1D7OA

Crystal structure of brassica napus enoyl acyl carrier protein reductase complexed with nad and triclosan
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
297
structure length
297
Chain Sequence
GLPIDLRGKRAFIAGIADDNGYGWAVAKSLAAAGAEILVGTWVPALNIFETSLRRGKFDQSRVLPDGSLMEIKKVYPLDAVFDNPEDVPEDVKANKRYAGSSNWTVQEAAECVRQDFGSIDILVHSLANGPEVSKPLLETSRKGYLAAISASSYSFVSLLSHFLPIMNPGGASISLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEAGRKQNIRVNTISAGPLGSRAAKAIGFIDTMIEYSYNNAPIQKTLTADEVGNAAAFLVSPLASAITGATIYVDNGLNSMGVALDSPVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ENOYL-[ACYL-CARRIER PROTEIN] REDUCTASE (NADH) PRECURSOR
publication title Crystallographic analysis of triclosan bound to enoyl reductase.
pubmed doi rcsb
source organism Brassica napus
total genus 101
structure length 297
sequence length 297
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 1999-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1d7oA00
1T4DA 2JCYA 4BNWA 2BGMA 1PR9A 2P4HX 3ABIA 3F4BA 1DAOA 3EC7A 3GN1A 2O48X 2HMVA 1GCOA 2QRLA 1ONPA 4O6VA 1SPXA 2OP0A 1PEDA 2J6IA 4GX5A 1NR1A 1LDYA 3ZU2A 3LT1A 3OEWA 4WEQA 1OC2A 4AICA 1ZJZA 4EI2A 5IZCA 3DONA 1CF2O 4RF4A 3MCVA 3IC5A 1X7GA 2GRAA 4I08A 5A05A 1U9JA 4IJVA 4BMSA 1NQ5A 3HHPA 3PIDA 2PWZA 3U09A 3HDHA 3ZZNA 2Y1OA 4CQMB 4Y9DA 4XIJA 3GNQA 4MKRA 4ZQBA 2NV6A 4KWIA 3WFIA 4CM4A 3QWIA 1P0CA 2R00A 2DPHA 1DIRA 1EVZA 2CY0A 4IMPA 4D43A 2DBRA 1GZ6A 1LQTA 5COBA 3BMOB 1WDMA 1N9GA 1P1IA 4E6PA 5KOIA 4LRTB 4RPJA 2NQTA 2EJVA 3OETA 3PHLA 3L4BC 3DOOA 3GZNA 3TWOA 3TOZA 5G0UA 2JJYA 1EK6A 1KOLA 5TJ9A 3PWSA 4ILKA 4NI5A 4BNHA 3KYCA 3V5NA 4ALLA 3H65A 1JKJA 1IZ0A 3HQ4O 3ZWYA 4DLLA 4UVHA 2VHWA 1D8AA 5EQDA 1XIVA 3A4VA 2EXXA 3QVWA 3VTZA 2E4AA 3UXYA 5GMOA 3KTDA 1ZK1A 5IDWA 4Z9YA 2I99A 3PJGA 2UAGA 3VPSA 2YZ7A 4RJTA 4L76A 1A27A 3ASUA 1BSVA 4PG7A 2CD9A 5KWEA 3E5MA 3BIOA 3HADA 2DFVA 1S6YA 4JNKA 1O94A 2X0NA 4DBVO 1YOVA 1NQOA 3IMFA 3ZU5A 1NVGA 4FSHA 4L4RA 5JE8A 5L4NA 5ITWA 4B7XA 3VTFA 1WNTA 4K26A 5TNXA 2XXBA 4IMRA 4A2CA 5JS6A 2UVDA 3VOSA 1LJ8A 3A28A 4X54A 3F9IA 1JAYA 5T64A 1E1MA 1SNYA 1QXSA 3ROKA 4UEKA 5JDIA 4A26A 1U5CA 4YDRA 2PKQP 4HFJA 1DJQA 2GZ1A 4XB2A 2VTDA 5C37A 1B15A 4I9HA 3U5TA 3VVBA 1DSSG 5L4LA 5ICSA 3Q11A 1PJ3A 1BDMA 1AXGA 2DTDA 4BO6A 4EUFA 1ZNQO 3OA0A 5IZCC 3WMXA 4RV9A 2WYVA 4MIYA 3F3SA 5THQA 3ZV6A 1TI7A 2JAPA 4DWVA 3KETA 3ZNNA 3QRWA 1PJSA 1GYQA 4O5OA 1V3UA 5C7IO 1U8XX 4E4YA 4FFNA 1DC5A 3D3EA 3O03A 3RC7A 1J4AA 1VSVA 1R16A 2FR0A 3D4NA 4D42A 4WCFC 4E2ZA 1A5ZA 2YHIA 3NT2A 3FD8A 3NX4A 1KVUA 4MJLA 2R00C 4QEDA 2X5KO 1I2CA 1EUDA 2J3HA 1DIGA 1HDGO 3VPXA 2DVMA 5JDCC 1X15A 3HDQA 5TS3A 3GEGA 2J3KA 3W6ZA 4JXKA 2CDCA 2AQIA 2CDAA 1GPDG 1HRDA 3AOEA 1UZLA 2HQ1A 4GAEA 3KEOA 4AJOA 4BO2A 1ZO8A 4N54A 5I7FA 4EEXA 3DMTA 4BB5A 4Z3DA 4II3A 4W7IA 4IDBA 3UN1A 2BKAA 3D0OA 4ITUA 2VRBA 2DTXA 3TZ6A 3LF2A 2WMDA 4RCVA 5A3JA 4OKNA 1QKIA 1O6ZA 4IS2A 4IQ8A 2CDBA 4DL9A 2VT3A 3WYBA 1GQ2A 5TC4A 4Y8VA 3U0BA 4PCVA 4BGIA 3F47A 3GK3A 1PQWA 3OH8A 3FTNA 5IF3A 1DPGA 3DEYX 1A4UA 4CQMA 3QQPA 4DMLA 1JVBA 1ISFA 2JHFA 3A1NA 3AUSA 4ZQHA 1QR6A 1E1KA 1GUYA 4AFNA 2ZJ1A 1U4SA 5FFFA 4MO2A 1OMOA 1X14A 3KYDB 1H2BA 2R6JA 2HUNA 3PXXA 2Q1UA 1N7HA 3WQSB 5F1OA 4IDFA 2D4AA 2EHDA 3BMOA 4I8XA 1R37A 1T1RA 2AE2A 4L4XA 5G0WA 3K73O 5GY7A 3B1JA 5FI5A 2YHUA 2Q1TA 3BMNB 2PH3A 1GR0A 4XB1A 1DFHA 3JD3A 5CPBA 2QIOA 3VH4A 3AOGA 3ETGA 3LSYA 4J4BA 1UP7A 2PTGA 2WYWA 3C1AA 4H15A 4CQMD 4D44A 3AM3A 2DU8A 3CPSA 5HA5A 1GV1A 1D1TA 2HU2A 3I4CA 5DCYA 1VL0A 5DULA 4BO8A 3AM4A 3DC2A 1CEQA 4M8SA 5G4KB 4RPHA 4AJ4A 1Q7GA 5CHEA 4A27A 4TRNA 3INGA 4L73A 4OIMA 2AMFA 3GVXA 3DAGA 4RO0A 4I5EA 3MOGA 1OBFO 4CLHA 2HJSA 2Q1WA 5EN4A 1P45A 2PK3A 4A5OA 4R69A 4BNVA 1C1DB 1I10A 4BMVA 5EQFA 4CR6A 1YKFA 4G65A 5F1KA 4URFA 3L9WA 3JQEA 3X2EA 2G82A 3WTBA 2GCGA 3PQEA 1E3LA 2X6TA 5KVSA 3BYZA 4MVJI 4GMFA 3B1KA 4J7UA 5TGDA 1ISHA 1GZ4A 3H9EO 4YB8A 3JCZA 4Z0HO 4IM7A 2Q1SA 5DBIA 1Q7BA 2G17A 1NFRA 4ONEA 4OSOA 3H4VA 2VNSA 4KTVE 5BNIA 1LQUA 4IINA 4WLOA 4BGUA 4XD2A 3GRPA 2GSDA 1PL8A 3M6IA 5F21A 4LK3A 1K89A 2PGDA 4IQ0A 3RIHA 3NDJA 4E2YA 5H82A 2V6FA 1ZK3A 4NBTA 1ZBQA 4D3FA 1ADFA 2VRCA 1I3NA 2YDYA 5FI3A 4UVDA 3G0OA 4IDGA 4M89A 3WSVA 1KEUA 5F1PA 3OIFA 2HJRA 1KIFA 3C7CB 2PZMA 2VZ9A 5CG2A 2C59A 4XYBA 1UXJA 4PN3A 1YB5A 4MVJH 1A71A 2HDHA 1H5QA 1PZEA 1HETA 4TROA 3PRJA 5MDHA 4CLOB 1WWKA 2VRCD 4HUJA 1A9ZA 4CMKA 3I1JA 1K5HA 1EVYA 1U3TA 4BO7A 2X0RA 3ONDA 2Y1CA 4J16A 3S2IA 2W2KB 3KB6A 3WB9A 3VDQA 2JCXA 1ZVMA 1GPJA 1CDOA 3KLMX 4DC0A 2Y68A 2J8ZA 5CDGA 1PL6A 3RASA 3GDFA 2OL4A 4DLAA 4MIOA 3NEPX 1B8VA 4CMHA 3NDIA 2C07A 1JLLA 1B2LA 3KYDA 2C2XA 4H16A 3TQHA 1ADCA 4F3YA 1VC2A 1NASA 3QVTA 4FOOA 3W4IA 3WGOA 4CL8A 3K96A 3WGZA 3G79A 3QIVA 4DIBA 3DTTA 4ZQGA 1DC4A 4OMUA 4HP8A 2GPTA 5AXAA 1C3VA 2Y0EA 4CL3A 3GGPA 4ZICA 1KVRA 1HKUA 3GOHA 3B6ZA 2UV8A 4K28A 1UP4A 4LVCA 1EEHA 1P1JA 3NUGA 1Z82A 1QORA 2X0JA 5EL0A 5G4KA 4NZ9A 4UEJA 4HBGA 2WYUA 3P2YA 4TZKA 2GN4A 2VHYA 1B16A 1PJLA 2EW8A 3EY4A 4HY3A 4XGNA 2JHGA 1XG5A 3WQQA 2NUAA 2HMWA 2EKQA 1E1NA 3KVOA 1C1DA 3OQBA 4PLWA 4HV4A 4P22A 3WS7A 1KEVA 1H9AA 2F1KA 1F17A 2RAFA 1LTHR 3WOHA 1U7TA 3LK7A 2XF8A 1CQIA 2J3IA 3WFJA 4MVJP 3E1KA 4BB6A 5I9NA 1IUKA 3ZGYA 3OQ1A 5LDGA 2GN6A 3RUEA 1O89A 3GPIA 4FN4A 2GDZA 4NPCA 3MJEA 1HZZA 5I7SA 2EGHA 1M67A 1XQ6A 3ZHYA 4R1TA 2X86A 3PIIA 4J0EA 3WGTA 4PFJA 4QECA 1YJQA 5LC1A 1SZJG 2UYYA 2B83A 3QWAA 4R1UA 4J6FA 4DTIA 1JKFA 4KUEA 4EDFA 1WDLA 1KVTA 2RHRA 1VKOA 5L3ZA 4ND4A 3GLQA 3FNHA 3WGIA 1RKXA 3TZHA 3UFXA 4L74A 4IQGA 1GYRA 1PJ2A 5ILOA 3L4SO 3ADOA 3FPCA 3MJCA 3I83A 3Q0EA 4CMCA 1LX6A 1XU9A 2D3TA 3JD4A 4GX1A 1PWZA 4W7HA 5JYEA 1JAXA 1GEEA 2C2YA 5IG2A 4RVHA 1HE5A 1JQBA 3CSDA 4FS3A 1IHYA 4BMNA 3G3EA 5B4TA 1Y1PA 2PZJA 2WSBA 4HFNA 3O9ZA 1Y9EA 4GLLA 2WJPA 2X1HA 4FFMA 1E92A 3ROPA 3PZRA 3RKRA 4YAKA 1GQQA 1OI7A 4K6CA 4CLOA 4GBJA 5H81A 2HKIA 3H6KA 4RPGA 5CAEA 3ZU4A 1GUFA 2VUSA 3VDRA 3H9UA 1GUZA 3SC6A 2GYYA 1ZEJA 3AUUA 5HRUA 4PIVA 1Q0QA 2GERA 2VZ0A 3PZBA 1FF9A 1G1AA 3I52A 2I3AA 3PVZA 4TRMA 5JNLA 1H93A 3DHNA 2W2KA 4UVEA 1KC3A 3TZKA 3WDSA 5T8KA 5JBIA 1P1KA 5IDQA 4WLEA 1B8PA 3LQFA 1I3LA 1PJBA 3A14A 2PFGA 4R54A 3DOJA 1ENYA 3AK4A 1H6CA 4CMJA 2AEJA 1RM5A 4J3FA 4DVJA 1JU9A 4N5MA 1P31A 4JROA 3U9LA 3NT4A 2V6MA 1M6WA 3K2BA 1HDOA 4O63O 4BKRA 3GAZA 1OAAA 4O0LA 1HDZA 3UICA 3SX2A 4CMIB 1SEPA 2AQKA 4XX0A 4GVXA 4EITA 1HXHA 2OZPA 1ZXBA 1Y5MA 3SJUA 3LDHA 2DAPA 1CWUA 4YAEA 3LC2O 3HSKA 3DZHA 2FOIA 4NJMB 5U9CA 5DOZA 2E37A 2YYYA 3DHEA 3ZI0A 2EW2A 1IULA 2BI7A 4M86A 4PZCA 4YEDA 5JCXA 1T4BA 2O7QA 5G4LA 5JAQA 3FF4A 1P1RA 1GQYA 4UVGA 2Q46A 5HS6A 3DQPA 5KVQA 1Q7CA 3BMCB 2PR2A 2NQ8A 5JMPA 2WTBA 4BO9A 3I6IA 3BXXA 2GD1O 3NTQA 1BWSA 1RPNA 1B3BA 1CJCA 4YAJA 1U3WA 4ND3A 5A5EA 4DYVA 4YJDA 1LU9A 2I9PA 4KQWA 3PDJA 5BSFA 4FJ0A 1PS9A 2G76A 2ZYAA 1MC4A 1NX6A 4RPLA 2VHXA 3F4LA 3H2ZA 3RUAA 5KNLA 4CLEA 1FDWA 4Q3DA 4CUJA 8LDHA 1PTJA 1RM3A 4TWRA 1W6UA 4IXTA 3WICA 4P4LA 5A03A 2VWGA 1YQGA 2QW8A 1MB4A 4E5NA 4MINA 3H9JA 2X58A 1JWBB 3DTYA 3KZVA 3QY9A 4J1SA 2WE7A 1YBMA 3DZFA 2CNBA 1L7DA 4DIOA 4FB5A 2VYNA 4Z0PA 3PHHA 3E82A 1SO8A 2C29D 3ZWXA 2QQ5A 4Q3EA 2C7GA 1MV8A 3NV9A 3TL2A 4GMGA 1L7EA 3WLEA 1QYDA 5KJCA 1R12A 1VKNA 4CM9A 4CV0A 5CEFA 2IZZA 1SCUA 1SEVA 3ON5A 5ITVA 1T24A 3U4IA 2BH9A 4MKXA 1B26A 1ID1A 3FN4A 4IS3A 1HL3A 3AI2A 1NVTA 2YV2A 3HN2A 4GKBA 2DUWA 2Y0DA 4ND5A 2VYND 4NH4A 1YJ8A 3WJAA 1AN9A 1E7RA 2OBYA 4EBFA 4LN1A 4KWHA 2IYOA 4QX6A 2LDBA 1VM6A 3NRCA 5ADHA 4CM9D 4IDAA 4BV8A 1ML3A 5CPFA 3AI3A 5DOVA 3JQ8B 5EESA 5T6BA 5ILGA 1ENZA 4WOKA 1Z74A 1ONOA 1ORRA 4PLCA 4XDYA 2CFCA 3BAZA 1YWGO 4DQXA 1WMBA 2JFHA 5BQFA 3U49A 2BFMA 1VJTA 3E48A 4NBRA 2JKVA 4IY1A 5GZ3A 1E6EA 3HFSA 3WR5A 1V8BA 4GGOA 1ZJYA 3D3WB 2EWMA 4HX5A 4DLBA 1YS4A 5IFLA 1PQUA 4GX0A 1NXQA 2QYSA 3QE3A 1Y5RA 3WXBA 5DCWA 4QO7A 3P7MA 3ZWNA 4J2OA 4OSPA 4CR8A 3WYCA 3JQFA 4PLFA 3DFUA 4XQCA 3H9QA 1HE2A 2AW5A 3UCFA 4EYEA 3TL3A 3NAQA 1UDAA 3ETDA 3LYLA 1AGNA 4BO5A 4HFRA 4CM7A 3RD5A 4CMIA 3BTVA 3TPCA 4BNUA 5JFOA 2NU8A 5JCJA 2V7PA 5MGBA 3IKTA 3DZIA 2NU7A 3W6UA 5A9SB 2Y1DA 1X0VA 4FFLA 4YVFA 2EP5A 4D3DA 2ZCVA 3ZV4A 3HB4X 4B79A 4BKQA 3JQBA 5KKCA 3ZHBA 2C5EA 3K92A 5JC8A 3O4RA 2NTVA 1A7AA 4NJMA 4RDHA 2X9NA 3JQ9C 5G0TA 3K8ZA 1L1FA 4C7JA 3PJEA 4DQVA 5U1PA 1QMGA 4HXYA 5T57A 3GH3A 2FPGA 2RCYA 1DHTA 1E5LA 3CIFA 4MVJE 3QW2A 2B36A 3CZRA 2JL1A 1E7SA 1NQAO 2OUIA 2FR1A 3W8DA 3DHYA 2I65A 1KERA 1VRWA 5JCJD 1NAHA 3D7LA 3BMCA 2B4QA 3MWEB 3QHAA 3HN7A 3VZQA 5BSGA 1E3SA 1I5RA 2LDXA 4BQRA 4YCAA 3TNLA 4PG5A 3M2PA 4GI2A 1UAGA 1Y6JA 1ISJA 1N2SA 4J90A 1BRMA 4B8ZA 4IDDA 2C82A 2E6UX 3F1KA 3E6AA 2HK9A 4FJ1A 2SCUA 3IJRA 2IDZA 3WG9A 4BGVA 2A92A 1E3WB 1LC0A 1VI2A 2PD4A 5C3MA 4D3SA 5A02A 2GN9A 1NNUA 1TVEA 3TN7A 1HEUA 2PKRA 1ADGA 2NTNA 3ZNPA 4AJ2A 1I30A 4H3VA 4O59O 4TZTA 4CLRB 2DBVO 4JJGA 3K31A 3PGJA 4CUKA 4ZHSA 3DBLB 2IXAA 3QLJA 1I3MA 4MVJM 4M49A 4QT0A 2P9GA 1BW9B 1LSJA 5DBGA 5C7LO 1N7GA 1E0DA 3IL2A 4KOAA 5KJ1A 2OGUA 4J7XA 4OQYA 2PY6A 3PP8A 2NVWA 3R0IA 1LDMA 4E31A 5KTKA 4BNFA 4DRYA 1HYEA 4Q3NA 5L4SA 4S1VA 1YB1A 1I2BA 5K0ZA 3VPGA 3ZNQA 3M2TA 2O4CA 4EUEA 1V3TA 2QZZA 2A35A 3OJLA 1O9BA 3GAFA 3Q2KA 3RUFA 4R3WA 4BNKA 3JQFC 4WNCA 2D1YA 1YBAA 3CTMA 1NVMB 3S1LA 4YJFA 4CMEA 1SC6A 2VOEA 5CDSA 1ZMOA 4INAA 2X22A 1E1LA 3A9WA 3LF1A 4GSKA 3VVCA 3O38A 1JTVA 2CVOA 3D4PA 3NTRA 1LLUA 3Q9NA 3W1VA 1IZ9A 4DGSA 2FWMX 3UF0A 1I0ZA 3MZ0A 4CODB 1A4IA 1TEHA 4DUPA 2NADA 1UXGA 3F5SA 3JQ8A 4CV1A 3NTOA 2NSDA 3H8VA 3JQBC 3VKVA 4PRLA 3EUWA 4LISA 1LRKA 4EUHA 4ALIA 4BNNA 3WGYA 1HYHA 1BMDA 3ZW8A 2AE1A 4CM6A 4R3NA 5B4UA 1F8GA 3AM5A 3S55A 4XGIA 5I9LA 3D3WA 3AFMA 1QV6A 1UR5A 2UDPA 3KOUA 2ZK7A 3EK2A 4FFRA 1IYZA 1E3EA 1AHHA 1DXYA 3RC1A 3WWZA 1R0SA 3UH1A 4KQXA 1TA4A 4PLVA 2X8LA 3AU8A 1NPYA 3E9QA 1VL8A 5A5FA 3NKLA 2DBQA 3MWDB 2CSUA 2ZCUA 3P5SA 4N7RA 3WLFA 1EQUA 3GQVA 4JBHA 1GADO 4CR7A 3H2SA 4WCDA 4YTEA 4AJHA 1AXEA 3JQ7A 1PJCA 5A9SA 1SMKA 1EUCA 2EP7A 3CXRA 2BMAA 3OQ6A 3VH3A 1WLYA 3QVSA 3NT5A 2P5YA 3CE6A 1T2AA 4W99A 1M76A 4UEOA 4BOYA 1FK8A 3PLNA 4JK3A 5EPOA 1F8FA 4K9DA 4YT8A 2IXBA 3ZW9A 2ZYDA 3BHIA 3OIGA 3QSGA 2DFDA 3RC2A 3L0DA 1Y7TA 3Q2IA 4ALJA 3AI1A 3PQFA 4LMRA 3FPLA 5JDIC 4Z3KA 1S7CA 3WYEA 2Q50A 4EJ6A 1O0SA 3IP1A 3AY6A 4XYMA 2DM6A 1ISIA 3S2FA 3AY7A 1C1XB 1KETA 3KV3O 2EKLA 2IEBA 4RVSA 1QLHA 4GWKA 4XJSA 4KDFA 4L8VA 2VHZA 3DZJA 4B3HA 3DOCA 5B4VA 1PZHA 2FR8A 4CV2A 3S2GA 3CUKA 5DP1A 1R4NB 2G0TA 2ZYGA 1FDUA 4CM3A 3TDKA 4CMEC 1E3WA 3MOIA 1UUFA 1YDEA 1XKQA 5CDTA 2YV3A 5EJ2A 2YFHA 2DPGA 3T7CA 1O5IA 4E5MA 4HADA 4WEOA 3GZ4A 4UVIA 4XJTA 3ZWCA 5HS4A 2FMUA 1C0IA 2O2YA 3GGGA 4DYDA 5L95A 4CLRA 1C0KA 1Z45A 2A4KA 3DBLA 4A73A 2WWRA 4E30A 1EZ4A 2W90A 2JD1A 4FC7A 1BW9A 3AOEC 4NMHA 5JO9A 3V1TC 1V35A 4XR4A 2HMSA 2HRZA 1I01A 4B4OA 4OGWA 3DMTC 4YA6A 4XQ9A 1I2ZA 1EFLA 3WSWA 3DBHB 4DPKA 3E9MA 1MXHA 1P74A 2NTJA 3C24A 3IUSA 2W8ZA 4M1QA 5KVCA 4IJWA 3L6DA 4J9VA 5DCUA 2ET6A 1PR3A 1XR3A 3HUDA 1XQ1A 3LU1A 3PGXA 1EBFA 3SLGA 5G2OA 2GN8A 5JYDA 4I9UA 1PQPA 1F06A 2OORA 3HFGA 3ROQA 4BO3A 1PGOA 2I66A 2OMEA 3DBVO 3FHLA 1HDYA 1X1EA 2O23A 3TFOA 3JQGB 4NIMA 4W4TA 5HTOA 3BTSA 4JX8A 4ZU3A 2POQX 4H7PA 5T67A 3VC7A 1IHXA 4ALMA 4EEZA 2VHVA 1TT5B 3V2GA 5A9RA 4BNTA 3LC1O 3ORFA 3TF5A 3EVNA 3WWYA 2X9VA 3R3SA 3JYLA 2FHSA 4IJKA 1IE3A 3WNVA 2GGSA 4XQGA 1RJWA 1XLTA 1P77A 4FIZA 3A06A 3OA2A 5DF1A 1KY4A 3EZYA 4BO0A 4OKIA 4OH1A 4MIEA 3K9QO 2WD8A 2DTEA 4E2WA 3WQRA 1H6DA 1OFGA 2B4RO 1KC1A 2ZQZA 3PFFA 1MG5A 3ENNA 4ZRMA 4QQRA 1XHLA 4QTZA 1PWXA 4QXMA 1XEAA 2Y1EA 1NHGA 4R4JA 3ZWAA 3GDOA 4M54A 1QRRA 3WGGA 1WZIA 5AXBA 1DAPA 1F0YA 2WE8A 4G81A 5JMWA 5I7EA 4UUNA 2W98A 1W73A 2ZQYA 4RGBA 4RVGA 2CMDA 3OM9A 2WEKA 2Y1FA 4NFHA 1D3AA 1LSOA 1D1SA 1HWYA 5AVOA 3RSHA 2GO1A 2BGLA 4CM1A 1CERA 5GZ1A 1DLIA 4RLHA 3DAPA 2HMTA 4FFOA 4J1QA 3RC9A 1Q0HA 3CINA 4BKOA 5LDHA 3GVCA 2JFGA 3AFNA 4A10A 3WGHA 3QVXA 1GU7A 4TKLA 4WKGA 4E33A 9LDTA 1LRJA 5FF9A 4YWJA 4CM5A 4WECA 2VYVD 1LEHA 3B20A 1EVIA 3RUCA 2P9CA 2B4TO 1C1XA 1NYTA 4G2NA 4LSWA 4RVFA 3EDMA 4CMGA 1FDVA 4ZVVA 1M75A 2ILTA 3RAJA 3I9KA 4Q3AA 1LDBA 1HT0A 1R4NA 4K6FA 2HRBA 3H3JA 4IZIA 4I1IA 4Q3CA 5L9AA 1J49A 1DRWA 2PLAA 3OMLA 1X7HA 4DBZA 3E18A 1D4FA 4BUCA 4FDAA 1V0JA 5TF4A 3PYLA 1ZCJA 5BNFA 3ITKA 3KXDA 4PLGA 4BNIA 3S2EA 3NJ8A 2VN8A 1YH3A 3CMCO 2YQ4A 1O95A 3H5AA 4NDNE 4CMAA 3OJFA 1J5PA 1HDXA 1M6HA 1XA0A 1EUZA 3OJOA 4Q9NA 3WNQA 2EKPA 4Z9FA 2YDXA 1BG6A 1K0UA 4BNZA 3ROMA 3K30A 2AG8A 4NJOA 4WLVA 4K1LA 1Q0LA 4M87A 3DBHA 3N58A 1YB4A 5A3VA 1MGOA 2P4QA 4MKZA 4D45A 3KRTA 5CEJA 2H6EA 4PRKA 5KJEA 4OOEA 4WASA 5FYDA 4GQAA 5ICMA 1DFGA 1ZSNA 1TT7A 3FTPA 3PQDA 4WOJA 1N8KA 4P4NA 3CZMA 1LLCA 3VHRA 1B7GO 3DBRA 3GNTA 1IY8A 1KEPA 4Y6SA 4B4WA 4CUZA 3ONFA 2PGJA 1YONA 3OFSA 1EQ2A 3NGXA 1B14A 1NAIA 3OHSX 1E6UA 3FI9A 4R9RA 3DL2A 4D7AA 5K6AA 3EW7A 3ZDFA 3JQGA 4UUOA 3M1AA 4ZA2A 1PGJA 2ZTUA 4WK6A 1GD1O 4MVJA 1GAEO 2CUKA 1TT5A 1NR7A 2O3RA 3OEYA 3SBOA 3KHUA 4Q3BA 4RZIA 3TSCA 5TLSA 1G0OA 3QJ5A 2D5CA 3BTUA 1EE2A 2YY7A 2YQ5A 5DDIP 3RQSA 3SC4A 4PLTA 1ARZA 4B4UA 4BHTA 1FXSA 3T4XA 4YRBA 5AYVA 3RUHA 4ESOA 1ENOA 2C20A 1Z7EA 3VKUA 3W8FA 4MVJG 4PLZA 2GNAA 2EIHA 3PK0A 2XOXA 2BFAA 2HK7A 4XDZA 4EJMA 5EMHA 1R6DA 2YFQA 4MVJD 1LLQA 4E3ZA 3HWRA 3LVFO 2VQ3A 3GC6A 3C1OA 4DC1A 1LI4A 3GDGA 4L75A 4JBGA 2FPPA 4BO4A 3JSAA 1ZUD1 3KUXA 4ND2A 3PHIA 1I3KA 1Y8RB 1HF3A 1PSDA 2IE0A 1X0XA 1A7KA 1IOLA 3E03A 3UW3A 2O3TA 2Q2QA 3ZH2A 1HYGA 5I8ZA 2VT2A 3U4DA 1GY8A 4PG6A 4DREA 4R51A 3RKUA 5L7YA 3I9LA 4AG3A 1B3RA 4I9NA 2AA3A 4BNGA 4WNIA 2BRUA 2IYPA 1U5AA 3WIEA 2HMUA 3HDYA 2Y05A 3JQ6A 4R01A 7MDHA 2HCTA 1DIAA 1CYDA 4IPTA 3UUWA 2NVUA 1VJ1A 4WJZA 5L40A 2BGKA 1XSEA 1CQJA 3GFBA 3DFZA 1PZGA 3RJ9A 2BELA 3E5RA 2RHCA 2VTEA 3L77A 2OBNA 2XPCA 4GWGA 4E5PA 2OHXA 2HLPA 4TQGA 2OO5A 5CG1A 4TKMA 2ZKLA 2X0IA 2X5JO 2DQ4A 1ZW1A 3E9NA 4LW8A 1B0AA 1TLTA 3GHHA 4ROSA 3I23A 2FZWA 1N1EA 3D5QA 4JBIA 3ZHZA 1SBYA 3V1YA 2Y67A 1LDNA 5JAIA 1KY5A 4EZBA 4WCFB 4XA8A 5DP2A 4J7CA 3SXPA 1ZEMA 1KBZA 3ONEA 1UXKA 3ITDA 4TSKA 4YT4A 1T2DA 3SLKA 4WE3A 2HAEA 1Z75A 3OICA 3EAGA 1MX3A 3CH6A 4B7CA 2UUOA 3W8EA 4PG8A 4Z9XA 4BNLA 4YR9A 3ZWOA 1KEWA 2EJWA 2HK8A 5K6AC 1MC5A 5KJ6A 4UREA 3HJAA 4U0JA 1V9LA 2O50A 1ZSVA 5IZ4A 3GA0A 4XKJA 2Y0CA 1QSGA 1ZK4A 4OQZA 4LCEA 1TXGA 1OZAA 2Q4BA 4FGSA 1YXMA 5TIIA 2GASA 1ZKMA 2Z95A 1H9BA 3FNFA 3DXFA 4HKTA 3V2UA 5IAAA 1EDOA 1F14A 5KCZA 4RLSA 1YQXA 2DLDA 5TT1A 4OOFA 2XAAA 4CLDA 1XGKA 3Q3CA 1SB9A 4A7PA 4PG4A 1EDZA 1AE1A 1UDBA 1N5DA 3ST7A 3H3FA 1Y81A 1PJTA 2ZJ0A 1E5QA 4YQYA 2QZ9A 1WW8A 2E82A 5C7OO 5T8KC 3JD2A 2I3GA 1MLDA 3I9JA 5IDXA 4E32A 2P68A 3FWZA 2XXJA 3X2FA 1NM5A 2B37A 3JQAB 4RQUA 1XU7A 4CV3A 1DFIA 1BXZA 2GZ2A 4A0SA 1U7HA 3W4KA 1DDOA 3W4JA 4E13A 4XIYA 5TRTA 2A94A 3EVTA 4BO1A 4LRSB 1A72A 4HNHA 3HDJA 3KBOA 4YJFB 2JCVA 2AQHA 3T4EA 1P9LA 3NYWA 1HZJA 1PZFA 3NJ4A 4YYZA 4IDCA 4TRJA 4FD3A 1BHSA 4J0FA 4DA9A 3ASVA 3U4HA 4Y6PA 3PHJA 3SEFA 2D8AA 5U4QA 1U2GA 3VH2A 4CQLB 1YE3A 3KM0A 4WPGA 3NGLA 4RORA 4XYGA 2G5CA 4R1NA 4II2A 1BGVA 5JY6A 3U4CA 4W6ZA 1I8TA 5AOVA 1WZEA 5JSFA 3JV7A 3G17A 3IOYA 4EW6A 5JO0A 2NACA 1LXCA 2PZLA 1GYPA 4YT2A 4IGFA 1BTOA 1JW9B 1Y8RA 1ZH8A 3FBGA 1UH5A 2V6BA 2YV1A 3ANNA 4DPMA 1FDTA 1YQDA 3IDSA 2O3SA 1NWCA 4AJLA 1PL7A 3DZGA 3VPFA 4JN6B 1WMAA 1LDGA 2J5KA 4XYEA 3RVDA 2OOSA 2PGLA 5THKA 2I6TA 1C0LA 3GUCA 2VOJA 4AJ1A 5JLAA 3FNGA 1ZSYA 4YAIA 3I3OA 1V3VA 1O8CA 3G1TA 3H5NA 4GH5A 4MP3A 3IJPA 1BXKA 3PWZA 3EYWA 5FWNA 4GVLA 2DUUA 3JQ7B 4YACA 1K2WA 4WUVA 1DIBA 4BNYA 1QP8A 1DOHA 2OP1A 1QG6A 3H9GA 2IZ0A 2TMDA 1K6JA 2E49A 2NM0A 4YXFA 2B0JA 2V6GA 4GLOA 4RVDA 2X9GA 1UP6A 2ZB4A 1DIHA 4JIGA 1T25A 4JLWA 1BVRA 5CDUA 3PI7A 3FCOA 3JD1A 1JVSA 2GUGA 4WCFA 4Z6KA 4GX2A 4R5HA 2BI8A 1QLJA 3KO8A 5GZ6A 5JPIA 2ZB7A 5JDCA 2CF5A 3PLRA 4IXWA 2H63A 4NQZA 4AJPA 4FGWA 2CF6A 4BKUA 4AJKA 5EINA 1HE3A 3I5MA 1I24A 3HG7A 3KYBA 4S3MA 3TZQA 5L7TA 1LC3A 4N5LA 1UXIA 1P1HA 2B5WA 3B1FA 5ER6A 1AHIA 1E7QA 4WLFA 3GVIA 4D79A 1U8FO 5C5IA 3R3JA 1DO8A 1IPFA 1AUPA 1GZ3A 3KSZO 5EERA 5L53A 4OO3A 4Y6RA 1EK5A 1GCUA 1WXDA 2GLXA 3Q9UA 3ZV5A 3AY3A 4XRGA 1V6AA 4L0QA 1C0PA 1T1SA 3QP9A 3ZWMA 5BT9A 2X5OA 3GT0A 4Q39A 4EGFA 4J4HA 2FSVA 4I5GA 4LMPA 2PZKA 4PLHA 4R68A 4IZHA 4ZQFA 4D41A 4E2XA 3UGKA 4W9NA 1YGYA 3D64A 3ZNOA 1M66A 1Y9AA 2AEFA 3C7DB 3GG2A 3GN2A 1NPTO 3HE3A 3INTA 3QA9A 4DQUA 5DT9A 1WPQA 2Z1MA 4DIFA 4GL4A 3ZCXA 3JQAA 3GG9A 3LLSA 2O3UA 3RBVA 2Q4EA 4JQCA 4J2HA 5ENDA 2NU6A 1QYVA 3ICCA 3ZU3A 4BGEA 3GEDA 4EJ0A 2B69A 1MXFA 3RROA 2DKNA 3OP4A 1ENPA 3NDRA 3PPIA 3TFQA 2CVZA 1MFZA 3ZWBA 3G1UA 1DHRA 3TRIA 4ZN6A 3JQAD 1HLPA 4A03A 4CQLA 3GUYA 4R1SA 3IS3A 3O8QB 1NHWA 1YL7A 3VZSA 5IN4A 1JN0A 3V2HA 2QX7A 3IAHA 5B12A 4LCJA 3FNEA 4L4SA 2AG5A 3U62A 1F12A 2GZ3A 3VZPA 3Q1LA 4FPXA 4OXNA 1G0NA 2IZ1A 3Q6IA 2V65A 4I5DA 4BS9A 1T2CA 1ULUA 1ZFNA 2PKQO 3OF2A 3VZRA 1ZK0A 5COQA 3ANMA 3G49A 4GKVA 2VWPA 3JYQA 2AQ8A 3QWBA 3GVHA 1T2EA 1U3VA 3GRKA 3PHGA 3WBFA 2CVQA 4C4OA 3LT2A 5L7WA 4OXKA 4FC6A 1NQTA 2VWHA 3I9NA 4RVUA 4YJGB 5TQVA 2YJZA 3I9MA 3H7AA 1K6IA 2C5AA 2DT5A 1PJQA 3AU9A 2ZATA 4JJIA 3V1UA 3DMYA 3BZUA 3WGQA 2VUTA 3UAGA 1LSSA 2WD7B 1W8DA 1W0CA 2ZTLA 3FWNA 4XGKA 4XQEA 3WIDA 5CEEA 2C54A 2AEMA 3AW9A 4BNJA 1LDEA 1EMDA 4RDIA 4F6LA 4YBZA 2VUUA 2J3JA 1E6WA 4OL9A 4XYLA 4W9NC 1XCBA 2B5VA 2O4UX 4XRRA 2ZTVA 4QUKA 4TRRA 5I9MA 5B1YA 4ND1A 3BHJA 4OAQA 4RF2A 1Z73A 3IKVA 2WDZA 4O1MA 4RF3A 5EIOA 3D1LA 4E12A 1HSOA 5T5QA 3F1LA 6LDHA 4ZRNA 5L51A 3CKYA 5G0SA 4G5HA 4NU5A 3RFVA 1E7WA 3PJFA 3ZWPA 3RCBA 3AUTA 1LNQA 4AVYA 2OXIA 3JQDA 1PIWA 1K6XA 5JAZA 3ZHXA 4J49A 5TX7A 1ISMA 4FJ2A 4JP2A 3WJ7A 1BXGB 1ZXLA 4PZEA 4YJHB 1VSUA 2D59A 3WBBA 4Z0TA 2FSSA 1P33A 5BSEA 3C7AA 4ZQEA 5JAMA 4AJIA 4N5NA 1NTOA 2ZB8A 4N18A 2IODA 5A1TA 3UCXA 5TSDA 2QG4A 5BR7A 1FJHA 1ULSA 3GMSA 1UJMA 4JP3A 3C85A 4HWKA 5HBRA 1VJ0A 2QYTA 4E5YA 5HM8A 3MJSA 3I9OA 4ZGWA 1IB6A 3K2EA 2EERA 4JJFA 1UXHA 3GFGA 1GV0A 5AQ1A 2O7SA 3DDNA 4BV9A 4CJXA 3MTGA 1KYQA 3EMKA 5J23A 4PLYA 4J4TA 4QSMA 4NU6A 4RQTA 3WMWA 1GL3A 4CMBA 4NG5A 2EV9A 3JYNA 3STHA 3DBRB 4LVUA 4MPDA 1UDCA 3F6YA 5CP8A 1H94A 2GF2A 1NWHA 3RU9A 2UUPA 3MTJA 3LT0A 1YRLA 4J1TA 3QWHA 5KIAA 1LA2A 2Q49A 4KUGA 4RPKA 3GMDA 2FPIA 1J0XO 1WDKA 4CM8B 3AWDA 1JDJA 5A06A 1XWFA 3PTZA 4UUMA 1NP3A 5LCXA 3L9XA 4OXYA 4GPD1 3E8XA 1BVUA 1PJ4A 1QYWA 3O8QA 4W82A 2FY8A 5JXWA 3LLVA 4XCVA 2BD0A 2BHLA 3HNPA 1T2FA 4KTTE 1UZNA 4U6SA 3CEAA 2AHRA 1EBUA 1FMCA 4WLNA 3HB5X 4GGPA 4B3IA 4DXHA 4F6CA 3EZLA 1KVQA 2JD2A 4P4GA 4D0RA 3ANLA 4NBUA 3S8MA 3C3XA 2R2GA 3IQDB 3DAFA 5ENVA 5AXCA 4MDHA 4BNMA 1PS8A 1ZZEA 3AUAA 3DZBA 4NNJA 4IBOA 4KMSA 3FRJA 3IUPA 4YPOA 4NHEA 4RZHA 2W2LA 3JYPA 1YL5A 1RYDA 4RL6A 1MA0A 4YJGA 3UCEA 3PFWO 4AL4A 1RYEA 4UAGA 1TB4A 2HO5A 2C7VA 1ADBA 2Q2WA 1R4MB 1X1TA 3ZWVA 1Q2XA 4F45A 3LC7O 1FDSA 3I4FA 5ER9A 5IXYA 2VYVA 4F46A 2Z5LA 1WVGA 4OJNA 1JWAB 1R66A 2WD7A 3UKOA 2JAHA 3LT4A 3D5TA 4NK4A 6ADHA 4HFMA 5CDYA 1HTBA 1PU2A 3ETEA 4FR5A 3R6DA 1MP0A 1ISGA 2NVUB 5KJFA 4NFYA 1P3DA 1GDHA 4ID9A 2W2LD 2EF1A 3TJRA 3EGOA 4IUYA 3N7UA 3MJ4A 1OC4A 2TMGA 4MOWA 2Q2VA 2EEZA 1Z7BA 4TMFA 1GTMA 2HSDA 3BTOA 2BFPA 1RM4A 5KVVA 3OJEA 2J5RA 3JQCA 4RF5A 1PGPA 3UVEA 3OIDA 2FN7A 3FBTA 2ZIZA 4R9SA 4MP6A 3C8MA 1HDCA 4TVBA 3K5PA 2DC1A 3BMNA 5ES3A 4R41A 5F5LA 1LSUA 2IRWA 1DB3A 3RJ5A 3O26A 4IIUA 2VNAA 1DC6A 2W4QA 3MJVA 2GR9A 4NBWA 4QO8A 4U6QA 1CRWG 1U1IA 3RI3A 1BXGA 4YJHA 2OFPA 4D0SA 2X7HA 3OSUA 5L45A 2NU9A 2J5QA 2NNLD 4B3JA 3BHMA 3KEQA 3RWBA 3P2OA 5KKAA 4ZD6A 2F00A 1E77A 2EGGA 4JCOA 4OYRA 2RH8A 4Y98A 3KSDO 4KP7A 1K3TA 1ZMTA 2BLLA 4R5MA 1W4ZA 4CLXA 5DBFA 3COSA 5FEUA 4MP8A 1ZK2A 1Y8QB 1DRVA 1H6BA 5K9ZA 1R0LA 2D5AA 4IDEA 2AXQA 1HE4A 2Q99A 4R16A 3WTCA 1EFKA 4YQZA 1KVSA 1HLDA 3QV1A 3SJ7A 1PGNA 3GY0A 3HZZA 1CIVA 2Y93A 4TVOA 3M1LA 1PX0A 1VPDA 3N74A 4FOSA 3GNSA 1NFFA 4LSMA 1VLLA 2P2SA 1WP4A 5JC1A 4PZDA 5IN5A 3PYMA 5B37A 1D7OA 1A9YA 1I36A 4NK5A 4AJNA 4CM8A 1SOWA 3F46A 1T26A 2QHXA 3BMQB 7ADHA 1Z6ZA 4BNXA 4JGBA 1U28A 1H0KA 4J43A 1SAYA 1R15A 5IJZA 1QYXA 1B8UA 2Q45A 3RUIA 3GR6A 2PNFA 2H1SA 2FZEA 3DB2A 1DLJA 2NLOA 1PGQA 2IEDA 4KUHA 2JFFA 5DN9A 3DR3A 3VPHA 2BFOA 4J1NA 2FRDA 1YBVA 3U3XA 3IP3A 4BVAA 3ENKA 4HNGA 1I32A 1VE9A 4YT5A 3SVTA 2H5LA 3T7EA 2PD6A 3IIEA 1U4OA 1XDWA 2VZ8A 4WGGA 2NVBA 1IL0A 3R1IA 2Y66A 1LUAA 5I7VA 1SB8A 5DNAA 4BKPA 1YVEI 8ADHA 1EE9A 1G6KA 3MEQA 4BL5A 2P91A 4U8GA 4U5QA 3RU7A 1R4MA 3GGOA 4CPDA 3GF4A 1DBVO 3DWFA 2JD0A 3CMMA 3UHAA 2ZTMA 3TZCA 4XZ3A 3QVOA 1J6UA 2X23A 2I76A 1HSZA 4D46A 3QWFA 5BNTA 4ALNA 1KS9A 2PD3A 3FR7A 5HWSA 3WX0A 4QFCA 2RH4A 4E0BA 3PJDA 4XEHA 5A4DA 5F5NA 5COAA 2P5UA 3PWKA 1MUUA 1GEGA 1UZMA 3OJ0A 4PVDA 5F3RA 2Q3EA 5IDYA 4IIVA 2H9IA 1BDBA 1YDWA 3PEFA 3PDUA 3OBBA 2PA3A 2C0CA 2Y99A 3L07A 3JD0A 3JTMA 3MJTA 1MG0A 1Q1NA 4U7WA 4L9RA 1XYGA 2Z1NA 5AXDA 2EG9A 4AJEA 3GHYA 5BSHA 5JY1A 1P1FA 1LRLA 4QFDA 5I8WA 4CM4B 3L6EA 4PVCA 4B7UA 4IJUA 1P0FA 3PYXA 3BA1A 4B8WA 1SOVA 3RFTA 5A04A 2WM3A 4WLUA 4FW8A 4C7KA 4KDEA 4IGEA 4FQ8A 1M2WA 1N9GB 1P44A 3KSUA 4DMMA 1EVJA 1YO6A 5TT0A 2RIRA 1ZIDA 3ADPA 4GSLA 1LBEA 2O2SA 3GZNB 5H83A 2YUTA 1E3JA 1LLDA 3RUDA 4DPLA 1JA9A 2X4GA 2O3JA 3TOXA 2D2IA 3KLPX 4NFSA 3VH1A 3KYCB 2G1UA 1E3IA 3JYOA 3EHEA 4BIIA 2YW9A 2VCYA 1GFSA 4YRAA 2VWQA 1DEHA 2I67A 2A9FA 1DRUA 3DO5A 3RBZA 1XELA 4U0KA 1MFPA 2PH5A 3D4OA 4I5FA 3L6OO 3GEMA 1Y8QA 4FBGA 4BQPA 1JKIA 5A9TA 4B4VA 1OOEA 3ZWWA 1HDRA 3H5RA 4NR0A 1U2DA 1YOVB 4J9UE 3F5QA 4AJJA 2B35A 1N92A 4KZPA 1YL6A 3GVPA 1RWBA 3ZN2A 4PLPA 1U3UA 4OM8A 4UULA 3FSRA 3VAZA 2DBZA 1NFQA 3ZV3A 3JQ9A 1N1GA 2BF7A 5TJHA 1RM0A 3B70A 3L4BA 3P19A 4FFPA 1C14A 3I6QA 1ONNA 1E7YA 1CETA 3RBXA 4P38A 4NBVA 4ZJUA 3RFXA 4XR9A 3OECA 3UOGA 1I33A 3LZ6A 1DJNA 3GPDG 1WAMA 4M55A 3ICPA 2PV7A 3BMQA 5JW6A 2P9EA 2E48A 3AJRA 3ULKA 3C1TA 1UAYA 2Y1GA 1IPEA 4E21A 1PS0A 1QYCA 1H2HA 2ZB3A 1X13A 1DC3A 1H6AA 4MVJF 1QV7A 3INRA 4J91A 1NBOA 5G0VA 2O3QA 5DZSA 1R0KA 1NPDA 4XWYA 4P8RA 1VL6A 4UUPA 2FP4A 3FR8A 4Y67A 2RBEA 4LGVA 4ALKA 2CZCA 3V8BA 4YRDA 5CFZA 2NWQA 4E5KA 3K6JA 2QRKA 3DZKA 4PGFA 5IXSA 2YHIB 4OHUA 2I5PO 1X7DA 9LDBA 2D0IA 4FCCA 1E7MA 4YAGA 2QRJA
chains in the Genus database with same CATH superfamily
4B3MB 5EUQB 1T4DA 3QU9A 3EF1A 3IHTA 1EDEA 2P4HX 2W2NA 3ABIA 3F4BA 4YP5A 2O48X 3ZQ4A 1S96A 3C3JA 2HMVA 2X8JB 4XASA 2QRLA 3K3PA 3P4YA 2O5CA 2W2QA 4UE3S 1C9NA 4PYNA 1M2HA 5JD5A 1T5LA 1V39A 2VA8A 3E58A 2IELA 1NBMA 1V4VA 1VGRA 4GX5A 4QATA 5HJ2A 1OZ0A 1BWRA 2FN9A 3QUAA 3ZU2A 5JSYA 3LCRA 3UMJA 4CN8A 1OC2A 3OMXA 3RB8A 2D1FA 4EI2A 5CH5A 4P08A 5HF9A 1SHJA 4LZWA 3ESDA 3OZFA 3PX2A 1L4UA 3L1IA 1X7XB 4RKQA 5CCBA 4QNMA 4I08A 3AETB 3NBYC 3UTDA 1XRJA 2VJAA 5AM3A 5EIBC 1U9JA 2ZUFA 1FRFS 1K5GA 1LI5A 5LQCA 4ERXA 4QM7A 2CHUA 3M5PA 1T4CB 3EBLA 3L0ZA 3EF0A 2PBFA 5JXIA 2Y1OA 5JTUA 4HD8A 5AVQA 3JWIA 4ND8B 4TQ9A 1FMJA 1GTRA 2CD7A 2G0NA 3I92A 3WFIA 3U5ZB 2IOFK 5AM5A 3QWIA 1UOOA 2PUCA 1XTPA 2Z58A 4YLEA 2W2PA 1DIRA 2D62A 3FNRA 2W0MA 3I1YA 4G1FA 1QE5A 4GYYA 2IP2A 5AK5A 3ETHA 3BF8A 5E9AA 2CY0A 4AZTA 4G1BA 3UJCA 1KJ8A 5LBIA 1DWOA 1JGTA 4UEWA 5KYUA 4KO2S 2DBRA 1GZ6A 3EXEA 3L2OB 1WDMA 2HRCA 2D7JA 1XFDA 3OETA 3PHLA 3Q7RA 1TU4A 3L4BC 1R5JA 5SY9A 3GZNA 4MPTA 3WA6A 1QH8B 3BX1A 3OX1A 2UYGA 1EK6A 1KOLA 3PQ3A 5LQKA 1W88A 3UANA 2HEGA 5FNVB 4ILKA 4URZR 1LPBB 3H18A 3KJIA 1E1QA 4Q6WA 4EX7A 1XEFA 1D8AA 4HX9A 4YCMA 5EQDA 1XIVA 5ELLA 3QY0A 2EXXA 4BBAA 3QVWA 2E4AA 4X0EA 3NEAA 1JYFA 1MTZA 1ZK1A 2NZJA 1T29A 2Y9MB 3W9UA 4IX1A 4FXOA 4Q48A 2MCFA 3T06B 4ACAA 2C96A 2HT6A 4US0R 5FYQA 3MD0A 4CKYA 4M1TA 4RJTA 5DWQA 1THMA 1FYWA 4AP9A 2AI1A 3TQQA 1TYZA 4RM3A 4LBVA 4JI0B 4UBIA 1MQ8B 5BW8A 4AUKA 1S2LA 2RGYA 1RZUA 4KDRA 4ZO9A 3DZDA 1NOIA 3AB7A 3ROGA 1RKUA 1N32B 1NVGA 4LMBA 2R86A 3K9NA 3OG9A 4GR4A 2CGEA 3JALB 3C4QA 4OUDA 3RNOA 3VTFA 5AUOB 4K26A 1VHQA 2XYRA 4R9NA 2ECKA 5JI2E 3U61B 4X54A 4IKEA 2JAQA 1S2MA 2CL6X 3SQXA 5E2IA 1NUHA 1JKMA 2I3DA 3MG9A 3NRJA 1IWBB 5KOHB 1U5CA 2VSNA 2FZVA 3GLVA 3ORSA 4HAZA 1WPRA 1G21B 4U8HA 5IBQA 2O2DA 2PKQP 4O0MA 1PKXA 4XB2A 1Q1AA 2VTDA 3RR2A 1O94D 4I9HA 5C37A 4FOPA 1M1ZA 5LNK1 1DSSG 3E7PA 4HQLA 3A9RA 3EAFA 1PJ3A 3I0MA 1BDMA 4FWBA 4BRUA 2RGRA 2ZVJA 5E4FA 4BBPA 1U81A 4RGYA 3ZY4A 4RV9A 1PBNA 2R47A 5EVCA 5JUWA 2BCGY 1SU6A 2QKYA 4IRUB 1B0ZA 3NQ41 3CRRA 2IPXA 1N8NA 4WY2A 1KK3A 5TB5A 3C4VA 1GYQA 3R6LA 3OM8A 4CN9A 2VDWB 1DMSA 4S2UA 1XVLA 2F43A 1QIDA 1DC5A 5FWDA 3DB1A 5HF8A 2EFCB 3PC3A 2VTKA 5LQJA 1CTQA 2CHVA 4IIJA 3ZZ0A 5HCIA 1VSVA 2MR6A 3AR7A 4HXGA 4WCFC 4CDMA 1A5ZA 3NT2A 1NSYA 2ZP1A 3KTAA 2R00C 1O97D 2NO4A 1EUDA 2X5KO 1THTA 4BECA 1DIGA 4XPZA 1GNVA 1XTBA 3KJGA 5C52B 3A9SA 3HKBA 5JDCC 4CGYA 4LCBA 3UJBA 3W6ZA 4JXKA 2O8NA 1UM9B 4YRKA 4HZIA 2CDAA 1GPDG 1HRDA 1PNOA 5KMGB 1SKMA 2BV3A 3CKMA 2HQ1A 4D5GA 3NUQA 1YCGA 4AJOA 4BO2A 5I7FA 1NP6A 4O08A 1E18A 2CFOA 3DMTA 4BB5A 1F3OA 3O8RA 2P11A 1D2AA 2JF0A 1RHJA 3PUHA 3UN1A 2BSQA 2ZB2A 1GA4A 3SNHA 2W6JD 3AUKA 4D9EA 1ORIA 2ZJAA 2VRBA 2IZOA 3OT1B 1MBZA 3TZ6A 3MMPA 4HUTA 3LF2A 3N75A 4IIFA 4NICA 3RC8A 5A3JA 1JAIA 2PGXA 3AUXA 4Q1VA 1B1CA 1O6ZA 3O9MA 4IQ8A 2JAWA 1ZD4A 5FLXA 5DIFA 4MA5A 2BKVA 2RHOA 3RT1A 2GF9A 4C6HA 4F8JA 4LF4B 3U0BA 4ZMRA 3F47A 3KUUA 1DV1A 4RKEA 3TIXB 3V32A 4CQMA 4LV8B 4WZBA 1IZ8A 4M7OA 3T1QA 2CYAA 3A1NA 3CONA 4TTIA 1QR6A 4MWGA 3A6DA 4URVR 1U4SA 1O94C 4UPEA 1X14A 2UUBB 2O0HA 2R6JA 2O52A 3IJEB 1SUBA 3OBIA 1HLGA 4PSKA 1N7HA 1J9EA 5ALFA 4IDFA 2GFHA 3NBFA 5WRFA 2V3WA 2IH2A 2RH9B 1C30B 4R2KA 1C3OB 1TVCA 3ELBA 3HPRA 5EG5A 5FI5A 1WEKA 4HDMA 4G26A 3U31A 1GR0A 3G0IA 1PEAA 3OIUA 5JDIC 3AOGA 3ETGA 3LSYA 3QYJA 2C7OA 3MXTA 1XTSA 3H5LA 1TVKB 2Z3ZA 3AM3A 2RB5A 2FFBA 1IU9A 5KNBA 1D1TA 3I4CA 4UAUA 3V4PB 4BO8A 3D59A 3SHFA 3U1BA 1NQWA 1CEQA 4M8SA 5JPDA 2A5FA 2AKEA 4RPHA 1WCXA 2ADMA 3INGA 5HCUA 1A9QA 1IMJA 5KU1A 3OE7D 4QNNA 2CUNA 3PRYA 4GC5A 1OBFO 4R81A 5JNVA 2ZT6A 3KQPA 3L93A 4CLHA 2Q1WA 1JIKA 5J2UB 3MTQA 4XXHA 1M72A 1P45A 2PK3A 3DKVA 4A5OA 4R69A 2XT9A 4BNVA 5AHRA 1J8MF 5IT0A 4KHPB 4FGUA 1GGFA 3ES9A 3D3NA 5JNSA 2VG8A 1FZQA 3NNDA 5J1SB 4JJKA 3UJ8A 3JQEA 4P3OA 1Z63A 1CQPA 2C2WA 4C7VA 1JEEA 3EGDA 3H1TA 3NDPA 4HQFA 4KEAA 5JH7F 4HJRA 4CKCA 4EGCB 2X6TA 5HEKA 1JFLA 4KFRA 2I34A 3C8UA 4MVJI 4P0TA 4GMFA 3RVMA 1WQ4A 2QSYA 3D6UA 1A1VA 5KNCA 2CHFA 1O57A 1S8FA 1Y7LA 2AFHB 2NUPA 5FLKA 2L42A 4IM7A 2Q1SA 2R25B 2AD1A 4DUYB 4FMBB 4LHVA 3P5BA 2SKDA 4BCBA 1H8HD 2NPIA 3H4VA 5LZ5A 5F64A 3LVBA 1IXYA 4PAWA 2VNSA 5KHAA 1L7QA 3VYRB 5BNIA 1T5BA 2FF5A 1ZJ5A 2C04A 1US8B 3BJMA 4N01A 4RM2A 5ESDA 4GEGA 3GRPA 4O3MA 2GSDA 1PL8A 5F21A 4BVKA 1KRXA 4LK3A 3LIIA 4IQ0A 4ENPA 1NMXA 3ZUPA 2O2IA 2ZSAA 3MN1A 1UWLA 1XPUA 2J0SA 1JPJA 5FOSA 4BE9A 5BV1A 1X80A 3HXOA 3V8PA 1YR3A 1JFFB 2VRCA 3HA7A 1DEKA 4LHZA 3SMQA 1LK7A 5B6JA 1PR0A 1Z3IX 2H7VA 1UJ4A 2LVBA 3G0OA 1LTQA 2GBLA 5B6PA 5DCLA 2HSWA 2APJA 1KEUA 4HVAA 3UXEA 1E9RA 1RADA 3B1YA 5BUSA 3J81k 5LP6F 1URPA 1KIFA 3VDMA 4A0FA 1J39A 3A1EA 1RZVA 5C8YA 5AOBA 2IX3A 4YECA 4RK4A 4PN3A 3A6LA 5CXQA 4R2XA 2OAGA 5L3RA 2HDHA 4O4JA 1H5QA 3R9XA 4I2VA 4A6DA 1DQPA 1HETA 2BUCA 3NPMA 2K87A 2ZI4A 2W6NA 1MO2A 5EE0A 5C8ZA 1MRSA 1Y4DE 3NZEA 1XQYA 3AGPA 4KVAA 4WXMA 1A9ZA 4CMKA 4CG1A 2BSXA 4YJ3A 1U3TA 4BO7A 1G5IA 4AKHA 1ZVQA 1WDWB 2AW3A 4J16A 4O4LB 4YFYA 4MW9A 3JPYA 2W2KB 3CUUA 1AZTA 1K8ZB 4U2BA 1YIOA 3WB9A 4C08A 4LG1A 2BHTA 1C1HA 4ROTA 3ABZA 3KLMX 2Y77A 2Y68A 2J8ZA 3L06A 4LKOA 1PR1A 4P2GA 3RAEC 2IU6A 1FXWF 1G8JA 4FQ5A 4X64B 1SXHA 5F98A 3NTVA 3TTXA 5GVRA 1KAGA 3NEPX 3VR2A 3ITEA 2X5NA 2ZWVA 4NV0A 4D8VA 4XUEA 3TX6A 4MV0A 1MV5A 2C2XA 3GDHA 1BEUB 2XJ4A 3N2KB 4L08A 3CKLA 4HGOA 1ADCA 3Q40A 1ODSA 4KI0A 4CIBA 3GJ0A 1NASA 2I8LA 2GCNA 3P4UA 3W4IA 3UMYA 4PBTA 3CRQA 2B8TA 3G79A 3QIVA 4DIBA 3DTTA 4BX2A 5FO1A 1AGRA 2TMKA 5DLPA 4EB3A 4MARA 4X93A 5KQMA 3NRBA 4QG7A 2KWIA 2VDRB 1Z0FA 2X2OA 3FTQA 1QNLA 1SG0A 3EEYA 1VB3A 3H1AA 4IV5A 2WJAA 1M8PA 4ZICA 1HKUA 3GOHA 3GT4A 3HSSA 3MFQA 4US2R 1JJFA 3WK4A 1UP4A 3ZLVA 3AHIA 4BLTA 3L7MA 1SIUA 1YK1A 2I6GA 1QORA 2YMQA 2YYSA 4JLOA 1YVRA 1GDTA 1J2RA 4NZ9A 1K5PA 1T1IA 2ZBGA 4J07A 2CHGA 2PVSA 4UEJA 2WYUA 5M7EA 5FNZA 2GN4A 1XL1A 2VHYA 2V4UA 4PRZA 2CKDA 2CNKA 1IG0A 4G41A 1M34A 2QGZA 4K05A 1YV9A 4EFKA 4UTNA 5HKOA 3DDHA 2XGSA 5JAPA 2JLWA 3WQQA 3MMXA 5E8JA 1UBHS 2FZ5A 1YUNA 4PLWA 1P62B 4ARZB 1ZL2A 1G5RA 2BVNA 2SNIE 3ND8A 3CJRA 4FYHA 3WS7A 1LTHR 3EXG1 1U7TA 5LN1A 2D5IA 3LK7A 3A1DA 1H2RS 2GHIA 3AHCA 1U0GA 4HB3A 4MR8B 4WXEA 1QDLB 3GRCA 3BRWD 2AMVA 5DNCA 5CLIA 2B7CA 4DJDC 4RHUA 4BB6A 2J30A 1XK6A 3B8HA 4YRJA 4Z4FA 3F3YA 4P54A 3RUEA 1ULAA 4FN4A 1DE0A 1D9XA 4RVOA 3UMFA 1H3NA 4MUEA 2Q9AA 3ZHYA 1JH9A 2PFKA 3AEYA 3WGTA 1R6BX 3VU0A 2XRMA 2MSCB 2AOXA 2E0IA 1UBJS 5LC1A 1KTIA 1YZ3A 4BVLA 1ST3A 2Z08A 3GBPA 1W19A 2B83A 2X1VA 2ON6A 1DUIA 3Q15C 4J0GA 2HD4A 4ZTBA 4AMZA 2JLAA 4DTIA 2Y76A 4D0NA 2OSVA 2GAOA 4RTMA 1RWKA 3MUOA 3M34A 3RLFA 1JBKA 3KLOA 4HS4A 5JIBA 3UAYA 1DADA 1PKEA 3OKCA 3CPJB 4PYIA 5BO5A 5I9SA 1I51A 3LUPA 1GYRA 2J45A 1PJ2A 5ILOA 1SCUB 3UT5B 1ECPA 2BEVB 1QG4A 2GFQA 1T3ZA 1KS2A 2IXTA 3ADOA 3BD9A 1LX6A 3MJCA 4R83A 1JB9A 3U6BA 1RBMA 4GX1A 4IRMA 4Q7MB 5JYEA 4N3NA 3OKPA 1E1CB 5ALPA 1GEEA 4LNUB 4X95A 2XYVA 2A7QA 3CSDA 1KMHA 1IHYA 2XE7A 4J0QA 4UU8A 4C06A 4HFNA 4XWAA 2ZUVA 5LB4A 3TLKA 1IATA 5ITZB 4AROA 4O8ZA 1TUBB 4DCUA 1YJCA 3QJGA 4YS6A 4ZYVA 3GD5A 4HWPA 1CDZA 1YFKA 1O6BA 1GQQA 1OI7A 1VLVA 1XKXA 3FAKA 2FETA 5K3OA 1Z07A 3H6KA 3STXA 1W0JD 4RPGA 4C1BA 5CAEA 4KE9A 1GUFA 5EQTA 1GUZA 3O83A 3SC6A 2GYYA 1IRXA 1ZEJA 2XHEA 3O0DA 4G25A 4HLNA 5DU2A 5DTIA 4PIVA 1UJBA 2VZ0A 4AKSA 2H5IA 2C4HA 2VXBA 3O4FA 1G1AA 5TEWA 3IR6A 1G5PA 1YB2A 4AKGA 3H86A 1OV4A 1NDHA 3DHNA 4M8LA 5GGYA 3V8EA 2VHCA 4UVEA 5AWFC 1GLVA 4ZARA 3S1AA 4D5EA 3AR9A 5JBIA 1QC5A 1A2KC 3HK2A 1B8PA 5HDQA 2N42A 3RDPA 1YB7A 3DOHA 4Y1EA 4NXMB 3B38A 1L7MA 3F74A 2OAEA 3OCYA 4PSDA 3A14A 4R54A 3IVAA 4MMXB 5IJXA 4JHXA 1HFKA 1H6CA 1L5HA 2JHPA 1XFAA 2WNIA 3HNOA 4CTKA 2C2KA 4NZYA 1WA5A 5B1EA 2UXCB 2QRVB 2XA9A 3OQHA 3KLBA 2UYCA 3R4CA 4UNNA 1L6IA 5DRTA 3U9LA 3VC1A 5BW4A 2V6MA 5EJ5A 1E5TA 1FRQA 1RHUA 4RXMA 4R31A 4O63O 1TK3A 4BKRA 4CMIB 3O8NA 1Q7TA 2NU8B 1U8UA 4FEYA 4KSYA 5K3BA 1PO7A 2NU7B 2YKGA 5DK4A 2VJOA 2YWXA 3KPWA 3L7JA 4WNAB 4B71A 4OXRA 4KLCA 2BZSA 4AF8A 1HZZC 3HBLA 3TD6A 3EXHB 2P5SA 3RTGA 2O05A 2FRVA 3IAM6 5EJ9A 3COJA 2DAPA 3HSKA 1A95A 2FGJA 5FPKA 1EWVA 3GJSA 3N87A 2FOIA 1QPZA 4D56A 5KU7A 1NTRA 2E37A 4OAPA 3DHEA 3IAS1 4MUBA 4ZYWA 2C00A 4Q00A 2FPGB 1Q1BA 3AR8A 4YJ2F 3RSQA 3DWGA 3CSUA 1GM5A 5DO9A 1X7WA 4NENB 5CNIA 1GWNA 2JCBA 1LI7A 2FWRA 4N7BA 2O7QA 3E7DA 4LY3A 2RARA 3TYXA 3OP1A 4UVGA 5DI3B 1ZM9A 2QX6A 2Q46A 2V8BA 4EEKA 4NV1A 1Y1SA 4DR1B 5AM0A 1VG9B 3BMCB 1ELOA 1BMFD 5ERGB 4ZEVA 2EJBA 1D6NA 5IX8A 3PA8A 2NQ8A 5JMPA 4B2YA 3GJXC 4DCNA 3B5IA 3FYUB 3VUFA 4NU8X 1XLUA 1D1QA 1M6VA 1VYUA 2CXQA 4GOMD 1K98A 2XWQA 4YAJA 5E7JA 4DNXA 2HX1A 4OBBA 3RRNA 3ADKA 3FLAA 5IAGA 4CT4B 3UJAA 2P0YA 4LNAA 2WU4A 3EZFA 4FJ0A 2BDEA 4I6EA 5AJUA 4PYMA 3A4NA 2YBEA 2IIQA 3GQBA 1RI5A 1SURA 2JH3A 2ZYAA 3DEJA 3DDSA 3M6LA 2HBQA 4XM2A 5TQ2B 2MDTA 3P0EA 2IEIA 3SG0A 3RUAA 1OASA 1PR5A 4M98A 2FN3A 4U02A 4KGDA 2QLNA 1MKYA 5E0OA 1KMCA 1PTJA 1DC8A 1PQYA 1W6UA 2QUAA 3EH2A 3G8YA 3L7YA 4HDKB 3I2HA 1JBEA 2QW8A 5EFOA 5GGXA 2WIJA 4JKYA 5A03A 1DBWA 5KPDA 3ZJUA 2EFGA 4JB2A 3PFCA 4H6WA 2DWQA 2QLBA 3IIJA 4PNPA 2RFLA 3I0NA 4J1SA 3QLVA 3E2PA 4JKOA 1Y6ZA 2R9VA 3O8LA 2YCBA 1W75A 4I4TA 2X4LA 2CNBA 5LA6B 1L7DA 1KRWA 4DIOA 3HJBA 4EHJA 1MW9X 3E82A 1BC5A 5EA2A 3ZPXA 1SO8A 4ZHQF 4AMVA 1USIA 4K03A 1PK9A 1OLUA 2Z3WA 3OD1A 4JX9A 3LPMA 2Q2OA 4LDQA 1C4OA 2ETVA 3QEMA 4GMGA 3TL2A 4E46A 5LDDC 1QYDA 3FCSB 1JSXA 3M6FA 1R12A 1VKNA 4DW8A 4TPKA 4E7OA 4H2DA 5CEFA 2IZZA 4DLKA 4H4CA 4Z1MD 1B26A 2C61A 1CY0A 3D7RA 4G4SO 4BMOB 3QMWA 3NTUA 3RBAA 1GKUB 5C5EA 1NRJB 1WIWA 2X8AA 2YV2A 4ETNA 2DUWA 1YCDA 2G9UA 2PGOA 1D2HA 2F90A 2VYND 4HDNB 5EJ7A 1YJ8A 2CZQA 2VCHA 1J0BA 1FNSA 2QJRA 3UK2A 4GM4A 5LZ9A 1REQB 3U7QA 3NRCA 1T9GS 1VM6A 1EFDN 1OH7A 1GRRA 3KZOA 2AVNA 1B0PA 1ML3A 2HZ7A 1EFVA 3L0YA 4AYTA 5JZBA 2WHQA 4O29A 5DOVA 3FDXA 3JQ8B 4OA8A 4AW9A 2OHVA 4M9CA 5EESA 4YAOA 3TDNA 1IM2A 4PAGA 2I8AA 2WKPA 4X3CA 3W9YA 3N5KA 2CFCA 3BAZA 1YWGO 3QPWA 4ENVA 2JA1A 1N2HA 5GTDA 2PYDA 4QHYA 2RGUA 2MSLA 1KDVA 2JFHA 4MO9A 4DQXA 5BQFA 3EH1A 2BFMA 4MUHA 3S5JA 3UV3A 4DYHA 2F6RA 5KSWB 5LYJB 2JZCA 2ZI7A 3DT6A 3F5DA 2ZRLA 2I1LA 2IYRA 3FZGA 1V8BA 4OUKX 4KK4A 4HX5A 2O9JA 1FFWA 3K8YA 1PQUA 1RRVA 1X1QA 2QYSA 1E3QA 2XMGA 5DHTA 4PC1A 1OWNA 4PF1A 2WT9A 2WR8A 2YHSA 3LZDA 4PTYA 3TPZA 2D6FA 3AGQA 3DDCA 3ZWNA 4ZAYA 4UQLA 5BN5B 1TQ6A 3JQFA 5TY0A 3VV2A 2AW5A 1JPVA 3UCFA 5IPFA 4EYEA 4IDHA 1RJEA 4AS1A 3NAQA 1C4XA 4NOJA 4QGHA 3EGIA 2FUEA 1YJBA 2PX5A 3WNZA 1IY0A 2XD4A 4UXIA 1OWLA 1XXHB 4BO5A 6REQA 1M0SA 2EZ8A 4BNUA 4RADA 1VYVA 5IH7A 5JFOA 3DZIA 5EZQA 3TTUA 5CM2Z 2R1VA 4DCSA 1K2VN 1OROA 1X0VA 2NO6A 2ZT5A 4CRWB 4UBLA 1NW7A 4BQNA 3DYVA 2ZCVA 1XPOA 3EQ6A 2UU9B 2JS7A 4OL0A 1QR2A 3MJHA 4P5PA 3NONA 4N8EA 5KKCA 2C5EA 1F51E 2HF7A 2KS6A 5JC8A 4LF6B 2B0CA 3LLCA 3R7AA 1Z0JA 1ZU4A 2ATCA 1XTRA 4HDCA 2Y71A 4QXPA 2ZAMA 2VF4X 3L0CA 4R40A 4I7EA 1Q0SA 1E64A 4YRLA 1DHTA 3CIFA 5KAPA 2FEOA 1T9BA 2JL1A 2J4CA 2IL1A 3AILA 5IUNC 1NQAO 4U9HS 3L79A 3W8DA 4KQKA 1ST2A 2HUPA 2YZ2A 5JCJD 2G5TA 2ONYA 1QB8A 2WQ7A 1L7VC 5JSZA 2B4QA 3TVTA 4O1IA 1GCAA 2VH1A 2ZAGA 1E3SA 1WXWA 4BQRA 2NYAA 4NARA 1RPTA 3M2PA 2ZPUA 1SBNE 1UAGA 3DH0A 4NBSA 4W9MC 4OHBA 5GIPE 5DGTA 3C3PA 3L6BA 3WRYC 2HREA 2ZJFA 5ALEA 3RS7A 3L8GA 3RWMB 4CIWA 3CUTA 4FGKA 3FKQA 4QSHA 4DG9A 3JWGA 3IJRA 2XKKA 4JJ8A 3QEBZ 3OTQA 2A92A 4BGVA 2P3SA 2PD4A 1VI2A 2OZLA 5C3MA 1HNXB 4IIGA 4R6WA 2RAUA 5A02A 3ET4A 1ADGA 2PRIA 2WFMA 3SBEA 2A5LA 1EFPB 4J94A 5KHLB 4H3VA 3BPSA 4QGBA 1N6PA 5ISMA 1EM8B 1YI8A 1SIBE 3AHEA 1XV5A 3K31A 3PGJA 1FQJA 1O58A 4K5QA 5IEBA 4CUKA 3QLJA 3ZJYA 4G8JA 5YASA 4MVJM 5DB4A 5DHUA 5AM1A 4FINA 4ISBA 2BE9A 3LUKA 1R9MA 1B6SA 4KXFB 5DBGA 3PNQA 1XLWA 3QUTA 1E0DA 2BMFA 2VK8A 5C46F 3EZ7A 4YMWA 1SXJE 3AJ9A 5DMXA 4I50F 1WB5A 3D7SA 4R2JA 2ZBUA 3NCHA 4P35A 3RYFA 3C8DA 4ZGGA 4L9WA 3K4HA 1C2YA 4BNFA 1N34B 1UKEA 2CYCA 4Y2SA 1KMQA 1XNJA 1QFZA 2YXDA 1YB1A 4HWTA 1GJRA 4S1VA 5JNWA 5KX5F 1GAWA 1NN3A 3M2TA 4MS1B 4U9IS 2RHDA 2PR7A 4I3HA 2UXDB 4QGAA 3MUNA 5I45A 1SBTA 5CLHA 4EAAA 4KPEC 2Z4RA 3OJLA 1O9BA 1XTZA 3RAFC 2TRSB 4R3WA 1QM5A 4HDRB 3SQOA 1OTHA 4RJIA 2ZYVX 1X9GA 2VOEA 3VMMA 4INAA 2X22A 3LF1A 4DQKA 4I1YA 3AR4A 3NTRA 3O38A 4UM9B 13PKA 1LLUA 1LBHA 4WIAA 1I0ZA 2IDJA 3TZEA 1G5QA 4PZYA 1SQGA 1RRGA 4MRMA 1A4IA 4BV2A 2BI4A 2NADA 3CS3A 4CV1A 3EXHC 4J76A 1VE3A 4MB2A 2IUTA 2OD7A 1DX9A 2NT4A 3ZXSA 4J6EA 2P7IA 3H5OA 2RGWA 1QIEA 1TKRA 1NATA 4MLZA 5ARBA 5KQRA 3EVAA 1XCLA 4L72A 4ALIA 1PJRA 5JXHA 3D4IA 4N39A 4WZZA 3W06A 5C1OA 3SC2A 1EZ1A 2YY5A 1UBSB 2AE1A 2ANCA 4R3NA 1NUQA 1CK4A 3KKOA 2MT9A 3BK1A 3EB9A 5FCDA 3WKAA 4EG0A 3ASZA 3D3WA 3AFMA 2WYIA 4BXOB 3IUJA 1UR5A 3KOUA 2GKOA 3NB0A 1NLMA 3WL4A 1IYZA 2BFBB 2JLVA 4GRIA 3W3AH 1OB2A 3FYUC 2XZLA 3T9CA 4X65B 1XKLA 2XMPA 2ODWA 4R1QA 2OA0A 1T2NA 2V9ZA 3H19A 4K2HA 4KQXA 3KQHA 1KAEA 1OXUA 1JDBB 2OSBA 1Z2NX 2WVJA 2X8LA 3AU8A 4PLVA 5AI9A 5A5FA 4F8YA 2DBQA 4L1KA 5FH9A 3SDBA 3P5SA 5EPUA 2HWYA 3F97A 3UC5A 4EVRA 3OY7A 2HIHA 5LLSA 1L5QA 1DXOA 3LQQA 1V96A 5CH8A 3EG9B 4YTEA 4AJHA 2BDUA 3CO5A 3CXRA 2EP7A 2Q5EA 3FSGA 2EJCA 3OQ6A 5FXMA 4MQLA 4JL6A 5BQXA 4TZ0A 3QVSA 1Z06A 1H1LB 2RBGA 3VV3A 2QD5A 2ZETA 1M76A 3C5HA 4BOYA 3H4TA 3QKWA 2I6SA 5EPOA 2X9QA 2IXBA 3H2IA 2HU5A 4RULA 2WV9A 3BHIA 4EY4A 3N8NA 1IZ7A 3FOZA 3A6FA 4MDEA 1EJ2A 2RKWA 1R7RA 3L0DA 3QHQA 4KXMA 1NVKA 2ZJ3A 3MGBA 2FG6C 4R0NA 5AESA 1KAQA 5BMVF 3WYEA 1N9KA 3ZZ1A 2AC2A 3ZI4A 4EJ6A 1GAXA 1X7ZA 2R0QC 3ICEA 3AY6A 5J4YA 4ZT3A 1G5TA 2CL0X 2HU8A 2MINB 1SIOA 4MCAA 3MWEA 4JZKA 2O5RA 2RHGB 2KLHA 4BAGA 1FW6A 3JAWB 3TIIA 3AFHA 3SC3A 4KXUA 1QLHA 1MH9A 2IPAB 3IEKA 1EA7A 5FKJA 1DV2A 4L8VA 2VHZA 4M7RA 3FVTA 1VMEA 3HVIA 4WADA 3NWEA 1O96B 2IQ5A 3IP7A 4FE4A 4FUQA 1XJ0A 2FR8A 4NMWA 4ZAXA 3VVMA 5B4VA 5K03A 1BRTA 3HJFA 3CUKA 1R4NB 2G0TA 2ZYGA 4CM3A 3OOJA 2R6ZA 3A37A 2ISQA 5IARA 1CJBA 3WZMA 1E3WA 3MOIA 4JSTA 4D9FA 5HYVA 1HM5A 5DPMA 5CDTA 1FE8A 2OV2A 2DPGA 3JAKB 4RHEA 2QRNA 2WMNB 3CM0A 4E5MA 5C7YA 4WEOA 1MZPA 2WTNA 1ZI8A 3HR4A 4MQ6A 5IVHA 4P4TA 1DL5A 3I2GA 1KNXA 5FTWA 1C0KA 1O3YA 2EFEB 3CN9A 3OO1A 3TUZC 2A4KA 1G1MA 4K9LA 4AIRA 4KR0A 4MGKR 4E30A 3OOYA 2OTCA 4L5JA 2C9YA 1ZXXA 2QRHA 4G97A 3P27A 1LVHA 4RDXA 2C5SA 4IDNA 4PX5A 3SS9X 1ZRHA 2HMSA 2HRZA 4L3VA 1I01A 5LXTB 2ZJOA 2JI8A 1O54A 5KTYA 3LM8A 1IN8A 2C5GA 3O2SB 1A4XA 4LPKA 1MXHA 5FTKA 2NTJA 4JI2B 3HVKA 1ZI6A 3P0HA 3W2IA 2W8ZA 2ZIGA 4QU0A 3H2GA 4U9UA 2OGZA 2CUTA 5LBTA 4J9VA 5DCUA 4DG5A 5BN3A 4C2UA 2ET6A 1PR3A 3ECAA 1G16A 1GARA 3PGXA 5IM5A 1UPXA 2OCIA 1YHYA 3GYGA 1IY1A 2BFDA 3FCEA 2GN8A 4QARA 5G2OA 5LLDA 1PQPA 2EOAA 2OORA 3Q8MA 1PWHA 1CR6A 3UFXB 4EMUA 5B7QA 1BDJA 4DNFA 4WD3A 1NVUQ 2O23A 2W2MA 3FY4A 1NN5A 3DW1X 2JZNA 1VJCA 3G9QA 4JX8A 2GK6A 5E6RA 3CG0A 3EG5A 2PL9A 1JIQA 1QAOA 3VC7A 4ALMA 3KZ1E 4C0LA 2IOQA 3V2GA 5A9RA 2C2BA 3GRYA 5ALTA 4AF6A 1DRKA 3ORFA 4NZOA 6AT1A 3TF5A 4MV5A 4IJKA 2ESRA 2GGSA 2XMQA 2O07A 1RJWA 4GZLA 4FIZA 5BWNA 2QSJA 1PT5A 1N0IA 1KY4A 2IHNA 2P67A 3K71B 5EXTA 2II6A 3KXPA 1P8AA 1K3UB 2LE0A 3CLTD 3ICOA 3K9QO 4LRYA 4M21A 4UM9D 4DIEA 5HIMA 4DQLA 2DHDA 4FK8A 2J9RA 3S3TA 3WQRA 4D8XA 5ED4A 3E8SA 1V7QA 5LMNB 3QOYA 1XQWA 2J9FA 4LEIA 3I39X 5LOVB 1MG5A 4B3BA 3C3CA 4YMGA 4ZRMA 4XWWA 3IUBA 1XHLA 5JVDB 1R6XA 4U39A 5ENZA 4EQ6B 3E3MA 3RNLA 2OC4A 3OF5A 1OJLA 3PE3A 4M54A 4YRQA 2Z2JA 1NSFA 3I2IA 4MLCA 1JG4A 3FFWA 3MWDA 2PNJA 4BPBA 1MOZA 2WE8A 1UJ5A 2XODA 4QPJC 2L17A 4MR9A 1UMBB 1VCHA 4UZEA 5DHRA 4JLUA 1PT7A 1X70A 1NULA 1PQ4A 4RVGA 5TQ0B 3VHXB 4B6EA 1E62A 3OM9A 1N5IA 5KB3A 2Y1FA 1XMXA 3O6VA 3T9FA 4EY7A 1R0RE 2GB4A 2EZUA 1EH5A 1PUJA 3II6X 1S8NA 3HEAA 4CI9A 2C84A 3TXAA 4M99A 1LF5A 2CLHB 4RLHA 1LZKA 5DWDA 4ZJYA 5KQLA 1N36B 1AZWA 3IIMA 2DR0A 2YBDA 4IFTA 2H85A 2ISCA 2JFGA 5KEIA 1ZRMA 5LQRA 2O7RA 5AI4A 2XYPA 4TKLA 3WGHA 3LDUA 5KWIA 5FF9A 4CM5A 4WECA 2VYVD 1LEHA 5KNDA 4WXPA 1P72A 4MI3A 1X87A 3CW2A 1C1XA 1QHFA 4FX5A 3NHPA 4CXMA 3I45A 3HBMA 4TT3A 5EUMA 3CNQS 3GAMA 1TAQA 1FDVA 4ZVVA 1M75A 3BSWA 1W2WB 4PGAA 3RAJA 5AW8A 1WVIA 3I9KA 4QDTA 1QCYA 1JXAA 5FNVF 5GONB 1JHRA 1U11A 1HT0A 1JFVA 2GPSA 2YOGA 3F96A 3HR8A 2HRBA 2JIDA 3H3JA 4DQ0A 1CRPA 4I1IA 4F4DA 2E6KA 1DAFA 2PLAA 3OMLA 4J0CA 2ZYIA 4JWTA 5LIPA 2BM1A 1G8SA 2AN4A 3EPRA 1U7UA 3B6IA 3BFPA 4DBZA 3ZX4A 8ATCA 4MQ5A 5JBQA 3B9PA 4J0DA 1ZCJA 3D4BA 3ITKA 5TF4A 4FT4A 2A30A 4OB7A 3S2EA 4BX8A 1TZJA 3SF8A 3NJ8A 2JGAA 5ICEA 3AR6A 2ROQA 2YQ4A 3UXHA 4HNSA 4NDNE 4CMAA 3OJFA 2VPXA 1HI9A 3OJOA 4MPPA 5HQJA 4YREA 1RRPA 1LX7A 3F49S 2W8BB 3AEQB 3DAYA 1CEEA 3UJ3X 1MJGA 4BNZA 2BM9A 1DKRA 1XCMA 1DTEA 1MRZA 1R8SA 2G1AA 3K0CA 3IOMA 1TF2A 1HEIA 1Q0LA 3NAZA 2R87A 1T8UA 4HB0A 1RRMA 2BR3A 4KX3A 2ODPA 4YMSA 1UL1X 2HF8A 3DBHA 4EB6A 4QIHA 2JJ8A 2WKWA 3I28A 4LI0A 4DSTA 1AQ6A 1MGOA 3QE9Y 4NZNA 4IR7A 1CZOA 1CS0B 3VO1A 2C2GA 2H6EA 4I66A 4WASA 2XUHA 2DZDA 4GQAA 5FYDA 3TCKA 3A1WA 4EHAA 1TKAA 1VPWA 3D8SA 4K88A 2YWFA 3PGMA 2YIJA 4WOJA 3AF6A 2WJ6A 1L5NA 1YNOA 1OX4B 5TMPA 4X85A 3DQQA 3CBQA 4Y6SA 5CFNA 4WXHA 5IULC 4PYQA 3K4PA 2VI5A 1AHPA 5G41A 3EIFA 3BE6A 1NAIA 1C5KA 1X8LA 1XN1A 2Y3IA 3FI9A 3HCPA 2LIPA 3OHSX 3PC8A 4YUZA 1DNPA 1YZGA 4NECA 3WB1A 4F7WA 1BX3A 1II9A 3M1AA 5GV7A 4HYTA 1KGSA 3LY8A 1RBQA 5IF9A 2ZTUA 4BV3A 3K32A 4G9BA 4EG6A 3FCYA 4RESA 1WXFA 4CIAA 4AQ7A 1SHKA 1K7YA 5E9QA 3PG5A 4Q9KA 3ESYA 4AC9A 3AXTA 2HHLA 3JU3A 4KJZA 2G63A 1QJCA 1VKJA 5DDIP 1XJ5A 5BUCA 4PLTA 3OJXA 1ARZA 4FCTA 3VYWA 5MN5A 5EWMA 3CZPA 1J99A 3QENA 4GWLA 2C20A 1G8PA 5EOVA 1Z7EA 2Z57A 2ZBPA 3VKUA 1WZCA 3RYCA 1JNXX 2XOXA 2BFAA 2XT6A 3UBMA 4EJMA 1P1BA 4MVJD 2EFDB 3P9YA 1RI3A 4FFWA 1EKXA 1GT91 4FTWA 3TLGA 1I4EB 5KOJB 1F6BA 5B3JC 1LI4A 1Y1TA 2EEPA 3MINA 2FPPA 1Q3HA 3WWDA 2Q5CA 4U00A 2AC7A 3BK2A 1ZUD1 3KUXA 3TTSA 4B0PA 1KAHA 3AFGA 1GKIA 1WUJS 2CJFA 1HF3A 2IE0A 4LE0A 4MV8A 3ZBQA 4Z51A 3C1UA 2R751 2O1XA 2CJPA 2O3TA 1M1UA 3ZH2A 3C6KA 1GAQA 2IXGA 3E70C 2YS7A 3LXMA 4I19A 2SKEA 5E7QA 5I9TA 4BE4A 4HHEA 1RQNA 3H5TA 4QU9A 5FQOA 4QYXA 1G2IA 3M4JA 3SE7A 2FOLA 2Q1XA 1BEEA 2BEUB 3KNZA 3VAAA 4RELA 1SXJA 2WJVA 1YDFA 1FIUA 1WW3A 1B3RA 1V26A 1L4YA 1QVVA 2AA3A 4I9NA 2HTFA 2VK2A 3L4JA 1N8SA 3AUFA 3HDYA 4IP0A 4GNKA 4R01A 1WXEA 4IPTA 3CCFA 1CYDA 2VBIA 3UUWA 2DQKA 2G9QA 2QQ0A 3TOVA 1VJ1A 2BGKA 3TLYA 1L4MA 1ECFA 1CQJA 2ZJBA 4KGXA 4DRZA 2BELA 1DUSA 3L77A 2XPCA 4GWGA 4GPBA 2HXYA 1H4VB 2X7XA 4RPIA 5MF6A 2FEXA 4TQGA 1JDZA 4RAQA 4HVTA 2UYQA 2HH9A 5F77A 5CG1A 1JECA 2ZKLA 2X0IA 3OE4A 4MICA 3DLBA 4JKIA 1WSAA 1ZW1A 5G1OA 1C41A 1JG2A 1ZN7A 1WLSA 2I62A 3PDWA 4ROSA 5AK0A 3I23A 2OG2A 5BQPA 4ZI7A 1GNQA 3D5QA 3CNHA 3IQGX 1GA6A 3ZHZA 5AKXA 2R97A 3V1YA 3AG6A 2OV1A 1N6IA 5JAIA 3L84A 3CKKA 4XA8A 1NW5A 4J7CA 1IDOA 5J5AA 5IKXA 5A4MS 1MO6A 3FVWA 2Q8QA 1FU4A 3C8HA 1UXKA 3HKCB 5T6MA 3SJCA 4YT4A 1E5DA 1LQ2A 1Z75A 2HAEA 2VNIA 5AMXA 5AW0A 1QONA 3CH6A 2G04A 2Z2YA 4ZI5A 4B7CA 1QB7A 4Z9XA 3ZWOA 5JAHA 4H1UA 2CCKA 1D8TA 1W5EA 1Z28A 1RHMA 1MC5A 2I6FA 5T4EA 5LZ2A 1Y82A 2FXIA 2J31A 3TIGA 1Q6YA 4G1MB 5CD9A 2BUAA 5JMTA 4WESA 4H1TA 1FFHA 3S27A 1ZSVA 3TAXA 1Y8ZA 4YMTA 1Q57A 1N4AA 5C5CA 4XKJA 3W2GA 4H08A 1YU9A 2V0GA 1ZK4A 5K45A 4J8PA 4BBZA 2Q4BA 5J2UF 2GASA 3L8MA 4ECAA 2ZSJA 3WB0A 3DXFA 3V2UA 1BQ4A 3FMPB 1EDOA 3P9SA 3H4IA 4RLSA 3K0FB 2YS6A 1SFRA 3MVEA 5TT1A 1QP4A 4QLAA 2XAAA 2A4MA 1LH0A 3T9EA 2A9VA 1DZ3A 4KYVA 1T0UA 1CZNA 2VJQA 4LOLA 3HRIA 1AE1A 3SS8A 1P18A 3H3FA 3P9ZA 4DANA 3UWSA 4YQYA 4E4TA 3DEZA 1USGA 3TKYA 1P4RA 1WW8A 4Z0NA 5T8KC 3BDVA 5HSGA 4MQBA 5AD1A 2YZKA 1BNCA 3BD7A 5AKGA 5BYKA 1NM5A 4CV3A 4JT8A 4LQLA 1BXZA 2VYFA 1OGJA 4A0SA 3RRYA 3TEJA