1QHNA

Chloramphenicol phosphotransferase from streptomyces venezuelae
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
178
structure length
178
Chain Sequence
MTTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKESIECAWAIAAHVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHLORAMPHENICOL PHOSPHOTRANSFERASE
publication title The Crystal Structures of Chloramphenicol Phosphotransferase Reveal a Novel Inactivation Mechanism
pubmed doi rcsb
molecule tags Transferase
total genus 53
structure length 178
sequence length 178
ec nomenclature ec 2.7.1.-:
pdb deposition date 1999-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07931 CPT Chloramphenicol phosphotransferase-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1qhnA00
2GDJA 4A15A 4DIDA 4GSYA 1P61B 4A2PA 3F0TA 2J3EA 3ZIAD 4P33A 4JLBA 1P75A 2OBNA 4MYUA 2AD5A 2X19A 3K9HA 1FQKA 5DYGA 5JZVA 1IY1A 3U4QB 1KI9A 1D9ZA 3UWKA 1KSFX 1KHTA 2FPMA 3CM0A 3QPWA 1A5TA 4ZDWA 3THXA 2NO0A 3SNHA 5JRJA 3SR0A 1GSIA 1SVIA 4LDJA 1VYTA 5BWMA 4M1OA 3SU8A 4M53A 2FNAA 4TLCA 3I1FA 1ZD9A 2O8BB 3AF0A 2BMFA 3H4MA 2XTMA 4Q9IA 4P4UA 1GRNA 4P4TA 4G1UC 1Q57A 4OI4A 2IW3A 2QSZA 4LV5B 4C7OB 4ITRC 3VX4A 4Q1EA 4X8HA 3A36A 4TLEA 1P2SA 3TIFA 1XRJA 3RLFA 1EGAA 1GUAA 3ZVNA 3U6BA 4GRAA 2BM0A 3CF6R 1KOFA 4R9UC 3SFZA 4QGAA 5JFGA 1WXQA 2GKSA 4CF7A 1Y63A 2OZEA 4JT4A 3AVOA 5FR1A 2OLJA 2KJQA 5DISB 3U3OA 1E2GA 4PO1A 1I4LD 4OQLA 3KJEA 3TH5A 1T5IA 5HCNA 3WMEA 5KPJA 1R0ZA 2V8OA 4Y0AA 2J45A 2R6AA 1R8SA 2YYZA 2YVUA 4IXMA 4Q4JB 3T15A 3REFA 5J4LA 1OFIA 4IKEA 2QP9X 3QQ5A 4QKQA 1D6JA 4PC7A 3TLXA 5J4HA 2J0VA 1E9AA 4LY6A 1N2CE 2E9SA 1P62B 4XD7D 4L15A 4BLPA 1G20E 2XSZA 4CEJA 2VP2A 4CEHB 3AEZA 5F9FA 2JIZD 4KYUA 1KMHB 1XD8A 1XXHA 4BFXA 4JYCA 3MFYA 2IHYA 1OH7A 2W0SA 3QPVA 1E9DA 2GZHA 1KYIA 4AIIA 1CR1A 2YKGA 1E2HA 4A2WA 3ZS9A 2WJGA 2REOA 3P1JA 3BIFA 3HU1A 3UK6A 2EFDB 5AUQA 1Z5ZA 5L8VA 4BFUA 4W5JA 2V1XA 2RCNA 5P21A 3RS7A 1QVRA 3TK1A 4KHZA 1SHZA 2EFGA 3PENA 2BMDA 1G8YA 1LS6A 1E32A 3LAWA 4B76A 1W4CA 1X8LA 2R6GA 4PSVA 4NPHA 1J2JA 4DLSA 1TUEA 4ASUD 1KJWA 3CH5A 4XSHA 4ACAA 1KZ7B 2QZ4A 5LD2C 2HLDA 3QBVA 5CDFE 3OFNA 4GI7A 4B34A 4HAWA 2C9OA 3KJGA 4LWZA 4WXRA 4EPTA 1G21E 4V02A 4Q1CA 2Z4SA 4MYHA 1Z0JA 2CEAA 2V6IA 3B60A 1YZKA 4MYCA 1SXJB 4BLOA 2DPXA 1N6HA 1S8FA 5L3SA 3MLEA 3K0FA 4TMTA 1UJ2A 3AF3A 1UEIA 1XJQA 2FJUA 2BJWA 1OXVA 2OLKA 2W6JA 3KKQA 3NBFA 3VNVA 3QEJA 3AH8A 4F91B 4B3GA 2W6ID 3H86A 4NH0A 3CRW1 4RD4A 1P7CA 4TSFD 4NTZA 2PMDA 3QENA 3TSZA 2C98A 4JYBA 1EFTA 1ANKA 4LJ4A 5BYKA 3TR0A 4HUQB 5DIFA 1CJMA 1US8A 2CVFA 2XAUA 4U00A 2H92A 3B1WA 4WZ6A 4PHFA 3BC1A 3PUZA 3SFVA 5A4JA 2W2VA 5CB6A 1NVXQ 2BEJA 2ZRDA 1XXHB 4B2IA 1G19A 5TB5A 4Q03A 2WWYA 3A37A 2J0SA 3VHXA 4Q1DA 4YDSA 2FFAA 2ZI9A 2VP6A 4NCIA 4PPNA 2RHMA 2WAYA 2ZYTX 2FX3A 4KFTA 5KSPA 4NDZA 2JEOA 2QRZA 4LJ9A 3AF1A 3RSOA 1P72A 2G3YA 1WB9A 3AP2A 1KNXA 3DM5A 4CYMA 4V0OA 1SVSA 4M9ZA 2QN6A 2OXCA 1DG1G 3I92A 3WBKA 2W2XA 1CR2A 1M7GA 1JXOA 4M22A 4RJLA 3RRZA 2BBOA 4S2EA 3L2OB 4QHTA 2BOVA 2P5TB 5UKDA 3U3RA 5EP2A 2GVDC 4L16A 4TL8A 2O8FB 1ZW6A 2GETA 4KBFA 1E1RA 1N5KA 3V4RA 1EG7A 1S9HA 2ZSAA 4TQ9A 5KOYA 3R8FA 2ZRHA 5KSOA 1LF5A 3H2YA 3ZJYA 3WYGA 3A4NA 2XXAA 1ZP6A 1PV4A 1EX7A 1YZUA 2CL6X 2F9LA 3LH5A 1NY5A 2QQEA 2JAQA 3T35A 2ZVPX 3AVPA 4WZAE 4O2RA 4IEIA 1ESMA 3AVTA 2HEIA 1YZQA 3CF2A 2C5LA 5E7IA 3K0CC 3IHWA 1ZNXA 1BMFA 3SBEA 5BN5A 3DL0A 5J4KA 4V0LA 2QSYA 4AWXA 3QBTA 5JBQA 1CJUC 5C4MA 3TSOA 5HE8A 4HATA 1NJFA 3SOPA 2A5DA 1VYVA 2P6NA 3CF0A 4DSNA 5DH9A 1T8TA 5GVRA 4C0BA 3TUZC 5SZIA 2LKDA 2JJ1A 2ZI4A 3KKMA 2FF7A 4F92B 1Z6GA 3LFUA 4YXWA 1JR6A 2BCGY 3CWZA 3B8HA 1JXMA 1N0VC 4US0R 1HE8B 1G5PA 1OFTA 1OLOA 4DEYA 3TW4A 4NCKA 2IYVA 5EXTA 1W4RA 3U3KA 4X8MA 2IUUA 5JHGB 4M9SA 4TMKA 3RYTC 1E0AA 3LLMA 1A1VA 2OCPA 1N6KA 4KSCA 3B1ZA 4PQFA 1KSJA 2R9VA 3I72A 2HT6A 4NCJA 3NEJA 1E9EA 4X8LA 1UADA 1Z29A 2WIBA 4BEBA 1VG1A 5JSZA 1P2VA 2P65A 2R6FA 1WE2A 2ZI6A 4OI1A 1E94E 1IXZA 3KUDA 2Z43A 3WNCA 4B2LA 3EZFA 4TN1A 2C2HA 2Q9CA 4AY2A 3KL4A 3NBXX 2GHIA 4GBMA 3BFKA 4ZO4A 4FINA 4HEJA 4JBYA 2IWRA 4QC2A 3EW9A 1II8A 1Q3TA 4JVSB 4Q7LA 5FUVA 1CRPA 5L3QB 1QHSA 1NN5A 3FYHA 4PPQA 5FFMA 2D3WA 4CRWB 4ZDJA 2NIPA 3CZQA 2FMXA 1L4YA 1E2FA 1XZPA 1CTQA 4AD8A 2GBLC 1LTQA 1F2UA 2AD1A 2QAGC 3WY9A 5F9HA 4UXJA 2ZRPA 2ZJ8A 4WW0A 1C1YA 3VNUA 2IS4A 1TQ6A 3IPXA 3DOEA 5CDFA 1OXTA 2PCLA 1NLFA 2ORIA 2VIIA 4DLUA 2QQ0A 1GG2A 1PLKA 2J7PD 4K81B 2F3TA 4D4KA 3RNLA 2GCOB 4G3XA 5DLQC 1NG9A 4O3MA 1G3UA 1F2TA 3EPLA 2MSCB 2OCYC 5BYJA 4B32A 3IIKA 1U98A 2B8TA 3OIVA 4OK5A 3G0HA 4GZMA 1SULA 4KFUA 1X86B 2WM9B 2ODEA 1FX0A 3HWSA 2HXSA 1FOEB 5FUYA 3KZ1E 4JVNA 4AYXA 1ZUIA 3DZ8A 2B92A 1OJLA 1E69A 2C04A 1GL7A 5IF9A 2Z0MA 2ORVA 1HQYE 4HDOB 1HV8A 1Z2AA 2CLSA 2VP9A 1QHNA 4LC1A 3KQHA 1Z6YA 3EIQA 5B2ZA 5AR1A 1HT1E 1R0YA 1HEIA 4OHXA 2ZYWX 5CB8A 1MABB 2CXXA 4QG7A 3X1DA 5FOWA 1OB2A 4IDNA 5F2EA 2PX0A 2QE7A 3KXKA 1MV5A 1T3SA 4CVNA 2QAGA 1II8B 4KFRA 1OXXK 3I32A 3SYNA 1LV7A 5E4FA 3CUEF 4C0QC 4LHWA 2W58A 3FMIA 4ERNA 2ONJA 3VR2A 3WYFA 3EX7C 4QL3A 1QHHB 4R98A 3REGA 4A36A 3W3ZB 4NYMQ 1RYFA 4NL4H 2DBYA 1E9BA 1IONA 5TXGA 4DDVA 2ZR9A 1RZ3A 1U99A 1FMJA 2AR7A 4M4SA 5KO2A 1KO4A 4EQ6A 4V0KA 4F4JA 1KIMA 4YMVA 5HR5A 1KNQA 4EUNA 3PXGA 1X1SA 2NZ8A 3GLGA 4K46A 2Q9AA 3NC0C 4M1KA 2X1VA 3KQNA 1GL9B 1H8EA 5JLJA 4HZIA 4MRSA 5EZ5A 2VPPA 1KJZA 2J59A 3LQRA 3WNDA 2GZDA 4A92A 3ASYA 4O0MA 3UXMA 4O2LA 3RSLA 3IHLA 1WQ1R 4RFSB 3EC2A 3EIHA 2PZGA 2KI5A 2WJHA 3B13B 4C30A 1N0UA 1OKKD 2SHKA 4LUCA 3T12A 2WV9A 1XCMA 2FFBA 4NYJR 1G8HA 4OHZA 1M34E 4GOJA 1VIYA 4MRVA 3N70A 3NHAA 1E2PA 1XTKA 1N6IA 2OFXA 1NLZA 2X77A 4QM7A 3CKLA 4Q9KA 3PEYA 3UIEA 4JL8A 3TRFA 1U81A 3GFTA 1IJFA 3B9PA 2J41A 3IQXA 1RRGA 3K70D 4Z8XA 4A4DA 3W8NA 3D31A 1AZSC 1N6RA 3C41J 3KKOA 5HCIA 1E1QA 3QKRA 2IWHA 2BHRA 2WKQA 3BGWA 1JB1A 4TMVA 2I3BA 5B64A 3RC8A 4LHVA 3C14C 1MR3F 3CX6A 1OYYA 3K0EA 3UPUA 4QGGA 2GXSA 2E87A 4B43A 1TNDA 1YKSA 4B71A 2MSEB 4Q9LA 4F38A 4Z1MD 3AF4A 3KB1A 4C0AC 4OK3A 3BB3A 5CLQA 5F3WB 4JLAA 1KAOA 4EFLA 1YHNA 2QM8A 2DY1A 4ESVA 4DVGA 1BKDR 1E2MA 4I1VA 1CP2A 4HZUA 3RRNA 1CXZA 3I8SA 1IOZA 5FOTA 3W6PA 3FB4A 2CK3A 2P2LA 1GOTA 2H7VA 3RS0A 3NC1C 1QVAA 2ATXA 1AGRA 2FU5C 4QNMA 1NIPA 1HYQA 3LNCA 2G77B 2WPDA 3AKEA 1GTVA 5DHFA 1F5NA 3GJXC 4CIDA 3IBGA 1YZNA 3IBYA 1R4AA 4YLGA 1JALA 2NPFA 1FTNA 1NY6A 1IBRA 1BYUA 2QORA 2XTZA 4X8OA 1LVGA 2IYRA 1IXSB 2RGAA 3CLVA 2VEDA 4R7ZA 3D6TB 2N1BA 1G6OA 4G01B 4QBGB 3PIRA 2B7CA 2ZJOA 1Y3AA 2WWGA 2QBYA 3LX5A 5JJIA 4KLNA 4M1YA 3UG6A 3ASZA 1BS1A 2RGDA 1H8HA 1Z6XA 5GJVC 1E3MA 3A4MA 4UJ3A 1XEFA 2F6RA 2OSBA 3DMNA 2H8KA 3M6AA 2H57A 4NP6A 4LGMA 1ZU4A 5B57C 1E2IA 2AHOA 3CR7A 1O3YA 1OHHA 3U3MA 3LW8A 1TL7C 2XOKD 1A82A 5JEDA 2D74A 1W36C 5GJWC 3OHMA 3LD9A 2EFCB 2JATA 4XVRA 1C4OA 4XIGS 4TMWA 4TYWA 2R6DA 3VMFA 2OUKA 2WVJA 2EYQA 1DO2A 4KLZA 4MKGA 3WHLA 4AURA 2DWPA 3QF4A 1R5OA 3MGCA 2VP0A 3B9QA 4IW3B 4V03A 4Q9JA 3VKHA 1P2UA 1KI8A 4PHGA 3FOZA 1XD9A 2PEYA 4Q4HA 3HPQA 3O8CA 1FNNA 1KI6A 2A5GA 4LJ5A 2AWNA 1E98A 3CRMA 2GJ9A 2DB3A 4PC1A 2GEVA 1E2JA 4B3XA 3E70C 1P3JA 3E2IA 3ZZ0A 3FFBA 3RDPA 5EUMA 4PR0A 4NE2A 1S3SA 2C9CA 2Z6VA 5FBLB 2WJVA 4G5QA 5J5CA 4OI0A 4ZIRA 2ZETA 4DXAA 4HI0E 3U5ZB 5CK5A 3A1SA 4M9XA 2XGJA 1YR7A 1MRNA 4PHTA 2IF2A 5JECA 5KNBA 2OXRA 4W5HA 2UVQA 4A8JA 5E7MA 1TU4A 1XX6A 5IK2D 2OHFA 4D2IA 1DS6A 1XXHE 2ECKA 2O5VA 1Z06A 4US1R 5JEEA 4MUBA 5DSZA 4GL2A 5H70A 2O0HA 1TQ4A 2QBYB 3FHCB 4FWIB 2QMEA 4FCTA 1E9SA 5HKKA 4QOSA 1YJ5A 2OAP1 2IS1A 4RKEA 1CLUA 2L0XA 3IQWA 4UXHA 5CYOA 3R7WA 1CRQA 1VG9B 3SBDA 3UKDA 3QJYA 1DVRA 2NQ2C 4LV6A 4PXAA 3HJNA 1YR9A 1NKTA 4US2R 5AWFC 2G9NA 2WSSA 2IYTA 3D3QA 3AUYA 3HYTA 4PAMA 3W9YA 2GILA 5GVSA 2A5JA 2GZAA 2AKAB 4FMDF 4ZKDA 2CBZA 2IYWA 2WJYA 1R7RA 3KDSE 3RVBA 3AP1A 1HE1C 2QMHA 2YOFA 4FWTA 1QZXA 4K8OA 2F55A 2JLYA 1MH1A 1ESNA 2CVHA 4Q4HB 1VMAA 4QJ3A 3CZPA 1BOFA 4LBZA 5KU1A 4KVAA 3RANA 2ZRCA 1XMSA 1ZM7A 2EFHB 1NBMA 1HTWA 1VIAA 2O8EA 1U8ZA 1VKJA 2CE7A 2CJWB 3P20A 2IYXA 3C4JA 3MD0A 5BN4A 1G7TA 2F43B 2OG2A 1S1CA 3ZIAA 3LBHA 4DT1A 2XZPA 1XDBA 1W2GA 4RSGA 4FMCF 5AJXA 1G7CA 1JPNA 1XD2A 4TQUS 2FEOA 3GLHA 4KJZA 2ZIAA 4DDWA 1ZUNB 3Q85A 3W3AA 4XSGA 4A8JB 2HJGA 1VTKA 3BJIC 2ERYA 3LWNA 4LYFA 3ZZUA 2YNMA 1PLJA 4IVQA 5FPKA 3KTAA 3X1ZA 1E4VA 3B6EA 2LKCA 4ZDIA 4YMUA 3P27A 4Q01A 3L82B 2CCKA 2D2EA 3LXXA 1WMSA 3R7WB 1XU4A 4NONA 4XVUA 4D26A 1NN3A 4H1VA 4RD6A 2QEQA 1I2MA 3KFVA 1D2MA 2HCBA 4D82A 4DLYA 1YVDA 2PJRA 2OILA 2RGBA 1WBBA 1DEKA 5DE3A 2ZR0A 4ZCIA 2JDID 5SZHB 3PEVA 4ZPXA 3ZD7A 4Q66C 1N6PA 3QOFA 4Q47A 2ZUDA 4DSOA 4QJ5A 1RKBA 3NVAA 4BGDA 1RYHA 2WOOA 1P60A 2C8VA 1OIXA 4LZZA 1PLLA 1WF3A 1Q20A 1Q1QA 2VBCA 2F1RA 1XBTA 3LBNA 5ANRB 4URYR 3A4LA 5FOUA 1J99A 4BFVA 4NKRA 4IFEA 3BFVA 1SXJC 3DO6A 3IUYA 2KE5A 2OCBA 4KU4A 4CT4B 3GJ5A 3TUIC 4BLRA 2A9KA 4LRWA 1FMLA 4Q19A 1DAKA 5BXQC 1E9FA 1GKYA 1JR3D 1FPMA 4FI3C 2UKDA 3BB1A 1MKYA 4CEIA 2RH5A 3PUWA 2C9YA 4XD7A 2H17A 1TU3A 3HU2A 2ZVQX 2D4HA 2WWWA 3F5FA 3KFXA 2J87A 2BWJA 3A1TA 3BWDD 5K8UA 1CEEA 2DHRA 4QRHA 4W7SA 1ZCBA 4LJ6A 1RJ9A 4JLDA 4Q1AA 3IO3A 3ZVMA 2Q3HA 4UKDA 1AS0A 1U0LA 2BBTA 1AS3A 3K0AA 1NVVQ 3EXAA 3VU9A 4G0NA 3CW2A 2BC9A 3NH9A 4LBWA 3R8CA 3RRMA 3ETLA 1Q1ZA 1P9RA 3IKJA 4EPWA 1DE0A 3MAAC 3Q5EA 4PC2A 2O8CA 4OKSA 4PAQA 3AF2A 3ECCA 2IX3A 2BEKA 1XEXA 1CIPA 2PJZA 2ZU0C 1JJVA 4EPRA 4LJAA 2VTKA 1PUIA 1G5RA 2IUSA 2IXEA 3KQUA 1U9IC 1Z0IA 2GCPA 2QRNA 3DZDA 3THXB 5JI2E 4PZLA 1X8JA 1DBSA 2QY9A 1K8RA 4B2PA 1M6NA 2FG5A 3K9GA 3RABA 3EZ7A 1M1YE 2HUPA 4FCVA 4HLDA 4JLPA 2IHBA 3T34A 1FW6A 2W00A 2J46A 4QM6A 3WXMA 4IEEA 4BASA 4EPVA 2CLCX 1SKQA 4FN5A 4N0DA 5KSYA 4W9MC 5FOVA 1ZUHA 2AWOA 4BFZA 3D8BA 1LB1B 2W6IA 2WHXA 4BUJA 4B47A 721PA 1QHGA 4TLAA 3MG9A 4FD2A 1K5GA 1KK0A 4HYYA 4DUGD 4HUTA 2FFHA 2O8DA 3JZAA 1CULC 2RGNC 3GFPA 3Q5DA 3NBZC 4D25A 3EWAA 4AG6A 3M1IA 3GEHA 1SXJD 2O0JA 4A9AA 3OESA 3U44A 1KI3A 2QAJA 2FFQA 5IRCD 1T5LA 2A2ZA 5LBIA 4M9QA 5J4VA 3IDQA 2C03A 1G3IA 3WP0A 2EW1A 2YC4C 3OF5A 1YRAA 3K0AB 3C8UA 4NYMR 3ICQB 3LO5A 1ZC4A 2VF7A 4HAXA 4CDGA 2XB2A 1YZTA 4B48A 4Z8YA 5JJKA 4AYTA 2GXQA 3LLUA 3L0SA 1ZIPA 2VHJA 4URVR 5F98A 1T8UA 2O8CB 2IEZA 3CO5A 2BKEA 2B21A 3GJ0A 5EE1A 1OSNA 1UKVY 1AZTA 1W2HA 1W4AA 3K0SA 2YJTD 1U8YA 1ZYUA 2FH5B 2OAQ1 1D9XA 3Q3JB 4G5SA 1KDPA 3K09C 4QGFA 4F4IA 1UPTA 3ZVLA 5DN6D 2WWHA 3TW8B 3THYA 3T61A 2IYQA 2EWVA 1QHXA 3C15C 3W8RA 4B3FX 3LXRA 1DAIA 4WXPA 3PFIA 4IFBA 5TV2A 4IOMA 1I2DA 5E95A 3QUSA 1XEWY 4L9WA 2MMGA 4YMSA 4I1SA 4XVQA 5A5GA 4PPGA 4BE7B 1GM5A 3SDZA 2FA9A 2GXUA 4RZ3A 2W0MA 2K5UA 3G82C 2G83A 2AL7A 1KDRA 1U8AA 2ZRFA 4LC0A 2JASA 4GT1A 1W44A 4OI2A 2O8DB 2ZE5A 4DC9A 3QKSA 3R9XA 4RZ2A 1ZIOA 3GLGE 2N42A 1L4UA 4E22A 2F9MA 4AC9A 2ZYUX 4ESHA 3BAFA 2TMKA 5EJEA 2VHTA 2W6JD 1JPJA 4DSTA 1JAHA 1N5JA 4LBVA 3KUCA 1XTJA 5EXPA 2VRWA 5L3SB 5LDDC 1T0JB 2ERXA 3UMRA 1VHTA 3K0FB 5JHHB 5FPTA 2ODWA 4D6PA 3WP1B 6Q21A 2FZ4A 4TT3D 5FI0B 1ZNZA 2DYKA 4IDQA 2FGKA 1OV4A 3K09A 3GJ8A 4DB4A 1T0HB 1NLYA 5EZ6B 1EWRA 3CR8A 2DWOA 4D4MA 3I5XA 2OV2A 1S3GA 1KI7A 2ZAOA 4KFSA 3IIJA 2DFNA 1CJTC 3PR1A 1US8B 1LY1A 5G40A 5K8TA 3IO5A 1ODFA 1S2MA 3CRQA 4Q4AA 1DG3A 2ZE6A 3OEHD 4ACBA 3QY0A 4DCSA 4MKHA 2ZI7A 4JLJA 1A2BA 1UKZA 2ZTSA 3KXIA 4EJSC 3GJ7A 5DO9A 4RFVA 2V55B 3QKTA 2OFWA 4GPTA 3M0EA 5LD2B 3RS5A 1RW4A 2V4ZA 3QXHA 1F48A 3RRYA 4P4SA 3ZGXA 5JWHA 1QHYA 5HZHA 1BH2A 4QGHA 2V3CC 3AQ4A 3WBJA 3OIWA 2YZ2A 1E2LA 2N46A 4ILEA 4Q48A 1W0KA 3EA5A 3QKSB 5IDVA 2J7PA 3WYAA 4M1MA 2VQSA 5JWRA 3QXJA 4PQRA 5H68A 1TEXA 1OE0A 4Q1FA 5FL7D 2WJIA 1XJCA 1HURA 4HLUC 3FFAA 4MH0R 5D3MA 2XXAB 3K0CA 3N2EA 4JLNA 1KI2A 1HT2E 3HPRA 3SN6A 4HSEA 1Z0DA 2XTNA 3FHOA 1C9KA 4DBLC 3PEUA 1W4BA 4DJTA 2ZITA 1Q1BA 4LOAA 2FZLA 1IN4A 2NGRA 2IC5A 2QL6A 4IOJA 1LS1A 3WHKA 1SKYE 1VG0B 2FSIA 3QI2A 3WRYC 2NMVA 4DZZA 1EX6A 2HF9A 3LVRE 4N1AA 4URZR 2NO6A 3NDPA 4B33A 3THWA 3C5HA 4L5BA 2IL1A 2FDCA 2JJ2D 3FKSD 1HQCA 1NSTA 1XZQA 4L9SA 2P67A 4LJYA 4GMDA 3K70C 4HDCA 1A4RA 5FTKA 1Z0KA 5JJLA 1G7RA 5AK0A 1N0WA 2XJ4A 1F6BA 2KWIA 1G8FA 3JVUA 5E3HA 5KDLA 1G291 4BLQA 1ETUA 3GCGA 1DO0A 4LJ7A 2G1KA 3SS8A 3WMGA 4V0MA 2XNDD 3K1JA 2GJAA 1PVOA 3LX8A 2HDNB 2ZPTX 3VQTA 2CHVA 2GXAA 4MGYR 2NG1A 2QGZA 3FMPB 1B0UA 1XTRA 2E1RA 4RD3A 4A2QA 5JSZB 1A7JA 3KXLA 3EPKA 4MRPA 3QG1A 3OE7D 4R2HA 2R62A 1AS2A 3RC3A 3CH4B 3MUFA 4TTRA 2W2TA 1W7AA 2GBLA 1GFIA 1TF2A 1XP8A 1S96A 2VSFA 2FPKA 4OQNA 1NN1A 1Q1EA 4O25A 2PZEA 2GAOA 4PAOA 4BLSA 5AJZA 5H8WA 1SVMA 3CNOA 5FBWB 4AKHA 2CL0X 1KY2A 1OKKA 3NG1A 1UKEA 3TQCA 1I4TD 3I5YA 2EWWA 1F3OA 2QI9C 1R10A 4OJQA 1J8MF 1O87A 1F2UB 1YU9A 2O0KA 4RZUA 3OIYA 4UXIA 3TBKA 3MSXA 1NIJA 4NMMA 2XEXA 1KSGA 2YC2C 1KI4A 2A3RA 2ATVA 1WA5A 2QROA 2ZREA 4Q4LA 1NP6A 4ZI2A 4JT2A 5JS7A 3OEED 4LYAA 2ZSFA 1F2TB 4RKFA 4DB2A 3R9WA 4YONB 2O52A 3K53A 2GNOA 4JL5A 1N6NA 1PUJA 4D4JA 4Z1MA 4DDUA 4JL6A 2MMCA 1FX0B 2ZRLA 3VHLB 1BYIA 1DPFA 4UNPA 2CHQA 1E4YA 1Q0UA 1NBME 1R2QA 3RS2A 4D80A 5HPYB 1T9HA 3A8TA 3KQKA 4OQFA 1RRPA 3FHTA 3X1XA 3EARA 1GVNB 4M1SA 4IDOA 4IXNA 3A1UA 5FBRB 2RKOA 3W5JA 2NO7A 1FUUA 4IDPA 1E79A 1V5WA 2CLDX 1II9A 2ZI5A 2ZRAA 4NHOA 3MRSA 4HAVA 2GRJA 1CBUA 5CLLA 4XWKA 2IYYA 1HH4A 2AK3A 3GLHE 3R20A 3VFDA 2J7KA 2DWQA 3CB4A 3FTQA 3OAAD 1GNQA 4IRUB 5CYPA 2P0EA 3GMTA 4HB2A 2GESA 2QMUA 4B6EA 5BW8A 2V1UA 1J90A 2ZI3A 3NDBB 3V4FA 3K9NA 3ZDQA 2QAGB 3BE4A 4EIWA 4ZCMA 4JJKA 2DFLA 4OHYA 5IHPA 3NWJA 2ONKA 4UQOA 1SGWA 821PA 1L7VC 1OFHA 2EYUA 2V7QD 1W0JD 4DKXA 4HB4A 2H16A 3AV0B 1G1MA 3LW7A 2EU8A 1MO5A 2G6BA 3VR6A 3EC1A 2CCGA 4OHWA 4Q1BA 1XWIA 2C96A 3L0PA 2UZ3A 2XOKA 3U7EB 4EQ6B 4C9BA 2D7DA 5CM9C 5E7JA 3GLGB 2JJ8A 3SJZA 1E0SA 3AGPA 5JI3E 4DCTA 4JZKA 2WBLC 1TF7A 2ZS8A 4BLTA 3WMFA 1NVVR 1KKLA 4MGZR 1RVDA 1IN8A 2KBFA 2AFIE 3BBPA 4C0KA 1CKEA 1KK3A 4F7WA 3S1AA 2VLIA 4JS0A 2BMEA 2ZE7A 4LBYA 1KK1A 2WMOB 3O8RA 1R5NA 1KO5A 4HLCA 4LX0A 2AK2A 1W5SA 2IBMA 4A6XA 1MO3A 1S4QA 4PO9A 2EFEB 1ZM3A 1QG4A 4OQMA 4QJ4A 1EFRD 1TX4B 2XZLA 2B7BA 4QBFA 5B30A 1AQYA 1E0KA 4B3CA 1CF4A 1S1MA 1DARA 2OBLA 1E9CA 2NO9A 3V9PA 1M7BA 3GQBA 5EUQB 3FMOB 4C0SA 4D0GA 2YOHA 2F1HA 3U61B 2IXFA 5IK2A 5DYIA 3QKRB 3THOA 2Q9BA 1QDEA 2YOGA 1COWD 4JSYA 1ZJ6A 1G7SA 4P32A 3ICEA 4WIAA 1M74A 1NVWQ 3TMKA 3PG5A 3QVUA 3TGPA 2CK3D 4JKYA 3FE2A 4JBWA 3LQQA 5B58C 4MGIR 4EFMA 2WPDD 3DM9B 4PHHA 2PX3A 4HZUB 4OQXA 2RAPA 3AVYA 1WDTA 3AUXA 3GLIA 5DI9A 3EPJA 2PT5A 2XX3A 4IVPA 3TQFA 2C77A 4XTCS 3KKNA 4PSAA 1P73A 3R9IA 4DLTA 2YINC 3FPAA 2IYLD 1Z22A 2FV8A 1N5LA 5CK4A 2GEUA 3CPHA 4WAUA 3GLFE 1DADA 3U7GA 4YDHB 3AKCA 3I61A 1D8TA 1H8HD 3GJ3A 4IVRA 4URXR 1X3SA 4NBSA 2G88A 2V54A 2FSHA 3RHFA 4RCZA 1L8QA 3J81k 5KPDA 1G3MA 1Z83A 5TY0A 3G5UA 2QPTA 3Q7QA 4RD1A 2J0UA 3PUVA 3BH6A 4HDQB 3LVQE 3QXXA 4TLDA 2ANBA 2ODBA 2X8AA 1KTVA 3B2EA 4RCYA 4D4LA 1ELOA 1G64A 1ZMXA 1SKYB 4PANA 1K6MA 1VCNA 1X1RA 2ZRKA 4GP7A 4DWJA 2GEDA 3B5JA 3RS3A 2AXPA 4Q7KA 5TVKA 3T1TA 2CNWD 3TVTA 2FEMA 3QF4B 4DCVA 1P9WA 4CW7A 4UNSA 3RWOA 3BORA 3NKVA 4JLVA 1JJ7A 1OXSC 4LYJA 2Z5FA 4XOIA 3MJRA 3MWYW 2QT0A 1KI6B 1W1WA 2BJVA 4LHYA 3ZQ6A 2MSDB 3SJAA 3EZ9A 4C0HA 2ODNA 4MUAA 1UBCA 1OIWA 1T3LA 2A5FA 2D7CA 2PMKA 5J47A 3ADDA 2AX4A 2EQBA 4D0LB 4JIMA 3W6OA 1UBEA 3VTKA 3GLIB 3U4QA 3U7FB 3EPHA 1GNPA 4I1OA 4ZIRB 4XWOA 1ZD8A 2VO1A 4B6FA 2JDIA 8OHMA 2FN4A 4U5XA 3MMPA 5FOSA 1VECA 2RMKA 1D5CA 2CCJA 2R44A 1RC8A 5HE9A 3LA6A 4Q02A 1H65A 1MO6A 4FXPA 1YZLA 3KQLA 2O8BA 2OBMA 1Z6AA 3PJRA 1AM4D 3B7GA 2PEZA 2GK6A 1XMVA 5EE9A 2OEPA 2QUZA 2GF9A 1IY0A 1OYWA 1YQTA 4TQAA 2VP4A 4XTRA 3AVWA 1T4GA 1KSHA 1P9NA 4WZBE 4BFWA 1OIVA 2BM1A 1KI1A 1OPXA 1W36B 4C7OA 5KNCA 4IJMA 2OCAA 4OL0A 5DNYB 2J0UB 1CS4C 1GKIA 1NJGA 2RGCA 3DEFA 4QXAA 5CJ2A 3FKQA 1JR3A 1N3BA 3NBYC 2QMOA 4JVLA 4Q5IA 4G5RA 3UWOA 4BWYA 5FUWA 1KO7A 3MWLA 4IOKA 5TMPA 2RGGA 1G16A 4KODA 3B1XA 4XH9B 2D62A 3BK7A 4HAZA 3AVXA 3PUXA 1P6XA 3DMDA 3Q9LA 4E5UA 5FR2A 5JS8A 3A1WA 3SQXA 1XPUA 4I81A 4B44A 5C18A 1KGDA 5JCPA 5KHOC 4KO8A 1G3QA 1JQJC 3H1TA 4I99A 1LFDB 4KCGA 1SHKA 1E2NA 1JEEA 2WWXA 1G4UR 3P4YA 2QPAA 2XB4A 5FPSA 2ZS7A 4TTPA 4IHQA 4R71A 3VX3A 1GIAA 1X8KA 2J9RA 4NYJQ 4GNKA 2R8RA 1F60A 1P5ZB 3IGFA 3RWMB 4E07A 1R0WA 2O8EB 2IXGA 3I8XA 3CBQA 3B82A 4XWAA 4AG5A 3ADCA 1QG2A 3KJHA 4CEHA 3LRPA 4DT1B 1KMHA 2OM2A 1AIPA 1UF9A 1XD2B 2IT1A 1FTSA 2BCJQ 3GLHB 2P6UA 1DTSA 2A5YB 1HA3A 2QTFA 3EZ6A 1TADA 2JIZA 4GP6A 4IDHA 3KX2A 3ONWA 2J0QA 1GWNA 1G8GA 3W5IA 2JLWA 3H84A 3KTAB 1Q21A 3I73A 3LY5A 3O47A 3QNUA 1FL9A 2VL7A 3SQWA 4NZYA 2BBWA 2D06A 2WICA 3U3JA 4QBIA 1Z2CA 3A1VA 221PA 4CEJB 3PUYA 4QBHA 1KKMA 5BQ5A 1FNMA 3T1VA 2ZS9A 2LWIA 4NCNA 4E03A 1WCV1 2Z4RA 3PITA 1J7KA 3O8DA 1RFLA 5A0FA 1GKUB 3QEOA 4DUGA 4TL6A 4ASUA 1EFHA 4KSBA 1MRSA 2JGNA 3W90A 1EWQA 4HB0A 2AKYA 4MGKR 4S35A 1SXJA 4LHXA 3MJHA 4JBXA 2PZFA 4Q7MB 3CRRA 3TKLA 3GLFA 1Z28A 3GPLA 2ZE8A 1N25A 3HYRA 4PTLA 4L8GA 1GDDA 2IYUA 5AJYA 2XZOA 1AJEA 1KO8A 4LI0A 4KXFB 3U60B 4GOKA 2GAAA 2Q3MA 4A0RA 4TMXA 1E0JA 5J40A 2QA5A 1LNZA 1OW3B 2ZRIA 1GP2A 1VYUA 2G1JA 4DLXA 3KKPA 4M8NE 3CX7A 1TAGA 3SYKA 4HUQA 3U6KA 3PQCA 1TUIA 2JA1A 121PA 4GDFA 3AKDA 1XPOA 4F93B 2Y8EA 1P2TA 4TSFA 5EQTA 4CEIB 5KTYA 1V43A 2DR3A 1KDTA 3VKGA 1ZINA 3DHWC 4AK9A 3HR8A 2GCNA 2WMNB 1YE8A 2X2EA 4A82A 4A0HA 1VPLA 2NZJA 3QE0A 3EWSA 4JSTA 1M2OB 1OH8A 4FW9A 3D7MA 2G0TA 5DN6A 5GADl 3ZLJA 5JWOA 3HU3A 5EXSA 5M04A 2WTUA 4U7DA 4PX9A 1CU1A 2J1LA 1NVUQ 1RJ9B 2VSOA 1AN0A 3SC3A 1OB5A 1Z08A 521PA 1SQ5A 1G6HA 4EAQA 4OYHA 1JI0A 2R2AA 3VU9B 3VR1A 1E6CA 4WVFA 2NOAA 3GP8A 3GEIA 5KDDA 2KSQA 5C46F 2XSZD 1U9IA 4ZKEA 2IA5A 5CIWA 2P5SA 2CL7X 3QIAA 1XEXB 1Q22A 4V0ME 3BRWD 4F4CA 2ZUBA 2O8FA 3B1VA 3DDCA 1IN5A 5C2JB 2REXB 1U0HC 4TYPA 2H1LA 1NNEA 1XF9A 621PA 3GLFB 3QKUA 5EE5B 3ZQJA 2FOLA 2W83A 1UBGA 1AKEA 2ZJBA 3C16C 3M4YA 4HLQB 4LCBA 1XMIA 4BFSA 2ZRJA 4WBSA 2PH1A 1EK0A 5ELXA 1GZSA 4NYIQ 3CWQA 5CITA 5FBVB 4M1WA 1OH5A 2FE4A 3DPUA 4CGZA 2BIFA 4U02A 2CE2X 2RGNA 3CRVA 4TT3A 4M0LA 1RIFA 1TMKA 2G0NA 2ORWA 2ZRGA 3SJBA 2F7SA 4TL7A 4PZZA 2HLDD 3TR5A 4DLZA 3OFND 3EA0A 4HB3A 4DLRA 2QTVB 1ZCAA 2GVZC 3SJCA 4B74A 1JAIA 2R6CA 3Q72A 2WKPA 1XTIA 4JVMA 4DEXA 3QXCA 1KAGA 4Z54A 5KYKA 2JLUA 3LV8A 1G17A 4Q9HA 3X1WA 3OEHA 1M7HA 3U44B 3BD9A 2VHUA 2WAXA 3JVVA 4KYIB 1VDZA 4JLKA 5LB2A 2ZJ2A 3CPJB 5G3YA 1VCOA 5FOXA 3EG5A 1NL3A 3C5CA 1II0A 4B35A 4BECA 3ZVRA 1E96A 3NH6A 1Q12A 1SVLA 3CPEA 4KAXA 1G8PA 1S0UA 4EDHA 1ZAKA 4NU0A 5EE3A 1A2KC 3L8ZA 4D0NA 4DCUA 5AUPB 2IS6A 4PSKA 1IJEA 1GL6A 3F3YA 4MYTA 4B3DA 4MKFA 4A0FA 1SVWA 3SHFA 1VCIA 1UDWA 2ZQ5A 2P3SA 3Q8XB 1ONBA 3DVLA 4GOXA 4TL9A 1XTQA 3ZS8A 3U2QA 2WOJA 1AGPA 3THYB 1XJ0A 1GAJA 4BQSA 1NMYA 1D2EA 2XITA 5FL7A 4UNRA 4G5OA 1FP7A 5L3QA 1KO1A 5HTKA 2VHQA 4WA7A 1LW7A 1X6VA 1NSFA 4M1TA 4PO8A 1FQJA 2HJVA 3CNLA 4MRRA 3GFOA 2YWFA 1NKSA 3U7HB 4PPFA 1ZC3A 1OT3A 3FVQA 4LK2A 5DHAA 4OHVA 3VKWA 4I1UA 2YV5A 5C4GB 5K8IA 3UATA 1E2DA 2GCOA 2ZRMA 4FMBB 4DDTA 3NXSA 2Q6TA 1E1RD 1PJRA 4AYWA 4JJZA 5DGXA 2GK7A 4LPSA 4Q18A 2V6JA 1KY3A 2YWHA 4GMXA 1G41A 2JJ2A 3FKSA 3AVVA 2ZRNA 1Z0AA 1CJVC 1T3HA 2V9PA 1IAQA 1EFCA 4MRNA 5FH9A 5D3QA 1DAGA 3E5HA 4P31A 1KMQA 1AA9A 2P6RA 1IN7A 2ZXUA 3QVVA 3B85A 2ZJZA 4B3BA 1QHIA 4Z51A 4UJ5A 1MT0A 1BMFD 2IUTA 2ZANA 4MA4A 2WWFA 2JCSA 3L43A 4QHYA 2ZJAA 2PT7A 5LB4A 2VF8A 4C4PA 2YWEA 2XNDA 3ND9A 4PQYA 1ZBDA 2GA8A 1KZGB 1UBFA 3C7KA 4II7A 1MABA 4EJSA 4IOLA 4YQFA 1GRRA 5AJWA 3QG5A 4Q21A 4URWR 1IXRC 2Q0HA 5J4YA 3PCRB 2UZIR 2NO1A 2ZAMA 4Q4AB 4URUR 4BFYA 1IHUA 5KSZA 1TQ2A 2JLRA 2KBEA 1MO4A 4L4UA 3OE7A 3AGQA 3IPYA 2JJ1D 5G41A 1GRQA 1TPZA 5CM8B 4YXWD 3LDAA 1UEJA 4TZ6A 2PLFA 1QHHA 2OESA 4GZLA 4LJ8A 1B23P 3TUJC 4LV8B 3ZYCA 4JKIA 2XNSA 3BERA 2C78A 4PFSA 2PLRA 3K8YA 3HDTA 3BB4A 5EXXA 1R0XA 4TYYA 1KK2A 1W0KD 2ZSBA 4P4SB 3AM1A 1BIFA 5FTNA 5AUNB 2Q21A 3GLIE 2BV3A 3QPUA 2JLXA 2QGNA 3WRXC 3FDIA 4HLUA 1UAAA 4KBGA 1ZU5A 4ZCLA 3OEEA 3GJ6A 1YR6A 3B78A 1RE0A 4RFSA 1UKYA 2GTPA 2QPOA 3BXZA 2ANCA 3QSYA 1Z63A 5HZKA 3EIEA 3ZD6A 1U90A 2D2FA 4TWZA 5D3MB 4TYNA 1E2EA 4DSUA 2H18A 1ZNYA 1R5BA 2CDNA 4TTQA 2QTHA 1WP9A 2HYIC 3X1YA 3OIUA 2HXYA 2QENA 2QT1A 1LF0A 3SZRA 3I4LA 4EFNA 1EESA 1RRCA 1XCPA 3FWYA 1NN0A 4BZPA 2WIAA 1FFHA 2FSGA 4M2LA 3A6PC 1NMZA 3T06B 3ND8A 3P32A 3MWJA 1M8PA 2WKRA 1NG1A 2FSFA 4EJSB 1G5TA 1ZM4A 3GEEA 5EP3A 2AXNA 1W46A 4Y0VA 1I4DD 4BPBA 4G5GA 3VR5A 4BEJA 2LCFA 3OAAA 2QM7A 5KUTA 3TJZA 1ZM2A 1CJKC 4OBEA 3THWB 1DELA 3NIBA 4CZ2A 2F1IA 1RPZA 1CR4A 4MDFA 3GJ4A 4N3NA 2F1JA 1OFUX 1EFUA 2ZR7A 1Z47A 3EAQA 1KJYA 4BZXA 3ADBA 2ZUCA 2GJ8A 2C95A 4DLVA 2A30A 4YMWA 3BFXA 1FZQA 2VHCA 2R65A 1PZNA 2V7QA 3L0OA 1W0JA 1GILA 1JBKA 5JCZA 2ZEJA 3KJIA 2REBA 2BMJA 4AI6A 2B8WA 1YR8A 1XCGB 4DCNA 5FTJA 1W5TA 4NCHA 2IEYA 2ZYVX 4PZYA 5KNDA 1W47A 4PC6A 1CR0A 4H1UA 2ZROA 1XB2A 4N0EA 3MWKA 1T91A 1U94A 2QE7D 5DI3A 1E99A 4M21A 1DAHA 2IF0A 3A58B 1JNYA 2IYSA 4P3YA 1U2RA 1E9RA 4J0QA 1K5DA 1S9DA 4KV9A 1IY2A 4C2TA 3NHBA 2OE2A 2JLVA 1ZD1A 4QHSA 2A7QA 1RRFA 3P4XA 2NTYC 2VH5R 2I1QA 3NTUA 5SZKB 5C1BA 1Q44A 1UM8A 3H0KA 3T1QA 2YHSA 3ZH9B 1G18A 2X2FA 4FCWA 4OJKA 2ASEA 2BKUA 1N6OA 1R6BX 5FBQB 3PEWA 1EFRA 2HYDA 4B73A 5FL3A 1JR3E 2I1VB 5JRZA 1AKYA 1MOZA 3IILA 3UG7A 1Q3HA 4PC3A 4RD0A 1SVOA 3VR4A 1IQPA 4RZXA 3K70B 3PVSA 4P0TA 4I4LA 4XJXA 1H8ED 1R8QA 4RY2A 5TDHA 2JLSA 4E09A 5AJVB 3BS4A 1Z8FA 3DKVA 4AKIA 4RVCA 3WNBA 1TTTA 2PCJA 3AP3A 1COWA 1NI3A 2Z83A 3TAHA 2BVNA 1XEWX 2AFHE 3IIMA 1XPRA 1Z3IX 1SZPA 3HR7A 1FUKA 4RD2A 1JECA 1ZNWA 2Q3FA 3QXSA 2FWRA 2OFOA 5JMTA 4LYHA 1EXMA 5K8LA 4POAA 3CIOA 2WZQA 3CONA 3DKPA 1G4AE 3CX8A 1E79D 1AK2A 4DRZA 5FTLA 2J5XA 1OXUA 1G3RA 4ABYA 1ZRHA 3HP1A 1W49A 3OZXA 3TNFA 2KB0A 1E1QD 2RB4A 4UNQA 3L8YA 2DCUA 2FPLA 3JZMA 5CJPA 1XFAA 2GF0A 1QRAA 2CMKA 3TE6A 4YMTA 5DI3B 4DLWA 1UDXA 2HV8A 2OO7A 1Z6TA 2ZJ5A 3I3SR 1XNJA 4FMDB 5FPHA 4A8JC 1VCMA 4A1FA 1AQUA 3T5DA 2F3RA 3E1SA 1T6NA 3AVUA 1IM2A 4W5WA 4HAUA 3DOFA 2QU8A 4TLBA 3SE0A 4CT5A 1WRBA 3SEAA 5IT5A 1ZM9A 2QP4A 1VHLA 4D81A 2WJJA 5FPYA 3O8BA 2B6HA 1TQDA 4ZI3A 5FTMA 2PL3A 5FUXA 4MDEA 2ZSEA 3W6NA 4TYQA 4FMCB 2ZRBA 2JLQA 1SXJE 2CNWA 1KDOA 2ZU6A 4MKIA 3RAPR 4C2UA 2DFKB 4H9GA 4QFMA 2ZJYA 4BRUA 1BO6A 5EP4A 5H1YA 4KITB 2QP3A 3ZZTA 3TSWA 4DHEA 1DAEA 1Z07A 2CJWA 2C99A 3S1AB 5BN3A 1E2QA 2F43A 2A78A 1U0JA 2RGEA 1Z0FA 3IEUA 1YZGA 1WBDA 3X2SA 4UNNA 4V0NA 1GNRA 2RHDA 3AKYA 1OHHD 3Q7PA 2BDTA 2IS2A 5GJBA 3T5GA 2GWHA 1P4SA 4KVGA 5L3RA 3UANA 2GJKA 3V00A 3W34A 1OF1A 3VAAA 3EZ2A 4TZ0A 5EE0A 5FI1B 1G9XA 2AN9A 4OK6A 2IYZA 3AVQA 2HCJB 1DAMA 1NF3A 2VA8A 4ARZA 3FMFA 3N2IA 2IK8A 2OT3B 2VYFA 3BH0A 4NYIR 3QF7A 2VP5A 2XJ9A 4R2IA 2I4IA 3L0IB 1NMXA 4GFDA 1XTSA 2QNRA 3P26A 4JLOA 4MQBA 3T1OA 3K9LA 3I62A 1W48A 3TAUA 4ZV4A 2WWIA 5CIQA 3AB3A 4BFTA 4DIEA 1DOAA 3EASA 1QF9A 4BZQA 4ON9A 4C0JA 1YRBA 2DFTA 1UFQA 4Q7JB 3MCAA 2VSXA 1J8YF 4A6PA 3F8TA 2WSMA 5SZJA 1L2TA 3UMSA 2CHGA 4KI0A 4LPKA 2ZM5A 3KB2A 5KDOA 5AUOB 4AKGA 1SVKA 2ZSDA 3BH7A 4HAYA 4EKDA 4EPXA 2GJSA 5HKKD 2FGJA 1TF5A 4JMPA 3SHWA 3UMFA 5L3VA 1DAFA 3TVDA 3IEVA 1W36D 1OH6A 1JQLB 1QBKC 1ZVQA 2RGXA 4LHZA 4C3ZA 421PA 3GD7A 4FIDA 3BOSA 3ADKA 1HUQA 2HF8A 4C0LA 2NPIA 3LBIA 3CNNA 2WSSD 3NEYA 5G3ZA 4BRWA 1N6LA 4B75A 3PV0A 4YC7A 1IN6A 4EPYA 2HT1A 2EVWX 1D2NA 2BBSA 3B1YA 5G53C 3RS4A 4ZDKA 4Q00A 3VR3A 1FP6A 3SI7A 2JLZA 4JLMA 1VG8A 1J70A 2QG6A 4TMZA 5LPNA 5GJCA 4A0GA 4ARZB 5EP1A 3N5CA 1N5IA 3FGNA 1GITA 4WOPA 3SYLA 1E2KA 1JEDA 4AKEA 1XMJA 4QNRA 2YWGA 4MITA 1NBMD 1HY3A 5TARA 2PBRA 1TEVA 1NRJB 4LSGA 2H5EA 4Q4JA
chains in the Genus database with same CATH superfamily
1EVLA 4A15A 5HKLA 4G56A 4A5SA 4DIDA 4MHTA 1JHQA 2R87A 4XPZA 1PNRA 1WSDA 2JFOA 2Y1EA 4MPRA 3DTVA 2HHCA 3OIFA 4WKBA 5LFAA 3K9HA 4G09A 3VM6A 4CTNA 3L77A 1AKNA 4YRCA 1LPNA 5JZVA 1J97A 2CKDA 3PUHA 2IYAA 4G0QA 5E3IA 3U4QB 5DWQA 1KSFX 3CM0A 2FPMA 3THXA 4YRQA 2GN9A 1UWCA 3EXG2 2WUWE 5CNMA 2ZWMA 3W8DA 4QO8A 1KL7A 3OOJA 4LK2A 2J9XB 2JB9A 2Z1DA 2YNMD 3R5JA 4CIBA 4BVAA 2A4KA 1FMCA 3OETA 1E9VA 3RC2A 1SHJA 2XVMA 2W8BA 3VKFA 5KTSA 3EFOB 2BMFA 3H4MA 1KFKB 4OXIA 1YAJA 4P4UA 3PJFA 3OA2A 1FQWA 1X8XA 3A6HA 1Q57A 4QO7A 1RQ2A 2CW5A 5P8WA 4RIFA 4RY9A 5IJZA 2QSZA 1O5IA 3BXPA 4AJOA 1OU4A 2XQJA 5JNRA 5MGBA 1NKVA 3NEPX 1A5SB 4EW2A 2QF7A 3TIFA 5E38A 5BO5A 1F9EA 2ZUEA 1CUUA 4Y1RB 3R9KA 1U7WA 4OKIA 2XH8A 4EYKA 4OATA 3KTDA 2PMFA 5I7VA 1DRUA 3NPMA 2AFVA 4QGAA 4GXTA 3FPFA 5TS3A 3S8YA 5JFGA 2C3OA 1NU8A 1TTQB 5GM1A 2VEOA 4YMLA 5DGDA 1X1EA 2X5NA 4P3XA 5FV7A 1MUUA 2P4UA 1N9ZA 1EUZA 3IBSA 4PO1A 4YV0A 4TKMA 2FQQA 1Z7EA 4KX5A 4B6GA 5J43A 5HCNA 5KPJA 1RHQA 1JTEA 1P5HA 4UUBA 4I5EA 4NZ9A 5ALXA 2NW6A 5K7SA 4IXMA 3T15A 1WDMA 3FCAA 1MX3A 2JF0A 3MOIA 3PGMA 3FH0A 4IKEA 1KMNA 5BNTA 4DYDA 2JFHA 3JV7A 5DU2A 2J0VA 1E9AA 1N2CE 2E9SA 1P62B 4D0RA 4L15A 1EAYA 5H80A 2XSZA 3VH3A 2X3YA 2L69A 4MW2A 3GEMA 4YBRA 5JNWA 4LXTA 1RZVA 3NTVA 1FTQA 2CNKA 3MBOA 3LK7A 1KMHB 2G80A 4JYCA 3ZGVA 1XVAA 1IMJA 4U5QA 2IHYA 1OH7A 4DA0A 5FOQA 1E9DA 4I3GA 1E2HA 1Z74A 4J0HA 2QY6A 2WJGA 1JFLA 1LPBB 4KQCA 4YDQA 4R8MA 4QREA 5AUQA 4WFQA 1UJMA 1Z5ZA 3QVKA 5J2TF 3WO0A 4F60A 4XASA 4FBGA 1V3TA 1UKAA 3TK1A 3ZE2B 2ZSIA 2OZLB 2VBFA 4YP9A 1Z25A 3PENA 1G8YA 3UMYA 3M9WA 1TM4E 3PL1A 4PSVA 3F4LA 4DLSA 4J75A 1JXQA 1IIBA 2YZKA 3CH5A 3CR3C 3QHAA 1DRJA 5KKNB 4EABA 9MHTA 4N0PA 1MGPA 4L27A 1P5RA 3IE1A 3AI1A 5AK3A 3ETJA 2XECA 3GARA 2I2FA 1OLSB 4FYVA 3I6BA 5JD4A 2EJTA 4UATA 5TJ9A 3TI7A 5FI3A 3EHEA 3GR6A 4GMGA 1BDMA 2D0DA 1DCMA 4Q1CA 1W87A 3DJFA 4MIEA 4R40A 3TIXB 4GYYA 2JCGA 1V8OA 1N5MA 2A35A 2IZ5A 5CB4B 2V6IA 3H11B 1LRLA 1OZHA 1SXJB 3CWCA 5DM1A 4BLOA 3IT0A 2Z08A 1N6HA 4BS9A 5KHLB 1PK8A 2MIIA 1PX0A 1CK4A 2OXFA 1PQUA 2FJUA 5AKXA 4EGJA 3JYOA 2W6JA 3P71T 4KWHA 3NOVA 4YR7A 4JHXA 2ZAGA 3AH8A 4F91B 1W0CA 3MB5A 4DBLE 4IIVA 3H86A 3Q12A 2H3HA 3UENA 1ZH0A 3SOZA 4RYDA 5BYKA 2I1LA 5DIFA 2XQGA 1CJMA 3LXUX 2XAUA 3O9ZA 1NOKA 4CM8B 5A4JA 2Q5JA 3TR6A 2BFEA 2Q27A 3FSGA 4IHKA 1DBWA 2ZRDA 1XXHB 4EKNB 2DKOA 1C3JA 2HU5A 3KR0A 4MTLA 4CUJA 3Q15C 4EW1A 4ZZ3A 1I0LA 5ISMA 1JWLA 1L5QA 2WB4A 3VI4B 4DM3A 3TGLA 1O94A 1OD6A 2GVNA 1P5FA 3KOXA 5A3RA 2WAYA 3D3NA 4MVJF 1SHLA 3UKJA 3EGVA 3ZQUA 1QPGA 3EUWA 4B6RA 3CB2A 2JEOA 3EQ7A 2PSEA 5IT4A 2G3YA 4MUIA 3KZOA 2XTAA 4RIHA 5HIIA 2B3TA 3FRHA 4CYMA 2BFDA 1F1BA 4M9ZA 1B8OA 3NHZA 1L5MA 2OXCA 4QUKA 3T3HA 1F0PA 1F3LA 2RD2A 3WBKA 3QX3A 3O4GA 4BN4A 1SCUA 1U28A 2AJDA 4G4SO 4BP9A 1SB9A 4E5MA 1O0CA 5FFFA 3GK3A 3TEFA 4B1FA 3G8DA 4DKJA 8AT1A 3J80A 1UWVA 2R4UA 3NM4A 2V7BA 3PB3A 1RADA 2FUEA 1E6EA 4RPHA 5EP2A 2GVDC 4J0EA 2O8FB 2VNJA 1OASA 2ACEA 1I6KA 4CI9A 2BHLA 4U1RA 5DBOA 4DMRA 3A0UA 1EG7A 1QKIA 3OZAA 5IJ0B 3EOAI 4R16A 2ZRHA 3GBPA 2XT6A 3L01A 2WV7A 3GB9A 3H2YA 5IYZB 2QTCA 1UBRS 3ITNA 4Y7DA 2XXAA 3ITDA 5DNAA 3PC4A 4HDNB 5H4GA 1VPDA 3GLVA 2GF2A 2QQEA 2WDPA 1M1XB 3LCRA 3AHDA 4EP1A 4MZXA 2VOJA 2AH5A 3L49A 2GFIA 4JB8A 2VAPA 3L05A 2AEEA 1YZQA 3CF2A 3QTLA 3UAWA 1Y3CE 4DEVA 3K0CC 3ZCVA 1J9EA 4E3WA 1ZNXA 4F3NA 4OUDA 3IQIX 1B6RA 1LLFA 4GSKA 4WKGA 4A7PA 1D2CA 1USWA 1ONOA 3AJEA 4FFOA 3G6WA 4PTYA 4V0LA 2W2QA 3K16A 3MQ4A 2BFBB 2FR8C 4M76B 5EMJA 1UP7A 1E4OA 5C4MA 3RUCA 5AVRA 1MT3A 3VO1A 3TSOA 5IU6A 1B14A 1NJFA 2EGGA 3NS7A 2A5DA 2V97A 4LJSA 1V8BA 3DZGA 4MCAA 4WECA 3CF0A 3QU7A 3WL6A 4KN6A 4YV2A 1RKUA 3FZYA 4IFTA 1FDUA 1IOLA 5CVVA 1I24A 3ETDA 4KHPB 1TM3E 2B82A 3KYBA 3LFUA 2Y67A 1NXSA 1SCIA 4FYPA 1TA0A 2O1EA 1M54A 2DERA 1HL3A 1JXMA 1K8YB 1FDOA 1N0VC 1OFTA 2PXXA 3BX1A 1A2QA 3H2JA 1S3IA 2NUAB 3GBSA 1RP1A 5AKGA 1CVRA 3L07A 2BLNA 5KYUB 5ALIA 3U3KA 4X8MA 1BXGA 4R2KA 3RUEA 4N82A 5AD1A 3KOYA 5JHGB 2NU6A 1P3DA 3RYTC 3WWPA 2A1UB 5C5DA 4UQPA 2OCPA 4XGIA 1M33A 4BVHA 2A0FA 4Z2YA 1A1VA 4PQFA 1KSJA 2H2IA 5BQOA 4BO5A 2GYUA 2Q4EA 4JSRA 4E4RA 1DLIA 2H0AA 4AKSA 1VG1A 3SIXA 1P2VA 1QQ6A 1HTBA 2P65A 2R6FA 3GGGA 3KUDA 2HDOA 4B2LA 3KKLA 1WKCA 4LZJA 1U3FA 3DXYA 4MQFB 2JFZA 1UBLS 4TN1A 2P3OA 1KP9A 3HFGA 2KS6A 4AXXA 4DMKA 2G7ZA 2Q6IA 4CM3A 1YB6A 2FP3A 4HEJA 2GARA 2IWRA 3AF6A 1AXGA 3ZV3A 3EW9A 1Y1SA 3A25A 3OX1A 5FUVA 5CFQA 5BORA 4CRWB 1MQAA 1Z7BA 3KYCA 4PIMA 1OBVA 1A3CA 1E2FA 1UZMA 5EWJA 4AD8A 3RRFA 4OXRA 4JV5B 1YV9A 1LTQA 1F2UA 2H5IA 2QTNA 2AD1A 3NGLA 4TTTS 2OUIA 3WY9A 5K6RA 4MEAA 1H1LA 3S2EA 3E05A 1RIIA 1L8OA 3HBLA 3JCZA 5T8KC 3V80A 5CDSA 3IPXA 5CDFA 2IS4A 4K28A 4K88A 2TMYA 3GI1A 4JOQA 2B94A 1QB8A 2GD0A 1NLFA 2VDWB 3KB8A 4EJMA 4W9NA 2VIIA 4DLUA 1JIUA 1PLKA 1U7ZA 1YFZA 1IYZA 1KYYA 2J7PD 4HNAB 1J2YA 1C3OA 2GCOB 5ITZA 2XKKA 1NF2A 1CUWA 2QUAA 4NZNA 3IQZA 3KKZA 2BFNA 3WSWA 2JI6A 2MSCB 4IMPA 3C5EA 1N5RA 3WL3A 4E70A 2J07A 4YAEA 2AIRA 1T4CA 2LNDA 2FQYA 3DLAA 1Z88A 3IIKA 4X91A 5BYJA 4DQVA 3RO7A 1U98A 2B8TA 4OK5A 2J9FA 1SULA 2VJBA 1F14A 2ODEA 4ZXFA 5K3CA 5B58T 2HXSA 3MIZA 4LCEA 2OV3A 4UPVA 1YRQA 1Z2OX 4U0KA 3RSZA 4AYXA 1YB2A 1M2KA 4B4OA 4CF4A 1PG5A 4DAOA 2V7UA 2QLFA 1RS0A 2J3DA 4TUYF 5IAKA 1CUDA 3OTIA 2Z0MA 1WWKA 1HQYE 4HDOB 5TS2A 2CLSA 4FFWA 1AKUA 2QB5A 1TYCA 1H4SA 4RGBA 1QHNA 3ZTTA 2XPCA 2BFCA 4UREA 5AR1A 1HT1E 4RZSA 1HEIA 4XYBA 2SKDA 4GPEA 1WHSB 3MUEA 4E5KA 1IDN1 2PFSA 4MLDA 1J1ZA 1XHEA 3COYA 5F2EA 3UUGA 5HIKA 2E4WA 4Y0NA 3IYLW 4X3OA 3ROFA 1TO6A 3AC0A 3CQ9A 2O2EA 1Y4ZA 1R64A 1Y6QA 2WUVA 3T7RA 1NP7A 3LUCA 3PPWA 1QGYA 1TYEB 2XUFA 4TXHA 7ABPA 1NFFA 3PSHA 3WYFA 4QL3A 1QHHB 3BHJA 3REGA 2WA2A 2D2IA 4WXYB 1K6JA 1KEVA 1RD4A 2TSYB 2XE6A 4NL4H 4BV9A 2OK7A 1X1CA 5DMXA 3R3ZA 2CFOA 3CY6A 2F64A 2ZB8A 3LZDA 5E2AA 4DDVA 1RZ3A 3WRXA 1UMBA 1FMJA 2AR7A 3OT1A 1CUXA 1YI8A 5TMEA 5JVDF 1UL1X 1FLAA 4F4JA 4QBKA 4AUNA 2PJUA 1SXIA 1VL0A 4FDTA 5HR5A 1RYMA 4JI5B 3GLGA 2JAXA 1G21B 2VK4A 4Y2XA 4K6FA 1BN7A 3I12A 4M1KA 4YEDA 5EJMA 3V1KA 4BQFA 1ADYA 2MR5A 1AKTA 3BIXA 2QMZA 3H4TA 4X64B 4J9VA 1HYGA 4IO0A 5EZ5A 2J59A 3LQRA 2PKYX 4TM8A 3ASYA 1D4AA 4I46A 4YAOA 3UXMA 4CKYA 3HVUA 3IS3A 1BW9A 2W2LD 3IHLA 1P74A 3ZHVA 2Z8ZA 5FLEX 3B13B 5EY5B 3MK31 3ZR4B 1RQNA 4B0PA 1J8DA 1OKKD 2I3GA 2WSBA 1XCMA 1V25A 1JNXX 1Z0SA 4O4LF 1G8HA 4Y2RA 1OWPA 4RXUA 3C7DB 4GOJA 4ZQIA 4OHZA 3WKEA 4A0FA 3SVLA 1XTKA 3DD1A 5A9SA 2X77A 1QIKA 3UKOA 5I8ZA 3UXHA 2Q1TA 4S24A 1MU0A 4HMOA 4C07A 3CKLA 1NUTA 3DYIA 1LZKA 1JG7A 3H1FA 1G2OA 1FP2A 3IQXA 3OE1A 3NXKA 4Q05A 1X7YB 2WEKA 5LZ7A 1R9MA 3TIVA 2BMWA 1EBBA 2Y2VA 1S02A 1XT6A 4F6RB 3QUAA 5DCUA 3JQFC 4UCXA 3GQVA 3KKOA 3QKRA 3TLYA 2B4KA 1UXKA 1A9TA 4XI9A 4OX9Y 1XO1A 3DEYX 3RC8A 1MR3F 1EX1A 4HDMB 1XE3A 3UPUA 2VKTA 3RU7A 2E87A 1A88A 1TNDA 2Q99A 2M6KA 3SC2B 2YXDA 4OK3A 2I76A 5A3VA 2MDTA 3BB3A 3DA8A 5CLQA 5F3WB 4QDXA 1SBIA 1UK6A 1N57A 1O6ZA 2ET6A 4ESVA 3WRVA 1E2MA 1CP2A 1EDEA 1W73A 2O48X 1IK6A 2P9HA 8ADHA 6REQA 2P2LA 2H7VA 2Q2OA 5KNCH 2ATXA 1Z2DA 5KNDD 3BMNB 1G0OA 1E1CB 3KAQA 2VYND 3LNCA 4BNNA 4DGQA 5C5CA 2QV7A 3EG9A 3IBGA 4P84A 5JJIA 5B1HA 1R4AA 3R0XA 2NPFA 5K99A 4WWHA 2FVXA 1ODIA 3HZOA 4X5OA 3M9XA 3RBAA 2AJ8A 4AMYA 3RWBA 4YDRA 1LVGA 1JQEA 3OWHA 2QRMA 1X9HA 3E27A 3PRYA 1CEYA 4X1OA 2LZ0A 1PNTA 1CDOA 1UDBA 5CR9A 5I51A 3RIEA 3H1EA 4G01B 3MRXA 3LCCA 3PIRA 4HEHA 4QBGB 4V1CI 2RI0A 2JHPA 3PYXA 1WUYA 4K40A 4KLNA 1UDAA 3MWDB 4TRRA 3LGAA 4QWWA 2WILA 5CCDA 3UG6A 2J8ZA 3T3EA 3C6QA 3QHQA 4OI0A 2BT4A 2O3QA 2VRCA 3B20A 3E9NA 3G9QA 3JAWA 3N6RA 4WZAB 4UJ3A 5GJVC 4XRGA 1GUDA 2G5TA 2XDQA 1OXBB 4OLFA 1AHPA 3TW6A 2H8KA 4PRLA 1KJ9A 3M6AA 4MVJH 3T0FA 3HWWA 4AZWA 4D9NA 1F8XA 4FJ0A 4QGBA 1E2IA 1PW5A 5DZSA 2FE1A 2DT8A 2XB8A 3CR7A 3JALB 4H18A 4LXXA 1I2AA 2EOAA 1A82A 1W36C 5KKAA 4KQFA 2P4SA 3OHMA 3KV1A 4XVRA 4HG2A 2I2BA 1C4OA 1WTCA 3H83A 4A23A 4XIGS 5LOVA 2DJIA 1GSAA 2Z04A 1KERA 4CJXA 2OUKA 3VJMA 4F4DA 4KLZA 4MKGA 3WL4A 3L9WA 2DWPA 1SURA 1N1MA 3B9QA 4XM1A 3OPYB 1RLJA 4DAEA 1QB7A 2ZYHA 3VPBA 2H0RA 4DDKA 3RS9A 1E8NA 2HFKA 4FMPA 1B76A 1WM1A 3X3HA 4CE6A 4P4NA 1FNNA 1TCAA 4B45A 2QVXX 2J0EA 3I2YX 3AIOA 3E3LA 2BEUA 2OECA 2C7RA 3DB1A 1HBJA 1QFZA 1Z18A 1ZN2A 3CRMA 3DHVA 3KEGA 5TEVA 3GMSA 4C5CA 4D97A 2DB3A 2GEVA 3M5PA 4JOCA 1GPBA 1UWLA 2I6UA 2INGX 3E2IA 3ZZ0A 3RDPA 3GLUA 4PR0A 4NE2A 5EUMA 5FBLB 3IKLA 2WJVA 1P7WA 1PKEA 4HPXB 3N8GA 1JAXA 4FZ5A 2ZBGA 4WFIA 1DMRA 3JZDA 4EHNA 3PK0A 5FAXA 1I10A 1HXHA 3D3JA 4ZIRA 3FLEA 4MA5A 1KEWA 2CLIB 2OWDA 5CK5A 2R5WA 3RTEA 4KQKA 4OA5A 3FXAA 4FEAA 4Q6BA 4BJHB 2D1SA 3UHPA 3AXTA 4W5HA 2UVQA 1FDWA 1PL0A 3K20A 5CYFA 5E7MA 5IK2D 4DV6B 4HEA1 4J4TA 1IDOA 3DV2A 1Z06A 4N5MA 1NA5A 1E59A 4US1R 3TD2A 3QNWA 1JLMA 3RUIA 3ZQKA 1Z45A 1I5EA 2F90A 1U11A 2MYNA 4S1VA 5H70A 1CUAA 1V1JA 2W37A 3T7EA 3UB3A 2R0QC 2QBYB 5CTJA 3TSYA 4EW3A 1E9SA 1QCCA 3GRYA 1PQWA 2H4FA 2OAP1 2P2YA 2ZUUA 4G25A 4K8RB 3MEQA 1MVOA 3OSZA 3IOYA 5CYOA 1WXGA 3ZHSA 1N1GA 1JUDA 1M8JA 3CUVA 3QJYA 3WADA 5B55A 3ZX4A 4X6LA 2E82A 1H9AA 1QG0A 4ALKA 3KOOA 2ZIZA 4CEIB 1YR9A 4KL8S 1AUVA 1T6BY 5H16A 5B3KA 3CVOA 3T3NA 4LFAB 3O4RA 4DIBA 5BT8A 4ZAFA 4ZT7A 3HYTA 1RKVA 2VYCA 1BDJA 3PUIA 4FOLA 4JWKA 4CQLA 2YQ5A 2E6UX 2GZAA 2RONA 4M49A 4FSXA 1GGJA 4ZHQF 4XD2A 5ECYA 3GVHA 4G5YA 4TM7A 2WJYA 3ZWYA 3KDSE 3HKEB 3K6RA 2X7JA 5EJGA 1FPQA 2YOFA 4FWTA 2IELA 4J6EA 1MH1A 2JLYA 1YVUA 1M83A 4Q4HB 1VMAA 5E8RA 3VVLA 3CZPA 2Z2IA 1BOFA 4BZWA 1NNI1 4QAQA 3RANA 4R7TA 3KSUA 2XUAA 1NBMA 1U1DA 2GR9A 4UAJA 4QQNA 4RDXA 4RTLA 3SMQA 5LQKA 3GFQA 4K7JA 1U8ZA 3E7WA 2CJWB 2RI1A 3P20A 3LP6A 3M1AA 1ULUA 2R1UA 5TPZD 4K6HA 4N7MA 4DT1A 4LJRA 1BROA 1W2GA 4KIGA 1G7CA 5I3CA 3QVGB 1JPNA 1XD2A 3W2EA 4BJ6A 3OZDA 3HTXA 1WB6A 4G0YA 1N7JA 3FBWA 4RM2A 3RVQA 5AW0A 1RHRA 1ZUNB 3RHZA 1CNEA 1TDJA 2HSWA 2HJGA 2CVQA 4I36A 5A4KA 4ZI5A 2YNMA 1XNGA 2WTAA 2IZ7A 3RIYA 3ZZUA 1E4VA 2AE1A 3ZJ4A 1EP2B 4LNUA 2VHYA 3SXUA 1JFRA 2W98A 2FR0A 2EZ8A 2D2EA 3LXXA 1NASA 3R7WB 1F4VA 4DY4A 3PTLA 4D26A 4XRRA 1KAHA 1NN3A 5E9AA 3PQ2A 2IEDA 2W2KA 4MUGA 3HJAA 2XRYA 4J6FA 1X87A 1RC1A 5EXDA 1FTGA 2P8SA 1JIKA 1IZ9A 3E5NA 3TCXB 5C34B 4A03A 1KDZA 4ENTA 3ZHBA 1E3DA 5JCJD 2C8KA 2G28A 3AEXA 4QDTA 4U7JA 2RGBA 4F6CA 5FBZA 3F3MA 1G0NA 4C20A 2AG1A 2MYUA 3STXA 3PEVA 1SXPA 1E61A 1R0RE 3R23A 3B5IA 4Q66C 4AZ0A 4C6SA 3MM4A 4JEUA 1VI6A 2QIOA 1CB0A 4DSOA 3NVAA 2IHZA 4GX5A 4K6OA 4AXBA 1CQWA 1DINA 1RYHA 2IY9A 5DKFA 3PQDA 1W52X 1YZ3A 1NRIA 2VBCA 1EFPA 1SFRA 2EFJA 2F1RA 3MC1A 5AMXA 2AFIA 1U2GA 5FOUA 3ZG6A 4URYR 3A4LA 4UM9D 1J99A 2HMYB 1OFVA 4NKRA 3C1TA 1SXJC 3IUYA 3WAKA 5FCDA 1KYVA 3DMTC 4NFHA 1DBVO 3TUIC 3WLPA 2G08A 1RYBA 1FMLA 3LFHA 4Q19A 5KREA 3VDMA 5LYJB 1GKYA 3D4BA 1JSXA 1FPMA 4FGSA 1JDNA 3BB1A 2BGIA 1JRLA 4I9NA 1Q0LA 4RLHA 1CEQA 1RTTA 4DG9A 2C9YA 2RJNA 2X0IA 1KH2A 4QYXA 4Z4HA 2D4HA 2O2ZA 3K8OE 2WG1A 4Y2JA 3KFXA 4C3OB 1I6LA 3A1TA 4CDMA 5E1MA 3RF7A 3K6JA 1F0YA 5F73A 5JIBA 1FMFA 1CEEA 4J2OA 4QRHA 4F2DA 3KZKA 3FMGA 3Q8KA 5FLKA 3CZAA 2RIPA 2BI8A 1ZCBA 1JDSA 2CXPA 3AHFA 3QYFA 4NV0A 2C5GA 4JVOA 3T9CA 4BVJA 4EYEA 3ZOZA 3VYWA 5KJ1A 1RCUA 4JJ6A 3PWZA 3UAZA 1FVOA 1IL0A 1H6DA 2WYIA 4UKDA 4X7RA 3ZUGA 1Z6PA 2PPLA 2P4QA 5FJIA 5IN5A 1YDFA 5A5VA 1SXHA 2Z5LA 4YS6A 3IAXA 4W5NA 3PU6A 1Y3FE 1UQTA 3NH9A 1BWPA 2E89A 3IERA 4O3FA 3ETLA 1EHYA 2O8CA 1DE0A 2PXAA 2ZT7A 3WKCA 4NG5A 2XE7A 2RK4A 1XEXA 3DTVB 1WNFA 1CIPA 2ZU0C 1N2OA 1JJVA 1L5FA 1QTIA 4B17A 5J2UA 1IXKA 1K8XB 3MCTA 1U0GA 2JANA 1M10A 1NDHA 3OBBA 4BX3A 4E0BA 3KQUA 3DZDA 3AW8A 3L7LA 3KT3A 1JDUA 3L1JA 1LSJA 3R5HA 2IUFA 4OXYA 4PZLA 1L7MA 2W9XA 3L7CA 3PGKA 2HL6A 4BV3A 2QY9A 2X0KA 3NHJA 4M9UA 5H3CA 1R74A 1M6NA 1K6XA 2FZVA 3FI0A 2PL1A 4TXMA 5EJFA 4D02A 5KJ6A 3K9GA 1OWOA 4AJEA 3A2KA 1ADJA 3NHSA 4HLDA 1Y81A 2UZ0A 3HS3A 4KZPA 3A3PA 2W8BB 2QT9A 3ILXA 5B53A 4Z7NB 1FW6A 2Q5HA 4BASA 1A8UA 4WXMA 1Z5NA 2OXTA 1KE1A 4ENUA 3ELUA 4JBHA 1ZUHA 1YOBA 5AJHA 1H0RA 3H0EA 4BUJA 4B47A 3EQ2A 3R5KA 4FFLA 3SIWA 1TYBE 4AM8A 1YNOA 1QHGA 1EP3B 2X0DA 2AMYA 1K5GA 3NJRA 1EVJA 3KL2A 4F4FA 2FFHA 2C0QA 4G1FA 4HQOA 1TAUA 2BDEA 3Q5DA 3SF8A 3S2SA 1VJDA 3EWAA 4AG6A 5L6MB 3M1IA 3GEHA 4RACA 4X62B 1LH0A 5IDXA 4RTPA 1SUBA 4AP9A 2OYCA 3VRHA 1HPLA 4A9AA 3T7SA 2QLLA 2FFQA 1T5LA 1E3WB 1DU4A 1T3TA 2C59A 2R7KA 2FZWA 5DLYA 3IDQA 1PQPA 4X8LA 4RMNA 1USUA 2EW1A 2LCIA 4UHDA 3KTFA 3OF5A 4B6PA 3MTBA 3DBRB 1UM9B 1TPYA 3NOQA 2I6XA 1YS7A 3GWZA 3HJUA 4HAXA 1JLKA 4X3PA 3WB0A 4CDGA 3F9CA 3NYWA 3TKYA 4PY2A 1X7WA 1OWMA 3QUQA 1TEHA 2PXCA 5T6MA 2J9ZB 4JELA 1IM8A 3ANNA 4AYTA 5JJKA 5F98A 3L7JA 5A7HA 4WK4B 4FQ5A 2IEZA 3L7BA 3TRHA 2PPVA 2W22A 2YW2A 3K0SA 5EE1A 1OSNA 3ZLVA 3D7SA 5LP6F 1ZYUA 3PRKE 2FN7A 1JXAA 3Q3JB 3CJRA 3K09C 4GYWA 4PNHA 4F4IA 3ZVLA 1IK4A 2GRAA 2HC9A 2WWRA 2EWVA 3W8RA 4L3OA 1YUNA 5JQGF 1RU3A 1LBIA 2WZCA 4WXPA 2HQRA 3PFIA 2EKBA 1QYVA 3UYLA 3ESRA 1X0XA 1GCAA 3QUSA 4L9WA 4OO3A 1I5RA 2MMGA 1Q15A 4YMSA 4ISCA 1YOVA 4PPGA 4D74A 3CU5A 3ZXIA 4S3MA 3IV7A 3HYSA 3REQA 3LTEA 2FA9A 1EVKA 2GXUA 5CDHA 3AZQA 3G82C 3C8HA 1UFVA 1KDRA 1U8AA 2ZRFA 4I55F 2HD4A 1FQOA 1ISRA 3QE9Y 4E5VA 3USZA 5ADUS 4FX2A 4Z6KA 2WU8A 2O8DB 2W4QA 3UH1A 1M2WA 1WR8A 4GZ3A 4FQ7A 1GPYA 2QN3A 3E8SA 4JQCA 4H1WA 3QKSA 4MV0A 5B1YA 3ONVA 1DRKA 3L46A 1L4UA 3KSMA 5ALKA 3OFVA 4DLNA 2JGKA 1ZJ5A 2WTMA 4Z5XA 3RJ5A 3N2KA 2VHTA 3U9SA 4CTOA 3OG9A 4H17A 4KXNA 3VR5H 4JI4B 3MJCA 2FHSA 4DSTA 3OTOB 5EXPA 1OU0A 2RH8A 4ZMRA 5LDDC 4W1RA 2ERXA 4RPGA 2C9MA 2JPDA 1R37A 1NF8A 1VHTA 4UHHA 1P39A 3UJHA 3WP1B 3UWMA 2FZ4A 4ZT6A 1ZNZA 1Y89A 2D5LA 3DEIA 2DYKA 4WQMA 4GR5A 4HH1A 3E4DA 1O6FA 3ESAA 2OZPA 3Q11A 5EHNA 3C39A 3I5XA 4PWZA 4DREA 4EWLA 4F1WA 1S3GA 4KFSA 2ZAOA 3KBBA 3T5PA 3IIJA 2EW8A 2DFNA 2YXBA 2VSNA 3Q9SA 4LZOA 1N5DA 1FJGB 1LY1A 3NIWA 3HCAA 3V8PA 5EFZA 1AC5A 5MDHA 1ODFA 1QK5A 2BFEB 3QH4A 4LRXA 3CRQA 1IHPA 1YASA 4OB6A 1TZ2A 1DMSA 4IZIA 4IX9A 4PZDA 3LL7A 7REQA 4QARA 5DBIA 4CIXA 1H2EA 2LW7A 2PRSA 2ZTSA 3Q88A 5REQA 3EEFA 4GBGA 4Q3BA 3GJ7A 4UZFA 2IOHA 4EG3A 4D99A 3P97A 3U0BA 3AYZB 1PD0A 5JSHA 2OFWA 4GPTA 1D2GA 4H7JA 3TF5A 1JA0A 2R7MA 1ZCZA 2E21A 2Q5QA 1SQ6A 3NP9A 4F3KA 1RZUA 1GQRA 4BWGA 2BFDB 1J8QA 1A95A 3KYDA 4IDDA 5ALQA 4P4SA 3ZGXA 1IAVA 1YS1X 2QRPA 4J4HA 2DFVA 1BH2A 1RPTA 4YH1A 1Y82A 4H4EA 3H9CA 4RV4A 3KHTA 3OIWA 2N46A 3GRAA 4IIHA 4XIYA 1W0KA 5LLDA 2PSFA 3KLNA 5ARCA 5JZSA 2J7PA 3V1TC 3TXXA 1AN9A 1DPGA 1G55A 4KXWA 1OI2A 5H68A 1PQ4A 1TEXA 1OE0A 2ETVA 3QQPA 4YCLA 2WJIA 1T4DA 1XJCA 3VH2A 1HURA 1U7XA 1QYXA 1X80A 2AG0A 3P2KA 4MV7A 1GQOA 4O02B 5H9VA 2ZB4A 1KETA 2XXAB 3EN0A 2WUEA 2XOXA 4CTJA 2YV1A 2GCIA 4C04A 4HVCA 5JXGA 1YAHA 1KI2A 4NECA 2YHIA 4FLMA 5ES3A 1HT2E 4FC6A 3PQ5A 4HSEA 2OOKA 3FBTA 5AKIA 1ML4A 4F86A 2GK3A 3SEQA 3WTCA 4C89A 1K0UA 1TM5E 1J25A 1W4BA 2Y1LA 3OJLA 3PEUA 2YY7A 4DJTA 4YT2A 3HO1A 2OQRA 1IN4A 2QL6A 4Z0HO 2H2FA 1LS1A 3OCJA 4IOJA 5KVSA 3QI2A 2FSIA 4KW7A 2BF4A 3V1LA 4DZZA 1FFCA 3LPDA 5KEIA 4IHJA 4F7DA 5EL0A 4ALMA 1Y0BA 3C5HA 4L5BA 2IL1A 3D6NB 5CEEA 2BHTA 2R66A 3T7AA 1TJ5A 3FKSD 1BMTA 3IX7A 4L9SA 4WKOA 3TLBA 3ZWQA 5IC4A 2WTXA 4GMDA 2Z3WA 4HDCA 2WNHA 1Z13A 3TNYA 5JJLA 2A33A 3M1LA 3WWEA 4HFNA 1EU1A 5DCWA 3UHAA 1G8FA 1X14A 4NZPA 4LTMA 1SD1A 4H35A 3TOCA 1PT7A 4ZWNA 1C7EA 1WO8A 1G291 1YDMA 4HXGA 2KMLA 3E3MA 4BLQA 5IUJC 1VA5A 5A9RA 3DEAA 1NI4A 3KVYA 4UBJA 5CVCA 3HGTA 4OBXA 4FDVA 2RAFA 1ENPA 1LLCA 2OKCA 2XNDD 2EARA 4B40A 3K1JA 4RTKA 1UPCA 4CKEA 2GJAA 1LDNA 3WX0A 2V0NA 2NU6B 1C7IA 3CVXA 2JG3A 1X1TA 1PVOA 2GXAA 2ZBRA 3DL7A 1XTUA 2QTZA 2I3ZA 3JQ8B 3NYIA 2RE8A 1ZGBA 5TQJA 3WGMA 4A2QA 3KQPA 4FS3A 3EPKA 3HUEA 5DNEA 3VU1A 4YCJA 1AS2A 3RC3A 3MUFA 1FFEA 4TTRA 5CVJA 3OEYA 2WJ6A 5J58A 1TF2A 1XP8A 3A9TA 5LUBA 1YHZA 2W2LA 4O25A 4PAOA 5AJZA 1SVMA 3CNOA 5FBWB 3KQOA 1OKKA 5BSWA 5LQMA 1NURA 1UKEA 1VPWA 4ZZIA 5LJLA 5EWJB 2WWVD 4XEHA 1F3OA 3PC3A 1R10A 2CXHA 1O87A 1F2UB 4HWOA 2DC1A 2IE0A 4IIGA 4RY8A 2PLNA 2O0KA 3UT6A 4C4OA 1C3VA 1U7OA 1U80A 2BZSA 3DAYA 3I6MA 1H1LB 2XCRB 3BFJA 3HHPA 3OIYA 3KVNA 3MSXA 4RWEA 5DBEX 2ZIWB 4NMMA 2KHZA 1QIFA 3VNAA 2Q29A 1KI4A 4MQ4A 1WA5A 2ZREA 4DGSA 2E5FA 2PL5A 5BSTA 4YT8A 1C3OB 4JT2A 4RWZA 5ITZB 1ATZA 4LOKA 4E31A 1MMFB 2VWGA 3V46A 1W85A 4P6VF 4DB2A 4QQKA 1FDVA 4AZTA 1T4CB 2O52A 3IHTA 1T3ZA 1TFUA 2PRJA 3W5HA 2WF7A 4D56A 1PUJA 1C8LA 2J9FB 4Z0PA 4XYLA 5CFZA 3BZUA 1EFKA 1XU9A 2MMCA 2FCAA 4GZ6A 5IUNC 1BYIA 1IXYA 2CHQA 3BXGA 4IPTA 4LHSA 2R3SA 5ECGC 2AVDA 5HPYB 3FRJA 5I9SA 1T9HA 1ILWA 3KQKA 5AKHA 1TA4A 1GEGA 1XDUA 4IIEA 4DFDA 1FDRA 1GVNB 1W93A 3COJA 2YR0A 3ANSA 5FBRB 3I58A 1DJNA 1DEHA 2Q8NA 3FUCA 2NO7A 5K45A 2ZRAA 2CLDX 2DFDA 3P9XA 1CBUA 1P0QA 4R8SA 4XWKA 2BFCB 3BSYA 3R20A 6PFKA 2CDCA 2A0KA 3GLHE 3R76A 2J7KA 3RRXA 3VFDA 3VR5D 2AMLA 4WADA 3OAAD 4EI8A 1DC6A 4QLBA 1ORIA 4IRUB 2PV7A 1T1EA 1TEZA 4EY7A 4HB2A 2GESA 2XWJI 5KOHA 3TPZA 2QTTA 3L1IA 5DDIP 1P6UA 4XX0B 1IN1A 3KCQA 3ZDQA 2X58A 2QL5A 4JLUA 4ZCMA 5T67A 2Z09A 5L7TA 2YFQA 1KYTA 5IHPA 2PX2A 4O33A 4LF6B 3NYQA 4RABA 5CGZA 2VRNA 3ISJA 1XMQB 1N34B 2WP8J 1W0JD 2OTCA 4HB4A 3VOSA 2WIGA 1P3Y1 4HC4A 3JD1A 1MOQA 3NUQA 2GZSA 3RHSA 4XWWA 2Y0BA 3MWGA 2CCGA 3DW1X 3IMGA 4Q1BA 3T5MA 2VPTA 5JW6A 3U16A 2R97A 2C96A 3IVXA 3OU6A 3ND6A 3LF1A 3OE4A 3PEFA 2XUIA 1J9GA 1BHJA 3I2IA 4JUBA 4RDIA 5IW8A 1ZA2A 4C3UA 2YN4A 3GLGB 1MO2A 4NZMA 3UZUA 1E0SA 4KREA 2ZIUB 3AGPA 3TD6A 5CA1A 2JFBA 3AUAA 1YR1A 1TF7A 3H9GA 1EIWA 4XB6B 1X77A 1VHQA 2W2PA 5E2BA 2C92A 5CDUA 3EW7A 3OLWA 1A4UA 2F62A 1IVSA 1BW9B 3W06A 5CX1A 2VLIA 5AI9A 3OLCX 4X3CA 5HF9A 1QCYA 1RACA 1Y3DE 2BGRA 1C1HA 1GU7A 2FWMX 1P29A 1FTWA 1PSDA 3D6HA 3QUCA 3ZI0A 3ZY4A 4E2FA 3O8RA 2Y3IA 5FNVF 4F45A 1S4QA 3N9IA 3NAGA 4G81A 4KUEA 4L0MA 5F4ZA 1EKXA 3CVWA 4M8IA 5A9SB 1ECFA 1IG3A 4QBFA 2P9JA 5LMZA 3I2GA 2IQIA 2VXYA 1A27A 1L4MA 2H1RA 4NBKA 4Z0NA 4A3SA 2XNCA 4B7XA 1UQRA 1SKUA 2AEJA 3WJ2A 4B09A 3GG2A 1E9CA 3D7LA 1RVV1 2BKLA 3V9PA 1M7BA 3GQBA 2EBWA 3FMOB 3FI9A 4MKXA 1GUYA 4UMVA 4AUKA 4D0GA 4JZYA 3TVYA 3JR7A 1F8GA 2IXFA 3CKMA 3AR7A 3QKRB 5IK2A 4BUCA 1C8BA 1YDWA 1P1JA 1K92A 3V6MA 2FEKA 1ZK4A 4MP6A 1ZJ6A 1ZISA 2BE7A 3L7DA 2PWPA 2VUTA 4A4DA 1WV1A 3LZCA 4JT9A