1MG5A

Crystal structure of drosophila melanogaster alcohol dehydrogenase complexed with nadh and acetate at 1.6 a
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
255
structure length
255
Chain Sequence
b'SFTLTNKNVIFVAGLGGIGLDTSKELLKRDLKNLVILDRIENPAAIAELKAINPKVTVTFYPYDVTVPIAETTKLLKTIFAQLKTVDVLINGAGILDDHQIERTIAVNYTGLVNTTTAILDFWDKRKGGPGGIICNIGSVTGFNAIYQVPVYSGTKAAVVNFTSSLAKLAPITGVTAYTVNPGITRTTLVHKFNSWLDVEPQVAEKLLAHPTQPSLACAENFVKAIELNQNGAIWKLDLGTLEAIQWTKHWDSGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alcohol dehydrogenase
publication title Drosophila alcohol dehydrogenase: acetate-enzyme interactions and novel insights into the effects of electrostatics on catalysis
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 98
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2002-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1mg5A00
4DIOA 5KVCA 4CQMB 3OECA 4OH1A 5JDCC 2AG8A 1ISHA 1SPXA 2W90A 3MJEA 1NAIA 4OKNA 1V0JA 2P5UA 1QLJA 3GNTA 3JQ7B 3OEWA 2PFGA 3FWNA 2X9GA 2ZTUA 1ZK4A 4WASA 1G6KA 3JQ7A 2X5OA 1XHLA 1UP4A 1VE9A 4B4VA 2QHXA 3PDJA 3GVXA 1HLPA 3QWHA 1B8VA 1B26A 2EW8A 4RLHA 1WDMA 3L9XA 1NWCA 2VYNA 3ROQA 3NKLA 4IQ8A 3ITDA 1ADGA 1N1GA 1CRWG 4EJMA 1EFLA 2RHRA 2CF5A 3RWBA 3K5PA 2E82A 3NGLA 3NTRA 3IMFA 3JQAB 4R3WA 4ZD6A 1P31A 2OP1A 4P22A 4EUHA 2O3RA 4AJEA 5JXWA 4HY3A 3Q11A 1Y1PA 1WAMA 5G4LA 1PJTA 2R6JA 2GRAA 3ONEA 1LDBA 3DZKA 2CVQA 4QO8A 4H15A 4PG7A 4XGNA 2J6IA 3WX0A 4X54A 2PH5A 1CJCA 1HEUA 4MPDA 4A5OA 1E7RA 3U4CA 1P0CA 2VYND 2HRZA 4E2ZA 3WYEA 4JCOA 3V1UA 5KCZA 1A27A 3ZV4A 4FN4A 2OGUA 1ONOA 2VHYA 1DLIA 5DCUA 2HMSA 2O4UX 1EBFA 2CVOA 4R54A 4K26A 3KRTA 2IZ1A 2E6UX 2W2LA 1EFKA 4ZQGA 3NT2A 3W8EA 4WOKA 8ADHA 1ZO8A 1NYTA 4Z0HO 4P38A 3SVTA 3I5MA 1BDMA 4D0SA 3HN7A 3WDSA 5ES3A 2NVBA 4Q3EA 1KVUA 3C8MA 4D0RA 3GFBA 2PTGA 1K5HA 1M6HA 2JFGA 3ZNNA 3GT0A 5HTOA 2ZIZA 5DCYA 1U7TA 3ETGA 5DF1A 3GF4A 4FJ2A 3ZWWA 1YGYA 3GRKA 1JKFA 2B4TO 4J2HA 4XDYA 3E18A 4CM6A 5IAAA 2EXXA 1B15A 3BMNA 2Q1SA 4IDCA 4KUHA 3PIDA 3C7AA 2QRLA 3ENNA 3R3JA 5I9LA 5KKCA 1JDJA 4BNNA 1DO8A 4A7PA 1E7WA 2PV7A 3DDNA 2HK7A 4FCCA 4IGEA 1Q0HA 1YQGA 1YB4A 2I66A 4MKXA 1G1AA 2Z1NA 3IQDB 4FOSA 4DQXA 3WFIA 1JVBA 3X2FA 1EQ2A 1H2BA 4KQXA 4AJNA 1OAAA 2Q2VA 4O1MA 1UXHA 1I01A 1R0LA 3B1KA 3ITKA 5C37A 1V3UA 5KVQA 1I2BA 2B5WA 3RASA 3JD2A 5JCXA 1SC6A 1F8GA 2ZATA 2DAPA 2G0TA 5DZSA 5TF4A 1PX0A 3ZU3A 1DEHA 1LLCA 1S6YA 3H3JA 3PXXA 5F5NA 1KVSA 1Q0LA 2DC1A 3JQFC 4TWRA 1ZSNA 5CDSA 5CG2A 1PTJA 2PZLA 2PLAA 5KVVA 3DAGA 2Q45A 1KVTA 3R3SA 1PWZA 1X0VA 1VKOA 4BNYA 1AXEA 2H5LA 4LGVA 1ZK0A 3UICA 4J7XA 4EZBA 1A5ZA 5CEFA 4G65A 4W4TA 3QY9A 4AJLA 3RC9A 2AEJA 4RDHA 2IZZA 2CDBA 5BT9A 4J1QA 2HUNA 3NAQA 3HG7A 4U0JA 4B3IA 3KBOA 3KSZO 2O3SA 3ZWAA 1BVUA 3BA1A 2Q49A 4NJOA 5A5EA 3PYXA 2D1YA 2ZCUA 4U6QA 3TZKA 1SBYA 1H93A 4ZICA 1Q0QA 2AE2A 1OC4A 1UXIA 2BFAA 2GN8A 4R69A 3QWIA 1EUCA 3G79A 5EL0A 5EPOA 4YEDA 5F1OA 5IDWA 4E2WA 4HFRA 3QE3A 4Y9DA 2CD9A 4WLEA 4IDAA 5JYDA 2VHXA 1PS0A 4NBVA 1PJLA 4BNIA 2PGLA 4HNGA 1V3TA 3LU1A 4CR8A 4DUPA 3GC6A 4JGBA 1W73A 1VC2A 5JBIA 1MFZA 3VVCA 1LDNA 1HE4A 3E48A 5BR7A 3LC1O 3W4KA 3VZSA 3ZZNA 4BGVA 3MZ0A 1J6UA 4LRTB 4DQVA 1E1LA 3NUGA 2NACA 4RLSA 4GGOA 2BMAA 1Z7EA 3C24A 2C07A 3JQEA 2EKQA 1GZ6A 1PIWA 3JD1A 3WLFA 5JC8A 2YW9A 2O3TA 3C1OA 4WCFC 2OP0A 3JQFA 3A9WA 5L95A 3OQ6A 4LSWA 3D4PA 2B83A 5L4LA 1JWBB 1E7MA 4UVDA 3W8FA 2CF6A 3D3EA 3WWYA 4NFSA 3F1KA 3OQBA 4DYVA 3HQ4O 1BXKA 5IN5A 4CUZA 4ZA2A 4QFCA 2P9CA 4BO5A 3PWSA 4S1VA 3Q1LA 2NTJA 2ZQZA 1Q7GA 1Z74A 1X7DA 4RQTA 3IL2A 1U3VA 5IJZA 5COAA 3UF0A 2UUOA 1N9GA 1Y5MA 4OSPA 5KJCA 1PU2A 3FPLA 1E7SA 3F5SA 2FN7A 1I30A 3PHJA 3H6KA 3AWDA 1A72A 1R4NA 3M1AA 4ESOA 1TA4A 4WLUA 4B4OA 4OOFA 4YJFA 2VT2A 3DWFA 1W4ZA 4ND3A 2OBNA 2Y05A 5EERA 3O4RA 3K9QO 1BSVA 1BWSA 2C54A 1Y6JA 3HUDA 1U28A 3KYCB 3K30A 4YT5A 1QKIA 3M1LA 5LDGA 3E5MA 4EBFA 1LDMA 4E32A 4K28A 1QYWA 4E3ZA 4WCFB 1JLLA 2DUWA 3ZHYA 1T4BA 1WVGA 3P2YA 3SEFA 1PJ2A 4XYLA 3H8VA 2E37A 3SLGA 5L53A 3PTZA 3GNSA 4FD3A 3K31A 3ONFA 5KTKA 1Z75A 4XGIA 3EK2A 3RI3A 1P1FA 4TKLA 3IS3A 4PVCA 3WQRA 4Y6PA 2FZEA 1C0PA 3WG9A 4W9NC 3GDOA 2QRJA 5F1KA 4AJ1A 4MOWA 2EKPA 4YBZA 1AHHA 2X86A 4Z6KA 5CEEA 4XGKA 3S55A 4I9NA 1KEWA 4CUKA 4IXWA 2W4QA 4M89A 1U4OA 1Y5RA 4TSKA 1LLDA 4B3JA 3ZV6A 2RH4A 1GZ3A 3RC1A 3NGXA 3U09A 1K2WA 2JAHA 2CNBA 3LDHA 1WZIA 1NVTA 4ONEA 4PLZA 4BNJA 3PK0A 4GQAA 2GDZA 1R6DA 1D3AA 3IKVA 4R9SA 4I8XA 1OBFO 1YB5A 1B8PA 1U4SA 3K6JA 1JA9A 1ZKMA 1PZEA 1QYDA 5A1TA 4DYDA 1LSOA 2O23A 1ARZA 4MVJI 2FR8A 1EQUA 2J3JA 5JMPA 2RAFA 1LC0A 2A35A 1U7HA 3ENKA 1QR6A 4OO3A 1IL0A 2AMFA 3ZNQA 4BNLA 1R4MB 1GDHA 1HT0A 2GLXA 5K9ZA 1ZK3A 1GTMA 2Q3EA 3GUYA 4R9RA 3UOGA 5AXAA 3QRWA 4HUJA 3IIEA 2GCGA 1T2DA 2VRBA 3NTOA 5DOZA 1T2AA 2NU8A 3GGOA 4WLFA 2VUSA 5ICMA 1EZ4A 1A7AA 3TL2A 3UCEA 2A9FA 4R16A 2B0JA 4W9NA 5JO9A 1HXHA 4F6LA 5C7OO 3IUPA 3RC7A 4XA8A 4DC1A 4XJTA 1VSUA 4E12A 3HHPA 3FRJA 2VWQA 4O63O 2HKIA 4L0QA 3E1KA 3INGA 1C3VA 4CMGA 3IJPA 4QXMA 1F8FA 4RJTA 4PVDA 4CLEA 2XAAA 1C0LA 1DRVA 1LLQA 1PQPA 1GEGA 4RZIA 4TRRA 3WTBA 1YOVA 2DTDA 2FOIA 1NQTA 2I9PA 4PLWA 3RVDA 4UUPA 1F06A 1AN9A 1SO8A 2FWMX 1LTHR 4YJGB 4TVBA 4L4RA 3IDSA 1EE9A 3JV7A 2PZKA 3P5SA 3ABIA 3BMCB 2I6TA 1DHRA 3MJVA 4IDBA 1BW9B 3KETA 3AOEC 1HLDA 2O50A 3D3WA 2YYYA 1DC5A 3DBLA 3PEFA 4EJ6A 1P0FA 1JQBA 3KHUA 3S2IA 1GUFA 3BZUA 4DTIA 1E6EA 3WSWA 1PGNA 1NQ5A 2O3JA 2XXJA 2PD4A 2IEBA 2BF7A 2OO5A 4TMFA 4XEHA 3DFZA 4UEKA 5GMOA 4MVJE 1YBMA 2WSBA 1AXGA 1L1FA 4YR9A 2GF2A 3PQDA 1DIRA 1CETA 1ENYA 1PQWA 1O8CA 3E03A 5IDYA 1MG0A 2HMTA 4YDRA 4MVJD 3GFGA 5CEJA 2ZQYA 4JQCA 1EEHA 3PGXA 3H9UA 1E6UA 3QIVA 2FZWA 2A4KA 4KMSA 5TSDA 2JCVA 1DC6A 1VPDA 1I2ZA 5ER9A 4F6CA 4XR9A 4D3DA 5ENDA 1IZ0A 4QTZA 2GN6A 5CDGA 1NNUA 1TT7A 4BO8A 1HF3A 1D4FA 4E2YA 1VL0A 2NVUB 3RBZA 1DDOA 3KTDA 4RF4A 3V1TC 2BLLA 1F14A 2WE7A 4W99A 5TC4A 2DPGA 1XQ1A 4QEDA 3WFJA 1O9BA 3QLJA 4FDAA 1IOLA 4XR4A 1HE2A 3FNEA 1B3RA 4ROSA 4CL3A 1A9ZA 1SAYA 3FPCA 3A4VA 4AJJA 4NBUA 3FI9A 3A1NA 1SMKA 2FY8A 4WLOA 7MDHA 4N5MA 2DFVA 4NQZA 4RF5A 3JQBC 5COQA 2WYWA 2BFOA 3MOGA 4BO7A 2JJYA 1MX3A 4WJZA 3WMXA 4PZEA 4XYBA 3RU7A 1Q1NA 2Y1FA 5TGDA 3L0DA 3TZCA 3JQ8B 1H5QA 1T2CA 4NK4A 3CMMA 4ALKA 1T1SA 3RBXA 3E82A 1M67A 3V2HA 2DBQA 5JCJA 1BXZA 4WLNA 5A9TA 5EESA 4CQLA 2R2GA 3I9JA 5BSGA 4QQRA 5JAZA 4XYGA 4YYZA 2NU9A 2OBYA 3HSKA 1BHSA 2YY7A 1FDUA 4YVFA 3WTCA 4DLBA 3PHGA 4HBGA 3OF2A 4J0EA 4DC0A 5ILGA 1DPGA 4CM3A 3H2SA 4XQCA 3IAHA 1MFPA 3D4NA 1YDEA 3DONA 3EUWA 4IMPA 4OXYA 1ZBQA 3K2EA 5DCWA 1BXGB 4DMMA 1K3TA 3VTZA 4RDIA 4QT0A 1P77A 5A9SB 2AEMA 3AUUA 4NJMB 5CAEA 3S2GA 5DP2A 4CM8A 2RBEA 4NJMA 1AGNA 2X4GA 2E48A 2YDYA 1QLHA 1RM4A 4QX6A 3ZDFA 4XRGA 4DLAA 1BDBA 4OOEA 3GVHA 4AJ2A 3ROKA 2Q2QA 2QYTA 2OFPA 4OJNA 3RFTA 1ISGA 2VTDA 2D5AA 2VNSA 3PWZA 4MP8A 4R51A 1RM0A 5JY6A 4RPLA 2YUTA 3QJ5A 3D4OA 3NDRA 3UAGA 1CEQA 1P1KA 2AQHA 3OA0A 4GH5A 4MO2A 1LEHA 4IGFA 4Q3AA 4GWKA 3C7CB 4J91A 1DOHA 3LF2A 5A02A 1N5DA 5T57A 4OQYA 2P5YA 4D7AA 2YZ7A 3CZMA 4J0FA 4IXTA 5TJHA 4XQGA 2C59A 3DMTA 3NT5A 2ZK7A 3AUSA 3TZHA 3EDMA 5B4UA 2J5KA 3ZNPA 4GGPA 5I8ZA 2WE8A 1U5CA 2X23A 4GVXA 2X22A 4J90A 4J6FA 3OBBA 5CDUA 5HRUA 3A28A 4I9UA 2BRUA 3HE3A 2WYVA 3P2OA 3EW7A 4PZDA 5CG1A 2DBVO 3PYLA 1NX6A 1HZJA 4Y8VA 4FB5A 2NSDA 1ZJZA 4KDFA 3GNQA 3CINA 4LVUA 4RVSA 4R41A 2QZZA 5I8WA 1NPTO 1NFRA 2R00C 2OMEA 4GVLA 4E31A 1RWBA 1TB4A 2WYUA 4ZRMA 1KVRA 3KYDA 1P9LA 4MDHA 4ALJA 1CIVA 1ZW1A 1KEUA 3JYOA 4NPCA 4RGBA 3WYCA 4TROA 3PHLA 2D4AA 3QVSA 1K6IA 3LVFO 3DXFA 3I6QA 3C7DB 1NM5A 3VPGA 2P4HX 4PCVA 1B2LA 4E5KA 3KV3O 4S3MA 4EGFA 4A03A 2GZ3A 2E49A 4U6SA 2BI8A 1MGOA 2X7HA 3MWEB 3GZNA 3AUTA 1E3LA 3LC2O 3ZV5A 1GUZA 3ZCXA 3D7LA 5ENVA 3KSUA 3TRIA 1KBZA 4KWIA 1PZFA 3AUAA 4A73A 5KNLA 3I9OA 1O95A 1H94A 4C4OA 1GADO 1EBUA 2AHRA 4UVEA 4CLHA 3SJUA 1XG5A 2PKQO 4NK5A 1ULSA 1BTOA 3IJRA 2ZYDA 4PIVA 3WBFA 3WR5A 3R1IA 1KEPA 2GZ2A 4G5HA 2IE0A 4BOYA 2Y1DA 4FSHA 4WK6A 1ML3A 2J3HA 2VRCD 3TOZA 4RPKA 5ITVA 5U9CA 3OHSX 3DHYA 3H65A 4NU6A 4OIMA 1ZUD1 3ROMA 1DHTA 2EJWA 4IDGA 4BNVA 4LCEA 4ZJUA 1SB9A 3BTUA 1PGJA 2R00A 3AM4A 3GA0A 3ASUA 3GGGA 4IM7A 4J9UE 3ZWPA 3AJRA 3RJ9A 3VC7A 4IPTA 5JFOA 4FS3A 4CV1A 1XA0A 2CUKA 2X0IA 2NM0A 2Y66A 3H3FA 4YJHA 1NR1A 4BB5A 4E21A 3RUCA 3CZRA 4QFDA 3AM5A 1O94A 3IP3A 4OKIA 1QMGA 3U49A 5F21A 4WKGA 5IFLA 3PJGA 1DIBA 1KOLA 4B79A 4YRAA 3ZV3A 2EV9A 2HRBA 2YFQA 3NEPX 4NDNE 3UN1A 4E6PA 1PZHA 2C0CA 4IMRA 1P33A 3OIFA 3X2EA 2D5CA 1HYEA 3BIOA 1N92A 4EEZA 1N7HA 3AOGA 3GAZA 4YXFA 3L6EA 1KY5A 1ZK2A 4P4NA 1K6JA 2JHGA 5JS6A 2JHFA 4DGSA 5I7VA 1I3NA 3WGHA 3ZWNA 3K8ZA 5KOIA 1H6CA 4QO7A 4IQ0A 3ZWMA 5B12A 1ZEJA 5KWEA 2H6EA 4KDEA 4XQEA 1XGKA 4BGEA 1DAOA 4EJ0A 1MXFA 3LYLA 4YQZA 4CLOA 2DM6A 3CSDA 3TJRA 2C5AA 2IDZA 4FJ0A 2HSDA 4ALLA 2PGJA 1NBOA 4PFJA 4E5PA 4NFYA 3TOXA 1MXHA 2WMDA 3BMNB 1Y8RA 5I7EA 3V2GA 5TX7A 1BGVA 1NFFA 2WTBA 1ZK1A 4IDFA 3DZIA 2QIOA 4BQRA 1WMBA 4F3YA 3M6IA 5DN9A 4MP6A 3DHNA 4WLVA 1GYRA 4EITA 3OA2A 4A10A 5H83A 3TSCA 3FBGA 2ZTVA 4BB6A 4CM5A 2POQX 3L4SO 1EVJA 4W7HA 3ST7A 2BI7A 4BVAA 3H9QA 4H3VA 3T7EA 3ZWOA 1ZXBA 1LQTA 4BNUA 4DIBA 5KVSA 3CH6A 3PLRA 1VL8A 4OAQA 1KY4A 1Q2XA 2I67A 3LK7A 4I5GA 4M1QA 2GUGA 2G5CA 2YJZA 3UVEA 4EEXA 2Y0DA 4B8WA 3G1UA 1DJQA 4G81A 3MJSA 1R66A 1A9YA 5GY7A 3CIFA 4CLRA 3OJ0A 1PJCA 1Q7CA 4MP3A 3ZH2A 2B35A 3QVXA 4BO3A 3JQGA 1U1IA 3H5NA 2J3IA 3KOUA 5F5LA 1GV0A 3UHAA 3WLEA 1UAYA 4CMBA 2J8ZA 4PLHA 3CPSA 1XELA 3B70A 3L9WA 1HDGO 2I5PO 4PLYA 4BKQA 1VM6A 3OIDA 4OXKA 2PZMA 5TJ9A 1HE3A 4JJIA 2P9EA 3DZGA 1H6BA 4WNCA 4YPOA 4NR0A 4YCAA 2ZJ1A 1DIGA 2X0NA 2EJVA 3AK4A 5MDHA 3BTOA 2VUUA 4D3FA 1S7CA 1QV6A 3LZ6A 1WXDA 4JK3A 2QZ9A 2X0RA 4B8ZA 3RUHA 1XLTA 2O2SA 2X8LA 3GEDA 4H7PA 3GEGA 3QVTA 4E4YA 2J5RA 4K9DA 5KJ1A 5A4DA 3PJDA 1NAHA 3DTYA 1I8TA 1GPJA 1PQUA 5U4QA 1UP6A 2PGDA 1U3WA 2AQ8A 4KTTE 2FSVA 3QVWA 3W6UA 2Y68A 1IULA 3VDQA 2OUIA 1LU9A 1XKQA 3BTSA 3W6ZA 4GBJA 1EDOA 1KS9A 4YT2A 4XD2A 1I36A 3HN2A 2IZ0A 3VZQA 4PZCA 3FF4A 4R4JA 4EDFA 3QW2A 3PVZA 2ZYGA 1HDCA 3LF1A 1HTBA 1NQAO 1PL6A 1YL7A 1ADFA 1W6UA 4NU5A 2G17A 2HCTA 2OHXA 1HKUA 1RYEA 1K89A 4PRKA 1VL6A 4JJGA 1T2FA 3OP4A 1U2GA 2DU8A 5FWNA 3CMCO 2XXBA 3G0OA 4BNXA 4YTEA 4YA6A 4L73A 1J49A 2GD1O 1JVSA 2DBZA 3MOIA 1LC3A 2C82A 2O3QA 2JCYA 5G0TA 4CODB 3KB6A 1I0ZA 4PLPA 1GD1O 3P7MA 4WGGA 1UDBA 5HS6A 1TT5A 1XCBA 2B36A 1AHIA 1XDWA 2DPHA 2Q1TA 3QP9A 4CR6A 3WYBA 1ISJA 3D1LA 1GV1A 3MTJA 4ND2A 5C7IO 3GVPA 1UZLA 3N58A 1YKFA 2O7SA 2VYVD 1N9GB 3F9IA 3ICPA 3ZNOA 4RVUA 4DPMA 2OL4A 1QP8A 1MG5A 1I3LA 4DLLA 3WJ7A 1QYVA 1HSZA 2HJSA 3PHIA 4IJUA 1R4NB 4FC7A 5G0VA 3OEYA 4TVOA 4YJFB 1AE1A 1NR7A 4MKRA 4UVHA 4DBVO 4DREA 3G1TA 3TN7A 2D3TA 2RIRA 2P68A 3RUDA 1X1EA 1ZCJA 2Q50A 1E6WA 3H9JA 1DBVO 1VJ0A 4NBTA 1VJTA 5JDIC 1UZMA 1UXKA 4NBRA 7ADHA 2C29D 5DP1A 4MJLA 1HL3A 1WDLA 3TNLA 3I52A 1TI7A 3N74A 3KEOA 5EINA 4XB2A 5IF3A 1FJHA 5DBGA 1UR5A 1MC4A 4JXKA 4Y6RA 5B37A 4HFNA 2C7GA 1ZIDA 4RCVA 5LDHA 1T26A 4J4BA 3NYWA 1YBVA 2PKRA 4CM9D 3JD3A 4P4LA 3AFNA 3F3SA 1HYGA 3UFXA 4BUCA 3AU8A 4Y98A 3GZ4A 2FRDA 4U7WA 5TT1A 4EI2A 3T4EA 3FHLA 1E3WA 3ZHXA 5JY1A 1E1MA 4DVJA 4W7IA 1YBAA 2A94A 3EAGA 5I9NA 2NU6A 3RUIA 1UH5A 3ZHBA 1LDGA 3ZW8A 2I3GA 2VZ0A 3WS7A 1LRJA 3DBRB 1Z7BA 1DSSG 2NNLD 4BGIA 2EERA 5CDYA 4GPD1 2I99A 3DBRA 4M87A 1O0SA 3FCOA 2GYYA 3GG2A 3PQFA 4N7RA 2HAEA 2TMGA 1Y81A 4IJVA 3VPFA 5IDQA 2X0JA 4FFLA 4XJSA 1TXGA 2Q4EA 1KERA 4BKRA 1A7KA 1A4UA 3NJ8A 4IJWA 5JDIA 1UAGA 4R1TA 2C2XA 4OHUA 1M6WA 1ZJYA 2VWHA 3I23A 1TEHA 2VHVA 3A06A 3QWFA 4L8VA 4O59O 4RF2A 2Y67A 3W4IA 3WOHA 4GKBA 2CMDA 1Y8QA 1X13A 4PLFA 2YV2A 1RM5A 2ET6A 3RFXA 5A3VA 3RKUA 1CF2O 5C5IA 2O2YA 4JIGA 4RVFA 3OJLA 2UVDA 4LISA 1PR3A 1PGOA 4ZU3A 1RKXA 2YFHA 3L6OO 1U8FO 3LT0A 1C1XA 3KYBA 2Q4BA 3AI2A 3ICCA 3LT4A 3MJ4A 4XDZA 1W0CA 3WQQA 5JYEA 1PJQA 3PDUA 4BO9A 2H63A 4BNZA 1YOVB 4J2OA 2NQTA 3L6DA 5AOVA 3RUAA 1H6DA 3GDGA 3QA9A 2I65A 3PJEA 1T2EA 2DUUA 2OZPA 4BKOA 4R5MA 1E5QA 3W8DA 4KUEA 2WWRA 4MVJA 3RCBA 1HRDA 3D3WB 3DZFA 4D44A 4YAKA 3DBLB 4N5NA 1HDZA 4XCVA 3JYLA 4M86A 1JU9A 1P74A 1VKNA 4NI5A 3NJ4A 3RSHA 1IYZA 2P9GA 2ZYAA 3QVOA 3O8QA 3I4FA 4MVJG 2NVWA 1ZFNA 4BHTA 1R0SA 2EW2A 2DFDA 3IC5A 3SX2A 4GMGA 3RKRA 2LDBA 4BNTA 1QSGA 3EMKA 4O5OA 1HE5A 3I9NA 3VAZA 4GL4A 1MC5A 1NXQA 2X1HA 1HSOA 2C7VA 4CM4A 2VOEA 4NH4A 1QV7A 2ZJ0A 1G0NA 4WEOA 4AG3A 3GN2A 2P4QA 4L75A 4LN1A 3E5RA 2B5VA 5DDIP 2HMVA 3COSA 4J1TA 2NLOA 1N7GA 3T4XA 1QRRA 2H9IA 5EJ2A 5JAMA 2UDPA 3PFFA 4BMNA 2HK8A 1GR0A 5G0UA 3WMWA 5FEUA 4UVIA 2F00A 4DXHA 1I24A 4UUNA 5CPBA 1LXCA 3CUKA 4U5QA 5L4SA 3JYQA 1O89A 3WGOA 3WBBA 4LMPA 1D8AA 5HA5A 4GSKA 4FR5A 3EC7A 1VJ1A 4ZGWA 4QECA 3W1VA 1B3BA 3F1LA 4I08A 3K96A 4Z0TA 1FDWA 1JKJA 5ILOA 1ENZA 4Q9NA 5MGBA 4XZ3A 4OYRA 1UXJA 3F46A 4TKMA 3OETA 1XIVA 3SXPA 1XEAA 5L7YA 5BSEA 1V3VA 2XPCA 4NMHA 4CV0A 5IZCA 1QORA 4KUGA 2EF1A 4KOAA 1TVEA 2QW8A 3DBHA 2J5QA 1Z6ZA 2WM3A 5ADHA 3GVCA 3QSGA 3R0IA 3LLVA 1SEPA 4MVJF 3QWAA 1LRLA 1Z82A 2IYOA 1E7YA 4GI2A 2X58A 2V65A 2CFCA 1P1HA 4R68A 4JP3A 1YH3A 2W2KB 9LDBA 1EUZA 2WD8A 4AVYA 3DC2A 3H2ZA 2Y1CA 4MIEA 2W2KA 1JAYA 3HB4X 1LNQA 2BFPA 2HO5A 3AY3A 4PRLA 3ON5A 4CQLB 3PLNA 2EHDA 3H7AA 1D1SA 1U3TA 4RPHA 3JD0A 4R1SA 3BHIA 3DMTC 2DVMA 2VZ8A 2BH9A 4XB1A 4YJDA 3ZHZA 1IPEA 4FFNA 2PA3A 2B37A 2OXIA 2EP7A 1J5PA 1GYQA 1EVIA 2AA3A 1YO6A 2LDXA 3PWKA 4NHEA 4NNJA 1GCUA 4AJOA 4ITUA 5C7LO 2BD0A 4GSLA 4ZQBA 3WNQA 2DKNA 1YXMA 2B4RO 3EZLA 4FOOA 3LLSA 3JD4A 3WWZA 3GPDG 4PG5A 4D42A 1NPYA 2VNAA 3RC2A 4CM8B 4M54A 5JNLA 5L51A 1PGPA 3I9MA 3OM9A 3U3XA 1Z45A 1GEEA 1KETA 6LDHA 2HK9A 3DMYA 1P3DA 4L9RA 5JPIA 2RCYA 5JMWA 5BSHA 1A71A 2SCUA 1NTOA 3U4HA 3FD8A 4WNIA 1L7EA 1LQUA 1U9JA 2Z95A 4NFHA 3H4VA 3QWBA 3PHHA 4YRDA 3GRPA 5JE8A 1ZXLA 5TRTA 3TFOA 5DBFA 2UYYA 1M76A 1ZVMA 1CQJA 2V7PA 4IDDA 2H1SA 3BMOB 5A06A 3KLPX 2EGHA 1DAPA 1X14A 4O0LA 3ONDA 1E1NA 2TMDA 3BMOA 4GMFA 3B1JA 4GKVA 4IY1A 3V5NA 3G17A 5TS3A 4F45A 1GYPA 4TRJA 4MVJH 2FPIA 4E5MA 4EW6A 1X15A 4RORA 1SNYA 5JW6A 4DIFA 3TWOA 2BGMA 4BNMA 3OMLA 1V35A 1T24A 3D5TA 1FDVA 2VCYA 3GR6A 4GX5A 4K6FA 4WOJA 1C0IA 3LT1A 3VTFA 3FTNA 4ZQHA 1UJMA 1LLUA 4NIMA 3RD5A 1NHGA 1U3UA 5COBA 5FYDA 3EHEA 5CFZA 3WGGA 1YL5A 1ZMOA 5JAQA 3CXRA 4KZPA 3S2FA 4JROA 1SCUA 3KYDB 5JSFA 2JL1A 3JYPA 4J4HA 2HDHA 4BKPA 1YWGO 4R1NA 1QXSA 1BG6A 1E0DA 3GY0A 5I7SA 4N54A 1I5RA 3PPIA 4HV4A 3SC6A 1I10A 5ICSA 5L4NA 3EVTA 1PJ4A 1I32A 3VZPA 3L07A 2X9NA 4LRSB 3UKOA 2W8ZA 4JP2A 1IB6A 3HFSA 2VRCA 1P1IA 3GZNB 3H5RA 3BMQA 3PYMA 3WGYA 1IHXA 1XR3A 4LSMA 1DIHA 2WJPA 4XYEA 3RAJA 2WD7A 3EVNA 3HDYA 3GLQA 5ITWA 3OJOA 1NP3A 4J16A 2YHIA 1YL6A 4C7JA 4PLTA 4I1IA 4Y6SA 3R6DA 5A05A 1LDEA 3LQFA 1YQDA 2AE1A 3SC4A 1FXSA 5T8KA 1VRWA 1YJQA 1ZMTA 4BO4A 5C3MA 1LX6A 3DAFA 4J3FA 3NT4A 5T64A 4BNHA 3NV9A 1H9AA 3M2TA 3E6AA 4CV3A 1JN0A 2NTNA 3Q9NA 4Y67A 4RL6A 5FF9A 5TT0A 4FGWA 3UW3A 2AQIA 3VKUA 2JD2A 2OOSA 3VH1A 5THKA 1PS8A 1MV8A 2A92A 3DOCA 4YWJA 4AJHA 4CL8A 2Y1EA 3F6YA 2WEKA 1DB3A 3G3EA 5T67A 4XQ9A 4E33A 4YJHB 9LDTA 1DLJA 3PGJA 3V8BA 3WSVA 2FP4A 4Q3NA 2WDZA 4XIYA 5A9RA 1V9LA 3HNPA 3D64A 4BIIA 3GDFA 4II2A 3FBTA 2FPGA 3ETDA 3WJAA 4KQWA 3Q2IA 3ZWXA 2IEDA 3SLKA 3WIDA 4I5FA 4YQYA 4DL9A 4CQMA 3PRJA 3FTPA 2EEZA 3ZI0A 1BRMA 3ZWYA 3JYNA 4ZVVA 2Z5LA 3DB2A 2VWPA 4D43A 1ISFA 1H6AA 3WNVA 4FBGA 4MKZA 3CTMA 1XWFA 3ETEA 1I33A 3ZU4A 5K6AA 3DFUA 3JQDA 2Q2WA 1HWYA 3Q0EA 1PEDA 5G0SA 3VPHA 4I5DA 2FSSA 2NUAA 3OFSA 3PZBA 3INRA 3NDJA 2JKVA 5EQFA 3UGKA 1QYCA 3V2UA 4ND1A 2GZ1A 3AI1A 2PK3A 4ZHSA 4R1UA 4QUKA 3JQAA 2ZTLA 3G49A 1HYHA 2G76A 5TIIA 4CQMD 3NX4A 1PS9A 1XYGA 4CLOB 1GFSA 1D7OA 3DOJA 5LCXA 5B4VA 1UXGA 1DFGA 4INAA 3CEAA 4KWHA 4A26A 2NV6A 4GX1A 1SZJG 1C14A 2E4AA 3MTGA 5EQDA 3WGQA 1B14A 4E2XA 3TQHA 1Y8RB 3BYZA 3ANMA 4CMIB 1I3MA 1WWKA 1NQOA 1ZNQO 4FIZA 1OFGA 1M66A 4HWKA 1KC1A 4K6CA 4CMIA 1IE3A 3DZBA 5HM8A 1LSJA 1E3IA 2YHUA 3O9ZA 4AICA 5IG2A 2VTEA 3JQAD 5JDCA 2NTVA 3C1TA 1QG6A 4DMLA 5FI3A 1N2SA 3PZRA 4AJ4A 3Q2KA 3RBVA 2DQ4A 4L74A 5BNIA 5B1YA 2O48X 5DT9A 2W98A 1E3SA 4B7XA 1ORRA 4D45A 3KLMX 3RJ5A 4PG8A 1R37A 4N5LA 4R01A 1T25A 5DNAA 2C2YA 3ZWCA 3Q6IA 4I5EA 3JTMA 1FDSA 5GZ1A 1X1TA 1J4AA 3OJEA 3ZWBA 4E30A 4CLRB 3KO8A 1VI2A 3HDQA 2W2LD 2RHCA 3JQGB 1MB4A 3RUFA 3C85A 4M8SA 3FNGA 3B1FA 3B6ZA 3GMDA 1NWHA 4IUYA 2O4CA 4E5YA 3VZRA 1UZNA 2OORA 4JN6B 1PWXA 4WE3A 4D46A 3FWZA 3IOYA 4A27A 4PLVA 4L76A 4GLLA 4UUOA 1EE2A 1ENPA 4CV2A 1LSSA 4OXNA 1BVRA 4HFMA 5AQ1A 5U1PA 1F0YA 2BKAA 1WDKA 1ENOA 1FF9A 1XQ6A 2DT5A 2JAPA 2JD0A 1LBEA 2VQ3A 3FN4A 1DRUA 1E1KA 1IUKA 3DQPA 4ZQEA 4CJXA 2HU2A 1ADBA 1DC4A 2NQ8A 3OIGA 3ZGYA 4IIVA 4J1SA 3U4IA 1AUPA 1JKIA 2Q1WA 2Y99A 4RVGA 3QV1A 3E8XA 1T4DA 4YACA 5A04A 3V1YA 3RUEA 2EWMA 5DULA 3S8MA 4BO6A 3NTQA 5KJFA 5G2OA 5GZ6A 2JD1A 1FK8A 1ISIA 2Y0CA 2YQ4A 3I9KA 2VYVA 4OL9A 1W8DA 1HDXA 5KKAA 2C5EA 3WXBA 5CP8A 1DJNA 1PL7A 3ANNA 4RPGA 1HDRA 4D3SA 3VH3A 5TQVA 1PR9A 1HETA 2IRWA 1SOWA 1V6AA 4L4SA 3E9QA 3PI7A 4FGSA 5ER6A 2HQ1A 4U0KA 4GWGA 3UXYA 4Z9XA 1MLDA 1JWAB 3BHJA 1TT5B 1K6XA 4HKTA 1RYDA 1ZEMA 4E5NA 3OICA 4FFPA 8LDHA 4ND4A 3K92A 4PLGA 4FQ8A 1CDOA 4PN3A 3FSRA 1X7HA 2CSUA 3O26A 3BHMA 5L3ZA 1IPFA 3HADA 3PIIA 1EK5A 2JFFA 4IS3A 4LCJA 3VKVA 4J1NA 4AFNA 5KIAA 2IXBA 4IBOA 4XWYA 1EMDA 4L4XA 3RU9A 5IXYA 3ANLA 3S2EA 5EN4A 4J4TA 1EDZA 1E3EA 5IXSA 3ADOA 4CM9A 3PQEA 4IDEA 3TZ6A 2I76A 1RPNA 3RIHA 4YAJA 1B16A 1WP4A 3M2PA 3DTTA 1H9BA 4ALNA 1O5IA 1OOEA 2DBRA 5J23A 3UH1A 3F4BA 3ZU5A 2HMUA 5FFFA 1GU7A 3LT2A 2VT3A 3HDJA 3ZN2A 1CERA 1E92A 1SOVA 2VN8A 2BFMA 2X5KO 3H5AA 4D41A 1KEVA 1A4IA 1OZAA 4UULA 3MEQA 3GUCA 2CVZA 3JQCA 3Q9UA 4Q3CA 3KSDO 3DAPA 1H2HA 3UCFA 1DFIA 4B7UA 1NPDA 3GN1A 2ZB4A 4IIUA 3TL3A 1I2CA 2FMUA 2GNAA 3UUWA 4OGWA 4RVHA 3N7UA 3JQ9C 4FPXA 1E3WB 3K73O 5I7FA 3PJFA 4P8RA 1WLYA 3WGZA 2NU7A 2ILTA 3KYCA 2F1KA 1CQIA 2JFHA 2PZJA 4HADA 1ID1A 1OI7A 1K0UA 4CMKA 1YS4A 5AYVA 4TQGA 3KZVA 1MA0A 4WCFA 2PR2A 3ASVA 1P1RA 2V6FA 3BAZA 3DZHA 4KP7A 1PJ3A 1KYQA 3I9LA 2EG9A 1R15A 4FFRA 4ZQFA 5AXDA 4CMCA 4OSOA 2ZTMA 3SBOA 3WQSB 4CLXA 1V8BA 1KVQA 4IS2A 1VLLA 4W82A 4Z9FA 5IZ4A 3BXXA 3CE6A 2IODA 4J7UA 3WGTA 4CM7A 2GN9A 1E5LA 4NZ9A 4TRMA 5F1PA 2DLDA 1LI4A 1CYDA 4KTVE 4ND5A 3VPSA 4BS9A 5CHEA 5G0WA 4DQUA 1N8KA 1XU9A 3WICA 1Y8QB 3I1JA 1DXYA 3KUXA 4TZTA 4IZIA 3D5QA 3O38A 1YJ8A 4D79A 2X6TA 4HXYA 3DZJA 1LJ8A 1M75A 1PSDA 1FMCA 1X0XA 1GUYA 1P44A 3AW9A 3ROPA 3S1LA 3OSUA 1ADCA 5A3JA 4YRBA 4XIJA 2PWZA 2Y93A 2I3AA 5EMHA 1ONNA 4MIOA 5L40A 3JQ9A 2FPPA 4FW8A 3GOHA 4J43A 4ALIA 4XX0A 1C1XB 2Y1OA 2BELA 1NHWA 1E3JA 1LA2A 5LC1A 3ADPA 3KVOA 2Y1GA 1QYXA 2BGKA 1R4MA 1PZGA 2P91A 4WUVA 1ZH8A 3AU9A 2EGGA 4BNGA 4RQUA 3VH2A 3VH4A 2GN4A 4AJIA 2CDAA 3LSYA 4BKUA 1ISMA 2QYSA 3GG9A 4GAEA 1PGQA 4IINA 2PKQP 1YONA 2BGLA 5IN4A 4HX5A 3O03A 4UAGA 2PY6A 3NDIA 5FI5A 4BNWA 5EIOA 1X7GA 2V6GA 4BGUA 4AL4A 1SB8A 1Y9EA 1RM3A 4ZN6A 2QX7A 4BNKA 5BSFA 4ILKA 4A2CA 1YRLA 5HWSA 5IZCC 1Y7TA 3O8QB 4YAEA 5GZ3A 5KJ6A 3DEYX 3GQVA 2EP5A 4J7CA 4PG6A 3DOOA 4LW8A 2VHWA 2X5JO 2V6BA 1DC3A 2GR9A 4ID9A 4BO2A 3GMSA 4ZRNA 1N1EA 3VDRA 2D0IA 1HDOA 2UV8A 2C20A 4CM4B 2AXQA 1IHYA 5H82A 1GCOA 3STHA 1KIFA 3UCXA 1GQ2A 3EZYA 4RVDA 4YJGA 3BTVA 2Q1UA 3E9MA 4M49A 4MVJM 4NBWA 5L7TA 2UAGA 3EYWA 4B3HA 3BMCA 3DR3A 5L7WA 1BW9A 3HWRA 1R16A 4OMUA 2IXAA 5L9AA 1EVZA 2GPTA 1I3KA 1H0KA 3DBVO 2AG5A 4WPGA 3VOSA 1UUFA 1YB1A 4HNHA 1EVYA 1F12A 1WPQA 4J49A 1MUUA 2ZCVA 4WEQA 4RV9A 5JAIA 1ZZEA 1FDTA 1UDCA 2PD3A 2BHLA 3KEQA 1YQXA 4CMHA 4A0SA 4XRRA 1CWUA 2HMWA 3ZWVA 2FHSA 1GY8A 5KJEA 5TNXA 2XF8A 1EUDA 4DBZA 4GX2A 3D0OA 1GQYA 1GAEO 1OMOA 1DIAA 5HBRA 1SEVA 1WNTA 1B7GO 2DTXA 1DFHA 2ZB8A 1LSUA 4DA9A 4CMJA 5DOVA 4FFMA 4WCDA 4GLOA 3VHRA 3U9LA 4W6ZA 3DBHB 4FC6A 4GX0A 4MIYA 4C7KA 1L7DA 3RFVA 4JBIA 1TLTA 2GSDA 5L45A 4I9HA 5A03A 3U5TA 3TZQA 1GL3A 2VUTA 4RPJA 4UEJA 4XYMA 1G0OA 2NVUA 3QQPA 4H16A 2Q99A 3JCZA 3FNHA 3P19A 4Q39A 5I9MA 1PJBA 2Y0EA 3KXDA 3L4BC 4LK3A 4N18A 1O6ZA 5JLAA 2X9VA 1ZSYA 3I3OA 1Q7BA 4UEOA 4OQZA 5CPFA 1WW8A 3AOEA 3GK3A 4FFOA 4G2NA 1HZZA 4R3NA 1F17A 5T5QA 4Z9YA 3OQ1A 4MINA 2G82A 3MCVA 1WZEA 2Q46A 4OM8A 1YE3A 1LUAA 2YQ5A 3AI3A 4TZKA 5HS4A 3IKTA 3C1AA 2CDCA 3GPIA 4B4WA 4EUEA 3ZW9A 4UUMA 3TDKA 3K2BA 6ADHA 4TRNA 3WIEA 2B69A 2HJRA 5IDXA 3F47A 3FR7A 3JQ8A 3HJAA 4AJKA 4M55A 2RH8A 4EYEA 5B4TA 4LVCA 2VWGA 1E77A 1YDWA 2NADA 3IP1A 3IUSA 3HFGA 2HLPA 4DRYA 4RZHA 3INTA 1OC2A 1B8UA 2UUPA 3Q3CA 2PNFA 5A5FA 2AW5A 1NFQA 3JSAA 1GQQA 3JQ6A 2ZB7A 1D1TA 4PG4A 2ZKLA 3AFMA 2P2SA 3TF5A 4BV8A 4E0BA 1IZ9A 4HP8A 3SJ7A 1GZ4A 1VSVA 3OH8A 3GEMA 4AJPA 3L4BA 2NWQA 5TLSA 1BXGA 3HDHA 2QRKA 3H9GA 3MJCA 1Y9AA 4PGFA 4ALMA 1RJWA 4XKJA 4BO0A 4YT8A 1JTVA 5JCJD 2VOJA 1Z73A 4BL5A 4RO0A 4BMSA 3TPCA 5H81A 3AY6A 4YT4A 5A9SA 2ZB3A 1WMAA 1YVEI 3ORFA 2GERA 3E9NA 2EKLA 2GO1A 3JQBA 4CPDA 1GPDG 4BQPA 2QG4A 4DPLA 4II3A 2AQKA 2PD6A 2VHZA 4UREA 4YAIA 3U0BA 2D8AA 3NRCA 2V6MA 4NG5A 4EUFA 3ZU2A 1C0KA 2FR1A 1PJSA 5T6BA 5T8KC 1EK6A 4U8GA 4Z3DA 2G1UA 1ULUA 3DL2A 3VPXA 3DO5A 4DWVA 5BQFA 3DHEA 3GHYA 3LC7O 2Z1MA 1MP0A 3PFWO 3KM0A 3WGIA 4QSMA 4Q3BA 4P4GA 3H9EO 3AM3A 5K0ZA 5AXBA 4IJKA 2GGSA 4F46A 4JBHA 1R12A 4FJ1A 3F5QA 4Q3DA 3HB5X 1ZSVA 4MVJP 4BNFA 5G4KB 4HFJA 2YDXA 1B0AA 4CMEC 1R0KA 3GAFA 4WECA 4E13A 5THQA 1T1RA 5G4KA 4J9VA 2EIHA 4URFA 4JLWA 5F3RA 5BNFA 3FR8A 4BV9A 4UVGA 1NASA 1U5AA 4LMRA 3RQSA 4BMVA 1E7QA 3BMQB 2CZCA 4JX8A 3TFQA 3RROA 3F4LA 5CDTA 1U2DA 2CY0A 1PL8A 2WD7B 4BO1A 2JCXA 2XOXA 3QHAA 2FR0A 3MWDB 4IZHA 3U4DA 5K6AC 1JW9B 2YHIB 5AVOA 2AEFA 4B4UA 1LRKA 4YAGA 3VVBA 2VZ9A 2YV3A 3I4CA 3I83A 4JJFA 2DTEA 5JO0A 3OJFA 3WB9A 1C1DB 1J0XO 4JNKA 3GGPA 3L77A 1M2WA 5JC1A 3HZZA 5DBIA 4CLDA 1JAXA 1C1DA 3A14A 3U62A 1BMDA 4DPKA 1UP7A 1NVGA 5BNTA 4PLCA 4IQGA 4RF3A 4Z0PA 4K1LA 3I6IA 4JBGA 2O7QA 2QQ5A 3GH3A 1HDYA 1XSEA 4CR7A 4CMAA 3CKYA 3EY4A 3T7CA 1UDAA 1ONPA 1IY8A 3FNFA 1P45A 3C3XA 2IYPA 4YB8A 3AY7A 3ULKA 1LDYA 1U8XX 2J3KA 1DRWA 3MJTA 3W4JA 2PH3A 2GASA 2B4QA 4R5HA 1NVMB 4O6VA 3PP8A 4B7CA 4CMEA 1XU7A 1P1JA 1KC3A 5AXCA 2O3UA 3B20A 2YV1A 4Z3KA 3GVIA 2D59A 4CUJA 3GHHA 4CM1A 3EGOA 2D2IA
chains in the Genus database with same CATH superfamily
4H7JA 1P7WA 2D7CA 4CQMB 4OH1A 5K0TA 1ISHA 4GYJA 1SXIA 1ZL2A 3PA8A 4TZ6A 1ZD5A 2QL5A 5G1OA 5EJ4A 5ABPA 4CF7A 4LXIA 4JLNA 3DR5A 1G6KA 5CCBA 4E94A 3VOBA 3I1YA 4NV3A 1NA5A 3OE4A 1HLPA 3QWHA 4LCBA 1O95D 2OHHA 1NVVR 5FOTA 1WL8A 3HNOA 2EW8A 3NTXA 5B58C 3GELA 1WDMA 3L9XA 2EG5A 1NWCA 2WG0A 4NVRA 5JISA 3HR4A 2CUZA 2W6NA 4R2XA 3W9UA 2NQ2C 3JWPA 1JBQA 4B35A 2ACVA 3M4NA 5H0IA 3HBAA 3TCKA 2I9KA 3FGPA 1ECLA 5IU6A 5IAJA 2AIRA 4WNAA 3ZXIA 3L8DA 2OZVA 4P22A 5A0FA 1XKLA 5JARA 1BX0A 3W5IA 3C3YA 1G59A 4HB4A 3CLTD 4PHGA 3O1JC 2QLLA 2GRAA 1JHDA 1LDBA 3NCHA 4UEQA 4MEBA 2XNHA 1EWYA 1E9DA 1F2DA 4ZI7A 1N7IA 2BGRA 4L9SA 2NTYC 3FWKA 5BPHA 1M6NA 2F62A 1SBTA 3WX0A 5JZBA 3CZ4A 3I53A 1HEUA 2ZGVA 3PUJA 4D3YA 2P7IA 2O0KA 3DYIA 3OURA 5DI3B 3PD7A 3S27A 5LWHA 4QHTA 5LUBA 4ZEWA 1Y7PA 2CYBA 1KMHA 3WYEA 1A27A 3CLUD 5BUQA 4DR6B 1RADA 2H0RA 2QQFA 4Y2SA 4M0LA 3ZV4A 1ONOA 5DCUA 3N8GA 4RXMA 4LYJA 5IXJA 3PSHA 2ZUSA 3FMFA 2ECKA 3KRTA 3A0RB 4BUJA 4ZQGA 4EY8A 3RRJA 3W9SA 5B5SA 2C9BA 5JSQA 3VR5A 3NHKA 4H3SA 4K87A 2OAQ1 1NXXA 4TGLA 4DCVA 4G5GA 1YRWA 1HRKA 5DM70 5EJMA 1JIUA 3NHSA 1AQIA 5ES3A 1G66A 5LKAA 2V7BA 2ZITA 1TOAA 2PTGA 1J8FA 2QX8A 2JFGA 3QE0A 2F1IA 3GFRA 3GT0A 3WIUA 5DCYA 1U7TA 5K5EA 2WWFA 3ETGA 3VNUA 4FT2A 1AK2A 5DF1A 3MQ2A 1O0BA 4HZGA 4Q9DA 3MWFA 4GYYA 1UMBB 3Q1KA 2IUSA 4O3FA 4OQPA 1N6PA 3LGXA 4BB0A 4CM6A 5IAAA 4NYIQ 2OVFA 1A0OA 4PU0A 3CEJA 3NR2A 4LTMA 1B6RA 1O77A 2PUFA 2C9DA 1ABFA 5CYGA 3N8IA 3C7AA 3PKJA 4RM3A 5I9LA 2IU6A 3SFVA 5I9IA 1M34E 1Z68A 1DO8A 5ALOA 1M8KA 4R9VA 4A7PA 3DDNA 4FCCA 1Y3AA 1PE0A 5CNKA 5IJAA 3OZUA 2EZ9A 2RGRA 4MKXA 4ARZB 1G1AA 2WHPA 4PNZA 3IQDB 5FT9A 4HPJB 1XDZA 1Z88A 1EQ2A 2Q6TA 4AJNA 2Q2VA 1AUVA 1KYTA 1BQ3A 1I01A 1K06A 2EX1A 4QIHA 4YJ3A 4EF6A 1BD3A 5KVQA 1I2BA 2BHNA 3IBGA 1IFXA 2GNOA 1Y5LA 2VCEA 3JD2A 1LLFA 1SC6A 1NP6A 4BN5A 3AP1A 4QYIB 1EVKA 5K8IA 1DEHA 2WMYA 1XT6A 3DDZX 3H3JA 3PXXA 2Y9MB 4RY0A 1SQGA 1IM8A 2EZ8A 2DC1A 4YI5A 1WCWA 4KRYA 2FW1A 4J76A 5DNCA 3DAGA 4X1YB 5LOVA 1PWZA 2XYVA 1AUOA 2IUEA 2B5OA 2FSHA 3L0SA 1H4QA 2IT1A 3RRYA 1LZLA 3ZK9A 4LGVA 3UICA 4J7XA 2ZDQA 1A5ZA 1J70A 5CEFA 1T3SA 1U8TA 4GI1A 4QUDA 4C76A 1WQ1R 3ML1A 3GLIE 2FYTA 2IZZA 4WNYA 3L1UA 5BT9A 2FSIA 4H7IA 5BV1A 4U0JA 2B30A 3PCTA 3D5EA 3EGVA 3L43A 4F2DA 1ZUNA 4BMCA 4ZVMA 4C4XA 1IDOA 2YXNA 4NJOA 2WQ7A 2QRGA 2PLFA 2WDPA 3HEMA 1K92A 3PUWA 4IIDA 5GP1A 1L3CA 5HPYB 5AVUA 4I55B 1UXIA 1PZXA 1S4QA 4UJ5A 5EL0A 2WM2A 5FWDA 3CWQA 5EPOA 1P9RA 3VU9B 2LZ0A 1JR2A 4YEDA 5HE8A 3QMPA 4HFRA 3QE3A 3ZBTA 1KI6B 5DBHX 4E2WA 2WOJA 4LC1A 1W93A 4TXLA 5JYDA 3BSWA 4L5YA 3CQ9A 3RODA 1PJLA 1TQ4A 3C3WA 4AMBA 3ULKA 4BNIA 3EXEA 4HNGA 5CD1A 1JHXA 1V3TA 3LU1A 1HGXA 4KQGA 3IJEB 4ADSG 3SZLA 1HNNA 3E8SA 2ZR8A 4N7MA 3VVCA 1HE4A 3IQGX 2P27A 4OQ4A 5JQGF 1K97A 1QGUB 3LPLA 4LXQA 5DGTA 1JSRA 5GWXA 5ALTA 3FSEA 3OT1B 3UT5B 2C2HA 4YYEA 4L5JA 2PV0A 1D2AA 4MDYA 2HD4A 3ZLJA 4JDUA 2R7AA 2A9VA 3A4MA 3QLVA 1EVEA 1GPWB 2YW9A 1MT0A 3B7WA 1W4BA 3C1OA 4FZ5A 5CB4B 2FEOA 1Q0RA 2OP0A 3JQFA 5KQLA 1KDTA 3TKYA 1SUPA 4LSWA 1IY1A 3CLSD 1FS5A 1X70A 4GPIB 2HT6A 5L4LA 4XB6B 3D3EA 2IITA 4HVAA 1GPUA 4NFSA 4KIGA 4N5DA 1RKUA 3GUZA 3ANYB 1OW3B 3UWKA 5IARA 1KYYA 1Q1BA 4OV6B 5CXSA 3CVUA 4AY6A 3GIDA 2JFWA 3KTOA 3H1PA 1FCJA 2XUAA 4S05A 1OYWA 2FWPA 2ZE7A 2ZQZA 1Z74A 4B45A 3VYRB 2CLCX 5EQJB 4RFSA 1J06A 1U9IA 3UJDA 2IY7A 2CXRA 2Q3BA 3EVAA 5JRZA 5JZOA 3FFBA 3DT8A 1FQKA 2XVAA 4KG7A 2I4TA 5C18A 3HXQA 5LJIA 4LJSA 1SHLA 4HYQA 3FPLA 5JSZB 4NBKA 3F5SA 4TXHA 4HNUA 2JARA 1L1RA 3K0AB 3V7WA 3AGQA 2QEQA 1Z62A 4MS4A 1CJBA 4WBNF 1R4NA 3M1AA 4F9TA 4KITB 4B4OA 1Z8HA 4U00A 3EUEA 3T0FA 3QEAZ 4ND3A 1ML4A 2OBNA 2Y05A 3LQYA 3O4RA 1BMQA 2OEPA 1BSVA 2C54A 3E3LA 1Y6JA 3HUDA 3NHLA 3ZHQA 4BFWA 5I7WA 1S02A 1RWNA 1XF1A 2VAMA 3M1LA 4BU0A 5LDGA 1D6NA 1L3IA 3GRYA 4EVRA 4DSAA 1T6YA 1ZOSA 2FR8C 3QFTA 4BZPA 1X74A 1Z4JA 4K28A 3M3PA 4N3NA 3LHSA 3T5CA 4ACAA 2GWHA 1HUQA 6AT1A 3RYFA 1JLLA 1WF6A 2IYXA 2JRCA 3G8AA 5DWVA 3X44A 4DC9A 3MLAA 5IP5A 2WKQA 1KEEA 3P2YA 3T3MB 1HPLA 1PJ2A 1W52X 2E37A 3OD1A 3SLGA 4DANA 3QKSB 3VXKA 3C3PA 4ND7A 3S2ZA 3KAKA 3IAS6 5KTKA 2QGFA 4KQHA 2FZKA 2YN2A 3FYUA 1V4VA 4JOSA 3C16C 4BFZA 521PA 1Z6TA 3CZ9A 4MRAA 3OTWA 4PVCA 3H18A 4TKLA 5CLQA 1E58A 5ALKA 2HLHA 3WG9A 3WQRA 1WG8A 4W9NC 5F9HA 1MIOA 2IXTA 4GBGA 1JR6A 2QRJA 4MOWA 2EKPA 2HZ7A 2X86A 2GN0A 4UJ3A 5EVJA 4Z6KA 5CEEA 2PZEA 1YR6A 4I9NA 5TQJA 4RZ3A 2HNBA 1DQSA 5EJ7A 9ATCA 2X15A 1ZU5A 2HNKA 3B9PA 1EGMB 2W4QA 3EIXA 5J2UA 2XKKA 3AVWA 3FXAA 1NC1A 2V7WA 4M89A 4AY3A 3ACCA 3L0YA 3X1ZA 2DR0A 1GG5A 3FLMA 4XSHA 5CVCA 4B3JA 5AUOB 5K99A 1FFYA 2DWQA 3CNBA 2HWYA 3UBTA 2X2FA 5HX7A 4H6PA 4B3XA 5HRCA 2JAHA 3WK4A 2DSTA 3Q4GA 3U4QB 4AKHA 1V47A 3S1AB 3OTGA 4ONEA 4UNSA 4RHEA 3PK0A 3HXMA 1PP4A 3B3JA 4GQAA 1IY0A 2GDZA 3ADKA 1AB5A 4GOMD 2IOFK 3Q7QA 3NEYA 4R9SA 2FPPB 1OBFO 2MMCA 3BJIC 4AZSA 2JZOA 1DGQA 3K6JA 3HCAA 1PZEA 4Q93A 3U13A 3UJ3X 2AYYA 1AZSC 1EQUA 1QE0A 2TYSB 1LC0A 1U7HA 1WR8A 2DHQA 2VJBA 3ENKA 4JUFA 1IL0A 2JLAA 4MYRA 2NZUG 4RD6A 4BNLA 2REOA 4F6RA 3RWMB 2AG6A 1OASA 2XAUA 1GDHA 5T7BA 4ZYYA 4MMXB 1JEAA 4HH1A 1RC8A 3I1FA 1C9EA 4LHZA 4BLVA 3PGMA 2PH1A 3RRMA 2ZWAA 3KZCA 5SYNA 4HUJA 3NH9A 4GR4A 1ZRHA 2WSSA 1M7GA 1FYVA 5SZKB 3ES9A 1YA6A 4G4GA 3LY8A 3BXPA 4DEXA 1T2DA 3Q15C 1T2AA 1UAAA 1LJUA 2QW1A 3RS5A 1JG4A 2IELA 4IFBA 4B9EA 4F4JA 3VMMA 1JP7A 1QWOA 1FRNA 3EIWA 3RC7A 4XA8A 2QT9A 2X8JB 4ZEVA 3HHPA 1OH7A 1V26A 2DHEA 2RDMA 3FRJA 2AVDA 4O63O 4POAA 1EXDA 2UU9B 2O0HA 5LYJF 1ZBDA 4LDZA 5I7HA 4OXXA 1CRQA 4S04A 2M6LA 2RFLA 4AJ9A 4EFKA 1C0LA 1E2GA 4L02A 1A8HA 3OTHA 1Q1EA 2B4KA 2VLBA 3PD0A 4PPFA 3TMAA 4P0PB 3WTBA 3E2IA 2J9GA 2GYUA 3OZBA 4X9XA 4ITRC 3W3AD 2DTDA 2FOIA 4KODA 4GUDA 4PSAA 4J75A 2YMQA 4KXWA 4QOJA 3R8CA 3RVDA 4AP6A 3FG9A 4EY3A 5IANA 1AN9A 2A84A 1NF2A 1LTHR 4TVBA 3JV7A 1GTL1 1SRQA 3TQIA 3ZLVA 1FL9A 3EDCA 4WXPA 3ABIA 4O1IA 3MJVA 4OG2A 2R44A 1UMCB 3T3DA 2P3LA 1C7QA 1HLDA 1P0PA 2OG1A 3L6UA 2YJ6A 3MT9A 4N41A 1XMVA 2QENA 3PEFA 4EJ6A 2HMAA 4GSYA 3KHUA 1F9AA 2P2DA 2ZS8A 1SVIA 1C1YA 2F67A 3D7MA 1A9XB 3GFSA 3NW9A 4HI0E 4TN1A 3WSWA 5JVDA 1UOPA 1JALA 4I3HA 3B5JA 4QJBA 2WWIA 1M8FA 1ICIA 2L18A 4G0ZA 4U3JB 4C0XA 1TCAA 1F2UA 3A05A 3DFZA 2INGX 4UEKA 2I55A 4XM0A 1YBMA 2Y76A 5DI9A 5GMOA 1A2KC 4R0MA 121PA 3BSYA 1DIRA 1NYQA 1CETA 2AX4A 3HXLA 3N8DA 1PQWA 4JLMA 5IDYA 4EW2A 2HMTA 4YUWA 1L5WA 1WPGA 3ZUPA 4QGSA 4EM6A 4FYIA 4YDRA 4P7GA 1MD9A 1B0ZA 2HIGA 3EMBA 4BVFA 3F49S 3GFGA 2CLKB 1MABB 2ZAGA 5ESDA 5CEJA 4JQCA 1AQLA 3MTIA 3FJYA 4QXRA 4TS9A 5FYQA 3ZZUA 1FS4A 2JFZA 3ET5A 2I2AA 1IY9A 1T8TA 5TS2A 3QIVA 4KMSA 2RKOA 1LK5A 3HJBA 4LJ7A 1TZBA 4Q21A 2JCVA 4AAYA 2IIVA 2HGSA 2FDCA 2E4YA 3V46A 4OHRA 2DR2A 1Z37A 5BMVF 2V7XA 2XKBA 5TV2A 2J4FA 5EJIA 2GN6A 2Q5EA 2A9OA 1YDGA 2J5XA 1VL0A 4X6YA 3RFFA 3KTDA 3P9PA 1PG5A 1GPLA 2PM8A 4OXQA 3V1TC 2BLLA 1K4KA 1ECCA 3E15A 1Y6QA 4TYYA 2AKYA 1NU8A 4FNAA 1DADA 4XM2A 1KFBB 3ESZA 1O9BA 3QLJA 5KWIA 1IOLA 5L3QB 4XR4A 1BRTA 4MWCA 1DG1G 2WHYA 3AUYA 1B3RA 3HB7A 5JS8A 5KWJA 1RIIA 2J3MA 4OQMA 4LPSA 1F8YA 4YO8A 4A0FA 1PFWA 3FPCA 3OO0A 4ENWA 3EWIA 1TF7A 2KYRA 3T7KA 2Z4SA 2FY8A 3R3VA 4WLOA 5C8YF 4PAMA 5D3MA 1VSTA 1SCAA 2WYIA 2QRZA 3ZGXA 3DCNA 5ARDA 3VR3A 4YRMA 1P6XA 2BFOA 2X40A 3MOGA 5CHYA 4BO7A 1SCDA 2BV3A 1FP4A 4A6DA 1POXA 1FUEA 2OK7A 5EJ6A 4DLXA 1PFVA 4TMZA 1CVLA 1OGIA 5F5XA 3SN6A 5IC6A 3RU7A 5CVUA 3RVLA 3TLBA 3L0BA 2RHJA 4L5IA 1DAIA 1KSHA 3R7WA 4R2JA 6GPBA 3RLIA 5E2AA 1H5QA 1GKLA 1R8XA 2JJ1A 3H83A 3OKFA 5LPNA 1F3LA 1NN3A 3VYTB 1RQGA 1JS1X 1AGRA 4AB1A 2GT1A 3G0CA 3LA8A 2OLEA 5EKSA 5IH7A 1BOOA 3E82A 1JE1A 1U0FA 3IO3A 2DBQA 5A71A 5KINB 3S81A 5JPDA 1BXZA 2VK2A 4D99A 4QRIA 3SYLA 2LR0A 4KB5A 3ZCTA 4CQLA 1VIDA 4P36A 2F9LA 1CXZA 4UHKA 2LP4Y 2OD2A 1DBPA 2NU9A 4YVFA 1BHSA 2YY7A 3TZLA 3WTCA 4C21A 4E08A 1IIBA 2XYRA 2PBRA 4HQRA 4L85A 1YQUA 1ZGGA 4DC0A 5ILGA 1DPGA 3M89A 4INZA 2D06A 5REQB 5M34A 1MFPA 2BRUC 4KYTA 2XCIA 1JZQA 2I7TA 1PCXA 1ZBQA 2BZSA 4JLKA 3UXHA 5D6NA 4ZDWA 2IV2X 5CW2A 1DEXA 2PXXA 3WRYA 1ORDA 2ORED 4MGEA 5HKAA 3LTNC 5KTSA 1RWQA 4FHFA 2ZSBA 1E2BA 4OP1A 1PFYA 2AEMA 1CQZA 3BQ9A 1WX1A 5KSWB 1JLMA 1VLZA 2ZSKA 3NVAA 3O3OB 5LNK1 5DP2A 4OLBA 1JHQA 3TH5A 3USCS 4PW0A 3C3JA 1GGMA 4NE9A 3SI7A 1G21E 4NJMA 3W3AH 3UH0A 1IBCA 1UEIA 1RYYA 3AR3A 3ISTA 3NVKI 2GYWA 3BQNB 4IXMA 4Y6LA 2QD2A 1S8NA 2FCRA 1RU3A 3DMRA 2HA2A 3EFBA 4DLAA 2G9ZA 2AZDA 1A2BA 3HA7A 3HDVA 3T34A 4AJ2A 1RAGA 2Q2QA 4EG8A 1P0QA 1WW3A 4OJNA 5FH9A 1T5LA 4DKJA 2Y0PA 4R51A 3E5NA 2V98A 1SXHA 3QJ5A 3QEBZ 4LG1A 3D4OA 2PPLA 3UAGA 5AI6A 3LX4A 4GWKA 4NKRA 1W94A 1EXVA 1VL1A 1GNPA 4UE6A 1Y4SA 2IPAB 3RGGA 4BFXA 3LUHA 2Q8QA 4KJXA 3ZQ6A 3CZMA 1H69A 2C3PA 1H1TA 5CYFA 4IIJF 5G40A 5IAEA 1DKMA 3DMTA 2KLHA 2X3FA 5H70A 1MC1A 3R3HA 3TZHA 3EDMA 3ZW7A 3KQYA 3VSEA 2C5BA 2D8MA 4AMUA 2WE8A 1B0UA 1U5CA 4MWDA 1COWD 1MOQA 2CLLB 4JITA 5AW4A 4MQFB 2WYVA 2AJ8A 3P2OA 3QJGA 4GP7A 4H1UA 4EI9A 5BT8A 5CG1A 6Q21A 1MPTA 1GQOA 2DBVO 2ILVA 3K1ZA 5TB5A 3RSLA 4JH0A 1NX6A 2QUKA 4GDFA 4G41A 4Y8VA 4OJKA 4OQNA 4KDFA 3U7QA 3UO8B 3KXKA 4RMNA 2XYHA 1ZM3A 3MWLA 4GVLA 4E31A 4EZIA 1R0WA 5E7MA 4AWXA 2GH1A 2ZLBA 1AZTA 5EUBA 3UMSA 3OLXA 1FMTA 3TQSA 3KQTA 2WYUA 4P3PA 2VPYA 4A8JA 1QCYA 1X6VA 3PFKA 4XI9A 1P9LA 1U0BB 4MDHA 4FWTA 1SVSA 3UAOA 5THXA 1GLGA 2C2WA 1G7RA 2E87A 3JYOA 3WYCA 5DU2A 3DAYA 1IQPA 1QGED 2C58A 3LKZA 3ICWA 2QMOA 1VJCA 3PFGA 1SZPA 2BEVA 2ZRAA 5LBIA 2AJCA 2V4ZA 4PRZA 3N0RA 2GM4A 3T7TA 4PAOA 5FUQA 4E5KA 4S3MA 4EGFA 4F5EA 2DUMA 3T9BA 4PEVA 2GZ3A 5C1IA 1X42A 1I7LA 4GO1A 2BI8A 2JS7A 3DMHA 1H4VB 3STWA 1E3LA 3G9ZA 2Z5VA 4QNRA 3A6GA 2WU8A 5FWAA 1EA5A 2OHGA 2MCFA 4B44A 2DY1A 1KBZA 2QS9A 4RTLA 4A73A 3FYSA 1O95A 1H94A 2GJAA 2JIQA 1EBUA 1Z4PX 2ZOSA 4MUMA 4CLHA 1QRUA 3KJIA 3SJUA 3TNYA 4NK5A 3QFFA 4YUXA 1ULSA 2DLNA 3IJRA 1KEPA 1C4OA 1A8UA 3GJYA 2Z1DA 3REOA 2VF5X 4EBBA 1P4GA 1SUWA 2P9FA 2Z8YM 4BOYA 3WFZA 1EJ0A 3E9YA 5K0JA 4FSHA 1US8B 3G82C 1J0BA 1FBNA 4OF4A 4WK6A 5JMTA 3ISJA 2X0FA 2CJWB 4ARIA 2HO4A 5IJ9A 5ANRB 5U9CA 4YCMA 1WUKS 2O8FB 4JYMA 3H65A 1MB9A 4INPA 4NU6A 1FPQA 4P98A 1ZUD1 4RYLA 4CHTA 4EX6A 5AVRA 2YY6A 2EJWA 1OIWA 4NJEA 4BQQA 2I8LA 1SB9A 4Y2QA 2R00A 3TL2A 3GGGA 4ZVTA 3ASUA 4NV1A 3IPRA 4WRRA 5K2OA 3ZWPA 2YUIA 3G88A 2XTAA 4GMXA 3RJ9A 3ZDYB 4U2FA 4P31A 4H4DA 4PNEA 4FS3A 5EZYB 2RJNA 3RHZA 2CUKA 3NFYA 2JA1A 4QUBA 2EKZA 1DQNA 4YJHA 2W48A 1ISSA 1FP6A 4E21A 3MWYW 1EESA 2RAUA 3ABRB 5K3FB 1XAJA 3S0JA 3AM5A 4L1KA 3W5HA 5C46F 2IS6A 2JHAA 3DFFA 1G1MA 3GD5A 3N59A 3WGLA 2EBFX 2Q4TA 4DJTA 2C2MA 1P5ZB 1NZJA 1ZI8A 2HRBA 3QMMA 3NEPX 3O2SB 1VZ3A 3UKDA 4IMRA 2RHTA 4MMYB 1USGA 3OF5A 3X2EA 1N5JA 3BIOA 1MAUA 4U7JA 1JX6A 1QS0B 4KX3A 2H31A 2HB6A 3FSGD 4BEVA 3R23A 2EJTA 2IEAA 4UXIA 4D4GA 2O2ZA 3AERB 1Z5ZA 1RJ9B 3AETA 5HF6A 1K6JA 2JHGA 4F4HA 4DIDA 4ZMRA 2EFJA 5CX1B 4P3NA 2ZANA 3CRZA 2FMXA 3FOCA 3PQ8A 4JR0A 4KXUA 1ZX1A 4U9IS 4YS6A 4ZXFA 2J30A 3VDNB 3I2GA 3K8ZA 1V8DA 1IM2A 2ROQA 1H6CA 1X80B 1YI8A 3UT6A 5KOIA 3KXIA 2G07A 4YC7A 3VNQA 3K6SB 1Q0UA 1SCIA 4KWCA 3IP5A 4CN9A 3FDJA 1T0PA 2D5LA 2FKAA 1PUIA 4HPXB 5KWEA 2PS0A 2MHCA 4QHYA 4XQEA 5TQ2B 2VO1A 1KQNA 3TSYA 4EJ0A 3EEBA 2P40A 4IO0A 1C81A 1N1DA 5IT4A 1NBEA 4FJ0A 4P4TA 1WM1A 1ZM4A 1YSCA 3BFPA 3DMPA 4GRAA 3EXAA 4RE6A 1DBWA 4RGVA 3VHXB 2CLHB 2B9VA 4N49A 2O0JA 3I92A 4MWSA 2R6HA 1NRXA 2WV7A 4NFLA 2UYOA 5FAXA 3W1EA 1SY7A 3P9YA 5I7EA 4CIAA 1CR4A 4W8HA 4OHCA 2GAIA 3M8KA 4Q66C 4GI5A 1ZK1A 2NXJA 2Z9BA 3E5HA 4H1VA 4HEQA 3DZIA 1OE0A 1WOYA 2G9QA 2QIOA 4QDKA 1DJLA 4BQRA 4GVPA 4F3YA 2FFAA 3G85A 4JGIA 4WLVA 2CMHA 3VKHA 4KN8A 3HJGA 1ZIXA 1N8TA 2GPJA 4MQEA 5FBRB 4CT4B 3AF1A 3K15A 5H83A 4I1SA 2P4EA 3FBGA 1W47A 4BB6A 3BD6A 4CM5A 2POQX 5HDBB 5CVVA 2P69A 2YXBA 3CNNA 1Z5NA 2FOXA 1JKXA 2J1LA 3AEKA 4H3VA 3WHLA 3RS2A 1QB8A 2HTEA 1IZZA 3RS4A 1IEQA 4K9MA 4DIBA 3IUJA 3HVHA 1DAFA 1K86A 4JJ8A 9MHTA 1LBTA 1Q2XA 2YR0A 4I5GA 2GUGA 1ILWA 2FN3A 3WY9A 2G5CA 3UVEA 1CJVC 2AMJA 4ECAA 3HBMA 1TRKA 1UT6A 4G81A 4JQOA 3UAWA 2QAGB 1R66A 2E89A 1E2QA 1TKAA 4JLPA 4K9NA 4RD4A 2I3BA 3BXHA 2VUIB 5HSGA 2FN4A 1QIKA 3GLIA 3ABSB 2O5EA 3ZH2A 4ZI7F 1XZKA 2B35A 2OFOA 4CIVA 1NIPA 2Z09A 3JQGA 5A7FA 5F5LA 1GV0A 5HNKA 4ICIA 1J7KA 4HL6A 1VMEA 5AW6A 3CPSA 1T10A 2FMFA 2O1WA 3B70A 1N4AA 1HDGO 2GEDA 3B6EA 4H0NA 2BJVA 4JQZA 4D6YA 3QY0A 5E4JA 1KMQA 1P9NA 1BQEA 2R6GA 2ZQ5A 3QOYA 4ER7A 4F1WA 3HU5A 4UNRA 3EYAA 3R0ZA 5HOEA 5CCEA 2RD2A 1HE3A 4JJIA 5B1DA 2CL7X 4GPBA 1QNFA 5H4GA 4MV0A 3LBNA 1FOEB 1EKXA 2YJ4A 2W0MA 1MVOA 1PHPA 3O7MA 3EG9B 3HYLA 4R2IA 1GRCA 1BGWA 4RULA 2VUUA 3LRXA 1QV6A 1Z6AA 2ZWMA 4Q1FA 5DHFA 5HFAA 4JK3A 2QZ9A 3W5AA 4FDMA 3NTVA 1I51A 3RUHA 1FNSA 1KDOA 4WESB 3Q72A 3L7MA 2XYGA 1P17A 2O2SA 2OOKA 3GEDA 1E9CA 1AH2A 1QFSA 1UBUS 3DEFA 5K8TA 3HI6A 3KJQA 2DFKB 4K7JA 5JCOA 5A4DA 2H3EA 4I6JA 2KW5A 2VJOA 3M6XA 4RD1A 2NT3A 1JEQB 3R4VA 1GPJA 2ZCJA 3AKYA 3B8HA 4OI4A 4ZKEA 3R6GA 2VXOA 4WXYB 3WLLA 1SUAA 4IOLA 3O0TA 2AQ8A 3H2BA 2A1UA 3D54D 2OV1A 2WNIA 3FPJA 4G4SO 4KTTE 3MTQA 4MLCA 3W6ZA 1LU9A 2REXB 3BTSA 1Z4MA 5TMEA 2IH2A 1LW6E 1KS9A 1NRWA 4YT2A 1FJ2A 1WD5A 2G80A 2BDTA 4XD2A 5AK4A 3TW8B 3X1XA 4C0WA 1VJ5A 2C1XA 3B6MA 5JS2A 3NM4A 2ZYGA 1TF2A 3KBBA 2JEOA 1HDCA 6YASA 1O5TA 1Z2PX 5EXEA 1XHEA 3SYMA 1JEYA 4WVLA 2XZLA 4ZHQF 2C1ZA 2YNMD 1HKUA 3NV7A 3AFGA 1J7JA 4OMFG 4XWAA 2AV6A 1NJSA 2XUDA 1VL6A 4QVIA 4JJGA 1NDUA 4D4JA 2DU8A 2XXBA 2CXPA 4I46A 3NIDB 4YTEA 4IZ6A 4YP9A 4ZZIA 3ONWA 1J49A 2GD1O 1I7QB 2G4LA 3D0RA 3N2NA 1LC3A 3MJFA 2O3QA 4HTFA 4CODB 4GGMX 1J00A 1L7MA 1I0ZA 1RYFA 2RK4A 3KUUA 3B53X 4GE0A 5EWMA 1QDEA 3HVUA 4WGGA 4LVNA 2RHWA 1TT5A 3ND5A 1XCBA 2JDID 1WSWA 2WHXA 2DPHA 2Q1TA 2LIPA 3QP9A 1W85A 4MB6A 4RTKA 1GV1A 1RKBA 4QPDA 2IOFA 3WSTA 4Z53A 1U02A 1BHJA 5CB0A 4P83A 1N9GB 5AKLA 3GA7A 3C8HA 4CEJA 2B25A 1N6LA 2BMJA 4RK5A 1L5GB 4LHYA 4LOAA 1P4AA 3G0HA 2OL4A 2ES4A 2CL0X 3R3YA 4ID3A 1I3LA 1WA5A 2VFAA 4TMWA 3WJ7A 4BMYA 4DLLA 1QYVA 2DFLA 3VC3A 2HJSA 4DDMA 3GBVA 3TI9A 4CXMA 3BB4A 2GM5A 3C4QA 4FC7A 5LMCA 3U5ZB 2FQYA 4TVOA 4RS3A 4ML3A 2LPMA 1NVVQ 3J7TA 4MKRA 4DBVO 1P2TA 3IV9A 2NOAA 1X1EA 3LVBA 4XJVA 1UJNA 2Q50A 3FOAA 5I6DA 3ER8A 4C6HA 1VJ0A 3WLIA 1UBLS 3QX9A 1UXKA 2K2QB 4RWEA 2C29D 3RH0A 5LKRA 4MJLA 2AI3A 3VR2D 5JJIA 1A04A 5LXTB 1TADA 1XZHA 4IRXA 4RQBA 3LI2A 1BXRA 5FV7A 3NYRA 4YMTA 1TI7A 3EISA 3N2KB 4XB2A 1O6GA 1XMSA 3LKBA 1FJHA 1MC8A 1MC4A 1GNSA 4LKRA 5B37A 2R0QC 1Y7LA 3LT5A 5EP2A 1YF3A 1ZIDA 1LBQA 3TD9A 3CKMA 1GPYA 1YBVA 2OXFA 5DHRA 3PNLA 4DNFA 1JHYA 3B3GA 3F3SA 4B6PA 2AG0A 2IS2A 1HYGA 3KNZA 4BQEA 4F9FA 2AK3A 4OGFA 3UFXA 3AR7A 1S8FA 1U8ZA 4BUCA 4QPPA 5CCXA 4OK6A 4EI2A 1K08A 1E3WA 2R62A 2D2EA 1E1MA 3DSRA 3HP4A 4RJLA 3THRA 3WQHA 1X8JA 5AKHA 4DVJA 4MVXA 5GJBA 1YBAA 3N0TA 4ZT4A 3WL3A 3ZCUA 5I9NA 3K72B 5LZ5A 3RUIA 1JQLB 5CVTA 5AM0A 2IEGA 4Q4CA 2HJ9A 3LDAA 3G0BA 2QTNA 3RRFA 3WMRA 1UINA 5DHQA 5KX5A 4XPIA 1YS2X 1QFZA 3D8NA 1ZLYA 1YMUA 4HXEB 3TI7A 3UAYA 1Q16A 3LLUA 3UV7A 1UFOA 1HKHA 1QRAA 1UQRA 3NNSA 4XFJA 3ZBQA 4JI5B 4AS3A 5ARCA 4M87A 4OMDA 3GG2A 4R3UC 5AJVB 2TMKA 5BNIA 3GFOA 2VYQA 2TMGA 4B73A 1R5JA 5B3JC 1GTZA 1JPVA 3K35A 4PHHA 4IJVA 3ECAA 3VPFA 4CGYA 1XPUA 1KRHA 3TLJA 3JAMA 2C61A 4XJSA 5GTDA 3IAUA 1E2EA 1KERA 1BU5A 2HJWA 5K3SA 2RARA 3FIUA 1A4UA 3UJ9A 3NJ8A 1XZIA 4JHLA 5JDIA 1CULC 3KB2A 3CTPA 5D5HA 4OHUA 3OU7A 1D0SA 1NJFA 1ZJ5A 2XLCA 3A7DA 3WMFA 1XZAA 1GLNA 3JY6A 4L8VA 3HMKA 4S1PA 4O59O 4HTAA 1PR6A 1OSNA 2FP3A 2RH5A 4NEHB 4TLDA 3W4IA 4KBFA 3SBEA 4XCQA 1TYDE 3WHKA 2YWEA 1BE6A 4LYYA 1QAQA 2YV2A 4BQFA 5E95A 5BMOA 3B5EA 1X77A 3W3AA 1PSWA 3L8GA 1J97A 3UV3A 2OZKA 5C5IA 1S2GA 3EJ6A 5FOWA 1MEJA 3OJLA 3SXUA 2UVDA 4LISA 4NMXB 3BF8A 4PV7A 3SBDA 3UG7A 4ZYWA 3IDOA 2JBAA 1XTJA 2GFIA 3NHJA 3NHWA 4HDKB 4J07A 3HJUA 4J1TC 3NKVA 1Z0FA 1PGOA 4M6WB 4CVNA 4ABTA 1F5NA 3L6OO 1L2TA 1PWYE 1U8FO 3EEIA 3LQ2A 3LGAA 5ITZA 1W36B 4PXYA 2Q4BA 1AX9A 5F76A 3LT4A 3V6MA 3LUGA 4G0OA 4MB0A 2QTAA 1CS0B 2I33A 1ODIA 2GHQA 2N9UA 2JFBA 4H1HA 4MCIA 4P5DA 3NBAA 4LJLA 1OFUX 2N1MA 4AKGA 3RUAA 2GBIA 5E4YA 1H6DA 5KNCH 2Q9CA 1SKUA 2AH5A 2EF0A 3T9CA 1TYBE 1T2EA 2DUUA 2OZPA 5J1SB 3D6NB 3W8DA 2DERA 3C2QA 4HLQB 2KM1A 4CEIA 1XA3A 1HRDA 4QASA 3O8OA 2ZI4A 3ZE9A 3KZKA 2Z5GA 1ONBA 4YCCA 1WCIA 4XCVA 1SQFA 4OAOA 1UJ4A 3A9UA 4F8YA 4M86A 1UFRA 1YJXA 3U19A 4RQAA 2P65A 2EFEB 3I4FA 5KWVA 1M73E 3SOZA 1ZFNA 2XOKD 2VHQA 5AKGA 4BHTA 2H9YA 1VBFA 4MAAA 2VPZA 1RZ3A 3IC5A 2H52A 2UZIR 4GMGA 4GZ3A 4UHFA 3P9QA 3RYHB 3E22A 3PIRA 4HAWA 5CITA 3OUZA 4O5OA 4GPEA 2RB5A 2DP4E 2QTVB 3I9NA 3K94A 1JI3A 4MYTA 4DYHA 5BNZA 4WFKA 1ULTA 1OA0A 5HG0A 4CM4A 2VOEA 5IJXA 4NH4A 4BQNA 2AF3C 3GN2A 1NU6A 2YY5A 3EX7C 2P4QA 1KIMA 2QKYA 4GE3A 2DQYA 4CW7A 4JJ6A 1KO5A 4BAUA 1OPXA 4JLAA 1KZ6A 3SF8A 3EQ2A 2R66A 3ECCA 1EWQA 3LVQE 5DDIP 2GX6A 4DDHA 2I6UA 1YE8A 2IH4A 4L8FA 2IYTA 4FE3A 2UDPA 1TL7C 3M9XA 4X1KA 5EJ2A 5JAMA 2HK8A 1GR0A 3NWEA 2NT4A 4JT2A 2JFQA 3TIVA 3UK7A 4DXHA 2BR5A 2XF2A 5CPBA 1E2KA 1LXCA 2FPOA 3JYQA 1VHQA 5MN6A 3WK9A 1Z39A 4X65B 1Z38A 1D8AA 1KPIA 3EZ2A 3UA3A 4FR5A 2X9LA 1VJ1A 2GILA 2R1TB 3F1LA 4I08A 3WRVA 2CZGA 1TM7E 3GV0A 5JSKA 3RTGA 4CCYA 5EWJB 2X0DA 5A3SA 4B3RB 3UTCA 4P9NA 4MYHA 1ZWLA 4QA9A 1DE0A 2WAXA 4TKVB 1XEAA 3U31A 3RIYA 1XAIA 5LJLA 4FEGA 2XPCA 4PSCA 1JMYA 1H42A 1FB5A 2BMVA 2H51A 5T6MA 5AUNB 5IZCA 1ZVVA 4MRMB 4JJZA 2JEYA 2QW8A 2J5QA 1HQYE 2C78A 2GRUA 2PMFA 3GX1A 1C8VB 3P20A 2V3WA 3P2KA 4ZU6X 3H1BA 1V95A 2VQEB 4MVJF 3OT4A 1H0HA 3GBSA 4PZPA 3D6VA 1KWGA 1RRVA 2CFCA 5HTKA 4B7AA 1VIAA 1MX5A 4RAOA 4X62B 4OBBA 3DV0B 3JRWA 3PWTA 3HI4A 4IG9A 3TXYA 4ZDJA 2QZ4A 3JARA 2IYRA 3AHDA 1EXNA 2WIKA 3H2HA 2Y1CA 5DYYA 3RSGA 5AKEA 2YXPX 2BBSA 4JOQA 3SY8A 1FU7A 4JFRA 2X6QA 2HO5A 3AY3A 4IHJF 3BWCA 4Y2PA 3WLHA 4KH1A 4K9LA 3SIWA 2XUIA 3BL8A 3H97A 1D1SA 2R6R1 3KPWA 1NSYA 3L40A 4RPHA 4ZC8A 1D0VA 3GP8A 1SKYE 1YS1X 1NW3A 2O14A 3AEQA 2DVMA 3DMTC 3MB8A 1QGZA 1Y8CA 2LCFA 2BH9A 2PUWA 4EECA 3E2PA 3DMDA 1IPEA 2G1AA 5I7UA 1NMEA 2OD9A 4CTOA 3HL4A 4GBMA 4B84A 4HEA6 2EP7A 3D6HA 1GYQA 4NHEA 5EEHA 1YO6A 4AJOA 1G21A 1CUHA 1CU1A 2PUTA 1CR1A 3IPCA 3OPQA 4BMPB 4ITUA 4MUBA 1WS6A 4UDXX 4KAXA 4F3NA 2FZ4A 5CH8A 1ZGJA 3EDYA 4YAFA 1CR6A 1OXMA 1O2DA 3KCNA 2PRSA 2CLFB 3GPDG 1RNLA 3WYFA 1MRZA 1IIRA 3GRCA 4QXOA 3ZGNA 1KJWA 4CM8B 4F4UA 5L51A 2WJAA 3I9MA 2D5BA 4MI9A 3U9SA 4W5TA 4D9IA 2RG7A 3D0KA 4Q3OA 4WZAE 3TLAA 3UMYA 4M2LA 2PMWB 1DVRA 4Y2YA 3U1TA 5C1PA 2Q5OA 1T1GA 6LDHA 3IUEA 5LZ2A 1P3DA 3A2LA 1L4HA 5G3YA 1I0IA 1JECA 1S1CA 2WAAA 2IW3A 1S3SA 1ZP6A 2W2PA 5JPIA 3TLKA 5BSHA 2XXAA 5DM2A 2SCUA 5LBTA 1NTOA 3W7VA 5LQNA 4IH1A 4EO7A 1COWA 5FNVB 1XI2A 3H0EA 3ZPXA 1U9JA 3KD2A 4RIIA 3ZDZB 4C88A 3FJOA 4KGXA 5MGNA 2D74A 2F9FA 4LYAA 3WKEA 3NNNA 2PMBA 1A5BB 2KBFA 4DSNA 4EHHA 4EX7A 1U2RA 2G71A 1XZQA 3QWBA 1TX4B 3I8XA 3PHHA 4YRDA 1C50A 1ZXLA 1X8KA 4WCVA 4G84A 1L5SA 1M76A 2A5YB 1Q0TA 4QU9A 2BYTA 4JA0A 2H1SA 5IK2D 2ZBFA 3BX1A 4J16C 5F7XA 1WZUA 1G18A 1BZYA 3I62A 2UYHA 1E1NA 3BMOA 4GMFA 3Q3EA 3V5NA 3Q7TA 4GKVA 4RBNA 3G17A 1JFFA 1H23A 2XDYA 4YRTA 3UMMA 4EW6A 4MVJH 4E5MA 3JVDA 4DTCA 5K05A 4LDJA 1L9KA 1GGJA 2WJGA 1CY2A 3STXA 4LYEA 4U9HS 3TWOA 4C7MA 2BGMA 4KQ6A 1M72A 2B20A 1J8MF 4D6PA 1NY6A 5CM9C 3AUKA 3ELWA 1V35A 3WAJA 2JASA 4JMLA 4DIUA 1XD2B 2AC2A 2OCPA 4WOJA 2HJHA 3FTNA 1UJMA 1RHMA 4QG3A 3A6KA 3ILYA 4ZYXA 5HZGA 3K9WA 4EY7A 4HRXA 2A78A 4MHTA 3KXPA 1JJAA 3NPMA 2EZUA 2DYKA 3U7EB 5B7GA 4EL0A 4FOTA 4G0QA 3CXRA 3S2FA 2NO9A 5FKJA 4URVR 4N76A 3X1JA 3KYDB 2FGKA 1TC1A 4NABA 4TMYA 4AN0A 4YI3A 1U2QA 4F97A 3MBKA 5JSFA 5KYGA 3COJA 3E0QA 4F86A 1BG6A 1E0DA 4JZYA 1UPUA 1Z12A 3CLUC 3UAXA 3JZAA 4HV4A