3KQUA

Three conformational snapshots of the hepatitis c virus ns3 helicase reveal a ratchet translocation mechanism
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
437
structure length
437
Chain Sequence
b'SPPAVPQTFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPITYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSSTGEIPFYGKAIPIETIKGGRHLIFCHSKKKCDELAAKLSGLGLNAVAYYRGLDVSVIPTSGDVIVVATDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRMGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTTTHPITKYIMACMSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease/NTPase/helicase NS3
publication title Inaugural Article: Three conformational snapshots of the hepatitis C virus NS3 helicase reveal a ratchet translocation mechanism.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/dna
total genus 148
structure length 437
sequence length 437
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3kquA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kquA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kquA01
3CH5A 2P3SA 1P7CA 4A2WA 3U3KA 3WNCA 1GL9B 3R8CA 1EFRA 5B64A 4Q1BA 3CB4A 1FOEB 1N5IA 2CK3D 1FX0B 2OLJA 3LD9A 3ZQ6A 3U44B 1G8HA 3OIUA 2MSEB 3EZ7A 4G0NA 3M6AA 4Q4JB 2QTVB 4IDPA 4AYTA 2ZE5A 3EA0A 5HKKD 1QHGA 4PAQA 3MGCA 1LY1A 3VNUA 4JZKA 1D8TA 3IDQA 3K70D 1KI3A 3A4MA 5L3SB 4JT4A 4NCJA 4NH0A 3VFDA 4DIEA 4KFRA 3QKRA 3ZZUA 4P4SB 2C04A 2EVWX 5CJ2A 3GLFA 3SYNA 3AUXA 3C5HA 3KQHA 1CJMA 1CS4C 3E2IA 5E7IA 2BV3A 1TPZA 2H57A 4DLRA 1U8YA 1AS0A 3RHFA 3FOZA 1Z63A 2Q9CA 1R5NA 4URWR 2ZI9A 3ZJYA 1SXJC 1J99A 1E4YA 1YZNA 5DGXA 1U9IA 3VR6A 1T5LA 2ZSBA 1YZLA 2OUKA 3RS2A 3T35A 5DO9A 5DHAA 1XU4A 1OH5A 2J7KA 3WXMA 1SVSA 1CP2A 1IN7A 3UKDA 1DG1G 3W6PA 5JHHB 4WIAA 3KZ1E 2L0XA 1E99A 2NZJA 1CR0A 2X1VA 1E1RD 1E96A 1T9HA 2XZPA 3QKRB 4MYTA 3RWOA 4D25A 3GLFB 4ASUD 2FG5A 3H86A 2OCAA 3DEFA 2P6NA 5AK0A 1OKKD 4FWTA 3WYGA 4PC1A 4TMKA 1G7TA 4FI3C 1MRSA 4I1UA 2BMEA 2FEMA 3TR5A 5TY0A 1IJFA 2QMHA 2ZREA 1SVMA 1FTNA 1OLOA 2W2XA 2H16A 1IXRC 4ZO4A 2ZI4A 2QP4A 3QKSA 2W0SA 1CRQA 3OFNA 4B3DA 2GZAA 1GVNB 1GNPA 2ZJ2A 4FMCF 4JIMA 4UNQA 4PHFA 3OZXA 4AG6A 1TTTA 3KUDA 3KB1A 3IBYA 1NVWQ 3C7KA 1S3GA 2FJUA 3I62A 2J7PD 3NH6A 1P73A 2V7QA 2DWQA 2PT5A 3SE0A 4KXFB 1X6VA 2D74A 4BLTA 4DHEA 3VKHA 1Z08A 2FOLA 2GDJA 3LWNA 3TMKA 1HT2E 3IBGA 4QJ3A 4MKGA 3VNVA 2UKDA 3B13B 4HB4A 3QF4A 1CBUA 4A0GA 4JLBA 5K8LA 1NVVR 2QT0A 1NVXQ 4FXPA 4KLZA 1ZNXA 4JBXA 3U6KA 2NO0A 2VLIA 3QE0A 4B3XA 1E94E 2GK6A 3QKSB 5B30A 3SFZA 2BCJQ 3I3SR 3V9PA 4L5BA 3T1OA 1AN0A 4ZV4A 2G77B 1VPLA 3C14C 4L4UA 2IXEA 4OI2A 5L3VA 2OLKA 3DDCA 3FDIA 1KDTA 2BMDA 4F4IA 4I4LA 3W3ZB 4Q9IA 1U8ZA 2ZI3A 3B1WA 1WQ1R 5FI0B 4QHYA 1UBGA 4MKIA 4RD2A 1XZQA 3TBKA 1F5NA 3I61A 2ZRMA 3I8XA 4WOPA 3TQCA 1G4UR 4A4DA 4D4LA 1JJVA 3QF4B 2GBLA 4QL3A 1LB1B 1QDEA 2XAUA 1XJ0A 3GFOA 2FE4A 1LF0A 2A5YB 5JS8A 1KAGA 1S1CA 2GEVA 2QRNA 1CR4A 1QHXA 5AUNB 1NJFA 1SKQA 5AUQA 1M7BA 1VDZA 5EP4A 5TDHA 3SR0A 4EPVA 2IYYA 5FTLA 1VG8A 1XTSA 3QPVA 3EZ9A 2QM7A 2ORIA 4V02A 2J46A 2AXNA 4MRNA 5CM8B 5FOSA 5SZHB 3NC1C 3SYKA 4HAXA 3MG9A 3QEOA 1OXSC 4ARZA 3NH9A 2EU8A 1XWIA 3Q5DA 1XTIA 4RKFA 2ZRPA 4LHZA 3QVUA 1PUIA 2F1RA 4V0OA 5TVKA 1P2SA 4OKSA 3LBHA 1OSNA 1M7HA 3KKQA 1ZJ6A 1YRBA 2VYFA 1JQJC 4UNPA 2DWPA 2AD5A 2ZSFA 5CB8A 4URZR 4IXNA 4Q1AA 2BVNA 4Q9KA 1N5LA 4G5SA 5BXQC 5LDDC 2ZJZA 3SJAA 3GJ5A 1OW3B 2QL6A 3CLVA 1E2IA 2VP0A 4M1KA 3RRYA 3AVUA 2GF0A 4MYHA 3NTUA 1PJRA 1FNMA 3P4XA 3PENA 2B8WA 2FDCA 1MR3F 1QHSA 3PEVA 4OQXA 2ZVQX 2IS4A 3EARA 4DKXA 1G7SA 4I1SA 5FTNA 2ASEA 3UXMA 3A1UA 3GFPA 5CIQA 2W58A 4DDTA 2JLWA 3WNBA 2PZFA 3EZ2A 3OE7A 4US1R 5D3MB 1VHTA 3X2SA 1SXJE 1IBRA 1OIXA 5FL7D 5HCIA 3CF6R 1F6BA 3IGFA 4YDHB 2YWEA 2VF7A 3V4RA 3L8YA 4TLEA 1KO7A 4HZIA 2D3WA 3AV0B 3MJHA 3PVSA 1W49A 4DLWA 1GITA 1Q1BA 2J0SA 4BWYA 2WWHA 1V43A 5K8TA 5E95A 5A4JA 4IVQA 4JT2A 5K8IA 3HU2A 5KUTA 5IRCD 4TYYA 4RD3A 5JHGB 4TMVA 2X8AA 3HP1A 2HV8A 1CXZA 3I8SA 2NPFA 5JECA 1TEVA 2FZ4A 2ANCA 3TAHA 5AJYA 1D2NA 1U99A 4ZIRA 3GEHA 1VG1A 2JLRA 4R2IA 3T1QA 1IOZA 4DUGD 1KO8A 2GNOA 1JALA 1DAGA 4Q7LA 4GBMA 1EFCA 1W4AA 3P1JA 2FFBA 2DYKA 4NCHA 1OPXA 1SULA 1SZPA 2NZ8A 1UADA 4JLNA 4OHZA 4QNRA 2QE7A 4UJ5A 3KUCA 4ITRC 2QM8A 1TEXA 2J0QA 2G0TA 2I1QA 2PCLA 3BORA 3ZS8A 3H0KA 3ZVNA 2XB2A 1VIYA 2HF9A 3MWJA 3DZ8A 3FFBA 3HJNA 2GXQA 4NU0A 1VMAA 2QBYB 2EYQA 3PXGA 4NYIR 3KTAA 4B33A 2BJVA 4RD4A 4ZIRB 2RB4A 2RCNA 4MKFA 1XF9A 4P4TA 1X3SA 1ZMXA 1UBFA 4DLYA 3C5CA 2XEXA 3BB1A 1ZUHA 2YVUA 5KSZA 4C2TA 1G3QA 5FBLB 3QOFA 4OI4A 5BN4A 4BE7B 2G83A 1NVVQ 4LJ7A 4ZKEA 2MMGA 4PQFA 2OAQ1 4FD2A 3QXJA 4M2LA 1H65A 1XMSA 5FI1B 3U60B 4UNRA 2QSZA 3ZIAD 4OQFA 2BBSA 2DWOA 1Q20A 4QBGB 3LQQA 1VYTA 1Z0DA 5ANRB 1OHHD 4AKIA 3EW9A 2XZOA 3AF0A 1EFHA 1YZUA 1R0WA 5J4YA 2QORA 3DVLA 3KTAB 3TLXA 2VHQA 5KNDA 5JJKA 4A82A 4IW3B 3DM5A 3F3YA 4Q7KA 1U98A 1AS2A 1DADA 2H17A 1O87A 1WF3A 2QMUA 3KQKA 2IEYA 3A4NA 4PTLA 1AA9A 3EC1A 2EWWA 4IRUB 1R4AA 1XNJA 4QBIA 1L8QA 4LHWA 5F9HA 2ZEJA 3W34A 3LDAA 1SVWA 4KVAA 1N0WA 1FPMA 1E2NA 1QHHA 4EFNA 2P5SA 2ATVA 2R9VA 1KYIA 3AP1A 4OHYA 5BQ5A 3SQXA 1AIPA 4HDOB 5FFMA 1OT3A 1Z83A 2A30A 4E03A 3VR1A 3K70B 3ZZTA 3ETLA 1FQKA 4NCKA 5E3HA 4C7OA 4WVFA 2KSQA 4ZI3A 1NIPA 4PPFA 1AKYA 4GI7A 2A78A 3G5UA 5EXTA 4V03A 3QY0A 4JKYA 1OKKA 3F0TA 3K9NA 5L3RA 1H8HA 1NBME 1X8JA 3GP8A 4Q4HA 3ZQJA 1OH6A 4TZ6A 1T8TA 1XD2A 5DSZA 4YXWA 2HXYA 4HAZA 4B47A 1P61B 4R71A 3SYLA 4TMXA 5AR1A 1RRFA 2O0KA 1FQJA 4L16A 4GL2A 4AI6A 4RD0A 1N5JA 1UBCA 2XITA 4FN5A 4P0TA 4YMVA 1QHHB 2DFTA 2Z6VA 5JMTA 1XEWY 4FINA 2H92A 3TW4A 1IJEA 1MRNA 2ZRDA 3AF4A 4EUNA 4IDOA 3TQFA 3BB3A 2J7PA 2WKQA 5F98A 5BN3A 2JJ2D 3BJIC 3DKPA 2D4HA 3EA5A 4A9AA 1GKUB 1T0HB 2VL7A 3UIEA 2GJKA 2ZU0C 4C7OB 3GLIA 4PO9A 1WBDA 1Z6YA 2FEOA 2YNMA 3T15A 3CONA 3WHKA 1GRQA 2CCKA 1Z6XA 1OB2A 2ZYVX 2CNWD 3QENA 3NBYC 1E0SA 1UDXA 4IXMA 2RGAA 1ZM9A 3J81k 1XTKA 2QMOA 3SZRA 2V54A 1XD2B 1P60A 3AF2A 1M2OB 1FW6A 4TMWA 1WCV1 4PHGA 2B6HA 5EE5B 1F60A 1AJEA 4HAWA 1Z3IX 3KQNA 2CHGA 4NDZA 5CIWA 1FMLA 3AVPA 1UKEA 2XNSA 4JKIA 4BFTA 1A2BA 1BIFA 5FTKA 3QI2A 1JQLB 3BAFA 3KFXA 4JYCA 5J4HA 1LW7A 2A7QA 4URVR 3U61B 2ZRJA 2XOKD 2GRJA 2IA5A 3K0AA 3O8BA 3BH0A 1UF9A 3DOEA 3CRMA 5G53C 4LYJA 3THWA 3QPUA 3A1TA 2IYXA 2YKGA 1SVLA 3AKYA 5LD2C 1BYUA 2W6ID 1ZYUA 3T12A 1OYWA 1Y63A 1RVDA 1Z6AA 1G6OA 2OILA 4PQRA 2VHUA 4HAVA 4I99A 4TQAA 3AH8A 4LOAA 1GIAA 3B5JA 3GCGA 3KFVA 4A6PA 3G82C 4Q1EA 2GEDA 3RRMA 4Q47A 3B7GA 1TUEA 1ZUIA 3GLGA 5HCNA 4PAOA 4LHXA 4Q18A 5H1YA 2CDNA 3CNLA 4QJ5A 1KSHA 1TX4B 3K0AB 1G291 3VAAA 3C8UA 5FUWA 3GJXC 5KSPA 1Q12A 1BYIA 4R2HA 5KYKA 4PC7A 1QBKC 5HE9A 4NL4H 4JLOA 5DYGA 3EWSA 5FUXA 1T3LA 1R6BX 1OH8A 3R9XA 1CJVC 4HLUC 1N6RA 1QF9A 1P2TA 1P9WA 3TRFA 5AJWA 1GOTA 2UZ3A 4LWZA 4KJZA 4GDFA 1E4VA 1KO4A 1KY2A 2OCPA 4MH0R 3ZZ0A 2AHOA 4H1VA 4DRZA 4XSHA 1KI9A 1KZ7B 4TYPA 2XJ9A 3WHLA 2SHKA 1S4QA 5EUMA 3GLGB 2NGRA 3QG5A 4XWAA 1W4CA 2QU8A 3HWSA 4GZMA 1E2HA 1KGDA 1NY6A 2PX0A 3TSOA 5CDFE 3R9IA 1N0UA 3CNOA 1Q1EA 4GOKA 2IUUA 2XSZA 3S1AA 5EE3A 2FPMA 3CX7A 4PXAA 5DN6D 5FL7A 3EC2A 4PAMA 3MLEA 1JR3E 3L0PA 4HLDA 4YQFA 1ZINA 2HT6A 2JAQA 3I72A 3C15C 1OFTA 1KJWA 2IS2A 2C78A 1W36C 4B34A 4OQLA 1KK0A 4X8OA 3W5IA 4A8JA 2QZ4A 2IEZA 3PUWA 5GJVC 3A36A 2Z5FA 4OQMA 5FTJA 1F2UA 1OXUA 4G5GA 3AP3A 1I4LD 3AVYA 1KMQA 2A5DA 1D2EA 3NIBA 1XPRA 2V6JA 3FKSD 4JJZA 3Q5EA 5BN5A 2O0JA 3S1AB 4DUGA 2JDID 2DFKB 2B92A 2GAAA 4FMCB 2JIZD 3NBFA 4IJMA 4WZAE 2REBA 4CYMA 4UXHA 3AGQA 1G20E 2EW1A 1K5DA 2OM2A 4DLZA 2KBFA 2AFHE 4WXRA 2GEUA 4O25A 3WBKA 1E9FA 2J5XA 2FSGA 1Z5ZA 2R44A 3V4FA 1Z0FA 2ZR7A 2GXAA 1M74A 1DG3A 2AKYA 2N42A 2VP9A 2ZE8A 3UK6A 3AF3A 5KPDA 1TUIA 3BXZA 4A8JB 1QZXA 3PG5A 1E9DA 1G3IA 3KKPA 1XD8A 2CJWA 3CRQA 4Q48A 4HB3A 4W5JA 5AWFC 4JSTA 2WWIA 2J0VA 2ZIAA 1G5TA 1F2UB 3MUFA 4M21A 521PA 4ZDJA 3GJ0A 3D7MA 4P33A 2O8FA 3NVAA 2WKPA 4KI0A 1QRAA 2R62A 3KJHA 4OL0A 2DR3A 3NDBB 4LJYA 2ORWA 2WPDD 1W0KA 2YOFA 4A92A 2CLCX 2O0HA 5EZ6B 1MOZA 1XXHA 3HR7A 2ODNA 3ICEA 2GXUA 2JA1A 1W5SA 1E2PA 3M1IA 4L8GA 3B6EA 4MGZR 3RWMB 4ACBA 1G4AE 2GWHA 2RGNA 1KI7A 1DS6A 1U0JA 1D6JA 2VIIA 3BWDD 3LO5A 4FIDA 2GTPA 2H1LA 3A4LA 3AUYA 4DSOA 2GCOA 4HB0A 3QBTA 1W47A 3W9YA 2C9YA 3X1DA 3UMRA 1J70A 2WZQA 3U44A 2KI5A 4KV9A 2CL0X 2CJWB 1VG0B 1A2KC 4D4MA 2QTFA 2C98A 4Q4JA 5KSYA 5J5CA 3ZVMA 2HDNB 1XMVA 3C16C 2IC5A 4E22A 5B58C 4EPWA 4XWKA 3IPXA 4TTPA 1JBKA 4B3CA 4BFZA 2DHRA 4BEJA 3K0CA 2XXAA 4HAYA 2BOVA 2VH5R 1U8AA 3FHOA 1N6LA 2ZRLA 1KOFA 2BCGY 1J7KA 5B57C 5JRZA 4ZCIA 3KQLA 2XNDD 2IL1A 4V0ME 5CK4A 4S2EA 2QQEA 2VTKA 3GJ4A 1E2MA 2VA8A 2GCOB 1UBEA 3EPJA 2WTUA 1DEKA 1G21E 2QN6A 1VKJA 2D7DA 1V5WA 4M1MA 4N0EA 4YMTA 3LXXA 4YMSA 4B48A 1KSFX 2GETA 3BFKA 1M1YE 4NBSA 2YYZA 2B7BA 2BJWA 2W83A 4JL8A 2C77A 3HYTA 4EPRA 3MRSA 2PMDA 4KO8A 1RJ9B 2NIPA 4ILEA 2XXAB 3GJ8A 1T8UA 2VPPA 2XTMA 3UG7A 3RSLA 4RZ3A 5FPTA 2XX3A 4PANA 3GQBA 3OF5A 2ZU6A 4PQYA 2X2EA 1TADA 2EFGA 1DELA 2OXCA 2PEYA 4MGYR 1JR6A 4B2IA 3FMPB 4TL7A 1U9IC 4DJTA 5KU1A 4BECA 5KSOA 4TT3D 1CJUC 4I1VA 3DOFA 2IYSA 1W1WA 1OFIA 3QKTA 2CMKA 4YMUA 5DNYB 1MABB 2GESA 3VR3A 4WXPA 3RVBA 2XTNA 2CVHA 1QHYA 2JJ2A 3WP1B 3EPKA 1ETUA 4FW9A 1Q57A 4LV5B 3W6OA 3TGPA 4RZXA 1EX6A 3NEJA 2REXB 3CRRA 5FBWB 4M1WA 2B21A 4RFSA 4NYMQ 3BS4A 1XEFA 2D06A 3LA6A 5EJEA 2ECKA 4AYXA 3IKJA 4PZYA 5KNBA 2VO1A 3FE2A 1OXTA 2VP6A 1XMJA 2ZETA 4JL6A 1XP8A 4DDWA 3CZQA 4U7DA 2QGNA 2R6CA 3GJ6A 4AYWA 4TMTA 1P2UA 5JS7A 3U3OA 2BWJA 1I4TD 2GZDA 1SVOA 3I92A 4IOLA 5GJWC 2H8KA 4AD8A 4RJLA 4Q03A 1HUQA 4NKRA 1Q44A 2MMCA 2ZYUX 3WNDA 3KXIA 3THYB 4DCTA 1IY2A 4TL9A 2FU5C 1G17A 2QGZA 1E2DA 4DLUA 3GEEA 4TLDA 1RE0A 1KK3A 4V0KA 4RFSB 3WMEA 3LVQE 5EP3A 2RGBA 4Y0AA 4NTZA 4NYJR 5FOTA 3WYFA 5A5GA 2W6IA 1MO5A 1MO6A 2P67A 4O2RA 1KNQA 4UXJA 5B2ZA 3X1ZA 3ASZA 3U4QB 1XXHE 4LDJA 3FWYA 4ZPXA 1KAOA 2WIAA 1CIPA 3K9LA 4FMDF 3TUIC 3UWKA 3CBQA 1NMXA 3QQ5A 4Q4LA 2ZM5A 4RD1A 2YJTD 3C4JA 2GJ9A 2GK7A 3P20A 4IFEA 4JVNA 3NEYA 5TXGA 4Q1DA 4DCNA 3CWQA 1U81A 1FZQA 2ZUDA 2PJRA 2LKDA 3MSXA 2WJHA 3T34A 2WWYA 3TIFA 3UMSA 2UZIR 2AD1A 3DKVA 4GZLA 3CR8A 3F5FA 2FX3A 3ZD6A 1BS1A 3HPRA 3MWLA 2WSMA 2VP2A 3TSWA 2XZLA 1OXVA 4XD7D 1DOAA 1HH4A 4GSYA 3VR2A 2JJ8A 1G1MA 1GG2A 4A0HA 2ZXUA 3DMNA 4JL5A 3SHFA 4HSEA 2V8OA 3IIJA 3Q8XB 2C8VA 3QXCA 1DBSA 1FP7A 3THOA 3PEWA 4HYYA 3PJRA 1Z0IA 3EIQA 4US0R 5FUVA 4DSTA 1E3MA 3VKWA 2GF9A 3QBVA 2ZSAA 4BZQA 1P4SA 2F9MA 1FFHA 2J59A 1TQ4A 1VECA 3GD7A 1R5BA 4Q7MB 1Z0JA 3K0FA 4K46A 2O8EA 4BFYA 5JCPA 1EFTA 2IW3A 4CEJB 3TUZC 4POAA 4C4PA 1P9RA 1U0LA 5DN6A 1WRBA 1VCMA 4GT1A 1T0JB 4G5RA 3QIAA 3BK7A 3X1WA 1R0ZA 1MH1A 1Q1QA 1M8PA 2C03A 5FPHA 3ZVLA 3SC3A 4C3ZA 2R6FA 4MGKR 1KSGA 3GMTA 3BBPA 4XVUA 2ZVPX 5D3MA 3TK1A 1NL3A 5C4MA 4GP7A 1G5PA 3SJBA 4G5QA 3GLFE 2DB3A 5KHOC 4B3FX 1YU9A 4AKHA 2JJ1A 1C9KA 1KJZA 2EFDB 1GL7A 1ELOA 2R65A 1FL9A 3V00A 2PEZA 4N0DA 4R98A 1ZD9A 3RSOA 1CU1A 5LBIA 4JBWA 1XX6A 1RRCA 4HLQB 3K0FB 2CEAA 2VP5A 4EJSA 4XWOA 3FKSA 4URYR 4EPTA 2O8EB 5CYOA 3DHWC 2ATXA 2F55A 2WOJA 4AURA 3RDPA 4F93B 2OFXA 2JDIA 3BH6A 1CJKC 4LJAA 2PMKA 4CZ2A 2BM0A 4LPKA 1FUKA 1IONA 1S8FA 3PQCA 4JJKA 1CTQA 2W6JD 1OB5A 5IT5A 8OHMA 1N6OA 3OEHD 4PHTA 1S0UA 3K9GA 1BH2A 4DXAA 3REFA 1KKMA 2QUZA 2QAGC 3L0OA 3SJZA 1QHIA 2QEQA 2O8CA 1Q22A 4JLJA 1MO4A 2D62A 1AM4D 3L0IB 3KXKA 4X8HA 2JCSA 2DFLA 3SBEA 1DAFA 2QI9C 1OIWA 1Z07A 2OXRA 5DYIA 3RS0A 1DPFA 4EJSB 5EUQB 3L43A 4UQOA 2WPDA 1GNRA 2J0UB 1J8YF 4B2LA 3JVVA 3LLUA 2QBYA 2RGDA 4PC6A 5D3QA 4BFXA 1HQYE 2ZJOA 4E5UA 1W0JD 2IHBA 2VHCA 2X2FA 3IQXA 3RRZA 2O8CB 1FUUA 3UANA 4D26A 3KQUA 1YVDA 5JEDA 1Z0AA 2BKEA 1XCPA 2JLVA 2FFHA 2OHFA 2DBYA 3VHLB 3BIFA 4LV6A 2IXFA 1P3JA 1P9NA 1EXMA 2GCNA 1U0HC 4LYFA 1GKIA 2Z4RA 4F4JA 1HTWA 1NN1A 3AQ4A 1ZM3A 2VEDA 4B71A 3I32A 5HE8A 3K0EA 2JLUA 1P72A 1E1QA 5FBQB 1YR9A 5C1BA 4F7WA 1W5TA 1JAIA 4M9QA 1OH7A 4NYJQ 4EQ6A 4DLSA 2HCBA 2WM9B 2YC2C 5L3QA 3T06B 4NCNA 2CK3A 4B32A 1OYYA 1G5RA 1W2GA 4TSFD 1OE0A 3ASYA 1GDDA 2BKUA 3K53A 4E09A 4MRSA 4PZZA 1TQ6A 4CT5A 3NKVA 2ZJYA 1VCOA 4N1AA 1PLKA 2ZROA 1FTSA 3EAQA 3AEZA 2ZJ5A 3KJGA 5DI3B 2PLRA 5HKKA 1KJYA 2WSSD 5JLJA 2P65A 3H1TA 2IWRA 2RGXA 1JEEA 1NI3A 2CL6X 4IVPA 3IIMA 4B74A 4LI0A 2OBLA 4KITB 5ELXA 2WVJA 5FL3A 1G19A 3Q7PA 5KPJA 3B85A 1EGAA 4P32A 3CM0A 3QEJA 3Q7QA 2ZS8A 1LVGA 4GOXA 3IEVA 4QC2A 4EQ6B 3W3AA 1II8A 5L3QB 2B8TA 1CR2A 4TT3A 5CJPA 2V9PA 2WICA 3A1VA 3QG1A 1RYHA 1KSJA 2GKSA 1NRJB 1YR7A 4LK2A 4MRVA 4OQNA 1YQTA 3DMDA 1WXQA 1DAKA 1HE8B 2YWGA 121PA 2Z4SA 3AVTA 1W48A 2AWNA 4BASA 4ZDKA 1SKYB 1HY3A 5F3WB 1J8MF 2VF8A 4CF7A 2ZRCA 3P27A 3H2YA 4TWZA 2WMNB 4PX9A 2GXSA 2OBMA 3WP0A 3K0SA 1ZNZA 3OIYA 2FMXA 5F9FA 1CJTC 2WJYA 3P26A 4Z8XA 1E1RA 1P75A 4B6EA 2FNAA 1G3UA 3QVVA 5EQTA 2PH1A 4ASUA 5E7MA 4CEHA 2ERXA 2JASA 4WBSA 1II8B 3LY5A 2WAXA 1M34E 1JJ7A 1NF3A 2IK8A 2J9RA 4B3BA 1C4OA 2ZPTX 3VU9B 3U7EB 1EWRA 4DLTA 3A1WA 3I5YA 1JXOA 2NQ2C 2OESA 2W0MA 1EK0A 1N6IA 3PITA 5JI2E 4PPGA 4WAUA 2P6UA 4PR0A 5EP2A 2VQSA 1P2VA 1XTRA 4A0FA 2ZAMA 2QAJA 4HEJA 2VP4A 1EWQA 2D7CA 2GVZC 2BMJA 1RZ3A 1Q1ZA 4BFWA 1N6KA 4LY6A 1JPNA 5CB6A 4QGGA 5SZKB 1OIVA 4DWJA 4CEHB 4F92B 1YR6A 4RZUA 4BLOA 4MDFA 1KMHA 4J0QA 2YC4C 3K09A 2BIFA 4DEYA 2QPTA 4GMDA 2F43B 4HLCA 1XCGB 1GSIA 2A9KA 5A0FA 1ZBDA 1HEIA 1Z29A 1W4BA 4M8NE 1A5TA 5CM9C 2ZJBA 4B3GA 2ZRBA 3TR0A 2XJ4A 3B9QA 4K8OA 3MWKA 1JPJA 1CF4A 1G7CA 1L2TA 4ACAA 4OHXA 4XD7A 3WBJA 3A6PC 4IDNA 4Q5IA 1KKLA 4LCBA 4QG7A 1SVIA 3PUXA 5JWOA 1JEDA 2I3BA 2FA9A 2QSYA 1SXJD 5FBVB 3M4YA 5HPYB 2PX3A 2QT1A 3BFXA 5EXXA 3UWOA 4CIDA 2IHYA 1KMHB 3CH4B 5FTMA 2K5UA 2WV9A 4GPTA 1VCNA 2BDTA 1ZNWA 3WRXC 1XJCA 1Z6GA 3O8CA 2NO9A 2NTYC 3CIOA 3JZMA 4D6PA 1GWNA 4DB2A 4OK5A 1Y3AA 1WBBA 1CKEA 4G3XA 4TMZA 1OXXK 4DDUA 5GJBA 3W8RA 4RZ2A 5JBQA 2A5FA 1TU4A 1ZAKA 2ODEA 4HUQB 4Z51A 2O8DB 3PV0A 2I4IA 1KDPA 1E69A 3QPWA 4GP6A 4PO8A 2F1JA 1D9ZA 1PLLA 2RH5A 4XIGS 3ADCA 1A82A 3U3MA 4BPBA 4LV8B 3EZ6A 3BC1A 4V0LA 3QXSA 4LJ6A 1X1SA 4RKEA 1AK2A 2WWXA 5JJIA 2IYRA 2ANBA 2IYLD 1K5GA 1E6CA 3O8RA 4NYIQ 4P3YA 4XTCS 4HZUA 1VTKA 3CKLA 1SHKA 3GLHA 2G88A 1PZNA 3KJEA 3TW8B 1W46A 4GNKA 2PT7A 3FYHA 1N6PA 1E9CA 3ADKA 5DH9A 4C0AC 2Q6TA 3U7FB 1XDBA 1XCMA 2P0EA 2C9OA 3ZH9B 4ESVA 4U02A 4NHOA 1AGRA 1UKYA 1EFUA 2AX4A 3KX2A 5EZ5A 3AF1A 2GJAA 3LFUA 3B1YA 3U7HB 2R6DA 4C30A 4ERNA 2NG1A 5G3YA 4MYUA 1JECA 4KFSA 2C5LA 4B35A 3DM9B 1A4RA 2RKOA 4PFSA 3T5DA 3LV8A 2YHSA 3FHTA 2Q9AA 2AN9A 1I4DD 1AGPA 4HZUB 4JVMA 5J47A 4HAUA 4LBVA 1ZCBA 1LFDB 4EFMA 3OEHA 3UPUA 2CXXA 3AKCA 1IN8A 3GLHB 2CHVA 2A2ZA 5LB2A 2HCJB 4TL6A 5FPKA 4PSVA 4A8JC 2GZHA 3EZFA 3T1VA 2WHXA 4BLSA 1S9HA 3D31A 2TMKA 3NHAA 1N25A 4KSBA 4XJXA 2C95A 4M1YA 1H8ED 5LD2B 2IYTA 3QJYA 2PZEA 4IKEA 4JLVA 4B76A 2QRZA 4WZ6A 4IFBA 4HUTA 4HLUA 5C18A 3RAPR 1G7RA 3PFIA 2V3CC 4YONB 3U7GA 1KDOA 2F1IA 2W2TA 2ZR9A 5CK5A 2VHTA 1NG1A 721PA 4LJ9A 2CLSA 4JLPA 4L15A 5FR2A 1G64A 3IHLA 2CE7A 2ONKA 4QHSA 5UKDA 1W0JA 5TV2A 1Z6TA 2C2HA 3ND9A 4TYQA 4IDHA 4OI1A 4EDHA 2V1UA 4LYAA 3GLIE 3AVVA 4QBHA 4MGIR 5DHFA 1VYUA 3KKOA 2ZRGA 5G40A 1SQ5A 3R7WB 1IXSB 3W6NA 2C96A 2QROA 4BFUA 1D9XA 3B9PA 3CX6A 4O3MA 3AP2A 3B1VA 1GRRA 4U5XA 4DSUA 1NY5A 3SNHA 2VSFA 5HZHA 4LPSA 1E0KA 4F38A 2OFOA 5BYKA 3IEUA 4P4UA 3SOPA 4FMDB 2RMKA 2BHRA 3WMFA 4EPXA 2AXPA 4IVRA 2G9NA 4ESHA 1GZSA 4A36A 1TL7C 2RGNC 2ZRAA 3EG5A 1J90A 2AFIE 1NBMD 4RD6A 4LGMA 3RS7A 2J1LA 1WDTA 4AKGA 3H4MA 5TMPA 2YINC 3CWZA 2AKAB 1N2CE 1G8GA 3D8BA 1DAIA 3PUVA 2QY9A 2FF7A 2XB4A 1LS1A 2WJVA 4K81B 4Z8YA 3SS8A 3E1SA 1T5IA 1WP9A 4Q9LA 2WSSA 4HDQB 5K8UA 2IBMA 4BQSA 3K0CC 1DO2A 3ZIAA 5EE0A 1ODFA 5GADl 1U2RA 2CLDX 4YC7A 1XB2A 4C0JA 1OHHA 5FBRB 4MRPA 3FKQA 3KKMA 1ZP6A 4NCIA 5AUOB 2QTHA 4LSGA 1RYFA 2RGEA 1U90A 4QBFA 1G3MA 3AVOA 1RJ9A 2JLYA 1TNDA 2ZYWX 2IS6A 2GA8A 4AG5A 3GLGE 2QP9X 4V0NA 2IF0A 4W5HA 2ZS9A 1E9BA 3R20A 3OIWA 3ZLJA 1KHTA 4FMBB 4N3NA 2J41A 4IHQA 1JB1A 4LHVA 4BLQA 5BW8A 1R8QA 3QXHA 1HYQA 2XTZA 2G1JA 3Q3JB 4QGFA 621PA 1VG9B 1QG2A 2JGNA 2MSDB 3FVQA 1ZC3A 1US8B 3K8YA 3N70A 2Q3MA 1YR8A 2ZTSA 4M1OA 1W2HA 1CR1A 5FOUA 4RFVA 1MABA 3NC0C 2OV2A 4CDGA 1T3SA 1UFQA 5HZKA 2WWGA 1FP6A 3CF0A 1QHNA 5EE1A 1E79D 2KJQA 3L0SA 3SHWA 2J87A 1OF1A 4EFLA 1J2JA 2DPXA 1TQDA 1ESMA 5L8VA 5EXPA 4OYHA 1NJGA 4Q4AB 2XGJA 2ZYTX 2WAYA 2E1RA 1KTVA 3EXAA 1R7RA 5JRJA 2W2VA 3IUYA 4YLGA 5SZIA 1VCIA 1ZIPA 2IF2A 2BMFA 3RANA 1UPTA 3GPLA 4JSYA 4JVSB 2PZGA 4PC3A 2FH5B 3PCRB 4C0QC 4ABYA 1DO0A 1Q3TA 1EG7A 2LKCA 5J4KA 1GKYA 4TLCA 3ZS9A 4LJ4A 5J40A 2IYQA 4LHYA 4WA7A 2B7CA 3NBZC 4XTRA 4B44A 4KBFA 4TTQA 3FFAA 2OBNA 2KWIA 2CL7X 2ZR0A 4MDEA 2ZJAA 1T3HA 3A1SA 2HYIC 1UEIA 3FMOB 1P6XA 5DI9A 4PHHA 3ECCA 2IYVA 4HB2A 4KFUA 3THYA 1MO3A 2I1VB 3MWYW 4EKDA 1R8SA 1XJQA 2V1XA 2CNWA 2W00A 1QVRA 5FOXA 2YOHA 1E9AA 1N6HA 4RCZA 2EFCB 1COWD 2WOOA 2WKRA 2OG2A 1TF7A 1YZQA 3LX8A 1XTQA 3ZDQA 4H9GA 4M22A 4OJKA 3U4QA 1G41A 1E2EA 3UG6A 1Z2AA 2OFWA 1XMIA 3AKDA 3RABA 4CRWB 4JVLA 4BLRA 1LTQA 1Z0KA 4ZI2A 4PZLA 4IOMA 2ZUBA 3TKLA 4QM7A 2OEPA 5IDVA 4NZYA 2KBEA 2O8BA 3CPJB 3TSZA 2V55B 3W8NA 1VHLA 3LXRA 1C1YA 3ZVRA 5JWRA 2XOKA 1SXJA 3BRWD 2IYZA 3BB4A 1YE8A 1WE2A 2GCPA 2ZI6A 4BZPA 1JR3D 1OFHA 1IN6A 1XPUA 1FMJA 4D0GA 1H8HD 1JAHA 4A2QA 5IK2D 2DFNA 1BMFD 4UNNA 3RS5A 2GILA 4YXWD 5G3ZA 4BZXA 1KO1A 1R0YA 3SEAA 1IN5A 4FWIB 3A8TA 4JLDA 4LX0A 1GM5A 1XBTA 4YMWA 3MMPA 4RSGA 1NVUQ 1YZTA 4M9XA 2O8BB 2WJIA 3RS3A 3ZD7A 2QP3A 4D0LB 3CR7A 2PL3A 4RVCA 1X1RA 2O52A 4MQBA 4Y0VA 3CF2A 1SXJB 2QQ0A 4PSKA 4MA4A 1TF5A 1KZGB 1NLYA 3H84A 4TQ9A 4CEJA 4BFVA 3VR5A 2GBLC 4KBGA 2E9SA 4NP6A 3VKGA 2GHIA 4KU4A 1GFIA 221PA 5CITA 1ZD8A 1W4RA 3MAAC 4KODA 1K8RA 2JLXA 3SI7A 4IOKA 1X8LA 1L4UA 4OHWA 1KY3A 1IM2A 2PJZA 1E2JA 2EYUA 2A5JA 1M7GA 4D81A 2PBRA 3X1YA 5JI3E 3T5GA 1YZGA 4IOJA 4HI0E 2ZI5A 3U6BA 4QXAA 1B23P 5TB5A 1KIMA 5JSZA 5JJLA 1CULC 3OAAD 1U94A 3PEYA 4BEBA 1RKBA 4A1FA 4TYNA 2ZRNA 2ZUCA 1UJ2A 1QG4A 1GP2A 1R5OA 1HT1E 2C99A 3I1FA 2IYWA 3LBIA 2VSOA 3FGNA 3LLMA 3GEIA 4C0LA 3FPAA 1VIAA 4TN1A 4JLAA 4DIDA 2Q9BA 5BYJA 1RFLA 1HURA 2EQBA 4W9MC 1E9RA 4HATA 2YWHA 1GUAA 1PLJA 5CYPA 1ZU5A 2HLDD 1H8EA 2RGGA 5J4LA 4EJSC 2NMVA 1GAJA 3K9HA 2ZRFA 2GJ8A 1II9A 5JCZA 4OBEA 4UKDA 2P2LA 4AK9A 1G18A 4AKEA 4XVQA 3IPYA 3UATA 5JSZB 1ZC4A 2OSBA 4QNMA 3ADBA 4BRUA 2EFEB 2E87A 2A5GA 4M9ZA 1ZUNB 1ZNYA 3IQWA 1Z06A 1XEWX 2Z43A 4NMMA 4Q01A 1EX7A 1NP6A 1IXZA 2JLZA 2BBWA 4O0MA 3PUYA 2QNRA 1ESNA 2J0UA 1GRNA 5IHPA 2JIZA 2IS1A 2F9LA 3RS4A 3HR8A 1UDWA 2IWHA 4NE2A 3NWJA 4EPYA 1DAEA 3A58B 3B78A 4DLXA 4CGZA 2ZAOA 4MRRA 2RHDA 4Q21A 3TJZA 2REOA 4DVGA 1T4GA 4PC2A 3OHMA 4A6XA 1IAQA 4FCTA 3ZGXA 5AJVB 3I4LA 4ARZB 1N3BA 1NN5A 4QFMA 1NN0A 1S2MA 5JEEA 5FR1A 4C0HA 1Z8FA 1E9EA 3IIKA 4KLNA 4I81A 4X8LA 5C46F 3CX8A 2JEOA 1NBMA 1Z22A 1SVKA 3KJIA 2R6AA 3KXLA 3CPHA 2XSZD 3B1XA 1LNZA 3T1TA 3MCAA 3BFVA 3REGA 2OZEA 1MV5A 1VYVA 2QG6A 1G8FA 4Q02A 4XSGA 2ZANA 1BKDR 2ZE7A 1NSFA 3OEEA 2HYDA 4DSNA 1BOFA 3RRNA 1E0AA 1FNNA 1TMKA 4ZCLA 1CLUA 1OJLA 2OCYC 4URXR 1EESA 3AVXA 1S9DA 2FSHA 2HEIA 2QAGA 1HE1C 1N0VC 1ZM2A 2O5VA 2FSFA 1QVAA 2NO7A 3CW2A 1KI8A 5JZVA 2G0NA 3CRVA 1B0UA 5DI3A 3EIEA 2A3RA 2N1BA 1YHNA 3VHXA 1W36D 1G6HA 5G41A 2VHJA 5KNCA 4NONA 3BERA 2F3TA 1ZIOA 1WB9A 4LC0A 2F6RA 2V6IA 3I5XA 2F1HA 2HT1A 1NKSA 5KDDA 1L7VC 4PO1A 4Q00A 2XNDA 1Q21A 3LAWA 4P31A 1NSTA 1R2QA 4D82A 1G8YA 3R8FA 1UM8A 1AQYA 3L2OB 3FMIA 3B82A 4IDQA 4MUBA 4LZZA 3VX3A 5HTKA 1E2FA 1E98A 2IUTA 3JZAA 3QUSA 3U2QA 4GFDA 2ORVA 3B8HA 3K70C 3F8TA 3BOSA 2QAGB 1S96A 3E70C 5IF9A 4M9SA 2Q3FA 1LV7A 2PLFA 4MYCA 1E79A 2YZ2A 2HUPA 3EIHA 1NMYA 2KB0A 2NO1A 4TZ0A 1NKTA 4HDCA 3TUJC 3SN6A 4M4SA 1DTSA 4M1SA 3IO3A 5GJCA 4LRWA 5GVRA 3ZYCA 2FPKA 3BH7A 3KKNA 2ZS7A 2WIBA 1O3YA 2P5TB 3MJRA 4Q19A 3LW7A 4UJ3A 2ONJA 4C0KA 4KYUA 4TLBA 2WBLC 1IY0A 4CVNA 1W0KD 4D0NA 5BWMA 3SDZA 3SFVA 2J3EA 2FFAA 3GFTA 1KI1A 2OAP1 1NN3A 3Q72A 2JATA 1XTJA 4OK6A 4QJ4A 4IEIA 4M0LA 3UMFA 1IN4A 4D80A 3TAUA 4GOJA 4C0SA 3VU9A 4JS0A 4DDVA 4QGAA 4B6FA 5KO2A 2IT1A 4S35A 4Z1MD 2GAOA 3WYAA 4M1TA 2F7SA 3NG1A 1A1VA 3CUEF 3NBXX 1OFUX 5FPYA 4I1OA 1AKEA 3QNUA 3HU3A 3AVQA 1G16A 2FV8A 1NNEA 2V4ZA 4E07A 2ZJ8A 3IILA 3RLFA 3TNFA 3VMFA 4UXIA 1UKVY 4F91B 2IYUA 3U3JA 4D4JA 4EIWA 3QF7A 1COWA 1GTVA 2Y8EA 3LH5A 4G5OA 4R9UC 3N2EA 1PUJA 2ZSEA 4DCUA 4ZCMA 3RC3A 1MKYA 3L82B 3NHBA 1EFRD 4UNSA 2YWFA 2G6BA 2QA5A 4ZDWA 4BFSA 3AKEA 4II7A 1N5KA 2MSCB 2FWRA 3ICQB 2F43A 2N46A 1NIJA 3BD9A 2WJJA 4Q1FA 2QPOA 2Z83A 3DO6A 4O2LA 1UAAA 3R9WA 1NG9A 1G8PA 1KI6A 3E5HA 5CDFA 1NLFA 5TARA 1CRPA 1E2QA 5EXSA 4Q1CA 1RIFA 3IO5A 3CPEA 3RC8A 5FPSA 2BEJA 4TLAA 5CLQA 4GRAA 4EAQA 1JR3A 6Q21A 1DVRA 1ZVQA 1I2MA 3K09C 4X8MA 1XEXA 3W90A 1XFAA 5KOYA 2IX3A 3TVDA 5IK2A 4DBLC 1BMFA 5H8WA 2ZITA 2JLQA 5AUPB 4Q9HA 2D2EA 4AC9A 1G9XA 4OK3A 2EWVA 2RAPA 3KDSE 1Z47A 1ANKA 1F48A 2CE2X 1D2MA 4BUJA 4TQUS 1SGWA 1ZD1A 3P4YA 4URUR 1YRAA 4DEXA 1KI6B 3VQTA 4B73A 4JLKA 4HUQA 2WWFA 2O8DA 4LUCA 4C0BA 3BGWA 2LCFA 1XPOA 4LBYA 1KNXA 5CLLA 1XEXB 4G01B 1E9SA 2G1KA 3FB4A 2FGJA 5KDOA 1HV8A 2NOAA 4PPQA 2HJVA 2R8RA 1UKZA 4Q4HB 4CEIA 2H7VA 3LW8A 4L9WA 4JMPA 1Z28A 3TH5A 4JLMA 2BC9A 2Q0HA 5DE3A 2ZRIA 1KDRA 3QKUA 1JI0A 3LRPA 4A2PA 1X8KA 5H68A 2OO7A 1P5ZB 1P62B 1UEJA 1TU3A 5J4VA 4NPHA 1KK1A 1PVOA 3FMFA 3SJCA 3OAAA 2ODBA 2PCJA 3JVUA 4AWXA 1RRPA 2NO6A 3OFND 3LQRA 3Q9LA 3GLIB 4LBZA 2OT3B 1GILA 3FTQA 1TAGA 4D4KA 1F3OA 3CO5A 1SKYE 2FGKA 2QPAA 3G0HA 5DLQC 1R10A 4C2UA 2HJGA 3HU1A 4CEIB 5P21A 3EPLA 2V7QD 3HPQA 1ZM7A 3VX4A 3C41J 2HLDA 1E2GA 2D2FA 1Q3HA 1ZU4A 1R0XA 2X19A 3AB3A 3LVRE 3Q85A 1LS6A 4QOSA 4CT4B 2RHMA 5AJXA 4TTRA 5FH9A 2AK2A 1ZRHA 2WMOB 4QKQA 2HXSA 4JYBA 4CW7A 1ZM4A 3NDPA 1DE0A 2QENA 2CCGA 4Z54A 3B1ZA 3PEUA 1AZTA 1BO6A 3AGPA 1JXMA 1JNYA 5EP1A 5JFGA 3LBNA 4PPNA 3AM1A 4DZZA 2OCBA 4Q9JA 5C2JB 4OHVA 4KYIB 3D6TB 2AR7A 1XD9A 1E2KA 5E7JA 3WY9A 2FZLA 4DC9A 4D2IA 2BBTA 4KHZA 5FUYA 1E32A 4LJ5A 4V0MA 3THWB 1SHZA 2W6JA 4BGDA 1X86B 2H5EA 2Z0MA 1HQCA 3MD0A 2CHQA 5M04A 1S1MA 3BE4A 3VTKA 2ZRHA 1GNQA 4RY2A 4MITA 3CZPA 2LWIA 3EPHA 3GJ7A 2Q21A 2BEKA 3R7WA 1F2TA 4XVRA 1I2DA 2ZI7A 2CCJA 2IXGA 4LJ8A 2X77A 1KO5A 4TYWA 4C9BA 5FOWA 4WZBE 4M53A 2R6GA 1XRJA 2CVFA 4ZKDA 1M6NA 1KI4A 1S3SA 3FHCB 4KCGA 3DZDA 1DARA 4QRHA 1K6MA 3LNCA 4FCVA 4B43A 4LC1A 4NYMR 1ZW6A 5DISB 1RW4A 1CEEA 4G1UC 1KK2A 3SBDA 3VR4A 5AJZA 3X1XA 1Z2CA 4US2R 3TVTA 3PR1A 1HA3A 1NMZA 2ZQ5A 1N6NA 3ND8A 1YZKA 1WA5A 4KAXA 3DPUA 4DCVA 5HR5A 4KSCA 5GVSA 3P32A 1MT0A 3THXA 1AS3A 3I73A 4A0RA 4QHTA 421PA 4OJQA 3CRW1 1F2TB 4KVGA 3ONWA 2JJ1D 4MUAA 5E4FA 5C4GB 3RNLA 3A37A 2VRWA 3M0EA 4B75A 2GJSA 3QSYA 2Q3HA 4Q7JB 2F3RA 4W5WA 5KTYA 3D3QA 1Q0UA 1DAHA 5F2EA 2RGCA 1AQUA 1ONBA 1PV4A 1L4YA 2WJGA 1DAMA 1YJ5A 1LF5A 4R7ZA 1W7AA 3OESA 4U00A 3LX5A 1D5CA 2QMEA 3N5CA 4PSAA 2FSIA 4TL8A 1TF2A 2ZE6A 1IQPA 1ZCAA 3L8ZA 3PIRA 5H70A 2GVDC 4W7SA 4F4CA 4DT1A 4FCWA 1GL6A 2AL7A 4QM6A 2ZRKA 3EX7C 1RC8A 3OE7D 3DL0A 3KL4A 4LBWA 4L9SA 5LPNA 2DY1A 4B2PA 2J45A 3OIVA 5KDLA 3THXB 4BRWA 2JLSA 3TE6A 4TSFA 1RPZA 1IY1A 3WRYC 2EFHB 3GJ3A 5DIFA 4JBYA 2IUSA 4ON9A 4XOIA 4BLPA 4ZDIA 1YKSA 3WMGA 3OEED 1US8A 1A7JA 3HYRA 4KFTA 2ODWA 5LB4A 4AIIA 3W5JA 1W36B 4RCYA 1W44A 3O8DA 5SZJA 4YDSA 2AK3A 4MKHA 2CBZA 2ZSDA 3RYTC 1E2LA 2C9CA 2HF8A 3CNNA 4DCSA 4QGHA 3QXXA 2BBOA 4AY2A 5JWHA 4Q4AA 4DT1B 2BM1A 1IHUA 3ADDA 4GMXA 4WW0A 2DCUA 1OV4A 2YOGA 2P6RA 3HDTA 2WWWA 3K1JA 821PA 1RRGA 2H18A 2VSXA 1FX0A 2KE5A 2R2AA 3O47A 3MFYA 4DB4A 3SQWA 4OI0A 1XZPA 3GLHE 3AVWA 4A15A 1AZSC 2NPIA 2FFQA 2FPLA 3T61A 4H1UA 4Z1MA 2OE2A 3NXSA 4DLVA 3B60A 2QE7D 2VBCA 1KI2A 3B2EA 1E0JA 2YV5A 4IEEA 2O8FB 1T91A 2ERYA 3U3RA 5FOVA 1NLZA 4XH9B 1TQ2A 3PUZA 3U5ZB 3N2IA 1G3RA 1II0A 1WMSA 2FN4A 3EASA 1T6NA 3IHWA 4LYHA 5L3SA 3KB2A 1E1QD 4Q66C 1XXHB 2AWOA 4P4SA 5EE9A 3EWAA 2UVQA 2G3YA 3SU8A
chains in the Genus database with same CATH superfamily
2ALJA 2XWSA 1KWGA 4DLLA 1UAYA 4RS3A 1X7ZA 1PR5A 3TEFA 3U48A 3Q8KA 4EG1A 4ISBA 5AI5A 3TLEA 2J6BA 4YJ3B 4WEOA 2AZTA 1FX0B 2OLJA 3LD9A 9LDTA 2Q27A 3A1CA 4HGQA 3BSWA 4H27A 1TIKA 4KTTE 3WQSB 3RC2A 1A5AB 1EVEA 2A0FA 3PYLA 3M6AA 3PKZA 4JB8A 5E0KB 5BT9A 3ND5A 4PYOA 4B0PA 2P5YA 3LQYA 4AYTA 5JQGA 5T4FA 2P1ZA 1Q5PA 2AGVA 1M1NA 4F9TA 2FSVA 4P7GA 3U4GA 1G60A 1LY1A 3PE3A 1DTEA 4JZKA 3WI7A 1W29A 1XLTA 5BOVA 4Z9XA 1RXYA 2UUBB 1SU6A 4NCJA 1JU9A 3G8CA 3GLTA 1NBHA 2V7PA 1R6TA 4KFRA 4DIEA 3C7DB 5KNDD 1O0CA 1TT7A 4ZJZA 3SYNA 1U6JA 3C5HA 3F6EX 1QOZA 1JG3A 5EEGA 3GCWA 4B4WA 3NHMA 4RKYA 1TZKA 2YIDA 3ZKWB 1ENPA 1TPZA 1DTWB 1LLFA 2H7YA 5E9AA 4P4NA 5J2TA 2FK8A 3IC5A 3TTTA 5IULC 2IY8A 3OTQA 2FWMX 4I1RA 4EYOA 2IVZA 2O4CA 4WBNA 3FOZA 2ATIA 5JU6A 5A9TA 2WY2D 2EOAA 4EQZA 1V5GA 4JELA 3GROA 4NV1A 2A5LA 3ZJYA 1NHGA 4F8EA 1J99A 1U3CA 2JH9A 1YZNA 2XMCA 3NGLA 1IHOA 4E13A 1SU7A 3TIGA 4QBTA 3V1UA 3VR6A 5D86A 4D97A 1TCAA 2P62A 4YHHB 2OUKA 4EF5A 2Y0PA 3TQRA 2HMYB 2I8LA 5DBIA 3TM4A 1H94A 2C3UA 4NBVA 3ZNQA 1K6XA 3QLEA 1QF7A 5G2OA 3R5HA 5JHHB 3A6ZA 3IJPA 4IHJA 4WIAA 2CBGA 2EZTA 2L0XA 4YRPA 2ETXA 1KE2A 2GT1A 3QKRB 1YCDA 1CR0A 4FZRA 3TZCA 2Q50A 2XZPA 4BIIA 3LF2A 2JARA 1RR6A 4M7PA 8LDHA 2WSIA 3R8XA 1W1UA 2VVTA 1DT3A 1ZSVA 5CG1A 1T9GS 1MX5A 3DEFA 3N2GB 2GH1A 3TTVA 4C7VA 1QPBA 4EW1A 1H4SA 3WMWA 2O5EA 1NXPA 2XMSA 3WAKA 2IDJA 4QREA 1QX3A 4FI3C 1F14A 1UP7A 2VLBA 3EZLA 4H0FA 4I1UA 1KC3A 2FEMA 1IJFA 2QMHA 2Y99A 1GQYA 2YUIA 3AEQA 1FTNA 5BQPA 1J2UA 3DQPA 4J9VA 2D2VA 1I6LA 4OLBA 4ZO4A 5IG2A 4L4XA 1YFKA 2W0SA 4B3DA 3I3OA 5LBTA 2GZAA 4FMCF 3L7KA 4K05A 4V24A 4AG6A 1QMPA 4CMGA 3Q3EA 5I9LA 3RAFC 3KUDA 3CT6A 4UTZA 3P2YA 3AHCA 2OENG 3REQA 2ZBEA 2YZKA 4EVSA 3G7NA 3D7RA 3W5UA 5T4HA 1DIHA 2CHUA 2FJUA 2H4JA 3B3FA 3PQFA 3OPYB 4D6YA 1J2EA 1EJBA 4RPGA 4NATA 1YJQA 1JHMA 1NNI1 2PT5A 3HCNA 1QFSA 3SE0A 1O08A 2Y0DA 4KXFB 3D0RA 1U2GA 3OFKA 1Z08A 2GDJA 5FTWA 1HT2E 3PFHA 3DDHA 5G0WA 4IMJB 1Q0HA 4AKTA 1CERA 6LDHA 3FCSB 3OTWA 1HYBA 3IT3A 5JNVA 4JLBA 4JXKA 5BSVA 5EHQA 1Z7YA 1I0ZA 2C92A 3OCUA 4IUCS 4JBHA 3L8EA 1DEHA 1ZRSA 3GVXA 4E7OA 4R54A 4FXPA 3UENA 3S5UA 2AMYA 1JHAA 1CY7A 3VM6A 5AVWA 2CDRA 3ELBA 4OSEA 3H5WA 5KQSA 2ZB3A 5CNIA 4XPIB 3E8SA 3I3SR 5LU9A 2HHCA 1AN0A 2G77B 3BDVA 3S2ZA 1Y89A 3C14C 4MUXA 3USZA 3UJ6A 3JYLA 3WGHA 3ANLA 1C7QA 2VT2A 2ZSIA 1KDTA 2FPGA 4OIFA 3ZDFA 4BV3A 4N39A 3IB3A 4Q9IA 4GLFA 4I6EA 4R5HA 4O4IF 5IYZB 3B1WA 1Q50A 3P94A 2ZUTA 1F17A 5DGTA 2SECE 4C4OA 2FE1A 2J3IA 4OP1A 2NV0A 4JUCA 1EX1A 4KGVA 2R7KA 1TYEB 2PMWB 3TQCA 4FGLA 4S04A 1G4UR 5J5CA 4NXMB 4A4DA 4EW6A 2BDEA 4D4LA 3PDCA 5TMEA 2ZLBA 4AMZA 2GBLA 1XI2A 2R751 3GP5A 2EKPA 4TXJA 4RJ2A 1Z4IA 1BHSA 1ENZA 1C4WA 3JQAD 4YAOA 4DAEA 1KBOA 2YXEA 3QEMB 2NTVA 4PQGA 2FWJA 1S1CA 1EK1A 2YFHA 4XE5A 1QHXA 2JBAA 3BHNA 4QVGA 4QYWA 1ND5A 5E4TA 5C8ZA 5AUQA 4DV3B 1TK9A 1M7BA 5EP4A 3DOIA 4GICA 3GR6A 4IO1A 5FTLA 4BU0A 4Q37A 1ZN2A 2JGMA 3OZWA 4XM1A 5MFPA 1S2LA 1YS7A 2AXNA 1KMCA 2CXSA 2J46A 2P9GA 3DBOB 1XF1A 3H11A 4KJXA 5FOSA 2ISSD 3QEOA 1Y1RA 2JI4A 3SXUA 1EVYA 3SYKA 3T7DA 4ARZA 1I4WA 1RCTE 3EXHC 1M1ZA 2R1VA 1J6UA 4RKFA 2ZRPA 4RADA 4N5HX 2CW5A 1PUIA 3QVUA 2IDZA 4JFAA 3IAM1 3UAGA 1FLNA 1K7XB 5TVKA 4HN4B 1OLUB 3E27A 4JA0A 4HWPA 3W4IA 1V4NA 3E9DA 3LBHA 4CKBB 3OY7A 3WLKX 3CVJA 4J0CA 3U13A 2XODA 2P9ZA 3L7JA 5ABPA 1QAQA 1YRBA 2YZMA 5COBA 2VYFA 3M5CA 1IE3A 3L7AA 3IAM6 4UVHA 3NP9A 4FFNA 5AKZA 3U09A 2B94A 5MHTA 4BQQA 2CHEA 4Q1AA 1TAUA 4ZAYA 1O03A 2NQTA 4L5YA 3FROA 2XCQA 1N9KA 1NP7A 2BGMA 5DGIA 3RI3A 5KJEA 3O4GA 2QL6A 2IHZA 1IDN1 3RRYA 1UBLS 4OJYA 5CNMA 3KCQA 5BQXA 3NX4A 1JIQA 1Y3CE 4B3JA 4CWAA 2RHGB 3NTUA 4UBLA 3PR2B 2V7WA 3W5SA 4AW9A 2B8WA 3D7NA 4PZDA 1BG6A 3PEVA 3SHQA 2PXXA 2ZJ3A 1F8YA 1BCRA 3AX6A 3EARA 4DKXA 2CJFA 4EK9A 2NW6A 4EUHA 1T2VA 1NSYA 5LZ7A 4I1SA 2VFAA 4K6GA 5CX1B 1DMSA 3UXMA 3A1UA 3Q9UA 4RH1A 2W58A 3EBPA 4PF1A 4ZO7A 5CURA 3WNBA 4DDTA 1XR3A 5A2QA 3O38A 5J63A 2ZUFA 1KEEB 2Z1NA 3TE7A 3UUFA 5KYWB 3FRJA 1NJ2A 1L1FA 4EFKA 1R8JA 2GPYA 5HCIA 2R68A 1DG9A 1F6BA 5F7ZA 3SX0A 4NNJA 4V38A 1SXPA 1N33B 3L8YA 3B3JA 5AVJA 2D3WA 3AV0B 4NS1A 3WV5A 1KOLA 4BLUA 2GZMA 5GPBA 3VTAA 3RSCA 4GH5A 3IP9A 4EI7A 2XKKA 1TLTA 2HI0A 1MFZA 1I14A 2GPAA 4UMFA 1J5XA 3A6KA 3FWPA 1SNYA 4UM7A 1VI6A 4M0DA 5A4JA 1QDLB 2R6JA 5IRCD 5ALJA 1SC3A 2C00A 3QUCA 5KAPA 3E1GA 3VOSA 2ZBFA 2WTEA 5TJHA 3SLKA 2FRDA 2VQ3A 5LJIA 1X1BA 2HV8A 3EGEA 4EMUA 3P9IA 4Y30A 2XKAA 3CZRA 5G4LA 2FZ4A 1VSTA 4FD3A 3S1LA 4LRQA 4GDMA 1ZJYA 1V9LA 3CLUD 2VYVA 4ZIRA 1M34B 1D2CA 3GEHA 2RGWA 3W8FA 4R2IA 1IOZA 2DAPA 1SIUA 3D6VA 3L4BC 4ZT7A 1U1CA 2Q8NA 1N3LA 4YPVA 1XOIA 5DCLA 4WDQA 2Z56A 1H0KA 4H3SA 1E92A 3G6KA 1DAGA 2Z9DA 2X5NA 1VYHA 2B8EA 4CIAA 4GI1A 2OGTA 2OFPA 4F3KA 5AHOA 1SWVA 4NCHA 1BROA 2JK1A 3NNSA 4ZYVA 5K6AA 3T7SA 4BNNA 4UJ5A 1YD7A 5JD5A 2WHQA 2B4RO 4WNAA 2JVKA 1L1EA 5A6SB 3HMKA 4CETA 1VFNA 1E60A 1WMBA 1DV1A 2NACA 3K9BA 4PYNA 4JP1A 1CS0B 1EM8A 5DW0A 2EF1A 1XAGA 1GNSA 1E1NA 3DZ8A 4TLMB 2JH3A 5E38A 1F5SA 1VMAA 1GUBA 3CKKA 5KTTA 5ED0A 4FDAA 4FFVA 4Z2AA 3ELUA 4P3XA 1DB3A 3L7NA 4RD4A 1GARA 3CCFA 1A04A 1QRDA 1XF9A 4P4TA 1C81A 2JLCA 3GDWA 5C7LO 5CD1A 1JDUA 2Z5VA 1P74A 1BVYF 1JF8A 3CH7A 3QLVC 1G3QA 1L7BA 4Y2YA 5AXCA 3LL7A 3QA3E 2P3LA 1R9GA 4WOBA 5FHRA 2OL4A 1HOXA 2LDBA 2Q6OA 3QP9A 3D64A 5BN4A 3HJAA 1TMYA 4TLLB 4B7AA 3B51X 1G38A 2PFKA 4EGJA 4J2OA 4IINA 4M89A 2AJBA 2XUOA 4PQFA 3TLGB 4LE1A 1GLNA 3O7WA 3QXJA 2HSWA 1XMSA 3TW6A 2C4TA 3EXEA 3IOCA 3DC7A 2DWOA 3ITEA 3GRVA 1GPNA 2DVMA 3CRZA 4LRUA 4YV7A 3AF0A 4HBZA 3VNSA 5LQRA 3KTAB 4HMPA 5BUCA 3F78A 4YUXA 2PXHA 1GGEA 3F3YA 4B6SA 1JU3A 1RXWA 2RSLA 2QMUA 1O58A 3ORQA 3R09A 4RWZA 4UEWA 2VTBA 1AA9A 4IRUB 2W2LD 1R0RE 4QBIA 3UOWA 4N8EA 4W5QA 5JSFA 4LHWA 3I9V1 1KZYC 2ZEJA 1OBOA 2BLLA 3CGWA 2DBVO 3VH3A 2ZTLA 5IUNC 4ZODA 1DX6A 1JFRA 1P1CA 4DNFA 1FPMA 1JDBC 3M89A 1E2NA 1QHHA 3HI6A 2P5SA 2ATVA 4OHYA 3I9V6 3WL4A 1NQWA 1OT3A 3GW8A 3P0HA 4JLUA 4RHTA 2QOEA 4UUAA 5EWMA 4ZARA 4A10A 2C20A 5KNDH 5T4EA 1GSOA 4REQA 3T9EA 1VOTA 3BRWA 3ZIDA 1AKYA 2AN4A 5BPHA 3R2JA 2GCEA 4RK0A 5EXTA 1XVUA 4AFNA 2FOXA 3TBFA 3K0KA 5C32A 4LN1A 1QAMA 1Z33A 4P22A 3OMXA 3EQ7A 2ZVJA 1K0UA 1JH9A 1N1EA 3HZZA 4Y2VA 1T8TA 1XD2A 3GNTA 3KELA 4ZAZA 4B47A 3DONA 1P18A 2FVXA 1RRFA 2O0KA 1FQJA 3CN9A 2FPIA 3N0TA 3CVOA 1MW8X 1FNSA 1N5JA 1Q6YA 4FN5A 2FKAA 4AP5A 3PC2A 4MPJA 1YMVA 1JIJA 2X4LA 2Y92A 2Z6VA 1GG5A 1PSZA 1O96A 2AOUA 4FINA 1C9MA 4U7FA 4L7QA 5DYNA 3MBIA 3SEZA 2EEZA 1XDUA 4H3HB 4LYDA 3TQFA 1LPAB 2J7PA 2VAMA 4AQDA 1PYGA 4R3WA 3ZEAA 1NBIA 2R3SA 1GN9A 3UIEA 2GJKA 1PF7E 2ZU0C 3LU1A 4C88A 4PQEA 3H5OA 1X1DA 1Z6YA 5T64A 5HIJA 5ESWA 2QLLA 3T4XA 1CJSA 5I7UA 2CMDA 3ADOA 3HADA 4UPVA 2ZYVX 3QENA 1R9JA 5JNTA 3L79A 1Q0TA 4RF3A 4NZZA 4YBRA 3IX7A 1A98A 1OCEA 3SZRA 2CXQA 1P60A 1SRQA 2BSAA 3ACBA 1FSGA 3NC4A 4AJ1A 7ABPA 3W2GA 3Q98A 1QP8A 5JASA 9MHTA 3KAJA 3FYCA 4POOA 3HVIA 1F60A 1TUGA 1R50A 4HAWA 1CUGA 1Z3IX 1P4HA 1TJ3A 2WG0A 2CHGA 2QVBA 2Y1KA 5CIWA 4ZQHA 5LQCA 1AZLA 4GP9A 1KZ1A 3D8UA 1P7VA 4IJVA 4CU5A 3WL7A 1BA2A 1O94D 1M5TA 1WHSB 4LXIA 1BFKA 2OQVA 3C3MA 4D79A 5JYBA 2L19A 5DDIP 4UU8A 5JNWA 3C3DA 3KFXA 4M55A 4PZ0A 5J4HA 2A7QA 2QTWB 5ADWA 1SC1A 1ND6A 1I94B 3OJOA 1SR8A 4L2IA 5GGYA 4XDYA 1X87A 4P0PB 4QOHA 3I28A 5H02A 4N47A 4LYJA 2VUSA 5CT5A 4DQDA 4G1CA 2VHEA 3PFWO 5KVVA 1GTSA 3WJ2A 5IN5A 5C80A 2K7FA 4DA6A 4NY1A 1ZYUA 1UIRA 2F00A 3KPJA 3Q3VA 4MHSA 1TM5E 4GLOA 4Z7QB 1UPAA 3OD5A 4PQRA 4IXDA 3J80A 2QLNA 5B5SA 1NKVA 4J1SA 3F7OA 1FFGA 3QNMA 4MMXB 4NIMA 3VO1A 4HNSA 2BHNA 2X14A 3AH8A 1YA6A 3GCGA 4MVJA 4GUDA 2YJNA 3OJLA 4G56A 2DBZA 2QYOA 1JLHA 1NVBA 4E4YA 3B7GA 3PE6A 4MA5A 5JMWA 3JAWA 1YBFA 3HL0A 3QVJA 2VS1A 3GLGA 2B8NA 4DLBA 2XKJE 4G8JA 2CDNA 3O1IC 4MSUA 1TX4B 2GPNA 4F5ZA 2QTAA 4M7OA 3GJXC 3TMAA 3VR5D 3FPLA 5JJ5A 1EK5A 3DYVA 5J5VA 1YH3A 4TWIA 1O5TA 3SWWA 4MVJI 2QUBA 5EL0A 1QYVA 1RWXA 1T3LA 4TS3A 1AA6A 1T4DA 2E37A 2XQKA 3M5DA 4P9NA 2WM2A 2J0EA 3LZ6A 4QQFA 4E2WA 2MIIA 3LYUA 4JJ4A 2OYRA 16PKA 1QQ5A 2PWPA 5HIIA 2UZ3A 5ALSA 4LWZA 3PQ8A 3OHSX 4KJZA 5AKIA 1FP2A 1KY2A 2L82A 4ZN6A 1XKXA 4H1VA 5A7HA 4C5BA 4DNQA 3CBGA 4DRZA 3SX2A 4BJ6A 4HHEA 2IELA 2EJCA 4I50F 4K6KA 3FWZA 1XNRB 1RM3A 1H5QA 1X92A 2SHKA 3HP4A 1QCZA 3QVGB 5EUMA 4GZMA 1E2HA 1PTKA 4BNDA 2JFOA 2QJOA 2XE6A 1DDOA 3R9IA 3LHFA 1N0UA 3CNOA 4C20A 4UVGA 3NIWA 3AJ8A 4CCYA 3MUNA 3CX7A 4CKYA 4UU1A 3NGXA 4F12A 3KQMA 2C2OA 2JAPA 3EC2A 3G0DA 3P0FA 3PCXA 2YVQA 5FL7A 4XB6B 5A05A 2JGAA 3GY0A 3OPNA 4EJMA 3V2HA 1EG2A 4FFSA 1CT9A 3O1JC 2XNKA 3HFSA 4LMPA 1A71A 1T8WA 3EQ2A 4QSHA 3BXXA 3C15C 1U04A 1Y1KE 1V7ZA 1KJWA 4GKKB 4GE0A 3NKFA 3UHJA 4CG3A 2IS2A 2BI7A 3LFTA 4HGNA 5K0SA 3HGQA 3MTEA 3R3HA 1KK0A 3Q7EA 2RI6A 2QZ4A 3PUWA 2CD7A 3A36A 2P1DA 1QIHA 3QMWA 3R1IA 4I6JA 2XWJI 4O29A 2FRVA 2X6RA 3AP3A 1SBNE 3AVYA 2A9QA 1BGVA 2V5VA 2Q7OE 2GSDA 5HUQA 1XPRA 5IUJC 2V6JA 2VQDA 5F1PA 4DYHA 2VUIB 5I7OA 3NATA 2N0SA 3PHIA 3PXUA 2NUPA 3S1AB 2ZJ7A 2DFKB 4S1PA 2B92A 1ULHA 1FUYB 1FA9A 1WBJB 3NBFA 4IJMA 4JOBA 5F51A 3ZPXA 2CFOA 4H15A 1L3CA 2B69A 4RVDA 4EMTA 2EW1A 2PZLA 3HYNA 2JH8A 4DLZA 4WXRA 2GEUA 4JR1A 5JO0A 1Z5ZA 2R44A 4CNBA 3E35A 2FZVA 1IATA 4IFIA 4DWWA 1S3FA 1FW8A 2CVOA 1IQ0A 2ZVDA 4OBXA 4RORA 4EWLA 5EHZA 2RHCA 3PQ4A 3WXBA 2EP5A 1DEXA 3CZMA 3MSCA 4Q48A 3VQTA 1EHCA 4HB3A 3ZWQA 4JSTA 3HL4A 1G5TA 1F2UB 1HPLA 4I8XA 4M21A 3OZIA 5HKOA 3D7MA 1H85A 1CJBA 4P33A 2X22A 1Y5RA 2IV7A 2O8FA 4Q0MA 4RJIA 3AKZA 1ZJJA 4N7MA 3KJHA 3LCRA 5BN5B 1KZ6A 3UC9A 5HX7A 1KQFA 3IQFA 3CA8A 1T4CB 4LJLA 3H04A 4X1OA 3GNQA 3U9SA 3QQPA 2PS0A 4JQSA 4XAQA 4AB1A 5B1DA 3BCHA 5KJ6A 3B6EA 3RWMB 5CR9A 2EGHA 1Y5LA 4YCSA 3R4CA 1RWOA 2F3PA 1KI7A 2GWHA 1L8OA 3AU8A 3GT0A 1J0CA 1PJ8A 1T36A 1U7PA 2FDXA 3DS8A 3GFSA 4HUJA 5TR9A 5AVOA 3VOAA 2XGGA 4MW5A 3QBTA 3TLKA 1ZA2A 3DNPA 5JD6A 3NEPX 3UMRA 1OYOA 3H19A 1UBMS 5EESA 3I23A 4AO6A 4DA8A 4P7FA 1N77A 3AUKA 1KYWA 2CJWB 4GOOD 1KDVA 1DKLA 3NHKA 1MZPA 5KSYA 1L0BA 2C98A 2LTAA 4KMOA 4Q4JA 4BMDA 4E5KA 1PL6A 3NM5A 3KVYA 4IXWA 3IMEA 2D3TA 4PRYA 4L8YA 4DNPA 4E22A 4EMSA 2ZIGA 4EPWA 1EDZA 1UK8A 1X70A 3PL5A 3OPMA 4O4JB 1HZJA 2QIOA 2HPHA 3K0CA 1JQKA 5C1IA 5JANA 4HH4A 2PIDA 2VH5R 3HVKA 4ZOEA 3FHOA 5AVKA 4XDHA 1QOQB 4PVCA 1KOFA 4MNTA 4ZI7A 1VLJA 4JP8A 5E6UA 3KQLA 3MK31 2IL1A 1SPBS 1X1CA 4KGZA 1IXKA 5LQAA 2QQEA 3G2KA 3GJ4A 1JLSA 1KAQA 1Y98A 2QDKA 2BFBB 1AKMA 4CTKA 4I5EA 1G21E 2FEPA 2QN6A 2WYOA 5LKRA 1NA5A 1NFRA 1XRNA 2XMBA 1K75A 3DAPA 4N0EA 3BTOA 1J39A 3CO0S 4YMSA 5F1OA 1XLTC 2R4UA 3RUCA 4R40A 3SBOA 2GETA 5I4BA 1JIXA 4Y2PA 2CUZA 2OVBA 3TR6A 3U40A 3URMA 2UAGA 1GTL1 3AJEA 1B00A 2XH8A 4TUYF 4KP7A 3JTEA 2PMDA 4PTZA 4OHFA 3VDNB 4AZWA 2I6XA 4BO7A 1V6CA 5LDHA 2G80A 4U7PB 2J6CA 2A0YA 4ILEA 2XXAB 1H2YA 2A7XA 2DT8A 3GJ8A 2VAWA 2X5JO 4RZ3A 5FPTA 5DNCA 1GA1A 1JFVA 4K3UA 3OF5A 2F3SA 2ZU6A 4HZGA 3RU2A 3AEXA 2X2EA 3OQ6A 1EX9A 4MGYR 4B6GA 2N3ZA 5EQFA 1SCNE 4B2IA 2GUWA 1X14A 3UF0A 5KU1A 3QWBA 4F1JA 2VH2A 1O6ZA 4ZO8A 5KSOA 1CJUC 3VC1A 4QIHA 2IYSA 1M2NA 2ZKLA 3HMQA 3QKTA 3OKPA 4YNBA 4M8SA 2EW2A 4JENA 1G5QA 1F7UA 1E3TA 4FDLA 3NFYA 2O19A 4UNIA 4F45A 2CVHA 4CLEA 1HLFA 2O2XA 4MUIA 4WESA 3RVRA 2XWBF 3WMXA 4IICA 1ETUA 3IMKA 4RVFA 1LBHA 3RNOA 3ET5A 1UK9A 4N8DA 4RZXA 5EVJA 3TG2A 4R9VA 4I46A 2PQ2A 1R64A 3DUFA 3E3NA 5JYEA 1XZMA 1EE1A 1NBOA 3CRRA 4PM4A 1PGNA 2YASA 4OXNA 4NYMQ 2PJUA 2QD4A 1DPGA 1JJAA 1TIPA 1X7WB 2WHYA 3G2MA 3BX1A 3GQBB 3SSNA 5CDYA 3EIXA 3E18A 1JFFA 3OZRA 4E5SA 2Z9BA 4BKUA 3WIOA 2YQZA 4OJMX 5EJEA 4DCOA 5AW6A 5AKEA 1E3IA 4PZYA 5KNBA 2VO1A 1U0OC 3JATB 4GOMD 2ENWA 3AR6A 4JL6A 4X92A 4GVPA 3HDYA 3CE6A 3HKCA 1YQEA 2QGNA 5EMMA 4KXYA 3DZKA 3GJ6A 4AYWA 3JWIA 2H6EA 1P2UA 1QUFA 2VJMB 3DD1A 4FX2A 4XGQA 3U49A 5GJWC 4BVBA 4CMIA 1V26A 1KEVA 2O1XA 2UZ1A 4WLOA 3W1EA 3P9RA 4AD8A 1U2GC 3T3PB 5HDQA 1Q44A 2MMCA 3L1UA 3JVDA 2NADA 3KXIA 1NE2A 3NP7A 4TL9A 3E2MA 2WKSA 3MOGA 4UHKA 1SUAA 2QGZA 4V1CI 4DLUA 2C3YA 1FIUA 3ZQKA 2HMSA 5FNVA 1SA0B 4TLDA 3RKRA 1Y5NA 2IXTA 2P2SA 1QO0D 5AVXA 5EP3A 2SCUB 1KJ9A 1MDBA 2OECA 2XNHA 3BWVA 1WW2A 1ZCZA 4NYJR 3NHWA 2P2YA 5A5GA 2W6IA 1MO5A 2P67A 1KNQA 5GP1A 4UXJA 4U7HA 4HY3A 8MHTA 3UH0A 3FWYA 3NJ4A 1KAOA 1FUIA 1CIPA 1P4JA 3R0XA 4HH1A 4L9AA 4FFOA 2GPJA 4D9NA 3PK0A 4RD1A 4F93B 1QB8A 3BFPA 1Y1LA 4I08A 4IFEA 5ALFA 4DCNA 2BFFA 1U81A 1FZQA 2ZUDA 4ZQFA 4FDUA 3KKKA 5SY4A 1IUOA 3S0JA 2WJHA 3C3JA 3T34A 4AJPA 2YXNA 1TT5B 3EODA 4BVGA 4NDAA 4DJDC 4OO3A 4NEGA 2H7XA 1B26A 1TIBA 1TOAA 1ICEA 1QKIA 1UANA 1YHYA 2CMGA 1E3EA 2CFSA 5D6NA 3IUMA 4UU0A 3K6SA 5JPCA 4D7AA 1KYVA 4XD7D 5KKAA 4PG5A 2QK4A 3IVMA 3OT1A 1JI3A 2VP3A 4A0HA 2OHXA 4ZZIA 4C29A 5LXTA 5DX8A 4MR8B 4DIFA 3RUEA 1ONOA 3NRJA 4JL5A 4XR4A 3LHDA 3Q0EA 3OUZA 1N2HA 4DV7B 1WVGA 2HQSA 1ISMA 1P1BA 2G4LA 4L95C 5FUVA 4HDNB 5ICFA 3ZDRA 1VJTA 4U3JA 4Z6KA 4MVWA 5DCUA 4RPHA 5EXDA 3VKWA 4HCJA 5IJ0A 5HRUA 2A9OA 2RONA 3L01A 3R77A 4FMPA 2PA0A 1A69A 1SG9A 4P38A 4ZT6A 2GYUA 2YV4A 3GD7A 1WSDA 3WWPA 4QULA 4R9RA 4U0JA 3ZE1B 1XZ8A 1W4ZA 5HYVA 3H3JA 2PGDA 5E9JA 1FLAA 2XF2A 4ZRDA 2BGGA 3TRDA 2NP7A 4J0GA 1AD2A 2R1TB 4FSDA 3VR5H 1G2QA 2Y1FA 5CGZA 3VPXA 1AHPA 4U6SA 5KQRA 3CMCO 1YR2A 4B9AA 4C4PA 1YRLA 3EVTA 2FMUA 1D7OA 4N0MA 4OCZA 4BPRA 2ORYA 4GT1A 1T0JB 2J30A 4MZXA 3PLRA 1E5VA 3QIAA 3X1WA 2XNCA 1GGFA 4G41A 3IRUA 2FPWA 1MH1A 4JITA 5H81A 4EKGA 3ZVLA 2JKVA 4BQRA 4J03A 1KSGA 2GOYA 2O8NA 3UKOA 2ZVPX 1LU9A 2XF8A 5EPUA 3KOMA 3TK1A 4Y6SA 5TS2A 5C4MA 1HNWB 1UP4A 3AG5A 1Q7TA 3AIIA 1NQXA 4HC4A 1EFDN 3DAHA 3DXXA 1YU9A 2C9MA 4Z49A 4PYKA 5KQGA 1A27A 2EFDB 1YOVA 2IPLA 2R65A 1EHIA 1J8DA 2G04A 1FL9A 2V6BA 1AOXA 4O6VA 3ONDA 4N0DA 3GVCA 4HFNA 2BMVA 4R98A 3B1KA 5TPZD 2Z95A 4KIUA 1U4NA 1XX6A 5EHNA 3V1LA 1HDIA 4DCMA 6ADHA 3CXUA 1QM5A 2D1FA 2VP5A 2AR9A 3FKSA 1BOOA 5CYOA 5BV1A 4MS1A 1OLXA 4AURA 4J76A 5FV7A 2JDIA 1CJKC 4CZ2A 2PMKA 3IS3A 2E49A 1NOIA 1G2PA 2GN2A 5CEEA 1IONA 3AM5A 4F72A 1ZJ5A 4O1HA 4XCVA 3WV4A 4D9EA 3EIWA 4XARA 5IT5A 3N2KB 4XYBA 5EHXA 2QR2A 1RQRA 4G0QA 2A86A 1GTMA 2H4XA 5EIHA 3M6UA 5K51A 4BHTA 2QAGC 4U2EA 1T43A 1BQ4A 3D0KA 5FWYA 2PSEA 1J7JA 4X8HA 1G6Q1 2DFLA 2I1WA 3NOXA 1VRCA 1ST2A 2YS6A 2QI9C 1OIWA 4JC4A 4QJBA 1UZNA 3SBEA 1Z07A 5DYIA 1QIEA 2D0IA 1DPFA 3TGLA 3T7TA 1A9TA 3AERB 1SY7A 1NWCA 4M8LA 5SYMA 1JU4A 4UU7A 5AVVA 4B2LA 2BPOA 3G1WA 3TLBA 3CLKA 3JVVA 5K6AC 3EXHB 3VR4D 2YRFA 2I91A 3TTSA 4FGZA 4EHFA 4E5UA 2Z6AA 1ZQ1A 1J9GA 1W0JD 3PFGA 2IHBA 4MAMA 3G88A 4G37A 1XTBA 5DCYA 4EJFA 4LHEA 4UC0A 1AQIA 1XDWA 2I3AA 4AX4A 3RRZA 2XRZA 2JZCA 1T0UA 3QELA 5BSUA 1L5VA 1RPTA 2I29A 2BKEA 3RJMA 1ZZGA 4DC0A 1C3OA 2FFHA 3DA8A 1ZOSA 3SFTA 3BIFA 3MN1A 3WZ2A 4LV6A 1RKUA 1X77A 3KQYA 5ICSA 3OQHA 4QARA 4CDNA 1EXMA 3EDOA 1GGKA 4LYFA 2Z4RA 3G68A 1PS8A 3A6FA 1WUTA 3KBBA 2NV2B 2B9VA 4QX6A 5TLSA 3QGMA 4CDRA 4B71A 1MENA 3NASA 3U4HA 2RHHA 3AOEA 3K0EA 2NAPA 2FETA 4QFCA 5H3CA 3V55A 1KFEB 4RXUA 3QMPA 1M33A 2YHAA 5F76A 3DD5A 1W5TA 1JAIA 1XE3A 2BRUC 5FO0A 1OH7A 5K2OA 4DDMA 1DC3A 4WJKB 4DLSA 5H9WA 2HCBA 4RQAA 5FQOA 3P2EA 2YC2C 3DCJA 3GUYA 4JOCA 5L3QA 1I2CA 3KWJA 4LVNA 5DM60 3BMCA 3F67A 2NU8B 3UH1A 3ABSB 3C74A 1KQ3A 3PNBA 3C6QA 4NV3A 1W2GA 4TSFD 1L1QA 1GDDA 3WGIA 1I3LA 3GUCA 4MRSA 3JS5A 1V45E 2LR0A 2ZJYA 1VCOA 5CAEA 3W5BA 1C1DB 2QTZA 1FTSA 4Q9DA 3KJGA 4TTAA 4FKMA 5B6JA 5HKKA 3GVIA 3LX6A 3F4BA 3ONNA 2IWRA 2RGXA 1ZS9A 2HUNA 2O8VA 3IJRA 4B74A 4LI0A 4BMOB 5ISMA 1NFQA 5ELXA 2WVJA 2ROQA 1G19A 3L46A 1I5OA 4CI0B 1YE5A 1DBRA 4KACA 3Q7QA 3COZA 5I47A 3BJZA 1LJLA 3CXRA 2WNSA 4AMUA 3ZYZA 4ECAA 1LVGA 2REQB 2YN2A 5HRAA 3IEVA 5DBEX 1Z7EA 5C1PA 2IIPA 3INRA 3VJMA 1QQ7A 2I8AA 1II8A 2GO7A 1JKJB 2X8JA 2YV1A 2BHLA 2V9PA 3QG1A 4WCFB 5E4JA 3R76A 4TS4A 5AM1A 5TMDA 1X7HA 2GEKA 3R3XA 2AF4C 4AUKA 4MICA 2HADA 1UQTA 3QYFA 4G8DA 4EL0A 1F8GA 3HBAA 1ILEA 1W48A 2PUGA 4NOJA 4ZVKA 2C2XA 2EDAA 4H3KB 4ZDKA 3OM1A 1M9NA 3OH8A 3WJAA 3GZNA 2WMDA 3COPA 5DRYA 5DX0A 4TWZA 3EXG2 2OBMA 5ITVA 7YASA 10MHA 3BUSA 2JD0A 3AETA 2FMXA 4PINA 4PG7A 3ZOZA 2EX1A 2WJYA 2KQUA 5GM2A 2VQFB 3I6IA 2XBLA 1E1RA 2PD4A 1P75A 3C7TA 1R4NA 2PH1A 2VWQA 5F2NA 3ZJ4A 3WQBA 4UHBA 3LUPA 2ERXA 3BA1A 3QHQA 1G59A 2G63A 4XVHA 3LY5A 5HMLA 2JGDB 2WAXA 1DBWA 3AEUA 1JX6A 2IK8A 3ECSA 3PE4A 3ROMA 3T3GA 3ZY5A 4MXDA 1NAIA 4LTDA 4DQVA 2YWXA 3LPCA 4UARA 3TX2A 4WZBA 4B8ZA 1U3TA 3R7DA 4YFYA 5BUZA 4FB5A 3A1WA 4Q7QA 2VNHA 1EK0A 1N6IA 2R1UA 1F4VA 2OO3A 3IKLA 3OQIA 2ZATA 1Y1QA 3WLFA 4LJRA 1H9AA 1XZGA 2QAJA 3IUBA 4ZOQI 2O06A 2DECA 4CV0A 2D7CA 5DZSA 2GVZC 4R8KA 1JPNA 1BCSA 1CFJA 2IXAA 3L06A 1MQ8B 4NU8X 4QGGA 5SZKB 4QTYA 4CEHB 2PGJA 4JUDX 4GKJB 4JXJA 4RW0A 4RZUA 3RVNA 5KYGA 2RHRA 1HFJA 2E3JA 4M54A 1KBQA 3WIUA 1TVMA 1EDBA 3K8QA 2BIFA 4FYIA 3U56A 1NXQA 5B1EA 3AXTA 1SQFA 1M66A 1MJFA 3HB1A 4GMDA 4PPYA 4C78A 5FWDA 3STXA 2G7ZA 2F43B 4H60A 4HWKA 2Y71A 1B8OA 5CVDA 5ENVA 1Z29A 4M8NE 1ZLYA 4TPKA 1G4HA 4MQMA 1E4EB 2XUIA 3OZUA 1YK1A 4CQMA 3TR0A 2XJ4A 3F8SA 2QVLA 4K8OA 3ZOKA 4DCGA 1THTA 1L2TA 4ACAA 1JDBB 1Z3CA 1RRKA 4HSGA 1RQ7A 2Q8QA 5IABA 2PNFA 3OOEA 1VJGA 1KKLA 2ZQYA 1Q1GA 2EZ8A 4QG7A 2ZTHA 3JY6A 2ZIUB 4IPTA 2HRDA 4GYKA 5I8ZA 1K2VN 1NW3A 3H5NA 3T5CA 3OTOB 3TECE 3IOEA 3L4KA 3FWNA 3RSGA 2NTNA 1N2CA 3M4YA 4G89A 4XFKA 1O1YA 1U80A 2PX3A 2X76A 3PRHA 5LIRA 1PR4A 4CIDA 1YFZA 1PWYE 1A4XA 3CUKA 3WGZA 3NDJA 4RHEA 1B1AA 2PBLA 4DB2A 3M4JA 2NTYC 4D6PA 5J43A 5JOQA 3VVMA 4AP9A 1KC1A 3HQ4O 5GJBA 4RZ2A 1A8SA 2DHQA 3OZCA 4DHWA 4MP3A 1HTTA 2MYTA 3PP8A 5JD3A 4C6RA 3WYDA 3ABQB 4PO8A 2QW8A 2F1JA 3AJ9A 5CTJA 3GRCA 4HS4A 5EKTA 5G0TA 1UCFA 1YDWA 4JI2B 3AUJB 4XIGS 1UT5A 2ZULA 2W2NA 3DT8A 4LV8B 4TKLA 3L7CA 3EISA 2YBDA 4DRXB 3T9DA 4UAVA 5E7QA 1NONA 4I2VA 2AOWA 5JJIA 1QP4A 1MC8A 1NDUA 2ANBA 1QCCA 5BNWA 3VH4A 4U4AA 2AN1A 4NYIQ 3UMBA 5GOTA 1YDGA 3WGUA 4Z7NB 1BXZA 1PZNA 4O08A 3TW8B 1X19A 2PH3A 4GNKA 5LOVB 4GMHA 1E6WA 4UHDA 3G0CA 2G9RA 3OKFA 5DH9A 4H1HA 1JE0A 5JATA 2XT0A 4BE4A 1BJRE 2C9OA 3NBAA 1K08A 2ID4A 2YDYA 4LZLA 4JNCA 4YJGA 3NDIA 2ZWIA 1YGYA 1U65A 1EFUA 1UKYA 1V11A 4FYVA 2GFQA 2VWHA 1K4YA 2Y1EA 4KPUA 4QD3A 3NHPA 3N8HA