3KQUA

Three conformational snapshots of the hepatitis c virus ns3 helicase reveal a ratchet translocation mechanism
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
437
structure length
437
Chain Sequence
SPPAVPQTFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPITYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSSTGEIPFYGKAIPIETIKGGRHLIFCHSKKKCDELAAKLSGLGLNAVAYYRGLDVSVIPTSGDVIVVATDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRMGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTTTHPITKYIMACMSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords Serine protease/NTPase/helicase NS3
publication title Inaugural Article: Three conformational snapshots of the hepatitis C virus NS3 helicase reveal a ratchet translocation mechanism.
pubmed doi rcsb
source organism Hepatitis c virus
total genus 148
structure length 437
sequence length 437
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3kquA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kquA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kquA01
4JLKA 3W8NA 2YOFA 4OJKA 1II8B 1VECA 2BEJA 1DO0A 2CL6X 2F3TA 2GJAA 3EAQA 2DCUA 3G5UA 1OYWA 4UQOA 4NYIQ 4DCUA 1QBKC 4I1UA 2RGGA 5AJZA 2D2FA 1G8GA 2XSZD 2FOLA 3GJ3A 1AQYA 4FMCF 5EP1A 2BBOA 4Q9KA 3BB4A 1E2GA 3IQXA 4PPGA 1GAJA 2IF2A 3UMSA 1KMQA 4DSTA 5JWRA 2YWFA 1LTQA 3K9NA 4ZPXA 3NH6A 2WAXA 1ZNYA 5L8VA 2ZE6A 1JAIA 4NL4H 4DWJA 1FTSA 4TTQA 1EFHA 1F6BA 2KI5A 2Q9AA 2VYFA 1P4SA 2H18A 2C99A 3QPWA 4TLEA 1ESNA 2ZTSA 2WBLC 3C8UA 1XD8A 3OEHA 3ZS8A 4DZZA 3AVUA 4EFLA 1U0LA 3OHMA 4C30A 3C15C 2HEIA 3K0EA 1C1YA 4KV9A 3C41J 3CZPA 1DAMA 3I3SR 1G3UA 1E2PA 3KQLA 4JSTA 1E2LA 2WWGA 4IKEA 1G9XA 1IHUA 3W5JA 5CYOA 4M4SA 1TAGA 4TMTA 3PXGA 3LXXA 4X8LA 3ZVLA 1V43A 4B74A 5KSPA 4I81A 3KUCA 1KSGA 3E1SA 2MSEB 1S9HA 1NN3A 1N0UA 2BBWA 3MSXA 4MRVA 1UFQA 3QBTA 4A1FA 4AYXA 5FBVB 2EWWA 2TMKA 4LJAA 1YR6A 4UNRA 2ZRAA 1RKBA 3SFZA 4AG5A 1A1VA 2REOA 4Q9LA 5EXSA 4PAMA 2ZYUX 2F9LA 5J4HA 4DEYA 3O8BA 4GI7A 4C0LA 3Q9LA 3GCGA 2FGKA 5TXGA 4BQSA 3CM0A 2VBCA 1AM4D 3ZDQA 2WIBA 1GWNA 4OHXA 3NG1A 2UZIR 3SU8A 2IS6A 4DSNA 1ZUHA 2QP3A 1P2UA 2ZRPA 1COWD 4BEBA 1AZTA 4MDFA 2G3YA 5KDOA 1JEDA 1XEWY 4A2QA 4TMZA 1S3GA 4DRZA 2F43A 2F9MA 2AD5A 2FFBA 1UKVY 3NH9A 3LQRA 3SDZA 3TRFA 3U3OA 2NZJA 1PLKA 4LWZA 4KODA 2HT1A 2OBLA 2J0UB 2WVJA 3EIQA 4DDVA 1Z83A 3SNHA 2QAGC 3GD7A 4JMPA 4BASA 4LDJA 2XX3A 3KB1A 2RGNC 5D3MB 4EQ6A 1IXRC 3CRVA 3THYA 4M1OA 3OE7A 4TQAA 4TWZA 3CUEF 1OH5A 1N6NA 3NBYC 1PLLA 4PC2A 4EUNA 2IT1A 1LF0A 4ON9A 3ZZUA 3VX3A 4DIDA 3GLGE 3HP1A 4TZ6A 1J90A 2ZJ8A 1H8HD 2FE4A 3D6TB 2QM8A 3REGA 4GZLA 1Z0FA 1E0SA 5B30A 3EZFA 4YXWA 1P61B 1W4AA 1FUUA 3MAAC 1K8RA 1QHGA 1OYYA 4RD4A 4UNQA 5TVKA 3FKSD 5FR2A 2G6BA 4E09A 1OXUA 2V4ZA 4BZPA 3W3ZB 4KO8A 2IW3A 2O0JA 5FTKA 4A6XA 4PQYA 3TSWA 1TNDA 3B6EA 2ZIAA 1H8EA 3QXHA 2AFIE 3TGPA 5DH9A 2YKGA 1KKMA 2ZITA 1W2HA 2C9CA 3I72A 3RDPA 5J47A 2F1RA 2OLJA 2ZSEA 4H1VA 4Z54A 2O8EB 4EFMA 4PZYA 4UNPA 2WAYA 3ZVRA 1KDTA 4TYPA 2FFHA 3X1ZA 5JS8A 1A7JA 2XTNA 1D5CA 3QKSB 2BMJA 4FMBB 4MRSA 2QROA 5FL3A 3T1QA 3EPJA 3TLXA 1KI1A 3AQ4A 1G17A 5JI3E 3K0AA 1U8AA 4KJZA 3RABA 4NMMA 4Z8YA 3RS3A 2FFAA 4IEEA 4GMDA 2WM9B 4ZKDA 1HTWA 5SZIA 2BM1A 5JJKA 2W2TA 3AKCA 2GA8A 2IS1A 3OAAD 3KB2A 5FTNA 4IW3B 4DDWA 1HE1C 1TU4A 5BQ5A 2ZRKA 2JLQA 2UVQA 3VHLB 3EPKA 4CT5A 3HU3A 2ZEJA 4D81A 1PUIA 4RY2A 1D9ZA 3UATA 1ZUIA 4M1TA 2WOOA 1G3MA 4JSYA 1NNEA 1BYIA 4OYHA 1F2TA 2BCGY 3GLHB 4W5HA 4QRHA 1Z0KA 2BJVA 3O8CA 1TQ2A 1VYUA 4P33A 1TEXA 3THWA 2PMKA 1ZM9A 1KAOA 1WRBA 1F3OA 2H8KA 2HLDA 2R6DA 4LYAA 5DGXA 2WWYA 5F9HA 2O8CA 2JA1A 1MO5A 4HLDA 4II7A 1AKYA 3R8FA 2F55A 2FZ4A 5KU1A 1CR4A 1W36B 2J41A 2FEOA 3GEEA 3DZDA 3H84A 4HATA 3WP1B 5JRZA 2Q3MA 4JL6A 4LJ5A 5E3HA 3CWZA 4RKFA 1RE0A 1GZSA 4XD7D 4B76A 1GRQA 5DE3A 3K0CA 5H68A 1HT2E 2FZLA 1XEXB 3TIFA 1NN5A 2C95A 2RMKA 5JEDA 2R9VA 3WYAA 3RWOA 1Z22A 2O8FB 4DCSA 1XD2B 3CRW1 3THXA 3WMFA 4WW0A 3FTQA 5EP3A 2ZI5A 4HYYA 2NO1A 1OPXA 4LJ9A 4E5UA 4JKIA 3AKDA 4L16A 4MGZR 1T3LA 4MUBA 2KBFA 1P75A 4D82A 2F3RA 4LJYA 3VR5A 4IXNA 3WMEA 1E1RA 1XJCA 3AKEA 1XCMA 3FFAA 4XVUA 4PQFA 1XFAA 4ZDJA 2OESA 4NDZA 5CIQA 1DE0A 2W58A 1GG2A 4PANA 2F1IA 3DMDA 1GSIA 4Q7KA 3X1YA 1DAGA 3TE6A 2RKOA 5FOXA 2ORWA 4EPWA 3FOZA 3UMFA 2W6JD 3FMPB 4YMUA 3VAAA 5DIFA 1ZU5A 2KWIA 3QXXA 3B78A 2J5XA 1LVGA 2V8OA 2WZQA 3PQCA 4LJ4A 1Z47A 5TARA 3TR0A 4DLRA 2B7CA 4HZIA 3A1UA 4I4LA 5B57C 5HPYB 2WJHA 4NCNA 4C2UA 2A5FA 1XBTA 5HCNA 1DAHA 1KIMA 2NO9A 3UWKA 3WHLA 4R7ZA 2ZRMA 3RS2A 5H70A 2DWQA 4P4SA 3NBZC 2OBNA 2RAPA 4ZDIA 2IYVA 2C5LA 2WWFA 4ZCLA 5BN5A 3U7GA 4OI0A 5DHFA 4O0MA 4RFVA 1Z0AA 2MSDB 3U7EB 3CO5A 1T6NA 1CS4C 4PAOA 5FPSA 5E7JA 3TJZA 2B8WA 1MABA 4NE2A 1YR8A 1KSJA 1G6OA 2DHRA 2R65A 2OE2A 3QKRA 5G3ZA 3VMFA 1TMKA 4KAXA 2OXRA 3ZH9B 2GJSA 2Q3HA 2CLCX 3D8BA 4QGFA 3KQUA 4NKRA 1DEKA 2BDTA 5EZ6B 5LB4A 3B7GA 2AK2A 4DT1A 3H1TA 3CNNA 3AV0B 2ZUCA 4HLUA 2XSZA 1XCPA 4ARZA 1J8YF 3R9IA 1E9DA 4JKYA 3CONA 3U6BA 1KK2A 3VKGA 3K1JA 5BYKA 2WMOB 5EE0A 3CF2A 3A8TA 4P32A 1OFTA 4ESVA 1MV5A 5J4KA 4WAUA 1II9A 2YWEA 4Q4AB 1G19A 4ZCIA 3QEJA 1JEEA 4KVGA 3TAUA 1ANKA 2GZAA 4QBFA 1P2SA 4UXIA 1SHZA 1NI3A 4XSHA 1QVRA 3HJNA 3GLIA 2PMDA 1XTQA 3KTAB 2WICA 4GDFA 3UMRA 5DLQC 3ONWA 4WA7A 1KO1A 1UEJA 3ND9A 5JSZB 4XVQA 1X3SA 2GVDC 3QE0A 1GILA 4DCVA 1E9AA 1XTSA 3PUZA 4OHVA 2QQEA 2Z83A 4BFUA 1V5WA 4D26A 3BFXA 3HR7A 3VU9A 1XD9A 1E2FA 1E94E 1FX0B 3KJHA 4H9GA 3T1VA 4ZDWA 3GFOA 1W0KD 4KXFB 3T5GA 4G5RA 2GEVA 2ATVA 4QGGA 5P21A 2PLFA 2VP9A 4KU4A 5KHOC 1J2JA 3NHBA 1XWIA 2QMOA 3AB3A 4M21A 5JMTA 3R7WA 3WNDA 2JJ8A 4A9AA 2BMFA 4MITA 2DFTA 1ZD9A 1VCOA 2NTYC 4BFTA 2CCKA 3G82C 3E2IA 3H86A 5FBQB 2A7QA 2YINC 3BS4A 3QSYA 4QBIA 1COWA 1TX4B 2PX0A 1XP8A 2KBEA 2KSQA 3AF4A 4FD2A 3PUWA 3SN6A 5F2EA 4KVAA 5JLJA 1RYFA 1E32A 4LBZA 4D0GA 2N42A 4LHZA 4US0R 2ZS8A 4DLSA 2A5YB 2R6FA 2C96A 3MWJA 4PO1A 4CEIA 1NVWQ 3BH7A 1E2EA 3O47A 4G1UC 1YZGA 1UAAA 2GF9A 3FWYA 3X2SA 1T3SA 4NZYA 4PHTA 3VFDA 2DY1A 1KY3A 1LV7A 1K5DA 2AWOA 2X8AA 3UXMA 1N25A 4Z8XA 2QTHA 2P6NA 1A82A 1CR2A 1MO6A 2YC4C 3AVTA 4FN5A 2GXQA 4IDHA 4ACAA 2PL3A 3HDTA 3WP0A 1H8HA 2WJYA 1JQJC 2RGNA 3WHKA 4DEXA 1KMHB 1YKSA 2H57A 5DISB 2O8BA 4US2R 1M2OB 1RJ9B 1L4YA 1RVDA 2N1BA 2ZUDA 5BW8A 1OW3B 2ATXA 1G291 3MLEA 3ADCA 2IYWA 5JI2E 3FKSA 3IHLA 1XX6A 3THOA 4QNRA 3QKUA 4PXAA 4Q18A 3AM1A 2JJ1D 1DAEA 2J7PD 2HF9A 3CKLA 2VLIA 1OV4A 5CM8B 5JWHA 4BFWA 4TYYA 3FFBA 1M34E 2C2HA 2ZI6A 3H0KA 4TSFA 4PHFA 1MT0A 5HE9A 4XWKA 1OIVA 4B3CA 1QVAA 2WKQA 3NC1C 4GP7A 1YRBA 4UKDA 1KTVA 2BVNA 2P67A 5IHPA 4BRWA 4OQLA 3F0TA 4OHWA 2GESA 1C4OA 1NIPA 3HWSA 4B71A 2MMGA 3UG7A 1DVRA 1T0JB 4BZQA 1Z8FA 4JBWA 5L3SA 3KJGA 2NMVA 4LPKA 1DG1G 3U4QB 2VP6A 4NCJA 3ZS9A 2AKAB 4TMVA 3AP2A 5FL7D 3KKMA 2R6CA 2CK3D 4FMCB 2YWGA 1G7SA 3LNCA 1IJFA 3A36A 2O0KA 2IUSA 3OAAA 2RGEA 1NLZA 3NWJA 1H8ED 1D2MA 1ZNXA 1IXZA 1G1MA 2K5UA 5IDVA 4BFYA 4LRWA 5EUMA 4HAZA 1G3QA 4GZMA 2B7BA 3SYKA 2ODWA 3NDPA 2XNSA 1Q22A 2YHSA 1T9HA 1J70A 1VDZA 3EZ7A 3LLMA 1XXHE 3IEVA 3U44A 5A4JA 1QG4A 1OH8A 4OI1A 1DELA 5EZ5A 2IBMA 6Q21A 1AN0A 2UZ3A 4E03A 1ZBDA 1F2UB 2IXFA 3QXCA 3AEZA 2GJKA 1NJGA 4QC2A 3S1AA 1G5PA 3A1VA 3BGWA 2QAGB 1O3YA 1TQ6A 2FPLA 1EFCA 2J87A 4TLCA 3LA6A 1DG3A 1QG2A 2VHQA 4NH0A 4XD7A 4A0FA 3SYNA 4C4PA 2KB0A 4D0NA 2ZRDA 4QHTA 4TL8A 1ZCAA 1YZQA 3I1FA 3W6OA 4P31A 4U5XA 5TMPA 1E0KA 1XTIA 3W6NA 1Z6AA 2WMNB 3UIEA 1PVOA 2H1LA 4EAQA 1AGRA 2A30A 3IPXA 2IYSA 2WTUA 2W2XA 3DM5A 1I4DD 3KUDA 1ZM7A 1Z0IA 2PH1A 2HLDD 1EFTA 1X8LA 2ZYTX 4DLUA 3VNVA 4S2EA 1UKEA 2B21A 4HSEA 1OJLA 2H5EA 3HR8A 4MH0R 4PSAA 4MGYR 5L3QB 3L2OB 1NMZA 1Y63A 3KKNA 1NL3A 2D4HA 3BH6A 4KBGA 4Q19A 1W46A 1QHIA 1I2DA 5KDDA 2BHRA 3BFKA 2Q3FA 3A4MA 3FMFA 5IT5A 2W6JA 3P27A 4XTRA 2FPKA 3K0FB 1UJ2A 1US8A 5FPYA 4NTZA 2QBYB 1OFHA 1A2BA 1QZXA 4I1SA 4EJSC 5KNCA 4LBWA 3NVAA 1WE2A 5F3WB 3IBYA 4I1OA 4AC9A 2EFCB 1KDOA 4D0LB 4ZI3A 4HZUB 1NG9A 4WIAA 2QA5A 4FCTA 1DPFA 1KI6A 1VIAA 1N6OA 4DDTA 1VPLA 4KLZA 1CJMA 3JZAA 1U94A 2ZI9A 1P3JA 1TU3A 3ETLA 3TAHA 1D8TA 4LHYA 2RGXA 2VO1A 5KOYA 3L8YA 2XB2A 2QT1A 3QPUA 1Q44A 5L3VA 4A2WA 1IN8A 2G1KA 4KFRA 3O8RA 5EE9A 2DWPA 1N0WA 4OK3A 1GKUB 2IF0A 5AUOB 5CJ2A 2VP0A 1IN7A 4LY6A 1OHHD 2G88A 1E3MA 4JVMA 4QL3A 3M4YA 3F3YA 4A8JC 1N6HA 4LHWA 4Q7MB 5EXXA 4FIDA 4NYJR 3NDBB 1U0JA 3RHFA 3K70C 3BK7A 1SVIA 2CEAA 2REXB 1KJYA 4KHZA 5FPHA 3GLFE 1CLUA 1E79D 5M04A 1XCGB 4V0KA 1FOEB 1G16A 4Q4JB 4JT2A 1ZP6A 4JIMA 4ESHA 4IHQA 2QTFA 4AD8A 2DPXA 5AJVB 5HCIA 3KKPA 4HI0E 2QY9A 1Z0JA 3A1SA 3O8DA 4IRUB 1JPNA 3SJZA 2FWRA 3K70D 3L82B 3CNLA 4IOMA 1DS6A 2I1VB 4U02A 5G3YA 2W0MA 2IXGA 3FE2A 3VHXA 1S96A 2D62A 2H92A 2JGNA 3IO3A 5CLLA 4IFBA 3AP3A 4M9ZA 4ZI2A 1XPUA 4BLPA 4R98A 1AA9A 4NU0A 4RJLA 1JJ7A 4XTCS 4DIEA 4X8HA 2YYZA 1F60A 1P2TA 3NBXX 2EFEB 2J59A 4JJZA 2ZAOA 4G0NA 4GRAA 3D3QA 2XTZA 2D7CA 2F6RA 4B35A 2RGDA 3LD9A 5B58C 4KYUA 4Q1AA 2EW1A 3TUIC 1W0KA 1G7CA 2ZRGA 3B8HA 3I61A 1MO3A 1U99A 3T15A 4B33A 1HYQA 2D7DA 3VR2A 1Z6XA 2OSBA 3GEHA 2RHMA 2QGNA 4PQRA 2ZR0A 4LSGA 3RAPR 1KOFA 4LCBA 4QKQA 4Z1MA 2DB3A 3RC8A 2B8TA 1ZMXA 3U61B 1S1CA 4NCKA 3C7KA 2Y8EA 2WKRA 4D2IA 4POAA 4QJ5A 4V0NA 1U0HC 5KPDA 3REFA 1OXTA 4M9QA 5A5GA 1M6NA 2C78A 3H4MA 3SJAA 2ZJZA 3FHTA 1Z6TA 1BIFA 5DO9A 3ZZTA 4MQBA 5KNBA 4DJTA 2JAQA 3QF4B 1DAFA 2R2AA 3L0PA 2XOKD 4JLJA 4PZLA 1BMFD 2C77A 3DZ8A 1EESA 5FOWA 3GLGA 3RVBA 1ZAKA 1OXVA 5DNYB 5H1YA 5JCZA 2R8RA 3T61A 1G20E 3U5ZB 4GOKA 5E7MA 1DAKA 1OXSC 3R9XA 3LBNA 1XMJA 1T91A 3V9PA 4KFUA 1G41A 2OCBA 4PFSA 4TYQA 4YMWA 2O8EA 2PZGA 1R10A 4MGIR 4MRNA 4WZAE 1N0VC 1L4UA 1GP2A 1I2MA 3FGNA 4LK2A 1NJFA 1QHSA 2CNWD 5EUQB 1OH6A 4O2LA 5IF9A 2A5DA 3CB4A 4Q47A 1SVLA 2A2ZA 3QBVA 1NF3A 1II0A 2GJ8A 5C46F 3I62A 2PJZA 2QE7D 1GTVA 4Q1DA 4IVRA 4IDNA 1G8FA 1IM2A 3IEUA 1JALA 2G0TA 2JJ1A 3OFND 1S0UA 2J7PA 3RNLA 3T12A 1B0UA 2CMKA 4NYMR 1E9SA 3B1VA 2AXNA 1ZW6A 8OHMA 3IO5A 4JL5A 4ZIRA 3TMKA 2BMEA 2QM7A 1UBGA 3LW7A 3BE4A 2IX3A 1QHNA 4P4TA 3PEYA 1J8MF 2ZS9A 3DO6A 4CDGA 4YMTA 4YDSA 1ZIOA 3RSOA 5KPJA 4TLAA 5HZKA 1GRNA 4MYCA 2EFDB 4FCWA 1TF7A 2IYUA 2ZI7A 3KZ1E 4URYR 1ELOA 3R8CA 3N70A 4F7WA 2AN9A 1IOZA 3CF0A 4M2LA 2IWHA 4M1KA 5J4YA 1EK0A 1VHLA 4RD0A 2VSOA 2ZVQX 5FL7A 2CK3A 1KI3A 1TQ4A 4IVQA 5GVSA 4A82A 2J7KA 1G7RA 2VEDA 1NRJB 3MMPA 5BN3A 1RYHA 1HEIA 4J0QA 3PUVA 4TSFD 1YZUA 1GNRA 4HLQB 5IRCD 1CF4A 1SQ5A 3QF7A 1ODFA 3KL4A 4MYUA 4EPTA 4TLDA 4QHYA 1XEXA 3SBEA 2O5VA 2ZR9A 4E07A 4YQFA 1Z5ZA 3QY0A 2ZJBA 3UWOA 3L0SA 2O0HA 1NN0A 2VTKA 4B2IA 2JCSA 4EDHA 2D74A 1CJTC 4UNNA 3RLFA 1HURA 5CK5A 2Q0HA 1YE8A 1NP6A 2R6AA 4JL8A 4HB3A 2CL7X 2QZ4A 3B82A 2E9SA 3BH0A 4C0JA 2GEUA 5FUXA 3V4FA 1N6KA 2PEZA 4BEJA 4TZ0A 3GLHE 3W9YA 4QOSA 3PUXA 1EX6A 3CW2A 3SOPA 5FFMA 4DLXA 4JLVA 3G0HA 3FMIA 1XTJA 2GETA 1BKDR 4MRRA 2QSYA 2R62A 3U60B 4CEHA 1T5LA 4HB2A 1Z06A 3TBKA 4HUTA 3FMOB 3QJYA 4WZBE 3JZMA 4CVNA 3UKDA 4Q9JA 1SKQA 3GJ7A 1GM5A 4A6PA 1CR0A 3GQBA 4HAWA 2V7QD 1Z6GA 1ZVQA 1N6LA 1E0AA 1KI9A 5EP2A 2P65A 1NMYA 2WWHA 4M1MA 4CRWB 1N5LA 1LS6A 4CIDA 3PVSA 3TK1A 2ZR7A 3OESA 1P2VA 4Q03A 3T1OA 4Z51A 5KSZA 621PA 2XAUA 3MWYW 2ZPTX 4A0GA 4R71A 1FFHA 4JLDA 3U3KA 2NQ2C 3AVOA 4TL6A 3CRMA 3W34A 3ZLJA 3R20A 2OXCA 2VHTA 2XZPA 5SZKB 4F4JA 1OE0A 2P2LA 1X1RA 2OILA 1FPMA 3EXAA 3I8XA 1U81A 4LPSA 5KDLA 1D9XA 1QDEA 1KYIA 2QGZA 2NPIA 5H8WA 1ZRHA 4BFVA 1WF3A 5HR5A 2L0XA 1NVVR 1T4GA 2AWNA 4Q5IA 1XJ0A 1E2HA 3WNBA 5JS7A 4Q7LA 3HYTA 2Z4SA 1E6CA 4EJSA 3ADDA 1NBME 3HPQA 3WY9A 1CRPA 4LI0A 3IDQA 4B43A 2OFXA 3WYGA 4DHEA 2G1JA 1W7AA 1GITA 1KJZA 2VSFA 2XZOA 2ASEA 4RFSA 4XH9B 2VH5R 3K0AB 5FUYA 2D2EA 3U2QA 5CB6A 3T06B 2B6HA 1SXJE 4Q4AA 1ZD1A 3P4YA 3RS7A 3ZD6A 1EWQA 3GJ5A 2QORA 3T35A 1OHHA 2FEMA 4Q4HA 4DLZA 5CITA 1YHNA 1SXJB 1N5IA 3U7HB 5EQTA 4DXAA 2FH5B 5EE5B 4PO8A 2XTMA 1P6XA 2WOJA 3SQWA 4JVSB 2X2EA 4QHSA 1E79A 1ZC3A 4L4UA 2EYUA 1Z3IX 1YZTA 1IY1A 1IN4A 4PSVA 3GMTA 1Q1EA 5EE3A 1UKYA 1GKIA 1N2CE 2AR7A 4A8JA 4ZO4A 1GNPA 3THWB 2VRWA 3KQKA 1CULC 2ONKA 2X1VA 1QHHB 1LNZA 3AVPA 1JR3E 4C0KA 2O8CB 4HEJA 1PZNA 2EFHB 4GP6A 1UDWA 4CEJB 2ZE7A 2ZI3A 2QMEA 2VF7A 3BD9A 4M9SA 3EA5A 2GCOA 1M7GA 3P20A 1GL7A 2ZSFA 4BGDA 2P6UA 3ZZ0A 1VG8A 4F93B 1NLYA 1E2QA 2O8DA 2CJWB 2JLSA 1VYTA 1K5GA 1NMXA 1P60A 3MRSA 3UG6A 2IUTA 2CLDX 1KZGB 2P5TB 3ZGXA 3K0SA 2V9PA 1CEEA 3K8YA 4MRPA 1KNQA 1G8YA 4KSBA 4M1YA 2FJUA 4NONA 3X1WA 3THXB 2NOAA 3KQNA 3EWSA 4QJ4A 5CDFE 1RIFA 2C9YA 1GVNB 4QGHA 4A4DA 4Q02A 3KXIA 4LHVA 2FGJA 4KLNA 1WXQA 4IDPA 3SHWA 4NPHA 2HUPA 1Y3AA 5GJWC 1ZIPA 3RRNA 3WRYC 3D7MA 3GFTA 1JXOA 4DBLC 2CHGA 1D6JA 2NO0A 3C16C 2XZLA 1HH4A 1CJKC 5JJIA 4AI6A 3EC1A 1XMIA 4AK9A 5BXQC 5JEEA 2OM2A 1XMVA 5CYPA 1IJEA 5TY0A 1UBEA 5J40A 1XTRA 4AIIA 1CU1A 1G7TA 3C4JA 3WBJA 4CF7A 1RW4A 2I4IA 5TB5A 4C0QC 3LV8A 3IBGA 1KY2A 3KFVA 1Q0UA 2XOKA 4GFDA 4RCYA 1BMFA 2NZ8A 2LWIA 1TF5A 4EPRA 2XB4A 2YZ2A 4XVRA 1KMHA 2CVFA 3M0EA 2ZXUA 4V0ME 1EFRA 3K9HA 4BZXA 4Z1MD 3EZ6A 1UM8A 3NTUA 4C0BA 1DARA 2JLYA 3OEEA 4P4SB 4US1R 1ZD8A 2UKDA 3VR1A 2QRZA 1XJQA 3OIWA 1U9IA 4C9BA 5JECA 3MUFA 3Q7QA 3CZQA 4NYMQ 5AJXA 4F92B 3L43A 2NG1A 3CLVA 3QKRB 4ILEA 2VSXA 1KI4A 1GL6A 4TT3D 2CNWA 3DM9B 4KFSA 2J3EA 4XIGS 3SI7A 2OCYC 4UXJA 2OBMA 2ZRFA 2AHOA 1R0YA 1XF9A 4DT1B 5DI3B 2NGRA 2QE7A 4M1SA 4MKGA 1YZNA 4JJKA 4PPQA 2F1HA 3I8SA 3QVUA 1E9EA 5G53C 4A36A 4I1VA 3SZRA 1WP9A 3OFNA 4ARZB 2D06A 5FUWA 1WB9A 4GNKA 4K81B 4BLSA 3K9GA 3BOSA 4MA4A 1ETUA 1VIYA 2GHIA 4QXAA 3RWMB 1G64A 1KO7A 3ZJYA 1ESMA 3SBDA 4BLTA 2FDCA 2BC9A 1L7VC 1MRNA 3FB4A 5CLQA 3ND8A 4Q66C 3KKQA 4C0SA 2IYTA 3SR0A 4N1AA 2Z4RA 2GILA 3ZQ6A 2XXAB 1DAIA 4URWR 1RFLA 2NPFA 2G0NA 3AF3A 1WA5A 5KSOA 3PIRA 1D2EA 1W4CA 2GZHA 3TSOA 4LOAA 4GBMA 3W5IA 2BM0A 1J7KA 1JI0A 1XXHA 5JWOA 1GUAA 5JZVA 1FL9A 1G8HA 5GJCA 4JZKA 4EPYA 1GKYA 4KBFA 2FV8A 3GJ0A 4Q1CA 4YONB 3QIAA 4B2PA 1Q1BA 2ZANA 2RB4A 5FOUA 4BRUA 1XZQA 4QG7A 3VU9B 4JLOA 2QRNA 3CWQA 3DPUA 1SKYE 1XEFA 2ZI4A 4EPVA 3GJ6A 1MRSA 1T8TA 1KHTA 1Z28A 4U00A 3ICEA 1OLOA 2BEKA 4FMDF 3R7WB 4KYIB 1S4QA 3W3AA 4JLMA 3AVYA 2IYLD 1G3IA 2F7SA 3VNUA 1SKYB 1W36C 3KKOA 3AKYA 2Q9CA 3P26A 1N6IA 2FA9A 3AUYA 4ABYA 1XEWX 2ZQ5A 3VR6A 4B44A 4C7OA 2WV9A 2F1JA 2C8VA 4FXPA 3SQXA 2PCJA 4R2IA 5EXPA 2DYKA 2ZU0C 3B85A 1UPTA 3ZYCA 5C1BA 1X8KA 2ZE8A 5L3QA 4HUQA 2ZJAA 1W36D 3UPUA 4LC0A 1Q1ZA 4D25A 1H65A 3DKVA 2WJJA 2FSGA 4IVPA 1E4VA 3WRXC 4EIWA 3DHWC 4PC3A 2IYYA 3TVTA 2ERXA 4BFZA 1Z2AA 4LBVA 2OLKA 1W0JD 4URUR 2DBYA 3GEIA 2W2VA 4M1WA 1Z63A 2WSSD 1U2RA 1BYUA 1LFDB 4B6FA 1TTTA 3EIHA 4F38A 4HZUA 4W7SA 2X77A 2V7QA 1HV8A 3B60A 3OZXA 1GL9B 5JRJA 4OQXA 2WJGA 4GT1A 1BS1A 2OZEA 4WVFA 4DB4A 2WWWA 2ZRIA 4LJ7A 1KK1A 1R8SA 1G5TA 2RH5A 2FSIA 5BN4A 3QG5A 4QBHA 5CIWA 2DWOA 3DVLA 3V4RA 1NBMD 3GPLA 2O8BB 4BLOA 5AUQA 4V0LA 2OAP1 2P0EA 3IIKA 2OAQ1 2IK8A 1RZ3A 3IQWA 4S35A 3F5FA 1E2NA 4FWTA 1R2QA 4CYMA 4LJ6A 2CL0X 2BOVA 2QNRA 1E9FA 4XSGA 3AH8A 5FR1A 4B48A 4D4MA 4PX9A 5JFGA 2GBLC 3Q3JB 2BMDA 2WJVA 1DOAA 4UXHA 3QUSA 4QFMA 5C2JB 4W5JA 3FHOA 3OF5A 1EWRA 3EASA 3IHWA 4FW9A 1DTSA 3RS5A 4MDEA 2YWHA 4IFEA 2YNMA 4N0DA 1S2MA 2PZFA 3PG5A 4OQMA 4AKHA 5DYIA 4TN1A 4A15A 4D4JA 2QUZA 3T34A 2Z43A 3TH5A 3GLFA 2W6ID 5DN6D 3QPVA 2QL6A 2SHKA 3ECCA 4NP6A 3ASYA 1JBKA 1X86B 2H17A 4DSOA 1P9NA 4QGAA 3NC0C 1II8A 1MOZA 2BIFA 1KSFX 5GADl 2JJ2D 5AJWA 1O87A 1PLJA 4A0RA 2N46A 2JIZD 1FTNA 1KSHA 1A2KC 3M6AA 5FBRB 3VX4A 4D6PA 5B64A 2VHCA 2I3BA 1M7BA 4HLCA 3LVQE 3RRZA 3BFVA 4Q48A 2V55B 2HDNB 1OB5A 1ZNZA 4XOIA 1N5JA 3P1JA 1YU9A 4RKEA 3U44B 2RGAA 1FP7A 5JJLA 1R0ZA 3AP1A 3C5CA 3NIBA 1M8PA 5FOSA 4D4LA 2HF8A 2IS2A 2BV3A 2ZS7A 3Q72A 3AVVA 1SGWA 3AVXA 1CRQA 1HA3A 3T1TA 1UEIA 3K53A 4Q00A 4CGZA 5FH9A 2OHFA 4N3NA 1LW7A 4BFXA 2PT5A 5K8IA 3EX7C 1UDXA 1TL7C 1W49A 2QT0A 5E95A 5E4FA 2J1LA 2IS4A 2WHXA 5KYKA 5J4VA 4OI4A 2ZSDA 3DDCA 2C9OA 1KDRA 4NBSA 2IYZA 5EE1A 2QMHA 3A1WA 4A92A 4B3BA 2JLWA 2QEQA 3ZVNA 4V02A 2V54A 3KJEA 3PITA 4GPTA 3Q5DA 4NHOA 3LH5A 4M9XA 5JHGB 4B3GA 1VCMA 3VKWA 4G5SA 2ZRBA 4F4IA 1CR1A 2HT6A 5E7IA 4B6EA 1W48A 3B1YA 3QF4A 1R6BX 2AFHE 2GK7A 5FBWB 1HE8B 2Q9BA 1AQUA 3LDAA 3QEOA 1S3SA 2AD1A 3A6PC 2V1XA 1SULA 4A2PA 1NY6A 1KAGA 2R44A 3WBKA 4URVR 3I92A 4DLYA 5K8LA 3UK6A 1Q3HA 1KK0A 1ZU4A 1Q20A 4QBGB 1YR9A 2QENA 2YVUA 1X6VA 2VA8A 4CW7A 2A5GA 2MMCA 3AF1A 4JT4A 3HU1A 1OF1A 2NO6A 3J81k 3LW8A 4PC1A 1US8B 2ERYA 4ACBA 4BWYA 2ZAMA 3AF2A 4YMVA 1OFIA 4YMSA 3W6PA 1WBBA 2YC2C 4YDHB 4XWOA 4M0LA 1QF9A 721PA 4RD6A 4WOPA 4URZR 5IK2D 1LS1A 1KI6B 4PSKA 5AUNB 4G3XA 1ZUNB 2J0UA 2WPDD 5F9FA 1XPRA 3A37A 5SZHB 4R9UC 5EXTA 3NXSA 4QM6A 3PUYA 4C0AC 1TUIA 4NCHA 1MR3F 5D3MA 4U7DA 1UADA 2D3WA 3X1XA 3KXLA 2CCGA 4TYNA 1KK3A 1UBCA 1GOTA 2ZUBA 2H7VA 3SJCA 2W00A 2CXXA 3B1WA 2EYQA 1R7RA 2DFKB 2VPPA 1E1QD 3LBHA 4TT3A 1G5RA 2XGJA 2FX3A 3CBQA 3R9WA 5FPTA 1E69A 2V3CC 1AIPA 2ZYVX 3PENA 2CHQA 4GL2A 1KI8A 1KI7A 1KO4A 1U9IC 4KFTA 3TSZA 1JECA 2HJGA 4OL0A 1EFRD 2HXYA 1DADA 4AYTA 2PBRA 4UJ3A 2QP9X 2PEYA 5TDHA 4DKXA 3OEED 1UF9A 121PA 4JYBA 1VMAA 3ZVMA 3LX5A 4F4CA 3LBIA 5FOVA 1AGPA 2QP4A 3TW4A 3VR4A 2HJVA 4Q1BA 1XNJA 2J0SA 4URXR 3QVVA 2QAJA 1TUEA 1W44A 3DMNA 4FINA 3U3JA 2P6RA 1SVOA 3AGPA 3B2EA 3CIOA 1IN5A 4C0HA 5K8TA 3QKSA 1VKJA 3K9LA 1KZ7B 2QPAA 3QG1A 4BE7B 3I4LA 2XNDD 2VL7A 4JLBA 2QI9C 2AKYA 5GJVC 2J0VA 4X8OA 3V00A 4ZDKA 2OCPA 4AKIA 2HYDA 3H2YA 3X1DA 3SJBA 5LD2C 1LB1B 1Q1QA 3EW9A 4A0HA 4TYWA 4TTPA 3W90A 2GDJA 4OKSA 1XRJA 1NY5A 4KI0A 4P3YA 1JB1A 2IYQA 2GNOA 1FNMA 2VHUA 1A4RA 3MGCA 2ZJ5A 3IPYA 1QHXA 3LAWA 2VHJA 1N6PA 1KKLA 2ODBA 2A5JA 1AZSC 3TKLA 2BWJA 2QG6A 2VQSA 3GLHA 5AUPB 4RZ2A 1Q12A 2Z6VA 4K8OA 1VCIA 2ORVA 1R5BA 2IXEA 4W5WA 1SVSA 1W4BA 4Q1EA 2DFNA 3IILA 4WXPA 3LY5A 4B3FX 2Q21A 4QNMA 1OB2A 4BLQA 4ERNA 1D2NA 1ZNWA 5KTYA 1ZJ6A 2KJQA 3EARA 1PUJA 4Q9IA 1IY2A 4Y0AA 1GIAA 2J45A 4P4UA 3A4LA 1EXMA 2VP4A 3PFIA 1RC8A 1AS0A 2OT3B 3MCAA 4LZZA 3E5HA 1AS3A 3A4NA 1S9DA 4IOLA 4MKFA 3JVVA 1W0JA 1AKEA 4L8GA 3GLGB 4HB0A 2ZM5A 4IEIA 2HXSA 2Z5FA 1XPOA 2WSSA 3KX2A 4Q21A 4MYTA 1P62B 3IIMA 1XD2A 5FTJA 1HQCA 4DLTA 2O8FA 4RD2A 1MKYA 4JBXA 3TUJC 5LPNA 2YOGA 4DLWA 2C03A 4GMXA 3BJIC 2NO7A 3CPJB 4IJMA 1CJVC 2PT7A 3TVDA 5FPKA 2OG2A 3NEJA 1R8QA 1P72A 3QKTA 1W2GA 2XJ4A 4G5GA 4K46A 5K8UA 3ICQB 4BUJA 1RRPA 1X1SA 1E9BA 3Q85A 2ECKA 3GJ8A 1OH7A 3RYTC 4RSGA 1OKKA 2FU5C 2H16A 2LKDA 3PEVA 4ASUD 1UKZA 2F43B 1U8ZA 1NBMA 2QPOA 1G3RA 2GKSA 3BERA 3QENA 4L15A 1T8UA 4V0OA 1KGDA 3NBFA 3ZIAD 4OJQA 3AVQA 3UANA 1NSFA 1S1MA 3LX8A 3U3MA 2B92A 4AY2A 4B75A 1P7CA 1UBFA 2GEDA 4TMKA 2AXPA 5HKKD 1RRCA 1RRGA 4DUGD 5AWFC 4AURA 2PZEA 3BBPA 5ELXA 3N2IA 3KQHA 2J9RA 4MYHA 2X2FA 2XJ9A 5FUVA 4EQ6B 2OEPA 3A58B 4ZIRB 3THYB 1FNNA 1SXJA 1TPZA 3KDSE 4B3XA 4MGKR 3CX6A 4X8MA 2GXSA 4IDOA 2PCLA 1G4UR 2ZU6A 4TQ9A 1Z6YA 3DKPA 2GBLA 3RANA 3SE0A 2YOHA 4LV5B 1T5IA 5JBQA 4B73A 1ZCBA 1CP2A 4QM7A 3SYLA 2JLVA 2AL7A 1TF2A 3CRQA 4WBSA 1NVUQ 1K6MA 1PV4A 2JDID 2W6IA 5DN6A 2GAAA 1QHHA 1VTKA 4PC6A 1OXXK 4L5BA 1NSTA 4RD1A 1BOFA 1AK2A 1G4AE 3CX8A 4M8NE 4M53A 2IHBA 4H1UA 5CK4A 4GSYA 3MFYA 4CEJA 1OIXA 1G18A 2YJTD 2JJ2A 1E98A 4N0EA 4IXMA 2IYXA 1JR3A 2JIZA 4G01B 4PO9A 1XZPA 3VQTA 1GDDA 3LXRA 4PPNA 2CJWA 2CHVA 4RVCA 4JS0A 4OQFA 2A78A 2EU8A 2VF8A 4HAUA 3SEAA 5CJPA 3PR1A 1XMSA 4HDQB 4PHGA 1C9KA 3GJ4A 4PPFA 521PA 4B2LA 3VTKA 2CLSA 4JLPA 4NYJQ 2P5SA 1LY1A 1GRRA 2WIAA 2IEZA 3QQ5A 4R2HA 4V03A 1EX7A 3PCRB 4GOXA 3IGFA 1OIWA 5J5CA 4DLVA 5CDFA 1RPZA 1KI2A 2QU8A 1F5NA 2IYRA 1Q21A 2FMXA 3KTAA 3N2EA 4C3ZA 3EPLA 1Q57A 2BKEA 3WYFA 1KO8A 4KITB 3MWLA 5JSZA 2RHDA 3BORA 2IC5A 1F2TB 1Z2CA 1W4RA 4FCVA 4CEHB 3LVRE 4FMDB 1JQLB 2V6IA 3BXZA 1FX0A 2MSCB 4ZV4A 3TUZC 4Q1FA 2ZROA 4P0TA 5L3RA 1FW6A 821PA 3PV0A 5EJEA 3CF6R 1DBSA 3C14C 1SHKA 5LDDC 3C5HA 3IUYA 4HB4A 1AJEA 4O25A 5JCPA 3K09A 1ZYUA 1HUQA 1YZKA 1Z07A 2VP2A 4IDQA 4MKHA 3CH5A 4V0MA 3KXKA 4TQUS 1JNYA 2REBA 4LV6A 5LBIA 1FMLA 2EQBA 1Z08A 5EP4A 4HAYA 4L9SA 4DCTA 1SVKA 2HV8A 1E2MA 4HDOB 3JVUA 2HYIC 3ASZA 3HU2A 4JLAA 4RZ3A 3FPAA 4OHZA 2GK6A 5AJYA 2ORIA 4TL7A 4AG6A 2WJIA 2ZRJA 2C04A 1BH2A 2WWIA 2V1UA 2VP5A 5IK2A 3QI2A 1YQTA 5DI3A 4B34A 1FP6A 3PEWA 2BCJQ 1JJVA 2OFOA 2IHYA 2WPDA 3HPRA 4BLRA 2ANBA 4E22A 3CNOA 1U90A 4EJSB 3LO5A 1P9WA 5FTLA 3U6KA 4DB2A 3MJHA 3KJIA 5B2ZA 1KJWA 4D4KA 2I1QA 4HDCA 1AS2A 1E99A 2X19A 4LUCA 1R5OA 1HY3A 3LWNA 3W8RA 2P3SA 4RFSB 2G9NA 2ZSBA 3WMGA 2JLUA 4Q4LA 1E1QA 2Z0MA 3MWKA 4I99A 3SC3A 2XXAA 2CCJA 2GZDA 4Q4HB 5SZJA 4AKEA 4DSUA 2OCAA 5HE8A 5C4GB 2HCBA 1RJ9A 3IKJA 3FYHA 4DCNA 4HAVA 5AR1A 3PJRA 5DSZA 1QRAA 3RS0A 4PAQA 2DFLA 2FPMA 2G77B 2V6JA 3BWDD 5BYJA 3GP8A 2EWVA 4OBEA 4IOJA 4PTLA 4A8JB 1XTKA 1IQPA 1MABB 3MG9A 3K70B 4NYIR 4BPBA 1NVXQ 4CT4B 3A1TA 1YZLA 1NG1A 1JAHA 1EGAA 2OO7A 3OEHD 1Q3TA 3ZQJA 4ITRC 2GCOB 4TTRA 2XNDA 3PEUA 3L0IB 1R5NA 3BAFA 1E2JA 4WZ6A 2O8DB 3U4QA 1TADA 1R0WA 2GXAA 3CH4B 1PJRA 2KE5A 1F48A 3LLUA 4MKIA 5G41A 2ZJ2A 2RGCA 1VG9B 2GTPA 3DEFA 2HCJB 4W9MC 4D80A 2ZRNA 1L2TA 1B23P 1IN6A 2GRJA 1XU4A 1FZQA 5KUTA 1VYVA 5FI0B 3TR5A 2GF0A 3P4XA 1A5TA 2ODNA 4UNSA 2Q6TA 3RRMA 2EFGA 2YV5A 1R4AA 2QQ0A 2AX4A 2QTVB 3P32A 1ZM4A 3GLIE 3CPHA 3T5DA 3TNFA 1FQJA 1E2DA 3CR8A 2IL1A 5TV2A 1NIJA 3WXMA 3CX7A 221PA 5KNDA 2ZETA 2GCNA 1E4YA 2PJRA 3GLIB 2GWHA 2E1RA 1WDTA 1MH1A 4L9WA 2ZJYA 2J46A 4MUAA 1F2UA 5D3QA 3EG5A 2ZRLA 3F8TA 1VHTA 1YJ5A 2ZE5A 1G6HA 3Q5EA 2FNAA 1W5SA 2QAGA 1YRAA 3VR3A 4RCZA 2JATA 5GJBA 1XB2A 1XDBA 3FDIA 5GVRA 1NKTA 2DR3A 4JBYA 3ADBA 2GAOA 1KNXA 2ZYWX 2OUKA 4JLNA 1M74A 3NHAA 1YVDA 1CTQA 2RGBA 1X8JA 3I73A 1CJUC 1OT3A 2R6GA 2RCNA 4JVNA 4LHXA 3AF0A 4YLGA 3SS8A 3SHFA 4DC9A 2FSFA 2IUUA 2JLXA 2E87A 1FUKA 2OFWA 2XITA 4PHHA 5F98A 4FWIB 1N5KA 4TMXA 1E0JA 2GVZC 2QN6A 2WSMA 3GJXC 2W83A 4LGMA 4YC7A 3OE7D 3EIEA 2CBZA 4JYCA 1E2KA 5FOTA 4F91B 1S8FA 2IA5A 1E9RA 1GNQA 4ASUA 5HZHA 1NLFA 5JHHB 3AVWA 1P9RA 4OHYA 1IONA 2LKCA 4YXWD 3I5YA 3ZIAA 5KO2A 3K0FA 1ZC4A 3IIJA 4CEIB 3GFPA 3B1XA 2QBYA 5ANRB 4DVGA 5HKKA 1SVWA 1W5TA 1U98A 3FVQA 4DUGA 2GCPA 1OFUX 2A3RA 4PZZA 4KCGA 4WXRA 4PC7A 4QJ3A 3U7FB 1VCNA 1CXZA 2ANCA 4IOKA 4M22A 1CIPA 3L0OA 3LQQA 1W47A 3ADKA 2FF7A 4LV8B 4LX0A 4G5OA 4LBYA 1G8PA 1NVVQ 3B1ZA 4Q9HA 4EPXA 5FTMA 4AKGA 2ZRHA 5C18A 1SZPA 2PX3A 2WWXA 5DHAA 1RRFA 2GJ9A 5LD2B 5DI9A 3B9QA 1OKKD 1VG1A 3DOFA 3AGQA 3OIUA 4Y0VA 4AYWA 1IXSB 1WQ1R 2JLZA 4O3MA 1P5ZB 1L8QA 1U8YA 3VKHA 4OK6A 2CE7A 4OK5A 3DL0A 3EA0A 3N5CA 4Q7JB 1SXJC 2JDIA 1BO6A 3EC2A 4DDUA 2NIPA 4B47A 1KO5A 1XXHB 3FKQA 1FQKA 5A0FA 3Q7PA 2ZRCA 3MD0A 1N6RA 4BECA 3M1IA 2BBSA 5HTKA 3B9PA 5AK0A 4ZCMA 1W1WA 1SXJD 2BKUA 4B32A 2O52A 2XEXA 5DYGA 1HT1E 4NCIA 3SFVA 421PA 4AWXA 3RC3A 1T3HA 1JPJA 1TQDA 4HAXA 3QXSA 4LYJA 2ZVPX 3FHCB 1LF5A 3RSLA 2QSZA 1Z29A 2IWRA 1FMJA 4Q4JA 3TW8B 4C2TA 4ZKEA 2FSHA 5UKDA 1GFIA 5L3SB 1G21E 5G40A 2OV2A 2JASA 3Q8XB 1HQYE 4JVLA 2PLRA 1ZINA 2W0SA 4EFNA 4BFSA 4C7OB 3K0CC 3BB1A 2FN4A 3WNCA 2A9KA 2LCFA 1P73A 4TLBA 4EKDA 3AUXA 1YR7A 1Z0DA 2CVHA 3MJRA 3QNUA 4PR0A 3BB3A 4HUQB 2JEOA 4OQNA 2G83A 1JR3D 1KDPA 3LFUA 5KSYA 1M7HA 4B3DA 2VIIA 4G5QA 3OIYA 3B5JA 4KSCA 1TEVA 2ZREA 5CB8A 5BWMA 2ONJA 3NEYA 3EZ2A 3RRYA 3U3RA 5C4MA 1E9CA 2J0QA 1T0HB 3BC1A 1E2IA 1N3BA 2FFQA 1NKSA 2C98A 3EZ9A 2CE2X 1WCV1 2QMUA 3D31A 4UJ5A 3NKVA 3B13B 1NN1A 1CBUA 3DOEA 1ZM3A 1E1RD 3S1AB 2IEYA 1IAQA 3L8ZA 3EPHA 4O2RA 1WBDA 1OSNA 3CPEA 3QOFA 1IY0A 4TMWA 4LYHA 5FBLB 4Q01A 3I5XA 2WKPA 2ZJOA 1R0XA 3OIVA 1ZM2A 2CDNA 4CZ2A 1J99A 3CRRA 4RZXA 1I4TD 1JXMA 3ZD7A 1IBRA 2GXUA 1E96A 1VG0B 1EFUA 3K09C 2EVWX 3BRWD 4LC1A 1JR6A 4FI3C 3TQFA 2ODEA 3E70C 4RZUA 2BBTA 3HYRA 4OI2A 3I32A 1EG7A 4XWAA 5LB2A 1MO4A 2QPTA 1WMSA 2FG5A 2ZSAA 2AK3A 3LRPA 1M1YE 4RD3A 1SVMA 5CM9C 5J4LA 2BJWA 4GOJA 1I4LD 1QHYA 3TQCA 1CKEA 3BIFA 5FI1B 3GLFB 4XJXA 1DO2A 4TL9A 4HLUC 2JLRA 3RS4A 3CR7A 4LYFA 1ONBA 3EWAA 3KFXA 3QXJA 4LJ8A
chains in the Genus database with same CATH superfamily
1KWGA 3TBFA 1THTA 2Y1OA 3C3WA 2OO5C 3AJ8A 4QE3A 3SX2A 1II8B 2F3TA 4DMLA 4YO7A 3T7KA 4JK3A 1K3FA 3M3PA 3SF0A 1E5DA 1NXOA 3U7IA 4UQOA 4BFLA 2WF5A 5K3EA 1OJ7A 4I1UA 1P33A 3EOBI 2D7JA 1PJ8A 2CLIB 3F3MA 1NJ2A 3HLKA 2XSZD 2FOLA 4GUDA 1AQYA 1WETA 2I3AA 1R6AA 2FPIA 1GLGA 4Q9KA 4YRJA 5HUJA 3BB4A 5KWIA 1E2GA 1ZGJA 4UPEA 4ZEXA 3M1YA 2XA2A 4I9NA 2BM8A 5LSAA 3O3NB 1KMQA 2H1RA 3WKBA 3K9NA 5IFKA 3NH6A 5GZ1A 4YMLA 1C2YA 5TMDA 1Y5NA 1SUAA 1QQTA 1F8YA 4CCAA 3FXAA 3UUGA 2J3JA 2HMVA 2K6GA 1AF4A 2KI5A 2Q9AA 2VYFA 1Z4PX 1ISRA 1JDNA 2HA7A 3QPWA 5CVVA 4PYJA 2ZTSA 5IM5A 3QPDA 3QMWA 4DZZA 3AVUA 4BU1A 1U0LA 1GTZA 1X87A 2HEIA 5ESRA 2I54A 4G0UA 2Z2KA 1QYDA 3C41J 1DAMA 2DBRA 3I3SR 4CMHA 2VT2A 2EDCA 2O7NA 2ZRQA 1KAHA 2WWGA 3E58A 1MA3A 1DKMA 1YE3A 4XJVA 2NZ2A 2YXNA 3QM1A 1IHUA 5CYOA 3F1LA 3SBOA 4I1PA 1WSDA 3PXGA 1QTNA 4U2GA 2EDAA 2VYND 2XQVA 3CJTA 3UJCA 3CB2A 2JFGA 3WB2A 5IEBA 4I81A 3KUCA 3Q5GA 3L7IA 3TLBA 1V2GA 3C4QA 2MSEB 4MARA 4CMIA 4HNUA 5AVRA 1UPAA 2H2GA 1N3YA 2J6BA 3L8GA 2XMCA 3LX6A 3PUJA 4MP8A 4R68A 3ZHZA 3U17A 4M54A 2TMKA 4N5LA 3X0DA 4AECA 4AZ3B 5BSVA 3ESZA 3SIXA 5KNDD 3IAS6 4OB6A 1WDMA 4Q9LA 2Z09A 1UM9A 4KOEC 3VC1A 5J4HA 3AHCA 4II3A 3O8BA 2FPXA 1UJCA 2A9VA 3KYDB 3RO7A 4C0LA 4XWWA 2UZ1B 3E9CA 1E77A 1ONNA 3NDRA 2VUUA 3CM0A 2QUAA 5EIXA 3KOUA 3ZDQA 1N92A 3GMDA 2V65A 4OFZA 4Z4HA 4JI4B 4TX1A 1ZLXA 2XUDA 2O7RA 3K4HA 1WXXA 2PRZA 4YRLA 2MSLA 4G6ZA 2IS6A 2IKSA 4Q3BA 4XWTA 4F3TA 1QZUA 4DABA 3C3KA 1ZUHA 2CFIA 1IHXA 3LF2A 1NXSA 5FADA 4IZIA 2G06A 1FSGA 3MLAA 1AZTA 2W6CX 3VJLA 3WFZA 5IDXA 1MOQA 1KYWA 1P0PA 4IDGA 3LTNC 1FVFA 1XEWY 2BFBA 2JVKA 4A8HA 2I22A 2AD5A 3AIIA 2OBBA 4WZAB 2QZZA 1J9GA 1EDEA 3LQRA 3A3KA 3NH9A 3R4VA 1VBNA 3DE5X 4M46A 3TRFA 1YNOA 3MERA 4KODA 1P7ZA 1LRKA 3EBPA 4KN9S 5DBEX 1YE5A 4HXEB 4PN7A 1HLGA 3SNHA 1WZNA 3ZNOA 1L1EA 2IZ7A 2QAGC 3GD7A 3ORSA 2C1ZA 4JP8A 3N2ZB 3V4PB 4JC4A 3OCVA 3NVMB 5IBPA 4ZREA 2XX3A 4EQ6A 5TQVA 5ECWA 1XCBA 4P35A 3OE7A 3THYA 3N2YA 3R7DA 3KKLA 1N6NA 2WY2D 2B78A 4R0MA 2IZ0A 1ZSVA 1RPJA 2ID7A 3BIJA 1TCCA 3KC2A 3ZZUA 4D5EA 2QRUA 2A35A 2NLOA 2QQ5A 3EFBA 1E1CA 3CKYA 5EJAA 2E37A 3GGDA 3U7RA 3D6TB 4EY7A 2QM8A 3C70A 4TWIA 3REGA 1AKMA 3Q9UA 5KQMA 1SAYA 2H5JA 5ICMA 4E6PA 1NQVA 3HBMA 5DB4A 2BONA 3WV5A 2ZYGA 5AD1A 1K8RA 1PR2A 1OYYA 1Z9BA 2X6TA 4QUHA 4RD4A 4UNQA 3RG8A 1PR0A 3USCS 1PL8A 1P4JA 1GR0A 3FSEA 3H3FA 3KSRA 4J94A 5TVKA 1JEQA 1L1RA 1TUBA 3FKSD 2V4ZA 4BZPA 3W3ZB 4DQDA 4QVIA 4IHAA 1RYBA 5D8DA 4D3FA 2V9ZA 1I36A 1H8EA 3QXHA 2B0CA 4Q4DA 2AFIE 3ECSA 5J47A 1CD5A 2C9CA 2JL1A 2XUKA 5BPFA 5MN5A 1NVMB 4KE7A 4RABA 1KQPA 4PZYA 3ASVA 3KYCB 1UJNA 2VYQA 2Z5GA 1A9ZA 3GFRA 6LDHA 1OLSB 3QKSB 4FMBB 4BNUA 5A5DA 3ESQA 3EPJA 2YXPX 3COSA 1PJBA 5DW0A 1HO3A 2PT9A 2IEGA 4I2VA 3GAMA 3AQ4A 1G17A 2CD7A 2I55A 2Q2OA 4FDVA 4MIKA 3TB4A 4KJZA 4LRXA 3RJMA 1NDQA 2BRUC 2GM5A 4PFJA 3GROA 2P68A 1A5BB 5AVJA 4ZKDA 5JJKA 2BM1A 1Y0BA 2IS1A 4YJ3B 2EERA 4U3JA 5FEUA 1ZN7A 2E4ZA 2GKOA 4K6GA 3Q4GA 2XWPA 1YBAA 2R7LA 3OJLA 3P5BA 1OLXA 1QC5B 3TVYA 1QPGA 5F23A 5F9MA 1C4WA 1JDPA 3BQNB 1AKWA 1ZAYA 3UATA 1MB2A 4ZRMA 3NI2A 1K0UA 5C8YF 3GT0A 3HJBA 3RR2A 3QEKA 3TXYA 2BCGY 4HADA 2I4NA 1ORRA 1KU6A 2SKDA 1QONA 1ZJ5A 3GLHB 3WWDA 4W5HA 1PV2A 3PC4A 4NAVA 1WCIB 3EK2A 1H2BA 2BJVA 4QSHA 5HF5A 3L5OA 4P33A 2YXEA 4OXYA 3RUHA 2YWDA 4YXFA 1PQ4A 2PMKA 1KAOA 2ID4A 3OOJA 4QPNA 2HLDA 2W9XA 3RK0A 5LIRA 1JJFA 1Z5OA 2X1HA 2OHIA 5L7TA 2ZAIA 1ISPA 3ZOKA 4AVYA 1VIVA 3PT5A 5DYWA 5JMOA 2O8CA 1DRWA 3FFTA 3MAGA 4MKRA 4WCFC 1OU4A 1U8FO 2FZ4A 2PKWA 1CR4A 2BGKA 2J41A 3EVEA 1ULBA 1K7XB 2D0IA 3DZDA 2Q49A 3GRPA 4FFWA 3HGMA 3BL8A 5I7OA 4G4IA 2GYVA 3E9QA 3F6SA 4Q3AA 3ILYA 2OMEA 4I55B 1GRQA 1LPSA 1P0MA 1ZESA 4YT8A 2X0JA 3A11A 3KZOA 1R88A 3IDFA 1XEXB 2YIMA 1FS5A 2ODPA 4QARA 4Z5XA 1PHRA 1YKGA 3V2GA 3WOHA 1E63A 3WYAA 1CDOA 5JEDA 1SUWA 3RWOA 4CF4A 3UMVA 1Z22A 6NULA 2O8FB 2WHRA 3KSZO 3WMFA 5DLEA 2ZI5A 3GVIA 2I4OA 1SURA 4CV2A 4UU7A 4LJ9A 4F2HA 4W5QA 4MVJE 4F60A 3AKDA 3HBAA 4CLXA 2V3WA 3OZ7A 3DXFA 1V5FA 4LJYA 3WMEA 2I3ZA 4L5JA 4GR5A 3FFAA 3NTRA 4PQFA 2OESA 5IAEA 1ZJYA 1DIOB 3COVA 3NC4A 4G1BA 2IPMA 1IHOA 1YCGA 4NDZA 2FVXA 2W58A 4IH1A 2P9TA 4RJJA 4UQLA 3IA7A 1FPQA 4Q7KA 3S7ZA 2VN8A 1HTBA 3X1YA 3ZV7A 1WABA 4KYVA 2O5EA 4RTRA 1U28C 5AKZA 3T7IA 2X7HA 1NZFA 2YFKA 3OF3A 3LCRA 3UMFA 1I1OA 1PG0A 3KVRA 4V1CB 4XJTA 1BS9A 3VAAA 5DIFA 4HQKA 1BGVA 2H2IA 2J5XA 4FNAA 3FUTA 4LMPA 4N40A 2G6TA 5KC8A 4AQYB 4BGVA 2EGGA 3VM6A 1H3FA 3FSGA 3H5RA 2ZJ4A 3M7IA 3NWEA 4HZIA 3A1UA 4PIPA 3CG0A 1SHJA 3H5NA 5AQEA 4BV3A 2O8DB 3WDSA 5HPYB 1TXGA 1PFWA 1XBTA 2NO9A 2O5RA 1ZISA 3T9EA 5ESDA 2I7TA 5H70A 4EATA 3STWA 2DWQA 2UXCB 3NBZC 1SMKA 2ZBGA 5FBKA 2UYOA 1NUQA 2RHHA 2IYVA 3WGOA 3G6WA 2WLTA 1JLLB 1SD1A 3G68A 4H6VA 4WOKA 4XFKA 4RFVA 3DO8A 3PIDA 1DGQA 2G08A 1E3IA 1Z0AA 2Q99A 3X1JA 1Q15A 5IDYA 2OYSA 3DL4A 3SHVA 4L57A 5HMMA 3L7NA 3TJZA 4D46A 4PPYA 2OWEA 1MABA 1HX7A 1MO2A 1KSJA 3DBVO 1L7EA 2DHRA 2R65A 3EGVA 1W4LA 1N2CB 2GZSA 3QU4A 4M89A 1TM3E 5IULC 2CLCX 3ETNA 1BTOA 4YV1A 1BFKA 3KQUA 1DEKA 2RHLA 5LB4A 4YFVA 2AK2A 2CSXA 1N4AA 2QD2A 1J9ZA 1JILA 3H1TA 3DAYA 1CV2A 1TC2A 4C0WA 3CNNA 4BMYA 2JLAA 1PR1A 1TTQB 3TIXB 3V1UA 4L7QA 1XCPA 3GUZA 4KH1A 1VJCA 1W34A 3EZLA 4RACA 1F1JA 4GBJA 4X97A 4E2FA 2OO5A 1HYHA 3JWGA 4UTNA 1R4ZA 3P94A 3A1FA 5CNKA 1DQNA 3KCQA 4EI9A 2XOXA 5AM5A 2TRSB 1SEPA 4P32A 1K4YA 1T1IA 2DU8A 2W2LA 3EGWA 3RK4A 1I9CA 1M10A 2RHRA 3QBEA 1ZJZA 1QS0A 1A71A 3HB4X 1M75A 4FEYA 1JIQA 3BCHA 1JEEA 3TAUA 1XZHA 4QBFA 3IJ5A 2AJ8A 1F8FA 1E2UA 1F06A 1KP2A 5A1JA 1VBKA 2GPNA 1FXSA 2WVAA 3N1UA 4MAMA 4L2IA 4P3NA 3UV7A 2FE1A 1YA6A 1WDWB 1KYYA 1ZVJA 4ZYLA 3GH3A 2ZBUA 3LPDA 4FHEA 1VE9A 4ZXFA 2NP7A 4GDFA 1KOGA 2EG9A 1QTIA 3ONWA 4FT2A 3WYBA 2FN8A 1J06A 1UEJA 3E82A 4XVQA 3QE0A 2GVDC 3HCCA 1GTL1 4YECA 4HX2A 1XRRA 4CM9D 3AL0C 5CU7A 1FFWA 2Z83A 3C8HA 1V5WA 4AJ1A 3BFXA 2OXEA 1XD9A 1E94E 3KJHA 4PIVA 3GFOA 3A9RA 4KXFB 1NRWA 4G5RA 4Q7EA 1E7MA 5BMVA 2VP9A 4YCBA 5BNWA 2H07A 3VR2D 1XWIA 4UCXA 1C0LA 3GI1A 5AM3A 1UJ4A 2J9FA 4ZZ0A 1NPTO 1PJCA 2CFSA 1LTHR 2JJ8A 3ETCA 4E6EA 1TQ8A 1R4NA 3K94A 2NTVA 3NGXA 3UJPA 1G63A 3FOCA 4ZHQA 2P91A 2I7DA 4HXFB 1I10A 2R79A 3M4ZA 2DFTA 3M6WA 1FTQA 1VCOA 3MWFA 2Y1GA 1XRMA 1JUDA 2CCKA 4NESA 5FWXB 3S40A 4FM9A 1YMVA 5FBQB 1GPKA 7MDHA 4QBIA 3URMA 4FVTA 3UC9A 4INPA 1COWA 1TX4B 1UZLA 3BMXA 4WLFA 1XP8A 2KSQA 1CZKA 3Q0TA 4HRYA 4YAIA 3IP1A 1WW3A 3DLPX 1TECE 3FIUA 2XGSA 1TO2E 2QLLA 4WPGA 3NOQA 4LBZA 2FVYA 1VSUA 4BMSA 1UC5B 4NU5A 3SGLA 1ZEMA 3I04A 2VUSA 1OI2A 2R6FA 5HF6A 4PO1A 4BV2A 1E2EA 1D4FA 1EFLA 5AT1A 5D85A 1CRLA 2QIPA 2NO4A 5EJIA 3LWBA 3MOSA 3O1JC 2HREA 1GL3A 3MTAA 3L1UA 2IV2X 4DR6B 3VFDA 2ZYAA 1LXCA 3FWZA 5J2UA 1KY3A 1LV7A 4D9IA 3QX3A 4J9VA 1Z16A 5BV2P 4DGQA 5C51B 1CDZA 2P6NA 3IMGA 2B1IA 1CR2A 3RH0A 3H2BA 4AWAA 3AVTA 5JISA 2PBLA 5AKIA 5BSFA 4ACAA 2WYHA 3PF8A 5KYUA 2PL3A 5JYBA 1L7BA 1T10A 1XZFA 4HDMB 1A76A 2B1QA 3NTVA 8ABPA 1H8HA 1MB3A 2O3UA 3P4UA 4PYIA 2UYYA 3N07A 3WHKA 3TWOA 5HKOA 2HA4A 3DO5A 3J7TA 3VGPA 4YY3B 4L8VA 1RXWA 4EHAA 2ATXA 3H1FA 1YRLA 5ALOA 3O83A 3THOA 2FP4B 3JQBC 4ZVSA 4BNWA 2LVBA 1RAFA 1PG5A 3LWZA 2FYTA 2HMTA 1OV4A 2ZIZA 3JAWA 4YGYA 3ZUPA 1QAOA 4YAFA 3EG9A 2FR0A 3N6XA 1YO6A 1M34E 2C2HA 1X7ZA 1M2KA 3AZPA 2VZ0A 5HGJA 1MT0A 5HE9A 5L51A 4OUDB 3COJA 4GP7A 4EVQA 1AXGA 2D8AA 1W88B 5IHPA 1M34B 5K05A 1NUUA 4OQLA 1YS1X 2HTEA 2ZTUA 4OHWA 4QXPA 4PFKA 5KQRA 3HO8A 3X1KA 3MCWA 3DZJA 1RZUA 3BUSA 2VAPA 5K3DA 2IOFA 3PZBA 3UG7A 1Z8FA 4JBWA 1ENZA 3W7VA 2NMVA 1A98A 3PNLA 3R77A 4Z7JA 4YR7A 4PE5B 3I04M 4QO7A 4LTNA 3EXFB 4INZA 3RKSA 2YWGA 2Y1DA 1G7SA 3LNCA 4PYQA 3A36A 1ZGCA 3BXXA 1NLZA 2RAVA 2ZT7A 2VJOA 3C3YA 1H8ED 1D2MA 5GV7A 1T5SA 2WU3A 1VA5A 1G1MA 1PSDA 2VHVA 3M89A 5DOZA 5IDVA 1LZLA 5CG2A 4CMCA 1Y7IA 3SYKA 5HDBB 5LQUA 1Z0SA 1Z34A 2PO5A 5F35A 1BVRA 3G85A 3ZHCA 1T9HA 2BF4A 4GWKA 1X1DA 1RC0A 3EZ7A 3MBKA 3KQWA 3LLMA 3Q11A 3U44A 3DYBA 2JIDA 1W5EA 4LWQA 5CNJA 3K5HA 1YCDA 3DE2X 4J43A 4OI1A 2GN2A 2JAOA 4MEAA 5HMLA 1RP1A 2H4WA 1NQTA 1SZDA 2AX3A 2IBMA 3PDJA 4IG4A 3QEAZ 1N7GA 5L7WA 5HP4A 4UPVA 1E0DA 2FPPA 4JWTA 2QF7A 4MLPA 3QXCA 3AEZA 2FXVA 3HKBB 3KQQA 3GL9A 4I3FA 3C39A 4M60A 2WDPA 1SNYA 4HTAA 4KXQA 3A1VA 1X3LA 4CFZA 3HYNA 5DYYA 2WSBA 4TLCA 4FS3A 1DG3A 2AC7A 4MMXB 2OGSA 3JTMA 2FQQA 4D0NA 2KB0A 2B7LA 4HJXA 4YMGA 2VZEA 1ZCAA 3QYFA 3RJ5A 1P8AA 5REQA 5FF9A 3ROFA 4WCFA 4OJYA 3IJEB 4R0VA 1Z6AA 3BCSA 5D5PA 2WMNB 3TOVA 1GAWA 1PNQA 1PVOA 2H1LA 5E6SB 3BN3A 1T5OA 4EAQA 4GLBA 3HL4A 2IIQA 2IYSA 3E3LA 2WTUA 3NGLA 3DM5A 3KUDA 1CQIB 1ZRNA 2PA3A 3DBHB 3P97A 1Z0IA 1SUCA 2HLDD 2PH1A 2ZBVA 4H59A 4PZDA 5CNMA 1KEUA 4DLUA 4V0RA 4S2EA 5M3BA 2B21A 4C3VA 2XYVA 3A7DA 4UM5A 1KRWA 4Q0MA 1IH8A 1GQQA 1OJLA 3EW7A 1D6SA 1XNHA 1XQWA 2B3DA 4BO8A 3UAZA 4KQMA 4ZYUA 2PUEA 2J3DA 3CCBA 1RWWA 1WZ2A 3BH6A 4H7IA 4WHMA 5A3VA 5LWHA 4JYZA 1IZ7A 4HDKA 3HM9A 3N2GA 5LQMA 1V7QA 1OTYA 5LA6B 4IUDS 1I2DA 2HADA 3PGMA 4GECA 4AQ7A 1MAHA 2Q3FA 5JH7B 4X92A 5CMLA 4BJ3A 2PA0A 3MWDA 1IL0A 1X13A 2YRWA 4OOEA 2W6JA 4YJHA 1H66A 5IT5A 2VJKA 1APBA 3WRVA 5CLGA 1US8A 4WKNA 3R0JA 2G9RA 2XB6A 2CNDA 3F3KA 2PQ0A 5KNCA 5ENZA 1H0RA 1OQAA 1RKVA 3MINB 1LD3A 3IBYA 2QUIA 4C7JA 2P3LA 4AC9A 4N0PA 4D0LB 3E03A 2ZBFA 4ZI3A 2GN6A 4BE9A 1KH3A 2JFWA 2QA5A 2Z4TA 5MN6A 3OUTA 3OTQA 3VUFA 2FMFA 2G7MC 3HBJA 3IAUA 2Q2QA 3I64A 4BGUA 1MVOA 1U94A 3D43A 4GBGA 1WDKA 2WZCA 1MJHA 3ETLA 4QBKA 1EEXB 1L5HB 1UCFA 4HRVA 3UAVA 3R7NA 3TAHA 2X9VA 4LHYA 5BQ3A 4JJ8A 1AOXA 4TKMA 4Y7DA 4PCUA 5KTKA 2RGRA 2XB2A 4QEDA 1V7ZA 3D4LA 4NF2A 1DOHA 2V7UA 3M6UA 2CHUA 1TIPA 1IN8A 5F2OA 1MEOA 1XELA 2YVLA 1BDBA 1Z25A 3IT1A 4Q3NA 4ND4A 5ER9A 1GKUB 4CTMA 2TYSB 3FCXA 4UCQA 1Y8RA 1YZ3A 5AVOA 3I6MA 4YRTA 1OHHD 3PHGA 3V3KA 2Q0XA 4YJ2B 1E3MA 4YPVA 3TLGB 3M4YA 4BTEA 3LS2A 2J3IA 4LYDA 1U0TA 3F3YA 5T8KC 1MOPA 4LHWA 1FFDA 2Z9DA 2VJMB 1L5GB 5TQJA 3F6PA 2QUBA 1SVIA 4KHZA 1IXKA 1UXKA 5JNWA 6ABPA 1HE2A 1RWQA 1E79D 1U3VA 3OTIA 2BFAA 4U0KA 2X15A 3WGJA 3ZU5A 1XCGB 1FOEB 3H04A 3BMCA 4JIMA 3QW2A 4Q4JB 5DNCA 2XUFA 5BMVF 2PH7A 2RDMA 5DX1A 5AJVB 3QEMA 5EVCA 3FVVA 4MO9A 5A3SA 4I9FA 1ZICA 4BWGA 4IRUB 1OT5A 2FWRA 1N32B 3AKZA 4G1FA 3L82B 3LY8A 1DS6A 1X14A 4WH0A 4J1QA 5HW0A 2I1VB 3VHXA 1MPXA 2BKLA 2W0MA 2GMWA 1DWPA 1S96A 2ZAYA 3DW1X 4ZHQF 2FQYA 1QF6A 2UZ1A 3KZVA 3AP3A 4M9ZA 4ZI2A 3ZHQA 4BLPA 4EVRA 5I9NA 4GLOA 3IE2A 1LK7A 3G2NA 4WOBA 4RTMA 4X8HA 2R2GA 4B6QA 1PDWA 1SR8A 1CVRA 1GZUA 4QOHA 3IUSA 3EQ6A 4GX0A 4N9WA 4B35A 1BGXT 3RV4A 3WQHA 2XUZA 3VJKA 4D9CA 4ND8A 5KJCA 4Q1AA 2LE0A 2P2NA 2ZRGA 4XX1A 2IPOA 4B33A 1EE9A 1QLJA 2PT6A 3V1NA 3R5FA 2ZTMA 1MAAA 4N39A 4R8RA 4X61A 3RHZA 1RWBA 3ZCSA 5JUWA 1A7UA 1QX3A 2BKAA 2TSYB 4Y6QA 1XRNA 1B1AA 3PNMA 2Y0DA 4LSGA 4PLGA 4YRCA 2PH3A 4QKQA 3U1TA 5LN1A 1UPBA 3VYSB 1U1CA 1OX4B 2IU6A 5J2UF 3MC1A 1ECGA 1KAEA 3T3NA 2V03A 3U3ZA 1SKMA 2GZ2A 4G1MB 1EVZA 1X0VA 1L4FA 1XJWA 4QJ5A 4KGVA 3REFA 3LBYA 5M29A 5BUSA 2D3TA 2Q1UA 4WK2B 4DXDA 1Q0ZA 5FKJA 2CXRA 5EQDA 2Z98A 2NUAA 2ZJZA 2TMYA 2FFRA 1BIFA 4KQWA 4OHPA 2YV4A 2EZ4A 4UOQA 5KNBA 1GNSA 4DJTA 3QVOA 4TOIA 2JAQA 4QTXA 1O9GA 3QF4B 1DAFA 4GH5A 2K7ZA 3EEBA 4L7VA 4ZJUA 4JLJA 1F7VA 4WLEA 2WYOA 3L3BA 1J09A 4W5TA 1P7PA 5D5HA 3MCUA 3NCHA 4R69A 5FOWA 3RVBA 1IUPA 1ZAKA 2G28A 5H1YA 4CN9A 3CZAA 1M2VA 1YS4A 2XMPA 4OLJA 4UHDA 1EFDN 1G20E 2HOQA 5BPHA 1KZHA 1QGOA 4QT4A 2BFFB 1E7RA 3HY4A 3INNA 1DAKA 4YH1A 3G79A 3FNRA 5E7MA 1YOVB 2RBGA 3HXKA 3O4FA 2W42A 5LWQA 1T91A 3HJUA 2HDOA 3LT4A 2VJAA 3WNVA 5ALGA 2OCIA 1EQ2A 4JQSA 1A50B 3RUFA 3V6LA 4TYQA 3DVQX 1J49A 3NBKA 1Q0SA 1GTRA 1R10A 1T0UA 2AFIA 1GARA 1L4UA 2PPLA 3R76A 3WYDA 1OLSA 1NJFA 1ECFA 2G1AA 5IF9A 5CIYA 5FTLA 2PX6A 3CB4A 4D3XA 5F51A 1JE1A 4L76A 2R1ZA 3AR6A 4N4AA 2P1DA 1GTVA 1Y37A 4GXTA 1ZH4A 1WSBA 1NTOA 1DT5A 3WK8A 4K28A 5CH3A 1YB6A 3FSRA 2JJ1A 4KLRA 1Y3CE 1TZMA 3RNLA 5K0BA 1B0UA 1ZKDA 3AUJB 4FS8A 3AO0B 4FNOA 4NZNA 4B5KA 4BB0A 3IO5A 4JL5A 2PGDA 3TRHA 3G13A 5CDUA 5K01A 4R1TA 2VHZA 3NWOA 3BE4A 1XZAA 4P4TA 1GN9A 4IRXA 1AHPA 1XMOB 1QC5A 4JHXA 2PLWA 5E3JA 2OFFA 1N7IA 3UK7A 4YDSA 3RSOA 4YMTA 3UJ6A 2X3UA 3ROKA 1GGMA 3JQAB 4QODA 2QLFA 5KJ1A 2R84A 2EFDB 2CLEB 1TF7A 4FCWA 4BCBA 1LTKA 1PRYA 3MPUA 1K2VN 4TKUA 4LQ4A 1YUMA 5DWVA 1U5BB 4BN0A 2HMUA 3Q3IA 1WHSB 3S29A 2Q8PA 3N70A 4PRLA 4GZ3A 3R8CA 4PS0A 2X2PA 3L0YA 4UM7A 2VK4A 4M1KA 5H4GA 3B6MA 4PG5A 3KUUA 4JZYA 2M6SA 3Q3HA 3X43A 3V8VA 3GOQA 4IVQA 2EF0A 1MH9A 5AI8A 5CD1A 2BGTA 2VEDA 3MMPA 1NP7A 2Q8QA 3N3AC 4K2AA 4MQ6A 4UAVA 4J0QA 3IX7A 4CR8A 2YN0A 2XUIA 2ECFA 2QL5A 3OQJA 4I0WB 1HC7A 1SQ5A 3IEIA 4BJ5A 5DRTA 2XRZA 4COKA 1F0KA 5F1KA 5L53A 3KL4A 5KQSA 2F17A 3H1PA 3ZY5A 2Y9MB 3OCWA 1XEXA 4E07A 4DQLA 4P83A 3W3AD 4YCSA 4IG9A 2O0HA 2QQFA 4GPIB 5EJ9A 1Y5MA 2VTKA 4NZOA 3AHDA 2JCSA 3R23A 4OH1A 4I5EA 1AA6A 4EDHA 2I8LA 3IRUA 1CJBA 4B7AA 2WLSA 1XKXA 2HMYB 3WGKA 2D59A 2R87A 4XUEA 3MSCA 4ZFNA 1ADJA 3ONFA 4P9NA 3W9UA 2XCTB 4CBVA 3R7SA 1DDGA 2E9SA 3B82A 4GP9A 4L9AA 4MVJA 4K9NA 3TM4A 3VGJA 4Z4IA 1N6KA 2PEZA 2XDWA 4TZ0A 4MULA 1MJFA 4YRZA 5E1OA 3PUXA 3TGWA 1NVKA 2HNBA 4AJHA 4IQGA 3EZYA 2VFAA 2FF5A 5HRAA 2ZIFA 5CFLA 1JQEA 4LJSA 4R54A 2B61A 4U7TB 4O2BA 3RQSA 3U60B 3LP6A 3WLHA 1BDIA 4V1CA 1X9HA 2XGGA 5DMHA 2QUHA 2Q1YA 3WWZA 4HUTA 3I2FA 3I52A 3JZMA 5FYDA 3VDNB 1A5ZA 3PJGA 5M5BA 1T5DX 1J2RA 2QJOA 3WXBA 4L0CA 5ERYA 1J20A 1UUFA 3NORA 3S44A 2PG3A 1C0IA 2VLBA 4BPRA 4K9SA 3VKVA 4HAWA 4D9NA 2V7QD 5KSYA 4Y30A 1E6WA 1RYDA 4B09A 4CRWB 1RJGA 2P65A 3GN2A 1XA4A 2G25A 3U4CA 1LS6A 4CIDA 1LPMA 2DLCX 3AT1A 3RT1A 2ZR7A 3OESA 3T95A 3MWYW 4R71A 4QAJA 1FFHA 5BV7A 5AXCA 4ZOQI 3ZDZB 1ZD2P 2BFEA 2NQ2C 2XCUA 3AJRA 3BSFA 4RF4A 3R20A 1MV8A 4EW1A 2OXCA 4F8EA 1WMEA 3WLNA 3F5DA 1Y8CA 2OILA 2ALJA 2GFIA 4DBVO 3WICA 3HKCB 3OJEA 4E1VA 2MIIA 3H87A 4GZ6A 3Q9NA 3ECAA 1P80A 1AKRA 3IUQA 2L0XA 4PV7A 4G8CA 3F73A 4FCCA 2J4DA 2QRLA 4Q5IA 4X91A 1E1YA 3U4DA 3GJTA 2VCHA 1RQLA 4JBNA 4Q7LA 1T8PA 2Z4SA 2Z3WA 4UULA 3FI9A 3TLJA 1M54A 5HCUA 1NBME 3ESRA 3WY9A 3F2IA 4IV0A 1EK2A 5MFPA 5BNFA 1B0AA 1J1UA 4CE6A 3JWHA 5K45A 4AJ9A 3IUNA 1G60A 2K2QB 1OASA 2P9JA 4MVJM 5CDYA 1A69A 5WRFA 1IUKA 3MJDA 1B43A 3TX6A 3KLPX 2OFXA 2PRKA 1CQZA 4JJIA 4O4JB 2OV4A 2VSFA 2AE2A 5TSDA 2VH5R 3K0AB 2D2EA 1T4CB 4UUBA 4YAKA 2F8MA 3H9JA 3P4YA 5DBIA 4ZCPA 3RS7A 2LV8A 4BNVA 2VP3A 4HVCA 5C7YA 4Q4HA 5CA0B 4NX2A 1FQWA 2PS1A 3O84A 2VWHA 1N5IA 5CYFA 3DAHA 3PRKE 1L5QA 3EHDA 1V3UA 2RJ3A 4FBGA 4X9XA 1Z6ZA 4WXEA 4DXAA 3G1WA 5EE5B 4PO8A 4UHFA 2C4UA 4UTPA 1RMQA 4RY9A 3SQMA 4JFRA 4CIXA 1YRWA 4BEWA 4PSVA 1IY1A 3ZCRA 1J5XA 3GMTA 1Q1EA 2HO5A 1UKYA 1GKIA 3D54D 4MHOA 3PGVA 2HIAA 2IQIA 4ND1A 4RE6A 3S27A 3T5CA 5T8KA 5HJ7A 2VRWA 3KQKA 1CULC 1EKXA 2X1VA 4BWFB 3LUFA 1JR3E 3D4IA 4ZANA 1HF3A 2SICE 3TZCA 1V9LA 3ITNA 1KYXA 3DD1A 3T5BA 1GAEO 1DEXA 3SIWA 4ENWA 1P7WA 2PU7A 2PUBA 1PT8A 3EYWA 4MRMA 2R00C 5IPFA 4I50B 2V8BA 2IH2A 1QVVA 2GCOA 4OMDA 1XL0A 2JKYA 4CM7A 1I94B 1PNVA 3GNTA 2C9DA 3BXFA 1SRQA 1VG8A 3OT5A 1NLYA 2HRRA 4MAFA 1E2QA 2O8DA 1QV7A 1RCTE 2MINA 1V48A 3C85A 3K4QA 1TK9A 3EVBA 3MB8A 3MRSA 5FNZA 4P38A 4AF8A 2O1EA 3UG6A 2EHJA 5IASA 2HM7A 4OYLA 5AK4A 2P5TB 3ZNPA 1JB9A 5CLHA 3FDXA 2COEA 4F71A 4RZIA 1SB8A 4QXRA 3X1WA 4N8SA 2NOAA 3KQNA 1KVQA 2EV9A 4OO3A 3R9KA 4QJ4A 3WV4A 1JHRA 4P1ZA 3JALB 2EKBA 4BO6A 1GVNB 2NUPB 3OF2A 4Q02A 3KXIA 4OXXA 1FQOA 3O9VA 1WXQA 4HMPA 3L8HA 4IDPA 5GOTA 3WIUA 3VR6H 1PQPA 3SEZA 1ZIPA 3NM6B 3EPRA 3D0RA 3D7MA 4K5QA 5F3RA 1D6JA 3C16C 2XZLA 1JHYA 1EA7A 2O2SA 3D5TA 4TGLA 3FIJA 4AI6A 5JSQA 3EC1A 1IIBA 1WO8A 2Z6UA 3BWXA 1TKRA 5K3BA 1QAQA 1ZHFA 3HB5X 1XMVA 5JEEA 2XLCA 3JR7A 2C5SA 1D2CA 5CYPA 5B3JC 4P3XA 1X8XA 1XTRA 4AIIA 1TVMA 3HJCA 2B5WA 3A9TA 1L7AA 1Z73A 3H5IA 4CF7A 3R5KA 5JASA 5TB5A 2CMHA 1XYGA 2EFYA 2FLKA 2ZJ7A 1TLFA 2EBWA 1UC8A 1PEYA 4J1SA 2VYCA 4HDMA 2HHCA 4ZN6A 4KNYA 1LPBB 1EDZA 1JHZA 2LWIA 3A6FA 2ZXUA 2YZ2A 5LZ4A 2HN9A 2PRSA 1EFRA 2PFKA 2HSZA 1P1FA 2IZ6A 2ODTX 3HN7A 1WV0A 4INAA 5AKGA 2OPHA 1BDHA 4C0BA 1DARA 1CZLA 4ARBA 4YR9A 3SXUB 5KTNA 3INGA 4Q9DA 3DTVB 1U9IA 3EEFA 4QA9A 1RNLA 1YSCA 5JMWA 3EQ7A 3F6RA 2PRIA 4LGCA 5E4JA 5FA8A 3CZQA 1DBIA 1N2EA 1H2WA 2JCGA 3ODGA 3MHPA 4OUDA 4UMFA 4EG8A 3ZJVA 5K99A 1QVWA 2PJDA 1RQRA 2PYDA 3KB6A 2CNWA 4UXJA 5CCBA 2XMQA 3KHKA 4WWHA 1WBJB 4QRIA 1SM4A 3ML1A 5B3KA 2YR0A 3P9IA 4DT1B 2CYAA 5DNVA 4MKGA 1YZNA 4EG3A 4I1VA 4LMAA 4RK4A 1VXRA 1P1CA 2D06A 5FUWA 4MCJA 4K81B 4GI1A 3L02A 2AXQA 2O6LA 3FCCA 1VIYA 2UXBB 2HRCA 1ZONA 2QN7A 3ID6C 4TM7A 1ULZA 1U80A 3CUUA 4O8ZA 1ESMA 3IOCA 1I6LA 2IHKA 4KXMA 3SBDA 4BMVA 5MGBA 2O8NA 4O63O 2BC9A 3FB4A 1M66A 3UHJA 5BOSB 3IOEA 2BKXA 1PO7A 3L1KA 3S2GA 1G38A 3P0FA 4C21A 1Q7BA 4TZKA 4U2BA 5K3SA 1DAIA 2QRKA 4BGEA 5L95A 3EUEA 1LLUA 1SIBE 2VJBA 3WLPA 5BSGA 3OJXA 4TRMA 1ZOLA 3TZEA 3TMYA 1UDBA 2IU4A 2GZHA 5DLPA 4GBMA 4EUKA 2WIJA 2OGUA 5LMZA 3KRTA 5ISMA 4B3RB 1PYOA 3W9BA 5EIWA 4I4IA 5BVGA 3FWPA 1G8HA 3UMJA 1WW8A 1O96B 5H4HA 1VA4A 2X5KO 4Q1CA 3HKBA 1VLQA 1WUTA 1PHPA 3K0HA 1DX4A 3NNNA 1UPFA 4ZVVA 4B2PA 1XZQA 1Q6YA 5BSTA 4UVHA 5HBRA 1A3CA 4MQLA 1AQLA 4H27A 2A7XA 1HPLA 2VDNB 1XSEA 2YFYA 4O2BF 4FMDF 4W7HA 1UL1X 2II6A 1NC3A 1NMEA 4NFLA 3AVYA 4A10A 5EFOA 2F7SA 4RYLA 2AQKA 4HC4A 4C4ZA 3KKOA 1RXSA 1FC0A 2OPBA 1C8LA 1P81A 2HPAA 4X1YB 4JD5A 3NHZA 2FA9A 1ZMBA 2A84A 3C87A 4JC8A 1CQIA 3PDCA 4J6FA 4ZP1A 3DBHA 4I36A 3RUDA 4S0ZA 4ABYA 3T5AA 1YR1A 2JCBA 3H7AA 2WV9A 4PCVA 2C8VA 3SQXA 4C7OA 4HQRA 1UPXA 4EK9A 4M0PA 5EXPA 3G9ZA 2DYKA 3RVLA 3IIIA 4Z9YA 2HJHA 1B0PA 3OECA 4PN3A 4HUQA 2OV6A 1WUIS 4LC0A 4YRNA 2PWBA 1E1KA 2QYHA 3ACCA 4NBKA 4V0SA 5BNZA 1FFCA 4FP9A 2HU7A 3MGAA 2YYAA 3HO1A 3F5MA 1K68A 3ILVA 4BFZA 2FUKA 3TVTA 5AW0A 3B53X 1CF9A 2C2MA 2OLKA 1VL0A 2P0YA 3I1YA 4URUR 2HA5A 1EP9A 2O06A 2Q5EA 1QFJA 5CVJA 2HZBA 1Z8HA 4QPZA 3HB7A 2P4UA 2ENUA 3H8SA 3SZ3A 1MRZA 1DX9A 4K03A 1HT3A 3BEDA 1TTTA 3CVYA 1M1NB 3ZXYA 3NHRA 2WEKA 3TYXA 1JVSA 3BTUA 2X77A 4W7SA 1FFXB 3CSSA 1Q83A 3EIWA 5EJEA 3DAFA 1QP0A 1PU2A 1TKBA 4YACA 1B4DA 1XDUA 2OB1A 2GS9A 2X40A 1OX6A 1GCGA 2OZEA</