1QHNA

Chloramphenicol phosphotransferase from streptomyces venezuelae
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
178
structure length
178
Chain Sequence
MTTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKESIECAWAIAAHVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structures of Chloramphenicol Phosphotransferase Reveal a Novel Inactivation Mechanism
pubmed doi rcsb
molecule tags Transferase
molecule keywords CHLORAMPHENICOL PHOSPHOTRANSFERASE
total genus 53
structure length 178
sequence length 178
ec nomenclature ec 2.7.1.-:
pdb deposition date 1999-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07931 CPT Chloramphenicol phosphotransferase-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1qhnA00
2REBA 2GCNA 1G8FA 1NVWQ 2WVJA 3KZ1E 2KE5A 4IVPA 4OYHA 4YQFA 1YHNA 4O3MA 1GNQA 1G9XA 2VO1A 2R6DA 4LV8B 3ZS9A 1ZUNB 1YR8A 4RD3A 3TW8B 2YOFA 1CJUC 2GEVA 5G41A 4QJ3A 2OEPA 3SHFA 4JLBA 1E0AA 2HT6A 3K0AB 1G8PA 3QXCA 2YKGA 5IF9A 1GTVA 3EX7C 4MDFA 1Q3TA 3SJBA 5LD2B 2W6IA 1HTWA 2XNDA 3AUXA 4TLDA 1F2TB 4P4TA 3RHFA 4U5XA 2A5FA 2JLWA 5J4KA 3DOEA 3QKUA 2A7QA 4ILEA 1GNPA 3ND9A 4NYJQ 3U5ZB 5LPNA 2GESA 3GJ3A 5CIWA 4CEHA 4BGDA 3ASZA 5JSZA 4DLUA 3TUZC 1AJEA 3HYTA 4LJ4A 2B7BA 1G4AE 3QF7A 4RY2A 2YWEA 4FCVA 4ZIRA 4WA7A 1T0JB 2W2TA 1XX6A 2DB3A 3TR5A 1MKYA 4OI1A 4TLAA 3AF0A 3EWAA 5KO2A 2IS4A 2F9LA 2VSXA 4I4LA 1BO6A 1E2MA 2FU5C 2GCOB 4EJSB 3DM5A 2O8EB 4E07A 1XDBA 2PX0A 3RSLA 5KSOA 2IS1A 2WZQA 2Z4RA 5LB4A 3ADKA 4A0FA 5CDFE 2B21A 1JNYA 4Q4JB 4TL9A 5FOUA 1LTQA 5GVSA 3T34A 2J0QA 2VP2A 1VCNA 1BH2A 1Z29A 1XTRA 1ZNZA 2QM7A 2R6CA 3HWSA 4EAQA 1RRFA 2CHVA 3SU8A 1G1MA 2V7QD 2PCLA 2FPMA 4G5RA 3VMFA 2J3EA 2WPDA 2QMEA 1VG9B 3TVDA 1OE0A 3NWJA 2B6HA 2EFEB 4DT1B 2KSQA 4TWZA 3E1SA 1F2TA 2W6JD 4MH0R 2HF8A 4TYNA 1W0JA 2QU8A 4HZUB 4P4SA 3K09C 2DCUA 4UNNA 2WOOA 3SFVA 3BB4A 3TAHA 4Q4AB 5BYKA 1JJVA 1CJTC 3EASA 3AM1A 1CKEA 3A6PC 4JBYA 4GPTA 3FTQA 1CBUA 4R7ZA 4NU0A 4RKFA 1TQ6A 1PV4A 3SNHA 2I1VB 1XMIA 1PZNA 4TTQA 1E2PA 2BWJA 2ZR9A 1KZ7B 1UADA 1IN8A 4D80A 4A9AA 5C46F 1T8TA 2RHMA 1CR1A 1XPOA 4Z54A 4M9SA 5K8IA 5JJKA 2G6BA 3HR7A 4KITB 1N6PA 4UNSA 3TSWA 1KJZA 2E1RA 2ZROA 2NZJA 2V9PA 3OEHD 2F1IA 4UKDA 2IUUA 4Q7MB 1Y3AA 4NCKA 5AUQA 5TVKA 1FX0A 2IUSA 1EFRA 3PG5A 4OQFA 5DNYB 1G8YA 1Z6GA 3ADCA 1GRQA 4URZR 2GJSA 1SHKA 2KI5A 4CDGA 5F3WB 4QHYA 2X1VA 3LH5A 3WHKA 2IS6A 2HCJB 3AVPA 1YR7A 2JJ1A 1Z6YA 1MABB 2GJAA 5B57C 2WTUA 1G3UA 1AS2A 4JKIA 5LBIA 3ZIAA 3FKQA 5L3RA 2V6IA 2J7PD 3CNNA 4NH0A 2Q9AA 1J99A 1QG2A 1GILA 3GJ5A 1E1QD 1GG2A 2GRJA 1QHGA 3DVLA 4URXR 3PUZA 2ZE7A 4OL0A 1T4GA 4ZO4A 1ZD1A 2BJVA 1G17A 4DXAA 4MRRA 2CL0X 2V1UA 4I1UA 3IKJA 1ZIOA 1M1YE 1XTKA 3RLFA 2OT3B 4XH9B 5HZHA 1Z0AA 4Z1MD 1X3SA 4NL4H 1TQ2A 2ZRNA 1OT3A 1DAFA 2ZI3A 2XJ9A 3ZVLA 3QUSA 3K8YA 2CJWB 3Q5DA 4PX9A 1NMYA 2QTHA 2F7SA 4LJ7A 4EDHA 4HDCA 2JLRA 1UKYA 2QT1A 1BIFA 2P5SA 3GLHB 4L5BA 2UZ3A 4DJTA 1WBDA 4TMTA 2BMEA 1SVWA 5UKDA 2QQ0A 2ZI4A 4F4IA 4EFNA 2P6RA 3QVUA 2V3CC 4LJ5A 2ZYVX 4Q1DA 3BRWD 3PITA 2GZHA 3LLUA 2IWRA 3K09A 1XXHE 3BE4A 1KTVA 1OYYA 2IW3A 3VTKA 4KCGA 4XSGA 2ZYUX 5JWOA 4OI0A 5FBLB 4AY2A 4QL3A 4RCYA 3LY5A 3AF3A 1KI1A 4MDEA 2ZAMA 1NJFA 1YZKA 4TTPA 1YE8A 5JRJA 1DO2A 1G3QA 3U4QB 1UKVY 3AVVA 2JJ2D 1QVAA 5FTJA 1R0YA 4TL8A 2ZEJA 4CT5A 3A4LA 4HB2A 1G291 3SYKA 1Q1ZA 1U9IA 3QPVA 4TQAA 3REGA 1AM4D 3QBTA 2ZJOA 4C0LA 1R8SA 4A82A 3PEVA 4B76A 4EPRA 4Q1FA 4Q9KA 2G88A 3MWYW 2JLQA 1XPRA 2BMJA 1I4LD 2D2EA 1OH8A 1N6NA 2AD5A 1ELOA 1R2QA 2WSSD 3KL4A 5BN3A 2CVHA 3IPYA 1Q3HA 3W8RA 1QHSA 1X1SA 2J87A 1NVUQ 4A0GA 1Y63A 2C99A 3B5JA 3TQFA 1KI7A 1JXMA 3IO5A 3KXLA 2V8OA 3UMSA 3LQQA 5JJIA 4PQYA 4XWKA 1JBKA 1W2HA 4TT3D 1KSFX 3A4NA 4HLUA 1WBBA 3B1WA 4KFUA 1J8YF 1W4RA 3O8CA 2GF9A 4LI0A 3LWNA 2W6ID 3NDPA 1G5RA 1UPTA 3CH4B 4RD1A 4DB4A 5H1YA 4A2PA 4DEXA 2H7VA 1JB1A 1GIAA 3IHLA 1E2EA 3QBVA 1C4OA 3CWQA 3T35A 2BKUA 1CJKC 2HLDD 3AB3A 2GJKA 3K9HA 4QOSA 3Q3JB 5B2ZA 2GEDA 2JAQA 3WMEA 4BLQA 1AN0A 1FNNA 3LVQE 3W5IA 4DIDA 2W2XA 1SXJD 2R65A 1NLYA 1A1VA 2ORVA 1IBRA 1W36C 4O2LA 1QHXA 2CCKA 1PLKA 1G20E 2VSOA 3GEIA 1S0UA 1NI3A 4Q9LA 4YXWA 4W5WA 4CF7A 4Q1CA 3D31A 2JASA 3NG1A 4EJSC 4L9SA 3VR6A 1F2UA 4D0NA 4TLBA 4LCBA 2FPKA 1NIPA 4EFMA 4M4SA 2FMXA 3RS2A 4KFRA 4CT4B 3BH6A 3C5HA 1JJ7A 1FQKA 3C8UA 2VP6A 1TL7C 4B3FX 4UJ5A 1BS1A 2C04A 2CNWD 1JAHA 4GZMA 3AP1A 4D4JA 2P6NA 2D74A 4TYWA 4OK3A 5J47A 3WP1B 3QF4A 4D0LB 4C0HA 3DL0A 1E6CA 4Y0AA 1N6OA 1P9WA 3VX3A 1KOFA 2H1LA 4Q19A 4ZI3A 4E03A 3VKGA 3WNBA 1N5JA 2ZSFA 5CM8B 5EE9A 2IWHA 1P9NA 2RAPA 4B6EA 2G1JA 2ZE6A 1JXOA 1ZCAA 3CH5A 3PR1A 2OE2A 3NC1C 4GNKA 3AKDA 3LAWA 5JI2E 3MD0A 5JEEA 4D82A 2BCJQ 2OFXA 2NTYC 4BZPA 2OCYC 3PEWA 1P9RA 1G3MA 1XMVA 1OSNA 3WMGA 2ZU0C 1UBCA 3FMIA 1FFHA 2P67A 3BB1A 3CRW1 3ZZUA 2WWHA 2F1RA 3AVQA 3QKTA 3PV0A 2QGZA 3JVVA 1N6LA 1YR6A 2Q0HA 2SHKA 3BH7A 1DPFA 4NPHA 2IYTA 4IDHA 5JI3E 5FOXA 3MGCA 1JALA 2J0UB 3C4JA 3MRSA 5AUNB 4TLCA 4AIIA 5EUQB 3MUFA 1NN5A 1N0VC 2GWHA 2ZSBA 4WIAA 1S4QA 4OI4A 2OUKA 1EFCA 5JZVA 2WJJA 1ESNA 5JMTA 2CVFA 5L8VA 2ZRBA 2F3TA 3GQBA 3DMNA 4URWR 4PXAA 2ONKA 1Z0KA 3W3AA 3ADBA 5GADl 1F48A 1E9SA 1LF0A 2H17A 4WW0A 2CE2X 4PZLA 4Q1BA 3BGWA 5AR1A 4IW3B 2GEUA 1H8ED 1ZRHA 1KO1A 5DHAA 1NSTA 1Z5ZA 2FN4A 3SZRA 4D2IA 5J4HA 2PT5A 5FPSA 1Z2CA 4I99A 4DSNA 5TY0A 1CJMA 4Q18A 1UKZA 3IGFA 2PEZA 2ANCA 4DEYA 2IBMA 1HUQA 3GLFA 2NPFA 4NYIR 1L7VC 1TADA 4LHZA 2YJTD 1M6NA 2YWFA 3WRYC 2XXAA 2J41A 1KI8A 2QNRA 2PJRA 4YMTA 4PAQA 5DHFA 1R5NA 1TQ4A 2ZS8A 1F60A 4EPWA 4US2R 3EZ6A 3LLMA 3T15A 3ZGXA 3B13B 4EQ6A 4XWOA 1OB2A 3TAUA 1KDRA 4BRWA 2QRNA 5FTKA 1RFLA 3UANA 4HAZA 4TZ0A 3T1QA 1U81A 2WMOB 2GVZC 4KJZA 1KKLA 3IBGA 3TVTA 4BEJA 3NHBA 3ETLA 4B44A 4CEHB 4II7A 1FP6A 3GLFE 1ESMA 2LCFA 4LDJA 2VH5R 2ZYWX 5K8TA 2OM2A 2PLFA 1KYIA 1P73A 1JQJC 1EK0A 3W9YA 3GLIA 4LV5B 1E79D 2EVWX 2WOJA 3K0FA 2IT1A 1IY2A 2N42A 4XJXA 1A82A 5FOWA 3U7FB 1X86B 1L4UA 1VTKA 2H92A 3P4YA 3S1AB 2FE4A 5B58C 1NSFA 3T1TA 4PQFA 2MSDB 1XEFA 4YONB 5FTNA 1E2QA 2GILA 1ZAKA 2IYRA 3CKLA 1VDZA 2O0KA 1IN7A 5CITA 3L0OA 3AF4A 5FOSA 4CRWB 2B8WA 4RSGA 1U99A 1KK1A 4Q5IA 2PCJA 2UZIR 2MMCA 2QMUA 3IQWA 4A0RA 3O47A 4HZIA 5KPJA 1P4SA 4D6PA 4N1AA 4QBGB 3K70D 1CJVC 1UFQA 3WY9A 4WXPA 1BKDR 3EARA 1K5GA 1KO5A 3NH9A 4UQOA 2PT7A 4A8JA 1J70A 1HYQA 4P32A 5EP1A 1NLFA 1YZLA 4E09A 1E1QA 2AX4A 3DEFA 1FUKA 4AWXA 3H1TA 2IHYA 3VQTA 1BYUA 2Q3MA 1E96A 2GJ9A 4L15A 4M8NE 5EXSA 5EUMA 3GLHA 4BZQA 1IN6A 3EZ7A 3GJXC 1S3SA 4JLPA 2IYXA 3CPJB 4PPNA 2R6GA 4B71A 2I1QA 2EFCB 3MWKA 2VHUA 3N5CA 4ZIRB 3RAPR 1YZTA 4AYTA 4V0OA 2WJIA 3EA5A 3CB4A 2EWWA 3DOFA 1KK2A 2ZRIA 1KK0A 3QKSB 2ODWA 3HR8A 4IXNA 2OLJA 1BMFA 1D9ZA 4QG7A 2ODEA 2G0NA 1LVGA 1PUIA 1QZXA 2NPIA 3OF5A 221PA 4ESHA 2ZRMA 5TMPA 4MKFA 2CLSA 4B43A 4BLPA 2ASEA 1JR3A 1CLUA 2ORWA 4IVQA 2XTZA 1QG4A 5EP4A 2D7DA 2QGNA 3QQ5A 1FOEB 1KK3A 2GVDC 3R9IA 1ZMXA 4CYMA 4RD6A 3BB3A 5AK0A 3U2QA 3NXSA 1S9DA 2ZUDA 3AVTA 2HUPA 1ZNWA 3UMFA 3SQXA 3E2IA 2QA5A 2ZIAA 2BV3A 2G77B 1E2IA 4D25A 4PHTA 1D6JA 3GLIB 1DAKA 2F6RA 1RRPA 4FN5A 2YVUA 3LVRE 3QPUA 3W3ZB 1LS6A 4EPXA 5GJWC 3SFZA 4ABYA 4EJSA 1SVLA 2DYKA 3KKMA 4NCHA 1US8A 4NDZA 1M7GA 1XEXA 2JGNA 1OXVA 4MA4A 4N0EA 4JLKA 2ZJBA 3TE6A 1FTSA 3EIEA 2PZGA 1EWQA 4KFTA 2L0XA 1OV4A 4OQXA 2QAGA 5K8LA 2Y8EA 2DFLA 4LYJA 2WJHA 3MSXA 2BHRA 4RD2A 1TF2A 1KMHB 1WE2A 3RSOA 4C9BA 3KFVA 4XIGS 2YC4C 1B23P 3VFDA 2C9YA 3B1VA 1NLZA 3TUJC 1JEEA 4XD7D 1P61B 1T3HA 2IYWA 1X8JA 4C4PA 4A1FA 3DPUA 4IRUB 4TT3A 2XOKD 4FIDA 3V4RA 1Q57A 4URYR 1W5SA 4XTCS 4HB0A 4RZ2A 1C1YA 1ZM9A 4FMBB 1A7JA 1T5IA 3X1DA 3MMPA 1Z0FA 1RJ9B 2IXEA 3CBQA 2UKDA 5LDDC 3RC3A 2ZRFA 3U3OA 1MRNA 2IXFA 5HCNA 1GZSA 3X1ZA 2P5TB 1HT2E 1Z6TA 1GITA 2NO0A 5LB2A 5KTYA 1T3LA 1ZUIA 2J7PA 2VTKA 3CR8A 4JL5A 2DPXA 5JBQA 1MR3F 4B2LA 2WIBA 1D2NA 1E32A 4IDPA 2DFKB 4F4CA 5EP3A 1OF1A 4KU4A 5DGXA 3KB2A 3RABA 2FV8A 4ZI2A 1SVKA 3HDTA 1G7RA 5FBQB 3O8BA 5GVRA 4DB2A 4TQUS 5AJWA 2ANBA 1DAIA 3R7WA 3U3MA 1OH7A 3ZS8A 1G3IA 5AWFC 3B1XA 1H8EA 4FMCB 1WDTA 3V9PA 4DWJA 3KFXA 4LJ8A 4Q01A 5IRCD 4QGHA 4Q03A 2CLCX 3CZPA 2O8CB 1RE0A 5DN6A 3QEJA 521PA 1XD2B 1X6VA 5DSZA 4KFSA 3FHCB 4GP6A 4Q48A 2ZI7A 4NMMA 5KDDA 3TRFA 2FPLA 5FOTA 1OFTA 4TYYA 1KSHA 2ZRAA 4BFSA 3O8RA 1MT0A 5B30A 2WV9A 1TUEA 4U00A 3RS0A 1TX4B 3ZZ0A 1QDEA 1S8FA 1KDOA 3UPUA 4M1SA 3BH0A 2NQ2C 1N6IA 3PUWA 4PC3A 2WSMA 2GXSA 4JLVA 3HJNA 3KKPA 1ETUA 4Q4JA 1SKYE 3QKSA 1O3YA 2OBMA 4B2PA 3EZFA 4TMWA 5ANRB 4IDOA 5JWRA 3GFPA 4CW7A 3VNVA 3F8TA 2VEDA 1UM8A 3UG7A 1IY0A 2XITA 3LW8A 5EE5B 1E9RA 3L8YA 3MJRA 1GFIA 4M22A 4A6XA 2IS2A 5F2EA 4AKIA 2OXRA 1P60A 3NBYC 1K8RA 4M9QA 5DH9A 1CF4A 1HA3A 5J4YA 4UXHA 4KVAA 5FUYA 4WVFA 4FMDF 1G7TA 1YZGA 1DAGA 5CJ2A 1GUAA 2ZRDA 3DO6A 4TZ6A 1WA5A 4URUR 1J2JA 1W7AA 1M8PA 3T5DA 3FMFA 4ERNA 4AC9A 4DIEA 1Q44A 3VU9B 1D5CA 4M1MA 1JAIA 4BLOA 1N5IA 2RGAA 5FR2A 2WSSA 4DCTA 2ATXA 3AKCA 1M2OB 4MUAA 3VNUA 2YINC 1YZUA 2KBEA 3OIWA 4BECA 4GL2A 5EE0A 4AKEA 1DE0A 2ATVA 3KDSE 3K0EA 5GJVC 4EPTA 4LJAA 2ZITA 1NF3A 4KO8A 4AYXA 1VIYA 2C98A 5EE1A 3L0IB 3DDCA 3KX2A 4HI0E 4MYTA 2CE7A 3AVOA 3IIMA 4Q7KA 1WQ1R 2B92A 3B8HA 1HURA 2C78A 2ORIA 3VHXA 2IC5A 1G7SA 3A37A 4PO9A 1T8UA 1EXMA 2E9SA 3GLGE 2OLKA 1DG1G 2C95A 1M7HA 2O8BB 3UXMA 1OHHA 3PCRB 1F2UB 4WBSA 3CO5A 3EXAA 4RCZA 5AJXA 1XPUA 1ZD8A 3AVUA 1X8KA 2DY1A 1KI4A 5C1BA 4AG6A 4B3CA 4GT1A 3WNDA 4EIWA 3T61A 4JLOA 3TJZA 1XTQA 1C9KA 4PPQA 5LD2C 1W4BA 1S1MA 2BDTA 3I3SR 1N0WA 4KSCA 4C2UA 4AKGA 2JLYA 4FMCF 4DUGA 4E5UA 2QN6A 3M4YA 4HAXA 5CJPA 2RGEA 3QKRA 3IQXA 4AD8A 3SYNA 4P3YA 4RFSB 1CTQA 4NYJR 3QKRB 4QBIA 4A2WA 1VECA 3I73A 2D06A 1YJ5A 2CMKA 1EG7A 3KKNA 4PSVA 2A9KA 4PHGA 2O0JA 2FG5A 5D3MB 4TTRA 1SVIA 4PHFA 3KQKA 3BFXA 1G6OA 1RZ3A 4NTZA 5EZ6B 3T06B 2WICA 2IXGA 1NNEA 1R7RA 2ZJ8A 1SKYB 5G3ZA 3SBDA 1T3SA 2FZLA 2DWPA 4A4DA 4TMVA 2IYZA 4JIMA 3AP2A 4HYYA 3PJRA 4XVUA 2DFTA 4LJ6A 3T5GA 3W8NA 3BK7A 1S3GA 2FFBA 3OIYA 1LB1B 2QSZA 2QQEA 4QGFA 3P27A 3EW9A 1UDWA 4Q21A 5BW8A 4CEJA 5G40A 3I5YA 2VP5A 3SE0A 1Z22A 1VHLA 4A15A 3PVSA 4JZKA 1U0LA 3MG9A 5K8UA 2IK8A 3A1SA 2N1BA 5HE9A 3VR4A 2MSCB 3FHTA 4D81A 1KO4A 3RS7A 4POAA 4KBFA 5FOVA 2CDNA 2EW1A 5TXGA 3FKSA 3OE7D 2VP9A 1OPXA 3IUYA 1E9AA 1Q12A 4AK9A 2AD1A 1MRSA 2XX3A 2C5LA 1VCMA 1RYFA 4JVLA 4F93B 4JBWA 3UMRA 5JRZA 3WBKA 3Q72A 1E3MA 3IPXA 3NC0C 2P3SA 3AVXA 4BASA 4BFWA 2ERYA 3GJ7A 4DVGA 5H8WA 3MFYA 4YDSA 5DYGA 4B48A 2WAYA 1Z0JA 1Z47A 4HDQB 3AF2A 3U3JA 1NVXQ 3KKOA 1G21E 2GDJA 1XU4A 1COWD 4YMVA 1IONA 2JCSA 3MCAA 3A4MA 2GA8A 2F55A 2QI9C 5P21A 4FCWA 2X2EA 1YU9A 2I4IA 1P2UA 4ACAA 4NYMR 1HH4A 1P3JA 1Q1EA 4OHVA 4OHWA 3B78A 4NBSA 3QEOA 5L3SB 2J1LA 3SR0A 4EKDA 2ZRHA 2HJGA 4KBGA 1UKEA 4LJYA 1EWRA 3U6KA 4PZYA 2GBLC 2AHOA 3RRZA 2C9OA 1J7KA 2OO7A 1DARA 1Z28A 3BFVA 3GPLA 4KYIB 3TIFA 4M0LA 3CF0A 3B6EA 3B1ZA 3W6PA 2YV5A 4PC7A 4WAUA 4A36A 1CS4C 1FP7A 3EPLA 3W6OA 2QP4A 5CYPA 4A2QA 2ONJA 4M9XA 2LKDA 3RS5A 1OHHD 4P33A 5F9HA 2QE7D 4O0MA 2GJ8A 1XF9A 2BMDA 2FA9A 4PC2A 4UNPA 3RANA 5HKKD 5JJLA 4TLEA 3DM9B 3AGQA 5AJVB 4BFZA 3X2SA 5FPKA 2XSZA 4TMZA 1PVOA 4QNRA 2H18A 3CLVA 1FZQA 4XTRA 1G18A 4NONA 4YMWA 4XWAA 4H9GA 4GOXA 3DKPA 2CCJA 4F4JA 1DAMA 3IHWA 2I3BA 1Q1BA 1QHHA 2RB4A 2RH5A 5DISB 1OFIA 1DOAA 1ZUHA 4TN1A 3OZXA 2J5XA 2ZVPX 2C77A 3T12A 4M2LA 4C0JA 2ZYTX 3H84A 1FW6A 1XJQA 4JJZA 4LBZA 2D4HA 4DSOA 1P75A 1E2JA 1F3OA 1J8MF 4B3BA 3BXZA 2C2HA 4QC2A 4RZXA 421PA 2R6AA 4XSHA 3MWJA 3SQWA 1N25A 1LF5A 1TTTA 1OXTA 3GJ8A 2WM9B 1RYHA 1NL3A 1SULA 2RGDA 2YZ2A 4H1UA 3VU9A 1KKMA 4B3XA 1SHZA 3QOFA 1AQUA 2O8FB 3ZZTA 4DLWA 5EZ5A 2WBLC 1EX7A 3NHAA 2HF9A 4M1YA 4Q7LA 4QHTA 2GBLA 3EZ9A 2WWFA 1E9BA 2OILA 2WWWA 2JLXA 1G5PA 3DMDA 2VLIA 2BIFA 2HT1A 2R44A 3NH6A 1FPMA 3KQHA 2FSFA 2HXYA 5KDOA 4IJMA 2ZRKA 3BJIC 4HLUC 4B75A 3BC1A 2A30A 2Z0MA 2XSZD 2CK3A 4DCSA 4ASUA 1TAGA 5CLQA 2XOKA 4IDQA 4M1KA 1E2HA 1KJWA 1F5NA 2JATA 3A36A 3TW4A 4GOKA 3X1YA 3GLIE 2ZRGA 3B7GA 2YOHA 1M34E 1SXJC 4C0BA 1VPLA 2XB4A 2X8AA 4JVNA 1DVRA 5M04A 4C0QC 1E9EA 2VHCA 1D8TA 3KKQA 5G3YA 4Q00A 2QMHA 5FUXA 4DDWA 2CHQA 4FXPA 4JT4A 4ESVA 5FPYA 5IK2A 3B82A 2HLDA 2H57A 4B73A 5DE3A 2IF2A 4PHHA 2QPTA 1WP9A 3SOPA 4QBHA 4PAMA 1KMQA 2IA5A 1M74A 3KJGA 3TSOA 2KBFA 2B7CA 4AI6A 4FINA 1GRRA 4ZDJA 1GWNA 1II8A 2PL3A 1E4VA 1VG1A 5BWMA 1ZNXA 5FBWB 721PA 5JSZB 1JEDA 4HDOB 4GFDA 4F91B 3GLFB 2CJWA 2ZJAA 4B3GA 5A0FA 3THYB 1BYIA 1YZNA 1DS6A 2EFDB 1ZVQA 1E69A 1TEVA 3C41J 2NO7A 3FMPB 1XP8A 2OZEA 3CF6R 2QEQA 1HQYE 3SJAA 1GDDA 1E1RD 1F6BA 1UDXA 4D4MA 3WYFA 1XCMA 4QJ5A 3KJHA 2J0SA 3V4FA 4Q9IA 1OLOA 3LBIA 3CRQA 1P7CA 2XTMA 1U8AA 2W0MA 1LFDB 2Q9BA 4LYFA 4G5QA 3FE2A 2O8CA 2IL1A 4J0QA 4DDVA 5H70A 2OHFA 5FI1B 4DLXA 4WZAE 3ZJYA 2ZUCA 1M7BA 2HV8A 2GCPA 5L3SA 1U8YA 2EU8A 2E87A 4YMUA 3GEHA 2FWRA 4S2EA 4DUGD 5KYKA 1AS3A 1IXRC 3TH5A 1NY6A 1MV5A 2RMKA 1JQLB 1UEJA 2AXNA 1JPJA 1SGWA 1PLLA 2FSHA 1KSGA 3ECCA 5DI9A 5FPHA 1CULC 2Z83A 3CW2A 3M6AA 4P4SB 5L3QA 1Z08A 1LY1A 4BQSA 2IUTA 3GCGA 3LA6A 4X8HA 121PA 2Z43A 1NJGA 1XRJA 4BE7B 3CPEA 2BOVA 4DLSA 1H8HA 2V4ZA 4I1SA 4BLSA 3HPQA 1P2VA 2GXUA 3L2OB 4JSYA 4Q7JB 2YYZA 1XXHB 3R20A 1R4AA 4DLZA 2CHGA 3SJZA 2R62A 2FFHA 4D0GA 3C14C 3K9NA 2QZ4A 1R0ZA 2JJ8A 3CWZA 3GFTA 4G1UC 5TB5A 1JR3E 4XVQA 1Q21A 1XB2A 1GSIA 4PANA 4H1VA 3THWA 1G8GA 5HPYB 2R8RA 3L0PA 3CPHA 4GBMA 5TDHA 3PEYA 1Z2AA 1FUUA 3TGPA 1I4DD 4HUQB 2ZPTX 2AFIE 2NZ8A 5FL3A 3PQCA 4TL7A 4P4UA 1UF9A 5H68A 2NIPA 2W0SA 5BN4A 4U02A 1FX0B 2XB2A 2GZAA 3GJ0A 4IFEA 2IF0A 2ZVQX 3LRPA 1HV8A 4NCJA 4LY6A 2NO6A 2BM1A 1OYWA 2PBRA 5J40A 1HE8B 2V1XA 4GI7A 2ZXUA 2X2FA 2YWGA 1NIJA 2B8TA 1WXQA 2H5EA 1U0HC 8OHMA 3G0HA 4QFMA 3TR0A 3CONA 1V43A 1EFUA 2R6FA 2PMDA 1KI6B 5FTLA 2BBOA 3ADDA 4FWTA 4LPSA 5SZIA 1YZQA 2VHQA 3FB4A 4UJ3A 1G6HA 5EXPA 4DLVA 1NMZA 2KB0A 1KI3A 1T5LA 2RGNC 4NP6A 5G53C 4US0R 3BD9A 3ZH9B 1E9CA 3ZD6A 2FSGA 3LXRA 5J4VA 1VCIA 1B0UA 5FR1A 2QSYA 2AN9A 3KTAA 3H2YA 2FGJA 1YR9A 4HB4A 3J81k 2BEKA 3SEAA 3ZVMA 4WZBE 5J4LA 4V0MA 3K0SA 2J0VA 1NBME 2QL6A 3DHWC 1JR3D 1II8B 3F0TA 5A5GA 1ZIPA 4C7OA 2NGRA 5E7IA 4IDNA 1AA9A 3BWDD 4XD7A 3I72A 1TUIA 1W5TA 2R9VA 4RD0A 2A78A 4RVCA 1N2CE 1ZC3A 4V0NA 1LNZA 1VMAA 4IEIA 2OXCA 5DI3B 1OB5A 1NY5A 2XJ4A 2QPOA 4KODA 5E3HA 2G83A 3P1JA 4JYCA 1E99A 2BKEA 2LWIA 4R2HA 3LW7A 1QHNA 3H0KA 3OFNA 5CDFA 4A8JB 4JT2A 4R71A 5EP2A 5AUPB 2FSIA 1EX6A 1N0UA 2AK3A 4R9UC 1O87A 2P0EA 2ZETA 4OBEA 3GLGA 3C5CA 2EWVA 3W5JA 2BJWA 1LV7A 1EFRD 4JLMA 3A1UA 3ZVNA 3K1JA 1H65A 4YLGA 4BWYA 5HKKA 3RVBA 3KQNA 2ZI9A 2A3RA 3KB1A 3G82C 3U3RA 4ACBA 2KJQA 2ZJ2A 2OBLA 3SI7A 4B3DA 3SC3A 2ZSAA 3THOA 1S2MA 3O8DA 4PC1A 1QRAA 4KAXA 1AK2A 1P5ZB 2MMGA 3ASYA 1I4TD 4F92B 1TF7A 4Z51A 2FNAA 2QG6A 2Q21A 3EIQA 1W46A 3CZQA 1SKQA 5KU1A 4MRNA 4LHXA 4GOJA 4MUBA 2ZQ5A 1YRAA 3FPAA 4ITRC 3VR1A 3OIUA 1NN0A 1Z3IX 1NMXA 2Q6TA 4OK5A 2NO9A 3WYGA 1IXZA 3ICEA 3BAFA 1UBFA 5ELXA 2O8BA 3W90A 3EIHA 1W0KD 4QGAA 1KY3A 3PUXA 4Q9HA 3BERA 4DLYA 1MO5A 2VSFA 2A5GA 2BC9A 2FFAA 3OAAD 2GTPA 4HUTA 1P72A 2REXB 3U7EB 1FTNA 3BBPA 3K0FB 3M1IA 4I81A 2QPAA 3I5XA 2DR3A 4RKEA 3RYTC 5KPDA 1WF3A 1AKYA 2RGCA 3LBNA 3OIVA 5CK4A 2QP9X 3EC2A 3VKHA 1E2NA 4DBLC 1XMSA 2QUZA 5F9FA 1ZU5A 1Q22A 2F43A 3ZQ6A 2GAAA 4CEIA 1AIPA 2GXAA 4V03A 3P20A 4HAYA 1G41A 2OCPA 2H16A 4JVSB 3WBJA 4RJLA 4QRHA 5CIQA 4ZV4A 1WMSA 3FMOB 3EZ2A 3ONWA 5DN6D 4ZPXA 4EPYA 1D2MA 3BFKA 4C3ZA 3K0CA 4ZCMA 2ECKA 4QXAA 2OFWA 3C7KA 3I1FA 1JECA 2QTFA 1CR0A 2QBYA 4MKGA 1MABA 1NRJB 1MH1A 1XFAA 2ZI6A 2ZREA 1TEXA 3Q5EA 3TK1A 2GK6A 1N5KA 4MKHA 1J90A 1R0WA 1XWIA 1ZYUA 3WP0A 1COWA 1R0XA 2F3RA 5DLQC 2HDNB 3TKLA 5BN5A 1KNXA 2JLVA 2ZRJA 3AP3A 4DSTA 2A5DA 1CRQA 3BS4A 1ONBA 2HJVA 4ZKDA 4BFYA 3FVQA 3LX8A 2HYIC 4BLTA 4LK2A 4AYWA 5C2JB 1U2RA 2ZUBA 3CNLA 5SZJA 4LYHA 2WKRA 2VPPA 3HU2A 2PZEA 3GLHE 1UEIA 6Q21A 4RFVA 2QAJA 1SXJE 4L16A 4QGGA 1UJ2A 2IEYA 4ASUD 4BUJA 4F7WA 4DCVA 3FHOA 1Z07A 3SBEA 3GLGB 1HQCA 3CNOA 4OQLA 4FMDB 3CUEF 2ZRCA 2D7CA 4UXJA 1CP2A 4Q02A 4PPFA 2OV2A 5SZKB 5D3MA 3KXIA 1OIVA 2WWGA 4M21A 1ZC4A 5KNCA 3CR7A 3I61A 1AS0A 5JECA 3WXMA 4GP7A 1DBSA 1KIMA 3L43A 3N70A 2EYQA 5DI3A 3QY0A 4I1VA 3L82B 1IN4A 1SQ5A 4PSAA 1NVVR 1GL7A 4UXIA 2OAP1 5KNDA 1UBGA 1RW4A 2X77A 4MYUA 4PTLA 5EE3A 1NKSA 2WHXA 3B9QA 2RGNA 4ZKEA 4L4UA 5KSYA 4URVR 3CX7A 3HU3A 2HCBA 2NO1A 3UIEA 5JHHB 5JLJA 3RNLA 1Q20A 4JSTA 2V7QA 1KDPA 2H8KA 2FX3A 1E0KA 2ZE5A 2VP4A 2AWNA 2WPDD 1ZD9A 1DAEA 3QG1A 1AKEA 2AXPA 5KUTA 3OEHA 2JDID 2CXXA 4MQBA 4NCNA 3QE0A 1N3BA 3REFA 1RC8A 2O8EA 2QE7A 1YVDA 2GHIA 3CRRA 3X1WA 4W5HA 3VR2A 2DWQA 2AKAB 1NP6A 3IIKA 5TARA 4ZDIA 2FFQA 3PUYA 2IHBA 5FI0B 4BPBA 4B34A 2C8VA 4RFSA 1N5LA 1N6RA 1S96A 4M9ZA 2GK7A 5E4FA 4UNQA 3AEZA 4V0KA 5JCPA 3U60B 4TQ9A 3K0CC 3ZIAD 1EESA 3R8CA 5FUWA 2JA1A 1G3RA 2OBNA 3D3QA 3TNFA 3KQUA 4V0ME 3RS3A 1XD2A 3QPWA 3E5HA 3Q85A 1LS1A 1E2DA 1IOZA 2JIZA 3EAQA 5FUVA 3A1TA 1OKKA 3N2EA 1U98A 3SJCA 4B47A 2W00A 3DZDA 4JVMA 4ON9A 3A58B 4Q47A 4B74A 1MO3A 4JBXA 4KXFB 1A2BA 2RHDA 3OHMA 4Z8YA 1XXHA 2XAUA 5C4MA 4YMSA 3Q7QA 1VIAA 821PA 1P62B 1KI6A 1D9XA 2UVQA 1IAQA 2NOAA 4LHYA 4ZDWA 2Z5FA 3L0SA 4LBVA 2ZU6A 4LV6A 3JZAA 4UNRA 5CB8A 1W36D 4HB3A 4LX0A 2IYYA 2YWHA 1R8QA 1MO6A 5DO9A 4MGYR 4PR0A 1YKSA 4W9MC 1E9DA 1TQDA 4JL8A 2OCAA 1YQTA 5E7MA 1II0A 1W1WA 2FF7A 1XJCA 4MYHA 1MO4A 3U6BA 1GKUB 1K5DA 2Q3HA 1R5OA 1VG8A 2G1KA 3RRMA 4OHXA 4TMXA 2WKPA 2ZM5A 1N6HA 3K9LA 1S1CA 1VKJA 1U8ZA 3THWB 2EYUA 4QM6A 2Q3FA 2ZANA 2GF0A 3U7HB 1Z83A 5JFGA 1OH6A 3WYAA 3HPRA 3S1AA 3TLXA 1Q1QA 1EFHA 3EWSA 4B32A 3CX6A 2WJVA 4B6FA 1KGDA 3RRNA 3RDPA 2WAXA 1ZJ6A 2J45A 2IYLD 4B35A 3H4MA 3B2EA 3NVAA 1G64A 1VCOA 2F43B 1US8B 4NE2A 3THYA 3RRYA 2BMFA 5KSPA 3UATA 3KJIA 1XTIA 1DTSA 5SZHB 1R10A 1G19A 1IY1A 2OFOA 3DKVA 3GJ4A 4WXRA 4BFXA 2P65A 1ZW6A 2P2LA 1KI9A 1XBTA 2CK3D 4Q4LA 1X1RA 4QNMA 4Z8XA 4EQ6B 3EPKA 2BM0A 3BOSA 3VHLB 4DHEA 3IIJA 3QXHA 1TPZA 5HZKA 1OXXK 2FOLA 1WRBA 3NKVA 4Q1AA 2RGXA 2D62A 2IYSA 2J7KA 2Z6VA 3THXB 1W44A 2AR7A 5E7JA 4IEEA 1FMLA 1R5BA 3AH8A 3GEEA 1W0JD 3A1VA 4X8OA 5HCIA 2JLSA 3SDZA 5JCZA 2CL6X 1Z0DA 4LHVA 2R2AA 4LRWA 2GNOA 3WNCA 3VKWA 3QIAA 3K0AA 4NCIA 4Q9JA 1KAGA 1DAHA 2GETA 3SYLA 2ZRLA 1IN5A 1FQJA 4MRVA 4M53A 4A8JC 3EPJA 1ZM7A 4JLDA 1L2TA 1XEXB 2AL7A 5CK5A 1KO8A 4A92A 4W5JA 1GRNA 3OE7A 1A5TA 3LO5A 1G5TA 4LOAA 4G5SA 1IJFA 5JEDA 2V6JA 3ND8A 2ZR0A 3WHLA 2PLRA 2JIZD 5IK2D 1N6KA 3JVUA 2FH5B 3AUYA 1KO7A 3T1OA 3CIOA 1RVDA 4DC9A 1IXSB 2MSEB 1A2KC 3IBYA 3LNCA 4A6PA 2F1JA 3T1VA 1L8QA 4TMKA 3VX4A 5BQ5A 2FJUA 2YNMA 3EG5A 3TBKA 5HTKA 1HEIA 3R9WA 4RD4A 5IT5A 4IVRA 2QRZA 3L8ZA 4WOPA 4BEBA 1ZP6A 1E4YA 2CEAA 2ZJZA 1G7CA 4G01B 4IHQA 4OQNA 1XEWY 5KHOC 1NBMA 4DCUA 1Z6XA 3QXXA 3KQLA 5AJYA 3U7GA 2DBYA 1XJ0A 2ZSEA 1T0HB 5FFMA 4KSBA 1RIFA 2QENA 2BBTA 3FFAA 1VHTA 4BFUA 1GNRA 1E2KA 1NKTA 1KJYA 3I92A 4G3XA 1SVMA 2KWIA 2D2FA 2XNSA 3B1YA 4C0SA 3PFIA 5C18A 3IDQA 2REOA 2WKQA 1KMHA 3OFND 2F1HA 1ZM4A 4FCTA 3VR3A 2VA8A 2PZFA 4PFSA 1G8HA 3I62A 1W47A 4FW9A 2ZJYA 3GMTA 1QHIA 1U90A 1IQPA 5FL7A 4NYMQ 4OJKA 5L3QB 3PEUA 1G4UR 4IOLA 3K70C 4HEJA 1TMKA 4TYQA 4JJKA 1RJ9A 1V5WA 2G3YA 4YXWD 5IHPA 1GKYA 3VR5A 1KY2A 4JYBA 4OJQA 3MJHA 2JLZA 4HUQA 4GSYA 5EQTA 4JL6A 1NBMD 4L9WA 4Z1MA 2V54A 4Q4AA 2VQSA 4A0HA 1GM5A 1OXUA 3QXSA 5F98A 1ZCBA 4C2TA 3TMKA 1U9IC 1TU3A 4FWIB 3F3YA 3UWOA 3KJEA 4TSFA 3OEED 1ODFA 3KUDA 4V02A 4ARZA 2VBCA 2WJYA 3IEVA 4DLTA 4GDFA 2AFHE 1XZPA 5C4GB 3FOZA 4IFBA 5CM9C 3U61B 5FTMA 4KLZA 4IOMA 4CEJB 1R6BX 1W49A 1T91A 2PEYA 2QAGB 3NTUA 3NDBB 4MGIR 4O2RA 4EFLA 1JR6A 2J46A 4Q4HB 1Q0UA 2VHJA 2Q9CA 4JMPA 1ZNYA 3R8FA 2VF7A 4MRPA 2JJ1D 1ZM2A 2EQBA 1QF9A 4JLAA 3Q8XB 1AZSC 2BBWA 2OAQ1 1X8LA 4P0TA 1EGAA 1FL9A 3MLEA 2BCGY 2EFGA 3A8TA 2BBSA 5L3VA 2PX3A 4QBFA 4Q4HA 2QT0A 3K9GA 4KVGA 5E95A 1OFHA 2ZE8A 3QENA 5IDVA 4OHZA 2GCOA 2IYUA 3VAAA 4YC7A 621PA 3ICQB 1E98A 3ZYCA 1IM2A 1XTJA 1ZBDA 2OSBA 2VP0A 4NZYA 1W48A 2JEOA 3U44B 4M1WA 3I8XA 4M1TA 3I8SA 3NBFA 1RRCA 3GJ6A 1KHTA 4LPKA 4ZCIA 4LJ9A 1H8HD 3C15C 1LW7A 1AGPA 1XNJA 2Z4SA 1CU1A 3GD7A 2BVNA 3LBHA 1NN3A 3OEEA 2G0TA 5TV2A 2IYQA 3N2IA 4OI2A 4K46A 2FGKA 2C03A 1AGRA 4GZLA 1XMJA 4PSKA 1OXSC 5EXXA 4D4LA 1HT1E 4RZUA 3F5FA 3FFBA 4HATA 5KOYA 3THXA 3P32A 1BOFA 2CBZA 3I4LA 3NIBA 2IEZA 4KHZA 3UKDA 2W58A 1WB9A 2O8DA 5KNBA 1S9HA 1L4YA 2LKCA 3CX8A 4MRSA 5J5CA 4KLNA 5JS8A 1OJLA 1NG1A 3AF1A 2ZRPA 2ZS7A 3TUIC 2CL7X 1G16A 2A5YB 2YC2C 2J59A 1UAAA 1CIPA 1SXJB 1XD9A 3PENA 3P26A 4X8MA 2XZLA 3R9XA 5CB6A 4BFTA 4FI3C 4EUNA 4LHWA 4LUCA 2F9MA 1XD8A 3NBZC 5GJCA 4HAVA 2WJGA 4L8GA 4QM7A 2P6UA 2WWIA 1KZGB 3IEUA 1W4CA 4MGZR 3RWOA 4BZXA 1E2LA 3AKYA 4KYUA 3QI2A 4GMDA 2QP3A 3IILA 4S35A 1NN1A 2VRWA 4QKQA 1GVNB 1JI0A 1AQYA 1A4RA 5CYOA 1E94E 1GKIA 1U94A 2QBYB 3OESA 1QHHB 2ZAOA 3AGPA 3B85A 2YOGA 4R98A 3D7MA 2J9RA 3I32A 4G5OA 1TF5A 2D3WA 4LC1A 1NG9A 4C7OB 3E70C 1KDTA 2XXAB 3DZ8A 2XNDD 1CR2A 1VG0B 1P2TA 1QHYA 2C96A 3B9PA 4HLQB 2VIIA 3Q9LA 2GKSA 1RRGA 4WZ6A 3EPHA 1EFTA 4PC6A 5CLLA 4ZCLA 3KTAB 5B64A 4OHYA 1RPZA 4DLRA 1E1RA 3EA0A 3KUCA 5BYJA 3LQRA 3R7WB 1PUJA 1XCPA 2QAGC 2G9NA 1II9A 5FBVB 2DFNA 3BORA 5A4JA 4CEIB 1UBEA 4JLJA 3UWKA 3PXGA 4D4KA 1CRPA 1VYUA 1OFUX 4IKEA 3GFOA 1E9FA 3AQ4A 4PZZA 4BLRA 4TSFD 2GZDA 2ODBA 4XVRA 2AK2A 1XEWX 1GAJA 4HAWA 2ZTSA 1I2MA 4W7SA 1W2GA 2ERXA 2O52A 1FNMA 2WWYA 1SXJA 4PO1A 2QMOA 2PJZA 2VF8A 1DADA 2QM8A 3RS4A 4E22A 2A5JA 1Z06A 1D2EA 2FEOA 3FGNA 2FDCA 3W34A 2RKOA 3QNUA 4F38A 2AWOA 1NVVQ 3C16C 3M0EA 2J0UA 4B2IA 1OIWA 3AVWA 4MKIA 2HEIA 4IOKA 3ZQJA 3NEJA 3NEYA 3H86A 4Y0VA 5AJZA 1CR4A 5EXTA 2CCGA 3W6NA 4PO8A 4HSEA 1WCV1 2PH1A 2QROA 3V00A 1KI2A 1OIXA 4PAOA 3CRMA 3JZMA 4IXMA 2VYFA 2C9CA 4EPVA 2WWXA 3X1XA 4PQRA 1OKKD 3MAAC 2JDIA 3QF4B 2W6JA 4K81B 3ZVRA 1E0SA 4O25A 1E2GA 1ANKA 2EFHB 2CLDX 4G0NA 4KV9A 4P31A 3SS8A 1DELA 1IJEA 4CVNA 4JS0A 4TYPA 3D8BA 3LV8A 4GMXA 5FPTA 3U44A 2N46A 2NMVA 4HLDA 1YRBA 3A1WA 1DO0A 4DCNA 2IX3A 3CRVA 5FL7D 1DEKA 1CXZA 2O0HA 1SZPA 1JPNA 4C0AC 1GL6A 2AKYA 3CM0A 4AG5A 4MITA 4AKHA 3SN6A 3IO3A 2VHTA 1QBKC 3QXJA 1VYVA 2YHSA 3AV0B 5BXQC 4GRAA 2XEXA 1MOZA 3HU1A 4DDTA 1GP2A 1HY3A 2ZSDA 1ZINA 3LD9A 1E0JA 2QY9A 3D6TB 3ZD7A 1E79A 4D26A 4US1R 4LWZA 3LDAA 5DIFA 2XZPA 4DSUA 3HP1A 1XZQA 5DYIA 4HLCA 2OG2A 4DDUA 2OCBA 4OQMA 1GL9B 1T6NA 3FKSD 2BEJA 4Q1EA 4BRUA 2W2VA 2RCNA 3GP8A 2IYVA 3ZDQA 1U0JA 3LFUA 1HE1C 5HR5A 1W4AA 3AKEA 2XTNA 3K53A 4N0DA 1PLJA 1P6XA 4LZZA 4IOJA 3TSZA 1TU4A 4V0LA 4NKRA 3QSYA 3SHWA 1RKBA 2ZI5A 4QJ4A 1Z0IA 1KAOA 3P4XA 2QORA 2A2ZA 4CIDA 3UK6A 2VL7A 2GXQA 4U7DA 3NBXX 5FBRB 4DT1A 2GAOA 4K8OA 1W36B 1PJRA 1SVSA 5FH9A 4LYAA 2HYDA 3G5UA 2DHRA 4HAUA 1KSJA 1KNQA 2NG1A 4Q66C 4B33A 5EJEA 3ZLJA 5AUOB 1AZTA 3QG5A 4NYIQ 2OESA 2W83A 1I2DA 4RZ3A 2V55B 5KDLA 4OKSA 3U3KA 4X8LA 2ZS9A 4CGZA 4QHSA 1W0KA 3Q7PA 4XOIA 2JLUA 4OK6A 2QTVB 3LX5A 5JWHA 3OAAA 2FZ4A 4C0KA 4DKXA 5KSZA 1GOTA 1BMFD 4LBYA 1DG3A 3HYRA 3QJYA 1Z6AA 3WRXC 1K6MA 3B60A 3QVVA 4NHOA 3PIRA 2K5UA 1OW3B 4HZUA 3CF2A 4YDHB 4MGKR 2PMKA 1SVOA 4MYCA 4DZZA 4ARZB 4DRZA 3AVYA 5GJBA 1VYTA 2X19A 4CZ2A 2O8DB 4G5GA 4M1OA 4TL6A 1ZM3A 5D3QA 1XCGB 4LBWA 1P2SA 2FEMA 2HXSA 4FD2A 5JHGB 2O8FA 2RGGA 2XZOA 1FMJA 2JJ2A 3BIFA 3U4QA 1CEEA 2CNWA 2ODNA 2ZR7A 2XGJA 2ZJ5A 4I1OA 1T9HA 4JLNA 2WMNB 2RGBA 4N3NA 1E2FA 5HE8A 3TQCA 5JS7A 2WIAA 4LSGA 4PPGA 3RWMB 3EC1A 4ZDKA 1Z8FA 2O5VA 4C30A 4AURA 3KXKA 4KI0A 1OH5A 3PUVA 4LGMA 4BFVA 1QVRA 1XTSA 2DWOA 3UG6A 1Z63A 4JKYA 3WMFA 4R2IA 4LC0A 3FWYA 3K70B 3RC8A 1IHUA 3LXXA 3MWLA 3FDIA 1TNDA 2TMKA 1ZU4A 3FYHA
chains in the Genus database with same CATH superfamily
3RVQA 3SMVA 2GCNA 1G8FA 4OYHA 2PUAA 2KE5A 4CTOA 5AKKA 2DKFA 1Z4NA 3KPVA 4IUCS 3UMBA 1AHHA 1J07A 4TWRA 1XNHA 1ZCFA 4QD3A 3ZS9A 1PJ3A 3A6ZA 1N2XA 1I0ZA 4JB0A 2XDQB 4D5GA 4LZAA 5EJ6A 5IDQA 1XZEA 2O2CA 1G59A 2W93A 4R2XA 1E0AA 4HF7A 2V4UA 2HT6A 4JLBA 4X62B 2YKGA 1B00A 1RQLA 2WD7B 5IF9A 2PZAA 1Y5NA 1J33A 4MDFA 4UOQA 1UC5B 4JI0B 2YIMA 3IS3A 3SWWA 1ZGCA 3DTVB 3FGPA 2W6IA 3G9TA 2MWMA 3AUXA 1NZFA 4FYVA 1X8XA 3QE3A 2VHWA 1YUMA 1F2TB 1VKNA 4RMHA 4P80A 4U5XA 4WVLA 2JLWA 1N2OA 4ILEA 1QF7A 3MF4A 1SBZA 1X13A 3CLSC 5CIWA 1CS0A 1T1SA 5KNLA 3NTQA 3E3OA 4P81A 4BGDA 3ASZA 5JSZA 5KVSA 3D5EA 3ZCPA 1WP4A 5ECWA 4B31A 5H4HA 3FCUB 4D43A 2XA9A 3F7TA 4E21A 4RPJA 3NOOA 4K9PA 4XB1A 2K7ZA 2E5FA 3AF0A 1I9CA 3PLNA 1REQB 2DT5A 2GM5A 2GZ1A 3P5BA 5BSTA 2IS4A 1KZYC 3M83A 4B8WA 1E2MA 2O8EB 2GMWA 1F2DA 4J07A 2GO1A 4E07A 3RSLA 4J03A 1BMTA 2WZQA 2IHTA 1Z4IA 4OP1A 3D5QA 5LB4A 2G07A 4EENA 3QBJA 2ODTX 4DIBA 5CDFE 1PZEA 1TUBA 5FO0A 3L18A 3OQ1A 4Q4JB 3GMDA 2PVSA 3HHEA 4X54A 5DOZA 1F5SA 1LTQA 1ULBA 2TYSB 4BB6A 2P41A 3VYUB 4IV8A 3KOUA 4MQ6A 1BH2A 3Q4GA 1XTRA 2QM7A 3HWSA 4UMDA 1RRFA 2CHVA 3SU8A 4XA8A 3VPCA 1G1MA 3OF2A 4KO3S 4Q9AA 1S3IA 5LJLA 3KLOA 3MJEA 3Q98A 4K2HA 1E7SA 5ADHA 4WZZA 2J3EA 3ZNNA 3EEFA 1RM0A 4J4BA 3TVDA 1HWYA 2ZCUA 3SY8A 1OE0A 5U4XA 1EM6A 3FSGD 3HDYA 3T7KA 3TZKA 1ZIYA 2EHJA 2A0XA 3LPNA 1Z9BA 1W4LA 2B6HA 2JEYA 3NWJA 4O08A 3C48A 4QOEA 3V5NA 3WIDA 1QCYA 4IXWA 3E1SA 1F2TA 3AY3A 4MH0R 5ALDA 1KDYA 4FDAA 1H1LB 3GZTB 3MNFA 2QU8A 4HZUB 4I5EA 4OAQA 4KRGA 1YRWA 2WQ6A 3SFVA 3BB4A 2D5BA 2JBAA 4Q4AB 3LUCA 4AX8A 4HQOA 4MV1A 3FYSA 4BGVA 3EASA 4G97A 3AM1A 5G0TA 3HWRA 5A9TA 3E3MA 3FTQA 3OZGA 4R7ZA 3S44A 2X7XA 3FPLA 2BPOA 4PYRA 2AJBA 1PZNA 1LLDA 3A9SA 1CV2A 2UYHA 1KZ7B 5C46F 4UTNA 1T5DX 2WMDA 3GP3A 2OXIA 5JCOC 4M9SA 2BGGA 5CVVA 2IZOA 1BHQ1 2G6BA 3ES9A 1L8LA 1N6PA 3GJYA 4K6MA 5D1HA 1DRWA 3DZHA 4A7PA 4EOGA 1DEHA 3DAPA 4F4DA 4PG4A 3ZWXA 5JJCA 3ZV3A 4G8BA 3R2JA 1W34A 1DCMA 5JBNA 2DPHA 1EFRA 3KQVA 3PG5A 4INPA 1G8YA 4LECA 4OQFA 5KI6A 2HMWA 1V9LA 1PK8A 3C8ZA 3H9CA 3P8ZA 2J32A 1QH1A 2X3UA 3BZWA 1EHCA 4CDGA 1QTQA 4IIDA 4YAOA 3HXKA 3L0BA 4YRJA 4CDMA 4IICA 4E46A 5J2UB 3CLHA 3HMQA 4A03A 9ABPA 3DJFA 2JJ1A 1Z6YA 4KSYA 4Y1RA 5F5NA 1G3UA 2VDOB 4NIMA 1PZGA 1TZ2A 2XGGA 4M0CA 3UJCA 2C31A 1YGYA 2J7PD 3OPMA 1E4EB 3FG9A 1A4IA 2FSPA 4UCQA 1GILA 3NDJA 1GG2A 1GAEO 4Z99A 5E3IA 4URXR 1P7ZA 1PD0A 2A7XA 4OGGA 2R47A 1YE5A 2J0EA 3B52X 2HO5A 2XCRB 4JBIA 4BP9A 2BJVA 1QSGA 5T3YA 4MRRA 5ALJA 2V1UA 5FPQA 1XRSB 3IKJA 4A0QA 5BSEA 2CFSA 1MHPA 4ZI7F 5A71A 4AMZA 2APJA 4L9RA 1K66A 4MW2A 4U7TB 4NL4H 1WOYA 5D86A 2FE1A 4CFYA 3EDQA 1OT3A 2Y1FA 2ZI3A 2XJ9A 2Y71A 3C7TA 3D6HA 3DZGA 4JEMA 4OMFG 1GUDA 3QH4A 2FN7A 4PX9A 1UMCB 5B7PA 5JFOA 2DHQA 3WL3A 4K2AA 2PH7A 4TROA 1Y34E 4DG9A 2IHUA 5LDGA 1HETA 1W25A 1XZ8A 3AY7A 3MK31 3TW8A 4ALKA 3P97A 1M2EA 4GHWA 3QWBA 4LJ7A 4DCCA 4EDHA 4GE0A 2JLRA 4JXKA 4PG5A 2QT1A 5AVRA 5K6TA 2VTVA 3ESZA 3BK1A 3TLKA 1L6RA 4PVCA 3CXUA 4QQ8A 3DQQA 4ZVPA 2BMEA 5UKDA 4I6JA 4F4IA 4K87A 4OFWA 4TX1A 3TG2A 4RE5A 4B4OA 5A7GA 2PD3A 4ESOA 1KEKA 2GZHA 3LLUA 2IWRA 1NVGA 3O8OA 3EXIB 1OYYA 1FLAA 2RG7A 3I0ZA 5CVEA 3WGZA 2XGSA 5AVQA 1C0PA 1DEAA 4PAWA 3LY5A 4RVUA 1BEUB 2O2SA 2IE8A 2ERCA 1WNFA 3TIIA 3WHIA 4TTPA 2DPYA 4MDHA 3SYRA 3ZC3A 4MB0A 1I4EB 1Z7WA 4P4GA 1Z17A 3AUFA 1QVAA 5E1DA 5FTJA 2COEA 3F9IA 3A1FA 5E0KB 4RM3A 4CHTA 1G291 3FHLA 1UXJA 1C7IA 2Y27A 2Q6IA 3VGJA 1Y3FE 1ZL2A 2KX7A 1A0OA 3FSRA 4ARVA 1R8SA 4K88A 3ABQB 3DBHB 3TNDA 2W2LD 1AQIA 1SU7A 4TV8F 1V35A 2QMZA 4L6AA 4UEWA 4B76A 4EPRA 1APBA 1RI5A 4Q1FA 2DBVO 3UT5B 3IAEA 1PJAA 4IM7A 2G88A 4P35A 4KZKA 1RRMA 3QVOA 4WNIA 3RJZA 8ATCA 4D3XA 1EBUA 1JXAA 4MZXA 5LOVB 1XPRA 1I4LD 2D2EA 2QRJA 2WIKA 4OBXA 5EPOA 4JI1B 3RAFC 2FRXA 3VPAA 3BDVA 1T25A 2B8EA 2GD0A 4DIMA 3TDMA 4B3SB 4Y9SA 1VMIA 3DWFA 4B79A 3DPSA 1UXIA 1Q3HA 2YS6A 2OWDA 1FLVA 1NVUQ 2F67A 1SBHA 1EU1A 1Y63A 2AB0A 4M88A 4R51A 3IO5A 4QYWA 1JR4A 1C8KA 2V8OA 3UMSA 4DJEC 3FBWA 4ARBA 3EULA 3L7JA 1W2HA 4B3IA 2XB8A 3I04M 3Q8MA 1VBMA 4L4SA 1CEXA 1YWGO 3TOVA 3WDSA 4AW9A 4INAA 1J8YF 1DBIA 1UJ6A 3AC0A 2XHEA 5E6RB 5J2UF 4BNVA 3NDPA 2BSAA 4IJUA 5KYVA 3EXIA 4CPDA 4E0BA 2WJAA 5B7QA 3CH7A 1DIHA 3MLAA 4X3PA 1JB1A 1Q17A 4YALA 3QBVA 5DWDA 3VR5D 1N1DA 3CWQA 4R0VA 5HZMA 1ZJZA 1HMPA 3K2BA 3X3HA 1Z8NA 2ZJ3A 1XNRB 2PX5A 4V2IA 3OQIA 5HJ7A 1DXYA 4BLQA 4E1BA 1L7AA 1FNNA 4CKEA 1S8OA 4LQLA 4PGMA 3CVJA 4GOOD 1YMQA 4ZQEA 1TO1E 5REQA 1W581 1W36C 3PC8C 2XTJA 1QHXA 1SM4A 1PLKA 5DM0A 2B4TO 2NZWA 1S0UA 1FTGA 1NI3A 3NJ4A 4FC7A 4MK4A 5ALFA 1VJRA 5DLPA 3HTXA 3NG1A 2JASA 1NHGA 4YR7A 5KTOA 8ADHA 3KPUA 3TTWA 1CUVA 1PZXA 2RKWA 1TVEA 2QU7A 2VWGA 1L5HA 1FQOA 1ICIA 1JDTA 4QUHA 3U4GA 4D41A 2XUOA 4LCBA 1HNWB 1VPTA 2FPKA 3RS2A 1KYXA 3BH6A 2FPIA 2VP6A 4LIPD 4O2AB 1TL7C 3L1JA 4B3FX 5BWLA 2C04A 2H4HA 4N6GA 2PX4A 2D74A 2ZYAA 3L9XA 4JA2A 4MUFA 2IEAA 3WP1B 4D0LB 3V6LA 4TYWA 1FNBA 1ML3A 1I3NA 1Z8DA 3F78A 1U0RA 2JD2A 3NU1A 3STHA 1DDIA 2FUKA 3DTVD 1GR0A 4TMFA 3THSA 1KOFA 2GK3A 2H1LA 5BR8B 4K0RA 1G5HA 4AECA 3DJYA 3PFGA 3WNBA 1A8IA 2D1SA 1N5JA 2IZ1A 2ZSFA 3TFOA 3COYA 2B4YA 5A1TA 5IT9A 3CH5A 4FTWA 2OE2A 1IRIA 4D9BA 4BAGA 5JI2E 2JL1A 4NPCA 2BFFB 3MD0A 2E89A 3ZR4B 3T99A 4D82A 2NO4A 4S3MA 4EHKA 2OFXA 2NTYC 3FNFA 3LFHA 4XCXA 4G0MA 5EYPA 3PEWA 4R6WA 1MN6A 1G3MA 1XMVA 1TM2A 1WF6A 3WMGA 4EJFA 3V3KA 3BB1A 2VNJA 3JQFC 3S5JA 1DDOA 3WTCA 2ZJ7A 3WHPA 3SI7A 4NMHA 1DPFA 3CT4A 2G09A 3QMVA 4NPHA 2IYTA 5DXFA 3IEXA 1M1NB 5A3VA 1LJLA 2RI0A 1M1ZA 5TJHA 1JALA 4Y2QA 2XHZA 1TYEB 3PPIA 1P2FA 2Z2XA 4R9SA 2LUOA 2CZGA 3WA7A 3NTLA 2GYWA 3GLKA 1Q1NA 3N2YA 5FADA 5KKCA 3UWDA 3QHQA 2II6A 4OHCA 4RKRA 4P5DA 1S4QA 4OI4A 4I8DA 4MLPA 2Q07A 5J63A 2FW7A 4ME6A 5KVVA 2WJJA 1ESNA 3UUGA 2F3TA 3K15A 2R1UA 3DMNA 2ONKA 1BVRA 2CVQA 4GVXA 2GPSA 3X44A 5IZCC 4FVTA 2ORYA 1H69A 1ZD4A 4HWTA 4WUTA 5GADl 2D3TA 4HGYA 1XDZA 1CJCA 4RSMA 4CQNA 1W8DA 3NCTA 2PSFA 4MVJG 4NZOA 4Q1BA 4WW0A 1Z5VA 3IAS1 4H6WA 16PKA 1H8ED 1KO1A 1BEEA 4BU0A 1NSTA 4GPIB 3BMQA 2RHCA 1QP8A 2QRHA 2EX1A 5I4IA 5HMLA 4CG0A 4AZSA 2ZAGA 1P80A 3ROGA 4GSKA 3OCWA 5CRIA 4Q18A 5JTUA 5ITVA 1J0BA 4RY8A 4B0OA 2Z4TA 2NYVA 4RDCA 4HH1A 3A3PA 4DEYA 3RUFA 1SHJA 3HB7A 4JP2A 4Z7OB 1YT5A 2BZGA 2NPFA 4U2GA 3HUDA 5EIEA 4RF4A 1OXMA 4CT0A 1GAXA 3ELYA 4S24A 3WRYC 4BYMA 2AUNA 2XXAA 1SPXA 2POQX 3H99A 2QNRA 4FJ2A 3DMTA 1J2TA 2JVKA 3A9VA 3G2MA 2ZJ6A 2ZS8A 4YRQA 4E2WA 1T5BA 1PGOA 1X38A 2AUTA 3DUFB 3OT1A 1XVLA 4HNAB 1OB2A 3TAUA 4U7HA 1UKAA 2XYQA 4BRWA 4G0OA 3MJ4A 3GGPA 1VPVA 4HAZA 4QICA 3T1QA 4BNYA 1HYHA 3N2GB 1MH9A 1ZGBA 1S02A 3CY6A 3IBGA 3G9ZA 5DW3A 4TRNA 1A8HA 3F73A 4CEHB 2FZWA 4OIMA 4IBOA 4RK5A 3JVIA 4LDJA 3AFHA 2P0YA 1WHTB 3QLUC 2NTEA 2PLFA 3IKMB 5I8WA 5ED0A 4MHSA 1P73A 2J3KA 1EGQA 4QJIA 4LV5B 1BW9B 3SVLA 3NS7A 4BS9A 5ENDA 5F5XA 1Q7GA 2N42A 3U13A 3W5UA 5I51A 1YKGA 1A82A 2CMHA 3P52A 4BNUA 1X86B 3MC1A 1E66A 1VTKA 4FGKA 1GV0A 3CNHA 5EIHA 4AS2A 5B58C 5IULC 3GXOA 3T1TA 2YS7A 5CXUA 2C42A 1RWMA 3Q9UA 3AETA 2ZB2A 1TT7A 1XAGA 4FEEA 4RABA 3AY6A 2GILA 1ZAKA 2IYRA 3MGGA 3UMCA 3IOCA 3A11A 3WZMA 5CITA 3AF4A 4WPGA 3KAKA 2B8WA 4ZOLB 1DO8A 2UZIR 2MMCA 1BD3A 2VPXA 2QJRA 2X6TA 4ZAGA 4A0RA 4HZIA 3U9SA 4Q0MA 3PNSA 2SNIE 4D6PA 1KYVA 3HKCB 3HY3A 4QBGB 3TXXA 5EJIA 3A26A 3C87A 3AUSA 1C0LA 1L4FA 4CM9D 3DZKA 1BDMA 1Z33A 4H08A 1KO5A 4KNYA 2ZPAA 4S1WA 4EK9A 4CV1A 2IP1A 3ZDDA 4OEHA 3I30X 2PUDA 2VJLA 1V1RA 3BULA 3RKSA 4CNQA 5E0OA 1TIBA 1BE0A 1UWVA 2ZTMA 1ZN2A 3TZLA 4AWXA 1Q1GA 5EIBC 3ORSA 1ZR4A 3D6NB 3KWLA 1NC3A 4P83A 5EXSA 2BE7A 1DKUA 3N0WA 3GLHA 4CIWA 1FRFS 1PU2A 2A3NA 4XARA 2IZ0A 3BTUA 2XGMA 3A2LA 3ZDRA 3KE9A 3I04A 4PPNA 3NTOA 4B17A 2NZYA 4KXVA 1L1FA 3T3IA 2ZQYA 3EDYA 4ZT4A 5A3QA 1YZTA 3TZHA 1LDEA 1FDOA 3CVXA 4EYEA 3KTDA 1NURA 2FW1A 2I6XA 4HOYA 2BMAA 2EWWA 1KK2A 2G6TA 5KNBH 5LA6A 1PK7A 4GC5A 2BAGA 3TI7A 3HR8A 1U31A 4IXNA 4EUKA 5A5FA 2CLFB 1TIPA 1OGIA 4IKOA 2G0NA 1L9XA 2XRFA 4KQFA 1LLFA 4E70A 4MP6A 1XVTA 3B2QA 2BRUC 3H04A 5LP6B 3KPJA 1WXGA 3OF5A 4HH3C 4UU8A 2J8ZA 1Y89A 2D5CA 3KVYA 3WK9A 5IW8A 1HG0A 4FXOA 3BGOS 4FNAA 4B43A 1G0OA 4CLOB 2ASEA 4MPDA 3IDOA 2XDWA 1JR3A 3HCWA 1KEVA 3AFNA 3I01M 4YVFA 2NWQA 1CVIA 2D7DA 1DWQA 2QGNA 4OB7A 5IEJA 4FYWA 5FBKA 2GVDC 3ADOA 1ZMXA 3OPQA 1GN9A 1YJQA 4RC9A 3SLGA 3WYCA 2QW8A 1K92A 1A95A 1NW3A 2O06A 3NXSA 3U2QA 3E9QA 4F6RB 1JHAA 1TKRA 2PL1A 2HUPA 4GC9A 3E2IA 2ZIAA 2HC9A 3SR3A 5FJJA 1E2IA 2C4VA 4R68A 1D6JA 4NICA 4YXFA 1C8BA 4MQFA 3UQYS 2YVUA 5HWSA 3LVRE 3WMWA 3SJUA 4BNJA 2YWDA 1E3EA 4OHPA 3FVRA 4TS3A 1OU4A 2G8LA 2YIDA 3CNBA 1N3LA 4KMOA 4XE5A 1SVLA 2F3QA 4NCHA 2ZZNA 1UM9B 4G1MB 5KYXA 1M7GA 2PGOA 2X5XA 4O2BB 1NW6A 5A6VA 1F17A 4DPMA 1ADBA 1KR5A 1OXVA 4M7RA 3TE6A 3ZKWB 3W3AH 2FI1A 3PZBA 3EIEA 5U4QA 3UV7A 3NV7A 5KCMA 4KFTA 3TJRA 3OJFA 2QAGA 2RBEA 4TN5A 4XCQA 3ZHOA 2AG1A 2DFLA 1E92A 5ADVA 2NVUA 4RD2A 1IUPA 4BKMA 3ZDFA 4C9BA 4KK3A 3RSOA 4C7MA 3IERA 2J5BA 3FJ1A 4ZI7B 5IXYA 4XIGS 2YC4C 1O5OA 3RODA 4MVJM 1ZA2A 3HSYA 3LP6A 3D1JA 3W5AA 1JEEA 3FUWA 1D4AA 1P61B 1IPEA 4NOLA 4XD7D 4FKMA 4S0ZA 4FFMA 4ZCPA 3ETDA 2XQJA 5DNVA 4RF5A 4I9FA 1W4ZA 2YMPA 2YWJA 4IRUB 3KRTA 4MAFA 4IHKA 1DP4A 3MMNA 1KH3A 4QTXA 4TT3A 5K4AA 4QYMA 3V4RA 1BDHA 2ZCJA 4QTTB 3ZZ1A 5JARA 3T5MA 4FMBB 2RH4A 3D4BA 1A7JA 3TRIA 1F38A 3SC3A 3UNXA 1D3AA 2PYIA 1TM4E 1THZA 3CX3A 1XP5A 1WW2A 2IXFA 5HCNA 5DK4A 3RFVA 3WLTA 1FUIA 1HT2E 1XFDA 2WVAA 1Z6TA 4PYKA 2PQ2A 2PUGA 1V6AA 2Y2UA 5LB2A 2FUCA 3I09A 2VTKA 3WGMA 2VZ9A 4NBKA 5D85A 4L0CA 4B83A 1NUUA 2DPXA 1MR3F 2MYUA 4B2LA 4WNYA 4P92A 5EGNA 5H83A 4BQRA 4DPLA 4YHHB 2QTMA 3OH8A 2G72A 3JQBA 4KU4A 3PVCA 4N49A 1SHLA 1VMDA 2FV8A 4FILA 3ZHUA 3LBYA 2IP4A 3HDTA 4TTSA 3JRXA 1KZHA 3TPFA 1X74A 3QPBA 2YJ3A 1NXTA 3LUAA 1T9KA 3T9EA 4ENWA 1B73A 1DAIA 1KF0A 4Y2UA 1F6WA 2BFMA 3N0TA 5AWFC 4DWJA 4YY3B 3KFXA 3L79A 4IDFA 1EEXB 4F2HA 1POWA 3LCUA 1RYMA 3CZPA 1CQXA 3JYOA 1L4MA 2YZ7A 4PZAA 5KYYB 1AQLA 4IIUA 5I9NA 2FETA 4G1CA 5JNUA 3PX2A 2C61A 3V2IA 2VOEA 3W1EA 3D7SA 4KFSA 4NDAA 4TSKA 1HR0B 4LYDA 3EFEA 5KDDA 1TTHA 1NVEA 3KTFA 1H42A 2PS0A 4JR1A 3ZE9A 5I3ZA 4IV5A 1KSHA 4F72A 1MG0A 1EP1B 3PHCA 4GYKA 1BXKA 1HDEA 2DQSA 4HS4A 4BKUA 5B30A 2WV9A 1TUEA 1BQ3A 1CCWA 4NAUA 4U00A 1S8FA 1KDOA 1ULUA 3UPUA 4GMGA 4M1SA 4X1YA 1T5HX 2HNBA 3QYAA 4GF5A 2BR5A 5G4LA 2GXSA 4FOOA 1I94B 1U5AA 3CLTD 4Q4JA 3QKSA 2JG3A 1J22A 4N9WA 2EV9A 3W7VA 3EZFA 4K9OA 5CIYA 2OL4A 3N07A 2Y1GA 5ANRB 2PGNA 3GFPA 1JLKA 3HCCA 4J0HA 1KYYA 1LQ2A 2XMZA 2W6PA 3KKZA 2HRBA 4M1QA 4YO8A 5JAOA 3VNVA 3EZLA 3COPA 2XITA 1RNLA 4E5YA 4XVCA 3MJRA 4KGXA 1O5TA 4FD3A 2A1UB 2R8PA 2PSSA 2YUIA 3JVDA 3NBYC 2VDWB 4G6ZA 1UC4B 3BE6A 2QX6A 3DHNA 1VPDA 1HA3A 3BN3A 3FFXA 3TEJA 1M5RA 1NAIA 4UXHA 2IYPA 5FUYA 5SY9A 1U3TA 4FMDF 1H2YA 4M1ZA 2QTWB 1G7TA 1YZGA 3NAZA 1VP9A 4HQNA 4PLZA 2UU9B 3PXDA 3D0QA 4OXXA 1GUAA 4TTJA 5KMGA 1WA5A 1ZY2A 4FONA 4URUR 1V16B 5IABA 3P71T 1A5ZA 3AM4A 4JNCA 3C45A 4U2FA 3FMFA 3QEMB 3WLOA 5C5DA 4DCGA 1E3DA 1KJ8A 3Q87B 4RTRA 3IMGA 1PSWA 4LHEA 1ETHA 1JAIA 4BZWA 4K3UA 2IIQA 4BLOA 4JI5B 3ZDXB 2WSSA 3QOXA 2P8JA 1G8MA 3OJCA 2VHYA 5ESXA 2QLFA 3EIFA 3QFTA 2LCIA 4YMIA 3TR6A 3OIWA 3W79A 1G98A 3ZE0B 3W9BA 3DFKA 3EIXA 5JH7F 1UXGA 4AKEA 1BE8A 2A4KA 2ATVA 5ALZA 3K0EA 2IOFA 2WYIA 4YLYA 4Q9DA 4AY4A 4XDGA 4JJ7A 1QO0A 1NNI1 4X85A 3KT6A 3PVZA 3KX2A 4LWQA 3B9RA 4MYTA 3NBQA 3GWGA 5DK6A 3AVOA 1DFIA 3SHQA 1KZ6A 1WVGA 2HU8A 3I12A 3IQIX 5LLSA 4AROA 3B8HA 1UMBB 1I3OA 4DLPA 2QMQA 1Y9EA 2FQXA 3A37A 3JWEA 4ZO8A 1W85B 1T8UA 1EXMA 2E9SA 4DOMA 2OLKA 3MBOA 4WHMA 1DG1G 2BP7B 5DW0A 4AJJA 5F64A 4M0KA 4JEHA 1MAAA 3OA2A 2CLLB 3EXAA 4F4UA 1XPUA 1ZD8A 1V8FA 1GTZA 1M1NA 1NASA 2VPTA 3HBNA 5BSGA 1Y33E 3A6EA 3R75A 1B8PA 3TTVA 1VLQA 1JHPA 2WMYA 1FUYB 2IIPA 1A8UA 1HI9A 4OOFA 4C6RA 4KSCA 5LP6C 2XY4A 2DR2A 5HJEA 5DSTA 1K88A 2OD2A 2W8ZA 3QKRA 4IGFA 2NV6A 3O31A 4RFSB 1VJTA 4ER6A 4QBIA 4A2WA 1D6SA 4AJ9A 3OBBA 2NLOA 4Y2RA 5DBOA 3QXGA 2R79A 1SBQA 1O58A 3PGKA 2CV0A 4GXRA 3VKVA 1R6DA 1BU5A 1UZUA 1XRMA 1BX3A 3GL9A 4RH3A 4X90A 5D8DA 3VR5H 4UPEA 2Q8QA 1SC1A 4YH1A 5EZ6B 3IVCA 4NTZA 4BGEA 3T06B 2C20A 5BPHA 3T3NA 1VGRA 2AC2A 3DYVA 5DMHA 3L7DA 5G3ZA 2GHTA 3NRJA 1TO6A 3T38A 3FWPA 3VTZA 3S8YA 2TMDA 4O02B 4RVDA 1SUBA 3NGLA 2DE0X 2PUCA 4YREA 1OUMA 4JIMA 1YJBA 3PJRA 3T5GA 3W8NA 1GADO 4DWOA 1YK1A 3ANXA 5LP6F 2QSZA 3KZNA 4L74A 2BGUA 3P27A 1KZ1A 2H1IA 3EW9A 3HSKA 4J0CA 5AW3A 3B38A 1Z26A 2RHOA 1E6LA 2J6BA 3KB6A 4LK3A 4QDTA 4CDRA 4ZJYA 1MG5A 3HLTA 3I39X 1UZNA 5G40A 3ZWAA 3I5YA 4X93A 5KWSA 2A8YA 3NTXA 3AUUA 3T1NA 2AZ4A 4DBVO 2GAFA 4A15A 2PK3A 3EIUA 3NHRA 3W4IA 5DYTA 3AYZB 3MG9A 5B2FA 3QWAA 2N1BA 4EF6A 3VR4A 5IXJA 1T4BA 3BSWA 4RTLA 3FHTA 1KO4A 3RS7A 3BWYA 4MP3A 1E18A 3FVVA 1QB7A 2HQSA 4CF4A 1AMOA 3FKSA 4DWVA 1JEAA 2XNJA 5D7NA 4MQ5A 1ZH0A 3I58A 5DLDA 1N5DA 1HQKA 2ZB3A 4A8PA 1VCMA 3KJFA 3PF9A 4N40A 4JBWA 3KZCA 3IV6A 4DARA 4KXNA 2I7DA 2WU4A 3WBKA 1N34B 2FPXA 1E3MA 4H27A 4MPJA 4FJ1A 1BN7A 1NVTA 1RM3A 3UHAA 5A0VA 2J9YB 2PJUA 4GQBA 2ERYA 2W2KB 1FSPA 4LRQA 4TPKA 5H8WA 4BNFA 4GUAA 2UVDA 1W9MA 1WUJS 1NVXQ 5EWJB 1Y8ZA 4C21A 4X1KA 3IXMA 1XU4A 2GEJA 3L92A 4XW2A 3ROEA 1IEQA 4MYDA 5K3DA 4AJ4A 4DG5A 3PDCA 1G20B 4KDFA 2WRZA 3GOHA 2G04A 5F9MA 3IXQA 1E5XA 1TAHA 1RKVA 3A4MA 7ADHA 2F55A 2QI9C 2I62A 2WFMA 2X2EA 1U2TA 3JQ7B 3O91A 4LKOA 2PVPA 1HH4A 4C0XA 3KD2A 3H5RA 3MT8A 3KQPA 3HC7A 4C43A 4ZJZA 3CMCO 5H7XA 3ZWYA 3GUHA 4YX9A 3U6KA 2OP0A 1RZVA 1YA4A 4PZYA 3M3DA 5FWYA 5JE8A 5IX8A 1HORA 4L75A 2TSYB 3KDPA 4INZA 3T7JA 4Y6GB 1KMIY 1MX1A 2C9OA 4ETNA 1J7KA 3EVBA 1L8XA 2FX5A 1Z28A 3BFVA 2PIDA 1THMA 2XQIA 1M2OA 3BCSA 3CF0A 1ODKA 3B6EA 2XUFA 3MWEA 3KT8A 4YAGA 3KZKA 2YV5A 4FFBA 1LQUA 3FFTA 1FP7A 3EPLA 2XB6A 3BGDA 3K72B 1JLMA 3PC3A 3RS5A 4CV0A 3VZQA 3RANA 2WG0A 1XF9A 1XTZA 3FMVA 4UNPA 4EVSA 1X9GA 4FNOA 1PG2A 4YP6A 5JJLA 2NV2B 2GCEA 2QYHA 3AGQA 1X1DA 3ZWDA 4BFZA 3OTQA 1MJ5A 3RU2A 2E18A 4TMZA 1PVOA 2J07A 4LVNA 1G18A 4YMWA 4G4IA 4R01A 3G6KA 4CMJA 4NXNB 4WNAB 3DKPA 1P3Y1 3TLGB 1QE0A 3QUQA 1QHEA 1QOQB 1SD5A 3Q0EA 4P7GA 5EMNA 1OFIA 1ZUHA 5B12A 4RYDA 2Q4RA 4LJLA 3GROA 3USZA 3OZXA 3IRUA 1C9NA 1GZVA 1QBGA 2ZVPX 4MV5A 1JSRA 1Z2DA 4TVKA 3T12A 4M2LA 1X80B 5IFLA 5JPDA 4XRRA 3BA6A 3DHEA 3VR4H 3L8DA 3TNJA 4QC2A 2A86A 3JY6A 1S7GA 3E9NA 4I3GA 421PA 2GEFA 1U5BA 2RBKA 4LRUA 1C3JA 4K9MA 3FPJA 4KRXA 2GBPA 3ZE1B 3SQWA 3BXPA 5EERA 5KOIA 3HA2A 3E3NA 3ZW8A 2V5AA 2JARA 3FXAA 3IPRA 4LXYA 4N8SA 4NK4A 3TSAA 3V1YA 4H1UA 1W88B 1SHZA 1Q7RA 1QV6A 2NQTA 5HDBB 2E3JA 2W2QA 3QTLA 4J6EA 2IZ7A 4HNRA 1GG5A 3R3HA 3EFBA 2NT3A 3UCFA 7MHTA 5A7HA 1QONA 5JAIA 1EX7A 5JYCA 2F2TA 1IQUA 2DC1A 2OK8A 1LSUA 4OQPA 3OE1A 1E9BA 1EVJA 2WWWA 1SG6A 1G5PA 4AF8A 4HZGA 1QF6A 2BIFA 3CTMA 4NJOA 3QI7A 4XGKA 3KQHA 4LI3X 2J09A 2HXYA 4J0IA 2Z1NA 4MLZA 1O6CA 2C3UA 2QVLA 1PL8A 3BC1A 3GDHA 2VSNA 2ZSKA 1TZBA 4JU8A 4XYGA 3URMA 4DCSA 1RI2A 4J8PA 1CC1S 4R05A 1UBLS 3DBLA 3JQ9A 4RMGA 3R6TA 2X0FA 3T7TA 2XOKA 4IDQA 4M1KA 3NUGA 1SKAA 1KJWA 2JATA 3A36A 3K20A 4W6ZA 4PZCA 4BPRA 1YK0A 2JRCA 2ZRGA 3B7GA 3DT8A 4PR3A 4E08A 4C0BA 1H5NA 1VPLA 3PRHA 4CQMD 5C9ZA 4CM3A 1TGVA 2OZPA 3B8EA 1ZVJA 5M04A 1E9EA 3H5NA 3A25A 3KKQA 1K7CA 1NXVA 2CNBA 2NUTB 1MPTA 4Q34A 2VAPA 4DDWA 3H16A 1UK9A 2CMFA 1YB4A 4B73A 1X7YA 5KYUB 1ODCA 2AZTA 2FEPA 3GX1A 2R7MA 5I01A 2JK0A 6NULA 4GR9A 1A9QA 3A7EA 4FQ7A 5B3JA 1G6KA 5CPFA 1H1TA 1D2RA 3KJGA 5EZYB 5KTTA 4UBMA 4AI6A 3JTEA 4FINA 2FHSA 4FUQA 4J3NA 3K0KA 4ZDJA 3LY8A 3LRTA 1KIAA 1CRLA 1AXRA 1AVTA 1VG1A 1JHYA 3WL6A 5JSZB 5A4DA 1JEDA 2OOSA 4Z7JA 2IU3A 2PLWA 1FDUA 4UDYX 2PXCA 3THYB 1BYIA 1M0SA 1DS6A 1YZNA 1ZVQA 2QLLA 1ID8A 5FA5A 4I6GA 3SZOA 1ZWLA 2EJTA 4K26A 1QIKA 1PT7A 3HO6A 1F8FA 1I6WA 2E21A 3IDFA 3FMPB 4FM9A 1W87A 1J24A 1Y1LA 5I7OA 2G1PA 2WA2A 1UUFA 3UW1A 5J5VA 1UQRA 3OP1A 1PFGA 3G8CA 4IINA 2QEQA 4OXKA 3AL0C 1I2AA 4QDZA 2WTBA 2WD7A 4M0UA 4QSMA 1JA9A 4C4ZA 4QJ5A 3KJHA 4MW1A 3RAGA 3OC0A 1JBEA 1XZCA 4HFRA 2NXNA 5C1DA 2HLPA 4Q9IA 5K0TA 1I33A 3VR6D 3UF0A 2B69A 1P7CA 4JHXA 1AQ6A 3C3AA 3DNPA 2W0MA 1L7DA 4KXWA 3ZKWA 2Q9BA 2J67A 2Z2YA 4G5FA 4MQEB 4CLRA 1XAIA 4DA4A 3TZQA 5H70A 1LPOA 3ZJYA 2CBXA 4HMOA 2YYSA 2GCPA 2GD6A 4HXFB 5DCWA 4DM3A 3LK6A 3UAOA 1ZJWA 4S2EA 1RJDA 2I2XB 5GONB 3O0DA 3CRNA 3II6X 1EVIA 4Z4EA 1NXSA 2X22A 5DTRA 3D7LA 3R76A 4DZRA 2JFGA 1E58A 4X6YA 5EKTA 4WESB 1SGWA 1PLLA 5HKBA 1ODSA 2XVMA 1KSGA 3RC7A 1U0NA 5C80A 3ECCA 3KEGA 5D00A 1P6QA 3OTHA 2ZSUA 2Z83A 3WI7A 3F46A 2R8YA 4PGAA 1U1EA 1X80A 4QDJA 3WQBA 2GA9A 1U04A 4TS4A 5AK6A 3LKZA 1IC6A 121PA 2Z43A 4ZRNA 4Q6WA 3EZYA 2NYRA 2BOVA 3M6XA 2JGJA 5EC8A 4YJFB 1AO0A 4I1SA 4BLSA 5KU7A 3DVAA 2BELA 4ZVRA 4BMVA 1KXJA 4YGXB 4I50F 4B9EA 4M60A 1XXHB 2YHBA 2R62A 3IVRA 4KUHA 1G2OA 1WG8A 2JJ8A 5TB5A 4U2EA 1L5LA 2MOKA 3A06A 5C5EA 4PANA 2V58A 4H1VA 3UJ3X 2IU4A 2JIRA 3AFIA 4NNPA 5HF6A 5HPYB 3WK6A 3LM8A 4GBMA 1Q95A 4BMYA 1Z5WA 3TZ6A 2PSDA 4QU9A 3QVLA 4TL7A 4P4UA 4DQUA 2F4VB 3UK7A 3ZCXA 1TIKA 2IH2A 1AH2A 2V45A 5BN4A 4U02A 5KYWA 3NDRA 2GZAA 2Z2JA 4IFEA 4PVDA 4UEKA 1HF3A 3HB9A 1HV8A 2BM1A 2PBRA 3MJSA 3NHJA 4IMIB 4GI7A 4R5HA 2ZXUA 1X19A 4KQ2A 3G9XA 4ZQGA 2I54A 2O2YA 1NF9A 4R3NA 1GTMA 1NOJA 2WUGA 5KTKA 4DA8A 2H5EA 1U0HC 3IAXA 3G0HA 4OGLA 4BEVA 1EFUA 4W8GA 3KJXA 2XCLA 4QZVA 1J0DA 2AOUB 2R6FA 3X1MA 2VQ3A 1KI6B 2D5AA 4ZWNA 3AR7A 4CI9A 4R8VA 3K2IA 4G41A 3ADDA 3NOQA 1WKCA 1ORDA 3BIWA 1E1NA 4UJ3A 3S7TA 2INGX 2UYQA 4NP6A 3WIOA 2RGNC 2BT4A 2Y05A 3VSAA 1FFCA 3LI2A 4GBED 3GW8A 4CN8A 3PGVA 3WK4A 2OGSA 3K5PA 1ATIA 3VU3A 3EBPA 3GLVA 3MINA 4YYZA 2C4KA 1FVHA 1H94A 2B1IA 3FUCA 1P4HA 1YR9A 3JD2A 4HB4A 3J81A 2PUTA 4HAOA 1QPZA 2QTBA 4WZBE 3DMYA 5J4LA 1P1JA 3EXG1 3F5QA 3U39A 2JVJA 4BUCA 4DJDC 4EY5A 5KKNB 1HE3A 1NONA 3PEFA 4C5CA 8AT1A 2H0QA 2ETXA 2NGRA 3IXLA 3NAQA 4QASA 3BXEA 1BOOA 4DWWA 3I72A 2BRUA 1GTL1 1KYQA 3GRYA 3HS3A 5EQFA 1H4QA 2BFCB 3A6KA 1J9ZA 1V5FA 2HWXA 4LKRA 1RYYA 2G7ZA 4PNPA 3DVQX 4HDAA 5DI3B 4D5EA 4W5RA 1NY5A 1CUJA 1OYOA 2OHVA 2GERA 3FZEA 1OB5A 1T2NA 5DEOA 4WOBA 3WGHA 3P1JA 3I5UA 4JYCA 9GPBA 3DLHA 2LWIA 2PKRA 3MIIA 3EF0A 4R2HA 4WBNA 2PZJA 2QD2A 3H0KA 5AI0A 1VPEA 3FCXA 1DAOA 3NORA