1MG5A

Crystal structure of drosophila melanogaster alcohol dehydrogenase complexed with nadh and acetate at 1.6 a
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
255
structure length
255
Chain Sequence
SFTLTNKNVIFVAGLGGIGLDTSKELLKRDLKNLVILDRIENPAAIAELKAINPKVTVTFYPYDVTVPIAETTKLLKTIFAQLKTVDVLINGAGILDDHQIERTIAVNYTGLVNTTTAILDFWDKRKGGPGGIICNIGSVTGFNAIYQVPVYSGTKAAVVNFTSSLAKLAPITGVTAYTVNPGITRTTLVHKFNSWLDVEPQVAEKLLAHPTQPSLACAENFVKAIELNQNGAIWKLDLGTLEAIQWTKHWDSGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alcohol dehydrogenase
publication title Drosophila alcohol dehydrogenase: acetate-enzyme interactions and novel insights into the effects of electrostatics on catalysis
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 98
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2002-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1mg5A00
4BQPA 3GVCA 3H2SA 1U28A 4IJKA 5F1OA 2Y67A 4F45A 5ICSA 1MFZA 4YJGA 2C20A 3I3OA 5DNAA 2HCTA 1ENPA 2RH8A 2GUGA 1DO8A 5JAIA 4C7JA 1P33A 1O95A 1B8UA 2G1UA 1MFPA 4GSKA 1EQUA 1T2AA 2BRUA 2NQ8A 3G1TA 4M55A 4F3YA 4RVDA 3E82A 2YQ5A 4PLZA 1DC5A 4PCVA 4BO8A 2DBVO 1RWBA 4R16A 1VM6A 1HDGO 5CFZA 1CIVA 3OEWA 4BNGA 2BELA 3E8XA 3GPIA 1U5AA 3D0OA 3DOOA 4TVOA 3LC2O 2FOIA 3PFWO 1OMOA 2W2KB 3WXBA 3GY0A 5AVOA 4AICA 3B20A 5B37A 2B0JA 5L45A 1MA0A 2FY8A 4IMPA 5JY6A 1VI2A 2YV1A 4BOYA 4PZEA 4UAGA 3VH2A 1ZK2A 2PZKA 4AJ4A 2D4AA 4KUHA 5KKAA 4NQZA 1KVRA 2OXIA 2ZATA 4YACA 4X54A 3RFVA 3M6IA 4AJ2A 4B8ZA 4RPGA 2ZB4A 1FJHA 1PJQA 2Q4EA 2R6JA 5AOVA 1P0CA 5ILOA 4R4JA 5BSGA 2AXQA 2QZ9A 4QFDA 1T2EA 2X58A 4YJHA 4BMSA 5L40A 3S2IA 5L9AA 4N7RA 3WFIA 4DVJA 4NH4A 3BTUA 4J9UE 4NDNE 3PYMA 4L9RA 3RBXA 1F06A 4UVIA 3L6EA 1ZSVA 3H9UA 4BO6A 3ST7A 4L75A 3U4IA 4CM6A 3U9LA 4B7XA 1E7SA 4IZIA 4H3VA 3C1AA 2NSDA 4FGWA 4FOOA 1F8FA 3PHLA 1CJCA 4D42A 3IJPA 4IINA 1KERA 2FWMX 3K96A 4R9RA 1OC2A 4J4TA 1N1EA 5G0TA 4AVYA 1J6UA 2W2LD 3DAPA 2Q3EA 4YAGA 1WPQA 4GKVA 5LCXA 2ZYDA 3ASVA 4AL4A 4CM1A 1Q7CA 4KZPA 5IDYA 1E7WA 1GQQA 2C29D 3LF2A 1JWBB 4UUNA 3P7MA 5A3JA 1LDNA 4FBGA 1EUCA 1S7CA 2B36A 3DZBA 3I4CA 3CUKA 5TSDA 4CL8A 1D7OA 2X8LA 4DBVO 1O0SA 2ZIZA 4I1IA 5ILGA 3E03A 1DAPA 1ZO8A 4ZRNA 4J3FA 4RPKA 4K26A 1AXGA 1YOVB 2WYUA 3AUTA 2W8ZA 4MP8A 4BGVA 2DTDA 3IL2A 2D0IA 1QYDA 2RBEA 1DJNA 3JD2A 4PLFA 3SVTA 1VLLA 3EAGA 4NHEA 3F5QA 2C0CA 2E37A 2HMVA 1C0LA 2XOXA 5CDTA 4IIUA 2I67A 2NVWA 3EVTA 3RUFA 4YYZA 1TLTA 4JP3A 1W4ZA 3GG9A 3OJEA 1XCBA 4ZD6A 5JYEA 2G5CA 4XQ9A 4FS3A 4NU5A 2C82A 4W7HA 5HWSA 4EUEA 3UKOA 1FK8A 3DB2A 4IDAA 1P1RA 2X9GA 3DDNA 5JDCA 1RM3A 1SMKA 4B3JA 3P5SA 2QRLA 1KS9A 5A3VA 3C1TA 4PRKA 1T4DA 3MWEB 3INTA 1HLPA 2NQTA 2BHLA 5C5IA 2I3AA 1QV6A 4NBUA 4UULA 1JLLA 2VQ3A 3U3XA 3WIEA 3N74A 2J3KA 4OOEA 4BUCA 5GMOA 1ZJYA 4M8SA 1GR0A 3BMOA 3BAZA 5A06A 3JQ8A 3V1YA 5TF4A 5HTOA 2FN7A 5U9CA 1NQAO 5GY7A 1NASA 5G4KA 2IODA 2VZ8A 3GPDG 3S2EA 4YT2A 2ZTLA 4E2ZA 2X9VA 2AEJA 1N5DA 4R41A 2CZCA 1E7YA 2P91A 3R0IA 4BNUA 1E3LA 1B7GO 1E1LA 4EI2A 3GF4A 4JJGA 4JXKA 5TJ9A 1ARZA 2CNBA 1VJ0A 1B8PA 3JTMA 2GO1A 1QORA 4ND2A 2O3SA 4W82A 3B70A 4MVJP 4AJIA 1Y5MA 3LU1A 4YWJA 2DBQA 2DLDA 4E32A 4PG6A 3KEQA 4MIOA 3VDRA 4CQMD 3DTYA 3A4VA 1PS8A 2GN8A 5JMPA 4ILKA 3F9IA 5F5NA 3PPIA 4BNLA 2GERA 4CQLA 3SJUA 5TJHA 2BF7A 3PQFA 5BSHA 4O59O 1LC3A 3KSDO 1ZFNA 4PG8A 4CM9D 3OH8A 2X22A 2YW9A 1B2LA 1QRRA 4U6QA 5G4LA 3FR8A 2Z95A 4OXKA 1DLJA 3JYLA 3LSYA 1NPTO 3FNHA 3HN2A 5A5EA 5L51A 4CJXA 2DT5A 4PFJA 5CPFA 3PI7A 1DPGA 3HDJA 3H3FA 3Q9UA 3WYEA 5I8WA 3ENNA 2O4CA 3Q3CA 1PL6A 3ASUA 4KTVE 4UEJA 5A05A 4PN3A 2PKQP 3KEOA 1RYDA 4WLNA 1SPXA 2WDZA 1R0SA 1D3AA 1NHGA 5DOVA 3S55A 1I3KA 2QIOA 4BV8A 6LDHA 3INGA 5TX7A 4F46A 3ZI0A 3EDMA 3RKUA 1YBAA 1E6WA 2Q45A 4XRRA 3WJ7A 4CLXA 5JDCC 5KNLA 2WYWA 3PRJA 1O6ZA 4CPDA 4IXWA 4K6CA 4KOAA 3ROMA 4DL9A 1D1TA 5ES3A 3PHHA 4YAEA 3UVEA 1NPYA 1K0UA 1X1EA 3EW7A 4EJMA 2NU9A 3JQDA 1RYEA 3WYCA 1B15A 4TVBA 4UUMA 4OJNA 1LLQA 4LK3A 3DEYX 2GGSA 2BLLA 4PVCA 4XEHA 1VE9A 4A2CA 4E5YA 1GUYA 2BFPA 4HNGA 1PGQA 4LCJA 3DOJA 1YL6A 3ZNQA 3W4IA 3OA2A 2J8ZA 3WTCA 3SC6A 1MB4A 3ZU4A 3FTPA 4W9NC 2EKQA 3D3WB 2DBRA 1Z73A 3CH6A 4IGEA 5IN4A 2VCYA 4MDHA 1N8KA 4XQCA 4WPGA 3AU8A 3KUXA 1JQBA 4MO2A 4TRRA 4E5PA 3L6OO 4L4XA 4BNWA 2NM0A 3Q2KA 2LDXA 4NJMB 4RVHA 1EVYA 5EIOA 1T25A 1LU9A 5KJCA 3ROQA 3ULKA 3M2PA 4J16A 4R3NA 2DFVA 3RAJA 1CF2O 2WWRA 4BKOA 4RZHA 5KCZA 1ISHA 4CLOA 4DYDA 5MGBA 1PGJA 3H4VA 1JAXA 1GYRA 4RCVA 2UDPA 3LYLA 4KTTE 3TWOA 4BL5A 4RPJA 4NZ9A 1ZXLA 2SCUA 4WLOA 3FI9A 1GAEO 3K73O 4Q39A 2IXAA 4WCFA 5CHEA 4WLVA 4YEDA 3TDKA 1I36A 2O23A 3KB6A 1DIHA 4IZHA 1B26A 2ZB3A 1I2ZA 1HWYA 3WGHA 4BMNA 1QG6A 1EFLA 5T6BA 3OP4A 2I65A 2Q2VA 2VRCD 5K9ZA 3TSCA 4WNCA 4B3IA 2GF2A 3F5SA 4II3A 4KQXA 3GFGA 3RSHA 1UP7A 2VZ0A 1ONPA 4HFJA 3U62A 5B4UA 5JBIA 1F8GA 1SC6A 2FZEA 1PZFA 2PKRA 2XAAA 1UP4A 3VTFA 3OA0A 4DUPA 1P1FA 1DRWA 3DZJA 4UEOA 5TC4A 1OZAA 3TJRA 1U8XX 3LT1A 2CUKA 4J43A 3UXYA 4JP2A 4AJJA 1H9BA 4R5MA 2HSDA 2BFAA 4RPLA 1EDOA 5JFOA 3ZHBA 4GGOA 3GR6A 1LXCA 3EVNA 2NTVA 2Q50A 3PXXA 3LT4A 4CMAA 4OSOA 1IE3A 4FSHA 1I33A 1HLDA 3DFZA 2EIHA 1IUKA 4BNHA 3GDOA 1ZEJA 4BB5A 2VN8A 1DC3A 3T4XA 5LDHA 3FWNA 1B14A 2NTNA 1K6IA 1U3WA 1TXGA 5EQDA 1CETA 4I9NA 4R1NA 4YR9A 5DT9A 5TS3A 2AQHA 4YDRA 1XQ1A 1XU9A 3KXDA 4F6LA 1ENYA 3E5RA 2B83A 4ALKA 4LISA 3NUGA 4Z9XA 2FSSA 1PIWA 1CRWG 2G76A 1WP4A 4B8WA 4FD3A 3BIOA 4WCDA 3ZV4A 4JBGA 3AY6A 4LSMA 5T64A 4BNIA 1GZ3A 1H6AA 1NFFA 4WEOA 3WX0A 3NDJA 4JQCA 3V8BA 3O9ZA 2NU7A 1H2BA 2W2KA 2A92A 4MVJF 3ZWCA 3KETA 5CDGA 5EPOA 3K31A 5JPIA 3NV9A 1ZUD1 3RFTA 4NIMA 3U49A 1YO6A 4FPXA 4RQUA 1O9BA 4U7WA 4BNVA 3LF1A 4EZBA 4XWYA 4YQYA 3BYZA 3AW9A 1E1MA 1R4MB 2Z1MA 5FF9A 2C5AA 3H3JA 3IMFA 4BO0A 3STHA 5B4TA 3KYDB 3PQDA 1C14A 3QVWA 5EINA 4O6VA 4RVSA 4OMUA 3NT2A 1MLDA 3ETGA 4PZCA 5EERA 2PD4A 1V8BA 4CMBA 4ZGWA 1SO8A 1YVEI 3IP1A 3JQBC 2P9EA 1B8VA 5DCYA 1M75A 3TZHA 4J4HA 3F6YA 2UUPA 3KBOA 3JYNA 1AN9A 1H5QA 3MEQA 4I8XA 3AU9A 4OIMA 4JN6B 3OFSA 4KUGA 5FI3A 2YHIA 4Y6SA 1V0JA 3WLFA 1LUAA 3HDHA 4L8VA 1EVIA 2NVBA 4CMCA 3D64A 5IN5A 3LT0A 4Z3DA 3OICA 5T8KA 4HX5A 1M76A 1XIVA 2QYTA 3G79A 3RUEA 4WECA 3WG9A 1H2HA 2IEDA 1W6UA 5GZ1A 1WDMA 3M1LA 1GYPA 2YQ4A 4EBFA 3K2EA 1RM0A 2NTJA 3MJSA 2JAPA 2O48X 1ISIA 1IYZA 1T2DA 3DTTA 3VTZA 3RJ9A 3AOGA 1ZH8A 4BKPA 1DIAA 2A4KA 3DHEA 4L4RA 1MC4A 3H2ZA 4KUEA 4PG7A 2B5VA 4G65A 3UICA 4CMIB 5DZSA 5IDWA 4FN4A 1UUFA 3NJ4A 2X23A 1EZ4A 1YOVA 3Q2IA 3G49A 4A03A 2GCGA 4BNMA 3I9LA 5KTKA 4A73A 3IIEA 2LDBA 1PEDA 3SBOA 1PJTA 2Z5LA 3FPLA 4UUOA 1FDVA 2YJZA 1MP0A 4HY3A 5LC1A 3H65A 2HJRA 1RKXA 1YL5A 1OBFO 3CMCO 1UAGA 2PH5A 1E7MA 4DRYA 2X0RA 1HKUA 1A71A 1K6XA 4HFMA 4INAA 1VKOA 3Q6IA 1ZCJA 5A9TA 2Q99A 2NADA 1GQ2A 5GZ6A 3KRTA 3AI1A 1GZ6A 2EP7A 2W90A 3U09A 5U4QA 1LRKA 1C0PA 1IHYA 1I10A 1X1TA 2IE0A 2QQ5A 1XELA 2D5CA 2VYVA 3WNQA 2YDXA 4IGFA 5L4LA 2PFGA 5A9RA 4ZICA 4E21A 2X0IA 4A26A 5U1PA 1IY8A 3IP3A 3D3EA 2I76A 4LRSB 4ALMA 2VHZA 1E92A 2IYPA 2BGKA 1AE1A 3DL2A 3KM0A 4O0LA 4ZA2A 4AFNA 2EP5A 1DDOA 3MTGA 3NT4A 4AJHA 3DWFA 5C37A 4OO3A 2B4TO 1C1XA 1XLTA 2TMGA 1EFKA 4GH5A 4BNXA 4B7CA 1LQUA 1WZIA 1Y1PA 1BDMA 1YB1A 3A28A 1KEVA 1NFRA 2Y1FA 3AK4A 2Y66A 4Y9DA 2OZPA 2QG4A 3CXRA 1LLUA 3K2BA 1JVBA 4RF3A 4YB8A 3T7CA 1PJLA 1GPDG 3WGOA 3RUHA 1N7HA 3LQFA 5JW6A 1IPEA 2ZK7A 3PTZA 4IQGA 5T8KC 5K6AA 3RQSA 4IM7A 2AA3A 3G3EA 4QO7A 4NBVA 1WMAA 2HQ1A 3DQPA 2DC1A 1BG6A 5TNXA 3R6DA 3NT5A 1NR7A 3IQDB 1U1IA 4NMHA 1DB3A 1NR1A 1DIBA 4MVJD 5JCJD 2RHRA 1ISJA 3DAFA 2O2SA 2ZB8A 1GY8A 4J1NA 4U8GA 4E2YA 2P5YA 2VHXA 1BXGA 5ENDA 5A04A 5IFLA 1UDAA 3K6JA 3VPSA 3I9OA 2X6TA 4BQRA 5L7TA 2CMDA 3W1VA 1NBOA 2VT2A 1HTBA 4PLGA 3RC7A 3FSRA 1DLIA 1VC2A 3I9NA 4TZKA 3P2OA 4GX5A 4W7IA 4DLBA 1UXKA 3AOEA 4J7XA 1QYXA 1A5ZA 1VKNA 1U8FO 1NWHA 3PJDA 2HKIA 1PU2A 2VYND 4FFPA 5BNTA 3BHJA 4P4LA 5HS6A 2JCYA 4LMPA 5DCUA 3G1UA 2E6UX 1PZHA 2P4QA 2QRJA 1ZNQO 3JQFA 2O3JA 4J1QA 2IZZA 4U0KA 3TQHA 1RPNA 1LLCA 2PGDA 1C3VA 1KY4A 2X7HA 3N7UA 4ZVVA 3QY9A 4Q3DA 4OKNA 4NBTA 1E6EA 5IDQA 3GVPA 1I5RA 3LLVA 1EVJA 2FR0A 1V9LA 4LCEA 4GGPA 1YXMA 4ID9A 5HA5A 3GVIA 3ANMA 5MDHA 1PS9A 6ADHA 1CYDA 1CDOA 1HRDA 1PTJA 2PY6A 3VZRA 5IG2A 1U2DA 1BTOA 3MWDB 2O2YA 4ZQBA 4D3SA 5L95A 4ALJA 2YYYA 2O3UA 3JYPA 3KYCB 1E1NA 3JQ9A 5KWEA 4N5LA 3V1UA 3H5RA 2JFGA 4HADA 2J5RA 5ITWA 1GADO 4TRJA 5F1PA 4C4OA 1HSOA 1R66A 1T4BA 4QEDA 4RGBA 1ONNA 5KOIA 4LVCA 3U5TA 2GSDA 3L07A 3WWYA 5A5FA 1ISFA 3D3WA 4JX8A 1I32A 3IC5A 2VRBA 5HM8A 2C7VA 4BIIA 1ZK1A 2JFHA 3CKYA 4G2NA 4QQRA 5JAQA 1EDZA 4KDEA 2CDAA 4NJMA 4CR8A 1MC5A 1NQOA 1H6DA 1SEVA 1OFGA 1HDCA 4FFMA 3HSKA 5KJEA 2PNFA 3ANNA 3LZ6A 4RV9A 4CV3A 1Z75A 3T4EA 3NGXA 2WTBA 4Y98A 2PKQO 1O94A 2VOJA 4EDFA 4IJWA 2X1HA 2G17A 2ZQZA 4II2A 4HKTA 5FYDA 3CIFA 3I1JA 4I5DA 2Y99A 3WMXA 4W4TA 1LC0A 3PYLA 5THQA 1LNQA 1YKFA 2X4GA 2PTGA 3RROA 3OIFA 1TB4A 4H15A 4LRTB 4BGIA 2HK8A 3ABIA 3AOEC 3RWBA 1OOEA 3LLSA 4I5FA 3FD8A 3E9MA 4JJFA 4Z0PA 3WGTA 1BSVA 4B4VA 2OHXA 3D5TA 4P4GA 1U7HA 1VSUA 3F4BA 2NVUB 2QYSA 2GPTA 3A06A 4Z0HO 4PRLA 3UCEA 4YXFA 3PFFA 1LTHR 1S6YA 4IMRA 4R68A 3FNFA 1YBMA 3AM5A 4TKLA 4UVEA 1UJMA 4XCVA 2IXBA 3JQFC 2J5QA 4QXMA 1Y5RA 4IDEA 2X9NA 2YUTA 5KVSA 4WASA 4XQGA 4HV4A 4AJOA 1LDYA 1ONOA 3AM4A 4QUKA 4PG5A 3WNVA 1Q7BA 3A1NA 3RJ5A 4ZHSA 4DIBA 4PGFA 3ZNOA 1ADBA 3FHLA 1QYVA 2NLOA 1P1KA 4MVJE 5AQ1A 5CG1A 2V65A 4J7UA 3ICPA 3ZH2A 3CTMA 1I3MA 3HUDA 4AJPA 1A9ZA 3MOIA 5JAZA 4BNFA 4R54A 2DFDA 3RBZA 4R1SA 2JCXA 3K9QO 2EXXA 4N5NA 2VWPA 3JQ9C 8LDHA 5EN4A 4XYGA 3DZHA 3VKUA 3D7LA 3GHHA 2PA3A 1JW9B 1IOLA 3IS3A 3OJFA 1NP3A 1DC4A 1PWZA 9LDTA 1FF9A 1WNTA 4CMJA 3AFNA 2DM6A 4K6FA 3W4KA 4DQVA 4U5QA 5BNIA 5IZ4A 1LDGA 3NDIA 2YY7A 4PLTA 3TOXA 3E48A 4GI2A 3RC9A 1DFIA 4WUVA 2WD8A 1ID1A 5FI5A 4PZDA 2AQ8A 1R0KA 3AUSA 3AY7A 1DIGA 5EESA 3JQ6A 3DBLB 3I4FA 3MZ0A 3FNEA 4CMKA 3DMYA 4DREA 2AE1A 1XKQA 1R4MA 2EGGA 1EE9A 3PVZA 1GZ4A 4YT4A 1W0CA 3HHPA 3I5MA 3JYQA 3KYDA 3GEDA 4J7CA 5DULA 5BT9A 4DPMA 1L7EA 3SLKA 2EKLA 5DP2A 4GMFA 4K1LA 4OM8A 1VL6A 4XIJA 1AUPA 3KYBA 2HK9A 3I6IA 4RLHA 3O03A 5BSFA 1W73A 4GMGA 4B3HA 5DOZA 2EHDA 3HFSA 1NFQA 2C2XA 4H7PA 1H94A 1HYHA 1NNUA 3CZRA 3GA0A 3ITDA 1MV8A 3VVBA 1PQPA 4IDGA 1EK5A 1PQWA 4RF4A 2D5AA 2FP4A 2DAPA 3PHJA 3RC2A 2C54A 5G0VA 1P44A 1U7TA 4YQZA 4CUZA 4EYEA 3TPCA 2NU6A 1JKJA 1IPFA 3H6KA 1TVEA 4GLLA 3GK3A 4I9UA 4E5NA 2PD6A 3AI3A 4YA6A 4A7PA 1Y8QB 1V3UA 4Z3KA 5KJFA 3WDSA 2Q2WA 1UR5A 2EKPA 1M67A 3PLRA 4RDHA 3HZZA 3KSZO 1P3DA 1T26A 1P1HA 3O8QB 4OGWA 4XR9A 3WBFA 2Y1OA 4DPKA 2BMAA 3ZCXA 2V6GA 4XKJA 4FOSA 4MVJH 3GC6A 3W4JA 3OSUA 3RUIA 4CMIA 4BO5A 3VOSA 1ISGA 2E4AA 4GLOA 1W8DA 4P22A 2OORA 3QVSA 2D1YA 3S2GA 3BHIA 4ALLA 1HDZA 1WWKA 2C59A 2CVZA 4ZU3A 1UDCA 4KMSA 1HXHA 2BKAA 3H5NA 2X0NA 3ON5A 4XRGA 1Y9AA 2PK3A 4HNHA 5IZCA 2ET6A 1YQDA 3JV7A 2HRBA 1GYQA 2UYYA 4XGKA 2H9IA 5L4NA 4AJEA 1SZJG 3ENKA 4WEQA 1GFSA 1O8CA 2WD7B 4HWKA 1HETA 4CM3A 2JD2A 2I5PO 3UUWA 2NUAA 2YV2A 4PLYA 4YAJA 3UGKA 2AG8A 2XXJA 3RUCA 4NNJA 4E33A 1P74A 5CAEA 2OP1A 3QQPA 3QRWA 3ROKA 1BVRA 4B7UA 1WW8A 4EUFA 2H6EA 4ND1A 3AUUA 1M2WA 4YT5A 3ONDA 5DN9A 4OXNA 3D4NA 4GX2A 5DBGA 4CODB 1KY5A 3ZWXA 2PZJA 1XU7A 4BHTA 1MXFA 5DP1A 2IDZA 3H9JA 2NWQA 4OAQA 4UVDA 4UEKA 5T57A 4Z9YA 4XA8A 3LC7O 1R37A 1YL7A 2HUNA 3L4BA 4BO1A 3WLEA 2QX7A 2YZ7A 1QV7A 1F14A 1E3SA 1ZK3A 2WJPA 1KIFA 2EJWA 3GZNB 4MKZA 4NFHA 4DYVA 4R3WA 2O3QA 3EYWA 5AXCA 1DHRA 3PGJA 3PWSA 1NXQA 1HE3A 3KZVA 3D4OA 2JAHA 3ZV6A 3AI2A 1ULUA 2AEMA 4XYEA 5EL0A 1E7RA 1QP8A 3ZZNA 4IBOA 4IDFA 1XDWA 4MIYA 2A9FA 3WQQA 3F3SA 1N9GB 4O5OA 5EJ2A 1N7GA 1WDKA 2FR1A 3NTOA 4E3ZA 3F46A 2GN4A 3TZKA 4XB1A 5A1TA 1XWFA 1V35A 4IJVA 4JJIA 5I8ZA 4OH1A 3ZW8A 5G0WA 1TA4A 3RCBA 1NPDA 2VUTA 3HDYA 4MOWA 1VJTA 4YAKA 3MJVA 5KIAA 4PIVA 2ZQYA 3PJEA 1DBVO 4BV9A 4N18A 2EF1A 4MINA 1R16A 1E7QA 5B12A 1U3VA 3JQGB 3JD1A 3PDJA 1NWCA 5GZ3A 3ROPA 3TFOA 1Y6JA 3IDSA 4I9HA 4E0BA 7ADHA 2BFMA 4Z0TA 3BMCB 5BSEA 2P9CA 5L7WA 1HL3A 1F0YA 1ENOA 4TKMA 3FCOA 1XEAA 2VT3A 3DZFA 3HADA 5JXWA 4BKUA 2GN6A 4FW8A 2I6TA 2J3HA 4S3MA 5CPBA 2DKNA 4BKRA 4E13A 1ENZA 1A7KA 4FFRA 1B3RA 4E2WA 3VH4A 1K5HA 2OGUA 2Y0DA 3WIDA 2Q1SA 4FFNA 1PJBA 3K5PA 4IDBA 4QO8A 5CEEA 1PS0A 1PR3A 3JQ7B 3OBBA 3PDUA 1U3UA 3OMLA 4NBWA 1VJ1A 3SJ7A 3RU7A 1U2GA 1ZEMA 1B3BA 1XQ6A 4LW8A 3DXFA 2OBYA 3ZWMA 3V2GA 2NACA 2IRWA 2POQX 4AG3A 4Q3NA 2Y1CA 4Y67A 4QT0A 4D43A 1ZXBA 2HMSA 5DCWA 3TNLA 2DPGA 5I9LA 3PLNA 5KVQA 5JC1A 3EUWA 3IOYA 4YRDA 1G6KA 4YRBA 1PZGA 4FGSA 2ZYGA 1P31A 3UN1A 4CUKA 1ZKMA 3OF2A 3ZN2A 1UH5A 3ETDA 3QJ5A 2O50A 4RQTA 1YH3A 2EWMA 1PJ4A 3OHSX 4TQGA 5I7FA 1KETA 4BO3A 4L73A 2CFCA 5ADHA 4CQMB 3WB9A 4Q9NA 4HFRA 2I3GA 1BMDA 3DMTA 3O38A 3OQ6A 5JY1A 3IKTA 2OBNA 5TT1A 1E1KA 3DZIA 1K2WA 3GN1A 3IUPA 3X2EA 3RC1A 3UW3A 5I7EA 1E3WB 4ND5A 4YCAA 2D59A 2OFPA 1A72A 1N2SA 2V7PA 2CF5A 3TZ6A 5FEUA 2VUSA 3KTDA 5A02A 4FDAA 3DBVO 3GT0A 1EUZA 3E9QA 5CDSA 3PWKA 4BO9A 1EK6A 4F6CA 3L9XA 3S2FA 2H5LA 4WK6A 3GUYA 5AYVA 4CM4B 5C7OO 4WCFC 1D4FA 2Y1EA 4FB5A 2VHWA 3RUAA 1R4NB 4R01A 3UOGA 3MTJA 1HEUA 1V3VA 3SXPA 4CLHA 3R1IA 1EQ2A 2D3TA 1MG0A 3QA9A 4MPDA 2CSUA 5L7YA 4QX6A 4KWIA 7MDHA 2AG5A 4FFLA 4L76A 1LLDA 4J0FA 1D1SA 3C3XA 3NJ8A 4CV2A 1SOVA 5JC8A 5T67A 1HF3A 2E82A 5TT0A 4PLHA 1J5PA 4R69A 1CWUA 1E5LA 4TROA 3UCFA 4RLSA 1TEHA 3AY3A 2FRDA 1F12A 3PJFA 2GZ2A 2JHGA 4NU6A 4RL6A 4E6PA 2B69A 4IS2A 4DLAA 1ISMA 4GX0A 5EQFA 4IY1A 3V2HA 3ZV5A 3VPGA 1E6UA 1E5QA 1YQGA 2O3TA 3L9WA 4A10A 5KJ6A 2EERA 3NAQA 3IKVA 3TZQA 1ZMTA 4ROSA 2HMWA 4JNKA 2XXBA 1T24A 1KC1A 5ICMA 1LDEA 2H1SA 1BHSA 4QECA 1N92A 1KEWA 3H9QA 4AJLA 4EJ6A 2AW5A 1JKFA 1JA9A 2QRKA 3N58A 1YGYA 2DUWA 2GN9A 3W8FA 1ZW1A 1ML3A 4YTEA 1HYGA 1YJ8A 4BNJA 1KC3A 1KVSA 3CZMA 3DC2A 4YJDA 2A94A 3B1FA 1GEGA 3BHMA 3U0BA 3T7EA 3DBRB 4RVGA 3W8EA 3ZU5A 2GR9A 1JVSA 3MJ4A 5DDIP 3KHUA 3Q0EA 3QHAA 2DTEA 1A27A 2DVMA 3VC7A 3E1KA 4DXHA 1IL0A 4CLRB 3OJ0A 1U3TA 3NKLA 1I0ZA 2BH9A 1SOWA 3BA1A 2BFOA 5H83A 1BWSA 1HE4A 5B1YA 1H9AA 3QE3A 3RFXA 2VHYA 4NJOA 3OJOA 2UAGA 1UDBA 3VPXA 1YB5A 3BXXA 1CQJA 2ZJ1A 1VL8A 1EBFA 5HBRA 4XB2A 1H0KA 3WGQA 4Y6PA 2Y1DA 3IAHA 3HFGA 4LN1A 3DBLA 3W6UA 1YB4A 1AGNA 1UXGA 4DA9A 3ICCA 1DHTA 3Q9NA 2RCYA 1DAOA 4KDFA 4XIYA 3L4SO 1L1FA 3E5MA 4B79A 4RVUA 4NK5A 1ORRA 3V1TC 1KBZA 1XSEA 3UH1A 5TIIA 4N5MA 3DBHB 1HDYA 1UAYA 4WNIA 5K0ZA 2VYVD 2VHVA 3ZHYA 1JU9A 3HQ4O 4CLOB 2ZTUA 2JD1A 5KJ1A 3GRKA 1RM4A 4BGEA 4D0RA 1AHHA 4EEZA 4IS3A 4HBGA 3ZWPA 3DAGA 3DZGA 5BR7A 1AXEA 1E3IA 1ZIDA 1IB6A 3ETEA 2JCVA 3DOCA 1PQUA 4FFOA 4D44A 3ZDFA 1Y7TA 3GZ4A 4YPOA 3VHRA 3RI3A 4N54A 1NAHA 1IHXA 2EG9A 3GLQA 1AHIA 3AWDA 3GRPA 4D3FA 4E31A 5B4VA 1BXZA 1Y8QA 3ZHXA 3FN4A 1XA0A 2OUIA 3WGGA 1PWXA 3ZNNA 4JBHA 4MVJM 1ZJZA 2FPPA 3BTOA 3O8QA 4XYBA 1HT0A 2HMTA 3PIIA 1I2BA 1HE2A 1V3TA 1Y8RB 3PK0A 3WGYA 5JAMA 1PGNA 5CG2A 1KOLA 4CM7A 5CDUA 3GAFA 5G0SA 4D79A 2GNAA 4A27A 3RIHA 5CDYA 2PGJA 3WQSB 3ZWWA 3G17A 3PHIA 2B5WA 1OC4A 3OQ1A 3S1LA 5TRTA 2C2YA 1HE5A 2BI8A 1M6WA 1WDLA 4RF2A 5IF3A 3OQBA 3JQAD 2IEBA 5C7LO 1P45A 3GVXA 2Y68A 1ZSNA 4MKXA 2HDHA 4NFSA 3ZWOA 1GCUA 3OM9A 1BW9B 4D45A 4RORA 1P1JA 4HFNA 3GQVA 3G0OA 3TRIA 1DSSG 1MXHA 1LSOA 4MKRA 3TZCA 3WMWA 4E5MA 5JO0A 1Y81A 4J49A 4PVDA 3DHYA 1PZEA 2WD7A 1XG5A 3FPCA 1YBVA 1Q1NA 4B4UA 3MJTA 4HP8A 5ER9A 4D7AA 2HK7A 5TGDA 4D0SA 1O89A 1K3TA 3WFJA 1GPJA 3BMQB 4G5HA 3WSVA 4Q3CA 2JKVA 3BMNB 3UF0A 1TT5B 3V2UA 3TL2A 1QMGA 3CMMA 2FZWA 2O3RA 4J2OA 4GL4A 1MUUA 5THKA 3A9WA 5CP8A 3KOUA 2DBZA 4UREA 3AFMA 4CL3A 1I3LA 1KEUA 1X0XA 3I52A 1T1RA 3JQEA 2VZ9A 2RH4A 3ZWVA 3ONFA 3WTBA 1EVZA 1X0VA 2W2LA 3WOHA 3OIDA 2ZCUA 1JAYA 4GKBA 1HZJA 1WLYA 2VNAA 3TFQA 2AQIA 1WVGA 1N1GA 1UXIA 5JO9A 4BNNA 5K6AC 3WGIA 1PX0A 2UUOA 4CMHA 1QSGA 4L0QA 4CM8B 5CEFA 2DPHA 4JBIA 4D46A 1GUZA 1U4OA 4JIGA 4NG5A 3GZNA 4TWRA 4O1MA 4B4OA 3C7CB 2E48A 5F5LA 3LVFO 1R12A 1SBYA 4QFCA 1U9JA 1X15A 1FDSA 3HB5X 4JK3A 3WWZA 4D41A 1RJWA 1MG5A 1GTMA 5A03A 2ZTMA 4NBRA 3P2YA 4FIZA 3ZWBA 4BVAA 3B1JA 1EMDA 1VRWA 1N9GA 2EV9A 3I9KA 4CR7A 4MP6A 4HUJA 3GVHA 3E18A 2G82A 4CV0A 4PLCA 2YHIB 2O4UX 2H63A 1IZ9A 4TRMA 1YWGO 3A14A 4EW6A 1PGOA 3NX4A 2D8AA 2WE7A 3NTQA 3WR5A 3R3JA 1Q0HA 5L3ZA 1KYQA 3HB4X 2CDBA 4J6FA 1DC6A 3VPHA 3CEAA 4FJ0A 2AQKA 4CLDA 2TMDA 1HDOA 1CEQA 4DMMA 1YQXA 1WXDA 3OECA 3JQGA 1VPDA 4K28A 1QKIA 3FF4A 4XZ3A 5COQA 4W6ZA 3VZQA 3ORFA 1B0AA 1U4SA 3BMCA 4M49A 2Q2QA 3K30A 4BS9A 2O7SA 2NNLD 2F1KA 2XPCA 2Q49A 4IDCA 5A4DA 1LJ8A 1FDUA 1NVGA 2VUUA 2XF8A 3AUAA 1X13A 3L77A 4FJ1A 1EUDA 3QP9A 2VTEA 3H9GA 1GEEA 1FDTA 1G0OA 2Y0CA 3U4HA 3RUDA 5I9NA 5A9SB 1DXYA 3K8ZA 3JQ7A 1NTOA 3LT2A 3TN7A 4JCOA 4ZJUA 4XD2A 2VWQA 3JQCA 5T5QA 4AJKA 5IXYA 1LQTA 2JD0A 4LGVA 3M1AA 1QLJA 3SLGA 4IIVA 4BO4A 3QWHA 2R00A 3PQEA 4J1SA 3VH1A 4W99A 1PL8A 1UP6A 3QSGA 5I7SA 3ZGYA 3ZWAA 3OIGA 3DONA 2VWGA 1ZZEA 2J3JA 1P1IA 4ZQGA 4WE3A 2PR2A 1SCUA 4J91A 4QSMA 2AMFA 1P9LA 3QVXA 4OQZA 4OSPA 4CQMA 4Z6KA 2F00A 1RM5A 3IUSA 4EEXA 4OXYA 3QIVA 1R6DA 4J0EA 4JLWA 4DLLA 5COAA 3S8MA 5COBA 2WYVA 5JLAA 2QZZA 3ZW9A 4CV1A 1QYCA 2J5KA 4GVXA 1EBUA 3GNQA 4ALNA 1C0IA 3RBVA 1E3WA 4CM9A 1T2FA 4Q3AA 3M2TA 1BVUA 4J4BA 3HNPA 1GV0A 2OO5A 1G1AA 1C1XB 2HLPA 4IDDA 1Z7EA 4OQYA 1HYEA 2YFQA 3F1KA 2E49A 1MGOA 4PG4A 4IUYA 2BGMA 2I99A 4ZQFA 3SC4A 4XX0A 2AEFA 3EC7A 5ITVA 4CM4A 5JDIA 3OJLA 1LA2A 1R4NA 1OI7A 3FRJA 4W9NA 4XQEA 4B4WA 2JJYA 3WICA 3QLJA 4DBZA 1HZZA 1DRUA 3EZYA 2I9PA 1VSVA 3B6ZA 5G0UA 1O5IA 1A4UA 3INRA 4L74A 4YVFA 2CD9A 4M87A 4WLFA 4FR5A 2QHXA 1PGPA 4I08A 4XGNA 3U4DA 3ZU2A 4DQXA 2A35A 3GGOA 3JQAB 4CMEA 1ADGA 3GDGA 3VDQA 4AJNA 5J23A 1ZK0A 4Y6RA 4P8RA 2RIRA 3BTVA 2WE8A 5HRUA 1WMBA 1YDWA 1YRLA 1E3EA 1BXGB 4GQAA 3ZV3A 2OMEA 1NM5A 4IPTA 4OOFA 4YJFB 3NGLA 1U5CA 1UZMA 3I23A 4OL9A 1FDWA 1R0LA 2ZJ0A 2GDZA 3EK2A 3EHEA 3ZWYA 5JNLA 1XGKA 1LX6A 2NU8A 3FTNA 5FFFA 1LI4A 5JE8A 2CVQA 1Q0QA 1M6HA 3EZLA 1BXKA 2HJSA 3C7DB 3PJGA 1ZVMA 1JDJA 1SB9A 3I9JA 2B4QA 3DO5A 4ZQEA 3QVTA 1DEHA 3C85A 4WOJA 3O4RA 1C1DB 1QR6A 3DR3A 2EW8A 3B1KA 5BNFA 2R00C 4YJGB 2VNSA 3GNSA 1JWAB 2DTXA 3GUCA 4RDIA 3HJAA 3QWIA 3W6ZA 1Z7BA 5KVVA 1NHWA 1NQTA 2PZLA 3MJEA 2DU8A 4TRNA 1BGVA 1E0DA 1H93A 1DOHA 4NI5A 1CQIA 2FPGA 4E4YA 3ZWNA 3MCVA 2X5OA 3DBRA 3SEFA 3C24A 4OKIA 4YRAA 4QTZA 2Q46A 5L4SA 4I5GA 4BNZA 2GYYA 4G81A 3PZBA 4CLRA 4OYRA 2IZ1A 3RVDA 2PD3A 4XYLA 3VKVA 1ZK4A 1PJSA 2UVDA 4E2XA 1H6BA 2B4RO 4LVUA 4BNTA 5C3MA 3KV3O 4IXTA 3JD4A 3GG2A 4J9VA 4IQ8A 5G2OA 5EMHA 1VL0A 3NYWA 1DFGA 2AHRA 4ALIA 4MP3A 3PIDA 3FBGA 1A4IA 2YFHA 4CR6A 5JDIC 2VRCA 1A9YA 3KSUA 5L53A 2G0TA 1NVMB 1LRJA 2V6MA 3F4LA 1D8AA 2HAEA 3K92A 2WM3A 4FC6A 4YJHB 4H16A 3TL3A 2B35A 3D1LA 4XYMA 3ADPA 3COSA 4DC0A 3DBHA 3CSDA 4YAIA 8ADHA 3PHGA 1JN0A 4GAEA 1NYTA 5DBIA 2HRZA 1YE3A 4CMEC 1XR3A 2X5KO 2Q1WA 2PZMA 2X0JA 4ITUA 4K9DA 4R5HA 4PLWA 1GDHA 3C8MA 2C07A 2CY0A 4MVJI 4MIEA 1H6CA 3MOGA 4URFA 3JQBA 4BNYA 4OHUA 4BMVA 4EGFA 1YJQA 4M86A 4U6SA 3DFUA 3GAZA 3UAGA 1Z45A 4ZRMA 2DUUA 2JFFA 3FNGA 4DC1A 4RVFA 1I8TA 1EE2A 3KLMX 3VVCA 4L4SA 4WLUA 2CVOA 3KLPX 3U4CA 3AM3A 4TSKA 1ZSYA 3C1OA 3PP8A 3KVOA 1I24A 1JTVA 1LSUA 3RKRA 2NV6A 3GMDA 3GEGA 1SAYA 3JSAA 1X14A 4Q3EA 4S1VA 4R1UA 3FBTA 2ZYAA 5IZCC 1Y8RA 2PLAA 1DJQA 4CMGA 3BZUA 5F21A 2FMUA 1E3JA 3NEPX 3GH3A 3H5AA 4E30A 3GHYA 4U0JA 4Q3BA 3OEYA 3W8DA 3HN7A 4I5EA 4ND4A 1KEPA 3O26A 1PSDA 4Y8VA 4CM5A 4GWGA 2P68A 1J0XO 1NX6A 4FC7A 2PV7A 4UVGA 1A7AA 4WLEA 1HSZA 1Q7GA 1HDRA 3UCXA 4JGBA 1BW9A 3QWBA 1IZ0A 1EEHA 1ADCA 2DQ4A 2FPIA 1BDBA 4FCCA 3ZU3A 5TQVA 1J49A 4KWHA 4RPHA 1WZEA 3HE3A 1GD1O 1FMCA 1LRLA 4R51A 1KVUA 3ADOA 3KYCA 3PZRA 4DWVA 3OETA 4XGIA 3WJAA 2GASA 1DRVA 3BMQA 1PJ3A 4GSLA 2OL4A 3BMNA 3QWFA 1TT5A 3QWAA 5JMWA 3CINA 3VAZA 3L4BC 4GX1A 2D2IA 4DMLA 4ZN6A 3LDHA 2PWZA 3HWRA 3WSWA 4DIOA 3JYOA 4UVHA 5DBFA 1PJCA 3KO8A 3C7AA 3PEFA 4RF5A 3RD5A 4BO7A 3JD3A 3ZHZA 2X86A 4FQ8A 2ZKLA 1XHLA 5HS4A 3PWZA 4MJLA 4UUPA 3BMOB 3FR7A 3F47A 3JQ8B 4P4NA 2C7GA 3GDFA 1QYWA 2JL1A 2J6IA 2VWHA 1P77A 4J1TA 1NQ5A 5JS6A 5G4KB 1J4AA 2W98A 1KVTA 2Z1NA 4CM8A 5JCXA 4GPD1 5TLSA 1PJ2A 2FHSA 4ZQHA 4YT8A 1KVQA 4PLPA 1F17A 1V6AA 3UFXA 4CUJA 1ZMOA 2IZ0A 4WKGA 2JHFA 2P4HX 1WAMA 4BO2A 4HXYA 5ENVA 4DQUA 4E12A 5JSFA 5ER6A 3GGPA 2HU2A 4Z9FA 5H82A 4TMFA 1FXSA 1XYGA 4WOKA 3TF5A 3TOZA 4R1TA 1MX3A 2GLXA 3P19A 2C5EA 2R2GA 1NAIA 1TI7A 1X7HA 5F1KA 2IYOA 5F3RA 5DF1A 3EGOA 4J2HA 3VH3A 2BD0A 1E77A 1LDMA 3GNTA 2YV3A 4ND3A 5FWNA 4MVJG 3CE6A 1QLHA 4CQLB 1GQYA 1ADFA 3EMKA 4XDYA 1GV1A 4DPLA 3GEMA 3E9NA 2NVUA 1I2CA 3WYBA 1P0FA 5BQFA 2EGHA 3WQRA 1I3NA 1PR9A 3EY4A 3R3SA 1CERA 5KKCA 5C7IO 3GOHA 4XR4A 3H7AA 1BRMA 3I6QA 1T1SA 3ZNPA 1YS4A 1LEHA 5IDXA 2YDYA 4CLEA 1M66A 1SNYA 2I66A 2P9GA 3LK7A 3H8VA 3NTRA 4NK4A 3NDRA 3NRCA 4O63O 4DTIA 4M54A 2CDCA 3D4PA 4R9SA 1G0NA 1B16A 2O7QA 2WEKA 3ONEA 4LMRA 3ANLA 4WGGA 1K89A 1LSSA 2QW8A 1YDEA 4IQ0A 5A9SA 2V6BA 1Z82A 1Z74A 3E6AA 1JKIA 2PH3A 2GD1O 3GN2A 3JD0A 4NR0A 3WS7A 1R15A 2OP0A 4RJTA 2RHCA 4A5OA 5IXSA 1SEPA 4JROA 3L6DA 4XJTA 2HO5A 5AXAA 3H9EO 4ONEA 4EITA 4D3DA 2AE2A 3VPFA 3AJRA 4XJSA 2P5UA 2VOEA 4EJ0A 3BTSA 3DMTC 1GCOA 1QXSA 3Q11A 4LSWA 3QW2A 4BGUA 4GBJA 1NVTA 4DIFA 4RZIA 3D5QA 2CF6A 2GRAA 5I7VA 1IULA 4A0SA 1DFHA 1X7GA 2UV8A 4BB6A 5H81A 1Q0LA 2PGLA 5JCJA 4MVJA 2Y05A 4DGSA 4NPCA 5JYDA 2W4QA 1DIRA 1GUFA 1Z6ZA 2WSBA 1Y9EA 1YONA 3F1LA 5IAAA 2ZCVA 3V5NA 4WJZA 2GZ3A 4YBZA 4C7KA 1T2CA 4NFYA 2P2SA 2BI7A 4IJUA 1Q2XA 3DZKA 4RO0A 5AXBA 4TZTA 3SX2A 3CPSA 3HDQA 5AXDA 1LDBA 3GMSA 3VZPA 3Q1LA 2RAFA 3X2FA 1X7DA 4AJ1A 2VTDA 4GVLA 2GZ1A 2Q1TA 2VYNA 2ZTVA 3I9MA 3WGZA 2BGLA 3I83A 2WMDA 3QV1A 4M89A 1UZLA 3HG7A 1ZBQA 2YHUA 4GWKA 1SB8A 1GL3A 1I30A 1LSJA 3MJCA 4ESOA 1K6JA 5I9MA 2J3IA 4WCFB 3RU9A 3RASA 2EEZA 4EUHA 1C0KA 2X5JO 3JQAA 5CEJA 4J90A 1UXHA 5LDGA 3VZSA 3PGXA 2FR8A 4PLVA 3PYXA 4BKQA 2FSVA 2Q4BA 3QVOA 5IJZA 1HDXA 3LC1O 1OAAA 2Y0EA 4XDZA 4KP7A 3GFBA 3L0DA 4YJFA 4E5KA 3ITKA 4FJ2A 4M1QA 2HMUA 2B37A 4P38A 1PL7A 2Y1GA 3IJRA 2Y93A 1L7DA 1TT7A 4BNKA 1LBEA 5KVCA 1UZNA 2ILTA 1I01A 2OOSA 3FWZA 3JCZA 4KQWA 2EJVA 9LDBA 3DHNA 2EW2A 1ULSA 1UXJA 3WBBA 2ZB7A 1GU7A 2V6FA 3GGGA 3UHAA 1C1DA 2Q1UA
chains in the Genus database with same CATH superfamily
3KFLA 1XAGA 3GVCA 3UMCA 4GMKA 2QG9A 1NZFA 4LF9B 1SUDA 2H00A 2I2BA 5L7WA 4I14A 2SBTA 3CW8X 3GARA 3ILSA 3NHUA 4C2BA 1TJPB 2HCTA 1ENPA 2ZUBA 2NIPA 2C0QA 2GUGA 2WF6A 3QX9A 4QOHA 5JANA 5LIPA 1L7OA 4C7JA 3Q7IA 4G0VA 1K9VF 3E9DA 4FGJA 2G9VA 4X63A 4ZYYA 1LLFA 1R9MA 4HMPA 4C30A 4WGFA 1W25A 1EQUA 2BRUA 2WVJA 2A4MA 5HKKA 4X8HA 1A5AB 1X3SA 2DFNA 3D7MA 4PY2A 4CG2A 1M3SA 3CF4G 4N3CA 3TAHA 4PCVA 1W0JD 4BO8A 2DBVO 3FWKA 1D03A 4R16A 1VM6A 5CFZA 1RJEA 1URPA 1CIVA 5FIUA 4BNGA 1GGHA 4BB0A 2KW5A 1H8EA 2RHHA 3D0OA 4HDKA 1ZG3A 3OU6A 3U0VA 4CKXA 3AY0A 4Q4AB 3B20A 3KU1A 5B37A 5B3LA 2XECA 2B0JA 2I7VA 3QEOA 4O4HA 4V0LA 4C3VA 5CITA 3M6VA 4K87A 1A1SA 4PZEA 3IP9A 2PZKA 3LRXA 1A2QA 2D1FA 2HA3A 4AJ4A 1KVRA 1KXZA 4QODA 2CBXA 2ZATA 1QHFA 1YZHA 4YACA 3STTA 3MINA 3IBCA 4D2IA 4DSNA 1RPZA 2FFAA 2XZPA 1VA5A 1P5JA 2NXJA 2ZSEA 3BD7A 3RABA 3TKAA 2PZFA 3Q40A 4KNYA 1FJHA 2P3SA 1NQUA 2HCJB 2OBLA 5K4GA 4R4JA 4I55A 1U8AA 4GNKA 3TRDA 4V0MA 3W5HA 4I2NA 4MUGA 1OKKA 5ELMA 2PUVA 3D54D 1A98A 3S2IA 4EY8A 1CJUC 4N7RA 3WFIA 1H8HD 3N8DA 3I62A 1NR5A 5ICSA 2X40A 1SVMA 5DYIA 5ALSA 4NCAA 2FZ5A 3OWOA 3BXHA 1BXRA 3HY4A 4LE2A 3L6EA 4WXYB 2O9JA 4PINA 1TYBE 4L75A 4MV5A 4CM6A 1MB2A 4C5AA 4IZIA 4PFSA 2YBEA 1B6RA 2QPAA 3QFCA 3TUIC 3PR2B 4GNRA 5BUCA 2KI5A 2NSDA 2QR2A 3PHLA 4RIEA 1MTOA 1T5TA 4RIGA 4DV7B 3IJPA 4E03A 1QG4A 3K96A 4ZPXA 1N1EA 5A62A 4P7BA 2YUIA 3C3BA 1ZD2P 3CVOA 2J9FB 3PD0A 2QAGB 1QH0A 4U9HS 2A0KA 3D2AA 2NXCA 4YAGA 3QV2A 2QROA 3K5IA 1ABEA 2ZYDA 2IU6A 3PNOA 4LC0A 5EHIA 5FXMA 5LCXA 4LXXA 4CM1A 3QXSA 1XTRA 3PDIA 3TSAA 5FNZA 3O6VA 4QOFA 2C29D 3CF0A 1N2HA 4G67A 4P81A 5IABA 1E9CA 2OQ2A 4YDSA 2Y76A 2B36A 3DZBA 3I4CA 4DBVO 3CUKA 4WFKA 1SK9A 3DXZA 1G20A 1U81A 4UU7A 1Z07A 1WHTA 3RYCA 4KFCA 2BMEA 4ZRNA 5BOVA 4CL0A 2YWFA 3NWEA 4K26A 1XMJA 5SYMA 2WOOA 2H17A 5LLSA 1JFSA 2IE8A 1JAHA 3OFJA 2WPDA 3HXPA 4UMFA 2ZVPX 3HXKA 4WL0A 4JI1B 3VYUB 3ZE2B 4M7OA 3IL2A 2QUIA 3SVTA 4PLFA 3WAKA 2A78A 3PPVA 3EAGA 1RI2A 3F5QA 2C0CA 3P9CA 3K1AA 1GPYA 4Y2JA 3T1QA 3UJHA 4AG3A 2HRQA 1CB0A 3TQCA 3H99A 3HPQA 5CDTA 1ESDA 2D74A 2I67A 3RUFA 4BQSA 1UKEA 4JP3A 3UENA 3GG9A 2XRZA 1QWSA 1LV8A 2XVZA 2YIJA 4RVCA 4YMIA 5M29A 1KAGA 3QMWA 5AJYA 1JIJA 3QF4B 4NU5A 4D3YA 3CUEF 2WT8A 3P5BA 4HLUA 5HWSA 4EUEA 1T5DX 2MR5A 2VDKB 3DB2A 1ZR2A 2BGJA 1JHAA 3DC7A 5AW1A 1MJGA 1PN3A 2VPXA 4R2WA 2DEUA 2X7JA 4GDFA 1CCWA 3P5SA 1AZSC 4M46A 3RTCA 1RW4A 1XMOB 2EZ4A 3QBVA 3RSFA 2V7QA 3BG5A 4UC0A 4D26A 2DERA 3OJXA 5A3VA 3VKHA 4PRKA 1T4DA 4QYXA 3INTA 4E1BA 1LFDB 4LBWA 3AVYA 2PKYX 1H4TA 1ZU4A 4DHEA 2GTIA 4I99A 4LXUA 2VQ3A 3WGMA 3OBIA 1Y7LA 3N74A 4YY3B 4LNHA 2B99A 2ZM5A 3PUHA 4QPCA 2IGBA 4B83A 5ICGA 3C97A 3FVRA 2VHEA 4N82A 2ORIA 3BMOA 2JAXA 3BAZA 1KFEB 3JQ8A 5A06A 1Q1QA 1GL7A 4NV1A 3LGSA 4LRWA 3V1YA 4BZXA 3MNFA 5DM4A 1NQAO 1NW7A 1IXYA 2EFHB 1NASA 3VV3A 2XZDA 4D8VA 1N5DA 1JE1A 3HYSA 3DR5A 4COOA 1C4XA 1A3CA 3BB4A 1OXMA 5JASA 3GLFA 2FQYA 2ZBRA 1B7GO 1E1LA 1FNDA 3QMMA 5B2FA 2M1XA 4MW9A 3T5DA 3JVUA 1ARZA 2V9ZA 5CLJA 2XIQA 1VJ0A 2A8YA 3HB0A 1WXWA 2IIBA 3JTMA 4OAPA 1QORA 5DNWA 2O3SA 4AY4A 4II7A 1OR8A 3WZLA 4AJIA 3LU1A 2DBQA 1KYXA 2E1RA 3CEPB 4DV2B 2IVZA 1TOAA 3C1UA 4PM4A 1P2BA 3B38A 3F6EX 3A4VA 3QENA 1H2WA 1PS8A 2GN8A 2I8AA 4C0KA 3F9IA 1TIBA 2O1SA 1YB2A 1O6BA 4DV5B 1XK7A 1BCSA 4LZOA 2ZRJA 1Z0KA 2BF7A 2XB8A 2BFFB 3GD5A 1Q16A 5LOVF 3DE4X 1P7CA 1WUTA 4D5GA 3ZLBA 2X22A 4UBMA 4G09A 4U6QA 1QRRA 1I9CA 1THMA 5G4LA 3A4MA 3FR8A 4OXKA 1YSCA 2WFLA 3EF1A 3WB0A 3K6SA 2VPPA 3ZCSA 3HA3A 2G1PA 3FNHA 1W4RA 1L8OA 2HU8A 1SUAA 3LL7A 4P9NA 5A5EA 3MGCA 4CJXA 3MJRA 5L51A 1BQEA 5CPFA 5BT8A 5L3SB 3HDJA 1Q77A 1RWVA 3Q9UA 3DQZA 2O4CA 3EBLA 3ICOA 4CCWA 1G59A 1Z2OX 3DMHA 5KSOA 3FCEA 4Q02A 1QM5A 1PL6A 3BUSA 1FCJA 1RT9A 1NDUA 3ASUA 4OK6A 4XGQA 3RTGA 5EUCA 1BOFA 5ALMA 3SHOA 1UFKA 5IW8A 2LCQA 1RMTA 5EHXA 4UQLA 2PKQP 3T9AA 4K9RA 4WLNA 2ZVDA 3HV2A 3BORA 4JLBA 2E0IA 5IRCD 1EFPB 2QBYB 1OTYA 2VDUE 3T8YA 2XZTA 3GZTB 4NMLA 3BK2A 1ZYUA 1IHUA 1E6WA 4JU8A 2EVWX 5AI5A 4EGSA 3WJ7A 1LH0A 3UM9A 4CLXA 2WYWA 4X1IB 1E9FA 1WUJS 3Q2OA 4QRHA 2FF5A 1FMLA 3S5JA 2ECQA 2P6PA 4DWWA 3IBFA 4TS1A 4AS1A 1FFAA 1I7SB 3SFVA 2UYCA 1NI4A 1NPYA 2P35A 1X1EA 3D6TB 3QBTA 4L9AA 1XD2B 2NAPA 3OQIA 3D5EA 4H9GA 2O5RA 4FK8A 1RYEA 3WYCA 4TKZA 4TVBA 3RU3A 4OJNA 1MX5A 1LLQA 3QE4A 4WMLA 1N2XA 5IJ0A 5FNVB 3GELA 5AOAA 4DW8A 2I4NA 4TV8F 5HOQA 4BEBA 1KRXA 1AQ6A 1M8FA 2H8GA 4HNGA 4LTDA 4MWOA 4CDNA 3RYIB 4AURA 5IF9A 1NJ6A 4LCJA 5KINB 4M1TA 4CEJA 1Z2DA 4J0DA 1YL6A 1GSAA 4KXVA 3TD2A 2YASA 2J30A 5F9MA 2J32A 2W4MA 3WTCA 2DJIA 4PYJA 4GL2A 3FTPA 2FZ4A 4W9NC 2HQBA 1WTCA 1EFAA 3OPMA 2QM8A 1DX6A 2FK8A 3KQSA 1GFWA 3IBGA 3D1JA 1HUQA 4HNSA 4IGEA 4MDHA 2JVKA 2ONYA 3MT8A 5ALZA 3BWXA 2J6HA 2O0MA 4WPGA 1R4AA 3GRFA 3CM0A 1S01A 1ULTA 3P0IA 3RW9A 5TMDA 4E46A 3Q2KA 1GLVA 1E6KA 3FDZB 2WC1A 3KSAC 4G9BA 3IQFA 3DT8A 1RWOA 2CBZA 4D4MA 2XQVA 1EAMA 1V1JA 4RZHA 4Q3OA 3IESA 4N47A 4A2WA 3SKYA 2R6DA 5LSAA 4MR8B 4MV6A 3A11A 2EL9A 3X2SA 4Q1FA 4ZAGA 4C4ZA 1QE5A 1FYWA 1Z4LA 4QYSA 1VYTA 2R48A 3VBCA 4XVCA 4LYEA 4CT5A 1JDSA 2BE9A 1D0SA 1KFBB 3LQ4A 5G1NA 3OCWA 2ZITA 2FSPA 3NXKA 1ZAKA 3NBYC 4QYIA 3FI9A 3OTQA 4WLOA 5EG5A 2BTOA 2IXAA 2Z58A 5MN6A 4ZARA 1FMTA 3HM9A 5CHEA 4DLXA 4KKVA 3MB5A 4NE2A 4D57A 4MO9A 1ODIA 3M5CA 5DASA 2BFWA 2GM3A 3NYQA 3R7DA 2BFBA 3IEVA 5ELLA 1QG6A 3PGKA 3ESXA 4RUKA 4DLZA 1L4NA 2I65A 5JQWA 3SR3A 4IUDS 5AJZA 3L7MA 5B3KA 3TSCA 2VTVA 3DHWC 3F5SA 4JODA 5BN5A 4KQXA 4MCIA 4HFJA 3DEJA 3G6KA 4WZAB 1CQXA 3C87A 3U62A 3USCS 5JBIA 1PZFA 4NCXA 2X0EA 5CFNA 3F78A 1L7BA 1QUEA 2MYNA 2D62A 2IYXA 1P1FA 2DHCA 2RAVA 3OA0A 3DZJA 4QBKA 4UEOA 4XD7A 3R7FA 3SZOA 3TJRA 1WTAA 2YC4C 1WKVA 1U8XX 4YI5A 3AJDA 1PSWA 1Y82A 4FE3A 4K6KA 4BGDA 1H9BA 1OLSA 2ODQA 2ZROA 1PO7A 5FORA 1XOIA 3HA7A 1G5RA 4OHWA 2RGBA 1YI8A 1DT5A 2AOTB 5H02A 5AHXA 5DB4A 4X3OA 5BVHA 4XE5A 2NTVA 4LHSA 1JR3D 1WZCA 3P9IA 3RRXA 1OWMA 4D0NA 1ZPDA 4JUFA 4MGHA 4ZGBA 1IUKA 2POCA 1KPGA 4KG7A 1VXRA 4MGZR 1II0A 1QGED 3K2IA 3RS5A 4K6HA 4TLMB 4TZ6A 1DC3A 1T5SA 1RQXA 3I2JA 3UHJA 3IA2A 3AHHA 4Q01A 1RU3A 2QXTA 2VFAA 4GKAA 4YJ2F 4M1YA 3P9KA 2F2TA 5IP5A 3O4JA 4RHTA 5EGSA 3EG9B 5EIAA 4LHVA 1DDIA 1N1DA 1XKLA 2P9TA 1N8TA 5DT9A 1EA5A 1ZN9A 3U6KA 1ZUIA 2PSDA 5D00A 1FIUA 2XGJA 4TYWA 2GPJA 3KXDA 4ZXFA 3FSEA 1ENYA 4HEHA 2WWTA 2B83A 4PBRA 5G1OA 2H1RA 3VPCA 4Z9XA 3SI7A 5F2EA 3SF0A 2R8YA 3AG5A 2OM6A 3ADBA 4ZVNA 3ZV4A 1G21E 2Q5OA 4WCDA 2YHSA 4WNYA 4GKKB 3AY6A 4PO1A 2Z6UA 2QN7A 2OHVA 1H6AA 1NFFA 1DCMA 1KZGB 3NDJA 3WX0A 2IV3A 1BGWA 2QS9A 3HLTA 2FEOA 2W2KA 5DX1A 1RI4A 2A92A 4MVJF 5D3KA 3ZWCA 5JI3E 5LKAA 3KETA 2HX1A 1JDPA 4BEWA 1RFGE 5JPIA 2PRIA 3SG0A 5I5EA 1MW9X 1Q3KA 1SVNA 2BR4A 3GJ8A 2J45A 1O96A 3NPAA 5EWMB 5EJ8A 3V2IA 1G42A 5J2TB 1LK7A 5ARCA 3GLIE 1P2GA 2OEPA 3IB6A 2Q2OA 2JFVA 1GCIA 3JAWB 3O90A 3O8LA 4FPXA 1O9BA 4V0SA 3U49A 2KS6A 1FL9A 1L5WA 2JKZA 4BNVA 1J8DA 2YY6A 3CRRA 3AW9A 1M34E 3KLBA 1Q7RA 3GA5A 1XCLA 3H3JA 1D04A 3I8OA 3KZMA 3VR3D 1Z8NA 1G8KA 1MX1A 5KYGA 2XDAA 3HJCA 1X8XA 2QR5A 3PQDA 4O6VA 4OUDB 4PQFA 1Z35A 4OQPA 2NX2A 3ETGA 3ZY6A 4PZCA 5EERA 4ZGWA 2A9RA 2B6HA 2VSOA 2C9BA 3L6BA 2XBLA 1G5TA 2NUBA 3OZAA 2P9EA 1N6KA 1EX1A 1B8VA 4ND8A 3QOXA 4IMJB 4AUEA 3LJKA 4C3ZA 1QV9A 3TZHA 3F6YA 1H0SA 4FOPA 2UUPA 3FYUA 4AZ0B 3S3TA 3WADA 3MEQA 1M2OA 4I8XA 4Y18A 4B0OA 4JN6B 4BFSA 3B1XA 3Q9SA 1RPTA 4RH0A 4WKOA 1DTSA 3AUFA 5CLLA 4X20B 1KEKA 1AKMA 4MW5A 1TCAA 4O4IB 4L8VA 4Q9LA 1BHQ1 2GYWA 4O8ZA 4Q1VA 4CMCA 4RHEA 1AUOA 2FP4B 3DPIA 4JBNA 1DVRA 2OQIA 4M1KA 1N8NA 3OICA 3A1UA 4R2HA 4YMUA 1JHPA 3PC6A 1HGXA 3ETJA 1Y1QA 2IYWA 3WG9A 2NU6B 3R3UA 2XT9A 3W6OA 1MVNA 3ZIAA 1WSWA 3S0JA 1GYPA 2YQ4A 3K2EA 4MQLA 1F9AA 2O48X 2XF2A 4HAOA 4JBYA 2IBTA 3DTTA 1EDBA 4MQEA 2WTAA 2ZSHA 1DKMA 3S2UA 3ZCVA 1ZH8A 2CXSA 4F96A 1DIAA 2VJMA 4P7JA 2GMWA 1UC9A 2A4KA 2C94A 1G8FA 2ZRBA 1KQPA 1Y7PA 1ZL2A 4Y30A 5FI1B 4KC0A 4CKWA 1UJNA 4PZPA 4I3HA 1J2YA 1UDWA 3R76A 4G65A 2XMSA 3R8FA 1ZNWA 1C30A 3BKWA 1T34A 2Y6UA 4HDCA 5IDWA 2QUHA 4X6YA 1JLSA 2YRXA 1T8YA 4ZKEA 3GCWA 5H7XA 2EFCB 3MT9A 1BN7A 3MCUA 4LF7B 3R2JA 1YOVA 2JJ1A 2GCGA 1XZNA 5FTKA 1F20A 1ZI6A 3QOFA 2XWSA 3IIEA 2LDBA 5EC8A 3SBOA 3TMKA 2AG1A 3FPLA 1EB8A 2ZTSA 3P9RA 2B20A 2CT8A 1KO8A 1MKYA 3BDAA 3MRTA 3O2JA 3C5HA 3PCRB 3BE6A 4FYYA 4X8MA 1OBFO 1GCAA 1MOQA 1OT3A 1SVIA 1UAGA 4AULA 3QKRB 1HA3A 1B0UA 4HGOA 5I7RA 3B3QA 4JLVA 2WM8A 5K3SA 3IUNA 5BV7A 4X7BA 4GBGA 2CFSA 2X1MA 3KTAB 3B1VA 3PEEA 4I81A 4KI0A 2QZ4A 2WD9A 4YP9A 5A9TA 5CVUA 3O93A 5JSHA 1KOGA 2IBSA 1KFJB 2FWBA 3R3YA 3AI1A 4KPUA 3IV9A 1GZ6A 2EP7A 5JWOA 1XLVA 2FGJA 2IE0A 2QQ5A 3GPCA 3WNQA 3LRTA 2D5CA 3K8YA 4EUNA 2YDXA 4F5EA 821PA 2P5TB 2WJIA 2DPMA 2NYRA 3O91A 1C7IA 2BMWA 3DOIA 2DBYA 4IFTA 4MV0A 4ZICA 2P0AA 4ZU6X 3GRYA 5U1PA 1IY8A 2HUPA 1M1NB 4BMPB 1HM5A 3PJRA 5TY0A 5HYVA 3D3EA 3QEKA 4MVYA 4ALMA 3KD3A 4BQIA 4OEHA 3WFZA 4Q15A 3HTXA 1CLUA 1AE1A 3DL2A 1X3LA 2YWGA 3DVAB 4L28A 4BLTA 2YOGA 2EP5A 2YZNA 5DLPA 1DDOA 2VXCA 5C5CA 5K0FA 2RKOA 3NT4A 5EXTA 3LXUX 1CYEA 4X7PA 1U7ZA 3A3NA 4ANFA 4EY5A 1DMRA 4GH5A 1NW3A 4DM3A 2JGNA 5IJXA 5HUHA 3OJCA 4B7CA 1LQUA 1Y1PA 2C4NA 3KBBA 3AF3A 1YB1A 1I2MA 5IUKC 2AOUB 4P3XA 4WY8A 4Y9DA 5LQUA 2OZPA 3FYUC 4B2LA 1LLUA 1TW3A 1JVBA 3A3OA 4LRUA 3QEJA 4HDOB 4XUCA 4AX8A 3GGJA 3WGOA 3WA7A 2X8WA 2C04A 1QO9A 2KM1A 4H1TA 1N7HA 3RUHA 3SXUA 3ICQB 4CTKA 1W1WA 1Z0FA 4NP6A 4RTQA 5HRAA 2Q29A 4HWSA 3AINA 4IM7A 1RWPA 2C2OA 1O03A 3G3EA 4QO7A 5JFGA 5KDLA 1XMXA 4P3KA 2FDXA 5H3LA 1RQPA 2VAVA 3BWCA 1NR7A 1U1IA 1RWKA 1JI0A 2WAXA 3ZDCA 4KQKA 4MQFB 1DIBA 3BHNA 3IBYA 4QU8A 1GRVA 1KFCB 2ZB8A 1GY8A 2WMNB 4J1NA 3V9AA 3W3ZB 2BTEA 1B23P 3BWVA 4JB2A 5C4MA 1BE6A 4JI8B 2HHAA 3N7AA 3K6JA 3I9OA 2X6TA 2PRSA 4BQRA 3FYCA 4UUBA 1K27A 2HHHB 1OBHA 2QUBA 3FLMA 2PBFA 2VT2A 3D0QA 4WVLA 3ELUA 2BYTA 1M6EX 2JLXA 1IY9A 2ZAMA 3OEHD 5ALKA 1Q0TA 1ZGHA 2CUZA 1UBTS 4DLBA 1A95A 5FBRB 4TTIA 2XLCA 4ZVOA 1VKNA 2GBIA 4V0OA 5BQPA 3DYIA 4LZWA 3O47A 2IHKA 4HAVA 2GHQA 1L4YA 2MYTA 2HXGA 3ZLTA 1X38A 1ONBA 4LMPA 4D81A 2VDLB 4KBGA 2ZYVX 3QLUA 4HNAB 1QGDA 1UODA 4KO2S 4WKCA 1HTWA 1QNFA 2IYAA 3LDUA 1ZNQO 3C8UA 3I09A 4JJ7A 2UZ0A 2NZYA 1G3UA 1FU4A 4FMPA 2ORWA 2KBFA 5K05A 1S9DA 1ZOLA 2WKPA 1QHSA 4GOJA 1SHJA 3R7WA 3RKSA 4BX0A 4EVSA 1XO1A 2PGDA 1DDGA 2OR3A 1YMVA 3N7UA 4ZVVA 5H3HA 1E1RD 2VLIA 3DVRX 2CHVA 4B6SA 1LVUA 1S7GA 4BXOA 2OV6A 3KHSA 4JDUA 5BN3B 5IDQA 2RHGB 3V8MA 2JFXA 3LLVA 3O8CA 2L19A 4DSAA 2FR0A 4OQXA 2I55A 1V9LA 1KL7A 4GGPA 1KK2A 1KI4A 5CM9C 1YXMA 3S81A 2ZJYA 1G6HA 3STUA 2YQZA 5CH8A 3S7TA 2JH9A 2WP8J 3OE7D 1HRDA 4MUMA 3QXGA 1EE1A 1PTJA 1YDGA 3I72A 4H2DA 4LXGA 3VZRA 3DKIA 2XTAA 1FXWF 5L8VA 4D3SA 1X7ZA 4KXXA 1T5IA 3CBQA 1BFDA 3ELDA 4WN9A 5KWEA 1A76A 4N5LA 2JVIA 3KWJA 4Z86A 2BL4A 4K9LA 3ZZ0A 4BEJA 3P0FA 1F6DA 5ITWA 5F2NA 1W52X 4US2R 1VXOA 1R66A 4DEVA 2XE6A 1ONNA 3IVRA 4FI3C 4MAAA 2WJ6A 4BX8A 4J7AA 3R9KA 4OLAA 3ZQJA 3L07A 3SZLA 1ISFA 1KZ9A 2CXOA 4JX8A 1RKVA 2VRBA 1IBSA 1VJDA 3OT4A 3Q3HA 1PV1A 2GRJA 2FVXA 3FKQA 3KQKA 2C7VA 4PXAA 4CIYA 5GTDA 5JAQA 3GIWA 4PF1A 4IIJB 1DWOA 3N0VA 1A8SA 4H7FA 4NJMA 2W8BB 3WNZA 5IHXA 4DV0B 2HBRA 5FA8A 1H6DA 1O95D 1BE8A 4Y0AA 3UB2A 2LW7A 2VJYA 3X1MA 1T9AA 3ANNA 3LZ6A 4I4TA 2OK8A 5GONB 1DC8A 3MBKA 5L3QB 2H0RA 4DDWA 4G4GA 2VF7A 4Y98A 4J0GA 2BMFA 2PKQO 4G84A 1Q0PA 4IEEA 1YA4A 2WPNA 1N2GA 2P0EA 1W4BA 4HKTA 2P7IA 1GZUA 3I1JA 2QTNA 1YR1A 4D74A 3HCRA 3KELA 1J00A 2PRKA 2X4GA 3OIFA 3HA5A 2IYLD 4H15A 2IUFA 1R0YA 4WI1A 2ZYSA 2HK8A 1XTPA 3L7BA 4RQBA 1VPWA 3DM5A 4U7JA 4LNUB 2I22A 4I5FA 1QVZA 3FD8A 5MFPA 3RK4A 3U3JA 2CK3A 5M7EA 1GNSA 2P9HA 3BOSA 4Z0PA 5DGIA 3D5TA 4P4GA 1ESZA 1U7HA 1PW5A 1I80A 1OLUB 1VSUA 2GPTA 1VMKA 2PU5A 1RRKA 2XA9A 4LOLA 4PRLA 3IYLW 1GTZA 1WKBA 2JARA 3FZYA 2PZGA 3ER9A 1X74A 1WMEA 3FUUA 4KJZA 1ZCBA 3EZXA 1PEYA 1W75A 4UVEA 1R6BX 3TRFA 1WBJB 4MV3A 1A9XB 1AKEA 1WIWA 3KB1A 2RG7A 3OSZA 3PR1A 3C45A 4RIFA 5IHPA 4F3CA 1KI6B 4MPRA 3ISTA 5FBLB 2VDWA 2YYZA 4G36A 3BPSA 4XQGA 2IA5A 3RS7A 1LDYA 1YV9A 2GJAA 1Q7BA 3SFTA 3JS5A 3PQ4A 4GOKA 3RJ5A 2CXPA 3AEUB 4EPTA 1ADBA 3FHLA 4L0CA 5A5VA 3VU1A 4DA0A 2RH5A 1E61A 5JAPA 4QATA 5JATA 2P4UA 1QQAA 2VRNA 3DUFB 5KQMA 3Q6MA 1BH6A 1T5BA 1YRBA 1SBTA 4S1OA 4XGRA 3U7QB 1C80A 1MRSA 3W5AA 4QTXA 1I3MA 2CHFA 3HUDA 3OZTA 3PR3A 4AJPA 1GZHB 2H4YA 1ZD9A 4BNFA 5JAZA 2BONA 2P3OA 2FFJA 4G6ZA 4MWDA 4R1SA 2BGRA 4Y2TA 3TCNA 2XBMA 3BILA 2EXXA 5JCZA 3EXEA 1PHRA 1PWEA 1KI8A 3PE4A 4FGZA 2VWPA 1KH2A 1P7WA 4BFXA 4ZHQA 8LDHA 5EN4A 1ZAYA 3DZHA 3JR3A 3I6ZA 2CJXA 3GHHA 5DTQA 2Q4TA 4P83A 5G41A 1L5LA 2O8EA 1JEQB 3V00A 1JW9B 3WWCA 1KMHB 2FV8A 1E2LA 3Q7RA 5SY9A 4UCWA 4YV0A 2XB2A 3N75A 1KE2A 2C88A 1PWZA 3THRA 4YXWD 1Z2NX 2QRGA 6YASA 2BVNA 4WKBA 3AFNA 3BH7A 5A3QA 1USGA 2CEKA 4GR9A 4ZFNA 4EQ6B 2JDID 2OVBA 1DUIA 2GZRA 4PQEA 3DE5X 2BZ1A 3TOXA 4ARZA 4CKCA 1AV6A 3SKXA 1JZQA 2OXEA 2QQFA 2OA0A 1DFIA 3FMOB 5ALHA 1CQJB 4NXNB 4PZDA 1MEOA 1RXUA 2J6CA 4O59O 3AY7A 3EXFB 4M1SA 1DIGA 5EESA 3UJ8A 3DBLB 4FDMA 4H27A 4NAVA 3GLTA 4EI9A 3TTSA 1OH6A 1RPAA 2AE1A 2Q5LA 1R4MA 1BO6A 1KYTA 1PEKE 2EGGA 3A3KA 2Z43A 3B9BA 3LOUA 5DYTA 3S28A 4YT4A 1N33B 2L0XA 1TUIA 3G5UA 4J7CA 2AN4A 4WZBA 3GEDA 3J7TA 3SSAA 5FV4A 3U4QA 3IV6A 5DP2A 2JKYA 2WUDA 4GMFA 1MA3A 1UM9A 1EP9A 2EKBA 2HK9A 3KYBA 3CR3C 3O03A 4C7BA 4CKBA 5GJVC 1XZDA 4B3TB 1XRQA 5ABPA 1N5OX 1K8QA 3EVGA 3TSZA 1ICIA 4B3HA 4JJ4A 4GS5A 5REQA 5J47A 1QOPB 4HVAA 4P2GA 4X44A 3UNXA 1QRUA 3VVBA 3NAGA 4Z54A 1MZVA 1FUKA 3LX6A 1NNI1 2PHZA 3TJZA 3N2KB 3CRW1 2VXBA 1C7QA 1DO2A 2E4VA 4HCJA 5D1NA 3TPCA 1JKJA 2OGSA 2WTMA 4RE6A 3G8YA 3VDMA 4EA7A 5BN4B 4B8YA 4B31A 5ELXA 2W58A 1K88A 5ECWA 1VBNA 1U6KA 1G18A 4IOLA 5A7FA 4A7PA 1V3UA 3QJYA 3KVRA 5TPZA 3OLQA 2YV5A 2OBXA 5AI4A 1GPNA 4EG3A 4Z3KA 4E3WA 3HC7A 5FYQA 3KE9A 3KVVA 4GXNA 1FY2A 5FTWA 4JMPA 1T26A 1Z6YA 1T9ZA 4XR9A 4KHZA 1CF4A 2HHJA 2XH8A 1PUIA 3W8NA 1J9EA 2PXXA 3C5WP 3W2EA 3ZJUA 5EWJB 4UU8A 2VF5X 4PW0A 2JRLA 3MJDA 4CMIA 1LPAB 3VOSA 2ZYIA 3WKDA 3DNFA 3U31A 1TCVA 3FETA 3QVSA 4L3VA 2D6FA 2FPWA 4ALLA 3DS8A 2C59A 4KMSA 5DM1A 4RY9A 4FYKA 1D2AA 2DKOA 1KR2A 3M33A 1T10A 2HADA 3ON5A 5C3UA 1KK0A 3ENQA 1KY3A 1XQ9A 2FETA 1XTSA 1HMYA 1DBRA 1LY1A 5D85A 2FF7A 1YQDA 3K2QA 2XAUA 4IDNA 2GAJA 4M0EA 2IF2A 1X1DA 4IUCS 3D7NA 3GLRA 1GYQA 2VVTA 3UKDA 1WV0A 4KVZA 4CG0A 2UYYA 3EMBA 4DDKA 2I6UA 4DBLC 1FRQA 2BC9A 1SZJG 2LCIA 4PHTA 3GFOA 5AOBA 1N75A 1O8CA 2OMKA 3VKFA 5C80A 3K5HA 2JD2A 1NVEA 4LS3A 5ALLA 2E89A 1K7EB 1RE1A 3DAYA 3LM8A 2DB3A 4KIJA 1P2UA 3RUCA 5TEVA 5C4IA 4OATA 1MD9A 5CAEA 3CVUA 5AW8A 1X9IA 2XVMA 4MDFA 1BVRA 1UMCB 3KKLA 2BAGA 1BA3A 2VSQA 2BGIA 4MYCA 4V0ME 2A0XA 1R64A 2Y0PA 4QU9A 4B1FA 2WJZB 4Q5IA 3ONDA 4KBYA 1PRYA 1E2MA 1OV6A 1FX0B 4PC3A 5DBGA 1H1LB 3DOUA 1RC0A 3SS7X 4CODB 5LZ2A 5BV8A 4RTJA 4RCYA 3LX4A 4PSDA 1QYRA 1K75A 2PZJA 3D9QX 4BHTA 5BSVA 1MXFA 4QLAA 2ZUFA 3CRZA 1KYIA 2QDXA 1LVGA 5B1HA 3OQOA 1GZ7A 2ZRCA 3O95A 2NWQA 3WWEA 1K92A 1V1RB 3SZRA 3PG5A 1O9HA 3PEVA 1DQRA 4S2EA 4GU5A 2P2ZA 4XA8A 1R6XA 3C16C 4RK5A 1J70A 3L4BA 1BA2A 1KBQA 1DKPA 2QX7A 3F97A 3OCYA 5LD2C 4FQ7A 4PR0A 3E1GA 1XRMA 1N2EA 5E9QA 3RS2A 5DBHX 1RBYA 4R3WA 5I01A 2RH9B 3IPCA 1KA9H 2ZUCA 1U8CB 1NLZA 3KZVA 1SRRA 2WAYA 1XA3A 4LY3A 3D4OA 2ZE8A 1IB0A 3D59A 2PXAA 2JAHA 5NLLA 2A0FA 1O57A 1ULUA 3AI2A 4OJKA 3NVKI 1QP8A 3SC2B 3DBIA 2XWPA 2YY5A 4IDFA 4JGIA 1K5DA 1GKIA 2PT9A 1Y4SA 2N46A 4PHCA 4ZCLA 4PNEA 5EJMA 4FLEA 4LYFA 4DR2B 4AYTA 1RXSA 3VPDA 2FR1A 1JJ7A 2VSNA 4P6VF 4ZALA 1E2IA 2PO5A 2QI9C 5GJCA 4LTNA 5HJ7A 4XFJA 1G20E 1UBOS 3OCCA 1V35A 2FPMA 3RM3A 5A1TA 5I8ZA 4EWLA 4OH1A 5LXTA 4P33A 1IMOA 2FKNA 2F8TA 5LB4A 3RS3A 3OZDA 1CP3A 1NPDA 3IBTA 4ZK2A 1J21A 1RWMA 3WLQA 3I92A 4DZRA 3UJ9A 4N7MA 5E8JA 2FMFA 4RD0A 2HPAA 3MJVA 2XMRA 4PIVA 2VBFA 2ZQYA 4OHYA 2EF1A 4MINA 4L51A 1I6LA 2C4KA 2Y8EA 2J3LA 3JQPA 3JD1A 3UMGA 1NWCA 4ZOLA 3SR4A 4HWOA 4E0BA 1U7OA 4KN5A 1FRVA 2ZSAA 3BMCB 1VCHA 2IK8A 4HZUB 5K4AA 1F0YA 3KB2A 5CYGA 4TKMA 1DTWB 1WD7A 1Z6QA 4Y6OA 2LNDA 2OM2A 3IE2A 3DZFA 5IU6A 5JXWA 3PFIA 2ZRGA 3TXXA 2GN6A 3VYWA 2J3HA 4IHJA 4RGQA 4PAGA 3BL8A 4S3MA 5CPBA 4BKRA 4O4JF 4LJAA 3O4IA 4E2WA 3T9BA 4YRLA 1FTYA 1DQZA 2F4NA 4RGVA 1CJTC 3I58A 5AIBA 2Q1SA 2QRNA 3I04M 1PJBA 1XZHA 2A59A 3KKOA 4Q1BA 4QBTA 2H0QA 2BV3A 1E62A 1PR3A 4PIMA 4ETNA 4NCBA 3PDUA 4AO8A 1U3UA 1IMJA 3OMLA 4NBWA 4TVSA 1IWOA 1OX6A 2OAQ1 3MD9A 4LW8A 1B3BA 3ENWA 3DXFA 3AKEA 2GN0A 3FSJX 1KSHA 3I1YA 3OF5A 2IRWA 1RFLA 2V3VA 3I1FA 4HTFB 1THZA 1ZD3A 4FHDA 4JUCA 4MA0A 4BLUA 4W9MC 1ZCZA 4Y67A 1ZXBA 5DCWA 3TNLA 5F78A 1GAWA 3BK7A 3D1VA 5CNKA 5I9LA 2FJ0A 4FTWA 4OTZA 3I6MA 4C2AA 3BBLA 1Y37A 3ADKA 1FYFA 4LJ4A 2FH5B 1PBTA 2ZYGA 4RKYA 4ZT7A 3OF2A 1R3DA 1P4HA 5HRCA 3MCZA 4PZLA 3T7KA 4TSFD 4RK1A 5LP6C 1L4KA 1YH3A 2EWMA 1AX9A 4GQIA 5KVAA 5T41A 1IWBB 1E6CA 3HCPA 3IAM6 3QUBA 4P3PA 2W6IA 3K0CA 4CQMB 5TQ2B 2XDWA 3EFOA 3QYFA 5BRJA 2JLSA 2YVKA 4UW9A 3GBPA 1ZJ5A 2FX2A 3ONVA 3RG8A 3H1TA 3GLFE 1BMDA 3TVTA 4EZIA 2XNHA 3TYXA 3OQ6A 4YX9A 1FRNA 5ALUA 3G9QA 5TT1A 4B34A 3CVJA 1E1KA 4DMFA 2HXSA 1K2WA 3RC1A 1JDUA 2WQ6A 4IMIB 4MI9A 5EKTA 3BD8A 1YFJA 4Q00A 4OQNA 2BH2A 1DWQA 1JI3A 1GKLA 2V7PA 4XX1A 3QBJA 3WWDA 4AMBA 5FEUA 1Y3CE 2CXTA 2EJUA 3EEOA 1QRAA 4WT7A 4FDAA 2FEAA 5E7MA 1YFKA 2YMPA 2ONZA 3NXSA 4BP8A 2GTHA 3PWKA 4KXFB 2HF9A 4L57A 3U4MA 4F6CA 4XX0B 4KDRA 2YXDA 2H5LA 2XOKD 2VHJA 3QU2A 4CM4B 4WCFC 2W2VA 1D4FA 3K9NA 4DRXB 4FB5A 2IFTA 5K8CA 4O2RA 5EZYF 3UOGA 1AKNA 1FDRA 2X19A 1P80A 1V3VA 2XNDA 3SXPA 3V2GA 3WMRA 3R1IA 3FUWA 1MG0A 1OLXB 5NULA 3M6FA 4QJ4A 1JT9A 5L7YA 3ZG6A 1SBIA 2WAMA 4CL2A 4A1OA 2FXIA 3N2GB 3B13B 3GRRA 4Z7OB 4KWIA 4MKHA 1DJMA 1CZRA 7MDHA 4FFLA 4L76A 4J0FA 3EZNA 3B3AA 4NDAA 5DISB 1D1SA 1E5VA 2OKGA 3IR5A 3WA6A 1OH5A 4RXUA 3TW4A 4S12A 1POXA 2D5LA 4R69A 1BJTA 3GQBB 4Y6GB 1U02A 2PVSA 2ZJ3A 5T4FA 3TTWA 3A0RB 1MRZA 4RLSA 3O4FA 5IVIA 1TUGA 3FOBA 4FUQA 5HFAA 2VO1A 4FFSA 1AMUA 1EXNA 1WVIA 2VDNB 3BN3A 3PJFA 3TEMA 2C92A 4E6PA 4EFMA 3WRYA 3QHPA 1CDEA 2GFQA 5LWQA 4IS2A 1H22A 1GOTA 4QDTA 3V97A 4GX0A 5SY4A 4ZEWA 5EQFA 1B43A 3R4VA 3X1XA 4IY1A 4MH0R 3V2HA 4GM1A 3IE1A 3HR7A 1Y48E 1C8BA 4AZVA 2Q7OE 1T3SA 5ALTA 3DDZX 4G8JA 5HE9A 1K8YB 1NBHA 4R0NA 5KJ6A 3II6X 2D7JA 1TMOA 3IKVA 4KIWA 3WK5A 3TQQA 3MLAA 4JWTA 3I73A 3RVKA 4BQOA 1RXCA 1Z26A 3TZQA 3L6UA 3F5DA 4X6LA 2ZJ4A 1L7VC 2IOHA 4ZVTA 1UZUA 3A1DA 4H18A 3DE1X 2HMWA 3VXKA 4IHAA 1KC1A 4C22A 1K98A 3CKMA 3IAS1 2YJ4A 1TK9A 4H7EA 5E0OA 4GQBA 5ICMA 1CY4A 1N92A 2XMDA 3H9QA 1G7RA 2WSLA 1K8ZB 4I1VA 5BYAA 2ZIFA 4HLQB 3WWOA 1JKFA 1JA9A 2AOXA 2WUEA 5KSWB 1TJ5A 2ATCA 4P3YA 3QF4A 2LTAA 1CUUA 4RY0A 1U1CA 1YB7A 1E1CB 2WUVA 4B43A 5I48A 1UC8A 5KB3A 3ZGZA 1PFVA 1QX4A 1OTHA 1ULAA 1YR6A 2J3MA 1HYGA 3NIFB 1L1QA 5BSUA 1CQZA 3CZMA 4BNJA 5DWVA 1CQIB 1GAQA 2G77B 4YJDA 2A94A 1YVPA 4ZK6A 3J7AC 2FPGB 2JHAA 2NP6A 2A9QA 1C41A 3U0BA 4YCDA 5EY5B 2QMEA 3DBRB 3T7EA 3VC3A 3DEAA 3U56A 4C2UA 5BOSB 3OWXA 1KRHA 3W8EA 1COWA 2OTCA 3EF3A 5GVSA 2DKFA 2BHSA 2R8BA 4BN4A 5BMVA 3OX2A 3Q0EA 5DW3A 3L1UA 2R62A 4RABA 4ZCQA 1MCZA 3H04A 2DTEA 2IZOA 1A27A 2DVMA 2KHZA 2QU7A 3OJ0A 1PWHA 1KJIA 3NKLA 4EB6A 1I0ZA 1JU4A 1SOWA 4B80A 3I05A 2NT4A 4YV1A 1TM5E 1REQB 5C51B 1HE4A 4F7DA 3QE3A 5IXJA 1SCNE 2VHYA 2FW6A 2G08A 4MVXA 4NJOA 4FQ5A 2WJ3A 2X9LA 4TMKA 2R87A 4Q9JA 3GCZA 2ZE7A 2HV9A 1VL8A 3OLWA 1RMYA 3AVPA 5DRTA 4W9RA 1CZNA 4XB2A 1H0KA 4UZSA 5F7ZA 3TQIA 4WKPA 3WGQA 3WMFA 1UPTA 4LN1A 3W6UA 2COEA 2AMYA 1AGNA 1ZH0A 3QI7A 1LD3A 3WNCA 4DA9A 1JWLA 2X13A 1P4GA 3I30X 3HB7A 3LUDA 3Q9NA 5C18A 5LVAA 2VP9A 4XIYA 5KSZA 1P18A 3E5MA 1JE0A 3EXAA 3FSGD 1VHJA 4LMBA 5M2QA 1VJGA 2CL7X