1QHNA

Chloramphenicol phosphotransferase from streptomyces venezuelae
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
178
structure length
178
Chain Sequence
MTTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKESIECAWAIAAHVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CHLORAMPHENICOL PHOSPHOTRANSFERASE
publication title The Crystal Structures of Chloramphenicol Phosphotransferase Reveal a Novel Inactivation Mechanism
pubmed doi rcsb
total genus 53
structure length 178
sequence length 178
ec nomenclature ec 2.7.1.-:
pdb deposition date 1999-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07931 CPT Chloramphenicol phosphotransferase-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1qhnA00
5FOUA 4OK6A 2FV8A 2NZ8A 2BCGY 5JLJA 2LKCA 4JBXA 4NCKA 1E6CA 3RS5A 5HR5A 1GILA 2VBCA 3O47A 3QBTA 2VO1A 5DI9A 2IYZA 1WP9A 5HE8A 5GJBA 1P2SA 4G5RA 4OI1A 1YRAA 1E9SA 2AL7A 4Q47A 3P27A 1QHYA 1XXHA 2IHYA 4PHFA 2ZETA 1GVNB 3QSYA 4DCNA 2YINC 4NYJQ 1U8AA 4NZYA 5EXXA 2EWWA 3IHWA 2UZIR 1HEIA 3GLFE 5BXQC 5KPJA 1DAKA 4BFSA 3EASA 3QXXA 4KYIB 4A8JB 3PUYA 1CJTC 3NBYC 1UDWA 1ZIOA 3GJ5A 3LRPA 4RVCA 2QG6A 4PHTA 1G3QA 4IDOA 4ARZA 1U98A 4B3BA 1E4YA 5FTMA 3ZYCA 2Y8EA 2X8AA 1SHZA 5DSZA 5CLLA 2JASA 5JI3E 4KFRA 4K81B 2WZQA 4CVNA 2V3CC 1UKYA 4C0BA 3EZ7A 4LPSA 3KB1A 2NO6A 1G41A 4RD6A 4FI3C 3D6TB 2WOJA 4IFEA 1DADA 3C7KA 1T0HB 2VHCA 4BRUA 2A7QA 4OHXA 4RFSA 3A36A 3V4FA 3Q5DA 2GWHA 2VP5A 3L2OB 2YC4C 3GP8A 4M22A 2ZI7A 2IYYA 4UNPA 4HUTA 1GOTA 3HYTA 4F4CA 1Q1BA 4TL7A 3LNCA 2ZRPA 1NBMA 5EUMA 3THOA 1G291 2DFTA 4US1R 4HB0A 1PVOA 2ZI5A 1UAAA 4LV6A 4DLTA 1Q1QA 2K5UA 3QXCA 1ZYUA 4QNRA 1DG1G 1W5TA 3HU2A 5DN6D 3AM1A 5JHHB 4AY2A 2VF8A 4LBVA 3O8DA 4R2IA 2HDNB 2QU8A 2VYFA 3F3YA 4Z1MA 4JLAA 4BZQA 1OH8A 2NO7A 2ZRLA 4OBEA 1W0KD 1G17A 2ZYUX 3A37A 5AK0A 1NLYA 1ZJ6A 4D0LB 2TMKA 4EAQA 2A5GA 3IPXA 4TYQA 1XD2B 2F1HA 3PUWA 3SBDA 4JLJA 1ZD9A 4UXIA 2IS4A 1CRQA 3D7MA 4P0TA 3CPHA 3U7HB 2EYQA 2Z0MA 1DELA 2HCJB 4POAA 3GLIA 2HXYA 4K8OA 1G8PA 3IBGA 1M7BA 4KLNA 3PUZA 2Z4SA 4S35A 2AWOA 2DFLA 4KCGA 4A0HA 2XGJA 4CDGA 4HYYA 4JT2A 4QHSA 3WHKA 2WPDD 1R0WA 2JA1A 4U00A 2ZRNA 3WYFA 4A82A 2XNDA 3PENA 4BFZA 4F38A 4NCNA 3T1TA 1UBGA 1XJQA 3SYKA 1X8LA 2BC9A 3R9IA 4NPHA 4B6FA 1FTNA 2QY9A 1Q57A 2AK3A 3RRZA 2QORA 1EX6A 1SXJC 2IWRA 2CBZA 4MGZR 4D80A 4YQFA 4TMVA 2C77A 5IK2D 2IUSA 4D26A 1XEXA 3OEED 3QKSB 2WWHA 1U9IC 1OXTA 2A78A 5KYKA 1EFHA 2R6GA 1OXVA 4JL5A 2BV3A 4DSNA 3B1YA 4LK2A 3ZJYA 3QIAA 4HATA 1R10A 2ZI9A 1BOFA 4JLMA 4Q01A 1JEDA 3BH6A 4JL8A 2H8KA 4CT4B 2GILA 4BPBA 2ASEA 1SVSA 4O2RA 1G4AE 1Z47A 4TMZA 5L8VA 1VECA 4JVLA 3DZ8A 3K0SA 2WSMA 4L5BA 3VR4A 4LJAA 2F3RA 5AWFC 5GVRA 3T35A 3ADBA 1DAFA 4HDOB 4DEXA 3DKVA 1P2VA 2H18A 4D4LA 3UKDA 1Q3HA 2GNOA 1FTSA 1E0AA 1E2GA 3IEUA 3LX5A 4Y0VA 1E32A 1U90A 3SQXA 2A3RA 3ASZA 4AYTA 3ONWA 3U3OA 2PZFA 2NPIA 3BORA 2BIFA 3TUIC 5DN6A 4TQ9A 3I61A 4IXNA 3MMPA 5EE0A 3T5DA 5J47A 1AS3A 3BC1A 4PC2A 2IXEA 1SXJB 4M1TA 2ZE6A 2C9OA 1TADA 5HCNA 2DWPA 5TDHA 5KUTA 3C14C 1G9XA 1Q0UA 3UG6A 1G8YA 2AWNA 4FMCF 2C03A 2FF7A 2HT6A 2H5EA 4DZZA 5BN3A 1HT1E 1OIVA 2A30A 2LWIA 4LUCA 1EXMA 4P4SB 1ZM7A 4KFSA 3B60A 3T34A 2HJGA 3OF5A 3PEWA 1EFTA 5FBVB 3QEOA 2KJQA 1N2CE 4TL8A 3ZD6A 3GCGA 3SFVA 1IXRC 5FUXA 4G5OA 2C95A 3AGQA 4HDQB 5TXGA 2J7PA 1BIFA 2PT5A 5EQTA 3LLUA 3ZVLA 4EJSC 2NPFA 4Z8XA 4Q4HB 1OHHD 5LD2C 3SZRA 2QMEA 4I1VA 2WPDA 4TMTA 1M6NA 2CHGA 3CF2A 1TUEA 5FOXA 2XJ9A 1U8YA 4M1OA 3VHXA 1JR3A 2IK8A 1YR7A 4PC3A 1L8QA 3Q7QA 3GQBA 5J4HA 4IXMA 4LV8B 3CH4B 1PLLA 3K0FB 2PCJA 1FP6A 2ATVA 3QF4A 2ZJOA 3CRMA 4QM6A 1XEWY 2Z5FA 3RYTC 2GAAA 1J8MF 1NMXA 2OCBA 2JATA 1M7HA 4Q7KA 4TN1A 1BYUA 2GF9A 2CXXA 2WIBA 1Z0AA 1Q21A 1VIAA 4II7A 1E98A 1QHXA 2ONJA 6Q21A 3CNOA 3TSOA 4US0R 1F6BA 3OEEA 4KAXA 1R2QA 1UFQA 3LX8A 5CDFA 4IVPA 1W4AA 4URZR 2OCPA 3FTQA 2ZSAA 3ADDA 2R6DA 4R7ZA 2KI5A 4NCIA 5DGXA 3KXLA 1II8A 5H70A 2XZOA 1PLJA 4JJKA 4TL9A 1KYIA 4G5SA 4XSHA 3DPUA 4YXWD 4KXFB 1HY3A 2CLCX 3VQTA 1M1YE 4TTQA 1O3YA 3RWMB 1PZNA 4B3CA 1KO5A 2ODEA 1DO2A 2RGAA 1YU9A 1YZKA 3ZZ0A 3UWKA 2EFDB 4EJSB 5J4YA 2NGRA 4PQRA 1W2HA 2V4ZA 4PZLA 4EQ6A 1YZGA 1G64A 2XEXA 3GJXC 4B2PA 5G41A 5AJXA 4B34A 2JLXA 2ZS9A 4JYBA 2QAGC 2ANCA 5P21A 5KOYA 1E0SA 2P6UA 1IN6A 1E9BA 2F1RA 3GFPA 4KLZA 2FPKA 3WYGA 1E9DA 3KQLA 4QBGB 4FWIB 3W6PA 4CEIB 4RKFA 1E2EA 1MRNA 1NVVQ 5HPYB 1VIYA 2C78A 3A58B 1E79D 3D3QA 1W4RA 1KDOA 3PV0A 3VHLB 3KXKA 3LXXA 3VR3A 2ZJ5A 4IEEA 1M8PA 4R98A 3UMSA 3R7WA 5C46F 2PLFA 1KZGB 4GOXA 1G3MA 1T3LA 1OB5A 3B5JA 1II0A 5KHOC 3OFND 1SKYB 3IIJA 1KI1A 1J7KA 3KX2A 2QT0A 3SS8A 1RJ9B 1YVDA 2OFWA 2Q21A 2IYQA 3V00A 2Q9CA 3AF1A 4OK5A 3PVSA 4O25A 2VF7A 2ZS7A 5JCZA 3U44A 5LB2A 5LBIA 3NKVA 3FKSD 4MH0R 2C98A 2R2AA 3AKEA 5KSZA 2ZS8A 1G4UR 4ON9A 4P33A 3H2YA 4S2EA 3VU9B 2OHFA 4MKGA 1W4BA 1QVAA 1MT0A 1F5NA 2MMCA 3NWJA 1TU4A 2GJKA 1DAHA 1EFRD 2QAGB 3BD9A 2G88A 3RS0A 4B48A 1MKYA 4NP6A 2QE7D 3OESA 1IY2A 5KSOA 1ZM4A 1IBRA 2O0HA 3NDBB 4OJQA 5E7JA 2HF8A 3GPLA 1D2EA 3NDPA 1MO4A 4ERNA 3VMFA 1KSJA 2OBLA 2WWFA 2BM1A 2ZAMA 4PAMA 1BMFD 3U3KA 5EXPA 3BS4A 4D0GA 1RVDA 3SE0A 1KJYA 1GRRA 2ZJZA 2FFQA 1X1RA 2I4IA 3T1QA 2BOVA 1XP8A 4V03A 4QJ3A 3AF4A 2A9KA 3B6EA 3KB2A 2GZDA 3K0AA 4A4DA 4G01B 5HZKA 1T8TA 2XSZD 1G8HA 2ZU6A 3K9GA 3QXJA 2IS1A 2QTFA 3PG5A 5EP2A 3B1VA 1XXHB 1SGWA 4FXPA 3OZXA 621PA 4FN5A 2VSFA 1XJ0A 3BH0A 3Q3JB 2YWHA 1H8HA 2Q9BA 4HAVA 1E0JA 4NCHA 1N0UA 3AQ4A 5FOTA 1S9HA 4PC7A 4A92A 4W5WA 2OV2A 3N70A 2J1LA 2GVDC 1E79A 1FFHA 1P6XA 1CBUA 2CE2X 4M2LA 5GVSA 4QNMA 4R9UC 4DB2A 1S4QA 1XZPA 2OFXA 1IQPA 1G5RA 2P6NA 3TKLA 3TSZA 1N6LA 2GXQA 3OFNA 1FP7A 4OQLA 4Q1BA 5AUQA 4MKFA 1XTRA 4FD2A 4QG7A 4V0OA 2FSIA 3PR1A 4DLXA 4V0ME 2QQ0A 2IYVA 3BERA 4PSVA 1KI2A 4C0KA 1GKUB 4U02A 3C41J 3I5YA 1E69A 3OE7A 3OIVA 4LC0A 1V5WA 4RFSB 3TIFA 5JJLA 3AF0A 1JALA 4DLVA 1KNXA 4A15A 3MAAC 2YOHA 1OSNA 1XTKA 1XCMA 2CMKA 1UKVY 1YR8A 2F7SA 2FGKA 2WVJA 3OAAA 4LBZA 3X1YA 2CL7X 3A4MA 3CLVA 1S2MA 2FEMA 4DLZA 4F4JA 3W34A 1XTJA 3MCAA 5DLQC 4UNRA 1OKKA 2BMEA 4IVRA 3PEVA 4X8OA 2BBOA 2QN6A 2RGNA 4GMXA 2J0UA 2QENA 3VKWA 3U6BA 2FSFA 1Z8FA 5C4MA 1N6OA 3HP1A 3REGA 2B8TA 4WZAE 1TQ2A 2P65A 3T12A 4RSGA 1S3GA 1KI7A 2FN4A 3ASYA 3LO5A 2XB4A 3KDSE 4HLUC 2XX3A 3H1TA 5BW8A 1OV4A 2RAPA 3M6AA 4JLVA 2IYLD 4EIWA 3NVAA 5L3QB 3W90A 3EPHA 1EG7A 4HDCA 2WWIA 3TAUA 4XOIA 2X1VA 2J59A 1Z28A 4Q00A 2GEUA 2YZ2A 4IJMA 3IO5A 5FFMA 1CIPA 3EW9A 3TH5A 4B44A 2A2ZA 3TJZA 2RMKA 2ZQ5A 3GLIB 5DO9A 2VP6A 5F2EA 3QQ5A 4WXPA 1NVXQ 2GAOA 2XXAA 3EWSA 3B85A 3EG5A 5K8UA 3GJ7A 2QSYA 1U0JA 1RRGA 1JR6A 1Z0DA 1WCV1 4URYR 1N5LA 1ZU5A 5CM8B 8OHMA 3WP1B 1UPTA 2GHIA 1UJ2A 1K5DA 2FA9A 4B43A 4R71A 3T61A 3KQNA 1XPUA 5AJVB 4DB4A 2JJ2D 1TQ6A 1VG9B 3GJ8A 3C16C 1JXOA 4DLUA 3L43A 4OHWA 1NVWQ 1CS4C 3GLGE 3Q5EA 2C2HA 4IEIA 5K8TA 3U6KA 4BLOA 3EA5A 3SI7A 3S1AB 1XEXB 2NZJA 4UNSA 3RSLA 4JSTA 5SZIA 2BKUA 4OI0A 4BFYA 4ZKEA 4ZDJA 2PLRA 2NG1A 1G7TA 3B1ZA 4Q1DA 2BEJA 4D81A 2ZRFA 2WMNB 2ZYWX 1QG4A 2E9SA 1SVIA 4OK3A 4Q1FA 4Q66C 4JBWA 5EZ5A 4C0SA 1TL7C 1CR1A 5B64A 4L15A 1NNEA 3R20A 3E1SA 3DO6A 1NN1A 1ZC4A 3HPRA 3X1XA 3QKRA 4PC1A 1DAGA 4CEHB 2Q6TA 3NEJA 1G3UA 1TAGA 1A82A 1BS1A 1AS2A 1GNQA 2X2EA 4LBWA 2B7BA 3LFUA 1N5IA 4QBHA 4W7SA 3LVRE 2QSZA 1X8JA 5EP3A 1M74A 1QHNA 3KFVA 4DDVA 1XD9A 4QJ5A 2ERXA 3GD7A 1JQJC 2ZUDA 1P5ZB 3CRVA 3B1WA 1RC8A 1WF3A 4XSGA 2V8OA 4TYPA 5B30A 2ZE7A 3EA0A 3MD0A 4QBIA 1OFIA 5F9HA 2VH5R 3L8ZA 1OJLA 3AF2A 1KKLA 1N6RA 3D8BA 3GLHE 1WMSA 4LJ8A 4NONA 1W36B 5BYJA 2VP4A 3DVLA 3FMIA 1G5PA 4QC2A 2PJZA 2P5TB 4EFLA 4BFTA 5EUQB 3IIKA 721PA 1U0HC 3BB1A 3LH5A 2EW1A 1ZINA 2V6IA 2AHOA 4TQUS 1XEWX 1VPLA 3T1VA 2QAJA 2CVHA 4TSFD 1Z0IA 4OQXA 1NIPA 2AFHE 1B23P 1QBKC 2R6AA 1L2TA 2R6FA 4MRNA 4QGFA 1Z2CA 3ZZTA 5DE3A 2KB0A 4NYMR 4QKQA 3AKCA 3O8CA 4BASA 3W6OA 1OH6A 3QKUA 4C0LA 1E2MA 2JLYA 3A1SA 3L8YA 3B78A 2ZITA 2KSQA 4Z51A 5JECA 4WIAA 4DDUA 2QEQA 5E95A 1AN0A 2QMHA 1ZM3A 4C7OA 2VEDA 4A0RA 1P7CA 3WMFA 4XH9B 1R5OA 1FOEB 1IM2A 4N3NA 1WA5A 2PZEA 4XIGS 5BQ5A 3FPAA 1VKJA 2FNAA 4LOAA 5AJYA 5H1YA 2DFNA 1WE2A 4N0DA 2BMDA 2RCNA 1R5NA 3MSXA 4LY6A 3KQKA 2HLDA 3IDQA 2IXFA 4RCYA 1C4OA 1XNJA 4A2WA 3THYA 3K09A 2ZU0C 4JLBA 3QF7A 3KKQA 5F98A 4M1WA 2ZR0A 2H7VA 2ZM5A 1KK1A 1W49A 1PUJA 3IHLA 2OESA 3U3MA 1P2UA 4RZXA 2OFOA 4AYXA 1KI6A 1ELOA 1ZBDA 2GCOA 2QUZA 1UKZA 3CONA 4FCWA 4DSUA 2QRNA 2C99A 1QHIA 2W6IA 4WOPA 2H16A 4V0NA 4V0MA 2AR7A 1YZLA 3CW2A 5JJKA 5CJPA 4ZDKA 1M7GA 1J8YF 2BCJQ 3P20A 4TLCA 2FSHA 1D6JA 5TB5A 2QMUA 2O8FA 4HAXA 1ZAKA 4PHHA 3SR0A 2E1RA 3IUYA 1Q12A 1GAJA 3O8BA 4LZZA 4ABYA 1KK3A 1OF1A 4HLDA 1W7AA 4A36A 2ZRGA 3AH8A 3R7WB 2VHQA 4BGDA 1Z08A 5DH9A 3AUYA 2AKAB 3SJCA 1ONBA 1YZUA 3KKOA 2Z43A 2A5DA 1TU3A 4DSTA 5KNBA 2AD5A 2HV8A 2IYSA 3P1JA 2JLZA 2PMKA 2ZJBA 1DARA 1TF2A 2ANBA 2IYWA 2J5XA 4D25A 3K53A 5DI3B 4ZPXA 2ZRIA 4B73A 4GI7A 2FOLA 4C0QC 3CF0A 3DM9B 1F2UA 1VYUA 5D3QA 3TLXA 5BN5A 2DB3A 3LQQA 2FX3A 4PC6A 1GG2A 4WXRA 4NH0A 2RGEA 3U44B 4DEYA 3SBEA 4GP6A 3RC3A 2H57A 4TSFA 2CHQA 4O2LA 3PIRA 2C96A 1E0KA 4KVAA 1XPRA 2G77B 1D5CA 1MH1A 2ZE5A 4M9QA 4W5JA 4ASUD 4M1MA 1L7VC 1TEXA 2ATXA 4KHZA 1W4CA 5FPHA 1Q1EA 1J2JA 4DUGD 2ODBA 2V9PA 4D4MA 3AF3A 2FG5A 5TV2A 3PJRA 5EE3A 2YJTD 3C5HA 2IWHA 3A8TA 3W3AA 3Q9LA 4V02A 2EFEB 3VTKA 1MO5A 3D31A 4X8MA 2CCKA 2FDCA 3X1WA 2RGXA 1S9DA 5J4KA 3KKNA 2BMFA 4TYNA 4JT4A 2CVFA 4JZKA 4BLQA 2V1XA 2ZXUA 4ZCIA 2V1UA 1HH4A 4OQNA 1Q22A 3B9QA 4D0NA 2O8DA 1Z0FA 4MDEA 4H1VA 4Q9JA 2OUKA 2WWXA 1UDXA 4B2IA 3ECCA 3GLGA 3THXA 2P2LA 5D3MB 1Z83A 1G19A 1VG0B 3K0AB 2GJ9A 5JSZB 3ZVNA 3PFIA 4L16A 2XTNA 3CM0A 1E1RD 4M9SA 3PCRB 1UBFA 4XD7D 2ZVQX 5TMPA 4XVRA 4LX0A 4DVGA 1XBTA 3A4NA 5G3YA 1QF9A 2ORWA 2BEKA 1RW4A 1NY6A 1AQUA 4OI4A 4Q4AA 4P31A 3CX7A 2AN9A 4GNKA 4ESVA 1CP2A 2IT1A 4UJ3A 1KMHB 2CJWA 2DY1A 1EESA 3MUFA 2IYTA 3RWOA 2AK2A 1FQKA 1OXSC 1G18A 1LNZA 1E9CA 1NKTA 2YWFA 5EXSA 3RS3A 2B6HA 2G83A 1OLOA 3RAPR 2F43B 4OYHA 1VYTA 1SULA 3BAFA 2YV5A 5CK5A 3JZAA 4RD0A 2OLJA 3A4LA 3OIUA 1G7CA 1AGPA 1I4TD 4TWZA 4RY2A 2O8BA 1RYHA 4RD3A 1YQTA 1AK2A 1Q20A 2CHVA 1V43A 3GJ0A 5DIFA 4YC7A 1CRPA 4YLGA 4BQSA 4MKIA 5JEDA 2HJVA 4M4SA 4LYFA 3RRYA 1X1SA 3CO5A 3BIFA 3GLHA 221PA 1Z2AA 4ZIRB 1HYQA 1LV7A 1XCGB 2A5YB 2CLSA 4M53A 3VR1A 3QVVA 2REBA 3RNLA 2IYUA 4NKRA 1FMJA 4DWJA 3B7GA 3WP0A 2FU5C 4DT1A 5GADl 1DEKA 4FMDF 4TLAA 4ASUA 3THWB 4QHTA 2OBMA 4PQFA 2O8CA 4UQOA 1E4VA 4PANA 4C9BA 2IUTA 1OW3B 2ZJAA 1W0KA 1G7SA 2ZRCA 2GKSA 4HAZA 1KKMA 1XFAA 2Q3HA 2VHUA 4DDTA 2MSCB 1D2MA 3IGFA 1ZW6A 3TQCA 4MGKR 2JJ1D 1HT2E 1QG2A 1Z6XA 1XMVA 2W2TA 3EZ2A 2CDNA 3KUDA 3MG9A 4Q7JB 5EP1A 3W6NA 4LDJA 5B2ZA 3KJIA 4B33A 4GSYA 2CL6X 3AVUA 1MO6A 1MO3A 2GK7A 2H17A 2YWEA 4Q4JA 4DDWA 3NHBA 121PA 3N2EA 3WBJA 3AVWA 1KSHA 4PX9A 5TARA 2EFHB 4TZ0A 2F55A 1KY2A 3VNUA 5EP4A 3FGNA 1OH7A 4GZMA 1E2NA 5TY0A 4F93B 1XWIA 5HTKA 3PUXA 1GKYA 2XXAB 3FHTA 3FFBA 4XWAA 1JPJA 1SKQA 1P3JA 3OEHD 4KJZA 2QPAA 3QEJA 4TMWA 2IHBA 3TAHA 5IHPA 5CIWA 2IA5A 3C15C 3EC1A 4OL0A 4US2R 4XD7A 1SXJE 2GJ8A 4PTLA 1AA9A 2QA5A 4C4PA 4M9XA 3BXZA 2O0JA 4FMCB 2BVNA 5IK2A 3J81k 1IN8A 5HZHA 1D9XA 4DSOA 2KWIA 3P26A 1W44A 2BWJA 2ZRAA 3X1DA 1XTSA 2GRJA 421PA 3WMGA 3GLFA 1U94A 1NIJA 1DAMA 1T9HA 4LI0A 2OAP1 5FUWA 5CB6A 1H65A 2PH1A 3MLEA 2J0VA 1HUQA 4LHYA 4PHGA 5J40A 5FUVA 2F9MA 1DOAA 1S3SA 3KJGA 2WJHA 4BWYA 4NBSA 5H8WA 2AX4A 5FOSA 3EPJA 1GNRA 4C30A 4EFMA 1Z6TA 1Z0JA 4JVMA 1MABA 2JDID 3WNBA 2QT1A 1FX0B 4I99A 2BJWA 2QM8A 2CEAA 4G5QA 1Z63A 3QKRB 1XRJA 2ORIA 2PEZA 3ZQ6A 3CKLA 2FZLA 1EFUA 3K0CC 2ZR7A 1VHLA 1X86B 4AIIA 2HYIC 5SZJA 1IOZA 1NLFA 1NKSA 1ODFA 5J4VA 1G20E 3K0EA 1KDPA 1KAOA 3KKMA 2OXRA 3SEAA 4CW7A 1HV8A 1II9A 1LVGA 1KY3A 2WWGA 3DHWC 3EZ6A 4IDNA 4PO1A 4M8NE 1OFHA 2GA8A 1DPFA 1ZNXA 2ZIAA 1ZNYA 2G6BA 2FGJA 3FE2A 4YMWA 3B1XA 2GTPA 4LSGA 5H68A 4EPWA 2ZJ8A 4B3FX 4DHEA 2PT7A 4YMUA 2RHDA 4P4TA 4UKDA 2GF0A 2X77A 4WAUA 1AIPA 1TPZA 1P4SA 1GL7A 3VAAA 1M34E 4RZ2A 1DS6A 4L9SA 1CF4A 2GCNA 2NOAA 3N5CA 5AUOB 3TQFA 1RRCA 3SOPA 3KXIA 1N6PA 2VP9A 4NCJA 3IIMA 4Q7MB 5AJZA 1Z22A 3U7GA 3AEZA 3BWDD 1NN0A 2UZ3A 3DEFA 4HEJA 3VX4A 1XX6A 1W0JD 4IDQA 4TQAA 3T1OA 1RFLA 1OHHA 3MJRA 4HLCA 2NO1A 2ERYA 2UKDA 3FMPB 2CNWD 4B6EA 4Y0AA 3EX7C 1NVUQ 2Z6VA 4DLSA 1US8A 3EPLA 2O0KA 2DWQA 5CK4A 2BBWA 5L3SB 1N5KA 3PUVA 1QHGA 4TYYA 3TE6A 2AKYA 2ZRJA 1FMLA 3IPYA 1PUIA 4DIDA 3IO3A 2IUUA 2E87A 2J87A 1E2HA 2WJIA 4Q9IA 5DNYB 3W9YA 1T8UA 4LJ7A 2WSSD 1TTTA 4OHZA 2WJGA 5AUPB 2XAUA 5JWRA 1VYVA 2EWVA 4Q9KA 4BEBA 1SXJD 2IEZA 4A9AA 2REOA 3AGPA 2VTKA 2GZAA 5FBWB 3BK7A 4Q9LA 3WRXC 3W5JA 4JYCA 3FVQA 1T3HA 4K46A 4YXWA 1ANKA 4LJ4A 4TMKA 3SQWA 2I1QA 3WRYC 5C2JB 1G6OA 1R6BX 1XZQA 2ZUCA 3IBYA 3RRMA 3L0SA 1R8SA 5JZVA 1L4YA 3KFXA 1WXQA 4CT5A 4P3YA 4TTRA 5IF9A 2JDIA 2CLDX 4TTPA 5JRZA 3I32A 1YE8A 4Q48A 4E09A 5C18A 1XU4A 4TZ6A 2GCOB 2QQEA 2RKOA 2DPXA 4RKEA 4IDPA 4WW0A 1GIAA 1TMKA 3AP3A 2ZROA 3QG5A 2XITA 4MGYR 4QBFA 1JI0A 2IXGA 2VSXA 4OHVA 1I2MA 5FBLB 3LBNA 2O52A 5BYKA 4ARZB 2O8FB 2QTHA 2YOGA 3UMFA 2OBNA 1QHHA 3LV8A 4TT3D 2JIZD 2ZSBA 3EIQA 2OM2A 1PJRA 4GL2A 4AURA 3ETLA 3AVXA 3QJYA 2FFHA 4Q1CA 5FOVA 1KK0A 3SC3A 4AKHA 5JWOA 3K9NA 1T6NA 4LRWA 4B2LA 3FKSA 3CRRA 2AFIE 3UMRA 3ZIAD 4TYWA 1LS6A 4PPFA 4A6PA 1IONA 4FIDA 2OZEA 2X2FA 3MWYW 2HCBA 1ZMXA 5FI1B 2EFGA 2EFCB 3QXHA 5A0FA 2X19A 1XTIA 4URVR 2CNWA 3CX6A 1QHSA 4B74A 3OIYA 3G82C 3NG1A 2CCGA 1RRFA 2V6JA 2W00A 3NC1C 3SYNA 1N6NA 1EFRA 3CR7A 4D4JA 4JLOA 4J0QA 1VMAA 1AM4D 2QE7A 2ZPTX 2G9NA 2W2XA 5DISB 3VKHA 3AKYA 4JBYA 2GDJA 4A0GA 4ZDWA 4YMSA 2WMOB 4NYMQ 4OJKA 1ZUHA 4E07A 1A2BA 4FCVA 1KIMA 1YR6A 3U60B 1VG8A 2OSBA 2OEPA 4WA7A 3K70B 1X6VA 4UNNA 5FH9A 4RZ3A 1BMFA 2EU8A 2W6JD 1SXJA 2PX3A 2QP3A 3A1TA 1RKBA 2BM0A 2UVQA 1CR2A 4I81A 3CIOA 2CCJA 3R9XA 2NQ2C 3RANA 3W5IA 1HE8B 3EAQA 3CWZA 2HEIA 2DR3A 4AKIA 2VL7A 3RLFA 1U9IA 2O8DB 1D2NA 5CB8A 2ZJ2A 1X8KA 3TMKA 4P4SA 3AB3A 1BO6A 1E9EA 3QVUA 4PR0A 1KAGA 1GTVA 1DVRA 3THXB 1H8ED 1N6HA 3Q85A 2XSZA 1KDTA 1UKEA 2GXSA 3K9LA 3T5GA 3REFA 3KKPA 5JS8A 5J4LA 1I2DA 4IOJA 4Q02A 4QRHA 5FTJA 4IHQA 2HUPA 1E9AA 2D74A 3A1UA 1CJMA 4LGMA 4HAUA 4RD1A 1MOZA 4Q4HA 3HR8A 4OQFA 1JQLB 4H1UA 1UADA 1XDBA 2VLIA 5FOWA 4BZPA 4B71A 4ZKDA 4Q4AB 1G8FA 3CF6R 5G40A 3TSWA 4C2TA 2IYRA 5A5GA 1Z3IX 4HUQA 1S8FA 3CBQA 3CPJB 4G0NA 5AUNB 3QG1A 1W36C 2QMOA 1CLUA 1E2QA 3I5XA 5F9FA 1KHTA 2N1BA 3I73A 1XMSA 4TT3A 1LS1A 3LWNA 3MGCA 821PA 3M4YA 5JRJA 3AVYA 1ZNWA 1F3OA 1G7RA 1KZ7B 5GJCA 5JS7A 3CPEA 2RGBA 2J9RA 2ZI6A 2O8EA 3EARA 4F92B 4LHVA 2DFKB 2YNMA 2Q0HA 1Z6AA 3P32A 1NSTA 1W1WA 4DXAA 2O8BB 2GK6A 4DIEA 3C5CA 4BE7B 4R2HA 3ZIAA 4KV9A 4KITB 1E2FA 1KTVA 4M1YA 1COWD 2AXPA 3TK1A 1D8TA 1JAHA 2J45A 3CNLA 4IKEA 1ZD1A 1VCIA 1XEFA 2J0SA 5SZHB 2CL0X 2GJAA 2OO7A 2PL3A 4EPVA 2WJJA 3SYLA 1S0UA 1ZIPA 1TQ4A 4KFTA 4DT1B 2EVWX 3EIEA 5K8LA 3UANA 3FDIA 3V9PA 3I3SR 2VP2A 3PITA 2JCSA 1OFTA 4JL6A 2HF9A 1TUIA 3RVBA 1OPXA 2ZRDA 5FR1A 1E2DA 2XTMA 2JEOA 2OXCA 4LWZA 3U3JA 1XMJA 4CEIA 5JJIA 1GFIA 2IC5A 2IF0A 3SNHA 3HWSA 1SQ5A 1VDZA 2D2EA 4EDHA 4AD8A 1R0ZA 4PO9A 4ZI3A 4GOKA 4RZUA 2WKQA 1YR9A 4GDFA 5J5CA 1DAIA 3SJZA 4BLSA 2QI9C 3BFKA 4FWTA 1FNMA 1KO1A 1NMYA 4LHWA 4XVQA 2H1LA 3LVQE 3AVVA 3B82A 1WDTA 1T0JB 2G1JA 3K8YA 1F2TA 4B3XA 1Z5ZA 3L0PA 1H8EA 3Q7PA 3ZVRA 2QP9X 3K1JA 4A0FA 3CZQA 4BFUA 4RJLA 4XWOA 3CZPA 5AJWA 1OXUA 5AR1A 3ZLJA 4QL3A 3FKQA 2WICA 4NU0A 4IFBA 5C1BA 4G5GA 1N0VC 4DC9A 3DMNA 2JJ2A 3QF4B 4A1FA 3EPKA 2C9CA 4KSCA 3T15A 4E5UA 3LBHA 1E96A 2NO0A 4JLPA 4JIMA 1ZM2A 3JVVA 1GSIA 2IS6A 1U2RA 3CUEF 1BKDR 4TLBA 5EE9A 5IRCD 4XTRA 2BBSA 3KUCA 1N5JA 1GP2A 3PQCA 4Z1MD 5CIQA 5FL3A 3FHCB 3WYAA 3WNCA 1JECA 4KSBA 4QGGA 5KDDA 3GLFB 4JVNA 1II8B 1VCNA 3GMTA 1R4AA 1IN5A 1WRBA 2G0NA 2RB4A 5E3HA 4DLRA 5KPDA 4HB3A 1ESMA 3RS7A 3R8FA 4LPKA 3DOFA 4BLTA 4GBMA 2SHKA 2YC2C 4XVUA 1P60A 2Q3FA 1XTQA 2QROA 2FJUA 3LDAA 1NRJB 2IS2A 2QRZA 5CYOA 1G21E 4UNQA 1T91A 1TQDA 1GRNA 4Q5IA 3AP1A 3LD9A 2XJ4A 521PA 3QPUA 2REXB 1JR3E 1IXZA 4I1OA 3U7FB 1Q44A 4D6PA 1MABB 1OH5A 2MMGA 3HJNA 4EQ6B 1GRQA 5KSYA 3MWJA 4JLKA 3DM5A 1N6KA 4NL4H 2JGNA 5F3WB 1EWQA 5FBQB 4EPTA 5GJWC 4F7WA 1P9RA 1GDDA 2BHRA 1UM8A 4LCBA 4DRZA 4LYHA 2XNDD 3CNNA 2XB2A 4MYCA 3A6PC 1ZCAA 4GFDA 2AXNA 3HYRA 1G5TA 2WKPA 4NE2A 4JLDA 5G3ZA 5CDFE 3U3RA 1R5BA 2WIAA 3UG7A 4AG5A 1NJGA 2BBTA 4NTZA 4AWXA 1OT3A 3LW8A 1FW6A 3FOZA 3DDCA 3U4QA 3BGWA 3QE0A 4OKSA 3NIBA 4Z54A 1CJVC 3AVOA 2R44A 3VFDA 5FPYA 4L9WA 3O8RA 1ZUNB 3L0IB 4Q1AA 2ORVA 1CJUC 1GL9B 3IILA 3SU8A 4IOKA 4JKYA 2R8RA 4YMTA 2W2VA 1N6IA 4RD4A 2IYXA 2C04A 3ZGXA 4PQYA 1SVKA 1W47A 4Q19A 2EYUA 4ZV4A 2D7DA 3I62A 3LAWA 3RS2A 4N0EA 2EQBA 3BOSA 3CR8A 2YVUA 3TVTA 2Z4RA 4HB4A 1S96A 3DL0A 3TW8B 3B9PA 4FW9A 2FE4A 3BRWD 2HXSA 3MJHA 1AKYA 1P9NA 3M0EA 1SVWA 1US8B 2ODNA 1IJFA 4Q03A 4F91B 2KBEA 1BH2A 2ZSDA 4JKIA 4XTCS 2IX3A 1SHKA 2HT1A 3I4LA 1W48A 3W8NA 4W5HA 3RHFA 3IKJA 3ZS8A 1XJCA 2I3BA 5K8IA 1Z6GA 4JVSB 5EXTA 2D3WA 2P5SA 3I72A 2OILA 3GEHA 3TRFA 3X1ZA 4F4IA 5JFGA 1SVLA 3SJBA 1KMQA 3UPUA 2OLKA 2GETA 1Q3TA 1P75A 1TNDA 4TL6A 2VQSA 3RDPA 1LW7A 5FTKA 1GNPA 4BLRA 3ICEA 1IXSB 4YDHB 4LYJA 4AKGA 3JZMA 1HA3A 3RRNA 4LYAA 4GZLA 5L3QA 4JS0A 3VNVA 1ZUIA 2PX0A 1W36D 1CTQA 1WQ1R 4CEJA 4HZUA 5ELXA 3KQHA 2W0SA 3R9WA 4M1KA 1KGDA 5L3VA 3KJHA 5FBRB 1CU1A 5A4JA 1XF9A 3FMFA 2WBLC 5EJEA 1GKIA 3BE4A 2JLVA 4U7DA 2WHXA 4MGIR 1ZVQA 5CITA 5CJ2A 2J7PD 2C8VA 2J46A 3X2SA 2RGNC 1CULC 4AG6A 4I1SA 1FPMA 1T4GA 2A5FA 2JJ8A 2NIPA 3EZFA 1FL9A 4CZ2A 4E03A 1NN3A 5ANRB 1AKEA 3NHAA 4JLNA 3KTAA 5FPTA 3BFVA 1FZQA 4Z8YA 2OT3B 1D9ZA 1YKSA 2BDTA 2IF2A 3P4XA 4LV5B 1JR3D 1JXMA 2KBFA 1C1YA 1YZQA 2ZSEA 3LQRA 2VSOA 1F60A 2F6RA 3ZDQA 1YHNA 3NBFA 4B3GA 1F48A 4AKEA 1VTKA 2MSDB 1Z6YA 1QHHB 2FEOA 3AVTA 5EZ6B 1KO7A 1E9FA 4KFUA 2QP4A 3HPQA 2LCFA 4KU4A 3E70C 4DLWA 1A7JA 5DYIA 2R62A 3S1AA 1HQCA 4IOLA 4X8LA 2JLRA 3I8XA 1OE0A 3FWYA 4PPGA 1NY5A 4HLUA 2DCUA 1CEEA 3VX3A 4AYWA 1FUUA 2N46A 2OE2A 2J3EA 4I1UA 2BMJA 4D4KA 3MFYA 3RABA 5IT5A 2WAYA 5EE5B 4QGHA 4B3DA 1T5IA 3CX8A 3FHOA 4JSYA 4JJZA 2V55B 1NG1A 4NYJR 4DUGA 3R8CA 5JWHA 1N3BA 2GXAA 2GBLA 5G53C 4CEHA 2J0UB 4RCZA 3QXSA 3ADKA 4EKDA 3DOEA 2FWRA 2J7KA 4RD2A 4XWKA 2FFAA 4CIDA 4UXJA 4AC9A 2D4HA 1Y63A 2GEVA 3TW4A 1IN4A 1ETUA 1RYFA 4MDFA 2DYKA 2GEDA 1Y3AA 2ZRBA 1KSGA 1AJEA 2VRWA 4WZBE 2A5JA 2W58A 4HAYA 4X8HA 5HKKD 2FMXA 1MR3F 2ODWA 2PBRA 3HR7A 5GJVC 2J0QA 2G3YA 3BFXA 1VCMA 1EK0A 2B7CA 3B8HA 5LDDC 3TR5A 3M1IA 1GWNA 3TR0A 1JEEA 1W2GA 4FMDB 1KDRA 4HB2A 2JLUA 3FYHA 1E1RA 1E2JA 2ZE8A 1U99A 2FPLA 2KE5A 2XZPA 4Q4LA 2N42A 4CRWB 1E2LA 4GRAA 4ZCLA 1IAQA 4QXAA 4PZYA 3SJAA 1LB1B 4KBGA 5HCIA 3Q72A 3HU1A 3ZH9B 1E2PA 3G5UA 3UXMA 4PFSA 3MWLA 4HLQB 3VKGA 1OYYA 4LJ5A 4IOMA 1IY0A 4ACAA 1IN7A 4PPQA 3B13B 5BWMA 1KO8A 3CWQA 2F3TA 3TUZC 1QRAA 4HUQB 3EWAA 1KSFX 1EWRA 5DHAA 5FL7D 3UATA 1MV5A 3L0OA 4KYUA 1A2KC 3GFOA 2Q9AA 3BB4A 1J90A 3KZ1E 2WWWA 4D82A 5E7IA 2QBYA 1IY1A 1OIXA 2D62A 1S1CA 2QPTA 3PXGA 1R8QA 2O8EB 1NF3A 2QZ4A 2C5LA 3AV0B 5TVKA 3UWOA 3GEIA 3G0HA 2RHMA 1UBEA 1ESNA 2ZSFA 4FMBB 1Z29A 3W3ZB 1DTSA 3PEYA 1GZSA 4IW3B 4C3ZA 3CB4A 3KQUA 3SHWA 2CK3D 4MRSA 1DO0A 3SFZA 3E5HA 1OB2A 1JBKA 2GJSA 4QFMA 1AQYA 2BJVA 3ICQB 1TF5A 4M21A 1E9RA 4PSAA 2VPPA 1OXXK 1YZTA 2J41A 4KO8A 1IHUA 4P32A 1G6HA 4MRVA 4NYIQ 3AVQA 3ZZUA 1FQJA 5LD2B 5KTYA 2JJ1A 2ZTSA 4TLDA 4Q7LA 1T5LA 1HE1C 1LF5A 1ZU4A 3RS4A 4A8JA 4CGZA 4BLPA 5IDVA 1K5GA 4BFXA 1H8HD 1JPNA 3K9HA 1EGAA 2RGCA 1KNQA 1W46A 2B8WA 4A2PA 4D2IA 2YKGA 2PZGA 2VHJA 3K09C 3HDTA 3LY5A 1B0UA 2FH5B 1WBDA 5HKKA 2QPOA 3QKTA 4MUBA 2HYDA 1WB9A 2GVZC 2F9LA 1OFUX 3LW7A 1KK2A 4Q21A 1FUKA 3QUSA 4IVQA 1N25A 3OEHA 3MRSA 4RFVA 2JAQA 1F2TB 2GESA 4WZ6A 5DI3A 3OE7D 3QNUA 3Q8XB 2FPMA 3I8SA 3P4YA 1I4DD 3GJ4A 4ITRC 1SVMA 5EE1A 3A1WA 1OYWA 1RPZA 1A4RA 4LJ9A 1OIWA 1HQYE 1NJFA 2XOKD 3U2QA 1KOFA 1SKYE 1YZNA 2QGNA 3OAAD 3EIHA 4OI2A 1LF0A 4C2UA 5KU1A 4EPXA 4C7OB 4GT1A 1OKKD 1VHTA 4LBYA 1XPOA 4B75A 1JB1A 3ADCA 1NN5A 3T06B 5JCPA 2G1KA 4GOJA 3RSOA 5JI2E 5FL7A 2IEYA 1RIFA 2CE7A 1K8RA 1PLKA 1Q1ZA 3DMDA 3SN6A 4NMMA 4B32A 1XD2A 4EPRA 2IL1A 3QPVA 3QY0A 4KBFA 1O87A 1E2IA 5FPKA 1KI3A 5B58C 3THYB 3AVPA 1GUAA 4L8GA 3VR2A 4C0HA 1DBSA 5SZKB 3WMEA 1TF7A 1G3IA 4PO8A 1VG1A 1AZTA 2WAXA 4IDHA 1XMIA 3B2EA 1U8ZA 1NL3A 2I1VB 4MQBA 4U5XA 2ONKA 5DYGA 4W9MC 1W5SA 1KI6B 5BN4A 1SZPA 3RC8A 2WJYA 2NO9A 3PEUA 2ZAOA 1UF9A 1X3SA 4G1UC 4BRWA 2B92A 4KODA 2CK3A 3A1VA 3AKDA 2ZANA 1LTQA 5D3MA 2D7CA 4L4UA 4WBSA 5JSZA 3ZS9A 1NP6A 2WM9B 3AUXA 5FUYA 2PMDA 3E2IA 3MWKA 1ZM9A 2MSEB 3OIWA 2DBYA 4Q1EA 4KVGA 3QPWA 2ZI3A 2DHRA 3K70C 1AZSC 5LPNA 1A5TA 1YJ5A 2ECKA 3QOFA 2YHSA 5C4GB 4FCTA 5JBQA 1G1MA 4AI6A 1Z07A 3U4QB 1XB2A 5CYPA 3QKSA 4MRPA 4MYTA 4DBLC 2ZJYA 1NG9A 4MRRA 3QENA 1KMHA 2FFBA 3NBZC 4ZCMA 4QGAA 2JLSA 1VCOA 5KSPA 1ZRHA 3FB4A 4PXAA 3LA6A 1C9KA 2YOFA 4MUAA 1F2UB 1L4UA 1JJ7A 4M1SA 1W0JA 2F1IA 4ZDIA 3ZQJA 2F43A 1BYIA 1XXHE 1TX4B 4BEJA 5KO2A 5UKDA 1FNNA 2WJVA 1I4LD 1DE0A 5LB4A 4WVFA 4DKXA 5KNCA 3LXRA 1JJVA 4NYIR 1E1QD 2F1JA 4LC1A 4MA4A 2OCYC 1J70A 4URUR 1CR0A 4PAQA 4URWR 1P73A 2Z83A 4PSKA 3CRW1 1QDEA 4LJYA 3EXAA 1CR4A 3NTUA 4DCVA 4ESHA 4ZIRA 5JMTA 1RZ3A 1NLZA 2XOKA 4LHXA 1N0WA 3VR5A 1NVVR 2WSSA 3WXMA 2FSGA 3H0KA 2PJRA 2W0MA 3THWA 4EFNA 5FI0B 4UXHA 2XNSA 3HU3A 1HURA 3WNDA 2PEYA 4A6XA 3GJ3A 3I1FA 4DCUA 2IBMA 4C0AC 4DJTA 1CXZA 1LY1A 1T3SA 4B76A 3W8RA 1EFCA 3NXSA 3TNFA 1WBBA 2P67A 3GFTA 4YDSA 1TEVA 3UIEA 4GP7A 5DHFA 1NBME 4YONB 5M04A 4NDZA 2H92A 4ACBA 1QVRA 3GLGB 4XJXA 2ZRMA 4JMPA 2WKRA 4M9ZA 1KI9A 4LJ6A 3VR6A 4CEJB 2P3SA 4HZUB 2PCLA 1G3RA 2WWYA 1EX7A 3NBXX 2ZUBA 2GCPA 2ZVPX 3LBIA 4BFWA 2OG2A 4O3MA 4URXR 3EZ9A 3F5FA 2QTVB 1E99A 2C9YA 3TBKA 5L3RA 1UEJA 3WY9A 2OAQ1 2GBLC 1IJEA 4MYUA 2GXUA 2O5VA 3GEEA 3NEYA 3FMOB 5KNDA 1E3MA 2QGZA 2QM7A 3TUJC 5JHGB 3ND9A 3UK6A 2VIIA 1P9WA 1KO4A 4BZXA 3KTAB 1NMZA 2BKEA 3K0FA 4QM7A 2CJWB 2XTZA 1ZC3A 1G16A 1U0LA 3WBKA 2JIZA 2ZRKA 3GLIE 2WOOA 1G8GA 3CH5A 1U81A 4N1AA 3IEVA 4E22A 2V7QD 2ZR9A 5FR2A 3U61B 3BJIC 4NHOA 1J99A 1P2TA 2XZLA 4AK9A 2P0EA 2V54A 4LHZA 4MYHA 1M2OB 1KI4A 3KJEA 5FTNA 1PV4A 2IW3A 1XD8A 3DKPA 4MITA 3IQXA 3F8TA 1QZXA 4PPNA 1GM5A 3JVUA 2ZEJA 4HAWA 4B35A 1R7RA 2B21A 2FZ4A 2HLDD 3GLHB 3BH7A 1ZNZA 2QL6A 5FTLA 2ZYTX 3CRQA 4CF7A 4C0JA 1E1QA 5B57C 1R0XA 4EJSA 2Q3MA 2O8CB 1UEIA 4YMVA 1FX0A 3OHMA 4DLYA 1KJZA 3NH9A 2R65A 3GJ6A 2WTUA 3C4JA 3BBPA 1RRPA 2W6ID 3NH6A 2D2FA 3TVDA 3I92A 2ZI4A 5HE9A 2ZYVX 2P6RA 2W83A 2AD1A 2R6CA 1P61B 2W6JA 2VHTA 1Z06A 2ZRHA 1SVOA 3F0TA 4Q4JB 2ZREA 3SDZA 4QOSA 3L82B 4HZIA 1RE0A 3LLMA 1ZD8A 1AGRA 2RGGA 3BB3A 4FINA 1NI3A 4H9GA 4EUNA 5CLQA 4TMXA 3QI2A 1E94E 1K6MA 1RJ9A 2WV9A 2VP0A 4IRUB 3H4MA 4KI0A 4PAOA 2G0TA 2NMVA 4P4UA 3NC0C 2QNRA 2RH5A 4HI0E 3KL4A 2D06A 2GZHA 3FFAA 4Q18A 3TGPA 4B47A 4BECA 4A2QA 2VA8A 3SHFA 1XCPA 4UJ5A 1A1VA 4BFVA 1CJKC 4QHYA 4OQMA 4QJ4A 3VU9A 4OHYA 1NBMD 1LFDB 1ZCBA 4CYMA 4G3XA 1MRSA 5FPSA 1JAIA 1P62B 2NTYC 4ZO4A 4ZI2A 3U7EB 4ILEA 1DG3A 3AP2A 2LKDA 5L3SA 2R9VA 4O0MA 2QAGA 1DAEA 3H86A 4BUJA 2YWGA 3K0CA 4PZZA 1KJWA 4A8JC 3V4RA 4Q9HA 3DZDA 5E4FA 2JLQA 1CKEA 3ZD7A 2L0XA 1ZP6A 1E2KA 2YYZA 1YRBA 3ND8A 2JLWA 2RGDA 3N2IA 4V0KA 4EPYA 5CM9C 3C8UA 2V7QA 1JNYA 3ZVMA 4I4LA 1NSFA 1GITA 3WHLA 3QBVA 1AS0A 4DCSA 1GL6A 3IQWA 4V0LA 3K70D 4HSEA 1UBCA 5KDOA 2QBYB 1HTWA 1S1MA 1R0YA 3H84A 5E7MA 4MKHA 1Z0KA 2DWOA 5JEEA 5KDLA 3U5ZB 4GPTA 4DCTA 4M0LA 1P72A 4TLEA 4GMDA 2OCAA 1COWA 1KI8A 3EC2A
chains in the Genus database with same CATH superfamily
3EXHC 2J9ZB 3ITKA 2J8ZA 2FW6A 5E4TA 3GNQA 1AC5A 5JLJA 2ORYA 2XUJA 2WP8J 5HR5A 3STTA 3UENA 4QTYA 1GILA 2BZGA 3HBLA 5E2IA 3Q3IA 3RC9A 3VI3B 5BVHA 3RU9A 1B7GO 1ODTC 1WP9A 1G66A 3FIJA 1G8JA 3H9QA 5HE8A 4H3HB 4RIIA 3SLKA 3TAXA 4E14A 3TTYA 1M2EA 4LXHA 3ASVA 3FNQA 4MUXA 2OOSA 3UAGA 4MR8B 4YAFA 5E9JA 3VV2A 2O5EA 4Q47A 1SU6A 2H2GA 1QWSA 2IHYA 2ZETA 5IYZA 4Y98A 1GVNB 3D8TA 4YS6A 4DCNA 3QSYA 1UOOA 3I6BA 3LY9A 4NYJQ 1BE6A 4PV7A 5H3CA 3IHWA 4JI4B 1HEIA 3COSA 3IX7A 3S2FA 3FY4A 1DKQA 2QDXA 3CEJA 5AHXA 2OQRA 4KYIB 4A8JB 1WXHA 3PUYA 1UDWA 1ZIOA 2CXPA 3D59A 3GJ5A 4PLYA 4EY8A 1C30B 1Y8AA 4IDOA 1PZXA 1AKTA 3ISTA 3QUAA 4TN5A 1U98A 1NQ5A 2WE7A 4Y2SA 4MJ7A 2GPAA 1KE2A 1LRJA 1Y8RB 2ZK7A 5DSZA 2QNIA 2WD7B 5ERGB 5JI3E 3TTSA 2WZQA 4M7WA 3RU3A 4I08A 3EZ7A 2XMQA 5JAMA 2UYHA 1U5AA 3BKWA 3HJHA 4FI3C 1A98A 2WOJA 3D6TB 4IFEA 3UUWA 2P0YA 4F9FA 1ILWA 4G26A 2QQGA 3G2IA 4OHXA 5JXGA 3I76A 3PF8A 3TQTA 1AKRA 3AJ9A 3DZCA 3EXHB 4C08A 3L2OB 2YC4C 1PNVA 4B4KA 3UT0A 3VDQA 5ICCA 5KTNA 1AQLA 3K1AA 4UNPA 4B0OA 4IWNA 2IZ5A 1JSRA 1WHTA 3SD7A 2GUWA 1CW2B 1UINA 3LNCA 1YIDA 1V39A 4CM7A 4ETMA 5BORA 2MJLA 2Q3LA 2DFTA 3HP7A 4WOKA 4D44A 1UAAA 4FHFA 4LV6A 2D6FA 2CYCA 3HHPA 1DG1G 2O3UA 3TLYA 1M9NA 3D6AA 5A4MS 5EJAA 4MNTA 3FFXA 2ZTLA 4KWEA 5IVPA 1B41A 3O4RA 5HK9A 1WW8A 3E9QA 2F9FA 2WNSA 4KDFA 4WY8A 2PV0A 1W0KD 4S1PA 3HBFA 4HO1X 5KWJA 3K5HA 4UREA 3BCRA 2ZAGA 3GJQA 4M36A 3IVMA 5AK0A 1H23A 3E9DA 2I7CA 3HDGA 1B1CA 3CINA 1RI2A 4TYQA 4NG4A 5EKTA 4OBWA 2F1HA 2TS1A 3OPNA 3PUWA 4LXXA 3QU9A 4IL5A 1CQJB 1WY5A 2IS4A 4G2TA 3D7MA 1HLFA 3N0WA 4G1MB 4IIBA 1ZOIA 4BQQA 3H19A 3B48A 3RHSA 3WMRA 1LDMA 1VBMA 2M1ZA 3P2JA 1W93A 3GLIA 3JD1A 1S8NA 2BT4A 1ISJA 3MN1A 1SBTA 2PGNA 3BXFA 3IBGA 3CH6A 4J91A 4HYQA 1REQB 4KLNA 3IODA 4FFDA 1IHDA 2WQ6A 3CUSA 5IEJA 3WIBA 2DFLA 3KJZA 5C8ZA 1F17A 3CCBA 4KPFC 3RS9A 4N9WA 4YCJA 3QVSA 9LDTA 1DJPA 1JWBB 3RARA 2A0UA 1R0WA 4O1MA 4ISCA 5KCZA 3WYNA 2I87A 3C0KA 1YL6A 4A82A 1I2ZA 4Y2JA 3PENA 1QZTA 4OYRA 4BFZA 1USKA 5DHQA 5JYEA 2DZDA 1Q7TA 1HZZC 1ZEMA 4ARAA 1QQ7A 2WU4A 3B3AA 1JU3A 3ILHA 5I7OA 1Q57A 4YRZA 1GG8A 2IZ0A 2IWRA 5EWJA 3ENQA 5JMOA 2CBZA 2XMDA 4MGZR 4EUSA 3DBOB 1BXZA 3WNQA 4Q12A 2C77A 3K96A 2Q6OA 4QREA 3T3PB 4OAQA 5A6SA 3LC7O 2IUSA 4D26A 4TYMA 1XEXA 3QKSB 2WWHA 5JCOA 4G9GA 2FPXA 3D02A 4HDRA 4JL5A 2BV3A 3T1HB 2OLEA 2VT6A 4FK8A 4LK2A 5DRTA 4HATA 1BOFA 1MEEA 4KNYA 1GKLA 2B7LA 1JEDA 2PXHA 2VHXA 4CLOB 1I0LA 4CQMA 5FWYB 2H8KA 3MNFA 5AI0A 4CT4B 2GILA 1PWXA 1SB9A 4LVCA 5K3FA 3TZCA 1WU8A 3QW2A 3N2GB 1SZDA 4O2RA 4RTMA 4DV1B 2E37A 1G4AE 1JUDA 1KEVA 1WCYA 1Z47A 1FNBA 3COWA 2VZ8A 3ONEA 3DZ8A 4JVLA 4R8VA 4B6PA 2MSLA 2WSMA 4DANA 1OAOA 1WXIA 4RL6A 3KQTA 4JY7A 2O2GA 3T35A 2YXNA 3AWIA 3P2IA 2YWBA 4HDOB 1P2VA 1PK7A 3UKDA 4G4GA 1Q3HA 4X3PA 3IJRA 2PY6A 3ZBQA 4PXYA 1QUEA 2P4EA 2X1LA 1T8RA 3IEUA 3ORYA 1Q14A 1DRVA 2V97A 3OM1A 5AW7A 1U90A 3SQXA 3MLBA 3PFGA 2A3RA 3FZEA 3ASZA 5NULA 3USZA 3ONWA 1Q0RA 3R6GA 3U3OA 1PWZA 1VOTA 3SIWA 3S2SA 1NUHA 2BIFA 4KQ9A 3VI4B 1OTXA 4FVTA 1LPOA 1XDDA 5ADVA 2VZ9A 1UK8A 2Q1WA 4IXNA 2VG8A 5EE0A 3T5DA 2FPIB 1CQZA 3ZKWB 4F2HA 3JSXA 1EVZA 2ACVA 5A3QA 1O89A 4FFSA 5DK4A 2EW2A 3LYAA 1CV2A 1LSSA 3COJA 2YHIB 2J4CA 1MOSA 2Q28A 3HFGA 3I8OA 2XMZA 3AHIA 1AE1A 1G9XA 2XZTA 3A6FA 1JEYB 3GDHA 1A8UA 4KO2S 1HT1E 1OIVA 3EQZA 3FCCA 2A30A 3FWZA 1K7YA 4RJKA 3IAFA 1YS4A 4ARUA 1QF7A 3W4KA 1FMCA 3PQEA 3T34A 1ORRA 3R3UA 1TK2A 1UDAA 1Z16A 2EHDA 4BJ5A 1LDNA 2VYVD 5JZSA 3PEWA 1ZGGA 1ZICA 2KJQA 1HM5A 3ETEA 4TL8A 3ZD6A 2VJMB 4BB0A 5F3DA 3T3HA 3TCXB 1U8CB 5HQJA 1P5RA 2ICAA 2WJ6A 3SHVA 1Z38A 1GUZA 1X7XA 4H3SA 4L95C 3LLUA 3ZVLA 4K6KA 4P4LA 4GWGA 4YJDA 2TSYB 2V7XA 5EVJA 5EFZA 4QVIA 2ISCA 4DIOA 1JEOA 2G7MC 4NBRA 2Q8PA 2WPDA 3IUJA 1RPJA 4J4HA 2VNKA 5A9SA 4Q05A 1TUEA 2HQRA 2G70A 2XJ9A 1FYFA 2PL5A 3ZC3A 1DBIA 2IK8A 2ADMA 2Q2QA 2QMZA 2R751 3GDGA 4PC3A 1L8QA 4RWZA 4H3KB 5HMMA 3VYTB 5CVJA 4IXMA 4C7JA 5EUBA 3K0FB 2PCJA 3KEFA 4B3IA 2BFEA 1FP6A 4RZSA 4W8HA 3SPXA 4CF5A 3QTBA 2ZJOA 2PO7A 4PWZA 4EM6A 4NBVA 1XEWY 2ECQA 2Z5FA 4BGEA 1ZMOA 1J8MF 1OUMA 2GBIA 2OCBA 3HLKA 1EUCA 4L2IA 4Q7KA 4XGKA 2WIBA 3B8EA 1Q21A 4RH3A 5DTRA 6Q21A 5DM0A 1JAYA 1JNXX 1S01A 5K0BA 3FHLA 3K92A 1Q11A 3LX8A 1E5XA 4IVPA 4EABA 1XRLA 3FAZA 4Q0MA 2BFBB 4WKNA 3FTQA 2ZSAA 1ENZA 5T8KC 4R7ZA 2HM7A 3KXLA 1SU4A 2H1IA 1SXIA 1KL7A 3KKLA 4N39A 4QDKA 5H70A 2PN1A 4UVGA 1KYIA 3PQ3A 3ZWYA 3ZZMA 4BBAA 4K40A 3VO9A 4CT0A 3TIVA 3FBWA 3VQTA 3W06A 4AUEA 4K9DA 4BNMA 1M34B 1NDQA 4K9SA 2ODEA 2J3QA 4INPA 3FSGA 1X13A 3PC2A 3ZWXA 2BAGA 2N1MA 4O4JF 2EFDB 4G41A 4G0YA 4DQDA 5KNBH 5JH7A 2CLLB 1WX1A 2HWYA 1HYBA 2IKQA 4PZLA 4RVSA 1TFUA 1YZGA 3ZOZA 4B34A 2JLXA 3ABZA 3GV0A 4WACA 3RYHA 2ZS9A 3O1JC 2WYWA 2ANCA 2K4MA 1E0SA 5C80A 1IN6A 1RU3A 2NXJA 1OD6A 3QRWA 2FPKA 3GCZA 2GZRA 3TZLA 3IALA 4N5LA 4QBGB 4PZPA 3RSSA 5IXYA 4IXWA 3DTVD 4CEIB 1DDIA 3E58A 5IKPA 2FEWB 1NVVQ 3HCFA 4YRQA 3EIOA 1VIYA 2C78A 3A58B 2BDUA 5TEWA 2W93A 4PLPA 3UV7A 4AZWA 4CKXA 5F1OA 1L5KA 3VR3A 2QJWA 3UMSA 1VRVA 1Z35A 2XXBA 1RAEA 1ZSVA 2UDPA 3GUHA 3PRKE 4QOGA 4KIUA 4V2IA 1KOJA 4LZWA 1R27A 4ROSA 5B5SA 2O2SA 2PD4A 3WHPA 1H4SA 2AJTA 3TQOA 1II0A 3L8FA 1C8LA 3RUEA 2A84A 4QLOA 4R68A 3DMPA 1RJ9B 3F7OA 2XF8A 3D6HA 3HBNA 5FJJA 4MVXA 1AKNA 3V34A 3T5BA 3EBLA 2M32A 2C4TA 3PVSA 3F3SA 4O25A 2VF7A 2UUAB 1UPCA 2ZS7A 4UBNA 2MT9A 4R54A 3O90A 5LB2A 1N3IA 5LBIA 4OMFG 4PSDA 3TLCA 1T8WA 2R2AA 4Q9AA 1TD1A 1WO8A 3R0IA 1G4UR 3OIFA 4ON9A 3OQIA 1GFSA 3IULA 2OO5A 3F2IA 3MT9A 3UJBA 1PT8A 1A7KA 1ECLA 4WX2B 5A0VA 1DIBA 2RK6A 3TKYA 4W6ZA 2F1OA 2EHJA 4P81A 2OZPA 1W4BA 5FT9A 3QE9Y 5LA6F 1MT0A 1CRWG 1F5NA 4LWQA 1A3CA 1VMIA 3WLNA 2I3AA 4Q3BA 2P9TA 3C6XA 1EFRD 4FHCA 2G88A 1SHUX 3FYUC 4OGGA 3EG9B 2JI6A 4MPJA 3MUNA 3OESA 1Y42X 1TCBA 1OZHA 2O0HA 5DFAA 4Y2RA 2ILTA 2CVPA 3NNSA 1D2EA 4Z4IA 2BGTA 2CZCA 3EY4A 1FE8A 1QRSA 2PL9A 4E5MA 3VMFA 3RJMA 1JF8A 1T9GR 4M7RA 4EGFA 2J4FA 2WWFA 1X80A 4RGVA 4OV6B 2HCRA 2JEZA 3MZ0A 2X0EA 3TLGB 1V1MA 3G9XA 4A0SA 4IDGA 3KC2A 5T3YA 2IPXA 4KYVA 3O31A 2IP1A 1PL6A 4MR7B 4I36A 4X1YA 1U7TA 4D0GA 5KZMB 4MR9B 4V3CA 4M8IA 3GAAA 1GLNA 2G4LA 2Q1SA 3ZY5A 4KXUA 5HRUA 3LZDA 4AULA 3VBCA 4I50F 1FYVA 3B6EA 4H4CA 1HYGA 4OOFA 4RIEA 2P27A 4P80A 1Y9EA 2MWMA 3L01A 1T8TA 3UWPA 1GPH1 4EYQA 2AFIB 1QE3A 1XCJA 3G2HA 2QW1A 3C3YA 1HTBA 3B1VA 1XXHB 1SGWA 1ZZEA 2VBGA 3CWCA 5G4KA 4ES6A 1R50A 2EG5A 5BSKA 2VSFA 1UBTS 1H2BA 1X1TA 3A2NA 3QPCA 4IDFA 5THQA 1IU9A 5E0KB 2Q9BA 1WDLA 4XASA 1D2RA 2ZJBA 1N0UA 1Y7HA 4A92A 4PC7A 5LDHA 4GBED 3ER9A 1RM4A 3FYUB 1ZH0A 4XFJA 5AW0A 3ID6C 5EI5A 3RI3A 1P6XA 3M5CA 3N7UA 5E8JA 3ZVKA 1GUFA 4R9UC 1S4QA 2GLUA 4UVHA 3U7IA 3MTDA 4B83A 5C8YF 4F8YA 1G5RA 2E4ZA 1UXIA 2P6NA 4O4IF 2WYUA 4RX1A 3TSZA 1N6LA 2QT9A 1E2BA 1TGVA 3Q15C 2GXQA 1RQLA 3OFNA 1K68A 3PXUA 5CXXA 3WTCA 4MKFA 4DJDC 4QG7A 4CCYB 3STWA 1E9VA 2Z2KA 5LP6F 3BERA 4G4IA 4PSVA 3FCAA 2GS9A 3O8LA 3H4IA 1E69A 2YNMD 1V5WA 3KOMA 4RFSB 1J5XA 3EXFA 4OHRA 4FKBA 5CX1A 4MO9A 4RJIA 1JALA 4JLUA 4DSZA 4DLVA 1E6EA 1NJ1A 2NTJA 1PFVA 1CNMA 3GCXA 2QMYA 5JY1A 4IUDS 1QFMA 3D3EA 4F12A 3PGKA 4F4HA 4FW8A 2LP4Y 1DIHA 1XP5A 2F7SA 2WVJA 3QYJA 4LBZA 4N82A 3SKXA 3X1YA 1X74A 4LXUA 5GIPE 3DE4X 1P5HA 4BRZA 1XTPA 3A6HA 4WK6A 1OKKA 4EHDA 5KJFA 5C81A 4D4HA 2VRNA 1PV2A 1FVOA 4KQMA 2BBOA 1Z39A 4GMXA 3TRJA 3ZPXA 1C4XA 1XVUA 2GDZA 2VBIA 5ALHA 3AEKA 2EJTA 2FWPA 4QYTA 2XDWA 3HP1A 2B8TA 2WK1A 1TQ2A 2DQ4A 4J29A 1S3GA 4NOLA 5DNEA 3VC3A 1SOUA 3UAOA 4MPRA 3ASYA 2XWBF 3WQRA 1VL2A 4L72A 5L3ZA 4K9RA 5DP1A 4BTLA 1A1SA 1LU9A 5BW8A 4JLVA 4Z0NA 2DBVO 2IYLD 2H5IA 1J4AA 4UAJA 5IJ0B 3WLKX 3EPHA 1EG7A 2BFOA 4HDCA 2HU2A 2WWIA 2ZXEA 1XQVA 3VSCA 2X1VA 4MLCA 2J59A 4A27A 1KY5A 4IJMA 2JF0A 4HDAA 5FFMA 1EMDA 4HRAA 3V5NA 1ST2A 1WLSA 1XU7A 5EOVA 1U6IA 1DQRA 4C21A 2I8CA 2RMKA 1V6AA 4YN3A 1TMYA 5AI4A 2WINI 5A2GA 3FW1A 3QQ5A 3RYCA 1NVXQ 3OCZA 1H94A 2NUPB 4WSOA 5KJ1A 4EHFA 4M54A 1RKVA 5JDCA 3K4HA 4YJ2A 1D0IA 1Z0DA 4JP2A 1MN6A 5DM4A 1WUJS 4GYWA 1C8KA 1N5LA 1OBCA 2Z2YA 2PH7A 4EHIA 1UPTA 3IXLA 3RJ9A 1NONA 4S1VA 3G17A 2HF7A 2FA9A 3IA7A 3VRHA 2R1TB 2XUKA 2D7JA 3H5RA 3MS4A 4RDCA 4BPRA 3KKZA 4EDFA 4CMJA 1M5UA 2JGFA 2KMLA 2JJ2D 3I0ZA 2BR5A 5ALTA 3B53X 4NCXA 1NW4A 1H9CA 2AHRA 2GN8A 1VSBA 3L43A 1CS4C 4UUQA 4FM9A 1Y5NA 3Q5EA 3GLGE 4HEHA 3IAS1 2GRUA 3SI7A 2JGIA 2GM9A 1ZXXA 2GHTA 4EENA 4OIMA 5CTAA 5H02A 2GCEA 4UNSA 1Q0TA 4RSRA 4DM4A 1KZ9A 4YFVA 4AZVA 2BKUA 5KYYB 2PLRA 1SCUB 3F7NA 2NG1A 2QJFA 3QTTA 2E3JA 4FEGA 3M6XA 4KACA 2QD5A 1U7XA 3MWEB 3D6VA 1DHTA 2E9SA 4P3PA 3RIEA 1QP0A 1SVIA 4OK3A 4Q66C 3DG9A 3B6ZA 3VUEA 1H3NA 4F8JA 2BFDA 4JBWA 2BEUB 4TXMA 1TL7C 4JUFA 5EZ5A 4YQYA 3SIRA 3W2FA 5B64A 4EW6A 5C1OA 3NORA 4L15A 1NNEA 2AX3A 3R20A 5DNVA 1A8PA 3BMOB 3HPRA 1JQ3A 4UUOA 5IBPA 4D42A 3T3NA 4J07A 1GN9A 3ABQB 3M7IA 2HA0A 1C8BA 2Q6TA 1YFLA 1GNQA 2C29D 2W8ZA 2X2EA 4IV5A 5HFAA 3TZQA 4QAJA 3ETGA 1F6DA 2XKAA 3G1WA 5ECDA 5JFOA 4W7SA 1KAEA 3QUCA 3K9QO 1M74A 3OM0A 3R7BA 3O26A 4ZI7A 1XD9A 3N9IA 1EIWA 4BIMA 4H1HA 2PKRA 3RCBA 3A7DA 2EBUA 1FXWF 4GLLA 3CUKA 1PEKE 2IFTA 3C6KA 4DQ0A 4U6QA 1WMEA 3HMQA 3SZGA 4XSGA 4TYPA 4QYWA 5AK4A 5LZ8A 1J22A 5B30A 4MWZA 1E3TA 1NAIA 1T5OA 2W2OA 5KMGA 1D4OA 3DHVA 3AR9A 3VH3A 1UH5A 2VH5R 4MV5A 1OJLA 1NLMA 4JT9A 1U3VA 3HJCA 1OGJA 1DCKA 2MSNA 2XHEA 4LJ8A 3ZY2A 5IUKC 4BMPB 1T0UA 4V24A 5DBEX 4BEWA 3ZLVA 3D1JA 3M4JA 2AV6A 1X42A 4GOND 4M0FA 4RIGA 3ZU3A 2Y05A 1SIWA 1SUBA 5EPOA 2GOYA 2P77A 2PJZA 1IHYA 1U0SY 4LF4B 5EUQB 4B3MB 2TMDA 5JNTA 3NIFB 3H5NA 3QMMA 1ZINA 2V6IA 1M76A 4LDNA 5TMEA 5C8XA 3L7DA 3D9QX 5AHWA 1Z17A 1XEWX 3EVEA 4QPCA 4RYLA 1KQ3A 3T1VA 3NANA 3D7KA 3L5KA 4TSFD 1Z0IA 1QOZA 4OQXA 1NVFA 1TKAA 2HBRA 4YI5A 4BS9A 2AFHE 4I6GA 1Q0HA 1ZWKA 1EGVB 2AJCA 2EJVA 5AK6A 1CY6A 1Z2CA 1FDRA 1TJPB 1K06A 4Q6WA 2C3OA 3O8CA 4QYIA 3W6OA 4BASA 3GQBB 3HDHA 4C0LA 1XVLA 3L6CA 3C3WA 4S1OA 1R64A 3L8YA 5CJJA 3ZHSA 4RA9B 2ZITA 2KSQA 2I91A 2VF4X 2X9QA 2GZ3A 2PKCA 5JECA 4WIAA 3MB5A 1P4JA 3L7AA 5HKBA 3K6KA 1W1UA 1MVLA 4DIBA 1HE3A 2CUZA 5AH0A 3PQ5A 1B4DA 1DTWB 5FIUA 5TPZD 1HWYA 1RBZA 1PGJA 3I1IA 4L73A 4WKPA 1QVWA 1FOEB 4E5NA 1QX3A 3PPYA 1BAPA 4J3JA 4N3NA 4DXHA 2PZEA 4XIGS 5BQ5A 4DCVA 3FPAA 5AJYA 2QDKA 4ZCSA 3RT1A 1OI3A 2UYYA 1PP4A 1K7CA 2BMDA 1R5NA 2RCNA 1QLWA 3GAFA 3LPDA 2HLDA 3MSXA 4JAVC 4O2AB 4JENA 3JYPA 4OHFA 1GV0A 3CHYA 5DLPA 4NK5A 3SC6A 4E94A 3KOWA 4HDMA 1C4OA 5B58T 3RC1A 5JYBA 4OLHA 1O6ZA 4W6QA 2ZU0C 1J8FA 5U9CA 4AXXA 3S7TA 5F98A 2COEA 3CUWA 4M1WA 4Y3UA 3VMMA 4XVCA 1KK1A 1W49A 4YXFA 3IHLA 2ZM5A 2B4TO 2X23A 5C37A 1NRIA 1ZD4A 4PICA 1KI6A 5K05A 2GCOA 4EG8A 3BXOA 1L8OA 1UBHS 2O2EA 3HJRA 5BW4A 4V0NA 2QVGA 4XLLA 2JFFA 1XF1A 4DIFA 3N2NA 2ODTX 1DEAA 3U9LA 4TWBA 4Z4FA 3GFSA 1J8YF 3R7DA 2UXBB 1ISPA 3RB8A 2HJ9A 3ZE7A 3NTLA 4LWPA 2FSHA 2O2YA 5DJ5A 2IP4A 3ISJA 2FKAA 4PHHA 5HM8A 3GYBA 3KYJB 4TGLA 1HPLA 3IUYA 4FYHA 3IE2A 1CX9B 2BD0A 3E0QA 3VTAA 5KBYA 4ABYA 1KK3A 1OF1A 3MS2A 1TEZA 2WG1A 2ZRGA 1W7AA 1PFWA 3K5PA 3Q11A 4V1CB 2XVAA 4GI1A 5DH9A 3VZRA 3CGGA 1Z74A 5C3UA 3LUGA 3SIPA 1FDSA 3ZIDA 4FLMA 4YRDA 3WS7A 3HYNA 3T0GA 5LL6P 3HB4X 2J5XA 5BSHA 2PUCA 5HIAA 3K53A 4KMMA 3G5TA 5DI3B 1YVPA 1RACA 1NR7A 2I4RA 3AM3A 2YW2A 1QE0A 3DM9B 1F2UA 3V4SA 4ZHQA 2LCQA 4TLMB 1FJGB 4X71A 1ZD3A 4WXRA 2JGEA 1OLUA 4N7RA 3RC3A 4OX9Y 4NFYA 5IKMA 2H57A 1O6BA 1AUVA 1T5DX 4C4ZA 2Z30A 4O2BF 4O2LA 5AW4A 4KVAA 3J7AC 1WSDA 2VPYA 1VL5A 1XPRA 1JH9A 2X14A 2MINB 4P7FA 4PZ9A 4RZQA 3KAQA 4DMFA 1OZGA 3NHWA 1L7VC 2NU6A 2WMYA 3KQYA 2CD7A 1Q1EA 2FQ1A 2I29A 2VQ3A 3SR3A 1UWVA 1LWNA 2FG5A 2H2WA 2RIRA 2LIPA 2YJTD 3C5HA 1CZNA 3DBVO 2IWHA 4Y9DA 3A8TA 4YJFA 1W6UA 3K5IA 2Q2OA 2ZJ0A 4WESB 2XRZA 3HY4A 4V02A 2EFEB 4FONA 4IHAA 4L0MA 4X8MA 1E4OA 4BO9A 2OMKA 3FGPA 5BV2P 3X1WA 4CJXA 4LFBB 5AVVA 4AQ7A 3KKNA 5DRYA 5I7AA 4DPMA 4EI8A 5C7YA 2SBTA 2I0FA 1BX1A 2BMFA 3M70A 1NC1A 1R3UA 1VJCA 1XALA 3PR3A 4JT4A 4JZKA 3FPCA 1RJGA 2RBGA 2R8BA 3LHSA 3ZHUA 1ID1A 1N2SA 2V5UA 3PPVA 2V1UA 1TZ2A 1ZUWA 1Q22A 2VDKB 2O8DA 1ZHHA 5B1YA 4K9PA 5DOVA 4WLVA 5CH3A 3UUFA 2WFLA 3C8MA 3VOTA 1NUUA 5FWDA 3GLGA 1XNGA 1U1CA 4M0EA 3NWBA 3IKMB 2GJ9A 3K0AB 3DA8A 4FNGA 3UZUA 1EK6A 5C32A 4YAUA 3CT6A 4L16A 1FF9A 3LRXA 4WBXC 1OAAA 1SG0A 2AGVA 3RVQA 4BNTA 3GX1A 5BWOA 5HRAA 2FPPB 4KGXA 1BMTA 3AFIA 5BR1A 3R6WA 3VKUA 1CYEA 1FEZA 1Y6QA 4LX0A 3L84A 1TKRA 2MYTA 4UDXX 5F7ZA 1JTFA 5JRDS 2ORWA 3O3MB 4PG6A 2BEKA 2XE6A 3DDNA 1Z34A 1AQUA 2PZMA 3AFOA 2WLTA 1XCLA 1N92A 1M6EX 2AEMA 2KQUA 1T10A 3NRCA 1P3DA 4L6IA 5KX5B 1U5BB 3CX7A 4ESVA 2C3PA 4JDPA 1CP2A 1A8HA 4P58A 9LDBA 2IEBA 3QU5A 3QYFA 4OD0A 1V26A 3RFUA 1GPJA 1Z4JA 4GPD1 2AK2A 3OA0A 3ND6A 4IIVA 1G18A 2ZLBA 5EXSA 1G5QA 5GV7A 1OLOA 3CSUA 3AYXB 1WUYA 1NYTA 1PR6A 2I6FA 4FOTA 2IU0A 1SULA 3WNVA 4DKJA 3FBTA 3LQKA 4FCCA 4H4EA 4NZMA 3ESAA 1YU6A 1SHLA 3MTGA 3BMQA 3OIUA 1G7CA 1C80A 1H4QA 4IZHA 2WABA 2XF2A 1O9BA 1MAVA 5DIFA 1T24A 2CHUA 2XA1A 4E12A 4EO7A 4BQSA 4NZZA 4HQFA 5AM2A 5CFQA 2YQ5A 2A5LA 2IHZA 4LYFA 1X1SA 3HDJA 3FNHA 2E4XA 4NCBA 1R74A 3V1UA 3ZQ4A 2YS7A 3H17A 221PA 5K2MA 3SDSA 1JIQA 1LV7A 1XCGB 2CLSA 3VR1A 1JX6A 3QVVA 3CURA 1V71A 4GX1A 4HDSB 4NKRA 3NHMA 1HZJA 3RNLA 4AL4A 2V0NA 1K89A 4FMDF 4TLAA 4ASUA 3OZVA 5JC1A 1K8YB 3TPCA 4C5CA 3FVRA 3WWCA 1E4VA 3OD1A 4PANA 1N2CB 4FS8A 2ZJAA 3DLCA 1EM6A 4G23A 3ZXIA 2GKSA 5HW0A 2MSCB 2H7CA 1ZESA 3LVBA 2B5OA 3F4LA 2FPGA 3SJ7A 3DLBA 5DYWA 1QG2A 3EZ2A 1XMVA 3MG9A 4LEIA 1YQWA 1C3JA 2A8YA 4U9UA 2AFHA 3WL7A 3KU4A 4QUGA 2R8YA 5I7WA 2WT8A 3I4CA 4XDZA 1JIVA 1X94A 4RKYA 3UJAA 1EX1A 3BIJA 4FJ1A 3AVWA 2ZXFA 3RUCA 4H0CA 1KSHA 1KEPA 2HO4A 1KY2A 3NJRA 3RK0A 4CU5A 4LDPA 1T6YA 2C2BA 4GZMA 1Z5VA 4MB2A 4PBTA 4F93B 1XWIA 2P9HA 3GMSA 4D3SA 1I5EA 2XXAB 4JOSA 1PWYE 4KW7A 1JZQA 5E6RA 3ZHYA 4CODB 5HKAA 1SKQA 3L05A 1MX5A 3B3QA 5GAJA 5IVKA 3N2ZB 3TAHA 5AM4A 1JS1X 3G8BA 5CIWA 1ECPA 1VSUA 3EC1A 1U9YA 4OL0A 4US2R 3WSWA 1TOAA 2FG7C 1DLJA 1AA9A 1F38A 4ND1A 1EA5A 3IT0A 2GD6A 3USES 1GUBA 3BXZA 3ZU2A 3S8EA 2FI1A 1AUXA 2O0JA 5JO0A 4LRTB 2JFBA 3RVSA 3RJZA 1M1YB 3QBEA 4UHCA 3GRUA 4OM8A 5HZHA 1MBZA 1VFNA 2AF3C 2B4KA 3LQ2A 2H1WA 3OCYA 4EYOA 4DLBA 2F48A 2KWIA 2NTNA 3P26A 4QQ8A 5ALIA 3O73A 3PWTA 1FFEA 1NYQA 2UVPA 2GRJA 3FPFA 3GH3A 5EXDA 4G8DA 2A59A 3T9BA 3VV3A 1UK9A 4X65B 3A6EA 4M38A 2FK8A 2XQFA 3H6HA 5IAKA 2JC3A 4B8WA 4DY4A 2QQFA 1CHNA 3BHNA 4S1WA 3D3WA 4LECA 5CB6A 1JXQA 1LBHA 4R2LA 3WVNA 3EGIA 4I55F 2VUHB 3ZNOA 1E3DA 4D5EA 2AX4A 3EPJA 4UHKA 4C30A 5D7NA 1Z6TA 1YV9A 2JVIA 1Z0JA 2ZBPA 1FRZA 2PV7A 3PL1A 4LNHA 3UAYA 4E4YA 1MW8X 5LVAA 5SICE 1FRNA 1V8DA 2QT1A 2P6OA 4MLZA 2BJWA 5KREA 3QMVA 4G5QA 4OA8A 1KEWA 1TM2A 1XRJA 1SU7A 2ORIA 1RJWA 4WNCA 4YV0A 3K0CC 2FDXA 1FTQA 1HLPA 1KBZA 2WU0A 1Q6ZA 1UJCA 1VRWA 4BJ1A 4YMGA 1BW9A 1IOZA 2GZSA 3EGOA 1XC7A 1PYOA 3JQFC 4J1SA 5FBZA 3UFBA 4RV4A 3K0EA 1KDPA 2H48A 3A3NA 3OI7A 1JLRA 3UB4A 1SCAA 2GD1O 1KY3A 2WWGA 3DHWC 4E7OA 4EO4A 3ITNA 3NLLA 3FE2A 3AJDA 2GASA 2ZIAA 1ZG3A 2FGJA 4FUTA 2Q0XA 3T0FA 7ADHA 3OLXA 1NLUA 1U1FA 2PT7A 3ED5A 1JEQB 2X77A 4IP0A 5B53A 1WDMA 2Q1TA 1RRVA 4FGKA 4LC9A 3A31A 4X91A 1A5SB 3VPSA 4BCBA 4YCLA 4OXRA 10MHA 2GSWA 2XCLA 4RZ2A 4L9SA 4ZGWA 3VSAA 2NOAA 1K3FA 3JVIA 3OFJA 2GZ2A 3H3XA 4JN6B 5HOEA 1B0PA 4PRYA 4O4JB 1RNLA 1T4CB 3H11A 1MX9A 3BWDD 2UZ3A 4RVFA 1GU7A 1ZWLA 2YHBA 4Y9TA 3VX4A 1W0JD 5THXA 4BE4A 4GWLA 1WU7A 3F96A 4AMVA 1SK9A 4F3NA 5BXYA 1OHHA 2A86A 1T9CA 3IHKA 4DTCA 4KYTA 4WWHA 2JH9A 4UEKA 4NV0A 4IDBA 4BJHB 5C8VA 2A92A 1NVUQ 4HDNA 4XR9A 1VHDA 1F8GA 5L3SB 4PW0A 1JHUA 4TYYA 1QHGA 3PFWO 3I2JA 3GRRA 3PHLA 5D5HA 4S3MA 4G0VA 3DDSA 3G2LA 5ADWA 1H66A 5HOQA 1FMFA 3IO3A 4HEQA 5LP1A 2Z8YA 1RRKA 1Q19A 1JBQA 5AW9A 3AXSA 1E2HA 3QELB 3RM3A 5HIIA 1KARA 1DC7A 1L7EA 1URPA 5T41A 1OPRA 4LJ7A 3VR5D 2WSSD 5DNYB 3KHKA 1IB6A 5EPEA 2FR1A 3W5HA 2XAUA 2FOIA 4C6SA 1CQIB 3SGLA 1WCIB 3RTGA 4IH1A 3T5PA 3AMVA 5ARBA 2WIKA 2G9UA 2EC5A 1CDZA 1ODKA 3OF3A 1UM9A 1WD7A 3EGDB 2ONZA 3WRXC 1GZ4A 3FVQA 1T3HA 2EARA 2Q5IA 4K46A 5EIWA 4YXWA 3H1PA 3CIFA 4F5WA 3U5TA 2I1QA 4HPXB 3JQQA 1A9XA 4A8PA 4CXMA 4EMTA 1ZH2A 2C54A 2WHYA 1S5PA 1Z73A 3NIGB 4JB3A 2ZZNA 1R8SA 2CXSA 1L4YA 2QVCA 4S1NA 4R41A 2JIRA 3NHYA 4JOBA 4Q4DA 1DEXA 4TTRA 3N2LA 1UK6A 4HNQA 1I3KA 3KSAC 2VUTA 1DQNA 4Q48A 1XU4A 2YMPA 4PYOA 4RV9A 3P9IA 3L1IA 2HTEA 2DPXA 1HG0A 2AMFA 1B0ZA 2GN2A 1PX0A 1M75A 1TMKA 3LHFA 1Z5PA 3P2YA 4G0MA 4YJ3B 5KNDD 3BGDA 1I2MA 3R5JA 2ECOA 3FF1A 2O52A 3LC2O 1B26A 3RUFA 4AJHA 5CG2A 1Y1RA 4JEHA 3GJSA 4NR0A 2Q2VA 3VGJA 4BNHA 1IY8A 5LP6C 5E3JA 1UMKA 2YOGA 4H6XA 2H63A 2OBNA 1XQ1A 3THRA 5HKOA 5AVXA 1CY4A 5KVSA 3N76A 5FA5A 1F12A 1ONPA 2E48A 4HPJB 3T1NA 4AURA 2RH4A 5AKXA 3E8SA 3GNTA 4LRXA 4GZ6A 3Q3HA 1GYRA 2FFHA 2YJ4A 3Q3VA 5FOVA 4AUMA 3NM4A 3EC7A 2FVXA 1MTOA 3F6BX 4FFNA 2YZNA 4AJOA 5JWOA 3K9NA 4AKHA 1T6NA 1WZIA 2PGJA 3IYLW 2XZDA 4KRGA 4LRWA 4IUCS 3HUFA 3B52X 1RAFA 4XWTA 4DLAA 5EERA 5DTQA 3UMRA 1QH8B 1U7ZA 2FTKE 3LT5A 1JA9A 5BN5B 1UFVA 1A95A 2BP7A 3MIIA 2GTIA 4FIDA 2NACA 2RH8A 5K0SA 2OYRA 2HCBA 1SG6A 1M2JA 2EFGA 3USCS 5A0FA 3KXDA 4HP8A 3IPCA 2J31A 1XTIA 3L7CA 1NFFA 1JDJA 2CNWA 2QG9A 1CUJA 3GVIA 3OIYA 3X1MA 4B74A 4D4IA 4BLWA 5DWVA 4AJEA 3SYNA 3IP6A 3GT3A 1QO9A 4BBPA 2V5AA 4AXBA 1QIFA 1OCEA 2ZYSA 3SOZA 4KK3A 1Y4ZA 3RTEA 3FSRA 3E82A 5BUQA 2W2XA 2RH9B 4J7AA 3SSNA 3J81A 4BY9E 3VKHA 3AKYA 4JBYA 1QBGA 5C8YB 4YB8A 5ALDA 4ZDWA 4FOPA 3RR2A 2WMOB 4C03A 2BGRA 1UJ5A 4OJKA 4ECAA 5JNLA 2YVAA 1ZUHA 3JAMA 4E07A 4V2UA 4BNNA 2HSWA 1GQYA 1KIMA 2I6XA 1F2DA 4CI9A 4D96A 5CDYA 5LP6B 4H7KA 3FAKA 1V6CA 2OEPA 4RH1A 1E6UA 4WHMA 4TKMA 1FUEA 1X6VA 2DF8A 4F97A 1BMFA 5BVGB 5CHYA 3A1TA 3UJDA 1WR8A 2D1TA 3KM0A 3P52A 3HKDB 1KTIA 2BTOA 3P0HA 2NQ2C 3IAHA 1K4YA 2NV6A 3PJEA 4ZN6A 2Q4OA 4P2GA 2IW1A 2Q9UA 2VL7A 3JQ8B 3A6GA 3RTAA 3RFXA 5HUHA 3FJOA 1H4TA 4GZ5A 3RIGA 3IIIA 3TMKA 4F06A 3U0BA 3QVUA 4PTYA 4BLVA 1DKRA 1IPFA 1H8ED 4N47A 3THXB 4Q93A 1VL8A 1XWFA 1AV6A 2R7NA 2XSZA 1UKEA 3K9LA 5CNMA 4MPTA 4MAAA 3ABRB 5JS8A 4P7JA 3KSBC 1IAVA 4BV9A 4Q02A 5F12A 4QRHA 3ADPA 5LZ2A 1C4KA 2HUPA 3K05A 4B17A 4CMHA 1YDFA 2NO5A 4IIJA 5KVCA 3HR8A 4O5AA 3KEMA 4OUDA 4D9HA 1UADA 2RHJA 3NPAA 2HMYB 3JAT