1D7OA

Crystal structure of brassica napus enoyl acyl carrier protein reductase complexed with nad and triclosan
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
297
structure length
297
Chain Sequence
GLPIDLRGKRAFIAGIADDNGYGWAVAKSLAAAGAEILVGTWVPALNIFETSLRRGKFDQSRVLPDGSLMEIKKVYPLDAVFDNPEDVPEDVKANKRYAGSSNWTVQEAAECVRQDFGSIDILVHSLANGPEVSKPLLETSRKGYLAAISASSYSFVSLLSHFLPIMNPGGASISLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEAGRKQNIRVNTISAGPLGSRAAKAIGFIDTMIEYSYNNAPIQKTLTADEVGNAAAFLVSPLASAITGATIYVDNGLNSMGVALDSPVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of triclosan bound to enoyl reductase.
pubmed doi rcsb
source organism Brassica napus
molecule tags Oxidoreductase
molecule keywords ENOYL-[ACYL-CARRIER PROTEIN] REDUCTASE (NADH) PRECURSOR
total genus 101
structure length 297
sequence length 297
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 1999-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1d7oA00
2FZEA 1G0OA 2HUNA 2QHXA 5DULA 5IDYA 4QTZA 1NWHA 2AEMA 3H5AA 3VAZA 4DMLA 1X15A 5IZCC 1B0AA 3OP4A 3GR6A 2FPGA 5KOIA 5BSFA 3JYQA 5A03A 1YJQA 1ZFNA 3DZKA 4J91A 4CLHA 4YCAA 3S2IA 4O63O 3T7CA 4WNCA 2B0JA 1WLYA 5TF4A 3UAGA 1J49A 4BO6A 1YB5A 1P1IA 5KJ6A 3DZHA 3WGIA 3ZV3A 4ZU3A 5KCZA 2X0RA 2O4CA 3OM9A 4RF5A 4YJFA 4O59O 1GDHA 1HDZA 3L9WA 4O0LA 1TEHA 4GLOA 5BSGA 4DLLA 4KUEA 1YBMA 3E1KA 1YH3A 3OICA 1HXHA 1MP0A 1MUUA 1UZNA 1AE1A 1BXGA 1ENPA 4XWYA 1LC3A 1U3VA 2IZ0A 1AXEA 3CTMA 3DBLB 5TNXA 4CM1A 5G4KB 1TT5B 3ZWAA 1HYHA 1A5ZA 1I2ZA 1PQWA 2HRBA 1E3WA 1RYEA 3K31A 3ZDFA 3LF1A 1T25A 5IXSA 4KTTE 3VZRA 5B1YA 3COSA 4UEKA 3RSHA 1A7AA 1PJTA 1VLLA 2PH3A 5LC1A 1H6AA 4XQCA 3PHLA 1B26A 3HN2A 1E7RA 4F45A 4ZQFA 1KYQA 2RBEA 2ZTVA 3DFUA 3NUGA 3ZWCA 3RVDA 1AN9A 4OL9A 4FJ2A 3JD1A 3KLMX 3BMQA 3WLEA 1DRUA 3IUPA 5AXBA 4E2WA 3JYNA 3MJEA 3BMCB 3AJRA 2Y99A 4PCVA 1F06A 1XQ1A 4CMHA 3ZU3A 1P1JA 3M2TA 3D4OA 2E4AA 1C0KA 2QZZA 3H2ZA 4OHUA 2VHXA 1EUCA 2X4GA 3LK7A 4BGEA 1E1KA 3MJSA 4RJTA 2DU8A 1XGKA 1QYXA 3BA1A 3D3WA 5FI5A 2OUIA 4CMAA 4I5FA 1VKNA 2GN9A 3LT2A 3A06A 2EJVA 5C7LO 2GD1O 3U4IA 4J7UA 5C37A 1T2FA 4MVJG 1NASA 4EJ0A 1XWFA 1ZEJA 3AFNA 1VC2A 3KSUA 1ONNA 1YE3A 3VPSA 1I01A 2VHVA 3JD2A 4AFNA 3JQGB 4QO8A 5JMWA 1SEPA 2IYPA 3HFSA 5AQ1A 3GEGA 4NBWA 4BNYA 3CPSA 4Z0HO 3FD8A 3C8MA 3GLQA 4B4UA 4E4YA 2CZCA 2JHFA 4CQMB 1TI7A 2B36A 1QXSA 5T64A 2YFQA 2QRJA 5T5QA 3WNQA 3NTRA 4IXTA 1KVSA 1P44A 5I9LA 2AE2A 1GEEA 3Q11A 4DPKA 4RZHA 4CV3A 4IGFA 2YZ7A 4GX0A 1H6BA 1MV8A 1PR9A 4BO3A 4BKQA 2A4KA 2AMFA 1PJCA 2CD9A 4HNGA 3GGPA 1YQGA 1ZMTA 2Y67A 3UN1A 1RM4A 1P3DA 4RVUA 4B8ZA 4OOEA 3DXFA 4D42A 1F17A 1HE2A 1B3BA 4NBTA 1UZMA 1EFKA 5KKCA 1PL8A 2JFFA 3FSRA 4NFYA 3PYXA 5CAEA 3SC4A 1CEQA 3HFGA 4ZQHA 2X0JA 2PD4A 2Q49A 1I33A 1WDLA 3ZW8A 3NT5A 2DBZA 4L75A 1BVRA 4CM5A 4CQMA 3GT0A 1IHXA 2OP0A 1ZBQA 4CL3A 2CDBA 1N7HA 3G49A 3AW9A 4AICA 3VPFA 2G17A 4UVGA 3UFXA 1NXQA 5JY6A 1PZFA 1YXMA 3AM3A 5COBA 4ESOA 4H3VA 1AHHA 3BZUA 3PWKA 2X5KO 5C7OO 1RYDA 1V9LA 4TZTA 5JO9A 1ADBA 4UUMA 1JWBB 2P91A 2YY7A 1I30A 5DZSA 3V2UA 4CM8B 1JKFA 3E9MA 4BS9A 1SO8A 3AU9A 2X0NA 4JIGA 3BMQB 1E7YA 2Y0EA 3E9NA 4DPLA 1ULSA 4PZDA 3D5TA 4JJFA 3O9ZA 2P68A 3GG2A 1O5IA 3CZRA 4CJXA 4EDFA 3SLGA 4WASA 1I3KA 2AQKA 1LI4A 4E3ZA 2X5OA 4BO9A 1Y8RB 2HDHA 1ZMOA 2EHDA 5B4UA 3H8VA 4Z9YA 2PZMA 4TMFA 4UEOA 4R1TA 4MVJH 5DDIP 1Z6ZA 4YDRA 2Y68A 5DNAA 1KVQA 3K73O 1DIGA 5TC4A 2W90A 2NU6A 1I2BA 1ENOA 1T24A 3JQFC 2YJZA 4D3DA 1EBUA 1QKIA 1X1TA 1PZEA 4QFCA 1JWAB 2CDCA 1HL3A 4YTEA 1U8XX 4Z6KA 2VTDA 1MGOA 3RQSA 1PZHA 1DBVO 3QY9A 2IDZA 1GYQA 1Y1PA 4GX5A 2GZ1A 1LLUA 3E82A 4ID9A 2H6EA 3WQQA 5CG2A 2AQHA 2G1UA 2XPCA 5C3MA 4BVAA 1GQ2A 3B1FA 2C5EA 2Q2VA 2D59A 3NT2A 1NFQA 1J4AA 4GWGA 3FWNA 1N9GA 2BELA 5HA5A 2RAFA 3AOEA 3Q0EA 2O7SA 1H0KA 1GZ3A 1YB4A 3KB6A 3OQBA 1YVEI 2YUTA 4J1QA 1LLQA 4FD3A 4MVJF 4PLGA 3DTTA 3RI3A 1C14A 5A05A 5JXWA 2BFAA 1E7QA 2Y05A 3U49A 4UVIA 2C59A 5A4DA 3B1KA 3VKVA 4D79A 1CJCA 1OC4A 2VRBA 1DXYA 3RAJA 3TZQA 5IG2A 3HNPA 4BB5A 3GZ4A 3K2BA 3QA9A 4NU5A 3ZU5A 1GUZA 4J7CA 3EHEA 4RLSA 2D0IA 3HUDA 1I8TA 1R4NB 2VWPA 4MKZA 3GVIA 2R6JA 2GN6A 1MA0A 3DZBA 4XIYA 2ILTA 5KWEA 1BTOA 2EJWA 3ETGA 3HDJA 2FN7A 2VT2A 2PD3A 1DFIA 3I9LA 4J2HA 2OXIA 4FJ0A 4DIFA 2FZWA 2YV3A 4CMGA 1ADCA 3RBVA 3WYEA 3WYBA 4HFNA 3P2OA 5EQFA 3RC1A 3H65A 4CLRA 3H3JA 3ORFA 3V1UA 2Q1WA 2JCYA 3DBHB 1C1XA 2XF8A 3MZ0A 4S3MA 4BNZA 4RL6A 2QRLA 4LRTB 3LT1A 2ET6A 1M67A 2DVMA 3PQEA 3MEQA 1ZK1A 4FPXA 3NDIA 3NJ8A 3DDNA 1O95A 3RKUA 1DC4A 1P0CA 4EJ6A 1R16A 3NTOA 3NDRA 4ND4A 1U5CA 2FR1A 4E13A 1P0FA 4MVJP 1NPDA 4FC6A 4IQGA 4TRRA 3DTYA 5EESA 2WWRA 3N7UA 4ALLA 4DPMA 2J5KA 2VQ3A 3TL3A 4Z3DA 1I3NA 2BGLA 1K5HA 4IJUA 4L4SA 4GQAA 4PIVA 1HKUA 1HDYA 1EFLA 3H9GA 3TNLA 5DCWA 3RUCA 3WR5A 3I1JA 3HJAA 3RU7A 1VJ0A 3BMNB 1EBFA 1RM5A 3FNEA 3HB5X 4CMKA 3DAGA 4NBUA 4WUVA 4RPHA 3KYDA 3MCVA 3CH6A 4GH5A 3H5RA 4FQ8A 5CEJA 2HJSA 1LLDA 3KEOA 2VOEA 4MKRA 2FR8A 4WLUA 4FBGA 4YAGA 1TVEA 2ZJ0A 3RJ5A 3JQ7A 2PH5A 3QIVA 4QQRA 3VH1A 4E5NA 1YONA 3ZHBA 1H9BA 1YO6A 2X86A 3O8QA 4MKXA 1Q7GA 1NHGA 1O8CA 2NTVA 4BNUA 1WW8A 4R16A 3WQRA 1DRVA 1S6YA 3GEMA 5JFOA 4WJZA 4WNIA 3EGOA 4IBOA 2EF1A 4J9UE 1DJQA 1FJHA 4KP7A 3ON5A 3GVPA 5CDSA 5F5LA 3DHEA 5JE8A 3ROQA 4JP3A 3SC6A 4TQGA 5ENDA 4XX0A 3MOIA 4JQCA 4B7UA 4IDCA 3ADPA 3DL2A 1XELA 2VHWA 4M89A 4OGWA 3EUWA 2B5VA 2P9CA 2YHIA 1EVIA 2ZQYA 3TJRA 1VKOA 2HJRA 1NQOA 1P77A 2ZCVA 4FR5A 4PLVA 3JCZA 4MPDA 1L7EA 3CSDA 3V2GA 3JQAD 5A06A 4YRAA 5CDYA 3DR3A 4RGBA 2P5UA 1HDXA 2W2KB 2NV6A 1YBVA 1LDMA 5L53A 5EPOA 4WLFA 4FN4A 3G17A 4KOAA 1QRRA 4EJMA 4IDAA 5TJ9A 3TPCA 4RZIA 3ROKA 3BYZA 2DC1A 1ZXLA 4J1TA 3OEYA 2QIOA 1BMDA 4J1SA 1XQ6A 1SOVA 1XA0A 2V7PA 3OSUA 3B6ZA 3FBTA 3GGOA 3V5NA 1E6EA 2BI8A 3GGGA 3KEQA 3KZVA 5JY1A 1UAGA 5AXDA 1C0LA 4R1NA 1CQJA 1JLLA 1U5AA 2YV1A 4JJGA 2HMTA 4XJSA 2JAPA 1VJTA 3EK2A 3WGGA 2V6GA 2WD7A 2BLLA 1E77A 3DZIA 1KVTA 4AJIA 1QYDA 4DQUA 3H9QA 4OKNA 4E5KA 1Q0HA 4WCFB 3BHJA 4BV9A 1OFGA 3D4NA 1EUZA 3W4KA 3GEDA 4FGSA 2I5PO 3ZU4A 4BNNA 1B3RA 4XJTA 3F9IA 3VPXA 2I66A 4FDAA 2X6TA 1U9JA 1EDOA 4UEJA 3VPGA 3QVOA 3ITDA 1IPFA 4WOJA 2NQTA 1T4BA 3GDOA 2XOXA 2AHRA 2DT5A 5KJEA 4QX6A 4Q3DA 1Z45A 5A3JA 2VUSA 3WGZA 2PTGA 2PK3A 2OFPA 3OIFA 3WLFA 4J4TA 5L4LA 4YT2A 4E5PA 4R5MA 1GUYA 3H9JA 3RIHA 5K6AA 4YRDA 1B16A 4Y6PA 2WE8A 2GF2A 3WWZA 1ZEMA 4INAA 4YBZA 4OXKA 4P4NA 3K30A 5KVCA 5TSDA 2HMVA 2YHIB 4Y98A 3E5RA 3PI7A 3RUHA 3FPCA 4YEDA 1IZ9A 3ZWMA 1A71A 1NR1A 3IIEA 5G0TA 2VHZA 1TXGA 3DOCA 3HHPA 1UXHA 4YT8A 3OA2A 4OXYA 4ZQEA 1PS0A 3HG7A 3IMFA 2Y1FA 4BGUA 6ADHA 4I9UA 1KETA 3F5QA 3GF4A 4XA8A 5L4SA 4Z9FA 5A04A 1T1RA 3DZFA 2JHGA 4PLPA 1KY4A 3ZWXA 3RUDA 2OP1A 4KQWA 4CR6A 2GSDA 1BG6A 2W2LD 3GPDG 1H93A 4JJIA 2DPHA 3L9XA 1PR3A 2PKQP 4E12A 3UXYA 3NGXA 4KTVE 2VWGA 1QSGA 3I83A 5KVVA 4IDGA 1R4NA 4WK6A 4YAKA 4BNKA 3GZNA 5LDGA 3ZU2A 4AJKA 3A4VA 1Y81A 5B4TA 3GAFA 4IDFA 5KTKA 2QZ9A 3Q3CA 1JKJA 3SXPA 4D7AA 4RF2A 5THKA 3GFBA 3U0BA 4WLNA 5LDHA 1E1LA 3PLNA 1JN0A 1G6KA 2R2GA 3NKLA 3PJDA 3GVCA 4UVEA 1PJ4A 3JQFA 2Q45A 3UW3A 5K9ZA 4D41A 1NWCA 5JNLA 1JDJA 3OJFA 4RVSA 5LCXA 3D1LA 2VUUA 4CLRB 2A92A 2E37A 2GN4A 4GX2A 3AWDA 2JCVA 3MJTA 4LRSB 1M6HA 3NAQA 1R15A 1CQIA 4NR0A 3D3EA 4Q3NA 3AFMA 5BNFA 1AUPA 3EMKA 2J3IA 4ZN6A 4FFMA 1PJBA 4AVYA 3RUAA 3PGXA 3JQBA 4S1VA 3RJ9A 3G1UA 3GZNB 3WJAA 2NU8A 4MP8A 4YR9A 1UDBA 1V8BA 1H9AA 2WM3A 3I23A 2G76A 3PK0A 1VL6A 1Y9AA 3GNTA 2X5JO 1NP3A 1LQUA 3VPHA 1HSOA 1E3WB 1NPTO 2OORA 3V8BA 4B7CA 1ML3A 3RC7A 5JAIA 4GKVA 2NWQA 2ZYDA 1SNYA 1GYRA 4BO8A 1VE9A 2V6BA 3MOGA 4G5HA 4BNVA 5JAQA 1G0NA 4YQYA 1P1RA 2YV2A 3JQDA 4CMJA 1DHTA 1E5LA 2DBQA 3TZ6A 4D3FA 4U8GA 5TQVA 3ULKA 4ALJA 1K2WA 4WEQA 4PG7A 4BO5A 3QJ5A 1ISGA 2PY6A 1PGQA 3DWFA 4ND1A 4A03A 4MVJE 3PP8A 1FF9A 4PG4A 4FS3A 1ZK2A 2O48X 4K6FA 1LX6A 2C07A 1XR3A 3ENNA 3NEPX 3L77A 4DIBA 4E2YA 2J8ZA 5C7IO 3DBHA 1E7MA 2O50A 1X14A 1HE3A 3PHIA 3KV3O 4R1SA 3ASUA 4RVFA 4FFLA 4XR9A 1Z75A 4B79A 2PNFA 1W73A 2DUUA 2JCXA 2E48A 3AY3A 5DCYA 4LVCA 1AHIA 3GA0A 4A27A 1XLTA 3STHA 1NBOA 1E5QA 1I3LA 3FRJA 4RQUA 4PG5A 2DUWA 1LJ8A 3OECA 2H9IA 2DBVO 5I7EA 3ZHXA 2ZB7A 2JFGA 2JD2A 2BFPA 3PJGA 4YT5A 5IDQA 3EC7A 4M54A 3BAZA 3AI1A 4IXWA 3KOUA 3NV9A 4NU6A 4HFRA 2WYVA 1LUAA 2C20A 4L9RA 2D3TA 2WMDA 2BHLA 1R12A 1FMCA 2RIRA 3OF2A 1CERA 4NIMA 1E3LA 4A2CA 2AXQA 2VN8A 1T26A 3BIOA 3C1OA 1ENZA 2EWMA 3QVTA 1E3JA 7MDHA 4NBVA 2GGSA 4E21A 4BNHA 1Q2XA 3H7AA 2GZ3A 2BMAA 2ZK7A 4Q3AA 3IAHA 4J0FA 5A9RA 1BWSA 1UDCA 1W6UA 1XG5A 1YOVB 1ISFA 4BNMA 4FW8A 3ZHYA 4KDFA 2XXJA 4MIEA 1GTMA 4N5NA 1IPEA 1Q0QA 3VTFA 5JYDA 1C0PA 3B20A 1UDAA 5ICMA 2DPGA 5HRUA 4FOOA 2O3QA 5DBFA 1KS9A 4KZPA 1YDEA 2WE7A 2NACA 1WMAA 3QVXA 3TSCA 1DLIA 1M2WA 1Y5RA 3BTOA 3FBGA 1KIFA 2PFGA 1UH5A 4ZJUA 3L6DA 4M86A 3DC2A 4FFNA 1OZAA 3AOGA 3FPLA 4ALKA 5EQDA 2QYSA 3O38A 2BFOA 2VTEA 2P9GA 5IDWA 5JW6A 1UP7A 5KIAA 3UCXA 4LMRA 3L4SO 3V1YA 5H82A 3O26A 2IODA 1DC6A 3VZSA 5DOZA 1EMDA 4XDZA 3D64A 3NX4A 1FXSA 4E2XA 3HE3A 3DBLA 4AJNA 4B3HA 2NVWA 4UUPA 3WG9A 1PX0A 2VCYA 4TSKA 3ZWNA 1P31A 4A73A 4JROA 3AU8A 4QECA 4CM4B 4J43A 1ZSNA 2GUGA 2E49A 2Z1MA 3UOGA 4BNIA 1LBEA 4NQZA 4U0KA 1CYDA 3FTPA 4J16A 4Y9DA 5EJ2A 3WXBA 1B2LA 4BKUA 1U1IA 5JAZA 1EZ4A 3OJOA 4JCOA 4L73A 1PJLA 5K0ZA 3KUXA 3CEAA 3KHUA 4OQZA 2IEDA 4HX5A 1DPGA 3T4XA 4IIUA 1D3AA 1GCUA 4XYGA 4PLHA 2AW5A 4R5HA 4L4XA 2P4HX 3F5SA 3IKVA 1ARZA 2P4QA 1E6WA 3Q9NA 4DIOA 4XRRA 1H94A 2HCTA 1AXGA 3O8QB 2OL4A 1ZK3A 1EVJA 2Y66A 3L0DA 3ZWOA 4GAEA 3DHYA 3HADA 4ITUA 2VT3A 3WDSA 1HZJA 1UP6A 3G0OA 4HKTA 4OMUA 4FOSA 4IZHA 3RUFA 3CMMA 4K28A 1NVTA 3PRJA 3I6QA 2V6MA 3SLKA 2DLDA 4RF3A 2Z5LA 2NTJA 4M49A 3KYCA 4DWVA 1DHRA 1ZUD1 3TOXA 2Y0DA 5CDUA 3D4PA 3F3SA 2HLPA 4EEXA 4PLZA 1OI7A 2HSDA 4DL9A 3R1IA 4LMPA 3PXXA 4CV0A 1NAHA 3H4VA 5HS6A 1OOEA 3I9OA 1KVUA 4IY1A 3PJEA 2D4AA 5I8ZA 4PZEA 1ZKMA 4NH4A 1U2DA 4BNTA 5FYDA 3AM5A 4CUKA 3QQPA 4K26A 3GNSA 4NBRA 3PIDA 5T6BA 3INRA 1KEWA 5CDTA 4IDDA 4GI2A 1IY8A 4BNLA 3C24A 2OMEA 1GFSA 3WTCA 4AJPA 2IXBA 4I5DA 1XHLA 1GPJA 3KSZO 4I8XA 2B4TO 3VVBA 3PVZA 1XYGA 4E31A 1X0VA 2W2LA 5GZ6A 3B1JA 2O3TA 3PFFA 3EZYA 3LLVA 1ZK4A 1HYEA 3NYWA 4FFOA 2G0TA 1E7WA 3LC2O 4R9RA 2BI7A 3ZV4A 1EE2A 1LSOA 4TVBA 3D0OA 3D7LA 4ZGWA 4RQTA 5CEEA 3DB2A 3JQ7B 1ISJA 4TRJA 3UICA 4EBFA 1U28A 3H6KA 3OETA 1CIVA 1PS8A 1GYPA 4D44A 4OM8A 3WICA 2OZPA 4CLOA 5HM8A 2ZYGA 5AXCA 2NM0A 4LK3A 5EIOA 2I3GA 1D1TA 3SVTA 1QV6A 5CDGA 4E6PA 1HE5A 1ZJZA 1EQUA 3WOHA 1WAMA 4ND3A 4WLEA 2DAPA 3RC9A 4MINA 4QEDA 4HFMA 2J5RA 3JYPA 5JMPA 2O23A 2CVQA 3ZNNA 2B5WA 4BOYA 1D1SA 2D2IA 5IZ4A 4EUFA 4DC0A 1LDYA 4D46A 1ENYA 3SBOA 2Y1CA 2F00A 5JCJD 1H5QA 1IB6A 4FIZA 2EIHA 4CUZA 1YB1A 3JQ8B 1ISMA 4XB1A 1JQBA 5IAAA 3OQ6A 4IIVA 3QWHA 1T1SA 4RPLA 5G0WA 3GMSA 4BNJA 5JDIA 4P22A 3P19A 4WECA 3E48A 2ZTUA 4J90A 4ZICA 1NQ5A 4WE3A 3OIDA 4NDNE 1OMOA 1GQQA 3K5PA 2I9PA 4UULA 1Y7TA 5L40A 4XB2A 1N1EA 3CINA 3FWZA 4YYZA 3X2FA 5TX7A 4R9SA 4PG6A 1HF3A 1V0JA 1MFPA 2VNAA 1BRMA 3LT4A 2Q99A 5DT9A 1JVBA 2GZ2A 4AL4A 5DF1A 5JS6A 4GL4A 4EW6A 4CM9D 4AG3A 3IUSA 1E3SA 5IN5A 5I7VA 2A9FA 4AJ1A 4YJGB 3E8XA 3DAFA 5JSFA 1XSEA 2A94A 5HBRA 2D8AA 4XQEA 2AG8A 3IJPA 1JAYA 3L4BA 1LSUA 5JDIC 4A10A 5EN4A 4URFA 3GUCA 1ZIDA 1O9BA 3OJEA 4H15A 5TRTA 4CPDA 2HK7A 4DMMA 1WPQA 4RLHA 3DONA 2Z1NA 4J7XA 1EVZA 5EMHA 1KEUA 1V6AA 2DKNA 5TT1A 4B3JA 4W6ZA 1Q0LA 1BW9B 2EKLA 3GHHA 2W4QA 2PZLA 1B14A 1VRWA 5CG1A 3FR8A 1SMKA 1GQYA 3F47A 3EVTA 2X8LA 1PWZA 4MO2A 3D5QA 1NYTA 1V3UA 3PHJA 4NFHA 4TZKA 3TQHA 4PLFA 3ICCA 4BMVA 4TKMA 3DBVO 1PGOA 3DMYA 4YB8A 3W1VA 3CMCO 4BNXA 5ILOA 3L4BC 1HTBA 1P45A 3U09A 2YHUA 5F1OA 4GVXA 1YQXA 4EYEA 2IZ1A 4CLOB 2Y1EA 4LCEA 1FDSA 4DGSA 2HK9A 2JFHA 3GH3A 1E1MA 1UAYA 1YKFA 4OXNA 3T7EA 2ZJ1A 5TGDA 5G0SA 1HSZA 1QYCA 2Q4EA 5EINA 2NVUB 4QXMA 2DTDA 3M1AA 3WMWA 3V1TC 5JLAA 5B12A 5BQFA 1Y6JA 1I36A 1RM3A 4KWIA 2D5CA 2YDXA 1FK8A 5CP8A 1QORA 5CFZA 4R68A 4RPGA 3G3EA 4DBZA 1LA2A 5IFLA 5IXYA 3IL2A 1T2AA 1NFFA 4JXKA 3MJ4A 4R69A 4XEHA 4Z9XA 1MXHA 2AE1A 5AYVA 1PL7A 2WD8A 4GGOA 3PWZA 1HLPA 1C1XB 3LDHA 3W4JA 3CZMA 3RU9A 5G0UA 1EK5A 4R1UA 3ZNPA 2EP7A 3JQCA 4E5YA 1QMGA 3C85A 3I9JA 3L07A 3IC5A 4DREA 3VZQA 3NDJA 3UH1A 3TRIA 2Y93A 4PVCA 1J0XO 1YS4A 4RDIA 3SEFA 2QG4A 4XGNA 1ZO8A 5DOVA 3C1TA 4DYDA 4R41A 1W4ZA 4LGVA 3PYLA 2VZ8A 2WYUA 3PJFA 5TLSA 4D45A 1PGNA 3HN7A 3L6EA 1R4MA 3W8EA 1S7CA 3LYLA 4R54A 4Y67A 5L9AA 3JQAB 1LRLA 2OBNA 4E33A 1JW9B 1KEPA 2GRAA 4WCDA 2BD0A 4DA9A 2RHRA 2CUKA 3BMNA 1MG5A 1PJ3A 2Q2QA 4W7HA 2PZKA 3C3XA 3I4CA 3WWYA 3RBZA 3WMXA 5A02A 4K1LA 3IJRA 1NVMB 1V3VA 3OA0A 4MVJA 4BGIA 4B8WA 4CM7A 2BGMA 4YJHA 4CV1A 3P2YA 3OEWA 2V65A 2PGDA 4GX1A 5FEUA 1VSUA 4H7PA 4ND5A 4ND2A 1LLCA 1MB4A 5DP2A 4QUKA 5FWNA 5L45A 1VI2A 3A9WA 1N5DA 1DRWA 1D8AA 3E6AA 3E9QA 4YWJA 5TS3A 4XQGA 5CEFA 4JGBA 5HWSA 4RPKA 4O5OA 3QW2A 4W7IA 4B4WA 1GV0A 1XEAA 2HAEA 2BH9A 4IGEA 1KERA 5H83A 3PDUA 4YXFA 4CM3A 4CMIB 4BMNA 2G5CA 4MJLA 3GNQA 4I1IA 4XD2A 2ZIZA 3KLPX 2D5AA 3K9QO 3MTJA 5F1PA 3WIDA 1JVSA 2OGUA 3QWBA 4JN6B 1HDRA 3GK3A 3FTNA 5GY7A 4R4JA 4BO7A 4CQMD 4KQXA 1D4FA 2FSVA 3OBBA 4JLWA 4F3YA 1HLDA 4G81A 3GRPA 4J4BA 5ENVA 4Z3KA 3DZGA 3JV7A 4UUNA 3ZHZA 4CMEA 4IINA 2IRWA 3RCBA 4CM6A 5JCXA 1WZIA 3RASA 5FF9A 1R0SA 2HMWA 4J0EA 3WYCA 5GZ1A 3JQ6A 2NTNA 3MTGA 1YWGO 2C2XA 4QO7A 4XYLA 5DN9A 1TLTA 2QW8A 1PTJA 2X0IA 9LDBA 3TFOA 1E0DA 4ONEA 1GZ4A 1C0IA 3M2PA 4Q3BA 3K92A 3PEFA 4E5MA 1Y8QB 4IMPA 2NUAA 4YJDA 2RCYA 4P4GA 4XZ3A 4DC1A 5JDCA 4IM7A 2WJPA 4EUHA 5AOVA 3GG9A 2RH8A 4GMGA 1SB9A 3WNVA 4YPOA 1I32A 1R4MB 3AUSA 4E0BA 3LF2A 1WDMA 1LDNA 1U4SA 2NSDA 1HDGO 2FY8A 3EAGA 3DO5A 3Q9UA 5T67A 1DIBA 3F1LA 3DQPA 3QHAA 1PL6A 1Z82A 2EERA 4B4OA 5L7YA 4PLWA 2HMSA 4NI5A 1P1FA 3TWOA 2TMDA 3VVCA 1UZLA 4PLYA 3W8FA 3TL2A 2XAAA 2HO5A 5L7TA 4UAGA 2J6IA 3ANLA 2O7QA 1C1DB 1YOVA 2QYTA 4GGPA 1DIRA 2I99A 3KYBA 5AVOA 2Q1TA 4J2OA 3ADOA 4L76A 2Y0CA 1O0SA 3AY7A 2GERA 3RWBA 1IULA 4G2NA 5GZ3A 1Y8QA 4QFDA 2PGLA 2IEBA 3H3FA 5THQA 3WGQA 1E6UA 2YQ4A 1DSSG 4BNWA 4CMIA 1U8FO 3INGA 4PN3A 8ADHA 1EQ2A 3ST7A 3VDQA 4YAEA 4B7XA 4MP3A 1BW9A 1UXJA 2AA3A 1PZGA 4YACA 1NM5A 1UXKA 3I6IA 5HTOA 2HRZA 3PGJA 5MGBA 4WLOA 4CLDA 1ORRA 3GFGA 2B69A 1K6IA 4U6SA 5T57A 1VJ1A 4HBGA 1ID1A 1ZXBA 1IL0A 1JTVA 4U7WA 5ITWA 1OAAA 2I65A 2VOJA 3LT0A 1LSSA 3KBOA 1RPNA 2X7HA 4GWKA 4RCVA 4MDHA 6LDHA 3WGOA 2ZB8A 1ZH8A 3ICPA 3I4FA 4HY3A 1EEHA 3QE3A 2ZTLA 1J5PA 3S55A 1LTHR 1FDUA 3I9MA 1SPXA 3AK4A 3S8MA 4OOFA 2C0CA 3LSYA 1U3UA 1IYZA 2Q2WA 4F6CA 4MP6A 2I76A 4DLAA 4CLXA 4QSMA 1QP8A 4ROSA 3FCOA 5BSHA 1KY5A 1ZCJA 1N9GB 2WDZA 4BO1A 3WJ7A 3PDJA 4FFPA 1E3EA 2YYYA 4JNKA 3DFZA 2EXXA 4CM8A 2X9GA 2FWMX 3K96A 4DXHA 2HU2A 5G4LA 3QWAA 1F8GA 1P1KA 3I5MA 4D43A 3WB9A 3EY4A 2VYVD 3N74A 3ZZNA 4HADA 5HS4A 4R51A 2O2SA 3KYCB 4FCCA 2HK8A 3QV1A 1QG6A 2UDPA 2ZB4A 3JYOA 3WGTA 2GPTA 4Y8VA 2O3RA 3BHMA 4TRNA 2B35A 1ZZEA 4PVDA 1MG0A 3ONFA 1P74A 3ZCXA 3AY6A 3WIEA 1KC1A 1VL0A 1RWBA 4ZQGA 1EK6A 3RFXA 2VRCA 1SOWA 3EW7A 1E3IA 3W6UA 4BO4A 4LN1A 1LC0A 3PFWO 2CDAA 3U4DA 1RJWA 3VH3A 3DBRA 3M1LA 4DRYA 8LDHA 5IZCA 4CQLA 3GVHA 4U0JA 1LRKA 1DFGA 4BMSA 4IZIA 3R3JA 5G2OA 2FHSA 4IMRA 1LDBA 1Q7CA 3ZNQA 1GCOA 4O1MA 4XGKA 1SAYA 1D7OA 4F46A 5BNIA 1T2CA 1ADGA 2B83A 4L74A 4YA6A 1GY8A 1WVGA 3HSKA 4A7PA 3C7CB 4I9HA 1VL8A 2C54A 3C1AA 5A9SB 3KVOA 2ZKLA 2X23A 2JD0A 3JQGA 2H63A 4OSOA 5DCUA 3B70A 2EV9A 2PD6A 5JPIA 5JC8A 2Y1OA 3ZWPA 4OQYA 2BGKA 4NJOA 4PRKA 3CXRA 4WLVA 3JTMA 5IJZA 1YGYA 1WZEA 2W2KA 1YQDA 1NNUA 1ONOA 4ZD6A 1DC5A 1A9ZA 4ZRNA 3FF4A 3IS3A 2JAHA 4NPCA 1TT5A 5EERA 2J3KA 2PLAA 3ABIA 3LQFA 3ZWVA 3HB4X 3ZW9A 2O2YA 3H9EO 4RVGA 1LEHA 1VM6A 4M1QA 3TZKA 4C7KA 1LNQA 1U7TA 4NK4A 1M75A 2J3HA 2AEFA 4JP2A 4XR4A 4ZA2A 1GV1A 3AOEC 4X54A 1QV7A 4NNJA 3KYDB 3CE6A 4GLLA 4M8SA 3UKOA 1EUDA 3PQDA 5KJ1A 2R00A 1Y9EA 3JQ9C 4HUJA 3VH4A 3MJVA 4J6FA 3T4EA 2W8ZA 3PLRA 2QRKA 3O03A 4UUOA 3BMCA 2CNBA 4MVJI 3GHYA 4P4LA 4CV2A 5IF3A 3P5SA 4PLTA 2WD7B 3VKUA 3DAPA 3K8ZA 2GDZA 3I9NA 2C7GA 3WGHA 3RFTA 5L4NA 3JD0A 1L1FA 4IS2A 3OMLA 3VOSA 4DQXA 4XYMA 1P1HA 3GVXA 3KXDA 3UCFA 2I6TA 3WSVA 2FSSA 4YRBA 2BF7A 1DIHA 3PYMA 4YJHB 1A7KA 2BFMA 1DO8A 3W4IA 4XGIA 1A9YA 1MC5A 4D0SA 4YJFB 1B8UA 3JQ9A 1PJSA 3HDYA 4FC7A 1SZJG 2VYVA 4XYBA 3U4HA 3AUAA 3QVSA 3S2GA 1A4IA 4K6CA 1HEUA 2NLOA 5FFFA 4DLBA 1WMBA 4O6VA 3VH2A 2Q1SA 3LVFO 4C7JA 1I0ZA 5G4KA 3LU1A 2E82A 2J5QA 5BT9A 2DTEA 1F0YA 1UXIA 2JL1A 4MIOA 4PFJA 1HDOA 1LSJA 2AG5A 5TJHA 3RD5A 2HQ1A 4CMBA 1FDTA 1GEGA 1LQTA 2WYWA 3PQFA 4CM9A 4RVDA 3U5TA 4KWHA 2PR2A 3IKTA 3LLSA 2PKQO 4CUJA 3WTBA 3BHIA 1YL5A 3JQ8A 4GBJA 2NADA 1C1DA 4E2ZA 3H9UA 4DQVA 1B15A 3P7MA 4OO3A 1BGVA 3IP1A 4BQPA 1GPDG 4LCJA 1I24A 2I67A 4TROA 4CM4A 3LC7O 1P9LA 4G65A 5A5EA 2YDYA 2EKQA 1DAPA 3OIGA 3WX0A 4NFSA 1GUFA 3MJCA 5KVSA 1CF2O 3QLJA 4PGFA 3ANNA 2CVOA 5KJCA 1N7GA 1TT7A 2UYYA 2YQ5A 5CPFA 4WPGA 4HXYA 2IYOA 2FPPA 2NVUA 4TRMA 4M87A 3PWSA 3UF0A 3G1TA 3GQVA 3GN1A 4CODB 1WP4A 1IE3A 4KMSA 2GLXA 5DP1A 3I52A 2EGHA 3GAZA 3HDHA 5G0VA 1QYVA 2YFHA 2LDBA 3FI9A 1X7DA 3A28A 2X9VA 3ETEA 7ADHA 3AUTA 1DFHA 4AJHA 2P2SA 3PTZA 3SX2A 3IP3A 4P8RA 5CPBA 4IDEA 4IQ0A 1GZ6A 3KTDA 4BB6A 1ISIA 3R6DA 1XCBA 3FNGA 1BXKA 3ROMA 2VYNA 2UV8A 3NTQA 4NZ9A 4CMCA 1H2HA 4WCFC 4PZCA 3JSAA 3Q1LA 4E32A 4UVDA 3ASVA 3ZH2A 4RV9A 4FB5A 3KRTA 3BMOA 5ES3A 4GKBA 1V3TA 4BIIA 5F5NA 5ER6A 4CR8A 1MLDA 2B4QA 2Z95A 4R3WA 3FNHA 4Q9NA 1JAXA 2O3UA 1BXZA 4BO2A 1MFZA 1X1EA 3IDSA 3TZHA 5CHEA 4KUGA 4RF4A 2JKVA 4EGFA 4D3SA 4OIMA 1JU9A 1NPYA 4BV8A 2PA3A 3VZPA 3HZZA 5ILGA 1PGPA 2Y1DA 1YBAA 1U3WA 3DEYX 4IJKA 3BXXA 3NGLA 1O89A 4MOWA 2Q3EA 2V6FA 4DBVO 1NR7A 1PEDA 1ZSVA 2OHXA 1M66A 4XIJA 2OBYA 1HWYA 4JBGA 4XQ9A 3JYLA 5FI3A 3S2FA 3ZWWA 3QWFA 4CL8A 5A5FA 2CF6A 4GMFA 2FOIA 3FN4A 1NFRA 1ADFA 4DUPA 3U4CA 4I5GA 4I9NA 5A9TA 3F4LA 3PPIA 1DAOA 2Y1GA 3A1NA 3E5MA 1I2CA 3ZWBA 1PSDA 1B8VA 4RO0A 3VDRA 3GRKA 3F46A 2PZJA 2ZYAA 1K6XA 1Q1NA 3ZV6A 3UHAA 2VZ9A 1DB3A 3WQSB 4ALIA 1QLJA 3AM4A 2PV7A 1KOLA 2O4UX 1Z7BA 1PJ2A 1GU7A 1W8DA 2B37A 1SC6A 1UR5A 1Z74A 3UUWA 1B8PA 4UVHA 1HYGA 3JD4A 3OFSA 3IQDB 3VC7A 4HP8A 1V35A 3VTZA 3GDFA 4U5QA 2RH4A 3DBRB 2DFDA 3WFIA 4A0SA 1NQTA 5MDHA 2VYND 4AJ2A 3H5NA 3N58A 4R3NA 4WEOA 4EUEA 4Q3CA 4Q3EA 4WGGA 3MWDB 2DM6A 4GVLA 5I7FA 4J3FA 4PRLA 4FJ1A 1N8KA 3QRWA 4HV4A 2VRCD 1SB8A 5COAA 3SJUA 3WBBA 4BL5A 1MC4A 4FGWA 2A35A 5DBIA 4N7RA 4BKPA 5JAMA 1GD1O 1T2EA 1YJ8A 1UXGA 2CVZA 4BKRA 4PG8A 3DMTC 3NT4A 3QVWA 1PWXA 4OKIA 4AJJA 4CR7A 3JQAA 3ZGYA 1TA4A 3OHSX 2UVDA 3FHLA 3ZNOA 1LU9A 4XDYA 3ROPA 3H2SA 2RHCA 3RKRA 3OH8A 4NHEA 5ADHA 1DDOA 1OC2A 1G1AA 2IZZA 2WEKA 1WDKA 4ZVVA 3WFJA 1YL6A 1PQPA 4YQZA 1X7HA 4LVUA 3BTSA 4LW8A 2FR0A 3DHNA 3AI2A 1F8FA 3GPIA 4DVJA 3I9KA 1KBZA 2VNSA 3JQEA 4L0QA 3KSDO 3OJLA 2E6UX 1Q7BA 1F14A 2C2YA 3R0IA 4N5MA 1L7DA 4A5OA 5JO0A 3INTA 4IS3A 3ONDA 4YVFA 4M55A 1EVYA 1SBYA 3TFQA 1UP4A 1CWUA 1X7GA 2AQIA 3BMOB 1LDGA 3RROA 3DMTA 3PZRA 4NJMA 5JCJA 1IOLA 3RFVA 3L6OO 1B7GO 3UGKA 4GSKA 1H2BA 3ZWYA 4IUYA 2C29D 2VWQA 3O4RA 3KETA 3E03A 4W82A 3NRCA 4MVJD 3QP9A 1SCUA 1EDZA 3Q2IA 2VHYA 1Z73A 2VZ0A 5A3VA 1A72A 1DEHA 1XDWA 1Y8RA 3FR7A 4ZHSA 5DBGA 1NHWA 4EEZA 1LXCA 2FPIA 4Z0PA 1E92A 3CKYA 1SEVA 3VHRA 3AUUA 5BSEA 2HMUA 2P5YA 3R3SA 4RPJA 3S2EA 4RORA 1XKQA 2GCGA 1KEVA 2XXBA 1BDBA 3X2EA 5U9CA 4HFJA 3ONEA 2WSBA 5KVQA 4R01A 1FDVA 4BNFA 5L3ZA 2TMGA 1I5RA 5BNTA 1K89A 3M6IA 2EEZA 1ZK0A 2ZTMA 4ILKA 1RKXA 3FNFA 2EW2A 3GUYA 3DZJA 2CMDA 1HDCA 2YW9A 1ONPA 1YRLA 4Y6SA 3U3XA 5I9NA 4RDHA 2SCUA 3F1KA 1TB4A 2EG9A 2ZQZA 4UREA 1BDMA 1OBFO 2BKAA 2FP4A 3TDKA 5COQA 4YAJA 4JBHA 1MXFA 2JD1A 2BRUA 1U7HA 3K6JA 2CF5A 1GADO 5ITVA 4LISA 1E1NA 1C3VA 4L4RA 4GSLA 1ZW1A 4P38A 3U9LA 4E30A 1DJNA 3EZLA 1EE9A 3C7DB 3EYWA 9LDTA 3I3OA 3LC1O 4EI2A 1BXGB 5IDXA 4NMHA 5ER9A 1HETA 4IJVA 1N2SA 1ZNQO 3HWRA 4XCVA 1CETA 1HE4A 2EP5A 4BO0A 3LZ6A 5KNLA 4C4OA 1QLHA 3DOJA 4OJNA 4TWRA 2DTXA 5U4QA 1NTOA 1XU9A 4D0RA 1NAIA 1F12A 1U4OA 1MX3A 1XIVA 2LDXA 3Q2KA 3U62A 4ALNA 5L95A 2Q4BA 2GYYA 3ZI0A 3RUIA 5B4VA 3ENKA 4RVHA 1BHSA 4Z0TA 2PWZA 1RM0A 3QWIA 2DQ4A 2OO5A 1R0KA 1WWKA 3ANMA 3F6YA 1GAEO 4QT0A 1ULUA 5T8KC 3GDGA 1DIAA 4AJ4A 4LSWA 4NJMB 4CMEC 1CRWG 1N1GA 2O3SA 4II2A 2WTBA 3D3WB 3UCEA 4W4TA 3GOHA 1FDWA 4I08A 2D1YA 2VWHA 3GY0A 5I7SA 1GL3A 4NK5A 4Q39A 3CIFA 3RBXA 3C7AA 1BSVA 1LDEA 1O94A 1PU2A 2DFVA 3QSGA 4PLCA 5IN4A 1IZ0A 1W0CA 5ICSA 4YT4A 3ETDA 4N54A 4ALMA 4EZBA 1JKIA 4FSHA 4ZQBA 5GMOA 3TN7A 2VUTA 5JDCC 4XKJA 5L7WA 5I8WA 1K6JA 4DTIA 3K2EA 1Y5MA 3WSWA 4IJWA 2CY0A 2AEJA 1IUKA 3PHGA 5KJFA 3GMDA 3NJ4A 4GPD1 4CQLB 3WS7A 1H6DA 2CSUA 5KKAA 4OYRA 4K9DA 2FRDA 5JYEA 2DBRA 4J49A 1N92A 1O6ZA 1DC3A 1K0UA 4AJEA 2X1HA 2C7VA 1T4DA 1NQAO 2GNAA 1R37A 3JD3A 1H6CA 2F1KA 4H16A 1ZJYA 3RUEA 2J3JA 3WBFA 2NU7A 2B4RO 2NNLD 3EVNA 3GC6A 5TIIA 2UAGA 4N18A 4W9NC 5F1KA 2O3JA 2ZCUA 1GR0A 3PZBA 3TOZA 1PS9A 3KO8A 2Q1UA 1J6UA 4F6LA 1VSVA 2Q46A 1WNTA 2GR9A 4IPTA 4J9VA 4OAQA 1HT0A 1JA9A 3SJ7A 3TZCA 1K3TA 1UUFA 3EDMA 1KVRA 2UUPA 4AJOA 2FMUA 3CUKA 4IDBA 3Q6IA 2OOSA 2JJYA 4JK3A 4W99A 4ZRMA 1E7SA 5B37A 3TF5A 1ISHA 5U1PA 1KC3A 2NQ8A 2C82A 3OQ1A 1AGNA 3UVEA 3S1LA 2Q50A 1IHYA 2I3AA 4WCFA 4YJGA 2QX7A 5EL0A 1BVUA 4W9NA 1ZSYA 2IXAA 3W6ZA 4AJLA 3PHHA 3W8DA 1I3MA 1VPDA 3HDQA 1HZZA 3G79A 1DOHA 5AXAA 1R6DA 4B4VA 4N5LA 3WGYA 1QR6A 4BKOA 2W98A 1HRDA 4JBIA 2G82A 4U6QA 1R66A 2X9NA 5H81A 1XU7A 5F21A 1PJQA 4I5EA 1M76A 2GN8A 3E18A 4WKGA 5J23A 2EGGA 3BTVA 3IOYA 1CDOA 3PIIA 4MVJM 2AQ8A 4EITA 4JX8A 2P9EA 3RC2A 4TKLA 5JC1A 4CLEA 5I9MA 2ZATA 4XYEA 3DOOA 4BQRA 2C5AA 1R0LA 1T2DA 1YDWA 4XRGA 4BHTA 2X22A 4Y6RA 5L51A 3ITKA 4A26A 4II3A 4B3IA 3A14A 4OH1A 2H5LA 4IQ8A 4OSPA 2GASA 2NU9A 1PGJA 2POQX 5A9SA 5JBIA 1U3TA 1YL7A 2R00C 5F3RA 5A1TA 2NVBA 3JQBC 1LRJA 5TT0A 2EKPA 1A4UA 5T8KA 1P33A 4DYVA 4BUCA 3HQ4O 4MIYA 5C5IA 1WXDA 1ZVMA 3MWEB 3AI3A 1QYWA 1U2GA 4BGVA 3ZV5A 1X0XA 4HNHA 5BR7A 4TVOA 3GN2A 3V2HA 4J1NA 4BNGA 2HKIA 2IE0A 4L8VA 2UUOA 2CFCA 4KDEA 4YAIA 1NX6A 1X13A 4KUHA 4WOKA 1PQUA 5K6AC 1A27A 4NG5A 1DLJA 2PKRA 4J4HA 1M6WA 2QQ5A 2X58A 2H1SA 2GO1A 1NVGA 3ZN2A 2EW8A 4FFRA 1UJMA 3F4BA 1PIWA 4LSMA 2ZB3A 2PGJA 4HWKA 1I10A 3BTUA 3OJ0A 3KM0A 1Z7EA
chains in the Genus database with same CATH superfamily
1M7BA 1TOAA 1G0OA 1JLSA 1Z2DA 4HF7A 3LK6A 1H42A 4QTZA 3BORA 5A2GA 2OCLA 1GLGA 3PICA 1QO9A 5IM4F 4Y2JA 4X61A 4U2FA 1X15A 2W48A 4F5EA 1QF7A 2J5BA 2QR3A 1MOQA 1XTKA 5BSFA 3LIPA 3JYQA 4O2AF 3ZE6A 2C99A 2XGOA 3WADA 5TXGA 4ABTA 1CIPA 3MMSA 4YCAA 5ALUA 3AF4A 4FT4A 1CULC 3REQA 3UWOA 4OU4A 1WLYA 2OAQ1 3EC2A 3VOTA 4QHYA 5E1DA 5ALWA 4H6WA 4MXDA 1YB5A 1CLUA 4FGLA 3LZDA 3NB0A 2J3QA 4AZ0B 5LOVB 5HRAA 3ZY2A 1D09A 1ZD1A 3O2QB 4B6GA 4RF5A 3O83A 1SXIA 4O59O 3VZBA 1GDHA 1LS1A 1RCFA 4TTIA 1QGDA 4RPIA 4DLLA 3JYHA 3QGMA 4D9MA 2BZGA 1RMYA 1YBMA 4I4IA 4QICA 1XZHA 5H70A 4S2EA 1UMKA 1IN8A 2AFIB 1UZNA 1AE1A 1BXGA 2B6NA 2B7BA 5EWLB 4BVGA 3D1VA 1U0HC 3AHCA 3L5KA 2IZ0A 1AXEA 3DBLB 3VNBA 1PKXA 1SKBA 4IYRA 3A26A 3LOPA 2R3SA 5G4KB 1TQ6A 3TD2A 4BVFA 4CM1A 2DPLA 1Z5OA 4XI9A 1HYHA 1A5ZA 1PQWA 2PUEA 5BT8A 3K31A 3QOXA 1V71A 2LXNA 5IXSA 1FVXA 4KTTE 3GLFA 4P0TA 3D7RA 4C4ZA 3RSHA 3ADKA 4YRFA 1U4NA 1TCUA 4PICA 1RYBA 1T36B 3KKPA 4KAXA 1B26A 1ZC3A 4RHEA 13PKA 3RV3A 2AR9A 1UC9A 4U9UA 4ZQFA 5KQGA 3IT3A 2HXYA 1CS4C 3FMGA 1XTZA 2QVBA 3STWA 3SZ3A 5FOSA 4OL9A 2RGRA 5FQOA 1SHZA 1V95A 3BMQA 3G9XA 1DRUA 5HQ3B 2ORWA 3LOUA 2PPVA 3JYNA 3ZCRA 3BMCB 4D3XA 1TAUA 4G5OA 4G8JA 1F06A 3ZK7A 4CMHA 1OFHA 1P1JA 1D0VA 3HY4A 5ALTA 1I2MA 4EENA 2QZZA 2CL0X 5AI9A 2X4GA 3MQFA 4BGEA 1ODIA 3PUYA 3WNDA 1AZTA 4BFVA 2ZVPX 1N9KA 2B2CA 2CW5A 1K4YA 5BQOA 5FI5A 5HF9A 5TQ2A 1NDQA 3K09C 4NZZA 5J40A 4I5FA 5H4GA 3QEMA 4RE5A 1WKVA 1EXMA 5IANA 3A06A 2PL9A 2MMCA 1JHZA 1UJ2A 2FH5B 3H1EA 4HRYA 4J7UA 2PYZA 4GECA 3HTXA 1P2VA 4OBEA 3GX1A 5JSZB 3Q4GA 3UXMA 3IQWA 2V03A 1ONNA 4X24A 2V45A 1OPXA 2VXYA 2XB6A 1OBCA 3VPSA 1M33A 2VHVA 1A5TA 2YRXA 4OHKA 5HSGA 3Q8LA 2J09A 2WU1A 4JY7A 1AGRA 1LW7A 3GEGA 3A1DA 3C14C 2F8TA 2HIAA 2ZXEA 5CXSA 4WACA 3JR7A 1VYHA 1T9HA 3AEKB 3GLQA 4HAWA 1YE8A 4FFSA 4EY4A 5SZHB 4E4YA 2R25B 4CQMB 1GZDA 4BQEA 1C7QA 3RVMA 2H18A 2Q0HA 1DX9A 4F6RB 2JCGA 4RTMA 5ETJA 5DISB 3N7AA 4EWLA 2WNIA 4GX0A 4IGFA 3V6MA 1UODA 2WPDD 3QBEA 1V41E 3SEZA 1H6BA 4MUHA 4TZ0A 2H0RA 3NCHA 1M2FA 2E0IA 4XOUA 4WJLA 4I1PA 4U00A 2SKEA 3QEMB 2XCIA 1ESMA 1YQGA 2VXBA 1GGJA 5CURA 3R5KA 1RM4A 3WB2A 1OROA 1X8LA 2YBDA 1SBHA 1Y4UA 2CCGA 2OD7A 4RVUA 3K5WA 4B6JA 1F17A 2QQGA 4D42A 2HA3A 3NRBA 4NBTA 4B33A 4ZYTA 1M0WA 5CFQA 5JSZA 1MORA 3DDSA 1I1OA 3W04A 4GLBA 4D98A 2JNWA 5LQUA 1EFHA 3QU9A 1MQAA 4F3CA 2EZTA 2GEUA 1JMKC 1O7JA 2WV9A 3U13A 1XVLA 3D6NB 2PD4A 1I5EA 3PHCA 1M0SA 3SZGA 2Q49A 4DOMA 2V8OA 5HQJA 4B87A 2AEEA 2IIBA 1LGYA 1JDZA 2IHZA 3FSGA 4PTZA 2P9ZA 2NPFA 3X44A 3KQNA 1BVRA 4CM5A 4CQMA 1W0JD 4Z7QB 4DEYA 3VA7A 1ZBQA 2AZXA 3LM8A 1MO4A 2CDBA 1ZIOA 2PGNA 3G49A 3AW9A 1JYSA 4IIDA 3F6RA 4DDKA 3N3BC 4UVGA 3B7WA 3SBDA 4YLGA 1PZFA 1KYTA 5COBA 3DLCA 4ESOA 5IYZF 2BH2A 1P91A 1ZDMA 2FMTA 4KQEA 1RYDA 3MSCA 2PLWA 4RJKA 1SU4A 4BGDA 1EX1A 1AJEA 2WIKA 1JWBB 1VBMA 4G0OA 1FYEA 1II8B 5KDDA 3EG5A 4QPJC 3ITEA 1MEOA 4I1OA 3V2UA 4CM8B 1JKFA 1GL7A 2X0NA 3AU9A 1RYMA 4JBWA 1U5BB 2CXSA 3E9NA 3UAYA 4QSHA 1ADYA 1UMCB 3F97A 3BGIA 3GRFA 4JJFA 4HMOA 2QV0A 3C6KA 3IQGX 3OP1A 4EHIA 3T1HB 2P68A 4D92A 1O5IA 2JAUA 1C9EA 4CJXA 3EAFA 3SLGA 4IIXA 5JXGA 1NF2A 2VI5A 1I3KA 4OEHA 4AT1A 1RIFA 3TSZA 3E7FA 3HKDA 2HDHA 2YYAA 1ZMOA 5FWAA 3QELA 3TIGA 1DWOA 2I1VB 5B4UA 3WV4A 3EWNA 5CVUA 3WFZA 1TUIA 1ECBA 4ON9A 5FLYA 1EGAA 2QN2A 2X4DA 5AW2A 3VNRA 4MVJH 4WK2B 1EQAA 4FW9A 2PE5A 4UTVA 5MGBA 2RHWA 1Z6ZA 3DDHA 3R24A 4ZI5A 3RDPA 4DIMA 2WTUA 4B6RA 2Y68A 1SR8A 4ZVNA 2CBZA 1E5VA 4KXWA 1SKMA 3TBFA 1I2AA 1RAFA 2GYVA 2V0CA 1T24A 3OTQA 4A8JC 2YJ3A 4CIYA 1T0PA 2LP4Y 3FVVA 1QKIA 1PBTA 1PVDA 4LIPD 1LD3A 4A23A 1CJUC 3A4MA 3KOYA 2CDCA 1W44A 2CKMA 1QZ3A 5AM5A 4LF5B 2EBFX 5A6SA 1MGOA 3RQSA 1WULS 3RODA 1DBVO 3P27A 2IDZA 1GYQA 2K6GA 4UHBA 4QRDA 4Q7QA 3V6LA 4BZZA 4DEVA 1A4RA 2QJRA 4GX5A 2CWDA 4TKVA 4TXLA 5EJ5A 3KB1A 5B7PA 4CEIA 3E82A 4XTCS 3MRVA 2X1VA 4ID9A 1FZQA 3VR1A 2LCIA 1PR4A 1M72A 2XPCA 4D6XA 4BVAA 1GQ2A 3I6ZA 4M21A 3RVQA 1UBRS 1NFQA 4MQEA 5KOJB 1NATA 4LDPA 5FD8A 1L3IA 1NA5A 4EFDA 2WNHA 2O7SA 1H0KA 2HDNB 2WF7A 3GQBB 3NQ41 1O96B 3HJFA 2QVCA 3MT0A 2YUTA 1ULHA 3L6RA 4MVJF 1MZVA 3PC7A 1GTZA 3RI3A 4BBZA 3IPYA 2BFAA 4MWDA 4FGJA 5CB4B 1AK1A 4D96A 3MBKA 3AEQB 3IV9A 4WNAB 4WAUA 2VRBA 1OC4A 2B20A 3OLYA 5IG2A 3HNPA 3C3KA 1L1EA 2PFSA 3GZ4A 4ZHQA 2PT7A 3RNOA 4RH1A 5E9WA 1DUIA 3QA9A 4D80A 3CVVA 1QRTA 4NU5A 3V1NA 3A9RA 1YF3A 3AT1A 1J00A 4KN6A 1IBRA 2FFQA 1MPTA 2D0IA 5CVEA 5EMLA 2H7XA 4B4DA 2A5JA 5B3LA 1SC4A 3EDRA 2ACEA 2ZETA 5JVDA 2WZCA 1A96A 3DPIA 1SBZA 3ESBA 3KUKA 3H4TA 4PS0A 3ZQ6A 4GRAA 3DZBA 1VMEA 2VHUA 2FPIB 2QTAA 3V9PA 4OQNA 4G5FA 2D3WA 4LX0A 3ETGA 1P9OA 3P8ZA 1DFIA 3ZGLA 3NFRA 2VBFA 4B6QA 2HNKA 2Y9MB 4B32A 2ZUFA 2W6QA 2JLBA 5D6OA 4DIFA 4FYIA 3GBSA 4UATA 5I47A 1WZ2A 2PX3A 2VK1A 1TIKA 1VPLA 3SHQA 3K1YA 3L93A 1NF9A 3ZBUA 4RD6A 5HCNA 3WYNA 4V2IA 4JJAA 3MTBA 1KNQA 3U7QB 1NONA 3PENA 1U31A 3LXRA 1IRXA 3H3JA 2BGRA 1KTVA 1WEHA 2JCYA 3TTUA 3PI6A 4BNZA 4IO0A 2RH5A 4RL6A 4BCBA 2JFZA 3B8HA 1Z0KA 2Q6OA 2ZJBA 5ALQA 1JSLA 4FFWA 5HKLA 1W0JA 2J67A 2QL6A 4EA7A 1GKLA 5KS2A 2ET6A 3I6YA 1HQKA 5JRZA 2DVMA 3MUNA 3LHIA 2VDWA 3MEQA 4EMTA 4G0UA 1GPBA 1L5OA 1VSTA 1CUZA 2ODBA 1KQFA 3F0TA 1DKUA 1P9WA 1P0CA 1V8ZA 3WA7A 1EM8A 2OZEA 1R16A 4ND4A 3RS4A 4BMPB 1U5CA 3AR6A 1VLMA 2CLDX 2JI9A 3LHSA 3SHFA 4E13A 3ME5A 1NXSA 4C4AA 2YWJA 4MVJP 4TRRA 3DTYA 3N7UA 4QODA 4X1IB 1OYVA 5CBKA 2J5KA 3TL3A 4AO8A 1E96A 1ZUIA 2PU7A 2BGLA 1IHUA 5SYAA 1L7VC 4B35A 8GPBA 4JUAA 4FZJA 4PIVA 4UPEA 3RS9A 3B3FA 5DHAA 4MGIR 3TNLA 1U2EA 1EFLA 1VJRA 3RRNA 3RVKA 1QRDA 3RUCA 3WR5A 5DMHA 1VJ0A 4P86A 3SVLA 1VP9A 1MRZA 4C78A 3FNEA 3AZPA 1N78A 1PW5A 1YZTA 2KBEA 1NLFA 3IUJA 1MJNA 5IH3A 2ZFUA 3LY7A 4MRNA 1C9MA 3OZRA 1Y9DA 1EJBA 4I6JA 2QG9A 2EKZA 3LVRE 3RHFA 4FMCB 5FUQA 2FEAA 2HJSA 2VAVA 3EEBA 4ENQA 1PT8A 4PC1A 1KIMA 2YJ5A 5AD1A 3KEOA 4YHBA 1FMFA 3O1HB 4MKRA 3SD7A 4Z3OA 4WLUA 4DQKA 3VJRA 3QY0A 3HNRA 4UC0A 2HLHA 4HRXA 4AZTA 3JQ7A 1W6RA 2V7VA 3QIVA 4QQRA 4BQSA 4E5NA 3U48A 3ZHBA 4RTQA 1EJ2A 1C50A 2X76A 3BWBA 3DM9B 2ZVDA 3HSYA 3ASYA 1KO4A 4QUEA 3L1VA 3WYAA 4DNPA 5DI9A 3DVAA 2ZIGA 2FE4A 4MUMA 1CRPA 3CRMA 3WHPA 1NLUA 3H86A 3H84A 3AEKA 2NTEA 3NAMA 3CRW1 4MTLA 3QW4B 3NVDA 3NGMA 5EJAA 2BT4A 1M1NA 9GPBA 1RE1A 2XCSB 2C4VA 2L0XA 4G5YA 4WJZA 2J0UB 4G37A 3EGOA 2CLIB 3TX2A 5J3JA 1M2VB 2O5CA 3GLFB 4QA9A 1RJFA 3ON5A 5CDSA 3K0HA 5F5LA 1PNOA 3UJCA 4OGFA 3S28A 3ECCA 3UWDA 5JE8A 1RYNA 5DMXA 3BC1A 4OHOA 4JP3A 1DJLA 2AC4A 1JYEA 1RLJA 3OX3A 4XX0A 4YGXB 5JS1A 4JC0A 3VR2D 3QYFA 4GXNA 4B7UA 5AM3A 3M5DA 4IDCA 5F4BA 1XELA 3Q8WA 2C9MA 4KU4A 3EUWA 1L4YA 2OBBA 3G85A 3D1JA 2ZQYA 2FEPA 4WOBA 4L2IB 2R7LA 5F35A 4UDOA 2CV2A 1AT1A 4Q4AA 3SMQA 3LQ1A 5LP6C 3HO8A 1E5XA 1OWLA 3FPAA 3TR0A 4L9WA 3AFOA 2PVCA 3KJEA 4EEKA 1EFVB 5IT9A 2IHNA 4M7PA 5CDYA 1IEQA 1FNMA 3KT3A 4KHZA 2NV6A 2OKGA 2FU5C 3QBTA 1YBVA 4CTOA 3QX3A 2CL6X 2EQAA 5E2AA 1UBEA 5EPOA 4GZ6A 4EABA 2HQBA 3BGDA 5DH9A 3N2GB 2LKCA 3TB6A 3BFPA 1JG3A 2O9JA 3EDOA 1R6XA 3ROKA 1ZS9A 4JI5B 2ZJ5A 4FDLA 3G9TA 4DJAA 2DC1A 4XM0A 3DGEC 1VSBA 3IHWA 5A0FA 3VKHA 1GRCA 4LPSA 3DVRX 3UK0A 3CGGA 3MHPA 2CHEA 4J1SA 1SOVA 5DM1A 5KNBA 4PO1A 3WL5A 3PFBA 3B6ZA 3PJRA 1OXMA 3AB8A 3GGOA 3GYGA 3HVHA 3OUUA 2WJYA 1ANKA 1NIJA 1YR6A 3OJXA 2VTBA 2X2FA 3AG5A 1WY7A 1UC4B 3DWIA 1NURA 1C0LA 3LP6A 3UAWA 3L8MA 2W2MA 5JNTA 1TLLA 1RZUA 3EDQA 2XCOA 2AMYA 4BASA 2YFYA 4LE1A 3WGGA 1B76A 1W47A 3M81A 2PS9A 4F86A 2PWBA 3R23A 3EXFA 3AETB 2BLLA 1QYDA 2QUJA 1NOIA 1GPAA 2WYOA 2ZSEA 1BJKA 3IEUA 3EXHB 1ZWLA 4A5SA 4D8YA 4ARUA 3IAUA 2IXEA 3OZGA 4BV9A 1OFGA 2ZAOA 3KALA 4KAJA 3GEDA 4Q3LA 5PNTA 3QLUA 2GEDA 1KI9A 3ZU4A 1FTYA 3RLFA 5JIBA 5LIPA 4NCIA 4AO6A 3W2GA 4P84A 4QDKA 4I19A 3LCMA 5T41A 4G9BA 4WFQA 1MJFA 4QL3A 2FVYA 4UEJA 3UJDA 4NOKA 3TNYA 1IPFA 3SC2A 4WOJA 2OV8A 1UJCA 3AI7A 3TNJA 3TFWA 4EJSA 1E1YA 2ZVJA 2HYIC 1Y3AA 3GDOA 4EF5A 1NGSA 1Q21A 2AHRA 4K6KA 2GM4A 2ZYUX 4G1MB 2FWNA 4G4SP 4K0KB 3GI1A 3PUWA 5LU9A 2PTGA 1SCAA 5HOQA 1G4HA 4NQRA 3L82B 3B1YA 1OBVA 3C6BA 3I5YA 1H1DA 3I2JA 4P80A 3R3YA 1JHVA 1L4FA 5L4LA 2GF9A 1MW9X 3MWJA 4YT2A 4E5PA 4R5MA 3IXQA 3JWIA 1QPZA 1B16A 1X39A 3KOWA 4Y6PA 2GF2A 3SIXA 1ZBDA 4BVHA 1O1YA 4P4NA 1TTTA 1N0WA 2Y92A 2YW2A 2HMVA 2YHIB 4KREA 2G71A 3PI7A 1TVKB 2WUFA 1RQRA 3FPCA 4QQ8A 3RUHA 3K9NA 1A71A 1NR1A 3PFIA 4UDNA 2VHZA 3LQRA 5DNWA 1AV7A 1X2BA 1GGHA 1RLOA 4AMYA 4ETIA 1XWIA 1QQ7A 1EZ1A 5FR2A 1MABB 1JLKA 1PFQA 1ZRMA 3DUWA 3B13B 4OXYA 3IMFA 5T4FA 4YT8A 2HZBA 1Y8AA 5EWLA 2GN2A 5JZ9A 1KETA 4JUBA 2MSLA 3E3OA 3RM3A 3VKGA 1GG9A 5C9ZA 4PLPA 1ZM3A 2CNNA 2M32A 2OP1A 1V2GA 1BMTA 4B46A 1Y6GA 2GSDA 2Z4TA 5BV8A 1H93A 3SSNA 2D62A 1KAEA 1KMCA 4DNOA 4AY6A 1CQPA 5DXFA 3T6KA 4Z4HA 2J07A 5KVVA 3AVXA 3UWPA 2DUNA 2QEQA 1R4NA 2C9YA 2ODPA 4YAKA 2WM2A 1JPUA 2I8LA 2ODWA 2ORVA 3GZNA 3IUNA 4AJKA 4ENRA 5LMCA 4C0JA 3N0XA 1Y81A 5B4TA 3CUUA 5FLEX 1MB0A 4MRAA 3IAAA 4RKYA 5G1PA 4REQA 2IWHA 5E6UB 2WA1A 3C3DA 3SXPA 2V1XA 3EVFA 5BQXA 4D7AA 3IP7A 4YPVA 2RAPA 1WUJS 5THKA 3B51X 3U0BA 5HCUA 1ITZA 2IVZA 3BJIC 1CIJA 2YN0A 5FBQB 1QF6A 3BB4A 4U2DA 3ESXA 4GT1A 4HTAA 1BHO1 3FYUB 1HV8A 3FVTA 3R6TA 4I1RA 1G6KA 1DKRA 1CLEA 1KU0A 5A5GA 4KAAA 2Q45A 4CBVA 5DT2A 1AK9A 1VFPA 1KMHA 3G9QA 4S0XA 1J9ZA 4UHJA 4KVFA 4UFPA 3HS3A 2ODTX 2ISQA 4RVSA 1N1MA 2F3SA 1I6KA 2XQVA 4HGZA 3M4XA 1VE1A 1ZJ6A 1V25A 1L9XA 2HREA 2H7YA 2GJ8A 2MSEB 3AWDA 4LHWA 4LRSB 3TW8B 5FI0B 4N0DA 2PJRA 1I6LA 1I1NA 3C5VA 3KQOA 3MTEA 1P2FA 4NR0A 3AFMA 3CRVA 4JXZA 3EMKA 4HDSB 5ED4A 1U8ZA 4KFSA 3WQBA 3W5AA 5TQ0A 5BP7A 4AVYA 2I2BA 4B83A 2AJLI 5LWHA 4PPNA 4ESEA 4Z1MD 5AUNB 3BQ9A 3IIJA 4DMGA 4S1VA 3A3KA 3DB1A 5CYFA 4D82A 3P4YA 3HXTA 2XEXA 4TV9F 4QJ5A 1RQXA 3RJ9A 3GZNB 4DUGD 1GFIA 4II7A 1ZM2A 4WN3A 1Y1LA 1TD9A 5BYJA 4Z49A 2GEVA 4YR9A 1P2UA 1NXPA 3N8KA 2ECFA 3ZGZA 3X1WA 4HEQA 1JT9A 4ER6A 2QLLA 4CCYA 3C7TA 1GT91 4X41A 1HSOA 5DHPA 1NPTO 2R11A 4BUZA 4FD2A 3V8BA 1ML3A 1TTHA 4U7TB 1IN5A 5B3AA 5C2JB 5K3EA 1OYWA 1XZPA 2IXDA 2P9HA 3I5AA 3THSA 1W25A 1TLFA 1GYRA 4L95C 2QTRA 3FZYA 4D4MA 2GEBA 1I4LD 4YQYA 5EXDA 4ER5A 3JQDA 2SCUB 1VLJA 2YHBA 3TZ6A 2XZPA 5KHOC 2V0GA 2J6CA 1PE0A 4ALJA 1GTSA 4GI5A 4PG7A 3O4HA 1R18A 4DKXA 2QU8A 2ZRDA 2REQB 1ISGA 3R2JA 2FDCA 5KOHB 2PY6A 3Q3GE 4P5EA 4WXPA 4ND1A 3C3BA 1P6QA 3PP8A 1KR5A 4PG4A 4V0LA 5A4JA 2I2FA 1HEIA 3IOCA 1XJCA 3PNBA 1J33A 4FGKA 1LX6A 5DLYA 1XR3A 2O0JA 1NBME 3ENNA 3ND6A 4DIBA 1PHRA 2WM8A 3HJBA 1A2BA 4MLPA 3HNOA 3DBHA 3EVZA 4G5RA 4HGRA 4Q03A 1BWQA 5CVVA 1X14A 2HH9A 1HE3A 2QQ0A 5HX7A 3II6X 2B3TA 4R1SA 1E6LA 1F38A 4YRPA 3M0EA 4B09A 2JCXA 1LPPA 1YUNA 2PNFA 5DHTA 2E48A 1VI5A 5DCYA 4U5XA 3RSLA 4LVCA 1AHIA 2PLRA 3GWGA 2REXB 1XLTA 2E89A 3QMPA 3QXHA 4QYIB 5E95A 1R0BA 4K9KA 4AG5A 1RZRA 3NLLA 2DUWA 3OECA 4Q7KA 2PSJA 2DBVO 3IUEA 5IDVA 3D6MA 3ZHXA 4YV2A 4RTJA 1KOGA 1KZYC 2QZ4A 4DGQA 2UZ3A 4HN2A 2BFPA 4CF3A 2ZRLA 1KSFX 2V7TA 1AKEA 3AI1A 3RFFA 1R6AA 1XDZA 1XOIA 2A9OA 4BYGA 1DINA 4EPTA 5EZYA 4BEBA 1QZUA 2HX1A 1SD1A 2WYVA 4ZT6A 3MTQA 4ZYWA 2VCHA 3BZWA 1NUHA 2D3TA 5LQRA 1QIIA 1S7GA 4OUDB 4QREA 1R12A 2VJDA 3OF2A 1K3UB 1BCRB 1KMHB 2XMZA 1CVRA 4NSNA 2BEUB 2AXQA 2IUUA 1T26A 7MDHA 1ENZA 2EWMA 3AL2A 2GGSA 1Y1TA 3KPYA 1Q2XA 2R8EA 2B9VA 3H7AA 2RI0A 2BMAA 3FMFA 2IA5A 2NT4A 3ETJA 3OEHD 4P3NA 4Q3AA 4YIHA 3IHTA 4TXJA 3VSBA 1UDCA 4BC0A 3MB8A 2P6UA 4GUAA 4BNMA 2G6BA 2GCOB 1OZFA 4FW8A 4RXTA 4UPVA 4K9LA 1VXOA 1Z5UA 2EU8A 1GTMA 2X13A 1YC5A 3K1TA 1Q0QA 4TWZA 3K1AA 3CF6R 3VTFA 1C0PA 2M6SA 1BMQA 3W7VA 4UE6A 1RYZA 5CAEB 3T52A 3NHMA 2I8AA 4LECA 4N4AA 2CHFA 3B3GA 4GR4A 2FEMA 5BW5A 3OU7A 2O3QA 1I7NA 2A3RA 4KZPA 1VL2A 4M9QA 2GYWA 4BVKA 2OWEA 2WE7A 2NACA 2AVNA 4N7JA 5K01A 1P17A 1DLIA 1NXOA 4Q4DA 4Q4JB 4JYAB 4GOMD 4IIYA 4ASUA 3STUA 3O91A 4QC2A 2P67A 3RRXA 3SEFA 4ZJUA 3IDOA 3AEUA 3HJGA 2KLBA 2CFTA 3B9QA 3AOGA 4FFNA 4I8DA 4DJTA 1WP9A 1B6RA 3V4LA 1H2FA 5A3QA 2QYSA 4D57A 3P20A 4DB4A 2NZUG 3F3MA 1V6SA 4HQKA 4JSYA 4CEIB 2PANA 2CK3A 4F8EA 5JW6A 4QOHA 1MV5A 1X1RA 3WKEA 1ZJWA 5EE3A 2QAIA 5EEGA 1K5PA 4BRWA 4BLSA 2D54A 2HA2A 2ASEA 3N7TA 2AK2A 4QG3A 3F2VA 3LUHA 3KQVA 1RI2A 3B2NA 5DOZA 1ZH0A 4OXRA 5FTLA 1W1WA 1Q1BA 3WL8A 3EE6A 4PRZA 4E2XA 3HE3A 2OEPA 2WQZA 1JUDA 3PQ5A 4UUPA 5EEHA 1C1YA 3FYSA 5DHRA 2ZPAA 4FE3A 3SSAA 2FZVA 3D6VA 1P31A 5E1MA 3ZWNA 4A73A 4M8KA 2YS7A 1UT6A 3UTDA 4KX5A 5ECWA 4JOCA 1KQ3A 4MRSA 4RY9A 5HJEA 3CEMA 3OZCA 2WIFA 4K6GA 4TT8A 2CLEB 4NQZA 2XGJA 1Z38A 3O6VA 2BJWA 4J16A 4BX0A 5BV1A 5FBVB 1OXXK 3O0TA 2O8CA 3OJOA 3MWFA 3F6PA 1NLMA 1FEZA 1PJLA 2IYWA 3DNPA 1E69A 4DA0A 4LNHA 4URUR 5AI6A 4DJJA 3GNLA 4AYXA 1E79D 3EUFA 3KHUA 4L8GA 4OQZA 2IEDA 1SOMA 4HX5A 3TTSA 1REQA 3HM2A 1XV5A 3T4XA 2FW1A 1E6CA 3O1LA 3ZD8A 4DMHA 1ZM7A 1PG2A 1ZD2P 2Q3LA 4DY4A 5F98A 3F5SA 3B6IA 3IKVA 2P4QA 3RVNA 4EO7A 5JADA 5JVDF 5AW6A 1D07A 4RTNA 4GKJB 4QD3A 1TVCA 1WCWA 3EPLA 1AXGA 4MIKA 3SQXA 2GPJA 2OL4A 2H8KA 2V58A 3AHHA 3IVRA 5FNVA 5EJFA 1XP5A 4JUCA 3ZWOA 3DHYA 4PCLA 2P2ZA 1IUOA 2ZROA 1P6XA 5BN5A 3AVPA 4FOSA 4UE3S 3KQLA 2DB3A 2RHLA 3ER8A 4K28A 4D97A 2RGWA 2OOKA 1OAKA 3SLKA 2A67A 3DA8A 1U81A 2BI4A 4Q1CA 1UOOA 1QU3A 4B2YA 3OOEA 5FBKA 1Q5PA 1WOYA 3R6WA 4M0UA 5BPHA 4U2BA 5CDUA 3ET4A 2XA1A 3NJRA 3FCXA 4X6UA 5D7NA 4PLZA 4EEXA 2GDJA 4L57A 2G4VA 2ERYA 3WL7A 1T0IA 3PXXA 2UZ1B 3ES9A 4CV0A 3QPDA 5AVTA 1OOEA 2JGEA 3I9OA 4MI6A 5BUSA 1C3OA 2D4AA 3LZCA 2FWAA 2H1IA 3K1ZA 2WTXA 4KH0A 4E1AA 4D8XA 1L7RA 4C4YA 4KE8A 3GRCA 1TCBA 4WOCA 4MDFA 1T5HX 1PD0A 3A4TA 1X42A 3AM5A 5FYDA 4CUKA 4A9AA 4F9EA 1NP7A 5I7AA 3GNSA 4JCCA 4XSHA 5TGTA 3NHFA 3HI4A 3PIDA 5T6BA 3I72A 4IXDA 1ECPA 4N5DA 3L4JA 5CDTA 2IDMA 5IK2A 3HGTA 3TMKA 5KPJA 1KEEA 2V3CC 1U8AA 1RP1A 3TGLA 1G98A 4V02A 2CLCX 1XHLA 5ALVA 1E94E 2IX3A 2VPZA 4I4CA 2I9KA 721PA 2W2LA 3D4BA 5FKJA 4DV5B 4RAQA 1GG8A 1C4XA 2ZIUB 2CXHA 3LLVA 4WOPA 4ZC8A 2KE5A 2HNBA 4A0HA 3LC2O 3VJMA 4DA7A 3DPSA 1LSOA 3AR2A 4TVBA 1RHMA 5CEEA 3OZSA 4RQTA 3U19A 3JQ7B 3UICA 5EJEA 2QS9A 1AO3A 1U28A 3EUEA 4DDMA 3OETA 3IP6A 2IZ5A 1ZHFA 4MR7A 4U6NA 1LBIA 1XVTA 2Q4TA 3IPRA 3T5CA 3WICA 2PGIA 4BX2A 2OZPA 2B6HA 3UWKA 3HR4A 1TQ4A 3SR4A 1F8UA 2Z6VA 2NM0A 5EIOA 4PINA 3SVTA 1D1TA 4AF8A 1E9AA 1QV6A 1TGVA 3BILA 3AP3A 5LP6A 3ND7A 3W5HA 5J1SB 4ZOBA 1EQUA 2CXXA 5EVJA 1MRNA 2GAJA 3I5UA 4ND3A 4U7WA 4I3GA 4WLEA 3RG2A 2XCTB 4FWIB 4HFMA 3NHJA 4URVR 1UEJA 2F7SA 2J5RA 1BE8A 4JI6B 5JMPA 3RG8A 2HCJB 2DZDA 2RJNA 3O94A 4BE9A 5CB0A 1OE0A 3GLHA 3ZNNA 2B5WA 3PR3A 2FZ4A 2H9YA 4E11A 1QS0A 2OCPA 1ENYA 4TV8A 1ISPA 1Y1SA 4TQ9A 1UKEA 4Y2XA 2F00A 3PC3A 2H9AA 4P5PA 2OXRA 3JY6A 5DHSA 4RM2A 5I9TA 4ZCLA 3HY6A 3V00A 4CUZA 4XX0B 1YB1A 3BF7A 1OA0A 4P08A 5LVAA 3RF6A 1JQBA 1YBHA 1D2MA 1QZTA 3IO3A 2FP3A 1JHPA 3HJCA 3KT6A 4IIVA 3RYHB 5BWCA 5K3OA 3WDKA 3ED1A 2AT1A 5G0WA 3PC8A 4BNJA 5JDIA 2O8DA 1PV4A 4P22A 2HEIA 3K0BA 5G41A 4ZHQB 3QTBA 1NQ5A 2Z09A 2HMYB 1RADA 1GSOA 2G1KA 2JI4A 2KB0A 1X70A 4O4HB 3IA2A 2B1QA 3S1AB 3PT5A 5IJ0B 4KYIB 3P2MA 2I9PA 3DT9A 4D2IA 5L3VA 1BJTA 3BMXA 1N1EA 3CINA 1O95D 2CHVA 2JA2A 3BXFA 4IDOA 5TX7A 3BB3A 3DKKA 4A2WA 1V0JA 4DQ0A 1DC7A 3GEEA 2VNAA 4F0JA 4ENUA 1JIJA 4JELA 5CXXA 4J2TA 4DA8A 1I2DA 1JPJA 3OY2A 4PAOA 1MZPA 3UKJA 4R8SA 3UWSA 1Q19A 1Q74A 5IYZB 2SHKA 1M6VA 1WXXA 4YJGB 5GTDA 1KO1A 2B7CA 3E8XA 4BMZA 5JSFA 5EPEA 4MTCA 5BSKA 2I7DA 4RA6A 4XQEA 1QAOA 5LLSA 1SBTA 1JAYA 3AVTA 3OJEA 2P1RA 4JC8A 2HUPA 1MO2A 2FZCA 2MR5A 2P69A 3CKKA 1MQSA 2ZW9A 4FLFA 4GF5A 2EJUA 4AX8A 2A0UA 1R88A 5JEDA 1XF9A 4J7XA 1RJ9A 3MMPA 1YVUA 4TLCA 3BGSA 1KEUA 5FPKA 4FI3F 5K0JA 2IYVA 3GA5A 4UNSA 2QYHA 4B3JA 5TT1A 4ZOQI 1Q0LA 1Y3HA 1BW9B 3C8ZA 3GHHA 2W4QA 3M6VA 1PR2A 2QTCA 3FR8A 3QMVA 2X8LA 3PNPA 1TQDA 2EQ5A 3TPZA 1JDBC 1Y89A 3KWJA 3DL4A 2X5XA 3I76A 2D1FA 3TQHA 2CLHB 4FNGA 1L4BA 2EARA 4Q21A 4HXGA 4BMVA 2GBLA 4TKMA 1U1DA 2CZQA 1QC5A 4OGGA 3W1VA 3NMUF 3V55A 5JRDS 2Q5IA 1WLSA 1LW6E 2GCIA 3CMCO 4ZT7A 4PQRA 4LRYA 4LMBA 4U2KA 2VF4X 3GT7A 2X6RA 4MWBA 3SAJA 1XTBA 1GPNA 4NBNA 3OZEA 1ZMXA 4EYEA 1WDWB 3NAZA 1JZTA 4IX9A 3B5EA 3T7EA 1OHHA 2ZJ1A 3NHWA 1E64A 2I4RA 5TGDA 4CKWA 1JE1A 1HSZA 3D3JA 3HR7A 5EINA 4E03A 4CXMA 1U80A 4DF3A 1G7CA 1GSHA 1KJ9A 3D81A 3EW9A 3JQRA 3RFCA 4JITA 4DA4A 3DULA 3JALB 1J23A 5BQFA 5EFOA 1TUEA 1E2UA 1VQ1A 4TTSA 2FSGA 3V8RA 4HOYA 1Y6JA 1RM3A 2X42A 2ZUUA 4KWIA 1L5KA 2X0FA 2D5CA 5K45A 2YDXA 1QORA 5CFZA 3RSCA 2ZYTX 4R68A 4RPGA 2DFKB 1P8AA 4I4LA 4NECA 1T2AA 4R2XA 1J42A 3H16A 5IVDA 5HF8A 5A0VA 1DGQA 4F3TA 4NPHA 5LNK1 4GGOA 4MW7A 3OKCA 4LQLA 1HLPA 1RYHA 3LDHA 3NATA 4AYTA 4XVUA 1DTEA 4DM7A 1GA1A 2MYPA 2QXYA 4B7AA 3WL4A 3ZBQA 2W71A 3VXKA 4UNPA 3ZNPA 4NABA 1CQWA 1R4ZA 1C4WA 3SQNA 3U17A 4CCWA 4QUGA 1KZ6A 5CJJA 5H8WA 1NMYA 1K7EB 3QX9A 3VZQA 3T35A 4HJXA 3BGVA 3UH1A 1YS4A 1ORHA 2R1VA 4FNAA 4WH0A 1EP2B 5IVIA 1L7XA 1HG1A 3CONA 4LGVA 2XCLA 3PYLA 3SS8A 4F8YA 5KTSA 3EUAA 2OSBA 1IHPA 2EIXA 2WYUA 3MS4A 2XVYA 2MU1A 2NU9B 3VYUB 1LF0A 3HN7A 3JALA 5JH7A 1M7GA 1ODKA 4QU0A 4WN9B 821PA 1F5NA 5IAEA 5E38A 3TLAA 4P98A 5L9AA 4NCXA 3CLUD 1LRLA 1ZICA 4CG0A 1KEPA 4W5NA 3LFUA 1OT5A 1K08A 2CUKA 1Q77A 3FLEA 2YWGA 1JB1A 4KVZA 4PSDA 3AVYA 1DMRA 1VCMA 2PGAA 4N0QA 4W6QA 3E8MA 1NVMB 2CUNA 1FXUA 4BGIA 1KDOA 4B8WA 4CM7A 5AQEA 3D8BA 5BXYA 3NEYA 1BD4A 1MEEA 1EFTA 1Z3IX 5EWMB 3PXAA 3Q87B 5CH8A 3ID6C 1AGYA 1SQ5A 4GLFA 4QYIA 5KQPA 2V5UA 4GX1A 3D7KA 1VSUA 1CUGA 3HJNA 2IV2X 2XB8A 5IS2A 3OIVA 1XDUA 2YH2A 1K98A 5DP2A 1RWOA 5KQRA 4QUKA 4EQ6B 5FWNA 4BMYA 1J97A 4X0EA 3DNMA 2OV2A 2X1LA 2MSCB 3A9WA 4BP3A 1U8TA 3EIOA 3IBCA 1DRWA 4OMCA 1D8AA 3E9QA 3LLMA 2G9RA 3DZCA 1RJDA 3M83A 4AKHA 5CEFA 5K0EA 3D7NA 1TKCA 5HWSA 2HDOA 2RKOA 3QW2A 4CCYB 3NBMA 1XEAA 2FZ5A 2C9OA 1ZRNA 4JT4A 1VB3A 2X40A 1WMEA 3C3MA 3LCRA 3RVLA 3W6PA 1KERA 3WOVA 3A6KA 3PDUA 3T3OA 3CUYA 5DM60 2Z8YM 3EGDB 5JI3E 1R4AA 4RY8A 4GLJA 4XD2A 1RBQA 2NSJA 2AZMA 3S2ZA 2AD5A 4JD5A 1E32A 4Q6WA 4GPAA 1TK3A 4MV9A 4HX2A 2AZ4A 2OGUA 1VE5A 4GZ5A 3D2LA 2F2TA 1L1RA 2C94A 3OCYA 3OHPA 2CJPA 5J4LA 4K9OA 3LX5A 1P2GA 5FA8A 3ZDYB 4C0QC 1UWVA 3QXCA 4B2LA 4F3YA 5HQTA 1HLDA 5DE3A 4YCMA 1H3FA 3ABZA 1SHKA 1VA5A 4J4BA 5GJCA 4JR1A 3JV7A 4UUNA 3W05A 3ZHZA 4I9FA 4IINA 1GKKA 3B6EA 1CHDA 2IRWA 3QVLA 4CM6A 2XE4A 3VHQA 1IXYA 1G7TA 1TC1A 5LBTA 3ZXIA 1VKHA 3OZ7A 1U8EA 4HEA1 1LF5A 1Z8FA 5FF9A 2OYCA 2HMWA 2GD0A 4S1OA 5GZ1A 1MRSA 1XAIA 1FTQA 1WHTA 2IEZA 2J87A 4I55F 2JVJA 2NTNA 2QWXA 2R1ZA 2C2XA 4EGJA 4XYLA 4B7ZA 4ZVKA 1HKHA 1EDBA 2DPMA 3OJCA 1PTJA 3AZQA 3TFOA 1E0DA 4PHFA 1QGED 3FHOA 4Q3BA 3PDIA 2QK4A 4NMMA 3VC2A 4E5MA 1L4UA 1W0KA 2YVLA 1IXSB 2R1VB 5IULC 1D2NA 3BDIA 3RSZA 1X1AA 3EZ9A 4IM7A 4CT5A 5AUPB 4H2DA 1RYYA 5KYYB 2RH8A 1FMLA 1SB9A 3PKIA 4YPOA 1ZITA 1QHYA 2DECA 3I9FA 4RSRA 1PZNA 3H5WA 4XPZA 5K3DA 3ZTWA 2BEWA 1RHRA 1OXBB 1IIBA 2R7NA 1VYTA 2NSDA 2NAPA 4KQ6A 1WG8A 4KXVA 3DO5A 4PGAA 2IUEA 5THXA 2PA0A 2H17A 1COWD 1DIBA 3QHAA 1PL6A 3H13A 1NVEA 4FYPA 4GDMA 5KMGB 2O8FA 5L7YA 2HMSA 1XEXA 1SRRA 1JLHA 4WKOA 2ZLBA 2OB2A 2J9YB 1GWNA 4PLYA 5JS8A 3V7FA 3C3WA 3CX6A 4N8SA 2JRCA 2WHXA 2XAAA 4RETA 5IBCA 2ACWA 1KJZA 3FMOB 5D1HA 2ZJ8A 1E8MA 3QYJA 2HJWA 4LX8A 3LPLA 3GLKA 2I99A 3KYBA 4OFZA 4Z53A 2VDOB 3H6HA 5JNUA 1ZI8A 1WMSA 4KE6A 5CGQB 2F3QA 2OYRA 1GU1A 2QP9X 2Y0CA 4B6OA 2GK4A 2FDRA 2QP3A 4BNWA 2JEOA 3B89A 5KWIA 4MRMB 1U8FO 2JFXA 2B1IA 2NTYC 2W00A 1EQ2A 2PPLA 3HWWA 4FGZA 3WK6A 1OFVA 1K68A 1SXGA 2AH5A 3C8DA 1D5WA 4HDOB 1ZX1A 4N40A 2W8BA 4B7XA 3KR9A 4EELA 5CT5A 2JGMA 1M10A 2Q9AA 3U44A 1H2RS 2P8JA 2V55B 2PMBA 2ZWMA 3ZD9A 1IUNA 3I6IA 2WC1A 3ZY5A 3LPMA 2K2WA 1F2UB 2CYCA 5ICGA 2I1QA 4RMIA 1Y42X 2QOEA 1CVLA 1SM4A 1PWYE 3KCQA 4U6SA 1N57A 1ID1A 1U7UA 1ZXBA 1PSWA 1QNFA 1JTVA 2CLMB