1MG5A

Crystal structure of drosophila melanogaster alcohol dehydrogenase complexed with nadh and acetate at 1.6 a
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
255
structure length
255
Chain Sequence
SFTLTNKNVIFVAGLGGIGLDTSKELLKRDLKNLVILDRIENPAAIAELKAINPKVTVTFYPYDVTVPIAETTKLLKTIFAQLKTVDVLINGAGILDDHQIERTIAVNYTGLVNTTTAILDFWDKRKGGPGGIICNIGSVTGFNAIYQVPVYSGTKAAVVNFTSSLAKLAPITGVTAYTVNPGITRTTLVHKFNSWLDVEPQVAEKLLAHPTQPSLACAENFVKAIELNQNGAIWKLDLGTLEAIQWTKHWDSGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords alcohol dehydrogenase
publication title Drosophila alcohol dehydrogenase: acetate-enzyme interactions and novel insights into the effects of electrostatics on catalysis
pubmed doi rcsb
total genus 98
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2002-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1mg5A00
2X0RA 3GOHA 3NAQA 3QIVA 3KOUA 4DXHA 3BAZA 2NV6A 4BNFA 4C7KA 4ND4A 3M6IA 2DPHA 4XCVA 2XXBA 1D1SA 5JAQA 2R6JA 2I9PA 2YDXA 2HRZA 1ORRA 2Z1MA 5DULA 5EL0A 4ALNA 4BIIA 1YWGO 1GPJA 3GZNB 4GX5A 2QHXA 2VWQA 2X58A 4F46A 3WLEA 3E82A 4J6FA 3HJAA 3LLVA 2ZB8A 4TWRA 1NX6A 3ETEA 3JQCA 3RUFA 3JD1A 1ZCJA 4RF3A 3U09A 5IDQA 4PLTA 4BMSA 1L7EA 2PK3A 4CL8A 5KVVA 1KETA 4XIJA 4CUJA 1KY5A 1FDSA 3DR3A 4FCCA 4O1MA 3F5QA 2VUSA 3KLMX 4NBRA 3E5MA 1LLUA 1QG6A 3ZHZA 4FS3A 4NBWA 5BT9A 4GKVA 1NR7A 1DDOA 2Y68A 5HA5A 3VDQA 4QO7A 2EGGA 1TT5B 2ZYAA 1RWBA 1JU9A 1B16A 1A9YA 1K6IA 1ZSVA 4ND5A 2OBNA 2EWMA 5ILGA 5EINA 1ADCA 5JE8A 1HTBA 4R1NA 1K0UA 4MO2A 1KVRA 2PA3A 3K96A 1Y5RA 1H2BA 4OHUA 4MP8A 3C85A 1CEQA 1BHSA 1GV1A 2IZZA 1H6BA 2G76A 2H9IA 3MJTA 4BNJA 3UAGA 4NK4A 3L6DA 1ZKMA 4E33A 2GD1O 1VJ0A 2JFHA 1YL5A 1PTJA 1LSUA 4CMEC 4BKRA 4BNTA 2DTEA 1DC3A 3OFSA 3E03A 4L75A 4Z6KA 4PZDA 5TC4A 3PP8A 3GPDG 4PG8A 2X5KO 2NVUA 3L9XA 1CF2O 1DIRA 5JDCA 3ZDFA 3EAGA 4IY1A 4WOKA 1GDHA 3NTQA 2DTDA 1H6CA 3V5NA 4K26A 4Y67A 3L4SO 2A35A 1G1AA 3W8EA 1UR5A 1PU2A 1QYVA 4JXKA 5BR7A 4XD2A 4GX1A 3FBGA 4FFLA 3UH1A 3W6UA 5TF4A 3R1IA 3DBHA 3WTCA 4N5NA 2C54A 2R00A 5DDIP 1V9LA 4XGKA 5A3JA 3WWYA 4MP6A 1XQ6A 3G79A 3Q2KA 3GT0A 4PLVA 2VTDA 2YQ5A 3MWEB 3MWDB 1IUKA 2ZTUA 1YB4A 1R4NA 2AQIA 3KM0A 1PSDA 1AHHA 4YRBA 2Y1FA 2Y0EA 3I3OA 4PVDA 4S1VA 4DRYA 2X5JO 3GVXA 4F6LA 3OIGA 1I32A 4KUHA 5FI3A 3ZV4A 4LVCA 3EK2A 1PQUA 4IM7A 1M6WA 2WJPA 4BO1A 1V35A 1HSZA 3OQ6A 5K9ZA 2YFHA 3UCEA 3WMWA 3M1AA 5C3MA 1W73A 2C59A 4EDFA 1YL7A 5CDSA 1VKOA 3PJFA 1P74A 1HETA 3SXPA 1JDJA 1JA9A 1FDUA 2A9FA 5I8WA 2I65A 1ENZA 4PLCA 4FPXA 2YW9A 3GN1A 1EQ2A 2FZWA 1ZH8A 1U8XX 4CM7A 3PVZA 4XIYA 3EMKA 1B3BA 3C8MA 4J1QA 4CLHA 2HCTA 2JCYA 4J16A 4ALLA 2HJRA 3DTTA 2OFPA 1J0XO 1NASA 4XB2A 4DVJA 4YQYA 1OZAA 1PZHA 4L8VA 1DIAA 5HRUA 2NVUB 4GGOA 1DLIA 3I9KA 3LYLA 1E77A 1R15A 4AJIA 3AWDA 3DBVO 1ZW1A 4OOEA 1EK6A 3PJEA 3T4XA 4YPOA 5EMHA 2OBYA 2VNAA 3ZU2A 3L77A 2POQX 1UDCA 3EHEA 2I99A 1M75A 3DMTA 1MGOA 2OGUA 1SCUA 3DFUA 2PD3A 4BNIA 1LUAA 3DBHB 1Z45A 4CLDA 4JCOA 2P4HX 4BMNA 3CXRA 5AOVA 3V2HA 4XJTA 3PIIA 4J0FA 4UUOA 5EPOA 3Q3CA 5G4LA 1PGOA 2VHVA 2BELA 3B6ZA 3LK7A 5KJ1A 3KHUA 5JXWA 4JGBA 3UOGA 1K6JA 4TSKA 1R4NB 3KYBA 1YJ8A 4YACA 3ROKA 1EQUA 1LLDA 3BIOA 3AOGA 4KWHA 4WPGA 3FNFA 3WR5A 3NDJA 1TB4A 1I10A 2B0JA 3UN1A 3O8QA 4WCDA 3RAJA 4PFJA 2Q1UA 4WLNA 5FEUA 1P3DA 2Q99A 3I52A 1E6WA 5TIIA 5BSFA 1VI2A 2WWRA 2WM3A 3IP1A 4HXYA 2JFFA 1A7KA 1PGJA 1ZJZA 2DLDA 2H1SA 1EVJA 2J6IA 3A14A 4WEQA 4JP2A 2WD7A 4NK5A 1HF3A 1SMKA 2VHZA 3U9LA 1ZXBA 4GH5A 3WYEA 3KETA 5DP1A 1O6ZA 1MA0A 4EI2A 3NTOA 2F1KA 5T8KA 5BSHA 1NPDA 2C0CA 4II2A 1HLDA 4LRSB 4RLSA 5G0TA 3WG9A 3ASUA 2DT5A 4HKTA 4RF4A 4YA6A 3AY7A 1ISHA 3NKLA 4BKQA 2CY0A 4ZN6A 4WLFA 1PJTA 3BTUA 3K31A 2YUTA 3GGOA 4ONEA 4TKLA 3C1OA 4CMJA 4CMBA 3MJSA 4D43A 1O9BA 2BGMA 2GN6A 1LTHR 4U6QA 1NVTA 3ZWWA 3ENNA 5B4UA 7MDHA 2EHDA 3C1TA 1UH5A 3FR7A 4FOSA 3ZV5A 2NVBA 4ALIA 1VL8A 4CLOA 2BFAA 4XDYA 4AVYA 1QLHA 1N2SA 2EJVA 1GEEA 1Y1PA 4EJ0A 1F12A 1TT7A 3GMDA 2HK9A 4ZQBA 1E3LA 4O63O 3FI9A 1FMCA 2X0JA 4FGSA 3RROA 1BG6A 1R4MA 3VZSA 1DC4A 3SVTA 3F6YA 3FHLA 1MG5A 2VT3A 3U62A 1MLDA 2PKQO 1ZSNA 1I3KA 2VRCD 2FRDA 3T7CA 2WE7A 5L53A 1I36A 2HMWA 3F4LA 3H4VA 3FD8A 3DBLB 3G1TA 3SC4A 1J4AA 2AEMA 3OIDA 2HMVA 1NFRA 3PGJA 1DFGA 3OICA 1EVZA 1KYQA 2OUIA 4FJ1A 3UCXA 5B1YA 3ONFA 5JC8A 1GU7A 2Q2WA 1V8BA 4QQRA 1X15A 3O8QB 3FTPA 3HFSA 1P1JA 2ZTMA 3G17A 2DBRA 2D1YA 1T26A 2FN7A 2X9GA 4D3DA 1B8VA 4FC7A 3FBTA 1X0XA 1GUFA 4LVUA 4GSKA 1G0NA 3JQEA 3EZYA 1SOWA 3I9JA 4TRJA 4MVJI 2RHCA 2FPGA 3BHJA 3OSUA 4LSMA 1A4UA 4CMKA 4LISA 2EGHA 2WD7B 3U4IA 5KJFA 3X2FA 3L0DA 3UGKA 1U7HA 5DT9A 4J2HA 5KVCA 3KB6A 4CV0A 4DC0A 2IYOA 4M54A 2JL1A 4JLWA 1NWHA 3EDMA 5B37A 4EEZA 3CMMA 5AQ1A 2RH4A 3AUTA 1CQJA 4D46A 4WUVA 5F21A 4MVJD 5TT0A 2E48A 3UF0A 5COBA 1T4DA 4NMHA 5JAMA 2WEKA 1E7WA 1XEAA 4D3SA 1BTOA 4WLEA 1LJ8A 4ALJA 1DRWA 3B1KA 4BO0A 1R0KA 4AJ2A 4O0LA 4MP3A 1EE9A 1Y9AA 5JCJA 1W4ZA 3D5QA 3K8ZA 2BFMA 4OKIA 3W4KA 4HV4A 1AE1A 2CF6A 5IXSA 4GVLA 3H5AA 3KVOA 3PWSA 4CLOB 4BNMA 1DRVA 5FF9A 1DO8A 1UP4A 3QY9A 2EW8A 1SNYA 4ZQHA 2C20A 8ADHA 1JQBA 5F5NA 3GG9A 1R4MB 1HEUA 1NVGA 1U3VA 1SO8A 2VYVD 3PYMA 4NBVA 4DQXA 4EYEA 3QE3A 3LDHA 4BNWA 1PWZA 2YYYA 3AM5A 1DB3A 2B4TO 1M2WA 2NM0A 3AM3A 1YE3A 2FR0A 1E7SA 3OIFA 2JHGA 2WYUA 3PHJA 1ISIA 4B7UA 2VWPA 1U28A 4BNVA 4NQZA 1T4BA 1Q7BA 2DFVA 2PZLA 3KEQA 3CZMA 4WKGA 1Z6ZA 3D64A 1DJNA 3QWHA 4N18A 1AN9A 1N5DA 1QYXA 3ZHBA 1IOLA 1F0YA 5FWNA 3ICPA 2OL4A 2UYYA 2Y1GA 1GZ4A 2BHLA 4IGEA 3HDYA 1P31A 3M2TA 3O38A 3CMCO 4MVJG 1YL6A 1DIHA 5GZ6A 1KVQA 2VHWA 4AJPA 3F3SA 3OBBA 4YT4A 3ZWVA 2C82A 1OMOA 1TA4A 1U5AA 2A94A 5TX7A 1DIGA 4XR9A 3RFXA 2J3IA 4OGWA 3NT4A 4J9VA 2GPTA 4L73A 3D1LA 1ISJA 2QG4A 3ZCXA 1P1RA 2OP1A 3DDNA 3PPIA 1TXGA 4ALMA 4A10A 1N1GA 4BNKA 3QVWA 3E8XA 1PS8A 4Y6RA 1PZGA 4U5QA 5KVQA 3JV7A 3I4FA 3JYPA 1TVEA 4R4JA 1ZEJA 4CUKA 4K9DA 4BGVA 2D3TA 1YS4A 1JKJA 2YHUA 4FSHA 1BGVA 3TSCA 3P5SA 4IGFA 3KV3O 1LDMA 4NI5A 3O9ZA 4QFCA 5KIAA 4O5OA 1HE4A 1U2DA 2X23A 3LF1A 1LC0A 2BD0A 3OQ1A 5A9TA 4YRDA 4DPKA 2FPPA 3G3EA 3QSGA 1M76A 1PJ3A 2I67A 3F1KA 3E9MA 4R5MA 4YRAA 3IP3A 4J1NA 4W7HA 4CUZA 4FFPA 3ZW9A 1SB8A 4GBJA 3MEQA 2WTBA 4IJWA 1ZVMA 3FCOA 1E7YA 3AK4A 4F3YA 1T2EA 2QW8A 4FFOA 3C3XA 3WQSB 2CVZA 4YJDA 3HDHA 3PDUA 2NU7A 1P1HA 3H3FA 2RH8A 5HS6A 1LXCA 1XU9A 1YONA 3EVNA 3C7AA 4D44A 4TZTA 4LW8A 4BNLA 2LDXA 4UULA 4RPJA 4EUHA 4YB8A 3JYLA 2B36A 4XX0A 4MPDA 4BNYA 1UXKA 3ANMA 1NWCA 1DSSG 1C0KA 4AJLA 3UCFA 3TF5A 2C2YA 4RQTA 3WGHA 4OKNA 4XYMA 4ND2A 3ST7A 4BO5A 5FYDA 3F1LA 1E0DA 1B3RA 3SLGA 1PGNA 1XYGA 3KSDO 1WDKA 3ICCA 2Q1WA 2R00C 3WLFA 4IDEA 4N54A 4B4WA 4CQMD 5A02A 5ICMA 3DBRA 1DLJA 3RWBA 3QLJA 3DAPA 4MKZA 3HB5X 2VZ0A 1EUCA 4QT0A 3JQ6A 3NJ4A 2NVWA 1YOVA 4IJKA 5DCYA 3SC6A 4HWKA 3RKRA 1MC4A 1ULSA 1VL6A 5A5EA 3D4PA 2IRWA 1I3LA 2ZJ1A 1XR3A 4M89A 3MJ4A 3EW7A 4ZU3A 4FB5A 2CDBA 3H9UA 4RGBA 4KZPA 2C29D 1VSUA 4IJVA 8LDHA 2O3QA 3PQDA 4BB5A 1O94A 3PHLA 3RUAA 4G81A 1J6UA 1MX3A 4RPLA 4IZIA 2HMUA 3P19A 3PGXA 2VRBA 1O95A 4WLUA 4CR8A 3LQFA 4K6FA 3VZQA 1DAPA 4I5FA 2W2KB 3RASA 4QTZA 1WWKA 4FJ2A 3D3WA 4ZRMA 1X13A 4R1UA 3TL2A 1C14A 1WVGA 1GYRA 4Y6SA 4R5HA 2JHFA 4KWIA 2NU9A 3HFGA 4HBGA 1AHIA 1ULUA 1H9AA 1XDWA 2AHRA 3GNTA 3KRTA 5EESA 1B0AA 4M86A 4ZJUA 4HADA 4OYRA 5TGDA 4WK6A 1XQ1A 4WCFB 4CPDA 3RI3A 1AXGA 5CDUA 4L4XA 4R41A 1B14A 2ZQYA 2ZTVA 3VKVA 1XELA 3GZ4A 3I5MA 3QWFA 3CIFA 1P1IA 1UJMA 5L4SA 1WZEA 3MOGA 2FR8A 2EEZA 2VOEA 1F06A 1GQYA 1A5ZA 1JWBB 5JAIA 4XQGA 4JBHA 5JPIA 3DMTC 1U4SA 4AJJA 1U9JA 5L45A 3W8FA 4DYVA 4K1LA 1ZZEA 4BS9A 4PG6A 4BOYA 2JD2A 5U9CA 7ADHA 4B3HA 2YHIB 3OA2A 3ZU5A 3DBRB 2WSBA 4IDAA 3R3SA 1QKIA 5H83A 1Y7TA 1LI4A 2OMEA 2EKPA 1YO6A 4IS2A 1N7GA 3GDGA 3U4CA 4PLYA 5T64A 4W4TA 3PZRA 3RBZA 3IQDB 3HN7A 1ZSYA 3GRPA 1LBEA 3VTZA 1N92A 4JNKA 4G5HA 4W6ZA 1HDRA 3AU8A 4PZCA 1VRWA 2Y67A 1U3WA 3N74A 3C24A 3WJAA 1W0CA 2P5UA 4KDFA 4DC1A 2X0IA 1X7HA 1Q7CA 1VL0A 2W2LD 3P2YA 1C3VA 2YV1A 3Q11A 3KYCB 1ONOA 3GMSA 2D4AA 3H9JA 4OQYA 1Y81A 3RBXA 3F4BA 1CRWG 1E1MA 1I33A 3TPCA 3OJOA 3D3WB 4C4OA 4RPHA 5T8KC 4FC6A 3SX2A 3RU7A 2DUWA 3X2EA 2PV7A 2C07A 4CR7A 1T1SA 3AI1A 2DBZA 3FPCA 2DVMA 2A4KA 3ZGYA 2Y93A 3A9WA 3H2ZA 3JQAD 4E5YA 3FRJA 4CM8A 4HNGA 4IDCA 4JJFA 1GD1O 4MINA 2CFCA 4OSPA 1LRLA 4Z0PA 3ZU3A 1V0JA 4WNIA 3MTGA 1RJWA 3GVHA 4XDZA 2VQ3A 3IMFA 4B8ZA 2ZK7A 2R2GA 1MC5A 2YY7A 3WB9A 5C7IO 3BZUA 4FBGA 3NTRA 1P44A 1QYDA 4J7CA 5ENVA 3NGLA 1PJLA 3RC7A 1ML3A 1NVMB 3IKTA 4E31A 1K5HA 1PQPA 2NUAA 2YFQA 1DOHA 4RVFA 5J23A 3ONEA 4W7IA 4ZD6A 4DGSA 3QVXA 1HLPA 1ID1A 1MXFA 3SJ7A 3G49A 5L40A 1WNTA 3PDJA 3RD5A 3W4JA 1LLCA 2C5AA 3PI7A 1PL8A 1GUYA 4FJ0A 4E2ZA 5A9SA 4JK3A 5F3RA 3ITKA 4OSOA 4AJ4A 2Q46A 2I3GA 5K6AC 1YQGA 3U4DA 4E30A 3H2SA 3JD0A 4E6PA 1E7QA 2QRKA 3GF4A 4ZICA 3NT5A 4J3FA 1N9GB 3OHSX 6LDHA 5CG1A 4DQVA 5JBIA 1FDTA 3RUIA 3TN7A 3K9QO 2VT2A 1GQ2A 5U4QA 3GY0A 3QVSA 4E0BA 3DAGA 4JBGA 3FF4A 3S1LA 2V7PA 3GK3A 2O4UX 2P4QA 3Q1LA 4ROSA 1LA2A 3VVCA 1IZ0A 1NQAO 3TZQA 2EERA 4OXYA 4BKOA 3I23A 4HUJA 4PLZA 5JDIA 9LDBA 1B26A 3F9IA 4J4HA 4R1SA 3PHGA 4XRGA 3IJRA 1U3TA 4CM4A 4A73A 2IYPA 1HSOA 1NXQA 3JQ7A 2UUOA 4IDDA 2W98A 3AY3A 4PG7A 3VH2A 4E5NA 1IZ9A 3HQ4O 1HDZA 2HMTA 4YVFA 3VPXA 5IJZA 1Y8QA 1NBOA 3DWFA 3GA0A 2H63A 4NJMA 5I7VA 4J7XA 2BRUA 4CM8B 3H9EO 2PGJA 2QRLA 3TFOA 2GZ1A 3LU1A 2VWGA 1UXIA 3ENKA 4IJUA 4RPGA 5T67A 2C7VA 1ADGA 2XF8A 3NX4A 4BMVA 1B8PA 4TRNA 3WGQA 4IPTA 2X9VA 2GO1A 4DPMA 3GAFA 3INGA 4BB6A 3I1JA 3FSRA 3GVPA 5TQVA 5L4LA 4FW8A 1P33A 3RQSA 3VPHA 1GZ3A 3BMQA 3DFZA 2NU6A 1UP7A 2I6TA 3C7DB 4PGFA 5CHEA 1RPNA 5DOZA 5GMOA 3JYNA 5I9MA 5LCXA 1VPDA 2VNSA 4IDBA 5DBIA 1SC6A 1IYZA 2Q3EA 2O3SA 4WLOA 5CPFA 2OHXA 3ZWBA 1E6UA 1B2LA 1J5PA 2VOJA 3I9NA 2GRAA 4ZA2A 4IZHA 5A9SB 2X22A 1P77A 2HQ1A 1MV8A 2DKNA 2YV3A 2P9EA 4NR0A 2ET6A 4JBIA 1K89A 4CM9A 2CUKA 3WGZA 2EKLA 3ZWXA 1HYGA 1KC1A 3WNVA 1OOEA 1B15A 3TJRA 3LF2A 4I8XA 3BHIA 2Q49A 4I1IA 2PLAA 3HUDA 3U49A 2IZ1A 1UAYA 1TI7A 4IMPA 3ZZNA 1XGKA 2QYTA 5DN9A 5IZCA 4NFHA 3AUUA 1JLLA 2PGDA 2IODA 4WNCA 2BKAA 3RKUA 1H93A 1O8CA 4YJGA 5IF3A 3DBLA 2EV9A 4IUYA 1NPYA 1OBFO 2TMDA 4CM4B 3HN2A 3VHRA 3JQ7B 1I3NA 3WJ7A 2QZZA 3W8DA 2RHRA 3UVEA 3IL2A 4P8RA 3M2PA 4BO7A 2HUNA 1Y8QB 3PZBA 4M87A 4B4VA 1CDOA 2NLOA 4NJMB 1GYQA 3W6ZA 1I8TA 1K6XA 4NFYA 4LMRA 1IULA 1WMAA 2CSUA 2ILTA 5AXAA 1ZJYA 3T4EA 4RZHA 3STHA 2EW2A 2FY8A 1WZIA 5JCXA 2TMGA 4RQUA 5KKAA 3QVTA 4BQRA 1PL7A 5H82A 4Z0TA 1YJQA 3BMQB 4NBTA 5EJ2A 3DO5A 1JAXA 3ZW8A 1GQQA 4P22A 1E1NA 3Q2IA 3ZNNA 4FR5A 3BA1A 5CP8A 1HDXA 4KTTE 3JTMA 2C7GA 1BDBA 4R9SA 3K92A 1N8KA 1DFHA 4L74A 5IN5A 1UXGA 2O2YA 3RJ9A 3EUWA 2LDBA 3NUGA 1QV7A 5AYVA 3I4CA 3LC7O 4CMHA 4BNXA 4WCFC 1U1IA 1SZJG 2ZIZA 4CMCA 1DJQA 3L6EA 1ADBA 3WMXA 3D4OA 4TVBA 4N5LA 4ESOA 1V6AA 3S2IA 3PFWO 4Q3DA 4A5OA 5KTKA 3VH1A 1H0KA 3ETGA 1I2ZA 3BTVA 4M55A 2DTXA 5LDHA 3LT4A 4MIOA 4TMFA 1EK5A 2JFGA 4XB1A 2VHXA 4MOWA 4YT2A 5H81A 1WDMA 2DUUA 1NFFA 3H5NA 4L4RA 5L51A 3WFIA 3OJEA 1E1KA 4TRRA 1YXMA 3ZNQA 1NQOA 4YJGB 4HP8A 4MVJM 2E49A 3FNEA 3H9QA 1B7GO 4IXWA 1X0VA 3RJ5A 2E82A 4EW6A 2Y1CA 5KJCA 5K6AA 2G82A 3PK0A 3V2GA 1FJHA 4A03A 4CM1A 5C37A 2NSDA 3E1KA 4TQGA 3GAZA 3DZJA 4BKUA 1A71A 3B20A 2VZ9A 1K2WA 4XA8A 1E5LA 3WXBA 5ER6A 3U3XA 2YQ4A 4Z0HO 3DZBA 4LCEA 4EUFA 4W9NA 2AE1A 3QP9A 4GL4A 3GQVA 4J91A 2VWHA 3MJVA 3DEYX 2X8LA 1FK8A 2OZPA 4YAGA 4RF5A 1EVYA 3G0OA 3NYWA 3PXXA 4ITUA 1LRKA 4E4YA 2FHSA 1GR0A 1E5QA 4B4OA 2DAPA 5DF1A 3QQPA 1EUZA 2PZMA 3H7AA 1NQ5A 4DBZA 3VAZA 4BNGA 2V6BA 5EN4A 4RPKA 4PRLA 2I3AA 2P2SA 2NQTA 4YJFA 1YBAA 2XPCA 2IE0A 5TNXA 3PLRA 4WASA 4YAKA 3NDIA 3I83A 5CAEA 2AW5A 3WWZA 1MFZA 4GPD1 4RVHA 3SLKA 4CMAA 5KJ6A 1YRLA 2VUUA 4QFDA 4DBVO 4JROA 5JMPA 4OAQA 2SCUA 2D59A 3CZRA 2NTVA 1C0PA 1NHGA 2VYVA 4BGIA 2Y0DA 3MOIA 1I3MA 1XCBA 2ZCUA 4F6CA 1VJ1A 4E13A 2PZKA 1EBUA 3DOCA 2NTJA 5AXBA 1Y6JA 5JS6A 3U4HA 3GGGA 1P0FA 1ZK3A 4HFNA 2HU2A 3IUPA 3JD4A 2FPIA 5U1PA 3UICA 2VYND 2EIHA 1V3UA 2ZJ0A 1YQXA 4P38A 5DOVA 3IKVA 5I9NA 4Y9DA 1PR3A 1X7GA 1ONPA 4YYZA 1ZFNA 4QEDA 3D7LA 2GDZA 3OJLA 5CPBA 2HSDA 4I5GA 4K6CA 5C7OO 1OAAA 1OFGA 3RFTA 4RVUA 1U5CA 5JCJD 5K0ZA 5JSFA 4DLBA 1OC2A 1KY4A 2O48X 3DHYA 3MTJA 2G1UA 3B70A 5HS4A 5ILOA 4LMPA 1HDGO 4JN6B 2OORA 5JFOA 4CQLA 1DC5A 1D8AA 1GAEO 3L07A 5L7YA 3OM9A 1LDEA 1HYHA 5HBRA 3Q0EA 3RVDA 3R3JA 2O3TA 5CEFA 4ZQFA 1F8GA 3H3JA 4ND1A 4OL9A 4Q3EA 4UREA 4NJOA 4R68A 5B4TA 2XOXA 1Y8RB 5KKCA 1BVRA 4BNNA 3GHHA 3ZWOA 3PFFA 1GY8A 4IS3A 3FNGA 4NH4A 3WNQA 5CEEA 3TNLA 4PLGA 1ISGA 2BH9A 3D5TA 2E6UX 2DPGA 4YJFB 2Y1DA 1O0SA 2GR9A 1I2CA 2J5QA 5GZ1A 2IXBA 4J43A 4Q39A 3KO8A 4YBZA 2PWZA 4IMRA 1UZMA 3AOEA 4FIZA 4N7RA 3BMOA 3ROPA 1I5RA 3WGIA 1QRRA 2VTEA 3INRA 1NPTO 4HFMA 3FPLA 3WOHA 2AG5A 2PD4A 4DYDA 2P91A 1PJBA 2G0TA 1H6AA 1IB6A 4I5DA 3GFBA 3Q6IA 1IHYA 4NU5A 2A92A 1PJSA 4MVJE 4YR9A 2GN9A 2E37A 1BMDA 2W2KA 4P4GA 3EC7A 2B37A 4BO4A 1NNUA 4R01A 2NACA 4R3WA 4UUNA 1FXSA 1KVUA 4CV1A 4AJHA 2JAHA 1CYDA 4PLWA 2Y1EA 3WSVA 1DXYA 2CDAA 3EY4A 4GKBA 4WCFA 4YWJA 5JLAA 3PRJA 4MVJH 1E3EA 3ZWNA 4CQLB 1ZXLA 2YV2A 3I9LA 1BVUA 1GYPA 2WE8A 1LC3A 4BNHA 1U4OA 2NQ8A 3AU9A 2DQ4A 4XQ9A 5DP2A 4CQMA 4FN4A 3K5PA 3VKUA 2NNLD 2Z1NA 3JYOA 1HYEA 4L9RA 3HSKA 3PWKA 3ZHYA 2GCGA 1PZFA 4EJMA 3RUCA 2P68A 1RYEA 3FWNA 4OM8A 1PWXA 3OF2A 4NFSA 1LDBA 1LEHA 1U7TA 2XAAA 1E3SA 3BMNB 1JAYA 3OECA 4CM3A 2JAPA 4GI2A 4TRMA 2YHIA 5ITWA 1T2CA 3C1AA 3VZPA 5LDGA 5JDIC 2ZYDA 4WLVA 1NFQA 3CEAA 2BI7A 3GPIA 1UZLA 1T2DA 3GNQA 1AGNA 3PTZA 2E4AA 3RU9A 1MUUA 3CSDA 3GRKA 4IBOA 2BGKA 4PIVA 1GCOA 1PZEA 1R66A 3PQEA 3WBFA 1VM6A 4XWYA 3V1TC 1EZ4A 3EGOA 1ZBQA 1HZJA 3Q9NA 2Q4BA 3TDKA 5COQA 3BMOB 1BRMA 1T1RA 4U8GA 3L4BA 2FWMX 4E12A 3PQFA 2D0IA 1R37A 2GNAA 2QX7A 2ZKLA 1XSEA 3ETDA 4B3JA 2PKQP 2GYYA 3KYCA 3JYQA 2BI8A 4D7AA 1O5IA 3WFJA 4D45A 1KBZA 3KUXA 1P1FA 1LQTA 1GL3A 3JQFC 3ZWCA 3NJ8A 3NV9A 1WMBA 3IUSA 4N5MA 1GADO 1U3UA 1GEGA 3HB4X 1MXHA 4RL6A 3VPGA 5CFZA 1P45A 2H5LA 1NR1A 1UZNA 3DZGA 4R69A 3E6AA 3ITDA 4MDHA 4RORA 4PN3A 1CJCA 4KQXA 4AG3A 4DQUA 5IG2A 4E2WA 4XJSA 4MVJP 1H94A 2ZB4A 1V3VA 4WEOA 4YT5A 3GUYA 3KBOA 3E48A 4PLHA 3S55A 1UP6A 1NQTA 3SEFA 4WOJA 2FSVA 2CZCA 3DHEA 4DL9A 3GG2A 1H6DA 3PJGA 5G0UA 3TZHA 1DC6A 3OEWA 3ZHXA 5MGBA 3WYBA 1WPQA 3IAHA 4BO2A 5I9LA 3VDRA 4CQMB 4XGNA 4HFRA 2NADA 3E9NA 5IDWA 3GNSA 3OEYA 1DIBA 4OMUA 4YJHA 3RC9A 1JVBA 4BO6A 3ABIA 4PZEA 5HWSA 2Q1TA 3CE6A 5BSGA 5IZCC 1H9BA 3LT0A 4J1SA 1YBVA 5DZSA 4BGUA 1HT0A 4DUPA 4MJLA 1MP0A 3JCZA 4DLLA 4INAA 3LVFO 5ADHA 4II3A 2G17A 2VCYA 5THKA 1D3AA 1HE3A 1YB5A 4J1TA 2B83A 4GMGA 4M8SA 3TFQA 3UHAA 4XQEA 2RIRA 1LDGA 2QIOA 2WMDA 4Y98A 3IJPA 1Z74A 5G0SA 1L7DA 4UEKA 3VVBA 2BFOA 1WP4A 3TL3A 1IPFA 3TOXA 3A28A 1ZEMA 4MKXA 1N9GA 3B1JA 4BO9A 3QWIA 3N7UA 3JQDA 2EP5A 3IOYA 2BLLA 4CLXA 3AY6A 4JJGA 4UEJA 3N58A 1P0CA 5KVSA 5G2OA 4PG5A 5EIOA 1X7DA 3ZWAA 4B79A 1PQWA 5A5FA 2J5RA 4J4BA 4KUEA 3HG7A 3WBBA 4UVEA 2YZ7A 3DL2A 3S8MA 4XYEA 1R12A 1O89A 4XYBA 3EVTA 3WX0A 1ZK4A 4XEHA 5ES3A 3UUWA 4QX6A 4RLHA 4EEXA 1PJCA 1VE9A 3HNPA 4E2XA 3WICA 2ZCVA 1KEWA 1HDYA 1PEDA 2V6FA 3RFVA 3D3EA 3AW9A 3L6OO 1LU9A 2HMSA 3GGPA 4LN1A 1AUPA 3CUKA 4AFNA 1DAOA 2HLPA 3HDJA 4UAGA 4EZBA 4Q3BA 2O7QA 4AICA 1MFPA 4G65A 1LSOA 4Z9YA 3BTSA 1ONNA 9LDTA 1N7HA 3QWBA 3PIDA 1GZ6A 3DAFA 5F1KA 3UFXA 3GEMA 4RDHA 2PKRA 3DZIA 2IZ0A 2FR1A 4ND3A 3WQRA 3GR6A 1HE5A 4YJHB 2AE2A 5BQFA 3LZ6A 2BMAA 2ZYGA 4UVHA 3TWOA 3GC6A 5EQDA 1NAIA 4A7PA 4M1QA 1MB4A 1EFKA 3PYXA 2HDHA 4ZQGA 3GN2A 2O3JA 1SBYA 3JD2A 5BNTA 2BGLA 4NZ9A 5B12A 4R3NA 1E7RA 2W4QA 4GWGA 5TRTA 3AJRA 5F1PA 3MJEA 3TZKA 2C2XA 4EITA 1C1DA 1DPGA 4E5MA 1CERA 1WXDA 3JQ9C 1XHLA 3FTNA 3BHMA 4NDNE 1W8DA 2Z95A 5G0WA 2CNBA 3ROQA 1EDOA 4OXNA 1EMDA 1OC4A 4EBFA 1JKIA 4RO0A 5IN4A 4W9NC 2O3RA 1LLQA 1Y9EA 2AA3A 3KZVA 3WIDA 3BXXA 3H5RA 1PS0A 3GVIA 1I01A 1QSGA 4O59O 3I9MA 2X7HA 3O03A 5A04A 2Q45A 4HNHA 4RZIA 1A72A 4IXTA 4E5KA 4CLRA 1BWSA 4GGPA 5JYDA 1EBFA 3QA9A 4CMIA 1QR6A 1XU7A 3JQAB 3RC1A 3H9GA 1KEPA 1VSVA 5THQA 3PEFA 1KEUA 4DPLA 5A03A 1TEHA 2UAGA 3BMCA 1ZK0A 4D3FA 2VHYA 3K6JA 3PHIA 2GGSA 3HWRA 2Q2QA 5JY6A 4DREA 1X1EA 4Z3KA 3SJUA 5TLSA 1EUDA 3KXDA 4O6VA 1C0LA 4BNZA 3O26A 1HDOA 1RM5A 3BYZA 5MDHA 5LC1A 5L7WA 5T5QA 4YTEA 4A27A 3UXYA 3IIEA 4LRTB 1D4FA 4E32A 1YDWA 3PLNA 4AJOA 4DIBA 2D5AA 1ISMA 2ZQZA 4WJZA 1A9ZA 4ILKA 1ARZA 3O4RA 4YAEA 3JQFA 4KDEA 1Q7GA 4E2YA 3B1FA 4L76A 1GTMA 4U0KA 1Q0LA 4NPCA 1RM0A 2F00A 4RVSA 1QYWA 3ROMA 4ZVVA 2UDPA 2Y05A 4Y8VA 4Q9NA 2GSDA 3EYWA 2VN8A 4PLPA 2ZB3A 4XR4A 1UDAA 1C1DB 1SEPA 3F46A 1KEVA 1DHTA 3WGOA 2B4QA 5CG2A 3VPFA 4W82A 2X86A 1SPXA 1NTOA 2GN8A 3RSHA 1FDVA 3VH4A 5BSEA 3VOSA 1GUZA 2BF7A 3F47A 5EERA 5EQFA 4NBUA 4BL5A 5BNIA 2OO5A 4F45A 3DB2A 1LX6A 4BUCA 4FFRA 2BFPA 4A2CA 1I0ZA 4IDGA 4Q3AA 4AJNA 4J0EA 5TSDA 2Y99A 3QV1A 1KOLA 4LSWA 1C0IA 4CLRB 2OXIA 2WD8A 1XA0A 3GFGA 5KJEA 4CMIB 3MCVA 1CETA 1A4IA 5I8ZA 1LSSA 1SOVA 3WGTA 4RVGA 4NNJA 3RUDA 4IINA 1T25A 1T2FA 2Q4EA 3BMCB 3JQ8A 3OMLA 2XXJA 3DC2A 4RCVA 5IDYA 3DQPA 2X0NA 1DHRA 1YB1A 3K30A 3TQHA 3HE3A 4CM9D 1ZK2A 4DLAA 2GZ2A 3ORFA 1QLJA 3VH3A 5JW6A 2HK8A 3IC5A 1L1FA 2J3KA 3AOEC 1EVIA 1VJTA 4OJNA 5A1TA 1BXKA 1IY8A 5AXCA 3QWAA 3Q9UA 3RBVA 2QYSA 3CKYA 1Q1NA 3WTBA 4NU6A 3ZI0A 1WAMA 1GPDG 3AFNA 3MZ0A 2Q50A 4MVJF 5IDXA 1LDYA 3OA0A 1F14A 4CM5A 4WECA 3WDSA 2JKVA 2HAEA 4J2OA 4C7JA 4BO8A 1Z73A 5HM8A 5B4VA 3LC1O 2GERA 1R16A 1YGYA 1DBVO 4LCJA 4GMFA 4URFA 2EF1A 4BV9A 3HADA 4RVDA 4OOFA 1Q2XA 4J7UA 1Z75A 1ZUD1 1KS9A 4CL3A 3RCBA 3WIEA 2I76A 4BKPA 1SEVA 5TJ9A 3HZZA 1UUFA 5TT1A 4E5PA 1EFLA 4J9UE 3V1YA 1YDEA 2VRCA 3TOZA 4FDAA 4GLLA 4QECA 3COSA 1JKFA 1HWYA 1H5QA 4DA9A 3GVCA 1W6UA 2YDYA 3KTDA 1RM3A 2NU8A 1PJ4A 5DNAA 3FN4A 1LSJA 1KIFA 5HTOA 3GH3A 4RV9A 1FF9A 2PFGA 5BNFA 3ANNA 3E5RA 4IDFA 4BGEA 1NYTA 1WLYA 4KUGA 4L4SA 4BNUA 1HZZA 1N1EA 2AEFA 2Z5LA 1KC3A 3UW3A 4R51A 3JQ8B 1KERA 4A26A 1M66A 1I30A 3WGGA 4K28A 1X14A 3RUEA 5IXYA 1YKFA 2AMFA 2IEBA 3E9QA 1ZMTA 1BXGA 4YQZA 3ZNPA 3VPSA 1JW9B 4KP7A 2FSSA 3JQ9A 4OO3A 1JVSA 4IQ8A 4OH1A 5A4DA 1HRDA 2DBVO 3JQGA 4H7PA 3IS3A 2RCYA 1YBMA 1BW9A 3I6QA 3DTYA 5KWEA 6ADHA 1NP3A 1HL3A 1E3JA 3PJDA 4U0JA 1LNQA 4Z9XA 1T2AA 3L4BC 3T7EA 2C5EA 4AL4A 4CLEA 2CD9A 3QW2A 4MVJA 2FMUA 5IZ4A 3OJFA 3P7MA 3DZFA 2J5KA 1UXHA 2O3UA 4CMEA 3V1UA 3H6KA 3CTMA 1Y8RA 2YJZA 3NDRA 5DCUA 4D42A 1A7AA 3PYLA 1IL0A 4KQWA 1PJQA 2HK7A 4DIFA 3S2GA 1XKQA 2FP4A 2AXQA 1DFIA 4JQCA 3H65A 4IQ0A 1CIVA 1PR9A 2HJSA 3AI2A 3JD3A 3JQBC 4I5EA 4OQZA 4JP3A 3AUSA 2G5CA 4OXKA 2UV8A 2OP0A 3CPSA 4RF2A 1UXJA 4I9HA 5CEJA 1GFSA 1IHXA 2OOSA 3AI3A 3AUAA 4GQAA 5JC1A 5L95A 2O2SA 2O7SA 3PHHA 5JAZA 1JN0A 2O50A 1WDLA 4D79A 1S7CA 5G4KA 4BHTA 2VYNA 4Q3CA 1PGQA 3DONA 4HY3A 2J8ZA 1RKXA 4ALKA 1LQUA 1A27A 4PCVA 3HDQA 2RAFA 4CR6A 2JCXA 1BXZA 1FDWA 3WSWA 4LK3A 4UUPA 2Y0CA 3FNHA 4DMLA 4HFJA 3OH8A 4D0RA 5I7FA 1DRUA 4GSLA 4R9RA 2PH3A 2EKQA 4M49A 2IDZA 1EE2A 5I7SA 2J3HA 3P2OA 2GUGA 3ON5A 5JNLA 2JD0A 3DXFA 1H2HA 1E7MA 4L0QA 3LT1A 1R0LA 3W4IA 2PY6A 3JSAA 3KSUA 1CWUA 3EZLA 3WS7A 2V6MA 1K3TA 5ER9A 1NAHA 1E3WA 2GF2A 1BXGB 2H6EA 4YDRA 4UUMA 1U2GA 3ZNOA 5JMWA 2J3JA 3OETA 5T6BA 4PG4A 4GX0A 3JQGB 1C1XA 1LRJA 4FGWA 4JIGA 5CDGA 2O4CA 1BW9B 4YAJA 4U7WA 2QQ5A 4MKRA 1QORA 4G2NA 5G0VA 1R0SA 1HKUA 3MJCA 1F8FA 4J4TA 4J90A 3ADOA 4QUKA 3RC2A 4NIMA 2FZEA 1ENOA 2CVQA 1WW8A 3KYDA 3ZV6A 5DBFA 4FFNA 2UVDA 3HHPA 3LC2O 4DIOA 3BMNA 3E18A 4YEDA 2GASA 1SB9A 2B4RO 4RDIA 5ICSA 2EXXA 4FD3A 1GV0A 2V65A 1IE3A 1PL6A 2V6GA 2ZATA 3ZV3A 3K2EA 1Z7BA 3M1LA 1EEHA 1ZMOA 2GN4A 4Y6PA 2PD6A 4X54A 4XYGA 5F1OA 5G4KB 4BQPA 4XKJA 2P9CA 3NGXA 3DZKA 1Q0HA 1EDZA 2PR2A 2DM6A 1JWAB 2GZ3A 4NG5A 2I66A 3QHAA 5KCZA 5C7LO 2AQHA 3V8BA 4XYLA 1RM4A 1RYDA 2EG9A 1J49A 4DMMA 4IIUA 2PNFA 5JYEA 2D5CA 3VTFA 4WE3A 3GHYA 1M67A 1HDCA 3BTOA 3S2EA 3H8VA 3PWZA 1AXEA 4XZ3A 3A4VA 4ZQEA 2P9GA 5A05A 1ZK1A 2CMDA 4MIEA 4DWVA 3GEGA 2QZ9A 2P5YA 1G0OA 2PH5A 5TS3A 1ENYA 4Z3DA 2VZ8A 3WGYA 4ZRNA 1E3WB 1JTVA 3NT2A 2B5VA 2JJYA 3DOOA 2ZB7A 4KOAA 4WGGA 4B8WA 1QMGA 1C1XB 4AJEA 5FFFA 1QXSA 2D8AA 3VC7A 2QRJA 3ANLA 2CF5A 1ADFA 3ZWYA 1E1LA 3K73O 2DC1A 4KTVE 2IEDA 3OJ0A 4I08A 2EJWA 4QO8A 3OP4A 2AEJA 3FWZA 4GVXA 5F5LA 2Y1OA 3AFMA 3ADPA 5AVOA 1HXHA 3L9WA 1CQIA 3GEDA 3KYDB 2CDCA 4H15A 1KVTA 2JD1A 2Q1SA 3ZH2A 4JX8A 5A9RA 1YQDA 1TLTA 2VUTA 2PTGA 1YH3A 1IPEA 1Z7EA 4P4LA 1E6EA 4R16A 2GLXA 1P9LA 5L3ZA 3D4NA 3S2FA 3SBOA 3ASVA 3DZHA 3ZU4A 4EGFA 4XGIA 5JDCC 4LGVA 4QXMA 1U8FO 4B7XA 1ISFA 1I2BA 4QSMA 4AJ1A 3CINA 1OI7A 3KLPX 1QV6A 1Q0QA 2JCVA 2ZTLA 4PVCA 5T57A 3VZRA 3KEOA 4A0SA 4E3ZA 1XWFA 2B5WA 5A06A 4EJ6A 4B3IA 4JJIA 3GLQA 1X1TA 1D7OA 2Q2VA 4BV8A 3QRWA 4CV2A 2B35A 5DBGA 4KMSA 1UAGA 2I5PO 3KSZO 3K2BA 4FFMA 5GZ3A 5C5IA 5CDTA 1P1KA 1XG5A 2W90A 2WDZA 3IDSA 1Y5MA 1R6DA 4FOOA 4TVOA 3I9OA 1NM5A 3ONDA 1E92A 1NHWA 3GDOA 3INTA 4PRKA 3ZWPA 3U0BA 4B7CA 3A06A 2DFDA 3DHNA 2X4GA 2CVOA 1B8UA 3D0OA 2RBEA 5A3VA 4CJXA 3LLSA 5GY7A 5KNLA 2UUPA 3TZCA 1D1TA 1LDNA 2Y66A 1VLLA 1ZIDA 4IIVA 3JQBA 4GLOA 4W99A 5FI5A 5CDYA 3NRCA 4BVAA 4I9UA 5IAAA 1PJ2A 5KOIA 3R6DA 4UVIA 2W8ZA 1E3IA 1ZO8A 1BDMA 2D2IA 3AM4A 4S3MA 1F17A 2X5OA 4XRRA 5JO9A 4ZGWA 5JY1A 1YVEI 4H3VA 3RIHA 4YAIA 1PIWA 3I6IA 1QP8A 4TZKA 2PGLA 3GZNA 4ID9A 4HX5A 4UVGA 4D0SA 3CH6A 5TJHA 1Z82A 3GDFA 3FR8A 1T24A 4IQGA 1KVSA 3NEPX 1BSVA 4P4NA 3ZWMA 2B69A 4J49A 2O23A 4U6SA 5I7EA 4UEOA 4CODB 4OIMA 4EUEA 2HO5A 4Z9FA 2NWQA 4Q3NA 4NHEA 5COAA 4CMGA 4R1TA 4D41A 4UVDA 4R54A 4FQ8A 5ITVA 1S6YA 2WYVA 1DEHA 1PS9A 3V2UA 4YCAA 3W1VA 1XIVA 3A1NA 4GWKA 3GUCA 2PZJA 1TT5A 1UDBA 4PLFA 1XLTA 1SAYA 5ENDA 1MG0A 1ZNQO 3WYCA 3TRIA 1HE2A 4DTIA 4TKMA 4H16A 4RJTA 2DBQA 2W2LA 5DCWA 3QJ5A 5L4NA 4XQCA 3G1UA 1VC2A 1VKNA 4YT8A 5L7TA 1QYCA 3DOJA 2HRBA 2X6TA 2AG8A 4CM6A 2HKIA 3LSYA 5AXDA 4YXFA 1GCUA 2IXAA 4B4UA 1PGPA 3R0IA 3OQBA 2X1HA 3RUHA 4CV3A 1V3TA 4E21A 2EP7A 3UKOA 5L9AA 1G6KA 2DU8A 4GAEA 4GX2A 4ZHSA 1ENPA 5IFLA 3LT2A 4BO3A 3F5SA 1M6HA 1YOVB 4MIYA 2X9NA 4I9NA 4AJKA 3WQQA 5JO0A 3ULKA 3C7CB 2AQKA 2WYWA 4TROA 2NTNA 2FOIA 1PX0A 3JQAA 1I24A 3ZN2A 3TZ6A 3U5TA 3DMYA 3QVOA 2AQ8A
chains in the Genus database with same CATH superfamily
3T7TA 3NBAA 1KIMA 3QIVA 3L1IA 5J59A 4EVQA 1FVFA 1QBKC 4MWTA 1EWYA 4ZPXA 2F1OA 3BAZA 2NV6A 4IGIA 3R40A 1KZHA 4F56A 3A26A 4C7KA 4ND4A 3M6IA 1FXWA 4XCVA 1D1SA 2D2XA 1XJWA 1Q19A 1W48A 3K94A 4QU0A 4WKNA 4XIGS 2I0FA 1P18A 4DSAA 1D07A 4DVGA 2IELA 2Z1MA 4EX7A 4M0KA 5DULA 5EL0A 2QL6A 2B7LA 2GVDC 1NG9A 1YWGO 1GPJA 2QTAA 1FNMA 4GX5A 5AHXA 5HOEA 2CYCA 2X58A 2FV8A 4F46A 4IICA 1W2GA 3WLEA 4J6FA 3QSYA 4OHPA 2HHLA 4RY0A 3LLVA 4XM2A 1GKKA 3MWEA 5ELMA 4AN1A 4UTXA 4TWRA 1NX6A 1L9XA 4LKRA 1T6ZA 3Q5GA 3U09A 1P0QA 2RARA 3OZVA 5IDQA 1PBTA 3VR5H 1FUEA 1U7ZA 5K0LA 4FYPA 4RDCA 1KJQA 4FOTA 1KETA 4OB6A 5ABPA 4ETIA 2JNWA 3DR3A 1AUXA 4FCCA 4DADA 3FKQA 2VUSA 4NBRA 1QG6A 1T8UA 4HHEA 1NVKA 4Q9AA 4ZREA 1L6IA 3RC3A 4ABYA 2Y68A 3B2NA 2VBCA 3N8HA 4DQLA 5HA5A 3VDQA 1GQOA 4R1LA 2ISQA 3CE9A 1A2OA 3M49A 1HA3A 3G0HA 4DDWA 2PRIA 2FX2A 2BSQA 4X41A 3WL5A 1XDBA 1MDFA 4G0UA 3X44A 1TZBA 1Z5NA 3V3TA 2GBIA 2W6JD 1SA0A 1GSAA 1Y5RA 3ASYA 2LKCA 1Z0UA 2YC4C 4Y18A 3PQ6A 3KZNA 2XYVA 3C85A 4JBWA 2GN0A 2I78A 3EY9A 2FQQA 3RRNA 4BNJA 3E22A 4R9UC 4WCVA 4CKXA 3L6DA 3JATA 1GNRA 4B80A 1N2CA 1VJ0A 5LZ8A 2AIRA 1YL5A 1PTJA 5FA5A 3WO0A 4EFLA 1H42A 5D84A 3T5BA 1BJKA 4JITA 3VHXB 1SHZA 4YROA 5ALEA 2DTEA 2O8FB 3H87A 3E03A 4H7FA 4L75A 4M6WA 4Z6KA 1YTUA 1ANKA 1V1RA 4QASA 5TC4A 2VJQA 2NVUA 2I6SA 1CF2O 4IHAA 3O8DA 1GP2A 2ADFA 5JDCA 2AMJA 3ZDFA 3P4YA 3EGIA 1WUHS 3PGLA 4O4IB 4Y0VA 1RADA 2DTDA 2Q3CA 1WDWB 4D81A 3QKUA 5FTMA 3U16A 4DC9A 1AHPA 3L40A 2XEDA 5CM2Z 1ZU4A 4QTYA 1PU2A 5BW4A 4XEUA 4KGXA 1OWLA 1M83A 4XD2A 4EL5A 4ZCRA 4GX1A 3O4IA 4JT9A 4FFLA 4RH0A 4AF8A 5TF4A 2PN1A 3DBHA 2QJFA 3GLFA 1YGPA 2UZ0A 4C29A 4DXDA 5DI3A 2BFFB 4RVCA 4XGKA 3R3WA 4MP6A 5J2TA 1KNXA 1XQ6A 2WHXA 1ZYUA 1BMFD 3G79A 1D2GA 2O5CA 3GT0A 3C74A 1NOKA 1TPZA 1VLQA 2OK8A 3LUCA 2JIPA 1RI5A 2C3MA 3NIFB 3LKVA 5E6RA 1AHHA 1Q15A 3MWFA 4DHEA 3I3OA 3IPRA 3KT6A 4PVDA 5HNKA 2HQSA 4DRYA 2X5JO 3GVXA 2MDTA 4X7RA 3RABA 2QDKA 2WG0A 3W6NA 4B87A 5BSKA 1PQYA 4R7GA 4HGRA 3KD2A 1PQUA 4IM7A 4O4HA 4PGHA 4AUMA 3CJTA 5ECGC 2UXCB 3HKEB 5IAJA 3T7JA 2HLNA 3L93A 2BGWA 4A8JA 1XTUA 3MJFA 4NHOA 3M1AA 2JVIA 3VR3D 3WADA 1OXXK 3IQHX 2XNCA 3PJFA 1P74A 2W83A 4UPVA 1G5TA 1YA8A 2AH5A 3ITEA 1V5IA 3CPHA 2V59A 3FBWA 4X44A 5DE3A 1I13A 3DVRX 3EOZA 4FDLA 1U0HC 3ZK8A 4FPXA 4I4TA 5K1ZA 4PAWA 2XCIA 4ZQCB 3QUTA 1CIJA 3VU1A 1NW5A 2K4MA 1O1YA 1YA4A 5JRZA 3RC8A 3W5UA 1EQ2A 2FZWA 3IE0A 4CM7A 3M5DA 1FVXA 1ZI9A 3QVUA 3R3YA 1KYXA 3KU4A 4K9QA 4NYIQ 4P83A 1OGJA 4J16A 2GAIA 3W3AA 3QBVA 3V1LA 4YMLA 1S8OA 2O07A 2WDPA 1SBIA 1VJRA 2B61A 4POAA 1SXQA 1NASA 5LA6F 4XB2A 1UPBA 1FSZA 1YCFA 3VXKA 3ZU6A 4DEXA 1HX7A 1AKWA 3HFRA 4ARZB 4GGOA 4M0CA 4KVAA 3LYLA 4WNYA 1V71A 4GOXA 3DPUA 1QQAA 1ZP6A 2X4LA 3GU3A 1KAQA 4EKGA 1MZPA 1NONA 3LBHA 4OOEA 1XMQB 1Z33A 1WBDA 1G16A 3B3FA 4RZ2A 1NUHA 3ZU2A 3FPAA 2POQX 2H2WA 1M75A 5CJJA 3DMTA 1BDJA 1MGOA 3SZLA 2XRZA 3CUUA 4BNIA 4G1BA 1LUAA 1EG7A 3HI6A 4JCOA 4BP8A 2P4HX 4B3XA 3CXRA 3RRBA 4C5BA 5HF8A 4RZUA 2WTEA 1KMCA 3QJGA 2AX3A 1QUFA 2YYAA 2FWJA 1FFBA 1JKMA 2B7CA 2VHVA 3B6ZA 3LK7A 3MXTA 3KWLA 2NZ8A 4JJ7A 5AJVB 4C4RA 2JIRA 3IEMA 4UPEA 1DO0A 1HTTA 1ZJ6A 1ZKDA 1TCCA 4HGYA 4WY8A 5BPFA 2R4TA 4MEBA 1SURA 4YACA 3AOGA 3K1ZA 4KWHA 5DXFA 2G4VA 1R0XA 2H5IA 5FNVA 4MHTA 2IS1A 5E6UB 3B8EA 3NDJA 1TB4A 1I10A 2B0JA 2ZYSA 3GRYA 3O8QA 3RAJA 2Z4TA 5JD4A 4PFJA 3V55A 5ED0A 1VGVA 1NI5A 2W2TA 3A4IA 3X1ZA 1RMTA 3I52A 3OG9A 4EBBA 3WZ2A 4Z7OB 5BR8B 1SCBA 5BSFA 5ILQA 4RFLA 2OEPA 1II0A 3THYA 2DQZA 3MNFA 1ZJZA 1PGJA 1WCIB 1U8UA 2DLDA 1GAQA 1UMKA 1L4FA 1PK7A 4KPUA 3SSAA 3VO1A 3VJKA 1U8EA 2WD7A 4ZDIA 2A9JA 4H7DA 4EJSA 2O8NA 1U2DC 2XNHA 3VSBA 5HKOA 2I03A 2C3YA 2VHZA 3R3VA 4GBGA 4P84A 3U7RA 1IC6A 4GH5A 3R9XA 1Q5PA 3C5WP 5DP1A 5K09A 4CKBA 4WNAB 2F1KA 4KV7A 3VU0A 1F9AA 2CXPA 1SOUA 3BF7A 1CUAA 3I2YX 4D0SA 4II2A 1HLDA 4LRSB 1MW9X 4QPPA 1JJ7A 3WG9A 3DEIA 4Q4AA 2FQYA 1PO7A 4H0CA 5D3MB 2DT5A 3HUFA 3MUNA 4RF4A 2WLTA 3ROTA 2IS6A 4AKGA 1KI9A 3IBYA 1ISHA 4P3KA 2VP0A 3GFFA 4MUBA 1PJTA 5CYGA 1SG6A 1FSPA 4G5GA 1OH5A 3T3EA 1VKHA 2UZ3A 4U7JA 5JCPA 4LFBB 2FU5C 3NHFA 2QE6A 2GN6A 3TAUA 1LTHR 1F6DA 4RD0A 4NBLA 4YHHB 5HUJA 2EHDA 3F49S 2OUKA 3TECE 3D3QA 1HG0A 1AA9A 3V4LA 5JD3A 3ZV5A 4Y2GA 1YZVA 5EMLA 4ALIA 3ZR4B 2FMHA 2ZPUA 3UTDA 2BFAA 4XFDA 4XDYA 3CRZA 3WZLA 4V1CB 1YR2A 4EJ0A 5BQXA 1LX7A 4MRMA 4FWTA 3FDJA 3HSYA 1HT1E 2J0SA 1E4EA 3M6UA 2C00A 4TXLA 4WACA 3B1ZA 1NSFA 2GILA 3PU6A 4O63O 1SCUB 3HVHA 4RH3A 5AJYA 3VOBA 4EMTA 3S7ZA 4TN1A 4FGSA 3RROA 3SVTA 4OQ4A 2Q5EA 1DC4A 3VZSA 4YJ2A 3F6YA 3FHLA 1MG5A 2VT3A 4LDAA 5ALFA 4DM7A 2HTFA 1D2RA 2BM9A 2OCPA 2Y0BA 3EULA 2X3YA 1ZSNA 3LW7A 3OZWA 4GQBA 3VO9A 4B46A 4EW1A 5JEDA 1I36A 2HMWA 3F4LA 2BMFA 4UDYX 3UBMA 1WB6A 1AKUA 5ARDA 3ZUPA 4N0QA 3KKKA 5IC4A 2VF8A 1KZYC 2A33A 4KQFA 4XM0A 3VJMA 2QD5A 1E9CA 1N9ZA 1DFGA 1KYQA 3HI4A 4X7PA 3L6BA 3ONFA 5JC8A 2MINB 1GU7A 2QMQA 1VCMA 2UVPB 5JALA 1G5RA 4QQRA 3MELA 3FTPA 1P1JA 1YJXA 2B6NA 2WTXA 2ANBA 2PG3A 4B6GA 2BUAA 2EQ5A 1EGMB 3FKJA 1I4EB 1IRIA 1JJBA 2DBRA 4INJA 1CUZA 4P5DA 1Y4UA 3UT0A 2IGBA 3FOCA 4FC7A 1RXYA 2VXYA 4PYOA 4WW0A 1EFRD 4CKEB 1SOWA 2IVZA 3MCZA 2FPGA 3ELWA 3ZVMA 2AFHA 2B3TA 3OSUA 4GHWA 4PANA 3I62A 4LISA 1K68A 1U3GA 2GVNA 2JATA 2M98A 1KAMA 1N7JA 3U4IA 3O8OB 1O8BA 3WP1B 3ZZUA 1H8HD 1KO8A 2ATVA 2BTQB 2DHQA 1QPGA 3K8QA 1N0HA 3RU2A 1SR8A 4ZIRB 3IV9A 3U80A 5KU7A 4JEMA 1HOXA 3EDMA 1RCFA 2V3VA 1G66A 5B37A 5L6LB 1JIIA 1NMEA 4TL6A 2YBEA 3E81A 3L7YA 4DE5A 3EOBI 3BK2A 2FWPA 4MAMA 3R5FA 2OVBA 4MVJD 3ZTWA 2E48A 2Y77A 3FUUA 3URMA 1J5XA 1S9HA 1U8ZA 3UG7A 5KNBD 4DDTA 1F4PA 3SQOA 4A0FA 5BUCA 5KX5F 2JGFA 3PQCA 1XEAA 1O5TA 4QXRA 4NSNA 5LA6B 1MO2A 2FKNA 4JDUA 4ALJA 4CTJA 3RYFB 1KH1A 1R0KA 2XKKA 3H11A 5AI0A 5FOQA 1WQ3A 4Q4CA 4MP3A 4B75A 1T13A 1M10A 1TQ6A 3IP7A 1RC0A 2IOFA 2BFMA 4GT1A 2ZIEA 3MD0A 3H5LA 5JROA 1DG1G 2ACVA 1GZVA 4OA8A 1ZW6A 3WYNA 1R1DA 1IB0A 1A76A 1PX2A 4BB9A 3ENWA 3OAAD 3N53A 1DO8A 4L57A 2EW8A 4UC0A 2BZSA 4YMHA 1CZHA 4NJEB 2C20A 1VZ2A 3GUZA 3MTIA 1QZUA 1TYDE 3N0XA 4HB3A 4OGGA 8ADHA 1GCIA 2AKAB 3GRCA 3N2IA 1QG2A 4YASA 1KBQA 1R4MB 1HEUA 1NVGA 4GPEA 4DQXA 3BSSA 1H8EA 3EWAA 1M0WA 1N6NA 4KDRA 5K3BA 2GCOA 3PXEA 2CUZA 2WW8A 2GCIA 1K8ZB 2JLSA 2W6MA 3QYFA 1DB3A 2B4TO 4GZMA 2JH8A 4HQNA 1YE3A 3C15C 4G5SA 3U4AA 4X65B 2Q4RA 2WAYA 1KEZA 2JHGA 4HRAA 2WYUA 4NBSA 4C0QC 2FLKA 4I3GA 2VWPA 4DW8A 2W42A 3BMXA 2E6KA 3K5IA 4UD6A 4Q15A 3UY4A 2C5SA 4PPYA 5EJFA 1O58A 1Q7BA 2DFVA 2PZLA 4N3GA 4CF6A 5BYJA 1Z6ZA 4AUKA 5ITZB 2TYSB 4N18A 1MEOA 3TX6A 4JJ8A 5FI1B 5BRAA 1VP9A 1QYXA 2NYAA 2VAPA 3P9XA 1R0WA 2W2OA 1IOLA 2ZWOA 2MU1A 2UYHA 2Y1GA 1Y4DE 1HMPA 3G5AA 4BDTA 4RY9A 3O38A 5GM2A 3OWXA 1U8CB 1YL6A 5KS2A 3OQIB 4MR9B 5DHFA 4CL2A 3FNRA 1OMOA 1XJ5A 2YXPX 3R7BA 2DSNA 5JQGF 1DIGA 3RFXA 4AD8A 2X6QA 3I32A 4TZ0A 2J3IA 1C9YA 4OGWA 5IM4F 1Z63A 2V0NA 4R2LA 1RRPA 2GXSA 2QG4A 4B0OA 4N0DA 3TMAA 3K0KA 2G06A 3CG4A 3C2QA 3I6BA 3EZ2A 2VHUA 2QS9A 4P34A 1DMSA 1EZZA 4ZTZB 3B85A 1N1GA 3VZDA 3QVWA 4BNKA 4LTNA 4AKTA 4C1BA 4FMBB 4KR9A 1JHAA 4MW0A 3NVKI 3N0TA 5DYNA 3BBPA 1QDLB 3WLNA 1ZCAA 2F43B 1FY2A 3ZE7A 5KVQA 3JV7A 4BNDB 3AF2A 3I4FA 1QRAA 2WTUA 3UJAA 3AEZA 4LXUA 2IF2A 2ODWA 2SCUB 4X71A 3R7FA 1Q2UA 4CUKA 3NRBA 5C80A 2WMNB 2YH2A 4I2VA 1YS4A 4HJXA 2GEDA 3L0PA 3I37X 5BYKA 5CXQA 1BGVA 5K8IA 3P5SA 4DR4B 4IGFA 1XCPA 3HBNA 3IULA 4QDZA 1SUWA 3UJ7A 4AU1A 2HL6A 2E4ZA 2CXRA 3NHUA 1V7ZA 3O9ZA 3ONNA 3QW4B 3DE0X 4NI5A 3U4QA 1W85B 3OM8A 3Q7IA 2QZPA 2Y1XA 3N2NA 1JHVA 3OQ1A 5A9TA 4YRDA 1CT9A 2GMWA 2ODBA 4F5DA 1PJ3A 2VRWA 3F1KA 1XRSB 3HH8A 3IP3A 4MWZA 4CUZA 3ZW9A 5D1HA 4GBJA 3CUYA 2ZRNA 1SRRA 1SK9A 5FR1A 3AK4A 3KUCA 4MROA 3WWOA 1IATA 1Y7HA 2QW8A 4DIEA 4V3CA 2CVZA 5WRFA 4N82A 1X77A 3PDUA 3ND5A 2ISCA 1BCSA 1P5HA 3GYGA 1IBLB 1G5PA 2PVCA 4JI6B 4UBNA 1QHIA 4DLKA 1XU9A 1YONA 1H3FA 3C7AA 1M5UA 3LGSA 4P98A 5HK8A 3E2IA 1Q12A 2CLMB 4BNLA 1BFDA 5AM4A 1UM9A 1HM5A 3LNTA 3CLVA 4OHFA 3H9BA 4RHUA 1HOTA 1E9EA 3UWMA 5AVUA 1ODKA 3BK1A 4Q7LA 4RHFA 3ANMA 3S3TA 1MX9A 4LZZA 4LX0A 5FBKA 1G38A 2RHGB 4U3JA 3UCFA 3VM6A 3A7EA 4XIFA 2WPNA 2C2YA 2Z1DA 2O1EA 1DOZA 1E2LA 3QVGA 3WGHA 4EK9A 1AVTA 2H9AA 1JLKA 1GFZA 1R0ZA 5DEOA 5JATA 5ULLA 2YWXA 3W9BA 4F4HA 1SU8A 5FYDA 3F1LA 1XP8A 1YFZA 1B3RA 2CV2A 1XYGA 5AR1A 1KXZA 1K5PA 1RWVA 1KDPA 2Q1WA 3U7JA 1W75A 4AY6A 3TXXA 3N2GA 2X0FA 4ZI7A 1FRFS 3AVPA 3JXEA 3PQ2A 2WWIA 2QJOA 4L4YA 3ZXYA 4YCCA 5JASA 2FWIA 3STVA 4F71A 5GOTA 4DKJA 4MKZA 4D8YA 4CT5A 2DUNA 3HB5X 2FHPA 5KSZA 4TSRA 1CZOA 4RNDB 3QLVC 3RNOA 5KUTA 1Z4KA 3DAYA 3A6KA 3ZY5A 4IJKA 3MRTA 1Q77A 4HWKA 4L1KA 3RKRA 2CZGA 2PHZA 4ROTA 2QTZA 3PEYA 1VL6A 2FG5A 1QVRA 3IVGA 4WQMA 5A5EA 1OV4A 5A3RA 2V6JA 2JFYA 1M6EX 1TVKB 2W58A 4M89A 4D80A 1W36D 3FMOB 3EW7A 2XTNA 3H9UA 1J2EA 2HSWA 4KZPA 1GQFA 2ALJA 4BJ3A 4YCMA 3KQMA 2VDPB 2HCBA 3PQDA 1GKYA 5BV1A 5JCOA 1FS4A 4JKOA 4G81A 3UW1A 4M9QA 1QFZA 1ZR4A 4AO7A 2YRFA 5DHQA 4MUNA 4AF6A 1CY4A 2IY8A 2ZRBA 1T0JB 3P19A 2VRBA 1LNZA 3COZA 1V7CA 4K6FA 2C2ZA 1FXWF 3VZQA 4G0VA 1DAPA 3D43A 4U00A 4HB2A 4E1BA 2FCAA 3BXOA 2W2KB 1LPMA 1WWKA 1GN8A 1X86B 1YDHA 4R8MA 1X13A 3BEOA 2Z6QA 2XGSA 2YL2A 3CLUD 3KJIA 4BMPB 1FLAA 3T41A 4Y6SA 2JRLA 3FNBA 2BTEA 1RJEA 1BYIA 4IF4A 1RVDA 5JD5A 1JWLA 1KPHA 1X8LA 2NU7B 2W2MA 1E8DA 2AHRA 3P96A 1GA1A 3TLJA 1NURA 3P97A 1DMRA 4K81B 4LDJA 4ZJUA 4MWCA 3KE9A 1XQ1A 2X15A 4KSYA 4CPDA 4N1AA 1CE8B 4OHVA 4QFBA 5CDUA 4DYHA 1GUDA 4BLWA 2BZGA 3D6FA 5HW0A 2ZQYA 3K0HA 1T9BA 2YN2A 3KKNA 3DD5A 1XELA 4JVLA 1XNGA 3IHWA 2N46A 3O2SB 1UJMA 5H8WA 5JQGB 2VOEA 3D4LA 3AFIA 3DSRA 4DB4A 4HDSA 3N6XA 4KODA 2RGYA 4PFSA 2V3CC 1LWNA 1Q1GA 1ZCFA 1JEDA 2OBFA 4RGQA 2H2GA 2PWPA 4HDQB 1FQOA 3WWDA 4JR0A 1VL2A 5F2NA 5L45A 2ZJ3A 3PQ4A 4KXXA 4BS9A 1RXCA 4PG6A 2JD2A 5HCIA 5U9CA 4QPZA 2GEFA 4L78A 3ZU5A 1L1EA 3DBRB 1WO8A 4IDAA 2PT5A 1QKIA 2QTVB 5B2EA 4EFDA 2I1VB 2A14A 3RB8A 5L3SB 1TZKA 1LI4A 1ULZA 3MN1A 3T1VA 5M29A 3W9UA 4WZZA 3U4CA 2P0YA 3F3KA 5T64A 2P65A 2P4UA 4JLMA 4GMHA 4P33A 2XIJA 3VHXA 5CD1A 1X3SA 4G8JA 2V5AA 4MDYA 4REOA 5FNZA 3SJBA 2ZU6A 1W0KD 3COWA 3UFBA 1B0PA 5HJEA 2QNBA 3VNRA 1HDRA 1KO4A 1M8FA 3DEHA 3GJZA 4ND6A 2M6SA 3Q3JB 2ONCA 5H80A 4Q7JB 3F3MA 4RTKA 1U3WA 4GS5A 3OCZA 1LFAA 4LYYA 1VTKA 1Z6XA 2JFQA 1PK8A 2C9MA 2HLDD 2CHUA 2QL7A 4IFIA 4O4IA 1KYTA 4KDFA 1X7HA 4JT4A 1NVUQ 1Q7CA 2XGGA 3P2YA 2W2LD 2HA0A 4CU2A 2GK7A 3A27A 3KYCB 3DT8A 2XQIA 1ZM4A 2N42A 4OQYA 2J0QA 2B92A 1K0FA 4WXMA 5EKDA 1U90A 2YWHA 3A8TA 3GLKA 3RBXA 1CRWG 2ONYA 4FDTA 4DMFA 4LFAB 1AURA 4KHZA 4D92A 2BFFA 2HPHA 3I1IA 3D3WB 1V48A 4RPHA 5T8KC 2XIQA 4FC6A 2IV3A 1C0EA 5FPSA 2JH9A 3H2HA 2DUWA 1Q74A 2W8BA 4NOJA 3F6RA 1XRQA 2PV7A 3TQIA 4ATNA 4Q4LA 3RT9A 4G97A 2AB0A 4M53A 2CUNA 1ZR2A 2P30A 2P6RA 3LY7A 2GN2A 4FFDA 4GPTA 3GDWA 4WK4B 3LKDA 3LX5A 5F2EA 1SVSA 2PJRA 4G0PA 3DYVA 3JQAD 3CLTC 4KPFC 1TF5A 2E4VA 2FPRA 4G1MB 5DCLA 1JB1A 1Y63A 5ALPA 4JJFA 3NIWA 3SSNA 1XWIA 4DBLC 3AVTA 3EXG2 1E2KA 2ZRLA 2L0XA 3K1TA 3KSMA 2W6JA 4WBXC 3EMBA 5FL7A 5I4IA 4WKBA 3ZU3A 5EKTA 2WOOA 4HAZA 4A36A 1RQ7A 3VZBA 1K6MA 4AMZA 4Y9TA 2Z2IA 4PBTA 1XZDA 1K92A 1Q44A 3OHPA 1XF9A 3R6LA 3BXPA 5FBHA 3T6KA 4B8ZA 4RQAA 3HA2A 2CMKA 1X7YB 4NVRA 3BZUA 2V7QA 4M1SA 2CKMA 2ES4A 2LXNA 3A0UA 3IH5A 4EHAA 4BGVA 5KQGA 3ETLA 3SX4A 1EGHA 3BWMA 2O8EB 5EP4A 2NUAA 2YFQA 1QH0A 3ONEA 5HIAA 3QVXA 2FRDC 1MXFA 1J9EA 3G2IA 3OX1A 3SJ7A 2PUVA 1JR2A 5M2QA 2ZRPA 4DSZA 3PDJA 1GRNA 3W4JA 1LLCA 1FB5A 5K3AA 3X1JA 2CLKB 2JI9A 1XV5A 3KLBA 3KZCA 3OCYA 3T1HB 1R8YA 1J06A 2EF0A 4QICA 4O2AA 2MMCA 5F3RA 2Q46A 2I3GA 3AERA 2XE6A 2EFDB 2IU6A 1X1QA 2YVAA 4G5FA 3HMQA 3U4DA 4PYKA 3H2SA 4D0GA 2XQFA 4NP6A 3IE1A 1VMDA 1J25A 3IDAA 5KO2A 2GPJA 3NT5A 3H2YA 4BE7B 5EUQB 1EX1A 1VKRA 3TMYA 1SHLA 1O5OA 3GRRA 2C95A 1TADA 2BMJA 3F9CA 1BMFA 3EARA 3KUKA 3ZGVA 3FHJA 5IBQA 4LNUB 1N5OX 1NKVA 4M37A 1NI4B 5E9AA 4KQMA 3KE8A 3RUIA 3TN7A 5BQ3A 3UMJA 1ZQ1A 3AUYA 4TV9A 1XTKA 4JBGA 1RHKA 4JUCA 4N76A 2ZBEA 3GK3A 3SM9A 3R24A 2G1PA 3BGVA 3SK0A 4NH0A 1QK5A 1E58A 4K9SA 3W9SA 1P2SA 5J5AA 4HUJA 4ISBA 1YFJA 4BN0A 3D7MA 3TSAA 4J4HA 4R1SA 4XRGA 4ZZ0A 3IJRA 3RSOA 4CM4A 4A73A 3LL7A 3HKDB 4BFXA 1NXQA 4PXAA 1MJNA 5DGDA 3KZ1E 4DQ0A 3VR3A 1IZ9A 1NTRA 4D9KA 2DMRA 1HDZA 2V55B 4YVFA 3IT2A 3VPXA 1CEEA 2CK3D 1ZIOA 2GXAA 1DAGA 1NBOA 3ZDRA 1OYVA 2ZETA 3DWFA 2FSIA 2H63A 4NJMA 4CZ2A 5I7VA 5KOHB 5LLDA 2ZWAA 3LX4A 2QLBA 4H3HB 2FMIA 3C43A 3SP1A 5K0GA 3LU1A 1E79D 3GPCA 5CIQA 5JVDB 3VKGA 1UXIA 3ENKA 1CU1A 4IJUA 1DQPA 4EL0A 2JLUA 2IUFA 4ZP1A 2HOQA 2XMZA 3NHWA 5AKZA 1EJ2A 3KR0A 3LECA 4H1UA 1ODJA 4DMUB 5CNKA 4EVIA 3CN7A 2IYEA 1XK6A 2QD3A 2VRNA 4IXNA 4QFMA 4IPTA 2X9VA 2GO1A 1OFVA 1GPYA 1T3TA 1XMIA 4S35A 5EE0A 1U0EA 1WZUA 1IU9A 2I29A 3INGA 3I1JA 3C6XA 4HXEB 3ZHSA 5L4LA 3RQSA 4LF9B 3DFZA 4JEIA 4ML3A 5HF6A 1UP7A 2I6TA 1UDXA 4QBHA 2PZFA 5CHEA 1E32A 4YMSA 2AUNA 5DHPA 5GMOA 2AXEA 1NBWB 3PPWA 1ZQ9A 4TV8F 5LCXA 1NVFA 1V9SA 1SXJB 2IZOA 4PQYA 5DBIA 3SLRA 1RWKA 3GRUA 3ZCTA 3A2KA 2Q3EA 5D3MA 3T61A 3FOBA 4NYJQ 4WLOA 5CPFA 1E6UA 1ZL2A 3DL4A 3BCRA 3T7DA 2NUTA 2X13A 5FFNA 5ALXA 2YV3A 1ZESA 5DN6A 1EK2A 2P9EA 1IVNA 2GK4A 1K89A 1DQNA 2CUKA 4OYYA 1Y34E 1YIDA 2EKLA 4ISCA 4CM9A 4ETMA 4CETA 1SQ6A 3KD3A 1OOEA 4L2IB 1MABB 1XU4A 2R48A 2WJVA 3LF2A 2OORC 2DHCA 3BHIA 3CLRC 1AK2A 2PLAA 3DVSX 3V80A 2GOYA 3U26A 4FQ5A 4RSGA 2CSXA 1TI7A 4IOKA 4JR2A 1TUIA 2J9XB 2PPVA 1GM5A 1XGKA 2VP6A 1OH8A 1V39A 5IZCA 1RPAA 1B42A 2HO4A 1T9DA 4NESA 4CQJA 5GTDA 3LV8A 4KR7A 1G6OA 4WNCA 3RKUA 1O8CA 2VSYA 3PX7A 3LKZA 5EEGA 3Q6NA 5AW3A 4YJGA 4OHZA 4DDKA 1ISSA 3GRVA 5IF3A 1W581 1X39A 2EV9A 4KIWA 4V24A 1YCGA 1NPYA 4R84A 1OBFO 3VAYA 1TYEB 1JHRA 3MF4A 2JLRA 3N8KA 4IVQA 3WJ7A 3AFHA 1YU9A 3W8DA 2MINA 2XADA 1SXJE 2ERYA 1AQIA 3PUWA 1DJOA 1F2VA 1Y8QB 4B4VA 4EFKA 1GYQA 1FFYA 1O9GA 5E4YA 5LYJF 3JZIA 3EXIA 2XBLA 2O1SA 1Z5WA 5DLEA 5FTWA 3X1YA 5IWAB 2I6FA 2G5GX 1E2GA 2ILTA 5AXAA 1XNHA 4Z51A 2XTMA 4AZ3A 2IY7A 1IY0A 1DKPA 1DC8A 3DMNA 4YRRA 1CNMA 4CKEA 5LQUA 3K8YA 5JCXA 4ESVA 5KKAA 2DJIA 1FYWA 1E3QA 3GJ4A 4YCNA 1CJSA 5BVHB 2DWQA 1G8KA 4JP8A 1DAHA 1DJPA 5BNZA 5EJ2A 5CB4F 5ESXA 3SEZA 2I6XA 5TQ0B 3DDWA 4GP6A 1QTQA 4AURA 4K87A 1QU3A 5AJHA 3WWPA 5EJ7A 3LDAA 4AKHA 1K7FB 4C0JA 1FRZA 3NWBA 4TN5A 5AHOA 1GGJA 3BZBA 1TAGA 4NBKA 3T4PA 1BHJA 4RPCA 1P8JA 2DWUA 3JTMA 5GZ3A 1NW6A 2C7GA 3GAAA 4P31A 4UTVA 1P5FA 3KEFA 2FMKA 3PUJA 5HDQA 3WGNA 1RJDA 3RYFA 3EUWA 3ZE6A 3DCYA 7GPBA 2GKOA 5BRJA 5AVZA 4IILA 3T9EA 1JU4A 2OESA 1U1IA 1RZRD 3DG9A 1N8TA 3ABOB 1IZ7A 1SZJG 3GEEA 3ZHTA 4CMCA 2R3SA 4CEIB 3W34A 3W2HA 4TVBA 1THGA 3U3ZA 4D4IA 2EFCB 4N5LA 1IXRC 3WOVA 5IAGA 1C7JA 3LFUA 4KO4S 3JAWB 3RS2A 3S2IA 4F5ZA 4FQ7A 4CTOA 1RKVA 3HR8A 3VH1A 1I2ZA 2JLYA 1MW8X 3GJ6A 3LT4A 3G9ZA 2FSFA 4NDAA 4RD1A 2JFGA 4TTRA 4WOPA 2ZRCA 2FF7A 4X3PA 2BKEA 2DUUA 2Q5LA 3HGQA 3IA7A 4MUYA 4XSVA 4GKKB 4JYCA 2HDWA 1E9AA 3WFIA 3OJEA 1E1KA 2H54A 3WP0A 5K45A 3UPTA 4HLQB 1NQOA 3FZQA 3IO3A 4BJHB 3THXB 4CF5A 3W9YA 4MVJM 5IJ0A 3RVDA 2E49A 3FNEA 3RS0A 4ZOAA 2COKA 1B6GA 2YZNA 4MGKR 3VVLA 2FVXA 3SBEA 3WMRA 4EW6A 4JU8A 5KJCA 1EFRA 2G82A 2G0AA 1FJHA 3NTVA 4WOCA 4FYKA 1EE1A 1KTVA 1ZGCA 2VTKA 3E1KA 1MNAA 3PB3A 4QVKA 1L1QA 3DDCA 1A71A 1TYZA 4B6PA 1OZFA 3CWCA 2GBLA 2CV1A 5AKXA 1E5LA 3VR4H 2QROA 2NW6A 4IFTA 1T5LA 1O6GA 4ZAGA 4Z0HO 3K1AB 1NW7A 4LCEA 1IQ0A 2AE1A 1QFSA 3L0BA 3QP9A 4WZAE 2WP8J 4ZPJA 1J09A 1CB0A 2VWHA 3OPQA 3MJVA 3DEYX 3A4LA 2VP4A 3AXTA 3OQIA 4MR9A 3ZJVA 3FM9A 3PKZA 5KNBA 4J03A 3SXJA 4AY4A 4L3OA 2VXCA 1KI3A 2H4XA 4C30A 3BRWD 1MAUA 3NYWA 5HFNA 3BPSA 1O95C 2FHSA 4FYVA 4JNCA 3VUFA 4QBTA 1U04A 4RGYA 4YCDA 1RQNA 5DF1A 1EUZA 4D02A 3FFBA 4DBZA 4BNGA 5KQMA 3RH0A 3D7KA 1YBAA 2XPCA 3G82C 4YJFA 4BAUA 4D98A 2O2JA 4FEAA 4K0KB 3UA4A 4ZZ2A 5BPHA 1YF3A 2VHJA 1OASA 4D9JA 1OWNA 3SY8A 3OAAA 3U9SA 4UATA 1SG0A 3E2PA 3QEAZ 5DLYA 2VUUA 2DFLA 5B3JA 1NN1A 4M46A 1H4SA 3H6GA 3MGAA 2SCUA 1GA6A 4ENWA 4ZHQF 1NHGA 3GD5A 4BGIA 4HWGA 2FSVC 5ADWA 4EA6A 5CMLA 1DTWB 2WIFA 2C9CA 2IE8A 2WM8A 2Y0DA 3EQ7A 4IOMA 4I1UA 4HEHA 3JAKA 3RIYA 3RAFC 1HFEL 2ZCUA 4RXUA 2GWRA 3MCWA 3FPSA 5BSWA 1RHRA 4OP1A 1W85A 1Y6JA 3T0FA 1LZLA 4DGQA 2HU2A 2H1WA 1KI8A 2REBA 1WZNA 4P08A 1AOXA 1F51E 4E51A 2R1VA 3DF9A 3ENVA 4BDSA 1F5NA 1WL8A 2WZDA 3A1DA 1S4MA 2ZJ0A 1FFGA 1KP3A 3I42A 4KG7A 3IKVA 4BVGA 4ZEVA 3DLBA 1IHDA 2RGGA 3O4VA 1M8GA 3RO7A 5F51A 4LOHA 1XEXA 3VR6A 3ZHCA 2BVNA 1ZFNA 1V6CA 3GIWA 3IAM1 4N6NA 3ZGXA 4JGIA 1WABA 1HGXA 3OJLA 4Z0NA 1KZ9A 2HSDA 1BE0A 4M9CA 5C7OO 1C7IA 1OFGA 2VJYA 3RFTA 3ZH9B 4RVUA 1IN6A 1U5CA 2W48A 3AVOA 5K0ZA 3SEQA 3USES 5JSFA 4F7DA 3DA8A 3JZAA 2CHGA 2G1UA 4R3UC 4YAOA 5IUKC 3E8MA 4KVGA 3IDFA 4WZ6A 2HDOA 3DV9A 4LMPA 2XKJE 1B8OA 5FWYA 3EPLA 1A8QA 1TUGA 3QE0A 1E20A 2P1DA 4TLBA 5DYIA 4R1MA 5EXEA 3R74A 3GGJA 3R3JA 1WHSB 2A0WA 2ZE6A 2O3TA 2Z8ZA 4V3BA 4XLLA 3V4PB 1GPBA 5CEFA 1F8GA 4XPIB 2MIIA 2A1UB 3TB4A 5C53B 1B23P 2EWVA 2XOXA 4CEJB 1BVRA 1W1IA 1ABBA 2IPAB 4BNNA 1QIHA 1LTQA 3KLOA 2AOXA 4IS3A 4GC5A 2B7BA 4MV0A 4RHCA 4HQRA 4EFNA 1L5OA 1VECA 5K03A 1K8RA 1TM4E 2VPZA 1UWCA 3SHWA 1ISGA 1EPUA 3D5TA 3MGBA 4ND8B 2DPGA 5EJ8A 3ZBPA 1AS2A 1YNSA 1O0SA 3CR8A 3E70C 1F20A 3FLBA 4QBGB 5BV7A 4OFWA 5GZ1A 4E94A 1QO7A 3I58A 1YAHA 4QUIA 3X1WA 2IXBA 3M4ZA 1XRLA 4FXPA 4TYPA 3ITNA 1EHIA 1XD2B 1TMYA 3JU3A 3G9XA 4RGVA 2VZLA 4HGZA 3TLZA 4AWAA 3G9TA 4IMRA 2QUKA 1UZMA 1W2HA 2AJDA 2C9YA 4KX3A 4DZZA 3HTXA 1U7UA 4MHOA 2FSHA 3STXA 1P7CA 4Q12A 4BRWA 3ZC3A 1AGRA 2YHSA 4PQEA 1A9PA 3FCXA 4N7RA 3BMOA 5KWVA 1QIJA 2VTEA 1J7JA 2IIPA 2LD4A 4HFMA 1J2YA 5J4VA 5ICCA 4LRUA 1TMOA 3FPGA 1ZVQA 1PJBA 3QU5A 1QG0A 2OG1A 1IEVA 2DFPA 2B8WA 4CN8A 4C4AA 2ZUEA 2C98A 4QT4A 4NU5A 1YIAA 2A92A 2WZBA 3ETJA 3TRJA 2A9OA 5LR6A 2K6GA 2GN9A 2C94A 2IXDA 1YIOA 2FUKA 1FDRA 2W2KA 4P4GA 1DBRA 4TTVA 2BL4A 3EC7A 3LM8A 3PQ7A 4FZRA 5LZ9A 1URPA 5C18A 1UBHS 2NACA 2ZSHA 4DR5B 1Z0KA 2QOEA 2XXAB 4AJHA 3IQFA 1OBOA 1JFFA 4BZWA 2X4DA 2A0FA 1JP7A 4PLWA 2ZW9A 3WSVA 4UZFA 3BRQA 5AUNB 3EY4A 3JS5A 1N1MA 2I22A 1ZA1A 5KYVA 1SD2A 1PUIA 4CW7A 3V4VB 5JLAA 4D1YA 3SZUA 1M1ZA 1E3EA 2B2NA 4IHJA 5FWXB 5LMCA 4ENUA 1ZXLA 1EQAA 3NWJA 4HNSA 3KU1A 3S7TA 4BNHA 3AU9A 2JASA 3ZUGA 2B8NA 2O52A 3T7SA 1EA5A 4F4DA 1H22A 2WK1A 4LG1A 4ZOEA 2XQJA 3THOA 5KYXB 1B4DA 4G1UC 4C7BA 3A25A 1OLXB 4LZOA 2Z1NA 4HLDA 4AP5A 4ZCLA 1D2EA 2G08A 3FTCA 5IUJC 1PZFA 4C22A 1I4LD 2VJMB 3LDFA 3FWNA 4ZT3A 3ER8A 1PWXA 4ZEMA 2I6UA 3QGMA 4NFSA 1LEHA 3C39A 3L0OA 1QZTA 4OQLA 3BMNB 4PE5B 5F9HA 2JAPA 2NO1A 3ASZA 4QAJA 3V4ZA 4KACA 1G6HA 3G5MA 2OHJA 1UKBA 1USKA 2E5LB 4WLVA 1VL1A 2PKWA 3CEAA 1ZG3A 1UZLA 5LMUB 2ODPA 2JFPA 1K6EA 3KR1A 2IUTA 3M8KA 3D0QA 1Z2DA 4JODA 4W1QA 5A5VA 3KHKA 5HIIA 3H84A 4M8IA 4M9SA 3O93A 3D5EA 3WK9A 3L4JA 5HF9A 1PZEA 3K35A 5KTNA 3WBFA 1XJ0A 3R44A 2I8LA 1C30A 1ZBQA 3EQ9A 2VH5R 3GP3A 3C6ZA 3HXPA 3K20A 4WY5A 4V0MA 5COQA 2YWJA 1M7GA 1BRMA 4HYQA 4XAQA 2CVHA 3TDKA 4QG3A 2Z58A 3PQFA 4Z4GA 2RKBA 4GRDA 1R37A 3DMHA 1NLZA 4ZMSA 2LKDA 3ZPXA 3ETDA 1XSEA 1LPNA 2V7VA 2BM8A 4WBSA 1CUCA 1OVGA 1ZDMA 3KYCA 1PFUA 2BI8A 3F90A 3I3SR 4ZEWA 5K99A 3O8CA 3MT7A 4NL4H 2VF4X 1P1FA 2AFIB 3Q2OA 2VAXA 4WBNF 3OOWA 1X42A 1T35A 4JKYA 1C3JA 3ZWCA 2JARA 1I0LA 1Z7WA 3IUSA 2WV7A 2W6ZA 4L08A 4OYHA 4RACA 1M2HA 1QGED 3MTQA 4G0NA 3TNDA 1MXHA 4F4UA 5CFZA 4L8YA 1P45A 1KFCB 2I4IA 2HRRA 3E6AA 4RORA 1XZKA 2A0UA 1TYCA 2CL6X 2W6OA 2ZBDA 3OQVA 1CJCA 4JLJA 4JLNA 4Q1FA 4E2WA 2GA9A 1P5JA 1W5EA 3IVXA 3SMVA 1F7UA 2RK4A 5BW8A 2BFDA 4O5AA 4XJSA 1GFWA 4B3RB 4E5VA 2GJ8A 3PC8C 4TTJA 1L5FA 1AIPA 1VJCA 4KB5A 2LE0A 2SKCA 3NONA 5FOVA 1Q91A 1KIAA 4KYTA 3D6VA 2FPLA 3GG2A 4DL9A 1T0IA 2O6HA 3M3HA 1DC6A 3JQRA