BA 2XYGA 5K8UA 4LV6A 2JHAA 4UTVA 2VQ3A 1V3TA 2XJ4A 3K15A 4KRYA 4XJVA 2W8ZA 5AOCA 2OLKA 2ZIUB 2FPGB 4EYKA 5T4EA 4HLUA 3EW9A 4RD4A 2O2CA 4Q4JB 2XB9A 1G291 1Z4KA 1OWNA 1C4WA 4I4LA 1RU3A 3PZRA 4O8CA 4Q21A 2CV1A 2FHSA 3F1LA 4UDOA 1NNLA 3CH5A 3DLIA 3SEQA 1ZP6A 5EJAA 1YJ8A 1W30A 3EOAI 3OY7A 4NC9A 3R0VA 1G21B 4IJVA 3ISVA 1M1YE 2ECQA 3VMMA 4E21A 2GN1A 2XOKA 1EFHA 2WLTA 2OYSA 4MOWA 3L0OA 2W0SA 1UBEA 5EJ4A 1UC9A 1RXSA 2DWCA 2PV0A 3K9HA 4B3GA 3C3EA 4CTMA 3MPUA 5HZHA 1OU0A 4YGYA 5IULC 1SUFA 1YZHA 2XUGA 1JJIA 1WXQA 2NUAA 5JLJA 5KNBH 3MPOA 2J85A 2BGJA 1R6DA 3SVLA 2B8JA 1U3CA 1XKXA 5ED4A 5FOTA 2Y4NA 1HL3A 4KLRA 1IWPB 1DRWA 3MJTA 1WZCA 2Y76A 4MVWA 4TWZA 4WA7A 4YUYA 5K3CA 4H4EA 5D7BA 4M49A 2AHOA 3A31A 1RXUA 3EIHA 3TI7A 1DZIA 3V55A 3WOVA 1E0KA 5DLPA 1D2CA 1EVLA 1KJ9A 1I3OA 2VRBA 3QV1A 3EUWA 5KX5A 3ND5A 1WCIB 2QX9A 5DM2A 1I5OA 1Q20A 3GAAA 1BS9A 1QF7A 5DOZA 1VFPA 3B5IA 1FXSA 2XTJA 2ZSEA 3EB9A 3H83A 2EYUA 2G06A 4R2WA 4BMCA 5A4KA 1WXDA 1JBKA 1TPZA 3GEBA 1R0LA 4RJLA 2VJKA 4X3OA 3CNOA 1Q5PA 2EAUA 3R0QA 4ILKA 2Z6VA 5K51A 4CDNA 3QXCA 4DLBA 3GEIA 5FWYB 1D5WA 1D6SA 3MWKA 3H8VA 5KIAA 5F7XA 4H3HB 1JMVA 1P1IA 1T8WA 1UBLS 2CFIA 3K9CA 1CEEA 3Q10A 1TT5A 2CJYA 5SYAA 1TADA 3HU1A 1H4SA 3RH0A 2VC2B 1M10A 3HV2A 2QNRA 3IVMA 4P7GA 5ECWA 2I3AA 1W85B 2XCIA 4YY3B 1ZBDA 5GP1A 3GY0A 5CEJA 3OIDA 5LIRA 1NWCA 2VYQA 3L8GA 5K6RA 2I03A 4R4JA 3QMVA 3MUOA 2JJ1A 1V8PA 2CXSA 2DETA 3UB3A 3SMQA 1IXSB 2XMPA 4G5HA 3ZWWA 2ATCA 2PDAA 4MUFA 1LK5A 2CEKA 2H48A 1AQLA 1NRWA 2XA1A 4WOJA 3VZCA 2YFKA 3M4ZA 1AC5A 5FP0A 3K2QA 4DV2B 3V8RA 4BIMA 1Q1AA 3D4IA 3K0AB 3EPJA 1QQAA 5I7FA 1Y89A 4D5EA 3LYLA 1L8LA 5T67A 3QBDA 3EFBA 1WDLA 1MRSA 3IE0A 1P77A 3JY6A 1NURA 1P9OA 3CZRA 4DA6A 4JB2A 5EWJB 2HRQA 4NNJA 1H0KA 1RM4A 2FB9A 4I4NA 3GW8A 3NV9A 1OGJA 5EQTA 2WOJA 3GK3A 1H93A 1GR1A 1TD1A 3FTEA 2LVBA 1SZCA 2C4WA 2NIPA 2NVWA 3D6VA 4FLMA 3LUKA 2H0QA 1QS0A 3RADC 1NSYA 3HVIA 3VR3D 4R0MA 1N32B 3EWIA 3CRNA 4YRZA 2JD1A 1CUZA 1GPYA 3D64A 1UCFA 2XIJA 3NM4A 5U1PA 5KVAA 1T5LA 3HVJA 4MPTA 3RJZA 8AT1A 1O95C 5JBQA 3OZRA 4HGYA 3QBVA 1CY0A 1PJAA 4MPPA 5CT9A 3VVBA 1V35A 2W2VA 3MXOA 1XZBA 1GL6A 1I7LA 4HN2A 4K9OA 1FSSA 1DDIA 3HLYA 1WZEA 3F9IA 4PYQA 1RJEA 5CTJA 5FHRA 4IV8A 3UTDA 2FSVA 1HDXA 4HQFA 3EQ6A 3C70A 5KAMA 3W9BA 4CIVA 4RTQA 3DW1X 2A2ZA 5A9RA 2CZCA 3I4CA 1Q6YA 3IAM6 3UK7A 2GWRA 2VP6A 1H2FA 4HDNB 3ROXA 1D1TA 5DNAA 4E13A 4G09A 4GDFA 3SYLA 1NVXQ 3COZA 1I80A 1XYGA 4OBWA 1GUFA 3CMMA 3MBIA 4YRDA 3TTYA 4H7IA 4E1VA 3E5RA 1TEVA 4GKAA 1XRSB 3DV0A 3SYRA 3PR3A 4CL2A 1IN8A 4LSZA 2VJNA 2ZJ0A 1GPLA 2DYKA 3NIWA 1XDBA 4CMEA 2BHTA 2RMKA 1SXJC 3BRSA 2QY9A 5BR4A 1YI8A 5C7LO 3PFCA 3ELDA 3FIUA 4QU9A 3F6SA 4GEGA 3PPXA 4L6CA 1KEZA 1L7QA 2KLHA 5AI6A 5EP4A 4RKFA 5EZYF 4YYZA 3HJFA 2C3PA 2O2EA 2AYXA 4JEMA 5JS7A 3QVGB 2Q5FA 4CMBA 3LYHA 3FPFA 4Q1VA 1C5KA 4V38A 1VJRA 3N07A 2I2BA 4EITA 2FPIB 4BVHA 1UQUA 4ZMRA 4PCLA 1NXSA 1UPUA 1WTAA 4AP5A 1WD5A 3RC8A 3O21A 4NBSA 3C1OA 5G0WA 4ARUA 2Y1FA 2GF2A 3GBSA 2WZBA 1P81A 3IKLA 3U1VA 4YV7A 4K88A 5KQGA 2YHSA 1EXDA 2D0OB 1QORA 5CLHA 5T4HA 1ZY2A 3E4CA 5HKOA 4P36A 3ZNPA 3G49A 1WL8A 2I66A 2NVOA 8MHTA 3QENA 3GJ6A 4WTOA 5EMHA 2R97A 3WYAA 2Z3ZA 1OLOA 1XD2B 3ZZUA 4OQ4A 1SC9A 3NHUA 1WCYA 3AF5A 1Z13A 2YY6A 3G6WA 4K05A 1VGQA 4KRGA 4FB5A 2POCA 4GXQA 1WUJS 1K5PA 4QFMA 2AKYA 4TT3D 1V39A 2PG3A 4P32A 1JDUA 4WXHA 5EE9A 4BGDA 1FFWA 2GRUA 3H75A 3IHKA 4RH0A 4TLEA 4ZKEA 2HJGA 4MQEA 2VWPA 5KHAA 3V46A 2PUFA 5JV5A 3W6ZA 2BM8A 1YOVB 1F06A 2F59A 3PPWA 3ENWA 3GLGA 4AICA 3U4AA 1BWRA 3JQAB 4X95A 1Q7RA 2WF5A 4P58A 3KYCB 2WT8A 5FADA 3WKCA 1KQOA 2ODAA 3HKDB 1MVNA 2A9PA 3BOSA 2QD1A 3AHGA 3NUZA 4HMQA 3GPLA 1E2QA 1Q0QA 2HEIA 1D0IA 2BFAA 3OMLA 4FIZA 4IS3A 2XF8A 1NPDA 3LW7A 1JQDA 5CDSA 3LKDA 2B98A 3G9TA 2B5OA 4R84A 5JNTA 2YC4C 4G0ZA 4JSTA 4RANA 1ZNXA 5FCDA 3FSJX 2OD2A 3JZAA 5D2CA 3UMSA 3X1MA 2QUAA 4ZPJA 5ARCA 4MYUA 1KDOA 1VSUA 2VAWA 3P9YA 4N3NA 3AFHA 3AHEA 3CZ9A 5CT4A 3BMCB 3BX1A 4YDHB 5E8JA 3LYAA 5IJXA 4BNUA 4JP2A 1IPFA 2Z4TA 1YZ3A 3HDQA 4G3XA 3RK0A 1G8MA 3PJFA 4HAUA 1O77A 2R6GA 1AURA 4DJTA 1N6IA 1QB8A 1ZK2A 3GPDG 3UAOA 2PUBA 4EHNA 1VLZA 1G16A 3FR8A 4ROTA 4WLUA 2EF0A 2A3RA 2QRJA 3JRXA 2HU5A 3QLEA 1GGMA 2W6JD 1VBNA 2CLEB 2HRBA 4HO1X 1T2AA 4IGAA 3K70C 1IN6A 1ZQ9A 2CDCA 2GJ8A 5KTRA 3OU2A 4Q3KA 3ZK7A 2WQ6A 5JWHA 1IBCA 3ASYA 3NW9A 2OBLA 4FIDA 3A27A 1T24A 2Q2NA 3TNJA 1ZRNA 2L2QA 4DXDA 4PWZA 1JQJC 2FFHA 1U8XX 3GUVA 1E6EA 3IULA 3RT9A 2R6ZA 3ZCTA 4DJDC 4RJTA 1RVV1 5BN1A 1RPZA 3MIZA 2NUBA 5ALFA 5EE3A 2YQ5A 2VI5A 3FSEA 1WSAA 1N6NA 5LYJB 4LQLA 1PG2A 4MQFB 3FCAA 1B6TA 4L50A 4B8ZA 1CUYA 4ME6A 2WYIA 2WVHA 3GFGA 5C51B 3BGOS 2HBRA 4L57A 4QU0A 5LQSA 1GYPA 3CTMA 3WLKX 2JLUA 1NW9B 3WLNA 1ZVMA 1A3CA 2OXEA 2C2GA 1B2RA 2VPWA 5B64A 2ZJOA 4Y2VA 3K1TA 4UEQA 1CUBA 1D4OA 2FQXA 1YB5A 2Q3JA 4MWTA 3VVLA 4Z53A 4Q7LA 1KZ9A 4CF4A 2XGOA 1DHTA 1T8SA 5CVTA 1ODLA 4G86A 4F9EA 5MGBA 2A5YB 2FMFA 4IV0A 5DHUA 4ZRNA 4JHXA 3W5DA 5H3HA 3W34A 3WO1A 1Z4NA 3EVFA 1BVYF 1JMYA 2N47A 4MYHA 4UQOA 2M32A 3OX2A 1V41E 3FGZA 5G1OA 4NWIA 4F2GA 3DOIA 3PV0A 5JCZA 1ESZA 1YAJA 3HV0A 3I8SA 3L4BC 1ZM4A 2YOHA 2Z98A 3IUMA 4G26A 3UBMA 1SHZA 1XDGA 5JZ9A 1I3LA 1R5OA 1OXMA 3KKOA 2X3YA 2NO7A 3OQHA 4I8IA 1AT1A 1SBYA 1F4VA 1UFQA 1YUNA 3EVAA 2KBEA 5DW3A 3G7NA 4EQ6A 4ES6A 2D5BA 4MX8A 1UDXA 1FQOA 2R8XA 2XXAB 1POWA 2YNMC 3AWIA 3MAJA 4MQMA 3UJNA 3K6SA 4OTZA 2V0GA 1VHQA 1NJ5A 2JHPA 2LPMA 1R12A 4EPTA 1KFCB 2NOAA 5IZCC 3IR7A 1KDPA 1TA0A 3O47A 4EUEA 5LSAA 3LUJA 5F3RA 4EI8A 2RCYA 4MS3B 1T6BY 1EHYA 3P4YA 3M3PA 5KDLA 3PE3A 1HV8A 1PGNA 1P1FA 2BRUC 4Q9JA 3WMEA 5KNCD 4BYGA 1QZZA 4W5TA 1ISFA 3CLSC 1Y98A 4D9CA 3SYKA 1T5DX 3EUAA 4G0XA 4NL4H 1NBMA 1NQXA 1QIIA 3Q12A 5K3FB 3QI2A 1KXZA 2QOEA 4HDKA 1IXKA 1M0EA 4NS4A 5K0BA 2X8AA 3DEZA 3BB1A 3KTAA 1CJVC 5LXTB 5K1ZA 4ZZ0A 5CB0A 5HJ5A 1P19A 4DIMA 3WG9A 1TMGE 2IHNA 1T4CB 3M0EA 1N57A 2V9CA 2ZULA 5DCYA 2VK1A 2C58A 3HL4A 5IM4F 3DOJA 3PEYA 5JR3A 4MHSA 3T0FA 3QEOA 3GDGA 1SHUX 1O4WA 2VJAA 4CEJA 1Z6XA 3TW6A 5JC1A 4XIYA 7ABPA 1R15A 1QIDA 4DR2B 2JGRA 1ECCA 1P17A 3AVWA 1L1RA 3IMKA 4UPVA 5C1OA 5FTLA 4LJSA 4P0PB 4KDCA 1DTWA 1GPNA 3C4QA 2JLYA 2ACVA 4NCHA 2IOQA 2V7VA 4LOLA 5KTPA 1B43A 3I6YA 3OLXA 3OC0A 4FWTA 1JQEA 4MQLA 3CZPA 2BKXA 3HCWA 1BDJA 1FUKA 1FNMA 1OXUA 1XN4A 1OV6A 1N1EA 1O96A 1YR2A 3W2GA 1FSPA 1EX7A 1HFEL 3EMBA 5ER6A 1R6BX 2X1LA 1J0AA 3T9BA 2GNPA 3RHZA 1R4MB 2GCNA 5K0GA 3N7UA 4MRRA 3GEPA 5KSPA 5JS6A 2O6LA 1I14A 3GJYA 4OHCA 3TCKA 1EB9A 4EB8A 2A6PA 4GWKA 1URPA 1JG6A 1BWPA 3AOEC 3K2BA 4DLPA 2BCJQ 2FZ5A 2JLAA 2Q7OE 5B6JA 1YWGO 2NV2B 1NNEA 2Q3MA 1RMTA 3FYTA 1MOSA 2P68A 4LDPA 5DI3A 2KHZA 2AB0A 4XQ9A 5GZ3A 2ZBVA 4FZVA 4TQAA 1ZH6A 3I9NA 4EHBA 4C22A 3IMFA 2B1QA 2HK8A 3UMVA 1X8KA 1KDZA 1Y82A 4PYIA 8ADHA 4WFKA 1RAFA 1SC4A 2PX2A 3U7FB 1QYIA 1E18A 4BDSA 4F5WA 1WB6A 3MWJA 3PGXA 5CB4F 2A59A 1E4EB 4TYQA 2QVCA 3KKEA 3IEKA 3L7LA 3UHFA 2IUUA 2EX1A 4NEGA 1BFDA 1NUQA 1VJCA 2I2CA 2P2SA 4PIVA 1U9YA 1NBMD 3EXFB 1FFBA 1NULA 1TPYA 1TU3A 1X6VA 4IRMA 4KVAA 4U6QA 4WK0B 1H94A 5I9MA 3F5MA 4N48A 4XQGA 2O2HA 1C14A 2G72A 3E82A 1E2LA 2ZRAA 4YECA 2PGIA 3B6EA 4EUKA 3U5ZB 1E2GA 1AUQA 3VNAA 4QDZA 2VWQA 4GX0A 4A2CA 1YQ9A 1OVGA 1KEVA 2DR3A 4R8KA 3ZXYA 4LJ4A 2OHHA 3ULKA 1ID1A 4MEBA 4P4SA 3TZLA 1E4VA 1IQUA 2H11A 4HYYA 3VTKA 3K70B 5JCOA 1JVBA 4AZVA 1CR6A 4AJJA 4GPD1 4JFRA 3GN1A 4IUYA 5ALYA 2HDWA 1D1PA 1T3ZA 1L1EA 2YC2C 5HIMA 3RIXA 3FTFA 4DAEA 1AZSC 2F67A 4CM9A 3ZJUA 3CEAA 3LOPA 2J3JA 4R1PA 2QXYA 4E03A 4F1WA 5E9QA 4LRQA 2F1OA 3EXG2 3IA2A 2G1UA 4QSHA 3TZCA 3LNTA 1DBQA 4A2QA 1NU8A 1JR6A 1HMYA 4UNNA 1SC1A 1LI5A 1NRIA 2LCQA 3E58A 5ARBA 3NZEA 2B4YA 4I1VA 1FNCA 4YMUA 2DKFA 1R0SA 5D84A 2LDXA 2WRZA 1WQ4A 1XKQA 4K1XA 4II2A 2WIJA 4XYBA 3P9QA 1DIAA 2WABA 4HRAA 3QU2A 5FL7D 1J9GA 2FAXA 3WHPA 3R7FA 3NTVA 1LPSA 3A1EA 5BUCA 4DXAA 1JE1A 1NKSA 3WJ1A 2PWAA 2AWNA 2HWWA 3D5EA 3RS7A 3PCTA 3E8SA 3KOXA 2QN2A 3SJCA 5CA1B 2F9FA 2VOJA 2G7ZA 2FW6A 5G41A 3JWGA 3WYBA 3PNMA 3IUEA 3GEMA 1PVDA 3HZOA 1MHTA 4JUBA 3V00A 4QVIA 4H7EA 1NU6A 2WUWE 3SC2B 4D9NA 1RJDA 3DCNA 4P7FA 3H17A 5AKLA 3FHTA 3OCYA 1M0TA 2NQTA 3RUAA 4ZT7A 3QOXA 3QP9A 3QBEA 5JQGB 2PANA 3BFVA 3FHCB 1P1HA 2IEGA 1V2GA 4O4JF 4X85A 1RBYA 1FS4A 1R50A 3OX4A 3VDNB 4WESA 3PKZA 4MRVA 5A0FA 2QENA 5JHHB 1GAWA 4YP9A 3O8OA 3RIHA 4JBXA 3M33A 4OVKA 1C8LA 2PKXA 3RM3A 4EMBA 4L1KA 2VBIA 2WM9B 1GDTA 4I4CA 3RVPA 5KWIA 2ZEJA 4GYKA 2QJRA 1S8FA 2SBTA 2YXPX 3OPYB 3H1FA 4CQMB 4R8LA 5D7NA 3F6RA 5JD4A 3W2FA 2CLIB 3OCZA 3EFEA 5AT1A 1HT3A 9ABPA 3QX7A 1AQIA 3CW2A 4UXIA 2FR1A 4ALJA 1QHHB 2VDMB 3QRWA 2G28A 4JMPA 2FX5A 3I5AA 2D2EA 3KLPX 2XDAA 4K8OA 5HMLA 2FRDA 1NQ5A 1C1HA 1CDEA 1QZ3A 2K2QB 4L08A 3GP8A 1T3TA 5EKDA 4ETNA 1DRKA 3KG2A 3QEKA 4YCCA 1CSEE 3EC1A 3PHBE 4MZXA 1V6AA 4DV7B 1G4UR 3DYBA 3WFZA 3ABIA 4PTLA 5CURA 1RYDA 2Q6VA 1N2ZA 2VHWA 3BMXA 3QIAA 5FFNA 4DIFA 3U4MA 4G2TA 1DZ3A 4XSHA 4XWOA 3GLHA 1OHHD 4D42A 4RD3A 1R9NA 1P6QA 1P29A 1XVAA 5LP6B 2OCBA 1BXRA 3H6HA 3O95A 4JWKA 4DYVA 3U7JA 2VXOA 3AJ9A 4UUQA 2J3DA 3A6LA 3ZGLA 1MD9A 5ALNA 5EIEA 1EK0A 2ZYVX 3DKPA 2OCLA 3QXGA 3SX0A 5KYYB 4A3SA 3GVHA 4DLKA 3PNSA 4RFSA 3U7RA 4DIUA 1XMXA 1XNGA 2FSIA 3RU3A 4LJKA 4PGGA 4YROA 1GR0A 1U7PA 4HMOA 3JVEA 3OZCA 3FWYA 3AF6A 3PLAE 5AHRA 2D3WA 2R84A 3HDVA 1RWKA 2BW0A 4DDHA 2QMOA 1Q91A 5KTNA 1P72A 4JSYA 4A92A 1I24A 1JZSA 3D8TA 4BX3A 2VP2A 1ZSNA 1SA0B 4UUNA 4FYKA 4Z7QB 3Q6NA 2GJ9A 4GD3Q 3VAYA 4BVEA 5G4KB 5KU1A 1EFRA 1EPUA 1THZA 4B43A 1LI7A 1VXOA 1KK0A 1MNQA 3NWEA 4OFXA 4DDVA 1IPHA 3ETHA 5HOQA 4MK4A 2J30A 1NPTO 3P96A 3LDAA 3FWKA 1G5FA 4WL0A 2VT3A 4HFJA 3WTBA 3ZCUA 4Q4HB 3A4LA 4H60A 1EVQA 4RY0A 2XDYA 1E1QD 2H3EA 1BU8A 3RBXA 3NTUA 1USUA 2NUPA 2OZPA 3AESB 3MQ2A 4ALNA 1J49A 3IUPA 4KYVA 2B99A 5E6SB 3VR2A 4DG5A 1YACA 4LOIA 5IFLA 4AFNA 3R6GA 1NLMA 3WL6A 3HRKA 4XWKA 4UFNA 5G0VA 1UZUA 1X94A 1L7BA 1YQEA 3FRIA 3PICA 4FEAA 4MA4A 5JCJD 5TJHA 4ZCTA 4EG8A 3E5HA 3IB6A 5YASA 4CG3A 4BGUA 2HBZA 3SICE 1PV2A 3IEMA 4JT9A 3VQTA 1KNXA 1P4GA 1G17A 3VUFA 3AONB 2PY6A 1CJSA 4YCDA 3SOPA 4AUKA 2PT7A 3FUVA 3D81A 3HDHA 4XUCA 3WXMA 2Q1TA 4AZTA 2C57A 3E7PA 3BEOA 3HCRA 4HK4A 1NYLA 2X0NA 2IXBA 2YHBA 3HUTA 1Z29A 3TKYA 2X9LA 4RMGA 2AG1A 3IUJA 3K2EA 4LSWA 5HK9A 1KBQA 4NX2A 2HTEA 2YWHA 1F0NA 5TE9A 4KGDA 2IUTA 1HOTA 3L06A 3UFXA 2VUSA 4OYLA 2AG8A 4GUDA 4RDCA 5LA6F 2I7TA 4EMUA 2LBPA 4GXNA 2GUGA 2JIOA 2XNDD 3CF0A 5G02A 3RDPA 1SUEA 5K8JB 2F90A 3GUCA 1TF2A 4GYYA 1KJQA 4NDNE 1W36D 1FVOA 3C6MA 1M7BA 3HYRA 3I05A 1EJBA 4KUGA 4OL0A 2O7VA 5EHIA 1M6WA 5CAEA 3QZUA 3S2ZA 2JFPA 5CA1A 2WUFA 1UWCA 1SQSA 2JCBA 2WTMA 5LBTA 1MRNA 3LT0A 4QSMA 1UPBA 3OFJA 4TXLA 4RK0A 2ZPTX 1NXTA 5KAPA 3IR6A 4TL6A 4WNAA 3CU5A 4W99A 5DSZA 2UZIR 4P35A 1RW4A 3TL6A 5KWEA 2QTVB 3KQTA 4U6SA 4E33A 5ES3A 1X42A 4P98A 3I9V6 1JLMA 4IDGA 1BX1A 2C9BA 3HFJA 8ABPA 5U4XA 3WLIA 3EVGA 5FX2A 1HLFA 1XLWA 2BFPA 1A50B 5HHTA 5C2JB 1MO5A 4DMMA 4UNPA 4BVLA 1XTRA 3RI3A 3RBZA 5CLJA 2LIPA 4RIHA 4TLDA 4QOIA 3NJRA 2XUPA 1DOZA 4DQLA 1RTTA 2N1MA 4KJXA 4NDAA 4UVIA 2NO0A 1S5PA 2FG6C 3ORQA 3WJAA 1L4LA 1PDVA 1QUFA 1Z5NA 2PVCA 3PHIA 5CVDA 1OWLA 4KU4A 3TX6A 1QDUA 5HUHA 4DV6B 3ADPA 1IFXA 3A3OA 1NY6A 3BWBA 1EVYA 1MXFA 2F3SA 1E9DA 3CA8A 2QSUA 5LL6P 2P3SA 4KN8A 4NFLA 1BEUB 3X0DA 1FFYA 1ZVKA 3SYTA 3W0LB 3KD2A 3KJQA 4PU0A 1OIXA 4D3ZA 3VKHA 1D04A 2CKDA 3PNPA 4H27A 1IHUA 1N3BA 1AV7A 1T0IA 4RL6A 4F71A 4UVEA 3KQWA 5ILQA 1NONA 3CKMA 4DEXA 1D2AA 5AXBA 4AKSA 2PXHA 1F2TA 1P33A 4WCDA 1IN1A 5HKKA 4H1WA 4N0PA 3WLJA 4Q3EA 1N7GA 2PGXA 3RT7A 3ONEA 5FTKA 1KDRA 5E6UA 1KMQA 3LK7A 5UKDA 2HSZA 5ALZA 4RMJA 4EM6A 3AKCA 1LH0A 1NBHA 3IIMA 3Q11A 2ZWOA 2EEPA 5EN4A 3FTPA 4HDQB 4O2BF 1L4BA 4WUTA 3X1WA 5KYWB 4KH1A 3FPJA 2BBOA 1CR4A 2B8EA 3KLOA 3VU8A 1ZAYA 2V7QA 3LUAA 2HSDA 4ZOEA 2IYXA 3FNHA 4ARIA 4IUCS 5JNWA 1U5BA 1AHPA 2OO7A 2CXTA 3ER9A 3C7KA 2PNFA 4ZYTA 5JT1A 2BGGA 3RREA 3ERCA 5TNXA 1U7ZA 1SCKA 1R2QA 2CVOA 4JVNA 1W1UA 1ZYUA 3IT0A 5J5AA 2CJXA 1O1YA 3ZWYA 1NG1A 5CA0A 4E09A 4L15A 5C5IA 5EMMA 3W9YA 1MABB 3KXPA 2E48A 3FNRA 1M72A 3DLPX 4HPWA 5TB5A 2YYYA 3X1YA 4TTIA 4O4LB 1D0VA 4GYJA 5CH5A 1A88A 5AVOA 2I4OA 4HNVA 1BA2A 3RHFA 3RV4A 2XDQB 2MU1A 3LUDA 4Q9AA 1N25A 3O38A 4BV3A 5EEGA 2OMKA 2Q4OA 3G1WA 4UFOA 1IEWA 3PEEA 3S1SA 2ODTX 4M89A 3T3MB 2KB0A 3AEQA 2VQSA 2AG0A 1FP2A 1Z5UA 3KE8A 3LUGA 4P82A 3U0VA 2OVBA 3GGSA 3C5WP 4RTMA 2WM3A 3FCEA 4DFDA 4QULA 3BGIA 5JXWA 5J2TA 2BMWA 2CVFA 3BGVA 3LL4A 4PG5A 1AE1A 2DTXA 2ZI4A 3JASA 3WK6A 4GLJA 2C92A 1W4CA 3UG6A 3DZGA 1A72A 1MLDA 4G1BA 2GM4A 1R88A 3OCVA 3SQDA 1YZFA 3ESYA 3KYIB 4IMJB 1RRMA 4A5OA 2F1HA 2R9VA 4R51A 4O3MA 5EFZA 4FOOA 3U13A 3RFTA 4DBLE 3X43A 3LPAA 4D8VA 1L2TA 5I47A 4WE3A 3VKGA 3OD1A 5PGMA 1O95A 3CN9A 4HDSA 3IURA 4KSBA 1Z4MA 4M1WA 4UPDA 3K0KA 1N0VC 3E1SA 2PSEA 4AJNA 1DAEA 1RQRA 3G2NA 4GM1A 1IVYA 4C5AA 3IJ5A 1SD2A 1JXAA 1LBHA 1OAAA 3RRFA 5F33A 4EJ6A 3JQEA 621PA 4BV8A 2Z6AA 3MK31 3KELA 1YXMA 2AX4A 2O14A 3OIWA 4PE5B 1KMNA 1PSWA 4DB2A 1HEIA 1SHKA 2H07A 2WD7A 3DUFB 3B7PA 3EGEA 4CMIB 1U02A 5HCIA 1HDEA 1T3GA 2PH3A 5LB2A 3AB7A 2NP6A 5AD1A 4IF6A 3RSFA 3TLEA 3C2QA 1O08A 3DL4A 3DR5A 4BYMA 4J0JA 4RHUA 2RHDA 3NTQA 1MPXA 2N42A 1M2JA 1RYZA 2E6KA 2Z9BA 3OQPA 4IINA 4MMXB 5FO0A 4I81A 4CT5A 3K1ZA 3TD2A 4MUAA 5AXAA 4CE6A 1ZUWA 1L7OA 2R47A 4JJIA 5FBRB 3IALA 4H4CA 1QZUA 1YJXA 2CXUA 5C81A 2O8DA 4P86A 1H85A 4UHHA 2C4KA 3WLPA 3S2IA 1P0MA 2W2PA 1D6JA 1D07A 4J49A 1IIRA 2ZJ2A 1XX6A 1ORTA 1YJAA 2A1IA 1XTQA 6AT1A 1KJNA 4YHBA 3MINB 3B53X 3CBQA 2GCOB 3Q0EA 3R6DA 4Q5IA 1Z2AA 1ZHOA 6LDHA 4G9BA 1VRCA 4IJKA 1X86B 3EVZA 1TT7A 3RYIA 4DKXA 1JJFA 1XMIA 5LDDC 4RVHA 4IIJB 4IHAA 4KL8S 3D7LA 1IRIA 2JI7A 1PQ4A 2PX4A 2GSDA 3R3ZA 4N5HX 4IDEA 1ZMOA 3WR5A