4ZI2A

Bart-like domain of bartl1/ccdc104 in complex with arl3fl bound to gppnhp in p21 21 21
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
185
structure length
185
Chain Sequence
LLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRSYFENTDILIYVIDSADRKRFEETGQELTELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKKLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Interaction of CCDC104/BARTL1 with Arl3 and Implications for Ciliary Function.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords ADP-ribosylation factor-like protein 3
total genus 69
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4zi2A00
2ZJZA 4QL3A 1T4GA 4TL6A 5CK4A 3T15A 1WF3A 4P31A 2WVJA 2J41A 1KO5A 3EARA 3OEED 4HUQB 1QHHB 4I1UA 5TMPA 1U81A 3SYNA 1SVSA 1HT2E 5CB6A 5HZKA 2CNWD 2B7BA 1AA9A 1S4QA 2QTHA 1ZNYA 3MG9A 1G7CA 1NP6A 4KITB 3L0OA 3U44A 3AKDA 3EASA 1HY3A 3EPHA 5H1YA 4XD7D 1O3YA 2ZE7A 1GRRA 1EFRA 1EGAA 1RIFA 3HU2A 1LF5A 2E87A 2C04A 3B5JA 4F93B 1KI6B 3OFNA 5FTKA 4HAUA 5EP1A 5DHFA 5E7JA 4YXWD 3BGWA 4HLUA 4LJ8A 3V00A 4P0TA 5KSZA 1E69A 1UKVY 2REBA 3R20A 2P0EA 2OCPA 3IDQA 3IKJA 1S0UA 1VYTA 2DFKB 4FI3C 1LV7A 3I3SR 4LPKA 2VHUA 2O8CB 2ZITA 1XD2A 2JLQA 1NN1A 1M7BA 2NPIA 5FUVA 3U3KA 3KQNA 5BN4A 1W36C 1NL3A 4US1R 2XTNA 1UDXA 1QVAA 4B33A 2D06A 2QL6A 4HSEA 4UXHA 1W48A 5B2ZA 4D0NA 3M1IA 5JECA 2DFTA 3WMEA 4XWKA 1JB1A 1R5BA 1E94E 2HXYA 3GLHA 2WWFA 4WXRA 1R0XA 1KMHA 4DUGD 1MV5A 3LX8A 3TAUA 4HB4A 3QE0A 1NMZA 3ZD7A 5EE5B 3CX6A 3D8BA 2GBLA 5J47A 3ZZTA 4MUAA 1ZIOA 1UKZA 1E2EA 1Q20A 3K0SA 5L3VA 1VG1A 4H9GA 4URXR 4UJ5A 4U5XA 2HT1A 1BMFD 3IGFA 3K1JA 4C9BA 3Q5DA 1WA5A 4KLNA 3KUCA 4RZXA 4NCNA 4DIEA 2WPDD 4O2LA 2V9PA 2DFLA 2UZIR 4L4UA 3BH7A 4A9AA 3H0KA 1TQDA 5KPDA 1QDEA 1ZIPA 2D3WA 3Q7PA 4TL7A 3OIUA 2ZI4A 2CXXA 3P4YA 3CW2A 2WJGA 3DOFA 1QHNA 1G7RA 3VKGA 1KSGA 1G7SA 2BOVA 4XVUA 1ZUIA 3AV0B 1Y63A 3EAQA 1XZPA 1YZKA 4TTRA 1I4DD 4XWAA 4C0BA 1US8B 3QKRA 4ACAA 3DOEA 4DCSA 1OXSC 2E1RA 1T91A 2IW3A 2F9MA 2QN6A 3O8RA 1W4CA 1V5WA 2H8KA 5CB8A 1QRAA 4HLUC 2O8DB 4MKFA 2WWHA 3THXB 1Z83A 1N6KA 4BE7B 5LBIA 4E5UA 2X77A 1OT3A 2NPFA 1E2PA 2W6JD 1OF1A 1G7TA 3EZ6A 3QJYA 3ZGXA 4HATA 5FBRB 4C0KA 4PSKA 2CE7A 1E98A 2A5YB 4E07A 1NBME 1NKSA 3Q8XB 1NIPA 4IOJA 1UJ2A 1YHNA 4QBHA 4EAQA 2ZE6A 4I99A 4W7SA 4QC2A 1FNNA 1HE1C 2VP4A 1E9FA 1F6BA 2JJ2D 4A2PA 2AKAB 4NP6A 4EPTA 3THWA 2CCJA 3NBXX 2QAJA 1H8EA 1E2GA 4DDWA 1XD8A 4BQSA 5KU1A 3CF2A 3SYKA 4PAOA 3LQRA 3U5ZB 2JIZA 1Q12A 4Z51A 2IT1A 5HKKA 2CVHA 3ZS9A 1XP8A 2OFWA 4MRPA 3BWDD 3GFOA 1N6NA 4G5OA 1J2JA 1CJTC 1QHYA 3EZ7A 2ZUCA 2PBRA 4LYJA 2RGNA 2ZI7A 1Z2AA 4EFLA 4C2UA 4HDQB 4QNMA 5SZIA 2A7QA 4CEJA 1IBRA 3B13B 2VBCA 4CZ2A 1E2MA 3CPHA 2XSZD 3QKTA 2WWYA 3FHCB 1GSIA 1PJRA 1AS0A 1E1QA 4ZCMA 3AVTA 1M8PA 3NG1A 1MO5A 3UANA 1EWRA 1R7RA 3EC2A 5D3MB 3P20A 2Q3HA 4XH9B 4FW9A 2IS6A 1UBEA 2V55B 2OG2A 5IHPA 1G3QA 1W36B 4G0NA 4PQFA 2YKGA 1OLOA 5HKKD 1DG3A 4BFUA 5GJBA 4CEIA 3BRWD 2BMEA 4PZYA 1NKTA 1X8JA 3PEUA 3VR2A 5FUXA 2F43A 3I4LA 4KVGA 2CL7X 2EQBA 3L82B 2P67A 2Z4RA 2RGBA 2ZRDA 1SXJD 3DZDA 1R6BX 5J4VA 2G0TA 3B7GA 2H7VA 2ZE5A 3H2YA 3KTAB 4DLRA 2ZETA 4AI6A 1IXRC 1FNMA 1XXHE 3NC1C 4BFWA 1U8YA 1KKLA 1EX7A 1KO1A 3TSWA 2VHCA 1U0HC 1S3SA 4BFVA 1UAAA 1S1MA 1N5LA 1NLYA 2D62A 3IHWA 4B43A 4TYNA 3PEYA 3HWSA 2D7CA 3M0EA 1PLKA 4XD7A 1L2TA 5FTNA 5CK5A 4YONB 1F48A 4PC1A 4OK3A 2R62A 2IYZA 2RH5A 4IVRA 2ZEJA 1BIFA 5AUNB 2PJRA 2V54A 1O87A 4URYR 1T8TA 3TVDA 3BH6A 2QRZA 3GEHA 1B0UA 1CP2A 4DWJA 1WQ1R 2OE2A 5G41A 1GRQA 1F2TA 1OXXK 4PPGA 1A2BA 1ZBDA 5KO2A 5F9FA 4BZQA 4DC9A 2ZRFA 4R71A 4GL2A 4TWZA 5KOYA 2XXAA 4FCWA 1YR7A 1E2LA 1FL9A 4KI0A 1XMIA 3EC1A 2P65A 5DLQC 2H1LA 1G6OA 2QG6A 4BFYA 4B76A 5C4MA 1VG8A 2J0UB 5JWRA 4MUBA 3N2IA 3U3OA 2FFHA 2DCUA 4LCBA 1E2QA 3CX8A 2QGZA 1KI3A 3P4XA 1T9HA 1VHLA 2ERXA 1K6MA 4CW7A 5FOXA 5KPJA 1ZD9A 4FIDA 3EWAA 1P6XA 3LA6A 1MRSA 4KCGA 3L8ZA 1Q1QA 3VX4A 4NCJA 2J87A 3GFTA 5BWMA 1JPNA 3DPUA 1FMJA 1GKIA 3TQCA 5FPHA 1E1RD 2LWIA 4KBGA 3GLGB 3UMRA 2ZRIA 2ZSFA 2ZJ8A 4NCIA 3F3YA 2OEPA 3QIAA 4UNNA 2XZPA 4TSFD 3CRVA 2ATXA 1GITA 5LDDC 2A5FA 3N70A 4C4PA 3G5UA 2VPPA 5FBLB 3AGQA 4QFMA 3MWLA 3CKLA 4US2R 1Q0UA 4QJ5A 2J0UA 2N1BA 3W6NA 1IOZA 3GJXC 4B47A 1G16A 2QMEA 4TL8A 3KQKA 2IS4A 3ONWA 1H8ED 1C1YA 3ADKA 2JGNA 2XEXA 3PVSA 4LPSA 1P9RA 4TMKA 2F55A 4QGGA 3QF7A 4TT3D 3B1ZA 2QMUA 2VP0A 3RSOA 2Q9BA 3LQQA 1YZTA 3AVQA 2J9RA 3Q5EA 3KJGA 5BN3A 1X8KA 2QEQA 5DIFA 2C95A 3A1TA 1NY6A 2GHIA 4MKHA 3WRYC 4QXAA 3U7GA 1H65A 3B1WA 2ZR0A 3W3ZB 3EPKA 1GOTA 5B57C 3KQLA 2KSQA 5BXQC 2NMVA 1XTKA 1IAQA 1Z0KA 3VAAA 1DELA 3HJNA 4DLSA 4FMCF 1ZUHA 2W83A 1KYIA 4QBGB 4L9SA 4ZKEA 1SKQA 4B3FX 3A1SA 4RD2A 4P3YA 2B6HA 3OF5A 4PAMA 5LB2A 4JLPA 2Q0HA 2YC4C 3LW8A 4LDJA 5H8WA 5EXTA 4DEYA 4C7OB 2A9KA 5CIWA 4K46A 3SJZA 1Q57A 2O8DA 4ZCIA 3D3QA 3WYFA 3PFIA 5CLLA 4DCUA 1DVRA 1ZMXA 2VSOA 1R5OA 3ZQ6A 4AKGA 4BFSA 4LHZA 2R6AA 4DCVA 4DDUA 1JJ7A 3O8BA 3VTKA 3THWB 3QBVA 3KXKA 3W6OA 3AVOA 4ZI3A 2EFCB 2YWFA 4II7A 1QF9A 2J1LA 5H68A 4NPHA 1VKJA 3GD7A 3T35A 4CIDA 2Z43A 2A3RA 1H8HA 2GRJA 4M9QA 3QENA 1XD9A 1Z29A 2OXCA 1JBKA 1RVDA 2RMKA 2WV9A 3I73A 5A0FA 1JEDA 2YOFA 4NYJR 2WSSA 2R9VA 4EPVA 2IEZA 2C5LA 3CNLA 3PIRA 4E22A 2ONKA 2R65A 3GLIE 1AIPA 1G18A 1I2MA 1F60A 3B1VA 3U60B 1NVXQ 4KLZA 1K8RA 4Q18A 2P2LA 4QGHA 5AK0A 1UF9A 4BGDA 2GAAA 2AXNA 5HPYB 3QOFA 3U44B 121PA 2HV8A 4KFTA 1KMQA 1JR6A 2QY9A 1Z3IX 4LWZA 5DI3A 3KB2A 5KDLA 4Q9KA 1KMHB 4DIDA 5FBVB 3A1UA 3ADBA 2FSHA 4A8JA 4A15A 4MYCA 1C9KA 4LHXA 1EWQA 1P75A 4KODA 1KSHA 4L16A 2UZ3A 3EIEA 3MWJA 4HEJA 3A58B 3FTQA 2WAYA 4M1TA 1SVWA 2DWOA 2J3EA 3VQTA 5JI3E 1TEVA 4Q66C 2V1UA 4DJTA 1IN4A 4NYJQ 3TNFA 4BLQA 2PLFA 4B2PA 4W9MC 5EQTA 1MO3A 2AR7A 4F4CA 4PPNA 4US0R 3OE7A 2QORA 4DUGA 2PH1A 4DSOA 4I1OA 3UK6A 4DLUA 3U7HB 5BN5A 1WE2A 1NG1A 1G5PA 4WZAE 2H16A 3FMFA 821PA 2HLDA 2GF9A 5IK2D 1Z08A 5JJLA 4BUJA 4YMTA 3FMIA 1SVIA 3REFA 1Q44A 4PHFA 4RZUA 4ZO4A 3LRPA 3I62A 3EA5A 1RFLA 5AJZA 4BRUA 2QBYA 2JLZA 3CR7A 3A8TA 4JT4A 2FEMA 2WTUA 2ZRJA 2O8BA 1XMSA 2J7PD 3ZVRA 1IQPA 1Z6AA 2Q6TA 4Q1DA 2GVZC 4LY6A 1NN0A 3LBHA 1CR0A 1N3BA 2R6CA 3MJHA 4URUR 4XWOA 1GM5A 1Z0DA 2VHJA 3SEAA 5EJEA 2O8CA 3OIWA 1MKYA 3CZPA 4MITA 4LI0A 5J4HA 3GJ7A 2ZRAA 4ASUD 2FSFA 3OAAA 4Q1AA 1EFRD 1HQYE 2O8FA 2P6NA 5SZKB 3T06B 3D6TB 1U0JA 1GKYA 4DZZA 1K5DA 1ZINA 2AFHE 3Q72A 5L3QA 4PHHA 1P2SA 1WXQA 2DY1A 1XCGB 1DBSA 2C98A 1BH2A 2ZXUA 2RB4A 1NMXA 2JLVA 3NTUA 3B6EA 3CF6R 1E9RA 5B30A 5J4YA 4PHGA 2RGXA 3AVXA 5J5CA 1CJKC 4EPRA 2MSEB 4TYYA 5LD2C 4C0SA 1W7AA 3B60A 2W6IA 3P26A 2OLKA 4EJSA 2PEZA 2QZ4A 3L43A 4LHWA 1KZGB 4TTQA 3PUYA 5AJWA 1G20E 3B2EA 3AQ4A 1BYIA 1OIXA 2NZJA 2OSBA 1DAGA 1KK1A 2GXQA 3NXSA 5G53C 1KDTA 1NMYA 4KYIB 4Z8XA 1PZNA 2CDNA 3SE0A 1OB5A 4LOAA 4B3GA 2OFXA 1Q1ZA 3R7WB 1OFTA 4QGFA 5JJKA 2F3TA 4IKEA 2CHGA 3JVVA 3LX5A 2UVQA 1W0JD 4A82A 2XGJA 5KUTA 1IY2A 4Q4AB 3LD9A 2JJ1D 2ZAOA 4B34A 2ZRPA 2WIBA 1N6PA 4WOPA 3TJZA 3UKDA 4CDGA 3MAAC 2W0SA 4MKIA 1Z28A 1X8LA 4WW0A 4DT1B 5AUOB 2RHMA 2VSXA 2IYSA 1GL7A 4P4UA 3A4LA 1U0LA 4LBWA 2C9OA 1B23P 1HV8A 1TUEA 3SU8A 3TKLA 5TXGA 1FPMA 1G5RA 2V7QD 1QVRA 2ZSEA 1IONA 3GP8A 4JSTA 1MABA 3VNUA 2OLJA 4ASUA 1Z6XA 3FKQA 4OL0A 2OILA 2CJWA 4NBSA 3GJ3A 1GTVA 3FPAA 3IILA 2BKEA 2QM7A 1G5TA 4G5SA 4B48A 3ND8A 4TN1A 5JHHB 1Q22A 1OW3B 4RVCA 4G5RA 4CEJB 2G1KA 3BFXA 1OH5A 3F5FA 5FI1B 4IVPA 5JRJA 2K5UA 1KY3A 2F6RA 3ZIAD 2Q9CA 4MRRA 1N5JA 4YC7A 2BCJQ 1FX0A 4CRWB 1VCOA 1S2MA 1M7GA 2IF0A 2GJAA 1UBGA 2OHFA 2XAUA 4OKSA 3LVRE 2NO0A 3RNLA 2IYLD 3WNBA 1GIAA 1NBMA 2JDID 1ZAKA 1FUUA 521PA 2CCGA 1IM2A 1SULA 4UNRA 3RDPA 3AF0A 2V4ZA 3BB4A 4QOSA 4ZCLA 4IOMA 5JMTA 4JJKA 2H18A 2ZUBA 4MKGA 2NQ2C 4LV5B 2KI5A 1K5GA 1GL6A 5CYPA 4DLWA 3SJCA 1HH4A 1W0KD 1IN7A 1XU4A 1R0YA 2Q3MA 3TR0A 1P5ZB 2BDTA 4BZXA 2EYUA 4PPQA 3QKUA 3SFZA 2A78A 3P32A 2IXGA 1JAHA 1XBTA 3NEYA 4LJ9A 1P72A 4N0DA 3B9PA 4MDFA 3C4JA 3NBYC 4PR0A 2J59A 3L0SA 5JHGB 2QSYA 5DISB 3X1DA 3FMPB 1KNQA 1GP2A 4Q21A 1XRJA 2FF7A 3M4YA 3CB4A 2G9NA 4YMUA 4ZKDA 2YC2C 1D6JA 3OEEA 1OFHA 3TW8B 2ZJBA 3PITA 4PX9A 3I1FA 1LY1A 5A5GA 2ZANA 5FPTA 3OIVA 5KYKA 1HUQA 3NC0C 1SXJE 4JIMA 4JBWA 2G77B 2O0JA 2JLUA 3HPQA 3L8YA 3PEVA 4Q5IA 2XZLA 1HYQA 2FH5B 5CLQA 1FQJA 1Y3AA 3TW4A 4PO1A 2V8OA 1QHIA 2Z5FA 2WHXA 2PZGA 3MUFA 5KNCA 3AM1A 1AGPA 5FTLA 4NTZA 5FOWA 2P5TB 3RHFA 3UXMA 3SOPA 1OV4A 1VMAA 2LKCA 1KK3A 2O0KA 4OQMA 4QBFA 1WMSA 3UG7A 4Q1FA 1Z8FA 2GZHA 4A36A 1IN8A 3ZVMA 1U9IC 1S1CA 2I4IA 3H84A 5JWOA 2OBNA 2WWXA 5L3QB 1Q3TA 5GJCA 2FMXA 3Q85A 1A7JA 5LB4A 2JA1A 4M1YA 4EQ6B 3CR8A 3R9XA 2JASA 3THOA 1XXHA 1TNDA 5HE8A 3GJ5A 2GJSA 1ZC4A 4B3DA 5F9HA 2JJ2A 1S9DA 2V1XA 4DB2A 4OHVA 4Z1MD 2ZRKA 4PC3A 3W3AA 3KDSE 3IO5A 3TVTA 3Q7QA 1EFHA 1JI0A 1ZD1A 2VP5A 2R2AA 4P4SA 1ZCBA 3K0CA 1ODFA 1U99A 1E0AA 5DN6A 3D31A 4XSGA 3K09A 3QXHA 4QHSA 4Q7LA 3LWNA 2Q3FA 5JCZA 1P2TA 2PJZA 3NBFA 4OJKA 1YRAA 1FQKA 2PLRA 2BBOA 3KKMA 1ZUNB 1MR3F 2C77A 2HUPA 2Z4SA 8OHMA 5IT5A 4Y0AA 5JEDA 4X8OA 5DHAA 3T34A 4HB2A 4W5JA 2QBYB 2QT0A 5DH9A 1LNZA 4OHZA 4TQ9A 2JJ8A 3T1QA 1HTWA 1M74A 1EXMA 1DARA 1D2NA 2QTVB 3HU1A 4M22A 3TUZC 4DRZA 3T1VA 3CIOA 1G8HA 1CEEA 4TT3A 3LFUA 1ZVQA 3EZ2A 1MH1A 3SYLA 3AUXA 1XTIA 3SBDA 5C2JB 1G21E 3OZXA 1YQTA 2OBMA 3AF1A 3FB4A 4V0NA 4DLTA 3CLVA 3EX7C 3QBTA 3CH4B 4AC9A 2BBTA 2KBFA 2IK8A 2I1QA 1J8YF 2BHRA 1ETUA 1TF7A 2D74A 2ODWA 4M0LA 3RABA 4Q7MB 2OZEA 5C18A 3FDIA 4N3NA 1Z22A 4IXMA 1LB1B 3PUWA 3C7KA 2VF8A 3CBQA 3RC8A 4G1UC 4V0MA 3IHLA 2ATVA 1UEJA 3AF4A 1QG2A 3ZVNA 1CJMA 2NGRA 1Z6TA 3C8UA 4LYHA 4D81A 2GCPA 2PT7A 2QPAA 2GBLC 2IXFA 3DMNA 1FTSA 1KK0A 4Q4LA 3RRYA 1R4AA 5JLJA 3AB3A 3KJEA 4NONA 3TK1A 3EIQA 2O8EA 4XJXA 1XTRA 3BERA 3L0PA 4H1VA 3SZRA 1KI7A 1SGWA 3BBPA 3GJ0A 5G40A 1E2NA 3WBKA 4Q7KA 3SJBA 3R9IA 1W0KA 3DVLA 2J0VA 2EU8A 2ZU6A 2UKDA 2IC5A 3KKOA 2DBYA 3GLHB 2BKUA 3LNCA 1PV4A 2BIFA 4NKRA 4AYXA 4TLDA 2BCGY 3QXSA 2GJ8A 4MH0R 4KSBA 2AWOA 3GMTA 4GRAA 1QHHA 3J81k 2KE5A 4D82A 5ELXA 3ASZA 3BC1A 1CR2A 2QI9C 1G8PA 2ZRNA 3NIBA 2G88A 1EK0A 4TMTA 4B6EA 3ETLA 2ZVPX 2YWEA 4TSFA 4HAWA 2ECKA 2RGAA 4MGIR 2CCKA 4PSAA 4D26A 2D2EA 5FTMA 2E9SA 2ORWA 2O52A 5HCIA 4M1SA 5CJPA 5EE1A 2QA5A 3GLIB 3U7FB 4KO8A 2DWPA 2JATA 2QMOA 4LZZA 4Q47A 1AGRA 3CH5A 3MCAA 3U3RA 2GA8A 4PZLA 2QP3A 1E4VA 4QKQA 1XTSA 2GCNA 4M2LA 2J0SA 4JLOA 1U8ZA 1XXHB 4JJZA 2HCBA 2IHYA 2BMFA 4HB3A 2PMKA 2ZJ5A 1RKBA 1I4TD 3LBIA 4LBVA 1TUIA 5HCNA 1JR3D 4Q4AA 2A5DA 3T61A 1DPFA 1T0HB 1E2JA 3EW9A 4FN5A 4JYCA 4GOKA 3CWQA 3TUIC 2XX3A 4TYQA 4PTLA 1E9EA 3SQWA 3WMGA 4JLVA 1NN5A 2HYDA 1R0WA 1UEIA 1XCPA 1Z6GA 3JZMA 5G3YA 4Q4HA 3ZQJA 3GLIA 3UMSA 3RWMB 4F91B 2WJJA 3PUVA 5BYJA 2FSIA 4TZ6A 4JSYA 3KFVA 1VPLA 4QGAA 2OT3B 4JL5A 4BWYA 3AVWA 2PCJA 1YZQA 3VR3A 3NH6A 2WWGA 2WWIA 3WRXC 2VLIA 1P9WA 5E7MA 4A6PA 1KHTA 2DB3A 4L9WA 3PXGA 2QAGC 2VSFA 4UKDA 1II8B 1NLFA 2C99A 2IEYA 2IXEA 2BEJA 2A5JA 1G9XA 1Z0AA 3WY9A 5HZHA 3EPJA 4YDHB 2JLXA 1GDDA 1GWNA 3WXMA 2VP6A 3PENA 3A36A 4JLKA 5FUWA 2B21A 3NWJA 4RD0A 4BRWA 1RRFA 3VX3A 4ERNA 4DVGA 2WOJA 2OBLA 3AKCA 1XF9A 4OQXA 3A1WA 2X8AA 5F3WB 3WHKA 2YINC 5EXSA 2RCNA 1TL7C 3NHAA 3BORA 5JS7A 1UPTA 5GJVC 2XNSA 1E4YA 4B35A 1G19A 1GRNA 4L15A 2OV2A 1YE8A 2VEDA 2OESA 2BBWA 2GEVA 1ZM3A 2J45A 1MRNA 2AL7A 4CVNA 2ZE8A 3KJHA 4IDNA 1YZNA 1FP7A 1LFDB 2ZRGA 1JAIA 4IVQA 4FCVA 4PQRA 4ZDWA 3V4RA 4HYYA 1E2IA 3CUEF 4D0LB 4NYIQ 4BLSA 1R0ZA 4BECA 4M1WA 1CS4C 1FOEB 2FU5C 2IYYA 3H86A 4PANA 2TMKA 2D7DA 4WXPA 3KTAA 1LS1A 5HTKA 2XJ4A 1COWD 2W0MA 3IQXA 1FMLA 2D2FA 3QEOA 3OHMA 4PFSA 4Q7JB 1KZ7B 2CLSA 5EUQB 1CR4A 4KVAA 1D9ZA 1EFCA 3ICQB 5JSZB 2NO9A 1X1SA 3VMFA 1I4LD 1RRPA 4C0QC 1J7KA 2YNMA 3AVUA 3FGNA 1NRJB 1NVVQ 1N0WA 2R6GA 4ESHA 5SZJA 4JL8A 4KJZA 5EXPA 3OEHA 4HB0A 3LY5A 1IY0A 4IHQA 4JKYA 1E9SA 2VYFA 5F2EA 3KXLA 3DKPA 2REOA 5H70A 3K0AB 5JZVA 3LXRA 4EUNA 3C5HA 5B58C 1Z0JA 4DCNA 2XITA 1AJEA 2OUKA 1S3GA 1S96A 5FFMA 2JLYA 4JLAA 1SVKA 1PLLA 3PUXA 2RAPA 1IJFA 1VHTA 2AWNA 5FOUA 1XCMA 4TYWA 5EZ5A 4HAXA 1W46A 4DCTA 4EPXA 1XEXA 4Q9HA 1Q1BA 1P2UA 4DLYA 5UKDA 1T5IA 1Z5ZA 3ZS8A 2J5XA 5DI3B 4TLEA 5EP4A 3OAAD 4NU0A 3W8NA 3X1WA 2FFAA 4NMMA 2DWQA 1XJQA 3MLEA 1TADA 5FOVA 3WP1B 4UNPA 3VU9A 3DM5A 1VCNA 3EWSA 5GJWC 5DI9A 4IEEA 1NVWQ 1F2TB 2WJHA 3DL0A 1P61B 3FKSA 1KOFA 4M9SA 4FWIB 1HEIA 1UFQA 5E95A 1SHKA 3ICEA 1U8AA 3SC3A 2QQEA 1SZPA 1QBKC 2KBEA 4JYBA 1E9DA 1W2HA 3K9NA 4RSGA 4B44A 3CWZA 3VR6A 1NN3A 4RZ2A 1JXOA 2OCYC 3GQBA 4XVQA 2O5VA 5EE3A 3TBKA 1YR6A 2XZOA 1KNXA 1CRPA 1TPZA 3HP1A 3QKSB 2VL7A 2BEKA 1KSFX 2L0XA 1KGDA 3S1AA 1A1VA 2CHQA 2ZRCA 4TL9A 1DO0A 1E6CA 3QVUA 2FFQA 4QJ4A 4BLRA 1HQCA 3AF3A 2ZJOA 3F0TA 4F4IA 4D80A 2A30A 4XIGS 2Q9AA 4D2IA 1JEEA 1VG9B 2QSZA 1JR3E 3WNCA 3BB3A 1A2KC 5AJVB 4IEIA 2AHOA 4GZMA 4D4KA 2ZR7A 4MRVA 1E0KA 3W9YA 4KHZA 1XB2A 1AS2A 3LBNA 3IPYA 1FX0B 1GAJA 1XEXB 4GOXA 2QGNA 4G01B 4D6PA 3RWOA 1SKYE 2OO7A 1ANKA 1HA3A 3HYRA 1ZP6A 4E03A 3RS3A 2ZIAA 3SN6A 3I5XA 1ZU4A 3WNDA 2DFNA 4B73A 4DEXA 4JBYA 4DLZA 3ZLJA 2G6BA 5EE9A 4J0QA 1W5SA 4MRNA 1II0A 1Z6YA 1OSNA 4Q00A 4XTCS 4OHXA 4C3ZA 5JJIA 2X2EA 3U7EB 3AVYA 3LLUA 2JJ1A 4DSUA 5L8VA 3TR5A 1CIPA 1JXMA 2ZR9A 3FFBA 5KSOA 1ZCAA 3BJIC 4LC0A 4B3XA 2RGGA 3NKVA 1P7CA 4IDPA 2IYRA 2QROA 2ZI3A 2AD5A 2WMNB 2ZS8A 4I1SA 2V3CC 2BM1A 4D0GA 4OQLA 4TLBA 5SZHB 3X1YA 1NVVR 4AY2A 3OEHD 1QHGA 4TMXA 4WBSA 1SHZA 1TTTA 2RKOA 3NDBB 5J40A 1PLJA 3FMOB 4BASA 4XSHA 2YYZA 4YXWA 4P33A 4D4JA 4PC7A 3ADCA 2QU8A 5CDFE 1OPXA 2H57A 2IA5A 4PO8A 3OESA 1E79D 5AJYA 5L3SB 3QSYA 1L7VC 1A82A 1AQYA 1ONBA 1OHHA 1TQ4A 4ON9A 1DS6A 5E7IA 4A0RA 1G3IA 1LW7A 3M6AA 4KFRA 4A4DA 2YHSA 2IWRA 3MWYW 3QXCA 1T3SA 2NZ8A 4Y0VA 4X8MA 1OXVA 5KHOC 2MSDB 3RS2A 1I2DA 2WKQA 3LLMA 5CYOA 5IF9A 1ZJ6A 3KQHA 4GP6A 1Q21A 3MGCA 1Z07A 5FL7D 1Z2CA 3K70C 2J46A 5TY0A 4KFUA 3AGPA 2XJ9A 1XDBA 3V4FA 2PX3A 3QG5A 3WP0A 5BW8A 4RKFA 2ANBA 4ESVA 4EDHA 1ZM7A 1XNJA 2R6DA 3LO5A 4F7WA 2RGNC 4KXFB 2C96A 1ZM9A 4LRWA 2JIZD 4MYHA 2YZ2A 1UKEA 2HDNB 1YZUA 3CNNA 4HLDA 2GEUA 2B8WA 1CBUA 3GEIA 2BV3A 3BFVA 4A2WA 3ZD6A 5GADl 3GPLA 4Z1MA 2NO7A 1NG9A 4JMPA 2FPLA 1IJEA 4JLDA 1D9XA 3C16C 2FGJA 1PUJA 4NHOA 5DYIA 2F9LA 4AD8A 2FG5A 4R9UC 4R7ZA 2J7PA 2FJUA 1PVOA 1GVNB 3NHBA 1MT0A 2RGDA 1Z47A 4G5GA 4NZYA 4YMVA 2NOAA 1JPJA 2FEOA 4B2LA 1F3OA 3P1JA 621PA 4HZUA 1WBBA 3SI7A 1E79A 2PEYA 2ZI6A 5TB5A 2ZRMA 1KY2A 2XNDD 2ZYWX 3MWKA 3QPVA 4K81B 1XX6A 1X3SA 1P60A 3AUYA 1DOAA 1MABB 1RW4A 4ZI2A 4M9ZA 2CLDX 3BIFA 5AUPB 3SHFA 1NSFA 2KWIA 4LYAA 5EP3A 3E5HA 1ESMA 2G1JA 3B78A 3QVVA 1N25A 1GNQA 1KDRA 4CEHA 4ZIRB 3O8CA 2C03A 1EX6A 2CL0X 4JZKA 1XTJA 1YU9A 1VCIA 3VR1A 1GNRA 3K53A 2FPKA 1W49A 2WICA 4LJ4A 1NNEA 4RFSA 4XVRA 2R8RA 1CLUA 2BM0A 3EA0A 4XTRA 2XTZA 3B85A 1JR3A 2OXRA 2ZVQX 4C0LA 3TSOA 4P32A 4DB4A 4RD3A 4URWR 2ZREA 3TAHA 3U3MA 3GLGE 4IDHA 2ZRBA 4LBYA 2BBSA 1XJCA 4A0GA 3EZ9A 4FINA 5BYKA 2CJWB 4LBZA 4NCKA 4M1MA 5DNYB 4RFVA 2ZYUX 2YV5A 5D3MA 5GVRA 3SJAA 2NG1A 4D4LA 3VNVA 2CVFA 2IYQA 2HCJB 4JVMA 1VYVA 5DE3A 4A8JC 4TTPA 4UJ3A 2X2FA 2JLSA 2PT5A 1AQUA 1ZM4A 4GZLA 3THYB 3WHLA 3AVVA 1AN0A 1D2MA 3QQ5A 1TU3A 1HE8B 4HAVA 4B74A 1G291 3OE7D 4WZBE 1N0UA 2VRWA 1E0JA 2F1JA 3CNOA 3I92A 4EFNA 4A0HA 3RRZA 2PX0A 2IYVA 3QPUA 4DSTA 1N6HA 2IHBA 4M53A 2O8EB 1N5IA 3NH9A 1RPZA 3Q3JB 4M8NE 1JQLB 2AD1A 2ZI9A 1FUKA 3REGA 3CRRA 2QUZA 1RJ9B 2ZSBA 4DKXA 2QENA 3PQCA 5FOSA 1OH7A 2WIAA 1FTNA 3DZ8A 2G0NA 3U3JA 1KKMA 2GF0A 1GFIA 1W47A 3AKEA 4EJSB 1D5CA 1MO4A 1DAIA 2R44A 5TDHA 4UNSA 5DYGA 3IO3A 3DDCA 3B1XA 4OJQA 1G3MA 3ND9A 3DM9B 5D3QA 4IOKA 4BZPA 4OHYA 1LTQA 1KTVA 4A92A 1HT1E 5F98A 1DEKA 3GJ8A 3B9QA 2ZYTX 1KJYA 2AFIE 1LVGA 2CMKA 4JLBA 4MGZR 4PO9A 1KDOA 3AH8A 4QHTA 3SQXA 3LVQE 1CF4A 2BWJA 4KSCA 2IUSA 2H92A 1G3RA 3HPRA 1OH8A 5B64A 4AG5A 1KI8A 1E2HA 4FXPA 4F4JA 2IF2A 3DKVA 2ZYVX 1R8QA 1VYUA 3W90A 1KI6A 4GP7A 5EXXA 3EPLA 4PC2A 4HDCA 2IS1A 3RS4A 4X8LA 4LYFA 2GWHA 3ZH9B 2CNWA 2FWRA 4LGMA 3NDPA 2FPMA 4LJAA 1E32A 4LHYA 5EE0A 2PMDA 1D8TA 2GETA 4B71A 3TLXA 2AN9A 2EYQA 2WM9B 2ZS7A 1R10A 3O47A 1E1QD 2GTPA 2XOKD 3IIKA 2EFDB 2OCBA 4X8HA 3FOZA 3SFVA 2XSZA 3UWOA 3IQWA 3N2EA 4MGKR 4HUQA 3EZFA 4A2QA 1VG0B 2PCLA 4HZUB 2FOLA 4QRHA 2O8BB 1E99A 4B32A 2WBLC 3K09C 2ZPTX 1G8GA 1G4AE 1KJWA 4OQNA 4Q01A 2W6ID 1BOFA 3HR7A 1J70A 1GUAA 2ZJYA 3DMDA 3UPUA 1M7HA 1OXUA 3ZDQA 4JT2A 3AKYA 1MOZA 3GEEA 1Z06A 2CEAA 2C2HA 1CTQA 2V6JA 3KKNA 3OIYA 4LUCA 3RAPR 1QG4A 2F43B 1KJZA 1FW6A 2ODBA 2ODEA 1DO2A 1QHSA 3K9GA 4NYIR 1ELOA 2G83A 3BAFA 3FVQA 2GXAA 4AYTA 3R9WA 2OM2A 4LJYA 5LD2B 4AIIA 1YZGA 721PA 3QF4B 3HYTA 4FCTA 2IYTA 3B8HA 3GCGA 1II8A 1ZM2A 4Q9JA 3W8RA 4CT4B 2GESA 2IBMA 2GCOB 3AP3A 1EESA 2XOKA 1FZQA 1XFAA 4LSGA 2ZAMA 3GJ4A 1RC8A 3RRNA 1RRGA 1T0JB 3KUDA 5GVSA 1OHHD 1M6NA 1NLZA 4IJMA 3W5JA 3VKHA 2BJWA 1D2EA 2GAOA 3BS4A 4LC1A 3I32A 5JBQA 3CF0A 1IHUA 3LW7A 4JVNA 2QNRA 5BQ5A 2EFGA 2VHQA 2FN4A 1M1YE 4DDVA 1F2UB 4BLOA 1CKEA 3FFAA 5L3SA 4C30A 1R8SA 1E2KA 2JEOA 1CULC 1QHXA 1UDWA 4Q1CA 4ARZB 3ZVLA 3C41J 2CBZA 5FTJA 2ERYA 5AJXA 5M04A 2GVDC 4BPBA 1N6IA 5A4JA 4EQ6A 2F1RA 3QXXA 1NVUQ 4PC6A 1JECA 4CGZA 2HXSA 2QPTA 1JJVA 2LKDA 3IEUA 4PAQA 3I8XA 2QT1A 5C46F 1JNYA 4QHYA 4RZ3A 3UMFA 4M21A 4W5HA 1IXSB 1W2GA 2C78A 2W00A 1UADA 3U4QA 2PZEA 4G5QA 4ZDIA 5CIQA 4URVR 3LXXA 2AK3A 1TF5A 4U02A 3LH5A 4I1VA 4OK6A 2QP9X 1Q1EA 4KAXA 3A1VA 5E4FA 2HF8A 4P4TA 1G3UA 4FMCB 3KFXA 4POAA 2ONJA 3IBGA 1KAOA 2Y8EA 4WA7A 2YOGA 1E1RA 4YDSA 4K8OA 3A6PC 2WJYA 2P6RA 3CRMA 2IUTA 5TV2A 3QPWA 4B75A 2NIPA 4DT1A 2VTKA 2C9YA 4M4SA 3SBEA 4OHWA 1BKDR 2H5EA 1ZC3A 3KXIA 2IYUA 4Z54A 1G17A 2XTMA 2FZ4A 3MRSA 3ZYCA 1DG1G 2WKRA 4BEBA 4B3BA 4NH0A 2YVUA 3SNHA 2QQ0A 2BMJA 3F8TA 2HLDD 3GLFB 4S35A 1YJ5A 3FHOA 1WDTA 2GXSA 3VR4A 4GMXA 2JAQA 4D4MA 4PZZA 4EPWA 2ZJ2A 4WIAA 2KJQA 3QKSA 4IXNA 3S1AB 3P27A 3KJIA 4EPYA 2ZRHA 3GJ6A 4UQOA 4QM6A 4Q19A 3RYTC 1WRBA 4FMDF 4GT1A 1IXZA 3PV0A 3KL4A 1NJGA 2EFHB 4N1AA 1FFHA 3AP2A 2IS2A 1SVMA 1L4UA 1S8FA 1U98A 2QRNA 3KZ1E 2W58A 2ZU0C 3LDAA 4YMSA 2JLRA 5AWFC 1RE0A 2QE7D 1RJ9A 3KX2A 3QXJA 4HDOB 2WJIA 3AVPA 2MMCA 3IIJA 4ITRC 2Z6VA 1R5NA 2W2TA 2GJKA 4WVFA 2GK7A 2FX3A 3I61A 4R98A 4TMWA 1COWA 2EFEB 5FOTA 1Q3HA 2DYKA 4ILEA 4ARZA 2GZAA 3R7WA 2D4HA 2CE2X 2XXAB 1KO7A 2WWWA 2ZSDA 3CZQA 4RKEA 2B92A 2PL3A 4B3CA 3LAWA 2FFBA 3VFDA 4GPTA 1TX4B 3K70D 5J4KA 2FA9A 4KBFA 5IDVA 4DLVA 5C1BA 3MJRA 4EKDA 4C2TA 4KFSA 2R6FA 1TQ2A 1P3JA 3A37A 5CJ2A 4HLQB 3O8DA 2XNDA 4LK2A 3K0AA 2F1IA 3VHXA 4B2IA 1E3MA 4OK5A 4JS0A 5CDFA 1NSTA 1NF3A 3SR0A 3VKWA 1G6HA 2MSCB 3VU9B 1AM4D 1DAEA 2RGEA 3RS7A 1IN6A 3CRW1 1DAKA 2XB4A 4IRUB 4EFMA 3D7MA 2B8TA 2VQSA 1ZU5A 4TMZA 1WCV1 4ACBA 4JBXA 4BFTA 1XEWY 3THXA 4ZPXA 2QM8A 3X1ZA 5K8IA 3WBJA 1G1MA 3CRQA 4TLAA 4HZIA 4DHEA 4JL6A 2I3BA 2SHKA 4EIWA 2HJGA 2RGCA 3T5DA 4GDFA 3UATA 1QZXA 2F7SA 5C4GB 3CM0A 4OI2A 1YKSA 2P6UA 4YQFA 2N42A 2W6JA 3IEVA 5K8TA 3R8FA 1DAMA 2MMGA 2VP9A 1W1WA 1OFUX 1P73A 1XMJA 3SDZA 4JLNA 2OAP1 1TMKA 3RSLA 1AZTA 1XPUA 2GCOA 2FZLA 1G8FA 1GILA 1SXJB 2QPOA 4O0MA 1W44A 4QBIA 3IBYA 2YJTD 3QF4A 4W5WA 1M34E 3GLFE 2ORVA 3TMKA 1XTQA 4AKIA 5JSZA 1G8YA 2EWWA 4YLGA 4O3MA 2AK2A 1CXZA 2O0HA 4Q03A 4MA4A 2KB0A 3CO5A 1W4RA 3T1OA 4U7DA 3KQUA 1NY5A 4JLMA 4M9XA 5IK2A 4DLXA 1T5LA 3JVUA 1ZNWA 5DO9A 2CL6X 1E2DA 3CONA 1LF0A 2EVWX 3BD9A 3I8SA 2BMDA 4DDTA 3U6BA 2GJ9A 5DN6D 1KIMA 3C14C 3BXZA 3U6KA 1F2UA 2CK3A 5HR5A 1SVLA 1DAHA 1ZNZA 4CT5A 4JKIA 2P3SA 4V0OA 2AX4A 4UXIA 1XEFA 5KNBA 4TQUS 3QG1A 1XWIA 3BK7A 2ZUDA 4Q4HB 3G82C 1J8MF 4N0EA 4A0FA 3RS5A 1XJ0A 2G3YA 3NEJA 1XD2B 4IDOA 3RVBA 4OQFA 1TU4A 2C9CA 4M1OA 3I5YA 3QNUA 1W4BA 2QTFA 2J0QA 2ZI5A 1XMVA 1XEWX 1YVDA 1DADA 2X19A 4D25A 4IFBA 5FPSA 1NBMD 2JDIA 1OIWA 3GFPA 1DAFA 1YZLA 4CEHB 4Q9LA 4PSVA 3THYA 1LS6A 2YWHA 1SXJA 5JS8A 4Q4JA 2OAQ1 2OFOA 1CU1A 1E9CA 2NO1A 1OKKA 3Q9LA 2VP2A 2V6IA 1KI2A 2CK3D 3SS8A 4OYHA 3FYHA 2EW1A 2IYXA 4RD6A 2PZFA 3U2QA 5JWHA 5E3HA 2CHVA 1N5KA 4BLPA 1C4OA 1R2QA 3EG5A 1ZD8A 3NVAA 1N6RA 4ABYA 1MO6A 4GNKA 2F3RA 1UBCA 1KO4A 1AZSC 1BYUA 4XOIA 4RJLA 1TF2A 1KO8A 5JI2E 2X1VA 4MYTA 4MRSA 1UBFA 3HR8A 3LV8A 4C7OA 3ZZUA 1CJVC 4RD4A 5K8LA 4LJ7A 1X86B 2ORIA 2VO1A 2ANCA 4AKHA 1W4AA 3FKSD 1WB9A 1VIYA 4CYMA 1CR1A 3K8YA 4GBMA 4LJ5A 1AS3A 4LX0A 1ESNA 2GILA 4YMWA 1U9IA 2FNAA 5TARA 3X1XA 1G64A 2YWGA 3BE4A 2VA8A 1US8A 3CPEA 3QKRB 4O25A 4V0ME 4WZ6A 5ANRB 4QG7A 5KSPA 3V9PA 4C0JA 2LCFA 4IDQA 4EJSC 4I4LA 3RC3A 1J99A 4RCYA 3HDTA 1YR8A 4LV8B 2IL1A 3AF2A 3EIHA 4NDZA 2FDCA 1AK2A 2QAGB 1P4SA 1G4UR 1JQJC 4C0AC 1W36D 2HF9A 4I81A 1A5TA 1VIAA 3TSZA 4U00A 2GZDA 2ZJAA 2NO6A 2GEDA 3SHWA 1E2FA 4F38A 1L8QA 3KB1A 3K0CC 3TGPA 5FR2A 4AG6A 2A5GA 1UM8A 1VDZA 1CJUC 1DTSA 1W0JA 3C15C 2IYWA 3CPJB 4KYUA 1P62B 2AKYA 3TIFA 4GOJA 4OBEA 4UNQA 5LPNA 1OJLA 2ZQ5A 1IY1A 4Q02A 1JALA 1RYFA 2DPXA 2WJVA 4RFSB 3WYAA 1YR9A 1L4YA 2C8VA 3ECCA 2JLWA 5CM9C 3EXAA 4HAZA 1U94A 1BS1A 1SXJC 1ZRHA 2WSMA 3B1YA 4OI4A 1OB2A 3MSXA 2QMHA 5FUYA 2IUUA 4GMDA 3UIEA 2HJVA 4ZIRA 1T3HA 2B7CA 4L8GA 4R2HA 2W2XA 4QNRA 1EG7A 2DR3A 4MYUA 2GKSA 1XZQA 4HUTA 1AKEA 221PA 5EZ6B 3BH0A 5TVKA 4PPFA 4HAYA 1II9A 3RANA 5KDOA 1N6LA 3KKQA 5JEEA 1GKUB 5KDDA 3E2IA 1FP6A 3MMPA 1OKKD 3AP1A 4TMVA 1GL9B 5DSZA 1NIJA 3QI2A 4RCZA 2WPDA 3K70B 4MGYR 1M2OB 1RRCA 5FL7A 3H1TA 4QJ3A 2OCAA 4NCHA 4NE2A 4O2RA 1Z0IA 2BC9A 2VHTA 3PUZA 4LJ6A 1E9BA 1J90A 4AKEA 4FMDB 4AURA 2ODNA 1KSJA 1RYHA 1SQ5A 3QUSA 4V02A 2Q21A 2RHDA 2A2ZA 4BFXA 1WBDA 4R2IA 1E96A 4RY2A 4AYWA 2VIIA 3I72A 2O8FB 3L2OB 5KNDA 1OE0A 2ZM5A 1G41A 3T12A 2DHRA 2ZS9A 2GNOA 2YOHA 1SKYB 3VR5A 1NJFA 2ZSAA 2GK6A 1BMFA 4NL4H 3MFYA 1ZW6A 2WKPA 5G3ZA 2Z83A 3ADDA 4V0KA 3A4NA 1T6NA 3W5IA 3GLGA 1TAGA 3PG5A 1OIVA 5CM8B 4IW3B 3QEJA 4TLCA 4LV6A 5JCPA 3ZJYA 2N46A 5KSYA 2WSSD 3VHLB 5J4LA 3R8CA 3C5CA 1OYYA 5AUQA 1OH6A 3RRMA 4P4SB 1VTKA 4PXAA 3PCRB 1S9HA 1F5NA 2GXUA 4ZV4A 1KI1A 4F92B 3WMFA 1H8HD 3U4QB 2WZQA 3K9LA 3KKPA 4JVSB 4L5BA 1KDPA 4WAUA 3GLFA 2AXPA 1VECA 3IIMA 4DXAA 2VF7A 3K0FB 2VH5R 1N0VC 4OI1A 1X1RA 3G0HA 2IX3A 4GI7A 3ASYA 4Q9IA 1WP9A 3B82A 3ZZ0A 3RS0A 1IN5A 4KV9A 5KTYA 2REXB 3TE6A 2QE7A 3A4MA 2ASEA 4H1UA 4B6FA 1TEXA 1GNPA 1KI4A 6Q21A 4CEIB 4TYPA 1KI9A 3UG6A 2WAXA 5DGXA 4V03A 3TUJC 4MQBA 2FGKA 5FBWB 3T1TA 4G3XA 3FWYA 4ZDKA 2FE4A 1U2RA 5FR1A 4PQYA 4E09A 3PR1A 3OFND 1CRQA 3IPXA 4OI0A 2XB2A 2FV8A 1AKYA 4Q1BA 4HLCA 4Q48A 5FPKA 3FHTA 4CF7A 3BB1A 5FL3A 2BVNA 1TQ6A 1Z63A 1KAGA 1SVOA 1Z0FA 3N5CA 1HURA 4AWXA 2V7QA 2QAGA 4A8JB 3TRFA 3E70C 2EWVA 4IFEA 1P2VA 1P9NA 1KK2A 1V43A 5FI0B 5P21A 3JZAA 4S2EA 4MDEA 3PJRA 1UKYA 2P5SA 4M1KA 4Q4JB 4AK9A 2IWHA 1T3LA 4GFDA 3X2SA 1T8UA 3DO6A 2H17A 4FD2A 4Q1EA 3W6PA 2FSGA 1E0SA 1PUIA 4JLJA 3ZIAA 3L0IB 4BLTA 1XPRA 5HE9A 5K8UA 3BOSA 2HYIC 1EFTA 2CLCX 2NTYC 4BFZA 2W2VA 1ZNXA 3H4MA 4DSNA 4DBLC 5AR1A 1RZ3A 2ZTSA 2Z0MA 1X6VA 2ZRLA 3WYGA 3TH5A 4PHTA 5JFGA 3CX7A 4Z8YA 421PA 1N2CE 1E9AA 1GZSA 1U90A 4GSYA 4KU4A 5EUMA 1GG2A 3FE2A 1BO6A 3HU3A 1VCMA 1OYWA 3IUYA 4A1FA 4C0HA 5FH9A 2QP4A 1EFUA 2WOOA 4NYMQ 3BFKA 3TQFA 4NYMR 5FPYA 4QM7A 5EP2A 5L3RA 3U61B 3GLHE 2JCSA 5CITA 4V0LA 2F1HA 2WMOB 3AEZA 3DEFA 4IOLA 1ZYUA 2ZROA 3DHWC 4JVLA 3NBZC 4URZR 2HT6A 1YRBA 4RD1A 5FBQB 3QY0A 2J7KA 4FMBB 4FWTA 4A6XA 1N6OA 3K9HA 4BEJA 3MD0A 4LHVA 3RLFA 3W34A 2BJVA 4TQAA 5JRZA 1OXTA 2HEIA 3E1SA 3K0EA 5IRCD 1XPOA 3PEWA 1DE0A 1OFIA 3UWKA 4ZDJA 3K0FA 4HI0E 3T5GA 1A4RA 1W5TA 2GDJA 1NI3A 2I1VB 4UXJA 4TZ0A
chains in the Genus database with same CATH superfamily
2ZJZA 4BO8A 5CK4A 1AHNA 1JFFA 1WF3A 4P31A 5K0JA 3SX0A 4AU1A 4CQMB 4HNAA 4I1UA 1ZWKA 4UUBA 1U81A 1Z75A 1BC5A 1BX0A 4ZVSA 1SVSA 1BWPA 1E1LA 3GW8A 3IEMA 1NXOA 1ZNYA 3FW1A 2GD6A 2M1ZA 5LNK6 2IHNA 4LG1A 1BJRE 3L7OA 3F73A 2JZOA 3OC0A 3U44A 4XD7D 2SCUA 3HDGA 3N75A 4EUFA 1ZLYA 4N41A 3BMCA 4JI3B 1WD7A 1COZA 3SDSA 2R7NA 2G8NA 5J1SB 1RIFA 3HCFA 3HU2A 3B5JA 3D1VA 4NBTA 4KRXA 1KI6B 2JGJA 2WHQA 3S8EA 4ZYLA 2EZ4A 3JWEA 1WBJB 1TU0A 4XGNA 4PHCA 5E7JA 4YXWD 2R66A 4HLUA 4LJ8A 3ZBTA 4U6NA 3MQ4A 5KSZA 1UKVY 1VFNA 2REBA 4TOIA 3BTSA 4E30A 1LLUA 2OCPA 2P0EA 5CNKA 3M33A 2GBPA 3BMQB 1GPH1 4OJYA 4DA8A 1NYRA 1VYTA 4FI3C 3FPJA 3QJ5A 3W5CA 1W75A 3FPEA 3I3SR 5IAJA 2VHUA 3R09A 4FHFA 5A3SA 3QMWA 2JGRA 2ZITA 3O93A 1NN1A 3OI7A 3PNMA 3RRXA 1PFGA 1YS9A 4CMIB 3DEIA 1FUYB 1QVAA 2FVXA 4EP1A 4I2NA 1RYMA 4LXTA 2QL6A 2Z2YA 4MJXA 3ZHRA 3GLUA 2C88A 2CW5A 2DFTA 4FNMA 4WKCA 4W1RA 1BXRB 1FMTA 1OU0A 4XWKA 4NIMA 1U0RA 4DOMA 2WJAA 3IQZA 2P7IA 4Q6BA 3QWHA 2JFOA 4WXRA 3DB2A 1KMHA 1RD4A 4DUGD 1MV5A 3QFHA 3OLCX 4HB4A 2DVMA 4JJAA 1JL3A 3PS9A 4ZARA 4IDFA 4CFSA 1VDMA 2MWMA 3FWKA 3L7LA 5LDGA 4H0NA 2HPVA 3O7MA 4J1SA 4QYXA 4MQUA 5I7AA 2IHZA 3ZLTA 2O7RA 4MUAA 3D3WB 2O5EA 3NAGA 1Q20A 3K0SA 1R9MA 2Q1XA 4BJ1A 3ZHOA 4HEA1 4E5MA 1UM9A 4CKZA 3D7NA 3UGTA 2GPTA 1ESZA 4C9BA 3BM5A 2ACEA 1WA5A 1N9GA 3WGQA 3PC8C 1JJIA 2PUJA 2WPDD 2IXTA 2R8PA 1MEEA 2D3TA 2V9PA 4JOCA 4K6KA 4R1PA 1GTMA 4RKQA 4WXHA 4B7XA 3NV7A 2BAGA 2DFLA 5IDWA 3GUYA 4PG7A 2R8OA 3BH7A 4BNJA 3FRHA 3F3MA 4IF4A 2D3WA 3Q7PA 4JJFA 4YAEA 2W5UA 4WCFC 1B1AA 3DOFA 4IDDA 3MS7A 2ZP1A 2O7NA 3FNFA 3L6OO 4P34A 4PBSA 4ZQEA 3TZEA 4A8TA 5K03A 5J2UA 3IRVA 1JT9A 3QVMA 3UJ9A 5JAZA 1Y63A 1IE3A 3SZUA 1XZPA 3QK7A 1OXKB 4TTRA 3DZHA 1IM8A 3C3MA 2Q2WA 4KE7A 4C0BA 1BNCA 3PRKE 3OTQA 4EMBA 5MN6A 4C3OB 4INAA 3E9YA 4E3ZA 1OZHA 2KM1A 2RFLA 1U3VA 5CA1B 2H4FA 4OB7A 1HRKA 1A50B 2D1YA 3E9ZA 3EIOA 3LTEA 2AV6A 4KKXB 5B6JA 2O8DB 1K3UB 5E3IA 4XE5A 3H6GA 4ZOLA 3GT3A 5K0EA 3CZ4A 2X77A 3MINA 4XOUA 2IUYA 1AG9A 2WTAA 5SICE 1E2PA 1V2GA 4EUEA 6AT1A 3AESA 3DG9A 2QMQA 3LUHA 1J09A 1XTTA 2GAIA 2WI8A 3RF6A 4BNIA 3CVUA 1OFUA 2PGOA 3VR4H 1U4NA 4E07A 1NBME 5LBUA 2AN1A 5GP1A 4RWEA 1VSUA 3QU5A 1FDRA 3X0DA 4D3ZA 3SJUA 4EAQA 1E63A 2YMMA 4CMHA 2ZE6A 4E2FA 3C24A 1FNNA 1HE1C 1USIA 2JJ2D 3R6DA 4GSLA 4M9UA 2WUWE 4LZJA 5D8DA 3ZH2A 2I76A 5EIAA 1M75A 4I46A 3SXUA 3THWA 1KQPA 4ZOLF 1XD8A 2C2KA 3TLKA 2W2LD 1I2AA 3VR2D 3GA0A 3PRJA 3SE7A 3M6XA 1ECBA 3RS9A 4E7OA 2WT8A 3L0YA 5D6OA 3I45A 3Q8LA 3ZXXA 2CVHA 3ANYB 4D9HA 3SF8A 4X6XA 1E61A 2HHAA 1PYOA 4EF5A 1L7OA 1SVUA 2PA3A 3TINA 2RJNA 4OHPA 2DM6A 3BWDD 2R5WA 3GFOA 2EKDA 1KH3A 4QXQA 4CTNA 4G5OA 3VVCA 4A6DA 2XH8A 1QHYA 4YQEA 5JNRA 4TM8A 3EHDA 2GCEA 2VSNA 4JC5A 3OJEA 2YZMA 1BCRB 2B8JA 4ENTA 5SZIA 1DQSA 2B8NA 2OGWA 2UYGA 2ZYIA 1IBRA 4G8DA 3KOZA 4R0VA 4UE3S 4DR6B 1D4ZA 5KYTA 2EP7A 5CHYA 5DLDA 1QV6A 1H2FA 1ZS9A 1A88A 5DMHA 3UOWA 2IH5A 1UL1X 3WK7A 1PJRA 1WMFA 1KR5A 4DDKA 1E1QA 3O4VA 4C07A 4X66B 1M8PA 1T2AA 1UPUA 5C8ZA 2B8EA 4O4IF 1EWRA 2ZDGA 1Y8AA 3AR8A 4B4VA 1XA0A 1BGXT 3JRXA 1YS2X 2E2WA 3NT5A 4FW9A 4UVIA 1JJFA 2V58A 1UBEA 1V8ZA 2IS6A 5IG2A 4TQGA 3LHSA 5EESA 2X9GA 5DX1A 1H2ZA 5FCDA 2YKGA 4AUMA 1OLOA 1J6UA 2JNWA 2VDKB 4MWGA 4UTOA 3ZEIA 3AQIA 3WGIA 3RGWS 4GU5A 1QQBA 1X8JA 3VR2A 2HQ1A 2JI6A 2F43A 3MZ0A 1IHDA 5FUXA 2B5WA 1G1AA 2HMYB 4BMDA 4MSUA 3T5MA 4GS5A 2PV0A 3P9KA 2WJ6A 1Y7HA 3KBOA 4JFRA 5J4VA 1ZD3A 1TVKB 4J3NA 3T3HA 1ZJZA 1JE0A 1GFWA 1P1RA 1P2DA 2WHEA 1UXKA 2H7VA 4XD2A 3IVAA 4WNAB 2VTBA 2Q5FA 1ULSA 4KEAA 3L6RA 8ABPA 3SLRA 1B8VA 3E9EA 3N87A 4RSMA 1TOAA 2I2AA 4BFWA 2WNSA 1C8KA 3JQFA 1IPFA 4G0QA 4R4JA 1G42A 1KO1A 2P30A 2VHCA 3DP9A 1S3SA 4GDMA 1DX4A 4JUDX 1S1MA 3H4VA 3OZ7A 1WXGA 1N5LA 1N5MA 1QS0A 3F5DA 3IFSA 3P0JA 5FNVB 4TYNA 2DFDA 3W77A 2HDOA 2EJCA 4Y2PA 2EGHA 3DBRB 1GCIA 3F7TA 1F48A 1ISIA 5CX1A 4IVRA 5D51S 2ZEJA 1BIFA 3H8SA 5E38A 2V54A 5AUNB 5JS1A 4UD6A 4URYR 1EP1B 1SQFA 1XZEA 3LKZA 3N58A 3S2SA 1HZZC 1TJNA 4N5NA 1Z73A 2XDQB 2HJ9A 2ACVA 5ECYA 2AFHB 2E89A 1JDNA 4EYKA 1CP3A 2EKLA 3ZTYA 3ORSA 2PR7A 4DLLA 4XVCA 1J33A 2QRLA 5BV2P 2C9ZA 3DMPA 5CCXA 4BZQA 4U7WA 1DTWB 4BNUA 4DC9A 3FPHA 1JS1X 1PG0A 3IPAA 1YR7A 1FL9A 2LD4A 3EC1A 3EF0A 2XRFA 3OZUA 5DLQC 5C4MA 4B76A 4F9EA 3ETNA 1KBQA 1O97D 4QBKA 2ECQA 2FZEA 3BCRA 1NVFA 1V3TA 2FFHA 5LR6A 1Y9EA 1H93A 3AJRA 3KM0A 2VZEA 3MIIA 3TOXA 2E6UX 3LHIA 3P4XA 1RJFA 1ZLXA 1TCBA 4Q3KA 1EE1A 1KDVA 2ERXA 3L7JA 2FQWA 4CW7A 3ZHYA 1ZD9A 2J33A 3JWIA 4FIDA 2FSSA 2IHVA 2R11A 4IHAA 1P6XA 2JFZA 3WLOA 4ENWA 2OCLA 3WZ2A 3KYCB 3LG2A 1PL7A 3F7NA 3VA7A 2J87A 3GFTA 1JPNA 1JA1A 2VKTA 3DPUA 1XGKA 1FMJA 3GPDG 3QX8A 4K05A 3ON5A 4ODIA 2I2BA 1TKRA 3DZBA 5FPHA 1UT5A 2LV8A 2ZRIA 2ZJ8A 4MVJE 3UMRA 4HRAA 1YIDA 2BF4A 1RDFA 5HIJA 3II6X 3CZRA 5ENVA 1J97A 1JIKA 2W4IA 5DHRA 3TAXA 5JFOA 5BMVA 2I67A 3CUUA 3PF9A 3EG9B 2HTFA 5BV7A 1F12A 2HMWA 2XBMA 1A9XA 2OOSA 3O82A 1K08A 1O0CA 4BRSA 3C3PA 4FUTA 5K8JB 3TXAA 3QE9Y 2XQIA 2PKXA 4QQ8A 1WZIA 3IHTA 2N1BA 3K3PA 3D8SA 3NHKA 4NZNA 1RI4A 5JDIA 2QMEA 5U4QA 1ADYA 5AI4A 5GZ3A 1SC1A 3KQKA 3ZGYA 1EG2A 1R18A 4XAQA 1C1YA 2EATA 3ADKA 2M98A 2XEXA 1E62A 1YL6A 3C3BA 4NFHA 5AMXA 3GPBA 1QHEA 3FD8A 4MYSA 3MOSA 4QGGA 2IV2X 3QF7A 2HA5A 1UK8A 4GGPA 3UEOA 1L9XA 1WCIA 1XMXA 3CSDA 3AY6A 3GRAA 2CMGA 3C3JA 3RSOA 2UU9B 4X64B 4BNTA 2QNBA 1I3NA 4LGYA 1SM4A 1OX5A 5BN3A 1KBZA 4FKBA 4MVWA 4UHCA 4GX5A 3PDJA 5IZCA 1TT5A 1HEYA 2JLBA 3TLCA 2C95A 2R4TA 3Q5GA 3IR5A 3AEKB 4Z7NB 2ZR0A 1GOTA 5B57C 2AG5A 5CLJA 1JTEA 1OWLA 4MMZB 4N03A 4JP8A 3VOBA 3JPWA 1EE9A 3ESZA 4XYLA 3HJNA 3TIIA 4DLSA 3ADPA 3K6KA 1C3EA 1QKKA 3NHZA 4FFMA 5A7HA 2Q7DA 2GARA 3E9QA 3QWIA 4ZKEA 5AKKA 1C0EA 1TK9A 1VOTA 3D7LA 3SBOA 4RD2A 1SOWA 4FIZA 4PAMA 1HDXA 2BR5A 4M86A 5LB2A 1ORIA 1NUSA 4JLPA 2XUGA 3KFLA 1N7JA 4FHZA 3SIXA 3VZBA 4DEYA 2XCIA 3OPVA 2QXYA 3MMXA 1GGKA 1JAZA 1NZDA 3BILA 1LVHA 4WFKA 3WYFA 5C3MA 5ADWA 1QPGA 1JH8A 5LZ9A 4ESEA 4BFSA 4H3KB 3IT3A 4MZDA 3AB7A 2R6AA 4DCVA 1E9VA 1HYBA 2PXXA 4DDUA 2EJUA 3VTKA 5B5SA 2FN7A 2ZG6A 3AX6A 4X6YA 1AK9A 3DXXA 5IBCA 1L4FA 1ZL0A 2I4OA 3KXKA 1RS0A 3AVOA 1UMBA 3PUHA 2ZJ7A 3IEXA 4S0XA 5BN4B 1QF9A 2J1LA 2L17A 3WTCA 2FDRA 3UNXA 1N2OA 2ZB4A 4WZBB 4YRRA 6NULA 4LZLA 4W4TA 3T35A 4EG7A 1H8HA 3HQ4O 4WBNF 1QH9A 1Z29A 3DOUA 3IDZA 3MEQA 4RY0A 1RVDA 2RMKA 3KBBA 4AMVA 4C4ZA 4NCAA 3E7FA 4L72A 4HDMA 1JSXA 3OZCA 5EJ6A 4HQFA 1HE3A 3VBEA 1CY7A 2HSDA 1BDHA 3IV7A 3PIRA 5JSHA 3EAFA 2ONKA 3KQSA 3GLIE 2OCGA 2YYSA 2XNCA 4OVKA 4PLFA 2FW8A 3B1VA 1NVXQ 4HDKA 4ZAXA 1RYBA 2HOQA 1XZHA 2BP7A 1K8RA 5AK0A 3KLNA 2D8MA 3WDKA 4ZHSA 2OZVA 3NHYA 4MB0A 3V4PB 4OF4A 2Y6VA 3QOFA 4QVKA 4MS3B 2HV8A 1JTVA 3ZTWA 5ICGA 3RFTA 2Z98A 4BBJA 4KB5A 3VZQA 4DV0B 1Z3IX 4IIYA 1KZYC 2P2CA 2I2CA 3KB2A 5DX0A 3I4CA 2WJZB 4I4TF 4Q9KA 4ZO7A 1E7SA 3MWFA 3NRBA 3O9VA 2FSHA 4ISBA 5HF5A 4A15A 2VKQA 4LDNA 4LHXA 5BQ3A 3NM5A 3S27A 4QUEA 5MGNA 3M6UA 3E9RA 1GGVA 3B6JA 4L16A 2ZUSA 4ZVTA 1ONOA 1I30A 3RG8A 5JY6A 4B74A 2BGWA 3RSGA 2HQSA 2WAYA 5I3CA 3M6FA 5JNLA 1G55A 5GQSA 3DVRX 1B0PA 3VQTA 3U9LA 1TEVA 4Q66C 5E6RB 5A6SA 3TNFA 4BLQA 4P3OA 2ISCA 2BKAA 3QIVA 3S5UA 3L7MA 5EJMA 4W9MC 4QYWA 5EQTA 3DFZA 2YWXA 3NIFB 3BRWA 4ZVVA 5TS3A 2WY2D 4DUGA 1YRWA 1ESDA 3ND7A 4I1OA 5DW3A 5LOVB 1GDTA 5LXTF 4ND3A 3TLZA 1G60A 4BKRA 1UPBA 5BN5A 1WE2A 3O6VA 1G5PA 4QEZA 4WZAE 2H16A 2QIPA 3HZZA 3UAGA 3WBFA 4J6EA 2GF9A 4RE5A 4RZIA 3P96A 1AQ6A 5T4EA 4K88A 4NESA 3FMIA 3F6RA 3N2KB 3OG9A 1MMFB 3V1KA 4ZO4A 1CDOA 2G7MC 3AM4A 4UTPA 3O84A 5B1IA 2EX0A 2K4MA 3O8QB 4GGOA 4BRUA 2WYVA 4TXMA 2JLZA 2DRIA 5FWXA 2CV0A 3GGPA 1Z6QA 3QI7A 4HMOA 3ANMA 2PZKA 3Q88A 4JT4A 3RYHA 2ZRJA 3ZOKA 4AX8A 1JMYA 1RPNA 1LLCA 2ZBFA 3EZYA 2GVZC 2QTTA 1CF2O 5JAIA 2BGRA 1THGA 3K94A 5J2TF 4YREA 2R6CA 3DAYA 4URUR 2UUBB 3GI1A 3KHSA 3PWTA 5ETJA 1E1NA 3OPXA 4F2DA 5EJEA 4TKVB 4MR8A 4Y2UA 1AE1A 4MITA 3O4GA 1XKLA 3OF3A 4F11A 3FFTA 3KOXA 4FHEA 3DGFC 1AZLA 4AF6A 1SBQA 5C81A 4RIGA 3S2ZA 1UT6A 3MILA 1EFRD 2P6NA 1UBJS 5JYCA 2PRJA 4TS1A 3DYBA 4ZYUA 1KIAA 3IP6A 1NVGA 2VAXA 4D3YA 2NUTA 4DZZA 1ZGAA 2AFHE 9LDBA 5AIBA 2TMYA 2DY1A 5JSFA 1JDJA 2GK3A 1SBIA 1UKCA 2PQMA 1K66A 1ODSA 3BG5A 3ZCUA 3S2IA 1G59A 3REQB 4YJ3A 1Q7CA 4LJKA 5F1YA 1CD5A 5B30A 5BY2A 4GX1A 2RGXA 1MX3A 5J5CA 3ZY4A 2MSEB 3EFBA 1HKHA 5DNUA 2ZPUA 5LD2C 1ETHA 1EUCA 2PE5A 1G63A 2W6IA 3GOHA 3P26A 4UCWA 4OV6B 4HFNA 2OLKA 4UAGA 3P45A 4DIOA 3AERA 1G20E 2HWYA 2PMFA 3DDUA 2NZJA 1JLMA 1E77A 2GXQA 3NXSA 5JQGF 4M0UA 1UXOA 1SQ6A 4KQEA 4KYIB 4LEIA 3BHMA 2CDNA 4Z8XA 3WA6A 4RPGA 3TSCA 3SE0A 4G0VA 4HS9A 2OFXA 4RLFA 3PXUA 1DKMA 2F3TA 1U1EA 4GLJA 3S1LA 5I7RA 1RZVA 4YRDA 3VAZA 3FTFA 3F5SA 1SCIA 4M3NA 4LJSA 5FX2A 2XXAA 1W0JD 4RVOA 4A82A 2AJ8A 1N9KA 4NX2A 5KUTA 5TGTA 3KDAA 2B4YA 4IIGA 1N6PA 3GVXA 4I1PA 4CDGA 3TE7A 1LI7A 1L5QA 1B8PA 1SU6A 2JIDA 4DT1B 4GMFA 3ZV6A 1BA3A 1GL7A 2R1ZA 3CLKA 2C07A 3A4LA 4GOOD 2GPAA 4RK7A 4LBWA 2V5AA 1B15A 1I6LA 1HV8A 1YCHA 1B23P 5FNVF 3RU9A 1GPAA 4UM9D 3GH1A 2V7QD 2B0JA 1Z6ZA 2ZSEA 3GQBB 4AO7A 5BUZA 2CWDA 3GP8A 1WCWA 2X5XA 3QGMA 4P3PA 2A0KA 3MPOA 5DX8A 2OLJA 4ASUA 4Q7EA 2UAGA 3FKQA 3HCBA 4IDBA 4V38A 1LU9A 2AW5A 4OHCA 4PNEA 1FVFA 1T3GA 1UBRS 3GIDA 3PEFA 2LCQA 2C20A 5ELMA 4R2JA 2NWQA 2M2IA 1HDIA 1NX6A 1QYRA 3EXIB 4M9CA 2PKWA 3KOUA 1GEEA 4TN1A 3QLUA 4RVCA 5U4XA 4U2KA 1XVUA 2JGEA 1WTCA 4HEQA 1P3Y1 1KWGA 5JRJA 1YV9A 3OPYI 4HNUA 1JHYA 1PHRA 1NR1A 2WDZA 1HL7A 4MW5A 4YCAA 5E8RA 5BVHA 2BCJQ 1DHTA 1FX0A 2EP5A 1KYVA 3CY6A 1S2MA 3ESCA 3LUFA 4H7FA 4CPDA 2X5JO 4TS4A 1C3XA 4LMAA 3UGQA 4HNVA 5E4TA 4PAGA 3SF8B 1O1YA 3C6BA 1FU8A 2G67A 2QN8A 4ZVNA 1I1HA 4HWPA 1V4NA 2GBGA 4L3WA 1EDDA 2OMEA 5E1BA 5E7QA 3RBAA 4AMGA 1G38A 2JFQA 4KPUB 1KAEA 4FT2A 1FUUA 5JXGA 4YA6A 1IM2A 1B26A 3FPBA 2PUDA 2V7XA 3OJXA 4CM8B 3UWSA 1GZ3A 2V4ZA 2ZUUA 4QOSA 4K9KA 4DR7B 1QYXA 2CDBA 2EBHX 2Y1XA 3VHXB 2ZIUB 4R1UA 2GBIA 5LQDA 1QTRA 3NBMA 2J3HA 1QFSA 4QAQA 2FXIA 3FCSB 2Y66A 1TLFA 3A9VA 3CMCO 3CKKA 3NATA 4G5HA 4TWAA 4B6QA 4XWYA 4XIYA 2G76A 1SB9A 1RWKA 2EERA 3V2HA 4AW9A 4DLWA 3A4VA 5CG2A 2XPCA 1Y6JA 4NBRA 4XQEA 1HH4A 5TQ2A 1SAYA 1R0YA 2Q3MA 4TUYF 1DJMA 4HVAA 6ABPA 2GN1A 4TKMA 1QE3A 2BDTA 4BZXA 3W1WA 2QG4A 2EYUA 2DKNA 4NHEA 5C1PA 3QKUA 2V0GA 1YCGA 1A71A 2A78A 5FA8A 1MDBA 1PI3A 4LJ9A 4C4RA 1H5UA 1SEVA 2GLTA 3NEYA 5HX7A 2EAUA 2PZ8A 2LW7A 2WLTA 3B9PA 4I5FA 3RRJA 1H2BA 4GGMX 4OD0A 1Y6FA 3K5PA 5F77A 2YIMA 5SYAA 3IL2A 2HHHB 1SXIA 2IKQA 2XDQA 3FMPB 5LJLA 1GP2A 3PVCA 2FF7A 3WLMA 1TYCA 1TZJA 5LKAA 5DN9A 5IEJA 3ISJA 2YC2C 1D6JA 4F97A 1U11A 4K9RA 1YFLA 4HP8A 1R74A 2VK4A 5LP6A 1U2EA 4PX9A 4WX2B 4BV9A 1ZK4A 1JZTA 1QZZA 1ADGA 1TLLA 3OIVA 4TXLA 3VXKA 5BUCA 5A04A 4QZVA 4H7HA 2G1UA 3PEVA 1AUVA 2FH5B 1FQJA 1S2LA 4ZZIA 2BFPA 4G63A 3Q11A 4B7CA 3QLUC 4HQ0A 2ZBGA 1AGPA 1QUEA 1TKAA 1XTBA 1DV1A 3IS3A 5JY1A 5ALUA 1KK3A 1ZSNA 4OQMA 3CF4A 4DIBA 3V4LA 4QAJA 3UG7A 3FTEA 1EVQA 2XYRA 4A36A 4DQKA 3BQ9A 4KGVA 1WSAA 1MAUA 4CG3A 3ZV4A 2PD3A 2PX8A 2RAFA 3H84A 4A03A 2OBNA 4UDOA 1RI5A 1VHQA 3DTNA 4EQ6B 1X7ZA 4ZGWA 4CIWA 3R9XA 4B4WA 2X7JA 1FSPA 1LSSA 3DKRA 4WDQA 4IQ0A 4G8BA 3T9AA 5F9HA 3HRKA 1XU9A 4LK3A 2CVQA 5CB4B 1RC1A 1S9DA 2V1XA 2M6LA 1WB4A 3GLTA 2O1XA 4AJHA 4G0WA 4DB2A 1H6CA 3HXTA 3Q7QA 3IMEA 3RUCA 1F2DA 1EFHA 4D8VA 1Q0QA 3PFCA 3NETA 3B36A 4P4SA 1LZLA 4RK0A 3PNYA 4ZAVA 3D31A 4XSGA 3JD1A 3GRUA 4MHTA 3WGJA 3I01A 3DD1A 3SIPA 2JFXA 5K0LA 3ETHA 4OL9A 3LT0A 1ES9A 5EHIA 1A96A 1BXZA 1OZ0A 1Y37A 2GFQA 2QN2A 1FQKA 3L1JA 3MOGA 5B4TA 3DA8A 1DRJA 2DPGA 3B2QA 4I7EA 5IT5A 2BEUA 3WSWA 4ZK2A 1PDOA 2RKWA 4BCBA 1P44A 1RAIA 2C00A 2HCTA 3VNBA 3S55A 1W93A 2PY6A 5DM60 1ZN9A 4N7JA 4C89A 4DMFA 1UKBA 5EHNA 4CG1A 1KQ3A 4WOCA 4WGFA 3ZGLA 3OPNA 1D2NA 3KIPA 3BXPA 3TUZC 5KX5B 1VLHA 2PTGA 3ID6C 3T1VA 1W5BA 1J5PA 4FGUA 1G8HA 5BN5B 3W4KA 4CQNA 1CRWG 1EK2A 1ZVQA 3P0EA 2I4RA 2PKQP 3AUXA 3MUNA 4UEQA 3SYLA 4TS9A 3OZXA 3EX7C 4L6AA 2FWMX 4D56A 3Q8MA 1DX6A 1S3FA 2XWBF 2JHPA 2VJPA 2QVCA 3ASUA 2I1QA 2ZB7A 3AWIA 4MQLA 2BHRA 2WT9A 4PXYA 4Q3CA 3RABA 1BX3A 5HIKA 1TQHA 1EE2A 4QX6A 1FYVA 1PW5A 2BKVA 1ZSVA 4D9KA 5B7PA 1OLUB 2ERCA 4QLBA 4OUKX 1PG2A 3C6KA 5D7BA 1E64A 2FPUA 4HRVA 2XYPA 2WRZA 2AH5A 2QJTA 5YASA 3WGHA 4F06A 3IHLA 3RVNA 3S1SA 5JU6A 2Q2QA 4MJ7A 4FPXA 3AF4A 4EZIA 4FKMA 3ZDDA 1X94A 1ZQ9A 3C8UA 2AG8A 3HL0A 4RAQA 4ZO6A 5T4FA 3HUTA 4DV6B 3LCCA 1DRKA 4N5LA 3AY0A 5IJZA 3OU2A 3AB3A 4BVJA 2FHPA 4EI2A 3A9RA 2P9EA 3D64A 3BERA 1E92A 3AONB 3SZRA 3TCXB 3NANA 1LRLA 1SGWA 2QD3A 3DWGA 2OR3A 1CR6A 1OXBB 3BVPA 3KXDA 4J0JA 3LX4A 4Y9UA 1E2NA 5G40A 5A71A 4Q7KA 5CVVA 1PR6A 3WAGA 2A7XA 4FGSA 3NHMA 4F56A 1VGRA 2UKDA 1OLXA 4NJOA 4IDGA 2FE1A 4GSKA 3GLHB 3IAFA 2BKUA 4IILA 5JNWA 3D4LA 4AYXA 1OUMA 4QYMA 4JXXA 3BK1A 2C4TA 1ZXXA 3ZE2B 3ZJTA 2XCOA 2OZPA 4ZOBA 4GHWA 3WWCA 1H0KA 4XLZA 1QHHA 5HFAA 3V9AA 3J81k 2ZTHA 3BC1A 3NIBA 5J23A 2QI9C 1G8PA 3JATB 3MCVA 3N8NA 3W04A 2QUBA 4TMTA 3ETLA 2RC5A 4HAWA 5F1PA 3BT7A 3Q7EA 3S68A 4I5IA 2Q3EA 4LNHA 2E9SA 2EJWA 4PLGA 3ZK8A 1NYTA 4HDSB 5KQPA 2O52A 3L84A 2Q1YA 3EQ7A 5CDTA 5EE1A 1AK1A 2FPGA 4YUXA 3U7FB 3EUEA 4OLHA 3DL2A 2OBYA 2HWXA 4EUKA 1W76A 3TQRA 3VH4A 1AGRA 3MCAA 4PZLA 3D2AA 1ZRNA 4KUHA 3PR3A 4EG8A 4QKQA 2WKSA 4L76A 2UZ1A 3RLIA 3JSAA 3LXMA 2HCBA 2EQ5A 2NXCA 4XUEA 3EDMA 2IHYA 2PMKA 1CQPA 2KHZA 4WZZA 4ROSA 3LBIA 3VSDA 2V59A 1Y8RB 2OAEA 5AVXA 5TQJA 3GJQA 2A5DA 1RZUA 5KNBH 5IAAA 3DH0A 1E2JA 5PGMA 4MQFA 3AFHA 3MBKA 3MGGA 2Q1TA 2VDWA 3CWQA 4NJMA 5HBGA 4KOEC 2HADA 3G2NA 4AY6A 2POQX 3WL6A 1E9EA 4L0QA 4DBLE 2Z5GA 1NN5A 3UOGA 1FFXA 4WINA 3F2IA 4CHGA 2QN1A 1Z6GA 3IQIX 4M6WB 2FPGB 1J9GA 4BAZA 1PJLA 1NKVA 4NS1A 1SQ0A 3WYBA 3HKEA 3KFVA 3BSWA 1VPLA 4HH0A 4C2BA 2OT3B 4BWYA 2PCJA 3R3VA 5ALXA 2UDPA 3C3AA 5C31A 4JI5B 1ML4A 5HJEA 3VBCA 3I2KA 3H2ZA 2VOEA 2H5LA 4LXUA 3R7BA 1OX4A 2VLIA 2SKCA 4U0KA 3U7QB 2BT4A 4OJMX 1KHTA 4U3JB 4WERA 1W88A 1E7MA 4XUCA 1BWSA 2DB3A 5I01A 4UKDA 1WCIB 1B0ZA 1M2FA 4FTWA 3HU5A 1FP2A 1K1EA 3QSGA 3ROQA 1C3OB 3WYCA 1U2ZA 1Z4QA 4EKGA 3V7FA 4YDHB 5H82A 1GWNA 2ET6A 1UK7A 1FIUA 2JCXA 3PENA 2O3RA 8AT1A 1U2DC 4BRWA 2PS9A 3DL7A 2I55A 3PIIA 1WL8A 4HH4A 4HNHA 1ZK3A 3OT1B 1E3JA 4N0PA 4PYRA 3SM9A 2WOJA 1G6KA 2NM0A 4ERNA 4ZJZA 3A1WA 4RVNA 4N3AA 3NYWA 3WHKA 4FUQA 1VJ0A 1A7UA 2RCNA 3G5MA 3NHAA 3BORA 3TZ6A 1O08A 5JS7A 4CKWA 1EVIA 1J22A 2PGIA 4B35A 1YE8A 1QCCA 4PQGA 2OESA 5KREA 2BBWA 3L9WA 2GEVA 2DUWA 2ZAGA 4OAOA 2OXTA 5F33A 3IUSA 1MRNA 1QOQB 3KJHA 4JB3A 2ZSJA 2ZRGA 4LDZA 4IVQA 3V4RA 4PQRA 4FCVA 1YMUA 2B5OA 4X44A 3L6DA 1Y7TA 2AGVA 1M2WA 2JZCA 3GCDA 4MCAA 4WGGA 3CUEF 2HPHA 2V6BA 3ZLVA 3V8BA 1KEUA 3QNWA 4DTIA 4IF6A 2FU5C 2FMKA 4N9QA 4QUAA 3AJ8A 1Z82A 1YOBA 4X00A 4HADA 1COWD 2W0MA 3GAFA 3IQXA 4PFSA 3L41A 5F5NA 4DPKA 3LRXA 2O14A 3VTZA 4U63A 3M1YA 2W6MA 4EY3A 3AI7A 2J85A 2N3ZA 4KVAA 1D9ZA 1L7AA 4QU8A 3ICQB 4MQ6A 4RDXA 3L49A 3P2EA 3D8NA 5IXSA 5JSZB 2NO9A 4NXMB 1LDYA 4HQKA 3VMFA 3WIUA 3PDHA 1EYZA 4C88A 1I4LD 2ILVA 3NYQA 4KN6A 5JBNA 4F6LA 3NLLA 3FGNA 2G8LA 1RABA 3H11B 4BEWA 2R6GA 3VJLA 4ER7A 3CLSD 5FA5A 3Q6IA 3Q0TA 4ZT4A 1IY0A 2ZBUA 4JKYA 1OWNA 4X24A 1A9PA 4J3FA 3OMXA 4ER0A 5EJ9A 5JZVA 1O94D 3NX4A 1LPNA 3C5HA 1SCUA 4H16A 2Y99A 3HB7A 3K8ZA 5B58C 3HBFA 4DCNA 1AJEA 4JOBA 1YFKA 4H27A 2H1SA 2Z58A 5SY9A 3FI0A 2AS0A 1S96A 1G6Q1 1TM3E 4JLAA 1SVKA 4QYIA 1RP7A 5C4IA 2JLYA 2QSJA 2X0KA 1R3UA 1X1DA 5CB4F 2AWNA 2XQJA 4YV0A 4TYWA 5EZ5A 2C31A 3NC4A 3LOUA 4C1NA 4DCTA 3I6IA 3NASA 3I1YA 3LHDA 1NP3A 1P2UA 4H08A 4LOHA 3ZS8A 2J5XA 4TLEA 3OAAD 1PNQA 3X1WA 2GZ1A 2C5EA 1YI1A 4RM3A 4HBGA 5LNK1 1XJQA 3MLEA 1KZ1A 2EZTA 4YUAA 2FP3A 5ALSA 1PEAA 3O1HB 1E1KA 1VCNA 3EVAA 3ICCA 2VWHA 1ISJA 3GRRA 3NHUA 4KIJA 5DI9A 4BU1A 1NVWQ 3NWBA 3F97A 3RIYA 3OHSX 4CKCA 3FKSA 4J75A 2BD0A 1ZEMA 4MS1B 4S12A 2R86A 2VN8A 2XNJA 4FWIB 3SHVA 3WI7A 1RZRA 2PUAA 1SHKA 2A58A 2IPLA 2E5WA 1XFDA 3ICEA 3RJTA 2QQEA 2R8EA 5LU8A 3IA7A 1SZPA 1QBKC 4RJJA 5GGYA 4CKYA 3T7KA 1A8HA 1E9DA 4KOAA 4RSHA 4MGEA 1TYAE 3G02A 3IOCA 5DHSA 2HCRA 5A2QA 4TSKA 1P1KA 2C1EA 4Q12A 1X0XA 1TIBA 1JG1A 1NF2A 2C7GA 3AIMA 1JXOA 3BIJA 3E6AA 3GJSA 4XVQA 5K3FB 1CRPA 1YR6A 4GBED 2TRSB 4KPUA 2C7PA 3REOA 1KFCB 3HP1A 3QKSB 1QTNA 4Q3AA 2CXQA 3KZOA 3JASB 4AP6A 4MRMB 3RAFC 4IJ5A 2DU8A 2ZRCA 5HIMA 2NZWA 2ZBPA 1E6CA 3N2YA 4YUZA 4RTPA 1K27A 2P0AA 3JQ9A 3MUEA 5TT1A 4BLRA 3KR0A 4DA4A 1PF7E 1XWWA 3HCWA 1V16B 4D80A 1QV9A 2A30A 2GCIA 2P69A 3HKCA 4FFRA 4PU0A 4XIGS 5EFZA 5EXDA 1VG9B 1D2RA 3BXEA 1U80A 2HH9A 3WNCA 3WLPA 1U3WA 4NC9A 5K1ZA 1A2KC 1LJ8A 4G97A 5AJVB 3R3JA 2AHOA 5H7XA 4YH1A 4D4KA 3UV6A 4MRVA 1ISGA 3WGLA 1AS2A 2IPMA 2QTWB 4XUGB 4BP9A 1YT5A 2OZLA 3FGPA 3OO1A 5L95A 3IR7A 1MOSA 4WJKB 3ZWPA 2Q3DA 5AI9A 2C4KA 1YR2A 3HZHA 2GM5A 2GF2A 5TQ0A 4E03A 1XK7A 3PIDA 2ZIAA 3F1KA 3QW4B 4G1EB 2DFNA 3LUDA 4B73A 2C3OA 2PZJA 3PC8A 4JBYA 4DLZA 3ZLJA 4OCZA 2G6BA 4PFJA 5EE9A 1W52X 2AFVA 4G0YA 4KK3A 5IVIA 2V5VA 3ER8A 3ABRB 2B3TA 4ND4A 5JJIA 3AVYA 2OK7A 3U7EB 3LLUA 3A3NA 5ED4A 1XHFA 4RVSA 2Q1UA 2ZT5A 3TR5A 4KE9A 4X41A 4IIDA 4D98A 1WXWA 2C2WA 3VZCA 3H2GA 3NKVA 3LS2A 4Y3UA 4BO5A 4UU1A 2CXOA 3J7TA 4OQPA 4G9BA 2WMNB 4CF3A 3ZDBA 1AV7A 2PX4A 2BM1A 3L6CA 4Y6QA 1IHXA 4AMUA 1NVVR 5HEKA 4AY2A 4GLBA 4UHEA 3UUWA 4O4HB 4TMXA 2IYAA 2HJSA 1G2OA 3E2MA 3M3HA 2RKOA 2YY7A 4MJ3A 3FMOB 1M9NA 2Z3ZA 1C7EA 5ECGC 1PSWA 3RVOA 1C7FA 4AZ3B 1IQRA 2X0RA 2Z9CA 4WCDA 3RKRA 4EHJA 1CUEA 3IQGX 3H2BA 1LTHR 1PQWA 5BSWA 2GYVA 5B2FA 1ONBA 2VCYA 1OHHA 1IZ7A 1HZZA 1KZ6A 2QRPA 2WA1A 5LCXA 4A0RA 3JU3A 4DUYB 2NSJA 3P9ZA 4MRMA 3TRDA 2PWZA 3CJQA 2YHSA 3G8DA 1L5VA 3PEEA 2NZ8A 3D6HA 1AOXA 4OMCA 4Y0VA 4X8MA 3VH1A 4YCLA 3T5PA 4UC0A 5U1PA 2WKQA 3LLMA 5IDYA 1PJ2A 1TIPA 5CYOA 1ZJ6A 1VI2A 4HBZA 1XZIA 2QZPA 5EZQA 3KELA 4DQUA 3KQHA 2VYVA 2ORED 4OUDA 1V4VA 1Z2CA 1I9GA 2MINA 4L7QA 5TY0A 1GLVA 1GCUA 3K70C 3NMUF 4LJLA 2I66A 1JLRA 3HCDA 4KFUA 5EKDA 3QHPA 2NSHA 2BUBA 3WP0A 3QG5A 1Q16A 2ZYRA 3IDAA 3H9JA 4RKFA 5CU7A 2NZ2A 1ZM7A 2VCHA 2RGNC 1YTUA 1JAXA 3Q8KA 1CQIA 1VE1A 3EIUA 5INTA 4TUYB 2YZ2A 4PCUA 2AI3A 5BSVA 3KQTA 1CBUA 3GEIA 3UV3A 1NSYA 1CIJA 4IY1A 3I58A 4RMJA 3TKYA 3FPGA 5A06A 1QR6A 1UZLA 2HFKA 4KPEC