1QHNA

Chloramphenicol phosphotransferase from streptomyces venezuelae
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
178
structure length
178
Chain Sequence
MTTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKESIECAWAIAAHVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structures of Chloramphenicol Phosphotransferase Reveal a Novel Inactivation Mechanism
pubmed doi rcsb
molecule tags Transferase
molecule keywords CHLORAMPHENICOL PHOSPHOTRANSFERASE
total genus 53
structure length 178
sequence length 178
ec nomenclature ec 2.7.1.-:
pdb deposition date 1999-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07931 CPT Chloramphenicol phosphotransferase-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1qhnA00
1LS1A 1KAOA 1XFAA 2GVZC 2CXXA 3SYNA 1SVWA 2ZE6A 4D0LB 3Q72A 1XPRA 2FNAA 1NI3A 3LLUA 4MITA 3WNDA 2GZAA 1IJFA 2NTYC 1EX6A 1G3RA 2OAQ1 3TH5A 4KCGA 4KFSA 5CLQA 4EQ6A 4MGKR 1JAIA 1H65A 2VH5R 3VKGA 1S3GA 1XTSA 4IEEA 4D81A 1SHKA 1TNDA 3TUIC 2QBYB 1JQLB 2FX3A 1KSFX 3D6TB 4P4SB 1QHIA 3FKSD 1RIFA 4POAA 2B8TA 1G5TA 4OQLA 3U3MA 1L2TA 3VU9B 4Z1MA 1XCMA 5GJVC 2IUSA 1SGWA 4LHVA 1UBCA 2FFBA 4K81B 4Q4JA 3CIOA 4UNPA 1FUKA 4HAZA 3VKHA 3FDIA 4UJ5A 3N2IA 4OHYA 4Q7JB 1U81A 1YZNA 4DRZA 3SFZA 3GJXC 4FMBB 5IK2A 2O8DA 3NH6A 1MKYA 2LKDA 2OBMA 3PITA 1E9SA 1Z0IA 2O8CA 4JVMA 4QG7A 3WNCA 2VL7A 4JLNA 4M1KA 3K70D 2EFHB 1H8HA 5KPJA 3W6OA 1CF4A 2KI5A 3B2EA 4DLRA 3U3KA 4NKRA 2BJWA 1XJQA 1Z0AA 4B3FX 2AFIE 1DAIA 2JLRA 4A0RA 3L43A 1KHTA 2BBTA 2QQ0A 1YRAA 5HZHA 4M1SA 4PHFA 1N0UA 4BFUA 3K0SA 1V5WA 5FI0B 1YR7A 2J0VA 2H17A 1DG3A 3FHCB 3THOA 1KMHA 1LFDB 3F0TA 3NXSA 4HATA 1UBGA 4HDQB 1SXJD 2JLSA 4OI2A 5L3SB 1Z0DA 5BN3A 3TUJC 2KWIA 1G17A 2JLZA 2JLUA 1PVOA 3GJ6A 1G5RA 3BBPA 2FOLA 4TMKA 4XTRA 3ZVLA 1U0HC 4EPXA 3QSYA 1VG1A 2QM8A 3GLHB 3LXXA 3OIUA 5CK4A 3CM0A 3EPHA 3RS3A 5F9FA 3CNLA 4A0GA 4LJYA 2JLYA 1M8PA 3F3YA 2W83A 3ND9A 2YJTD 4Z1MD 5IDVA 4O25A 1EK0A 3BAFA 4F92B 1P2SA 1YHNA 3O8BA 3PCRB 2VPPA 5CITA 3RRNA 1HT1E 5CM9C 1NSFA 4BZPA 1JEEA 4PSKA 4I1SA 3C15C 4MRPA 3ZZ0A 2C96A 5KSOA 3MWYW 1XEXB 4TMWA 4AK9A 2ZAOA 3B5JA 1OLOA 3K9GA 2FMXA 3U6KA 2KE5A 2PZEA 3RS2A 3FYHA 2ATXA 4FIDA 4Y0AA 5KYKA 4QOSA 1KY3A 1EG7A 1KO8A 3T5DA 5K8IA 4DSUA 2QGNA 1WBBA 3B6EA 4URVR 3MUFA 5EE5B 3GJ5A 3DKPA 4L8GA 5AUQA 5J4KA 3TJZA 4F38A 3L8ZA 3MD0A 1XMIA 1UM8A 5AJXA 4MDFA 1NIJA 4OQMA 3GLFE 2IYRA 1P4SA 2CL0X 3QVVA 3I8XA 2Q0HA 5LDDC 4V02A 2J45A 4LHZA 1W7AA 2QSZA 4WVFA 4R71A 4US1R 3CX7A 4TSFA 4JKYA 1E96A 2ODBA 4US2R 1N2CE 3R9WA 2G83A 3WXMA 1C4OA 3CKLA 1UF9A 1W36C 3U61B 2X2EA 1DOAA 2O0KA 4OQFA 2O8FA 3NVAA 3K1JA 3KDSE 1KIMA 1AN0A 2P0EA 2ZS7A 4I81A 4G1UC 4ZIRA 2DYKA 2ZJAA 5DHFA 3I73A 1R5OA 1DAEA 3QF4B 1F48A 4L9WA 2R6GA 3BERA 3MLEA 3FE2A 3NBFA 4MQBA 2YC4C 4ZDJA 1VHLA 2FEOA 2D4HA 3P4XA 4JLKA 2IYXA 1NMYA 4C9BA 3MWJA 4ON9A 2PZGA 4JMPA 5HE9A 1X8KA 4G5OA 1KO7A 2QRNA 2A2ZA 1S2MA 4UNRA 4C7OB 3JVVA 2R44A 3IO3A 2HCJB 2HLDA 4EDHA 1RZ3A 4WA7A 4K46A 1FOEB 3V00A 4PTLA 1HT2E 5KSZA 3OZXA 4PO1A 1TTTA 3AVUA 4FXPA 2CDNA 1OXUA 2BWJA 3LY5A 4A2QA 1S9HA 1X86B 3L0SA 3QY0A 1DG1G 2OESA 5KSYA 1GZSA 4FWIB 4ACBA 2FA9A 3N70A 4LGMA 2LCFA 3MJRA 1BYUA 1UBFA 4HUTA 4E07A 4EPWA 3A8TA 1YZLA 5D3MA 4CEHA 2B92A 3PXGA 4PC3A 2ZRKA 1QHSA 2ZU0C 3Q5EA 4BEBA 2RGXA 3GLIA 1A2BA 4GMXA 1H8ED 4LHXA 5DI3B 5LD2C 1KDPA 2BIFA 4R2IA 3ZIAD 1R5NA 2QE7A 3TE6A 5AJVB 1MH1A 2OAP1 3VHLB 4JJKA 3EX7C 4BFWA 5JJLA 3I92A 2G77B 4NTZA 421PA 3DMNA 4HB2A 4ZDIA 1EGAA 3ND8A 4CT4B 1E2JA 1J8MF 1E2LA 3LQRA 3DOFA 5TVKA 3QG1A 1KAGA 4Q1CA 3RS4A 1PLKA 2WWXA 1J2JA 4HB3A 1Z5ZA 5DNYB 5FBVB 1COWD 1DAKA 2QT1A 2X2FA 2XTNA 2Q3FA 3AV0B 3QXHA 5JSZB 2WMNB 3DL0A 2GF0A 4FMCF 1KZ7B 2RCNA 1U9IA 2WICA 2V7QA 3A58B 3I5XA 1CP2A 1G8YA 5FPSA 2OFXA 5EE3A 2ZRHA 1ZBDA 4QBGB 1E2GA 4QJ4A 4URUR 3Q85A 2QP4A 3CH5A 3VR1A 3U4QB 121PA 1NN5A 1NBME 2BHRA 2QMEA 1Q44A 2PMKA 2OG2A 4O2LA 1CEEA 2O0HA 3CR8A 5FL3A 4NL4H 4EJSB 3P32A 3S1AB 1TF5A 1KMHB 1KZGB 3U44B 5P21A 2XAUA 4IOMA 1VIAA 2REOA 2BKUA 5TB5A 3PUYA 4CYMA 2DFKB 1A82A 5EXTA 1NLYA 1LNZA 1W2GA 4MRVA 2D74A 1Q0UA 1NIPA 3B60A 3TIFA 3P1JA 1VCNA 1KK0A 1E6CA 3IPYA 3ZQJA 1D9ZA 2OXCA 1M34E 5H68A 3SYLA 5KHOC 2WSSD 4TL6A 2IHBA 4GOXA 4V0KA 721PA 2GA8A 3VNVA 1Z08A 4M8NE 5J40A 4D4KA 4ZDKA 3TGPA 4Q01A 4PC6A 5EUMA 4RZUA 1XP8A 3K0EA 3LBIA 4U02A 4XVUA 4I1OA 5C4GB 2W58A 2J46A 2V1UA 1GP2A 2O0JA 2GESA 4PQYA 4PO9A 2AK3A 1XJCA 2ERXA 3B82A 3OESA 1COWA 2D06A 2WOOA 4NCJA 4NYJR 4GL2A 2GEDA 1BIFA 1TQ4A 4I99A 2GJ9A 3EPLA 4Q9KA 1Q1EA 4NH0A 1Z0KA 3ADBA 1N6IA 2J5XA 4OKSA 2QP9X 1D8TA 1TPZA 3QJYA 1VG9B 1TX4B 2P5TB 3RLFA 1YQTA 2R8RA 4M9SA 2ZROA 4ACAA 2ZSEA 3TUZC 2IX3A 4JLJA 3VR2A 2VO1A 3Q3JB 2FDCA 3EW9A 3OIYA 4XJXA 4LI0A 5FR1A 2VSOA 1AZTA 4J0QA 3BWDD 3FPAA 3N2EA 5JMTA 3CPEA 3QEOA 1RRGA 2VP5A 4WBSA 1D2EA 2FWRA 5JS8A 4F7WA 4F4CA 3WYAA 1RRCA 1GKYA 5FBQB 4E22A 3KQLA 3TW4A 5J4VA 4HB0A 2GZHA 4OYHA 4G01B 4HUQB 4HAWA 2V3CC 5GADl 4A92A 4PZZA 5C1BA 1DAMA 4G3XA 2O8EB 2O8BB 4RD3A 1XCPA 3KKPA 2XXAA 3PEVA 3AVVA 4CF7A 4Y0VA 1OJLA 2E87A 2W2XA 2QAGB 2V55B 1U8ZA 4NE2A 4BFYA 3KJEA 2ASEA 5JHGB 2N46A 1P9NA 2IBMA 2ZJ2A 4XIGS 1LF0A 3Q7QA 3U7HB 4LJ9A 1WP9A 2WOJA 1UFQA 4JLOA 3EWSA 3OE7A 4E03A 4M0LA 4MGYR 1CR0A 1T3SA 3T12A 1E0AA 4DWJA 3HPRA 2FFQA 3CONA 4BZXA 3BXZA 4WXRA 3IEVA 1DADA 1D5CA 1NG1A 4AG5A 1RYHA 2PT5A 2OZEA 4TQUS 1XBTA 2P67A 3VMFA 5DGXA 2CNWA 3LW8A 1NSTA 2QY9A 4MH0R 2PCJA 3VR6A 2WPDD 2G88A 1A4RA 2ODNA 1C1YA 1E9CA 4LX0A 1ZW6A 3DEFA 2UZ3A 5L3QB 4R98A 4W5JA 2C98A 3AEZA 1ZM4A 5SZJA 2OHFA 2QROA 5FTLA 1B23P 1MT0A 3T34A 2VEDA 5J4HA 2OCAA 4KI0A 3QKSA 1E98A 2QA5A 4L15A 1N6KA 2QL6A 4Q18A 1W4BA 4LC1A 3UATA 2E1RA 4KBGA 2IA5A 4YC7A 3IGFA 4EJSC 3NC0C 4JBXA 1GG2A 3NIBA 3DMDA 1KDTA 5J4YA 2ZM5A 2ZQ5A 1HH4A 1EFHA 1PUJA 1EFTA 2P2LA 2GAAA 4YXWA 5FPHA 1ZJ6A 2CK3A 1UEJA 2ZYTX 3X1ZA 1Z63A 2BMJA 1OYWA 4DLVA 621PA 2UVQA 1ZYUA 1JPJA 1Q1BA 1NN3A 3DDCA 4NYIQ 2F1RA 3RANA 3PUZA 1IY2A 1GNPA 1G16A 4YQFA 3NDBB 2AWOA 5E7IA 3UMSA 3M4YA 1KI1A 1CJVC 4I1VA 3THXA 1ESNA 3ICEA 3FOZA 5JWRA 2ODEA 3BB1A 2XSZA 2C9YA 4IHQA 4PR0A 2ZJ5A 1ZU5A 3TKLA 5EE9A 1F2UA 3EZ2A 3PUWA 3D7MA 2OT3B 1II8A 3WMEA 4MRSA 2HT1A 2NO7A 2R6DA 4ITRC 1PZNA 1R4AA 3VNUA 2I3BA 2VHUA 2OO7A 3M0EA 2ORVA 2F7SA 2WPDA 4HSEA 1XWIA 3P26A 3W90A 2BMDA 2E9SA 1ZNYA 4A2PA 3A1UA 1KO1A 4PC1A 3SHWA 3RRMA 2GCPA 2IEZA 3CRRA 1QG4A 3FMIA 1QHHA 4DCTA 2CE2X 1MO4A 5AUOB 1NVVR 1BS1A 1GILA 4TLBA 3TR5A 2WAYA 3QKUA 2J0UA 5CJPA 4IDOA 3FHTA 3AP3A 3IILA 2VP2A 4KYIB 5HCIA 4YMVA 1IONA 4TYWA 2FEMA 2ZRMA 1WB9A 4Q7LA 2Z4SA 5EP4A 4ARZB 1RW4A 3H1TA 1YZQA 1WA5A 4M9XA 5FOUA 1W36D 3PJRA 1N6HA 2IHYA 4B43A 2RMKA 4P33A 3W8RA 3B9QA 3IO5A 4YXWD 5DLQC 1GOTA 1OFTA 4NYJQ 3UMFA 1HE1C 4LWZA 4AC9A 2W0SA 1UDXA 1KDOA 1MRNA 2NO6A 2J1LA 2OFOA 2H8KA 2VA8A 3NHAA 3CR7A 3A37A 4XD7A 2PH1A 4DDVA 2DWPA 4M22A 2JCSA 4LSGA 2ZI3A 5JI3E 2AHOA 4OHZA 1HEIA 1N3BA 1IOZA 1W47A 5B57C 1E0SA 3L0OA 2F55A 2XSZD 2VHJA 4DUGA 1KJYA 2BDTA 3QENA 1OV4A 5IRCD 1N6OA 4Q5IA 3QKTA 2P6NA 1M74A 5BQ5A 1EWRA 4QL3A 3TMKA 4PC7A 1W36B 4OI4A 1IXSB 3ZVMA 5JCZA 2OCPA 2PJRA 2O8BA 1XD9A 2C78A 2NO1A 4TL8A 3RS0A 1AM4D 1P2UA 2WHXA 5AJZA 1I4LD 4DDUA 1HE8B 4JYCA 4URYR 3IDQA 1E69A 3X1WA 2ZR0A 5JLJA 2RKOA 2LKCA 1FX0A 1UKVY 3PIRA 1KO4A 3LBHA 4AYWA 5IT5A 2D3WA 4IKEA 3AVXA 4CEIA 3NH9A 5FOVA 2JJ2A 1Z0FA 4MDEA 3SDZA 1TEVA 4HAYA 4TZ6A 3AM1A 4Q4HA 1XD2B 3WBJA 3QNUA 1FUUA 1Q3TA 4LJ4A 5IK2D 4TLDA 1GAJA 4OJQA 1Q57A 3GFTA 2QZ4A 4DIEA 1P62B 1E2PA 1SXJB 2ZEJA 3PQCA 4ERNA 2ECKA 2CLDX 2XB2A 4LJ6A 3ZGXA 1S1CA 1VYTA 3LVRE 4TWZA 2AD5A 2NGRA 3ZYCA 1Z2CA 4FMDB 4M1YA 1JEDA 1Q12A 2QBYA 3TVDA 3ZVNA 2IUTA 3CRW1 2ZRBA 4JVNA 2HXYA 3QE0A 4XD7D 1CRQA 3SJCA 3K0FA 4MUAA 1NNEA 1XU4A 1I4TD 2GAOA 1SVSA 4BZQA 5CIQA 1U2RA 4EKDA 2IS1A 5KTYA 3ZDQA 1J99A 4XSHA 4U00A 4DUGD 3GJ4A 1SQ5A 2F9LA 4JVSB 5F2EA 1PV4A 2NG1A 4LC0A 4XWOA 5JCPA 1GL9B 3AUXA 2HJGA 2WJHA 4XWAA 521PA 2Z6VA 1Z28A 3OEED 3EG5A 3GLIE 2Q3MA 1OFIA 4GNKA 3VAAA 2PEYA 1C9KA 1A7JA 1VYUA 2Z5FA 2VSXA 4Q66C 2NQ2C 2ZE7A 4OK3A 4B6EA 4ASUD 1GRQA 1N25A 1E1QD 2JJ2D 1D9XA 2OXRA 3UMRA 1D2NA 2VHTA 3RRYA 4ZCLA 1T0JB 4RZ3A 2GJSA 4V0NA 4B71A 1NVWQ 1G64A 2ERYA 4DCSA 4R9UC 1NMXA 3BH7A 3WNBA 2C5LA 4TT3D 1E9FA 4UXIA 2IYVA 2YZ2A 4LYFA 4MYUA 4Q19A 2KBEA 3EAQA 2V9PA 2ZR9A 1CJKC 2HUPA 4FWTA 2P5SA 2J41A 1OT3A 1F2UB 2IL1A 1KI4A 4US0R 1NJGA 1SVKA 3OIWA 3ECCA 1YR8A 4ABYA 1DVRA 4C30A 2FSHA 2EYUA 4HZIA 4IXMA 4WIAA 1E4VA 2J0SA 3K9NA 2GXAA 3T35A 4IOJA 4KVGA 2ONJA 4BLPA 2R62A 5BYJA 4WZ6A 3GLGB 3UXMA 1BYIA 4Q1AA 1N5JA 1YZGA 2WM9B 1L4UA 4LYHA 3GFOA 2WBLC 1A5TA 3OEEA 2IT1A 2F43A 1US8A 1MO5A 1OE0A 3AF1A 2O52A 4H9GA 1G8HA 1T3LA 4QBIA 1YZKA 3DM9B 4NCNA 3BC1A 5FUXA 5JS7A 2ZYUX 1GKIA 2A5FA 1IBRA 4EQ6B 4JT4A 5KUTA 4QBFA 4TZ0A 4F91B 4RJLA 3UKDA 1BMFD 1ZC3A 1ETUA 2AWNA 1W4CA 1T9HA 3BB4A 1KO5A 4KLNA 3UK6A 5AUNB 1U0LA 3PEYA 4TTRA 5DO9A 2PBRA 1MABA 4P4SA 2GK6A 2D62A 2MMCA 4HEJA 1IHUA 4V0OA 3K9LA 1Z6TA 1VIYA 1AJEA 1QG2A 4QBHA 4CT5A 2W0MA 4BQSA 2ZAMA 3W6NA 3NEJA 3H0KA 5CK5A 4GOJA 4A0FA 3O8DA 4RD4A 1E9RA 1RFLA 4FMDF 3AP1A 5FBLB 1YR6A 1KI6A 1KKLA 2ZANA 2JLVA 1BH2A 4OJKA 2BMEA 4BECA 2ZSDA 1P9RA 1LS6A 1Z6YA 3NEYA 5EP1A 4DSOA 1NRJB 1CIPA 4W7SA 3TNFA 3TQFA 3GEHA 3ZIAA 2H5EA 2F3TA 4NYMR 4B2PA 4DHEA 2GDJA 4ZO4A 1QZXA 3PUXA 3RWOA 3UWOA 4Q4HB 5FUWA 2YWHA 4DLTA 2HLDD 1QF9A 1CJMA 2PX3A 4AIIA 3FKQA 4XTCS 4JLPA 4Q00A 4F4JA 2CE7A 3NBYC 4V0LA 1I2DA 3NKVA 4B75A 5HR5A 3R8CA 4G5SA 1PJRA 3BS4A 4I1UA 4KAXA 4QXAA 1ODFA 4LBZA 3K9HA 2C2HA 3O47A 2IWHA 3W5JA 3QOFA 3WHKA 4B74A 3U6BA 3AF3A 1ZRHA 2QGZA 1SXJE 1GL7A 1OH8A 2PJZA 1KI9A 3AVWA 3CLVA 3FWYA 4YONB 2RAPA 1ZCBA 3SOPA 3AGPA 2B6HA 3PFIA 2IF0A 5JRZA 3GFPA 4H1VA 1G7CA 2VF8A 2CLSA 4Q02A 2QE7D 3KQHA 1IAQA 5F98A 3AVQA 4JT2A 2IYQA 3I8SA 3HU2A 2R65A 2CCKA 2RHDA 1OIXA 4HAUA 1OKKA 5FPYA 4M2LA 4NU0A 2A78A 2GEVA 5JJKA 4PHHA 1RKBA 1W0JD 4C0JA 5JSZA 1RPZA 3LD9A 3ADCA 1OFHA 4DJTA 1X8JA 4PXAA 2QTHA 2VP0A 3D31A 3HR8A 4XVQA 1Q20A 3FMOB 2C95A 3K09A 3UANA 4K8OA 1OH5A 1TQ2A 3UPUA 1GIAA 1P9WA 2XNSA 2ZRNA 2IWRA 2YOFA 5A5GA 1CXZA 3EZ7A 5FTJA 1KJZA 3LNCA 1J90A 1S8FA 3U4QA 5CB8A 4EPTA 1IN5A 1X8LA 1XZPA 4Q1DA 2WSMA 3DZDA 3TBKA 2ZPTX 3CWQA 3KKNA 4MKFA 4QHSA 4EJSA 1NF3A 2JASA 4Q4AA 3AB3A 2J7KA 4TL9A 4Q03A 2ZI7A 3TSWA 3THWA 3FMFA 2IS6A 1HTWA 2FSFA 2XZPA 2YV5A 4CRWB 1Q1QA 4D0GA 3WHLA 1T5LA 1W49A 1ZD1A 4TTQA 3AF0A 4WAUA 3BB3A 1U94A 1XJ0A 3BH0A 4LOAA 2J59A 2O8FB 4I4LA 1UKEA 2A5JA 3DO6A 3RC8A 1G8FA 2FG5A 2F6RA 2WZQA 2ZITA 3GP8A 5E7JA 3SQWA 3WMGA 2OEPA 4C2TA 4AYTA 1VYVA 2G6BA 2QPAA 1JECA 2DFNA 3CZPA 4NYMQ 4CW7A 2NZ8A 4WOPA 4LRWA 3VX3A 4IDNA 1KI7A 1BKDR 1WQ1R 3P27A 1OXVA 5IHPA 4N3NA 3A1TA 4IDPA 2C04A 5BN4A 1AA9A 1JPNA 4QNRA 1XZQA 1UPTA 3AGQA 1ONBA 1AKYA 3KFVA 1OF1A 2YWEA 3OEHD 3BOSA 3GEIA 4WXPA 4JL8A 1Z6GA 2IYZA 4UJ3A 1CR1A 1QHNA 2FU5C 1DPFA 2F43B 4JS0A 4NPHA 3EZ6A 4B3GA 3VR3A 3W9YA 4Q9JA 3BFXA 2XEXA 4L5BA 3ZVRA 1W4AA 2CVFA 2FPKA 2P6UA 4M1OA 4GI7A 3LW7A 3MCAA 4M53A 3VR4A 1IN7A 1YU9A 1WE2A 4D80A 3A4LA 1JR3D 3KJHA 1F3OA 4DEXA 1NY5A 1KSGA 5KPDA 5HKKA 1KNQA 1NY6A 1MABB 1E1RD 3CPJB 4IDQA 1OFUX 4Q1BA 4L16A 5B30A 2JLQA 2ANBA 1F60A 3B1ZA 4IDHA 5GVSA 1B0UA 2IYUA 2ZE8A 3A1VA 2IEYA 4OHVA 4FINA 5JFGA 3LO5A 3SBDA 1WMSA 4AG6A 5L8VA 1XPOA 1G18A 3EARA 3PENA 4M1TA 3PR1A 4MUBA 4V0MA 2W6IA 1NKTA 2ANCA 2GTPA 4KHZA 1YKSA 3E70C 4BLRA 1AS3A 1KI6B 1FW6A 4GRAA 5FOXA 1XTQA 1AGRA 1CTQA 2H7VA 1HY3A 4BRUA 2QAGA 3KQNA 1MO6A 2GXQA 3RRZA 4DZZA 2MSCB 3C7KA 1P72A 3DKVA 3FFBA 3TR0A 3OEHA 3RVBA 2G0TA 4EUNA 1E2IA 2BOVA 4JBYA 4HAVA 3KXLA 3EC2A 4HYYA 4RD0A 5AK0A 1RJ9A 4GP7A 2HXSA 4GP6A 3IQXA 2VP6A 1VCMA 1NMZA 1BOFA 4JLDA 1P5ZB 3W3ZB 3U3OA 4QJ3A 3E2IA 3U44A 1Z07A 5L3RA 4N0EA 3G5UA 4YMSA 2G1JA 1GNQA 3Q7PA 3WRYC 5EZ5A 4A0HA 4DBLC 4ZI3A 1V43A 3T5GA 4TTPA 1OW3B 2CHGA 3T61A 2GZDA 3CRVA 1ZM7A 3ZZUA 4A2WA 2BV3A 1FTSA 2WMOB 3H86A 4PO8A 4C0QC 2J3EA 2A5GA 4IVQA 1DS6A 2J0QA 1DAHA 3QBVA 3C4JA 1N5LA 3CO5A 1G1MA 4MA4A 4LV8B 3ZD7A 1Z22A 3F8TA 5G41A 2QEQA 2CVHA 2BMFA 2V6IA 1M2OB 4IEIA 1IN4A 3NHBA 3PG5A 1FNMA 4RKFA 2ZJZA 2FGKA 3KTAA 2PCLA 3L2OB 1II0A 4IOLA 4PX9A 2QPOA 2WKPA 4BLSA 2PLFA 4C0LA 5JECA 3CF2A 1W44A 1W46A 2AXPA 2VHCA 4DCNA 1JXMA 2JAQA 2H18A 1TQDA 2ZRLA 1AQYA 1IXRC 3EZFA 1ZU4A 4EPRA 4DVGA 3TAUA 4IJMA 3H84A 2XB4A 3CWZA 2UKDA 4NCKA 3R7WB 3O8RA 2D2FA 1WBDA 2ZETA 1I2MA 1S9DA 4DLYA 3MG9A 3AUYA 1XEWY 3QEJA 5AR1A 3EA5A 4UXHA 3X1DA 2W2TA 1W2HA 5FI1B 3G0HA 1YE8A 2AK2A 2IXFA 1AS0A 4OI1A 5DH9A 1E2HA 4HDOB 4KFTA 1RC8A 2O5VA 2H92A 2QUZA 1O87A 3AKCA 3BJIC 1SKQA 4URZR 2WJYA 2AX4A 4KLZA 1MV5A 1IXZA 1YR9A 1UJ2A 4CEJB 1NP6A 4BE7B 1U8AA 1KSJA 4ZCIA 1U9IC 3QPVA 4NBSA 5KDOA 5SZHB 3GQBA 1OH6A 2CEAA 5LPNA 2O8EA 1LB1B 5G53C 1EFRA 2IYYA 3T1QA 1JJ7A 3SBEA 1MR3F 4LBYA 1IM2A 1HV8A 3MGCA 1R7RA 2WWYA 2VQSA 4TYPA 3SHFA 3W6PA 4NZYA 3ASYA 4NHOA 4ARZA 2ZVQX 2JJ8A 4Q1EA 4C0BA 2GJ8A 3CNOA 4X8LA 3G82C 2K5UA 1ZUNB 4GSYA 4LBVA 3GJ7A 4IW3B 1TUEA 2QMUA 1SZPA 5UKDA 5A4JA 2IK8A 4JLMA 4ZPXA 4TMVA 1VTKA 4YMUA 2XNDD 4Q21A 5A0FA 3B85A 1F2TA 4D0NA 3ICQB 4U5XA 1L8QA 2ZJ8A 1IQPA 3RDPA 1T8TA 4JKIA 4UQOA 1AKEA 3NDPA 2PEZA 4Q9IA 4QHTA 4ZCMA 1JR3E 2D2EA 2YNMA 3I4LA 5FTMA 3B1WA 4DT1A 4F4IA 1KK1A 3THYA 1CRPA 4B73A 3B1YA 1Y3AA 4KJZA 1K5DA 5TY0A 3LV8A 4Q4JB 1BO6A 3BE4A 2ZXUA 4ZIRB 1IY0A 4TL7A 4QRHA 2WIAA 3D3QA 2AN9A 2RGDA 2B8WA 1M1YE 4GDFA 2GEUA 3QKSB 2JLWA 3SE0A 2RGNC 1YZUA 4C2UA 4A36A 4FI3C 1VDZA 3L0PA 4MKGA 4A9AA 1N6LA 1LVGA 2OILA 5K8UA 3R20A 5BN5A 5B58C 1G3IA 3QBTA 3K53A 3BK7A 4TYYA 3AVPA 1U90A 4KSBA 4WZBE 1EFRD 1K8RA 3FGNA 2DHRA 4NYIR 4OK6A 3SJAA 2VP4A 2ODWA 3T06B 3AVTA 4C7OA 2HYDA 3LLMA 1Z47A 2X77A 4HDCA 1HURA 4TQAA 3W8NA 2YINC 4DB2A 4AKIA 5C2JB 4BPBA 5EXXA 2OFWA 1ANKA 1M7GA 2OCBA 2W6JA 4RVCA 1R0WA 3U7FB 5TARA 2B7CA 5GJCA 3BD9A 4BLQA 1AGPA 4JYBA 2JLXA 2OLKA 4JIMA 3FMPB 5SZKB 1JR6A 1OB2A 3IQWA 3LWNA 2OSBA 1GRRA 2OBNA 3MSXA 3PV0A 1SVIA 3ZH9B 2ZS8A 1VCIA 1O3YA 4PZLA 3THXB 1NBMD 3LDAA 1X1SA 4NP6A 1TU3A 1OB5A 4X8OA 4OHWA 1YVDA 3WBKA 4CIDA 4B3BA 1VCOA 1E32A 2XNDA 1XRJA 4ASUA 2JATA 1WRBA 1II8B 2VBCA 5DI3A 4JSTA 5CYPA 2CMKA 2JDIA 3K0AB 3RS7A 5KNCA 1R6BX 1CKEA 5G40A 4DLWA 2FH5B 2BCGY 3EIHA 4HB4A 3JZMA 2R6CA 3QIAA 2ZRAA 1XTJA 4S35A 3C5HA 1JJVA 1N5KA 1TUIA 2P65A 2ZI6A 4M4SA 2YC2C 2OUKA 2REBA 2ZI9A 3NC1C 2D7CA 4EFNA 4B3DA 4AKGA 3T1TA 2GCNA 5AJWA 4DSTA 2DY1A 2QORA 3ZD6A 1T5IA 5JWOA 2EVWX 2R6FA 4IXNA 3GLFA 3BFKA 3GPLA 1J8YF 1FZQA 1R0XA 4IRUB 3HYRA 1N0WA 4M1MA 1G21E 4D26A 3R7WA 2XOKD 3VFDA 1W1WA 3I1FA 1CLUA 3X1XA 4OQNA 2G1KA 4FN5A 1XCGB 2QM7A 2AKYA 2XTZA 4FD2A 2CL6X 1SKYB 1F5NA 1FMJA 1CR2A 3D8BA 2GBLA 4GPTA 1TF7A 2ZRPA 3V4FA 4DCVA 2FPLA 5DN6A 1D6JA 1VMAA 2A5YB 2QU8A 1LY1A 1XTKA 4PAMA 3HU1A 4DDWA 1AK2A 2GJAA 4TMZA 3SJZA 1E2FA 3WRXC 2BVNA 3GLHE 3KB2A 3HR7A 1NVUQ 1QDEA 2WVJA 4MKIA 3DZ8A 1BMFA 4BFZA 1OIVA 1DE0A 1E2MA 4BLOA 2W2VA 3K8YA 2CCGA 3KB1A 4MYCA 4BUJA 2X1VA 2IS4A 3LAWA 4FCWA 1GM5A 1TADA 1GVNB 2W00A 4XVRA 3GLGA 1E9DA 5LB2A 2QMOA 3QXJA 4PFSA 4BLTA 1U0JA 4CEIB 1UEIA 3VR5A 3F5FA 2PX0A 4AI6A 4TMXA 2GXSA 3GJ8A 2F9MA 2XZLA 2BM0A 3QF7A 1E9AA 3A1SA 3FB4A 1XMJA 2BEKA 5EUQB 5ANRB 2GHIA 2WWWA 1TQ6A 4RFSB 4YMWA 1DELA 3TK1A 1W5TA 2VSFA 4DKXA 2NMVA 3DPUA 3I72A 3IBYA 4QGAA 5D3MB 2RHMA 5LBIA 4GMDA 3RWMB 2V7QD 1LF5A 3QXCA 3DHWC 4DLZA 2Q21A 3GLIB 4QC2A 3JZAA 4DT1B 4BEJA 3QKRB 3THYB 2WIBA 4DDTA 3L0IB 1YZTA 3OAAA 1CR4A 1G41A 4BGDA 3E5HA 1X1RA 3Q5DA 4TYNA 1IY1A 2FFHA 4LJ5A 2DWQA 1LTQA 4HUQA 4B3XA 1ZNXA 4P4UA 3IHLA 2A9KA 2IS2A 1DO2A 2RGEA 4XOIA 2XXAB 1S96A 4EPYA 5GJWC 2H57A 1Z29A 1XXHA 2VYFA 4X8HA 3WP0A 1W4RA 3CH4B 4HLUA 1NLFA 3EXAA 4OQXA 1ZD8A 4DLSA 2R2AA 2UZIR 1KY2A 5HZKA 3TLXA 4A15A 1M7HA 3LBNA 1FQJA 3KUDA 4B6FA 4KYUA 4Q7MB 2QENA 1Q3HA 3KXIA 1G3MA 4LDJA 3P4YA 3LVQE 1VKJA 3FFAA 3U5ZB 3NBZC 3BH6A 2CHVA 2GILA 1W0JA 4YDSA 2QAGC 4II7A 1EFCA 4OBEA 1NG9A 3KQUA 4KITB 1G19A 4PHTA 4C0SA 1GKUB 3IBGA 3AP2A 5CYOA 4NMMA 4EAQA 1CJUC 1S0UA 1ZM2A 4HLQB 3QXXA 4GOKA 4M9ZA 4YLGA 5F9HA 3C41J 5DSZA 2ZVPX 2WWIA 1FQKA 1DBSA 1E79A 3KL4A 3A6PC 1KDRA 3DOEA 4HLCA 1CBUA 1NVXQ 1DTSA 4JL6A 2VHQA 2WKQA 3AVYA 3NBXX 1T0HB 3OAAD 4A6PA 3EIEA 3PVSA 2OM2A 4JLAA 2DFTA 3RHFA 2JJ1A 2CLCX 4DLUA 1ZIOA 5DYGA 2EWVA 5DIFA 3HP1A 3CPHA 5FL7D 3SQXA 4IFEA 3LRPA 5DI9A 2J9RA 3GJ0A 1KYIA 3HDTA 2GXUA 4PAQA 1OKKD 4B3CA 1EFUA 3EASA 1CS4C 5GVRA 1G6HA 2CNWD 3U7EB 2XGJA 1ZM3A 2DR3A 3ONWA 1PLJA 1W5SA 3RS5A 2DWOA 4A8JA 5KO2A 4D82A 4LJ8A 4PANA 1WCV1 3MMPA 3MJHA 1TMKA 4DEYA 4DLXA 1S1MA 3UG7A 1N0VC 1W48A 2GNOA 5JHHB 1R8QA 4OHXA 2NOAA 5HCNA 3R8FA 3ADDA 4TLAA 3U60B 1XMVA 3RC3A 3QQ5A 2EFGA 3A4MA 4TLCA 2F3RA 3FHOA 3V4RA 2FV8A 5E7MA 3OE7D 2WJIA 4RZXA 4LJ7A 3LX8A 3PEUA 2IC5A 2RH5A 1ZNWA 1HQCA 1IN8A 1K6MA 3EC1A 2P3SA 2AXNA 2YOGA 4D6PA 3QPUA 1QVAA 2KSQA 4JVLA 1Z8FA 4B44A 2FZ4A 1MRSA 3B1XA 4KSCA 5H8WA 1E1RA 2JA1A 2KJQA 3A1WA 1XPUA 2BCJQ 1OH7A 1XEXA 2J0UB 3ZZTA 2ZIAA 1EESA 2A3RA 5B2ZA 1XF9A 3UIEA 5EJEA 2BEJA 4IOKA 1XNJA 4F93B 1EWQA 4QGGA 1WDTA 3GEEA 4IFBA 1R2QA 2CBZA 3EWAA 4UNNA 1KK3A 4MYTA 4KFUA 4KFRA 4NCHA 1N5IA 1OXTA 1ZCAA 4UXJA 3CW2A 3REGA 3B8HA 4AURA 2A30A 4FW9A 1SVMA 2CCJA 1I4DD 2HCBA 4CZ2A 4RKEA 821PA 4AWXA 221PA 4ZV4A 4MGIR 2OBLA 3BIFA 2HDNB 2BBSA 5AWFC 4HLDA 2EU8A 2MMGA 5BXQC 4MRNA 1AZSC 2C9CA 3CUEF 2F1IA 4OK5A 1N6NA 2CK3D 4B34A 1JR3A 3LH5A 4M21A 3V9PA 1SHZA 1SVLA 1N6PA 3X2SA 3LX5A 3VU9A 2R9VA 2VRWA 2ZRDA 5M04A 4D4MA 1XTRA 4FMCB 1KKMA 4NCIA 5L3QA 3I61A 2H1LA 3SNHA 1OIWA 5LD2B 5CB6A 1Z2AA 3LXRA 1G7RA 1GSIA 4DSNA 6Q21A 1U98A 2FGJA 4NONA 2O8DB 3SS8A 2J7PA 4Q4LA 2O8CB 1KI3A 3N5CA 3CRQA 4FCVA 1P73A 2NO0A 2WJVA 1FX0B 1GITA 5EE0A 1QHXA 1E2DA 4HI0E 1U99A 1G20E 1G3QA 2QP3A 4KO8A 1GNRA 4UKDA 3KKMA 2ZJBA 4N0DA 2G3YA 4KODA 3X1YA 3Q9LA 1XD2A 1GL6A 5K8TA 2ZRCA 3QXSA 2V4ZA 4A1FA 5DISB 2DB3A 1KNXA 2ZREA 4LYAA 1II9A 4DCUA 4QJ5A 2YVUA 4M9QA 3SZRA 5E3HA 4UNSA 1SXJA 1Z06A 2GBLC 1W0KD 1E2KA 4QNMA 5CDFA 2JEOA 5SZIA 5DE3A 4CEHB 2VLIA 1X3SA 4DC9A 3KXKA 2KB0A 3IEUA 5FTNA 4RD1A 2Y8EA 3NWJA 1T8UA 3FVQA 4UNQA 2RGCA 4WZAE 3UG6A 4QKQA 4KVAA 3REFA 5BWMA 4A6XA 3HWSA 1SKYE 2VF7A 5H1YA 3LA6A 5C18A 1OHHD 4EPVA 4ESVA 1EXMA 1P6XA 2R6AA 3WYFA 3CX6A 1LV7A 4D25A 3AKYA 3U2QA 3BFVA 4G5GA 3KFXA 4WW0A 5J4LA 1AQUA 4V0ME 4MRRA 1P2VA 2ZSBA 5L3VA 2V54A 4ILEA 4NDZA 3B9PA 3MAAC 2X19A 1OPXA 1QHHB 4B2IA 4P3YA 4P31A 2GVDC 2QAJA 4JZKA 1FL9A 5KDDA 3O8CA 4XWKA 3OF5A 4L4UA 4YMTA 4GFDA 2JIZD 1HYQA 2J7PD 3MWLA 3QG5A 2G9NA 3RNLA 5H70A 4B2LA 2LWIA 4JSYA 1XB2A 1RE0A 2Z0MA 3B1VA 4A8JC 4QM7A 2FN4A 3IIKA 1KTVA 1UDWA 3ZS8A 2C99A 1CJTC 3EPKA 1VG8A 1CULC 2BBOA 1RYFA 2C03A 3W34A 4EIWA 3KX2A 2F1HA 3RABA 5G3YA 2GCOB 3RSLA 1GUAA 2VTKA 3IIJA 1ZUHA 1NKSA 4TSFD 1OXSC 4RCZA 2ZYVX 4M1WA 5JZVA 1ZP6A 5GJBA 5JRJA 1DAFA 1T3HA 2ZRFA 2YWFA 3NG1A 1W0KA 1KOFA 4MKHA 1T6NA 4AKEA 4P0TA 2QNRA 3EZ9A 4TLEA 4PC2A 4AKHA 5K8LA 3RSOA 2PMDA 4C0HA 5J5CA 3RYTC 2WWFA 2ZJYA 2B7BA 4V03A 4JL5A 1KJWA 1OHHA 4B32A 4TN1A 1KMQA 1G7SA 4RCYA 2EWWA 1FP6A 3T1OA 2PLRA 1XTIA 3CF0A 5FOSA 2IYLD 4IVPA 2C77A 3I62A 3KJGA 3SEAA 2D7DA 1GDDA 1F6BA 2NPFA 2X8AA 3VKWA 3W3AA 1E0KA 3TAHA 5EXSA 4ZKDA 3I3SR 2GF9A 2RGNA 4LHWA 3SN6A 4PPFA 4QM6A 4TT3A 4D2IA 2ATVA 4XH9B 5DYIA 2JIZA 1US8B 3QVUA 4QGHA 5FPKA 4Q7KA 1NJFA 1PLLA 1HA3A 1NN0A 2FSGA 1RJ9B 1DEKA 1FNNA 5EP3A 2GETA 1QHGA 5JEEA 2WWHA 3CF6R 1L7VC 2REXB 2WAXA 1ZNZA 3SYKA 3KQKA 1EX7A 4PSVA 5KU1A 1UAAA 4Q47A 4LHYA 1KSHA 1G4UR 1Q21A 3WYGA 3J81k 2VP9A 1F2TB 4KU4A 4O0MA 1DARA 5E4FA 4URWR 3CX8A 4Z54A 2RGGA 2TMKA 3VQTA 2ZJOA 2W6JD 2ONKA 4ESHA 5JI2E 3K0FB 5FH9A 1E1QA 1NLZA 4W5WA 1Z0JA 1A2KC 3TRFA 3NTUA 1P61B 3SC3A 1G7TA 1ZM9A 1R10A 1K5GA 1FMLA 1AIPA 4BWYA 4EFMA 2DFLA 3B78A 3MWKA 2JGNA 2CJWA 3QUSA 1FTNA 2WV9A 4D4LA 2QTFA 4PSAA 2Q3HA 1YRBA 2FSIA 3HJNA 4LYJA 3AKEA 1PUIA 1ZAKA 1VPLA 3BRWD 4E5UA 4Z51A 1RRPA 5JEDA 4PQFA 2GWHA 2YWGA 3SJBA 2ZR7A 2C8VA 3KTAB 5KDLA 2Q9AA 1IN6A 3VHXA 5BW8A 2ZUDA 1R0YA 4DB4A 1KK2A 5CDFE 4RY2A 2IYTA 4R7ZA 2I1VB 4Q48A 1KGDA 1AS2A 2BBWA 1H8EA 4BFSA 1J7KA 5FTKA 1QBKC 2WKRA 3C5CA 4R2HA 2AR7A 4Q9LA 1E9BA 4GZMA 4PHGA 4C0KA 4HLUC 4L9SA 4LPKA 3S1AA 4H1UA 3AF2A 4HZUA 5B64A 3M1IA 4C4PA 1OXXK 1E9EA 1ELOA 3OFNA 3QI2A 1GWNA 3L8YA 2FFAA 2H16A 5HE8A 5FOWA 4E09A 1U8YA 1ZC4A 1NBMA 1Y63A 2EFCB 1J70A 2YHSA 3LQQA 2EW1A 4Q1FA 1E2EA 2FJUA 2HT6A 2XJ9A 2YYZA 2WTUA 3K70B 1E3MA 5JJIA 2DBYA 3U7GA 4CEJA 4LV6A 3K09C 4DIDA 4YDHB 1JB1A 1XDBA 4RFVA 4MGZR 3UWKA 1G4AE 4MYHA 4G5RA 2JDID 4XSGA 4LBWA 1G6OA 2QI9C 3CB4A 2V8OA 1XEWX 2ZU6A 3AQ4A 4QHYA 1UBEA 1E2QA 3K0CC 2IW3A 3B13B 1UKZA 4BASA 1CU1A 2ZUCA 3IIMA 1Z83A 2BM1A 2CHQA 2ZRGA 1R0ZA 3K70C 2EYQA 4FCTA 4JLBA 4LUCA 4TQ9A 4LCBA 1Z3IX 3GLFB 3H4MA 4G5QA 1NVVQ 3ZS9A 4RSGA 1ZIPA 5KNBA 4P32A 2P6RA 2GCOA 2WSSA 1TEXA 1JQJC 1R5BA 5EP2A 5D3QA 3BGWA 4Q4AB 1G3UA 4IVRA 4GT1A 2XOKA 3WY9A 2QT0A 1G5PA 2ORWA 2WJJA 4S2EA 3GMTA 3T15A 5JBQA 3OFND 2QPTA 1E99A 1OSNA 4PPGA 2KBFA 1P2TA 4PPNA 4QGFA 5DN6D 3OIVA 3ZJYA 4BFTA 2BKEA 1FPMA 3GJ3A 2A5DA 3HU3A 1P60A 3TVTA 4QFMA 5FBRB 5KNDA 3AF4A 2G0NA 2Q6TA 3E1SA 1KI2A 2IYWA 5CJ2A 4AY2A 3TSOA 2CL7X 1OYYA 4ZDWA 4Z8XA 4LZZA 2ZYWX 1R8SA 2NPIA 1E4YA 2QSYA 1M7BA 1G8GA 4KV9A 2ZE5A 1ZVQA 2ZSFA 8OHMA 1L4YA 3RAPR 3H2YA 2QN6A 3KUCA 1Z6AA 4B35A 3TW8B 3KJIA 3KKQA 3KZ1E 1FP7A 2ZI5A 3ETLA 2B21A 1A1VA 4D4JA 2FZLA 5BYKA 4LY6A 1WXQA 1SXJC 2Q9CA 3KKOA 1SVOA 1D2MA 2IYSA 2Z4RA 4LK2A 3WMFA 1VG0B 1GFIA 3M6AA 1G291 2HV8A 3L82B 3U3JA 4ZKEA 4OL0A 5CM8B 1IJEA 4RFSA 1TU4A 3GLGE 1N6RA 4EFLA 4RD2A 1P7CA 5EE1A 3W5IA 4A4DA 2ORIA 3C16C 2ZSAA 2Q9BA 4BFVA 4GBMA 3Q8XB 4RD6A 3SFVA 1NL3A 4Q9HA 2HF9A 2AL7A 3ZQ6A 2V1XA 2YKGA 1YJ5A 2XJ4A 4AYXA 3QKRA 3TSZA 2HEIA 2FPMA 3I5YA 2SHKA 4JJZA 3TQCA 4W9MC 2J87A 2ZRJA 2RB4A 5TXGA 2EFEB 1DO0A 3K0AA 1QVRA 2CJWB 3CNNA 2RGAA 1XX6A 2AD1A 2EFDB 2PZFA 4AD8A 3T1VA 2YOHA 3AKDA 4TMTA 3IPXA 4PZYA 5ELXA 4P4TA 4C3ZA 3I32A 2NIPA 3HPQA 5HTKA 3CRMA 2I4IA 3P20A 2QRZA 2DCUA 2ZI4A 1E79D 4W5HA 2OCYC 5HKKD 1S3SA 2N1BA 3C8UA 3AH8A 2I1QA 1Z6XA 2WWGA 3R9XA 1KI8A 2IXEA 4CVNA 2AKAB 3ASZA 1E2NA 5HPYB 1RVDA 2JJ1D 1UKYA 1ZUIA 2HF8A 5FOTA 5IF9A 1JI0A 1E94E 5AUPB 5CIWA 2Z83A 5FL7A 1P75A 4O2RA 1DAGA 2OV2A 1XEFA 3DM5A 1TF2A 1GRNA 2W6ID 3FTQA 4HZUB 1G9XA 5L3SA 5DHAA 1FFHA 3THWB 1HUQA 2DPXA 1JBKA 1M6NA 3CZQA 4LPSA 4LV5B 2HJVA 2N42A 3SR0A 4B47A 1NN1A 2GKSA 1XXHE 3DVLA 1MOZA 1LW7A 3GLHA 3PUVA 4ZI2A 4HAXA 2QG6A 2ZRIA 2RGBA 1P3JA 2IF2A 2QTVB 1UADA 3C14C 2F1JA 3CBQA 1ZD9A 5AJYA 4URXR 5FUVA 4TYQA 3ADKA 1S4QA 3JVUA 5FPTA 4B48A 3MFYA 5J47A 2ZS9A 1JXOA 2MSDB 1JALA 5JWHA 2PL3A 5FUYA 5G3ZA 1Q1ZA 4X8MA 3R9IA 3U3RA 2C9OA 3OHMA 5KSPA 4O3MA 1TAGA 1RRFA 1TL7C 2EQBA 3IUYA 3ZLJA 3EIQA 4OI0A 3IHWA 3QPWA 4CGZA 3GCGA 2PT7A 1WF3A 3GD7A 2AFHE 4LJAA 4BRWA 3MRSA 2FF7A 2FE4A 4N1AA 4RZ2A 1MO3A 4PPQA 4A8JB 1JAHA 2BC9A 4Z8YA 4CDGA 5LB4A 3PEWA 4JLVA 3EPJA 1QHYA 1SULA 1Q22A 3BORA 3EA0A 1ESMA 1T91A 2GK7A 3HYTA 2MSEB 3FKSA 3K0CA 1XMSA 2A7QA 2VIIA 3VX4A 5TV2A 4DXAA 2ZUBA 5C4MA 3IKJA 3WP1B 1E0JA 1VHTA 5FBWB 1ZMXA 1GTVA 1G8PA 4G0NA 4JBWA 2WJGA 4U7DA 2NO9A 3B7GA 3SI7A 4BFXA 2BJVA 5TMPA 2L0XA 4B76A 1X6VA 2XX3A 5E95A 4C0AC 3QF4A 3A4NA 1ZINA 5EXPA 4PQRA 5CLLA 5KOYA 3VTKA 2IUUA 2XTMA 2Z43A 1QRAA 5C46F 1JNYA 3SU8A 1H8HD 1XD8A 1HQYE 5TDHA 1T4GA 3AVOA 5EZ6B 4KXFB 3LFUA 1XXHB 2QMHA 2IXGA 2ZTSA 3A36A 2XZOA 5F3WB 2GJKA 2QQEA 2XITA 4PAOA 4B33A 5FR2A 4KBFA 5EQTA 2GRJA 4A82A 1VECA 2OLJA 2OE2A 5FFMA 2HYIC 2NZJA 4GZLA 2V6JA
chains in the Genus database with same CATH superfamily
2JAUA 2MYNA 1XFAA 2O2CA 3FIJA 1MF7A 1Y5MA 3AF5A 1KJQA 2P4UA 3Q72A 4RMGA 2FNAA 4XKJA 5IARA 3E9CA 4F3TA 3ADPA 3N0VA 3UV3A 3FG9A 2OAQ1 3C6QA 3HE3A 4G4JA 3TH5A 3I23A 4I1RA 1M8GA 1QCYA 4U7FA 3W77A 1JAIA 3OPQA 3VKGA 3REOA 2J33A 1JDUA 1UANA 4QTUB 4W9RA 3KKZA 3UT5B 1M5RA 2EXXA 4HWTA 3KOYA 2NU9A 4EJ2A 4S1WA 3VYUB 1VPTA 3PQ3A 3FKSD 4Y67A 4POAA 3O21A 1YVEI 5I9MA 1ZAYA 3HVJA 1G5TA 1X7HA 3U3MA 1WD5A 4IZHA 4RNDB 8MHTA 4MIEA 4ZO7A 4Z1MA 2ZWIA 1UBCA 4LHVA 4UNPA 3PDJA 3EDOA 5TGDA 1I6KA 2HK8A 4LY0A 4R69A 2PS3A 1G8MA 1CUCA 1N8NA 4OB7A 2ODPA 4R40A 3IC5A 4EI7A 5LUAA 4OHYA 1YZNA 5H3CA 4C01A 4DRZA 4JIGA 3GJXC 3SFZA 4YJ2A 5IK2A 5DHPA 2XGGA 3IDZA 4LWOA 3ZLTA 5JNLA 1MKYA 3M9WA 2O8CA 3W7VA 2JLBA 2EBHX 2CDCA 3RREA 3ZWWA 1X9HA 1WDKA 2WDZA 3C6MA 1XLWA 3D4PA 3WDKA 5I7EA 1CF4A 3QIVA 1X87A 3W78A 1H8HA 5KPJA 1DDGA 4RGBA 1R12A 2A86A 4K9PA 2BH9A 2PSDA 4GOOD 4PFJA 2XR1A 4DLRA 1QU3A 2WV7A 3D0QA 3AUKA 3O38A 4ND1A 2BJWA 1XJQA 3L41A 1WMDA 4I14A 4YECA 1EUQA 3STHA 2AFIE 2G5TA 2JLRA 3H9JA 2QQ0A 3R6TA 1MOPA 3PHGA 3AESA 3VPDA 1A71A 1TVKA 2OWEA 2A58A 5EPOA 2H4JA 1R5JA 1SCDA 3DLCA 2J0VA 4B79A 2JFFA 4HNGA 2H17A 1F06A 4B87A 3DV0A 1LFDB 4HATA 1K6IA 1UBGA 2BONA 3CVVA 1SXJD 4UU0A 2JLSA 4A5SA 3CUKA 5BW6B 4A03A 3TUJC 1PWXA 1G17A 2AH5A 3UKOA 4DJ5X 3I6IA 3VC2A 4QGSA 2JLUA 5HWSA 5CH8A 4BGIA 1G5RA 4XTRA 4EPXA 5DHQA 3Q3CA 1VG1A 1Z56C 3LXXA 3HCWA 3OIUA 5CK4A 3RF7A 2H4FA 2VK4A 3LUHA 3RBVA 3X1KA 3LLSA 2C5AA 4ZHSA 2NU8A 4BNWA 5JASA 1BMDA 4EZEA 2A0KA 2V6BA 4MYSA 3L18A 3C4VA 2YJTD 1ISPA 1T0IA 2HMVA 2HI0A 1D4AA 3KQQA 4M54A 3DMTC 1N0IA 3BAFA 4FZ5A 5L3ZA 3GQBB 1P2SA 3JQ8B 1M2KA 3O8BA 3S2EA 5LSAA 2CVQA 3NS7A 4LVCA 5IJ0B 1VI5A 4BX2A 3DWIA 2DHDA 3DF7A 3TEJA 4PSKA 5AW2A 1JP7A 3H0CA 2BTEA 4FIZA 3MWYW 3EMDA 1XEXB 4TMWA 2XHEA 4AK9A 1XLVA 2QRUA 4QASA 1SU7A 1USUA 1OLOA 2GASA 2J3HA 4WLUA 1EB8A 1SAYA 4R68A 3ZWDA 1ZDMA 1Z62A 1IHDA 1P44A 1JAYA 3CE9A 2FR8C 4MEJA 4RAQA 4CMCA 4ZYXA 4JDPA 4LK3A 1EG7A 1KO8A 2JD0A 1BJKA 5K8IA 4DSUA 3UAZA 1DPGA 1WBBA 3B6EA 3GT3A 4O2BB 3SEZA 1HDOA 3MUFA 4URVR 5EE5B 3H2HA 3HKEA 4MI6A 5AICA 4TTVA 2QMZA 1PU2A 1L9XA 4GYJA 4PYKA 5IEJA 1T6XA 3KPWA 2OBBA 1XDWA 1YONA 3FDFA 2CF6A 3GH3A 4CHTA 1NIJA 4KWEA 3GLFE 1Z18A 2GN6A 1P4SA 1Q3KA 2CL0X 3I8XA 3QVVA 1EDOA 3UA3A 4V02A 4R7TA 1QTIA 4AZ0A 4LHZA 2GZRA 3WIBA 4D8YA 4I0WB 1R37A 3IAHA 3AFHA 1RBMA 4MEAA 1YQDA 2LXNA 4TSFA 4AUKA 1TAUA 1DDIA 4I4CA 4BZZA 2ODBA 5DHTA 3IB6A 1N2CE 3DLAA 4B40A 3GPBA 5KX5B 1CB0A 4Z2AA 3R9WA 3GYGA 2OCGA 2OZKA 3CKLA 4QDKA 1T9KA 4IS3A 5CNJA 2OENG 2O0KA 3SVZA 3KDSE 2R96A 1E1YA 4I81A 2VF4X 1IDOA 1TMOA 2PXAA 3UUFA 1N1DA 1U4NA 3IEMA 2B4QA 5J9FA 2EATA 2BI4A 4GR4A 1M5UA 3UJ6A 2QDKA 5ILQA 1O8BA 3UGJA 4KOAA 2X8JB 1SCUA 2DQKA 3DAYA 2Q5LA 3IT0A 4J7XA 2FEOA 3C24A 2GPYA 3M5CA 4EM6A 2X6TA 2EX1A 3P4XA 5MGNA 1P6QA 2IYXA 3NYIA 5BNFA 1ZD3A 4O4LF 4C9BA 2RK6A 4CI0B 1CF9A 4ON9A 4LFBB 4O5OA 2DSNA 1VHDA 3R5XA 4JMPA 4WJLA 2O5EA 4G5OA 1A98A 1YGPA 2XGOA 2D2XA 4N0PA 1T5OA 2HBYA 4D56A 3AEXA 3H65A 4XQEA 4BATA 5KVQA 3KWFA 4HAIA 3ONFA 2VYQA 3IP7A 4WA7A 4UTRA 5DLYA 1OZGA 5JSFA 1YFLA 2HQBA 5KSZA 4DS3A 1G8SA 4BMPB 1V11B 1DTWA 4PO1A 5HBRA 1YS2X 1PTKA 4QUGA 4YJ3F 1X86B 2A3NA 1DG1G 1RXSA 1GZSA 4EYSA 1DZIA 3KUUA 3N70A 3OBBA 2LCFA 1YS9A 1BYUA 4ARVA 3UMCA 4E07A 4EPWA 3K6JA 5BORA 2IPNA 3NDJA 4BEBA 1MAUA 2QRKA 1WB6A 2RDMA 4I9NA 2DT5A 1G20A 4S12A 5E0OA 5DI3B 4E6PA 1X1QA 1KDPA 4DQVA 3JZDA 4HXGA 2VZLA 3OIGA 3VHLB 4J43A 1U80A 1EM6A 1XA3A 4HT3B 5L6MB 1T1IA 2ZIZA 5B58T 5TGZA 1EI9A 4JROA 421PA 3DDHA 1M72A 1EGAA 1O8CA 3JQBA 1E2JA 3ND8A 1ZD2P 1J8MF 2HNKA 4DWOA 3UFXA 1NXVA 5ALKA 1OY1A 1B1CA 4NV3A 1PLKA 1JG4A 5TF4A 2CVOA 2XWPA 1ZY2A 5FBVB 4K0KB 1COWD 1NAHA 2QT1A 3FDJA 4DLKA 1XZHA 5B4UA 4R8MA 3A9SA 1QYRA 2XB6A 2Z2JA 1Y6QA 4Q82A 4BGVA 2NU6A 2J9FB 1PYOA 3BWMA 1K68A 4OUDB 4Z4FA 2RCNA 2CXUA 1QF7A 2WICA 2ZSIA 2WKSA 1PYGA 1Q0QA 3L46A 1CP2A 3RASA 4JI3B 5AM2A 1NASA 3MK31 1JTVA 3C7TA 5C8ZA 1NUSA 4MW1A 1ZBDA 3RCBA 2IYAA 3BHIA 5EWJB 2EW2A 3NCHA 3U4QB 1U2GA 3SY8A 121PA 2QHXA 3RFTA 1NI5A 1NBME 2BHRA 2VT7A 4KMOA 4ZVQA 3ZU4A 3RTDA 4ECEA 2NMVA 4EUFA 1CEEA 3UHFA 5AI6A 4XIJA 4EJSB 3S1AB 3PYMA 2O19A 1KMHB 2K7ZA 2XAUA 4IUBS 4B09A 3G9UA 4RMHA 5TB5A 1FYWA 4KVZA 3ROMA 5C5EA 1LNZA 3AHDA 3I58A 4LRXA 4KI7A 5BSUA 2JHGA 2ZWVA 4EGCB 2PL1A 3HUFA 1UJMA 3SMVA 1OREA 3B60A 4H2DA 3DE0X 2R7KA 5KTRA 5KIAA 3W7AA 3TRKA 2WYOA 1KAHA 3AILA 3SYLA 4AT1A 1MX3A 2OQRA 4TL6A 5LQDA 2PRZA 4V0KA 1Y1PA 3EPPA 3L7AA 2IUYA 3V7YA 2WFLA 1UP6A 4D74A 4ZDKA 2PUWA 1MQAA 3TGPA 1AY0A 3NI2A 2V7UA 1SB9A 1UCFA 3PVZA 4PC6A 3L0ZA 5EUMA 3PQEA 1RACA 4KX3A 3WKBA 4OGLA 3K0EA 4R3WA 5C4GB 2W58A 2O8NA 4GL4A 1UOOA 4E5KA 1G2PA 1GP2A 3LQ1A 4PNZA 5CPBA 2NW6A 4ZTZB 1JHUA 1JMYA 3MIZA 1NFFA 1Q0ZA 2WVAA 5FWDA 4P86A 3OESA 1BXRB 1COWA 1VE3A 5AKIA 1YU6A 2Y76A 5ICCA 1ZRSA 2GJ9A 3S2IA 1JWAB 4NCAA 4KO3S 1Y8AA 2XQJA 3EIXA 1Z0KA 1E5VA 3UHAA 4C3UA 4OKSA 4GLOA 1CQPA 2QP9X 1D8TA 1TPZA 3O75A 1CUWA 3OQ6A 5F1OA 1VG9B 1Y4DE 5B55A 2E18A 2X5XA 2P5TB 1GU0A 3RLFA 1RHKA 3UGKA 3BICA 3RNOA 1TZKA 2O8VA 4FSDA 4CE6A 2ZSEA 4H31A 2IX3A 3WWDA 1MOSA 2PX6A 4JLJA 4CKEB 2VO1A 5GTDA 4XUCA 2FDCA 2WF6A 1CPYA 4JI4B 2Z6UA 4HP8A 5ETJA 2UZ0A 2VSOA 3TQSA 2WYWA 3BWDD 5EZYB 3QU9A 1F8UA 4TZKA 4BRZA 2D3TA 4GPZA 3TMYA 1I1HA 3THSA 5F2OA 4BOYA 1RRCA 2A9RA 1WTCA 4E22A 3KU4A 3KQLA 5HRCA 5ER6A 1KFJB 1CJSA 2I0FA 2XDYA 3NAQA 4G01B 5KREA 2XKBA 2O1EA 4BO5A 4A92A 5F5LA 2NTVA 4G3XA 2O8EB 1ECGA 2KM1A 3MUEA 4KQIA 2O8BB 3TFWA 1LKZA 3GGDA 2ALJA 3R6WA 2FHPA 4YJHB 3ZE8A 4GI3A 4M1ZA 4DMFA 1FA9A 2QAGB 1Y0BA 3ZGVA 4NE2A 1FYXA 1EUYA 4HAOA 2YJ6A 1SQGA 3TOXA 2FVXA 3AUJB 1XZEA 3A6FA 5JHGB 4RAOA 3G8CA 3U4IA 4NJEA 4YCJA 4XIGS 4EI9A 3Q7QA 1PX0A 1V39A 4BQNA 1JHDA 3V4PB 3KTDA 4REQB 2WOJA 3W5UA 3W0LB 3FWPA 4PNHA 3U1BA 2NUPB 3EWSA 4HWSA 2AC4A 1HLFA 1R4MA 3OE7A 3FROA 2FPPB 4M0LA 4S1TA 1HTBA 1GXSB 1SNYA 1CR0A 1T3SA 1E0AA 2H4WA 2HL6A 4GVPA 5CDTA 1IB6A 3RYIA 1B74A 3BXZA 2XD9A 3VC3A 2NV6A 3ZWNA 1NG1A 1GPJA 4KRXA 2CBGA 3T9DA 2OZEA 2W8BA 2P67A 1BA2A 3GUUA 3N8GA 4K9KA 1SCBA 5DGXA 3VMFA 3K7EA 1WXWA 3DMRA 4BMYA 5E6UB 5AXDA 3EHDA 2V9CA 3DW1X 4IDFA 1JFTA 2WPDD 3PGVA 1V16A 1NVMB 1WXFA 4IJWA 5DM4A 1V8DA 1C1YA 1YBVA 3ZU3A 4Q93A 2GT1A 3TD6A 4A6EA 2ORYA 2XKKA 1XRNA 3DEFA 4QYTA 3SFTA 4YAUA 2GPAA 4MHOA 1NXQA 2II6A 4P54A 2BHLA 3S2GA 2HR1A 1MT0A 1HT3A 2VQDA 5TIIA 2ZJ4A 2EF1A 2XKAA 4FFLA 4ZQIA 3QKSA 4N5MA 4UTPA 4S3MA 2D1YA 2QL6A 4Q18A 4G9EA 3LX6A 2FTKE 3R1IA 2ZIWB 4CXMA 1Y9EA 3IAXA 4JXXA 1MOQA 1ZJWA 3DZCA 4KUEA 2W6QA 5JQGF 3TL2A 3NIBA 3KVYA 3WK5A 1EFHA 2UYCA 2IUFA 2C83A 4UE3S 2GAAA 1TM3E 4L78A 3HJCA 5J2TA 2ZYTX 1RJFA 2BMJA 1OYWA 1EUCB 4DLVA 1OMOA 1YJQA 621PA 5IAGA 4NXMB 1J9ZA 1K6XA 1X0XA 5ABPA 3ISTA 2PXCA 3DDCA 1I7DA 4HYTA 3ZZNA 4NYIQ 2F1RA 1V7ZA 4KR0A 4MW5A 1GNPA 1G16A 1GYQA 2AJTA 2J31A 2Q0SA 2HU5A 3M4YA 3OZVA 1CJVC 1SUFA 3CW8X 3KO8A 1N2GA 2V7XA 1RM3A 3MEQA 1LH0A 3FOZA 2FFRA 3ZJTA 5JWRA 4L5IA 3O3OB 4PTZA 2C9YA 1REQB 1ZU5A 2V4UA 1DKPA 3TKLA 1PJ8A 3ZI0A 1WVGA 1E5XA 3E9NA 1YJAA 3EBPA 3PUWA 3D7MA 4IUDS 4Q16A 2A8YA 2I2WA 4HQNA 1P31A 3T7DA 1JFFB 2R6DA 3R4VA 4ITRC 3DE6X 1IC6A 1R4AA 4WCFC 3U9LA 2I3BA 4R01A 1JHMA 4L4XA 1Q7GA 5BYAA 4MO2A 2R5WA 3GWGA 4U2BA 3N3BC 1ZNYA 2FN9A 2GERA 3A1UA 3MJDA 3SHWA 4Q37A 3IDFA 4A2PA 1DWPA 2MT9A 5EIEA 4OX9Y 3CRRA 4W1PA 4O4IB 3QYJA 1QHHA 4MQEB 3WKDA 4EKIA 1MZVA 4G37A 3F3MA 4IF6A 1P5JA 5FPPA 3H2SA 3QKUA 3S44A 2Q6IA 2NU7A 4IDOA 5AI5A 2AZMA 3ZI7A 2ZIEA 5IUNC 5KU7A 4G0UA 3SXUB 4MQFB 3O0DA 2WB4A 1TJYA 2ZRMA 3FY4A 3QMMA 3V4SA 4IS2A 4ARZB 1E6MA 3T3OA 4GKJB 3BMQA 4M9XA 3C3KA 3HJFA 3WNVA 2EHDA 1DC8A 1UXJA 1MG0A 1S7GA 5DLQC 4UBOA 4NYJQ 3PUHA 1Q1NA 2B61A 1HE1C 2OHOA 3PFGA 3OPMA 4LWZA 2IJGX 3P9CA 1KDOA 4F4FA 3FLAA 2J1LA 4BVHA 5L9AA 3NHAA 1TD1A 2H8KA 5CCEA 3MUNA 1X7GA 4IH4A 4Z49A 3E6AA 4XD7A 4PR3A 5I4CA 4LWPA 5IU6A 2JCSA 3L77A 2VG8A 5DLPA 2AHOA 2R6ZA 3ZYZA 4B7ZA 3HWRA 1IOZA 1G9TA 1VE9A 3NHPA 3GXBA 5B57C 3UCXA 3ZHCA 4DFDA 2F55A 4UBMA 2BDTA 3OX1A 1OV4A 1QGED 2F48A 4EHJA 1Y1TA 3GJTA 3QKTA 4M7OA 4Q5IA 4L51A 1X38A 5BQ5A 2F3SA 1NVGA 5LBUA 3WKAA 4IZOA 3VZBA 4OI4A 4I8DA 1W36B 3SD7A 1EJ2A 1PGOA 2CUNA 2IYOA 1NBOA 4MTCA 1OX6A 4QU5A 3OUTA 3M6FA 3HBNA 2C78A 1V35A 2NO1A 1XTBA 1AM4D 2WHXA 1B6GA 1HE8B 4ZEXA 1PD0A 1ZISA 3D54D 2GFQA 2NNLD 3IDQA 3KFLA 4JWTA 1JA1A 2PG3A 4FZ3A 4URYR 3X1WA 1IMOA 1QVZA 1Y5IA 4ZCTA 2LKCA 4JYPA 3LBHA 5I4KA 3TGLA 2D3WA 1X2EA 3VYSB 1E5DA 3TIXB 2RH4A 3V1KA 4NC9A 4CEIA 4F4HA 3F96A 1YTUA 1RADA 3NM4A 1I7SB 1MAAA 3CA8A 1H0KA 3CZAA 3R24A 1XP5A 2GA9A 3QNUA 4I8XA 4DNQA 1OBOA 3J81A 4YY3B 1GAJA 1O0BA 1CSEE 1JDBC 3DBHA 2WUFA 3G7SA 5HKAA 1P62B 1SXJB 1C8LA 5DM60 4ERNA 4JX9A 1GZ7A 2CLDX 2ECKA 2BEWA 3I9FA 3HHPA 3C3EA 4LJ6A 3B20A 1XT6A 1VYTA 4XYEA 4KR3A 1IG3A 3PYXA 2AD5A 4FT2A 5G4LA 2BHNA 1SBHA 1Z2CA 4FMDB 4M1YA 1E1NA 1FXWF 2UVPA 2ZCVA 3VH4A 4ZWNA 3ZVNA 2QF7A 2XRFA 2XVMA 3ZOKA 1DQRA 2GPTA 4IHJA 2ATEA 1I6WA 2W2PA 3QE0A 4U8HA 3NHSA 2K6GA 5L4LA 3K0FA 1I4TD 2J3LA 2GS9A 4NAHA 2H8GA 4AL4A 1JDSA 4GF5A 3AMVA 5T3UA 1LK0A 3ZTTA 5KTYA 3SVTA 3DCJA 4TTSA 2ORED 4U00A 3GJ4A 1AZWA 4ZZ1A 2ZPAA 4DGQA 4MR8B 3OLVA 4L1KA 4FOTA 4LC0A 3LUCA 4LZJA 1EWTA 5K3OA 4AJJA 4CF5A 1KRWA 2CFTA 1Z28A 3GLIE 1QAOA 2Q3MA 1OFIA 2W22A 2P91A 1KDZA 4TUYF 1TE2A 3U39A 3ZZMA 4DG8A 4UVDA 3OA2A 1QV7A 2IDKA 3GARA 1BN7A 1T4CB 1A76A 4B6PA 2RI6A 4CQMB 1DXYA 2VSXA 1WIWA 1VL0A 2IVFA 2R6R1 3B48A 4ASUD 1P1HA 3JAWB 1GRQA 1T1SA 2ZDGA 4I4IA 3FLBA 4N82A 2VS1A 2OXRA 1PEYA 3SM3A 2J32A 4RXUA 3ODGA 3AJ8A 1GQRA 2GJSA 3RT9A 2OHJA 1DQZA 1QWSA 1IRXA 1G64A 4A0QA 2Y93A 3V2GA 4DCSA 1T8YA 3BK2A 4L9AA 1VIMA 1GRCA 3SS7X 4PFQA 3UF0A 4TT3D 1E9FA 2NV0A 2IYVA 4LYFA 4L72A 2KBEA 4ZO8A 3UQYS 2W2LA 1CJKC 5FJJA 5LYYA 2YV4A 2BGKA 3AHJA 1YR3A 1ZOIA 3WLFA 1OT3A 1F2UB 4J2TA 2Q4OA 3C6ZA 3EW7A 3JPWA 5NLLA 1KI4A 2QB5A 1Q19A 1VZ2A 2P1RA 3HO6A 4C43A 4A8PA 4OHCA 3QEBZ 4YAEA 4US0R 1UFKA 1YR8A 3CEHA 3ORSA 4DBLE 4C30A 3HRKA 3TD9A 3VJMA 5ALVA 2QWXA 3H3JA 4KV7A 5JZMA 1XVUA 1BFDA 4MIOA 1DUSA 4Z3DA 5BR7A 3GVHA 1DC3A 4KIUA 4NY1A 4ZZIA 2DUJA 2XQFA 1DBVO 4BP1A 2H5JA 1CJBA 2BCEA 1E5LA 1KPGA 1RWMA 1ZJ5A 2H07A 1AUVA 2O3TA 4JXKA 3T35A 3ZXXA 1LWNA 4XE5A 4FFPA 5DWVA 1S01A 5BYJA 1EM8B 3T94A 4GQIA 2O50A 3UXMA 1L4FA 4MVJM 1RWOA 1YZGA 2WM9B 3B5EA 2ARKA 2GX6A 3GFOA 3ILVA 2WBLC 4LYHA 4M83A 4PM4A 1XVLA 1P8JA 1Q0RA 4RHEA 3JR3A 1B16A 2B83A 4OUDA 3KSUA 3P0RA 4UHKA 1US8A 9GPBA 1JSRA 1I3OA 3LDUA 1BX0A 3ZV7A 4H9GA 1RPTA 1G8HA 2JB9A 2O7NA 1T3LA 1OGJA 2RGYA 4XCVA 3WGUA 2FMHA 4OHFA 1YZKA 3DM9B 1W87A 5AM1A 5JS7A 5ECGC 1C1DA 1V26A 4KXUA 1IBRA 3I6ZA 3SSNA 1L4KA 2MINB 3NP7A 4QT0A 1N2ZA 4YR9A 5KUTA 4TZ0A 4M38A 1FMFA 4OXIA 4FBMA 3TQIA 1LBTA 4OXXA 3UK6A 3UT5A 3W2FA 4FYJA 1YDWA 5DTIA 3AX6A 4TTRA 3OLWA 4HEJA 1IHUA 2VPZA 3RC1A 4BNUA 5H81A 2O5CA 1ID8A 3GFBA 2I62A 4W7HA 3AWDA 3H9BA 2HX1A 1EEHA 4WK6A 1J2EA 3K05A 4QG3A 4IWXA 4DKJA 1QG2A 1AJEA 4CT0A 2W0MA 5FBKA 1OGYA 5JBNA 5CK5A 3UN1A 4A0FA 5IBRA 3HN7A 2H4ZA 3DAPA 1FDUA 1ORDA 1XKLA 2VBGA 5AVQA 2E3JA 2FXIA 2XDQB 1QRSA 5FNVF 1YR6A 3LCUA 5E4JA 5I9BA 2JLVA 1T25A 1ENYA 2VDKB 4EARA 3C3CA 3CEJA 4DLAA 1UOPA 1Y4AE 3QU7A 5KWIA 2B37A 3NEYA 2FZEA 4MW2A 1NRJB 1T9ZA 1V1MA 3GEGA 5I5GA 5T67A 3TQFA 4DSOA 4N01A 1K88A 2F3TA 2GDJA 3NDRA 1QZXA 5C1IA 4NBRA 3HTXA 4CKZA 2G5CA 1PKXA 1Z5PA 3O8NA 3KT6A 2FX2A 1MJFA 3DEHA 4RTRA 4W8OA 2NPOA 5LQKA 1U7TA 4EL5A 1EFLA 2XBUA 1CJMA 4OQZA 3AR2A 3O3CA 4LJSA 4MEBA 3LPLA 4F4JA 4A73A 1RVV1 3ZJVA 1I2DA 3V9AA 2Y6VA 1Z75A 4I5IA 2ID8A 2W93A 3HBJA 3R8CA 2K2QB 4BCBA 4L7QA 1ODFA 2FQXA 3K9HA 4LBZA 1HRKA 5D2CA 2GNAA 3LXUX 5GINE 5H02A 3V1UA 1OWLA 4HJXA 1Z7GA 3WBBA 4RVSA 1VPVA 2D1RA 3BMOB 4UCQA 1MORA 4N3AA 5I9IA 4LF5B 3FWYA 5BR1A 3Q2KA 2UZ4A 1T24A 1JLKA 1Y3DE 3K8ZA 3U7IA 3PFIA 4GQAA 1DQNA 1G7CA 4Q02A 2QE7D 3UKJA 3KQHA 3E9QA 3KPUA 2MR5A 2EL9A 1RM0A 2OV1A 2IYQA 2PR7A 4P8RA 3HU2A 2JCBA 3D3NA 1HWYA 2WHQA 5JE8A 2CGEA 4GKKB 3FX2A 5JJKA 1TZCA 3B1JA 4KXXA 5EIAA 1RPZA 3R44A 4CMIB 4DREA 1K7EB 3OZWA 1SEPA 4L4YA 4JR0A 4DJTA 3SNKA 2EP7A 4DLLA 3FTPA 2VP0A 3HR8A 4PXAA 3SS9X 5JSHA 1CQZA 3BWYA 1Y89A 3A3KA 3FMOB 2YH2A 3COVA 1MV8A 4G0XA 5I5EA 5E1DA 1Y7PA 2GAIA 2Q4EA 2WAMA 5D7BA 2ZRNA 2LIVA 1PZGA 4M1QA 4D4IA 3CCBA 4QUAA 2OVFA 5FTJA 3PRKE 4QUIA 1KJZA 3Q12A 1J90A 3RI3A 1PJ4A 1X7WA 5DGCA 1IN5A 4DR4B 4Q1DA 1D2AA 2FEKA 1QK3A 1NF3A 2JASA 3HYLA 1WZ2A 5BR4A 1SHLA 1BWSA 1NYLA 3TSWA 4ZYTA 3THWA 3GU3A 3KOMA 2AFVA 4M0KA 2YV5A 1JFVA 1Q1QA 3OQBA 2YYSA 1T2UA 2R86A 4GBED 2P40A 1T5LA 2YZGA 1ZD1A 4TTQA 1M6WA 4E13A 4KWTA 4Q3NA 1Z15A 2G8NA 3BH0A 5JG7A 4I4LA 1UKEA 3USCS 2WJ6A 1Y5LA 2OWDA 3IUEA 3K73O 1W6RA 3MRTA 4MV1A 4KAAA 1U9ZA 3SCZA 3GBSA 3SQWA 2VWGA 4C2TA 4AYTA 2G6BA 2Q49A 2QPAA 1JECA 2DFNA 3CZPA 3HNRA 5EKUA 5EINA 4OGFA 2BRUA 5K9ZA 3QWBA 4UARA 4WADA 3U4CA 3VX3A 4L7VA 1KI7A 3T7CA 4AJIA 1MGPA 1Z4JA 2JGAA 1R0CA 5BN4A 1L0BA 4KW7A 1AA9A 4A16A 4QNRA 4TKLA 5LDHA 1EK1A 3HXOA 1UPTA 1PSDA 2YR0A 1KEEB 4X93A 3OCJA 3BRQA 3RV4A 2VI5A 1LPNA 4YYEA 4X1YB 1KY5A 3MTGA 1GLVA 3DTTA 3HCDA 2YWCA 2IOFA 2V0GA 3T5MA 1SC4A 3EZ6A 3L02A 4XX0B 1RABA 1YKGA 2PKYX 2PRJA 1VLQA 3MT8A 4KAFA 2EJUA 4OQQA 4PZAA 3VUEA 5IG2A 3A6DA 3PQ2A 4HXYA 1DTWB 4L5BA 3WGMA 1E4OA 3EZXA 3QVGA 1BDIA 2OP1A 4FYXA 5E9AA 1A5AB 4RPCA 4M53A 1IXKA 3VMMA 1IN7A 2CHFA 3VR4A 3WQRA 3ZEIA 1ZL2A 5TVGA 4J16C 3KJHA 2WT9A 3ANYB 1NY5A 2HMAA 4R1SA 1KSGA 4DMCA 5BSWA 4YPFA 1NUPA 4YMHA 1GQYA 2QL5A 2LD4A 1NY6A 1PJAA 1XRSB 3CPJB 4O4HF 2MYUA 4OXNA 5AOAA 5B1EA 5EEHA 4K03A 3P2OA 4L16A 2ATIA 4RVDA 5B30A 4EB6A 3UK1A 1WDWB 3N3AC 2E37A 2HRCA 5F7XA 5GVSA 2WSLA 3G0OA 3A1VA 3EVCA 2EKPA 2IEYA 1I7PA 1K6EA 3PPWA 4FINA 4H6WA 4WXHA 1WMSA 2DP4E 3QBDA 2LRHA 5EQFA 3RTBA 3SBDA 3U9SA 5JISA 4BVLA 1G18A 2VAVA 4KUHA 1WV1A 2B34A 3PENA 5E9JA 1S02A 4M1TA 3PR1A 4V0MA 4E70A 3KYBA 2P3OA 3GF4A 4GI5A 4RQTA 4ISCA 3VPBA 2ANCA 4F2GA 2NYAA 5LVAA 2FR0A 3QFHA 3E70C 3QHAA 1QNLA 1JBQA 4RZHA 3ER8A 3P9IA 1AS3A 4PZPA 1NBHA 3PSAA 4B0PA 1XTQA 4TWAA 3S3TA 2LW7A 5MN4A 1OTXA 3SQOA 3ZDXB 4B80A 1L9KA 1IZ0A 3H9CA 3V8RA 1HY3A 1XYGA 4DC1A 2Z5LA 2F3QA 4DPLA 3I1YA 4UM9B 1RRVA 1TYDE 4LSZA 2BN4A 2FE1A 3DE3X 4MMXB 3RRZA 5HFNA 4CNBA 2P7IA 1GTJ1 3KD3A 4UAUA 1JX6A 4Z9BA 3FPLA 3KZOA 1ESEA 4X1KA 1JDZA 2G0TA 2P8JA 2WIDA 5CLHA 3TR0A 3L8EA 4EUNA 1E2IA 5JPDA 2XT0A 3KXLA 2FQWA 2XVYA 3C3PA 3IFSA 3NKFA 1XC7A 2Q9UA 2HXSA 4GP6A 1KYXA 3DS8A 3IUJA 4MJLA 1BOFA 1E5QA 4AZTA 1CV2A 5FBHA 2J48A 1JG2A 4JLDA 1QRTA 5LUBA 3EAFA 1P5ZB 1AMUA 4C4XA 3U7QA 2ROQA 4M36A 3V4ZA 1A5BB 1DKNA 4U3JA 1YS4A 3E4CA 4M89A 1YCFA 3L49A 3WGZA 2FW7A 2VNSA 1BGWA 3JD4A 4N0EA 4ZOBA 4YMSA 3CEMA 2G1JA 4M87A 1ST3A 4RMJA 2ISCA 2YMQA 1PFVA 3DFFA 4ZXFA 3CJTA 4C5AA 1WAMA 1JKIA 2XUDA 3BREA 3PPYA 2ACVA 3FUXA 3KSZO 4TTPA 2VP3A 1DAPA 3PFHA 1T9AA 1KQOA 3EDQA 3T61A 1NONA 2AIRA 2ABWA 2BV3A 1FTSA 1KP3A 2ZATA 1SD2A 4FEAA 4PO8A 2J3EA 3ZD9A 4C0QC 1W25A 5AVYA 5HXAA 1DS6A 1Y8RB 4AULA 1DAHA 3NFRA 4RLHA 5BSKA 1UBMS 4M8KA 3OZRA 4X41A 1DHRA 4NAUA 4PLWA 1UJ6A 3ESXA 2MIIA 3CO5A 3DE7X 4B81A 1G0NA 1Z22A 1I3LA 1QOZA 4H08A 1AGYA 4R2XA 4Y18A 3F8TA 1DQSA 1DKLA 2QEQA 1PJ3A 2DQSA 2QW0X 2HIGA 1M2OB 3E22B 3CMCO 3NHBA 1DX6A 3EXIB 4IIJA 3IOBA 3JTMA 3JVIA 5H9WA 1TYBE 2O1XA 1XSEA 4OQEA 4QX6A 1II0A 2DQZA 2FLWA 4PX9A 1TLTA 2QPOA 1LPPA 3D4BA 5JECA 1C7EA 3KTOA 2PAAA 1KAQA 3VI4B 1HRDA 5LZ7A 2H18A 1TQDA 3B5IA 1O6FA 3LBYA 5HSGA 2C61A 3H5TA 2HADA 1JLSA 3H84A 4E88A 1Z16A 3FCUB 2EGGA 2XB4A 4RF2A 3O8RA 3HYSA 3QVWA 1VL5A 2IXBA 2XQIA 4E5YA 1UWVA 3VRHA 4DWWA 4J4HA 2Y3IA 4COKA 1J1IA 3QEJA 4X84A 3EA5A 3X1DA 3W9BA 2W2TA 1A4XA 5T6BA 3C3YA 2C3PA 1YE8A 2IXFA 1UDAA 1H1LB 3PIIA 2YMMA 3RV3A 1E7WA 4HDOB 5ES3A 5EZYA 2WINI 3I6QA 3FPSA 5JCOC 3KR2A 1RC8A 3EGWA 2BGJA 2EV9A 4LOJA 3DL4A 2Q99A 4KLZA 3FA2A 3WWOA 1MV5A 2HSWA 2IP1A 1WTAA 5LMZA 4MZDA 3SSOA 3QTTA 1EVEA 4PYRA 1FE8A 4YPVA 5IS2A 1U8AA 4ZCIA 4GPEA 2P30A 1M66A 3L7BA 4BVAA 5MDHA 1OH6A 3AJ9A 1FNSA 3OJWA 4WOJA 2O8EA 1YB5A 5G53C 1Y42X 1B8PA 1EFRA 1DBRA 2VUTA 4JOCA 4UCWA 4H6XA 1MR3F 4H4DA 4B4KA 3GFRA 4FR2A 1HF3A 5LA6A 3ZXUB 2DBZA 5M2QA 4JR1A 2VNIA 3IQIX 3SK0A 3VGPA 1P2DA 2I7DA 1N34B 2RBKA 3SHFA 1KF0A 1PL0A 1CUYA 1GGHA 1HM5A 4NHOA 2PXXA 1B8VA 4H59A 4OFBA 3VTFA 3EMBA 4JQSA 5BVGB 1BX1A 4G4SO 1TK9A 2P4QA 1QQAA 4OUKX 2QY6A 2JJ8A 2BHSA 2W8ZA 2ZVQX 2AMFA 4YAKA 4PCAA 5P8WA 1SM4A 1WDMA 4X8LA 3G82C 1HMYA 1X7YA 1ZUNB 1OBVA 2PX5A 4RHUA 2FPPA 4LBVA 3PDIB 3C6BA 2H06A 2PVSA 1QR6A 1EMDA 2AEMA 3WGOA 3SHTA 5LP6C 3OEWA 1XGKA 2IK8A 2IV7A 4B85A 4ZPXA 5HOEA 4TMVA 4QE3A 5REQB 2PUHA 4YMUA 2XNDD 2Q4DA 4Q21A 3B85A 5EMJA 1SPXA 1F2TA 2W8BB 4OQPA 3ICQB 1V5GA 1GR0A 5E6SB 1E3QA 4M6WA 3RDPA 1L7EA 1VKRA 5E6UA 2QMQA 2W2OA 4Y6LA 5FTMA 4DT1A 4F4IA 1KK1A 1GQQA 3O7MA 1K5DA 3IP6A 4MUJA 1I5RA 1XTVA 1GPYA 4I36A 1C3LA 4FFMA 4BAGA 2YHUA 4CCAA 3M2PA 1U7HA 3EFHA 1IY0A 4TL7A 4ZD6A 4P34A 5I9NA 2BFCA 2WIAA 1FS6A 2JGRA 2P27A 4OMDA 3NJ8A 1O5TA 2RGDA 4Y2UA 4ND2A 1NPYA 3ROEA 4GDFA 3QKSB 13PKA 3SE0A 4D3ZA 3C7DB 4A36A 2CLKB 1J4AA 4A9AA 2IIBA 3PF8A 1E1MA 1LVGA 2OILA 4QOGA 5K8UA 5F3RA 3QBTA 3H1EA 3BK7A 3FNIA 2GYWA 3LG2A 3O7WA 4D9GA 4JJFA 3FGNA 3OM0A 5FYDA 4YWJA 5IT4A 2VP4A 3AVTA 3G1TA 1NNSA 1T36A 1XRMA 4LZOA 3UT0A 1T2NA 4G4GA 1E2UA 4LYDA 5K0LA 1QTQA 1YI1A 2DCMA 4AMYA 4DIKA 4GE0A 1MA0A 3NT5A 3EGXA 3C5EA 3VYRB 3RRJA 4POOA 3OOHA 5F33A 4MV0A 3I6MA 4HH1A 1EDBA 4WECA 4BLQA 2HMUA 2OLKA 1PGPA 1E3WA 4X1OA 5DSXA 3LWNA 2CSUA 4WY2A 4EHKA 3ETNA 1ZXXA 4ZOLF 3MSXA 1GTSA 4LY3A 1ZR2A 3QRWA 4HDKB 4EY8A 4HYQA 1EFDN 3LDAA 2BMWA 2FPGA 1TU3A 4NP6A 3PC6A 1ZK2A 4DMKA 1YVDA 3K30A 1KTIA 4ICIA 4CIDA 2XNDA 4ASUA 2JATA 1X7DA 1JYFA 4X20B 5E2IA 3ZV6A 5TEWA 4YCDA 2C9BA 3MJVA 4TS1A 3WRVA 4DQXA 2RHBA 5EA2A 2GNPA 3VO9A 3HCOA 2Z2IA 1BXZA 4ZP1A 2P75A 3I5AA 5LYJB 1OU0A 2V65A 1VHWA 2JDIA 1R6BX 3HBMA 1CKEA 3PE4A 5ARBA 2FH5B 3A9WA 1JILA 4CLEA 5BV2P 3EIHA 5PGMA 4L6AA 5JAUA 4TMFA 4HB4A 3QIAA 2ZRAA 3A70A 1TAQA 4LVOA 3IJ5A 1GGNA 4O63O 2A6PA 1X15A 2PS0A 3LCVB 3LZCA 3PNPA 4Y2XA 4LXYA 1OXKB 5HZMA 1QOQB 2YC2C 4WUTA 1HLDA 2ZXFA 2B1QA 1FTYA 2D7CA 3D4OA 5EIFA 1MBZA 2G07A 1QGAA 4KXVA 3GZNB 4AKGA 1A9RA 2JD2A