3BS4A

Crystal structure of uncharacterized protein ph0321 from pyrococcus horikoshii in complex with an unknown peptide
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
253
structure length
245
Chain Sequence
b'SLSWEIEELDREIGKIKKHSLILIHEEDASSRGKDILFYILSRKLKSDNLVGMFSISYPLQLIIRILSRFGVDVIKYLENHRLAIVDTFGSFHGIMPGVWYLEGMLSSETLPIKYAKAVEDHKKVWMDLNLFEGRELYGFAISMSGYLEVFTPEETLRYLETSAEVRYGHPAYKKYPRGTNFWLWEGVKDKRVLLSVYRRADYVLKTRSSLGENGIKRELLVIKTPKVRFEYEFKGNEPKLRREG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein PH0321
publication title Crystal structure of uncharacterized protein PH0321 from Pyrococcus horikoshii in complex with an unknown peptide.
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
total genus 96
structure length 245
sequence length 253
ec nomenclature
pdb deposition date 2007-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3bs4A00
4GNKA 1DAHA 1XTRA 3T1VA 2QP3A 4RY2A 2RGCA 3CRRA 1U0JA 5SZKB 2R6FA 2BJWA 3SEAA 5BN4A 4B2LA 4UQOA 4BFXA 4DIDA 1LVGA 2B8TA 2ZRKA 5SZIA 3TIFA 1TL7C 1N2CE 4OHVA 4E22A 3K0FB 4R2HA 2AL7A 4PQYA 3RS2A 3GPLA 1RE0A 4HZIA 1JR3D 2OCBA 1M7GA 5EE9A 5TV2A 1MABA 4POAA 4Q21A 5C1BA 3QKRA 4M1SA 3IHLA 2F7SA 3KKMA 5J4KA 4WZAE 3AQ4A 4QXAA 1JALA 1W2GA 1NBMA 1KI2A 5DIFA 4V0MA 1VCMA 2GCPA 1QVAA 2RGNA 3THYB 2JCSA 2UZ3A 1M7BA 2HT1A 4PHFA 3HDTA 4DCTA 1I4DD 5FPSA 3LBHA 4TLDA 4D4JA 1W46A 4YDSA 4B43A 1XB2A 4EJSB 1OLOA 3A1TA 3OE7D 4OQLA 4HI0E 1OKKD 4IDQA 2YYZA 5KSPA 5EUQB 5EP3A 4XJXA 4QBIA 2IUUA 1IY2A 2QM7A 3CH5A 4HSEA 4LPKA 3LO5A 3KJEA 4QOSA 4EPWA 1J8YF 1YRAA 2VBCA 5EZ5A 3O8BA 4JJZA 4XIGS 4CIDA 3K0SA 4FWTA 4CZ2A 2IS4A 1N6LA 1IN6A 3ASZA 3AUYA 2GVDC 3FE2A 4OHWA 1JXMA 3TKLA 3W6NA 3F0TA 1H8HA 2FDCA 2AD5A 5FTJA 4PO1A 3ZD6A 2DFLA 2J7KA 3GLIB 2DFNA 1GKUB 4TT3A 5AJXA 5C2JB 1A2KC 4NCJA 4RKEA 3EARA 4A4DA 4OI2A 3WRYC 4DSUA 1IN5A 2AK3A 1F5NA 2H17A 3C16C 3GJ7A 4KJZA 3GFPA 2CNWD 5CJPA 3QG1A 1ZIPA 4LYAA 1UJ2A 3KTAA 4DLUA 1ZVQA 4QBHA 4LHXA 4QGHA 1KY3A 4W5HA 3IBGA 2RGDA 4AIIA 1P6XA 1XEWX 2WMOB 1Z6XA 1BO6A 1X1SA 4HB3A 4DLXA 1MKYA 4DSOA 1RIFA 5C18A 2WJVA 4FW9A 3BOSA 1NVUQ 1E2HA 4JBWA 1OSNA 4MYUA 3RABA 3FMOB 3TVDA 5ELXA 4PPQA 2PMDA 2RB4A 3UK6A 2VP9A 2GEDA 2XITA 1JB1A 3L8YA 3ZIAD 5EZ6B 3U7EB 2NTYC 4DBLC 4NU0A 2AXNA 3B85A 1ZUNB 2JJ2D 3DDCA 3TR0A 5L3SB 4LJ5A 4HB4A 1XMIA 3CPJB 4KAXA 4PPGA 4A0GA 3R7WA 3BE4A 2CJWA 4PSKA 4YC7A 1XD9A 2WAYA 4RD6A 2GXAA 3QXSA 2IA5A 3RWOA 2OLJA 5F9HA 4XOIA 4NCHA 3PENA 5H1YA 4HLQB 2IF2A 3G5UA 2IYRA 2FGKA 1VDZA 3ZZ0A 1QDEA 1KJWA 3OEEA 1DADA 1N25A 1Z2AA 1NI3A 3VR2A 5B64A 5J4VA 3BH0A 5CITA 1WB9A 3SYKA 2GBLA 2YZ2A 1JJ7A 4OI1A 4HB0A 3QY0A 3UWKA 2ZRPA 3ASYA 1DS6A 3UANA 2PLFA 1GITA 2XOKA 2NZ8A 3CNLA 1R0XA 4FCWA 4Q9IA 4DDUA 3BGWA 2PCLA 4LYHA 3K9HA 2ZU6A 5C46F 4DUGA 4PC6A 4Q7LA 5DH9A 1SXJA 4QKQA 5P21A 2J87A 2HEIA 2Q9AA 4OK5A 3JVUA 4JBYA 4ASUA 1H65A 1HUQA 5FBRB 2ZS7A 1YQTA 1YRBA 2DFTA 1LY1A 2C78A 4CEJB 1II8A 4D0NA 3C14C 1AZSC 4AC9A 3EC2A 4IOJA 1PUJA 4Z8XA 1QF9A 1E2FA 1XXHB 2I1QA 4X8HA 1COWA 5FL7D 1Y3AA 2A78A 2DHRA 5JEEA 3NWJA 3PVSA 4M21A 3GJ5A 4NE2A 1UDWA 1SHZA 1YR8A 3FFAA 2P67A 4GOJA 4IEEA 3SYLA 1CR2A 5AUOB 5D3QA 2YINC 3PG5A 4QGFA 4BFWA 4B71A 2V1UA 1XJ0A 2IT1A 5BN3A 1NSFA 1W36D 4LBYA 3VX3A 2XNSA 3AF1A 1P2SA 3PUZA 4I1UA 2CK3A 2NPFA 4YMVA 4ZDKA 1KAOA 4PQFA 1RRCA 1KHTA 1T91A 2V7QA 2O8DB 3QPWA 3AM1A 2BBWA 3AKDA 1GL7A 3AP2A 4ACAA 4BFZA 1HQYE 4G3XA 2JLVA 2HLDD 1HE8B 2B6HA 2HXSA 3QBVA 1OXVA 4AK9A 1DE0A 3G82C 2KE5A 1BS1A 2FPKA 1FMLA 1G7RA 1N0WA 1W5SA 3WP1B 3NBXX 3LX8A 4AKEA 5F98A 3G0HA 3ZGXA 3CM0A 2W6JD 4RD0A 1GM5A 3EZ2A 2CVHA 2IX3A 4JKIA 4C2TA 4HUQB 2QRNA 1NNEA 2O0JA 1N0UA 2QP9X 2D7CA 2VHJA 2X2EA 4TYQA 1YZGA 5EE5B 4LHWA 3TBKA 2JLYA 4NH0A 2FEOA 4OQNA 1E79A 2O8BB 3TJZA 5JHHB 4D81A 2QT1A 4UXIA 1RYHA 3A58B 2GXQA 5EXTA 3B7GA 1OIWA 1Q22A 3QXHA 2EYQA 2IL1A 5CIQA 1FW6A 2NMVA 2GCNA 1US8A 1KMQA 4V0ME 1KSGA 2ZR7A 4EPTA 2O8EB 3CX8A 1KI7A 4AYTA 3U44B 1HYQA 1EGAA 4M9SA 4KCGA 4L9SA 4JLKA 4ZCLA 2ODEA 2F1RA 2DBYA 3MRSA 3QF4A 1JXOA 4R7ZA 1ZRHA 4DDTA 3FKQA 4JLVA 2FG5A 3K53A 5L3RA 4DCSA 1AJEA 4LV5B 4C0BA 3B5JA 2OILA 4TQAA 3OHMA 3OZXA 4GZLA 2QI9C 4YMSA 4F38A 4P3YA 2FFHA 2GZDA 1NBMD 1GTVA 1FNNA 2Q0HA 4TMVA 1NIPA 1T9HA 4C7OA 3RYTC 1QHSA 5B30A 1GILA 1QRAA 2IYZA 1XJQA 1KKLA 1Q20A 1IJFA 4HUTA 1P61B 3WMGA 2C2HA 2RHMA 3E70C 1VYUA 3KFVA 5AJYA 3TSWA 4X8MA 5KSOA 1JEDA 2C99A 3LX5A 2WSMA 3X1WA 1GL6A 5FOSA 2AFHE 5FL3A 1Z0JA 4JT4A 4BRWA 4GPTA 1DAMA 3NTUA 1E2KA 1S1CA 1VYVA 3FHOA 2YKGA 1UKYA 1GNPA 3VMFA 4UKDA 1GNQA 1XTIA 2QE7A 4MUBA 4PHTA 5DI9A 3K8YA 3QKSA 4QJ4A 4RCYA 5L3QB 3EPKA 4ESVA 1OF1A 1UEJA 1H8HD 1R4AA 2GJSA 1KI8A 2QPAA 4NP6A 1ZM9A 2DB3A 4CEIA 2CXXA 4DDVA 4TT3D 3HU2A 4D0GA 4Q4JB 4B6FA 2KI5A 1UBCA 3NXSA 3O47A 2ZJYA 1SZPA 1TEVA 2FFBA 1EFTA 2G1KA 4TYNA 3SQWA 2IS6A 3LBIA 4MRNA 4FCTA 1Q3TA 3FTQA 4G5GA 2ECKA 2I4IA 5GJWC 1WP9A 3QKTA 2PT5A 4OHXA 2VSFA 3OEHA 3FGNA 5JBQA 1SKQA 5TMPA 2QORA 1VIAA 4EQ6A 2FOLA 5LPNA 3WRXC 4ARZB 2AN9A 3Q5DA 2IHYA 3ZDQA 2P6RA 1G5RA 2G0NA 3MLEA 1E3MA 1KMHA 3RS5A 1U99A 4PO8A 1QHXA 5K8TA 3QXCA 1G16A 4F93B 1VIYA 4MA4A 4P4SA 1G3IA 4EIWA 5HR5A 5KTYA 3BK7A 1OE0A 4M4SA 4BEJA 2GCOA 4YLGA 4NCKA 3AH8A 2C8VA 3GLHE 4FCVA 4B35A 4TMWA 2P6NA 2QMOA 4WXRA 4KVAA 5A0FA 1VECA 2ZAOA 1GSIA 1KJYA 4JLJA 3RVBA 3Q8XB 2GXSA 2YOGA 5JWHA 1KO7A 4A8JB 1SVIA 2XSZD 4LI0A 4OK6A 2EVWX 2ZRNA 2BDTA 3U7HB 4I1VA 1M6NA 2RMKA 1DVRA 5JCZA 2IS2A 1VG9B 1FPMA 1XPRA 4DLSA 4LJYA 3UXMA 2CBZA 1YR6A 4GOXA 1YZKA 2CLSA 3CW2A 2NO9A 2F6RA 4OYHA 1MO4A 3IQXA 1P9RA 1SXJE 4MGYR 2ZYWX 3OEED 3VAAA 3HP1A 4QG7A 4RZ3A 4B2PA 4URZR 1Z0DA 4TQUS 1W36B 3CB4A 1SKYE 2ZIAA 4FN5A 1S0UA 2GESA 3KB1A 2X8AA 3H1TA 3THOA 1WQ1R 3KXIA 3K0CC 1E4VA 2XOKD 1OXUA 1W4AA 3NBZC 4GL2A 1LNZA 3FVQA 4IDOA 3QEJA 1E99A 4LJAA 2YVUA 4PAQA 3SFZA 4DUGD 4PR0A 2Q21A 3V4FA 2MMCA 2F43A 4P32A 3EIQA 1KDRA 4Z8YA 3U3RA 4RD3A 4BFVA 3D3QA 2IC5A 1Z0FA 4ASUD 3AVTA 2FEMA 2BEKA 2REOA 4M0LA 4FINA 1IQPA 3T61A 1JR6A 1TU3A 2JAQA 1DAKA 2QL6A 3CWQA 5HE8A 4TYYA 2N1BA 2IF0A 3LXRA 2JIZD 3VHLB 2GEVA 4LOAA 4LYFA 1OPXA 3AP3A 1T5LA 1U9IC 3WMFA 1XF9A 2CCGA 2OCAA 1X3SA 2V6JA 4W9MC 4QRHA 1G3UA 4Q4AB 1CU1A 1KSHA 4TQ9A 3SI7A 3X1XA 2HV8A 1J8MF 1COWD 1R0YA 1KY2A 3B2EA 3OE7A 4BLRA 4IXNA 2YOHA 1S9HA 1E32A 3C4JA 3ADKA 4MKGA 2HYIC 1G20E 1UAAA 2ZRFA 2H1LA 2WKRA 3ADDA 4QL3A 1VCOA 1LW7A 2AWOA 1R5OA 3NC1C 1B0UA 4IJMA 3A4LA 3T1OA 1FTSA 2MMGA 2IXEA 3BWDD 5E3HA 4MGIR 3KUCA 2CK3D 4LV6A 1L8QA 3Q7PA 4HLCA 4PANA 1NY6A 4BRUA 5EXSA 4E07A 1N0VC 3CO5A 2RGBA 5BYKA 3OESA 4D80A 4LZZA 3KDSE 2PJRA 4AI6A 1XEXB 1G8HA 3L0OA 1MO6A 2GVZC 3MMPA 1XZQA 2KWIA 3U3MA 4LCBA 3D31A 2NIPA 3B1WA 4IOLA 2AD1A 4JL8A 5CLLA 3B1XA 4Q4LA 3DPUA 2JLSA 3L8ZA 3IIMA 3KJIA 3CRW1 3P32A 4MKFA 5TARA 2QQEA 3SR0A 1WBDA 3K0EA 1VG0B 1OFTA 2CLDX 5DHAA 4EPRA 1N5KA 3T06B 3QQ5A 1ZYUA 1J70A 1Y63A 1W7AA 1KGDA 3R9IA 1MO3A 3I61A 1XJCA 1E9DA 3DHWC 3P20A 5E95A 1IXRC 1NF3A 3SU8A 2BMJA 4TWZA 3CF0A 1U98A 3QEOA 1XMJA 2QUZA 3MUFA 3NEJA 5EXXA 5EXPA 2ZSFA 2JJ2A 5FOUA 1AKYA 1YZTA 4US2R 1XTJA 4NCIA 1U90A 2D74A 1UKZA 3LW8A 2FWRA 3THWB 3IEUA 1Z0IA 1QHHA 2BMEA 4HZUA 3WY9A 5F9FA 3VR3A 2BM0A 1G9XA 2PX3A 4QGGA 4JKYA 4IDPA 1AA9A 5FI0B 2D7DA 1KZ7B 3GLGE 3U60B 3Q72A 5TY0A 3RDPA 3AP1A 2J9RA 821PA 2ZE7A 1P75A 4UNRA 3I3SR 1NP6A 3LFUA 2JLRA 3GEEA 4LHZA 1E69A 3BJIC 3KL4A 3V4RA 3KXKA 5IT5A 5UKDA 1W1WA 1SVSA 2R6DA 2O8CA 2B8WA 1OFUX 4PX9A 3UWOA 2E1RA 3LBNA 4MRSA 2OM2A 2VHUA 4ZI2A 5GADl 4WVFA 5JMTA 2A5YB 1BMFA 3BD9A 3QPUA 1U8ZA 2PZGA 3CPEA 3TAUA 1WXQA 4C4PA 1SGWA 3CZQA 3EPLA 2J45A 4RJLA 2WTUA 5CDFA 4LPSA 2WWHA 3WXMA 4CGZA 4Q5IA 2NQ2C 5JSZB 1W4BA 4U5XA 4MGKR 1G5TA 1K6MA 1TQ4A 5H68A 1G18A 2BOVA 3MWYW 4KO8A 1DPFA 5EE0A 1UKEA 1KKMA 2CJWB 3IBYA 3ZQ6A 2WWWA 4DSNA 2V6IA 3VKHA 3GLHB 3RS7A 4NYJR 2F3TA 1R6BX 2ANBA 1X6VA 4A8JC 5JRJA 4EAQA 4PZLA 1E96A 4PSVA 2XB2A 4RVCA 4JVMA 4HLUA 1P7CA 4G0NA 1L2TA 2VSXA 4Q9JA 4Q1BA 2ZJBA 1JAIA 2ONKA 3UKDA 4L15A 3GFOA 1I2DA 2PCJA 2ZUCA 2IWHA 4B3FX 3NVAA 5JCPA 3OAAD 1ZNYA 1NN5A 3MJHA 4LYJA 4DLZA 2FN4A 3TUZC 2B7BA 2QU8A 2VLIA 3ZLJA 4HAUA 3CWZA 5AR1A 1OV4A 4Q01A 1SXJB 1ZAKA 4CYMA 1GP2A 3K09C 1W36C 1YZQA 5DLQC 1KNXA 1NIJA 2VL7A 3LLUA 2BVNA 3SOPA 3ICQB 1F3OA 4ZDWA 4DT1B 1AM4D 3D6TB 1NJFA 2HF8A 1II8B 2OEPA 4PAMA 3WNDA 1GIAA 4M1TA 2YOFA 2FJUA 4FMDB 1HURA 4FXPA 5HPYB 5KYKA 2ATXA 2QTFA 1SVKA 1Z8FA 3PXGA 5CM8B 4UNPA 2QRZA 2Q6TA 3TSZA 3AF2A 1GG2A 2QAGA 3L0SA 4OQXA 1XBTA 4E03A 2IYYA 2J59A 1SULA 1XCMA 5FBLB 4QNRA 4A2WA 3CR8A 1E9EA 3TQFA 4MQBA 4JT2A 5DO9A 4QNMA 3QSYA 1P72A 2QP4A 3M1IA 2CHVA 4QHSA 4Q4HA 5FPYA 2QGZA 2ZSEA 2J0VA 2RCNA 2F1JA 2CDNA 5JI2E 3AUXA 1YE8A 1N6IA 1OB2A 1M7HA 1XNJA 2O8FB 5KSZA 2OAQ1 3FKSA 5EP1A 4DCUA 3QJYA 1CTQA 1GNRA 1F2TB 4B44A 3PUXA 1KI9A 4BE7B 2WJGA 2ZSDA 1AGRA 1CJUC 2ODNA 3TW8B 3W5JA 4BWYA 1Z63A 5JJIA 4JSTA 1W44A 3B82A 1UBEA 4BEBA 1F60A 2R2AA 2PBRA 3FDIA 1T3SA 5CK5A 2ZUBA 2PZEA 3VHXA 4LC0A 1T5IA 1W48A 1JPJA 1QG2A 4FMCB 4L5BA 1MR3F 1E9SA 4B34A 4Z51A 3EC1A 2RGNC 3ZVRA 1WMSA 3AKYA 3A37A 4QM6A 1N5LA 3BB4A 1ZD9A 1KTVA 4O2LA 5G41A 5SZJA 4AKHA 1FP6A 4D26A 3CNOA 2IYTA 4M22A 1HQCA 3KQKA 4KVGA 5KNCA 1XTKA 2B21A 4OJKA 2A5DA 3EAQA 3I72A 4Q00A 5KU1A 1R2QA 3W34A 1E9RA 2ZYUX 2Y8EA 2QNRA 4OHZA 5JLJA 4NYMR 4C0HA 3AVVA 5GVRA 3V9PA 1E9BA 2AX4A 3W8NA 4TL8A 2ERYA 2W58A 3MWJA 3K0AA 3Q85A 4B32A 2D3WA 4GDFA 2W83A 1T8UA 4C7OB 4B47A 1TEXA 5JJLA 3HR8A 4B75A 3B60A 1G8YA 5F2EA 3KZ1E 1I2MA 4MITA 2QY9A 2QN6A 3LH5A 4Q66C 4BFTA 2QM8A 4XWKA 1QHGA 2BCJQ 4IFBA 1MRNA 1S4QA 1A2BA 2REBA 2VHCA 2FMXA 2NO1A 2ORWA 1DO0A 4TMTA 1G3MA 1W0KA 3VKWA 3GLGB 3CF6R 2XGJA 3Q5EA 2CCKA 1E0AA 1JQLB 5KPJA 2OFOA 3W3AA 2VIIA 3A4MA 1JECA 3BIFA 1LTQA 1Z83A 2WSSD 1DG1G 3CX7A 2ZI3A 1VKJA 2FSGA 3CRQA 4LRWA 3AVUA 1XCGB 4M1YA 1E9AA 2G88A 2XSZA 3OIUA 3RANA 4RKFA 2AFIE 1CR4A 2VF8A 4HATA 3VU9A 3UG6A 2JJ1A 2OUKA 4WZ6A 4HAXA 2L0XA 2EW1A 1GKIA 3RS4A 4TLEA 1TQ6A 2AR7A 4AWXA 3OIVA 5BW8A 3BS4A 2BBSA 2GKSA 4LJ4A 4HEJA 3SC3A 4TYWA 3W90A 1DAIA 3ND8A 2AKYA 1ZINA 3GJ4A 3I32A 1R0WA 4E5UA 2PL3A 1KMHB 1FQKA 3SNHA 1RC8A 1ZW6A 2NO0A 2ZRAA 3NDPA 2GZAA 5EP2A 1XD8A 3VR1A 4D0LB 1KI1A 4IDHA 2FV8A 2QMEA 3ADCA 2ZI5A 1XRJA 1FUKA 3TSOA 3U2QA 1G4UR 1BMFD 4W5JA 2GCOB 4D6PA 1E9FA 4Q47A 2HT6A 4DHEA 4GI7A 4CRWB 3OF5A 4AYWA 1NVVR 3KKPA 1N6OA 1RFLA 2WJIA 1W47A 2GHIA 3T15A 2IUSA 5GJBA 2IEZA 2JIZA 3WYGA 5C4MA 4LJ8A 4JL5A 3TNFA 1HY3A 1SXJC 3SJZA 1OB5A 1TQDA 3LXXA 1Q1QA 1QZXA 1ZU5A 1U0LA 3B1VA 3EPHA 2CMKA 2BHRA 2FU5C 4P33A 1KDOA 3W6OA 1AS2A 2VEDA 2XEXA 4QHTA 1IN4A 1CP2A 2FSIA 2ZTSA 1CJVC 4HLDA 2R44A 1RKBA 4PO9A 1KJZA 4OKSA 1E2NA 1NG1A 4IKEA 3KB2A 4U02A 4EFLA 4AY2A 4DWJA 1JNYA 4KYIB 2VH5R 4G5QA 1C9KA 2GF9A 3P4YA 3W5IA 2OBMA 3ZS8A 3C5HA 5CK4A 4NMMA 3H0KA 4RZUA 1FX0A 3QPVA 5HCNA 3Q7QA 2BBOA 4FMDF 2O52A 1E4YA 2RGAA 1AQUA 3C7KA 1GFIA 3GJ0A 1W49A 2HCBA 2CE2X 2DYKA 1Z3IX 1L4YA 4AG6A 2N46A 2R6AA 2QPTA 2H5EA 2YWGA 4MDEA 3N2EA 3VKGA 3OIWA 1VCNA 2QTHA 4PQRA 2ZU0C 2G83A 2ATVA 1IHUA 5KNDA 4DVGA 1A5TA 2QROA 3U7GA 1P73A 3K0FA 5FUVA 3BB1A 4KFUA 2DWQA 2I1VB 2VHQA 1NLFA 4DXAA 3QBTA 4I1OA 1ZD8A 4XD7A 2XZPA 4A0RA 5LDDC 3SZRA 4E09A 1KI6B 4G5SA 4GP6A 2FE4A 3C41J 4O3MA 1HE1C 1W4RA 1PUIA 2JLQA 1NN0A 2OAP1 3PEYA 2C96A 4OJQA 4X8LA 3ZZUA 4LX0A 3THYA 3IQWA 3EZFA 2XX3A 1NBME 3SE0A 4Q7JB 3I8XA 4I4LA 2CL7X 1E2MA 1DO2A 5CB8A 3U7FB 2JLZA 1Z6TA 4ZV4A 4EJSA 4MH0R 3CPHA 4S2EA 4B33A 4F7WA 4URWR 1EFRA 4CT5A 1Z6GA 2OXRA 2ZE5A 4Q1CA 3EA5A 3FKSD 1AQYA 2QMUA 5JS8A 1YVDA 5TB5A 2RGGA 3T1QA 3UMSA 1A4RA 2GXUA 2V1XA 3W3ZB 3E5HA 4FMCF 4DLWA 2GEUA 3F8TA 4IW3B 4WW0A 1N6PA 5AJWA 2CL6X 3K9LA 1DELA 1NY5A 1CJTC 3GJ3A 2J0UB 1WA5A 1EXMA 3LLMA 2A5JA 4B3XA 4PPNA 2PH1A 3AEZA 5EP4A 1ONBA 2PJZA 4US0R 4Q9HA 4I1SA 3PITA 1Z07A 2WJHA 2ZETA 3LD9A 4PZYA 2WKQA 3VTKA 5TVKA 1G19A 4BFYA 5FUYA 1E2EA 3AF4A 4ZCIA 3CNNA 4EPVA 5FPKA 3FPAA 1ODFA 2CE7A 3L0IB 3MFYA 5DNYB 4TL9A 4JVNA 4Z1MA 1GVNB 4KBFA 4KBGA 4LSGA 2OFXA 1MO5A 1OXTA 4YDHB 5D3MA 4DLVA 4L8GA 2NO7A 4GT1A 4WOPA 1X8KA 1G41A 1OYWA 3GCGA 4BFSA 4CW7A 1XZPA 3ZS9A 5IF9A 2ZRCA 2IYLD 4QM7A 3U3JA 3BFXA 1KNQA 3LQQA 4Q1EA 2W2TA 2ZRBA 1QHIA 4RZ2A 1VPLA 2ASEA 3JZAA 1ELOA 3RWMB 2OCPA 3GLFA 2YNMA 2AKAB 1M2OB 1GL9B 3U4QB 5B57C 5F3WB 2XZOA 1IY0A 2XNDD 5FOVA 2QTVB 1T4GA 3HPQA 3REFA 1P2VA 2R6CA 1I4TD 2AXPA 2IYXA 1GRRA 2OBNA 5FTNA 4MYHA 2Q3HA 1XDBA 2ZR9A 3BFKA 4PTLA 4G1UC 5CYOA 5EUMA 5L3SA 521PA 1HH4A 4ZIRB 2FFQA 3OAAA 1UBFA 4JMPA 4QHYA 1GWNA 1N6NA 3BH6A 2ZJOA 1W0KD 4JS0A 2BM1A 2BKEA 1XTSA 1R5NA 4M1WA 3PCRB 5JWOA 3TQCA 5EJEA 2FX3A 1II0A 1MT0A 3AGQA 5FPHA 3LRPA 5J5CA 3P1JA 2FGJA 2IXGA 4NPHA 4WZBE 3LDAA 421PA 5KOYA 1QVRA 4KHZA 3VR5A 2GTPA 4JVSB 1K8RA 2D06A 1PLJA 4F92B 2HCJB 4LUCA 4V03A 3QVUA 3KQUA 4JVLA 3QF7A 3TE6A 4PAOA 2JJ1D 3AVYA 1CF4A 4Q18A 1RYFA 2EFDB 3LA6A 1NVVQ 3NHBA 3VQTA 3J81k 3L43A 2XTZA 2NG1A 4PZZA 4Q48A 2EFEB 4MRPA 5B2ZA 4DLTA 5DI3B 1U2RA 3RC8A 2B7CA 5C4GB 3B8HA 2QSZA 3MJRA 3U3OA 1PVOA 3DVLA 3RAPR 3ZJYA 2QSYA 1GRNA 1RJ9B 4U7DA 4KU4A 2Q3FA 1XXHA 4BZPA 1YJ5A 2OE2A 2IXFA 2ZEJA 3K70D 1E2IA 1B23P 1GOTA 1TX4B 1F48A 2QMHA 1E98A 3Q3JB 4GSYA 4MGZR 4TL7A 2CHGA 4ZO4A 1KSFX 1M34E 3TW4A 2A5FA 1XMSA 2EQBA 5K8LA 2P65A 2OV2A 4PHHA 5BN5A 2GF0A 2YWFA 4C30A 1WRBA 1G64A 4XSHA 4RSGA 2C03A 2ODBA 2PZFA 4KYUA 2H92A 4KFTA 1CJKC 3S1AA 2V8OA 4R98A 3IUYA 1LFDB 1ZNWA 3BRWD 3KKQA 4K81B 3I4LA 2PX0A 2QAGB 4PC1A 2GJKA 4W7SA 4UXHA 1M74A 2DR3A 1SVWA 3BORA 4FI3C 3QOFA 3QE0A 5EE1A 5FTKA 4G5OA 3HWSA 1XWIA 1Q0UA 1E2GA 1FUUA 4R2IA 3ZVLA 2HJVA 4Q19A 3TR5A 5AJZA 1E2DA 1DAFA 2WOJA 5G40A 1SQ5A 3AVOA 2ZQ5A 3WNBA 2GJ9A 4GOKA 1E6CA 2Z4SA 1A82A 3ONWA 3ZD7A 1T3HA 2WOOA 2OO7A 5AJVB 2DPXA 4JLOA 2VSOA 5FOWA 1D5CA 1E0JA 1MABB 4HAWA 1AGPA 2WVJA 3QKRB 4NKRA 3A4NA 1H8ED 4BZXA 3CH4B 2D62A 4BQSA 1MRSA 1XEFA 2P5TB 2JJ8A 3BERA 2J3EA 4UJ5A 3FMIA 5BXQC 4MRRA 2GRJA 2QBYA 4S35A 5L3VA 1IBRA 2C9YA 3DKPA 4TLBA 1KO5A 3CRVA 1C4OA 4RFVA 4NL4H 4BPBA 1IOZA 4FD2A 3TMKA 5LBIA 3N70A 3UG7A 3R8FA 1XD2A 2WHXA 4TTQA 1D8TA 2ZYTX 2ZJAA 1ZD1A 4IOMA 3NHAA 5BYJA 4XD7D 3NBYC 4XVRA 3WYAA 2CEAA 3UPUA 5JEDA 1NLYA 4V0KA 1OXSC 3EIEA 3WBKA 3KKOA 2BMDA 5IK2A 5FBVB 1JI0A 3EA0A 5CM9C 3FWYA 2BJVA 4IOKA 2WSSA 621PA 3IPYA 4WBSA 5JFGA 1HV8A 3TAHA 1U81A 1EWQA 2W2XA 2VTKA 2ZAMA 2Q3MA 1OFIA 3U5ZB 4C2UA 1BIFA 3TGPA 2ZSBA 1IN7A 2W0SA 4M8NE 1EFRD 4Y0VA 1NJGA 2BMFA 2G77B 2H57A 4QJ5A 3DOEA 2JA1A 1J7KA 3WHKA 4DIEA 2EWVA 1OH5A 4B3BA 3FYHA 3KTAB 2WIAA 4N1AA 2OZEA 1AKEA 1VHLA 1UBGA 2AHOA 5L3QA 2W6IA 4FMBB 4A2PA 1T8TA 5FH9A 4C0LA 1TADA 2QG6A 4Q4JA 1Z6YA 3RLFA 3RRYA 5M04A 1LF0A 5JHGB 4ZKEA 5FR1A 1E2QA 1G3QA 4CVNA 2XXAA 3IGFA 3NH9A 2PEYA 4G5RA 3B9QA 2ZRDA 4Z1MD 1S8FA 3H84A 4A2QA 121PA 3GLFE 2FH5B 1P62B 1EFHA 2QZ4A 1Z29A 2P0EA 2CLCX 1YZLA 4AG5A 4ARZA 1TPZA 4M1MA 2ZRIA 2LCFA 1TU4A 3DZ8A 1N3BA 1WCV1 4P4UA 2NZJA 4D82A 5J4LA 5JECA 1S1MA 2H18A 2GILA 3B6EA 1BYIA 3F5FA 4IHQA 5LB4A 2FSHA 3K9GA 3R7WB 3KQHA 2J7PD 1P2TA 2QGNA 4KLNA 2WPDA 2VF7A 4M9ZA 3QKUA 4XSGA 3CF2A 1Z06A 1Z22A 3WNCA 4M9XA 5KHOC 2JGNA 1NN3A 1MV5A 4JJKA 4PC7A 1NG9A 2G3YA 1CLUA 1GDDA 3HU1A 2REXB 1QG4A 1WDTA 5AUQA 4DLYA 4URVR 4JLDA 4BFUA 3VR4A 3LVRE 1Q12A 1Z08A 4NYIR 1AS3A 2IS1A 2A30A 5JZVA 1X86B 2G9NA 4BECA 1NLZA 1OYYA 1R10A 3TUIC 3K70B 2ZVPX 4TLCA 3W8RA 1A7JA 4OQMA 3O8RA 3E2IA 4KFRA 4CEHA 4URYR 4LGMA 1YZNA 2WWIA 4ITRC 1ZNZA 4F4CA 4TLAA 4WA7A 2WAXA 4ZKDA 2V55B 3QUSA 3NDBB 2O0HA 1OH7A 4LC1A 3M4YA 3QIAA 1T3LA 2HYDA 1YKSA 4KSBA 4DB4A 3H4MA 4I99A 3X2SA 1WBBA 5AUPB 1MOZA 1GKYA 4YMWA 4IVRA 4JYCA 4ILEA 3IDQA 4MKHA 1ZU4A 4JLBA 4A9AA 1XU4A 4GP7A 3NKVA 1N5IA 1DG3A 3P26A 1AN0A 1E94E 2IYQA 1RRGA 2D2FA 3HYRA 3KKNA 3TH5A 3D7MA 3GFTA 1CR1A 1TAGA 4BLPA 2G6BA 2R8RA 1N6KA 2FF7A 3PJRA 2YV5A 2A5GA 3W9YA 1SVMA 2ZUDA 2IYVA 1P2UA 1VG1A 3HR7A 4MYTA 5TDHA 1KAGA 3O8CA 2EFCB 1XP8A 2QAGC 2X19A 1KZGB 1R8QA 1W5TA 3EWSA 4Q4AA 2F1HA 3VFDA 2WBLC 4GFDA 4WIAA 3HJNA 3OFNA 1I4LD 4R9UC 4D4KA 1EWRA 2RHDA 4BLSA 4L9WA 2ZJ8A 4OI4A 1ZMXA 4H9GA 3R9WA 3ICEA 4N0DA 3RNLA 4C0SA 4NONA 4LV8B 2ZRMA 2A3RA 1N6HA 2J41A 3N5CA 1RPZA 2V4ZA 2UZIR 3B78A 4D4LA 3FMPB 3IIKA 4H1VA 1DOAA 1YR9A 3VNUA 3P4XA 5G53C 3ZZTA 1EESA 3MWLA 4CDGA 4YXWA 3EXAA 2XAUA 4HB2A 4A15A 1OH6A 3EASA 5LD2C 4HAZA 3WMEA 4U00A 4HAVA 3NBFA 3PUVA 3ADBA 5CYPA 1XEXA 3E1SA 5JI3E 1G6OA 3B1ZA 1NKTA 4MUAA 2PT7A 1ZM7A 5JRZA 2BEJA 4IFEA 2P6UA 3EG5A 5K8IA 3WP0A 1US8B 4QFMA 3C15C 3PUYA 4Z54A 3I8SA 1P60A 2R65A 2I3BA 2VA8A 5TXGA 5GVSA 5KO2A 5BWMA 3AF0A 1KDTA 1FZQA 2DFKB 3QF4B 4NBSA 4F91B 2LKCA 2VP2A 4RFSA 3R9XA 4J0QA 3KJHA 4RD4A 3JZMA 4M2LA 1LS6A 4KSCA 4TL6A 2DWOA 3SFVA 5KDDA 5KDOA 3GJ8A 5FFMA 2XNDA 1T6NA 1F6BA 2WJYA 4N3NA 4D4MA 2X77A 4Q03A 5DYGA 1OT3A 5FR2A 1RW4A 1O87A 4B74A 1LV7A 4A82A 2H16A 1CXZA 4LDJA 3L2OB 2ZE8A 1LF5A 4JYBA 3DKVA 3KJGA 3THWA 2A9KA 4US1R 4ZDJA 1KIMA 1G7CA 4WXPA 3X1DA 2ZROA 2Z43A 4DB2A 4TTRA 3PEVA 1G8GA 1T0JB 5IK2D 1NSTA 3ZVMA 1CRQA 4TMKA 2DWPA 2ZVQX 2IEYA 4EPXA 5D3MB 1TUEA 1ZC4A 4B6EA 5EE3A 4TSFD 2FA9A 2ZM5A 4EFMA 5ANRB 1S9DA 3BH7A 3F3YA 2VHTA 2J5XA 3QKSB 3ZVNA 1IN8A 4DC9A 3H86A 4Q1AA 2H8KA 3KFXA 4CEIB 5IDVA 3QVVA 1CKEA 2BV3A 2JLUA 1P3JA 1VMAA 1CIPA 4TTPA 2DY1A 4KLZA 2RH5A 3DL0A 3EPJA 1NN1A 2R6GA 1DBSA 5IHPA 1XPUA 2JDIA 3GLFB 2OT3B 2Q9CA 4AKIA 1EFCA 1FMJA 4B48A 4O2RA 1LB1B 4DKXA 4BZQA 1S3GA 1C1YA 3NEYA 4EQ6B 4G01B 2BBTA 4AYXA 2IYUA 2W6ID 2LWIA 1U94A 2BC9A 1RRFA 2HJGA 1JJVA 1U8YA 3AV0B 4OQFA 1UADA 2ZE6A 2GNOA 3EW9A 4JLPA 5JSZA 4LY6A 3TRFA 4IRUB 2CHQA 4QC2A 2WM9B 4JLMA 4A0HA 2NO6A 4BLQA 4DSTA 4NYJQ 1SVOA 1WE2A 4EPYA 5CDFE 1J2JA 5DE3A 1JEEA 1ZP6A 5DYIA 3SS8A 1E1QA 3GLHA 4P4SB 1XX6A 1BH2A 3SN6A 3EIHA 1F2UA 3NC0C 3Q9LA 5DHFA 4A92A 5A4JA 3O8DA 4ZI3A 5J47A 3QG5A 4JLNA 1K5DA 4JIMA 4KV9A 2GBLC 4BUJA 2WWXA 3MD0A 3PR1A 1S2MA 1XTQA 1P9NA 4NYIQ 2JASA 4B76A 2JLWA 1E1RA 1QHNA 4V0NA 1NMXA 1W2HA 1TQ2A 2ZI6A 3B1YA 3KX2A 5IRCD 3K70C 2UVQA 3CBQA 1Z28A 1OJLA 2AK2A 5JWRA 3ND9A 1ZM2A 1PV4A 4Y0AA 4OK3A 2IBMA 3KQNA 4GMDA 2WPDD 2P3SA 4ACBA 4RZXA 2Z0MA 1T0HB 4UJ3A 2KB0A 5SZHB 2RKOA 2C77A 4V0OA 4ABYA 4ZDIA 3RRMA 1S3SA 4DT1A 2C5LA 1SHKA 1TUIA 2XJ4A 3LNCA 4ZPXA 1MH1A 4X8OA 3GMTA 2W0MA 1ZM3A 1YR7A 2OESA 1EX7A 1O3YA 1RVDA 1HEIA 2AWNA 3RSOA 1EK0A 2OXCA 3ZH9B 3GQBA 3THXA 1E0SA 1OHHD 3DO6A 3RS0A 4D25A 4UXJA 5E4FA 1IXSB 4XTRA 1ZCAA 3PEUA 2O0KA 4B2IA 1H8EA 4GMXA 1YHNA 3TLXA 1KI3A 2F43B 4HAYA 4YMTA 2ZSAA 3I5XA 2NOAA 5AUNB 1Z6AA 3REGA 2OG2A 3M0EA 3SJCA 1JAHA 1UF9A 5JS7A 1AS0A 2B92A 4R71A 3VR6A 4GRAA 2BKUA 4HYYA 3LV8A 2PLRA 3S1AB 1XPOA 2Z6VA 1G17A 1E0KA 2ZI7A 1G291 3GJXC 3DEFA 5A5GA 2O8FA 1Q57A 3PFIA 1G6HA 3CIOA 3MWKA 5KPDA 3W6PA 1F2TA 1KSJA 2J1LA 3LVQE 3EZ6A 2JEOA 1OIVA 1UFQA 4ZCMA 4DRZA 5CJ2A 3IILA 3SBEA 1Q3HA 4UNQA 4IXMA 1OXXK 1QBKC 2P2LA 4NCNA 3SJAA 2G0TA 4FWIB 1GAJA 1NMYA 1UM8A 3NIBA 4EFNA 1IONA 1E2JA 2GETA 3RHFA 1CS4C 2FPMA 3VX4A 1KK3A 4ON9A 3AB3A 1R0ZA 1FTNA 4RD2A 2QEQA 3RRNA 2D2EA 2ZPTX 3A1UA 3OFND 3X1YA 1ZIOA 2F9MA 3QENA 2ZRHA 2V3CC 3R8CA 1KK0A 4JL6A 4F4JA 2Z83A 3RSLA 2WJJA 5FUWA 1X1RA 4M1KA 3T5DA 2ZI4A 1W4CA 3B13B 3LAWA 2QBYB 2QAJA 3A6PC 8OHMA 4BLTA 2RGXA 3NH6A 3FB4A 3T1TA 2HUPA 4EJSC 4YXWD 2UKDA 1FFHA 4NYMQ 2ANCA 2ORVA 1U8AA 1DTSA 3P27A 4WAUA 4EUNA 3D8BA 3GLIA 1XD2B 1AK2A 2WICA 3BB3A 5KUTA 1FQJA 1TF7A 2D4HA 1ETUA 2V54A 1HT1E 1N6RA 2K5UA 3LQRA 2VYFA 3BC1A 1G7TA 5B58C 2FNAA 3UMRA 2GDJA 2WV9A 3AKEA 2ZRGA 1KK1A 2F3RA 3EWAA 3B9PA 1BYUA 2TMKA 2W00A 2NPIA 3FMFA 3U6BA 3R20A 4QGAA 5DGXA 2ODWA 2VO1A 3GD7A 2N42A 2Q9BA 3RS3A 1VG8A 2MSEB 4PFSA 4HZUB 1QHHB 3HPRA 2J7PA 3GLGA 3H2YA 2FSFA 3EX7C 5DISB 1TMKA 4HDQB 1E9CA 3AVXA 1PZNA 2GWHA 1J99A 1Z0KA 2GAOA 5HCIA 2R62A 4XTCS 4C0JA 1P4SA 1ZUHA 4NTZA 1ZJ6A 2MSDB 1Q21A 2PMKA 2YHSA 3NG1A 3IEVA 2PEZA 3U61B 2WKPA 4P4TA 2C9CA 1OIXA 2KJQA 1D2MA 3KXLA 1KDPA 3I73A 4TZ6A 2IK8A 2Z4RA 1HTWA 2YC4C 3PEWA 2O8CB 4AKGA 3N2IA 4C3ZA 6Q21A 5KSYA 2F9LA 4DCNA 4IEIA 2CL0X 1FNMA 4M1OA 1D2NA 5KDLA 3ECCA 3K1JA 4KXFB 4B3CA 3CX6A 3QXXA 4IVPA 2XXAB 2OCYC 2J0SA 1BKDR 3WYFA 4QJ3A 3DM5A 2IHBA 2BWJA 3ZQJA 4DCVA 4DJTA 5GJCA 2V9PA 3CLVA 4HDCA 4EDHA 2FZ4A 3I92A 2VQSA 1HA3A 1M1YE 2GK7A 3C8UA 4LBWA 1K5GA 5HE9A 4KODA 4PSAA 2O5VA 4MYCA 2JATA 2F1IA 3BFVA 1OFHA 4UNNA 5DN6A 2JDID 1EFUA 1PLKA 5AK0A 2CVFA 1RRPA 2VP5A 4TN1A 2WWYA 3SBDA 4I81A 4NDZA 4BGDA 5HKKA 3SYNA 4CEJA 2R9VA 1SVLA 1M8PA 5FTLA 4A36A 1ZC3A 3LY5A 1GRQA 4OBEA 4UNSA 1Q1BA 4V0LA 2EFHB 4A1FA 4Q9LA 1W0JA 3AVWA 1KYIA 4C0AC 5EQTA 1N5JA 1EX6A 2QENA 2GJ8A 1Q1EA 3LW7A 1R5BA 3MCAA 1E1QD 2ZYVX 3TVTA 1CEEA 4A0FA 4C9BA 1UKVY 3K0CA 4O0MA 4EKDA 1RZ3A 1E2PA 2VP6A 4YMUA 4CEHB 1FL9A 1JQJC 3VNVA 1XMVA 3DMDA 1Z5ZA 4PC3A 2WIBA 3V00A 3SDZA 1Q44A 1TF5A 1E2LA 1FOEB 2ONJA 3UIEA 1Z47A 2ORIA 3CRMA 1Z2CA 1E1RD 2GJAA 2WWGA 5BQ5A 2W2VA 1TNDA 1KO4A 1HT2E 221PA 2Z5FA 4JBXA 2ZI9A 5FPTA 4DLRA 4MDFA 3L82B 1JR3A 2O8DA 3I5YA 1X8LA 2RGEA 2ZS9A 4CF7A 4YQFA 1FP7A 3GEIA 1U9IA 5G3ZA 1ESMA 1SXJD 1AIPA 1D2EA 4K8OA 1IM2A 1ZUIA 3A36A 5FOTA 2CCJA 2MSCB 5HTKA 1UPTA 3PV0A 1IXZA 3PQCA 5G3YA 1YU9A 1NRJB 2GA8A 3DM9B 4DDWA 721PA 4Q9KA 3A1VA 3I1FA 4LWZA 3T34A 2NGRA 4Q02A 4Q1DA 5H70A 4Q4HB 3VU9B 3A1SA 3BAFA 4URUR 4NHOA 5FBQB 4HUQA 2ZXUA 1BOFA 1D9XA 4LK2A 1OKKA 3MSXA 3JVVA 4TZ0A 2OLKA 2E87A 2H7VA 2OSBA 3CUEF 4O25A 4KFSA 1KO8A 5LD2B 1KI6A 1JPNA 4NZYA 4C0QC 3U6KA 3KQLA 3X1ZA 2O8BA 1G8PA 2EU8A 5CLQA 5FOXA 1OH8A 1WF3A 2YC2C 3AVPA 3IIJA 3QI2A 4MRVA 1II9A 4ESHA 4OI0A 1EG7A 1NVWQ 2YJTD 4LBZA 5J40A 3BXZA 1X8JA 1NVXQ 5LB2A 4B73A 2O8EA 3U44A 3K9NA 4LBVA 3I62A 3GEHA 2QPOA 5FI1B 4AD8A 4XWOA 2X2FA 2V7QD 3A8TA 2DCUA 3AF3A 2XJ9A 5FTMA 1V43A 3MG9A 2C9OA 3UATA 4FIDA 1S96A 2P5SA 1G4AE 2X1VA 2ZJ5A 2XZLA 4LJ9A 3FHTA 4YONB 2CNWA 1CRPA 2ZR0A 4OL0A 1KK2A 4LHYA 5H8WA 4H1UA 4TSFA 2J0UA 2SHKA 2WWFA 2IW3A 2BIFA 1VYTA 2J46A 2VPPA 4XH9B 3SHFA 2EWWA 2OBLA 2IYWA 3IPXA 5E7MA 4CT4B 1L7VC 1P9WA 4RFSB 3A1WA 3GLIE 2C95A 3QXJA 4B3GA 4IVQA 1NL3A 2KBFA 4JSYA 3CKLA 1Z0AA 1E79D 2E9SA 2ZRJA 4XVQA 4XWAA 3ZIAA 3K0AB 4RD1A 1NKSA 3ETLA 3IHWA 1ANKA 4GBMA 1VHTA 1J90A 3MAAC 1G8FA 2QT0A 4HDOB 3T35A 3QNUA 1G5PA 3UMFA 4L16A 1IJEA 1P5ZB 4B3DA 1XEWY 2GK6A 1KOFA 3SHWA 1G3RA 4C0KA 2FFAA 2J0QA 1OW3B 1DEKA 3DOFA 1GUAA 1PJRA 1JBKA 4PXAA 1UEIA 1G1MA 2KSQA 2VP4A 1YZUA 1NMZA 4Q1FA 1ZBDA 4N0EA 3U4QA 4LJ7A 4LHVA 3OIYA 3ZYCA 4KI0A 3EZ9A 3TUJC 2A2ZA 2XTMA 1TF2A 2IWRA 1U0HC 3U3KA 5E7JA 3L0PA 3DMNA 5HZKA 2G1JA 4Q7MB 4PHGA 4BASA 2JLXA 2XTNA 3FFBA 4ZIRA 1DARA 1ZNXA 1DAGA 3AKCA 1DAEA 3SJBA 3LWNA 5CB6A 3RRZA 3AVQA 5J4HA 2WMNB 3GJ6A 3RC3A 3TK1A 3DZDA 3IO3A 4DEYA 3CZPA 3MGCA 5KNBA 2ZJZA 1V5WA 2FPLA 4JLAA 2HDNB 4F4IA 1D9ZA 4RCZA 3GP8A 4AURA 4P0TA 2QE7D 3PUWA 4A8JA 1R8SA 3BBPA 3CR7A 2HF9A 5JJKA 1CR0A 5E7IA 1CBUA 1QHYA 4DEXA 3PIRA 2EYUA 3CONA 3T5GA 2C98A 5FL7A 1OHHA 4A6XA 5FBWB 2GAAA 3C5CA 4M53A 4PC2A 2VP0A 1ZM4A 2C04A 1F2UB 4HLUC 4TMZA 4D2IA 5L8VA 2QA5A 3OEHD 4IDNA 3IO5A 3HYTA 4MKIA 5DI3A 3WHLA 4ERNA 1L4UA 2YWEA 3K09A 1LS1A 4V02A 5CIWA 5AWFC 4OHYA 2OFWA 4URXR 1R7RA 3SQXA 3FHCB 1RJ9A 1AZTA 4QBFA 5J4YA 2ZS8A 4QBGB 2IUTA 4GZMA 1XCPA 3EZ7A 4W5WA 4PPFA 1ESNA 5GJVC 2HLDA 2A7QA 4KITB 2QQ0A 3KUDA 4TYPA 1KI4A 3HU3A 2F55A 5DN6D 1XXHE 3T12A 2GZHA 1IAQA 2RAPA 1UDXA 4Q7KA 4A6PA 1IY1A 1CULC 2VRWA 2OHFA 2ZANA 4TMXA 5K8UA 2LKDA 4LJ6A 2BCGY 2EFGA 1VTKA 1G7SA 1SKYB 2FZLA 2KBEA 1G21E 2WZQA 1CJMA 3AGPA 3IKJA 1PLLA 5HKKD 2ZRLA 4BLOA 4XVUA 5DSZA 5HZHA 1TTTA 1D6JA 4JZKA 3WBJA 1KO1A 2W6JA 2ZREA 2ZITA 4P31A 2YWHA 4DZZA 2ZJ2A 4II7A 1W0JD 2HXYA 1VCIA 1XFAA 1GZSA 1ZCBA 3M6AA 1A1VA 2ERXA 1Q1ZA 5FUXA 4L4UA 3THXB 2IYSA 1FX0B 4M9QA 3FOZA 1JR3E 2XB4A 4K46A
chains in the Genus database with same CATH superfamily
1W2WB 2VJCA 4RAOA 4KOAA 1XTRA 1MVNA 4IZ6A 2QP3A 1UFOA 4L73A 4PZUA 3RASA 1O6BA 4EJ6A 3CRRA 1U0JA 1PL8A 2H54A 4NOKA 4W8OA 1WXGA 3C7TA 4DMFA 1J1UA 1ODTC 2X0JA 2QRJA 4UQOA 3W78A 1LVGA 3BF7A 1WHTB 4YJ3F 5SZIA 2VYNA 3C3AA 3F6RA 2B1RA 3QMVA 3GNSA 3RS2A 2YHBA 5DP1A 1RE0A 1CD5A 1GNLA 2YZGA 5EE9A 5TV2A 4D9FA 1Y6JA 5IMBA 2WYVA 1XWWA 3UAOA 2RJNA 4Z86A 1L7AA 1LEHA 3HY6A 2PWAA 4OHOA 2E4VA 3UJHA 3AQ4A 1JALA 1DBRA 2C8LA 5DT2A 3C39A 1K5HA 1EU1A 1KI2A 1W93A 1X19A 3A4IA 3E8XA 4O4IB 4PYKA 3JAKA 1RIIA 4V0MA 4AMGA 4JVOA 3U4DA 3THYB 1RSZA 4GLJA 4RVGA 4QSHA 4AP6A 2UZ3A 4I1PA 1JA0A 3L7JA 4EY5A 1I4DD 1UXKA 1QFZA 4PYQA 2QTAA 4G65A 4TLDA 5IBRA 4CIWA 2XMBA 2O5CA 4J0GA 1EUDA 5LIRA 4L27A 3HY3A 2WSBA 1DHTA 1A3CA 2WNIA 4LMRA 1M0WA 1TT5B 3F5MA 4P2BA 3ZX5A 4ENSA 2CW5A 4HI0E 1F4VA 1OKKD 2ZSKA 1GPH1 3FNHA 1KIAA 5KSPA 4KO1S 4E15A 5I7UA 5EP3A 4XJXA 4DLAA 4HNTA 2ZPUA 3DTVA 2A9FA 2HT1A 4LPKA 3LO5A 3QQPA 4WWHA 4ZO9A 2WWTA 2VBCA 3M81A 2B5WA 4R7GA 3E03A 4KAAA 5E1MA 5CCBA 1NONA 1G8MA 2AUNA 3DS8A 5A5VA 2JI6A 4FWTA 4QGBA 1N6LA 1VPEA 3RM3A 3W2TA 1IN6A 3C3XA 3ASZA 3FE2A 3GT7A 1VP9A 1QK3A 1UK9A 3O8OB 3TMAA 2Y6UA 1H8HA 2FFJA 3T7CA 4UHEA 2HMSA 1DCTA 1QQBA 3GARA 4XCXA 3QPAA 2GZ2A 2DFNA 1PQ4A 2W4QA 3A2LA 3K05A 4I55F 3KHSA 4O8CA 4QLAA 5BSVA 5C2JB 4B3HA 3EARA 4OI2A 3LQFA 2OCXA 2EQAA 2RCYA 3BE6A 3N0VA 4DSUA 5DEOA 4N0PA 1EZ4A 4G25A 2AK3A 2P6PA 2H17A 2IHJA 2WRZA 4FFMA 3GJ7A 4Y8VA 4KJZA 3GFPA 1R4MA 5KTPA 1T0IA 5JSQA 2DP4E 2GN2A 2SECE 4R01A 2GM3A 3KSMA 3WGNA 2V0CA 1UBOS 4WK6A 3D1LA 3AIOA 3BFPA 1WSAA 3UPDA 4G9EA 2VC2B 4B5LA 1CS0A 2I8LA 4JI5B 1RJEA 3M6FA 4J29A 3NUQA 1U1FA 1EP9A 1BO6A 2WMDA 2ZIWB 4CI0B 4DLXA 2FMKA 1RIFA 3BAZA 4RC9A 3OTQA 3BOSA 3CSSA 1KPGA 3HFRA 1R15A 4I4TB 4J9UE 5CRIA 2R5WA 3GFSA 2HXGA 4O4HF 5FRDA 3TX2A 5ELXA 2DPHA 3JD1A 4UM8B 4B8YA 1XDSA 2REQA 3L8CA 3ZIAD 2AC4A 1N7JA 3CBGA 1WOMA 1NJ8A 3PA6A 5EZ6B 4RQTA 1IN1A 5HWSA 1P0MA 1QO7A 5GPBA 5JFOA 2W6OA 3FLBA 4IQ4A 2NU7A 4ZVSA 1LLFA 2H5JA 2YDXA 2XT6A 4DBLC 5F2NA 1XTPA 2HAEA 2OPBA 1WPRA 4G0PA 4BAUA 2JJ2D 3TR0A 5L3SB 3FLMA 4GAEA 4GYJA 2ZBDA 2B7LA 1UOQA 2Z2XA 3UB3A 4BNNA 3S81A 1XRLA 1KZYC 2KPOA 2V6GA 2WT8A 4INAA 3R7WA 2I66A 2CJWA 3IT0A 2BFFB 1ZCFA 5HK8A 3TLKA 1XTUA 2GXAA 3QXSA 1ZKDA 3HUEA 1R37A 5DNDA 4FB4A 4XOIA 2B99A 3O31A 4YRCA 5CDUA 1CJSA 4QTZA 2IF2A 1SIBE 3BSSA 2FGKA 2QX8A 3PQ6A 3DEHA 2RG7A 1E7SA 3ZWPA 3WGJA 3DE4X 2I2CA 5B64A 4GWGA 5J4VA 3BH0A 2FSPA 3T5AA 1WB9A 4KDRA 4MYDA 3RYFA 3SYKA 4YAEA 4OU4A 4HB0A 3SM9A 3UWKA 4ARBA 2ZRPA 2QZPA 4DRXB 4R8LA 2P2NA 2HU5A 1MZPA 2XOKA 3CNHA 1AUXA 3EUFA 2NZ8A 3CNLA 4YREA 4Z9XA 3C3EA 4DDUA 1YF3A 3HKEA 4DUGA 4G56A 4Q7LA 5DH9A 2BY4A 1G2QA 3C3KA 4U2KA 3OPYB 2QN3A 5BOVA 3AM5A 2QF7A 2J87A 1JP7A 2Z08A 3LKZA 5AJTA 4TROA 5H3LA 1JFFB 2CUTA 1WBJB 3JVUA 4MLCA 4RK0A 5CH8A 2X2OA 1JIIA 1M1ZA 2E4AA 1NBAA 2ZS7A 3E9MA 1DWUA 4NZ9A 4WXEA 1NDQA 3OWHA 3DAFA 3P2KA 3F1LA 3BMCB 2VJOA 3IE2A 2WD9A 4DM4A 3IAS1 1U0TA 4CM3A 1JQDA 3MWFA 3C14C 2LCQA 4MPJA 1AZSC 3ZU2A 1DWQA 4YJGA 4IOJA 4DV6B 5C1IA 2DBZA 4Z8XA 4X8HA 3A11A 1JEQB 3DFZA 4IGAA 2XCIA 2ZVJA 3L5OA 4UCWA 1Y3AA 2A78A 3I5AA 1B42A 4PWYA 4QTXA 4JELA 1KAMA 4ER6A 3A6KA 4F96A 2BP7B 2BGNA 1Z68A 3I9V6 4D96A 1EVEA 3ESCA 5FXMA 1UDWA 1SHZA 3GLUA 3H1BA 3FFAA 3RJTA 3L6OO 1JA9A 2OECA 4U7FA 3SYLA 5BV0A 9ATCA 5AUOB 1SU8A 3COJA 2NP7A 3IOMA 4B71A 2H4HA 2QN9A 3FIJA 1XJ0A 3WZ2A 4F5YA 3S3TA 3ZJVA 1JGTA 1YCDA 4N5LA 3CNEA 1P2SA 2FR8A 4OQYA 3T3IA 4BVEA 3HZHA 4YT8A 4DV2B 1KAOA 3DF7A 1T91A 1Z4QA 3MJFA 4Q3AA 2BFWA 4CDMA 2O8DB 1Q14A 3AP2A 1WCWA 3HJGA 2JLVA 3OZFA 5F5NA 4YV2A 2HXSA 4D44A 3P0IA 2Q2VA 2IYEA 2HA5A 3OPNA 4J76A 1OXVA 3R8XA 3RG8A 1N7HA 3BHJA 2KE5A 5REQB 1QE3A 4HTFB 1UXOA 2CXRA 2FJPA 1J2RA 2GA9A 1WEKA 3N76A 4GO1A 4ERXA 3ZHBA 4K9SA 4Y0NA 4FGUA 1N2CB 5BWLA 2P68A 3M4NA 5KYUA 1YFZA 4OGWA 2HA6A 3FDXA 1Z73A 4P5DA 4UM7A 4X20B 3H9GA 2CJXA 2CVHA 3PTZA 3YASA 1EFLA 4E32A 3ZOZA 4HYTA 1U3CA 2O0JA 1YIOA 2X2EA 3DL4A 3MJVA 1FFCA 1I51A 4RV5A 5EE5B 5LQMA 2QT9A 3PTLA 2O8BB 1U7DA 2AR0A 3KYCB 3K5HA 4KN6A 2G82A 1GPLA 4PFJA 4FZ3A 4QU8A 4UXIA 3PNKA 4K9QA 4D81A 2XCSB 3LNTA 1TKCA 1XYGA 1SC4A 1KJJA 1C1XB 3B7GA 2XUPA 4FKZA 1NATA 1Q22A 1UQUA 4FD3A 4PEVA 5CIQA 5ENZA 3M8KA 1PL6A 1US8A 3MJEA 1KSGA 3ROXA 3SE7A 4EPTA 4O4IF 3CX8A 1KI7A 1OLSA 1YO6A 3WQBA 1W87A 4M9SA 5AHOA 3JQ9C 1C8VB 3DEYX 3FOAA 2F1RA 3LHKA 4YUWA 5IAJA 3HB5X 4FFPA 1SC9A 3ETDA 3KAJA 3O4JA 3WGHA 3PJGA 2IUYA 4JLVA 1JMVA 1YC5A 3NEAA 3H3XA 2O19A 4RABA 2ZK7A 2XMRA 4XGQA 3OZXA 2QSUA 4GZLA 2GKOA 4G07A 1HDXA 3WWCA 4KBYA 3CG0A 2QV0A 4LWOA 4P3YA 4RTLA 5DYWA 4EVIA 1TI7A 1NIPA 2OV1A 3OKPA 4YAGA 3L1IA 1MVOA 5B30A 1QRAA 5F1YA 5DSTA 3ZHTA 3MMZA 1Q20A 3KOWA 3QFCA 4B6EA 1IJFA 3KR2A 4HUTA 1WCIB 2PQ0A 2RHMA 3H11B 3G7SA 4K5QA 3ZDRA 2Q6VA 1LU9A 1EEHA 3E70C 4FFWA 5H02A 3BMQB 2B8NA 4N3AA 5IFLA 2FAXA 5AJYA 1EM6A 1WULS 2BGRA 5KSOA 3ZCPA 3GAFA 2C99A 3QX9A 2HHAA 3FF1A 3G8YA 1V8PA 4JI3B 3MZ0A 1PJ2A 2BUAA 1G9SA 3UV7A 2NZYA 1CJBA 3NTUA 4ZXFA 5C32A 3HKBB 2K2QB 1E2KA 4YRAA 2YN2A 4A27A 2JLCA 2X8LA 3FHOA 1UKYA 3WV4A 1GNPA 4FDMA 4I2NA 3QYJA 2QE7A 2VUIB 3ACBA 4PHTA 2C7GA 2BFBA 3QKSA 5DI9A 4JXKA 3SKVA 3R0QA 1YJXA 7REQB 1R4AA 2VHZA 3GQVA 5BW5A 1JQEA 1QORA 2P4SA 5EINA 5C5DA 1J5EB 4TT3D 5IUNC 3VSDA 1MGPA 4BNXA 4Q4JB 2KI5A 4DG8A 2RI1A 2D8AA 1NBWB 3ZLUA 3AHJA 4TYNA 2ZJYA 3SS9X 3EEBA 1TQHA 1WXEA 3M5DA 4HVCA 3KWJA 1AG9A 3OLXA 4W1PA 2DKFA 5DWVA 1QX4A 3OPVA 1ZOSA 5ALFA 4G5GA 4I4TF 5CA1B 5GJWC 2A88A 2PXXA 4EY7A 2VAXA 3FWNA 1P0PA 1I30A 3IHKA 1P7VA 4MUGA 2G9RA 2QL5A 3OEHA 3HDVA 5ALTA 1ENYA 2GZRA 3ET4A 1NFFA 3IMKA 1GTZA 3PE6A 4HXFB 4M0UA 4UVDA 5JBQA 4EQ6A 2AR9A 4QNNA 3VBEA 1S7CA 1DMRA 1EUCA 1MAWA 3DXZA 4NV0A 1FX1A 3DT8A 4X1IA 3RS8A 1DIHA 1G5RA 2O4CA 1SB9A 1EDDA 3QLTA 2QYTA 5DRYA 3LC7O 4UZSA 4DMGA 1HYGA 4FYMA 2WM8A 1Y5MA 1WV1A 4HWOA 2WQ6A 3VAZA 3NLLA 1VIYA 4MA4A 4P4SA 4BX9A 2JHGA 2M1ZA 2QN2A 5KTYA 3BK7A 2GCOA 4UAUA 3WGKA 1T36B 1XDZA 4TMWA 2O50A 4XDGA 3FYUB 3MJSA 4WXRA 1QUFA 4YQYA 4BMXA 1SMKA 3BTSA 2GPNA 5ARBA 4ZREA 5BP7A 5L7WA 1T5HX 3EXEB 2E4YA 4JLJA 3ZNNA 3K2QA 5JWHA 1KO7A 4CG1A 1K86A 1D6MA 2XSZD 2V7UA 2EF0A 2MINB 3UCEA 4CFYA 2AZTA 4CMHA 1YHZA 1NC1A 3PJEA 5ALZA 1F2VA 1RXCA 2GPWA 3ADPA 4RZHA 4QLBA 1M6NA 3G2MA 1SHTX 4HS4A 4WVLA 4E94A 3A1CA 4YI3A 2IXTA 3TX6A 5D1HA 3ZVKA 4DLSA 3DE5X 3FUCA 4RTPA 4RDHA 1JBEA 2JCBA 1T5TA 4GOXA 4WJKB 3A4VA 1YZKA 4Y1FA 4F8YA 2NO9A 3C70A 5BWNA 1QDUA 1I4OA 2X13A 1SXJE 4MGYR 4PE5B 1X7YB 1RKUA 2ZYWX 3ZW8A 3OEED 4B2PA 2PAFA 4FUTA 4AFNA 3E9EA 4URZR 1Z0DA 3LPMA 4TQUS 1KWKA 4MR9B 1OCEA 2O2JA 4L72A 4YLEA 4WFIA 1TYEB 3DDOA 5D86A 1D1TA 4ZXPA 2YWDA 3UBTA 4H4DA 3H9EO 5IKMA 1QRRA 1N3IA 1Q0PA 4IDOA 4UDNA 4UFNA 4ZC1A 2YVUA 2I6UA 3DC2A 4F4FA 4H6PA 4HBZA 4L5YA 3AO0B 1LK5A 1FP2A 5CFZA 4PR0A 5K6TA 3WGYA 4FT4A 4P32A 3FMGA 1KDRA 3DVAA 2P3QA 2A1TS 4RD3A 5KC9A 3D3QA 2IC5A 1Z0FA 3AVTA 3FBTA 3PKJA 3G3EA 5ILQA 2XR1A 4WOKA 4FINA 4FW8A 3JALB 3N3BC 4DV0B 3ZXYA 1DAKA 3B5EA 2ZCUA 3C3BA 3N2KA 3PXXA 2IF0A 4GIBA 1TM7E 5HE8A 4D4GA 5KBYA 3Q8KA 4LYFA 2O14A 3F7NA 3QLEA 1XLTA 2N3ZA 4JH0A 3WMFA 2V6JA 4MAAA 3UK1A 2R6ZA 1FNSA 4C4XA 1NYLA 4ENWA 4TQ9A 1KSHA 1T6BY 3LHDA 1J00A 2H4ZA 1PQPA 1R0YA 2HV8A 3FNQA 3OE7A 3X1XA 4CPDA 5A02A 1H22A 1JDSA 2YOHA 3OC0A 4Z7NB 1D6SA 2TS1A 4KGXA 3GLFE 3C4JA 3DL2A 1SELA 1YXMA 4TWAA 1UQTA 4M0FA 5C51B 1HDGO 3NYIA 4NIMA 4HGNA 3NBUA 1YU6A 4W1SA 4KAFA 2D1QA 4BMZA 3FSGD 4IJMA 1FTSA 2J48A 5B7NA 4GLLA 1FFEA 4E6PA 4URXR 2IODA 2OK8A 2WAAA 3BK1A 4DIMA 2C58A 2JFHA 1XZFA 2JI9A 3DO5A 3KUCA 4MGIR 4MR8B 3SR3A 3SSOA 4X60A 3ZU4A 2PUEA 1Q77A 4BRUA 5ARCA 1GPNA 2C0CA 4GMKA 1Z8DA 3VU0A 2RGBA 1RLMA 4LISA 2WJ3A 5BYKA 2PJRA 1X8XA 3VVLA 3L0OA 1P1BA 4QA9A 5AI5A 3ST7A 1UK8A 4FTWA 2NXJA 2HLHA 1YC2A 5DX0A 2OP1A 3B1WA 3CZMA 2ZP1A 3M9LA 4IOLA 4AJIA 5K0FA 1T4BA 2FW9A 2AD1A 3BA6A 3HN6A 4HQOA 3QGMA 3OQ1A 4MR7A 2C61A 1Y81A 2JLSA 4IYJA 1GZVA 3KJIA 4WKPA 3CRW1 3P32A 1QRUA 5KNDD 4MKFA 4JD5A 4RY0A 5TARA 2QQEA 3SR0A 4FZVA 3K0EA 5EHNA 1Y8ZA 1NU8A 3G59A 3AJEA 2ZBQA 4GXNA 1SVUA 4I1RA 1ZLXA 4BNMA 3Q8MA 2CLDX 3EIFA 4KWCA 3R9XB 4CLOA 5JZBA 1N5KA 3TCXB 1UZAA 1YB5A 3MWDA 3WIUA 2D5BA 1T29A 3CZ5A 1XAIA 1XJCA 3P20A 3PD7A 3N8IA 3UICA 1V3TA 2CV0A 5FTWA 1HE4A 4KWHA 1R6DA 3QU2A 2JAOA 3LHIA 3M34A 2AUMA 3CF0A 5FAXA 3CVYA 3QEOA 4DR7B 2OZLA 3JR7A 1UFKA 1VIDA 1H4QA 3H5LA 4FSXA 3A3YA 3KC2A 2ZXEA 1DI0A 5FOUA 2GNPA 2QRGA 5IP5A 4NCIA 1JEJA 2D74A 2IIQA 4YRFA 4MAMA 2VBIA 3I9OA 2GD1O 3HDYA 4O4LB 1KP2A 2FWRA 1PWZA 3PDCA 4ZT4A 1XUOA 1ZCJA 3OCZA 3VVCA 1YSCA 3VR3A 3HCWA 4RTQA 3PL5A 2YXNA 5ER9A 5ITVA 4JKYA 4IDPA 3SDSA 3HJCA 1A9PA 1KZ7B 4GM4A 3KTFA 1BW9A 2PX2A 3JQCA 3Q72A 2CV2A 2ZPAA 4J4HA 4JU8A 5LWQA 821PA 3W6UA 3F90A 2PD3A 4FX2A 2WG1A 3GEEA 4LHZA 3BJIC 3V4RA 5JZOA 1D1SA 4UTPA 1W1WA 3DZFA 3JATB 3PYMA 4PYJA 5IMSA 4PX9A 4TUYA 3UWOA 3JQDA 1BMDA 3E35A 3GC6A 4NEQA 4OFZA 4DARA 1A8IA 1YRYE 4BO8A 3ZHVA 3VZPA 2X9QA 4B3JA 5PGMA 3Q9SA 4KK3A 1GLNA 4G9BA 3P5BA 2JC3A 1H0RA 1O94D 1RRVA 4F5WA 1RADA 3P2OA 3JVEA 5KNBH 2GR9A 2HJSA 2VNIA 3NI2A 4N7MA 3TZLA 3ZWQA 5CA1F 1Y3BE 4QECA 3HB0A 2P41A 4EMTA 4BDTA 1ATZA 2J45A 4D6YA 4LPSA 3PFHA 4Q5IA 2BGJA 3TGWA 4U5XA 4MGKR 1G5TA 4AMBA 2VK4A 3WSWA 1V1RA 1LNSA 1TQ4A 4DV7B 3H2GA 1KRXA 5EE0A 2PNFA 1KKMA 3BE8A 5FIUA 3TO5A 2WWWA 4C3VA 5J1SB 4D3YA 5K7SA 1XMQB 1XDGA 1RWVA 2OBBA 1L4KA 3FYUC 1WKBA 5ED4A 2ANBA 2OO3A 1BXKA 3PNOA 1WHSB 4FFLA 4GEGA 4NQRA 2QE6A 5CHEA 4EAQA 5CT6A 3E58A 4RVCA 1RYYA 4JVMA 4ZN6A 4URFA 4ZJUA 4F4HA 4Q1BA 2ZJBA 5U4QA 3UKDA 5SICE 5FNVA 1PVDA 4EARA 3G1WA 5IF3A 3CQ9A 4HGYA 2ZUCA 1GKKA 2G8LA 2HNBA 3QLVC 4GPZA 3BBLA 4ESOA 5JCPA 3OAAD 3HCNA 4H15A 2NUAB 2HY7A 1CUVA 2TYSB 2DQYA 4CJXA 2FETA 1EJ6A 1W6RA 3R1IA 1N2EA 4P82A 4RZIA 1B8PA 3U0VA 5KJFA 2VLIA 1TYBE 1V37A 3OBBA 5D6NA 4D1YA 5FP0A 1OV4A 3CYFA 4KLAA 3ICVA 3RUEA 1GP2A 3PHIA 3DHYA 2E82A 3T7TA 2XCOA 5DLQC 1JJBA 1KNXA 3A31A 2OVFA 3LLUA 2BVNA 3SOPA 3ICQB 3ACDA 4XB2A 4HX2A 5F5XA 1NJFA 1AE1A 5FEMA 3ABOB 3WO1A 1II8B 2A0UA 1YQUA 3FPFA 1HURA 4FXPA 5HPYB 1BJTA 2ATXA 3HFJA 4M1EA 2B8JA 5K45A 1FYVA 3A1DA 2R8XA 2DR0A 1YJCA 2P9GA 3WGMA 1AB5A 1ZWLA 3TSZA 3R41A 3DCIA 2WNSA 3QU4A 3EXHB 4DGQA 1XBTA 4F2GA 3A1NA 2J59A 2DC1A 3LLSA 4CCYA 1UKAA 5H16A 3W1EA 3AT1A 1SIUA 4IKOA 3DC7A 2ZIXB 1RTKA 1LX7A 4G8CA 2O5RA 4RPLA 1RI4A 5AQEA 4V0SA 3P9KA 4K0RA 1YS1X 4R2XA 4HQLA 4A6EA 2A9VA 1TCCA 5IC6A 4OIMA 3OFSA 1FYEA 1GUZA 4CMBA 2R7KA 2RCNA 3SGLA 3W0LB 4DJAA 2CDNA 2K87A 2EBUA 3COYA 1M7HA 4WK4B 4D79A 4F3YA 3FDZB 2XWQA 3SSMA 1MJGA 2OAQ1 3HA5A 3I09A 16PKA 1YTUA 2IU4A 3QUCA 4DCUA 4OXXA 1UR5A 1CTQA 1RXEA 2EAUA 2VOJA 2WTNA 1RQ2A 1YGYA 3DAHA 5LLTA 3AR9A 3GWZA 1AGRA 3P2IA 5K20A 2FPGB 3TW8B 3TZEA 4GVLA 3A9RA 1UBEA 3EBLA 1JWLA 3AB7A 3ENQA 5AXAA 3ZWAA 4DRYA 3FDIA 1Z4IA 3O75A 3HVKA 2QLMA 4BKPA 4DIBA 4Y2VA 3D5QA 1GCOA 3C43A 1T5IA 4LC0A 1FJXA 1JPJA 2ON6A 2MSWA 3K9QO 1E9SA 3UT0A 4BL5A 3C24A 3U13A 2UXBB 4S04A 5LQDA 1C1DA 2Q0QA 2RGNC 4MW4A 1WMSA 4D5EA 3L93A 1DAPA 1ZD9A 1KTVA 3DV2A 5G41A 5LZ9A 1ORTA 1WVMA 2J32A 5BURA 5J2UB 5NLLA 5GV8A 3H83A 4IRXA 4XPIA 4BC1A 3HBJA 3K9BA 4YCJA 3CNOA 2AOWA 1UBTS 4NESA 5E3IA 1XQVA 2YZMA 2DPYA 2QLJA 3FWZA 4H6WA 1XTKA 1VJ0A 2B21A 3EAQA 4OJKA 3I72A 1RXYA 4EY6A 3DF9A 4Q00A 2ZCJA 3QX7A 1P33A 1R2QA 1C2TA 4RA9A 2O5EA 1J1ZA 1QFXA 1GYQA 2Y8EA 2QNRA 4FYJA 4C0HA 3AJ8A 2E2WA 2OD2A 5GVRA 3MILA 2GPSA 1AQNA 3ILSA 3ZD6A 5E6RA 3WYDA 3NHRA 4TL8A 4CMEA 4IG9A 4E2FA 1Q50A 3ZGYA 1N4AA 2I4NA 4RACA 4PN3A 2W58A 3WAGA 1SK8A 4B5KA 2QW1A 5AVZA 4GDFA 1RVV1 3LFTA 1PSZA 2W83A 2QJWA 5LDGA 3HUTA 4EZIA 3L41A 4WLVA 3OQBA 4QJBA 1G8YA 5DW3A 5JCJA 1I2MA 2ZAIA 3DT9A 4IKPA 2QY9A 3A6JA 3E27A 1VKZA 3LH5A 3W9BA 4XWKA 1EH5A 2G25A 2PZKA 3K1TA 4QEZA 5CW2A 3HO6A 1FFWA 4I8IA 1X7WA 3KDPA 1L5KA 1Y82A 2FMXA 4V1CB 3IKMB 2BFEB 2G1PA 3L6RA 3KVRA 4EENA 4FU0A 2UAGA 2P2DA 2FR1A 1G3MA 3RO7A 4YAKA 5KX5A 1T1IA 2VSQA 2WINI 4UUAA 3A0RB 1DJLA 2CCKA 2OCGA 2WAMA 1E0AA 3MTAA 4O4LF 1JQLB 1KFJB 2OFOA 3W3AA 4HDKB 4OOEA 1DJNA 4I14A 2JGEA 3A4MA 1L5SA 3BIFA 1Z83A 2UZ4A 3D8TA 2YFKA 4XZ3A 1DG1G 2XPCA 1W29A 4HAIA 5DTRA 2NU6B 2ZI3A 1VKJA 3RAFC 2DMRA 2MTBA 2H59A 4P93A 5HCUA 2MYTA 4HFRA 1XR3A 1FYXA 1WSBA 4B80A 5C80A 5K05A 3FGPA 4P2GA 3OCVA 5JSYA 1CR4A 4HATA 1U0BB 4G9GA 1LQUA 5TJHA 5LKRA 2I1LA 4S0XA 2GTHA 1CF9A 1SZCA 2O8VA 2EW1A 2PL1A 4GBJA 4IM7A 4PV7A 3QWHA 4BNDA 2GLTA 3V1MA 5BT8A 3DLPX 4TLEA 4WZBA 4ZOLA 3C97A 4UVHA 1VYHA 4AWXA 3EFHA 3OIVA 1OI2A 1QQ5A 1RT9A 4MVJD 4QPJC 3BS4A 2BBSA 5BW8A 1J0XO 2PGAA 2O3SA 4FZ5A 3ISVA 1N0IA 2BTQB 1K2WA 4GPAA 3ND8A 5KCZA 1JQAA 2OXFA 3FPHA 2ID7A 3UMVA 2PL3A 3V8EA 2NO0A 2OSVA 4YP6A 3LYLA 3L7BA 3LOUA 1A8PA 3ADCA 3PNVA 2ZI5A 5C7IO 4NCBA 2O3UA 2R8OA 1FUKA 3P2JA 2Z5LA 1EYZA 1H3NA 2UVDA 3E4CA 3GK3A 3L06A 4K9RA 3TSOA 5CFRA 5TGDA 4GR4A 2ZZKA 1XA4A 4D6PA 3EJ6A 3AYZB 1IOVA 4RGBA 5H4GA 2CF5A 2O4UX 2ZVDA 4GI7A 2H1OA 1U1DA 1IHPA 3HQ4O 3TLYA 2UZ0A 2YBEA 1MB0A 3OF5A 5LC1A 4X7PA 3KKPA 3M82A 1LSUA 5AJUA 4BO5A 3IUQA 3W8DA 3PX2A 1GKLA 1ZISA 3DE2X 3W77A 1Z4OA 2IEZA 2L19A 3BYZA 3CZCA 2OBXA 2HKIA 2A4MA 3EGDB 5JE8A 1OA0A 3SYTA 1A9ZA 1TGYA 1HY3A 4WJLA 5B3KA 4ZCSA 3TD9A 3NT4A 1PHRA 4EB0A 2FP3A 4QASA 1SUIA 1C3JA 1ZU5A 5CPBA 4ZP1A 1U2SA 2X9GA 3IR7A 1YHYA 3U7JA 2R7NA 3ZDDA 4P33A 3ZHQA 2I22A 2VHWA 4CU2A 1H1DA 3UC9A 2SKCA 4JI8B 4QULA 1OOEA 2VZ9A 3MYYA 4FP9A 2FSIA 2ZTSA 3E8MA 3CUKA 2OQIA 3OEWA 4HLDA 4MI9A 2R44A 4N40A 1JYEA 1SBHA 4I50B 1P2FA 3FPJA 1BKSB 3AESA 4W63A 5BV2P 5CFQA 1J0AA 3HC7A 4TWBA 4Y7DA 4AY2A 5WRFA 2O54A 3B6MA 1JNYA 3ZCVA 1X2EA 4KYIB 2VYVD 4UBJA 2AN3A 1L5ZA 5HF8A 5EKXA 1OUMA 3W5IA 2ZJ1A 1JE1A 3OJXA 2OBMA 2YCLA 3EXHC 4G89A 2WG2A 3NM4A 3TRIA 5TF0A 3H0KA 2FRDA 2NQ8A 3IR6A 2ZQYA 5FKJA 2GBCA 3VZBA 2RGAA 4IRMA 4QARA 1GUFA 1YBHA 1L4YA 5C5EA 1L1RA 2MU1A 2RIPA 4ZEWA 1CT9A 2H9IA 3DOHA 3H65A 4MDEA 3N2EA 1OXMA 2C1ZA 3VKGA 3U48A 2HDOA 3STVA 4GI2A 3VHQA 4KXYA 1ZHFA 3KYBA 1NM5A 3RU3A 3PXCX 1MENA 2HNAA 3WQRA 4IG4A 1USUA 2HSDA 2IYFA 4DVGA 1RM0A 3BD6A 3MS4A 3O93A 3N7UA 1P73A 1L5LA 2IH2A 3ZCQA 4QFDA 3GR6A 2YW9A 2CFOA 3LUKA 2BMAA 3NONA 3QBTA 5CCEA 4A91A 2XZPA 5YASA 1IAVA 4RKWA 5LDDC 4E09A 3RKSA 4GP6A 1QVZA 4DCCA 2C2KA 3GAMA 2FE4A 2PR7A 3D0RA 3KLNA 3C41J 4HMQA 3ANNA 1W4RA 4ARSA 4BAGA 4N5IX 3ICPA 3PEYA 1P5RA 2C96A 2QYHA 3PUKA 1PYGA 5BO5A 1Y37A 4CCAA 2FW6A 4J1NA 3H7AA 1L5NA 1E4OA 5HM6A 3GN2A 1NXOA 4QU5A 2JFYA 1Z5WA 2CNKA 4J07A 5EN4A 4ZMSA 3PHBE 4N82A 3VI3B 2IXDA 1E3WB 4YBZA 4MH0R 3OQOA 1D0IA 1CF2O 3OT4A 4B33A 4U1RA 2OXRA 1OYOA 3EZNA 2DXIA 4Q1CA 1HFJA 3FKSD 4CF4A 4BX2A 4YCDA 1YVDA 3UMSA 2RGGA 3OJWA 1IOWA 2V1XA 4GKBA 5KIAA 4ND8B 4CF3A 4DLWA 3OSZA 1LDEA 5E9WA 4IW3B 3QEKA 3R5HA 1DX9A 3TZ6A 1RS0A 3LBFA 4CLHA 4GP9A 5AJWA 5JCOC 3A3OA 3ORSA 3EGEA 3CHYA 1M8FA 4B87A 1FFXB 2EHDA 3GJ3A 3R7BA 1WA5A 3KAKA 5J2UF 1EXMA 3K9WA 2A5JA 3KAPA 2OXIA 4B3XA 4PQGA 4YCMA 1DZ3A 4DUZB 3FSRA 1TYCA 4AULA 3GLSA 1ONBA 3I6ZA 1W5BA 1ZH4A 2JI8A 2UUOA 3W5UA 4WQMA 1H6BA 2PN1A 3DT6A 1FA9A 3E5MA 3PC4A 4US0R 5JBIA 1WO8A 2Y71A 4CQMB 3TXAA 3DUWA 3LD9A 1K8QA 1ZL2A 2WKQA 4IXDA 4R9RA 3UWSA 3VTKA 2RC6A 4JI6B 4WNCA 5FUYA 4I19A 3AF4A 1CNMA 2X41A 2BF4A 4EPVA 4E12A 5BQFA 3F71A 4JJFA 2FZEA 1YZFA 4JVNA 2W2KB 4Z1MA 3HCRA 4WJZA 3EMBA 4NNJA 4UHKA 5BY2A 1E62A 1RAHA 2H52A 1XKLA 2YR0A 2HIMA 1F6WA 2H9AA 5JMPA 1JMYA 4A7PA 4PLYA 2RAVA 1OYWA 2O06A 3E7WA 5ALSA 3RC7A 4BGVA 5KNCD 2AT1A 3W1WA 1O58A 4Z9YA 4U39A 1JZSA 1R6VA 3A6DA 2VQ6A 3BFXA 4P4GA 4Q1EA 5HS6A 4DNPA 5EJMA 4BEVA 2FMFA 1PEYA 3MBIA 1C9DB 1Z5GA 3AJRA 3GRRA 4HGZA 5LUBA 2OD7A 4FX5A 2OCPA 2ZUUA 4HADA 1SEVA 1M2OB 5F3WB 3LC0A 5B57C 9ABPA 3RJ9A 1IPHA 1PZMA 2ISQA 1IY0A 2XNDD 1G55A 4YHBA 2JFPA 2H48A 3FR8A 3ZDAA 4Y2RA 3HPQA 4FGSA 1QSGA 2OQ2A 4JODA 5LLSA 4DDMA 3H5AA 9LDBA 2OBNA 3MTDA 2WFLA 2CJYA 4F12A 2BFDB 1XDBA 4OKIA 5EAIA 2DAPA 4WHMA 1D07A 2PGXA 3EK2A 521PA 5J5VA 1BRMA 1HH4A 3L7DA 3ZW7A 2IEDA 2LDXA 3M1YA 3PDIB 3V7YA 2IW1A 4JMPA 4MW0A 4DY6A 5AK3A 3ETEA 4KE6A 1NUSA 5F77A 1N6NA 1Z9BA 1YONA 4PVCA 4YAJA 3ME5A 3TQOA 1ULZA 1XTSA 3C6ZA 1R5NA 5FNZA 5B5SA 2HPZA 4QYWA 3HB1A 1PT7A 2FX3A 4GI1A 4XW2A 1CYDA 2D4AA 4O2AA 5FPHA 3P1JA 3PXEA 4ENQA 3T1YB 2R00A 5L6MB 1Z15A 3S70A 5KOYA 1XU7A 2WSYB 3FUTA 4KHZA 3VR5A 1S01A 3L7YA 1CUUA 4IQ0A 1SCDA 4I5FA 5CBPA 2D06A 5JHHB 1P0CA 1KPHA 1PLJA 5EPUA 4ZVMA 2VRBA 4CMIB 3QVUA 4ALKA 3QF7A 3FAKA 3FPBA 3LP5A 2W4IA 3UKJA 1DT3A 3M6XA 1E7MA 3EN0A 1PS0A 3GY0A 1JLLB 3P0RA 1Z5OA 1PS8A 3C5WP 2WU8A 3L43A 4LS3A 1HO3A 1VHJA 2JHCA 4R16A 3H3FA 2EFEB 3HA2A 4XEHA 5B2ZA 2ZUTA 4CF5A 1A9YA 1NMSA 1AMUA 4B6SA 2FSSA 2QTLA 3H3JA 2XD9A 3MJRA 4LTNA 2RJOA 3DVLA 2QSYA 1PEDA 4IMPA 2WB4A 4CF6A 1Y4AE 4RNDB 4KU4A 5M5BA 1VL5A 1DWOA 2XUIA 1XXHA 2XY4A 2QSJA 3O7MA 4M8SA 1UJ4A 4WADA 4YCAA 2WYUA 2OE2A 5GAJA 4YRDA 2IXFA 3R7NA 1B23P 1E2IA 4WOCA 2XVYA 5AQ1A 1EVYA 1TX4B 2YUTA 1IL0A 1F48A 1Y6ZA 3NHKA 3JARA 1AKRA 1ZJYA 1E6WA 2BEWA 1W8IA 2DUUA 3DKIA 3QJ5A 5FF9A 1KSFX 4FK8A 4X1OA 2A5FA 1I2BA 1XMSA 1ZXXA 3ZX4A 2UDPA 2QXYA 1JAXA 1P2GA 4ITUA 5HVNA 4FGKA 4KRGA 1KDVA 3FTPA 1SCQA 2ATIA 2Z8YM 4UHHA 1K8ZB 5CVTA 1G64A 2XKKA 1VE6A 2H1RA 3QLUC 4XSHA 2IHVA 2Q1WA 4I50F 3U16A 3CIFA 4JJ8A 4KFTA 2BONA 2PUWA 5EGNA 3Q8LA 3D2BA 3E53A 4J49A 3TGLA 3ZE6A 1XL1A 2QIPA 1Q6YA 4JUDX 2ZTLA 2H51A 3NYRA 3OZGA 5JG7A 1PGOA 3BRWD 3DDWA 4M88A 1JSLA 1MEJA 3OZSA 1U0OC 3PRJA 4U7HA 3B8EA 3ZV4A 1U3GA 1RRKA 2XF2A 3ONEA 2QAGB 1OAOA 2GJKA 3PF8A 4J0JA 1M74A 4NJEA 4PC1A 4YV7A 3NVMB 1SVWA 4ES6A 1LSSA 2VPIA 5LZ2A 4XJTA 4G5OA 4UEQA 1RYEA 2W2LD 4ZVPA 1IXYA 1S8OA 1A2OA 5JXHA 4LDAA 2C3MA 1W0CA 3PHHA 2OHOA 2WOJA 3O1HB 4EKEA 3AVOA 2ZQ5A 3QX3A 2B4AA 1E6CA 2G80A 1A82A 3RVLA 4MV4A 1Z16A 3K6RA 2YJZA 5EXDA 4XQGA 3V2HA 4R40A 4HNQA 3X1KA 1VFNA 1Q0TA 3NBAA 5AESA 4AZSA 1PNRA 1UWCA 4ALIA 4K7JA 2OZPA 5EC8A 4RNCA 2VSOA 2A7XA 3MB5A 1ZESA 4IXTA 3HNPA 1SXIA 2WTXA 3UK0A 4NKRA 2IE0A 4H2DA 2HREA 3RUDA 1H8ED 3GAAA 4BVJA 3I1YA 4BZXA 1XCOA 2BLNA 4J0IA 3NIFB 3G5LA 1AXEA 2VRCA 4MRRA 1IBRA 2C9YA 3SVLA 5ELLA 1XTZA 1C4OA 1P17A 2E5WA 2BKXA 4ZAXA 1CUGA 1IOZA 1BHO1 1U9JA 2D59A 4FD2A 3TMKA 1EUDB 1KH1A 5LBIA 2RE8A 3R8FA 3F2IA 4AICA 1SWWA 1MAVA 1J7JA 4TTQA 3A6ZA 4OLAA 1S3IA 5DCWA 2I78<