1QHNA

Chloramphenicol phosphotransferase from streptomyces venezuelae
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
178
structure length
178
Chain Sequence
MTTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKESIECAWAIAAHVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structures of Chloramphenicol Phosphotransferase Reveal a Novel Inactivation Mechanism
pubmed doi rcsb
molecule tags Transferase
molecule keywords CHLORAMPHENICOL PHOSPHOTRANSFERASE
total genus 53
structure length 178
sequence length 178
ec nomenclature ec 2.7.1.-:
pdb deposition date 1999-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07931 CPT Chloramphenicol phosphotransferase-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1qhnA00
3I8SA 1YR7A 2Q21A 2ANCA 3Q5DA 4DSOA 4M53A 5K8TA 4HSEA 1BMFD 5L3QA 4OI4A 2X1VA 5GJWC 3U3OA 1KTVA 4YMWA 1V43A 2QSZA 1GRRA 2AXPA 2ZI7A 3FKSD 5EQTA 5IDVA 4ACBA 5K8UA 2RB4A 4Q4JB 3EA5A 1OJLA 4CIDA 2BV3A 1QHHB 1DOAA 2OCYC 1F48A 3QBVA 1ZC4A 2ERYA 2UVQA 2PCLA 2RGGA 3AVOA 4X8OA 2G0TA 2WKQA 3A1WA 2AN9A 4BZQA 1S8FA 3E5HA 5DN6A 4TSFA 4I4LA 1Z5ZA 1FNMA 2FU5C 2XB4A 1XMSA 1GL6A 2JJ8A 1HT2E 3CRQA 3NTUA 4RD1A 4FIDA 2ZRFA 2ZS7A 3GFOA 1HTWA 4ILEA 1W36C 6Q21A 2IS4A 1N6LA 4MKGA 2OXRA 1SQ5A 1FQJA 3GLFA 1W44A 2CJWA 3TAHA 3VR2A 4P4UA 4WZAE 2QU8A 2Q9CA 4C0JA 1E4YA 1GILA 1ZP6A 3W5JA 1A5TA 2VL7A 4TN1A 1AKYA 1VDZA 4UNSA 3THOA 4C4PA 5IHPA 5DO9A 2RGBA 3BH7A 3IDQA 4PPNA 1XTIA 4GPTA 1WBBA 4B32A 1R0XA 4C0QC 1WCV1 4IFEA 1N6NA 5H1YA 1ZCAA 2P6UA 4XSHA 1FTNA 2IWHA 3ICEA 4KAXA 1UEIA 2VHTA 2JLZA 4WW0A 3T15A 2CXXA 1CR2A 2CL7X 3DDCA 2PMDA 3B85A 1QZXA 4DT1B 1S9DA 2VHQA 1J99A 1P73A 3K0AB 3U7GA 4LZZA 2ODNA 2VYFA 2A5JA 3KJIA 4FN5A 1VPLA 4ZV4A 2V1UA 1G4UR 3LNCA 5H8WA 2PT5A 3F8TA 3MWLA 2WIBA 2EFCB 3BFKA 5AUPB 4DUGD 1T8TA 5J4HA 3UIEA 1OYYA 1NY5A 2OLJA 4D2IA 5KSYA 1Z3IX 4TZ0A 3CNLA 2XNDD 4KODA 1EFHA 5CDFA 2DBYA 1EX7A 4DWJA 3I5YA 1P62B 2ZRNA 2RCNA 2XOKD 3MMPA 1II8A 4CYMA 3A8TA 3DHWC 1MV5A 3K8YA 2ZS8A 1JEEA 1M34E 5KSZA 3LXXA 3AF1A 5F2EA 1ZRHA 3ICQB 2IXFA 2GETA 3FDIA 1H65A 2VSFA 4RJLA 4JL6A 1J8YF 3LH5A 1U98A 5L8VA 1Q1BA 3G5UA 2D4HA 4I1OA 4NCKA 4MYUA 1FW6A 121PA 1E98A 3KL4A 3IBGA 4PC2A 4B2LA 2WJVA 5GVRA 3BD9A 5B30A 3E70C 4HYYA 3I72A 1NN5A 4Q4HA 3TUJC 1XTRA 4MGZR 3NKVA 1LS1A 4O25A 2QMOA 3HJNA 1K5DA 4Q18A 3P32A 4AC9A 1XEXA 1P60A 3GJ5A 2CK3A 3PIRA 2W2VA 2AWNA 3NVAA 4LHWA 3C7KA 1P6XA 5AK0A 1E3MA 1XTKA 2WJHA 3SI7A 1NMXA 4DDUA 5FPTA 4AWXA 2OT3B 1U0LA 2LCFA 4MUBA 3B7GA 2J7PD 3QG5A 4IOKA 5FI1B 3SZRA 1C1YA 2ZAMA 4I1SA 3BFXA 2XZLA 2OM2A 3OEHA 4CZ2A 2J45A 4FMBB 721PA 3R9WA 3AV0B 1EFTA 4JLKA 2A9KA 3X1YA 2QL6A 2EQBA 3AP2A 1VIAA 3AVYA 1PV4A 2QP3A 4Q4AA 3LLMA 1G18A 4P4SB 4R2HA 3O8CA 3AVQA 4ZI2A 3TLXA 4BLQA 1RRCA 3A36A 5FI0B 5FOXA 4EJSB 3NHBA 3UPUA 4HAUA 3TR5A 1W47A 1K8RA 2QA5A 3I1FA 2MMGA 2R6AA 5AJZA 2V3CC 2O8DB 4II7A 5FBLB 4PQRA 1OXXK 1Q44A 3UK6A 1VG0B 3MUFA 1XX6A 4ZKEA 2XJ4A 2O8CA 3X1WA 2JLSA 3U6BA 2QTHA 1UKYA 1W0KA 4EJSC 4AI6A 4PQYA 1E2IA 1LFDB 2FWRA 3WBKA 4LV5B 3W8RA 3S1AA 5DI3A 1B0UA 1D5CA 1XD9A 1YZKA 2C2HA 2ZRAA 4FCVA 2VF8A 2YNMA 1GNRA 3DM9B 4MGYR 5LDDC 4FD2A 3NG1A 3GLHB 2GEVA 3PJRA 3E1SA 1J8MF 1H8EA 3LFUA 5C4GB 4QBHA 5HE8A 3VU9B 2IS2A 4POAA 2GA8A 2GJ8A 4IJMA 2JLYA 5CK4A 4F38A 1GKYA 4IVRA 2V4ZA 2ZR7A 4XVRA 421PA 3GD7A 1RRPA 3NBYC 4HB3A 5CB8A 2F1IA 1OFHA 4G5SA 1QHNA 1NG9A 4FMCF 3VHXA 4A0HA 1XWIA 2PMKA 1KO1A 4JYBA 1QRAA 2A5FA 2N42A 2ZANA 2ZETA 2C5LA 4N3NA 1NN3A 1QHIA 4E22A 5HZHA 3IIMA 1XMVA 2ZI4A 1GDDA 3RS0A 1N25A 4NE2A 4EPWA 2GCOA 5C2JB 4MRSA 1DO2A 3RRZA 2NO6A 2HUPA 2ZRBA 4L15A 1JI0A 4EAQA 2GEUA 5HKKD 3L43A 1DEKA 3C8UA 1J2JA 4Q1DA 5CK5A 4B6EA 1T0JB 3CPEA 2F43B 1VG8A 2BDTA 1ZW6A 3KKOA 5H70A 1KIMA 1E2QA 1JALA 2VQSA 1EX6A 4G3XA 4ZDKA 1KO8A 2VH5R 1BO6A 2YOHA 4NONA 5KNBA 4MRNA 5M04A 3U7FB 2O8FB 3V00A 1DAEA 1NMZA 3B1VA 1F2TB 4JSYA 3BAFA 4LJYA 2NMVA 1XJCA 4Q21A 2NPIA 1XCMA 2ZRIA 2ZRCA 4RZ2A 4ZPXA 4BQSA 3EX7C 4AYTA 1WF3A 4FW9A 5DH9A 3RS2A 4D82A 4UQOA 1OB2A 2C9OA 2WKPA 3CB4A 2IYSA 3RHFA 1SGWA 2ZE8A 2VA8A 5C4MA 5J47A 2DFLA 4PO9A 2QPAA 2IYQA 1YR6A 2ZPTX 4BPBA 1FPMA 5EE3A 2BBTA 4A1FA 5TMPA 4LYHA 4Q02A 4ON9A 1QVRA 2EW1A 3MJRA 4HAZA 2P5TB 3HR8A 1P9WA 3I32A 1X1SA 2GK6A 1G7SA 4X8LA 4IEIA 2QE7D 4LK2A 1S3SA 2Q9BA 1DG3A 2R6DA 3VX3A 4DLZA 1Z0IA 3QXHA 5F98A 3CRVA 2OG2A 2QBYB 2G3YA 1GWNA 4TQ9A 4KBFA 1U2RA 3IEUA 2GCNA 3GQBA 1VCNA 4A8JC 5JECA 5G53C 4FCWA 4RD3A 2JIZA 2KBFA 2GXSA 5SZKB 2ZJOA 1T9HA 3CZQA 5FUVA 5CDFE 4A15A 2QUZA 1NBMA 2K5UA 2F1HA 4UJ5A 1UKZA 4KLZA 2WICA 1CXZA 3TUIC 2HXSA 3FMIA 1AJEA 4HDQB 4CEHA 1LF0A 4IXMA 1PUJA 1CKEA 1KO4A 3DZ8A 2BMFA 2BJVA 1E0SA 1ZD1A 4TMXA 1HQYE 4OQLA 4TLDA 4V0NA 4B34A 1ETUA 1W49A 4PC1A 3K1JA 2XX3A 2C9CA 3KQKA 3LLUA 3A37A 1YHNA 1F2UB 1EK0A 1NG1A 5E7JA 1F6BA 2P6NA 4ZDIA 2AD1A 1JAIA 4NYIQ 1XD8A 1XDBA 2WV9A 4G01B 1N6HA 2O8EB 2O8BA 2BEJA 2OAQ1 5K8IA 5ELXA 4KV9A 1G8PA 1IY1A 4DLWA 1WRBA 3CH4B 2CL0X 3C5HA 1GFIA 2BJWA 4KHZA 4JVSB 4OK6A 3SEAA 4WZ6A 2G0NA 5AUOB 2I1VB 4M22A 3CIOA 3THXB 3SOPA 4DLUA 2F3TA 2F3RA 4HLUA 3LO5A 4C0AC 5KDOA 3DOFA 1F2TA 4LJ4A 4OQNA 1AA9A 1R5NA 1H8HD 4TQAA 3EXAA 1U8ZA 1N6KA 1S1MA 2BM1A 1E9RA 5FTJA 821PA 1XU4A 2Z4SA 3GMTA 1JNYA 1QHHA 4Q1CA 5FPSA 3VHLB 2AXNA 3W6PA 4Q4JA 4QC2A 4Q7KA 1VYVA 4JT2A 1TQ4A 1MABA 1OV4A 2A3RA 1A2BA 1S0UA 2PCJA 2QMEA 3QVUA 1U0HC 3AM1A 2C04A 4HB4A 1DO0A 4TMKA 2FJUA 2JDIA 1XNJA 3BIFA 4O2LA 1U9IC 4PAQA 1E4VA 1Z2CA 1AZTA 3LQRA 2HCJB 3BFVA 1E1QA 4L4UA 4I1VA 3BWDD 3C4JA 4LBWA 1PLJA 4AY2A 2DHRA 3FKQA 3GPLA 2Z4RA 2WJYA 3GLGB 1ONBA 4WA7A 4M0LA 1N5JA 4B76A 2J0UB 1KDRA 3WBJA 3EASA 1D9ZA 3L0SA 4JVMA 2JLRA 4QGHA 4O3MA 2QRNA 4TYQA 4J0QA 4IW3B 2CBZA 3AP1A 4QBFA 4P4TA 4B3BA 5IRCD 2GAOA 1S4QA 3MD0A 5HE9A 3H86A 2AK3A 4M9QA 2ZRJA 3VR6A 2WJIA 4BASA 4D0LB 2RKOA 1ZD8A 4MGKR 1YZQA 2OFOA 3QNUA 3WNCA 2IYXA 1D2EA 2V55B 2CEAA 1XJ0A 4NH0A 2V8OA 4LSGA 4Y0AA 3D31A 3CUEF 1KO7A 1JEDA 1GAJA 1UDXA 1G8YA 3K9LA 2PEYA 5DISB 4DRZA 1CIPA 2OEPA 2GNOA 3PEYA 1DS6A 1L7VC 2QZ4A 5CLQA 1G7RA 1AIPA 2QMUA 5E7IA 3ZGXA 4XWOA 1E9AA 2QM8A 4AG5A 3FHOA 4F91B 1NVVQ 4UNNA 4WBSA 2QI9C 4RZ3A 5LB4A 1E9DA 1ESMA 3NH9A 4LX0A 1MT0A 3D8BA 3FKSA 5GJVC 1KSGA 2V54A 3PEVA 4A82A 5EJEA 3OHMA 2HV8A 2VHJA 4H1VA 1ZM3A 4F93B 2SHKA 3K53A 2ZE6A 3LBNA 2CNWA 4P33A 4C0BA 4DLRA 3GEEA 4N0DA 2P0EA 2ZSBA 3BB4A 2F7SA 3SFZA 4XWAA 3WNBA 4RSGA 4D4LA 1D6JA 3IBYA 4AG6A 3LWNA 1ELOA 4BLPA 4CEJA 4UNQA 1CTQA 2ZSEA 2PZEA 3V4FA 1ZJ6A 2GJSA 5B57C 2ZAOA 2QNRA 2VSXA 3CBQA 1AN0A 4BLSA 3DO6A 3ZVMA 4DB2A 2VIIA 1BS1A 4Q1AA 2GJKA 2DWPA 4B35A 1IJFA 4ZDJA 1T3HA 3HWSA 5GVSA 5DI3B 3THWA 3QXXA 1GNPA 3KXIA 2ZITA 3RYTC 1TUIA 4BLRA 3B8HA 4BFWA 5FL7A 1KJWA 2B8WA 4PZLA 3UMRA 1JR6A 4K46A 1HA3A 3NIBA 2Y8EA 5FR2A 1BKDR 3BE4A 3LX8A 1U9IA 1XZQA 4OHWA 3KUDA 5BQ5A 1AS3A 4NCNA 4BZXA 2IL1A 1UBGA 2GESA 3BRWD 1HE1C 1T8UA 4LHYA 1EXMA 2RAPA 3WHLA 1JR3A 4PC3A 2ZJ8A 3T1QA 3U7HB 3OFND 2GAAA 4RCYA 4JLDA 4GOJA 3LW8A 3X1XA 4ERNA 4IOJA 2HJVA 4Q03A 5EXPA 5G3ZA 1AS0A 4A6XA 4DCVA 3RABA 3QSYA 1KK3A 4QFMA 2ZEJA 4OQXA 4JT4A 2P2LA 2QP9X 3TGPA 1TADA 4F4JA 3HU1A 1IN4A 2GBLA 3EZ7A 1UADA 5JCPA 2XZOA 3UKDA 4JVLA 4A8JB 1JECA 3TQFA 4V0MA 2CLCX 3P27A 2F1RA 1SXJC 4V0ME 3I4LA 3EIHA 1FZQA 2GVZC 2VP5A 1KI2A 4DDTA 5JJIA 4IFBA 4M1OA 4YXWA 2ERXA 1XFAA 1M74A 3OEED 3AF4A 5JS8A 1UDWA 4ITRC 3WYGA 3AGPA 4EPXA 1R0WA 1Z07A 2V7QA 1T5IA 4YONB 3KXLA 4BWYA 1KSJA 2EYQA 1VCIA 2ZR0A 3AQ4A 5J5CA 2ONJA 3GFTA 2CMKA 4OHZA 1KY3A 1S96A 4RY2A 4E03A 2VP9A 3PUWA 1UEJA 4JL5A 3MWJA 1T91A 4UXIA 3REGA 4QM7A 3UANA 4TL8A 5E7MA 4A0RA 5HZKA 3IEVA 1YZUA 1P9NA 2KI5A 3OIYA 2MSDB 4LCBA 2QY9A 1P2UA 2B7BA 1MO5A 4D4JA 3ASYA 3TVDA 2FNAA 1NSFA 4OL0A 2CHVA 3VMFA 1KAGA 1E9SA 1ZNWA 3GLGA 3U4QA 4M1KA 4JSTA 5E4FA 3ZVLA 3MCAA 5JCZA 4BGDA 4LV8B 1J70A 4Q00A 4A4DA 4MRPA 3VR3A 3CRRA 1G3RA 1YZTA 4JBXA 2WM9B 2ZUDA 4MDEA 1TQDA 1XD2A 4G5RA 2MSEB 4BLTA 4ZCLA 2GCPA 4PC6A 3A4LA 1KDPA 3CONA 4GOXA 4Z8YA 4N1AA 1HEIA 1VG1A 4QOSA 3EPLA 1VHTA 1QVAA 5G3YA 5KPDA 3IQXA 3CKLA 4U7DA 1E2LA 4LJ7A 4DCTA 1CEEA 3FE2A 4DBLC 3AF3A 4NYMR 4XD7A 3WYFA 5A5GA 3V4RA 1Z08A 2BEKA 1SKQA 4JLMA 4OI2A 3GP8A 2ZREA 2H17A 3DVLA 4E09A 2NO0A 3CF0A 1XEWY 2A2ZA 4M9XA 1KDTA 4TL6A 4DZZA 4HLDA 5BN4A 4DUGA 1TL7C 1R0ZA 3GLHA 3B1WA 3BK7A 1UF9A 4URYR 5CLLA 2X2FA 1W1WA 1NIPA 1IY2A 2W2XA 2XB2A 2E9SA 3NXSA 4JLPA 3B1YA 5EE5B 1CLUA 2ZRMA 3RRNA 1OFTA 2GJ9A 3MRSA 3RC3A 4D80A 2IYVA 2ODEA 3EZ6A 2OSBA 3K70B 2CLDX 5CM8B 2KWIA 1ZM9A 5BW8A 4W5WA 5EZ5A 2AFIE 1R5BA 4TLEA 1NL3A 2DFKB 4RVCA 4MITA 1OXUA 3RANA 2WJGA 3KUCA 1NF3A 2QMHA 3CX6A 4C3ZA 1EFRD 2OHFA 3FMPB 1TEXA 2ZJ5A 4JYCA 2BBWA 4ESVA 1GOTA 4KSBA 1QHXA 4Z8XA 1A4RA 4NZYA 5KYKA 2PZGA 4RFSA 3HYRA 1Q12A 3T34A 1KZGB 3R7WB 2NZJA 1X8KA 4H1UA 1IN8A 3A1SA 3DL0A 1P9RA 1ZMXA 2FA9A 2H92A 4UKDA 5FH9A 4CVNA 3WMFA 3QI2A 4UXHA 1OH6A 2VBCA 1P75A 1P72A 2P5SA 4KO8A 3LXRA 1ESNA 2EFHB 3KZ1E 1DBSA 4ZCMA 2E87A 3KB2A 3VR5A 1TX4B 3U60B 2IS6A 1OXVA 2YV5A 1E2KA 4B3CA 3EIQA 1RYHA 1Z29A 4HUQB 3UG6A 3R20A 2QRZA 4A36A 4F7WA 621PA 3HR7A 1E79A 1LB1B 4QL3A 5DHFA 4BFYA 4DLYA 2R65A 4TQUS 4XTRA 4OJQA 5JFGA 1Z22A 5EUMA 5JWRA 4AKGA 2XSZA 3L8ZA 2J0UA 2QE7A 3WY9A 2RGCA 1Z83A 4KFUA 4LY6A 4NKRA 5DIFA 1LTQA 4ZDWA 4C30A 4PHGA 3VQTA 2QAGC 3LX5A 2ZI9A 3VKWA 1G8HA 4Q4HB 2A30A 3TUZC 1EWQA 4M1WA 1KI3A 2QTFA 2YKGA 2GK7A 3DPUA 2JJ2D 2XNSA 1AZSC 1NMYA 1XZPA 3FYHA 4PANA 3FOZA 1ZU5A 2G1KA 3TAUA 1RKBA 5JEDA 1DARA 1E2GA 4MKHA 1K6MA 3Q7QA 3AVUA 4LJ5A 1KHTA 3K0EA 1IM2A 4LOAA 2GEDA 5D3MA 1DAMA 3ZH9B 4JKYA 4LBVA 1U8YA 2J1LA 3IKJA 1KY2A 2ZRKA 5DYGA 1QHGA 3A1UA 4HUTA 3FMFA 2R6GA 5GJBA 1MO4A 3R9IA 3IHWA 1II8B 3K09C 4MYCA 3PV0A 1D9XA 2W83A 4M8NE 1E2MA 2A5YB 4B74A 1RYFA 1G3QA 2WJJA 1XP8A 1NN1A 4OI1A 3BB3A 4D25A 2REBA 4RZXA 1E2JA 2IYLD 3CR8A 1US8A 4Q7LA 4HEJA 4DEXA 4MKIA 2PJZA 2OV2A 3THXA 1F60A 2IYZA 4MRVA 4QNRA 5SZHB 1ANKA 2D2FA 1W5SA 5J4LA 3M1IA 1FMLA 3AKCA 5EE1A 2ZTSA 3MAAC 1KZ7B 1E9EA 1QBKC 2QN6A 3R8FA 5KO2A 3LRPA 2ZR9A 5CJPA 4AURA 4C2TA 1JQLB 3SS8A 3TH5A 3DKVA 3RAPR 1KGDA 2IX3A 2JLVA 4JLJA 2W00A 3NEJA 2ZSFA 1Q0UA 3VNUA 2ODBA 3ZQ6A 4JKIA 2ZI3A 1WMSA 1TTTA 4V0KA 4B3DA 2HT1A 1Y3AA 1S9HA 2W6ID 5EP1A 4MQBA 1ZUIA 4I1UA 2ZJAA 4IDPA 4MDFA 4LPKA 4NTZA 2J87A 3P26A 3OFNA 2HCBA 2V1XA 3EW9A 5G40A 1R10A 5FBQB 2FGKA 4QJ4A 2BBSA 3W6NA 3BH0A 2TMKA 1LNZA 3CPJB 2CDNA 2GHIA 1SXJA 1XEFA 2Q3FA 1U90A 1OPXA 4KLNA 3NDBB 2J46A 1AQYA 1Z28A 1ZVQA 1CJVC 5EXTA 2UZIR 1CF4A 1P7CA 1Q20A 1G6HA 4P4SA 2B21A 3KKNA 1WE2A 4PSVA 2JLXA 4QJ5A 3C5CA 3EWAA 3CWQA 1VCOA 1XTSA 2VF7A 2ZSDA 1E69A 2OE2A 3ZVRA 2ORIA 1M1YE 2W6JD 1GIAA 2EFDB 2CVFA 3BGWA 2DB3A 3R9XA 3OIVA 4BRUA 3HDTA 1D2MA 1IJEA 2PLFA 5HKKA 3KJHA 4IOMA 3CO5A 1NIJA 3QE0A 4ZO4A 2ZRHA 1P3JA 2QAJA 2P6RA 1KK1A 1WP9A 1IXRC 3OEHD 5SZIA 4DSUA 3CZPA 3F0TA 2DR3A 2JIZD 1JQJC 3U44A 3C15C 5EZ6B 5CM9C 3WNDA 1N6IA 3GJ8A 3RRYA 4P3YA 4EFNA 4ARZA 3GLIB 3TSWA 2JLQA 4MUAA 3IGFA 1G16A 4HZIA 2JGNA 2ZYTX 3QPWA 3H4MA 3GLFB 1RJ9B 1DAIA 1VKJA 3JZAA 3TVTA 2NG1A 4URUR 1UJ2A 3W5IA 3CX7A 4DB4A 5B58C 3THYA 1OKKD 3T5DA 3EZFA 1E96A 1H8HA 3T1TA 1Z2AA 2PJRA 4M2LA 1N5LA 4Q7JB 1UAAA 1LS6A 2OO7A 4JIMA 4EFLA 5HPYB 3FVQA 1IXSB 1L4YA 1G64A 3QF4B 4PR0A 2FSFA 1PLKA 5DYIA 5KSOA 2H1LA 2AR7A 3MJHA 1IXZA 2FPLA 4QBIA 3SR0A 4CW7A 4OK5A 2W2TA 1XBTA 1ZM7A 3R7WA 4F4IA 2OZEA 1OFIA 4MH0R 4W5HA 2VP0A 1KKMA 1W4CA 4BFXA 1G291 3IQWA 3OAAA 2GILA 3ZVNA 2WWXA 1W4RA 3T5GA 1Z6TA 2WAXA 1D2NA 1UBFA 1W4AA 3TSOA 1NBMD 1KI8A 3CLVA 2EWVA 4YXWD 5HR5A 2KSQA 2QORA 4NCIA 4JLBA 2NO9A 2B6HA 4YMTA 2CNWD 3K0FB 3HPQA 3AVVA 2PLRA 3VKGA 2R2AA 1KDOA 3I92A 5C18A 2VP2A 2J0SA 1I2DA 2YWEA 1E1RD 1QG2A 4L5BA 1B23P 4L9SA 3B9QA 3M6AA 4N0EA 1ZYUA 4KYUA 2H5EA 3THYB 3HYTA 1HUQA 5L3VA 1N6RA 1LY1A 3EC2A 4UXJA 3W9YA 1G3IA 1G21E 1G7TA 1GKIA 1G41A 2A7QA 2DFTA 1ZM2A 5TV2A 4C7OA 1R4AA 4B2IA 2RHDA 1KSHA 2GZHA 3PG5A 1SVSA 3TJZA 4GMDA 1QG4A 4LC1A 2JJ1D 1ZNZA 3U44B 4PPFA 3G0HA 2QG6A 1NJFA 5AUNB 4B6FA 2OLKA 2PT7A 2ZRGA 1Z6XA 2C8VA 4EUNA 1JXOA 4G5GA 2OCPA 4US2R 3K9HA 5IK2D 4RCZA 2ZJBA 3ADBA 5EE9A 2IF0A 3C41J 4DIDA 1FP6A 4R7ZA 2H18A 4EPVA 1PUIA 2ZI5A 3IUYA 2FSHA 4ACAA 2YWFA 3GJ3A 2JASA 4JS0A 1JR3D 3TQCA 1E9BA 3QVVA 1U94A 3VFDA 5IT5A 4B44A 1RRGA 1ZIOA 4KVAA 4WXPA 1NVWQ 1GVNB 1SHKA 1KK2A 2ATVA 3DMNA 2O52A 1KK0A 1NLFA 1AGRA 2NO1A 1XEWX 4A2WA 1YZLA 2WSSD 4YMVA 1X3SA 2BWJA 4UJ3A 1RRFA 3H84A 2KB0A 3CNNA 1JBKA 2L0XA 3UWOA 3VU9A 1BYUA 3GLFE 4ZCIA 3IIKA 2KE5A 3SBEA 1AK2A 2O8BB 3W3ZB 4B43A 4EIWA 4OJKA 4YC7A 3WP1B 1G6OA 1OXTA 4Q9KA 4Q9JA 1Q57A 1UM8A 4GZMA 1PVOA 4C7OB 1Z0DA 4JLNA 4YDHB 3T1VA 1R0YA 2C95A 4YQFA 4PTLA 5B64A 2YZ2A 1KJZA 3AUYA 3N5CA 5BWMA 3JVVA 1GL7A 1MKYA 3I3SR 1XMIA 4LUCA 2P65A 3BC1A 4FMCB 3SHWA 2D06A 2RHMA 5AJYA 3EPKA 4RD0A 2IBMA 3RS7A 1RPZA 1EESA 2EFGA 4TTRA 4DEYA 5JI3E 4LHXA 2G77B 1TMKA 4Z1MA 3MFYA 3RS5A 4LYFA 3QEOA 4M1MA 3W3AA 1JAHA 4LJ9A 2F9MA 1S3GA 4QJ3A 1SKYE 3DEFA 5FL7D 1ZM4A 3QIAA 4MKFA 5CJ2A 1CP2A 4B73A 1E99A 1US8B 4BE7B 5CITA 5KSPA 1RW4A 2JA1A 4PFSA 1OH5A 1MO6A 3L0PA 2B8TA 4PAOA 3SYKA 1G1MA 2J3EA 1OLOA 5TB5A 2GRJA 4V03A 4OHYA 1XCPA 5E95A 2VHUA 4FI3C 4M4SA 2WIAA 1KNQA 1NI3A 1GG2A 4C0LA 4EQ6A 5JJLA 4WZBE 4DCSA 3NC1C 3I73A 4BFVA 1VCMA 4XOIA 1TQ2A 2QM7A 3O47A 4A2PA 3L82B 4DXAA 5FTLA 3VR4A 5CB6A 2V9PA 1I4DD 1VYUA 1TF7A 1ZAKA 4TYYA 4M1YA 4B3GA 1ZU4A 4ZI3A 1UPTA 3GJ4A 2IHYA 5JHHB 3AF2A 3GEHA 1IBRA 2WOOA 1PLLA 1XXHA 1YVDA 3CF6R 2D2EA 2VPPA 5KPJA 1DAKA 2IWRA 2RGEA 3NWJA 2IEYA 1G7CA 3OE7D 5KU1A 3CPHA 3GJ6A 2WWYA 1OT3A 2REOA 1E2NA 1G3MA 4NL4H 1EWRA 3ZIAD 3OZXA 4E07A 4URVR 5BN5A 3B5JA 5GADl 2AL7A 1TU4A 2GXAA 3T12A 4WXRA 3FWYA 2AX4A 4FINA 3CRW1 4IDQA 2ZROA 2JEOA 1RIFA 4KXFB 3VR1A 2ZYVX 4KYIB 3LY5A 3SC3A 1CS4C 2OAP1 1AQUA 3AVTA 5JWOA 2C9YA 1FQKA 2BC9A 1W0JD 3BB1A 1W5TA 4LHZA 2P3SA 3L0OA 1E9CA 2FE4A 1KMHA 4QGGA 4LRWA 4NYJQ 2NPFA 5E3HA 2VHCA 4HUQA 2QT0A 4HAXA 1NVUQ 1NSTA 2YC2C 4XVQA 2A78A 1DADA 4NMMA 2C99A 1VHLA 2FFQA 2Z6VA 4DLSA 5J4VA 2JLUA 3AKDA 4ZIRA 1LF5A 1O3YA 3W6OA 4B47A 2V6JA 1Z0KA 4FWIB 4UNRA 2ZI6A 2RGNA 1AGPA 3K0CA 3OF5A 1L2TA 2WPDA 2QBYA 3EIEA 2R8RA 3GLGE 5JI2E 2OCAA 1VTKA 2QPOA 5LD2B 2CE2X 4NYIR 4QHTA 2XXAB 3EC1A 4LYAA 4QHYA 2ZJYA 1KYIA 4PAMA 4HDOB 4OI0A 4HDCA 1R8SA 1Q22A 4Q48A 1ZUNB 2D74A 4K8OA 2FPKA 2QSYA 2LWIA 4LBZA 4D81A 5JSZA 1FTSA 1XPUA 5FR1A 4M9SA 5DI9A 3B1XA 1BH2A 3GLHE 1T5LA 2V7QD 4XD7D 1UBCA 2IT1A 3G82C 3IPYA 5JRZA 5JJKA 4GNKA 1LW7A 1YZGA 5AUQA 1DPFA 2BMEA 2FX3A 2R9VA 3EAQA 3LAWA 4D26A 4L9WA 8OHMA 2HYIC 2ONKA 1HH4A 2HLDA 1YR8A 5CYPA 3UG7A 3IIJA 4BEBA 3CX8A 3RVBA 3EPJA 3TMKA 5KNCA 4BZPA 1XJQA 3SYLA 3L8YA 2E1RA 2A5DA 3ZZUA 1E32A 3DZDA 5JMTA 3A4MA 2J41A 3TKLA 3L0IB 4KFRA 1GM5A 1SHZA 2F9LA 3VNVA 3K0CC 3PENA 2BCJQ 5J40A 2Q0HA 5KNDA 2JLWA 1W36B 5LPNA 4IHQA 1A82A 1NP6A 3M0EA 1SKYB 1GP2A 2FH5B 4LJ6A 4C0KA 2IYTA 5JZVA 1E2HA 2C03A 1JXMA 2OCBA 1BOFA 1Q3TA 3P1JA 3NDPA 1K5GA 3LW7A 2ZUCA 2GBLC 5FBWB 5EP3A 3EZ2A 3RS4A 1XD2B 4JJZA 1W4BA 4CEIA 1MRSA 1D8TA 1E79D 1N5KA 4BFUA 3QBTA 2FZLA 3WMGA 1JB1A 2OFXA 3CH5A 1HY3A 3KTAB 1G9XA 3NEYA 3AUXA 3CWZA 4QBGB 3KKPA 1KJYA 4PHHA 1SXJE 1O87A 4CDGA 3GLIA 1I2MA 2Q3MA 2GXQA 5AJVB 2MSCB 1FFHA 2ORVA 4NHOA 4HAWA 5IF9A 2BIFA 2JJ2A 3ZQJA 2H57A 2IS1A 2HDNB 4FXPA 4PXAA 2WWIA 1CRPA 2JAQA 1NJGA 4DCUA 4GDFA 5FBRB 1BMFA 1Z6GA 2HT6A 2I4IA 1E0JA 2IXGA 2VLIA 3Q3JB 4Z51A 1P4SA 2XZPA 2YC4C 4P32A 1UKVY 4PHTA 3CR7A 5AWFC 1NVVR 1LV7A 2GDJA 3SHFA 5BYKA 4DSTA 3WYAA 1OIXA 3KJGA 2FZ4A 3KFVA 2PX0A 2VRWA 1Q1QA 3Q8XB 4TWZA 4CT5A 3WMEA 1P2VA 3QENA 3SJBA 4TTQA 1EFRA 3WHKA 2VSOA 4EJSA 4M9ZA 2WSMA 4EPRA 3SJAA 4BECA 4Q1EA 1HURA 1JR3E 1GUAA 1Z0JA 3U6KA 1M7GA 1M7BA 2GTPA 2J9RA 3N2EA 3AKYA 3SE0A 3ADDA 1OHHD 3ZYCA 1U81A 4S35A 1TU3A 3X1DA 2HJGA 5FTKA 4A0GA 1W7AA 4D4KA 4B3XA 3B2EA 3U2QA 1G4AE 4KVGA 1T4GA 3I8XA 1KMHB 2WWGA 3ZS9A 1U8AA 4QGFA 2IYUA 3EG5A 4OQMA 4XIGS 1HE8B 2IEZA 2CHQA 1OYWA 3W90A 1COWA 2W0SA 2WMOB 1KI4A 5TY0A 5FOUA 4QM6A 1L4UA 3KJEA 3B9PA 3PUYA 5SZJA 2J0VA 5FOWA 3ETLA 4MGIR 1XEXB 1CU1A 3VKHA 1KKLA 3MSXA 4HLUC 4RKFA 1YRAA 3AP3A 4BFTA 3P4YA 3BJIC 2DFNA 1DAFA 3SYNA 1XPRA 4GP7A 4G5QA 2ZQ5A 2XSZD 4LV6A 4LYJA 2ZSAA 3QXJA 1JJVA 2O8DA 2XITA 2CLSA 1MR3F 3QKSB 2Z5FA 4WIAA 4D6PA 4OK3A 1CR4A 2GWHA 1X86B 5A0FA 2FPMA 5BXQC 2AWOA 3KQUA 4RD6A 2IW3A 1E2PA 4OKSA 3K09A 1FMJA 1SXJD 4CEJB 3NBZC 2HF9A 3HP1A 4A2QA 3LBHA 3M4YA 4OBEA 3ADCA 4NPHA 1P2TA 5TARA 4MYHA 3KTAA 1XF9A 3KFXA 3Q72A 1HQCA 3LV8A 2F43A 1MABB 1ZINA 4Q4LA 3SQXA 1OH7A 4XJXA 1OW3B 4Q1BA 3ND8A 4WAUA 2CCJA 2FFBA 5JWHA 2BBOA 1KNXA 4PPGA 4AD8A 3AVWA 2G9NA 3TBKA 2PBRA 4HLQB 4DKXA 4LJ8A 4LC0A 1FUUA 5DN6D 1N5IA 4HZUA 4TSFD 5FL3A 2CE7A 3LDAA 3QXSA 4TL9A 2AHOA 1EG7A 2IYRA 4IDNA 3TSZA 4YLGA 4JLAA 5D3QA 4URXR 2OBMA 1IONA 2BMJA 4LBYA 2IK8A 3OE7A 1QDEA 4CGZA 1RVDA 2R44A 4TT3D 3RSOA 3TIFA 4RKEA 1SVLA 1ZNYA 2ZRLA 1CJKC 4TLBA 1SVMA 3LVRE 4V0OA 3SJZA 4L8GA 1RFLA 1HYQA 2G83A 1N6PA 2YWGA 1C4OA 1E2DA 4RD4A 1KMQA 4JBYA 3B1ZA 1EFCA 1G5RA 4G5OA 5LB2A 3IO3A 3PITA 3PUVA 4JL8A 1GRNA 3QPVA 2DYKA 2PZFA 1KO5A 2IA5A 4QGAA 4EPTA 1X1RA 4Q47A 1QHYA 1LVGA 4C9BA 3DM5A 3QKTA 1A2KC 2HF8A 1Z06A 2XTNA 1OKKA 1CJMA 4B33A 1W0JA 3K0FA 4BLOA 1I4TD 3K70D 4AIIA 1P2SA 3MWYW 2P67A 1NVXQ 4TMWA 2IF2A 2AK2A 5JS7A 1II0A 4XH9B 1TAGA 1Z6YA 2O8FA 4NBSA 3RNLA 1TEVA 2FOLA 3AF0A 1XRJA 1GITA 4ESHA 5GJCA 4R2IA 1VECA 1JPJA 1M2OB 1NLZA 2G1JA 4NYJR 3U3RA 1E0KA 5FUXA 1WBDA 4GOKA 3CNOA 3B6EA 1Z8FA 3BORA 4MYTA 2EYUA 2DCUA 2ZXUA 4P31A 3ZD6A 1CR0A 3Q7PA 3QKUA 3AKEA 1II9A 3OAAD 4G0NA 4PQFA 1MRNA 5L3RA 5KHOC 3U5ZB 2J59A 2BMDA 4IEEA 2Q3HA 4NDZA 4Q5IA 3QF4A 3CM0A 1WXQA 1W0KD 4M1TA 4KFSA 5JLJA 3U61B 5EXXA 2ZU0C 5EXSA 5JRJA 3J81k 2QPTA 4E5UA 2W6JA 3T1OA 3FFAA 2RGAA 1Q21A 2BHRA 1ZD9A 1A7JA 2HXYA 1ODFA 3GLIE 3F3YA 2O0JA 1DE0A 4ZKDA 3NHAA 4LWZA 4AKHA 1IN6A 1H8ED 2C98A 4LPSA 2D7CA 4X8HA 5FFMA 4PHFA 4AKEA 3U7EB 4WVFA 1OF1A 1CJUC 1GL9B 1YJ5A 2FEMA 3HU3A 2R6CA 3N70A 1PJRA 1ZCBA 1G5PA 1IQPA 3C16C 3EPHA 2EFEB 1E2EA 2OBLA 4TMZA 3KXKA 2ZVQX 3THWB 2Z0MA 2ZUBA 5CIQA 1YR9A 4EQ6B 1NLYA 5G41A 3PEUA 2YYZA 5BYJA 3PQCA 2NZ8A 4IDOA 4X8MA 3BOSA 4OYHA 4TZ6A 2XNDA 2EU8A 2Z43A 5KDDA 1OE0A 2CCKA 3K0SA 1IOZA 4QXAA 1SVWA 3K70C 2W6IA 2REXB 3MG9A 1NKTA 4DLVA 2ZJZA 4Q1FA 4ASUD 1DAHA 1SULA 1T0HB 2BKEA 2C77A 2WWWA 3PVSA 4P0TA 3LBIA 2CVHA 2YOGA 3EA0A 4RZUA 3KKQA 4JMPA 4ZIRB 5L3QB 4PO8A 5L3SA 3KQHA 2HEIA 3U4QB 5FBVB 1N0WA 4HB0A 4JZKA 3RS3A 4K81B 2JJ1A 1N0UA 2X2EA 2WAYA 3GJXC 2O0HA 3FTQA 3T61A 5KOYA 2IUTA 3SFVA 2ZRDA 3OESA 1G8GA 3DKPA 4EPYA 1T3SA 3K9GA 1WB9A 2H16A 1M7HA 1Z47A 2DWQA 3NC0C 4H9GA 2XTZA 4I81A 4U02A 4CF7A 3QG1A 1M6NA 4TLAA 3K0AA 4JVNA 3PEWA 1VYTA 5K8LA 2QQ0A 3IO5A 1R5OA 2Q9AA 2IYYA 3TK1A 3A6PC 5JSZB 1HV8A 4HI0E 1Q3HA 4PSAA 4Q9IA 1U99A 2IC5A 4QG7A 3HPRA 5JEEA 2WOJA 5EUQB 3OIUA 5KTYA 1E1RA 1E6CA 2D62A 2YJTD 3CW2A 5CIWA 3ZJYA 5HTKA 3TW8B 2WSSA 1GNQA 1GRQA 4GI7A 2N1BA 4MRRA 4KFTA 2FFAA 3O8DA 4UNPA 2HLDD 2KJQA 4TMTA 4D0NA 3BBPA 2J7PA 1G8FA 1T3LA 1QHSA 2R62A 4TL7A 1YZNA 2GVDC 2GXUA 2FV8A 4L16A 4O0MA 4AYWA 2FSGA 2FN4A 3I61A 3EZ9A 4RD2A 5FTNA 1N0VC 1EFUA 2W58A 2GZDA 4C0SA 2XJ9A 1OIWA 1PZNA 1IAQA 2FF7A 1XMJA 4U5XA 4CRWB 1DTSA 1M8PA 2KBEA 4NP6A 5L3SB 2GF9A 3GFPA 3AEZA 2FMXA 1N2CE 1TF5A 5FPYA 1MO3A 1Q1ZA 2BVNA 1MH1A 2RMKA 4NU0A 3TW4A 1DELA 4OHVA 4FCTA 1NKSA 2F1JA 5C46F 1F3OA 4TLCA 3SN6A 3WRXC 4US0R 1FUKA 4WOPA 1KI7A 2QROA 1ZBDA 3VTKA 3ZLJA 2C78A 2O5VA 2IUSA 4RFVA 5D3MB 1KSFX 3PUZA 4KITB 3TNFA 2QGNA 3H2YA 2XTMA 1DVRA 2GJAA 3QF7A 3A1TA 3ASZA 2NTYC 3RLFA 1NNEA 4IOLA 5AJWA 3U3JA 5DE3A 1KI9A 3LD9A 1JPNA 1OXSC 1RE0A 1RJ9A 3Q85A 3A4NA 2WPDD 3RRMA 1X8JA 3FB4A 5F3WB 4XWKA 3C14C 3AVXA 3I5XA 3SJCA 1X8LA 4DSNA 4JLOA 1SVOA 1UBEA 3ONWA 4GT1A 1F2UA 3U3MA 2X8AA 3KDSE 4DDVA 3ZIAA 1N3BA 1XCGB 3SQWA 3JVUA 2J5XA 1R2QA 2OESA 4GRAA 1VIYA 4OQFA 5FUWA 4URWR 2VP4A 3VX4A 2LKDA 2ZVPX 1ZUHA 3A1VA 2UKDA 4IKEA 4LGMA 1YQTA 2G6BA 4FMDF 3HU2A 4AYXA 1A1VA 3KQLA 2Z83A 4D0GA 1GKUB 4BUJA 1FL9A 4XVUA 4KJZA 4LJAA 2PL3A 4IDHA 1Y63A 3LVQE 2XXAA 2FFHA 2X19A 3TRFA 4R71A 2W0MA 4DHEA 1GSIA 3T06B 3BERA 1GZSA 5P21A 4Q4AB 1RC8A 3DMDA 4KU4A 2WWHA 2R6FA 5DSZA 5KDLA 1SVIA 4Q19A 4IRUB 4Z1MD 1BIFA 1HT1E 1JJ7A 2VEDA 4QRHA 4YMSA 4DDWA 2VO1A 3MWKA 4DCNA 3QEJA 1CJTC 4A6PA 4QKQA 1OIVA 2DWOA 3R8CA 4DC9A 3PCRB 3V9PA 4NYMQ 1AKEA 3EWSA 4KI0A 2UZ3A 1OB5A 4DLTA 5EP4A 1SZPA 5EP2A 5IK2A 4LDJA 4B48A 4PO1A 2EVWX 3JZMA 4US1R 2ECKA 4Q9LA 4FWTA 3FHTA 2ZS9A 1AM4D 2CCGA 1IHUA 2QENA 1TF2A 2NQ2C 2AKYA 5J4YA 4QNMA 3IILA 2ZYWX 2YHSA 3QKSA 3UMSA 4W7SA 3PXGA 1NY6A 2CJWB 4R9UC 5FOSA 1YRBA 1AS2A 2FSIA 2O8EA 1KAOA 2IYWA 4ABYA 5LBIA 2NGRA 4YDSA 3UWKA 4ARZB 3RDPA 3QXCA 4V0LA 5FPHA 1DG1G 2ZM5A 4CEIB 1FX0A 4F4CA 2ZRPA 1BYIA 2OFWA 3L2OB 4GBMA 4XSGA 5DHAA 5C1BA 2GZAA 2H7VA 2NIPA 4HZUB 1Q1EA 2GCOB 3QJYA 1ZNXA 3W34A 1NN0A 3QQ5A 4HAVA 4Q66C 3VAAA 2CK3D 4B3FX 2YOFA 3KKMA 2QAGA 2AFHE 2VTKA 3QPUA 4JLVA 4PZYA 4TMVA 5KUTA 2OBNA 4DJTA 4G1UC 1XTQA 1KOFA 4HATA 1Z6AA 3GJ7A 3WXMA 2ZIAA 3WP0A 2JDID 2D3WA 2OUKA 1SXJB 4OHXA 4LI0A 3K9NA 3MGCA 1IN7A 1G20E 5FOTA 1NRJB 3BH6A 3RC8A 2QEQA 3B78A 4Q01A 2PH1A 1OFUX 4HB2A 3RWOA 4O2RA 3PFIA 1SVKA 1T6NA 3SU8A 4KBGA 3AVPA 2I1QA 1C9KA 5AJXA 2B92A 1J7KA 1GTVA 4GMXA 2Q6TA 4HAYA 5UKDA 1ZC3A 3ND9A 5JBQA 2ZJ2A 2JCSA 2OXCA 1YU9A 2DY1A 4MA4A 2IUUA 1IY0A 1CR1A 3P20A 4DLXA 1CBUA 5EE0A 2GKSA 1TNDA 4LHVA 3X1ZA 2F6RA 2FEOA 5DLQC 2XOKA 3KX2A 3QKRB 1IN5A 1WA5A 3ZZ0A 2O0KA 3GJ0A 3REFA 3QOFA 4EKDA 3ADKA 3CF2A 4GZLA 3S1AB 2QGZA 3QKRA 4B2PA 4W9MC 3QUSA 2A5GA 4CEHB 1CRQA 4AKIA 3UXMA 3SNHA 3Q9LA 4AK9A 1Z63A 4A92A 4W5JA 2WTUA 3KB1A 1G19A 1VG9B 2AKAB 1FNNA 2I3BA 1P61B 2FGJA 2ASEA 2ORWA 3FFBA 4JJKA 5FPKA 3ZD7A 4GL2A 2WVJA 1V5WA 1P5ZB 5TVKA 1E94E 3BS4A 4BRWA 2LKCA 2ZE5A 3TR0A 3T35A 1R8QA 1E1QD 3IPXA 4C2UA 3FHCB 521PA 2PX3A 4EDHA 2NO7A 1TQ6A 3P4XA 1FP7A 1KI6A 4GP6A 4M21A 4EFMA 2WZQA 2WMNB 3OEEA 2EWWA 2BM0A 5H68A 2FG5A 3ZDQA 3O8BA 4PZZA 2JATA 4F92B 3AH8A 2BKUA 1FX0B 2F55A 4TTPA 4TYNA 1OH8A 5F9HA 4YMUA 2RGDA 4D4MA 1E9FA 2G88A 4URZR 3AB3A 4V02A 5TDHA 3H0KA 3F5FA 1Z0AA 2QAGB 4BFSA 4S2EA 1W48A 4TYPA 1S1CA 2RGXA 3FGNA 4KSCA 2X77A 4PPQA 4TYWA 2B7CA 2RH5A 1R6BX 2H8KA 3MLEA 4HLCA 4B71A 1S2MA 3NBXX 4KCGA 4I99A 5FTMA 3QY0A 1XXHE 4CT4B 1J90A 3H1TA 1X6VA 2ZE7A 2ZU6A 4BFZA 2BOVA 4Q7MB 1OSNA 2ZYUX 2ANBA 2D7DA 2J7KA 3Q5EA 1YKSA 1COWD 2NOAA 3D3QA 3ECCA 5JHGB 4Q9HA 3I62A 1WQ1R 2ATXA 3NBFA 3D7MA 3FMOB 1G5TA 3LA6A 4JBWA 3GEIA 1VMAA 3PUXA 2XAUA 5HCIA 4DIEA 5TXGA 3PR1A 1W2GA 1EGAA 1W36D 3UATA 1WDTA 4C0HA 1RZ3A 3LQQA 3NH6A 1MOZA 1ZIPA 5AR1A 1E2FA 3CRMA 4IVQA 2IHBA 4BEJA 1DAGA 1KI6B 2N46A 3DOEA 3FPAA 4PC7A 4XTCS 5CYOA 3SBDA 4A8JA 2IXEA 1G17A 5FUYA 2CL6X 2GF0A 5HCNA 4B75A 2CHGA 2YINC 5A4JA 1TUEA 2WHXA 3SDZA 4M1SA 4RFSB 2AD5A 2V6IA 4NCJA 1QF9A 2QP4A 4PSKA 5B2ZA 5ANRB 4IXNA 3W8NA 3U3KA 2WWFA 1NBME 2YVUA 4Z54A 2XGJA 4QHSA 1E0AA 3B13B 2J0QA 3B60A 1U0JA 1OHHA 3N2IA 1XTJA 2C96A 3ZZTA 3ZS8A 4R98A 3A58B 1TPZA 1F5NA 3D6TB 4PX9A 3E2IA 1FOEB 2OILA 1G3UA 3UMFA 5J4KA 1KI1A 2ODWA 4IVPA 1I4LD 3RSLA 1Z0FA 4DT1A 3B82A 3X2SA 4GSYA 5DNYB 3GCGA 2O8CB 4GFDA 4DVGA 5FOVA 2PEZA 2RGNC 2HYDA 3IHLA 2WKRA 4A0FA 1R7RA 2XEXA 3O8RA 2YWHA 3EARA 4U00A 4Y0VA 2VP6A 2QT1A 2QTVB 4TT3A 3RWMB 1UFQA 221PA 1L8QA 1N6OA 2WBLC 3WRYC 4ASUA 5LD2C 1CULC 4NCHA 5DGXA 1XPOA 2BCGY 4A9AA 1XXHB 2DPXA 3AGQA 1W46A 3KQNA 2QQEA 5BN3A 1YE8A 4FMDB 3TE6A 2FDCA 1UKEA 2MMCA 1W2HA 3OIWA 3BXZA 1XB2A 5F9FA
chains in the Genus database with same CATH superfamily
4EA7A 1FMFA 3DFUA 4WFJA 5AKEA 2X3YA 4RULA 1SH7A 2YFHA 3SFTA 4FX5A 3WQRA 1N1MA 5FXMA 4HSEA 4ZT7A 3DZBA 1D0VA 4RDHA 4GXQA 5T4FA 4P34A 3KEMA 3PDIB 1CUYA 1V43A 2AXPA 4ACBA 1I7PA 3FDFA 1RI2A 2IQIA 2A5LA 3STWA 2RB4A 4FDMA 1TOAA 1OJLA 1PZGA 1R12A 1W5FA 2NXJA 1KORA 3WSWA 3NPAA 1NT2A 1BX1A 1UPBA 5CFOA 2G0TA 1YVEI 5EIAA 3MUOA 4I3GA 2IV3A 2ADOA 1Y7PA 4XFKA 2PQMA 4FSXA 4TSFA 1Z5ZA 3R1IA 1PEDA 3LQ2A 4X60A 1XMSA 4WKCA 2R68A 1JHQA 1QRTA 3D2CA 2ZS7A 3PA8A 3DTVD 4ILEA 6Q21A 2Y93A 3IX7A 1Z5WA 4F2PA 3EGDA 2IEIA 3MJDA 1XDSA 4H3HB 4BPRA 1LRLA 2PAAA 2ZSJA 1P7VA 4IAOA 1QM5A 4B83A 4LQLA 3VR2A 3G8DA 4P4UA 4WZAE 1TYEB 2WFLA 3LBAA 1E4YA 4NNJA 4C0JA 2Y05A 4MWEA 1A5TA 4DCJA 4M0PA 5IHPA 1JDPA 2ZSIA 3A0UA 4BV9A 4C7BA 1WZ2A 3TFQA 5D85A 3RRXA 2C5GA 2J08A 5A3JA 3TI9A 3P9QA 2B99A 5AKZA 1JG1A 2XIQA 5H1YA 1IE3A 2P6UA 1Z2PX 3QKWA 4G23A 2JLZA 2P9ZA 1GAEO 3DEJA 2C7GA 3L7IA 4JUBA 3A4YA 3SX2A 2QZ9A 3OO0A 1Y1RA 2QV7A 4DT1B 4Y2YA 4EW6A 4FZ5A 3SSOA 3DZCA 1L1RA 3MIZA 5HZMA 1PT8A 4MW4A 4FFRA 2VYFA 4M0UA 3KSZO 4EYGA 2A5JA 1E58A 2OORA 3ODGA 1CUCA 1UC5B 4P1ZA 1JXAA 2H5JA 2QRMA 3GK3A 1I01A 5J1SB 1G4UR 4G86A 1NM5A 4EL0A 5H8WA 3HKDB 1VMIA 3F8TA 1B3BA 4R2JA 3D1VA 5HFAA 3ZGVA 5IANA 4DF3A 3BFKA 3G8CA 4UZSA 2DETA 3L1UA 4BQRA 1LGYA 1T8TA 4YQZA 1E66A 3UIEA 2FEPA 1OYYA 1A3CA 1NY5A 1RC1A 2JGKA 1E1LA 1Z3IX 2VQDA 3ELUA 4QFBA 1XMPA 3CNLA 3J81A 4TZ0A 4KODA 4RLFA 1EFHA 5CDFA 3PGA1 3HLTA 4AM8A 1OWPA 4DWJA 5DNUA 1APBA 1BN6A 1QH1A 3QHPA 2IITA 1H3FA 2P6OA 3X1JA 3BGIA 4CV0A 3WGHA 3HB4X 5A7GA 1K0UA 4Y9UA 1GRVA 1II8A 3FOBA 3MCZA 2P9BA 4JROA 3D59A 3NNNA 5LNK6 2Q5CA 3LFHA 2ZS8A 4KKVA 1Z4LA 3RVJA 3DAYA 4UM9B 3DKKA 4A73A 2GLTA 4GVPA 3QLVC 1JPVA 1KBZA 1P45A 2IXFA 1H65A 2X8BA 3C3KA 3KUKA 3E22A 1P5RA 4JL6A 5CBPB 5L7WA 4GKKB 4KNWA 2AOVA 1T9DA 1J0XO 3I0MA 1IN1A 4I1OA 1WKVA 1ISMA 2Q3JA 1E98A 3CFYA 4C20A 3KM0A 5HIJA 4B2LA 2WJVA 1QAOA 3BD9A 1SVNA 1YUMA 1CQWA 1SC1A 5LIRA 3OZTA 1USVA 3INTA 5CB4B 3TUJC 2VS1A 3OOYA 2PTHA 5J58A 2IZOA 5ALWA 2AKEA 2JL1A 3CSUA 3FVTA 4IF4A 4O25A 3JQQA 4GW3A 4Q18A 5KNCH 3RADC 3GJQA 1XQWA 3WIVA 3G8YA 2CK3A 3GJ5A 5BUQA 2W2VA 2I91A 1SQ6A 2OENG 2WIKA 2AWNA 3NVAA 3QJ5A 3GT3A 1RC0A 4S05A 1E3MA 1QO0A 3F7MA 5FUQA 1BE6A 1NMXA 4DDUA 2AJBA 2FPGB 5FPTA 2DPGA 1HG1A 2XYVA 3WB9A 5I9LA 2HREA 1WPXA 4MCHA 1WIWA 3G9XA 1WNTA 2IP2A 3OEHA 4CZ2A 721PA 3R9WA 4FMBB 4MPJA 1CY8A 2A1UB 3WISA 5L9AA 1KQFA 1WEHA 4PVDA 4QXQA 3GUHA 1TIPA 1VIAA 2R47A 1RABA 3FXAA 5CFRA 3IL2A 1BEUB 2QP3A 2IZ5A 5FWAA 1H4QA 4J03A 4PZ9A 4H6XA 4NJEA 2ORYA 5ER9A 4W5OA 3PS9A 3A36A 5FI0B 1T5OA 5IHXA 3UPUA 1YZHA 2A14A 2Q3BA 5H4HA 3WC4A 4DMRA 5LDHA 3S3TA 1YA4A 2EX4A 1W47A 2CVQA 3G2IA 4IUDS 4MPTA 4NBTA 3I1FA 2QA5A 1CUGA 1LBTA 5ECWA 1R6VA 2P6PA 2ZB4A 5AJZA 4II7A 4DA7A 4ECAA 2HCRA 2QVZX 5DHRA 3WYDA 1QCCA 2YWXA 3UK6A 3W1VA 1ZITA 4ZEMA 4Z5XA 1VG0B 3N7AA 5L4NA 1OBHA 1JLKA 1XMOB 1XX6A 4BJ1A 2O8CA 3LVBA 2W6NA 1N2SA 3P9XA 3AFNA 3BGSA 1W0KA 3DCNA 4GGPA 4PWYA 4PQYA 1E2IA 2FWRA 2XQIA 4L5AA 4MQEB 3RUFA 3U0VA 4A6DA 4XRGA 2XIJA 2CUTA 1NHGA 4CFZA 3L8GA 2C7RA 1P4JA 4WN9A 1D5CA 4EY3A 1D3AA 1KETA 1YZKA 1ZMRA 2UZ1A 2G06A 4U63A 3T9BA 1ID8A 3IXLA 4ZO8A 2AR9A 1GNRA 2FQ1A 2VWHA 3G2OA 5LDDC 4FD2A 4BKPA 2PGAA 3GLHB 4PM4A 3DOIA 2GEVA 1CR6A 1V71A 4AXBA 4ZQFA 2E1PA 3DHNA 3E1SA 3PBKA 1GCAA 3LFUA 5HRCA 5KJCA 1KDZA 2O4CA 4G4SO 4MGEA 4KAFA 5HE8A 3VU9B 4POAA 2GA8A 2GJ8A 3GZNB 2X42A 4IJMA 3X44A 5BWOA 3ODPA 3PHHA 3AKZA 4L6CA 1HEYA 1DX9A 3WMXA 3PQ7A 1HMPA 4P53A 5AHRA 4E2FA 5CH5A 2A5FA 2VWGA 2ZANA 3VR6H 4BFLA 5BSKA 2PUGA 4N3NA 3LWDA 4WNAB 1YB6A 2HBYA 2VUTA 3FPCA 3AMVA 4LF9B 1YS2X 2ZT8A 5HZHA 3IIMA 2ZVDA 1XMVA 3W9UA 5JROA 3G2QA 1GDDA 4NE2A 4KQJA 1NJ5A 4MOWA 4RK4A 1PL8A 3E4DA 4DG8A 5TEVA 2XVMA 1C7ZA 2RGUA 3DMTC 3QPCA 2DPYA 2GEUA 3QVOA 3QYAA 1NPTO 1DEKA 3GGPA 4KK4A 4Q1DA 4CKEA 3FB1A 5IJZA 4D8YA 4B6EA 1T0JB 4CLDA 2AN1A 3EMBA 1DT5A 5KC8A 1KIMA 1JALA 1D8AA 2GFHA 2VH5R 2RHGB 4WERA 5A7HA 1DEXA 1BO6A 1JWBB 1ADJA 1Z2NX 4XYBA 2QF7A 1JQBA 4ALMA 3U7FB 2J3KA 3RF7A 3L18A 2JC3A 3BAFA 4ZQEA 4Z0TA 2R48A 2RHWA 4IRXA 4MA0A 4ENTA 1E3QA 4BQSA 2ATCA 3RS2A 4UQOA 1OB2A 3LQFA 2WKPA 3CB4A 3MW8A 4QBTA 4WGGA 5C5DA 3LHKA 5JYCA 3CSSA 2F8TA 1Q3KA 5C4MA 3IUEA 4PO9A 1K27A 1AGXA 2JFHA 2BGKA 2UZ1B 2BW0A 2QW0X 4OO3A 5JPIA 1EZZA 2XMRA 3UUFA 1U4OA 2IYQA 5TMDA 1HE3A 2ZPTX 2YN2A 4UU7A 3GP5A 4IEFB 2Q4EA 5AI0A 1X0XA 4HAZA 5DNVA 2XR1A 3PXUA 3HR8A 1N8SA 1P9WA 3C97A 2JFZA 3I32A 2HDOA 3P45A 2OZKA 1LD3A 3OZCA 1ZL2A 4MEBA 4RS4A 2QLMA 4F5YA 4LK2A 2R6DA 1ZQ9A 1Z0IA 4J6EA 1UMDA 1DPGA 2CXQA 2BL4A 4JC5A 3I2JA 5KJFA 5I4BA 3QVXA 1RZUA 1M3SA 2O50A 3GVPA 3T3MB 2P5UA 5K0ZA 4KXYA 3UFXB 1PJ3A 3U4IA 3DNMA 4FCWA 3WG9A 4C3OB 1JG3A 1YJ8A 4JOSA 2JIZA 2KBFA 1QIFA 4FX2A 5SZKB 3GD5A 1T9HA 1THZA 2A9VA 5CDFE 4A15A 2QUZA 2IPXA 4JYPA 3IR5A 3JQ7A 4UJ5A 2HDWA 1HE4A 2O3UA 1UKZA 2RC6A 1NNUA 1J39A 1J42A 1FRFS 1OXKB 3PIDA 2Q41A 3HRKA 2WICA 1P8AA 3CYFA 4WESB 4F3YA 2X76A 1NM5C 4HDQB 3BRSA 3UXYA 2XUQA 1Y4ZA 1HG0A 3GJTA 1CKEA 2DAPA 3JQDA 3WL5A 2EJVA 3DQQA 3ELYA 1M2EA 3CRNA 1KU0A 4OAQA 4DWOA 5IUNC 4OQLA 4TLDA 1ETUA 4R1PA 1RWOA 5EKUA 1VE1A 2XX3A 2CWDA 2C9CA 3PPYA 4L8YA 3RU9A 3KQKA 1DIBA 4IH9A 3A37A 3NANA 3RTAA 5BWBA 4CMIA 1F2UB 1N4AA 3AZOA 1J56A 1RKQA 4C78A 2JRCA 1NG1A 4FFWA 1ORRA 5E7JA 1JTFA 3RBAA 2PWZA 1JAIA 5FAKA 1QC5B 2ZKLA 3JQ9C 4R2WA 4RVHA 2WV9A 4WCFA 1X1EA 3RS8A 1HFKA 4I5IA 4G67A 4I5EA 3ISVA 5K8IA 3IEPA 3F74A 4KV9A 4WBXC 5LZ8A 5T64A 4Y3UA 3UOAB 4RDXA 1SZDA 3ACCA 1IY1A 4S1WA 4DLWA 1WRBA 5F33A 2EP7A 2YFQA 2NQTA 3ASUA 3D7NA 5FJJA 3A0RB 2BJWA 3IAM1 1AKTA 2P11A 2C3PA 2VNAA 3R3UA 4OK6A 3SEAA 3ZNOA 1BZYA 2G0NA 3OT4A 2ZYHA 4MYSA 2F3TA 4HLUA 3LO5A 3DB1A 5ALUA 5KDOA 4OUKX 5I45A 3FRIA 4TVSA 3VR0A 3OMXA 2M6LA 1P7ZA 1U8ZA 2J9YB 1SC4A 1E9RA 3HYLA 4K9KA 1XU4A 821PA 1RYDA 2IXDA 3EEQA 5IW8A 1LRKA 1SBHA 3FTFA 2AXNA 4J1TA 4GR4A 1VPEA 1WV0A 4LI3X 4QC2A 4AZ0A 4BNIA 4JT2A 5IABA 4ZICA 3DAGA 3GRPA 1MABA 3RFVA 5E4JA 1OV4A 3MWFA 2AB0A 2R5NA 4RVSA 3ETEA 1M33A 3O4HA 3ORYA 4P58A 2C04A 1U2DC 4HB4A 5AQEA 3TBFA 5A4DA 1DO0A 3D5EA 4M9RA 4ZVSA 1XNJA 1QYWA 5AW4A 5JNSA 4BNJA 3JD2A 1RLIA 3GIDA 3MLAA 3HA5A 3QLJA 3TOCA 1CZLA 1SCKA 2BFOA 1Z2CA 2FPUA 4KWTA 4EKYA 1H22A 4MUMA 4G0PA 4AY6A 3L8DA 4Y67A 4EGCB 4HBZA 4BE4A 3DDWA 4PTZA 3DAOA 2VDLB 3NASA 4AZ3A 3BWDD 4BY9E 4LBWA 3WGTA 3AY6A 3A04A 4Q3OA 1VE6A 3QEAZ 4GKJB 3FKQA 1OXBB 1MB3A 4L7VA 4LX8A 5KWJA 4MLDA 4DBZA 2VDNB 5BV8A 3FRHA 1MIOB 2J0UB 5BYBA 3VR5D 1D9ZA 1VHQA 3M70A 1GNLA 2D8AA 4LVUA 3ROPA 3DCYA 3TLZA 1I2ZA 2AUNA 4IW3B 5LZ9A 1T5SA 4QEDA 1IATA 5KVAA 1QAQA 4QBFA 3E6AA 4MS4A 4BNWA 5HE9A 2O14A 1YL6A 1IPEA 5C1DA 4D9BA 1U0TA 4N01A 3FWPA 1T5HX 4D99A 4D0LB 4L7QA 1NVEA 4FEEA 2NT3A 4WACA 4C5CA 4ZCTA 5CLHA 5LZ7A 3QNUA 2AN4A 5JSKA 5AOAA 3RW9A 2CEAA 1XJ0A 4MVXA 5DP1A 4QGSA 5AD1A 4DQLA 5AVVA 5KVCA 4REQA 4G85A 4LSGA 4KPEC 3D31A 5EJAA 3DD1A 3SM9A 1KO7A 2GCEA 2ZIZA 4YP7A 5AK6A 3K9LA 2O2XA 4N6GA 1OXMA 3NDIA 5DISB 1LDEA 5L7YA 3VPCA 1TCBA 2FQWA 4PLPA 3RK4A 1QX3A 1E1KA 4QUDA 1W96A 3EXHC 5EMMA 3V6LA 5CTJA 2AIRA 1G7RA 3AI1A 5E7IA 1LDNA 4RTRA 4L4ZA 1E9AA 2QM8A 2X5OA 1RXEA 3FHOA 1ZGCA 1LC0A 1URPA 4UNNA 3DWFA 3JSAA 4WCVA 4RZ3A 3GDGA 5LB4A 3VA7A 3RB8A 3K0BA 2NUBA 4HRYA 3R8XA 4RE5A 4Y6SA 4A82A 1JIVA 2VHJA 3AY7A 4JOCA 1T4DA 1ZM3A 2GN9A 1GPH1 3S40A 4BMSA 2FAXA 2SHKA 3LBNA 4KKXB 4ZAZA 2JBHA 3GA0A 4ZO9A 4B9EA 3MYRA 3D3KA 5DWVA 1Y8CA 2C7PA 3VJMA 5FYQA 1ZO8A 5D87A 1YMQA 1FP1D 1RP1A 2QU7A 3OJFA 4BLPA 1M6EX 4UNQA 3DPSA 3TLMA 5TEWA 2ZSEA 2PZEA 4ZAGA 3V4FA 5CA1F 1HE2A 1NLMA 1FFYA 3OX3A 3H99A 1Q0HA 5KYUA 1AKQA 1A7KA 4RCVA 2B83A 3STYA 4F8YA 2PZMA 1BWRA 2ON6A 3NWEA 2Y1DA 1MJGM 1QONA 3CBQA 1AN0A 1QH0A 2WDPA 3FSEA 3LOPA 4Q1AA 4B35A 1UKCA 1JQEA 3A70A 4XM2A 1T3HA 5LBUA 2Z3ZA 3HH8A 1EBBA 4YAEA 5EOVA 4EKEA 3G0DA 3VO1A 2Z9CA 1PCXA 2ZITA 3D1LA 3IKMB 5IXSA 4CKCB 3R3ZA 2C42A 2BUAA 3C7CB 4LDNA 4EA6A 3DWEX 1U5AA 1KJWA 2B8WA 3ONDA 4PZLA 3UMRA 4YCLA 1UODA 1Q7EA 3NIBA 4JR2A 2ZUSA 1W87A 3B3AA 4K1LA 1BKDR 3BE4A 1CQJA 4J75A 4N0MA 1U9IA 3ER9A 2OCLA 4G9EA 1AS3A 1B6GA 2WSYB 2JD2A 3ESZA 2EBUA 2OB2A 2VXOA 3P9CA 3PEEA 1SKUA 4NK5A 3FX2A 4A8TA 1GN9A 3FPBA 3KOUA 3RPEA 1YCHA 5CT8A 5C8DA 4I08A 4WLOA 1ADFA 1B0ZA 1FDTA 1EXMA 1YS9A 2B69A 3EQ8A 4LOJA 4O02B 3MJFA 4LHEA 5COBA 5CRIA 5G4KA 4E14A 3T1QA 3UT6A 5IAOA 3NUZA 3FA2A 2VATA 1WUKS 1K9SA 1OTXA 1VL2A 2WAMA 5K8JB 1P2FA 4AQYB 1X7XA 3WJ7A 1CEEA 2GAAA 4RCYA 4ITUA 3TZQA 3TIXB 1V5EA 3L4SO 1TC2A 3QBJA 3T38A 4Q03A 4P9NA 5EXPA 5G3ZA 1SCQA 1AS0A 1DMRA 4CMEC 4DJDC 4EGFA 3RABA 1KK3A 1VSUA 2Y1EA 4JT4A 1IM5A 3NHPA 4BP1A 1P18A 1JP7A 2DH5A 1KQ3A 1JHYA 1TADA 3BE5A 3BGVA 3FNBA 3PWZA 2GBLA 2OKGA 1RJFA 2XZOA 2JKZA 2VT3A 4UCWA 1JN0A 1I1NA 1U28C 3NCTA 4XB6B 4YBRA 1SG9A 3TQFA 1S2IA 2VJQA 2ZBQA 4AO8A 2GVZC 1KI2A 4M1OA 1PYGA 2V03A 1ICIA 4NIMA 1XPJA 2IOQA 4XUDA 5GGYA 2IYOA 4ER3A 5A71A 2A6PA 2I29A 3OVMA 3SSMA 4EG6A 2GYVA 3EXEA 1I0LA 3KFLA 3OBIA 2ALJA 3KXLA 3OA2A 3ZZNA 4ENQA 4IQFA 2PE5A 5J5CA 3DMTA 4FYHA 4OQDA 3WYBA 1SK8A 2XUPA 2I0FA 3O3CA 4Z9FA 1YCDA 5LUAA 1KVRA 1Q0RA 3SJ7A 3JRNA 1WW8A 1TXGA 3DBRB 2FB9A 3TAXA 1L5ZA 1F7UA 3VVMA 3UANA 5KNLA 4TOIA 3IEVA 3LCMA 4PIPA 2WWVD 3WYNA 1YZUA 2YVAA 4KTTE 3NV7A 5C9ZA 1AGNA 3LS2A 3BJZA 2B7BA 4EECA 3W1EA 1EDZA 2JCVA 2FSSA 3ASYA 3VAZA 4L73A 2P9QA 1LLQA 1VA4A 1TA4A 4OAOA 2QJRA 3AR7A 3TQOA 1PGQA 2OZLA 4TS1A 3FZGA 4J3FA 3UB2A 1Y6ZA 4IXDA 5AK4A 3IBFA 1BQ3A 1KYZA 3DLTA 1PG0A 2QVXX 2XUOA 4YN3A 3T41A 4O1IA 4B80A 4AJ2A 4Y98A 4FYVA 2H0QA 3GUCA 4FYKA 5E4FA 1LW6E 4LV8B 3F9CA 2D1QA 4HKTA 1VBMA 1T8PA 4JBXA 4HH0A 3QTTA 2CC2A 4QUGA 3IAFA 3T7SA 2WM9B 4OUDB 3ZXXA 1OTHA 2UUBB 1KP9A 1TMGE 3NHSA 4TVOA 4YTEA 5EXDA 1Z4QA 3P2JA 3TSAA 4CDRA 3WLMA 4BLTA 4E3ZA 4CR8A 2H1CA 3ROZA 5JS2A 3ZWQA 3DGFC 3C6XA 3FY4A 1VLJA 3BXFA 3ONVA 1WCIA 2P5YA 2W7TA 4HWGA 3WK6A 5SYAA 5EWLB 4E2ZA 3I53A 3O4FA 4NULA 4BVEA 1WX1A 3IQXA 1OUMA 3CKLA 1YDWA 4U7DA 6CHYA 4JDPA 3WXBA 4BO9A 1QR6A 3CMCO 4XD7A 2HQSA 1FNCA 2BEVA 4DCTA 1JTEA 1OVGA 1SKQA 3ML1A 1J2EA 4DC0A 3GP8A 3F8WA 1WDWB 1U5CA 3R7AA 3IAHA 3LCJA 4DA4A 4E09A 4JVOA 4Q9NA 2NO0A 3V8QA 4AKTA 2C4UA 2BFBA 1KDTA 3ZLTA 5JW6A 2DM6A 2LPMA 4W4TA 2Q28A 3PIIA 1NWCA 1UF9A 1PS9A 1M2GA 3RSHA 4OA5A 4E46A 3UCEA 4LF6B 1A8UA 1NYLA 5MGBA 1ZHFA 1QLHA 4I19A 1Q0ZA 3HVUA 3B1YA 4JHLA 4JLPA 4WEQA 4GKVA 1CLUA 1VSBA 1ZA2A 5F73A 1XRQA 1Q7CA 4H18A 1EIWA 3GI1A 1Z5VA 4D80A 2IYVA 5FPQA 3EFHA 4EG1A 3D3WB 4IIHA 4UHJA 1ZM9A 3CNHA 4XVCA 2GZ1A 5JQGA 1WQ3A 1ONPA 1NL3A 2B4YA 2IPMA 4NS1A 4OGLA 4PG5A 5JVDA 2QMHA 2RAVA 3CX6A 2SKDA 2ZJ5A 2GOYA 2PSEA 4JYCA 3L7NA 3HUEA 2XA2A 3PXDA 3SF8A 3KXDA 3H2HA 5LL6P 5KYKA 5ITWA 2PZGA 3WLJA 4X63A 4RZHA 1Q12A 3T34A 1RRMA 3TINA 5K7SA 3TQTA 3MGGA 2J07A 2J32A 3OF3A 3ID6C 1X8KA 1Y98A 1IN8A 4HAOA 1UXKA 2DTDA 2FA9A 2H92A 2UYYA 3GWGA 1MG5A 1TCUA 1VE9A 3WMFA 1RAHA 2H48A 3VSCA 4UXHA 1R4MB 3IUSA 4XA8A 2VBCA 1P72A 4KO8A 3P2MA 3TQQA 3CLTD 3ZBUA 1DBSA 1LBHA 1UWLA 3G7UA 2QTBA 1VLZA 4KE6A 4Y2UA 1BS2A 2Q4BA 1DRVA 3EPRA 4I55F 4IO0A 4N0QA 3HG7A 1WXIA 4AS2A 1BKSB 1OXVA 2H11A 4B3CA 3HJFA 3W5SA 4OQZA 1ZGZA 4E33A 3UOWA 1Z29A 2D1SA 2D7JA 3IODA 3OZ7A 2VPXA 4PPYA 5ALTA 3T5BA 3R20A 4I8DA 4JLSA 1TO6A 4W5NA 2A57A 4M8LA 4NE9A 1YSCA 4TS3A 3HR7A 3MBIA 1LB1B 4RIEA 4URHA 5DHFA 3T7RA 3O3MB 4DLYA 4WI1A 2B1GA 2YHAA 3H19A 4UCFA 4B2YA 4XTRA 1C3OB 1I36A 3S0JA 2PRZA 3TR6A 5KCZA 2VKQA 4M98A 3RQSA 2Q1TA 1M5RA 1KY5A 4W63A 3JWIA 3BRCA 3FSGD 2NZWA 1DWUA 2XGMA 2C7BA 2EIHA 1SR8A 3P2YA 4C30A 4QLBA 1LTQA 5DT2A 4PHGA 5IVDA 2JCYA 3VKWA 1G8HA 2HJSA 4ZXFA 4ZOLB 3TUZC 3N0WA 2XB8A 4YJFB 1EWQA 2EW2A 4BP8A 1KI3A 3AJAA 1U0GA 1PEAA 4TV8F 3MRVA 3SVLA 3FYHA 5G2OA 4K9SA 1PJZA 2YYSA 5JEDA 3CLUC 1QTQA 2ONZA 3IELA 4FSHA 1E2GA 1QP4A 4X7RA 4NAVA 4LJ5A 1KHTA 4A6EA 4EHDA 4MAAA 4DE5A 3K0EA 4LY0A 4B6SA 1IM2A 4K9LA 4ARAA 4LXUA 1NQXA 2OORC 4LBVA 4HF7A 2J1LA 3IKJA 3KVOA 3TM4A 5FLKA 4CV2A 5DYGA 1STOA 3NBUA 2VA9A 3A1UA 1ACJA 4WDRA 1X7YB 3CY6A 1A50B 1OBOA 2C4MA 1V2HE 3IHWA 4XXHA 3PV0A 5ALVA 5T7BA 3PXBA 1V5FA 3NDRA 1EB9A 4NOKA 2PKWA 4BTVA 4C06A 1RJEA 1RWBA 1XP8A 1SURA 2O57A 2Q1SA 4RHCA 2HCFA 2QMYA 3ZKAA 4DGQA 4PYLA 2XT6A 4QSHA 2IYLD 2RJOA 3I9V6 4MGHA 3MB5A 1US8A 2F8LA 4Q7LA 4U2FA 4YJGB 3DAFA 4CM4B 4MKIA 2A0UA 4NS4A 1HFJA 3I2KA 2HQ1A 2OV2A 2PJZA 3DT9A 4QNRA 5DHUA 5J4LA 4OJYA 2KW5A 3K7EA 5IM4A 1M0SA 5EKSA 4EHKA 1FMLA 1NDUA 2B4QA 3GLKA 4RZIA 4Y2HA 2OSVA 4XDZA 3W5UA 5T57A 4TV9B 2WUEA 3R8FA 2ZR9A 1U8FO 2BCEA 4GYKA 2PH3A 4XFJA 1FYEA 3WDLA 3Q0IA 5CLJA 3ZWKA 2AOTB 1SQFA 1NBEA 1YIAA 4R9VA 1AQJA 2V97A 3H5NA 2PGNA 2AQIA 3H9CA 2NSJA 4GQIA 4EI9A 4WGFA 2HT1A 2W6ID 3HJGA 3NTRA 2Y1WA 4UAGA 2Y3IA 5EP1A 1ZUIA 3T99A 5A06A 4I1UA 2W8BA 1R66A 2B7LA 4RQBA 1J4AA 4NTZA 1YH3A 3P26A 3DMHA 4E11A 2CLEB 2X40A 1CNFA 3NOXA 5G40A 4A0QA 1JBEA 3WGYA 2R0QC 4ZO7A 4QJ4A 2HSGA 1HLFA 1GSAA 1USIA 2W2LA 5DYWA 3ZU6A 2TMKA 2Y0CA 3F2VA 4ODIA 4Q9DA 3TZ6A 1DJPA 1QOPB 1ABFA 1EFKA 1SXJA 2FJ0A 3WFZA 2JIOA 1YNOA 3BZBA 3R7LA 1XEFA 2FWNA 4WADA 1AOXA 4NXNB 2Q3FA 1RAEA 2Q0QA 3I2HA 4ZU6X 1SBZA 1ZVQA 3HBAA 5EXTA 2NVUB 2JRLA 4D9EA 4YRSA 2OD9A 1HTBA 3H3JA 1G6HA 2WV7A 4M3NA 1FXWF 5IBPA 4AJLA 3DOUA 3KKNA 3PGKA 1WVIA 4TTSA 4ZREA 1ZN2A 1NAHA 2EF0A 2VH1A 5KQLA 1VKHA 4PLZA 5MGNA 1N33B 2AF4C 3EWAA 3BYZA 4I2VA 5FJIA 1WJGA 3D3NA 4UEJA 4W8OA 4CIBA 5HX7A 1Y7LA 1QVVA 4F2WA 4GH5A 2YJ6A 4D7AA 4MUKA 1P74A 4KTVE 1JQ5A 1D2HA 1M1YE 2W6JD 1A8PA 2DU8A 2EFDB 4KB5A 1ZBQA 4F3TA 1UCFA 2QR2A 5EIEA 3AW9A 4RF5A 2O54A 2I2WA 1NBWB 1IHXA 4FSDA 1D2MA 1TM4E 1YZYA 1IJEA 2C92A 2QX6A 3CNBA 4LTNA 1XAIA 1L6RA 3CO5A 4IOMA 4ZO4A 5KMGA 2ZRHA 1LUAA 1P3JA 1B00A 3IQDB 1IXRC 5K4HA 1F2DA 3GPIA 1V8PA 3AYZB 3OEHD 4EEZA 4JU9A 3F0TA 4R7TA 1RWPA 2DR3A 2JIZD 3BJEA 4V1CB 1I3OA 3C15C 5EZ6B 4U7PB 3HNRA 3U44A 1C8VB 1SUPA 4YJ3A 1N6IA 1RYNA 2PZAA 2YJNA 4X1YA 4P3YA 1XF1A 1UIRA 1AD2A 4MUAA 4MZDA 2H3HA 2ST1A 2H52A 2ZYTX 3QPWA 4RF3A 4EG8A 3L40A 4YI3A 4ZGWA 4HH1A 3RYFB 3IQIX 3TVTA 4PFQA 1G2QA 4URUR 1SXQA 4EJFA 1QC5A 2CDBA 2W37A 4QU9A 4F1KA 3CX7A 1SA0B 1XZNA 2NAFA 3BXGA 2JKVA 3T5DA 3EZFA 1E96A 3WNZA 2P9CA 4ZOEA 3Q0EA 1CW2B 1N5LA 1C0LA 1E6LA 3EDQA 1D4OA 4K9MA 1S2OA 1RQLA 4WZBA 4ZHQA 4AN1A 4F1JA 4D96A 3JYOA 4D43A 4Z49A 5E9WA 5DYIA 4F2DA 4KAAA 2BUBA 1S2LA 3R2JA 5TC4A 3M3HA 3ENNA 1IXZA 3DS8A 4QBIA 4OSPA 1UEXC 3EDOA 3ZWCA 4EYQA 1YHZA 5IFLA 4GQAA 1KEEA 1J1ZA 2VPQA 4HMQA 4MW6A 3OWHA 4DNXA 2OQ2A 1K6IA 1HLPA 1OFIA 4MH0R 2IE8A 4OXQA 2YFYA 5FA5A 4DR4B 1GUBA 3RVMA 3A2KA 3GH3A 1W1UA 3C8DA 1JJIA 3QFRA 2PFSA 4GOLD 5GV7A 4GLJA 3MHPA 1HWYA 3K20A 4ZAYA 3WV5A 1KYWA 2GILA 3OAAA 5E6RA 4ARVA 1R9MA 1MG0A 4MJXA 6ADHA 1W0CA 3RYIB 2C3YA 4KNYA 3RC1A 4KREA 5JZBA 2WAXA 3UT5B 5JS6A 1SD5A 1F5SA 3ICCA 4HY3A 3SSNA 3TSOA 1KI8A 1XALA 5M5BA 1HYGA 3CLVA 2XA1A 5LOVA 1TLTA 3EXHA 5HR5A 1KZ4A 4BMYA 2AFVA 2QORA 2ODAA 1OGYA 3COSA 3W4KA 2B6HA 2HFKA 2Q1WA 4RTSA 2YXPX 4J7XA 3VKGA 2PLRA 2Y1LA 3CX3A 3PCTA 4Y7CA 3U37A 2VP2A 4MYDA 1N1EA 3EEBA 1I2DA 5BNIA 4Q4DA 3RIGA 1EHYA 1QG2A 2WF7A 4X3PA 2QRUA 3E61A 1LI7A 2Z1MA 4IXTA 1H5NA 2H5EA 2HJHA 3R5HA 4BO7A 3THYB 3HYTA 1N6RA 1LY1A 4P4NA 3W9YA 1G3IA 1G21E 3IOCA 4DXHA 1P4RA 4B6JA 4D57A 4DMLA 1D6MA 4MP8A 1RMTA 3ELWA 2YY5A 4C7OA 1UPXA 3DE4X 3ZK9A 4B2IA 4PXSA 5MFPA 1K06A 1KSHA 2H85A 3PG5A 2R1ZA 4RH3A 4NVRA 1KAHA 4JI5B 1C1XB 5CHYA 3CTPA 3UJCA 4PPFA 3VSDA 3ZCTA 3KLOA 4A26A 1JG2A 3SYMA 3JZIA 3D6JA 3OLWA 3TB4A 3E9QA 2OLKA 2PT7A 2ZRGA 1UC8A 1SHJA 5IAGA 2GH1A 2OCPA 1GNTA 1GNVA 2E21A 3K9HA 3WWPA 4CKEB 4DJ5X 2XUDA 1K7FB 2QK4A 1AY0A 1TTQB 2ZJBA 4KW7A 3ADBA 1I10A 4OOEA 5AKIA 2H18A 3ZVNA 1XRLA 1JMKC 1PUIA 4H7PA 3WLTA 5KWVA 1ZIXA 3LCUA 2E6UX 1WVMA 1R4MA 4YDRA 4RK0A 2V3WA 4W1RA 1E9BA 3GOHA 3LNTA 4B44A 1O5OA 1MAHA 4ZI5A 4FS8A 3RSZA 2LCQA 4R2KA 3DMNA 1WKBA 1KDYA 4ES6A 3MA0A 3AL3A 2NO1A 4BVFA 1YZLA 4EGJA 1GLGA 4YMVA 1E6KA 3PQDA 1ZJYA 1K7XB 2FLWA 2VJOA 1E77A 1OC4A 1UDAA 2ZQYA 3K4HA 3JARA 4O4LB 4CHTA 4E15A 1RRFA 1C1DA 3H84A 5HF5A 2D00A 1OREA 5AOCA 1LNSA 2KB0A 1XZMA 1FSGA 2L0XA 3VPGA 1ZN8A 3VU9A 3QU5A 4ZCIA 2H54A 1MLDA 3ON5A 3UHFA 2O8BB 2Q5HA 2XQGA 3W3ZB 4C0WA 1V11B 4OJKA 3NUGA 4YC7A 4MEAA 2YW9A 4LS3A 4MK4A 4YCBA 4Q9KA 3HSKA 4ZCPA 1IY9A 1YXMA 1E61A 1P0PA 4FIZA 4PYMA 1ESDA 1GL3A 5DYNA 4IDBA 3T52A 4JLNA 1PVOA 4EGSA 4J7AA 1NRWA 4D9HA 5CD1A 2C95A 3D7SA 4YQFA 1MOQA 4D0SA 3NBQA 4WL0A 4DNQA 3AUYA 1FP4A 1GL7A 1SPXA 4FNOA 3EXHB 3TTVA 4LUCA 3NYRA 4UMVA 4OKNA 4FMCB 4B81A 5EMLA 4G0VA 3UN1A 2D06A 3GO4A 3EPKA 4YPFA 3AF6A 3TS1A 2IHZA 3F3MA 1B8PA 3BRWA 3VTFA 4BMCA 3RREA 4DREA 1RPZA 1H6BA 4DEYA 4ZALA 1LWNA 4I9UA 5DM0A 2FYTA 2YZKA 1N9GB 3TOXA 4FNAA 1CZNA 2QS9A 3KU1A 3P8ZA 2D5CA 2NQ8A 5E6UA 1N0IA 3IALA 3ZU3A 1NA5A 2F9MA 2VK2A 3BXPA 4BBJA 4Z6KA 5IPFA 1SKYE 4E5DA 1EJ6A 2QVLA 3QIAA 4KXVA 1P9OA 4MKFA 5CJ2A 1CP2A 4B73A 5CITA 1TO2E 4UDNA 2PX4A 3AL2A 2GM3A 1L7BA 2YQ4A 4PAOA 3COPA 3VPDA 2EV9A 3GCXA 5TB5A 4LWQA 4AICA 4C2AA 3R3YA 4E5MA 3GMSA 1XCPA 1YMUA 3ZI0A 2WIAA 2NUTB 2PA0A 4C0LA 4EQ6A 1V8OA 3LUAA 2ARKA 4UREA 2FPGA 1ADYA 4ZEOA 4DR5B 5BPFA 1SA0A 3KELA 4RXMA 1SCJA 4CV1A 4EKNB 3TRJA 3O47A 3OFKA 4A2PA 3L82B 1LQTA 4DA9A 2JGMA 4RPLA 4MLCA 4DXAA 5FTLA 5EMNA 2YCBA 1I4DD 1MDFA 1TF7A 3JXEA 4TYYA 3B3QA 3PXEA 1ZU4A 2AF3C 1X74A 2Q50A 2NSDA 3IOBA 2B2CA 1H85A 2OR3A 4RPKA 1NU8A 4B46A 4DEVA 5JHHB 1PLLA 1LPPA 2XDYA 5C3MA 3AG5A 2NYAA 4JEHA 5JPCA 3EUEA 5CHEA 2ZUWA 1DAKA 2FW7A 4X95A 2PIDA 5H3HA 4CKCA 4U9UA 5CT4A 3I62A 1G7CA 3OE7D 1JHAA 2HZBA 7MDHA 5AKGA 3RJTA 2OV3A 2JHFA 3G2HA 1G3MA 4YNBA 1GARA 2JG3A 4E08A 4URVR 5BN5A 2WJ3A 1C3JA 5ENDA 1G63A 1DCTA 1TVCA 1OAAA 2EZTA 2AX4A 3P9IA 2Q6IA 1ESZA 2JEOA 1RIFA 4C5BA 4DCCA 4JUFA 5EPOA 1ZK3A 4Q7EA 2OAP1 3H5RA 2G76A 3C5EA 3AVTA 4WNYA 1FQKA 2BC9A 3MRTA 1RNLA 1XVLA 4ZVKA 3NYIA 2NPFA 4DIBA 5BQXA 4NU5A 3NP7A 2ZWMA 2VHCA 2C9MA 3GJRA 2QT0A 3GOQA 4HAXA 4HUQA 2WQ7A 3GVCA 4KXUA 4EM6A 1XZBA 4HOYA 5DHQA 1L5RA 4KXMA 4XVQA 1J8VA 3D0OA 1IMJA 1A77A 1WUTA 5EJ6A 4EKIA 2FFQA 5CA1B 3BHNA 2B4RO 2Q7XA 4ZWNA 4B8WA 1A9XB 2GR9A 1JS1X 2XXBA 1N8KA 1O3YA 5HF6A 3V3KA 3VNSA 4HTAA 4JJEA 4HEQA 1QQAA 1DDIA 4M89A 5IVKA 1DC4A 4KP7A 4FE3A 1U9CA 1G8MA 2G07A 3OF5A