3BS4A

Crystal structure of uncharacterized protein ph0321 from pyrococcus horikoshii in complex with an unknown peptide
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
253
structure length
245
Chain Sequence
SLSWEIEELDREIGKIKKHSLILIHEEDASSRGKDILFYILSRKLKSDNLVGMFSISYPLQLIIRILSRFGVDVIKYLENHRLAIVDTFGSFHGIMPGVWYLEGMLSSETLPIKYAKAVEDHKKVWMDLNLFEGRELYGFAISMSGYLEVFTPEETLRYLETSAEVRYGHPAYKKYPRGTNFWLWEGVKDKRVLLSVYRRADYVLKTRSSLGENGIKRELLVIKTPKVRFEYEFKGNEPKLRREG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of uncharacterized protein PH0321 from Pyrococcus horikoshii in complex with an unknown peptide.
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein PH0321
total genus 96
structure length 245
sequence length 253
ec nomenclature
pdb deposition date 2007-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3bs4A00
3C4JA 3H86A 3TGPA 4DB4A 1IN5A 3TVDA 1P60A 3AGPA 4DIDA 3LD9A 3WNDA 4TQUS 2YC4C 4C0BA 2AXNA 2P65A 3SN6A 3CH5A 2XEXA 5CITA 1U0LA 5J4VA 1NBMD 4B43A 1EWRA 3OIWA 1D6JA 2MMCA 2C5LA 3KTAA 3AF1A 3FMFA 1YR7A 5C46F 3Q8XB 3R20A 5HCIA 4NE2A 4KFRA 2HCBA 2P6UA 1DELA 1M34E 1XEFA 2C9OA 2ZIAA 3L82B 3Q3JB 1P5ZB 3IDQA 2BC9A 1NVWQ 2XITA 1GSIA 1VPLA 5KNDA 1F48A 5F9HA 2J0QA 2Q3HA 5BYKA 1YZTA 3CR8A 1XTQA 4OK3A 1XXHB 1A7JA 2GEUA 4DLRA 5HCNA 1JECA 2HJGA 2QTFA 4TZ0A 1SHZA 1VHLA 1T6NA 3VHLB 2XTZA 3E70C 4NTZA 1H8HA 3DDCA 3SHWA 3GMTA 3CWQA 2HCJB 4A4DA 1KIMA 1GP2A 2H92A 1Z06A 4DCUA 1NN0A 4QGFA 2HXYA 3G82C 5L3QA 5IRCD 2ZJ5A 4HDCA 3P26A 4PSKA 4PPNA 4D6PA 1YRBA 2REBA 4MKFA 4ZPXA 3PQCA 5TARA 3W6OA 2GXAA 3R9XA 1TU3A 3K70B 3RRYA 1MABA 4MGYR 1DOAA 1OXSC 2OFWA 2PZFA 3P27A 3BOSA 5J4YA 4QGAA 4PC6A 2FFAA 5LDDC 2QEQA 5FR1A 4Q1BA 4CT5A 4GSYA 4POAA 4HLDA 2R2AA 2AK3A 1IN8A 4HAXA 1Z07A 4Q00A 4D4LA 3R9WA 3NEYA 3ADBA 1ZD1A 2NO9A 3KFVA 4I1UA 4JVSB 4QGHA 1BYUA 3MWKA 4W5HA 1A2BA 1QHSA 4Y0AA 1BH2A 2ZITA 4YC7A 3SYNA 3CF6R 2NMVA 3I4LA 1G4UR 4UNNA 1PUIA 1XP8A 2HYDA 4Q02A 1MABB 2QPAA 5FR2A 2W2VA 2F1IA 1DG3A 4B73A 1KJZA 1P61B 1R0YA 2J59A 3VR3A 1XPUA 3K0AB 2QMUA 4YXWA 2VP6A 4X8LA 3AF0A 1G19A 1HH4A 3EXAA 1NNEA 3DKPA 5C18A 3RS3A 2VYFA 2VBCA 1GITA 1P3JA 3GLIB 2QORA 1E32A 1YZGA 1G7SA 1XXHE 2QNRA 2GVDC 4TQAA 3SS8A 4JYBA 3U2QA 1Y3AA 4C7OA 1AQYA 1G21E 4ON9A 3GPLA 3GJ0A 3BD9A 4XWOA 2P67A 4MYTA 4XVUA 2F3TA 4FWIB 3U7EB 4TYNA 1FPMA 4P3YA 4HB4A 4GI7A 2GEVA 5DO9A 3B9QA 5K8LA 2QGNA 1XJQA 2VIIA 4HDOB 2QAJA 2GF0A 1YE8A 4JLOA 3DHWC 2PL3A 1TQ4A 4XH9B 5D3MA 4PQFA 2B8WA 3CRMA 3IILA 1EG7A 3BFKA 1TQ6A 3W6PA 1MR3F 1GRRA 1TUEA 2XX3A 2E1RA 1RVDA 2CE7A 4UNSA 3FE2A 1HEIA 3T5GA 3RSLA 1OFHA 1G8YA 3WNCA 2GVZC 3QKSB 2VHCA 3GJ3A 4A1FA 3OEED 4LSGA 2W58A 3FMOB 1S1MA 1UFQA 5DI3B 3X1WA 4IDPA 1GAJA 4B71A 1CF4A 4FWTA 2RGBA 2Z4RA 2R8RA 2N1BA 4BE7B 1E94E 4EPWA 2RB4A 4PZYA 5CB8A 5C4GB 3A4LA 3I61A 3QXSA 4IXNA 1FW6A 2VQSA 1XJ0A 2BIFA 2WWIA 5FL3A 5KSYA 4KFSA 5G40A 4PPGA 3EC1A 1W4CA 1NVVR 2CHVA 1SULA 4JBWA 4DCTA 1A1VA 4LUCA 3C5HA 4KO8A 1F60A 2JDIA 1G5PA 1GL6A 1JAIA 3GLIE 1T91A 3VR6A 1XTJA 1R5OA 5DI3A 1P73A 4XJXA 5EJEA 2O8FB 3RS7A 5KDLA 1HURA 4QL3A 3N70A 4N1AA 2OO7A 1Z6AA 4IOLA 4N0DA 3QXJA 3P4YA 1VECA 2PBRA 1WBBA 2JLVA 4X8OA 3AVQA 2A3RA 4UXHA 3PV0A 5IT5A 2RAPA 4AKEA 3AVUA 2OFOA 5F98A 4NZYA 5JWHA 5L3QB 2DWQA 1GKUB 2IK8A 2LWIA 3NIBA 3RAPR 1W46A 2ZSDA 3L2OB 4P32A 4Z51A 1ZM3A 2GBLC 4CDGA 4BRUA 2QMEA 5DISB 2PT5A 2IYUA 2VA8A 1WF3A 5E7JA 2OE2A 1T4GA 3U7HB 3TMKA 5JSZB 4P4SA 1XD8A 4ASUD 4UKDA 3LRPA 4LBYA 2XOKD 5SZIA 1QHHA 3A1TA 4GP6A 2CJWA 2F6RA 3NDPA 1T8TA 3FTQA 1WA5A 3VTKA 2IEYA 4A0GA 2GCOA 5KOYA 1R5NA 2FSHA 1ZBDA 1E9CA 4Q9JA 2HLDD 2WKQA 3MG9A 3RWMB 1OXUA 1P72A 3OFND 1FQJA 5DHFA 1FMJA 1VYUA 3K9LA 2J0UB 4C0QC 2W6ID 2AHOA 4DEXA 2OEPA 3SJZA 3GLFB 2J0VA 1ZW6A 3NHBA 3KQUA 1CXZA 1Z3IX 1CR0A 3GJ7A 1E2EA 2P2LA 2R65A 4M8NE 1JQJC 2HV8A 1ZRHA 1XMVA 2O8CB 3ZVRA 1E2NA 1G8HA 2AKAB 2FFQA 2LKCA 4GBMA 5JI3E 4O3MA 1ZNZA 4BFXA 2ZRCA 4DLXA 1CJVC 5IK2A 4BLOA 2I1QA 2NTYC 5BN5A 2VTKA 3I5YA 4YMTA 1HT1E 1NG1A 1X8LA 3BC1A 3K0CC 4HZUA 1RIFA 3KUDA 4MKGA 4E03A 2FV8A 2OV2A 1X8KA 1KHTA 4DSTA 2F7SA 4PAQA 5D3MB 1WE2A 4WA7A 4NPHA 3TBKA 5KSZA 3W34A 2WPDA 2LCFA 1VDZA 1TQDA 2V7QA 4MA4A 4QNRA 2V55B 3M4YA 3ZH9B 4OI0A 3MRSA 1VHTA 3A1VA 2O8CA 4GNKA 3QIAA 4PC1A 2XXAB 2AD1A 4JBYA 2V9PA 2JGNA 1J8MF 4QOSA 1TADA 2J7PD 2G77B 1EFHA 4HZUB 2Q0HA 3CX6A 4FINA 1JR6A 2VF7A 5K8TA 3DMNA 2Q9CA 4Q4HB 4KLNA 2V7QD 3OE7D 2WJJA 4BGDA 5JFGA 3HU2A 3WBJA 4TTPA 2C98A 3IIJA 4BUJA 3C5CA 4DCSA 1G7TA 1ZYUA 4Q47A 3AP3A 1E9BA 3SEAA 2VPPA 4M1YA 2H18A 3IIMA 2EWWA 4PX9A 2JIZD 4PO8A 1E2GA 2ZI4A 5KTYA 2CLCX 3AV0B 2HXSA 2GCNA 1W49A 4A0FA 4XVQA 2FU5C 4LWZA 421PA 2HT1A 4LX0A 4B32A 3ADCA 3CM0A 1F2UB 2CNWD 1FFHA 2FH5B 4FIDA 5EXTA 2PZEA 1Q3HA 3OEHD 4Q7LA 1KK2A 2WTUA 3B60A 1OV4A 2IYWA 1ZM4A 3PCRB 2EW1A 4RCYA 3SYKA 3VQTA 1CRPA 1QHGA 3GJ5A 3DM9B 1PV4A 1VG0B 3T06B 2XSZA 5CYPA 1P7CA 1LTQA 1NL3A 1MO4A 2WV9A 4N0EA 1OE0A 3NBZC 1RZ3A 1RJ9B 2IA5A 3QXHA 5AJXA 1BMFD 1OKKA 1Z8FA 2O52A 2VHQA 5EXSA 3S1AB 3ZS9A 4AG6A 2V3CC 4JS0A 3P20A 5ANRB 4GFDA 1K5DA 3SFZA 3W8RA 4EPYA 1U0HC 3VKGA 4W5JA 2QP3A 5FBLB 3SFVA 1R5BA 2HUPA 1G8FA 3QXCA 3MGCA 2IS1A 1DBSA 3A8TA 3VNVA 3CNNA 3BH6A 4A8JC 1ZC4A 3UMFA 4EPXA 1M8PA 1P2SA 3CPEA 2J0SA 2PH1A 3AVXA 1W0KD 4K46A 1CU1A 5JSZA 1XWIA 1N6RA 1QG4A 1XMSA 4G3XA 2CJWB 4BFWA 4F4CA 1YRAA 4ZCLA 2IHBA 1E9RA 4Q4LA 1UKEA 5EZ6B 2PMKA 4NCKA 1AA9A 1CULC 1AJEA 4FMCB 5F2EA 2NO1A 2HYIC 2C95A 3TIFA 3QVUA 2QL6A 4GMXA 4MDFA 2Q6TA 4M53A 1IM2A 2CVFA 3MFYA 1W2HA 1QHYA 4JJZA 1Z0JA 1Z0KA 3GFPA 2H16A 1P2VA 3U7FB 2JLQA 4Q03A 8OHMA 2VP5A 1TU4A 2QP4A 1XTSA 4LC0A 4LJ8A 2NPFA 3QEOA 2QT0A 2VHTA 1SXJC 4HAYA 3D7MA 3DKVA 1XMIA 5HTKA 1XPOA 1YR6A 3AQ4A 2FN4A 4KCGA 3EARA 1NVXQ 5A4JA 4F92B 4DLVA 3HU3A 4YQFA 3ZDQA 2QAGA 2HDNB 1NMXA 2XAUA 3H84A 1GRNA 3N2IA 1NVVQ 2QG6A 1ZU4A 2W2XA 2A5JA 1DAEA 2BDTA 3ND9A 4G5QA 1H8HD 3UATA 5H1YA 5TY0A 4ZDKA 2CL0X 1CJUC 4DLSA 2MMGA 1Q1EA 1SXJE 3QKUA 1D2EA 1OXTA 4M1SA 2JJ2A 4AC9A 1CRQA 4BLPA 1ZD9A 1COWA 3TSZA 1VCOA 4ABYA 3GLGB 1T5LA 2G83A 1R0ZA 4G5OA 1CKEA 2FEOA 1R8SA 5KO2A 4OK5A 4V02A 4C9BA 3VFDA 3WMFA 3OIUA 1YU9A 1KI3A 3OFNA 3WYFA 5B64A 3ZIAD 1JPJA 3QEJA 5BN3A 4ESHA 3AP1A 2HEIA 1XZPA 4M1MA 2I1VB 5JJIA 2ZANA 3LLUA 1JI0A 3I72A 1G18A 3M1IA 4NCNA 2AR7A 3IBYA 2G3YA 3KB2A 4TQ9A 1SKQA 2IW3A 1TQ2A 4LYJA 3CONA 2EFDB 2DYKA 2VP2A 4TN1A 1GKIA 1DTSA 2ZE5A 1E79D 1O3YA 1N3BA 4G1UC 3WMEA 4B44A 5GJWC 5M04A 1VCIA 1KKMA 4TYPA 1X1RA 3Q7QA 4CRWB 1ZMXA 2Z83A 4B2PA 4Q19A 4B3GA 1E98A 3ND8A 1KO7A 4MUBA 4BZXA 2FJUA 3CX8A 3KQNA 1XMJA 1XFAA 4IFBA 4QC2A 1RRCA 2IYSA 3QY0A 2N46A 5JWRA 1ESMA 3OAAA 2WZQA 1AKEA 1LV7A 3X2SA 5KPDA 1V43A 1S0UA 4Q4JA 1XZQA 2ZVQX 4TL7A 1NSTA 4LZZA 4EPRA 4D81A 3ZQ6A 2D4HA 5FBVB 1TNDA 2JATA 4FMDB 2LKDA 3CRRA 4NHOA 1RJ9A 1KNQA 4BLTA 4M9QA 3B78A 2ZUBA 1OF1A 3B85A 3EPHA 1AZTA 2PJZA 5C2JB 2EVWX 1YZKA 2QZ4A 4LCBA 5DN6D 2O8FA 1P62B 4KODA 4B76A 4F4JA 2HT6A 4TMVA 3FPAA 1R10A 2NG1A 4B35A 3KDSE 2DY1A 3B9PA 4LJ5A 3ZVLA 4FW9A 2GJKA 3RNLA 5FBWB 4ACBA 2OESA 4ZDIA 1KZ7B 4MYHA 4WOPA 2JLUA 2YHSA 3R7WA 3BJIC 3NBYC 5KNCA 4EUNA 2YC2C 1NLFA 2G1JA 4MH0R 3I1FA 3HR7A 1MV5A 2OUKA 2ZR9A 2YOFA 5L3VA 4OQXA 3RS2A 2VO1A 1D5CA 5FBQB 1C4OA 5G53C 2IWHA 1XD2A 3IPXA 3IPYA 1GKYA 1DS6A 1YQTA 1XXHA 3D6TB 3OEHA 3QKRB 3PR1A 1PVOA 1GILA 3SJCA 4R2IA 721PA 3RS5A 3F3YA 3M0EA 2RHDA 4UJ3A 1S2MA 2GNOA 2A5YB 5EE0A 3ZYCA 4B6FA 2YVUA 3K70C 5FI1B 5GJCA 1FZQA 2WWYA 2XSZD 2IUTA 2YWEA 4NYMQ 4DDUA 4JT2A 4V0LA 3LX5A 1ZNXA 3PEUA 2CDNA 2XNDD 3EAQA 4Q1AA 1ZD8A 1SXJD 1RRFA 1IXRC 1XTIA 3IHLA 4MKHA 2G0TA 1N5JA 1R4AA 2ZRJA 4RFSA 4OKSA 2RHMA 5G3ZA 4ZI3A 3H2YA 2Q3FA 4RCZA 1EX6A 3TQCA 4A6XA 621PA 5KUTA 4OHYA 5L8VA 1N5LA 1FMLA 3V9PA 4KVGA 1DEKA 1SKYB 2X2EA 4PHTA 4GT1A 1PZNA 1DAKA 3FHTA 1BS1A 4BZPA 1TEXA 3SU8A 1DVRA 2IYYA 2WOOA 5SZKB 4R2HA 1GWNA 4MRNA 4TL6A 2ZRPA 2V54A 4DC9A 4DDTA 1EX7A 4OQFA 4FCWA 3WP1B 4EKDA 4DSNA 3C16C 3HDTA 5FTJA 1WDTA 2ZSFA 4TT3A 2ZUCA 2OXCA 2PX0A 2QY9A 1ZUHA 3HWSA 4C0JA 4EFLA 5AUOB 3OIVA 2WKRA 1JXOA 4DBLC 2H7VA 2WKPA 5FOVA 3X1YA 3ZIAA 2TMKA 4GP7A 4IKEA 1E69A 121PA 3VU9B 1QDEA 1ZIPA 1S4QA 3GD7A 4LGMA 1EFRA 2CCGA 1EFUA 1TMKA 2IC5A 2ZRHA 3PVSA 1L2TA 4P4TA 2KB0A 1T0JB 2F43A 3B5JA 3TJZA 4RSGA 4GL2A 4FN5A 3ZZ0A 4HAWA 1XU4A 3RYTC 2BEKA 2QMOA 1KSGA 3K9HA 1KY2A 4I4LA 1J7KA 4IW3B 4OYHA 5TXGA 3E1SA 3A4MA 1L7VC 5FL7D 3W5IA 3PXGA 4C4PA 4B75A 4WBSA 3OZXA 3UWKA 1CR4A 2R44A 3BB3A 4EFMA 2SHKA 4JL8A 1KI8A 821PA 2WJVA 2QU8A 2ZRBA 3HPQA 3VU9A 5D3QA 4YXWD 2ZPTX 5JEDA 3F8TA 4PC7A 1ZAKA 4IDQA 1WQ1R 3MLEA 2ERYA 1UBFA 5TVKA 1Q1ZA 4A2QA 3M6AA 2GTPA 2NGRA 1UBCA 1XD9A 1NIPA 2G88A 3LW8A 5L3SB 2CK3D 4IJMA 4Q4AB 3IEVA 3K0EA 4NONA 4PPQA 5IK2D 1LB1B 2EFCB 1AS2A 1SVOA 2VSOA 2W2TA 3CZPA 1IY2A 1DAMA 4M9XA 3SI7A 4F91B 3ZLJA 1PLKA 4W9MC 4QKQA 1GVNB 2IYRA 1NN1A 4TLBA 1C1YA 2WAXA 5B58C 2BKEA 2KBFA 4NYIR 5HPYB 5EE5B 2ORVA 1KTVA 3KKOA 3R7WB 1EXMA 4AURA 3EPJA 1HYQA 4CEIB 3AH8A 1LS1A 3CWZA 1E0KA 1J2JA 5L3SA 3A6PC 4Q1FA 3EZ9A 4XTCS 3O8RA 3S1AA 1A5TA 1NKTA 3AF4A 5LB2A 1SGWA 4IOJA 1US8A 4A2PA 4F4IA 2O8EA 2DFNA 4Q9HA 3OEEA 4O25A 2F55A 1VKJA 1XD2B 2CVHA 1AGPA 2J7PA 5DHAA 1JBKA 4US2R 4MYUA 4QFMA 3N5CA 1KI2A 4FMDF 3QJYA 1N6KA 4NBSA 1QZXA 3VKWA 3UMRA 1JEDA 2F1JA 2ORWA 2AWOA 3BK7A 5DIFA 1RW4A 4HAUA 2ORIA 1TPZA 2ZRIA 1U9IC 2DR3A 1QHNA 1CP2A 2R6CA 2OZEA 3F5FA 4HLCA 4U00A 2AX4A 5JRJA 5P21A 4RZXA 2ONJA 1J99A 4PSAA 4PR0A 2QT1A 1XTRA 4PSVA 4C3ZA 1NN5A 1Z6GA 2D74A 5SZJA 2GZHA 2GESA 2ZRDA 2G9NA 2Z5FA 2XNDA 4OK6A 3K09A 3QG1A 4GRAA 4KITB 2Z0MA 2Q9AA 2AKYA 1FX0B 4MYCA 2C99A 4JVNA 5DNYB 2OFXA 3THYA 4ZCMA 1W4RA 1MRSA 1OXXK 3QOFA 4LYAA 2IXFA 1UDWA 1E0JA 3SC3A 3FKSA 1NJGA 3HP1A 3I62A 4P4SB 1D9XA 4HI0E 2GJSA 2WWFA 4YONB 4NDZA 1CJMA 3BB1A 4II7A 2VF8A 3A37A 4B3XA 4TYQA 2X2FA 4JLNA 3LY5A 3TAHA 2A78A 2GF9A 5JHHB 1VYTA 2CHQA 4OI4A 3U61B 2NO7A 1IONA 4OI2A 4PFSA 2ZSBA 3CF2A 3QI2A 1IBRA 3BH0A 3IQXA 2O5VA 3GLHB 1NBMA 3THYB 1G20E 3CO5A 3UANA 1VG9B 2J0UA 3BGWA 2ZVPX 1CJTC 2R6DA 4BFVA 2BWJA 5BW8A 2VRWA 3NG1A 1M7BA 2ZRAA 3WNBA 3C41J 3UPUA 2NZJA 2F43B 2GXUA 1T3LA 2C77A 3X1DA 4BEBA 2ZSEA 4QHYA 3X1XA 3T1OA 3VR5A 1CIPA 4W7SA 4NCHA 1DE0A 1PLLA 3LFUA 2OBMA 4XWKA 1SVIA 2RMKA 3P1JA 4AYXA 1UBEA 1E1RD 1G4AE 4WZ6A 4BRWA 3FMIA 1LNZA 3K70D 2ERXA 2FF7A 3MUFA 4HUQA 3GFOA 4NYJR 1UPTA 1L4YA 2C04A 3IIKA 2IYTA 3LWNA 4FD2A 3ICEA 1CTQA 1NSFA 2FSFA 3CBQA 3H1TA 3CW2A 3GLHA 4HLQB 4S2EA 3TUJC 4AD8A 4Z8XA 5EP1A 4ITRC 4YMSA 2GAOA 3WBKA 1EFCA 2YJTD 4KAXA 1OB5A 3TVTA 2DPXA 4XTRA 2V1UA 2F9MA 1MO5A 4ZI2A 3QQ5A 4M9ZA 1KGDA 1FP7A 1LF0A 1GNQA 5JZVA 2WVJA 1JALA 2RGXA 1UADA 4BASA 4ZIRB 4DLUA 4BWYA 5KDOA 1FTNA 4LK2A 5CJPA 4Q7KA 4RKEA 4KJZA 2RKOA 1HY3A 4QHTA 2ZUDA 1E2PA 1UEIA 3WYGA 4MUAA 3AF2A 4U02A 3KQKA 3QENA 2JJ1D 3ONWA 5J4LA 5FTKA 4YDSA 3SJAA 1Z08A 1TX4B 3B1VA 2PX3A 4C30A 4L4UA 4A92A 2HF8A 1MO6A 4KI0A 1K5GA 5TMPA 4IFEA 4LJ7A 3NVAA 2GAAA 5JLJA 4ZIRA 3FB4A 4C2UA 5E7IA 1T8UA 4QM6A 2WICA 3I32A 1US8B 1G64A 4Q9KA 5TB5A 2O8EB 1NLYA 3GJ4A 1YVDA 3PJRA 1AK2A 4TMXA 5JBQA 3WMGA 3QPVA 4US0R 5CDFA 1ZM7A 2AD5A 4ACAA 1BYIA 1F2UA 3IEUA 4NYJQ 1FNNA 2JJ8A 2YINC 2F1RA 4H9GA 4DDWA 3K0SA 5DLQC 2F1HA 2WSSD 3NKVA 3B1ZA 5CIQA 3SOPA 3SE0A 1GL9B 1ZM9A 2ANBA 1IY0A 5KSOA 5C4MA 4CVNA 1NY5A 2DFKB 2A30A 1RYHA 2YZ2A 2GJ8A 4M22A 3PFIA 1YR9A 1DAGA 1G3QA 1N5KA 1Z22A 5J5CA 5DN6A 2IS4A 2WSSA 1OB2A 2CCJA 1NY6A 4M1KA 3QKRA 5AJZA 1KKLA 3QKTA 4I1OA 1ELOA 2QRZA 4XD7A 4EPTA 3REGA 3J81k 2QE7A 2KJQA 5A0FA 1KI6B 2Q9BA 2ZJ2A 5E7MA 3FYHA 4JSTA 5BN4A 1XDBA 4PHGA 1Z2AA 3WP0A 2P6RA 1CR2A 1R8QA 1XJCA 1ZUNB 2W00A 3GLGE 4LJAA 5FTLA 4URWR 2ZETA 2IT1A 4MRSA 1OLOA 3U3JA 4TLDA 2C9CA 3B6EA 4D0NA 4ESVA 1UAAA 1RPZA 1YKSA 2VHUA 2FX3A 3BFVA 2EU8A 4RFSB 1KMHA 2VLIA 1J8YF 3PUYA 1JR3E 4Q9IA 1Q1QA 4AKIA 4MGKR 1E2FA 1Z6XA 1W5SA 4LV8B 4OI1A 3L8ZA 4LOAA 2OLKA 3LX8A 4G5GA 3KB1A 1DADA 1II0A 1OHHA 2PEYA 4QGGA 1KO1A 2XZOA 2JLYA 1GG2A 4ZKDA 3AKCA 4AYWA 1U0JA 2JEOA 2ODNA 2DWOA 2REOA 4JZKA 3CZQA 1JB1A 2QENA 2OCBA 4NH0A 3AVWA 1M2OB 1KJYA 4DSUA 3QVVA 1BOFA 1GNPA 3WYAA 2D7CA 1SVLA 4HUQB 1LY1A 3NH9A 3NWJA 4LBWA 2ZYVX 4V0KA 4RJLA 5G3YA 5LPNA 6Q21A 2ZAOA 3MMPA 1UBGA 5G41A 4KLZA 1S8FA 2RGGA 1SZPA 3QG5A 1HV8A 2VSFA 3BXZA 3EZ7A 4JBXA 4LV6A 2PLFA 4IEIA 5FTMA 5HE9A 3W3ZB 1Z28A 2IF2A 3GLGA 2GCPA 2V6JA 4IRUB 3DMDA 4TZ6A 2KBEA 3AVPA 2XNSA 1CBUA 1OH6A 2D2EA 3GEHA 3ZQJA 2WOJA 4GOXA 2YOGA 3JZAA 2GJ9A 1OFUX 2G6BA 3SBDA 2IS2A 5CJ2A 1FP6A 3LVQE 1LVGA 4D4JA 5AJWA 4KSBA 1KOFA 1DO2A 5BXQC 2WWGA 3ZZTA 4AYTA 4IEEA 3CIOA 3Q7PA 1QG2A 1OH8A 1XEWY 4QNMA 2XOKA 1G6HA 2G0NA 3K1JA 3EIEA 2FSIA 3B1XA 2QI9C 3U60B 1Z0FA 4TT3D 3AUYA 1T3HA 2FA9A 4NKRA 1AKYA 2IXGA 4Z1MA 1IAQA 3FFBA 5BQ5A 2ZSAA 3AKEA 3VX3A 4TLEA 1EFRD 4L5BA 4OBEA 1F3OA 3BE4A 4ZO4A 2XTNA 1W36B 4MQBA 4LJ6A 1FNMA 3AM1A 2WJHA 3RC8A 1Q3TA 2QP9X 4WW0A 5AJYA 3ZVMA 2P6NA 4A8JA 3SYLA 3T35A 2A5DA 2FPMA 2ZREA 3WHKA 5HZKA 4CEIA 4FMBB 2A9KA 3THWA 1W44A 2O8DB 2C8VA 2WWXA 4M9SA 1JQLB 3UMSA 1QF9A 1VG1A 4TLAA 3ZD6A 3JVVA 3EWSA 2BCGY 4I1SA 4RZ2A 1S96A 3ASZA 4KSCA 1KZGB 1G291 2ZS7A 4IXMA 5AUNB 4MRVA 5FH9A 1E2HA 3KUCA 5KYKA 2OCYC 1Z63A 3E2IA 2ZRGA 5EE1A 4MKIA 4LPSA 4RD2A 3K0FB 1Z47A 2AXPA 5CLLA 2CLSA 3PENA 2HLDA 4EJSB 2WPDD 1SQ5A 4XD7D 3W8NA 1KI7A 1WCV1 1RRPA 3I5XA 1NF3A 2X8AA 3GLHE 1TF2A 3THWB 2O8DA 2GJAA 4DSOA 4Q18A 1RFLA 3GFTA 5CYOA 1U99A 5CB6A 4DT1B 4LHWA 2NQ2C 1JJ7A 2O0KA 5AK0A 1COWD 4B3DA 1G8GA 3OHMA 2J46A 2YNMA 4QBGB 1FX0A 1HE1C 4CEHB 4S35A 4JVLA 4B74A 1CR1A 3RRZA 4D26A 2CLDX 1YZUA 4RZ3A 5AUQA 1XEWX 1HUQA 3KXIA 3B1WA 4L15A 2IYZA 1AZSC 1U2RA 1G16A 4G0NA 1ZC3A 3IUYA 2V1XA 2V6IA 2EYUA 2BJWA 5EQTA 4DIEA 4KFTA 3B13B 1YZQA 1BMFA 1OKKD 4BLRA 1B0UA 2IS6A 2QQ0A 2H17A 3B2EA 4AKGA 3IHWA 1E9EA 2BCJQ 2OT3B 1S9HA 3SJBA 5J47A 2XB2A 3VKHA 1G5RA 3T1VA 2W6JA 1KMQA 2IF0A 2FMXA 1KO5A 4FCTA 4X8MA 2O8BA 4R7ZA 1IY1A 1QVRA 2E9SA 1Z0AA 4WXPA 4JLMA 1KYIA 4XSHA 3I8SA 4GPTA 2BBSA 2UKDA 2FFHA 3U4QB 3L0OA 4GZMA 1NBME 5AWFC 3DVLA 3L0SA 3OIYA 4J0QA 1W0JA 4AY2A 1KDRA 3K0CA 3AKDA 4LC1A 4D0LB 2OSBA 3CPJB 3EC2A 2X19A 4GZLA 3I8XA 3EX7C 4XSGA 3NHAA 4ZDWA 4LHXA 1Z0DA 2ZJZA 2RGNA 3EA5A 5IDVA 2QTHA 2QSZA 2J5XA 4YMVA 5EP2A 4BFSA 4B47A 4Z54A 1XCGB 4GOKA 4LBZA 1UKZA 2WWWA 4M1TA 4HB3A 4B2IA 4B3FX 5JCZA 1DAFA 5CM8B 5GJVC 2WWHA 3KZ1E 3SZRA 1N25A 4PC3A 3U44B 1QHIA 5JWOA 2IYLD 2WJIA 4W5WA 2WHXA 4FI3C 3UG6A 3V00A 3HJNA 2D3WA 4E07A 5FOWA 2RH5A 1A82A 2WBLC 2BHRA 1SHKA 3LXXA 3HYTA 4E5UA 5TV2A 2BV3A 4JMPA 1O87A 1NIJA 1E9FA 4UXIA 3TW8B 4B33A 1G6OA 1KK0A 3QPWA 1S1CA 3PEVA 5KPJA 3KXKA 3LDAA 2GK6A 2ZRNA 4RD4A 2WJGA 2GZDA 4A8JB 3G5UA 3ZS8A 2D2FA 3Q9LA 4B3BA 2QTVB 3T61A 1U8ZA 3ADKA 3C15C 3HPRA 5J40A 4URYR 3FFAA 4R9UC 1UEJA 2RCNA 4Q4AA 4MDEA 4LJ4A 1EWQA 3B7GA 4OQMA 1YHNA 3VAAA 1H8EA 3HR8A 3LVRE 4JLKA 3EPKA 2DFLA 1E6CA 1K6MA 3KJGA 5GVSA 3K09C 5JCPA 4A9AA 2JJ1A 1N0WA 1Z29A 4PQYA 5JMTA 1N2CE 1SVWA 2ZS9A 3P4XA 1KDTA 3RWOA 4I1VA 4N3NA 1N6NA 2ZR0A 4DRZA 2ZE6A 3KKMA 4JLAA 2REXB 5CK4A 2BBOA 2J45A 1E0AA 1G1MA 1QHXA 2EFHB 3Q5EA 4PHFA 1NI3A 5DH9A 1OYYA 3CLVA 3QNUA 5H70A 3CX7A 3RS4A 2R62A 4DT1A 1IQPA 1E2MA 2IYQA 1W48A 1E2KA 1IJFA 1KI9A 5CM9C 4DUGA 1YJ5A 5CK5A 3WXMA 1VTKA 4IOKA 4JKIA 2FPLA 3RRMA 3GCGA 1ESNA 3K9NA 4C0LA 3DPUA 4IVQA 4LYHA 1R0XA 5B2ZA 2UZ3A 4Q01A 2QMHA 4QRHA 3CRVA 2KWIA 1M7GA 3C7KA 1KO4A 2YYZA 4UXJA 4URZR 4TYYA 1E3MA 4ZDJA 5EP3A 3DZDA 4PXAA 2NO6A 1U94A 3FHCB 3FWYA 4RD3A 4JT4A 1XX6A 3A4NA 5FPTA 3PUWA 3EIHA 4OHXA 3AKYA 1IJEA 2OHFA 4HEJA 4XOIA 4A15A 2H57A 2ZS8A 4A36A 2A5GA 4KVAA 1M6NA 2CNWA 5FL7A 2VSXA 1KI4A 1WRBA 1WXQA 1W47A 1Z6YA 3PUXA 4Q66C 4D2IA 4IOMA 5FOSA 4HAVA 2F3RA 3T34A 3ETLA 1OH5A 3QUSA 4P31A 4WXRA 3RRNA 4BPBA 5C1BA 2BJVA 2F9LA 2ZI3A 4KBGA 2OILA 1E9DA 2ZYUX 2KI5A 3EZ2A 4L8GA 2JASA 1N6LA 3FKQA 3TSWA 2QSYA 1KSFX 1SVKA 3KXLA 4Q7MB 1XCPA 2NOAA 1AGRA 1OSNA 2ZJAA 4AKHA 2Z43A 4Y0VA 4F7WA 3H0KA 4PAOA 1TEVA 5TDHA 3Q5DA 4H1VA 3BFXA 4E22A 5KSPA 1CS4C 2P0EA 3MWYW 1W4AA 1W0KA 1TTTA 5LD2B 4CZ2A 4QJ4A 3TW4A 5E95A 4NYIQ 4CYMA 2RGEA 2R6AA 2B7CA 1IHUA 4RD6A 2I4IA 4V0MA 4R98A 5B30A 4Q1DA 3T1TA 1NP6A 4QJ3A 1J70A 2H1LA 3ECCA 2OM2A 4DXAA 4JLVA 4UNPA 1U90A 2QUZA 2V8OA 1TL7C 3RABA 4IVPA 1N6IA 2BMFA 2C96A 3BB4A 4P4UA 3SDZA 4Q5IA 4YDHB 1NG9A 3CKLA 1YZNA 3BRWD 3CNOA 3NTUA 4HUTA 2PJRA 2AN9A 1KSHA 1MKYA 4EAQA 2FFBA 4A6PA 3CPHA 3O8BA 4NP6A 2GBLA 4OQNA 2YOHA 4O2RA 2WIAA 4DJTA 1IN7A 4OJQA 2C03A 3H4MA 3QBTA 4OL0A 5B57C 5KU1A 1D2MA 4PQRA 1II8A 3DM5A 3PIRA 4M0LA 3BIFA 2Q3MA 3TAUA 4CW7A 2OXRA 2B6HA 1HT2E 4K81B 4IVRA 4HDQB 3PITA 1VIAA 4LJ9A 2X1VA 3BORA 4PO9A 4EIWA 1V5WA 3MAAC 4HSEA 4BQSA 4BEJA 4LY6A 4GDFA 2P5TB 3QXXA 1OHHD 3UKDA 1S9DA 1I4DD 1E4VA 4V0NA 3DO6A 2ZI9A 4PHHA 4DEYA 2PMDA 1KAOA 3WRXC 1UF9A 1MH1A 4QBHA 1E99A 5H68A 1JEEA 3U3RA 5K8IA 3DOEA 3RHFA 1NN3A 2OAQ1 3LNCA 1NJFA 5F9FA 1DPFA 3REFA 5FPSA 3VX4A 1GDDA 2NPIA 1XNJA 1AM4D 1N0UA 1YR8A 4EJSA 2W0SA 3V4RA 2IL1A 2L0XA 4CGZA 2A2ZA 3LQQA 3KKNA 4LI0A 2WM9B 3RVBA 2PT7A 4KFUA 4TSFD 1E79A 1Z5ZA 4IDOA 2ZE8A 4IDHA 1AN0A 2D06A 2W83A 3A58B 1ZVQA 4DDVA 2ZEJA 4TLCA 2BMEA 1KAGA 3C14C 2OLJA 4OHWA 3KX2A 2W6IA 1GRQA 1XB2A 3V4FA 4A2WA 3GEIA 3BAFA 5DI9A 2RGCA 3K8YA 5IHPA 5BWMA 3ASYA 3KJHA 2QN6A 5HZHA 3AVYA 4Q1EA 1KO8A 1SKYE 4ERNA 1W36D 3KJIA 4CEHA 1CLUA 4HYYA 3HYRA 2QM8A 1KI6A 5FUXA 4G5RA 1JR3A 1II9A 2VL7A 4O2LA 3T15A 4JVMA 2JA1A 4AG5A 4ARZB 3VMFA 4LV5B 2OCAA 2JLXA 2GXQA 2WJYA 4RY2A 3VR1A 3THXA 4B3CA 1FL9A 3W9YA 3ADDA 1KMHB 4DUGD 1PUJA 1T5IA 2ZYTX 5EXXA 3W3AA 1G5TA 1GTVA 4M2LA 1JR3D 1W2GA 2BEJA 1BO6A 2NO0A 4TMTA 5GADl 3N2EA 2GKSA 2N42A 4PANA 4I99A 4QJ5A 1JAHA 1N0VC 3WRYC 3CRW1 4FXPA 2O8BB 4D82A 5F3WB 5JI2E 3W5JA 1UKYA 2FGJA 3ZGXA 2BVNA 2FEMA 3PUZA 3O8DA 2PCLA 3ICQB 3TH5A 4DB2A 3KTAB 4B34A 2ATXA 5GJBA 1Z0IA 4Q48A 3IKJA 4TL9A 3DL0A 1DG1G 3JVUA 4D80A 1ZM2A 2FE4A 2BOVA 2ZRFA 4C0HA 1P2TA 3WHLA 3GQBA 5CIWA 4C0SA 3F0TA 4BLSA 4V0OA 3LW7A 3NEJA 3MSXA 4PTLA 5LBIA 1PLJA 2A5FA 4HLUA 2QE7D 2ZTSA 3L0PA 5JHGB 3TK1A 2PEZA 4HZIA 5HKKA 2ZROA 3Q72A 4HATA 2ZI7A 1Z6TA 2QBYA 1NKSA 1H65A 2XJ9A 2V4ZA 4PZLA 2Y8EA 3EZFA 4NYMR 3BERA 5FOUA 1TUIA 1R6BX 3B1YA 4QM7A 1X6VA 3KFXA 4YMUA 3U44A 1GFIA 1R0WA 4MGIR 3QPUA 2J3EA 1ODFA 2WMOB 3TNFA 221PA 3B82A 5DSZA 2XTMA 1YZLA 3U3MA 2ONKA 3PEWA 5EUMA 4A0RA 2FGKA 4US1R 1XEXA 4BFZA 2W6JD 3AEZA 3I73A 4DVGA 2GILA 4JLPA 3GJ6A 1IXSB 1W1WA 521PA 2MSCB 2VP0A 1Z2CA 1ZIOA 2VP9A 2AL7A 5E4FA 1OIXA 2IEZA 3TLXA 4G5SA 1XCMA 3GJ8A 2A7QA 1QRAA 2JCSA 5EE9A 1UM8A 3U3KA 4DLYA 3SQWA 2B21A 3AP2A 3NC1C 4XWAA 3UIEA 4B2LA 5CLQA 1E1RA 2IBMA 3GJXC 4L9SA 4QXAA 2CL7X 1F2TB 2WIBA 2EQBA 3SBEA 1XEXB 2DCUA 2PLRA 4DLTA 2FG5A 4EJSC 2EYQA 4TYWA 1L4UA 3DEFA 1VMAA 1ETUA 4BZQA 1WB9A 1HE8B 2G1KA 2GZAA 3CRQA 3MJHA 4UNQA 4D25A 2B92A 1WP9A 2J9RA 1WMSA 1F5NA 1P9WA 1SXJA 3MWLA 3T12A 1VYVA 4O0MA 4EPVA 1GIAA 1ANKA 1G41A 1HQCA 1T0HB 1XRJA 4WVFA 4PAMA 4U5XA 2IHYA 1L8QA 3LH5A 2CMKA 4LDJA 1LFDB 4M1OA 3A1WA 1G3MA 2OBNA 1W5TA 2XJ4A 3AVOA 3IO3A 4QBFA 4NMMA 2IXEA 2JLZA 3RANA 4JJKA 2ZU0C 4FMCF 1Q57A 4L9WA 4NCIA 3QBVA 3SHFA 2CBZA 1LS6A 4BFTA 1EESA 2KE5A 3EZ6A 3I3SR 4CIDA 3TKLA 3OESA 3AVVA 4F38A 2GRJA 3K0FA 1SXJB 4LYFA 3GLFE 2WSMA 5E3HA 1NMYA 3AGQA 3LBIA 1KK1A 2QM7A 4GOJA 2ZXUA 1IOZA 1EGAA 4Z1MD 2I3BA 5J4KA 3U3OA 2ZJOA 3LV8A 3FVQA 5JRZA 3QKSA 4ZKEA 3KQLA 3R8CA 1H8ED 4OHVA 3RLFA 5L3RA 1D2NA 2FZLA 3TR0A 4RZUA 5JS7A 4OQLA 1JJVA 4KV9A 2RGDA 2IUSA 1OXVA 3QF7A 1Q20A 1OFTA 5BYJA 4RKFA 1QVAA 4L16A 1JPNA 4TL8A 1G3RA 1LF5A 2EWVA 1RKBA 1ZCBA 1W36C 2J41A 3K53A 2FWRA 2ODWA 4P33A 1KSJA 3NXSA 5SZHB 1KI1A 4DCNA 5DYIA 4D0GA 3UWOA 3A36A 2Z6VA 1DAHA 5DGXA 4DLZA 1R7RA 1G3UA 2ZI5A 3LO5A 5KNBA 2BBTA 2ZU6A 4HB0A 2OBLA 2ZRLA 4ILEA 3A1SA 3AUXA 5UKDA 4U7DA 1D8TA 1ZUIA 1MOZA 2RGAA 1I2MA 1M7HA 1UKVY 4LBVA 3WY9A 1G7CA 2AFHE 3D31A 2OCPA 3VHXA 1ZJ6A 4I81A 3U4QA 2AK2A 3RDPA 5FOXA 2QPTA 1G3IA 3EPLA 3LBHA 3CUEF 1J90A 1P75A 1XF9A 4JIMA 3UG7A 3EASA 3BWDD 2MSEB 4JL6A 2JLSA 4JLJA 5HE8A 1MRNA 1ZNYA 2ECKA 3CH4B 4LJYA 5ELXA 3DOFA 2GK7A 1G9XA 2PZGA 4JKYA 4QHSA 1MT0A 1X86B 1I4TD 4URXR 2EFEB 5EP4A 1RRGA 3UK6A 3NBXX 1E9SA 1ZNWA 2FZ4A 1PJRA 1IN6A 2QA5A 3GEEA 1GM5A 2O0JA 1S3SA 5FTNA 2ZQ5A 2C9YA 3RSOA 3FKSD 3VR2A 1W7AA 4KU4A 4WIAA 2HJVA 3CNLA 1OT3A 2ZAMA 1JNYA 2FOLA 1KK3A 3O47A 1ONBA 4LRWA 4WZAE 3CB4A 3K9GA 3ZJYA 4PPFA 4F93B 4GMDA 1EFTA 5FUWA 2J1LA 2DB3A 4CF7A 1F2TA 3RC3A 4JLBA 2CCKA 3LXRA 3LBNA 1AS3A 4IHQA 1MO3A 2VEDA 3LLMA 2VHJA 5LD2C 4LHVA 2ZR7A 3IGFA 4XIGS 3OAAD 1F6BA 1EK0A 1KNXA 1P4SA 1Q21A 2J7KA 1U98A 1GZSA 3EWAA 3FOZA 1U8AA 4C0KA 1KDOA 4MGZR 1U8YA 2GHIA 2QPOA 4KYIB 1X1SA 1RC8A 3NC0C 3DZ8A 3IO5A 4Z8YA 3TRFA 2QRNA 1R2QA 3TUZC 3P32A 5JECA 4KXFB 2ZYWX 1UJ2A 2R6FA 4BFUA 1C9KA 4QBIA 1N6PA 2OAP1 4AWXA 2GDJA 1E9AA 4RFVA 3TSOA 5CDFE 1KY3A 2BMJA 4EQ6A 1XTKA 2BM1A 4KBFA 1ZP6A 4Q1CA 4V0ME 3OE7A 2GETA 4C2TA 4EFNA 4URVR 1FUKA 1K8RA 1W4BA 3THOA 4UNRA 1Z83A 3GLIA 2ZI6A 3QE0A 3NDBB 1FOEB 3D8BA 1N6OA 2CE2X 4ZV4A 2CXXA 2QROA 2NZ8A 2MSDB 4AK9A 1G7RA 2CHGA 4MITA 3ZVNA 2IYXA 1B23P 2X77A 3ZD7A 1E1QD 1BKDR 2ASEA 3IQWA 4BLQA 2DFTA 3QSYA 3BH7A 1ZINA 4PO1A 1NLZA 2AFIE 3E5HA 4ASUA 1OIWA 2YWGA 5FPYA 4EQ6B 2BKUA 2HF9A 4Q4HA 3GP8A 5LB4A 1AQUA 3OF5A 3FDIA 2BM0A 5EUQB 4DLWA 4DZZA 4ARZA 1OH7A 3G0HA 1P2UA 1S3GA 4M1WA 4URUR 2ATVA 4NL4H 2XZLA 2C2HA 1VCMA 1X8JA 3FGNA 4JYCA 3ZZUA 1AIPA 3NBFA 4RD0A 4JL5A 3MD0A 2ZJYA 2ZM5A 5JJKA 1D9ZA 5HR5A 1LW7A 1ZCAA 2AWNA 5FUYA 3X1ZA 4AIIA 5FFMA 4BECA 1OJLA 3AF3A 2RGNC 3NH6A 2NIPA 3JZMA 3PG5A 4KHZA 5K8UA 2GEDA 3EG5A 4EDHA 1X3SA 5FOTA 4M21A 2GXSA 3LAWA 4TWZA 2YWFA 4LHYA 2ZJ8A 1CEEA 2H8KA 1HA3A 2DBYA 2FNAA 5FPKA 2YKGA 1Q22A 4AI6A 3W90A 1KDPA 4TTQA 1P6XA 1NRJB 3SNHA 1E96A 2UZIR 3SR0A 1QBKC 2E87A 2WAYA 4JLDA 2WMNB 4LPKA 2ZRMA 3TE6A 3Q85A 1IXZA 2FSGA 1DO0A 1I4LD 3C8UA 2ZJBA 4OJKA 3U7GA 1Q1BA 1UDXA 2ZRKA 3EA0A 1IN4A 3QF4B 2CEAA 2FPKA 4HB2A 4P0TA 2CK3A 2QBYB 3CF0A 3U6BA 1VG8A 5AR1A 3U5ZB 4Q7JB 2Z4SA 1HQYE 1KJWA 2JJ2D 4YMWA 5DE3A 3R8FA 3MCAA 3KQHA 1OIVA 5A5GA 5KHOC 2B7BA 1DAIA 4TMWA 1AS0A 2P3SA 2IX3A 5JJLA 3PEYA 5JS8A 2GA8A 5EZ5A 2JLWA 2FDCA 2C78A 3EIQA 5J4HA 1U9IA 1FUUA 4UJ5A 5AJVB 4WAUA 4R71A 3HU1A 2DHRA 1FTSA 4D4MA 5HKKD 1ZU5A 1E2IA 1M74A 2QGZA 3KL4A 4HAZA 3QF4A 2IYVA 2JLRA 4TMZA 1VIYA 3LA6A 1XPRA 1E2QA 4M4SA 1QHHB 3TUIC 4B6EA 2DWPA 3L0IB 1GNRA 1RYFA 1W0JD 4RVCA 2PCJA 2GCOB 2QQEA 3L43A 2KSQA 3T5DA 4E09A 1OW3B 2QAGB 2VP4A 3IBGA 4DWJA 5EE3A 1E4YA 1Y63A 2UVQA 2W0MA 1P9RA 4NCJA 2XGJA 1II8B 1NVUQ 4RD1A 2XZPA 4UQOA 4D4KA 3MJRA 1GUAA 3KKQA 5FBRB 3GLFA 3AVTA 1RE0A 2K5UA 4MRPA 1OFIA 4TMKA 2EFGA 1BIFA 2D7DA 1N5IA 1T9HA 4CT4B 4DCVA 2BMDA 4A0HA 1P9NA 2O0HA 1CJKC 5AUPB 1E2LA 1OPXA 3SQXA 1Q12A 3TQFA 3A1UA 1NMZA 3BBPA 3FHOA 3KJEA 1G17A 2JIZA 4NU0A 1G8PA 4OHZA 4BFYA 3U6KA 1HTWA 4H1UA 1U81A 3FMPB 1Q0UA 4QG7A 5DYGA 1OYWA 3TR5A 1GL7A 1SVMA 2GWHA 4IDNA 5IF9A 1A4RA 1SVSA 1DARA 5GVRA 1N6HA 3T1QA 1M1YE 3K0AA 1WBDA 2JAQA 4YLGA 4B48A 3EW9A 4MRRA 3B8HA 3KKPA 3D3QA 3I92A 2ANCA 4CEJA 2J87A 1E0SA 2R6GA 4HLUC 2D62A 4TTRA 1E2DA 4PZZA 1XBTA 2YWHA 2VH5R 4V03A 4DKXA 4ZCIA 2BBWA 4WZBE 2ODBA 5FUVA 3BS4A 2ZE7A 4JSYA 2XXAA 4C7OB 4X8HA 3CR7A 4PC2A 2Q21A 3AB3A 3R9IA 2H5EA 3UXMA 4Q9LA 2YV5A 4C0AC 1GOTA 5JEEA 2IWRA 3VNUA 4LHZA 3MWJA 3W6NA 4A82A 2JDID 3L8YA 4FCVA 4K8OA 1TF5A 2ODEA 2OG2A 1E2JA 5EXPA 4CEJB 2B8TA 1I2DA 3LQRA 1FQKA 4Q4JB 1T3SA 2IUUA 3RS0A 2CL6X 5H8WA 3VR4A 1TF7A 1VCNA 4TSFA 5FPHA 1TAGA 2R9VA 5FI0B 1Q44A 1JXMA 1E1QA 1A2KC 4DHEA 2P5SA 4XVRA 2QAGC 2XB4A 4G01B 3THXB 4KYUA 3PUVA 3O8CA 5KDDA 4Q21A
chains in the Genus database with same CATH superfamily
3E2PA 3H86A 5B3LA 3TGPA 4K6MA 1IN5A 3ED5A 1EBFA 4FOSA 3O75A 1P60A 3AGPA 4YJ2B 4KQCA 4IIDA 4V0QA 2MYPA 3WNDA 4QQKA 4R40A 4ZFNA 4KRXA 1EVZA 2F17A 3ZCQA 4XEHA 1JEYA 3QTLA 1U0LA 4FT2A 2DRIA 4MVJE 4R1UA 5J4VA 5JQGB 4NXMB 1K6JA 5E1MA 3GFVA 1BHJA 2JHPA 4XQCA 4ZQBA 4AJ4A 4J3NA 4HXFB 3DF7A 4FUTA 3KTAA 5F51A 3ZV5A 3L8CA 1ZOLA 4X64B 4YRTA 3NPAA 1G98A 3VAAA 5T7BA 3B2QA 3M6MD 5CT5A 3OTHA 3UJ8A 2P6UA 1UWKA 2YFYA 1M34E 3CXUA 5MN6A 1W19A 3VZDA 2FG6C 4RLQA 2ZIAA 1XZCA 3HJTA 3L82B 3Q3JB 3IDQA 2HPVA 3MJCA 2AYYA 2BC9A 2Y93A 3F4BA 1VPLA 2XUZA 4HH0A 5FNZA 3VI4B 5A5FA 5IKXA 2C5SA 1YZTA 4KRGA 4BNMA 4LCEA 3FVTA 2XYQA 5EGSA 2B5VA 4ZZ3A 5HG0A 5ED4A 2R66A 2GEUA 3HI4A 3FJOA 2D00A 2CDBA 1B14A 2A14A 2HJGA 5EXDA 4D4GA 1SHZA 4CR6A 1T6NA 1H9AA 3TFQA 4DGSA 3E70C 4E5MA 3EQ9A 2FUG6 3DDCA 3OJLA 1RZUA 1V6AA 4ZOAA 2F64A 2PD3A 1WUJS 5AICA 3SHWA 4A4DA 5IT0A 1X1DA 1XZFA 1DT5A 4I9HA 2H92A 3M5DA 3K2QA 4GXNA 2VHWA 1U0EA 1YA8A 2GN9A 1ECGA 4I3HA 3U3ZA 3G82C 3ZI0A 1AGYA 2EDAA 2ZJ5A 3FJYA 1C3XA 4PPNA 1SVUA 4MKFA 2QQGA 1GD1O 1W29A 2QD2A 3C8ZA 2GO7A 2FQQA 1OXSC 1VFNA 3Q8LA 1DV2A 3WJ2A 3KHUA 3VSEA 2G40A 1IM5A 1P91A 2FFAA 2M1XA 2Y1KA 3UXYA 2QEQA 1NQWA 2UVDA 5KS2A 2CDRA 4POAA 1YS6A 3BMNB 3V1LA 1PZGA 1CS0A 4JP1A 4BJ1A 3GJYA 4LG1A 3T7TA 1B4DA 4MGEA 1IN8A 1CQJA 4PYLA 3KETA 4BJ6A 4CKEA 4L76A 4O4JF 5T67A 4XGNA 1X92A 3JVIA 2HMTA 6LDHA 3MWKA 1THMA 4HX5A 1A2BA 1HMYA 1QHSA 2OBFA 3HCCA 3EPRA 3OJEA 4QDKA 4D42A 5I01A 4YC7A 3T7SA 3I4LA 2A1TR 1O08A 1G4UR 2YDXA 1PUIA 2HYDA 4ZAVA 1KYTA 1OWPA 3NBQA 3VTFA 3HCBA 5MHTA 3LT1A 4YCAA 3MSCA 4B73A 1B3RA 2H8GA 1KJZA 5JD6A 1BHSA 4OHKA 4BV8A 2J59A 3NTVA 3OY7A 2Q1WA 4MS1B 1PGOA 4KMMA 1MVNA 4PTZA 4DCMA 4XGQA 3A9TA 1IUKA 3CLSD 3PC4A 1G19A 1HH4A 4BS9A 4C6SA 5E2BA 1FFAA 1CZUA 3RS3A 3ZC3A 4PU0A 5BT8A 1P3JA 2PANA 2RAVA 3NCTA 4JT9A 4U7WA 1EUZA 5SY9A 4UTXA 1E32A 4I1PA 2Y27A 1REQA 3SS8A 5GIOE 2WA2A 4FEAA 3F9CA 1JQBA 3FIJA 3GA5A 1F6WA 5AOAA 4Z49A 1G21E 4YJDA 2DQKA 3SBOA 4MYTA 3BQ9A 2AQKA 1SC6A 3LUHA 4YO7A 5FDFA 1ZDMA 2SCUA 2QUJA 4FSDA 4HB4A 1T2NA 3D3JA 5DO9A 3LUPA 2GPSA 3GLSA 1E3JA 3CKYA 4Z3OA 1YE8A 1U28C 3H7IA 2PL3A 2VAMA 4JLOA 5D3MA 2X8JA 2XF8A 4M38A 1ZH8A 1EG7A 3S3TA 3BFKA 3W6PA 5A4MS 5JYDA 4M1QA 1GRRA 1P29A 4F7DA 1J23A 1TUEA 1B15A 3D3KA 1WZNA 2E1RA 3HN2A 2CE7A 3IAM1 3OFJA 4NV1A 5BVHA 3HJGA 1E4EB 4BZZA 4N6OA 3WNCA 2GVZC 3OPQA 1P0QA 1MC5A 5DYTA 1GGNA 4LDRA 5BURA 3OEED 4HDAA 4LSGA 2OP1A 1L7NA 4DS3A 3TG2A 4E08A 4KNVA 4Q34A 4ND5A 4CG0A 1QB8A 3V32A 3BVPA 4PSUA 4FWTA 2Z4RA 4OCZA 1PQYA 2WLSA 2XKJE 2QMYA 1NUHA 3F98A 4X1YA 2D5LA 4D4HA 5KTMA 4FNAA 1N3IA 2RB4A 3E9YA 3JD2A 4WKBA 2XCLA 2HU2A 5C4GB 1ZIXA 4DLPA 3I61A 2VQSA 5FL3A 5KSYA 1J2EA 4FWBA 1QCZA 1FC0A 1E1YA 2VNAA 3HUUA 3LF1A 4HPXB 4IG4A 4ROTA 3AJRA 1J39A 3GMIA 4Z9YA 3EC1A 3I9JA 4OU4A 4WN9B 3SZUA 2BLLA 3EULA 3KDPA 4YUZA 1SULA 2BTQA 3L4BA 3ZI4A 4H7KA 4GD3Q 3MJSA 1F60A 4KO8A 1G5PA 1WCWA 1EAMA 1GDHA 1GYQA 1QCYA 3V7WA 2X42A 3RS7A 3RHSA 5KDLA 5JD3A 4UFPA 1K8XB 3C1AA 2Z56A 1PW5A 3GMDA 2H9AA 2RB5A 4FONA 1UBNA 3HKEA 4J16C 2OO7A 4PGGA 3QJGA 1RRKA 2XRMA 2W2MA 4X8OA 3AVQA 4ZCTA 2A3RA 4GP9A 1A9XB 1WZCA 4RXUA 4UXHA 4AB1A 5I4KA 3L06A 2N3ZA 4GLBA 4QVKA 4X91A 2PSFA 1WHTA 4AKEA 1OLUA 2OFOA 5EHZA 1QPGA 1XALA 3C7AA 2BPOA 4YHHB 4NZYA 2HLNA 3HJRA 1T0BA 5SV2A 2DWQA 3BA1A 4B9AA 2VT6A 4WNYA 4I6GA 3BQMB 1YFKA 3B52X 2JIOA 4AWAA 10MHA 2Z5LA 2ZSDA 3L2OB 1TD9A 5F21A 3PWZA 1YI1A 3TZBA 2GSWA 3SD7A 4Z51A 4U4AA 5ITSA 1ZM3A 1A7KA 1MEJA 4CDGA 4M1EA 1ECLA 2YYYA 1Y89A 4MP6A 1TAQA 2QMEA 2C7RA 1G8MA 4YLYA 3ECSA 1OLSA 1YH3A 4M9UA 1M8FA 3HL4A 2I8CA 1T4GA 1FVXA 2OE2A 3ZHOA 1ZNQO 4YT2A 4YDQA 5JADA 1CQJB 1UOEA 3LRPA 5CLIA 1I2BA 5SZIA 3A9CA 4GOLD 3UBMA 4CKEB 2I4TA 3NATA 4RV9A 1JKIA 1K0UA 2P69A 3NDPA 5JJ5A 4UAVA 3CNQS 4L2IA 2NNWB 1SIWA 2Y77A 2LIPA 1NXSA 1G0NA 5JXGA 3JQAA 5ES4B 4Q9AA 5HIAA 1X2EA 2OGSA 3NOXA 3EOBI 2J8ZA 3CS3A 4HLNA 4QTTB 5I8ZA 3OPXA 4KI7A 4BNGA 1NM5C 1P72A 1BN6A 3EVZA 1FDWA 1OYVA 3NEAA 4EKYA 2W6ID 5LXTA 1JS1X 2ZB7A 5EJMA 4IDAA 4EWLA 5AOCA 3RVDA 3SJZA 4ZZIA 4YASA 1R6XA 4ND7A 2YRWA 3MWEB 5CU7A 5ALRA 5ALXA 1AQLA 2A9QA 4AZ3B 1ORDA 3N59A 5KJ1A 1YQXA 4LNAA 1Z3IX 5HK9A 4LXYA 5IM4F 1CR0A 5ECYA 4AN0A 3FRHA 4PLCA 4TOIA 1E2EA 5BV7A 4AQYB 3S2EA 2P2LA 3LBFA 4M8NE 3R0QA 1JQJC 4MX8A 3MCTA 5KYXA 3ZVRA 1H2EA 1G8HA 4CKYA 1UK9A 2ESRA 3LLSA 1C50A 4I6JA 4J75A 4BFXA 4DTIA 3FFXA 5A04A 4XDGA 3HUEA 4DLXA 1EUDB 3GT3A 4PBTA 4CIYA 5JZOA 3IB3A 2I1QA 4HWRA 5BN5A 3ESDA 3I5YA 4YMTA 1HT1E 3RG8A 3BC1A 4MKGA 3FF1A 1RIFA 4BKMA 1SBNE 2FV8A 3V97A 4JYPA 5BSRA 2WI8A 4TT8A 4UQPA 3A0RB 1WE2A 1Z0UA 5D3MB 3TKAA 2DPHA 2UXDB 2IVZA 1NR1A 4M0CA 3RVSA 3WGKA 1VDZA 4Y6SA 1G42A 4Z0HO 4QNRA 4I6EA 3UJPA 4L7VA 1UC9A 2EXXA 3BWBA 2CXNA 3A1VA 3GC6A 3I9NA 4OHPA 5HMLA 3R6GA 4IZOA 1Y9JA 2XXAB 5A3SA 4Q24A 3C24A 1MO2A 2V9PA 2R7AA 4CL3A 2JGNA 4CF6A 1PNTA 2CV0A 4BQFA 1J8MF 3HTXA 1E5XA 3RG2A 5EUBA 1EFHA 4HZUB 2YCBA 5BR7A 1N2SA 3NPMA 4FINA 1IZ9A 4KXUA 3TLGB 2DPLA 3TQHA 3B36A 3WGQA 2CWDA 3GELA 2VBFA 4BGDA 2HA7A 4I4CA 2GB4A 2PGAA 2Q07A 4IMPA 1XQ9A 2Y1OA 4TTPA 1N1MA 4BUJA 1RYEA 4YK7A 3N3BC 3LPLA 3R8XA 4RK6A 3AP3A 3NASA 5KNCH 4MRAA 2H18A 3EEBA 4PFKA 4WN9A 2VZLA 1E2GA 3CTMA 4KQKA 5KTYA 3CLUD 3AILA 3C0KA 1ID1A 4KV7A 3AV0B 2HXSA 2GCNA 5EJAA 4K9QA 4P7BA 3IP1A 5DP1A 5FWYB 4KPFC 2FFJA 4A0FA 3KUXA 4XVQA 1H42A 2H52A 1FFDA 2Q5HA 4I1RA 4P2BA 1WL8A 4YCMA 2WF5A 1FTGA 2PUVA 4KEAA 4BVFA 4B32A 3SICE 1XO1A 3CM0A 3ADCA 5EWJA 4RIGA 2PZEA 1Q3HA 3DTYA 3GWGA 2AHRA 3ABRB 5ADUS 2YWRA 1OV4A 1NC3A 1E1LA 2BEUA 3I9KA 1J0CA 3SYKA 2QVLA 4UM7A 3VQTA 3VSAA 5IKPA 3RCBA 3TQIA 1B8UA 2FYTA 3LSYA 1QDUA 1Y9DA 3BCUA 3BWXA 1D2GA 2XSZA 2NVBA 1M5TA 2GAJA 2YIJA 3CEHA 1TW3A 4GEGA 1CD5A 1NL3A 1MO4A 3KOYA 4ARSA 1EX9A 2VUUA 4AM8A 3QXHA 5AJXA 1GU1A 2Z09A 4JOSA 1NRIA 4FC7A 4L8LA 2O52A 5EXSA 5L95A 1V9CA 5ALZA 2M6KA 5I7FA 3SKVA 2W4QA 1EXWA 4TZTA 4EPYA 3BDIA 3LHIA 2QJWA 2MINA 1ZICA 2GAIA 1XN1A 5FBLB 5JY6A 1X7GA 3QX7A 3KJQA 2FSUA 2I8LA 3AX6A 4BKQA 4D9IA 2BGRA 3A8TA 5CA1B 4IZHA 3JYHA 2ZJ0A 5HW0A 3I4FA 2V0GA 1ZK0A 1P2SA 3CPEA 1ZISA 2G5PA 3EXIA 1KHHA 1VGQA 2XXJA 1LQTA 3M6XA 3ON5A 2ZWOA 4FEYA 4M46A 1ZUNA 1KDYA 3N0TA 4E14A 2BFCA 3GZNA 3IXLA 4GGMX 1G8AA 2J30A 4CG2A 2E5LB 3IX7A 1VE5A 3ZDYB 4LKRA 3GGOA 4K0RA 4R84A 3ROXA 4TMFA 1YRAA 1LPSA 1VHDA 3IDFA 1PKXA 5DT9A 1H9CA 1RD4A 2EAUA 4O8ZA 3GCWA 1AJEA 4HYEA 4J1QA 2X13A 5F2EA 5AI8A 2GRAA 1PV1A 2GM9A 2C95A 3TIFA 3CLTD 4MVJG 2QL6A 1PJTA 4X20B 4L7QA 3RU7A 4IDEA 4MDFA 2HU7A 1K63A 3GFRA 4FUQA 4QBKA 4DRYA 5HRUA 3UTDA 1W2HA 2X5XA 1QH8A 2QD4A 3VH1A 4D9EA 1Z0KA 2PKQP 3FBGA 1GTL1 4Z9FA 4G56A 3CN7A 3MWEA 8OHMA 2NPFA 1XTSA 4NBTA 4I08A 4AZ3A 1BWQA 4JBLA 1WULS 2WHPB 1P31A 1SIOA 1QR6A 4CTKA 1U2EA 2OHJA 1V8DA 4KCGA 3EARA 4F1WA 2WM8A 1O94D 1TK9A 4G2NA 3H2HA 1W59A 3HU3A 2QAGA 5CXSA 3DAGA 4MB0A 4LMBA 4Y2JA 1XTTA 2ZYDA 3MAGA 3HB9A 4RHYA 3PNMA 1DIGA 3ZCXA 4WFJA 1ZU4A 1QFXA 3HCNA 5COAA 1JAYA 1SG9A 2W2XA 3WGMA 4DNQA 4UAUA 5HVNA 4Z86A 3B3AA 2WQ7A 1XMOB 3GUCA 4B0OA 4G67A 4D3SA 2CL0X 3Q5GA 1IN1A 2AOVA 3RU3A 1SXJE 1YZVA 2OCXA 1DL5A 3QKUA 5DZSA 1MBZA 1LI4A 1U0RA 4AC9A 1CRQA 3EEFA 1ZD9A 3TSZA 4ABYA 4MYRA 1JLKA 4V02A 5BY2A 4MYSA 3EQ7A 3D7NA 1JDBB 3V3TA 1KI3A 3O7WA 2OO3A 1NR5A 4ZD6A 3SHVA 5B64A 1L4NA 5BMVF 3EH2A 2FF5A 3BSFA 4ESHA 3AP1A 4WOKA 1IG0A 3VGPA 3M1LA 2AG0A 2I1VB 3NDIA 3RV4A 3NALA 1GAEO 3L7AA 4BV3A 2IH2A 5JJIA 3GRAA 2X0IA 4WZZA 3K31A 3WGTA 4M9CA 3PF9A 3IBYA 1Q1GA 1U3CA 2IW3A 3Q9NA 1TQ2A 2ENUA 3LBAA 4GAEA 4LYJA 2VPZA 4TQ9A 1MAAA 4A2CA 4CN9A 3FSGA 1K5PA 2IVFA 1VKOA 3N58A 2DYKA 4HRYA 5BRJA 5LR6A 2J85A 4EVRA 1NV9A 2ZE5A 2EZ9A 1Y8AA 1E79D 4UUAA 4PG8A 1Y5LA 1NMEA 1NVKA 1JFRA 5TF0A 1ORVA 3BD7A 4G1UC 4WUVA 2F8LA 1Y42X 2PYIA 1W34A 1L5WA 3IVCA 5GJWC 5JIBA 3UV7A 4NH4A 3WQHA 5AW9A 1XZJA 2C8KA 3L7LA 3Q7QA 2HMVA 4MKXA 2ACWA 5HUQA 3KAJA 4F6RA 1Z0ZA 1KO7A 3OCYA 2WYOA 3ZIDA 4BZXA 3KJNA 1S2GA 4D45A 1UBSB 4L5IA 2TMGA 1U9ZA 3X44A 1XTVA 3OJ0A 3AV3A 1Y8CA 5I5GA 2XBLA 1DUVG 1JDTA 3LTEA 3P45A 4PCAA 4RH1A 5F1PA 1EAYA 1LV7A 1MXHA 4YAOA 3X2SA 1Z4IA 5KPDA 1IL0A 2FAXA 1V43A 3VYTB 4KRFA 3GGDA 4FYMA 4TL7A 4TKUB 4LZZA 1W87A 4FFLA 2ADMA 1JFLA 2H0RA 3TTUA 2A67A 4D81A 2D4HA 4EPRA 2HRBA 4WCVA 4WZBB 3UJ3X 1LSSA 1O97C 4NHOA 1KNQA 3WLLA 1JHDA 5L7YA 3B78A 4RVOA 2EATA 2ZUBA 2GCEA 3EMBA 1ZUWA 1U4OA 2FW9A 1AZTA 3EPHA 2MOKA 3VOAA 4UM9D 4J1NA 3HNRA 3EIWA 5DTMA 5AW3A 3I0NA 5NULA 4LCBA 4F11A 2ACEA 3RAJA 1J9ZA 2DUMA 4XZ3A 1NWHA 3RBVA 5LQMA 4B76A 5JH7B 2O8FA 1NGSA 4F4JA 3C39A 5I9LA 4L95C 1R10A 1YJAA 2I0FA 1CZHA 2JH8A 2G80A 2DY1A 1TYDE 3OETA 1G6Q1 3SQMA 2C57A 1TKCA 1U2QA 2X5KO 3AY0A 3NLLA 3CZ9A 3PQ5A 5FBWB 5AW0A 3KT8A 4ZDIA 4WOPA 2GMWA 1NONA 2YHSA 3WLTA 2VTDA 4GBGA 4EW6A 2VH2A 3R7WA 1UIRA 4F4DA 5LZ9A 1IY8A 2JLBA 4B6JA 4EUNA 1JDBC 1NLFA 2YXEA 3AJAA 3OJWA 2G1JA 1VSVA 2HH9A 4MH0R 3SX2A 4C4YA 3D4PA 3LCCA 2AVNA 2OUKA 4QSMA 2JNWA 2ZR9A 3CZRA 4RHFA 3N7TA 2WSYB 5CFOA 2I2XB 3I04A 4G97A 2R5NA 3F7OA 3OUTA 2VO1A 5JE8A 1D5CA 3C3PA 4BTLA 5A05A 2G72A 3Q7EA 5FBQB 1HEUA 1JQ3A 2YIVX 1JR4A 3IPYA 4GQAA 3GDFA 2AZ4A 5E1DA 3UA3A 4JLWA 3HDHA 1HNNA 3OEHA 3M3DA 3PR1A 3AY7A 4HDRA 4WECA 1YA4A 4M76B 721PA 3F3YA 3M0EA 5A9RA 1S2MA 2A5YB 5EE0A 5ELLA 2J3MA 1YVPA 2AH5A 2HX1A 2WUGA 4PGMA 4RQAA 4EQZA 2WWYA 1L7DA 3IA7A 2GI4A 4R4JA 3G89A 4DDUA 3UY4A 3WL3A 1ZNXA 5I4IA 2PQ6A 3T9CA 1IVNA 2CDNA 1GLGA 2XNCA 2XNDD 3EAQA 1P0FA 1RLOA 1RRFA 3H6GA 2AV6A 2VRCA 1IXRC 3IHLA 4MKHA 1YRHA 1N5JA 3X1XA 3NHWA 4RFSA 2UUBB 2NSLA 3H2YA 3K7EA 5C8YF 2DETA 1TRKA 2GEFA 1CZNA 4HFRA 5KUTA 3OU2A 5L8VA 1N5LA 2ZATA 3W9BA 1LPNA 1DEKA 1C2YA 2NT3A 2XE6A 2HN9A 1PZNA 2HPAA 3WFIA 3LC0A 1QRSA 3AUFA 5B36A 2JL1A 1YVRA 4RFLA 2ZWIA 1E6WA 3OZSA 2WOOA 3TB4A 3GT4A 1MLDA 2PSEA 5SZKB 3FLBA 1GWNA 3OZCA 1QE5A 2HV9A 5H82A 3EZYA 2HRDA 3M4ZA 2HHJA 4FCWA 1ISSA 4WSOA 2GN2A 3C16C 3HDTA 5FTJA 4WLEA 3O4IA 4TT3A 1ZCZA 4W9RA 4YRAA 3BL8A 5T6MA 3HWSA 4C0JA 1K75A 4EFLA 2WKRA 1I4OA 4IIXA 4RUKA 4DBLC 1J5EB 1UBOS 2YMMA 3ZIAA 4OHBA 4B4VA 3OQNA 2TMDA 1K97A 3OOYA 3DYBA 2BY4A 4JI3B 1ZIPA 2DSNA 3GD7A 4H6PA 3W04A 4YCLA 1TMKA 2ZRHA 4U8GA 1KVRA 2ZDGA 4GKBA 5JDCA 4MW2A 1EUCB 2F43A 2JJMA 3TJZA 1SC3A 5H02A 2HQOA 5F7XA 1XTBA 1A95A 3CV3A 3T4EA 4YV0A 4UC0A 3MLBA 2FE1A 3UO8B 3WADA 3CIFA 2ALJA 1C8BA 4IW3B 2VJYA 4K40A 3RUCA 1FZTA 1L7VC 4MR8A 1K6XA 2OD2A 1QO7A 2XWSA 5A4IS 1O94C 3BGSA 5B1HA 5DW0A 1V1RA 2WYIA 5FP0A 2F4VB 3EF0A 4IHAA 3O8OA 4DGQA 5CT4A 3BIWA 1XL1A 3OUUA 3IR5A 5BOVA 2B9VA 1N2HA 1DJMA 1J97A 2P4HX 3DOJA 3HPQA 2PO7A 1E4OA 2ZGVA 3OY2A 3PX3A 3X43A 4E0BA 1XAHA 4WLOA 3F8TA 2Z6UA 2HBZA 5KNBD 4XAQA 2NXJA 3IC5A 1HXHA 1XAJA 1PP4A 1WQ1R 3L7BA 1PCXA 1BQ4A 5TVKA 3TINA 3MWFA 3NDJA 5C31A 1E61A 3IBCA 4NOKA 5I9MA 3NFRA 3IEVA 4DXDA 1TFUA 1XCBA 2K87A 2QTMA 3OO1A 3R74A 1KMNA 2QKYA 4NFSA 3NUQA 2AQ8A 1SVOA 2VSOA 3E1KA 3WGZA 4C4AA 1O96A 5GWXA 3ZLJA 2Z1MA 3L6BA 2C59A 3DB1A 4OXRA 2AOUA 4TRJA 2G25A 1CVLA 2IEAA 3MW8A 5E3JA 4NEHB 1NF8A 2Q6OA 1GVNB 4OXYA 2WIFA 2FEWB 3LK6A 3LY9A 2XZLA 1FSGA 3QXGA 5CH8A 1C1YA 2M9MA 4MMZB 5ALHA 1Q5PA 2R47A 2KBFA 4HBGA 5EE5B 1WHSB 5IJ9B 5BR4A 1OY1A 2CF6A 2EW8A 4Q9NA 3R7WB 4E4RA 4EP1A 1DKNA 2W5UA 3CE9A 5DNAA 2VJQA 2W70A 3CWZA 5F77A 3ANNA 2YJ5A 3H11A 2F59A 3W2FA 4B1FA 4C4ZA 5L3SA 4QVIA 4CMEA 5K2OA 3AF4A 1SGWA 4F4IA 5I7UA 2Q28A 2DFNA 4IUBS 3VU8A 4CU5A 1H23A 2OD9A 2FP3A 4O25A 1VKJA 3NORA 2NXCA 4MUIA 3I9MA 1X9GA 4LXIA 4I1IA 4TSRA 3ABIA 3UC5A 3FCXA 2XW6A 3VDNB 2I7VA 1N6KA 1YUBA 3L8EA 4QDTA 3N07A 3TM5A 3WK9A 5AD1A 4O4IF 2H2DA 2YJGA 3ZDRA 4NFHA 2AWOA 3BK7A 5DIFA 4HAUA 3AJDA 1TPZA 2HSEA 5AXCA 4ZVPA 2AKEA 2FPRA 5AVYA 4CXMA 1CP2A 1XTPA 2R6CA 4ZVOA 4HLCA 5JBNA 4CUZA 4H7IA 5EJ9A 2FN8A 3I05A 4H4CA 3G8AA 4RZXA 4JQZA 3VDXA 1IWOA 2I9PA 1YCHA 1H6AA 5TE9A 1N2GA 1NN5A 1IATA 2NYVA 3OFVA 2BI7A 4Y9DA 2I2AA 4DIKA 4EA8A 2G28A 1UPFA 4O1HA 4IFTA 1E3QA 4M7WA 4ZRNA 2IV7A 3O1HB 2CMDA 2OORA 1WY5A 4NJMB 5AK5A 3ER8A 3TX2A 3T5BA 4MYCA 3LPCA 4AZTA 4KO2S 2CB0A 3CNHA 4XB6B 4L28A 5DNYB 3THYA 4ZCMA 1W4RA 4LJKA 2PLAA 4HUJA 4YMLA 1U3GA 3FKSA 5IDWA 4ZCPA 2YR0A 3RRYA 2YTZA 4HI0E 3RIXA 2JFVA 2FZGA 1GPAA 3AHFA 3G7NA 3OHPA 2WWFA 4N7JA 3D6FA 4NDZA 3LGSA 4Q7EA 4OSOA 1EDOA 4II7A 3RRFA 2RBGA 4BCDA 4UOZA 3S2YA 3GXOA 4DZRA 4WZAB 3F97A 4N5LA 4RABA 4N40A 2C4MA 1HLDA 2QG4A 4ALKA 4C87A 3TAHA 2A78A 4KPYA 2PS9A 3AK4A 3EAGA 4M0DA 1PS9A 4OI2A 2JF0A 2ZSBA 3CF2A 3QI2A 5IAKA 1IBRA 1M2EA 1X19A 2AE2A 1FP4A 3AUUA 1NQOA 3BH0A 3EDYA 3DB2A 3IQXA 5I7AA 1XI2A 5JV5A 1VG9B 3BGWA 3JZFA 1CJTC 2OC4A 1H1DA 2PU7A 2R6DA 3DT6A 3Q2IA 4NCXA 5JSKA 2VRWA 3FTPA 2WG0A 3QOXA 1JFFB 1FP2A 2CLKB 2F43B 2UYOA 4REMA 4ZTBA 2GXUA 3X1DA 4LWPA 1M76A 3ITKA 4BEBA 1W4LA 1N5DA 1PFYA 3T1OA 3RM3A 5AVRA 5IHXA 3GGGA 3DW1X 4W7SA 2GAFA 4YDRA 5DHTA 4BV2A 2O3RA 4DA7A 4AY6A 1YQDA 1L9KA 2RMKA 3RTBA 4N3CA 4AYXA 4JJAA 1JZSA 4O4HA 4WZ6A 2EBWA 4O2BB 3ODGA 2CXUA 4D8TA 3K70D 2ERXA 3WSTA 5AJTA 3MUFA 2JD1A 4HUQA 4F5ZA 4K3UA 1G8SA 3BEDA 3DJYA 4FD2A 3ICEA 3L1UA 3E48A 1NSFA 3CBQA 4DWOA 2P9JA 4HLQB 5CVCA 1P45A 5EEHA 4ITRC 3B9RA 3F47A 3ZZNA 4EDFA 3WSVA 1M1UA 4B79A 4KAXA 4CKCA 1JLRA 3F6CA 2HPHA 2G07A 1DRUA 1RYDA 4JP3A 3FWHA 5U1PA 2B6NA 3BWEA 4FGWA 2PKCA 3VDQA 3MA0A 3QQ5A 3WB1A 3T0GA 3IBSA 3KDAA 5ALUA 5EWLB 3CNBA 3EC7A 4HQ0A 5BPFA 4P22A 2R1TA 4NCAA 5TPZA 1UADA 2IP4A 1FX1A 1HLGA 4DLUA 2R4QA 4HEQA 4BWYA 4YYEA 4DMCA 3PGMA 4PCUA 5L3ZA 1SWVA 4YCSA 5CJPA 1KYZA 4RKEA 3SSNA 2R8BA 4EYSA 4G65A 3PC3A 1NQVA 1TKAA 3PEFA 3EGXB 1QO9A 1Z4JA 3P2IA 4QHTA 5AO9A 2WYUA 4LSZA 2VJCA 1VCHA 1ZGCA 2WKWA 2XECA 4OREX 1LVUA 3WYGA 2C2OA 3KQKA 1V8BA 1H93A 1RAEA 2O2XA 2OPBA 5F2OA 3ONWA 4MAMA 1KEEA 3IE1A 1S8NA 5FTKA 3UEOA 4HMOA 1SM4A 1IPFA 2AG1A 1Y3CE 3DA8A 4PYRA 4RA9B 2M6LA 1EK1A 2IUYA 4HWSA 4C4XA 2YUTA 5FWXB 3B1VA 1UZNA 1SXGA 3MUEA 4UDOA 1DDOA 4L4UA 1KEPA 3QOWA 4RHTA 5I47A 4KI0A 1NTRA 3MS2A 3U3DA 4LF5B 1TA9A 3IT1A 5I7EA 4MJLA 4HVTA 5JLJA 2PVSA 2C5HA 3EYAA 4MZDA 2JAHA 1VDMA 1M6YA 1RWKA 1T8UA 4H4DA 5GONA 4QEZA 4P1ZA 3FIUA 5BNFA 4MUHA 4XUCA 3RWBA 4F0JA 2X4LA 1RXCA 4XWWA 1NLYA 5DOZA 4LIPD 4DWWA 4Q3OA 5AW5A 1AK2A 5JZSA 4TMXA 3PNYA 3FDZA 3WMGA 5CDFA 4HH4A 1O95A 2NZWA 2HA4A 3K2IA 1X7WA 3K1ZA 4K8RB 4CLEA 3NV9A 1V41E 2GZ2A 2XUFA 1NXOA 3IUSA 3MTAA 2PN1A 3MS7A 4GZ3A 3B1ZA 4RX1A 5G0VA 3SOPA 1GL9B 4C29A 5HXAA 1I3NA 1Z18A 3LKBA 3VYWA 5LMUB 1LJ8A 2H7XA 5C7OO 3TE7A 2RH8A 1FFWA 4PYKA 1U1EA 2FZWA 3AHCA 1M2FA 4EGSA 4P7FA 1JG4A 1O2DA 2O2DA 4QARA 4R3UC 4LXGA 2GJ8A 1IEVA 4M22A 5DIZA 3UJNA 1YR9A 2AEJA 1GADO 2G1AA 1Y5MA 4G0QA 4DF3A 3JRXA 1JE0A 4NZZA 3JPYA 4GH5A 5CVTA 3QKRA 4JODA 1QRDA 1KKLA 2V9CA 4XD7A 1YU6A 2H2FA 4EPTA 3REGA 2BMAA 3O5AA 4Y6QA 5EMHA 4BO1A 1KI6B 2RHLA 3FYHA 2JARA 4RETA 3BJMA 4KLRA 4PHGA 3R0XA 1Z2AA 2IE0A 3HWX1 1UXJA 1R8QA 3HUDA 1PR9A 5DKFA 1MQ9A 5KJCA 2VYCA 3GLGE 4FJ2A 4LJAA 1ZH2A 3DAOA 1CY6A 3L84A 4N03A 4D0NA 3U3JA 4HGOA 3ES9A 1TU0A 3E3NA 3QE3A 4N0MA 4NAUA 1E3WA 2X22A 1SG0A 1FFXB 2VHUA 5BV2P 2VLIA 2XCSB 2QV0A 2I34A 1U65A 4PWZA 3TNYA 4AKIA 4V39A 4MVJH 4JCOA 1NW5A 1W5SA 1Z6XA 4LJLA 4LV8B 4OI1A 4P5PA 1OCEA 4YBRA 3L8ZA 3V2GA 3QMVA 2M6SA 3W79A 4G5GA 2MWMA 4GKJB 2KS6A 2H1CA 4YAGA 2HMSA 2Q5FA 5KVCA 5FUMA 5BN4B 1L5MA 3CURA 4QGGA 5EY5B 4DV2B 1T3GA 2NV0A 3I2FA 4MV0A 1PW7A 1CEXA 1WEKA 7GPBA 2XMZA 1TMGE 2BW0A 2OKGA 4FHDA 4XSVA 5KOHB 1PR6A 3RUFA 5E6RB 3PRKE 2O1EA 3ZE9A 4CKBB 5ERXA 4OP1A 1N9GA 1JB1A 2G67A 1J9GA 2OCBA 4DG5A 4TVBA 1GV1A 4PN7A 4DSUA 2ZJFA 1RPNA 1GNPA 3KV3O 4FOLA 4O2BA 1IVYA 2WP8J 4GQIA 4HUQB 4U7TB 3NH9A 2B20A 4LBWA 2PH5A 1T1RA 4BNYA 1UM9B 3EVAA 3OZ7A 5G3YA 5KJ6A 1UBGA 4CFSA 1Q1AA 4ODIA 2RGGA 5TT0A 5ALFA 3EZ7A 1B6GA 1U04A 1WVGA 4PW0A 5H81A 4AS3A 4Q3KA 2PLFA 3IP3A 4IEIA 4LDNA 5FTMA 4Q16A 3GOQA 3IHKA 5CT6A 3W1EA 1JQDA 5AHOA 1YB5A 2WA1A 4JJ4A 2GS9A 4RIFA 1F1JA 1NVFA 5D3KA 3KBOA 3SWWA 4FGJA 4AF8A 3ODPA 4BQNA 1Z5WA 1Y7IA 3VC1A 1Z4OA 3AVPA 2EV9A 4IX1A 1KZ4A 3K05A 3ZQJA 2WOJA 1W96A 3DAFA 3GYGA 3LYLA 4ARVA 5TT1A 4FNGA 1KRXA 2G6BA 5F1KA 3QVLA 3VOSA 1VRCA 3SBDA 1K4KA 4LSWA 3I01M 5BSGA 1LVGA 2PRSA 2WTXA 3JYLA 3O6VA 5AJWA 1NVEA 1KOFA 3VA7A 5HDQA 2VG8A 4AYTA 3ZZTA 4IEEA 4DMMA 2VJBA 2A9FA 4WNIA 2O5EA 1OH8A 4QNMA 3T52A 4DARA 2Z5VA 3M3HA 1G6HA 4LA4A 2ONZA 3K1JA 3L6EA 1JI3A 2XCQA 2HQSA 4URFA 2PWYA 1WJGA 1H3FA 3OPMA 3AUYA 1A8IA 2GLTA 3QFTA 5DX1A 4Y9UA 1THZA 5T6BA 3SAJA 5HRAA 3C6BA 1RXUA 4IJKA 5BQ5A 2B3DA 4YB8A 1RLUA 2EGGA 3RFVA 3TLYA 4F9FA 2CBXA 5KWSA 1PWYE 1TO6A 4DUYB 1YACA 2UVPB 3HO6A 4AJPA 4TLEA 1EFRD 5T4BA 4XLLA 3B5EA 3URMA 3DMGA 1F3OA 4HBZA 1UK6A 3RIHA 2XTNA 3OD1A 5CVEA 5GADl 4DG8A 3DFZA 3RUDA 1G8JA 1NBWB 3T7KA 2DC1A 2ZPAA 3IR7A 4C3UA 3AM1A 4KHPB 4BJ5A 3TD6A 3KKZA 1Q3TA 4F2PA 2Z5GA 5C53B 3FG9A 3D8RA 4NABA 4X24A 4WW0A 4P6VF 3GDWA 4R5HA 5A4AA 4RLFA 3DOCA 3STVA 3T35A 3G5LA 5HZKA 2H48A 4CEIA 2PT9A 4FMBB 5J43A 1PE0A 1W44A 3OPYA 2C8VA 2WWXA 2H1FA 1PI3A 4MO9A 1TEZA 1MB9A 1O5TA 4QTXA 4Z3DA 2Y6UA 1QF9A 2EKDA 3QLUC 3UMSA 4MUYA 4BUCA 3ZD6A 4K86A 3M4XA 4N41A 2W2LA 4KSCA 1KZGB 3W77A 4B4OA 1RQ7A 3CGGA 1XZDA 4TSKA 4NEGA 4ENTA 5AUNB 4JDUA 4DCPA 5FH9A 3VKVA 1E2HA 2ZIXA 2X23A 3WISA 5KYKA 1ZMBA 3E8SA 3KCNA 4RTNA 2ID8A 3INRA 2ATCA 2Q5LA 4MKIA 4RD2A 5LQRA 2HLDA 3LUFA 3UAXA 1G2QA 1K6IA 1T9GR 2D5BA 3PNVA 4OB8A 4PR3A 3UA4A 2YQZA 5IYZF 3Q8MA 2PQMA 3K96A 2JBAA 4INAA 3THWB 1NV8A 1GT6A 3LQKA 4I5IA 3QVKA 4FYXA 4Q18A 3WBBA 2O2JA 3GFTA 1JKJB 3MTJA 4QOFA 1FFXA 1JJ7A 4JP2A 3H1BA 3D4BA 3PR2B 3T9EA 3WKBA 1WU8A 1I6WA 4UCFA 4IIUA 4A91A 1QZUA 4CIVA 4D5EA 1YB7A 4BEVA 1T1EA 2J46A 3WJ1A 3L40A 1JP7A 1C3JA 1NQUA 4FM9A 1FU4A 2J3DA 3G9TA 3EIOA 4BTEA 4B7AA 4FFMA 1Z36A 4S35A 4B74A 1FFEA 3RRZA 2ZLBA 1QNFA 2B2NA 1N4DA 3BMCB 3I4CA 3JWEA 3PGKA 1U63A 3EXEB 4EI9A 1JEJA 2Y68A 3ANXA 1U4NA 4RMJA 2PZMA 2ZZMA 5IM4A 1RU3A 1NE2A 1G16A 3IHTA 1ZC3A 2W7TA 5E6RA 4CKBA 5K6AC 2OCLA 2HIGA 2BJWA 2ZKIA 5C8VA 2BHSA 4LYGA 1BMFA 1W30A 3BHNA 1DQSA 4BLRA 1B0UA 3B2EA 1F2VA 1S8OA 1S9HA 3SJBA 4DM3A 5GTDA 2FPSA 5J47A 2R48A 3QEMB 3VKHA 1JIUA 4QIHA 4WL0A 4BP8A 2H08A 1PF7E 2YXDA 4NIMA 2QRUA 4ZJZA 1RMYA 4NWIA 4LHSA 3PA8A 3PQ2A 4MIKA 1R4NA 4WXPA 3V2IA 1BDHA 3GARA 3ZNPA 3GA7A 3RVNA 4NJEA 4D5GA 3VPFA 1V5FA 1XWWA 2BFOA 4GPTA