1QHNA

Chloramphenicol phosphotransferase from streptomyces venezuelae
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
178
structure length
178
Chain Sequence
b'MTTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKESIECAWAIAAHVVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHLORAMPHENICOL PHOSPHOTRANSFERASE
publication title The Crystal Structures of Chloramphenicol Phosphotransferase Reveal a Novel Inactivation Mechanism
pubmed doi rcsb
molecule tags Transferase
total genus 53
structure length 178
sequence length 178
ec nomenclature ec 2.7.1.-:
pdb deposition date 1999-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07931 CPT Chloramphenicol phosphotransferase-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1qhnA00
2BBOA 2RHDA 3A1UA 1OH6A 4DCNA 1T8TA 1OYWA 3QUSA 1IAQA 2QG6A 4GOKA 4YMUA 2EFGA 2XNDA 4O2RA 2J0SA 4CF7A 3LX8A 4C7OA 3SNHA 5CIWA 4BECA 3BE4A 1COWD 3ZVLA 1IBRA 4HB2A 1IN8A 3UMSA 3L0SA 4MDFA 1J8YF 3R8FA 3NXSA 3KKOA 2HDNB 2QAGA 2O52A 3H2YA 4LI0A 3TJZA 5C4MA 3U3RA 1LTQA 5TMPA 1U9IC 1MOZA 4YC7A 3SI7A 2MMCA 3DDCA 3Q3JB 3SJBA 4DKXA 2GEUA 2BJWA 4IKEA 3T12A 1K6MA 2VP0A 1BMFD 1J70A 4NMMA 2RGGA 2XEXA 3HJNA 3W3ZB 3THWA 1C4OA 1R0XA 3WBJA 1I4LD 2RGEA 1SVKA 4V03A 4JMPA 1XZPA 3KTAA 2GWHA 1H8HA 2GESA 3NH9A 1QHYA 2BMFA 3RRMA 4Q1FA 4OQXA 4B76A 4PAMA 4IFBA 4OHWA 4ZCLA 1E3MA 3QXXA 1IN6A 4LC1A 3ZQJA 5EE5B 5F2EA 1VCNA 2IYLD 2IYTA 2JLRA 2O0KA 4TL8A 2GXUA 4B3GA 2PT5A 1E2JA 5HKKA 1KNXA 1FNMA 1U90A 4G5QA 1UBEA 4OQNA 3SBDA 4ARZB 3PEWA 3LLUA 2WSSA 1UADA 2E1RA 2FEMA 3BB1A 1II8A 2GETA 3CX7A 3OEED 4CIDA 5CM9C 4FCWA 1FX0B 4TWZA 1WE2A 3ICQB 2QORA 4ILEA 3MRSA 3HYTA 1KI7A 3O47A 2W0MA 1GFIA 1XB2A 2ZJOA 3Q5DA 2ZJ5A 4D4KA 1CXZA 1NL3A 4DUGA 4F4JA 4YMVA 2O5VA 1G20E 1MT0A 4IRUB 1DG3A 2QTFA 5ELXA 2GJSA 3AKYA 3I8SA 1NN1A 4BZPA 2WV9A 2IYVA 3OEHD 5EE0A 4FINA 4YONB 1L7VC 2D2EA 1DAKA 1YJ5A 4RD0A 5IRCD 3WYGA 2V1UA 1NF3A 4TYPA 4UJ3A 3RS2A 3IPYA 2VO1A 2YWGA 3QKRB 5EP4A 1ZM7A 4M1WA 3UMFA 3LVQE 4G0NA 2IXEA 2UZ3A 3CF6R 3IIKA 4R2HA 2RMKA 3B1YA 2RGNC 2ZRBA 1S1MA 1ZNZA 4JL5A 4TYNA 3AUXA 1W2HA 2OV2A 2WBLC 5E3HA 4B34A 4NCNA 2C2HA 1ZW6A 2GVZC 4DB2A 3FMOB 3T1TA 2IUTA 3ADBA 5CB8A 1OFIA 5CK4A 5KHOC 4D25A 2O8FB 3T1VA 3W8RA 2IF2A 3IEVA 2QMOA 1X6VA 2B7BA 1GOTA 5A0FA 3AVXA 2CLSA 2ZEJA 4HLUC 2R6GA 1P9NA 2OO7A 4KLZA 3SR0A 4U00A 3R20A 4OI4A 1ZAKA 2ZSAA 1SVSA 4GZLA 4JLOA 1ZUNB 2ZSEA 5JJLA 1G16A 2J5XA 5FOVA 1J7KA 5KO2A 2ZRCA 2YOHA 1S9HA 3C15C 3T5DA 5IT5A 2G0NA 3CRW1 1QHXA 3I62A 2FH5B 1KI9A 1Q1EA 1P73A 1TAGA 2ZU0C 4HZUB 5JI2E 5LB2A 1IONA 2WHXA 2QY9A 3DEFA 4AKEA 1T4GA 2I1QA 1ZM9A 4ARZA 5JJKA 4WBSA 4N3NA 2NO7A 5AJWA 2BEKA 1DG1G 4II7A 1XXHB 4US0R 1EESA 3RS0A 3EWAA 1P4SA 4LYAA 5FTNA 4F92B 2EWVA 4TLCA 1N6KA 2BBSA 3QIAA 2OXCA 1O3YA 5G41A 1E2PA 1IY2A 1FX0A 1COWA 1P2VA 2IEYA 2V55B 3AVPA 3QKUA 4PO1A 4XVQA 3TLXA 5KU1A 2ZREA 2ZU6A 1LY1A 3K09C 1KDRA 1A7JA 3O8CA 4BE7B 2YINC 3K0AB 4LBWA 4B6EA 1TQ6A 1DAHA 3FMPB 4D4JA 2X1VA 1DBSA 3GEEA 1RRFA 3QF4B 4KBGA 1Q57A 5KSPA 2QEQA 5E7IA 4DDUA 5KOYA 2JDID 5JHHB 2DB3A 4UNRA 4A9AA 1US8B 3BH6A 4FXPA 1YR8A 3U6BA 1U0LA 2ZI4A 2XAUA 1I4TD 1BMFA 5KSZA 4Q4HB 5EXXA 3TUJC 5J4KA 4JJZA 3QKRA 4M0LA 2B6HA 1T5LA 3KX2A 3DMDA 3AB3A 2FFAA 2ZVPX 4MA4A 1WXQA 1OLOA 3FPAA 4JLPA 4NHOA 3W3AA 4P3YA 5D3MB 1JJVA 3PCRB 4Q4LA 4F93B 1FZQA 1W44A 2CLCX 1KI8A 3L0IB 2OEPA 4YQFA 1J2JA 2YV5A 2YWHA 3CH4B 5TY0A 4DDTA 2J7PD 2IHBA 2F9MA 2PZGA 4AYTA 2O8FA 1GRQA 4TMVA 3KJEA 2P5TB 4HAYA 1P7CA 1SQ5A 4PFSA 4JYBA 1I2MA 5JCPA 4C0JA 5HE8A 2V7QD 1TQ2A 1DAEA 4WAUA 2IEZA 2VSFA 2ZRAA 2XOKD 3CZQA 2Y8EA 3MD0A 5H1YA 4F4CA 3QXHA 1M1YE 3AF4A 3BGWA 4DCSA 2IXFA 1NG9A 3A1WA 4XSHA 3OEEA 5FPTA 4BLRA 3LA6A 3Q5EA 3GJ0A 4B3XA 2ANBA 1Z47A 1ONBA 2VA8A 3CPHA 1XP8A 3LW7A 2F1JA 3QPWA 3TW4A 1XDBA 1M6NA 1X1RA 4LBZA 1IQPA 5FOTA 2XITA 4DC9A 1NKSA 3IUYA 1RW4A 2K5UA 1P9RA 4LJ8A 4Q1AA 4FCVA 1XXHA 3DM5A 3FGNA 3LXXA 3OEHA 4GOJA 2F3TA 1NVUQ 3Q72A 3AP2A 1AZSC 1X3SA 5HE9A 3W5IA 1ZMXA 3A8TA 3X1DA 2VP9A 2ZRNA 1W48A 3E1SA 3VKGA 1W36B 3GEIA 2FJUA 1FNNA 2YWFA 3K0AA 1U99A 2HJVA 5TB5A 2HT1A 3QF4A 1OXUA 3LBNA 1T9HA 3LH5A 4EPYA 2NTYC 3A1TA 4IVPA 1US8A 4PXAA 1QHGA 4IXMA 4AIIA 4YMWA 4Q02A 2JLQA 3E2IA 3QG5A 4B44A 4Q4HA 2HUPA 1HY3A 1EFCA 4KFUA 3TR5A 3SYNA 1KK3A 4OI1A 2VEDA 3RRYA 2FX3A 4OK3A 5KYKA 4L9SA 3WYAA 5D3MA 2GXSA 3GMTA 1CRQA 1MH1A 3WBKA 1RPZA 3EXAA 4JT2A 2ONJA 3K70D 2Z43A 1WBDA 4FIDA 3DKVA 2WKRA 4PZLA 4XWAA 4PPFA 3RLFA 1X86B 1T5IA 3W6OA 4AYXA 4M1TA 2QMHA 2WWHA 4NCIA 5UKDA 1KGDA 4AI6A 4QC2A 2IYUA 4TLEA 5FTMA 2XXAB 1FP6A 1G3QA 4MRRA 2A5YB 1YZKA 2KBFA 2WJGA 5B30A 2R6CA 4KO8A 3OF5A 3DZDA 2H57A 2B21A 3MWYW 4PHHA 2D4HA 1G7TA 2KB0A 1D2EA 4EAQA 1FFHA 4QKQA 4QM6A 4EJSB 2ZSBA 3AGQA 3T06B 4EDHA 1S8FA 5CJPA 2VTKA 4QFMA 4E07A 3HU2A 4BZXA 4WZBE 4TZ0A 2GZDA 4GZMA 4DSTA 3AVVA 4M2LA 1DAMA 2I4IA 5AJVB 4CGZA 1GKIA 5C1BA 4N0EA 1P60A 3SYLA 4K8OA 4K81B 3THYA 4N1AA 1NY6A 2HXSA 5H68A 4ASUA 3QEJA 1EFUA 3LXRA 2FDCA 1TF7A 2O8CB 4TMKA 1GILA 1KJZA 3K9LA 2JLSA 2ZRGA 3BXZA 2YYZA 4DBLC 3AUYA 2VRWA 4PHFA 1G17A 1XRJA 1GM5A 4LRWA 1UKVY 2JJ1D 4URWR 4AURA 2QSYA 1OV4A 3T1QA 2OBMA 1P6XA 3JZMA 1E9SA 3K70B 4MUBA 1EFRD 4OK6A 2WWWA 1N6LA 2WOJA 4URUR 1DOAA 2J7PA 4OJKA 2JATA 3P4XA 4PPNA 4DCUA 2AXNA 1AKYA 5J47A 5G40A 3L8YA 1U8AA 1ZNYA 4JSYA 5EXTA 1W0JD 3X1XA 1YHNA 1CJUC 4M9XA 2V3CC 2EU8A 1E2EA 1E2LA 1Y63A 1NSFA 1NLYA 2OG2A 2OXRA 2V7QA 4QHTA 2QUZA 3ASYA 4BEBA 1UEJA 2OILA 2XOKA 2WMNB 4F4IA 4L5BA 3R7WB 3HYRA 4L4UA 2OZEA 2R2AA 3H4MA 1XCPA 4Q9IA 2ZI7A 1CS4C 4YDSA 2C04A 2EYQA 3EIEA 4M22A 2IYXA 4JVNA 4B2IA 3EPHA 4PHGA 3NBXX 4ZCMA 2ZVQX 5KDOA 5BXQC 4A0GA 2QTHA 3C41J 5FUVA 3SE0A 2XXAA 1R7RA 5DE3A 4A0RA 4BLPA 2ZYWX 4OQFA 5AR1A 5DNYB 5L3VA 3WY9A 2X8AA 2ZYUX 2JJ2D 5FUXA 3SZRA 4Z8XA 4H1UA 1TF2A 1SZPA 2QGZA 3MUFA 3CF2A 2IK8A 3BFXA 1KSGA 4U02A 1E99A 2IS1A 2VIIA 3LBHA 1AA9A 1H8ED 4IOJA 4M9ZA 4YXWA 1XMIA 4Q4JB 3P27A 1G8FA 4V0KA 5HTKA 4NYMR 2PZFA 1HT2E 3C5CA 3K53A 3TUIC 2BCJQ 5JWHA 3IQXA 3SS8A 2P0EA 2BBTA 5EP2A 3SQWA 2A5GA 1L2TA 4DSUA 2FPLA 1E69A 1F2UB 3ICEA 2O8CA 4EFLA 3GLIE 4RFSB 3WP1B 4DLTA 3Q7QA 4OQLA 1KOFA 2G88A 4PAQA 4TTQA 2ZRKA 5A4JA 2FFBA 1SXJE 2JAQA 1D6JA 1XJQA 2ERXA 1XPUA 1GNQA 4ZDWA 4Q7KA 1Q1ZA 4BFSA 4OHZA 5FBVB 4XWKA 2VP6A 1NI3A 1NN0A 2GCPA 2WZQA 4EPXA 1UDXA 2ZE8A 5EE3A 3BD9A 1HTWA 3E70C 1QVRA 4I1VA 5FH9A 1HQYE 2MSEB 2BM1A 1ZCBA 4RCYA 5GJCA 621PA 1D2NA 2QE7D 5B2ZA 4GRAA 4HYYA 1NVXQ 2OESA 2F55A 1KDOA 1T8UA 1Q20A 2AXPA 3I5YA 3A37A 3BFKA 4PSKA 1S0UA 4KYUA 5SZJA 3LD9A 2AKYA 3RS7A 1W7AA 2HCJB 5HPYB 4XWOA 2GZAA 2F1RA 1WP9A 2EFHB 1W5TA 2QI9C 1M8PA 2VF7A 3IQWA 3TNFA 3U3JA 4KFTA 1RRCA 1SULA 1NBMA 1NLZA 4AD8A 2QP9X 2H16A 4URXR 4C4PA 1II9A 4EPWA 4XTRA 1NIPA 1OIVA 1HE1C 2ZETA 1P2UA 3ASZA 3KUCA 4KJZA 2QQEA 4PR0A 4KSCA 4GOXA 3WMEA 4DSNA 2ZYVX 2EWWA 1G4AE 4EPVA 2F43B 4AC9A 1Z22A 3SC3A 2PJZA 3QKSB 2MMGA 4Q47A 1KI1A 1Y3AA 4JIMA 1A2BA 5FBRB 5KDDA 2AWNA 1VYVA 3AM1A 2A78A 5CITA 3MLEA 1OXXK 3VAAA 3VHLB 4XD7D 1YR7A 5FPHA 2PL3A 1F60A 1OF1A 2BHRA 3JZAA 3QY0A 4UNPA 2JJ1A 2ODNA 4G3XA 2IA5A 2NQ2C 1XFAA 4W5WA 4RCZA 4FD2A 2ZS7A 4IDOA 5FPYA 1E79D 1W0KD 1EFRA 2H8KA 1NY5A 4RSGA 2P2LA 2ZRDA 4DWJA 3K0EA 4DB4A 4HAUA 1ZUHA 4LGMA 3CUEF 4RFSA 3TVDA 3K9HA 2W6JD 3FKQA 2RB4A 2WVJA 3AVQA 1W0JA 2ZRPA 4Q66C 3GLGE 3GLGB 2L0XA 4LJ6A 2RAPA 5BYJA 1S1CA 1AN0A 1VMAA 3AKEA 2XB2A 1Z28A 1XD8A 1OT3A 3NVAA 4TMZA 3V00A 4B32A 1TL7C 3AEZA 3QE0A 4TYQA 3ZIAA 1WMSA 2KSQA 2UKDA 3GFOA 1WCV1 4JT4A 4UNSA 2PX0A 5B64A 2CMKA 2W83A 2ZAMA 5FOXA 5KNCA 3X1ZA 3R9XA 3BOSA 3U6KA 3CB4A 3QBVA 1YU9A 3PUYA 3AVOA 1D9ZA 2VP5A 4S35A 5FOWA 1K8RA 2FSHA 4LV8B 3U3KA 1KIMA 1ZINA 3Q85A 2WKPA 5KTYA 4QBFA 2XTMA 3FB4A 4MGKR 1RZ3A 2JJ2A 3L82B 1FUKA 3PEYA 3QI2A 3FFBA 2REBA 1BOFA 1MO3A 2ZJYA 3TVTA 1N5LA 2JEOA 1Q1BA 3I1FA 4M1SA 1H8EA 5CLQA 1O87A 1QG2A 1ESMA 1YZUA 2RH5A 2I1VB 2QT0A 4B3FX 3U7HB 1X1SA 1T3SA 1E2IA 3QPVA 3SN6A 4A0HA 2FFQA 1KMHB 3JVUA 3W8NA 2F43A 4TT3A 3T61A 4QGFA 3QKSA 2NMVA 3ND8A 2GA8A 3KQUA 5J4HA 5EXSA 2HYIC 3I61A 1B0UA 1DO0A 4Q9JA 4I1UA 2GEDA 1XD2B 3LO5A 4PANA 3MJHA 2JGNA 3C8UA 1JQLB 1S2MA 3QJYA 4B75A 3PITA 5EQTA 4I81A 3RRZA 1OE0A 3ADKA 4M53A 1VG9B 2WJYA 1ZCAA 4QHSA 5HZHA 2VH5R 5DLQC 1QHIA 1AGPA 3SJAA 2A30A 2QE7A 1OFHA 5C4GB 1T91A 2FMXA 2O8BB 2AFHE 2YKGA 3NEYA 3ZH9B 4JBXA 4DLSA 1XMVA 1TEVA 3ZVRA 1RJ9B 4B2LA 1R5OA 1M7HA 3BERA 3ZD7A 2XZLA 1KK1A 3QXCA 5CJ2A 4AK9A 2ZR7A 1N6NA 2QENA 2QPOA 4HSEA 1FW6A 2B8TA 2DWPA 3EIHA 1VTKA 4PSAA 2ZRLA 2NZJA 4NP6A 3VR1A 1G3IA 3MSXA 1W4RA 4PQRA 1E9EA 3GJ8A 3B85A 5DI9A 4QXAA 5DHAA 5DYGA 2RCNA 2FG5A 1CULC 2R62A 2WJVA 4BWYA 4MUAA 4WVFA 2P3SA 5BYKA 121PA 5JEDA 2V1XA 5KSOA 1U9IA 1VG8A 1JQJC 4ESVA 2PH1A 3KKNA 2OBNA 4PPGA 1NP6A 1D8TA 1E4YA 1NSTA 3F8TA 1Z63A 2CXXA 4LWZA 5LBIA 4BFVA 1N0VC 1TADA 1NMXA 3M1IA 1OYYA 3K9GA 3IKJA 3SBEA 1E79A 2ZRIA 2AKAB 1QZXA 1Z07A 4CVNA 2N42A 4HLQB 4RY2A 4Y0VA 1CTQA 3T15A 2XZOA 1OH7A 3VHXA 1OIXA 4PZYA 1T0HB 3CF0A 2W6JA 3OIVA 2DFLA 4G1UC 3R9IA 1W49A 5FPKA 1UKYA 3B60A 2XTZA 1CR2A 2X2EA 1ZRHA 3K0CC 1XD2A 1T6NA 4Q4AB 5LD2C 4ZO4A 3GLHE 3GLHB 4Q18A 2VF8A 2OCAA 1EXMA 2DHRA 4QGGA 2A5DA 1E2GA 4QRHA 1L4YA 2VLIA 5SZHB 4C9BA 5BN5A 4JLNA 2RGAA 1XWIA 3U61B 4PO8A 1XTIA 2C98A 1DO2A 2Q9CA 3B7GA 2O8BA 1ETUA 1CRPA 2ZXUA 2YHSA 2C9OA 2CVHA 3KFVA 5M04A 3L8ZA 1YVDA 3LFUA 1RJ9A 2Q3FA 3SEAA 3CX8A 4OHVA 1SVMA 4V0OA 1KTVA 5EUQB 2QPAA 1G8YA 4PQYA 1R5BA 3BB3A 2W2VA 1KJYA 1OXVA 5KPDA 4MYCA 5AJXA 4GT1A 4P4TA 2FSFA 4JBYA 3M4YA 1ZUIA 4XH9B 1L8QA 3IO3A 3M0EA 1QHSA 4QJ4A 4I4LA 1UBCA 3RABA 3LLMA 4NCKA 4IFEA 5FBQB 3PEUA 2B92A 1CJVC 1TUIA 4WXPA 2XJ4A 4C2TA 3P1JA 4C0BA 4IOMA 1SVIA 2WICA 5F98A 5FL3A 2C03A 1GWNA 2ZUBA 1M34E 1NVVQ 3F3YA 4MRVA 1A4RA 4Q1BA 1P2TA 5J40A 4E22A 5LDDC 2W2XA 2CE7A 4KAXA 4LJAA 3GLFE 3GLFB 2FEOA 4WZAE 1DARA 1D9XA 3PUVA 3T34A 2TMKA 2CCKA 3TGPA 4DVGA 2CK3D 3AP3A 1G5RA 2HF8A 4DJTA 3E5HA 4HLUA 1NKTA 4CEJB 2OFOA 1W36D 4C0AC 4JLJA 3UWOA 1ZD1A 2BOVA 4HATA 5AK0A 2QQ0A 3KZ1E 1V5WA 2C96A 3ZLJA 1DAIA 1OH5A 4GPTA 3HU3A 4R7ZA 3D6TB 1KSHA 4W5JA 2EFEB 2QN6A 2WWXA 4M1YA 1R0WA 3H1TA 2FOLA 1YZQA 4Q4AA 4BRWA 2HXYA 3NBFA 2QTVB 1CR4A 2ZJ8A 2R9VA 2EFCB 4ZI3A 4MGZR 1LFDB 1DEKA 4FW9A 4RZXA 1E9RA 4QBHA 8OHMA 4FWTA 2ATXA 3DKPA 3REGA 1UAAA 4JL6A 4U7DA 4TQUS 5KUTA 5EZ6B 1YE8A 3B6EA 4BFTA 1IY0A 3SHFA 3I32A 3U4QB 4ZDJA 2ZSDA 3A1VA 1E0SA 1E2KA 1VYTA 1EG7A 2VQSA 1TU3A 4JSTA 1Z6YA 3EX7C 3KXIA 1F3OA 3VU9B 2FPKA 3I8XA 1E9CA 1KO7A 4LSGA 1MO4A 2WWGA 5J5CA 2V4ZA 1C1YA 2P5SA 4QJ3A 1EK0A 3OZXA 2QRZA 2Z4SA 3O8DA 3RWOA 2ZI5A 4V0NA 4DT1B 4LJYA 4TLAA 2AK3A 3MMPA 3K0FB 4JYCA 3WP0A 3A4LA 3JVVA 1EFTA 4YMTA 1TUEA 5GADl 2IUUA 3GFTA 5JJIA 5CB6A 3SYKA 1G4UR 4L9WA 2ZRJA 1A1VA 521PA 3GPLA 4JJKA 2VP4A 3TAHA 4DLYA 3OE7D 2A3RA 1S9DA 1SVWA 2LKCA 4P4SB 2LKDA 2JA1A 4E09A 4DSOA 1HUQA 4UNQA 1NVVR 1P75A 4C2UA 1KZ7B 1Z06A 4TL9A 1XNJA 4FCTA 1E2MA 3GLFA 4ZDIA 1IXZA 1SVOA 1JXOA 3KJGA 3T1OA 1P9WA 1Z29A 3I73A 1FUUA 1KO5A 2F1IA 4Q1CA 1F6BA 2GK6A 3IDQA 3RVBA 4HZUA 4CEJA 1E2QA 1T3LA 3AF2A 2WIBA 1Z0JA 5DSZA 1S4QA 1GKUB 3CRQA 1IN5A 1SHKA 4DLZA 5F9HA 1PJRA 4POAA 5DO9A 3GEHA 4EKDA 4QNMA 1Z08A 4PPQA 2J46A 4WA7A 4KODA 1W46A 4MKIA 3LQRA 2CNWD 4NU0A 2BV3A 4KU4A 2ZRMA 1MRSA 1UEIA 2ZYTX 3PG5A 2CL7X 4CRWB 4IHQA 2JIZD 1F48A 4W5HA 3K8YA 4GDFA 4M4SA 1N2CE 3U3OA 1VKJA 3LRPA 1LS1A 1UJ2A 1JXMA 1N0UA 3BBPA 3OHMA 5FTJA 1Z5ZA 4QG7A 3WMFA 4QNRA 4P0TA 4GMXA 5IDVA 1ZNXA 4HB0A 1LB1B 4Q1EA 6Q21A 3U4QA 5FR1A 3AKCA 2R44A 3QBTA 2P6NA 4HAZA 1CLUA 3PQCA 1PLJA 1I4DD 1KAGA 2ZJBA 4M9QA 3A58B 4LV6A 4BEJA 4BFZA 4D0NA 2VP2A 2XJ9A 3VU9A 4BRUA 3PJRA 4Q5IA 4AKIA 4B3CA 4C30A 3ECCA 1A5TA 3TIFA 2Q21A 1BIFA 4DT1A 1TF5A 4A2PA 5JEEA 5JS7A 1ZP6A 2V6JA 1P72A 3K0FA 4P31A 2CK3A 3P32A 4YLGA 4HUTA 2DYKA 3EIQA 3MFYA 2FE4A 1U8YA 4FMCB 2O8EB 2IL1A 2ZR0A 4TSFD 2ZM5A 1JALA 2ZR9A 4B33A 2QA5A 3VMFA 3OAAD 1GIAA 2GBLA 4XOIA 5AWFC 2NPFA 3UG6A 4LPSA 1VDZA 2VYFA 3DVLA 1Z6TA 4EPRA 5IK2D 4Q7LA 3CONA 4Q1DA 2IT1A 4XTCS 3QKTA 4BLOA 2F7SA 4Y0AA 5EP1A 5FL7D 4DXAA 1X8JA 2WJHA 3EASA 1NN5A 2EW1A 4MKHA 4PQFA 2J87A 4JS0A 2CHGA 3O8BA 2V54A 1XU4A 2AX4A 3EW9A 5SZIA 3TSWA 2CHVA 3BS4A 3LQQA 3ONWA 2JDIA 3RRNA 1XTQA 1E32A 1RKBA 2ORIA 2YJTD 4PC3A 3U44B 2FZLA 1GNRA 2FSGA 1EX7A 3SJCA 3CRRA 4ABYA 5G3YA 1OFUX 1XMJA 1IN7A 3RS5A 3FHOA 4JVMA 1DAGA 2G83A 2QAJA 4QL3A 1CKEA 3ZGXA 2O0HA 3BORA 1CR1A 3LWNA 3TR0A 1WF3A 2QU8A 3CNNA 4RD6A 1Q22A 2QRNA 1HQCA 4LYFA 4QBGB 5HCIA 4OYHA 3TQFA 4A8JC 1GNPA 2GRJA 4ZPXA 5FTLA 1PLKA 3PUZA 3FE2A 3NG1A 1R2QA 2FGJA 4KITB 2G6BA 1GL9B 3PV0A 4MGYR 1UBGA 4NYJQ 4KYIB 1U94A 1SXJD 3MGCA 1GG2A 2PZEA 3GJ3A 5DN6D 2NO9A 2DR3A 3AGPA 3KXLA 1CBUA 3OE7A 1J90A 1C9KA 5CIQA 3C16C 1RRPA 4LJ9A 3N5CA 4IEIA 3W34A 3P4YA 4HZIA 4ZI2A 4G5SA 3B1WA 1U0JA 4D4MA 5L3SB 1Z3IX 1GRNA 1KI3A 2Z6VA 1Z8FA 4US2R 3KQHA 2ZRHA 1NG1A 2ZS8A 3U60B 1AS3A 2NZ8A 3LAWA 3EA5A 1SHZA 1ZU5A 1D5CA 4HUQB 3ADDA 1OSNA 4UJ5A 2BDTA 1JJ7A 2ZPTX 2WAYA 4I1SA 1S96A 1XEWX 4DCVA 1KMQA 2Q3MA 4PC2A 3PIRA 4GP7A 4F7WA 4EJSA 1IY1A 4CZ2A 5K8LA 1RYFA 2ZITA 4TQAA 3QSYA 1KKMA 1R10A 2CNWA 3QEOA 5TDHA 2VHTA 2OBLA 2FSIA 2WMOB 2BM0A 2PT7A 5EE9A 3AF0A 1JEEA 4OHYA 2ERYA 2JIZA 4IJMA 3CWQA 4DEYA 3EPLA 2VBCA 2DFKB 2B8WA 2HCBA 4ITRC 1P61B 3ZVMA 2ORVA 3U7GA 3NWJA 4Q7JB 1NNEA 3GQBA 3X1WA 3GJ5A 4OHXA 3R8CA 2GAOA 5JSZB 1ZBDA 3RHFA 5FI0B 2HYDA 4D4LA 3ZD6A 4BGDA 2HEIA 2A5FA 3LV8A 1VYUA 2G1KA 3AKDA 1IJEA 3B8HA 3L0PA 3THXB 3GLIB 5LB4A 2PEYA 4KV9A 1D2MA 4FMDF 1JECA 4LPKA 1KK0A 1G19A 1SXJB 2PJRA 1LVGA 2BEJA 4PAOA 2RGBA 2BKUA 1G6OA 3FFAA 5DGXA 3M6AA 1G21E 4Q03A 3DPUA 3R9WA 4Q19A 1P3JA 1ZU4A 2IS4A 3KKMA 3RS4A 2J3EA 1E9FA 2PCLA 2YC2C 4X8OA 3ZYCA 2XSZD 1KI2A 4KXFB 1UBFA 1LF0A 3TRFA 2XGJA 3KQKA 5AJYA 4L8GA 4B3BA 4E03A 2HJGA 3C7KA 3CRMA 4NYJR 2N1BA 1YR9A 3UMRA 4LV5B 5CDFE 4TSFA 4RD3A 2EFDB 2CL6X 2V9PA 3OAAA 4IOLA 3U5ZB 4RZ2A 3R7WA 1XTSA 5IK2A 1GRRA 3RC3A 2QM7A 1IOZA 4AY2A 5KDLA 4X8HA 1E9BA 5L3SA 5CYOA 4UXHA 4CEHB 4UKDA 5JS8A 5GJWC 3NH6A 5FL7A 1LF5A 1KZGB 1OPXA 4HUQA 1RFLA 2J1LA 2GF9A 3C5HA 3RSOA 4EUNA 2R6FA 1Q3TA 2V8OA 4DDWA 2XB4A 1HURA 3D7MA 1EWRA 4D80A 1CJMA 4KHZA 1G3RA 2DFTA 1R8QA 2FF7A 4CEIB 1VPLA 3BWDD 3AVYA 3NHAA 1MV5A 1GVNB 4N0DA 5JZVA 4RD2A 2OCYC 2ZJ2A 1DVRA 1IJFA 4OKSA 5G3ZA 5BWMA 3CM0A 4Q4JA 1KSJA 3KUDA 1FP7A 3UG7A 3VR5A 4C3ZA 5L3QB 3TH5A 5JMTA 2ZUDA 3GCGA 2H7VA 2GEVA 4P4UA 1LNZA 5FUWA 5JSZA 2MSCB 1A82A 4DLXA 1H8HD 3X1YA 4BLTA 5DH9A 3VKHA 1XJCA 3NHBA 4NKRA 1F2UA 4AG6A 1Q0UA 3THXA 1ZVQA 3GLIA 5FPSA 3SQXA 3VX3A 4TTPA 1VHLA 3N2IA 4FMCF 1L4UA 2AL7A 1SXJA 2ZS9A 4GNKA 2GCOB 5DN6A 2CCJA 1RE0A 2H1LA 4NBSA 3RNLA 3P26A 2BC9A 5B57C 3NBZC 3ADCA 2QROA 1OW3B 2WWYA 2NO6A 1TX4B 3HPRA 3L2OB 3SJZA 3PR1A 3GD7A 4WZ6A 2ODEA 1XJ0A 2BVNA 4OI2A 4Q9LA 3AVTA 2OAQ1 2DPXA 1VG0B 1PZNA 3TSOA 1G291 2FU5C 2VL7A 1BYIA 4RVCA 2WSMA 3Q7PA 4QBIA 4C0LA 2GXAA 3TMKA 4KVGA 1XEXB 3OESA 4XVUA 1XTKA 4M9SA 3RDPA 1JR3D 4PO9A 2GXQA 5FBLB 1UPTA 5JHGB 1GZSA 2GVDC 5FBWB 2ZUCA 3TAUA 4D82A 1ELOA 1RVDA 3KQLA 1NMYA 5KPJA 2HF9A 1YRBA 4OK5A 4IDHA 5TARA 4A92A 1VG1A 1N5KA 3LY5A 2GAAA 4CEHA 4CYMA 3J81k 4WIAA 3SHWA 1SKQA 1G7RA 5AUOB 4Q00A 2VHUA 4DLWA 2REXB 1S3GA 3EAQA 1UKEA 2BJVA 1M74A 3AF3A 1NVWQ 3EPKA 1T0JB 3QOFA 1G7SA 2Q9BA 1EGAA 1W5SA 1DELA 5AUPB 3VNUA 4CEIA 4XSGA 4MGIR 2G1JA 3IHLA 4LHWA 4DIDA 2OHFA 4MYTA 4ZDKA 4LHXA 2NGRA 1U81A 2KBEA 2YWEA 1XX6A 2J7KA 3IGFA 4F91B 3EPJA 1I2DA 1R0YA 1R8SA 2ZRFA 1KY2A 5CLLA 4Z51A 1WQ1R 4B73A 4NE2A 5L3QA 1AQUA 5IHPA 4EFMA 5P21A 3TQCA 5H70A 4ZIRB 2IYSA 2GK7A 4PX9A 4EQ6B 2JLUA 2XSZA 2YC4C 4HB3A 4JBWA 2ODBA 3ZDQA 3RC8A 3IIMA 2Q0HA 3FHCB 1KK2A 1VCMA 2CE2X 4C0KA 4MRNA 5GJBA 1G18A 1NJGA 2OUKA 4IEEA 5E95A 3TW8B 1X8LA 2E87A 4HAVA 1KHTA 5B58C 3LDAA 2PMDA 1V43A 3GLGA 1IHUA 1JR3E 5LD2B 2OM2A 2SHKA 1E2FA 2EYUA 3VQTA 5BW8A 2QAGC 4TL7A 2O8DB 1TNDA 3OIUA 3H0KA 2GILA 3CKLA 5HCNA 3A6PC 4A36A 3KKPA 1FMJA 2DWOA 1WBBA 5F3WB 1FQJA 1YZLA 2W6ID 2GJ9A 3LBIA 3WHKA 2PLFA 4A4DA 3I92A 1CU1A 1JNYA 3WRYC 2P67A 5E7MA 1XTJA 3CNLA 3L43A 4RZ3A 2FN4A 2IF0A 3KL4A 4MQBA 5EP3A 2A5JA 4Z1MD 4W9MC 4TMXA 1XEXA 1FTNA 2MSDB 4R98A 2GJKA 4WOPA 1U0HC 3REFA 3CX6A 4RKEA 2BMDA 2D3WA 1GAJA 3DOEA 2JLWA 4JLMA 2Q3HA 4R9UC 5KNDA 1U98A 3D31A 4B35A 5C46F 4M1KA 4KBFA 3LVRE 3RAPR 4DCTA 1QBKC 2CLDX 4B6FA 1KYIA 4MYUA 3A36A 3FHTA 4XD7A 2H17A 4MDEA 2F9LA 1Q12A 3EZ9A 4UNNA 2IHYA 4TMTA 2GDJA 2PX3A 1W0KA 4LJ7A 4NCJA 3W6PA 1NMZA 1N6HA 5EXPA 1KMHA 2QNRA 1R0ZA 4HLDA 3UATA 1WDTA 1TTTA 1UM8A 4B71A 2JASA 5CK5A 3FMFA 4JZKA 4KVAA 1DS6A 3QQ5A 4GL2A 4ZKDA 2ZROA 3MJRA 3QVVA 1E4VA 5FOUA 1ZNWA 1ZD9A 3DMNA 3SOPA 3V9PA 1Q1QA 4LHYA 2C9CA 2JLXA 4ZIRA 2REOA 4EQ6A 1PLLA 1WB9A 1AIPA 4B3DA 3NBYC 1W4CA 4Q21A 2GJ8A 1XBTA 4CW7A 4LJ4A 2BMJA 1VCOA 1N5IA 2X2FA 4MITA 4O25A 1R5NA 821PA 5CYPA 3MWKA 4BFXA 2GTPA 5K8UA 1N5JA 2FWRA 3VR3A 3K0CA 1JEDA 2AFIE 4L16A 1JR3A 4XVRA 2D2FA 3B1XA 2V6IA 2OSBA 4C0HA 4M1OA 1G3MA 3B78A 2O8DA 1QG4A 4FWIB 1ANKA 1TMKA 4M21A 2VSOA 1CF4A 3FTQA 3UWKA 2ZJZA 1NRJB 2QMUA 4YMSA 3QNUA 5SZKB 1Z83A 1Z0AA 4NDZA 1Z0DA 3KDSE 1GUAA 4JLBA 3F0TA 3B13B 2IYZA 2DBYA 4C0SA 2IYYA 2Z0MA 1GL6A 1E1QD 4FMBB 4TLBA 2ODWA 3NC1C 2AK2A 4QGAA 5TV2A 1CJTC 2LCFA 3Q9LA 3TUZC 2OFWA 2RGNA 2CEAA 2JLYA 1UKZA 4O3MA 4D2IA 1VIYA 3CIOA 2FA9A 3BC1A 1P62B 5C18A 1BH2A 2WTUA 4LHZA 2J0QA 3LW8A 3EC2A 2D7CA 4KCGA 1XCGB 4IXNA 5A5GA 1PV4A 4JLDA 2QM8A 1Q21A 2OFXA 1TQDA 2AR7A 3DZ8A 3G5UA 1MKYA 2FPMA 2OAP1 2PMKA 4NTZA 1FPMA 1WRBA 2VHQA 4HB4A 1M7GA 4XJXA 5L3RA 1OB2A 3I3SR 3FOZA 2GZHA 4D6PA 1EWQA 2RGDA 1ZD8A 3CO5A 4IVRA 2YVUA 5JWOA 1MO5A 4CT5A 2PBRA 2IWRA 2JLVA 1H65A 3AH8A 3CPEA 4A0FA 2CJWB 1NN3A 2NO0A 3WNDA 4LBVA 4ON9A 3ZS8A 2IYWA 4DZZA 4QHYA 2Q6TA 3GLHA 4GSYA 1EX6A 5BQ5A 3F5FA 4G5GA 3A4MA 3OFND 4UXJA 4RD4A 3B2EA 2H5EA 2ECKA 3ND9A 2W6IA 4HDOB 1PUIA 2NOAA 1HV8A 2QGNA 1XXHE 2WPDD 4D81A 2IS6A 1VECA 4Q48A 3TKLA 2WJIA 2WIAA 1QRAA 4Z1MA 3W6NA 2BKEA 2AN9A 3PUWA 2VPPA 2RKOA 4IVQA 1W4BA 1E2NA 2ZIAA 2IUSA 3K09A 2A9KA 3FYHA 4URVR 2DY1A 1JPNA 2GNOA 4JLAA 1M7BA 4Q9KA 1AK2A 3CH5A 1OJLA 3EZFA 2VHCA 3DHWC 3QPUA 2R8RA 3D3QA 4ASUD 3B1ZA 3S1AB 1Q3HA 4D0GA 1K5DA 1CP2A 3I4LA 1ZC4A 4B74A 2ZSFA 1AS2A 4ZCIA 1OFTA 4FMDB 1F5NA 3SFZA 3MWJA 1FOEB 1N25A 2C5LA 2C95A 3DOFA 3VFDA 5ANRB 1K5GA 2CL0X 2XNSA 4JVSB 1Z6XA 4US1R 3EZ6A 2QSZA 2H18A 2Z4RA 4KFSA 5GJVC 4DIEA 2WM9B 3UXMA 3ETLA 1E6CA 3Q8XB 4LK2A 3VKWA 5EJEA 4LJ5A 3VR6A 1YQTA 3ZZ0A 3ZVNA 3V4RA 4AWXA 3U7FB 2C99A 3BJIC 1MO6A 1OXSC 2ZI6A 2HT6A 2DFNA 2PEZA 3VR2A 1QF9A 3P20A 5FTKA 2PLRA 1A2KC 4J0QA 3WRXC 4UXIA 5J4VA 4GI7A 4G5RA 1LS6A 1AQYA 2IXGA 4BZQA 3EG5A 1AM4D 3WNBA 4A6XA 2F1HA 2BBWA 4LBYA 1MABB 3SFVA 3UK6A 4PC1A 4PHTA 4AG5A 4MYHA 3MWLA 4GBMA 4A6PA 2P6RA 2R65A 3ZQ6A 1P5ZB 4TYWA 3NEJA 1E2HA 4R2IA 2WOOA 2CJWA 1JAHA 3EZ2A 5JI3E 4X8LA 1NJFA 3C14C 4JVLA 3W90A 3WNCA 3B9PA 3KKQA 2KWIA 1M2OB 1KY3A 1QDEA 2WWIA 1G5TA 3VR4A 1G5PA 1JPJA 4MRPA 3CR8A 3H84A 3BIFA 3IILA 5EUMA 2X77A 2NO1A 3UIEA 4DLRA 5BN4A 3THYB 2PCJA 1OIWA 1MR3F 2RGXA 4LHVA 2OT3B 1DPFA 2J45A 1QHNA 2W58A 3DL0A 1ZJ6A 3B1VA 1E1QA 5AJZA 2IYQA 3BFVA 4D26A 4B43A 3RWMB 4HLCA 4FN5A 4LOAA 4YXWD 1OXTA 3TSZA 5IF9A 4DEXA 1OH8A 3QENA 4QOSA 3EZ7A 4KSBA 3K1JA 4A8JB 1AGRA 2JJ8A 5E7JA 4DHEA 1SVLA 3KJIA 3FDIA 4NONA 3C4JA 5D3QA 3AV0B 4MKGA 3N2EA 4PC7A 4Q7MB 3S1AA 5J4YA 4TLDA 4NZYA 1KJWA 1YZNA 1YRAA 1XMSA 2QL6A 5DISB 5JRJA 3G0HA 3VNVA 2A7QA 2ZJAA 4L15A 2GCNA 4E5UA 1HEIA 1N3BA 1KO4A 4A2WA 4LDJA 2OLKA 3UANA 1N6OA 1XF9A 1GL7A 2ATVA 4JKYA 1B23P 1Z2AA 4BFYA 3LNCA 4P4SA 3IEUA 3BH0A 2FGKA 2GBLC 4IOKA 2G0TA 3GJ4A 1PUJA 3QXSA 1SKYE 1SKYB 2AWOA 3ZZUA 5JWRA 4AKGA 3MCAA 1JI0A 5J4LA 3CLVA 1R4AA 1GSIA 1JAIA 2QZ4A 2Z5FA 2CBZA 1JBKA 4OBEA 3RSLA 4EPTA 4CDGA 1KAOA 1II0A 3FKSD 3OFNA 1ZM4A 1Z6GA 2C8VA 2GHIA 1G8HA 2DWQA 2WPDA 4BQSA 3U2QA 2WWFA 4JKIA 1MABA 3V4FA 3BAFA 2RHMA 2KJQA 2KE5A 1G7CA 3BK7A 3G82C 4NYIQ 4FI3C 1NBMD 3L0OA 5KSYA 1GITA 1R6BX 2YNMA 4IW3B 3MAAC 3K0SA 3H86A 1CR0A 2EVWX 4NYMQ 421PA 3B9QA 1UFQA 1W36C 4OI0A 5DI3B 3EA0A 1XZQA 4URYR 2O0JA 3I5XA 3GJ6A 1XEFA 5FFMA 3PUXA 3B5JA 3U3MA 3EWSA 1ZM2A 3EC1A 5K8TA 4RZUA 1IXRC 3FMIA 2JLZA 4BPBA 3W9YA 1F2TB 2UVQA 1KDTA 3IO5A 5JCZA 2QP3A 2ORWA 2ZI3A 1E0JA 1XTRA 3MG9A 2QT1A 3WYFA 1JR6A 5FOSA 4TYYA 1IXSB 1EFHA 4RKFA 1LV7A 1OKKD 4TZ6A 4KI0A 4TTRA 3VTKA 4A8JA 2NIPA 1OHHD 1UDWA 4V0ME 2WAXA 3GJ7A 4CT4B 1PVOA 1AZTA 2CDNA 4DRZA 2C78A 4NCHA 2D7DA 3CZPA 4W7SA 4LZZA 3WXMA 2IC5A 3B82A 3CBQA 4TN1A 1HYQA 2NPIA 2YOGA 2ZE7A 2EQBA 2GJAA 4OJQA 1DTSA 1QHHB 4RFVA 4EIWA 4I99A 1TQ4A 3K9NA 1NIJA 5GVSA 3NDBB 4GP6A 1ODFA 2O8EA 2FZ4A 4JL8A 3BB4A 1XPRA 4ESHA 1YZTA 3OIWA 2HLDD 4PTLA 4ERNA 3ZIAD 1Q44A 4MH0R 4EJSC 2JCSA 1HA3A 3HDTA 3SU8A 3QF7A 2ZTSA 1NBME 3NDPA 5BN3A 3IBGA 1N6IA 3KB1A 2P6UA 4KFRA 4HAWA 4EFNA 2QBYB 2BMEA 4V0LA 1XD9A 3KB2A 4TMWA 5FI1B 5AUNB 4D0LB 3KQNA 4WW0A 1W47A 1BKDR 2G3YA 3U44A 5FUYA 3TK1A 1KO1A 2C9YA 4V02A 1DADA 1KI4A 3FWYA 3KJHA 1ZM3A 4BFWA 3SDZA 2WKQA 4DLVA 4NYIR 4HDQB 2GKSA 1MRNA 5DHFA 3AVUA 1E1RD 4B48A 3U7EB 2IBMA 3OIYA 1N6RA 1RIFA 3BH7A 1CIPA 1VIAA 4TQ9A 2A2ZA 5DI3A 3NTUA 4A2QA 3K70C 1G1MA 3VX4A 3CNOA 1OB5A 5E4FA 1N6PA 2NG1A 1RYHA 4TT3D 2C77A 1FMLA 2FV8A 3NC0C 721PA 3X2SA 4F38A 5F9FA 1F2TA 4P32A 2IYRA 3CW2A 4B2PA 2ZE5A 2AD1A 1U8ZA 2D62A 1KKLA 3IIJA 2IWHA 2Z83A 3WMGA 4O0MA 1RC8A 1Z0KA 4V0MA 2H92A 3HR7A 3HR8A 2G77B 4BLSA 2Q9AA 4ACBA 3TBKA 1BS1A 2QMEA 2WJJA 4DLUA 221PA 4AYWA 1P2SA 2XNDD 3GJXC 1CJKC 1NLFA 3HP1A 4G5OA 3WHLA 1YR6A 2IS2A 2OLJA 1TU4A 2VHJA 1J8MF 1E96A 1QHHA 3CWZA 3THOA 4U5XA 2R6AA 4K46A 1E94E 2ZAOA 2ZQ5A 4KLNA 2KI5A 3A4NA 3FKSA 4X8MA 5EZ5A 4DDVA 2OCBA 3BRWD 1WA5A 3IPXA 3NIBA 4GFDA 1W1WA 4RD1A 4HDCA 4ACAA 1TPZA 3KFXA 3ZS9A 3GFPA 3A1SA 1E9DA 3UKDA 4JLVA 1S3SA 4Z8YA 1GKYA 2R6DA 1G41A 4IDQA 4LYHA 2ZI9A 1SGWA 2OCPA 4YDHB 5JFGA 4PSVA 5JLJA 5H8WA 1UF9A 1LW7A 2QBYA 4QM7A 2D06A 1CEEA 1VHTA 4Z54A 4XIGS 2CHQA 4QGHA 4BFUA 4A15A 2OE2A 1HT1E 2J0UB 1W2GA 2LWIA 4OL0A 2G9NA 2D74A 1BO6A 2ZE6A 3RS3A 1KSFX 1KNQA 3PVSA 5KNBA 2J0VA 5AUQA 3TE6A 1ZIOA 2FFHA 1U2RA 2E9SA 1JB1A 2XX3A 5DIFA 2RGCA 1KI6B 2AD5A 1J99A 3O8RA 1SXJC 2ZANA 3RYTC 4PC6A 2ONKA 3EARA 4OQMA 1BYUA 1OKKA 1FL9A 2J41A 3T5GA 1E2DA 1ESNA 5FR2A 4LYJA 5HKKD 1OHHA 3KXKA 4GMDA 3QXJA 4B47A 4ZKEA 1AS0A 3T35A 1E0KA 2IW3A 1E98A 3CPJB 2W0SA 5JBQA 4R71A 2WSSD 1YZGA 2P65A 5C2JB 5HR5A 1TEXA 3IHWA 2BCGY 4IDNA 1G64A 4C7OB 4ZV4A 1HE8B 2QP4A 3QG1A 4LX0A 2IX3A 3D8BA 2I3BA 1AKEA 3PEVA 4BLQA 1E0AA 2B7CA 3AP1A 3ZJYA 1YKSA 4TL6A 2N46A 5CDFA 4BASA 1VCIA 3IBYA 4HI0E 2QAGB 2HV8A 1IN4A 1XEWY 4NPHA 2HLDA 2XTNA 4H9GA 4DUGD 2AHOA 1ZYUA 2XZPA 4I1OA 1XPOA 4LCBA 5EE1A 1RRGA 3I72A 4JLKA 4S2EA 2UZIR 3CRVA 4UQOA 2FNAA 1T3HA 4HAXA 3GP8A 2F6RA 5K8IA 4PZZA 1GP2A 3QVUA 4HEJA 4Q01A 3RANA 3THWB 2BIFA 4LUCA 1N0WA 5G53C 4WXRA 2YZ2A 3KTAB 2GF0A 5TVKA 5TXGA 5JRZA 1G8GA 2DCUA 2W00A 1FQKA 1ZIPA 1DAFA 4MKFA 5HZKA 4BUJA 4C0QC 3HWSA 5L8VA 1W4AA 2W2TA 4A82A 4QJ5A 1G6HA 2BWJA 4MRSA 5DYIA 4Q9HA 2X19A 1E1RA 3NKVA 4NL4H 1KO8A 1Z0FA 1GDDA 3AVWA 2J59A 3DO6A 4A1FA 1AJEA 1HH4A 1GTVA 4P33A 4LC0A 4IDPA 1Z6AA 4O2LA 3CR7A 3PFIA 3AF1A 1QVAA 1XCMA 2J0UA 1KDPA 3PXGA 1G3UA 4H1VA 3HPQA 2J9RA 5CM8B 1Z2CA 2VSXA 3N70A 4G01B 3LX5A 1DE0A 1II8B 4NH0A 2ASEA 3UPUA 1X8KA 2ANCA 1KI6A 1Z0IA 2F3RA 4RJLA 3PENA 1FTSA 4M1MA 1G8PA 2GCOA 4AKHA 4URZR 3DM9B 3AQ4A 2YOFA 1G9XA 2CVFA 3HU1A 2CCGA 1IM2A 5GVRA 5LPNA 1E9AA 1ZC3A 2QPTA 4LY6A 3FVQA 5JECA 4M8NE 3W5JA 3ZZTA
chains in the Genus database with same CATH superfamily
2BBOA 1QV6A 1RXVA 1BXGA 4DCNA 2PGJA 1OYWA 1RNLA 5JDCC 1OA0A 2QG6A 1L5MA 1RMYA 1JLKA 2FDRA 2O3SA 1UP6A 4KQHA 3UA3A 4QXMA 4HNUA 5CIWA 1DHRA 1WS6A 3K6JA 2CZQA 4I5IA 3ZVLA 4D4HA 1IIBA 1IHYA 1FYDA 1F0NA 3DAOA 2J3HA 4WI1A 2OK7A 5ALZA 3KKOA 3H2YA 3JPYA 2O52A 4LI0A 3RFCA 3TJZA 2WHRA 4ARAA 1J06A 4E7OA 2V45A 4I50B 4EGSA 4JEMA 4CLOB 5C4MA 5ILQA 5TMPA 4YC7A 2ZJFA 5CFOA 2GGSA 4GR9A 3OLVA 2MMCA 1KC3A 2OZKA 2FJ0A 2JEYA 4HGOA 3ESBA 3WDMA 3UTDA 3ZWBA 1TU0A 2GEUA 1LLFA 2BJWA 3W5UA 4IKEA 3T12A 3M1AA 2Y6UA 3PC7A 1UJMA 3TGLA 1Y8ZA 2VP0A 1BMFD 4NMMA 3FZNA 3PE6A 5LZ8A 5JANA 4YAFA 4WZZA 3W3ZB 1C4OA 1FVHA 1R0XA 1BVUA 3T0FA 4CT0A 4RVHA 3WGTA 1WKBA 5ALFA 1BRTA 1SJ9A 2GM9A 4DAOA 4IWXA 5MN6A 1QHYA 4C43A 4U9UA 2BGGA 1NXOA 1RWBA 1QYDA 1UQUA 1UBSB 3EXFA 3KE8A 1RI5A 3KUXA 4OQXA 4Q1FA 1ORTA 4IFBA 4OHWA 3V46A 2WB4A 4IIYA 2C20A 1DIHA 4PTZA 5EE5B 1GAWA 1Y9JA 2JLRA 4E2XA 5EWLB 1F6WA 1NJ5A 1TT5B 3AUKA 4H7IA 1JIUA 2GXUA 3SX2A 3F3MA 3PB3A 4JT8A 4IUDS 3RVNA 3VNAA 3WLAA 4RENA 2X0JA 5HKKA 4PV7A 1QNFA 2QR2A 4C78A 3R6WA 4ND8A 4G5QA 2G9VA 3BF8A 3LLUA 2GR9A 4DQVA 4KR9A 3HJCA 1PQUA 5ADVA 1LRJA 1P0PA 2E1RA 2XBMA 4E2WA 2JHCA 5IT4A 1DX4A 2GETA 3EFOA 3IVRA 1I7LA 4CUKA 3O03A 5CM9C 5DHTA 4X66B 2O19A 1WXWA 3MBIA 2X3FA 4Q9NA 4U6QA 3ICQB 2GPWA 2QORA 3BMCB 3HYTA 3MRSA 1R0SA 2HKIA 4N8SA 3O47A 4EYQA 2FFRA 2FRDC 2W0MA 3FYDA 4J76A 4JD5A 4EAAA 5BSMA 2PSFA 2OCIA 1YK0A 4QDXA 3DWFA 4J6FA 1CXZA 3GP5A 4B3HA 2IH4A 1ADGA 1A8IA 4YMVA 2O5VA 1MT0A 4IRUB 2NU8B 1DG3A 1TRHA 5ELXA 3S40A 2GJSA 3A0RB 5GM1A 3LDHA 1AMUA 2Z3WA 4ZZ2A 1PZMA 4ZXPA 5CIYA 1L7VC 2DFDA 3PGMA 1YRYE 5EIOA 3WYGA 2QL7A 1ZK4A 1DQSA 5BSFA 5JYEA 1Y8CA 4D6YA 2JFVA 3EUEA 5BQOA 2OXTA 1L7QA 2LRHA 4OCZA 2JNWA 4M1WA 1ID8A 2UZ3A 3IIKA 4R2HA 1YBAA 1DIBA 2XQGA 3IUNA 5JYDA 1RI2A 5CXXA 3B1YA 2C42A 1IZ9A 3H4IA 2E6UX 2AVDA 4I50A 4WA8A 3IERA 2Q5CA 3IX7A 4WGFA 2PUJA 1MFZA 3E0QA 4K28A 2WBLC 4NFSA 3SZOA 5A06A 1I3NA 4NCNA 2DPYA 2NUBA 1EKXA 3IURA 3V7FA 4CF5A 5JH7B 2F3UA 2C2HA 2VWHA 3D4NA 4RIEA 1XHLA 3VSCA 3ON5A 4DB2A 3N0VA 4DBZA 3OZGA 4KMMA 2O8FB 3G8DA 1IBCA 4D97A 4A27A 2C9DA 2SECE 4MARA 4XJSA 4LQCA 3HO6A 3RU7A 1NGSA 4MW4A 5A0FA 4E14A 2CLSA 4K9QA 3AVXA 4HLUC 2OO7A 5TMDA 2XOEA 4W1RA 5DGIA 1YTLA 1M73E 2XCOA 5BUQA 2X8WA 2H5JA 1O58A 3G0IA 5J1SB 1XG5A 1JQKA 4FC7A 2PKCA 3RSSA 4HDKA 4G67A 4YV7A 4WLOA 3DLHA 1I6LA 2BPOA 2Q8PA 1CRLA 5FCDA 2Z58A 1G16A 16PKA 3L7YA 4P8RA 4LXTA 3ZDZB 6REQB 1TM1E 4Z7JA 4KN6A 3QFFA 5G02A 5KO2A 4HVCA 2P6MA 4UHKA 4C76A 4GKJB 1Z5VA 4YPOA 1FJ2A 3I62A 5EWLA 1PGQA 3VHQA 4RH3A 4ZALA 1Q1EA 2EAUA 4Q3BA 3JQAD 4BV8A 5A9RA 4EA8A 3M6MD 3GAMA 4FT2A 3B3FA 1A9RA 4YVFA 4CG0A 1Y1KE 1QKIA 1QYRA 1JWAB 2Z1MA 3DLPX 1CPYA 5JJKA 3H6KA 2NO7A 5AJWA 2BEKA 2E49A 1I8TA 4US0R 4U7WA 2I8CA 2M98A 4F3TA 3TR6A 1N33B 1LRLA 4AJNA 3SAJA 4TLCA 3QIAA 2BBSA 4YI5A 3NW9A 3I83A 3UAXA 5I7OA 1E2PA 2F3QA 1P2VA 2IEYA 2O1WA 3R3VA 5JMPA 1DBWA 3BMCA 1USWA 2VJCA 5KWSA 1B1AA 4GP9A 3H2GA 4QYSA 2ZU6A 2X76A 1LY1A 3WMRA 2CZGA 3GC6A 1GQRA 1QQ7A 3O84A 4QODA 4LRUA 2I03A 2QN3A 4LIPD 1CF9A 2BI8A 3FMPB 5JCZA 1TAQA 3GEEA 3OETA 4KBGA 5KOYA 3ETEA 4F0JA 4DDUA 5JHHB 3G2LA 4RPLA 3KETA 1Z6QA 2BDEA 3BH6A 3GMDA 5AW9A 2VK8A 4QFBA 1Z6ZA 1BMFA 5KSZA 3U4CA 1Q11A 2XBUA 2GEFA 1BS2A 2PAFA 3LLVA 5L6LB 1D4ZA 4JJZA 1VKHA 4M0LA 4PSUA 1FYEA 2A6PA 1UUFA 1Z3CA 3DMDA 1M1NB 3AB3A 1NYLA 2FFAA 2ZVPX 3FPAA 4JLPA 4NEGA 4NHOA 4O2BF 1CDZA 4XWAA 3HCWA 5M3BA 4BTEA 4CIAA 5K7SA 4FFNA 4QUIA 1PWHA 1FZQA 1VPVA 3D7KA 3OJWA 3OQ6A 5JH7A 2CLCX 1GTRA 2DR2A 2RGYA 3VYRB 3ZXXA 4AN4A 2YWHA 1MUUA 4YCMA 4IPTA 4GPIB 3W1VA 5EUCA 2CXTA 1PNQA 3FZGA 2PZAA 2O7RA 2QG4A 4X95A 2O8FA 1J1ZA 2VK2A 3PE3A 4MWZA 3A0UA 3JQAB 1D1QA 4G81A 3BMNB 2FN9A 1I2MA 1UOQA 4J0CA 4OP3A 5FFFA 3ZCRA 3FM9A 4LHEA 3ONFA 4C0JA 2V7QD 4G26A 4XI9A 4WAUA 3P2JA 4KDCA 3K6SA 2VSFA 1H0RA 4L6CA 1F8GA 4MB0A 2Y8EA 4NFHA 4R8KA 1CUVA 2W93A 1NT2A 1QZ3A 1OMOA 3QXHA 4MS4B 3SXUB 3U7IA 3WGNA 2VT3A 1T6XA 5NLLA 5E1BA 2P79A 1NG9A 3O92A 1H4QA 5KOIA 3LQ1A 4K2HA 3U7JA 3AIOA 6REQA 3RO7A 2JI8A 1YKFA 3CEPB 4BLRA 1RBZA 4XXHA 1DJQA 5FBKA 5TLSA 1P8AA 3LW7A 4KZPA 4ITUA 5JADA 3G89A 1PX2A 1M6NA 1X1RA 3GUHA 3LYAA 1CERA 4P35A 1V3TA 1RHMA 1X1QA 2XITA 4B09A 4DC9A 3PGJA 1X13A 3PHJA 2YFHA 4AZ3B 1P9RA 3VISA 5LCXA 3HZZA 4E5DA 1A7KA 1CUWA 4FCVA 2ZP1A 1BFKA 2F3TA 4GOJA 3QX3A 4G0YA 3SBOA 4C3UA 4NHEA 2V4MA 2P7HA 1LW6E 4ODIA 1QJ4A 4W1QA 2EP5A 2QJOA 2FQ1A 3AP2A 3AR5A 1Y98A 2NYUA 3EOAI 4TUYB 5GGYA 4LYGA 1EVLA 1X3SA 1T4BA 3KOUA 3HRKA 3LSYA 1U1IA 2Z9CA 3TJMA 4BNUA 1A8HA 1ZMXA 5KNBH 2O20A 4ENTA 2F17A 1HQKA 1W48A 4E5KA 1W36B 3BE8A 3GEIA 4RTMA 1ISMA 2OOKA 1U99A 1MVNA 4QU9A 3R3XA 4IIHA 4TVBA 4EHAA 2DT8A 1D09A 2PUTA 1K66A 1QV9A 1T9HA 1TJYA 3EZNA 3A1TA 4I8DA 5C0OE 1G8SA 2XB9A 3G2HA 2F48A 4BIIA 1A50B 4G0VA 2JLQA 2JLUA 3D54D 1GQ2A 3QG5A 2PO7A 3OUTA 3EPPA 4U9IS 1HY3A 2ZT7A 3AFOA 1U28C 4KFUA 3GRZA 4OI1A 1P33A 1JR4A 3PUHA 4MB6A 2YXPX 3CN7A 4OK3A 4F45A 2ACVA 2E3JA 4L9SA 1M1NA 3H87A 4AY3A 3GMTA 1CRQA 4GQIA 3B7PA 1ZL2A 3EXAA 4W8OA 1KETA 5GP1A 1QK3A 2Z43A 4TWRA 4BO9A 3HUTA 1U65A 2D5CA 4WBXC 1SQFA 4PZLA 3T3MB 2JEZA 2HK6A 1FVXA 1R3DA 1V8OA 3W6OA 4AYXA 4M1TA 4BKOA 3HWX1 2IXDA 2QMHA 3ZGLA 4CNQA 5IN5A 2NXEA 3GGSA 4TLEA 3JQAA 3PJFA 3E7XA 4YRTA 5FEUA 1FP6A 1MQ9A 4MRRA 5ALVA 1H0KA 2XNJA 5B30A 2OPHA 1QJCA 3HSSA 4XR9A 4YJ3F 4KO8A 5ITZA 1ZEJA 4F3KA 4EYGA 4QUJA 2J0EA 3MWYW 3HXLA 3PRKE 4MS4A 4XYEA 3SXUA 4WDRA 4KK3A 4COKA 3HB4X 4ITVA 5EFZA 4CLOA 5JARA 2IRWA 3ZNQA 3T06B 3AVYA 1U4OA 4QFDA 3E15A 4X0EA 1DOHA 4QWWA 5A1TA 1I33A 3KIPA 2ZULA 4E07A 3TFOA 2PX5A 2BN4A 2E2WA 2W6OA 2ZYRA 1Q7BA 4WZBE 3JVDA 4FSXA 2QNBA 2PBZA 2ZCUA 5HFJA 3VI4B 4D43A 1R9GA 4FYIA 3AF6A 2JW5A 3AVVA 4M2LA 1DAMA 1X7XA 1ENZA 4DYVA 3GZ4A 4F9FA 3VO9A 1VPWA 5AJVB 1JUDA 4EB6A 1E5VA 1QHEA 3THYA 1NY6A 1FP4B 3EIWA 3PFCA 1CUYA 1V2GA 5E0OA 3UJNA 4NSNA 2GSWA 2XCSB 3S29A 4WLUA 1D6SA 2CZCA 1ZMBA 2AOTB 1ZOLA 3AR4A 4KQKA 1IB6A 4QZVA 3FBGA 3OPYA 1JU9A 3KKZA 1GILA 4ZJYA 3K9LA 4TUYA 1XRPA 2PNFA 4X94A 2VRWA 1DKMA 5KAPA 3OJEA 2P2DA 2G71A 5IKPA 3ORHA 3UB3A 3MT8A 2I6XA 2YTZA 4GOLD 1G0NA 4HSGA 5DV9A 3T1QA 3O1HB 1E8NA 3GJRA 3ZY2A 2HW8A 1JSZA 4GLBA 4R9VA 3Q6NA 3ZHZA 5ALRA 3GNSA 4OK6A 1RWPA 1OZAA 2AZ4A 2WWWA 5LQAA 1N6LA 2H9YA 4U63A 1QC5B 3IP6A 1IK4A 1E3TA 2HXGA 4OJKA 5BWOA 3DMTA 3ZDEA 4FLMA 3IELA 3Q41A 1NF2A 5J47A 5G40A 2CEKA 1QTQA 3L8YA 4D7AA 1ZNYA 1HMYA 2JJYA 5EXTA 3OF2A 4QRIA 1ES9A 3PTLA 1FDSA 3A04A 4J7UA 3RU9A 4RTNA 2V7QA 2OXRA 1NLYA 1FDRA 3CEAA 3NT4A 4ZYTA 1QPBA 1UEJA 4P3NA 3AINA 1GZUA 1GKKA 2WMNB 1JBQA 3CFYA 4CCSA 4L5BA 2HB6A 3HYRA 2ZXEA 3R5HA 3BE6A 2OZEA 5AM4A 4QPNA 3R7WB 3UFBA 4ZI7F 2F1OA 2ZI7A 3UN1A 1C7ZA 3FN4A 2UZ0A 4M22A 3ZE7A 3USCS 4B2IA 4DUPA 3P2OA 3EWIA 5ILOA 1L9XA 1S7GA 2NXJA 3SHVA 1XFDA 1JU3A 4D6XA 1GUDA 4ZCMA 3G5MA 2ZVQX 3L7DA 3OO1A 1KJ9A 4XFKA 2QTHA 4TROA 2D5IA 1PNVA 3GELA 5LOVA 1IVNA 1VB5A 2I3ZA 3AUFA 4A0RA 3GJZA 4OQFA 4U0KA 3JQ8B 3DMGA 4EUSA 1D1PA 4Y6PA 5DNYB 2R3SA 3M6WA 5K0EA 5L3VA 1CRWG 3FLBA 5AH0A 5FUXA 2SKDA 2XUAA 1K68A 2I3DA 4BUCA 3R4VA 3NETA 3A6GA 4U02A 1V3QE 2VIIA 1HFKA 3HFJA 2ZBFA 4H6XA 4CFZA 1A72A 2YJZA 4JBIA 2DAPA 5A0VA 1ZGAA 2XUGA 3L9XA 4V0KA 3Q3CA 1TYBE 4UU1A 2MIIA 2I6FA 4ZGWA 3C5CA 3NP7A 2J4FA 4BP1A 5JAQA 6ADHA 3TUIC 4EY8A 2Q2WA 3SS8A 4B85A 3GRAA 1HO3A 1O8BA 4I0WB 4BNLA 5CNJA 3T0IA 1FP4A 1O97D 2P2SA 3DE6X 3SQWA 4AJ2A 5LN1A 2C2MA 1L2TA 1JJIA 4V2UA 3ICEA 1Z38A 2AOTA 3ZCXA 3WP1B 3K5IA 4OQLA 1KOFA 4H59A 4RVSA 1GCOA 3VPFA 3GJTA 4AB1A 2ZRKA 4P0QB 3DFIA 5C7OO 2I2FA 2FFBA 2JAQA 4AWBA 1J33A 1U3TA 3WZLA 3WDKA 3MWDA 1JH9A 1RXYA 4ZDWA 5K99A 1Q1ZA 1PF7E 1SUDA 2BEWA 3JATB 4RHXA 2XA9A 5FBVB 4XWKA 4M9UA 3DL4A 2VP6A 4TX1A 2HMTA 2GCPA 4N5HX 4MKXA 2NM0A 2VAPA 4OQEA 3E70C 1CHNA 5EE3A 1GPNA 1QVRA 4I1VA 1HQYE 5EIWA 4C4ZA 3ITNA 2R5FA 1Z2EA 3CCFA 3VO1A 1VLHA 2OTCA 2PKQO 3COJA 1N1GA 1UXOA 621PA 1RRKA 1NZDA 1ORHA 4RKWA 2EF1A 5CT6A 2CLIB 4LJLA 1T8UA 5FWYB 3PNLA 1L5VA 2P2GA 4UEOA 4Y6RA 3F3KA 2QU7A 1GUYA 1RQ2A 4WBNF 3LUDA 5SZJA 4YHHB 3PLAE 2X6TA 3RROA 3SX4A 1JSXA 3RS7A 2P2CA 2ZIUB 4XWOA 2JKVA 2F1RA 2QI9C 2EFHB 4N3AA 3KLNA 3TNFA 2GJ4A 2IPNA 4KFTA 5B55A 4KIFA 2N3ZA 2VPXA 1XZGA 1HOXA 1QQ5A 4DV6B 2FHSA 4HMOA 2EARA 3G49A 3FCUB 1ZONA 3ABRB 2EG5A 4I8IA 4KJZA 3NAGA 2XWPA 4KSCA 4YDQA 4DRYA 3F4LA 3O7WA 5C5CA 3R7DA 4EPVA 2JHAA 3SC2B 5DRYA 5FYDA 1UBUS 4C1BA 2H85A 2XCRB 2QD3A 2EZTA 1Z22A 3Q6MA 1L4GA 2VNIA 1Y3AA 2NVBA 3GA5A 4RSMA 4DDHA 2ZSHA 3DE5X 1PV2A 3KYIB 2CHFA 3X1JA 3IKTA 4JFAA 3R3JA 5BWBA 2EEPA 1KVQA 2H7CA 4FZJA 2P40A 4CMGA 1M2EA 2WZBA 3MLEA 3VHLB 3WLSA 4EENA 2BHSA 1WZEA 2NQ8A 2HLNA 2ODNA 4DIOA 2NQ2C 3ISVA 5DB4A 2I0FA 4W5WA 1WBJB 4FD2A 4W4TA 2ZS7A 3DOUA 3IMFA 2A88A 1U1GA 2H8KA 2J32A 3DOIA 2D7JA 2OP0A 3I2JA 2GYWA 4DC1A 1EHIA 2ZUSA 2F90A 1U3VA 5TSDA 3IP9A 4BGVA 3WIOA 3OX3A 4LGMA 1BQ3A 3TRKA 1N34B 3F6EX 3N2ZB 3CC8A 4M9CA 3AVQA 2JH8A 3GLGE 5ER9A 3YASA 4IZ6A 3G2JA 4R1UA 1NVFA 3K94A 4B82A 3QPDA 1VMAA 2R84A 4F12A 3NVAA 3JATA 5BP7A 1P4GA 3V00A 1N2HA 4B32A 2R1ZA 5ARDA 3RUDA 4Z99A 1R37A 1SKUA 3A05A 3ZIAA 5HHTA 1KWKA 3O38A 2UKDA 4L1KA 3WJ7A 4KI7A 3U4AA 3PK0A 1QORA 2P9EA 4YYZA 4WCFC 3ZV6A 1FP2A 1IEXA 1PR1A 4BY9E 3KR1A 3U37A 5FOXA 4XM1A 2RBKA 1DRWA 3BOSA 3IIEA 3OURA 5AOAA 4JLWA 1TQHA 1YU9A 2O4CA 4OX9Y 4BX0A 1R0RE 2AN3A 1R50A 3L8MA 3TDNA 1QOZA 3PTZA 4LV8B 3U3KA 1KIMA 3DNMA 3Q85A 3STWA 3V2UA 5A5VA 5KTYA 3W7BA 3BCRA 1DWPA 1FRVA 1AKQA 1EWYA 1S2IA 1YQEA 3K4PA 4MGKR 5CP8A 5JYBA 5LIPA 3QH4A 1F8YA 1CDOA 1WXEA 4S12A 5C81A 3NKFA 1FDOA 1MO3A 1XDSA 2YRXA 3TVTA 4TS3A 3I1FA 3C39A 1EVJA 2V7UA 5G1NA 1BTOA 4YCCA 5EAIA 1UPCA 1YZUA 3FTNA 2QT0A 4PFJA 1UM9A 3L1IA 4X71A 3IQHX 1MW8X 3FWZA 3UMCA 3E58A 1E2IA 1GA6A 1TGVA 3C6MA 3G9XA 4A0HA 2QTBA 1ZK3A 2P62A 1CY7A 3TEFA 2FUEA 1AE1A 3T61A 2IP2A 3NAMA 4CKCB 5FUQA 4UFPA 4XGNA 3T5BA 2IHTA 3VJLA 2ZW9A 4GI3A 5EXSA 1E3EA 3A3YA 4FHFA 4BNXA 2K6GA 1BGVA 4I1UA 3VDQA 2DQYA 1P5RA 1PS8A 4K0RA 3MJHA 2A1IA 1UH5A 1XTBA 3RJTA 3ASVA 1ECPA 2AG0A 2HX1A 4KNYA 3RSZA 2IDMA 1K3FA 2VKTA 4MYDA 4BQNA 1EX9A 3WLTA 2HPAA 1H5UA 1YUBA 3ADKA 1UXJA 4YCBA 1J39A 4OOFA 5DYWA 4X1IB 3OZEA 1TMYA 2VH5R 4YREA 4EP1A 1V5FA 2G9ZA 4MLDA 5AXDA 3DQZA 1FSPA 4IMIB 4HV4A 4ZRMA 5C4GB 2H2IA 3I9LA 3KWJA 4U7HA 3EJ6A 4D0RA 2CUZA 4YN3A 3ZH9B 4JBXA 3BT7A 2BY4A 1Q74A 4JYMA 2X9VA 1TM2A 2PIDA 2WSBA 4L0MA 2L69A 2XLBA 3IVXA 4X85A 5EHXA 2F8SA 1M7HA 3S2GA 4Z3KA 2BTEA 3OQJA 2ISSD 4N39A 1N6NA 2QENA 4HSEA 1V4BA 1MV8A 3OOJA 4PLTA 1QQBA 3GF4A 4AZ0B 1JDBB 1XGKA 2JH9A 1A9OA 3CJRA 3HYLA 3KJQA 2FQWA 5C4IA 4MZDA 1DP4A 1RBMA 4QQRA 3ROTA 2HHLA 5JG7A 3U31A 2X1HA 2I2XB 1ADBA 1G3IA 3IXMA 4FPXA 4LEIA 1PDOA 4R8SA 3KXDA 1A9TA 1E9EA 1GTSA 4CUZA 5DI9A 2CY0A 1ZRMA 2CD9A 4QXAA 4C07A 5BNIA 2FG7C 2R1VB 5DHAA 5DYGA 3L04A 1NONA 2E4WA 4ER3A 2ZAYA 2WJVA 4WVFA 2JFPA 2X40A 5THKA 4H7DA 1FLAA 5DXAA 2RC5A 5CFQA 1H6CA 1YDGA 2NV6A 1MB2A 2NSLA 4G8JA 4ZYXA 2D1SA 3CUKA 4RMJA 1VSQA 4WK4B 1XVUA 4DBVO 2C1XA 1CEXA 1SRQA 3EDYA 1Y1QA 5JD4A 4UPDA 3E22B 1KPHA 4EHKA 4BQRA 4E2FA 2IITA 2PRSA 1QAOA 5C7LO 5KYVA 1FU7A 1XRNA 2AQIA 3KSBC 3IKMB 4WJLA 3N6RA 4WJZA 4Z7OB 1CZOA 2XUKA 2IFTA 2L17A 5JTUA 3G2QA 4ZU3A 1HFEL 3LCCA 2Q6LA 1XMOB 3L0ZA 4EABA 1J97A 2N42A 4HLQB 3T15A 2XZOA 1R1DA 1SZJG 4CKCA 5JZMA 4MMYB 5BURA 2B2NA 5AVKA 4FYVA 1ULTA 2GZ3A 3RK4A 1Y3HA 3IPAA 4J49A 3VYUB 1UKYA 2Z57A 1UOPA 3ULKA 2VSQA 3GX1A 5HUHA 4E11A 2BLLA 4BO5A 5D6NA 2FEAA 2REQB 2ZIWB 5LSAA 3GLHE 4Q18A 3ZHYA 2VF8A 4QQNA 5ESXA 5ALLA 1UK8A 4J91A 4MVJE 5K0CA 1IHXA 3CLUD 4QRHA 4BN4A 1V2HE 4XM2A 1WMBA 4Y3UA 1HYHA 1I5OA 1T13A 2RG1A 1XWIA 3BRQA 3LVBA 5F1YA 2P9ZA 4MVJM 2CLHB 5CU7A 4FUQA 4BNDB 3AQIA 1ZN2A 3H5VA 4UAUA 3V7NA 1VB3A 2ZXUA 1FMTA 1QIIA 3KFVA 3OKAA 4HN4B 2VCHA 5HJ7A 1EM6A 4JP1A 3S8EA 1QRRA 1KIFA 4RDIA 3DKRA 5ALSA 3FFTA 3CX8A 1NBEA 2XB8A 4YBRA 1SVMA 4P54A 4L8LA 1OWLA 4PQYA 3LUCA 3P8ZA 3TLEA 4YR9A 1R5BA 3ROGA 4EHNA 1DBPA 4AZ0A 4MYCA 3HABA 4GT1A 5CD9A 1ABBA 2OPBA 4W5QA 4JBYA 4HDRB 2Y93A 1ZUIA 3GLQA 1B26A 1L8QA 3IO3A 5JAUA 1UC5B 1NE7A 3B5IA 1T36B 1JIIA 3ILHA 4NQRA 4QJ4A 3MK31 2Q6VA 1HDOA 4F96A 3RABA 3F7MA 3LLMA 4IDDA 2QUIA 3AFGA 1EWTA 2Y67A 3V34A 1X1BA 2R1VA 5EUBA 1EUZA 2E5FA 1MENA 1TUIA 2XJ4A 1GQQA 1N1DA 1RJGA 5F98A 2ZDQA 1SIUA 1M34B 2WZDA 4Q1BA 5J40A 3QHAA 1E5XA 3ZDQA 1JFSA 3GCZA 3Q3EA 4KAXA 1E89A 1LTKA 1XAGA 3MJEA 2FEOA 1JFLA 1R74A 4LJAA 4MPRA 4PGHA 4WZAB 2W2QA 4CLEA 1M75A 4WKGA 1J1IA 1V96A 1NT4A 2CK3D 3AP3A 1GTG1 1RXIA 1FFAA 2HF8A 3QBJA 4HADA 4KXVA 3UXYA 1NKTA 4HMPA 2FUG1 3RUEA 2ZCJA 1W36D 2JFWA 1V7ZA 2Y0PA 3AU9A 3OX4A 1DXHA 4JLJA 3DL2A 4C0AC 4CM4A 1I0ZA 1I0IA 3DONA 4NZ9A 3M70A 5JVDB 4R8RA 3DEKA 1U0TA 3FCOA 1LQUA 3EVGA 1JDNA 1U7WA 5K2MA 4MCIA 1S2GA 5CR9A 3HU3A 4R7ZA 4UARA 1M83A 1WHSB 1K8XB 3FSRA 3FYUC 5AM1A 1OX6A 2WWXA 4KXLA 4L08A 4M1YA 4EHDA 4EUKA 5C37A 1P0MA 2LDXA 1ABEA 5I9IA 2FMHA 2ROQA 3FOWA 4FEEA 2HWWA 3EGDA 3Q15C 2BL4A 5AVWA 1DEKA 1UAAA 5JSHA 4N9QA 3DKPA 3N6VA 5EZ6B 1LI5A 1FU4A 1TJ5A 4WCVA 4BFTA 2E5LB 1IY0A 2FWNA 1QUEA 4X5OA 1UZMA 3CNEA 3I1JA 3A1VA 4TTJA 2QB5A 4BNDA 4ZDJA 3U4QB 2O23A 3TGWA 5K3SA 3WVNA 2ACEA 1I1OA 2IIVA 2HSWA 3SICE 4DCCA 3KSZO 1EFKA 4MNTA 3FPGA 2IYOA 3UWDA 1I5EA 1QO9A 4HCJA 4EEKA 4LSGA 3HN2A 5A5FA 1TTHA 4YEDA 1OJ7A 4V3BA 4B46A 1AUVA 4NFYA 1JQ3A 4HDRA 5K45A 2PUDA 5MHTA 3NT5A 4TS4A 1NULA 2IEBA 3AEXA 3PUJA 4TLAA 3USES 1BMQA 1T36A 2D0OB 2J67A 5FA6A 1EFTA 3GRFA 4YMTA 1L5SA 1NA5A 1VGQA 3KLMX 4JNKA 3AJ8A 5EJ9A 5JJIA 1G4UR 2PXXA 5A4AA 1VFNA 1ULAA 3QA3E 4L9WA 521PA 3UJDA 5ARCA 4BWGA 4JJKA 3IUEA 4J7CA 4BATA 3B12A 5HQ3B 3GPLA 4DLYA 4HXGA 4OVKA 4BPRA 2PVCA 4X84A 2LKCA 1EHYA 2LKDA 3CKMA 4D9CA 3GFGA 4QXRA 1E4OA 1M34A 5JD5A 3T3OA 1NVVR 1ZIDA 4IS3A 1KZ7B 4C2UA 1Z06A 5D1HA 1XNJA 4FCTA 3ZQ4A 4G1VA 5BMVB 1GTMA 3TI7A 9LDTA 4WZAA 2CFTA 4MS1B 3U3ZA 4Y6SA 3WLPA 4ZDIA 1IXZA 1GFWA 3T1OA 1EHCA 4D9FA 1NHWA 2YXNA 3VVLA 3WL6A 1L5HB 2G6TA 2NO4A 5EJMA 2F1IA 4AWAA 2E89A 3RVBA 2ZBVA 5EMHA 3BICA 3O9MA 4UATA 1DIAA 2ZWAA 3GEBA 4MJ7A 2VDVE 4YASA 4N18A 3Q3GE 2F4NA 5DP2A 5KVSA 1U3DA 4NIMA 1FS4A 1KYTA 1IN5A 2W8ZA 3NT2A 1BVRA 1GZHB 4NOMA 3NHRA 1P18A 4HDNB 3GEHA 3T9AA 2BFDB 1WVMA 3VDRA 4ERXA 3SVTA 3BDIA 1WHSA 4KODA 1SY7A 2YN4A 5TPZD 4GPBA 2EHJA 4K7JA 2A0XA 3ZE0B 1PUXA 5JUWA 2FPPB 2ZYTX 3HVIA 4BGIA 5I3ZA 4CRWB 4IHQA 3MFQA 3U9LA 5L4LA 4H6PA 5K1ZA 1U11A 4W5HA 3E4CA 4LY3A 4YB8A 1L9KA 4JI3B 4GDFA 1DGQA 4F3CA 4K1XA 1ODSA 1PR4A 3DBRB 1VKJA 1LS1A 2HSZA 4X20B 1OAOC 1T0UA 2Q0XA 2G4VA 1EFVA 1GU1A 2LV8A 3G2NA 2PV7A 1OBOA 1T5HX 2XCQA 3PLNA 4HB0A 4R41A 4Y7CA 2HLPA 3U4QA 4CKXA 1FDWA 2P6NA 4MCJA 3PQCA 4WCDA 1PLJA 1ST3A 4M9QA 5F3RA 5CCEA 2C7VA 2QVYX 2ZTMA 3TRDA 4CCYB 2QWXA 4M8IA 4I1PA 1SBZA 1UWVA 1I2CA 1YT5A 3LUBA 4BFZA 4BO0A 2CT8A 2X7HA 5DHRA 5FJIA 3A6EA 2P4SA 1O08A 1U1DA 4Q5IA 4OBBA 1KEEB 1Y6GA 3KP1A 1OTXA 1OI7A 4N5MA 3NAQA 3UJCA 1OLXA 1Q19A 1LZKA 1ZP6A 2V6JA 1P72A 2CNLA 5EMKA 2CK3A 1NE2A 4N3BA 4YLGA 1ADCA 3VU1A 2XUZA 1Y8QA 4UFOA 2XUDA 4JI7B 3EIQA 3EZYA 4U39A 5L9AA 1LBSA 2XXBA 1U8YA 2EGHA 3BN3A 1VE7A 1NOIA 3KD2A 4OKNA 5HQ3A 3JVIA 5K8TA 2I62A 3AIKA 1VMIA 3L79A 2ZR9A 3WB0A 4UDOA 5E7QA 4P7FA 1UXIA 4P3OA 1NQOA 2WU0A 4XFDA 1GIAA 3EGIA 3UG6A 5JZ9A 3SS7X 2VYFA 4A23A 5IK2D 3JSAA 1MF7A 3CONA 4PHCA 3OA2A 2IT1A 3LYUA 3QK7A 2QMZA 5AIBA 3H6HA 3NUZA 1JL3A 1JRLA 2GPBA 3CTMA 3H3FA 3QKTA 4Z9XA 3MWEB 3NYIA 2XMZA 1WX1A 1Y5LA 2GB4A 2WJHA 2P6PA 3I6QA 2YNMC 3QFTA 1L5HA 2G1PA 2C97A 3ORSA 4J90A 5DXJA 3WGZA 2J87A 3WL5A 3B3QA 3E7FA 3Q5GA 3N8NA 4TGLA 5L3ZA 2V54A 3DLCA 3ROPA 1XZLA 3CBGA 3HLTA 2IVZA 1N3IA 2CHVA 4RMGA 5CFRA 5LFAA 3ONWA 2JDIA 4POOA 3RRNA 4BZXA 4PC3A 4DMFA 2VTDA 1GNRA 3VOAA 4MV4A 2DKNA 2AF3C 5JCOC 1X87A 3L4KA 2BFDA 3CE6A 1XMJA 1M6YA 4JN6B 1WMDA 4RO0A 4LNAA 3AHGA 3FVRA 3JD3A 4U9HS 4WXHA 4HXYA 2M6KA 3USZA 3VDXA 2AE1A 3LUFA 3WG9A 5JS6A 2O0HA 4RZIA 2FPPA 4QYIB 2QY6A 4LXHA 1O6FA 1W6UA 1ECJA 1HQCA 2QRNA 3VR5D 3E9CA 4OYHA 4ER0A 4ZOEA 2WTMA 3DBRA 1SCAA 5I7RA 4ZPXA 5FTLA 2B2CA 2OHHA 4E2YA 3SMQA 1ZZEA 1IRXA 1WPQA 1IHDA 3TPFA 2I2DA 1RJEA 5AVUA 3G59A 1R2QA 2FGJA 4MUNA 4Z4EA 2UXDB 1M5UA 2WUGA 3ANSA 2DBQA 5DM4A 1ECGA 5LQSA 1TD1A 4IDFA 4G23A 1BD4A 3SIXA 3A6JA 1ZLXA 2X8JA 1C8KA 4LTNA 4KYIB 1U94A 4M0PA 5DW3A 3TZKA 2H31A 3ZQKA 1GG2A 4QREA 2HIHA 3O21A 5DTQA 1J9ZA 2UYGA 3AGPA 4JCOA 5IKOA 3ZWYA 4BKUA 5K0JA 1MJGM 1YS9A 1W30A 2MSLA 1C9KA 3EF1A 2GVNA 3P19A 2WLTA 1NBWB 2C3MA 4G5SA 4MIKA 3PQ2A 5BQ5A 1U0JA 3VPHA 5L3SB 3DAGA 1KI3A 1SFRA 1ULZA 2Z6VA 5A3RA 4RM2A 2ZS8A 1WW8A 3N76A 4UC0A 5P8WA 5KQSA 3QEBZ 2A92A 1CY1A 2NZ8A 4KRFA 2AJTA 4KJXA 3PKJA 1SHZA 3BWEA 2IE8A 3D2CA 1JBEA 2PE5A 1L5KA 1OSNA 1Y4ZA 3LA8A 5JSQA 1HFJA 2JZNA 1RBQA 2Z9DA 2BDTA 4GZ5A 3UJ8A 3ZD8A 4BO7A 3K15A 4PS0A 1C7IA 4E3ZA 2WAYA 3K2EA 4I1SA 3G6KA 4TRJA 5I3CA 1XEWX 2W11A 3RVMA 1N92A 3F9CA 4PC2A 3UY4A 1UQRA 2PH7A 1N57A 4W5OA 2WTAA 4QUBA 2ZDHA 1C7RA 5K8LA 5B6PA 4WUVA 3WIEA 3PKZA 2ZITA 7ABPA 3DBVO 1LLUA 2BFAA 5TPZA 3FVTA 4P1ZA 3QEOA 3JQCA 2J9ZB 3FKJA 3MWEA 2UUAB 5G0WA 3I2YX 3K8ZA 3AF0A 5LQUA 1FCJA 3LOQA 4OHYA 3GFSA 3KTDA 4IJMA 3B9BA 4LVUA 4PG6A 3KPWA 2VH2A 2HCBA 4DE5A 1QWOA 2YCLA 1TKBA 4BS9A 4M55A 3U7GA 3SSNA 4WTOA 4FQ8A 2NUTB 3KSDO 5JSZB 2PQ0A 3CZAA 1O5OA 1V9LA 3ZE9A 2FUKA 1MIOA 3HBAA 1XVIA 2CD7A 4D4LA 4BGDA 2HEIA 4IJQA 4DUYB 2PUGA 3B8HA 3CLTD 4H60A 1ZI9A 3ID6C 2PEYA 3KV3O 3II6X 2CBXA 2Y05A 5CXQA 4IR7A 2Q9UA 1KK0A 4Z9YA 1Y82A 2ARKA 2Q1UA 2BEJA 2ZSIA 4PAOA 3RSGA 4QYIA 5M7EA 2IQ5A 4JWKA 1U0GA 4X00A 3OUZA 3Q6IA 3TX6A 2IJGX 1MDFA 3KKMA 4YWHA 2PCLA 3ZYCA 1Z4QA 6YASA 2PU5A 3R41A 2O2YA 3IXQA 1YCDA 4FZRA 4KQJA 4GLFA 4F72A 2XGJA 3H5WA 1AT1A 4TVKA 1QIGA 1L5LA 3AT1A 3JSXA 4FDAA 3RNOA 1N8TA 4QTUB 4R5HA 3EMVA 4WWHA 4RACA 4CF6A 1PD1A 2ZTVA 4ROSA 1WHTA 3TKYA 3U62A 3R0IA 2ZVJA 3TIGA 4NYJR 3AXTA 2N1BA 5CDFE 3EVZA 5DM2A 5HIJA 3K0BA 4DLLA 1RI3A 5JW6A 2EFDB 1ZXLA 3CLSD 1C3OA 3L0DA 1JFTA 2PMWB 5IK2A 1GRRA 1NVKA 4G97A 3MN1A 3QKWA 4X8HA 4KP7A 1E9BA 2HSEA 1XR3A 4PIMA 5KDLA 1ZHOA 1UAYA 3TEJA 5L3SA 1U0RA 3QOYA 2WIJA 4UKDA 1KEUA 4RORA 1AMOA 1OX4B 2ONCA 3CLRC 3KJFA 1BW9B 3RQSA 4YCJA 3H9BA 5ULLA 2HY7A 1RKVA 1C4KA 2ST1A 1ESEA 4IQ4A