1MG5A

Crystal structure of drosophila melanogaster alcohol dehydrogenase complexed with nadh and acetate at 1.6 a
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
255
structure length
255
Chain Sequence
SFTLTNKNVIFVAGLGGIGLDTSKELLKRDLKNLVILDRIENPAAIAELKAINPKVTVTFYPYDVTVPIAETTKLLKTIFAQLKTVDVLINGAGILDDHQIERTIAVNYTGLVNTTTAILDFWDKRKGGPGGIICNIGSVTGFNAIYQVPVYSGTKAAVVNFTSSLAKLAPITGVTAYTVNPGITRTTLVHKFNSWLDVEPQVAEKLLAHPTQPSLACAENFVKAIELNQNGAIWKLDLGTLEAIQWTKHWDSGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alcohol dehydrogenase
publication title Drosophila alcohol dehydrogenase: acetate-enzyme interactions and novel insights into the effects of electrostatics on catalysis
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 98
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2002-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1mg5A00
4X54A 1PJ2A 4NK4A 3NRCA 4D41A 3LU1A 1K6IA 2VUTA 1N1EA 4P8RA 4P4LA 3SC6A 4FB5A 1PWXA 1TA4A 1R4MB 4WUVA 5KWEA 4B8WA 1P77A 1WLYA 3S2IA 1A71A 1F14A 2DM6A 4M1QA 3IP3A 4YWJA 3E9MA 3G1UA 4E32A 3TF5A 3JQGB 4IGFA 4R1UA 3N7UA 3T7CA 3WWYA 4BNIA 1LA2A 1P3DA 4JQCA 2EKQA 2EGGA 5A3JA 4N18A 4MVJI 1VSUA 1YBMA 1NQOA 4CLOB 3E8XA 4YT2A 1X0XA 3NDJA 4FJ1A 5L53A 3JQFA 2PZJA 1DC5A 1I2ZA 4RF2A 4WLFA 1YS4A 3C85A 3GNTA 2Y66A 3E5MA 4DQUA 1W4ZA 4FIZA 5IDQA 2FWMX 1WWKA 3TWOA 2QYSA 5CDYA 3CUKA 1LJ8A 1PGQA 1V8BA 3JQ8A 2ZIZA 2G1UA 4G5HA 3QWHA 1N9GA 3U4IA 4KOAA 4W99A 5ENVA 3QP9A 4I5DA 1NPTO 2P68A 2PFGA 3E9QA 3ZNQA 5JY6A 1A7AA 3QVOA 4PGFA 3NDRA 1DJNA 1BDMA 3ETGA 4NBWA 3ROMA 2OXIA 3OA0A 3UGKA 4CV0A 4PG8A 3S2FA 1ADGA 1V0JA 3CMMA 1SMKA 4NG5A 3VZPA 4DMMA 2D8AA 2OHXA 4L4RA 4R41A 2VWQA 1K6JA 4E2XA 1D7OA 2Q2QA 1OC2A 3D7LA 4C4OA 2RH8A 3QRWA 4CQLB 1XLTA 1CJCA 1LRKA 1IHXA 4AJLA 3O26A 2FN7A 4BMSA 8LDHA 4OM8A 3ZU2A 3GC6A 1RPNA 3DOCA 3PIDA 1P9LA 4MDHA 4PZDA 5T64A 5A06A 1NXQA 3L9XA 4Y9DA 5G4LA 4BNUA 2HRZA 1E3IA 1HETA 2BGMA 1U4OA 4O59O 2JAHA 5ICSA 4RDIA 4BNKA 1CWUA 1NAIA 3IJPA 3ZWOA 4IDDA 3EZYA 4MIYA 2GCGA 2G17A 1E3WA 2I66A 1AE1A 4EBFA 3WMXA 4A2CA 1Y8QA 4J7CA 3ZV6A 2Y99A 2NVWA 2AQIA 5T8KA 3JV7A 2CF6A 4PIVA 1IZ0A 4BNTA 5I7VA 1WDMA 4RPGA 1IPFA 3TSCA 4OL9A 5A5EA 1GDHA 3H5AA 3JQAA 3ZGYA 1FDTA 4ZGWA 4MPDA 3AUUA 2WEKA 1GQ2A 4GVLA 4DPKA 2V6GA 3LT1A 1BXGA 4DQXA 3PQDA 1AXGA 4CMGA 1KVTA 1KVSA 4GLOA 3AY7A 1XIVA 1EUDA 2QRJA 5COBA 3B6ZA 1QV6A 3AFNA 2EW8A 3FWNA 1MFPA 4B3HA 1QR6A 1GPJA 4WLEA 4IUYA 1PJSA 1E3JA 3DHEA 4FFPA 4EI2A 1DLJA 3F6YA 2AA3A 2VYVD 3HWRA 1O9BA 1E3LA 1EE9A 4YJGA 3MZ0A 4EUEA 5KOIA 4L8VA 2OORA 2YUTA 4WCFA 3M1AA 4IIUA 3ZU3A 1MC4A 2VNSA 1HE2A 5A3VA 1EFLA 4PLWA 2PY6A 3TNLA 1DSSG 3VAZA 2W8ZA 3H5RA 4H7PA 4PLGA 4M8SA 4P22A 2O48X 1O5IA 1Z6ZA 5C7IO 1LC0A 4Z0HO 3FPCA 3BTOA 3KBOA 2FR8A 4CMKA 1ZJZA 3NT2A 5JCJA 5ADHA 5TJHA 1KVRA 1O6ZA 1X0VA 5KCZA 1DJQA 2BGLA 2EXXA 4WPGA 5HTOA 2DAPA 3P2OA 5IZ4A 2ZYDA 4DRYA 1Z45A 1M75A 1U2DA 1YQDA 2NADA 1NTOA 3GRPA 4CM1A 4WKGA 2GRAA 1GUZA 4ZQGA 5BSEA 1AHIA 4TVBA 3I6QA 3DZBA 5JAQA 2HMSA 2WWRA 1ZEJA 3AK4A 3RU7A 1NHGA 2W98A 2O23A 4J1SA 4QXMA 1Q2XA 2B83A 1JKFA 4YJHB 4I5GA 3HE3A 4Z9YA 3PVZA 2GERA 3BHMA 4MVJE 3CTMA 4GLLA 3OJEA 1KS9A 4LSWA 4PG7A 3PIIA 3K6JA 3IS3A 2PNFA 4XJSA 5JYEA 4NJMA 4KUHA 4BS9A 4B4OA 4HNHA 5IDWA 4DYDA 2Q45A 4HADA 4BNYA 4ND2A 4OOFA 2O3RA 3BHJA 5TIIA 1ML3A 1WZIA 4D79A 1W8DA 4IQGA 1ZUD1 4CV3A 3T4EA 2JFHA 2UUPA 1KVUA 2EP5A 3TDKA 3I4CA 2WE8A 4GKBA 4UREA 2HJSA 4JJGA 5JDCC 4FR5A 3QY9A 4DLLA 2QG4A 4XB1A 1PZGA 4FFLA 4XQCA 1Q7CA 3NKLA 1CEQA 3ZNPA 3WTCA 4IS2A 3DAFA 1NFRA 4XCVA 4YCAA 4GMFA 2JAPA 1VJ0A 4BNMA 1NVGA 3FNHA 1RKXA 4GWGA 4LMRA 4O0LA 2VYND 1GYRA 3BTUA 3WQSB 5KNLA 2O3JA 2OOSA 2NV6A 2FPPA 1BHSA 1HDGO 4AG3A 4E31A 5ITVA 2P5YA 4QQRA 4AJNA 1I10A 3RC2A 1YO6A 3GFGA 2BRUA 3H2ZA 4IS3A 3EK2A 2IXBA 2CVZA 1ZBQA 4PVDA 2Y1DA 3WGYA 4DIFA 4Y6RA 3LT0A 1T2FA 3DFZA 3OJOA 4JCOA 3W4JA 4D46A 4I5EA 1R15A 4ZD6A 1C3VA 3A4VA 2Y67A 5H81A 2WD8A 5IAAA 1E3SA 1XU9A 2Q1SA 4CLXA 1GV0A 4BO6A 1DRUA 3FTNA 3NGLA 3PGJA 4K9DA 1H94A 1P1JA 2Q49A 1JA9A 3V8BA 2P9CA 3ETEA 5G0VA 2X0RA 3HADA 2NQ8A 3GEMA 5HWSA 1NVTA 1ENPA 4QTZA 2J5RA 1FK8A 1NQ5A 1V3UA 2QX7A 1HE3A 4GI2A 3BA1A 1B0AA 2EWMA 3VH4A 1MG5A 2FR1A 4CV2A 3I9OA 3WLFA 1K89A 4F3YA 4YVFA 1LUAA 5GZ3A 3R0IA 4S1VA 4E0BA 3U9LA 3RD5A 2EG9A 4PLTA 5AXAA 3VKUA 3LC2O 5A9RA 4G81A 1WDKA 3WWZA 1HTBA 3L6EA 3GUYA 1FDWA 3WR5A 1D3AA 5AXBA 3KSDO 4EUFA 1H6DA 1JU9A 1EE2A 3HDQA 3TFQA 5KTKA 1YKFA 4U7WA 2DT5A 5U1PA 4FDAA 5HBRA 3PLNA 1EK5A 2NM0A 4UVHA 3ZW8A 5LDHA 1UXKA 3H5NA 3JYPA 5AXCA 2GYYA 3AY6A 1I2BA 2Y68A 3A14A 7ADHA 4E5YA 1ZCJA 3GVIA 1SB8A 3L9WA 4HFRA 1U2GA 3JQCA 1ZK4A 2J3HA 1LDEA 4LMPA 1X1EA 4MKZA 4J1TA 4II3A 1DRVA 4II2A 4RVHA 5DCWA 3VOSA 5CG1A 1RM4A 2WM3A 5L3ZA 5JY1A 2ZB7A 3B1FA 3KTDA 5U4QA 4YJFB 1FF9A 2WYVA 3K73O 5G0TA 2VT3A 1JN0A 4JBHA 2GSDA 3WS7A 1TT5A 2V7PA 4CUJA 5L7YA 4J7XA 2P9EA 5IG2A 1DLIA 3EMKA 4RPHA 3IKTA 1NFQA 1KERA 4D7AA 4NZ9A 1LDGA 1GQYA 1NPYA 5FEUA 4JP3A 3H65A 5B12A 3WDSA 2CD9A 3LC7O 2A94A 1XWFA 3MWDB 5ENDA 4E5KA 4BMNA 2GO1A 5IN4A 2GF2A 1XQ6A 1E3EA 4RQUA 3BMQA 4CQMA 1OBFO 4BIIA 3QJ5A 1VPDA 2VN8A 2JCXA 3H7AA 2OFPA 4RVSA 3DZFA 1GZ6A 1LSSA 3RBVA 4UULA 1LSUA 2AQKA 3ZHBA 2C59A 4CMIA 4IXWA 1HLDA 4O1MA 4FW8A 1PJ4A 2HO5A 1X7DA 3C1OA 3DBHA 4JN6B 4NIMA 1T2CA 3WIEA 5AXDA 2ZK7A 2O50A 2IZ1A 1ADBA 2J5KA 1NX6A 4WLVA 2H5LA 2DBVO 2G82A 4IM7A 3BZUA 1U7HA 3ZHXA 4NH4A 4G65A 3GUCA 4P4GA 3EGOA 3FR7A 2OBNA 3HNPA 3QWIA 4IPTA 3KB6A 2VWGA 2XAAA 5L45A 1XG5A 3ONDA 1NVMB 1VC2A 3EVTA 1N92A 2G0TA 4CL3A 2EKPA 1GEGA 1QYCA 4ZQBA 4E4YA 1H5QA 2PH3A 1KEPA 2JHGA 3GVXA 4XR4A 4IMPA 4J4BA 5L40A 1KVQA 3AUSA 5JMWA 1EBFA 3GR6A 4KQWA 3D3WA 3GAZA 3GQVA 4OGWA 1U8FO 1L7EA 2IEBA 3MCVA 4K6CA 4BQPA 4XQEA 2HU2A 1I3MA 3GLQA 2HMVA 1BWSA 3MJVA 2NVUA 1BG6A 3I4FA 1A4UA 4LRTB 1M6WA 4QEDA 5DF1A 2Z1MA 1E7QA 3HSKA 4GPD1 2D3TA 1A7KA 3PDJA 4CM8B 3A9WA 3ZHYA 4BO2A 2FP4A 1K3TA 1T4BA 3ASUA 1JVBA 4OJNA 5AVOA 2ZCUA 3D4PA 4A0SA 3E82A 1AUPA 1Z75A 1E1LA 4J91A 1Q0QA 3IDSA 3RKUA 4ZJUA 3RASA 1QYVA 1SO8A 3FBTA 4HY3A 2W2LA 2C54A 1R4MA 4R3WA 4RF5A 3IP1A 1Y6JA 4YQZA 3EVNA 5IZCC 1XSEA 1SCUA 1SAYA 1R0SA 4D44A 4EZBA 2A4KA 4Z3KA 1ORRA 3JQGA 4M87A 4CMEA 2V6MA 3VVBA 1PQPA 3KLPX 1GY8A 4NJOA 1Q7GA 2PD3A 1PZHA 4F45A 2ZYGA 3B70A 1I3LA 4CLOA 2AEFA 3NT5A 3U5TA 1NAHA 3E18A 1HDRA 4XKJA 2YJZA 3ZV3A 4UEOA 3PP8A 1ISMA 1G6KA 1QRRA 3AY3A 2DLDA 1B14A 5TSDA 5A5FA 3TZHA 4R1SA 3V1UA 3UW3A 2A35A 3DEYX 1ZMTA 3MEQA 4RLHA 1YB1A 2P2SA 2PZKA 4XGNA 3INGA 3P19A 4NBRA 3DOJA 4WOKA 4A7PA 4ALJA 1JDJA 3AI1A 3AOGA 3M2TA 4EUHA 3FSRA 5JSFA 2YFHA 4EEZA 3ENNA 4URFA 5JBIA 3PTZA 4RLSA 3HDHA 1DAPA 1UP4A 1VRWA 4QUKA 2FPGA 2OGUA 5H82A 4Q39A 3ZH2A 1WPQA 1UP7A 1XCBA 1XKQA 2DTEA 3EYWA 4RCVA 3WGIA 1F8GA 1HZJA 1UXHA 4YAIA 4M86A 5F5NA 4ZVVA 4NBVA 3AI3A 2YHIB 5IJZA 1W0CA 2YHUA 4RF3A 3PZBA 2HCTA 4K28A 2NU8A 4GX2A 4CQLA 5IN5A 5BNIA 4ZRMA 4B8ZA 4UAGA 1L1FA 3S2EA 1I32A 4J1QA 4CM6A 2YV1A 5JC8A 1DIHA 9LDBA 5THKA 1RJWA 5DOZA 4MVJF 4I9UA 4NU5A 3GK3A 1GZ3A 4YEDA 3GDOA 4IDBA 4ND4A 3LZ6A 3OQ6A 5G4KA 1WNTA 1MV8A 4J2HA 4OQZA 3SC4A 4B3JA 3ROKA 2RBEA 1NWCA 1TVEA 1B3RA 5IZCA 1QLHA 1HF3A 3VHRA 3JQFC 3IUSA 3MJTA 3WMWA 2HKIA 4XGKA 1T26A 5DP2A 4B7UA 2W4QA 3DBRA 4CM4B 2DPGA 1LXCA 2P9GA 3D3EA 2X86A 2GZ2A 3JYOA 1MFZA 1T1SA 4BNGA 4NHEA 4BO1A 3DDNA 1GAEO 2HAEA 1EVIA 1FDSA 4EJMA 3OICA 5TLSA 3GH3A 4WLUA 3WYCA 3CKYA 5JS6A 1N7HA 3TZQA 3ST7A 3RFTA 3ZWMA 5JMPA 3X2FA 3DL2A 1C0PA 1NYTA 1XA0A 1GUFA 2ZJ1A 3LYLA 1UZMA 1AXEA 2BHLA 4J4TA 1PJ3A 4BGEA 4GWKA 4IDAA 4UUMA 2QW8A 4Y8VA 5A9SB 1QMGA 2UUOA 4BVAA 2EJVA 1WP4A 3SLKA 1EQUA 4J0EA 5JCJD 1XYGA 3BIOA 4FGSA 3VPHA 5H83A 3PWKA 4J0FA 3Q9NA 4W9NA 1PGNA 2ZTUA 3B20A 1JTVA 4NI5A 5DN9A 2WMDA 1PR9A 3A06A 1LQUA 3WJAA 4BL5A 2Q99A 1RM3A 2ILTA 1Z74A 2X58A 2ZJ0A 3PI7A 3VKVA 4ZICA 2VRCA 3I52A 1PJQA 2PLAA 4ZHSA 4WASA 4BKPA 1P33A 1UP6A 2C20A 1EFKA 1FDVA 1R0LA 3IOYA 1H93A 3KYCB 3PGXA 5ER6A 3RUCA 3FF4A 1YOVB 2CVOA 5FI3A 3E03A 3Q9UA 4IINA 4O63O 5G0WA 3WQQA 4XJTA 2PD6A 2I6TA 3PJFA 4D3FA 4MP6A 4D0RA 1P44A 2QIOA 2WD7B 5L51A 3U4CA 3ZW9A 4LK3A 1NFFA 3GVCA 1N8KA 3KXDA 4GX1A 2F00A 3V2UA 3EDMA 4IBOA 4QSMA 4OSPA 1ISHA 2C5EA 5T8KC 6ADHA 2BH9A 2D0IA 3HFGA 3KYBA 4LW8A 1V6AA 3VPXA 5CDTA 3K96A 4PN3A 5CAEA 4YJHA 1KC3A 1B3BA 3JD4A 1DC6A 5L9AA 4RQTA 3G3EA 4BKUA 3JD2A 1OOEA 3IC5A 4GSKA 4PZCA 4W7HA 2Q2VA 3AUAA 3SX2A 1E6UA 4TROA 3GDGA 2J3IA 3KSZO 2FHSA 2UVDA 1D4FA 4G2NA 3WNQA 3INTA 3FD8A 4Y98A 1R4NB 4FFMA 3GZ4A 3AWDA 4R69A 3D4NA 4K26A 4Z6KA 1JWAB 4NR0A 3GEDA 1PSDA 1F12A 4BHTA 4CJXA 3GZNB 3H9JA 4D45A 4YT4A 2Y1OA 5I8ZA 4MVJA 4WCFC 1ONNA 4R1NA 3FTPA 3ROPA 5JAMA 2PGDA 4MVJM 1SEVA 5COAA 3D5TA 4O6VA 1GEEA 1QKIA 5C5IA 4BOYA 2W2KA 4DYVA 3N58A 5HA5A 2CVQA 1QYWA 4AJ4A 2G5CA 3E48A 3W8DA 3BAZA 4Y6SA 3GGGA 4RVGA 5C3MA 4RPKA 2J3KA 3Q2KA 4BO4A 5JAIA 3OEYA 1YONA 2Y0DA 3UFXA 2JCYA 1I01A 1IPEA 1PJLA 4UVGA 4RDHA 3BMNB 4BO7A 5I7FA 4HUJA 1PGJA 4CUZA 4R5HA 1QYXA 3H8VA 1U5AA 4OH1A 5K6AA 3GNQA 2EEZA 1ISFA 5DBFA 1F8FA 3ULKA 5JLAA 4CM9A 3GA0A 4XWYA 1YBVA 1C1DB 2YYYA 3MTGA 1HDYA 4TKMA 1PGPA 3ETDA 4UEJA 5KVSA 5FYDA 4UVEA 3ABIA 5T5QA 3ZWBA 2IYOA 3G17A 2IZ0A 3UCEA 3G1TA 1HDOA 2DTXA 1ZH8A 2IEDA 4M54A 1M66A 4ALIA 1EVJA 3OIDA 2R00C 1Q0LA 3DTYA 4INAA 4DC1A 2EHDA 2O2YA 4BKQA 2X9NA 4B3IA 1R16A 3WXBA 3ZCXA 4FFRA 4YAJA 4TRNA 1MC5A 2YDYA 5KVVA 2HMWA 4B7XA 1H2HA 5EESA 5JCXA 1P0CA 2E49A 3NT4A 5EINA 3JD1A 3WGZA 5CDGA 4KDFA 4RZHA 1Y8RB 2EKLA 2NVBA 2ZTVA 1B26A 5IDXA 1E1KA 3SXPA 3TRIA 2X7HA 2C5AA 1PGOA 3ADOA 5A02A 4GX5A 1BXKA 5CEJA 2EP7A 4DUPA 1PWZA 3UHAA 3H2SA 5FI5A 1MXFA 4HFNA 1UH5A 3CZRA 3G0OA 2AHRA 1GL3A 3WX0A 1U3WA 1UXJA 1IE3A 4PLYA 5JAZA 4R3NA 1Z73A 3OECA 1C0LA 3MJ4A 4PG4A 5FFFA 3U3XA 3U09A 4OSOA 4EYEA 5ICMA 2AXQA 1VE9A 4FC6A 5U9CA 3KLMX 3FI9A 1Y1PA 3HDYA 5ITWA 4AFNA 3MTJA 4CL8A 1E6EA 1WW8A 1TB4A 1I24A 3GG2A 4CQMD 1OC4A 4B7CA 4PRKA 1YL5A 1L7DA 1NNUA 3PLRA 4QFDA 1HZZA 2Y93A 4E5NA 4YJFA 2IYPA 2C7VA 5T67A 4L4XA 5T57A 4AJEA 3U62A 3C3XA 4BB5A 1U3UA 4I9NA 1HL3A 5B4VA 1HYHA 5JDIA 2GN8A 4FQ8A 1IUKA 2PZLA 3IJRA 3WOHA 2VRBA 3DMTA 3FCOA 5TJ9A 4RORA 2WJPA 3R6DA 1HKUA 2FRDA 4L0QA 4OKNA 4WJZA 4TWRA 1GYPA 3VH2A 3O4RA 5DCUA 1VJTA 1LDYA 3ENKA 2X0IA 2GDZA 2CUKA 2R00A 3PYLA 4ESOA 3I3OA 1P1FA 1ID1A 4B4WA 3DHNA 1DPGA 1WMAA 1AN9A 4A5OA 3JD3A 1A27A 1KYQA 4FBGA 3GAFA 5BSFA 3EC7A 5F1PA 4UUOA 2WYUA 1O0SA 2PR2A 4RJTA 2I67A 3DOOA 4A73A 4JK3A 3VPFA 2Q4EA 4XYGA 2O4UX 4CODB 1ZMOA 5TNXA 3DHYA 2JL1A 3EUWA 2X5OA 3PFFA 2J8ZA 3HUDA 2UAGA 3D0OA 4W82A 5LCXA 5KKAA 4WCDA 3PRJA 5C7OO 1N1GA 4XRRA 3DONA 3RUFA 1C0KA 1UR5A 1GZ4A 2O4CA 3SJ7A 1PTJA 5KIAA 3MJCA 2O7SA 2Y1FA 4H15A 4WGGA 2YW9A 1Z82A 1FMCA 4MJLA 1ZK0A 4GBJA 5I8WA 1XU7A 4PZEA 4XIJA 2PZMA 4EITA 1WVGA 2Y0CA 1U3TA 2Q1UA 2D5CA 2HDHA 3ADPA 1ZXBA 4EGFA 2I5PO 3M1LA 2JKVA 4UVIA 3KOUA 2Y1GA 4LN1A 5TC4A 1MB4A 4A10A 8ADHA 4RF4A 4DXHA 1MX3A 1GU7A 1J49A 4L9RA 1HDCA 1LBEA 1CYDA 1N2SA 3G49A 4KTVE 1DRWA 5IXSA 2BGKA 3NTRA 2NU9A 1PIWA 2VHYA 3JCZA 2WYWA 4XR9A 3PQEA 1LSJA 4BNXA 2CMDA 4JROA 1KOLA 4CM8A 1HRDA 3PYXA 3ZU5A 5A04A 1H6CA 1R12A 4PLFA 2CSUA 3HJAA 3ZWYA 1I33A 1E3WB 2P5UA 3BTVA 4XGIA 3AOEA 1J4AA 3ZN2A 4IQ0A 2JCVA 2J3JA 1R0KA 2A92A 1Y9EA 2GGSA 2IDZA 3K31A 4QX6A 5DBGA 4CMBA 5CDUA 1HE5A 4HWKA 3GMDA 2CY0A 3QE3A 1F0YA 3W8FA 4C7JA 1UDCA 3JYLA 3S55A 4YYZA 5L4NA 3VTFA 2X0JA 1I30A 2ZB8A 1U1IA 2B5WA 3V5NA 1BXGB 2OP0A 2I9PA 4Z9XA 3RQSA 5KVCA 5K0ZA 1NR1A 3C1AA 3LLSA 3I83A 1J0XO 1DFGA 1HDXA 3PHJA 2DKNA 4B79A 3MOGA 1JAYA 1SZJG 5C37A 1A9ZA 5MDHA 5AOVA 2OBYA 3V1TC 3OETA 4H3VA 1UZLA 3JSAA 4BKRA 3KETA 2GN4A 3H9UA 3UH1A 2BI8A 3I9KA 3ZI0A 1VKNA 5TS3A 1OMOA 4DGSA 3EZLA 5JC1A 1ARZA 2YDXA 1E7RA 2ZTLA 4ILKA 1UJMA 3GG9A 1MA0A 4LCJA 5JNLA 1P74A 3FR8A 3MWEB 3SJUA 2DUWA 4ND5A 3L0DA 4BO8A 3T4XA 1ENOA 1G0NA 3PWZA 5L7WA 2WE7A 4R9SA 3OBBA 3U4HA 1ADFA 1ZW1A 3M6IA 5JE8A 5GZ6A 5CEFA 1B7GO 1LQTA 3ICCA 1PU2A 3HDJA 1HWYA 4J6FA 4WNCA 1RYEA 2PTGA 4NU6A 2YHIA 4M89A 4MVJG 1KIFA 5ER9A 3N74A 1BVRA 1Z7EA 2B35A 3F4BA 3SLGA 1K5HA 1U3VA 2WDZA 4DVJA 3PHLA 4PLPA 3NYWA 4NNJA 3C24A 3PDUA 2EGHA 2VYVA 3RWBA 1C1XB 1VL6A 2YZ7A 4XRGA 3QVXA 4J4HA 1AGNA 2PKQO 4IQ8A 4ZQHA 4D43A 1ZVMA 1LEHA 3GOHA 4WNIA 3WICA 2HK7A 2ZCVA 2Y05A 1PZEA 4BV9A 3AM5A 4DMLA 2JFGA 4CMEC 4J16A 3JTMA 2AG5A 4R5MA 4WLOA 4ZQFA 4BO0A 1H9AA 3LLVA 3OP4A 3U4DA 3O8QB 3Q6IA 4LVUA 3F1LA 4ND1A 1I0ZA 3W4KA 3ZWNA 4M49A 3H3JA 2XXJA 5EMHA 4CM4A 1V9LA 2PKRA 4TRRA 4R68A 2FPIA 4JBGA 5ILGA 3HFSA 1EDOA 3RAJA 3HZZA 4K1LA 5CFZA 3C7CB 2Y0EA 4DTIA 4BO3A 5BT9A 3RC9A 4ALLA 2AEJA 3K2BA 4LSMA 3OH8A 2VRCD 3F5SA 3A1NA 2B4QA 1ZIDA 5BNTA 1QLJA 3E5RA 3VDQA 2NWQA 2YV2A 1X14A 4JLWA 5TF4A 3TOXA 2D59A 5AYVA 3UXYA 1YL7A 2Q46A 3QIVA 1GPDG 3KYDA 1VL0A 3ICPA 2FMUA 4TRJA 5L7TA 1ULSA 4DLAA 1DC3A 3VPGA 4AJHA 4KZPA 3STHA 4ALNA 3CE6A 2DC1A 4NK5A 4MVJP 3H4VA 3QA9A 3WIDA 1DHTA 3D1LA 1E1NA 4JNKA 3TN7A 1BTOA 4DBVO 3RIHA 1VL8A 3KM0A 3W6UA 1OZAA 1IHYA 3E6AA 2NU7A 3JQEA 3WJ7A 9LDTA 3NDIA 4RVFA 4CR7A 5JXWA 3ITKA 5DOVA 4YPOA 1WAMA 3QW2A 3RUIA 1X13A 3RI3A 1FXSA 3ONFA 3VZSA 2DU8A 4YAEA 1NQAO 1Y9AA 1Q7BA 1YE3A 4N5MA 4J1NA 4JIGA 3GEGA 5TX7A 1ENZA 3DR3A 1YWGO 4XZ3A 3DO5A 3HB5X 3GRKA 4R01A 2B0JA 2BFAA 3C7AA 3JYNA 3MJEA 4NDNE 4YAGA 2FSSA 3F46A 4WEOA 3WBFA 2G76A 1CRWG 1KETA 2CFCA 3OM9A 1VSVA 3WQRA 4HV4A 3ZNOA 4HFJA 3KYCA 3O38A 1IZ9A 4WOJA 5DDIP 1LNQA 1YOVA 3Q2IA 2IZZA 3EY4A 2DBRA 4E2WA 1GFSA 3RFXA 1YJ8A 3OFSA 2RAFA 3Q3CA 4ZA2A 5EQDA 4CM7A 2VWPA 4XYMA 2VYNA 1WDLA 2WD7A 4PVCA 5KJCA 4DA9A 4MP8A 4RV9A 4CLRB 1SEPA 2LDXA 2PA3A 3CH6A 3LVFO 3OEWA 4XDYA 3F4LA 5KVQA 3LT4A 3VPSA 1DFHA 2GASA 3C8MA 3PWSA 3ZV4A 1HT0A 1E5QA 5HS6A 3PZRA 3D64A 4MVJD 4Y6PA 3IQDB 2AEMA 4GVXA 2BLLA 4WE3A 3KEQA 1P1KA 3DBLB 4FJ2A 4GGOA 3VC7A 1SOVA 4GGPA 3VH1A 4BNHA 3IL2A 1GD1O 3PEFA 3UUWA 4LGVA 2ZB3A 1I3KA 4XIYA 3BMOB 4EDFA 1P0FA 1EUCA 4W9NC 1R4NA 2X9VA 4Q3DA 2BKAA 1VKOA 1UDAA 4R1TA 5B4UA 2Q3EA 5EJ2A 4PG5A 3SEFA 4HFMA 3AUTA 2X4GA 5GY7A 4E5PA 1T2AA 1ZSNA 3JQ9C 3GZNA 1DOHA 2GPTA 1U8XX 4IDCA 2VUUA 4MP3A 4CLHA 1PX0A 2I65A 5A05A 2ZATA 4IZHA 2Q2WA 1W73A 2NLOA 4Z9FA 1RM5A 2JD0A 1RM0A 2X9GA 4FPXA 1YB4A 5CPFA 1D1TA 4YBZA 4TZTA 2XPCA 2YFQA 1XHLA 4J90A 3ZWAA 5BNFA 4BMVA 3CIFA 1QSGA 3JQAD 3UCFA 4B4VA 3K9QO 3FNFA 1BW9B 3FPLA 4FJ0A 3WGHA 2VTDA 2IXAA 1YDWA 3DZIA 2ZYAA 2DBQA 1EDZA 3RSHA 1NHWA 1K6XA 3L4BA 5I7SA 3COSA 3AU9A 4NQZA 3VDRA 4CMJA 3L77A 1K2WA 3BMNA 2D5AA 2X23A 4R54A 2AQHA 3OSUA 4KUEA 1KY5A 4CMAA 1LLQA 4U0KA 4JJFA 4DPMA 2VNAA 3F1KA 4CQMB 1A9YA 1R6DA 4E12A 5JPIA 5ES3A 1YJQA 2DVMA 2NQTA 4BGIA 2RHCA 4E13A 3ORFA 1LRJA 3CXRA 2O7QA 4MIOA 3UAGA 4D3SA 4FCCA 4CMIB 4AJ2A 4R4JA 3WLEA 1LI4A 2H63A 1ZK3A 2SCUA 3BMCB 2RIRA 3GDFA 5BR7A 4K6FA 4LVCA 1YQGA 3IMFA 3ITDA 1CETA 2D4AA 3H9GA 4FFOA 4LISA 4FD3A 5A1TA 2X5KO 2LDBA 2PV7A 2ZQYA 3QWFA 3E1KA 3TZCA 1Y8RA 4OOEA 4YRDA 4U5QA 5A03A 3AFMA 4NBUA 1E1MA 2C29D 1RYDA 2HUNA 2BMAA 1M67A 3TZKA 4Q3CA 3VH3A 3JQ9A 4KWIA 4FOOA 2O3QA 5DT9A 2XF8A 5CPBA 5HS4A 1YQXA 1KY4A 4XA8A 4BNNA 5JYDA 1ZO8A 2NTVA 1UXIA 2VHZA 3QWBA 5K9ZA 4DLBA 1Z7BA 4BO9A 4TQGA 2UV8A 4WLNA 1Y5RA 4YACA 5ILOA 3WNVA 3JQ7B 4OYRA 4BUCA 3CSDA 3OJFA 4HBGA 1HYGA 4EJ0A 1UAYA 2J6IA 3KRTA 3NEPX 4IJUA 5I9MA 3QV1A 1MLDA 4U0JA 3DQPA 1NWHA 1WZEA 3F9IA 3QWAA 4AJPA 4Q9NA 4AJKA 4E3ZA 3DZKA 1RWBA 5K6AC 4DC0A 2Z5LA 1VM6A 1EEHA 3DAGA 4IGEA 2FOIA 4WECA 4NMHA 2NACA 3TFOA 1PZFA 3KUXA 4TKLA 1JKIA 4J49A 3PK0A 1P45A 1MP0A 1X7GA 4BNJA 1YXMA 3RBXA 4OXNA 5AQ1A 3FRJA 1VJ1A 4RGBA 1PL7A 4GAEA 1YH3A 4A26A 2VT2A 5CHEA 1J6UA 4DREA 4DWVA 3GN2A 1H9BA 2P4HX 2AE2A 3DZJA 1JW9B 5HRUA 1H6AA 1HXHA 1D8AA 4L75A 3WSVA 1SBYA 1GCOA 4A27A 3SBOA 1MUUA 3PXXA 3OJ0A 5EL0A 5KKCA 3HQ4O 1Y81A 4IY1A 3GT0A 3CMCO 3QLJA 4GQAA 2PWZA 4D42A 3V2GA 2FZEA 3HHPA 2JD2A 3GPDG 3Q1LA 4BO5A 2HMUA 4RZIA 4F6LA 5GZ1A 3NV9A 1YGYA 3ANLA 1V3TA 3S2GA 4F46A 3K92A 4AL4A 3UF0A 2HK9A 3C1TA 1PS0A 4BQRA 3BXXA 4R16A 3RC1A 1CQJA 1KEUA 3PQFA 1ISJA 3F47A 3PHHA 4IDFA 4PLCA 3PJEA 1ISIA 1XEAA 4E6PA 3NX4A 3K2EA 5DP1A 1LLUA 1G0OA 4QECA 3JQBA 2HK8A 4R9RA 4LCEA 1EBUA 1BGVA 2B36A 4CR8A 1TLTA 3V1YA 2GUGA 5G0UA 4E5MA 1DO8A 2OZPA 2D1YA 2DFVA 1U5CA 1U7TA 3E9NA 4OXYA 3HN2A 5CP8A 3TL3A 3I1JA 1R37A 3GVPA 2X5JO 2QZZA 3FBGA 3R3JA 2C07A 2GLXA 4L76A 5JDIC 4DQVA 1B8PA 1CDOA 2PH5A 4CLDA 4Y67A 4YT5A 3DMTC 1GV1A 1XELA 3LC1O 4W4TA 3DTTA 5HM8A 1HEUA 2ZQZA 3QVTA 4HXYA 3WFJA 5G4KB 4XD2A 1CQIA 2AMFA 3PFWO 3CINA 3WSWA 3WGOA 2AE1A 1ZK1A 2VWHA 1ENYA 4BNVA 1GADO 5I9NA 3DBRB 5JO0A 3DZGA 4YB8A 1CF2O 2JD1A 3KV3O 3R1IA 3JD0A 1BRMA 2ZKLA 2R6JA 2QHXA 1DAOA 2EF1A 4GX0A 3ZZNA 4BB6A 2Q1TA 1DC4A 4WEQA 4NBTA 1O95A 4S3MA 4KDEA 3TZ6A 4U6QA 1K0UA 1QYDA 2POQX 4XYLA 2E4AA 1WXDA 2B37A 5F21A 1JAXA 2VHWA 1YL6A 4AVYA 2IODA 4CMHA 5TQVA 3RU9A 1LC3A 1E7YA 3DB2A 3GVHA 3K30A 2DUUA 1XQ1A 1ULUA 2DPHA 2O3UA 2RHRA 3U49A 1AHHA 1JWBB 2EJWA 1C14A 3UCXA 1CERA 5KJ6A 2NTNA 2HLPA 2VTEA 3W6ZA 2X8LA 3DWFA 1FJHA 3L07A 2EIHA 3V2HA 4JX8A 2WSBA 4OMUA 1XDWA 1BDBA 3WGTA 3GN1A 4W6ZA 2CZCA 2H1SA 1QP8A 3O9ZA 4MKRA 5L4LA 3B1KA 3GY0A 2GZ1A 4HNGA 5IF3A 2YQ4A 2TMDA 1YRLA 4PCVA 4MO2A 2QQ5A 2H9IA 4I08A 4ZN6A 3G79A 4IDEA 3QVSA 4JGBA 1LTHR 2PK3A 4JXKA 4NFSA 3DAPA 3BHIA 2P4QA 3WBBA 2VQ3A 2AQ8A 1UZNA 2NUAA 3AOEC 3NGXA 3IUPA 1T4DA 1UDBA 3H3FA 3MOIA 4Z0TA 4E21A 4Q3BA 5JW6A 4ALKA 1YVEI 1LSOA 3FN4A 4TSKA 1O89A 4J3FA 4PRLA 4LRSB 2NSDA 1C1XA 1A5ZA 4L73A 4UUPA 4FFNA 2Z95A 2GD1O 2IE0A 4XYBA 2BFPA 3OQBA 2VZ0A 2X6TA 1HSZA 3W8EA 3ZNNA 2BI7A 2NTJA 3P7MA 2FY8A 4YT8A 3JQ8B 3W4IA 3EW7A 4DBZA 2BFMA 1B16A 1N9GB 1PL6A 2O2SA 3EHEA 4N54A 5F1KA 3O8QA 1B15A 4U8GA 5THQA 1DB3A 2IRWA 3ZWWA 1P31A 2C7GA 3I9NA 1ZFNA 1HE4A 2I3GA 2P91A 4GH5A 3UOGA 5BSGA 4EW6A 4XX0A 4BNZA 4J9VA 3OHSX 3ZWVA 3DZHA 4ROSA 1UAGA 1UUFA 2HMTA 3OJLA 1EK6A 2X22A 6LDHA 4J43A 3RUDA 1LX6A 1F06A 2GZ3A 5A9SA 1LLDA 4CV1A 1A72A 2RH4A 3ZWPA 1X1TA 2B4RO 2HRBA 3L6OO 3VVCA 1PS8A 3ONEA 3DBVO 5L4SA 1VLLA 1JQBA 2FZWA 2W2LD 3AM3A 4DIBA 1GTMA 2W2KB 3I5MA 3DMYA 2Y1EA 3PYMA 4YAKA 1F17A 3ZHZA 1GYQA 3GHYA 1EMDA 3H9QA 5G2OA 2VOJA 3DFUA 2BD0A 4IXTA 4RVUA 4IJVA 3RVDA 5EERA 2DFDA 3LDHA 5JO9A 2EERA 3JYQA 3ZWXA 2CF5A 2JJYA 2GNAA 2E48A 1DIAA 4O5OA 4I9HA 3I6IA 3INRA 5G0SA 1HDZA 3D4OA 3F5QA 1SC6A 1Y8QB 1IL0A 2Q4BA 5LDGA 2VHVA 3P2YA 3Q0EA 3EAGA 1T1RA 3WTBA 1SOWA 3RUAA 1PJCA 3P5SA 1S7CA 5EQFA 3MJSA 1LLCA 3QQPA 1ONOA 1BMDA 1DIRA 2GN6A 5FWNA 4E2YA 3JQAB 4GSLA 1X15A 3VTZA 1M6HA 2Z1NA 4XQGA 1TI7A 2E82A 4D3DA 1LDMA 4BKOA 5TT1A 3LT2A 2VOEA 2E37A 4CLRA 4EJ6A 2UDPA 4N5LA 3OA2A 4Z3DA 3UICA 4UEKA 2Y1CA 3QHAA 4M55A 1EQ2A 3JQDA 4AICA 5J23A 1DIBA 3UKOA 2A9FA 4J9UE 1IYZA 2UYYA 4Q3AA 4UUNA 5A9TA 4AJJA 3DXFA 1DDOA 4QT0A 4PLZA 2C2YA 2PGLA 2OP1A 3DBLA 4IJKA 3RJ5A 2B4TO 2CDCA 1KBZA 5JDCA 1S6YA 3UN1A 2DBZA 4YJGB 3FNEA 1EZ4A 4GL4A 2V6FA 4FN4A 4WCFB 1P1HA 3OIGA 1E0DA 3BMOA 1O8CA 1X7HA 1EVYA 1OAAA 1HLPA 3WYBA 5I7EA 3OMLA 2C0CA 1H0KA 4H16A 5KJ1A 3TQHA 3FNGA 3W1VA 1E6WA 3RJ9A 2X0NA 1SNYA 4AJ1A 4PLHA 1B8UA 2OUIA 3S1LA 1YBAA 3GPIA 3R3SA 3OF2A 1HYEA 4BGUA 1QORA 4OHUA 4HX5A 2EV9A 3GF4A 4BGVA 3IAHA 3L4SO 1ZEMA 1ONPA 2C2XA 1ADCA 3K5PA 2TMGA 2EW2A 1LDBA 3KEOA 4CLEA 1JVSA 2BFOA 4E30A 1T2DA 1ZSVA 4CM3A 1BW9A 3JQ6A 3L6DA 1XR3A 2I3AA 1Q1NA 5TRTA 1J5PA 1MXHA 5C7LO 4MKXA 3PHIA 1DBVO 3ZDFA 1EVZA 1LRLA 3PHGA 2X1HA 1BXZA 3I23A 5T6BA 3BTSA 5F3RA 4XYEA 4CPDA 4NJMB 4E33A 2ET6A 3GFBA 4TZKA 1T2EA 1IB6A 2W90A 3OQ1A 4OIMA 2NNLD 2GR9A 2VZ9A 5JFOA 2QYTA 4J2OA 3B1JA 1C0IA 2VCYA 4NFHA 2B5VA 1EUZA 3QVWA 4EEXA 2I99A 3ANMA 4N7RA 1B8VA 2WTBA 1M2WA 2QZ9A 5B4TA 2XOXA 3HG7A 2E6UX 2BF7A 3GGOA 1T24A 4CMCA 2XXBA 4E2ZA 3PJDA 3I9LA 1QG6A 1BVUA 1E7SA 3AJRA 4FSHA 1TEHA 3ON5A 4MOWA 4L4SA 4XDZA 4J7UA 3WYEA 3BMCA 4A03A 5CDSA 2V6BA 4IZIA 4YJDA 2AG8A 1ZSYA 1E7MA 4JBIA 4XEHA 1FDUA 4ID9A 1ZJYA 4QFCA 2YV3A 3GGPA 4FOSA 3WGQA 4ND3A 1PQWA 1PJBA 2I76A 2Q1WA 3RC7A 5TT0A 5A4DA 3VZQA 3A28A 2HJRA 3CPSA 3NTQA 4BNWA 4KQXA 3KVOA 4KMSA 1QV7A 1V35A 2CNBA 3NJ4A 1NBOA 1A4IA 2JHFA 1R66A 5IDYA 4DPLA 1TXGA 2VHXA 1E5LA 3TJRA 3JQ7A 2OO5A 4OAQA 3L4BC 1CIVA 2NU6A 5L95A 2HQ1A 3ZWCA 4YRAA 4Q3NA 3X2EA 3ROQA 2RCYA 3GHHA 1YB5A 3IIEA 1PJTA 2D2IA 1W6UA 2JFFA 3RFVA 5MGBA 1O94A 2J5QA 4I8XA 4ITUA 1DHRA 1BSVA 3FHLA 4YTEA 3HB4X 2OL4A 2ZB4A 3D5QA 3ANNA 4UVDA 1PR3A 5CG2A 5KJFA 1JKJA 1DXYA 1IOLA 4HKTA 1PQUA 1JLLA 1NP3A 5I9LA 1UXGA 2OMEA 5DULA 4ONEA 2AW5A 3CEAA 4CR6A 1LU9A 3TPCA 1ZKMA 3KHUA 1GCUA 3UVEA 2R2GA 2C82A 4TMFA 4YRBA 4AJIA 4FGWA 1YDEA 5B37A 4R51A 2H6EA 3FWZA 4F6CA 5DZSA 1V3VA 1NQTA 1P1IA 3Q11A 3KZVA 1IULA 3RUEA 1U9JA 5IXYA 4OKIA 5DBIA 3KSUA 4RPLA 3AI2A 3K8ZA 3LK7A 1LDNA 4I5FA 3RUHA 4ZQEA 5DCYA 2VUSA 1N7GA 5KJEA 1I8TA 4RL6A 4C7KA 5EN4A 4JP2A 4WK6A 3PJGA 5GMOA 1OI7A 1ISGA 1N5DA 3OIFA 4ZU3A 2QRLA 2BELA 4BNLA 1KC1A 4CM9D 2FSVA 1KEVA 1DFIA 3IKVA 4KTTE 1DEHA 1NM5A 2ZTMA 4QO7A 3ZV5A 3ASVA 3AM4A 4NPCA 3GNSA 1D1SA 2CDBA 3KO8A 4HP8A 1I3NA 4KUGA 1ZXLA 2FR0A 2YY7A 3TOZA 1U4SA 4BNFA 4JJIA 5BSHA 4D0SA 1OFGA 1P1RA 1I36A 1TT5B 4FS3A 3RCBA 4B4UA 4Q3EA 1E7WA 2HSDA 1I5RA 4DL9A 3RROA 2YQ5A 3ZU4A 1PS9A 2DTDA 1QXSA 4YA6A 1IY8A 3CZMA 2PKQP 4GMGA 2F1KA 5LC1A 3NUGA 4OXKA 1B2LA 4U6SA 1NPDA 1NASA 5BQFA 3S8MA 4PG6A 4I1IA 1TT7A 3O03A 4RPJA 3WG9A 1SB9A 3BMQB 2V65A 3RBZA 4ALMA 1GQQA 3BYZA 4IMRA 3H6KA 5FF9A 1C1DA 4CUKA 2PGJA 1G1AA 1VI2A 4GKVA 4YQYA 5EPOA 1GR0A 2CDAA 1E92A 3TL2A 3LQFA 4ZRNA 1T25A 2B69A 3I9JA 2DQ4A 1GUYA 1MG0A 4PLVA 3AU8A 1Q0HA 3DBHB 3RKRA 2PD4A 1DIGA 1ZNQO 3PPIA 5DNAA 3NJ8A 3M2PA 3LF2A 4MINA 2O3TA 3WB9A 4Z0PA 3QSGA 4TRMA 4NFYA 1XGKA 4QO8A 1PL8A 1PEDA 1MGOA 2GN9A 1Y5MA 4OO3A 5IFLA 4RVDA 1HSOA 3F3SA 4XQ9A 3LSYA 1SPXA 1H2BA 3VZRA 4XB2A 2O3SA 3H9EO 4TVOA 5EIOA 1NR7A 4DIOA 2VZ8A 4IJWA 4P38A 4FC7A 4YXFA 3LF1A 1WMBA 1ZZEA 3GMSA 2QRKA 3KYDB 4IDGA 5COQA 3T7EA 4CM5A 1E77A 1KEWA 4OQYA 4MVJH 4W7IA 3C7DB 3D3WB 5B1YA 3U0BA 3AW9A 5CEEA 3HN7A 7MDHA 1Y7TA 4KP7A 1ZK2A 4IIVA 3SVTA 4YR9A 4BV8A 3WGGA 3JQBC 4KWHA 4AJOA 2Q50A 2NVUB 3NTOA 5F5LA 3I9MA 1U28A 4L74A 1H6BA 4MIEA 5TGDA 1I2CA 4PFJA 3WFIA 1M76A 4RO0A 3NAQA 5F1OA 3DC2A 4N5NA 4P4NA 4YDRA
chains in the Genus database with same CATH superfamily
1PJ2A 2BEVA 3TE6A 3MNFA 3V00A 4HWTA 4KI0A 4BUJA 1HL7A 2VUTA 3FFAA 1N1EA 4UDYX 2IUTA 4Q3KA 4RU1A 3WLAA 3SC6A 1EIWA 4FB5A 1THGA 3A2MA 5JFGA 1G5PA 1C30A 1J8VA 5J40A 1R5BA 5CCBA 1HORA 1R4MB 2AT1A 1P77A 5LZ8A 2R87A 1OU4A 1Q0SA 3DEIA 3EBLA 1F14A 3HPQA 5K99A 2EX0A 2OCDA 3GFFA 1LPBB 3EGIA 1SCUB 3GLIA 3IYLW 5FKJA 5F5XA 4O1HA 5EKDA 5K8JB 2CC2A 5C81A 4RE5A 4Z4HA 3MMNA 4DA8A 2EGGA 2KE5A 5A3JA 4G0ZA 2PNJA 4MYDA 3SYNA 3HBMA 4IEIA 4HXEB 1XVUA 3HVUA 3HVIA 4RF2A 1YQEA 2GI4A 2PZBA 5L53A 4DJAA 3IIJA 5CA1A 3WWDA 2Y66A 1NN5A 4DQUA 2VBIA 2DUMA 5ALDA 3T5MA 4ZOLB 5F4ZA 2FW8A 5IDQA 1JV2B 1WWKA 3L8EA 3LHDA 2QYSA 3MAJA 3KG2A 5GM1A 5CDYA 2IPXA 2ZU0C 3SK0A 3OI7A 3GGDA 3ZLVA 4G5HA 2MSNA 3EXIB 1MF7A 1RWOA 4PGAA 3RS4A 1L3CA 3P4XA 4W99A 5ENVA 3MPOA 4WOBA 2P68A 1V7CA 2V6IA 3E9QA 4F12A 5GJBA 4X64B 3QVOA 1AGYA 3GJ7A 2CYCA 4JIMA 4PGFA 3BORA 3O90A 1VJ5A 4UD2A 3I8SA 2BH2A 5KDDA 3MIIA 1DJNA 1G8AA 3ETGA 2XCUA 3F96A 1ZESA 3RU3A 3FWPA 3AHDA 3K7EA 1KFEB 4GZ5A 4JOQA 1E1CB 4DJJA 3ZHUA 5KVAA 5JS1A 3QU7A 4R0MA 1EJ6A 1BIFA 3EVDA 1OKKA 1NYRA 2WWIA 2JLUA 1MVLA 3NHAA 2XGSA 3VZPA 4DMMA 2D8AA 2GBIA 1SVNA 2QAGC 3LHFA 1G6Q1 2OHXA 2C2KA 4L4RA 3CN7A 2JFVA 2OCGA 4BE7B 1TTTA 2VH1A 4LC0A 3AR8A 1D7OA 4KAAA 2NU8B 3D7LA 3RFUA 3TBHA 3S0JA 3HLYA 5DNVA 1NJ1A 3NH9A 3V4SA 4CQLB 2DQZA 4BN0A 4WXHA 4L78A 1LRKA 1RVV1 3ISJA 4OXQA 3VM6A 2FN7A 4M3NA 4RKFA 1YHZA 2N46A 4IFEA 1WB9A 1L9KA 2ANBA 3ZU2A 4UXHA 3SYKA 3BAFA 2OOKA 3K6SA 3ZZ1A 5YASA 4B46A 4OHKA 4HGOA 3KLOA 4LGYA 1Q44A 1NXQA 4LRYA 1XWIA 2HDOA 3IP7A 2XY4A 4IV0A 4DIKA 4NWIA 3ZJTA 2HRZA 4H2DA 3U9TA 1YACA 5BNZA 2PQMA 2BGMA 4O59O 5ICSA 3L0SA 3A4IA 1H4TA 4L4UA 4RDIA 3DOIA 5AVKA 2EFYA 3KE9A 4BZQA 1IM2A 4QNMA 5J1SB 4Q24A 4CF7A 1WXFA 1SCDA 3EZYA 1SBZA 3M6XA 2G17A 1X86B 2I66A 4Q6WA 2OGTA 2R8EA 4YQEA 1JYEA 5D01A 1X19A 4PXYA 4ED9A 1RBZA 1WETA 1JIJA 3ZV6A 2NO0A 5A2QA 4BFTA 5KX5F 4IXDA 4L3WA 4RHFA 4JI0B 4P4SA 1IZ0A 2WABA 4BNTA 1L2TA 2BE9A 4J76A 5I7VA 4B6JA 4RPGA 1KORA 1XX6A 4OL9A 2DERA 2JFZA 3HCPA 1FJXA 3P2MA 2HRDA 1CY6A 1JFRA 3EIOA 3GGSA 1ZA2A 3JWGA 4X6LA 3ZDYB 2V6GA 2XLCA 3HY4A 5HZMA 1Q6ZA 1GOTA 2B7LA 3KJGA 4OV6B 2A5FA 1E58A 4EHBA 3NOQA 1RDFA 1KVTA 4F2DA 3PR2B 3N28A 1D2EA 2B34A 2VDVE 4ZCRA 1ZIOA 5BQXA 5JQGA 3G1WA 4PPFA 4WQMA 3NNDA 4W5QA 3DDSA 5IAKA 4HZUA 1GPJA 4CV3A 5F73A 1PJSA 3HVKA 3DDUA 3M4NA 1EKXA 3IO5A 5JV5A 3PPXA 3ELDA 1MEJA 1FOEB 4FFPA 4EI2A 1ZD3A 1TRKA 3E2PA 1CRLA 3PT5A 1O9BA 5CNJA 3IIKA 2WJIA 4MDYA 1EE9A 3QI2A 1P9WA 2OXRA 4IYJA 1PT8A 5KOIA 2OORA 3RTGA 5L3SB 2VAWA 4D9BA 2SBTA 4JITA 1HE2A 3OEHD 5IC5A 5A3VA 4PLWA 4QZVA 5LJIA 4HWSA 2WNSA 2PJRA 1DSSG 4RHCA 4MGZR 4H35A 1WBJB 4I9GA 3EFOA 3N8IA 4R1LA 5E0KB 5GM2A 5EZQA 4O4LA 4G09A 1Z6ZA 2CV1A 1YNOA 3W5DA 2FWAA 3BTOA 4IICA 3TS1A 1JDBB 2BEWB 2FR8A 3KBOA 3REGA 3OPVA 3T7KA 1N2IA 1ZGAA 4TT8A 3EW9A 1KVRA 1O6ZA 1OWMA 3QLUA 4GQIA 1X0VA 3VR4A 1A5BB 1JR4A 3IX7A 1U0BB 4U2GA 5J9FA 3WNZA 2C4KA 2ZYDA 3KDSE 3AL2A 4DRYA 5IJ0B 1NQXA 2NADA 4B45A 1A5SB 4QYIA 2QXYA 4JI6B 3GRPA 5CNKA 1GUZA 2G0AA 4FOTA 3B5IA 3TIVA 3RU7A 1KK2A 1NHGA 2ZIFA 3I34X 4FNOA 5J2TF 2WIGA 1Q2XA 3D7NA 3N8DA 1SBHA 1MR3F 3MD9A 2GERA 5TQJA 3BHMA 1RPAA 2PIDA 4U9IS 2V0GA 1MIOB 4HMPA 3Q8LA 4PG7A 1VHTA 1U7UA 3PIIA 2YXBA 1WCIB 5CB0A 2X2FA 3ASZA 1KAHA 1F2TB 4WK0B 5HDQA 3VR3D 1S3FA 2SKEA 4HNHA 1R5OA 1ZN7A 3FCYA 1E9RA 2OECA 2P1DA 1U8UA 3BHJA 4G9BA 4Q9IA 2GAOA 2I2FA 2Q0HA 1GGHA 3MQ4A 3LNTA 1CXZA 3VHQA 3ZZ0A 2C1ZA 4D79A 4OK5A 7REQA 1BMFA 2UUPA 4YAFA 2CXQA 4M1TA 1IHUA 5E1BA 121PA 1FBNA 2WE8A 2IYSA 2X42A 3G5AA 2QUBA 1JIQA 2HJSA 3H9BA 2J08A 4GKBA 1C3OA 2TMYA 4NV0A 5K3DA 2NU9B 4ZOQI 4DB2A 2OCKA 1RAIA 1Z83A 4CCAA 2KBEA 3FFWA 4FFWA 3IJ5A 5AKKA 3I2JA 3ZNPA 3FYCA 4RD2A 2C4MA 2OPBA 4IS2A 1O5TA 4CTKA 4HX9A 2CLEB 3UO8B 4MUMA 4ARZA 1LWOA 1DXOA 2QR5A 2LIVA 4FLMA 2JAPA 4QC2A 4B3MB 1VJ0A 3DMGA 2OE2A 3CBGA 4C2TA 4YRCA 5CA0A 3T41A 1Y6FA 2QLFA 4RW0A 3FNHA 1RKXA 4IIGA 4AY2A 2AWNA 2QEQA 2VYND 4IIJF 4KXUA 4TLMB 4V0RA 3F90A 1B43A 2Z9CA 3WQSB 4JA0A 3OZFA 2NV6A 3P9XA 5EXDA 1HDGO 4LHXA 4E31A 3TECE 1DBSA 5E38A 2Z9DA 3LI2A 3CURA 3D59A 3MC1A 4X1YA 2HA0A 4AJNA 4DADA 4CKBA 4D57A 4IV8A 3ESYA 2BRUA 4HAIA 2GJKA 2ZVPX 5FD8A 3OOSA 4DOMA 2IXBA 3A31A 4KFRA 1WSDA 3AF2A 3SXUA 1DUVG 3LT0A 2OV8A 3DFZA 1T3HA 1D09A 1UBUS 1Z5NA 3C45A 2ZRGA 3EARA 6REQB 4D46A 3KQKA 2ZJ3A 1R15A 4I5EA 1K68A 2ZUBA 2IPLA 5H81A 4ECEA 5IAAA 1Z2PX 1K8QA 1XU9A 4W8GA 1NBMD 2X2EA 1KR5A 1E32A 2NXEA 3SF0A 1JHXA 2CLSA 1XAJA 3PXUA 1X92A 2R79A 4LHEA 3DKVA 3BB4A 5J4LA 1CQIB 2H7CA 4A2QA 5B55A 3PPVA 3VO9A 1U7ZA 1DBWA 4DSUA 1O54A 3KTAB 5K45A 2NQ8A 2OHGA 3GEMA 1NVTA 1JRLA 4J0CA 1YZLA 1FK8A 1V3UA 2QSJA 3O94A 1G8MA 4IILA 1YDFA 1BEEA 1Y6RA 2ZR7A 5E4JA 5H4HA 4K05A 4KFCA 4UBOA 3LOQA 2FZGA 1B0AA 3KU4A 3G8CA 3UT6A 3VH4A 2A1IA 5EJAA 2FR1A 2BCGY 3IPRA 4CV2A 5HQJA 4HN2A 4F5ZA 1IHOA 1Z2EA 2OQ2A 4JYMA 4MJ3A 1LVHA 4QGHA 4YVFA 2QX4A 3OESA 3R0IA 3TTTA 3KYJB 5AM4A 4MVYA 1KZ6A 1LS6A 1NGSA 1T5HX 1TK9A 1YS1X 2UZ1A 3O75A 1KE2A 1VYHA 5LBUA 2G9VA 3X43A 3JARB 3L6EA 4AWXA 3GUYA 1DZ3A 2B9VA 3L05A 2FI1A 4HWGA 5DHPA 4KDCA 4DLNA 2XYRA 4FZJA 5AP9A 1JU9A 2RB4A 3DPSA 4JFRA 2H1FA 5U1PA 4YMHA 5JNVA 2CJWA 1ZJWA 1X7ZA 5H02A 3HJTA 5EP1A 3S6JA 1NLYA 3A6EA 2IYZA 4KB5A 1FDRA 4EELA 4KR7A 2IU6A 2QUIA 3TNJA 1IN8A 1XC7A 2Y68A 1EXDA 1QZUA 3A04A 3G5LA 3UPTA 2IS1A 3SOZA 2A5JA 4PICA 3VKGA 1H8ED 1YZQA 2ATCA 4HQOA 5IAGA 1U2GA 2WU3A 3JQCA 1IY9A 1ZK4A 2A0YA 2LBPA 4NC9A 1NNI1 5BN1A 1X1EA 4LOKA 5B7PA 4II3A 4RVHA 4II2A 5DCWA 1T3ZA 2FVYA 1RJFA 1RM4A 2HFKA 2WM3A 2ZB7A 1DL5A 3B1FA 3BUSA 3KTDA 3KUKA 4X91A 2C77A 1PT5A 2CDNA 1NVWQ 4FBMA 4UHEA 3HYNA 1TZMA 2P8JA 3MWYW 4X45A 4DIUA 4YJFB 1VMIA 1EFDN 3MSXA 4PZLA 3AZQA 3KZOA 3SZ3A 2YZ2A 3K73O 4EVQA 4PNEA 4OP3A 4MQLA 2VT3A 1AKTA 4N4AA 4P84A 1JN0A 3BFJA 4DSAA 1AO0A 3TG8A 3CCBA 4ZJZA 5AVXA 1P4RA 3MT7A 4CUJA 5L7YA 4MS4A 4WIAA 4AP6A 4N03A 2V7XA 2BR4A 2OD9A 1A76A 2Z2YA 4XUGB 4BU0A 1RVDA 1KERA 2H4WA 2QM3A 3FJ1A 4D7AA 1GQYA 3Q2OA 2XZDA 1QVAA 3LL4A 1VHJA 4JP3A 1KRHA 3WDSA 3OEEA 1YU9A 2JH9A 1YS6A 3GJTA 2WLTA 4ER6A 2CD9A 3LC7O 3MWDB 5ENDA 3SY8A 5BPFA 2X6RA 2GF2A 1XQ6A 5GADl 3L7NA 3KQTA 5F3WB 1SCIA 1MOPA 1VA5A 3RTBA 2ICAA 3A3NA 1L5LA 3B5JA 4MRAA 5KYTA 4ZFNA 1EWYA 3EGEA 2J7PD 2JCXA 2VN8A 3CY6A 2ZUWA 3H7AA 4WNAB 1PW7A 3ZJYA 2GJ8A 2EGUA 4G0OA 4O2BA 3DZFA 1GZ6A 1LSSA 4WFKA 3GI1A 2O8BA 4BP9A 3GRYA 5F78A 1EGHA 1H0SA 1F4LA 1W5SA 1GGFA 1PJ4A 2B1QA 2H8GA 4ZTZB 3DBHA 3KHTA 1DG1G 1NBHA 1H65A 3AL3A 4WKNA 2O50A 3RSSA 2JAWA 1QP4A 1VOTA 3EWIA 1JDUA 2XSZD 1YS9A 4FQ5A 4HB4A 5LZ5A 3VMFA 5FUVA 2G82A 4IM7A 3QTBA 1FIUA 4NH4A 5BRNA 3D8NA 3ZYCA 4YO8A 4MA0A 3SQNA 3BPSA 3R6LA 4TUYA 3K1TA 2DB3A 5EAIA 1QHFA 3CO5A 3HNPA 3QWIA 5EMKA 2Z09A 1PUXA 2VWGA 5L45A 1XG5A 5BYAA 2VLBA 1KH1A 1NVMB 5H4GA 3E9DA 2G0TA 4CL3A 3C3KA 3RLFA 4ZQBA 4EMSA 1N2BA 2B3TA 3FOEC 2VPIA 4IMPA 4Q1AA 4Q9DA 1P72A 2GM9A 2PTHA 3ANXA 1TF2A 4XR4A 5JR3A 4A8JB 1E8NA 3ZPXA 1NIJA 1EBFA 3ETCA 3EEQA 1SC3A 4DFDA 1E9VA 1U8FO 3P27A 1HC7A 4TSFA 1L7EA 3T5DA 5CFNA 4MWEA 2E85A 1USGA 2RGAA 3GLQA 1JHOA 1PFYA 4M98A 1OBVA 1BWSA 1CB0A 4IZ6A 3SSOA 1KMCA 2AN5A 2QLNA 3JZMA 5A7GA 2IV7A 4O02B 8GPBA 2D0OB 3HSKA 4HAWA 1IEQA 1ZN2A 2D3TA 2V5AA 2R6GA 3TW8A 4WK2B 4S0XA 4UQOA 4F06A 1NRJB 4IIHA 5BRAA 1CQPA 2D4HA 2F9FA 2Q3MA 1JDZA 4BO2A 2FP4A 3PENA 3MJFA 2ZULA 4DXAA 3F4BA 2YIJA 5AVOA 2ZCUA 1L7AA 4TLAA 1Z75A 1E1LA 2QBYA 1W88B 2PAFA 1EVEA 1FUYB 3O4HA 5I47A 1SO8A 1Q92A 5U4XA 3EA4A 3OJCA 1QS0B 3G2NA 5J59A 3K0FB 1G42A 4RF5A 1Y6JA 2Q6TA 5CFLA 1ORTA 1ZWKA 1RCFA 1SAYA 1R0SA 2AN3A 2I6GA 5CT6A 2A4KA 4JLPA 3ROGA 4HDMB 2FEPA 3V1NA 1VMKA 3WZ2A 4EJSC 1PQPA 1N36B 3BWMA 3KLPX 1VPLA 2J0UB 4NJOA 4D0GA 5LN1A 3HCFA 5AW9A 1YULA 5K0EA 3AFIA 2J5BA 4CLOA 2AEFA 2W71A 2XQVA 3OZGA 1IQRA 4E7PA 3U5TA 1T8YA 3U7JA 2A84A 2AJTA 4E5SA 2VDMB 1E9DA 4TTVA 4XKJA 2HEGA 4QDUA 1KHHA 1YHNA 4IRUB 3PNPA 5ALRA 5K3EA 4O3MA 2ZJYA 1RLMA 5ESRA 3TZHA 4DNPA 3P4YA 1QANA 3DEYX 1ZMTA 3UBTA 1ZIXA 3AV3A 5DISB 2PG3A 4CI9A 3T9FA 4CEIA 2PZKA 2JAOA 2CXTA 3VGJA 5CT9A 4GECA 2P62A 2JLSA 3DOJA 4XDHA 2COUA 5BV1A 2V1UA 3QJYA 2PMKA 3AOGA 3VU1A 2MSCB 2QE7A 5G1OA 4MSUA 5AVTA 3FSRA 1XUOA 5J43A 1VPVA 3ENNA 3BULA 3UKDA 2Z5VA 4WBXC 3OP1A 3PNQA 3K2QA 1BMQA 1VRWA 2X7JA 2QKYA 2BWJA 2HRCA 2W2MA 2ZR9A 3C3WA 1PYGA 3NKFA 1JLSA 1WPQA 4HAUA 4EJFA 1XKQA 3QSYA 3BIFA 4QGGA 1STOA 2H4XA 1RWNA 4I14A 4RJJA 3TRJA 4NCAA 2P2LA 1N0HA 4R1QA 3JASA 4EENA 2QOEA 3G68A 4ZVVA 3FSEA 3WNBA 3OQHA 4NBVA 2QLMA 2YHIB 2YHUA 3INNA 4OXIA 3IEKA 1E59A 2FPOA 4C30A 3RNOA 2X13A 3RAEC 2FPMA 4HWPA 3TSAA 4GX2A 3HDVA 2RAPA 2ZI3A 1V8DA 3MLBA 2C2GA 4HHEA 4MB0A 5KCMA 5TXGA 1Y5IA 3N8HA 5BR4A 1LX7A 1ZD8A 3M34A 2XR1A 2Z2IA 3JXEA 3CR8A 4MZXA 3RHSA 3CBQA 1Z6QA 4NZZA 4OYLA 4PINA 1LH0A 1XOIA 3LTEA 1I32A 5E6RB 1L1FA 3IVGA 3EGCA 5ESWA 5CITA 9LDBA 3N0TA 4MW1A 5THKA 1RJWA 2OAQ1 3B9RA 1JI3A 4I9UA 5IS2A 3NR2A 4N0EA 1Z4JA 3WL3A 2BHSA 4LG1A 2FQ1A 4KR9A 5G4KA 1MV8A 4C22A 1QUEA 1SKBA 1YC5A 2CXRA 3K5IA 4FGUA 4OQZA 4WZ6A 4HNVA 2OHJA 4UE2A 1JDTA 1KEKA 4LZPA 3P9YA 3WIBA 4CIVA 3OWXA 1ULZA 4XGKA 2HA6A 1XXHA 3DBRA 2DPGA 2AR9A 3D3EA 4TYNA 1YKGA 2GZ2A 1SELA 1O97C 1YZNA 2Y8EA 3JYOA 4G5QA 4H7JA 1LK7A 4IKPA 1MFZA 4KN9S 5CTAA 5ALXA 4NHEA 5HJ7A 1C3EA 4ZAGA 3Q1KA 2HAEA 1U31A 4INJA 5KU7A 1KQGA 3KSAC 4EJMA 3OICA 2G77B 2JHCA 2QL7A 3TFWA 3GWZA 2CEAA 1FUUA 3FNRA 3MOSA 3WYCA 3CKYA 5LP1A 5JS6A 1N7HA 4KITB 1BGWA 2O1EA 5LQNA 4M9UA 2QZPA 1GUFA 2ZJ1A 2HWXA 1U99A 4PAGA 3LYLA 4RFVA 1UZMA 5FLKA 1VE5A 1DT3A 4BGEA 4YRPA 2QW8A 4E3WA 1QMGA 1V96A 2RGNC 3SEQA 1SRQA 3JVIA 1UMCA 5ALWA 2RJOA 1AF7A 5BSWA 1HMYA 3T9BA 2JB9A 5AKJA 1E18A 4QEZA 5KDLA 3VPHA 3WBKA 4EPRA 1XTSA 2QENA 4W9NA 3RS5A 3Q9NA 4ZHQF 1E4OA 2IOFK 5LB2A 2O8CA 1E9EA 4TS3A 1EFPA 4RTMA 1PR9A 2MT9A 3A06A 4TMZA 5TF0A 2QLLA 4D81A 1LQUA 3WJAA 1ZAKA 1K27A 3LFUA 1CUBA 4I0WB 2QTCA 1Z39A 2Q99A 4RTRA 5F2NA 1XLTC 2ZJ0A 4NCXA 2YMMA 3FLEA 3VKVA 3IUYA 4OHCA 3WJ1A 4DA4A 1JJAA 1CTQA 2GDJA 3KZXA 5C51B 2PLAA 5BVHA 1FFXA 2JBAA 1AU9A 3E7FA 4E11A 2FG7C 4LYEA 2CN1A 4F9TA 1WXQA 1EFKA 1N0IA 2WF7A 4B40A 3TRFA 4CIWA 2TSYB 1H93A 4TTIA 3RUCA 3ORHA 4CN9A 1EG2A 2ODBA 3M33A 3Q7PA 4RXUA 1N7JA 1EA7A 2DHDA 3E03A 1Y3FE 3KPJA 3H4MA 4H1TA 3L01A 4IINA 2HQRA 4QAJA 5G0WA 4CF6A 2BMJA 2WTUA 1SK8A 2IP4A 3FDFA 4AYTA 2HDWA 3FPKA 4MP6A 4NENA 1P44A 1POWA 3F5FA 2PCJA 2QIOA 4EATA 2OA0A 1Z0AA 2B99A 4LK3A 5H3CA 3FUUA 1SWVA 3GVCA 4F4IA 3O73A 4PS1A 4NQRA 4MGYR 2BMVA 4RVNA 2C5EA 5T8KC 2TMKA 2D0IA 1Z5VA 3HKCB 4MARA 3E27A 1V6AA 1IJFA 2ZXFA 2EKDA 4ZO8A 2VP3A 1Y48E 4DSNA 5CDTA 3K96A 4PN3A 4MAAA 5CAEA 5FWYA 2DXIA 2CSXA 4M1MA 3RJZA 5EJEA 1DAEA 4YJHA 1T4MA 5IK2A 3CNOA 3UANA 3JD4A 1UF9A 1O03A 3IOMA 5J63A 2OWDA 2KHZA 3BXHA 3H1AA 3JD2A 5ALVA 2R9VA 4J0HA 5K05A 1OOEA 5DTQA 3RRZA 6ABPA 3FCUB 5JRDS 4PZCA 5K0JA 2D2XA 4RANA 1E6UA 1J2TA 4N6NA 2J3IA 2FRVA 3KSZO 2UVDA 2W8BA 3BJIC 5LXTF 3F9RA 5LUBA 5C32A 3INTA 3V7UA 2QX6A 4IHQA 4FFMA 4G0PA 1XRQA 4V0MA 2NUPB 2IZ5A 2PRYA 4R69A 3FMGA 1Q3KA 4Y2VA 3D4NA 1FUEA 4O4IB 2OZLB 2XYGA 2WKPA 3WK4A 4AP5A 4TV8A 4RIEA 5ITZB 5B7NA 4RH1A 4BE4A 2XZLA 1G3QA 3KWJA 3GZNB 4QUIA 3HTXA 4H3SA 2BTOA 4IIXA 3KXKA 4MVJA 2AUNA 5HFJA 3T1VA 4EY3A 5MGNA 1K88A 5LLDA 2IIVA 2H85A 3K1ZA 1MT3A 3PA8A 3FTPA 4RA9A 5JZOA 1GNSA 5COAA 3ICEA 1AQJA 1NU8A 5DTRA 1UPAA 5A1JA 8AT1A 2ZB2A 5C5IA 1KQOA 1GLGA 2F62A 2GAIA 4HYQA 2PQ0A 1QYWA 3RVMA 1FFGA 5KYVA 4GC5A 4C4YA 2NYRA 4Y6SA 1MU0A 2ZRCA 5E7MA 4EQ6A 4RPKA 3AMVA 1SXHA 4WMLA 3L79A 1PN3A 3X1KA 1YONA 4WVLA 1QAQA 1E62A 1H22A 1KY2A 4A2WA 1UBMS 4RKWA 2BSAA 1Z28A 4F7WA 4RDHA 3BMNB 3QOWA 2MIIA 4AZ3B 4BO7A 2YJ5A 3H0KA 3WQHA 4ZO4A 2H2IA 2WV7A 3LAWA 3WHLA 3X2SA 3SC2A 5EP4A 3GQBB 4UPDA 1NC1A 1T0UA 3T0GA 4EZEA 4XVCA 4B2YA 3MIZA 5DBFA 4X97A 2XUGA 3VSEA 3AP1A 3GA0A 5ERGB 4XWYA 3OD1A 1FFYA 1YBVA 1EJ2A 2YXEA 4GG1A 4Y7CA 3T4PA 1W48A 3AG5A 4RFLA 2JNWA 1O6FA 1PGPA 1VCIA 1VE7A 2WF6A 3AKCA 5FYDA 3WYFA 4UHHA 3ABIA 3M4YA 4Y2YA 1DX6A 2HU8A 3T3DA 4YLYA 3OMXA 1X94A 3S29A 1BKYA 2AZXA 2ERYA 4E1BA 5BSVA 2IEDA 1M5RA 4QOJA 4A0FA 1TVKA 1EVJA 2GKOA 1Q12A 2B8JA 1AN0A 4IH9A 5H16A 4F3TA 1NMZA 1RWMA 4HAVA 4XM1A 2CLIB 1UQRA 4LRXA 3WXBA 1C8BA 5KVVA 1Z2CA 4DR2B 1WUYA 2GPWA 1JILA 4B7XA 4D98A 5D6NA 1ZDMA 2CK3A 2E49A 1GXSB 3C3JA 3NT4A 5J2UB 1F9EA 1Z0UA 3D9QX 3H5IA 3ORRA 5CDGA 5IVKA 4HEA6 1TL7C 1H1LA 1QC5B 4WZAA 1Y8RB 1UC5B 3DEFA 2ZTVA 2I2DA 4UCFA 1B26A 3WP1B 5IDXA 3SXPA 5BWMA 4J03A 1PGOA 2KBFA 5BWNA 5A02A 1T9BA 3RJ5A 1C7QA 1ODTC 4L5IA 1EVQA 1YB6A 2GN1A 3WKDA 2O2ZA 3UHAA 1QBGA 1N3IA 1G5QA 1UH5A 2HN9A 4C87A 1JT9A 2AHRA 4A1FA 3ROXA 3BFVA 5KQLA 5AK4A 3DMNA 4L5BA 3Q10A 3CJRA 5JAZA 2CLMB 1OLUB 2GPAA 1SUSA 3OECA 1X1CA 2IS2A 3MJ4A 4PG4A 5CJPA 1IBCA 2FV8A 8MHTA 1F20A 4B82A 2ZJ5A 5EWLA 3TH5A 5C8YA 1TZBA 2XB8A 5CLJA 3FI9A 1MOSA 1ECGA 2Q3CA 5IF9A 2Q3DA 1L4LA 4I1PA 5T41A 4IVQA 5EIHA 3K1AB 1KY3A 1KQPA 3AGQA 4QYTA 1KK1A 1TB4A 1V5GA 3KLBA 1GQFA 4MWDA 1JHQA 3ENVA 3GG2A 3LC0A 1QFZA 4RSRA 4GOOD 5C8VA 2JIZA 2C5SA 1OTXA 2JLVA 3SHQA 4QFDA 2IWRA 4R8KA 1RJ9B 3N8KA 2J87A 1FUKA 5IANA 1RZRA 2VJKA 4B84A 1CY0A 1LGYA 5IMBA 3DE3X 3C7KA 1Q20A 4ZGWA 2C3PA 3WSTA 1G21B 2ONJA 1SKYB 2H4ZA 1IH8A 3UMVA 4FQ8A 1BEZA 3AR3A 3SNKA 3WOHA 1MAUA 4XWGA 2G9RA 1WMFA 4DCJA 2OWEA 1MBZA 2Y4OA 5JSHA 3OZVA 4RK1A 3VXKA 3K9GA 4WJZA 2WF9A 3ACDA 3TE7A 1JTFA 3VH2A 4CWAA 1UBKS 3CC8A 2C31A 3O4RA 1PFGA 1O58A 2C3YA 2AG6A 3ENKA 4LYGA 1C9EA 3F7OA 4ZGBA 3NW9A 2G9QA 5JBQA 2ZE6A 2O0KA 2CUKA 2HHLA 2R00A 2V54A 3AO0B 4TN1A 4KIUA 4YGYA 2C9YA 1ID1A 1E5TA 1Z6GA 4FE3A 3PQCA 1ZS9A 5WRFA 3MUNA 2GEVA 3JD3A 3PXAA 2F7SA 2XTAA 4R71A 1NL3A 5HF9A 5BSFA 5B1HA 3EC7A 3T0IA 4WTOA 1QQ6A 4NJEA 4UUOA 3V4LA 4D8TA 1O0SA 4G0WA 3H2KA 2PR2A 3E3LA 1P8AA 3C6ZA 4LC9A 5I7UA 1F60A 3OIVA 4PXSA 3VPFA 3FG9A 5IM5A 1MH9A 4HEA1 3RSLA 4YLEA 3I5XA 2IHNA 4BWFB 5HKLA 3DHYA 3KKEA 3DTVD 3WHPA 2X5OA 2CV2A 2BONA 3FCSB 3DF7A 2J8ZA 4TKUB 5IVPA 4EGSA 1DAHA 5SZKB 4W82A 5C7OO 5KKAA 2QRZA 4NYIR 5EVJA 1UL1X 3DONA 3O9MA 5KQRA 2BIFA 4J07A 3EOBI 1O94D 5AVYA 2G67A 3TLXA 1I6MA 3BQNB 4XM2A 2HPVA 4WGGA 3LQRA 2YW9A 1Z82A 2ISQA 1G8FA 2M32A 4MJLA 3U3KA 5I8WA 4UU8A 3VYWA 4MLCA 4XIJA 2HZ7A 2PX3A 2AYXA 4QNRA 4R6XA 1U3TA 1UBCA 4EY7A 1CS4C 3W9SA 1K7SN 3ADPA 3EEIA 2LCQA 3HWX1 1ORWA 4MR8B 1XLVA 2VF8A 2YIDA 3M1LA 4IMIB 3R3ZA 3BEDA 3RTCA 5C34B 8ATCA 5TC4A 3OX4A 4DCUA 4LF4B 4PN7A 1JQLB 3DV9A 2NSJA 4L9RA 4RZQA 1H2WA 1P7ZA 1N2SA 3QNUA 4AF8A 5JH7B 2BGKA 1PIWA 3WLHA 2VHYA 2R3SA 3TM4A 3VNUA 1CRPA 5BP7A 5CDHA 3OHPA 4HLDA 2GD0A 4OCZA 3SM9A 3ZKAA 1QGYA 4JROA 4A1OA 1E9AA 1KOLA 1U0RA 2AMVA 5ADUS 1VA4A 1CC1S 1RRGA 5KOJB 3FUXA 3AUJB 1ECBA 1Z4QA 2EP8A 3FNBA 2HREA 4C0WA 1WG8A 4L0DA 1Q21A 4OLHA 3TAUA 2R4TA 3VHXA 1NW8A 4C7OA 1HPLA 2VJCA 3AOEA 3N2GB 4OQMA 5AHOA 2DEUA 2QP9X 4LNUB 3U7RA 4UXIA 3KQVA 4HB0A 3QBTA 3L7BA 1NNLA 2WAXA 3CLRC 1UIRA 1R0KA 4YRQA 4IV5A 2GGSA 4U02A 1K7YA 5DBGA 2Q6VA 421PA 3KSMA 3ZLUA 4F7DA 4HWKA 2YWFA 3AVUA 4RZ3A 2CY0A 3ZCVA 2EWWA 5HRAA 3MD0A 2CNNA 1UDCA 3P96A 3PX7A 1PYDA 4FYVA 2P9JA 2GPJA 2IVFA 3NBYC 3QFFA 4KO3S 4LUCA 3BJRA 4MQFA 4WKOA 4AKIA 5HR5A 1EVKA 2I9PA 3RQSA 4OFZA 5K0ZA 2C61A 3IAAA 1NR1A 4GICA 3C1AA 3TD6A 1WEKA 1ZN8A 2V3WA 2ABWA 1LB1B 2YWGA 3ETLA 1Y80A 1JVNA 2VHQA 1TM1E 2IXFA 3R40A 2QAJA 4DR3B 1LQ2A 1ZUIA 4W1SA 2HMAA 4PHTA 5MDHA 1AX9A 2WIKA 2NYUA 1S2NA 3OETA 1SURA 3ZCUA 4BKRA 1E6CA 2GN4A 3H9UA 2OK7A 3ZI0A 3IAS6 3WO1A 4YRMA 1J99A 3FE2A 1VKNA 1J2EA 2OBXA 1OMOA 1Y1QA 3EZLA 3JVVA 5E2AA 2ID7A 1JNYA 2V7TA 4DEYA 9GPBA 4K7JA 4NBSA 4YJ2B 3LUKA 4DVGA 4IVPA 4N3CA 3KLNA 3OLZA 4MV1A 1PFVA 4JUAA 4BRZA 4U3JB 1SZCA 2A5YB 1TADA 3ELBA 3SJUA 4PM4A 3SHWA 3T4XA 4JUFA 1JZQA 1XDDA 1ENOA 4DCMA 4HZIA 1G0NA 2EBUA 2PSHA 3PWZA 3WV5A 4KXXA 3OBBA 1AKUA 3R41A 4PPGA 3TTUA 1ILEA 4MV9A 4S1OA 1LQTA 1ZRHA 3FB4A 1G4HA 5B1DA 1HWYA 2HPZA 1PSWA 1P2TA 1YQTA 2UYQA 4ZV9A 4DLXA 2JVKA 4LFBB 1KIFA 1YRWA 2ZBDA 2B35A 3F3KA 2WDZA 1HH4A 1V8ZA 1Z33A 2HFJA 4PIMA 4RABA 3NYWA 1AQUA 2OFFA 4DM7A 2O2GA 3U44B 3WB0A 3VPAA 1A0OA 4D9NA 4Q1DA 1GFZA 4NDZA 2YZ7A 4XRGA 1HFJA 3ED1A 4D43A 3CVJA 4ZQHA 4ZYXA 2AFIE 5AVSA 2G5PA 2R66A 3P9RA 1WXXA 2P8SA 2RSLA 1L8LA 1U0FA 4UOZA 2G5TA 1NP7A 3OZWA 4R5MA 1NMQA 3ANTA 3JTMA 4BO0A 3H2IA 4W8HA 2VDJA 2RHDA 2AI1A 2ZVJA 3ASYA 3VAYA 3OP4A 1Z17A 3O8QB 5T4HA 1GGEA 4PY2A 2DOKA 3F1LA 2JDID 2WLSA 4LX8A 4ND1A 4Z3OA 2VKTA 3C6BA 4M49A 3ZIAA 5JUWA 1U2PA 4WN9B 2JCBA 4FHFA 2FPIA 2FU5C 4NBKA 3BHNA 1EDOA 2SHKA 4LXXA 5J5VA 1EJ0A 2VVTA 3P2KA 4XX0B 3C7CB 1OV4A 5ENZA 4ARIA 1QONA 2IYAA 3W8RA 4L95C 2AEJA 1E1RD 1QIEA 2G1JA 1TGVA 1FNSA 2XW6A 3F5SA 2P41A 1ZIDA 1RC8A 1QLJA 3M6LA 2NWQA 3TOXA 5TF4A 3LPLA 3BM5A 4CTOA 4UHKA 4XEUA 3T15A 3KYDA 4HJRA 4UEQA 3ICPA 1IOZA 1H4SA 3Q8XB 2ZI7A 1E4EA 4RKQA 2IKSA 3P9ZA 4AJHA 1W93A 3IP8A 1M5TA 4GW3A 3UWSA 2QVGA 3CE6A 1G2IA 4MVJP 4BYMA 4F6RB 2XGGA 3VR3A 3PEEA 5BNWA 3GLHA 5HDBB 1VTKA 3UYKA 7MHTA 3E23A 1QNLA 3ZLTA 1TA9A 1BTOA 3RGGA 3TN7A 4YS6A 2I8LA 1OHHD 3I04M 3KM0A 4M7PA 1OZAA 4TS9A 3IKJA 2GFQA 3E6AA 4J0KA 4MNTA 5GAJA 3SZGA 4DCTA 3LCUA 3TB6A 1Q19A 3THYA 2JJ1D 3MCTA 4IH1A 4CR7A 1X74A 5KX5B 1UBOS 4L8GA 3RUIA 3HJGA 3RI3A 2VIIA 5GONB 1FXSA 2VJQA 3ONFA 4N5DA 2Q7OE 1P19A 3VZSA 1Q7BA 1AUQA 2JGEA 3GEGA 4HAZA 4G63A 2PMDA 1ENZA 4X7PA 1V4VA 3DR3A 5AESA 1G2QA 1RXEA 1M2HA 3GRKA 5J47A 3OQIB 3C7AA 3DVAA 2PGXA 2FSSA 1F2UB 3C8UA 1CRWG 3GLUA 1KETA 5IASA 5D8DA 3LD9A 1VSVA 3KCNA 1DUIA 2R6ZA 4GI7A 3CHYA 3ZNOA 4F3RA 3O38A 4F8YA 2C03A 2COEA 1YOVA 1M7HA 3E3MA 3Q2IA 4K9QA 4BC1A 1NLUA 4G0VA 4RV5A 2DBRA 5DYWA 2WG0A 1IEXA 1CVRA 1LW7A 1DVRA 2DE0X 1ZXXA 2RAFA 3E22B 1N2CA 1V9CA 1DKNA 3N2IA 3MUOA 5M3BA 1VG8A 1M83A 2VYNA 3FRHA 1G8JA 2QTMA 2ZE5A 2II6A 1P9OA 1ZCZA 5KWIA 3LUDA 1NYQA 4B2LA 4JEIA 4DUYB 1QCYA 1UBLS 2GEJA 4ZAVA 3GLGB 1MZPA 1NT4A 1RP7A 1HOXA 4XDYA 3NNNA 4PCUA 4WCVA 2WJZB 3GT3A 1HT0A 1E5QA 2OD7A 3KB2A 3IURA 1QRTA 3Q6MA 3R9WA 3R5KA 1JG7A 3IQDB 2PS0A 2ORWA 4RMJA 1DG3A 3COVA 1PNVA 3SYLA 4WFIA 1L8AA 1COWA 2HA7A 4IHAA 4KLRA 3EQ6A 4AJ1A 3KEQA 2IHJA 2PSDA 1ELOA 2V9CA 3IPYA 4FJ2A 1FXWA 4ARUA 4GEKA 4DNOA 3BDVA 4HVCA 3VC7A 4NZPA 3LDGA 2BSXA 1UDRA 2IZOA 2B6HA 3HSYA 4EHNA 4QDTA 4OF4A 4OI0A 4ASUD 4LGVA 3BCUA 5BSTA 3T52A 3KVNA 5FA5A 1N2JA 2ADFA 2AN1A 3H84A 1I3KA 5IH3A 1ST2A 3RV4A 5GVRA 3S5UA 3SBDA 4EDFA 1P0FA 2DYKA 4LOLA 1NKSA 5I9TA 4QYSA 2E7ZA 3WWPA 1S2IA 5IUKC 1UDAA 2BV3A 1D03A 3HEMA 4FX2A 4V0QA 1O6GA 5EJ2A 3SEFA 2BFWA 4US0R 3R7SA 3WMGA 4HFMA 1M2JA 1CZRA 3EIEA 4QU0A 1RHUA 4JR0A 5FBQB 3W6NA 2X4GA 4UNIA 4E5PA 4UPEA 1ZSNA 4GKKB 2RD2A 1DOHA 1T9CA 2W83A 4IDCA 3UOWA 3JRWA 1D2AA 3V32A 3RRXA 2K5UA 2ZATA 2OC9A 3EX7C 4X7MA 1L7OA 3LPDA 1XFDA 4M2LA 2PMEA 4KO1S 1JFSA 2NIPA 4TL7A 4F86A 2J9YB 1D1TA 2GLTA 1ZM7A 3UK0A 3BBPA 4OJMX 1T6ZA 1UQUA 2ZWOA 3LUAA 1Z37A 3ZWAA 1AUXA 5BNFA 3CIFA 4N48A 3FPHA 4I50A 3V2IA 4QARA 1PG0A 3P0EA 1JDBC 2BGJA 2AZMA 4DIEA 1RI5A 1ISSA 1AUOA 1WTCA 2NUTB 2ZYAA 3E2IA 3EXHA 2QS9A 1F6WA 1Q14A 4AECA 2XKKA 1GFIA 2R7NA 4REQB 1SBIA 3COSA 4CMJA 1MT0A 3L77A 4OHMA 1G9SA 4R54A 5D3MB 5EJIA 2AQHA 3GZJA 5FPQA 1X1RA 3O6VA 3SP1A 3C3EA 4NOJA 1ZUNA 4MO9A 1Y1LA 3N2KA 2GH1A 4JJFA 4M9RA 5FB3A 1USUA 1JHVA 5JPIA 1SKQA 1V5FA 1YUBA 3NTLA 2FJ0A 2DVMA 2NQTA 1IY2A 5ES3A 4BGIA 3QUBA 5ALIA 1G38A 3WGLA 1M2VA 2I2BA 4KNYA 5DHSA 2PPVA 4D6PA 3H18A 2ZQ5A 3IIIA 3TZEA 3VR6A 2RMKA 2E21A 2XF2A 2O7QA 4D3SA 1A2KC 3T3MB 1NXPA 1M6VA 4CMIB 2VP2A 3F9CA 2CE7A 1M0EA 5AD1A 1TU3A 4WD3A 2RGUA 3JQRA 1LI4A 1TVCA 4Q9AA 2DKFA 3EWAA 1L7NA 1SQ5A 2RIRA 3BMCB 5BR7A 4K6FA 1XZMA 2YYAA 4DSZA 1EAMA 1P9RA 3IMFA 3BVPA 1XEFA 2D4AA 2XUPA 3H9GA 2GTIA 2GCOA 3RS0A 2AG1A