3KQUA

Three conformational snapshots of the hepatitis c virus ns3 helicase reveal a ratchet translocation mechanism
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
437
structure length
437
Chain Sequence
SPPAVPQTFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPITYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSSTGEIPFYGKAIPIETIKGGRHLIFCHSKKKCDELAAKLSGLGLNAVAYYRGLDVSVIPTSGDVIVVATDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRMGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTTTHPITKYIMACMSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease/NTPase/helicase NS3
publication title Inaugural Article: Three conformational snapshots of the hepatitis C virus NS3 helicase reveal a ratchet translocation mechanism.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/dna
total genus 148
structure length 437
sequence length 437
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3kquA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kquA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kquA01
3AVPA 5JS8A 1NY5A 1Q57A 4RVCA 1KNQA 1AGRA 2YINC 4RD2A 4CVNA 2IXFA 2GXQA 1F60A 3KDSE 4OHVA 3C4JA 3NIBA 3O47A 3WMEA 1OIXA 4CIDA 2ZS7A 2ZR9A 1E99A 4US1R 1QHSA 4MRPA 2OXCA 4DDUA 2QTVB 4MYTA 4DEXA 5JWOA 4NL4H 2VQSA 5KDLA 3VKGA 3P27A 4ASUD 2J0SA 4G5GA 1DELA 4QBFA 3UWOA 4CEIA 4PQYA 3M0EA 2NTYC 4DCTA 3R8FA 4TYPA 2FF7A 1NMZA 2H8KA 2EFGA 4YMSA 4B3XA 1Z2AA 4RZ3A 5FI0B 4JLOA 2OCPA 4M1SA 3PR1A 2BC9A 4F93B 1P2TA 1DPFA 2QP9X 3U3JA 1W2HA 5LPNA 1SHZA 2DWQA 1BOFA 1G8HA 1KO8A 1SVOA 1UDWA 4LC0A 1AA9A 4M1YA 1CF4A 2I3BA 4ILEA 1ZYUA 2NPIA 5K8UA 1FQKA 3VNVA 1DAKA 1ZD8A 4MGYR 2Z6VA 3LW7A 4CDGA 2JA1A 5E4FA 2FZLA 4RKFA 2ZE5A 3PCRB 1W36B 1DO2A 4F38A 1G291 4PAOA 3CH5A 4GPTA 1EX7A 2FPMA 4D4MA 5FUVA 4HLDA 2G3YA 5F2EA 3SJZA 3EPJA 3TSZA 2C5LA 2R65A 3MUFA 4CGZA 3QEOA 1XF9A 4PX9A 2BMEA 1G8GA 2FU5C 3RHFA 4E03A 1ETUA 3B8HA 1YR8A 1VHTA 3UANA 1MKYA 2XEXA 4RFSB 2J59A 3NDBB 2WPDA 3CO5A 3R20A 4M1OA 1E79A 2REBA 1BMFD 1XTQA 1RIFA 2BV3A 4NYMR 1R0ZA 1ZUIA 4V0MA 5CLLA 3CNNA 4C7OA 1ZD1A 5JMTA 4UXIA 2LKDA 2P2LA 4JMPA 4NP6A 4D4JA 3AVWA 5FOXA 4DUGA 3OIVA 2J45A 1M7HA 3CR7A 1VECA 4XVQA 5FOUA 2WSSD 2W83A 5J47A 3DM5A 5EP4A 1GM5A 2ANCA 3LWNA 2JDID 2D7DA 1S0UA 4LJ7A 1J8MF 2QA5A 2AXPA 5HCIA 2GXAA 4IEEA 2IYLD 2HXYA 5JBQA 1COWA 1HQYE 2HLDA 4BFVA 4TQUS 4MGZR 4CRWB 5KNCA 2WV9A 3T12A 5J4LA 3UMSA 1OXSC 1L2TA 1KK2A 1XZPA 1W47A 4C0QC 3K70C 4C7OB 3L8ZA 5JHHB 4QGGA 1UKZA 4OKSA 1FL9A 1Q1QA 3B60A 4P32A 3ZDQA 4L15A 4LWZA 1QF9A 1UJ2A 1G41A 1E96A 4Q00A 4C0AC 3HU1A 3B9PA 4CT5A 2AK2A 2CK3A 4ASUA 3BFKA 3PITA 3NXSA 3FMIA 5L3SA 4D25A 3A1VA 1OHHD 2OBMA 1OFIA 1KSHA 4FIDA 1XPRA 3AKYA 4XJXA 3C7KA 4L9WA 6Q21A 2RH5A 5H8WA 2Z5FA 3TVDA 2ZSBA 3CF6R 4ESHA 4FMCF 4B32A 1QG4A 3GJ4A 3CNLA 2FN4A 1QHHA 3KJGA 2ZI7A 3AKCA 4MRNA 5KSOA 3AUXA 3DEFA 4XH9B 2YV5A 2EFHB 1VKJA 3I8XA 1CJUC 3BERA 1Q0UA 3FPAA 4NCNA 2P65A 3MD0A 3QKSB 3UKDA 4LHZA 3ICQB 1AS0A 2FSGA 4E07A 5FL3A 2DPXA 1FFHA 1DADA 5L3SB 4GSYA 4DCSA 4ZPXA 2QAGA 1WXQA 1R5OA 4GNKA 1IBRA 1IOZA 2PEYA 3RRMA 1F48A 4Q48A 5EXTA 4Z8YA 3THXA 1LF0A 2QORA 1E2MA 3NWJA 2OG2A 4QHTA 1Q1BA 1LS1A 3QQ5A 2X2EA 3GFPA 1G3QA 1QHHB 2PX0A 1BMFA 1I4DD 2AHOA 4L5BA 5GADl 1WB9A 3L0OA 2J87A 2P6NA 2Q3HA 2UVQA 4TTRA 4HZUA 4D26A 4IOJA 1F2UA 4IW3B 4EPTA 1JXMA 2GILA 3FFAA 3GLHE 4GMDA 1GRRA 2FFAA 4JKYA 2WSSA 5HCNA 3WNCA 1VCMA 1U0HC 4IDHA 3EPHA 1E2JA 2ZJBA 3DDCA 2JDIA 1GRQA 3EWSA 2B92A 3KQHA 1E9SA 4ZIRA 3VR4A 1ZW6A 4GFDA 1X1RA 1IJFA 3IUYA 3RSOA 3D7MA 1KI9A 1QHNA 3FHCB 1II8A 3MWKA 4A15A 4HAXA 4BLQA 2FZ4A 3FFBA 1NN5A 3LXRA 3PUZA 2REOA 3EZ7A 1UEIA 2YYZA 4GRAA 3EXAA 1XNJA 3RLFA 3TR0A 1B0UA 1AQYA 1P6XA 4HZUB 2JLWA 2LCFA 1F2UB 2R6GA 1FTSA 2IHYA 2QM7A 4HI0E 3MLEA 4LGMA 3H1TA 4YXWD 2AKYA 2PX3A 4CEJB 3UWKA 3T1TA 4W5JA 1JALA 1HEIA 3EIEA 1OHHA 4PHHA 1IAQA 4DXAA 1U8AA 1NY6A 1S3GA 4DLWA 4ZIRB 3FHOA 4WXRA 5DYGA 2MSDB 4ZDWA 4AC9A 4MUBA 3PVSA 2GJSA 2EFEB 2CMKA 1K5GA 2PEZA 2WJIA 5C4GB 2FA9A 3SJAA 4N1AA 1XCMA 1M6NA 3X1DA 1N6HA 2EWWA 3GLIE 2BBSA 3A58B 4DVGA 2JJ1D 3F5FA 4L8GA 3X1XA 2ZS8A 4OI0A 4TZ6A 3RRYA 3P26A 2I4IA 4YLGA 2XOKD 1XEFA 2RGCA 3NDPA 2V3CC 1KSFX 2FFHA 4Q1CA 2YWGA 1T8UA 4IRUB 1FX0A 2BEJA 3R8CA 3TBKA 1NL3A 2ERXA 5JJLA 2VHUA 3VR6A 1C4OA 3L8YA 1MRSA 4MRVA 4NHOA 4TN1A 3T5GA 3NBZC 2C03A 4EAQA 4AWXA 4ZKDA 2CHQA 5J4KA 4RD6A 3EIHA 4FN5A 4D4KA 3T06B 1G9XA 4OQFA 1TQ2A 2GNOA 1NKTA 2H92A 1NKSA 3PUXA 2GZAA 1BO6A 1R4AA 4WZBE 2DCUA 3QKTA 3DKVA 4KSCA 3T1OA 5E7JA 4BLRA 1W0KD 1BS1A 3SFVA 4PO1A 1G5RA 3GJ7A 3JZMA 1YE8A 2DWPA 5H68A 4LHXA 2EFCB 4A82A 5DH9A 5BQ5A 2ODWA 1E2GA 3T1VA 3I61A 1FX0B 2OV2A 5F9HA 4PAQA 8OHMA 1VYTA 3LQQA 1RJ9A 2BM0A 2J1LA 1M7GA 4ZCMA 2ZSFA 2KB0A 2XSZD 3RS0A 1FP7A 2O8CA 2GBLC 4QGAA 3U3RA 1EFTA 1Z6GA 2O0HA 2YNMA 1D8TA 5J4VA 3FVQA 4B35A 2B8TA 3NEJA 1S4QA 4TTQA 3NEYA 4PPFA 2FNAA 2OE2A 4JVNA 3EIQA 2GTPA 1RFLA 2NIPA 2BWJA 4XSHA 1SVIA 4PFSA 3U4QA 2A7QA 4A8JC 5FOTA 4HLUC 2XZPA 1P2UA 3VU9A 4LYHA 1ZAKA 2H1LA 3CPJB 3P1JA 2ZPTX 3K53A 4P4UA 5LB2A 4B2LA 1E2NA 1KSJA 1F3OA 1MT0A 1RJ9B 2IUSA 4PZZA 2LWIA 4PO8A 4WIAA 2GCNA 3GEEA 2ZJAA 3ZZUA 2ORIA 5TXGA 4A1FA 1EWRA 1U90A 5FUWA 2OXRA 3QVVA 4WOPA 4A6XA 4YMVA 1MO6A 1Z06A 2O8CB 4OQLA 3GLHA 4AKGA 1OH6A 3QJYA 2XXAA 2CVFA 4IDPA 2JIZD 2JJ1A 5AUPB 5KYKA 3OEEA 2IEYA 4MYHA 3L0IB 1XPUA 3Q3JB 4AY2A 3O8CA 1HY3A 2VIIA 3HU3A 1P9NA 4NYJQ 4TMWA 5L3QA 1QRAA 4BFXA 3W90A 3U4QB 1GKIA 4LBYA 3SHFA 2VF8A 4EPXA 2AFIE 4JVSB 1YRBA 1IN8A 1UBGA 2ZVPX 4A92A 2O0KA 1SXJC 3ND9A 2RGGA 1EFRA 3T61A 5F3WB 3ZVLA 1XPOA 3WP0A 4U00A 2FSHA 1ONBA 2R44A 3KXKA 4EJSC 4IOLA 1RE0A 2OEPA 3CKLA 3C8UA 2ZJZA 4JVLA 4RZ2A 3GLHB 2H5EA 2XXAB 3OZXA 3SDZA 4OQMA 1RRPA 4ABYA 4DJTA 1ODFA 5FPSA 2HJGA 5AUNB 5L3QB 1MABA 1KHTA 5D3MA 4LJ6A 2QRZA 1A2KC 1PJRA 1GZSA 1XEXA 3DOFA 4FCVA 2ZITA 1FUKA 2XAUA 3LLMA 2C96A 4DCVA 4BGDA 2VYFA 3NTUA 5FOWA 4C4PA 3K0CC 1TF2A 4BQSA 1AKYA 5TDHA 1WE2A 2F1HA 4G3XA 4TLBA 3UXMA 1KYIA 1XD2A 5AUQA 1LV7A 1LW7A 2DFTA 3GLIA 3U5ZB 2EW1A 1KDRA 3EPLA 2PL3A 2NO9A 1NG9A 1QBKC 4TTPA 2JAQA 2E87A 2RGAA 3BK7A 2JLQA 4TQAA 2TMKA 4QGHA 2O8FB 3RANA 4P3YA 3KL4A 1RRFA 4NCJA 1ANKA 3QPUA 2ZROA 4JLJA 5D3MB 4QNMA 1RRCA 3AH8A 4GDFA 4KCGA 3VR5A 1EG7A 1DAHA 5DNYB 2XB2A 3DZ8A 221PA 1KJYA 1D9XA 1JPJA 2WJVA 4CW7A 2IYTA 5TY0A 1JAIA 1E0JA 5HE9A 2ZQ5A 4RSGA 5BYJA 4KBFA 5JHGB 1G4AE 4UXHA 4HB4A 2VEDA 3TQFA 1XD2B 1MRNA 4IVPA 4KAXA 2QTHA 4M9QA 1YR6A 4BRUA 3QF4A 2QGNA 3GMTA 3K1JA 5FOVA 3GJ8A 2CNWD 3RS4A 5IRCD 2JIZA 3ZIAD 4S35A 2FG5A 1E6CA 2V54A 1FPMA 1CJVC 2GWHA 3PQCA 3QI2A 1XDBA 4LV5B 3W8RA 1FNNA 5CK5A 2QENA 4QG7A 1XEWX 2OILA 2R8RA 3CNOA 4C0LA 3CH4B 3B9QA 1NJFA 3C5HA 5IF9A 2ORWA 1KK3A 1S3SA 4JYCA 1U9IA 4E22A 2AD5A 4TMTA 4N3NA 2CLSA 2W00A 5IDVA 5GJBA 1NVWQ 3QKRA 1RPZA 3SOPA 3QF4B 2RGDA 5DI9A 1X1SA 2JLSA 3NBXX 2QU8A 1G3IA 2P6UA 1T3SA 3SJCA 3W3ZB 4CT4B 4ESVA 3LAWA 5AUOB 2Q3MA 3L43A 4IFBA 4UKDA 4OQXA 1G3RA 4TWZA 1KKLA 3SYLA 4B47A 4A2WA 1NMYA 4LJAA 4DDVA 1K6MA 2UZIR 4OL0A 4W7SA 2BKEA 1ZM7A 4HATA 2HT1A 2IT1A 4M1TA 1QHGA 1I2MA 1Z8FA 3LLUA 4G1UC 4JLBA 1HT1E 1N2CE 1IY1A 4OBEA 1JEEA 1VIYA 2QMHA 3N5CA 1EWQA 4RD3A 2Z0MA 3I1FA 3R7WA 1WA5A 3EZ9A 3QKRB 4B44A 2ZI6A 3QXXA 1JI0A 2NO0A 4K8OA 1U8ZA 1RYFA 3GCGA 4JSTA 5JI2E 2GAAA 1VYVA 3VR3A 1NJGA 2PT7A 3B13B 4TYYA 2ZI5A 3THWA 2QE7A 3WBKA 1OFHA 3REFA 1VCIA 2F7SA 2IYZA 3FKQA 1AGPA 3AP2A 4HAVA 2WKRA 4QXAA 5HE8A 2IS4A 2GKSA 2QMOA 1C9KA 1ZM9A 1E1QD 1G1MA 3ICEA 1G7CA 1JB1A 1KO4A 2O8BA 4Q01A 4QJ4A 2W6JD 1ZNWA 4XD7D 5CJPA 4DLXA 2C9CA 4P33A 5CIQA 2G9NA 2ANBA 3T1QA 5L3VA 3R7WB 2J7PD 5EE3A 1U0LA 3R9XA 1JQJC 1VCOA 2A5YB 4BZPA 3IEVA 1NSTA 3LFUA 1P2VA 1L8QA 2Q6TA 1VIAA 2CNWA 4B2IA 4AD8A 2ECKA 1V43A 1E2IA 3ZIAA 2BCGY 2XTNA 4ERNA 5C46F 3THWB 1OYYA 5G40A 1U94A 3KXLA 1OXUA 4DHEA 2D3WA 4PQRA 3NHBA 1JR3E 1ZNXA 2GETA 1HH4A 3JZAA 2QRNA 2YZ2A 3EW9A 1YZTA 3MFYA 5BWMA 1TF5A 4P0TA 4U5XA 4BFYA 2O8BB 3WBJA 1NBMD 4LYFA 1VHLA 2ONJA 5FPYA 2GEUA 2GJKA 5B30A 2IXEA 3A1UA 3JVVA 4A0FA 2GCPA 5FUXA 1DARA 1A1VA 3RS5A 3RC8A 2WIBA 4KLZA 3TQCA 1XMSA 821PA 1YZQA 3ZZ0A 2JLVA 3GJ0A 1YKSA 5KTYA 5E7IA 2IF2A 3TNFA 2PMKA 1XTJA 2RGNA 2WKPA 4O3MA 2GHIA 3VX4A 2PMDA 2OSBA 1W2GA 3U3KA 3K9LA 3R9WA 2V55B 5FTJA 1W4CA 2Q0HA 5C18A 1E2HA 2VHCA 3WHKA 5JRJA 1VYUA 2ZR0A 1JR6A 3WNDA 2WIAA 3OE7A 3RWMB 1G18A 2YWEA 2ZE6A 4QBHA 4LJ5A 3T5DA 4AG6A 5KUTA 4NYIQ 1WF3A 4M22A 3VHLB 1CJKC 1Q3HA 1XX6A 2C78A 4KITB 1JJ7A 1JR3D 3C5CA 4KO8A 2GJAA 3W5IA 4PHGA 1T91A 3RS3A 4P4TA 3IBYA 1W36C 1R0WA 3C41J 3TRFA 1NVVR 2VLIA 2Z43A 2ZRGA 2XITA 2AKAB 1SQ5A 4NCIA 4KFRA 4TMZA 2C9OA 3MWJA 4CEHA 1E1RD 3IGFA 3OEHA 4A4DA 1EFCA 1ELOA 1KMHA 2ZRPA 3QIAA 2FJUA 5L8VA 1DG1G 1X6VA 3MG9A 1DS6A 4Q1AA 5TB5A 3ZH9B 4DSTA 4DLZA 1T5IA 4WZAE 2W6JA 4JLPA 2EU8A 3ASZA 2G77B 5KDOA 4BFZA 1ZCAA 4US0R 3B1YA 1RYHA 3TSWA 2ZRFA 3TVTA 1LTQA 3L0PA 3I62A 3ZD6A 2FFBA 3U6BA 4EDHA 3OAAD 3WRXC 1G20E 1CLUA 2Z4SA 1HE1C 1R5BA 4Z1MD 4TQ9A 3B7GA 4XVUA 1XJCA 3TUIC 4HUQA 5EXPA 2VBCA 4Q7MB 3LA6A 4A9AA 1Z5ZA 1KMHB 4GOKA 3RSLA 4BE7B 5JLJA 3SQXA 1P60A 2WOJA 4LJ8A 3AV0B 4FXPA 3A6PC 2CLCX 2OBNA 3KKOA 2QPTA 1XP8A 3LVRE 5FBWB 3EARA 4D2IA 3HP1A 4O2LA 2GCOA 1SHKA 2BBTA 1DAMA 4LHVA 1N6LA 4MRRA 2GRJA 3TJZA 1P3JA 4DLUA 1E2QA 1AQUA 1KO5A 4CEIB 4IXMA 4DLYA 3K70D 2IXGA 4KV9A 4Q7LA 1N0UA 3NG1A 1YZLA 3A1TA 4DLTA 4BLTA 1G3UA 2B8WA 4PXAA 4HUQB 2AR7A 2NGRA 3DOEA 4GBMA 3I3SR 5GVSA 1Q3TA 2HYDA 3QXHA 4I99A 1HTWA 1TQDA 4IXNA 3UG7A 4A36A 1T0HB 1Z6YA 1GUAA 3A36A 4RZXA 4BEJA 1B23P 5E3HA 2A2ZA 4TSFD 4PC7A 1Q1ZA 1UBEA 2GEDA 2QT1A 2GCOB 2OCYC 1E2PA 1L7VC 2A5FA 2FGJA 4NH0A 1NSFA 4AYWA 1T8TA 4PQFA 2DFNA 3BB3A 1E0SA 3THOA 1XZQA 4PHFA 3M6AA 2QQEA 4ITRC 1JR3A 1FTNA 4Y0VA 1GTVA 2BJVA 5G41A 3P20A 2V8OA 5CLQA 2IX3A 2BEKA 1W0JA 3TW8B 2VP0A 1VCNA 4UNSA 3I4LA 2V6JA 4EUNA 4OK5A 3D3QA 1Z0AA 2BBOA 1A5TA 4D0LB 2IS6A 4KLNA 1E2FA 3GLFE 4GP7A 5B57C 4RCYA 3EZ2A 3A1SA 3DMNA 5GJVC 2ZIAA 4UXJA 5EQTA 4PO9A 4R71A 4CF7A 5KDDA 1T0JB 3HJNA 2ZSEA 5ANRB 1Z6TA 3A4LA 1ZUNB 2OUKA 3OAAA 1XXHE 1U0JA 2YC4C 4RD4A 5ELXA 1P61B 4KBGA 4Q1DA 4BLPA 4Z1MA 1GILA 1JAHA 3PEUA 3I32A 3FTQA 4TMKA 4O0MA 4EKDA 3RS2A 4HAWA 2QZ4A 2WWXA 4P4SA 2VP9A 1I4LD 3GLGE 4JVMA 2F1IA 1RZ3A 2ODBA 3LX8A 1SKYE 3GJ6A 4B6EA 2F43A 3D8BA 2G0NA 4MUAA 1Q21A 1CRQA 1X86B 3BXZA 2RKOA 3W6NA 3LNCA 5G3YA 2OESA 3QNUA 2HDNB 3MWYW 1G21E 2GF0A 4M1KA 4KSBA 2H57A 4QHYA 2FEOA 2V7QD 3OIUA 2ZU6A 2OO7A 3QUSA 3SC3A 4Q1FA 1UBFA 1GNQA 2R2AA 4NMMA 3HYTA 4ZKEA 1OFTA 5SZHB 2EVWX 4MYCA 1MO5A 1CTQA 1NI3A 3CX8A 3MMPA 4RD1A 3K8YA 3N2EA 4MKGA 4Q03A 1GDDA 2NO7A 1W5SA 2F43B 3VTKA 2Q3FA 4URYR 1OH8A 1Z08A 5E95A 2BMDA 4Q66C 3UMRA 3V00A 3CPHA 1E98A 1LY1A 2NOAA 3ZZTA 5JRZA 1BKDR 1DAIA 2XNSA 4L9SA 5JEEA 2GZHA 3X1YA 3LH5A 1TTTA 2DR3A 2G0TA 1E2LA 1R5NA 1KKMA 1WCV1 2QAGB 4NCHA 5DISB 4XWOA 5JS7A 1Z6AA 1F2TA 2QN6A 3TUZC 5GVRA 4KFUA 2GVZC 4B3BA 1ZNYA 3THXB 4WAUA 5CYOA 4R98A 2H7VA 2ZXUA 2IF0A 1TADA 1SVWA 1Z6XA 1KTVA 4C2TA 3FOZA 1PUIA 1ESNA 3I8SA 4NKRA 1PZNA 3U44A 1GKUB 2GZDA 2OAP1 2WTUA 1MOZA 4C30A 2QNRA 2RGEA 4Q9IA 3U3MA 2GVDC 4V0OA 4Q9JA 3U6KA 4HUTA 3ETLA 4MDFA 121PA 3A4MA 1NVUQ 3K9GA 1ZRHA 3V4FA 4AG5A 3PFIA 2Z4RA 3WNBA 721PA 1OB2A 1CXZA 1S1CA 3G5UA 3B1WA 3QXSA 3U60B 4JBYA 2OAQ1 4QHSA 4FW9A 3BH7A 5TMPA 2ZTSA 2RHDA 3MJRA 2KSQA 3NHAA 5HZKA 1DAGA 1II8B 4IFEA 5J40A 4DEYA 5HKKD 5JCPA 3ND8A 2B7BA 3AF1A 1W4BA 4KFSA 5EJEA 3SHWA 1SVKA 3HR7A 4FINA 4MKIA 3TE6A 4B3CA 4D80A 3PUVA 1OFUX 3K0EA 1DTSA 2AD1A 2C04A 1SVLA 2C98A 1CR2A 1QZXA 4HYYA 3TAHA 5CITA 3LX5A 1F5NA 5DN6D 4TZ0A 1KSGA 3VFDA 1SXJE 2WOOA 5FBVB 3LY5A 2IL1A 1W49A 2OZEA 1E94E 3AQ4A 3ADDA 5CB8A 2V7QA 1BYUA 3A8TA 4HDCA 1N25A 3UK6A 1S9HA 1XFAA 1P73A 1R8SA 1Z28A 3EZ6A 4IVQA 1OPXA 1N5IA 3RDPA 1KOFA 5LBIA 2GK7A 4IDNA 1GNPA 2V6IA 2DY1A 3GLFA 2BKUA 1NIPA 2FWRA 3FB4A 4OHYA 2CL7X 1UADA 3EG5A 2YWFA 1EESA 2CHGA 3K9NA 1UDXA 5DO9A 5F98A 1KAGA 5HZHA 3AUYA 2KWIA 1XMJA 2W6ID 5AR1A 5GJWC 4JL5A 4KYIB 3QSYA 1XXHA 4JT2A 4Q1BA 1I4TD 1A2BA 1P2SA 2ZRLA 4Z54A 1ZM4A 1VG8A 3U7FB 3AP3A 4OHXA 1FMLA 2NO1A 2ZS9A 3T35A 1DE0A 4LHWA 4ON9A 4D4LA 1QHYA 2B21A 1WBBA 1G3MA 2ZE7A 3GLGA 4NYJR 3GLFB 1YQTA 1KO7A 5C4MA 1Y3AA 3RRNA 1UAAA 1GVNB 4TLAA 4DLVA 2ZSAA 1KJZA 4URVR 3IILA 4R2HA 3QE0A 2NG1A 3CRVA 3BB4A 4YDHB 5KHOC 3RWOA 1SXJD 3AM1A 5LD2B 5CDFE 3E1SA 3AGPA 5IT5A 1ZMXA 3IQXA 2JLXA 1XXHB 3PXGA 1CKEA 4KODA 1W4AA 4HEJA 3K0AA 1G19A 3GQBA 4OI2A 4YXWA 2IK8A 2Q9CA 1FUUA 4KYUA 2C77A 2X8AA 3CWQA 2H17A 3VQTA 4TMVA 4DSOA 2FDCA 2ZRMA 4RJLA 3EAQA 1KI3A 2YOGA 4TYQA 2WWGA 1GWNA 1NVXQ 2WVJA 3GLGB 5DIFA 2GXUA 2WAYA 1II0A 4Q7JB 1IY0A 1SKYB 2AXNA 1KI2A 2XZLA 2VPPA 1R0YA 5HKKA 1KJWA 4X8HA 5SZKB 3BH0A 4UNRA 1OE0A 1BYIA 1JJVA 1Q44A 3MJHA 2IA5A 2CCJA 4M9SA 4GT1A 2JLUA 4I1OA 2OLJA 3KQUA 3KB2A 2W2XA 2ZANA 3LD9A 4EFLA 2NZJA 3LBNA 1IJEA 1BIFA 1TMKA 1PLLA 3K0AB 5AJWA 4TT3D 3HU2A 3HWSA 3TMKA 1XCPA 4II7A 4PTLA 3TUJC 1OIWA 4EQ6A 2XOKA 3SFZA 1T3LA 5LDDC 3VU9B 4TLDA 5BYKA 1K8RA 2IEZA 4TMXA 2FOLA 1OW3B 5EP1A 3T34A 5HTKA 4IHQA 3I72A 2D2EA 4EFNA 2WWYA 3BIFA 3VKHA 2KBFA 4HLUA 5AJYA 3K0SA 2ZYTX 3P4XA 4C0BA 5M04A 5JSZA 2WWWA 3KJIA 4Q1EA 4NU0A 5BW8A 4GMXA 3KFXA 5IK2D 2QGZA 2IBMA 1W0KA 1CS4C 3AF2A 4BLOA 2GJ8A 4NE2A 3ZS8A 1WP9A 1KI8A 2F9MA 5CB6A 1XU4A 4RFVA 3RVBA 2DFKB 4YC7A 1ZVQA 5TVKA 4KFTA 2W0MA 2ZYUX 3HR8A 3LDAA 4A2PA 5TARA 1Z83A 4WXPA 1U2RA 5FUYA 1CU1A 3SS8A 4FWTA 4LY6A 3GD7A 4ZI3A 1XMIA 1U8YA 4IDOA 3ECCA 3GEHA 2VSXA 4GZMA 5JSZB 3S1AA 2XSZA 1NLFA 2O8DA 4LV8B 2CL0X 4Q4LA 4Z8XA 1BH2A 4A2QA 1HQCA 1SXJA 2HXSA 5FTNA 3IO3A 1KGDA 4DZZA 4LSGA 1E3MA 2QROA 1MABB 4FWIB 4EJSA 5J4YA 3W8NA 2QT0A 1X8JA 2CJWA 5K8LA 1CRPA 3BFVA 1XEXB 5E7MA 4ZDJA 4ARZA 1E2KA 1FQJA 2ONKA 2UKDA 2F3TA 3X1WA 1G5TA 4B3FX 1E69A 5JCZA 3Q9LA 4NTZA 5K8TA 1AKEA 5J4HA 2JASA 1JEDA 3KXIA 2P0EA 3W6OA 1KAOA 4KHZA 1LFDB 4B43A 2N42A 4TL8A 3GLIB 3SJBA 1GITA 4YQFA 3LW8A 4QOSA 3S1AB 1YU9A 2O8DB 5FR1A 3KKMA 3CBQA 1L4YA 1C1YA 1SXJB 1WDTA 3KB1A 2CE2X 1TU3A 1G16A 1N6NA 2B7CA 3CF2A 3K0CA 3VR2A 3AVTA 5TV2A 4WBSA 4LC1A 3E2IA 4PPNA 5EZ5A 1D2EA 1XTSA 3AP1A 4H1VA 4IVRA 4F91B 2VL7A 5LB4A 4TT3A 4EJSB 1E32A 1TQ6A 1GG2A 2ZRIA 4TLCA 1IM2A 3GFOA 1EXMA 2QMUA 5AWFC 4U02A 4DKXA 1KIMA 2QM8A 4JIMA 1U99A 2EYUA 3ZJYA 4D81A 2BOVA 1TUEA 2DB3A 4KJZA 2OBLA 2X2FA 3SBDA 2BMFA 2P3SA 1CR4A 1ZINA 2IYWA 5CDFA 4LBWA 4TYNA 5KSYA 4GL2A 3BAFA 1IN6A 1N3BA 2JEOA 4M0LA 1TQ4A 2Q9BA 3W34A 1XD9A 5JWHA 1QDEA 3IDQA 5IK2A 1DG3A 1L4UA 2DBYA 3GJXC 2G6BA 1O87A 1S2MA 2IYRA 1OT3A 2R62A 3GEIA 5FPTA 3F0TA 3EC2A 2IWHA 2A9KA 4IKEA 1G64A 1LNZA 2ZRDA 2OT3B 3TIFA 2IYUA 1W7AA 5EP2A 3V9PA 2ZEJA 3VMFA 5DSZA 3OESA 1LS6A 1O3YA 1P7CA 5DHAA 2PLRA 1IQPA 1KI6A 3L2OB 1NBME 1Z29A 3B85A 2F6RA 4JSYA 4URZR 1YZGA 1HA3A 3JVUA 3RC3A 4K46A 1M7BA 2BDTA 2WJHA 3QVUA 3DHWC 5KSPA 1EFUA 3LQRA 2AWOA 3B6EA 3QPVA 4MITA 2ZM5A 4OHWA 2GF9A 2QL6A 4ACAA 5EUQB 3VKWA 2N1BA 4XVRA 2G88A 5DGXA 4TLEA 3Q5DA 1IXSB 2H16A 2XJ4A 2C2HA 3NC1C 2CL6X 2CE7A 2VRWA 3PENA 5CIWA 2ZRJA 5A5GA 1KI6B 4FD2A 1SZPA 4BFUA 2EYQA 4AKEA 4MH0R 4JL6A 1ZU4A 4LZZA 2VHQA 1D9ZA 1ZC3A 1CJTC 2JLYA 2H18A 1S9DA 1Y63A 2FMXA 1GOTA 1K5DA 2CCGA 2VSOA 4JBWA 3ZQJA 3BOSA 3MWLA 2WMNB 2N46A 5KO2A 4FI3C 1RRGA 2K5UA 1R8QA 4JLNA 2QP3A 1GL9B 2V4ZA 4OYHA 3EWAA 3PIRA 4NYIR 4QJ3A 1CULC 1DVRA 1X8LA 4ZDIA 4LBVA 2RGNC 1XWIA 1W36D 1G6HA 2XJ9A 1DO0A 4ZI2A 2ZSDA 4A0GA 2ERYA 2HT6A 2QEQA 3FKSD 4UNPA 3ZVMA 3DPUA 1N5KA 4BPBA 2ZUDA 1HURA 4NPHA 3MGCA 2HF9A 3CRQA 4MGKR 4HB3A 1Z63A 1OKKD 2ZE8A 2WHXA 3O8RA 4DSNA 1N5JA 1HE8B 4UJ3A 5CJ2A 1YZKA 3PEYA 2W0SA 2XZOA 2P6RA 2D74A 1Z0IA 2BHRA 3D6TB 2GESA 4PPQA 3G82C 4LYAA 1CP2A 2XB4A 1IONA 4JYBA 3CW2A 3U2QA 2PCJA 5FBRB 2HCBA 4B3GA 4AI6A 2C95A 521PA 2GXSA 2BM1A 5BN5A 1N6IA 4M21A 1OV4A 421PA 4IOMA 1E0AA 1IN7A 4IDQA 4YDSA 1S8FA 1VDZA 4BEBA 4EPRA 2D62A 2WWFA 1G5PA 3AF0A 1N6RA 1PV4A 3WMFA 1T4GA 2J5XA 3AB3A 3QENA 2F1RA 2C8VA 3ZVNA 1MV5A 3NVAA 3H0KA 1A82A 2QY9A 1E9AA 4Q9HA 2WKQA 3H84A 2E1RA 4KVGA 3BE4A 3AVQA 1SGWA 3A4NA 1KZGB 5UKDA 2RAPA 3NBYC 2CBZA 4JT4A 1E2EA 1VG1A 3Q8XB 3QBTA 4Q19A 4U7DA 1IN5A 2J9RA 1OXVA 2Q21A 2FSIA 4DBLC 5JI3E 3DM9B 3FHTA 1E1QA 4URWR 4PC2A 3HYRA 4DIEA 2IUTA 5FFMA 4XD7A 2RGXA 4FCWA 3UIEA 1JXOA 3FDIA 3CR8A 4K81B 2J7PA 2ZRNA 3C15C 4A0HA 2QBYA 5L3RA 3V4RA 3K09A 2OCBA 1WRBA 3NKVA 2FGKA 4Y0AA 1NIJA 1ZUHA 1F6BA 4DLRA 4UQOA 3ZVRA 5KOYA 2HV8A 3LO5A 1P9WA 2AWNA 2VP4A 3BS4A 2ATXA 1JNYA 1AZSC 3ASYA 1XTRA 2ZJ8A 4PC6A 4PC1A 3EZFA 4QJ5A 4CEHB 4B74A 1OYWA 4AYXA 3LVQE 2XX3A 2QP4A 4LK2A 3ADKA 2WICA 3WHLA 1JECA 2BCJQ 1NBMA 1T6NA 2VTKA 5HPYB 2NMVA 1CIPA 2R9VA 2J46A 3ZLJA 3CX6A 5EP3A 3KQLA 4D0GA 2ZU0C 2CK3D 3FKSA 2V9PA 2QBYB 3N70A 1SVSA 1Z3IX 1Z0JA 3A37A 3AKDA 4JLMA 3MRSA 4PZYA 1OKKA 4XWAA 4BECA 4XIGS 3EX7C 2OCAA 1DAFA 1NN0A 2J3EA 4GOXA 3IPXA 4I1VA 4RFSA 1KK1A 2XTMA 1QVRA 3IO5A 4EPVA 5C2JB 3SR0A 2VP5A 1OF1A 1US8A 3WRYC 1PVOA 4OI1A 2VA8A 1W5TA 4AYTA 1NVVQ 3TGPA 2NZ8A 2R6DA 3C14C 4UNNA 5K8IA 1FMJA 2RHMA 4PHTA 3IIKA 3PV0A 1E9RA 4V0KA 3QG1A 4LPSA 5FTKA 1R10A 3SE0A 1W48A 3B5JA 1G6OA 1VMAA 3K9HA 1W44A 4DB2A 5A0FA 1OSNA 4WA7A 2IUUA 5D3QA 5FOSA 5P21A 1OH7A 1AN0A 3CRW1 4N0DA 3U61B 5KSZA 4WZ6A 1RVDA 5FTLA 1US8B 4RCZA 1E1RA 1N6PA 4MA4A 1CJMA 1II9A 2ZREA 1KI1A 2IS2A 4MKHA 2WJGA 1Q1EA 3LXXA 4B76A 5DE3A 5FTMA 3HDTA 1YR9A 1ZCBA 3EC1A 3BRWD 1QHXA 1D2NA 3AEZA 3AKEA 3GJ5A 4LX0A 1QG2A 3THYA 1ZU5A 5F9FA 1FZQA 3A1WA 1E9DA 3IHWA 4PC3A 1RW4A 4HB2A 3HPRA 1CR0A 3OHMA 1IXZA 1PLKA 1T9HA 1OJLA 2O8EA 1H8ED 1G4UR 3BJIC 3GP8A 1Z0KA 2QAGC 4KVAA 4RY2A 3OFND 4JLAA 2J41A 3KQNA 1OXTA 1UKEA 1FP6A 3SYKA 5EUMA 2FPLA 2EWVA 3QKSA 4AK9A 4QNRA 4X8OA 4B34A 1GAJA 4NYMQ 3WYFA 3BFXA 4AKIA 4D6PA 4HZIA 1E9BA 2MMGA 4BUJA 4YMUA 3THYB 3EA0A 3CIOA 2VP2A 3FMFA 1E4VA 1ESMA 5EE0A 4R7ZA 4US2R 1TU4A 1GNRA 2OFOA 2HJVA 4B3DA 4Q4JA 5FL7D 2ZYWX 3ZYCA 3D31A 4AKHA 4Q9KA 2PBRA 1DAEA 2O8EB 3AF4A 4MYUA 2YVUA 3QBVA 1KO1A 2LKCA 1EX6A 4FCTA 4P4SB 5J5CA 1Q20A 4YONB 1W4RA 4V02A 3B82A 3VX3A 4TSFA 3CLVA 2ODNA 3FYHA 1UEJA 3OIWA 1E9CA 2MMCA 2O0JA 1MO3A 1NF3A 4LJ9A 1WMSA 4PANA 4Q18A 4JZKA 5DLQC 2YJTD 4EIWA 3W5JA 1E4YA 2PH1A 1KK0A 1AJEA 4NBSA 2UZ3A 3TR5A 2IW3A 3F3YA 1P62B 3U7EB 3PJRA 2ZUBA 2W2TA 3K70B 2C9YA 4TL9A 1VTKA 2ZAOA 1U81A 1LVGA 4Q4JB 1M8PA 3OF5A 1P75A 3L82B 1GSIA 4HLQB 3SQWA 4OK3A 1D5CA 3RAPR 4PR0A 3CUEF 1JBKA 4Q7KA 4DB4A 1WBDA 2DFLA 1J70A 4R2IA 2ZYVX 2AFHE 1IN4A 2ZJOA 1NLZA 4LHYA 1AZTA 2HF8A 3W6PA 2QPOA 1Q12A 1MR3F 4QM6A 3P32A 5EXSA 2ZRBA 3ZGXA 2IC5A 4BRWA 1XMVA 4TL7A 1N5LA 2DHRA 4CEJA 4GP6A 1KZ7B 3ONWA 3CWZA 3K0FA 4KI0A 3VHXA 2YOFA 1UKVY 1HT2E 2KBEA 4E09A 2P5TB 1EFHA 4B73A 2QUZA 1F2TB 3TW4A 1KY3A 2FEMA 3CPEA 1ZNZA 3DZDA 2W58A 2E9SA 5CM8B 4OJKA 2FSFA 3WXMA 4MDEA 4LI0A 1H8EA 3GFTA 1VG9B 1KMQA 4F92B 2RMKA 4DRZA 1J99A 3IIJA 3OFNA 1S96A 3U44B 3PUWA 1I2DA 3ADBA 4DDTA 1XB2A 1EK0A 1G8PA 1TUIA 5SZJA 4QBGB 2OFXA 2WJYA 4DLSA 4EPWA 2ZRHA 4B71A 2GDJA 4E5UA 5CM9C 1WQ1R 3CB4A 1UBCA 1X3SA 3K0FB 3X2SA 2WZQA 3DO6A 4HLCA 3SBEA 2ZETA 3CRMA 1T3HA 2PZEA 5LD2C 2CHVA 1OXXK 4BWYA 2ZI9A 2QAJA 5FL7A 3QG5A 5FR2A 2YOHA 4URXR 3SU8A 2OHFA 4RD0A 4ZO4A 1N6KA 3BH6A 3FE2A 1TEXA 5FH9A 1E2DA 1P4SA 2NQ2C 1GP2A 1XCGB 4X8MA 2WWHA 5JEDA 3IHLA 3OEED 3QEJA 4EFMA 1J8YF 4LRWA 5KNDA 2RB4A 5SZIA 2DYKA 5G3ZA 1R7RA 3OIYA 2BMJA 2PT5A 2QQ0A 3CZQA 1KDPA 1R2QA 5B64A 2OFWA 2AN9A 1P72A 4P31A 4Q4AA 4G5SA 4MRSA 4Q4HA 2V1UA 3KQKA 1GFIA 2JLRA 3RS7A 1UFQA 1KI7A 4JBXA 4R9UC 3UATA 3ZQ6A 4QGFA 1DOAA 1U98A 1YHNA 1EFRD 2D2FA 3B2EA 3EPKA 1LF5A 3QY0A 4ZCLA 4DC9A 2ZJ2A 1XBTA 1AK2A 3RRZA 2XNDD 4LJ4A 2ZJYA 1TPZA 2GJ9A 4M4SA 5HR5A 1H8HD 2VF7A 4QFMA 5FBQB 2WJJA 1OH5A 4H9GA 4M9ZA 1XRJA 2GEVA 3U7GA 4Q4AB 4Q4HB 1N0VC 1T5LA 1G8FA 2YC2C 4PPGA 1Z0DA 1NLYA 2L0XA 4NZYA 3H4MA 4ZDKA 1JQLB 2FV8A 1RKBA 2EQBA 1H65A 4GOJA 2PZFA 4FMDF 1R6BX 1XTKA 2FX3A 4B48A 3AVXA 3I5YA 3I73A 1J90A 3TK1A 3PEWA 1AS2A 2KI5A 3C16C 3BORA 2CDNA 2CXXA 5BXQC 1M2OB 3IQWA 4C0SA 2F9LA 2DWOA 2QMEA 2QI9C 2A30A 1GL7A 3Q85A 3PG5A 2ODEA 3KUDA 2O5VA 5CK4A 1AIPA 1OIVA 1ZIPA 2BIFA 2ZAMA 1SVMA 1M34E 3QXJA 4JLKA 2AX4A 2ZR7A 4HDOB 4PSVA 4G5RA 4DT1A 4G5OA 4LV6A 5DN6A 2F3RA 4XTRA 1G8YA 4BFWA 1IXRC 1GL6A 4Z51A 2W2VA 4F4CA 3KKNA 2JJ2D 1CBUA 1E9FA 4CZ2A 1XEWY 2GBLA 2QTFA 3RABA 3LBIA 5DYIA 4JJKA 2JGNA 2ZVQX 2J0VA 4LJYA 3Q7PA 4BLSA 4C0JA 3WMGA 4F7WA 3AF3A 4FMCB 3B78A 3AVYA 3PUYA 1KDOA 1P5ZB 3I5XA 4NCKA 2HCJB 4A8JA 3G0HA 3PEVA 3WY9A 4DSUA 3CX7A 3B1XA 3U3OA 3FGNA 2CVHA 4DT1B 2W6IA 4LBZA 2G83A 1E9EA 4M2LA 5JJIA 3DMDA 2PJZA 2QSYA 5H1YA 1N6OA 2FFQA 3BC1A 1IHUA 4EQ6B 3NBFA 2F1JA 3Q5EA 3QPWA 3MSXA 2IYQA 3R9IA 3U7HB 2CLDX 1X8KA 2XNDA 3E5HA 4XWKA 2SHKA 3AVVA 4Q47A 5GJCA 3X1ZA 2P67A 3VR1A 3O8BA 5DHFA 4A8JB 5BN3A 1GRNA 2X77A 1Z0FA 2O8FA 4JLVA 1H8HA 4QC2A 2GA8A 3QOFA 4YMTA 3BGWA 1J2JA 1YR7A 1HUQA 1YZUA 2VHJA 2Y8EA 2R6CA 2AK3A 1G7RA 1Q22A 2HEIA 2YWHA 4Q02A 3LV8A 2A5DA 3GJ3A 2R6AA 4ACBA 4POAA 2X1VA 2XTZA 4V0NA 2IS1A 1MH1A 2BVNA 5AJXA 1TX4B 3FMPB 2IWRA 1ZBDA 3AGQA 3T15A 3L0SA 5KPJA 3ADCA 4TL6A 1G7TA 4HB0A 2AL7A 4ZCIA 3SNHA 1UM8A 1TAGA 2B6HA 3M4YA 1AS3A 4C0HA 4OJQA 3IEUA 5KU1A 3P4YA 2ZUCA 4XTCS 4BFTA 1XD8A 3CRRA 4I4LA 2HYIC 2KE5A 2ASEA 2ORVA 1G17A 2QE7D 1U9IC 1A4RA 5FPKA 3SYNA 2IYXA 4WVFA 3Q72A 3RYTC 3I92A 1YJ5A 2FPKA 4S2EA 4A0RA 1GKYA 4NONA 3DL0A 3J81k 3FWYA 4Q21A 4FMBB 2WWIA 1V5WA 2C99A 2IHBA 3F8TA 3MAAC 3WP1B 3SEAA 3KJEA 3LRPA 4OI4A 2JATA 2CJWB 4I81A 1P9RA 4UNQA 1A7JA 5EE5B 2JJ2A 3FMOB 5EZ6B 3EA5A 2OLKA 4ARZB 1XJQA 2YHSA 4D82A 5JZVA 3UPUA 1S1MA 1NMXA 5C1BA 4AURA 3EASA 2G1JA 2VH5R 3KKQA 3BB1A 4Q5IA 3NC0C 1GIAA 1OLOA 1VPLA 2NO6A 2A5GA 5IHPA 1EGAA 3SI7A 3QKUA 2XGJA 5G53C 1KY2A 4QL3A 4DCNA 1SULA 1ZM3A 2ZRKA 1TNDA 1NRJB 2PCLA 4YMWA 2NPFA 3AVOA 1D6JA 4JKIA 3W3AA 1CEEA 1DEKA 1FNMA 1RC8A 2ZRCA 3H86A 1DBSA 5AJVB 4UJ5A 5FPHA 2QSZA 1NG1A 4BZXA 1HV8A 1XTIA 4QBIA 2RGBA 3E70C 4M8NE 1TEVA 3DVLA 1Z22A 2V1XA 4G0NA 4LOAA 3KFVA 5B2ZA 4PSAA 1AM4D 2ZRAA 4V0LA 4BASA 4HAUA 5AJZA 3HPQA 1IY2A 3CF0A 4LCBA 3CM0A 1PLJA 3KJHA 1UPTA 4Q9LA 2J0QA 1YZNA 3BD9A 2ATVA 3CONA 3Q7QA 4HSEA 3UG6A 3B1VA 2P5SA 4HDQB 2HUPA 2GAOA 4QRHA 1N0WA 2ZI3A 2PLFA 4LPKA 1LB1B 3TKLA 4A6PA 4M9XA 5EE1A 4W9MC 1W1WA 4B2PA 4JS0A 4MKFA 2WAXA 2D7CA 4H1UA 3OE7D 2REXB 4FMDB 4OHZA 3SZRA 1YVDA 2GK6A 2VO1A 4L16A 3IPYA 2MSEB 1ZP6A 4D0NA 3CZPA 4J0QA 4PAMA 4BZQA 5JWRA 1FW6A 4OQNA 5EXXA 2J0UA 5B58C 1M1YE 4IEIA 1G7SA 4M53A 3KTAA 4W5WA 4XSGA 2G1KA 3OEHD 4G01B 1KDTA 1OB5A 4CYMA 2QG6A 4DDWA 1UF9A 3NH6A 4EPYA 4C2UA 1ZD9A 4O25A 4MQBA 4IOKA 4AIIA 1NN1A 3BWDD 1Z07A 4XOIA 2WBLC 4KU4A 4TYWA 1ZC4A 1D2MA 4HAZA 2I1VB 5DI3A 3SN6A 3WYGA 3BBPA 4V0ME 1QHIA 2CCKA 1KI4A 3KX2A 3KUCA 3TSOA 4F4JA 1PUJA 1XJ0A 4GI7A 1E0KA 3GPLA 1FOEB 2JCSA 4PZLA 4RZUA 5BN4A 5JECA 2J0UB 4N0EA 4B6FA 2WM9B 2IYYA 4DCUA 1ZM2A 4KXFB 3KTAB 2JLZA 4M1MA 4DIDA 1Z2CA 2A78A 3VNUA 2FE4A 2I1QA 4W5HA 2ZJ5A 3M1IA 3LBHA 2QPAA 1NNEA 5FBLB 3H2YA 4B75A 3UMFA 4BFSA 5KPDA 1HYQA 3REGA 2F55A 1Z47A 4DWJA 2VSFA 1CR1A 2BBWA 4PSKA 4ZV4A 4OK6A 4M1WA 5CYPA 5KNBA 2ZI4A 2FH5B 4O2RA 4C0KA 2BJWA 3B1ZA 4JL8A 4LUCA 4WW0A 5DI3B 3W9YA 2RCNA 3RNLA 1M74A 5FI1B 5AK0A 3KKPA 4NDZA 4QKQA 621PA 2A3RA 1ZIOA 4HAYA 4L4UA 3O8DA 2A5JA 2WSMA 3N2IA 4MGIR 3AVUA 4RKEA 4X8LA 4G5QA 3ZS9A 1YRAA 3IKJA 5A4JA 5JFGA 2VP6A 2X19A 4F4IA 1ZJ6A 2D4HA 2WPDD 4GZLA 3QF7A 1R0XA 1E79D 3K09C 2EFDB 3MCAA 3WYAA 1J7KA 2Q9AA 2Z83A 3VAAA 3TH5A 1SKQA 2O52A 4C9BA 2YKGA 2PZGA 1JPNA 1MO4A 5EE9A 4IJMA 2PJRA 2VHTA 4LYJA 2D06A 2MSCB 4B33A 1W46A 4I1SA 3DKPA 1TL7C 3IBGA 1QVAA 2JJ8A 4LDJA 4JLDA 4QM7A 4DUGD 3TAUA 1NN3A 3IIMA 2IYSA 2WMOB 2J7KA 2KJQA 4JJZA 5H70A 1NP6A 4V03A 3ZD7A 1TF7A 3KZ1E 1KNXA 2CEAA 1UKYA 3QXCA 2IYVA 2R6FA 4URUR 1COWD 1W0JD 3TLXA 2HLDD 4C3ZA 5JJKA 1VG0B 2OM2A 3NH9A 4I1UA
chains in the Genus database with same CATH superfamily
3L6CA 4CCWA 5EHQA 5JS8A 2VDRB 5KNCD 2YYSA 1AGRA 1O94A 4CVNA 2RCYA 4UHKA 2FKAA 2GXQA 4D9JA 4IZHA 3IUEA 3C4JA 1UBLS 3PXAA 5LMUB 3MJFA 3AYZB 3O47A 3WMEA 2HKIA 3WZLA 5IT9A 4CIDA 2VK1A 2ZS7A 4US1R 5LFAA 4GWGA 1QHSA 4JWKA 3L79A 4BFLA 3IQEA 4DDUA 3A7EA 3QTBA 4MYTA 4NL4H 5KDLA 3SKYA 3R3SA 3CFYA 2J9FA 3DE5X 1FDUA 1A5SB 1DG9A 4WNIA 4YRPA 5JZSA 1FIUA 3U7QB 2QKYA 2A1TS 1TYAE 2NTYC 1RRMA 1XTUA 3SKVA 2WSYB 1NMZA 2C5AA 2B7LA 4MQFB 5IJZA 3KU1A 3HHEA 4RAOA 1QE3A 4M1SA 3GPCA 1D7AA 1M6YA 4RVOA 3ROPA 4NDNE 1SHZA 4E0BA 5A5EA 1FEZA 1KO8A 3LPCA 4LS3A 5HDQA 1CF4A 3UMMA 2QLNA 1DC6A 2VHWA 4IPTA 2B0JA 5EIXA 1DAKA 1G1AA 2FZLA 4HNAA 4KRFA 2PUCA 2V4UA 4F38A 2IITA 4D4MA 4GPTA 4NESA 1T1SA 1HX7A 1C7RA 2NADA 2JHFA 2D1YA 5SYNA 1UINA 3O8OB 2H63A 2PGLA 3ZJVA 2FWNA 1G8GA 2AOUA 3JAWB 4CU5A 3AEXA 5I8WA 1PYGA 3DVAA 1X7WA 3CUKA 3HUEA 1YR8A 3TXAA 1SHUX 5HBGA 4JI8B 1ZSVA 2DWCA 1VHTA 1MKYA 3E6AA 4RFSB 1H0KA 5G2OA 2VAWA 2WPDA 3CO5A 3TI9A 4CKBB 3DH0A 1XQ6A 2REBA 4IYRA 4WERA 5DGTA 5DM4A 4YYEA 3N2GB 1XTQA 1RIFA 1SCQA 4BV2A 1V6AA 3FJOA 1VMKA 4G89A 3RWBA 4EQZA 5ITWA 1R0ZA 1U7XA 5CLLA 3GEBA 3FFXA 1X38A 1ZD1A 1X1AA 4UXIA 2LKDA 3IIEA 4EFKA 2HA5A 4NP6A 3KQOA 1P5JA 1F0YA 4H59A 4DUGA 1RWPA 4TRNA 3TZBA 3GGGA 5LBTA 2J45A 1M7HA 4AVYA 4J0HA 3VSEA 3EBOA 2OXEA 2OCDA 3PC2A 2D0DA 3DM5A 4H0FA 4FFNA 2FXIA 1WIWA 1Z4JA 1S0UA 3DQPA 2VH1A 5HCIA 2GXAA 1UPBA 2HF2A 2XE8A 3GJQA 2PSFA 1IUKA 2IYLD 2HXYA 4GLFA 3VR4D 2RHGB 1FFXB 2JANA 1BHO1 2HLDA 4M0FA 4TQUS 3KPUA 1UR5A 1EB9A 3VJLA 4UBIA 1YQUA 2VHVA 3FYSA 4L9RA 1YS2X 1G5IA 3ZUPA 3U4AA 5KNCA 3DWFA 1KGSA 5ITZB 2WV9A 5J4LA 1D03A 3WWYA 1OXSC 3C7CB 1O9BA 1KK2A 1TZMA 2J6CA 4IHJF 3DF7A 3PC8C 2XMZA 1KQPA 1RQGA 5I9BA 3TTVA 5JHHB 3FYCA 3B60A 1I8TA 1Z0SA 1L5VA 1T6BY 1VPVA 2NUPA 4L15A 4LWZA 3UB3A 3ZDQA 5DLPA 4Q00A 3DMYA 3B9PA 3K1TA 1UMCB 4M1ZA 4Z86A 1OBFO 5JS6A 4UBJA 5BOSB 2CK3A 2WU3A 4YCJA 1X9IA 2M2IA 3PITA 3NXSA 3H2GA 4W1SA 3HB9A 1LDNA 1OHHD 2AZDA 1LRLA 1KAQA 1KRHA 1FP1D 1LC3A 4RKQA 1M8FA 3E5RA 5J63A 2ZJ7A 1NMSA 1TVKB 4XJXA 1O0BA 4L5AA 2Q46A 4FYMA 2W2KA 4WFKA 1BDHA 1EXDA 1S2IA 1HDRA 4DPMA 3B7PA 1FNCA 1G2OA 3K2BA 2P9HA 1QGZA 2HMTA 3P45A 1T2DA 2ZI7A 3AKCA 4NC9A 1C0IA 2PSJA 4RPIA 2ZIUB 1QF6A 1IQ0A 2UZ1B 2XQGA 2Q99A 2Y66A 4YIKA 3AHEA 2VJNA 1V37A 2O2YA 2N9UA 2CKDA 3AIKA 2YYAA 2QRKA 3AX6A 1PL0A 1Y6JA 3BERA 3L7AA 1V1RB 2Q3EA 4HN2A 1DQNA 2P65A 4NU8X 3QKSB 4TKVA 1SKMA 3ZPXA 4XQ9A 2FSGA 4WNAA 4NFLA 5FL3A 2DPXA 3ZCVA 4EHIA 2ZDQA 3ZD9A 2V97A 4GSYA 5L3SB 1D2GA 1PDVA 1V11A 3KUXA 1WXQA 4DV7B 3U0BA 4GNKA 1QIJA 2PEYA 1R0SA 1O5IA 1F48A 3RRMA 5D01A 1AF7A 3EB9A 5ER6A 3AG6A 2X0NA 1QH9A 2QORA 3OTWA 3ES9A 3G17A 4UUNA 3N05A 3SBOA 4FJ0A 2IU3A 3GFPA 3TZEA 3R5SA 3VR5H 3K92A 4AB1A 3M82A 1ESEA 4B09A 1UBKS 4HUJA 2Y6VA 3EIUA 3C45A 4L5BA 4FZVA 5GADl 1WB9A 1W5AA 3PQEA 2P6NA 1RBYA 4D97A 2IP1A 2PH3A 5TX7A 4YCSA 5BNZA 3V2HA 4IOJA 4IW3B 4KYVA 4N54A 2XYVA 4FOLA 1Y1SA 3M6WA 3OU2A 4WX2B 4BBZA 4JKYA 4HFNA 4LY9A 2O5CA 1PHPA 3ANMA 1DUIA 4GLBA 5HCNA 3BRWA 3EPHA 3O83A 2ZJBA 2M6KA 2WT8A 1ULSA 1F06A 3EIFA 3NUQA 3DEYX 1WNFA 1K6IA 2N47A 2C4WA 2FUG6 3FOBA 4IXTA 3VR4A 4UUPA 4F9FA 2HDWA 1MU0A 3IUYA 4CIVA 3K5IA 4HHEA 4QPNA 5FIUA 3JQ7A 1KI9A 2HA3A 3MWKA 5D86A 1R4MB 1SN7A 1DHRA 2Z8XA 3F4LA 3H19A 4GEKA 2UYQA 1XKQA 4HAXA 2J6HA 4O8CA 5F5XA 4F97A 1BDBA 2BH9A 1NR5A 3EZ7A 1F1JA 1KS2A 4Q3NA 4EG8A 5EJGA 1EYZA 1JVNA 1FB5A 4GI2A 4INOA 1GXSA 4FGZA 4PYJA 5CDYA 3AWIA 4QEZA 2WFLB 2YW9A 1F2UB 1G60A 2IHYA 1JKMA 1XVTA 4WL0A 1ZJYA 4UM7A 3OURA 4FGLA 4YXWD 1E4EB 1GPKA 5KS2A 1LXCA 1A7AA 2NO4A 3G59A 1QV7A 3CEJA 1XYGA 4IJQA 4A2CA 3IP9A 4ZZ1A 1CQJA 1EAYA 4I6GA 1OHHA 4DXAA 3CRZA 3NOOA 1DQYA 1NY6A 1S3GA 5DWDA 2XE4A 3TE7A 3NEPX 3RUEA 3NT2A 4BX9A 3UBTA 5D5QA 1KPIA 3RRBA 2V7VA 4N6NA 1L7QA 4LW8A 4BEVA 2IBSA 4MUBA 3PVSA 3K8OE 4GZ3A 2GEBA 4L72A 2EFEB 4BNHA 4QO7A 1QAQA 4OB6A 4EHNA 3H1GA 1O95D 1J00A 1K92A 4CTMA 5BUZA 4N1AA 4BDTA 3DL7A 1QKIA 3I2GA 1FDIA 3KEGA 2L42A 4ZAZA 2E5LB 4K3UA 2BBSA 2DH5A 4DVGA 1HRKA 2JJ1D 3BF7A 1D2AA 3OJOA 3NP7A 3WKBA 1SHTX 1Z7BA 2Q1XA 3X1XA 4L4XA 4FYXA 1AB6A 1TM3E 4DYHA 1MX5A 2Z6UA 4P1ZA 2I4IA 4YJGB 2H4JA 3M1LA 3IUSA 3DTNA 2X8BA 2FFHA 1T8UA 3EE6A 1HZZA 4I4IA 1N2SA 5JJLA 3VR6A 3GRZA 3L8YA 4MRVA 5FI5A 1I14A 1RMTA 4GGMX 1WJGA 4AWXA 1M6WA 4ZKDA 1E5QA 2NU9A 3HVHA 4IGAA 4O1MA 2I6UA 3CVUA 3EIHA 4QUHA 4D4KA 3TIXB 4X00A 4PRKA 4WKOA 1AMOA 1F51E 3NFYA 5CFLA 2PDAA 5DTQA 2WUGA 2FK7A 1LRJA 3M4ZA 5LZ5A 4GGPA 1ES9A 3WGTA 1AVTA 3UHAA 1CV2A 3PBKA 3EVEA 4GD3Q 4CBVA 3QX7A 1DDGA 1AHHA 1KBQA 2DCUA 3DKVA 3M1YA 4GPZA 5E38A 1OC2A 4AG3A 5JXIA 3U13A 1ZPDA 2DWPA 4ZYTA 1AKMA 2EFCB 3E22A 5JJ5A 1MOQA 1X1BA 2XHZA 4DR1B 5DH9A 2VWQA 5DOVA 5BQ5A 3HXMA 3IELA 1B15A 1BE6A 4YRBA 2O9JA 2ZIFA 4RHTA 5KVQA 4OP1A 4YRSA 2DP4E 4A73A 3WBBA 2BFMA 1VYTA 3L92A 4U63A 4CLOB 4L57A 3WA6A 4BNJA 4D5GA 2BM0A 5FYQA 1FQOA 4ZU1X 3QE2A 3GRAA 3M2PA 3H0CA 4K87A 1HK7A 2ZSFA 1Z2NX 4O1HA 2J3MA 3ZY6A 3RS0A 5BMVA 2O8CA 5U1PA 4I4TB 2GBLC 4M36A 1S2NA 1AGNA 5IZCA 2XCUA 3AIIA 2FKNA 3FVQA 3GN1A 1YMQA 3JVIA 2B8TA 4B35A 4AJ1A 4TTQA 3V1KA 2VG8A 2PS0A 4HD8A 3E4CA 4X1YA 2PKCA 3JS5A 4M7RA 3S40A 4JFRA 3WC4A 1VP9A 1LU9A 3VR5D 1N8SA 1X2BA 1UDBA 2OWEA 3PPVA 5FOTA 2O0MA 2WTEA 2GN0A 4F7DA 3PHLA 3UWSA 3P1JA 1R00A 2P4QA 1NBWB 2H4ZA 5CIYA 5IYZA 4B2LA 2XOXA 3TKAA 2RC5A 1F3OA 3DD1A 1JZSA 1RJ9B 3PC6A 2REQA 1XHLA 5G1NA 1Z56C 2PO5A 4MVYA 1UPCA 4G0QA 3MTJA 3KQVA 3OI7A 3LUAA 1Z06A 4E33A 4UTZA 8ABPA 3VZBA 4RTRA 3H5TA 4NBWA 3MTIA 3NIGB 3AJRA 4XB6B 4F0JA 3X1JA 1RLIA 4I55B 4PCUA 2ILTA 1EUCA 2JJ1A 3LXMA 1B8VA 5SY6A 4C0XA 2GM5A 2Y1XA 5KYKA 3E7DA 3JYLA 1RU3A 4TSKA 4TMWA 3HU3A 1X0VA 2CXHA 4FP9A 2W2MA 2GNPA 3D2CA 5E2AA 1ZI6A 3BXPA 3H5LA 4BFXA 4KR7A 2C3YA 3QELA 4G41A 2W4MA 5EHXA 3F9CA 2B5VA 4N0QA 4JX8A 2ZVPX 5C1PA 2AG6A 2WWVD 5IT4A 4ZMRA 4M8SA 5C8YF 1KP3A 2RGGA 3ND9A 4YRRA 1BXRA 1XU7A 1EFRA 3T61A 4JB8A 3Q8KA 1JSRA 2X42A 2JHCA 2O1SA 5TR9A 4OF4A 1IXKA 2AFHB 2JL1A 2XGOA 4FFMA 1QYVA 2WHEA 2FN3A 1X13A 4IICA 1RE0A 2OEPA 1PQWA 1U9JA 2PIDA 2XKKA 1P1KA 1S5PA 2CMGA 3WK9A 3E9NA 4HGZA 4D6YA 4ERXA 4CKZA 4P0QB 4BIIA 3DL2A 2EG5A 1X1TA 5HS4A 4YAOA 1YQQA 2HJGA 5AUNB 3FUCA 1MABA 1R1DA 1RTTA 5DTMA 5L3QB 3S1LA 5I7SA 2C4MA 2X3UA 5D3MA 1DWPA 4NZ9A 1AK9A 2WLSA 3VZSA 3KQTA 3EA4A 5BR8B 3DOFA 4FCVA 2ZITA 4I5EA 5HFAA 2CF5A 5M7EA 1NNSA 2PYIA 4R8LA 1PBNA 1RT9A 4G8BA 2GHQA 4BGDA 4JELA 4M0EA 2CUNA 2FYTA 2VYFA 4YJ3F 4Z4IA 4G1BA 1I7SB 1XAGA 4UUOA 3ESBA 4BQSA 4ZO9A 2WG2A 1ABBA 4Q6BA 2IIVA 3TNJA 1SOMA 2Q2VA 2V7BA 4HXGA 1O89A 1L7OA 2H11A 3GLIA 3C3WA 3EPLA 1NG9A 2F00A 2LR0A 1XUOA 4TTPA 2JAQA 1EK2A 3BK7A 4TQAA 1F38A 1M72A 3N2ZB 4QGHA 1PYDA 4XX0B 4NCJA 3BMNA 3K4QA 1RACA 1T1IA 2F90A 3FW1A 1CFJA 2EKZA 2ZROA 2Z04A 3JQ8A 1XK6A 3EIWA 2BFDB 4QNMA 5JZOA 3VR5A 5HUHA 4PV7A 3UFBA 5JBNA 2AW5A 3BGDA 2Z4TA 2Z98A 3DZ8A 3PJFA 1GYRA 2C5SA 5TY0A 4P38A 1E0JA 1PNQA 4JN6B 2BGLA 1WW2A 1QXSA 5JHGB 1G4AE 1TA4A 4UXHA 4WASA 1W581 3TDMA 3A28A 3TQFA 4O2AF 1XD2B 1MRNA 2I22A 5EJMA 5A6VA 3ELBA 3FPLA 3D7KA 2IHKA 4M9QA 3PXXA 5E8RA 4R0MA 4AY5A 3QF4A 2IYAA 3ZD8A 4ZHQF 4C06A 2BUBA 1GAWA 3D6HA 5ALZA 1YKGA 4GX1A 3WE7A 2XMGA 4ND5A 3RS4A 3T3PB 3ENKA 5IRCD 4S35A 2FJPA 4LV5B 2JHGA 1I80A 3RSZA 2QD4A 5AKZA 1P1CA 1QQ6A 4OOFA 4QG7A 1XEWX 5ES3A 2UUOA 3CH4B 3RIHA 1FW8A 1NJFA 5IF9A 1IZ8A 3PUKA 1L7MA 1KK3A 2EF0A 3MYRA 1UC8A 1OOEA 2AD5A 4RLQA 5FBHA 5CBPB 4TMTA 2CLSA 3PVCA 3ESXA 1TTHA 5E3JA 2OK7A 3DTVA 2Y1FA 3AR6A 1GPJA 3NH9A 3OE1A 2A9VA 1NVFA 3PC7A 4TYMA 1JS1X 1XYVA 2AI2A 2QRQA 2Y1CA 4GM1A 4PSUA 5AESA 2RGDA 5L9AA 3B36A 1C4XA 1C1XB 4DWOA 1C9MA 3RU2A 2QU8A 3EQ7A 1P45A 2MDTA 4ESVA 4X64B 3MWGA 4YAWA 5AUOB 4Z5XA 4LK3A 2NAFA 5EL0A 1MJNA 1PR3A 3Q3HA 4CXMA 4XFKA 2DFVA 2MTBA 3TIVA 4A2WA 4RJKA 4FNMA 4LJAA 1XN4A 4JP1A 1LNQA 3WGYA 2PV0A 3WS7A 1BRTA 1EZZA 4AZ0B 2IZ0A 4L75A 2QVGA 4FE4A 2BKEA 1ZM7A 3O2SB 1Z8FA 4G1UC 4JLBA 1BH6A 1MB3A 2XDQB 1N2CE 2OV6A 3CTMA 4UD2A 4YY3B 2VEOA 2DHCA 4HAIA 4MS1B 5BP7A 4QTYA 3CE9A 1PQPA 2QMHA 3N5CA 1P7YA 1SNYA 3P9CA 4NABA 1EWQA 4DABA 4RM3A 1Z6PA 1TC1A 1WA5A 3EZ9A 5KJCA 3M3DA 4K8OA 1U8ZA 3GCGA 4HQ6A 1GEEA 5CURA 1UXJA 1NYLA 3KRTA 2QM0A 5HW0A 1JA1A 1RCTE 3B13B 4YP9A 1DXOA 3WBKA 2N1MA 1OFHA 3PI6A 3W1WA 4F4UA 1JLKA 1BE0A 4JI7B 1VCIA 4HJXA 1L1QA 2ZYDA 4HNRA 4QXAA 3RU7A 1NXPA 3AP2A 3K6SA 4Y3UA 3F8WA 1C9NA 3CMCO 2ZXEA 1ZM9A 1VJDA 4I6JA 3AU8A 1E1QD 3D8RA 3C87A 4B3IA 1GPUA 1KC1A 1Z7GA 5CJPA 3FBWA 4MQUA 4L4ZA 4P33A 4YCBA 2ANBA 3T1QA 3VMMA 1F7UA 1PX2A 2BSXA 2J7PD 1C7IA 2IHTA 4MV4A 3ODPA 2P1RA 1QGDA 3QVOA 3BA6A 3GN2A 4P35A 4AWBA 5JQGF 4LF9B 1HE5A 3R9XA 5BPHA 4BZPA 2CBXA 3G2MA 3GX1A 4DMUB 1X7DA 2Q6TA 4EGAA 4B2IA 3CLTD 4JP3A 5H81A 4DREA 2ECKA 4QUEA 1ZZEA 1V43A 5IM4A 1E2IA 2XTNA 2Q8QA 5G40A 2AFIB 1OXUA 4G81A 4HTFA 2X5JO 4KWIA 2D3WA 5FD8A 3NHBA 4H0NA 4HV4A 1QP7A 1K86A 3JZAA 3L4EA 4ZVVA 5A4IS 3EW9A 1L9XA 3V33A 2POCA 3EYWA 3IQZA 4Y7DA 4LF7B 3KXPA 2B6NA 3OJLA 4P0TA 4UMVA 5CJJA 1UMBA 3R5JA 5D85A 1NBMD 4LYFA 1PGJA 2ONJA 3EZNA 1A1SA 2P35A 2TRSB 3FNQA 1JYSA 2GEUA 2HBRA 5AI6A 2YRWA 3IQFA 4KE7A 2DMRA 2TMGA 4AQ7A 1E7WA 5FUXA 2BDEA 2C2KA 5IXJA 821PA 3WK5A 4YCDA 5K3EA 5JH7A 1JHRA 3H17A 5LQCA 3T4EA 3W1VA 3LPDA 4KK4A 5JISA 5LQMA 4C3UA 2W2LD 3QVJA 2QQGA 3TINA 1PTKA 1Y1PA 1Q2XA 2JJMA 3CG0A 4E1BA 2WKPA 2YHBA 1MXFA 3VX4A 3ASVA 1PV1A 2IOHA 4QE3A 1CQIB 1AXEA 2OZKA 1JEQA 4E5KA 2HGSA 5F76A 1SA0A 1SBCA 3ZDCA 2V55B 4U2DA 4DC1A 1XZBA 4K9MA 4F5YA 1UWCA 1E2HA 4DCGA 2Z57A 3KZNA 2VHCA 2ZUTA 5FDFA 5B7QA 5BURA 3EISA 1VYUA 4H15A 4HWKA 2XCOA 2X6RA 3NPAA 4QULA 3OX1A 5EWJB 3BKWA 3OE7A 3TDKA 1XZIA 1YZ3A 2YWEA 4J1TC 1H0RA 4QBHA 2ZTVA 3T5DA 5A9SA 1GV0A 1SFRA 2WSBA 2XB9A 3NHJA 5JMWA 3V2GA 1A7KA 2C78A 1E20A 3R1IA 4MI6A 5BWOA 1JR3D 4KO8A 3EN0A 1Y8AA 3UGQA 4BATA 3C7DB 1CK4A 3TRFA 2ZRGA 3BPSA 3FJ1A 5ALEA 1SQ5A 2XECA 5IJXA 3MWJA 3E3AA 1G8AA 4MK4A 4C4RA 4A4DA 2ZRPA 5C5EA 3QIAA 4KIFA 3DPIA 4GX2A 3LRTA 3ZWDA 1YS7A 2JGDB 2O14A 2YHIB 2UUBB 2IH4A 4DLZA 1XZJA 3JALA 4WTOA 4MQMA 5BNIA 1TTQB 2NTEA 1TYDE 1B4DA 4E5MA 2Q9UA 3LJKA 3RIEA 4MV5A 4BJ1A 5KDOA 3MSCA 4XJSA 3SC2B 3P19A 1ACMA 4N3GA 5C3UA 3UJHA 3F7MA 2EF1A 3I62A 1ZCJA 1YS4A 4IJWA 8ATCA 2NM0A 3MS2A 1M66A 4NK5A 2E4AA 2QL9A 1I7PA 1IMOA 1X3LA 1ZA2A 4ONEA 5AMXA 1NTOA 4LZPA 3MWDB 4XB2A 3V6LA 3WWZA 4NU5A 3MOIA 4XVUA 4BJ6A 3L7IA 2ZJ0A 2VBCA 3FNEA 4Q7MB 5FQNA 4A9AA 1Z5ZA 4GOKA 4NMLA 4XLLA 3RSLA 4BE7B 1VKRA 5JLJA 3BDAA 2IUYA 1PNOA 1CYDA 4MW0A 2QPTA 2VJPA 3LVRE 4MJ3A 4DAOA 5F7ZA 1PGOA 2BELA 3DTYA 4PLZA 3ZXUB 4F3KA 5FBWB 3EARA 3GW8A 3DLTA 4NCBA 4DA8A 1OY1A 3AZOA 3KU4A 3VAYA 4H4CA 3WYEA 1PSWA 5B1DA 2C84A 4MRRA 1XHEA 1B42A 3R0XA 3TJZA 2JFZA 2JARA 2XXJA 1PD0A 4GUAA 4NFHA 4UM5A 3LT2A 4K6GA 1EJ2A 1RM5A 1CERA 5AVJA 4DLYA 3QVTA 2IXGA 4D46A 5U4QA 3K70D 4I36A 2W2LA 1JPVA 3DZJA 3MQ2A 3L0YA 3MZ0A 4O4IA 5A5FA 1BA2A 3H18A 3JXEA 3T7CA 1X7ZB 2ACVA 3T5MA 4DLTA 4DIMA 1UOPA 3I9MA 3ENZA 2VNHA 4HUQB 1XN1A 2I03A 3VO1A 4GBMA 4OHCA 4YPVA 3FWHA 3WGGA 4J2HA 4OFBA 5B36A 3FLBA 3ZY4A 1CQPA 3A14A 1QGOA 1T35A 4HL6A 5CA1B 5JT1A 1T0HB 4PGMA 4RZXA 1O5TA 2WQ7A 1XRPA 2ONCA 1B23P 4GIBA 4RF4A 3QW4B 3W1EA 5AK3A 2W2NA 3T6KA 3FTCA 2WWRA 2GCOB 2IPNA 2OCYC 1T8WA 1QIGA 2C2YA 2VAVA 3F9RA 3Q88A 4H7EA 3WSVA 4EKNB 2A5FA 3FRIA 3H4TA 4AYWA 5AJHA 4MS3A 1T8TA 1L8XA 1ZK2A 1YVRA 2C2GA 2DFNA 2WIDA 3K4PA 1ZI9A 5AO9A 5JMOA 3M6AA 2QQEA 1WXFA 1JR3A 2IUEA 2VSYA 1FTNA 4E70A 3G2PA 1NVKA 4PZEA 1UBNA 5G41A 3UCFA 1LDYA 2WIFA 3E9ZA 3PHHA 1MIHA 2JLAA 2A6PA 5CLQA 2FUG1 5G4KB 2G80A 5HGJA 3BZWA 3TW8B 4UNSA 5DXJA 3R23A 4EUNA 3CLUC 1Z0AA 2BBOA 2D1QA 1SKBA 2XMBA 3L0CA 1XA3A 4N4AA 4R31A 4XJVA 2IS6A 4CLRA 1V8ZA 3UAZA 3NX4A 1FS4A 1K75A 4UASA 4ZCSA 2X41A 1Y7IA 2K7FA 2CMDA 3A1SA 3DMNA 3DC2A 1TKBA 3ZZNA 1L5MA 3L7YA 1E89A 2AVDA 3RCBA 2O2SA 4WPGA 3S3TA 2TMDA 2WVHA 3D43A 3WK7A 5EQTA 1IH8A 4LNHA 3NYQA 3RBAA 4PVDA 1W5FA 1V6CA 1T0JB 4FPXA 4IH9A 4QPPA 5ANRB 3A4LA 4AZ3B 1CUBA 1ZUNB 4IKPA 7YASA 1U0JA 3N76A 3L49A 4K6MA 4Y6SA 4OX9B 2ACKA 1NT2A 5D00A 4EJ0A 1GR1A 3EXEB 3D6AA 4E2XA 4Z4FA 2H3EA 2WKWA 2AFRA 1GILA 5HM8A 4ID9A 3PEUA 1GTJ1 4NJOA 2Q4TA 3KXDA 1E1CB 4JDPA 1YA8A 3H16A 3OP1A 4TM8A 3RS2A 4RA9B 1HFKA 3F6RA 1I4LD 2PKXA 4V38A 4D43A 1CQWA 1P3Y1 2HMSA 3PQ8A 3DP9A 4EHAA 1RZ3A 2ODBA 3LX8A 2BTOA 1SKYE 4PG5A 1ML4A 1A8HA 4B6EA 3U31A 2Q5CA 1RYBA 2FI1A 4ZT6A 4IFIA 3KBOA 1X86B 2D2VA 1P3DA 2MWMA 5L40A 1LBSA 2QRPA 3JWIA 3T1HB 1XHFA 2I7TA 4ZK6A 2NTJA 1C8LA 3ZKAA 3ZWBA 3F6CA 1IBKB 1TK3A 3FUXA 4LMPA 3GY0A 4LF8B 1Y8ZA 1TMGE 3LP6A 4HWPA 5B3JA 4Q1FA 4RPKA 1UBFA 2DFPA 2ON6A 2H07A 1GNQA 1PF7E 3DZGA 1CG6A 1F17A 1OFTA 4YASA 5JD4A 2ZQZA 3CX8A 4WUVA 3I05A 1GQQA 1F3LA 1W6RA 3DAFA 4RD1A 5EMNA 1I3OA 3GARA 3K8YA 3IPAA 4XRRA 4LXXA 4Q03A 2JH9A 2HSGA 5E1OA 5KYYA 1W5SA 2Y71A 1FJGB 4URYR 1T6ZA 5FAXA 1Z08A 3B9RA 4R1SA 1Y9AA 3Q5GA 4B40A 2NOAA 4P5DA 2SICE 5KPDA 1DAIA 4CI9A 2XWJI 1IWBB 1U1IA 4MAMA 2DT5A 1QDUA 4DC0A 5JEEA 2FPWA 3RVDA 2GZHA 2JFQA 1Y3FE 3A27A 3WGHA 3X1YA 1OV6A 5AVOA 4UREA 2CXRA 3DYVA 4HJRA 5COBA 3WL3A 2ZW9A 2QAGB 4HZGA 4NCHA 4XWOA 3BCUA 3MBIA 1WF6A 5EIHA 1TK2A 1HSZA 4JXJA 3G6WA 3WGJA 4E3ZA 3DGEC 2CNBA 5JYDA 4MUYA 3T4UA 2DC1A 2X40A 3GWZA 1ZNYA 2UVDA 4WAUA 4OXRA 5K0NA 3ZNNA 4B3BA 4OLFA 5T4HA 1LPAB 1I2AA 3AFHA 1H22A 2RGYA 3DE6X 3QEKA 4FFSA 4WZAB 2X6QA 4C2TA 2XIQA 1ESNA 3SHOA 2HNKA 4K6HA 1C9YA 3QZUA 1YDFA 1YUBA 2HGZA 4NKRA 1DBQA 1GKUB 4AX8A 2OHGA 1MOZA 4C30A 3FZQA 3SE7A 1SXPA 1OGJA 3KLBA 1Y1TA 2C0CA 4PX3A 3V1NA 1J2EA 2E37A 1DJLA 2I4MA 4ISBA 3R7AA 3TZQA 4HUTA 3ETLA 5LP1A 121PA 1ATIA 3QUQA 3RFXA 2PQMA 1ZRHA 3GXOA 1L6RA 3V4FA 4OIMA 1VJRA 4E11A 1VE9A 1JH9A 2Z4RA 1M9NA 2A9RA 2XTJA 5ALTA 721PA 2BH2A 1OWNA 3ZGOA 3C5EA 3W9UA 4D4IA 3TZ6A 3C3XA 1SZCA 4C78A 1EQUA 3BH7A 3IE2A 1PSDA 1GGVA 5BQPA 2ZTSA 2RHDA 3IALA 3U09A 2KSQA 2IHZA 4ZAGA 2DCMA 2YMQA 1ZN7A 3PQ5A 3NIWA 4QUKA 1T4MA 4IFEA 5AHOA 5J40A 5KJFA 1ESCA 4PBRA 5JCPA 1J56A 1Y82A 2OGTA 4IMPA 4BCDA 4FM9A 1UZLA 3RUIA 1JR4A 9GPBA 4G4JA 1WB5A 1XKLA 4KFSA 1V4VA 5EJEA 3WZMA 4BNXA 3Q8LA 2C5EA 1L6IA 3TE6A 2JZOA 5KI6A 3UM9A 1CZHA 1U2GA 1SVLA 5KOIA 1CR2A 1YL6A 4RPJA 3TAHA 3P97A 5CITA 4Q1VA 2OR3A 4HVCA 1F5NA 5E2IA 4CT0A 4TZ0A 3VFDA 1SXJE 1RC0A 1J2YA 2OZEA 3ED1A 5I5EA 2H2IA 2INGX 3PA8A 4HDCA 1PK9A 1SKAA 3UK6A 2IQIA 4DMLA 3WJ2A 4PGHA 2PA3A 1S9HA 1XFAA 2RBEA 5JFOA 2GO1A 3L84A 5EJ2A 1NXXA 4PGAA 1ZH6A 4N65A 1G0OA 3EGXB 4IDNA 1GNPA 1PTJC 3Q98A 5IBQA 4BNNA 2E4VA 3BQMB 2Y1OA 3GWGA 3B38A 1UADA 3PGKA 2X4DA 3CT4A 3K9NA 5IJ0A 1UDXA 2Z8YA 4QRIA 1T29A 1J9GA 1KA9H 4YMIA 2VPZA 2ZYGA 3T7JA 4YV1A 1XMJA 2YWRA 5LZ4A 5AR1A 5JTUA 1RI3A 2PKQO 2XD9A 5EVCA 4JT2A 4CNQA 4H16A 4PN3A 2YBEA 2VLBA 3T3OA 3IE1A 3IUQA 2VTBB 3UMJA 3CX3A 3NYRA 2V45A 3NCTA 3RV3A 1LVHA 4CL0A 1J0BA 4EB6B 4Z54A 1ZM4A 1VG8A 3R5XA 3E3NA 2HNAA 2YNMC 3L0ZA 4TUYB 1U3CA 3N0XA 4OHXA 1FMLA 4EO9A 2Y2UA 4I4CA 4E94A 3BL5A 4YRQA 4D4LA 2B21A 4HF7A 5I48A 3NBKA 1Q15A 1QKKA 4CN9A 3F74A 3GLFB 2Z09A 1YQTA 1KO7A 4C6SA 5C4MA 3N2KB 5KC9A 1OVMA 4L9AA 2ZSAA 1KJZA 5A3SA 3VR0A 5B1IA 5IUKC 5L4LA 4U9HS 3QE0A 3WSTA 3RH0A 2ZWAA 2NG1A 3CRVA 1CB7A 2HRRA 3BB4A 4KYTA 3EF3A 4YEDA 5DDIP 3RWOA 3TQTA 4YCMA 3HUFA 4Y30A 5CEEA 3AM1A 1V9CA 5IT5A 1ZMXA 1BKYA 1SY7A 1XXHB 5F33A 3PXGA 2R25B 3KVNA 3HNOA 2DR2A 2D6FA 1YUNA 2DQZA 3FI0A 3KAQA 5TPWB 3HVRA 4KYUA 1V3VA 4TMVA 5BYBA 4YV0A 2ZRMA 1CW2B 3LRXA 4H7KA 3SX4A 3QVGB 1WDMA 2RGWA 5E4JA 2EJTA 2WZDA 2J32A 4NBTA 1L8OA 2CLLB 1U7HA 1GWNA 1NVXQ 2ADFA 3ANLA 3II6X 2WAYA 3NVDA 4P83A 4R16A 5DIFA 2EL7A 4Q7JB 3G7SA 3LQ1A 5BRAA 3A2KA 4WCFA 4FGUA 2AXNA 3KZMA 2GEFA 1VZ3A 4X8HA 1RHKA 3RDPA 1R64A 4KAAA 4M0DA 5KNBH 3SXUB 3KSAC 2IA5A 1SBQA 5F21A 3H2KA 4I1OA 2C7VA 2OLJA 3KB2A 2NZYA 4RSMA 4EFLA 2NZJA 2OHVA 1IJEA 3AR4A 1BIFA 1TMKA 4S24A 1SU6A 4N8DA 1FRZA 3HWSA 3RLIA 4PTLA 4RIFA 5FWYB 1FA9A 2AUTA 3IP3A 2XOKA 1HTTA 4AJIA 2NYRA 3S8EA 5LYJB 1QG0A 1K8RA 1JR2A 2IEZA 4TMXA 5AM3A 4CQNA 1J0XO 3AJ9A 1OW3B 4REOA 3RVMA 5GV7A 4IP0A 4D9MA 1T2FA 3O74A 1DWQA 5LL6P 3P2MA 4RTMA 3OQIA 4EHFA 2PQ2A 4UVIA 2JCBA 3GMIA 3BIFA 2V96A 4HLUA 1BOOA 2DHEA 3B70A 3I01A 4ND7A 5K2MA 4TGLA 2VNKA 4WKCA 3TZCA 1BGXT 2A88A 2O2ZA 2Q0XA 4DN6A 3I53A 3V8BA 1PG5A 5ALNA 3M1AA 4NU0A 3T5BA 5BW8A 3AM5A 3KFXA 5IK2D 5D1NA 1ACJA 1CS0A 4E7PA 3D5QA 5IKPA 2IBMA 3AF2A 1EFVA 1I6MA 2WP0A 3E9DA 3LA8A 4IO0A 4JJ8A 2V7PA 4DGQA 4F3RA 2VXYA 1RAGA 3PKZA 1WP9A 3K9FC 4BZZA 4TRMA 4LRSB 4NZZA 4B3JA 3DDNA 4RFVA 3P9XA 2DFKB 4NHEA 1VA5A 1E8MA 5FWAA 4FWBA 3URKA 3JASA 1X80B 1VI6A 3M5WA 3JSAA 3TEMA 4OU4A 4QDTA 4EA9A 2QRJA 2HDHA 3HR8A 3F3MA 5TARA 1Z83A 4JB0A 1L3IA 1QANA 4BCBA 3D7RA 3LGXA 4ZI3A 2ETVA 2QWXA 3LKBA 4IDOA 2GM9A 3AOGA 1W4ZA 2VSXA 4I3GA 4WH0A 3S1AA 2XSZA 1LPOA 2CL0X 2J09A 3H1PA 2CLHB 3LZDA 3VAZA 3QPCA 5CB4A 5HEKA 3IUMA 4Q3OA 4RNDB 2GEKA 5A4MS 4G2NA 5JAZA 4PR3A 4ZT2A 2IE0A 2K2WA 1P31A 3AEQB 1THGA 2JIBA 2JZNA 1VJ1A 1FLNA 3HZHA 3S2EA 2QT0A 2CJWA 4RUKA 2QM3A 3KR1A 5KMGA 4ZDJA 4ARZA 4AULA 1E2KA 3LCUA 4RTLA 2F4VB 3HLKA 1H5NA 4QT4A 3O9VA 4H7FA 4G25A 3Q9LA 4Q3AA 4UDNA 3E0XA 4U2EA 2G76A 4QU8A 1QTNA 2P0EA 5T5QA 3W6OA 1KAOA 1G2IA 4BOYA 1KEKA 1S8NA 4KHZA 4ETNA 5CA0B 4NVRA 1BE1A 3SJBA 1ZUD1 5LSAA 3LW8A 1YU9A 5CG2A 3CBQA 3FBGA 3LT4A 4PRYA 5ICCA 3ZJUA 4G26A 1WDTA 2CE2X 3K0CA 2B7CA 3CF2A 1ESDA 4KAJA 5LQDA 2E55A 1OLXA 3ZV7A 3C3KA 3E2IA 1D2EA 3AP1A 4H1VA 4IVRA 5KTMA 3PHJA 1E62A 2BONA 4EJSB 4Z2AA 5T8KA 3WGVA 3NTXA 4LDQA 4BNUA 3TJRA 1VLJA 2Z95A 1ZJZA 2M6LA 1RWBA 1NBHA 5DTRA 5K9ZA 1KFJB 5AWFC 5TQ0B 1NP3A 2ZUVA 4G0ZA 4GGOA 2FW1A 4D81A 1PGPA 1IZ9A 2JIQA 1TUEA 2UV8A 3LSYA 4BP3A 3NTQA 4Q3LA 1XP5A 4BP8A 2OBLA 4CV2A 1EVLA 3SBDA 3V46A 3GVHA 1JIXA 3E23A 2Q41A 1L5YA 3DR3A 3PX2A 2GBCA 2EEPA 5KSYA 1U28A 2I67A 3BAFA 2DQYA 4MA0A 3S6JA 1N3BA 1E2BA 1O03A 4R1QA 4ZI7B 5LQUA 3BJRA 5C35A 1B1CA 5D8DA 3W34A 5JWHA 2VJKA 3FUVA 1W29A 2DT8A 5IK2A 3VU3A 1XJ5A 1L4UA 2DBYA 3ZXIA 1XF1A 4G9EA 4MRMB 1H6CA 1Y9EA 2WUVA 4BX0A 2WQ6A 2JEZA 2FVYA 1S2MA 2P90A 2HHJA 1NJ5A 3DAOA 1OT3A 4ZGGA 1TUBA 2FK8A 3GEIA 4QDXA 5KNBD 2CVZA 4R0NA 1NLUA 2HO5A