3KQUA

Three conformational snapshots of the hepatitis c virus ns3 helicase reveal a ratchet translocation mechanism
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
437
structure length
437
Chain Sequence
SPPAVPQTFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPITYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSSTGEIPFYGKAIPIETIKGGRHLIFCHSKKKCDELAAKLSGLGLNAVAYYRGLDVSVIPTSGDVIVVATDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRMGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTTTHPITKYIMACMSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inaugural Article: Three conformational snapshots of the hepatitis C virus NS3 helicase reveal a ratchet translocation mechanism.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/dna
molecule keywords Serine protease/NTPase/helicase NS3
total genus 148
structure length 437
sequence length 437
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3kquA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kquA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kquA01
2J7PD 4IDQA 3GFTA 3WMFA 2NIPA 3H4MA 3AVYA 2XJ4A 4A0RA 1PJRA 3N70A 3U6BA 1O3YA 5L3RA 1R0WA 1JAIA 5AJYA 4V0MA 3EWAA 2XOKA 4DHEA 2C04A 4PQYA 1LS1A 3PUZA 4URWR 3U7GA 4KODA 5J40A 2JGNA 3QOFA 2GDJA 4UXIA 5CITA 4ZI3A 4JZKA 4Q4AB 1KI6A 4RD3A 4C3ZA 5KSOA 1W5TA 3SYNA 3AGQA 1AKYA 1UKZA 3SC3A 3PEYA 4R2HA 1TUEA 3C41J 2ONJA 4TQAA 3TR0A 2CHGA 4DSTA 1KSHA 2JATA 4UXHA 2ZPTX 3RLFA 5J4LA 2JLQA 1DOAA 4C7OA 1MOZA 2A78A 3WNBA 1H8ED 4ZPXA 4QJ5A 2RCNA 3BE4A 4M2LA 5JSZB 2CK3D 4UNRA 1ZD1A 4DEXA 3ZVLA 5TV2A 3QE0A 4MUAA 2G9NA 2A9KA 3MJHA 3R7WB 2V6JA 3K53A 2BCGY 1NVXQ 1FP6A 1FX0A 3GLHA 2O8FA 1UF9A 3UPUA 4AKHA 4RKFA 4B6FA 4ACBA 1FNMA 5C2JB 2QBYA 1SGWA 3AF4A 4M9SA 3TQFA 3RANA 4CEHA 1I2MA 1EXMA 4A8JA 2C5LA 3V9PA 5GJBA 4FW9A 2CDNA 3O8BA 1DO0A 2ZJ2A 5AUOB 3B2EA 1TNDA 1P2UA 4Q9JA 2HUPA 4RD4A 1R5BA 2OT3B 5FTKA 3KUCA 4NP6A 5AJZA 3VX3A 1D2NA 2C96A 1MR3F 2AD5A 2GTPA 2HYDA 3GJ0A 3SS8A 2XOKD 2GKSA 1XB2A 2WSMA 2ZI9A 4YDHB 3LXRA 4Q9KA 2HV8A 2IC5A 4JKIA 2GJKA 4FMDF 5EE5B 4DLYA 1OT3A 2C2HA 2QAGA 4DCUA 3AV0B 3GP8A 4C0LA 4CVNA 2O0JA 4JLOA 2RB4A 2WJHA 5FL3A 3PXGA 1GILA 2C99A 3P27A 4XTRA 2JIZA 3FMOB 3GLIE 2ZTSA 4D0GA 4UXJA 4EUNA 5EP4A 4F38A 1Q1BA 1RIFA 3MUFA 3CW2A 3T1VA 3LLUA 1OF1A 3T5DA 3K9NA 5J4YA 1I2DA 4B43A 3CLVA 2JLVA 4I1UA 1HE1C 3HR8A 3QKSB 4OI4A 1DARA 1DBSA 4JJZA 2DWOA 3ZH9B 2AX4A 1E2NA 1Q12A 1VCOA 2XSZA 2PEZA 1F2TB 1EGAA 4ZV4A 3GEHA 4IFEA 4MKFA 1RJ9A 4NZYA 1LVGA 2IYQA 4OHVA 3LH5A 2O0KA 1FL9A 4B35A 3GLFE 5JI3E 4OK3A 3HDTA 4DDUA 2ZROA 2WICA 1LB1B 2XNDD 3WYAA 3EIEA 1YZNA 2WWWA 4RZXA 3F5FA 4BLRA 4BZPA 1W47A 4MGKR 1XTJA 2UKDA 4JLPA 4DLTA 3OAAA 3NVAA 2BIFA 1R0ZA 4I81A 4IRUB 1JEEA 2QP9X 1AJEA 2J0SA 4ZIRB 4A0FA 3L0IB 4B44A 4I99A 5JJIA 3PR1A 4HDQB 4DVGA 3AB3A 2R6CA 3G5UA 1V43A 3W8NA 4RZUA 4Q4JA 1ZNWA 5FOTA 5JHHB 1PVOA 1PV4A 1C1YA 1AS3A 3B5JA 3DM5A 3Q9LA 4S2EA 2CXXA 3U44B 4TQ9A 5BN4A 2RGEA 4D25A 2VP0A 1PZNA 3QSYA 4O2RA 4N1AA 2QG6A 1G4AE 1N0UA 3LRPA 4GMXA 3OFND 3Q7QA 1NY5A 5JZVA 1D9ZA 1ZMXA 3PUYA 1G21E 2KE5A 3MCAA 5BW8A 4QBHA 2X2FA 1XNJA 3CPEA 4HB3A 1NRJB 5IHPA 1GVNB 1KDPA 5CYOA 2BM0A 2JDID 5KSYA 2BM1A 2MSDB 4OHWA 1TAGA 2QORA 1IJEA 3IBGA 2PLRA 3I32A 2FH5B 1ZNYA 2ZREA 4B2LA 5C46F 5H68A 1C4OA 5DI3B 2NZ8A 3C14C 4KBFA 5HE8A 3RRNA 2IYLD 1U9IA 3EX7C 5FH9A 2WWHA 2YOHA 4FMCF 1KI2A 2NPIA 4Z1MA 2FE4A 2J1LA 4Q47A 4UQOA 4OHZA 4R98A 2QGNA 3TW8B 4ZCIA 3C16C 1Z6XA 3QJYA 3RC8A 1NBMA 4LV5B 3E1SA 4Q4LA 4HB0A 4BFSA 3REGA 1TU4A 4X8LA 2ZRAA 3WMGA 2NMVA 4K81B 4V0KA 2HLDA 1ZP6A 4QFMA 1AIPA 2XJ9A 1CLUA 2J7KA 2IUUA 4D81A 3ZYCA 1KK0A 1JQLB 1XD2A 2V1XA 3ONWA 1SXJB 4TLDA 2OBLA 3SNHA 5KOYA 1JR6A 2BMFA 1GKIA 1U98A 2IYWA 2AR7A 1DAEA 1IXSB 5CM8B 2IA5A 2VA8A 2QA5A 3A4NA 1CKEA 4FINA 3VR5A 5KNCA 1Z29A 2BBWA 2IYRA 4JT2A 3X1DA 1BMFA 3MLEA 3I92A 4KI0A 2CL6X 3KJIA 5F9FA 2Z83A 5L8VA 5KNDA 2GBLC 1F60A 3AVXA 2AXPA 3VKHA 1F48A 4DSNA 3GLIA 3BK7A 4G5OA 2DFNA 3OEED 4Z51A 1G4UR 1NL3A 1OXVA 4DT1A 2ZYUX 3CF2A 4UJ3A 5HE9A 4AIIA 3R9WA 3ZVRA 3THXA 4BWYA 1UBEA 4US0R 3T35A 2B92A 2GJAA 2XAUA 1J99A 4ZKEA 3JZAA 4LZZA 1UDXA 1GNPA 3OEHD 3NXSA 4Q9HA 2RGCA 3W6OA 3TSZA 3UIEA 4IVPA 5JWRA 3C15C 5D3QA 3X1YA 2NO7A 1KI4A 3LBHA 3CNOA 3IPYA 3PENA 5GVRA 3TVDA 2GXQA 5CJPA 5JS7A 1HEIA 4EFMA 4CZ2A 5KUTA 1IONA 3LW8A 3D6TB 4I4LA 3QUSA 2QUZA 2XZPA 3IILA 5DHFA 4PSAA 3DL0A 1OIXA 1AQYA 1XJQA 2HXSA 2KI5A 1N5IA 1P61B 5C4GB 2GZAA 1NMYA 3QEJA 4QC2A 3UMSA 1DAIA 2DHRA 3IDQA 3IBYA 3L0OA 5FPHA 4DDWA 1TF7A 2WWXA 2FN4A 4HAWA 4FWIB 2RKOA 3MD0A 2QSZA 5FUVA 4B2IA 1G8PA 4XD7A 2VO1A 1KSJA 3NBXX 5CLLA 1KKLA 2V1UA 1UM8A 2ZITA 1AM4D 5FPSA 1OV4A 4B71A 2IYVA 2AD1A 4JL8A 2J87A 3Q3JB 4IFBA 2CE2X 3QBTA 2YKGA 2WJVA 1HT1E 4WZAE 2BEJA 1EFUA 1OXTA 1ONBA 2WAYA 3HP1A 5KSPA 1IAQA 1Q21A 1P9RA 4LJ4A 1AZTA 3WRYC 1NBME 1LNZA 1W0KA 1W7AA 1KI9A 3I4LA 4AYWA 1Y3AA 1VMAA 2Q9CA 3IUYA 3KZ1E 1EFCA 1BIFA 3W8RA 3X2SA 3TSOA 1VG8A 4HDOB 4R7ZA 1SULA 2PT5A 2QTVB 5H1YA 4AC9A 3HWSA 1TMKA 3QF4A 2Q3HA 3I61A 1E2KA 1MABA 4DLRA 1GKUB 3CX6A 1GNRA 4LHVA 3OIWA 1DO2A 1X8LA 3AVOA 2OCPA 4TN1A 2P65A 2F9LA 1Z47A 2FF7A 3NIBA 4LJ9A 3AVPA 4BRWA 3CF6R 4HATA 1I4LD 4MUBA 5JI2E 5G3YA 1GIAA 1QBKC 2G0TA 4HZUA 4YONB 5CIQA 1N6HA 1KAGA 1YZGA 4CEHB 5EXPA 5BN3A 2V7QA 1E2QA 1JEDA 4Q66C 1CJTC 4PPFA 2WWFA 2PMKA 2QQ0A 1M7BA 4TWZA 2KBEA 3IPXA 2VHUA 4LC1A 2N46A 2O8DA 1KDRA 5DIFA 2G6BA 1JPJA 1XTRA 2ZAMA 2GCOB 3QXCA 1HTWA 1R5NA 1S0UA 2W0MA 3OIYA 4CT4B 3K1JA 2BDTA 1NN0A 2EFGA 3P4XA 1NN5A 1XBTA 3K70D 1SZPA 4Q9IA 1JR3A 1NLFA 4ZDKA 5L3SB 5H8WA 1KGDA 1U8ZA 3K09C 4LYFA 2OFXA 2FFQA 1W2GA 5CYPA 5E95A 5AJVB 2PMDA 4TSFA 2ZRDA 5BXQC 2RMKA 4D4LA 1U81A 3MMPA 3GJ7A 3SQWA 1ZCBA 1NVVQ 5GVSA 3SHFA 1N5JA 4LPKA 3KTAA 1XD9A 1QG4A 2IW3A 1JPNA 5J47A 5EE1A 2WHXA 1RW4A 2QNRA 2YINC 3H86A 4ASUD 1Q1QA 3EZ7A 3R8FA 5TVKA 5G3ZA 2Z43A 4BPBA 3VU9B 1SVMA 3K0FB 2CEAA 2QRNA 4BFXA 1IN6A 2JAQA 1H8HD 5CK5A 3W3AA 1N6IA 1GFIA 1XWIA 2GXAA 1KI8A 5AUPB 4HLCA 2GRJA 3PJRA 3T1QA 2ZRBA 4ZCLA 3TGPA 4D4KA 1S1MA 5CK4A 4KCGA 4TTRA 2YWFA 3WRXC 5KPDA 2J0QA 1X8JA 2IYTA 2RGDA 4LBVA 3X1WA 4URXR 4AYXA 2REBA 3THYA 2O8EA 2PJRA 4QNMA 4FMCB 1M34E 1R2QA 4ZIRA 1L8QA 5DISB 2YOFA 5BN5A 2WIBA 1ESNA 1YZKA 4PAOA 1TUIA 1KI6B 2PCJA 1TADA 2WOJA 3IGFA 5EXSA 4JLJA 4C9BA 3P20A 4HDCA 1U0JA 1X1RA 1YZQA 2OAP1 2W6ID 3ZS9A 1PLJA 2PZEA 4KITB 1W36C 1A4RA 1FPMA 1KI7A 1MO4A 1WB9A 4C7OB 2F1RA 5C18A 1HV8A 1NBMD 4GPTA 4JLNA 4B74A 4BECA 4EKDA 4RZ3A 4NCJA 4XVUA 1E79D 4ZCMA 5CM9C 1OB2A 3GFPA 1W44A 2FDCA 2XNSA 3CRW1 3UANA 4MRRA 4OK6A 1OE0A 5GJCA 3ECCA 5EJEA 2ZR0A 4PHHA 1N5KA 4TTPA 4OKSA 1MRSA 4B47A 1S4QA 1U9IC 2KSQA 2VF7A 2IWRA 1N6PA 3EWSA 1XTKA 2CK3A 3B1VA 3FKQA 1G16A 2W6JD 1SVLA 2QBYB 3W5JA 4N0EA 1G6OA 4KO8A 2ZQ5A 1JI0A 4OI2A 2VHQA 3CF0A 4F4CA 2CHQA 1NI3A 2H5EA 4LCBA 4GP6A 5DI3A 2HCBA 4KSBA 3KUDA 2F55A 4B33A 3NH9A 1S3GA 1G41A 3W3ZB 4YXWD 1XPUA 2W0SA 4EJSB 4IKEA 3ADCA 3TE6A 1U94A 4GFDA 1DAFA 2J46A 4MH0R 1HQYE 4PFSA 2Q3FA 3UKDA 3ZZUA 5E4FA 2GHIA 2Z4RA 1LF0A 4M22A 4XWOA 1IN8A 2BMJA 2GVDC 1GRRA 3LBIA 4LYAA 4A8JB 2AN9A 3AF0A 4Z8XA 2VP9A 4XSHA 4D2IA 4E09A 3F0TA 2QAGB 1DAKA 5K8TA 2X2EA 4F92B 3VNVA 1W48A 1E0AA 1KNQA 1LW7A 3EC1A 2QI9C 4FIDA 1VECA 1HURA 2ODNA 2ZSDA 1VCIA 4PANA 4CF7A 3QEOA 5KO2A 2ZUDA 1AQUA 1GL9B 3HYTA 1XXHE 4V0ME 2QP4A 3MRSA 3ADBA 2OCYC 4JLVA 3R9IA 2EFHB 3VR3A 1ZJ6A 3KX2A 3CWQA 3LVQE 3EPKA 3E2IA 3T5GA 4ZI2A 1SHZA 4GOJA 4HLUA 3QKSA 2V6IA 4JLMA 1JBKA 1R7RA 3I1FA 4BFVA 1CU1A 2QM7A 1CULC 5DHAA 4O25A 2OG2A 2ZSEA 3K0EA 2FZ4A 2VQSA 4YMUA 2EWWA 5M04A 1X3SA 2ZYVX 4BUJA 5KPJA 3GLFB 2ATVA 1RZ3A 3A1UA 3VHLB 1KTVA 1T9HA 3EARA 2ZVQX 2P2LA 2RGXA 2P6UA 5CIWA 1ZU4A 3NBYC 3ZQJA 1SQ5A 4CEJB 4HAVA 2IXEA 4LHWA 1KMHA 1R0YA 3CR7A 4Q1FA 2BJWA 1BOFA 1WE2A 1VTKA 4DCSA 1P9NA 1M2OB 2B8WA 3CKLA 4P3YA 1NMXA 3Q85A 3C8UA 3PITA 1Q3TA 1TPZA 2CVFA 2PX0A 2JLRA 2LWIA 2D62A 3B60A 3BB4A 3RRMA 1SXJD 4F93B 3A4MA 3GD7A 1HA3A 3JVVA 4NE2A 4WZBE 1NJFA 4YXWA 2GJSA 4IHQA 3U6KA 2XX3A 1YJ5A 3FB4A 1A5TA 3U4QB 2GAOA 1Z5ZA 1KOFA 3Q5DA 1KI1A 1K5GA 4NPHA 4B34A 5JJLA 3OZXA 2QN6A 2QY9A 4KFTA 4BLPA 4RKEA 2REXB 1G8YA 4E5UA 4FCWA 2CL7X 1SKYB 1ZM4A 1PUJA 2GXUA 2ZJOA 1FUUA 2XXAB 1CRQA 3CZQA 3RS7A 3ZD7A 3PCRB 5FI0B 2ZJ5A 2P6NA 4NYIQ 4Q1BA 1G7SA 2BV3A 1US8A 3LBNA 4RVCA 2IYZA 1JAHA 5CDFA 2G83A 4EJSC 2Z6VA 2FV8A 1KO5A 2K5UA 2J7PA 3WP0A 1AS2A 2WTUA 2ZJAA 4CRWB 2WWYA 3N2EA 5SZIA 3A8TA 2D2FA 3OE7D 1KO8A 4A9AA 4ARZA 4MGYR 2JLWA 4WXRA 1DS6A 1XEXA 4Z54A 2W00A 1TQ4A 2HDNB 3LY5A 4P4UA 3BBPA 4PZZA 5J4VA 4JLBA 1JXMA 2P5SA 3KB1A 5FL7A 1YR7A 2E87A 2VSOA 2EW1A 3B78A 3PUVA 4KBGA 2CJWB 1HY3A 1W4AA 3NHBA 1YR6A 5FBVB 1HH4A 4U7DA 1L4UA 1ZCAA 4W9MC 4P32A 3QKRA 1E0KA 4QGFA 4LV6A 1ODFA 1E6CA 4CDGA 4GRAA 2MMCA 3B8HA 4IDNA 1FTSA 1G18A 2ZRGA 4RFSA 1SXJA 2ZS7A 3B7GA 3IHWA 1IJFA 2FOLA 3LXXA 4Q4HB 3F8TA 2X19A 5F3WB 1GAJA 2PEYA 2DFTA 3A1WA 5CJ2A 4PO1A 4TLAA 1LF5A 4URZR 2WKRA 4EPRA 1H8EA 2FSGA 2A7QA 4Q02A 1F3OA 1Z06A 3CNNA 3L0SA 4TLBA 3OF5A 2OBMA 3IQXA 4G5SA 4DEYA 5KSZA 2A5YB 4IOJA 5IK2A 4GNKA 4ESVA 1CIPA 1CJUC 3T12A 4JLAA 3K0AB 5DI9A 2V9PA 2OESA 3EAQA 1VDZA 5EP1A 3NBFA 4ZO4A 1NKSA 4D80A 3TIFA 5TXGA 4GMDA 1KZ7B 3NEYA 3BOSA 4H9GA 3WHKA 5JCPA 1NIJA 4GBMA 4ERNA 1LY1A 2PT7A 2YC4C 2JLZA 1ZINA 5HCIA 3THXB 1YKSA 1UADA 4HUQA 5EUMA 2ZI5A 3LW7A 3GLGE 4AWXA 4URVR 3I72A 3WXMA 4D4JA 1RPZA 4MDEA 4POAA 1P5ZB 3TRFA 4CW7A 2IS2A 1QHXA 2WSSD 2C9YA 3OAAD 3RYTC 3ZDQA 2IS4A 4W5HA 4IEIA 2WPDA 3GJ6A 2HT6A 2WM9B 1UKEA 2ZYWX 3EIHA 1QHHA 2OCAA 1YQTA 4J0QA 4JBXA 1E99A 3SYKA 3THOA 2QGZA 3THWA 3FE2A 1NNEA 5FTJA 1Z63A 1ZUIA 4Q1CA 5FOWA 4URUR 3SE0A 3K9GA 4QHSA 4PC3A 1ZIPA 1SVIA 1ZW6A 4RCYA 1D8TA 1E9BA 1ZVQA 3VU9A 3K0FA 2NQ2C 2IS6A 1T0HB 2WIAA 4IW3B 4RJLA 3MAAC 1N6OA 1QZXA 1SVKA 1WP9A 5JECA 1ELOA 1F2UA 3E5HA 3P1JA 4BZQA 4EPTA 4JSTA 2ZJYA 1U99A 4LBZA 5AK0A 3FHTA 2CLSA 2REOA 3R20A 2YV5A 4B3XA 1WBDA 1EFRD 4GDFA 2QPOA 1ZM9A 3AP3A 5EUQB 1CF4A 1ZD8A 1R5OA 4G01B 3CO5A 5AWFC 1XEWX 3THYB 2O8EB 2F1JA 1E2IA 1E9CA 1UJ2A 3OFNA 4TL9A 4C0HA 1W36B 3L2OB 1FZQA 4PC2A 4BFZA 3I3SR 4V0OA 2VHJA 4LI0A 4C4PA 4QGAA 4DKXA 4FXPA 1G3MA 2O8CB 1NSFA 4DSOA 4AD8A 3RSLA 2QSYA 2FFAA 4IXMA 2FPLA 2DWPA 1NJGA 2DFKB 4NCNA 3ZD6A 1DG3A 1E9SA 1ZUNB 1G291 1W4BA 3LAWA 1S9DA 3DKPA 3IEVA 4A6PA 1XD8A 4L9WA 1E69A 1KK3A 2QT0A 1U2RA 2GVZC 2LKDA 1OFTA 1OHHD 2ZI4A 1E96A 1FQKA 4OBEA 4KV9A 1DE0A 1XX6A 3QPVA 3DKVA 3BH0A 4RD1A 1R4AA 3O47A 1SKQA 1T0JB 3PG5A 3KQHA 2BBOA 1Z6AA 3AUXA 5LPNA 2IHBA 3U3KA 3UMFA 4HZUB 2ZRJA 2FSHA 5FFMA 3T1OA 3VR6A 5DH9A 2R2AA 3PEVA 3MWLA 2FA9A 1MABB 2VBCA 2ZUCA 2GXSA 2JJ2D 1VG9B 4OHXA 3RAPR 2RHMA 2IX3A 4NH0A 4H1UA 2QTHA 2Q6TA 1G3IA 1OFUX 4XTCS 1P60A 2HF9A 2YWGA 3IKJA 2VSXA 4OQLA 2GCOA 3I8SA 4OQFA 4PXAA 3SDZA 3EA5A 3HU2A 3QVUA 4D6PA 3ADDA 2O8BA 2JJ1A 1KJWA 4HAYA 4TMZA 2YC2C 4DB4A 3GJ8A 4U02A 2C95A 4MITA 1N6RA 2ZU0C 3VAAA 4EDHA 2GWHA 2BHRA 3BH6A 2W2VA 5A0FA 1E2FA 1GRNA 1GITA 2OAQ1 4K8OA 2ZRKA 1QHGA 4C2UA 4YMVA 3DMNA 1NLYA 5JRZA 4XVQA 3QPUA 3S1AB 1Z08A 4PPGA 4HI0E 2O0HA 4G3XA 1GSIA 1A2KC 3ND9A 4TSFD 4QXAA 2B7CA 3RVBA 1IY0A 4JVNA 1M1YE 2ZEJA 1GNQA 5L3VA 2EFDB 2NTYC 3AP1A 4X8OA 2OHFA 3RDPA 2F7SA 3RS0A 3GLFA 4NMMA 3F3YA 4WA7A 2ZYTX 5HCNA 2IHYA 5HPYB 1OHHA 1C9KA 1PLLA 1QDEA 2G1KA 4NYMQ 5DO9A 5FBLB 4TZ0A 3FMFA 1BS1A 3C7KA 5K8UA 3B1YA 3CX7A 4BZXA 4OJQA 3MWYW 2PZFA 2C77A 3AVTA 2OCBA 2OILA 1Z0IA 1QRAA 1OLOA 5DN6A 3KJGA 1SXJC 4M1KA 2QENA 3ZIAA 3KDSE 4Q9LA 4BEBA 3DMDA 4E03A 2EVWX 1UBGA 2GF9A 1E9EA 1JR3E 2DPXA 2W58A 4B3BA 4A82A 4B48A 4C30A 4M1TA 3ETLA 4GI7A 4MGZR 2AK2A 4P31A 3IO3A 3QKUA 1F2TA 4OQNA 4TL6A 3ZJYA 2HYIC 1XRJA 1ZRHA 1BO6A 3U4QA 2IL1A 3JVUA 3OIVA 4DLUA 3QKTA 2EU8A 1OXXK 4RD2A 5FBQB 4HAZA 4PC7A 1CXZA 3I73A 3I8XA 1NSTA 2JLUA 2VEDA 2GBLA 2G1JA 1XP8A 1XMJA 1N6KA 1XFAA 1GM5A 4B73A 2V54A 2XXAA 1RYFA 4AK9A 1Z2CA 1AGPA 3LX5A 1PLKA 3AKEA 4AI6A 2O52A 3N5CA 4LHYA 3T34A 4MYHA 2CHVA 1W4RA 2F43B 3LDAA 3IO5A 3U5ZB 2FG5A 4PTLA 2OXCA 4PO8A 4LHZA 4EPWA 1ZM3A 4BASA 4AURA 1QG2A 2IF2A 2UZIR 3RRZA 5F9HA 2XZOA 2H18A 5CLQA 3U44A 4IVQA 4ON9A 1VYVA 2IF0A 2WWGA 4X8MA 3CONA 2ONKA 4LJ6A 3L8ZA 3GJ3A 4UNPA 1OH5A 1GP2A 3TSWA 2BKUA 5IF9A 1J90A 2WJGA 5A4JA 3W34A 2CNWA 2AFIE 3EPLA 3DPUA 1II0A 2ATXA 2ZJ8A 2FSFA 4PZLA 1FFHA 5A5GA 3K9LA 3ND8A 2A5JA 4Y0VA 121PA 2DR3A 1II9A 3CRVA 4KFSA 2BBTA 2OFOA 3UWOA 1T3SA 2G3YA 2ZRMA 3AVQA 4LWZA 5B58C 3J81k 4A15A 4DB2A 1ZM7A 3EZFA 4IOKA 4NYJQ 2FGKA 2XEXA 2CCJA 5F2EA 4HUTA 1KK2A 4Q21A 2ZRFA 2AK3A 2AWNA 4WVFA 3IIJA 5DLQC 5C1BA 1YRAA 1SKYE 2DYKA 1DTSA 2I1VB 1O87A 3FPAA 4IDOA 1JALA 2RGAA 4HZIA 3AM1A 4Q1DA 3TUIC 4TYQA 1LS6A 2GJ9A 2LKCA 4LPSA 5ANRB 4YMSA 1HE8B 1Z8FA 2GZDA 4N3NA 2BC9A 5JFGA 2QTFA 4WIAA 1S96A 3ASZA 5KTYA 4K46A 3VQTA 4AKEA 3BB1A 1RC8A 4Q00A 4OI0A 3KKOA 4I1OA 5FBRB 4CGZA 3EC2A 2GA8A 1NY6A 1Z0KA 1A1VA 1KMHB 2I3BA 5D3MB 1OYWA 4Z8YA 4PR0A 1K8RA 5FPTA 1ZD9A 2Q21A 2F6RA 1E2PA 2R6DA 3QBVA 2JJ8A 5KDLA 1VG1A 1XDBA 3N2IA 1G8GA 1KSGA 3TVTA 1XJCA 2GZHA 2MSCB 4F91B 1G3QA 3NH6A 5HKKD 1RRFA 4GZLA 2BBSA 4OYHA 3RS3A 3TR5A 4KAXA 4KYIB 1N25A 1KAOA 2FJUA 4G0NA 4RD0A 2RGNA 2FSIA 1P9WA 1ZYUA 1W0JA 1P2VA 3RWMB 4DUGD 1P62B 4AY2A 3LO5A 2D3WA 2VH5R 1AK2A 2IS1A 5FR1A 3M1IA 3ASYA 1W4CA 3PUXA 3EPJA 3HU3A 4A2WA 4GL2A 5TB5A 4QJ3A 4JYBA 1RYHA 4ZDIA 4DLXA 1Z0AA 2JIZD 1OKKA 2IEYA 5IT5A 1DPFA 4MYCA 1AA9A 1XXHA 4QGHA 2YHSA 4XVRA 3NC0C 3MFYA 4TMKA 2ZE6A 3M6AA 1OH7A 4RSGA 3HR7A 4DCTA 1ANKA 1E98A 2L0XA 3AQ4A 2VTKA 3TK1A 3QNUA 3ZLJA 1II8A 2VP5A 4EIWA 3FKSD 3TMKA 1W46A 2PJZA 3IIKA 5JCZA 1T4GA 2FGJA 2CE7A 3TUZC 3SFVA 4O0MA 1B0UA 1H8HA 1T3HA 1TU3A 4TZ6A 4CT5A 3AKYA 5EXTA 4D26A 2H57A 4XD7D 4R71A 5EP2A 3LVRE 1DVRA 2C9CA 4BFWA 2ZE5A 3CBQA 3AGPA 721PA 3OE7A 3TUJC 1GG2A 3I5XA 4IOLA 3VTKA 1B23P 4KFUA 3VR1A 3UATA 2YWEA 4DCVA 1JQJC 1DG1G 3U3RA 1Q44A 1AGRA 2PLFA 2IYYA 1OYYA 5JMTA 2VF8A 3GFOA 1XEXB 2QM8A 3WNDA 5AR1A 4BEJA 3LX8A 2NO9A 4LJ5A 2OZEA 2J0UA 1ZNXA 3TNFA 3PQCA 1W2HA 4CEIA 4B2PA 2D4HA 2OV2A 3SFZA 5SZKB 1L4YA 2CJWA 1M7GA 1YR8A 1G6HA 5P21A 2PH1A 1G7RA 1HT2E 1N0VC 1YZUA 4LYHA 2TMKA 2QMEA 4D0LB 1TTTA 3VKGA 1E4YA 4M1SA 1R8SA 3VR2A 1E79A 3QKRB 3SHWA 1NP6A 3PEUA 4GP7A 4JVMA 4GSYA 3QF4B 1D6JA 1WXQA 1NN1A 3B1WA 4YDSA 5JLJA 4RFSB 4DC9A 2R8RA 4IDPA 1NG1A 5FR2A 4M9ZA 3BFKA 1XEFA 4QNRA 3V4RA 2R6FA 2J45A 2J5XA 3FMIA 2ZIAA 5G53C 3CRRA 2V7QD 3L0PA 1KO1A 2W6JA 4RCZA 2ZJBA 2FU5C 4M53A 1BKDR 4QM6A 4JKYA 2QMOA 3G82C 2D2EA 4PHGA 1GWNA 3FFAA 2A5DA 1KMQA 1QVAA 2CVHA 3PEWA 5AJWA 1J7KA 1S8FA 4A4DA 1VYUA 3BWDD 2ZVPX 1TEVA 1ZU5A 2XSZD 1TQ6A 4DCNA 1OXUA 3K70B 1Z0DA 2ERXA 1UEIA 5BQ5A 3S1AA 5KDDA 3AF3A 3KXIA 3TKLA 4OL0A 1E4VA 2SHKA 2IUTA 4HB2A 1UBCA 4V0LA 3GMTA 3QY0A 5L3QA 2XITA 4TLEA 3G0HA 2OUKA 2OM2A 1M6NA 1WCV1 2W2XA 4BFYA 3OHMA 3B85A 1Y63A 4IEEA 4M9QA 2KJQA 2VP6A 1SVOA 1GTVA 1S3SA 2P6RA 3Q5EA 3KXLA 4F4IA 3U7HB 1UFQA 1F2UB 1COWA 3SBEA 3WY9A 3TAUA 2WKPA 3SZRA 1DEKA 1G5TA 2ZM5A 4P4SA 4QGGA 4DXAA 1IN5A 1J2JA 3QXXA 1KNXA 1UAAA 1KSFX 3QVVA 1RKBA 3X1ZA 1BH2A 3HPRA 4B3FX 1TF2A 2F1IA 2KB0A 4EQ6A 5EE9A 1DAGA 4PHTA 3SOPA 1E1QD 3MG9A 2J59A 3ZGXA 1P75A 2VP2A 1UKYA 4DLZA 5J4HA 3T15A 2HJVA 1FOEB 4XH9B 3B1XA 1N0WA 3L82B 2YZ2A 4JL6A 3RS2A 4JIMA 2I4IA 4M8NE 4BQSA 2G77B 3GEEA 4C0JA 3K9HA 4C0SA 1Z2AA 2B7BA 2IUSA 1X6VA 4D0NA 2VHCA 1E32A 2VL7A 1XCPA 2B6HA 2G0NA 2ZR9A 4TL7A 2XTZA 3EIQA 1IM2A 3GLHE 4DIEA 1QHYA 2A2ZA 4KSCA 1N6NA 5FPKA 3QIAA 1R0XA 1E2MA 4QJ4A 2KBFA 2YJTD 5JSZA 4DWJA 4Q48A 2BKEA 4Q1EA 2ERYA 5EE3A 4B76A 2YYZA 2ZRIA 2MMGA 2XGJA 3UG7A 4QL3A 3K0SA 1KK1A 3QQ5A 1G5PA 3C4JA 3A6PC 2D7CA 4NHOA 4QM7A 1COWD 3SJAA 2NGRA 3H0KA 4EPXA 5KNBA 4A1FA 3NBZC 1CR2A 2GEVA 2E9SA 3KJHA 1WA5A 5DE3A 2BMDA 2QRZA 1DAMA 1SHKA 3BXZA 2QZ4A 1E2HA 2YOGA 2W2TA 2C8VA 1BMFD 1RVDA 2FX3A 5FUWA 4E07A 2O8BB 2AL7A 2ANBA 1XPRA 1XMSA 4EJSA 2NOAA 4MRVA 3BAFA 4JMPA 2HT1A 1OIWA 3W5IA 5LD2B 2HXYA 5FOXA 4G5QA 3Q72A 3QXSA 4UNSA 4MRNA 1LTQA 2HEIA 4OI1A 2X77A 2JCSA 1M8PA 2Z4SA 3KQKA 3B9PA 5FUXA 4EFLA 3DEFA 4DUGA 2J3EA 4NTZA 1WBBA 1QHNA 4EAQA 1FNNA 2Q9AA 1KJZA 2OXRA 2VYFA 521PA 5LDDC 5E7JA 5HZKA 3DM9B 3KKMA 1G3UA 3WP1B 4W5WA 1E2JA 4QKQA 4B6EA 3CM0A 1XTQA 4PC1A 3CX8A 2A5GA 4TMWA 4JBWA 2ZE7A 2ZS9A 3O8CA 3BS4A 2JA1A 2NO6A 2QU8A 3NHAA 5EP3A 4Q01A 3PIRA 4AYTA 1OPXA 3GLGB 4MGIR 2WWIA 3BC1A 2VSFA 4A2PA 4L16A 5JRJA 2C78A 4BGDA 1KIMA 1Z22A 2FFBA 2WJIA 4OQMA 4U5XA 1HYQA 4Q7LA 2QROA 1D9XA 4TT3A 1U8YA 2HCJB 5FTMA 2BWJA 3IEUA 4BFUA 4R2IA 3BB3A 4AKIA 3CIOA 4QBGB 5DYIA 2QMUA 3B13B 3V00A 1G8FA 2QMHA 1K6MA 1NVUQ 3NG1A 2MSEB 4KJZA 5HZHA 1MO5A 1CJVC 2WSSA 4LYJA 4KYUA 1Z6GA 2XNDA 1VIAA 3AVWA 1IN4A 3SEAA 4I1VA 1QHSA 1U90A 2ODBA 4PQRA 4Q18A 4KVGA 1SVWA 1E2LA 1VYTA 3EG5A 5B30A 4EPYA 1X1SA 1GZSA 1G8HA 3HYRA 1LV7A 5CB8A 2WMNB 1II8B 5AUQA 1DADA 2G88A 3BFVA 3P4YA 2FFHA 2AXNA 1KJYA 4JL5A 4TYNA 2ZAOA 4ILEA 3SN6A 4DIDA 1OB5A 1R10A 5DYGA 1KY3A 2VHTA 4M21A 4FD2A 4W5JA 1KY2A 1XZQA 1YZLA 4JVSB 2PCLA 5TMPA 1N5LA 2EFEB 2GILA 4KXFB 4C0KA 5UKDA 4DDVA 3NDPA 1Z6YA 2V8OA 3WHLA 4TQUS 3Q7PA 3DHWC 8OHMA 4PAMA 1CR4A 3WMEA 3DZ8A 1OW3B 3SQXA 3REFA 4Q19A 5K8IA 5KU1A 4JBYA 1IXZA 1MT0A 5E7IA 1CRPA 1MRNA 3W90A 5TDHA 2PL3A 3GJ5A 1JXOA 4XSGA 3DOFA 4NCHA 2XB2A 2QAGC 5FL7D 2JDIA 1VIYA 5AUNB 3B6EA 4ARZB 1N3BA 3UG6A 3QI2A 2GAAA 4NYJR 5SZJA 4TTQA 4NKRA 4UKDA 4ZKDA 4HLUC 1CTQA 5CDFE 3BORA 3BGWA 5FOSA 3EASA 1YZTA 4Z1MD 1E1RD 2WJYA 5IDVA 1Z07A 3LQQA 4OK5A 3ICQB 1LFDB 2OO7A 821PA 4BE7B 3UWKA 1AKEA 4DRZA 1IXRC 1XD2B 4NONA 2J9RA 4TYYA 2WBLC 3QPWA 1IOZA 4B3DA 2QEQA 1JJVA 4PC6A 2HLDD 2C98A 1VPLA 3GJXC 4V02A 4UNNA 3DVLA 1EK0A 5D3MA 1KDTA 1JECA 2WMOB 4FMDB 2H8KA 1NN3A 1DAHA 1M74A 1U0LA 2ORIA 2VRWA 4Q4HA 4R9UC 3WYFA 4XJXA 3BJIC 1UPTA 1UBFA 1EX7A 4HLDA 2EWVA 1TX4B 2QPAA 4L4UA 3AVUA 4UJ5A 4NYIR 3B9QA 5KYKA 3FMPB 2FPKA 2WZQA 3TQCA 5LB4A 1VHLA 3K0AA 1T5IA 1E1QA 3D31A 5SZHB 2HF8A 3RS5A 3ADKA 4LV8B 3SI7A 2RGBA 1CP2A 1RRCA 2R62A 4O2LA 3MWKA 4OJKA 2R44A 1E2DA 3HU1A 4LJ7A 4MRPA 5FI1B 2B8TA 1V5WA 4HUQB 2ODWA 4L15A 3CH4B 1H65A 4Q7JB 3BFXA 1CS4C 3C5CA 4A36A 1ZNZA 1YHNA 3KQNA 1W0JD 2ZANA 1Q1ZA 1XXHB 3GEIA 1PUIA 1ZAKA 3AF1A 1FTNA 4KU4A 4DLWA 1Z0FA 2A30A 1XU4A 3RABA 2EYUA 3GPLA 2A5FA 3VNUA 2NO0A 2J0VA 5G40A 3FGNA 3CB4A 4JS0A 3DO6A 2R9VA 3QXHA 1G1MA 4FN5A 2QQEA 3EZ9A 4MA4A 1QHHB 1EWRA 4XOIA 1VCNA 5BYJA 4V0NA 3IHLA 3THWB 3TJZA 3ZZ0A 1N2CE 1E1RA 4HYYA 3LWNA 2IXFA 1G5RA 1JB1A 3ZZTA 1CJKC 3MSXA 4ZDJA 1J70A 4PAQA 3WBKA 4MDFA 4M1OA 1E9FA 3VMFA 4MKGA 3K09A 3SR0A 4M0LA 3CPHA 4C0BA 1G19A 2GESA 1TQDA 3W9YA 4OQXA 2QT1A 2DCUA 2VPPA 4PO9A 5DN6D 4S35A 3LA6A 1UKVY 1FP7A 3CR8A 3L43A 3RRYA 4C0QC 3NDBB 2PX3A 2KWIA 1A82A 1BYIA 3CZPA 2GCPA 3DZDA 4F4JA 4KHZA 4AG5A 2AWOA 2I1QA 5IK2D 1EWQA 4C2TA 3M4YA 4LC0A 2ZUBA 4G5GA 1KYIA 4B32A 3LFUA 4NU0A 2OEPA 5E7MA 2J0UB 4FI3C 1T91A 1S1CA 4PPQA 5FBWB 3CPJB 1G7TA 4TMVA 2O8CA 4CEIB 3FHOA 2N1BA 2XB4A 4GOKA 1IBRA 2OBNA 3HPQA 2OFWA 2ASEA 2JEOA 3TBKA 1P4SA 4OHYA 2ZRPA 4JLKA 1W0KD 2D74A 2AFHE 1XPOA 3D7MA 5G41A 2V3CC 4X8HA 5AJXA 3IQWA 1KO4A 2FWRA 3V4FA 3A36A 3B1ZA 5EXXA 4MKHA 1CEEA 4US1R 4I1SA 1OH6A 1E2EA 2IK8A 3C5HA 3R7WA 1CR0A 1FUKA 4M9XA 4LBYA 4DLVA 2GF0A 2R6GA 2Z0MA 3EZ6A 1NF3A 2JJ2A 3FTQA 3GLHB 3SU8A 2O8FB 1XTSA 2GK6A 4LDJA 2ZRNA 3QG5A 3VKWA 3BRWD 4NCKA 2YNMA 5B64A 3FHCB 3FVQA 2XTNA 1J8YF 1G20E 4DLSA 5GJWC 4U00A 2O8DB 4IDHA 3TAHA 1OFIA 1S9HA 1OIVA 4W7SA 4XWKA 4US2R 4IVRA 3EW9A 2VP4A 1NIPA 4LRWA 3EZ2A 1ZC3A 1P3JA 3I5YA 1X8KA 2BJVA 1Z6TA 1TEXA 2ZU6A 2IWHA 1FX0B 2CNWD 4B75A 3PUWA 1IN7A 5E3HA 5L3SA 3DOEA 1XCGB 2OSBA 4D4MA 1HUQA 2JLXA 3ZVMA 4G1UC 3KQUA 2D7DA 3BERA 4TT3D 5B2ZA 1EFTA 3RHFA 2X8AA 1T8TA 3NTUA 4Q1AA 5FUYA 4A92A 4M4SA 3W6PA 3EXAA 4A0GA 5JHGB 4Q5IA 4FWTA 4NYMR 3KKNA 3A1TA 2QL6A 4QRHA 3KTAB 2O5VA 2AKYA 3RS4A 3UK6A 3K0CA 1OKKD 1XJ0A 3TW4A 1G9XA 2ZXUA 4QBFA 4PQFA 5HR5A 1VG0B 3GQBA 3KB2A 2LCFA 4HEJA 4NDZA 4MYUA 3U3MA 4D82A 3GLGA 2BVNA 1G64A 2D06A 4EQ6B 1FW6A 5LBIA 4F7WA 3U2QA 4JJKA 1U8AA 4ITRC 4LJYA 1GUAA 4HSEA 1WMSA 4P4TA 1GOTA 2C9OA 3KL4A 2F9MA 4YMTA 3LNCA 4NL4H 1Q22A 3FKSA 2C03A 1T8UA 4ZDWA 2X1VA 4NCIA 3P26A 1AS0A 4TLCA 2F3RA 4UNQA 5KDOA 2FEMA 2ZI6A 1CR1A 2WKQA 3LV8A 3Q8XB 1G7CA 1T6NA 4M1WA 5BYKA 3T1TA 3FOZA 2BCJQ 5LD2C 3IIMA 1ZIOA 1I4TD 5F98A 1RRGA 1ZUHA 4WW0A 3WNCA 3ZVNA 5HKKA 1P73A 3MJRA 1E94E 1SVSA 1TF5A 4GT1A 4LUCA 2Q0HA 2CLDX 2ZETA 3I62A 4BLQA 1A7JA 1AN0A 1AZSC 1W1WA 3D3QA 4PZYA 4QG7A 5IRCD 2BOVA 2BMEA 2N42A 2ANCA 4RZ2A 5FOVA 5C4MA 5FTLA 4YC7A 2JJ1D 1D5CA 2QE7D 2EYQA 4G5RA 4GZMA 3KFVA 3ZS8A 2ORWA 1UDWA 3OEHA 1GKYA 4Q4JB 2P3SA 3R8CA 4CYMA 1XMIA 1MKYA 4AG6A 3NEJA 3UXMA 3X1XA 3SJCA 2Z5FA 2W6IA 4IXNA 3U61B 1GRQA 3A4LA 4RY2A 2YWHA 5EZ5A 2VLIA 3DDCA 2CCGA 4TMXA 5KHOC 1Q1EA 5FPYA 1NG9A 3EA0A 3AP2A 3H2YA 4JLDA 1EX6A 3T61A 5JEDA 1Z0JA 2XTMA 4PHFA 1BYUA 4BFTA 4Q4AA 1EESA 2CMKA 2GEDA 421PA 1EG7A 4LBWA 4PX9A 1G3RA 2Y8EA 1Q0UA 1Z28A 1GL7A 2ZR7A 4EFNA 3QF7A 1EFHA 2F43A 1NMZA 3FDIA 3U3OA 3ZQ6A 3AEZA 3K70C 3O8DA 2PZGA 4LX0A 5GJVC 2AKAB 1MO6A 2GJ8A 4QBIA 2EQBA 2ZJZA 4M1MA 2P5TB 3QXJA 4KFRA 1FMLA 4Q7KA 1CBUA 3GCGA 3CRQA 3A37A 1P2TA 1KKMA 3CUEF 5EZ6B 4YQFA 2F3TA 3A1SA 2H92A 4GOXA 3KJEA 1NLZA 1Q3HA 1VHTA 4WAUA 3ZIAD 1U0HC 3E70C 2V55B 2WOOA 3PV0A 2Q9BA 4O3MA 1P6XA 1JR3D 1IY2A 1XMVA 2V4ZA 3A58B 5JWOA 1F5NA 1XZPA 3WBJA 5TY0A 5FOUA 1YRBA 1L2TA 2GEUA 4BRUA 4ACAA 3NC1C 3U7EB 2AHOA 2CCKA 2DFLA 2FMXA 2EFCB 4IJMA 4A8JC 6Q21A 2H17A 2IYUA 3MGCA 1OXSC 2QE7A 2Q3MA 4TYWA 3BH7A 3OIUA 2UVQA 2ZRHA 2DB3A 2ZRLA 3KFXA 4MYTA 4LY6A 3VFDA 4WOPA 4LOAA 3VX4A 1I4DD 4PSVA 2ZI3A 4CEJA 1W49A 221PA 1E2GA 2QP3A 5JEEA 3KKPA 2XZLA 3M0EA 3K0CC 4JT4A 4BLSA 4XIGS 1WRBA 4LHXA 3FYHA 4L9SA 1EFRA 4HB4A 1E9AA 1E3MA 4LSGA 4DT1B 4E22A 1RRPA 1FQJA 3VR4A 2FNAA 2GNOA 3O8RA 2P67A 4MKIA 1RE0A 2FPMA 3OEEA 2WJJA 3BD9A 4II7A 1L7VC 5JWHA 3BIFA 2WVJA 4XWAA 2FEOA 2BEKA 1ZC4A 5CB6A 1KDOA 3U3JA 4JYCA 1OH8A 2CBZA 1ZBDA 1RJ9B 1G17A 1Q20A 1QHIA 4MRSA 4RD6A 2DBYA 2H7VA 3CH5A 3SJBA 1XF9A 2OLJA 3RSOA 5GADl 1P7CA 3JZMA 5DGXA 1GL6A 2RGGA 4JVLA 4KLZA 1XTIA 2IYSA 1RFLA 3L8YA 4DBLC 4TYPA 2ZSFA 1SXJE 4A6XA 2JLYA 1DELA 3UMRA 2J41A 4L8GA 4B3GA 2CL0X 4V03A 3SJZA 1R8QA 2ZI7A 1S2MA 3A1VA 3NKVA 2OE2A 2GCNA 1E9RA 1W5SA 2R65A 1US8B 1Z3IX 5FTNA 1YE8A 2H16A 5K8LA 4DZZA 4QHTA 4MQBA 2ZSBA 5HTKA 2QPTA 3PFIA 4LJAA 1E0SA 1T5LA 2B21A 3NWJA 4DDTA 4BLTA 4H1VA 2WV9A 1P2SA 2IT1A 1E0JA 3AH8A 1IQPA 4AKGA 1VCMA 3HJNA 1K5DA 3RNLA 3RC3A 4FMBB 3SYLA 3FWYA 1YVDA 4LK2A 2RHDA 2QAJA 1IY1A 2UZ3A 5DSZA 3CWZA 1WDTA 4EPVA 4LJ8A 1TL7C 5ELXA 1W36D 1JNYA 1NVVR 2RH5A 2CLCX 1HQCA 3LQRA 4YLGA 1QVRA 3MWJA 4QHYA 3EPHA 4ESHA 2GETA 2NPFA 4WZ6A 1OJLA 3WYGA 3VHXA 5BWMA 4Q7MB 2RAPA 3ICEA 5JJKA 1F6BA 1ETUA 1YU9A 3P32A 4YMWA 3W6NA 1KZGB 4P33A 2P0EA 3CNLA 3K8YA 2DWQA 4WXPA 2WAXA 2NO1A 2YVUA 1P72A 4B3CA 2JASA 3QG1A 2IYXA 2R6AA 4RFVA 1Q57A 3QENA 5EE0A 2ZRCA 3LD9A 4KLNA 4A2QA 2NG1A 4M1YA 2H1LA 3AVVA 1XCMA 1N6LA 3D8BA 2F1HA 1X86B 3RWOA 1MO3A 4DSUA 2HJGA 2VIIA 621PA 1T3LA 3H1TA 3AKCA 3LLMA 2OLKA 3SBDA 5LB2A 2RGNC 1TQ2A 1E9DA 3OESA 1XEWY 3PVSA 1Z83A 1J8MF 2A3RA 1OFHA 3KQLA 2DY1A 4Q03A 4HAUA 3TLXA 5J4KA 4IOMA 2JLSA 4BLOA 2GK7A 4JSYA 2E1RA 1KI3A 1NVWQ 4L5BA 3U7FB 3T06B 2ECKA 2NZJA 4P0TA 2FZLA 1MH1A 1A2BA 4TL8A 3AKDA 2ZS8A 1IHUA 2ZE8A 3CRMA 5TARA 4CIDA 1CJMA 1ZM2A 4NBSA 1GDDA 5B57C 5JS8A 1WQ1R 2ZSAA 4N0DA 1MV5A 3GLIB 2PBRA 4PSKA 2IEZA 4WBSA 2W83A 1UEJA 5J5CA 2WPDD 4HLQB 4QOSA 1VKJA 1YR9A 1ESMA 2ODEA 3AF2A 1KO7A 1M7HA 4LGMA 3GJ4A 4C0AC 1FMJA 3U60B 1D2EA 1WF3A 2IBMA 5EQTA 5L3QB 1KHTA 4PPNA 3R9XA 3H84A 4KVAA 5JBQA 3AUYA 4FCVA 4TMTA 1QF9A 4HAXA 3TH5A 4ASUA 2ORVA 1OSNA 4FCTA 4Y0AA 1NKTA 5H70A 4DJTA 3KXKA 4ABYA 4A0HA 3B82A 5DNYB 4P4SB 3KKQA 3FFBA 1D2MA 2IXGA 4URYR 1R6BX 1JJ7A
chains in the Genus database with same CATH superfamily
2CVOA 3TO5A 4EYKA 4PCLA 1AHHA 1XE3A 5JXHA 4XX1A 3K94A 4NVRA 3TDKA 1M1UA 4E30A 5I4BA 3TAXA 2NIPA 2OCIA 3H4MA 1K7SN 3NNNA 3E35A 2XJ4A 4RETA 3WXBA 5LQAA 1GPWB 1YJBA 3TJRA 4QPZA 1PJRA 2RHOA 3N70A 3ZWMA 5JCOC 5LYJB 4R2KA 5LA6F 2HU2A 2NXJA 1AQLA 1R0WA 1ZOIA 4EYGA 2GM4A 4G81A 5AJYA 3EIFA 2KX7A 3LYLA 2R6R1 1ITZA 2XOKA 3W05A 3C8ZA 5G0WA 4DRYA 4PQYA 2JI4A 1PJCA 1Z8HA 3EB9A 1RMTA 1VJRA 1WEKA 2YJ6A 4A6DA 2PK3A 3H5AA 4KODA 4UAJA 4DC0A 1A7KA 1O1YA 3DW3X 1BWRA 5CITA 1VPWA 4OAPA 4LXYA 1LU9A 2HDOA 3TNDA 5AKZA 4Q4AB 1DRVA 2BMWA 2G5CA 4C3ZA 1W5TA 3D4NA 2OR3A 4G8DA 4YT5A 5JNRA 3D8HA 1CQXA 1JAYA 2ATCA 3FPKA 3OCCA 1Q0RA 4HQOA 5TR9A 1I3NA 1B93A 1NOKA 4TQAA 3C7CB 2CHGA 3D5QA 1BCSA 2PVCA 3C5VA 1KSHA 3D0KA 3QEMB 2JATA 5AHWA 3ANTA 4XWTA 4EGSA 2Y1FA 2ZYDA 4C7OA 1R0LA 2BGLA 1H8ED 2FPIB 3BE4A 4EB6B 4M2LA 3RRBA 2FVYA 2QWXA 3MC1A 4DBVO 4UNRA 1FVXA 4KREA 5ICMA 2DKOA 1JA0A 4ML3A 1I94B 5HFAA 1CNEA 1WMEA 1ZGAA 3K53A 3U7QB 2BCGY 4QATA 3OM8A 5BUQA 5CDSA 2O4UX 3JQ6A 4WUVA 4ZMBA 2BM9A 3OZUA 4H7DA 4NAHA 2GFHA 4QU0A 1OOEA 2J9YB 2G08A 5C2JB 4ACBA 1XAHA 1HDZA 2NV6A 5K0CA 2NZXA 2SNIE 4BNYA 1VA4A 3I6IA 2ZT5A 1I2MA 2OZLA 1EXMA 2LDBA 4QEKA 4A8JA 2FQYA 1F06A 3L0BA 5GJBA 1K5PA 3SBOA 1DO0A 1PJSA 4PO3X 4IGAA 1PVVA 1RCFA 4EECA 1M1NB 3MMZA 3O0TA 3REOA 1GCIA 4ARSA 1TNDA 3T4XA 5IDWA 1ZMTA 2DBZA 2M9MA 4G67A 1NHGA 2Y77A 4Q9JA 3KUXA 3MS2A 1RHUA 1SHTX 1NA5A 1J00A 3I1JA 2VUIB 1IY9A 3ZGNA 1T4BA 3KJZA 5BMVB 3KUUA 1D2NA 1FP1D 3PRHA 1MR3F 5CFOA 3SS8A 4BGEA 1V71A 2WSMA 1QRUA 4DZTA 2ZI9A 4LRTB 1RD4A 2NYUA 2HV8A 5EE5B 3RVSA 1OT3A 2XD4A 2QAGA 4K6FA 4DCUA 5EMHA 5BR7A 2DC1A 4IIDA 3PPVA 4KQWA 4E3ZA 3HXOA 1M34A 2WJHA 1OWLA 3NHJA 5FL3A 3HADA 3PXGA 4AT1A 1XLTC 3EJ6A 2NVUB 3R3UA 3LZDA 4I9FA 4D0GA 1N32B 1M6YA 1H0RA 3EISA 4KN9S 4C22A 1ZK1A 1X7ZA 4LK3A 2GEFA 2ID4A 4Z9AA 2OHOA 2FB9A 1Q1BA 1RIFA 2HTEA 3CW2A 1T6XA 3GQBB 2P1DA 1TYEB 3ANSA 2ZIGA 3LWBA 2FI1A 3DVRX 1YRQA 3T5DA 1B0PA 3PR2B 1RC1A 1NSYA 3GEBA 3K9NA 2IX9A 1HTBA 2I4RA 1KVQA 3CLVA 3FNBA 3GGSA 2PX5A 3HR8A 3TPZA 3WA7A 2CLOB 4NBWA 2EZ9A 3IAM6 1EZZA 5DDIP 3ZH9B 1LD3A 4DG8A 4AQ7A 1P4GA 1M2OA 3F8SA 1BDBA 1FRQA 3PJEA 4CF5A 3G2IA 5LZ4A 3SZLA 4MA5A 4B35A 2H0QA 4FFPA 1E6KA 4OK3A 3NGMA 3GLFE 2VTBB 4DDUA 5BW4A 5LYJF 2PRZA 4Z9BA 5FUBA 4CL0A 1HDGO 1VPEA 5EIEA 4MVJP 1YZNA 3JD0A 3Q40A 3EMBA 5U4QA 4A1OA 2H1WA 2IHKA 1XTJA 4BZPA 1MX9A 4UTOA 4YV7A 3TE7A 4R0NA 1JHXA 1R0ZA 1I3LA 2Q9UA 1HDIA 3HZOA 4CKYA 1H23A 1BDMA 1V16B 3X1JA 1PNRA 3PQFA 4UCFA 1ICEA 2DHQA 5LXTF 3SICE 1EJBA 5BV2P 1HLGA 5EIAA 2M98A 3T95A 4F12A 2HL6A 2RAVA 2WYIA 2FRDC 4A5SA 3G8CA 5ALPA 4TTJA 1QF6A 5ARDA 2R6CA 3TLJA 1GNSA 3W8NA 1P6QA 4Q4JA 4DLBA 5FOTA 2O1SA 2O5EA 1AS3A 2XUHA 1SXQA 3S8MA 4YLYA 2LE0A 3DM5A 3QKWA 4GZ6A 1WDMA 4FFRA 4EMUA 5KREA 3U44B 4N7BA 1QZ3A 1VIMA 3UENA 1EEHA 1JB9A 3QFRA 3IQEA 1N8SA 2J33A 4O2RA 3IX7A 4N1AA 4O5OA 2QG6A 3DYVA 2I3AA 3BRWA 4ME6A 3V7FA 2IBTA 3LRPA 4GMXA 3QA3E 1KMMA 3OFND 3L8GA 2F8MA 2L42A 1ZMXA 3I6BA 2HA5A 2UZAA 4AO8A 2H1OA 2GVNA 2XCUA 2KE5A 3NRBA 3GQVA 4QQNA 4CNQA 1XNJA 5BW8A 4YHHB 3U3ZA 1GSAA 1C0LA 1L7BA 2Q99A 3CPEA 5M2QA 3OVMA 4E7PA 2BM1A 4QSMA 5CCDA 1HG0A 4XCVA 1TAGA 3GJTA 1IJEA 3IBGA 2PLRA 2QX8A 1XZKA 3O8OB 2ZREA 4OX9Y 2ESRA 4MQFA 1P8JA 5C46F 3LUDA 5HE8A 2NZ8A 1EP9A 2QB5A 4YP6A 3JARB 1U9IA 2XVMA 3UA4A 4U7WA 1H2BA 3KQTA 4KEAA 2NPIA 3O91A 2BE7A 2OORA 3VDMA 1ZO8A 1A5SB 2R1VB 3A6HA 1RI5A 1T4CB 1W6RA 2YWXA 3IQIX 3CUKA 4RORA 1XNGA 3C16C 1E3EA 2LV8A 5EHIA 5ARBA 1NBMA 3RC8A 4LG1A 3DUFB 4CEIB 4KIJA 1TU4A 4X8LA 4XEUA 3RFVA 2NMVA 1VHQA 3Q3HA 4MRMA 2XYHA 4JXXA 5I7VA 4NESA 5CAEA 3U26A 4RS3A 4DV1B 2X1LA 1ZP6A 1W29A 1AIPA 2F3PA 1CLUA 2J7KA 3AUUA 2G04A 4QFMA 5E6RB 3T4UA 5HGXA 4D81A 1CETA 3JRXA 1XA4A 3ZYCA 1KK0A 1HYGA 1JQLB 4YR7A 2V1XA 5KYVA 1JU3A 1SR8A 4XDZA 3SNHA 3ZTYA 3ZDAA 2FG7C 4O4JF 4C03A 1XZHA 4D8UA 2PUBA 2C3YA 4TV9B 4UCXA 4XDHA 3QBDA 3UJDA 1JKJB 1IL0A 1GYPA 4EY7A 3ZE8A 2B9VA 2YIDA 2QA5A 4N82A 1CKEA 3VR5A 4B9AA 1I7DA 1M6VA 1OTYA 5AHKA 3EGWA 1V7CA 3CCBA 3GNTA 1V25A 4E4YA 1KPHA 5CBKA 1BMFA 1XF1A 4BKQA 4KI0A 3KJIA 5F9FA 4QASA 3VOSA 1IWOA 1SIOA 2P2DA 4H7FA 4KOEC 4C4OA 2Q5CA 3VKHA 3GLIA 1JU9A 1LXCA 4G5OA 3K5WA 3QVSA 1SHJA 3HA7A 1W34A 4TVKA 1ODTC 3HFSA 1NL3A 1N34B 3ZHCA 1M2HA 2VQEB 2ZB3A 4AIIA 2FRXA 3DEHA 4L85A 4N3GA 3Q98A 3R9WA 4CN9A 3GDFA 5E9QA 2IYEA 1XFDA 2OV1A 1UBEA 1UWLA 2PIAA 2GKOA 2XBUA 3HA2A 4G85A 2BSAA 4QUIA 5EJMA 1L7MA 4KQ9A 3R7SA 3KTOA 4WV3A 2GN2A 2OB2A 4YB8A 2XUGA 1DIGA 1TDJA 2A9PA 4QVGA 4ADSG 3NXSA 5BT9A 1ZD2P 3DOJA 3RTGA 3BCUA 5B1HA 1UPXA 1N2ZA 2W6OA 4GXQA 2ZVJA 4QPPA 2P78A 1MTOA 2CSXA 4YALA 1ZRSA 3CNOA 1GCGA 1MVOA 3LS2A 3PENA 5GVRA 2VBGA 4KJXA 5JS7A 3BZBA 1PFQA 1RQLA 2JIDA 1W5FA 3ZHVA 1VI5A 1E7WA 5IT4A 1Z73A 2F00A 1FF9A 2H7CA 4J8PA 4J1TA 1TJ3A 3HHPA 3BK2A 3MWEB 1WB6A 1U28A 3N6VA 4NEQA 3ES9A 4LECA 4PSAA 2JIOA 3OPMA 4WUTA 4DOMA 4EI7A 1WZ2A 1P61B 1OWMA 2W2MA 2GZAA 1CVLA 1QV6A 2NT4A 4H1TA 1EFVA 4JJEA 5HZMA 1N5RA 4NXMB 1DG9A 3IBYA 3IDZA 1DJLA 4UMFA 1WAMA 3QVKA 1S4MA 1TF7A 4IDAA 4BP3A 1JWLA 3IOEA 2FN4A 4HAWA 1Z7YA 5SY6A 3SQNA 5E6SB 3OCVA 2IP4A 2I5PO 4JEMA 3WV4A 2EZ8A 1KKLA 2ZITA 3OO1A 3O1HB 3HCDA 2IYVA 4WY2A 5KMGA 2AD1A 2H6EA 3FSEA 2AVNA 2B35A 5K05A 1UAGA 4RPIA 3MJDA 3ROGA 4P3OA 3W77A 4WZAE 4O08A 4CM6A 4ZHQA 3JY6A 2FMTA 3COZA 1ONBA 1CRLA 1WF6A 2FUCA 1M54A 2XDQB 5CR9A 5KSPA 3RSSA 4MS1A 3V55A 4FZJA 4RABA 1AMUA 2GASA 2HRCA 3SQMA 3R5KA 4YQEA 2ZZMA 4QJBA 4NJEA 1WQ4A 1G66A 3NU1A 1EIZA 1Z3CA 1VMAA 4LCEA 1XG5A 3W8RA 3W9UA 4X91A 4HDOB 3QE2A 2R6ZA 4R7ZA 2VF5X 1WW2A 2JGEA 5EINA 5H1YA 3TTYA 4ZN6A 3HWSA 5IEBA 1ORDA 1MABA 3HVKA 1SBZA 2OA0A 2BFPA 3CX6A 3PHLA 1KEZA 3F6EX 1TXGA 3IB3A 5T57A 4MW0A 4QTUB 4R2JA 4TN1A 2O14A 2P65A 5BRAA 1Z47A 2D1TA 1QH8B 4LJ9A 3KVNA 4HATA 4MUBA 5KOHB 1SXPA 1I9GA 2ZW9A 3PYLA 5A04A 4JQCA 1WG8A 4DSZA 5BN3A 1T0PA 2IIVA 3HG7A 2GM9A 1CPYA 2HA4A 3QOWA 4ZU1X 1QC5B 3BSFA 4MW6A 1Y81A 2I2DA 2Y1EA 3GDGA 3PRYA 5D51S 5DBOA 3JRNA 4UDYX 2R7MA 5IAEA 2WE7A 1H42A 2B37A 3KQSA 3PNQA 3W5VA 4LZJA 1F14A 2EKLA 5K5EA 4KQ6A 4QXMA 3L84A 4RQBA 1WXFA 5AOCA 2C2MA 2XUIA 3QXCA 1ZVVA 4YXFA 4JUIA 5FI3A 4A73A 5BMVA 1Q7EA 1MIOB 1W93A 4D43A 3P5BA 3V1YA 3G49A 1R5NA 1SB8A 5C5DA 3OIYA 1MAAA 3K32A 1MBZA 4FYMA 1F8XA 4RENA 1SWVA 1SZPA 3KVVA 1KFBB 5H8WA 5EIBD 1GARA 1X80A 2V74B 2O3RA 2FFQA 1RWKA 2JGIA 5AI5A 1U2DA 3HDVA 1ZXXA 2XQFA 5E95A 1KBZA 2O8VA 8ATCA 2EGHA 5DB4A 2RMKA 1VCHA 2GLTA 5KTKA 3AWDA 3GJ7A 4NH4A 1XDWA 3QFCA 2ZXEA 4OP3A 5GVSA 4N5DA 1KYTA 3TX2A 3VPGA 3WQBA 2EGUA 2O2XA 4RK4A 3KPUA 3GCDA 1JPNA 1Z4KA 3A4YA 1F4VA 2QW8A 2WHXA 1ZI6A 3M70A 4OJMX 2FPSA 2OV4A 2QNRA 3DMTA 5HW0A 5DNDA 4BAUA 3D59A 1Q1QA 3H04A 5FNZA 3TZEA 4K87A 2X4GA 2QVLA 5B6PA 2EIXA 2Z43A 4L2IB 3I2IA 5H16A 1SVMA 1QWOA 1XCLA 1T9GS 1SIBE 3A6JA 2QRNA 2RJOA 2DXIA 1H8HD 2I2AA 2M6RA 4BE4A 1HDOA 1GPUA 1WW3A 5LYJA 3GMSA 1L1RA 2MCFA 4DVJA 3PJRA 1OZFA 1EK6A 4FOOA 3DVAA 4PG6A 4RSMA 1FC0A 4MSUA 3T9EA 3N8IA 1PZXA 5PNTA 4EY4A 3TGPA 1VKOA 4TTRA 3WRXC 1L8AA 1GLVA 2RGDA 3K0HA 3DWGA 3P9ZA 3X1WA 4DWWA 3JTEA 1Y8QA 3MA0A 3N39C 2RHCA 3HWX1 2AHRA 4FMCB 4G8CA 3L8EA 3QUQA 3WL5A 1JG4A 3SF8A 4C07A 4ZIRA 1L8QA 2C97A 4M98A 3UOWA 2FE1A 2EFJA 2BR5A 4MW5A 5DNAA 4HFMA 4MTLA 5IU6A 1KI6B 1Z15A 3IIIA 1GA4A 1Y9JA 3FVTA 4HC4A 4MCAA 4PBTA 1SCDA 1T1EA 1SURA 2WOJA 1WX1A 1AUPA 1R64A 2H5LA 3IGFA 2PLNA 3C85A 3P20A 4Z3OA 2OAP1 4R69A 5EZQA 1UT6A 4WWHA 1H5NA 2Y1GA 1PLJA 3A6ZA 3DBIA 1QZUA 2W43A 2P8SA 1D4AA 3DXYA 3TTTA 4H59A 2QHXA 1W36C 1ODJA 4ENPA 1MO4A 5AJHA 2OQ2A 3P94A 2Q4RA 1QE3A 4FJ1A 5FP0A 3E3AA 2X6QA 3UCXA 5C18A 5JO0A 2XMDA 4IF4A 3S7ZA 4B74A 4ZCMA 4EKDA 3FPGA 4RZ3A 4XVUA 4PRLA 3SLRA 5CM9C 3ONFA 3FHJA 4ND8B 1GQFA 3IDOA 2OBFA 2YY6A 2Q0XA 2Z95A 1HWYA 2DR0A 2ZULA 4MQ6A 4O8ZA 2AFHA 3ZN2A 5GJCA 3ECCA 1G1AA 4ARUA 4FFLA 5BNZA 4FZRA 4E13A 3K1ZA 1XTPA 1EVYA 1SQ0A 3CGGA 2XGOA 1ZD5A 4HPWA 4TTPA 2KSQA 3JWPA 4XUGB 3RIHA 1XTKA 4Q3KA 3B1VA 2F1OA 1G16A 3G7SA 3QKIA 3VZSA 3W5JA 4OI2A 5KC8A 1DKRA 1N4DA 4J07A 3CF0A 1UPAA 5KKCA 4MV0A 1BQEA 2H5EA 4GIBA 1YCDA 3CNEA 4KSBA 2F55A 4XLTA 5AK6A 5CXXA 5HIMA 2JF0A 2GLUA 3ONDA 2Z8XA 4CM9D 1S3GA 5FBKA 4BMNA 3NFYA 5EKXA 3W3ZB 2FK8A 3TL2A 1DWQA 1KVUA 4IKEA 4B4WA 3LVBA 2P4HX 1U9JA 2A9JA 4TMFA 3QU7A 4QQ8A 2FDXA 3CGWA 3FCEA 3LI2A 3OF2A 3CNBA 4NG5A 4JLUA 4ZQHA 5AM5A 4LVUA 1JEQB 4PFSA 3U4DA 4QM6A 2Q3FA 2VC2B 4RVFA 3UKDA 4UM9B 5KTNA 5E4FA 2Z4RA 4KO1S 4WI1A 4PVDA 1LF0A 2OCGA 4M22A 4ZQGA 3U37A 1SH7A 1Z2EA 1IN8A 1F0PA 3DP7A 1V11A 2GVDC 4UVIA 3MTEA 4ZP1A 1EVJA 4LYAA 2OV8A 4Z8XA 4X64B 5EC8A 4H4CA 4XSHA 1N2CB 4D2IA 3F0TA 2XI4A 1R9GA 2CZCA 5B1IA 2VSNA 5I7OA 2AC2A 2M6KA 1PR4A 2C2XA 1FVOA 2J6CA 4FIDA 3LMKA 1VECA 2AF3C 2B4KA 4JOCA 2WJWA 3RSHA 5GAJA 4WFJA 1NP3A 3UMCA 1EK1A 3GJRA 4WZBB 4ZANA 3RJZA 4L4XA 3D6FA 2QP4A 3R5SA 5DRTA 4AN0A 1Z25A 2H0AA 3NJ8A 2EFHB 1OXBB 5DP1A 3B1KA 3LVQE 4QDJA 4RJIA 4F3YA 3S27A 2PSHA 3DEJA 2SCUA 4IX9A 3K9FC 2AN3A 5P8WA 4JLMA 1SA0B 2W11A 2RC5A 1ZSVA 3HJGA 3I1FA 4NJMA 4QDZA 5JNVA 1TIKA 1CULC 4O25A 2OG2A 4E5KA 1GDTA 4C7MA 4YMUA 2EWWA 5BMOA 1X3SA 1BE1A 2ZYVX 4BUJA 4G4SO 5ARCA 2VRCA 1ZOOA 3VHLB 1NGSA 3WQSB 2F64A 4ZCSA 1LPOA 1M9NA 2E4WA 2ZVQX 4YTEA 3ZQJA 2VTBA 4GZ5A 4CJXA 3A10A 1TJ5A 3UMJA 3IB6A 1UK6A 6ADHA 1R0YA 5J2UF 4BYMA 4YJGB 3GCXA 1L3BA 2Z9DA 3HWRA 4DSAA 1VTKA 3TQIA 3WICA 1D6SA 2VDRB 1P9NA 3VNQA 3WGUA 2YDYA 4P3YA 3Q85A 2XW6A 3BE8A 3FPHA 4JWTA 1DKLA 1Q3TA 1RWPA 4M0MA 3KWJA 4QREA 5CDTA 4FYJA 5KSWB 3B60A 1HEYA 1TTPB 1GPBA 1IZ7A 1P6UA 3RRMA 4PN3A 1UQTA 3GDOA 3MJVA 2XUAA 3A4MA 1HA3A 3UNXA 2IE0A 4NE2A 1T26A 4TV8B 5E9WA 1P4JA 3ANMA 4YXWA 4WJKB 1QP4A 2Y0EA 2GJSA 1YJ5A 2VNJA 1Z5ZA 3ZI7A 1K5GA 1VMKA 3PSHA 2J9XB 5JJLA 3ICPA 2XUPA 3G17A 3KC2A 1CRWG 3F73A 3K92A 1QIKA 3KCNA 3ABOB 1QMGA 1YOBA 2CL7X 4GM1A 3CMCO 3HNPA 4AZWA 4E88A 1PUJA 3WGVA 2GXUA 3DF7A 5FCDA 1D2GA 4ZOAA 5JJ5A 1F12A 4QYSA 3CT4A 3GWZA 3DQPA 4JASB 5FI0B 2ZJ5A 2ZB2A 4C6RA 4WOCA 4ED9A 4EUEA 1US8A 3M4ZA 4RVCA 3UMMA 1WL8A 1JAHA 4QOJA 2G83A 5CDFA 1KDZA 1MENA 2FV8A 2K5UA 2ZUVA 2J7PA 3D02A 3EZGA 4RGYA 4UOQA 3DLCA 4D3DA 4WKPA 4CRWB 1H05A 3GVPA 1RSZA 2YVKA 1J7JA 3KOZA 4EMBA 4AFNA 3JQ8B 4A9AA 3F7MA 4MGYR 2JLWA 1XEXA 1XO1A 4K6OA 5C35A 1MG0A 3LZ6A 3QU9A 3J80A 4OA8A 5A02A 4PZZA 5FUQA 5F2NA 5KEIA 2E5FA 2ZP1A 3FRHA 4RIEA 4JLBA 5BSVA 1JXMA 3SHVA 2FP3A 2O6HA 4RF5A 3VAZA 1ISGA 2E87A 2VT7A 4M1QA 4LZAA 1HRKA 3VR4D 5JDIC 2P5YA 3NHBA 3TLGA 3MLAA 5FBVB 4G84A 4WKOA 1DT5A 1O54A 1UH5A 3H2GA 4MS3B 1ZCAA 4MQFB 4B79A 4W8HA 4EW3A 1A04A 4P32A 5AVRA 3ZCQA 5IEJA 3OY7A 1ZHHA 1E0KA 1ZIDA 4QGFA 4LV6A 3CJTA 2JCYA 2MMCA 2R1VA 3S6JA 2OK7A 1G18A 1W59A 1NTRA 2BSXA 1Y1RA 1SXJA 1QK4A 2ZRGA 2BP7A 3B7GA 3CB2A 1M2GA 3IHWA 3K5PA 1A0OA 4HNHA 2C4UA 2AIRA 5DNWA 1B6GA 1SK8A 1GAJA 4H4DA 1GV1A 2DFTA 2XY4A 3AY6A 4TLAA 1LF5A 4OLJA 4UUMA 4NEGA 4URZR 2JW5A 1HE2A 2Q3LA 2IJGX 4U3JA 1A72A 1JS1X 2A7QA 2AI2A 2ZT7A 3KRTA 4FOLA 2ZRQA 4FUQA 4FC7A 4W8OA 4DEYA 3IQXA 4G5SA 4XFKA 4HGQA 5FQNA 5A7HA 5TMBA 1H93A 5H83A 1CJUC 3T12A 2UVPA 3WGGA 2GPWA 2HO4A 4K28A 1G6KA 4LNUB 3I04M 1E3WB 1C29B 4ICIA 5EP1A 3QMWA 5LOVF 2A0KA 2X42A 1P8AA 4ZO4A 1Z74A 4D80A 4A0SA 1I6MA 1OLUB 1A27A 3NEYA 5GGXA 3Q0TA 4GBMA 5FA6A 1LY1A 1CQIA 4LYDA 2TS1A 4NIMA 1YKSA 4GL4A 3SC4A 4MW2A 1FDOA 3DW1X 1YKFA 4AP9A 3I52A 4RZHA 2VDQB 5T64A 4ABTA 4POAA 1EEXB 1P5ZB 1BGVA 2C59A 2EIHA 2FW7A 4H60A 2A5LA 2WSSD 1P4HA 2Y99A 2HK7A 2D0IA 4CUKA 2IS4A 3HB7A 1UOEA 5JV5A 4LOIA 4LXQA 4YS6A 2HT6A 2WM9B 5C52B 3B3FA 2I3ZA 1QHHA 2XMRA 4EZEA 3THOA 3NRCA 1NNEA 1VLMA 3AO0B 3OE5A 1HSOA 1RCUA 1EQUA 4G1FA 2GZ2A 3LFTA 5FOWA 2I9PA 3P8ZA 4YRCA 3K35A 3KSDO 4PC3A 4L02A 2PNJA 3SE0A 5K0JA 5KX5F 4NFLA 5LU8A 4RZIA 1NJSA 1ZVQA 2GH1A 1XZGA 2C5AA 1F2VA 2IS6A 2ZWIA 2WIAA 3AUFA 5F21A 4QELA 1A98A 4LY3A 4EY8A 1QZXA 4RS4A 2BFMA 1SCQA 5AW8A 5JECA 1B42A 2LDXA 3E5HA 1ZK0A 3VRHA 7REQB 1TI7A 3C7DB 2ZJYA 2HQBA 4NY1A 2H29A 2REOA 3QRWA 3R20A 3GLSA 4LRUA 1EFRD 4L74A 1LPSA 1CFJA 1RM0A 2QPOA 3AINA 5FWNA 5HQ3A 1XYVA 1CF4A 1DBIA 1HNXB 2LVBA 1BVRA 2C61A 1XA0A 1ZJZA 4RM2A 5AWFC 1NNSA 2K6GA 1XEWX 2ZTHA 3VH4A 2AJLI 1E9CA 3THYB 3T3NA 2UUBB 4WKBA 5AVTA 1K7EB 2B4TO 2GAFA 3NUGA 4CMGA 3WLLA 2I67A 4A23A 3H2JA 3CKKA 2VYNA 3HKDA 3HSSA 2XBMA 3H99A 1U0TA 4JI2B 2BUCA 4QGAA 2ZJ3A 4HMQA 5U1PA 2O8CB 3MTDA 2OHJA 1EA5A 3A70A 4QZVA 2UZ4A 4IIHA 1UMBA 4HYTA 1JG6A 2YW2A 1CCWA 1UXOA 2H11A 3L07A 4NQZA 4ZT6A 3UJHA 2F8LA 1NJGA 2JI6A 3JR3A 4BEVA 5B7QA 1E9SA 1ZUNB 1AK1A 2WF7A 1N4AA 2XRZA 2IDMA 1P31A 1DKOA 2QL5A 4BWFB 2AF4C 1UL1X 3DZIA 1JVNA 1T1RA 3G2JA 3N7TA 3M4XA 4RV4A 2EARA 3G9UA 4JJIA 3ZDXB 3D54D 1QYWA 2FQXA 1FQKA 3HVJA 4TV9F 2ZUEA 1D2HA 3BH0A 1DJPA 5GMOA 2VK2A 2WWRA 4Z49A 1DOHA 1FFCA 1Z6AA 2GS9A 2GUGA 3RQIA 4UTRA 1M83A 3ACDA 4DCOA 1CFZA 1U0GA 1RM4A 3EVBA 2FSHA 4PNZA 4F4HA 3T1OA 1WZCA 3LUPA 1P1IA 2MJLA 3PEVA 4G5FA 2WUWE 4M8IA 4QOFA 3NAMA 2P8JA 4R1PA 4QTYA 1GZ7A 2ZUCA 3ZGYA 4OHXA 1LJUA 1J8FA 2V03A 2G17A 4ZVUA 4JIGA 1GGJA 2CL5A 1XZBA 2IX3A 2Q6TA 1J5XA 3BDIA 3I53A 1OFUX 3UEOA 2PH7A 2YWGA 3VGPA 3IKJA 4ZFNA 2VSXA 4OQLA 2H07A 4OQFA 9ATCA 1JEQA 3HU2A 1X39A 1TMYA 2GYVA 3OFKA 4BV8A 5JXWA 4YRMA 3JQQA 1KJWA 1QK3A 4BRZA 4HAYA 1JJIA 3LG2A 1VIDA 3GJSA 2PKRA 3ETCA 2HSWA 4B6RA 3BD6A 1HDCA 1ZISA 2VK4A 4EEZA 1EUYA 1HLFA 3ANLA 3GJ8A 4KR6A 5DTQA 1XUOA 3TMYA 2PQ0A 2WU4A 2Y9MB 1N6RA 2ZU0C 4MUIA 4X1KA 4ARIA 2OO5A 5LZ8A 2BHRA 3E05A 1DCTA 1BEUB 5HBGA 1I3KA 2O20A 4P4NA 4Z0TA 4C2UA 2ONYA 3UT0A 4ES6A 2DERA 3MELA 1K3FA 2I66A 4XVQA 2WNIA 4UUOA 4EY6A 2X14A 4PPGA 4HI0E 2O0HA 2R00A 4KHPB 1SC1A 4IIXA 4JP3A 4AN4A 1NBWB 1YU6A 3N59A 3ZI4A 1Q16A 5FAXA 3ND9A 1PJAA 4QFCA 1Y33E 4QXAA 1XRSB 4CUJA 3T3OA 2B7CA 2VKTA 2J4CA 3E7FA 4OB8A 1Q2XA 3UPDA 1IY0A 1WKBA 2NTYC 1CIVA 3O2QB 4B1FA 1R16A 4F96A 1OX4A 3KKEA 3RS0A 2YHAA 1U3UA 2FHPA 3N8HA 3N8NA 5K8CA 2PKQP 1C9KA 2FP4B 5IYZB 4FDLA 4NYMQ 1THMA 5BN3B 3DOUA 2G80A 4YFVA 4TZ0A 5LLTA 4F6RB 1TA9A 2H1SA 2YMLA 1WSDA 4I2VA 4WCDA 5KKNB 5L51A 1NXTA 1DP4A 3NV9A 3UW1A 4J2OA 4B3TB 1RVV1 1OLOA 4C2BA 4TS3A 2B1RA 2FW6A 3KJGA 2IKQA 4K6GA 3RVJA 1ZMBA 4XB2A 1F38A 4I4TF 4PLHA 3WK5A 2SECE 2Y68A 3Q7EA 3DMDA 4Q9LA 3UUFA 4BEBA 5CFQA 5E9AA 1FDUA 1GAXA 1E9EA 1JR3E 2DPXA 4HNGA 9LDBA 4FSHA 1QIJA 4V0RA 4ZC1A 3UJ3X 4C30A 4B3BA 1UBKS 4GI7A 4BQEA 4KKXB 2AYYA 4TL6A 5F7ZA 2HYIC 1B8PA 3LECA 3EUAA 9LDTA 3ORHA 1CDDA 1O5IA 4D57A 3A0UA 5DU2A 4D98A 3VO2A 5LFAA 3EIUA 4F1JA 1CS0A 1NWHA 1VKRA 2UZ1A 4LRXA 4P2BA 2QTMA 2QYHA 5DWDA 5BYBA 3DDUA 2C2YA 4FNGA 4MQLA 4Z86A 5EOVA 1S5PA 1Y8QB 2EKZA 3O8QB 4M76B 3GLRA 3ML1A 4OUDB 4RD2A 3CC8A 4HAZA 3RUIA 5IJZA 1YR2A 3P9CA 4RADA 1PT9A 1ZN9A 1MN6A 1NLMA 1U7DA 1V9SA 4KP7A 1NSTA 2JLUA 3NWEA 1C8KA 2QTLA 1WIWA 4TXNA 2J85A 1XMJA 3ZK8A 2B7LA 2FKAA 1V41E 4B73A 1CZHA 1WVIA 4TXHA 4ZAWA 3KALA 2X41A 5GOZA 3S2SA 4AK9A 4Z7OB 1RHKA 3HUDA 1AQNA 1AGPA 4Y2QA 3K8QA 1A8PA 3AKEA 4HXFB 3AEXA 2PS1A 3WGMA 2BISA 3T34A 1EJ0A 2CHVA 2F43B 5DCWA 4ALKA 5AW9A 5EMMA 3EQ9A 1YOVB 4PTLA 2OXCA 5BVGA 1CUJA 1JLMA 4M46A 4ZV7A 4DR1B 4R5MA 2OYRA 2YXNA 3Q6IA 2IF2A 4QICA 4WFIA 1PVDA 4Y2RA 1R4ZA 2QK4A 4B85A 1PWEA 1VMEA 2L2QA 3DH0A 2H18A 5IVDA 3U44A 4XR4A 1QYRA 1VYVA 3DGEC 3GV0A 4KDFA 4MVJH 5BN4B 2IF0A 3AEKB 3THRA 1FYDA 3CONA 3ODPA 2H1CA 4C87A 2ZZNA 4M87A 4LZOA 3UA3A 2R5WA 4YECA 2FSPA 4WERA 1GP2A 5IF9A 1OH5A 2H65A 1T9BA 3DNPA 3LQYA 5LZ7A 3PFNA 3MPOA 2AFIE 3E9DA 1QH1B 3DPUA 4RXTA 3M9WA 2XT9A 4NCAA 1XKXA 4ZO8A 1M8GA 5I9IA 4OQZA 1MCZA 3BMOA 1F8GA 2VSYA 3UWOA 4LWZA 2GM5A 4DB2A 1P1RA 1ULTA 4XKJA 1EHYA 1AQ6A 3B7PA 5JO9A 2NTNA 3Q7TA 2FGKA 4NZPA 4DMUB 4LKOA 1KK2A 2ALJA 2HBRA 2AK3A 2AWNA 1J8VA 4WVFA 3P45A 4CODB 4LE2A 3TNJA 3H2IA 4HQLA 4Y6OA 3RJTA 1H1DA 1O87A 3T0FA 3FPAA 1J9GA 4FHCA 5C8DA 3AM1A 3TUIC 3PXAA 1ODCA 4IJQA 2UVDA 2AW3A 3DTVA 1TUBB 2IXDA 1ORVA 1Z8FA 3KQQA 4IHJA 5D3ZA 1O9BA 4F45A 4I55A 1FJGB 3ZE6A 3H8WA 3O3CA 4ZYVA 5KTYA 4G0ZA 3VQTA 4AKEA 4AROA 3H1AA 1RC8A 4Q00A 4U7GA 5FBRB 3FTCA 3EC2A 5COBA 4MVJM 5CW1A 3N05A 4HDMB 1KP3A 1YL7A 1KYYA 2NYRA 4U6QA 1A1VA 2PGIA 4LOHA 5F64A 1E62A 4D9BA 4JI0B 3LCMA 1OYWA 4Z8YA 4YJGA 2NXEA 2OSVA 1Z37A 4WGFA 4AJPA 2ZB4A 1A8QA 1L6RA 2BFEA 1ZLYA 5KDLA 3D4OA 3N2IA 3FPCA 3A3YA 1BFUA 3K9WA 4HYEA 4YJDA 4X3PA 5BMVF 3CSDA 3TVTA 5BOVA 3UAYA 5KTTA 1UZLA 4UU0A 3ZWNA 5HKKD 4DA7A 3NP7A 4E5PA 1RLTA 1RRFA 2ONZA 5TSDA 4OYHA 2O06A 2PZJA 3RS3A 2VDMB 4X93A 4CQMD 4BB0A 1WXIA 1T1IA 1QQ5A 3N75A 3ZWXA 2AXEA 2CBXA 3TVYA 1POWA 4BX8A 4ZGWA 4TOIA 1OX6A 4LYYA 1W0JA 1P2VA 1P62B 2OP1A 1CZNA 3A6LA 3F67A 3C3XA 3JRWA 1AK2A 1AKMA 4GO1A 2GA9A 4RVUA 2Q0QA 1V6SA 3DV2A 2OM6A 4WOJA 4EYEA 5KQGA 3EPJA 3HU3A 4A2WA 3CRNA 1VJ5A 4G0MA 5L7TA 4MVJA 4QJ3A 2FOXA 4BVLA 4W99A 4ENWA 3KBOA 1Z0AA 5IT5A 3C5EA 2PJUA 1VPTA 3H2HA 4MYCA 3NBAA 1JXAA 1PR5A 2XTJA 3BAZA 4QGHA 2G4LA 2J3HA 2RSLA 2B61A 2FVXA 2ZIEA 4GI2A 2VQFB 5A03A 2PBZA 2ZE6A 1UBNA 5BQXA 3CBGA 4JV5B 2WQ6A 3AR8A 4HO1X 3K6SA 2L0XA 3AQ4A 3GUZA 2XTAA 5JASA 1P0FA 3ZLJA 2VP5A 3COPA 5ALNA 1FDVA 1N9GA 1ILEA 4DR5B 2I8CA 1N8NA 3TMKA 2R87A 4BCDA 3D7KA 2AW5A 1TYCA 3IIKA 5JCZA 2VYVD 3DMPA 3JQ8A 5IUNC 3SFVA 1WM1A 3K05A 1T3HA 4ER3A 1TU3A 2XDYA 4WN9A 3GLGA 5G1PA 5C3UA 3AKYA 2HK9A 2CHUA 1PAUA 3DEKA 3LC2O 4ZHQF 4ZGBA 1XNRB 2HWWA 1TGYA 1O95D 3FYCA 1ENOA 3Q3CA 4NARA 4YJFB 1XRMA 3QPDA 4TTIA 3RK1A 4IOLA 3ESBA 1MXHA 2CJFA 2V58A 3VR1A 3G9ZA 2J5BA 4RTMA 1L7OA 2YWEA 3L4BA 4IH4A 3HL4A 2OBYA 2GN4A 4DMCA 1DG1G 1K7YA 4Q82A 4MLDA 4EUSA 5JIBA 1AGRA 4MMXB 1WB5A 2IYYA 1OYYA 3NUZA 1EA7A 3GFOA 2QM8A 3PQ4A 5KNDD 4OU4A 4BEJA 2IW1A 3PXBA 2IV2X 1GEEA 2ODTX 2IGBA 3BQ9A 3ER9A 1ZNXA 1TU0A 2R3SA 3R3WA 1W8IA 2G76A 4Y9UA 1S2GA 2D4HA 3D81A 4MS1B 1L4YA 2CJWA 5JW6A 1G6HA 3GLKA 4QUBA 1TZMA 3KQPA 4PXYA 4CG1A 1RKUA 5J43A 3Q8LA 1GXSA 3HP4A 4PYIA 1K8YB 4MS3A 3AHJA 1A4UA 4P3XA 5JNSA 1J33A 2X9QA 3AMVA 2BI8A 2EBFX 3GOHA 1NP6A 3PEUA 2B8EA 3OT1B 2QTVA 4GP7A 4QULA 2NZYA 5L40A 1I2ZA 4JYAB 1IRIA 1WXQA 5JLJA 2WC1A 4LMRA 4IDPA 3G9XA 3FUXA 3P96A 4J0FA 3V4RA 2R6FA 3MTGA 1RXVA 3LDUA 4JMLA 4HGPA 2WD7B 2YRWA 4KQCA 1WPRA 4M53A 3GK3A