2K2QB

Complex structure of the external thioesterase of the surfactin-synthetase with a carrier domain
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
242
structure length
242
Chain Sequence
b'MSQLFKSFDASEKTQLICFPFAGGYSASFRPLHAFLQGECEMLAAEPPGHGTNQTSAIEDLEELTDLYKQELNLRPDRPFVLFGHSMGGMITFRLAQKLEREGIFPQAVIISAIQPPHIQRKKVSHLPDDQFLDHIIQLGGMPAELVENKEVMSFFLPSFRSDYRALEQFELYDLAQIQSPVHVFNGLDDKKCIRDAEGWKKWAKDITFHQFDGGHMFLLSQTEEVAERIFAILNQHPIIQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrocidine synthetase 3 (Tyrocidine synthetase III)
publication title Structural basis for the selectivity of the external thioesterase of the surfactin synthetase.
pubmed doi rcsb
source organism Brevibacillus parabrevis
molecule tags Ligase/hydrolase
total genus 44
structure length 242
sequence length 242
ec nomenclature ec 3.1.2.-:
pdb deposition date 2008-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2k2qB00
2R8BA 4UFOA 1NX9A 2PUJA 3CCBA 4QNNA 3WKEA 3E0XA 1BEZA 3AZQA 5EIHA 1F6WA 3OM8A 1Y7IA 2DQYA 1DWQA 4MWSA 3KOOA 1EA5A 1YA8A 3I6ZA 4D9JA 4IO0A 3FWHA 3NGMA 5HQ3A 4IQ4A 1ZD4A 1DINA 5ALJA 3C43A 4HXGA 5CBKA 4G9EA 1S8OA 1MX9A 5IVIA 3F67A 4BYMA 2OPHA 2C0QA 2Y2UA 2HU5A 4PSDA 3H17A 4X85A 3BDIA 2IITA 1AQLA 3OPMA 4FDMA 1W75A 3GBSA 5HF5A 1CUAA 4JEIA 4QWWA 2H7XA 2K2QB 3WKBA 1ZIXA 5A2GA 5KWIA 4UUQA 3QMMA 3D2CA 3MUOA 2Z3ZA 4FBLA 3L1IA 1CFJA 4KAAA 1J2EA 2HHAA 4W9RA 2C0PA 3IULA 2XQKA 2R11A 2OCIA 4PO3X 6YASA 4UHDA 5SYMA 3WKCA 2QS9A 4BAUA 4OD0A 2OCGA 5CRIA 1HL7A 1BROA 1DTEA 3G8YA 1G5FA 2ZYHA 3IVMA 5EHQA 4ZGBA 2J4FA 2QXUA 4J0IA 3HZOA 4BVKA 4OU4A 1H2ZA 4ZV7A 5C8ZA 5HQ3B 2B61A 2ACKA 3V1MA 2B20A 1CRLA 5LZ8A 5JATA 5D7BA 2XQGA 1XQYA 4GEGA 1U65A 1XLWA 2OLEA 2UZ0A 3BDVA 4C4ZA 3DDUA 2XUDA 4UBJA 4FWBA 2WG0A 2VQ6A 4E14A 5JALA 1SFRA 1UOOA 5DYYA 1N5MA 3WWOA 4U2EA 5IKXA 3DOIA 1JJFA 3AINA 3HI4A 4UHHA 5KWJA 1Y7HA 3H2GA 3DOHA 1CUIA 2PVSA 4MEBA 2WLSA 2FJPA 1XKTA 5FRDA 2I78A 3UUFA 2CMFA 4CIAA 5AK5A 1Q0RA 4C6HA 2ACEA 3F98A 4KYVA 1E3QA 4WFIA 2QR5A 2JEYA 1UXOA 5JZ9A 1QIDA 3H0CA 3B5EA 5BWCA 5K3FA 3FSGA 1LZKA 5AI9A 5I9IA 3QPDA 3OG9A 5CT8A 2BUCA 3QMVA 2H1IA 4HRXA 3O4JA 4KE8A 3TRDA 1SCQA 3STTA 1ZOIA 4G8BA 5LZ7A 3M82A 2ZJFA 4OB7A 5T4BA 4CG2A 2FX5A 4J0DA 1QIMA 2ONCA 3IBTA 4KJXA 1MJ5A 3PFBA 4WY8A 3IB3A 1BN7A 4B84A 5JD4A 2WUFA 3ESDA 1EI9A 4K6KA 3C45A 2XQIA 1CUBA 4LHEA 4HRYA 2ZYRA 3BE8A 1LGYA 3GUUA 2XUFA 4RE5A 4TPKA 4Y9SA 5ALQA 2YASA 4OB6A 3RLIA 4MWTA 1CUXA 2C5GA 4JYPA 4GECA 5LKRA 1TCAA 5EIAA 5C8VA 4HVTA 1EDDA 1LBSA 3WWDA 2I3ZA 3R3UA 3W06A 2HU7A 5AP9A 2VJCA 2QT9A 4AO8A 4W1RA 1P0MA 3VJMA 4CCYA 4YPVA 1CR6A 4QZVA 2VJAA 1XRQA 1JJIA 5DYTA 1YASA 3OC0A 2ORYA 5K3FB 3I1YA 2QJWA 5CT4A 5AK3A 3QH4A 3DQZA 2C58A 3C5VA 3H2JA 3WZMA 4EY5A 2HL6A 3IUMA 4H7EA 5H3HA 3A2MA 4WJLA 3EIOA 4B9EA 3ZLUA 3O9VA 5HKBA 5HF6A 2OGZA 3LCRA 1FFAA 4AO6A 2WHQA 2X76A 5EGNA 2ZYSA 1NU6A 1O6GA 4Q3KA 5ALYA 2WTNA 5FKJA 5FDFA 1ZI8A 5K3EA 3AZOA 1CUCA 4LXGA 4G4IA 4U2FA 4Q1VA 4BTLA 2AJ8A 4AMZA 2Q0XA 4P93A 2HA3A 1JU4A 1TRHA 2CZQA 2XMQA 3DYIA 4X3CA 2WUGA 3R3XA 4FBMA 4ZXFA 2WG1A 5LZ5A 3O4GA 1BRTA 2WKWA 4G4JA 2W6CX 4J0KA 5JAHA 1XZLA 1E8DA 5AI8A 3RKSA 4UBMA 3IIIA 2HFJA 4AZ3A 3GA7A 3G9TA 4BZZA 4E46A 5AM5A 3DKRA 2V97A 1THGA 3W9BA 3HABA 1YCDA 4UFNA 4EY4A 4CCYB 3CN9A 4JYMA 4HXFB 1MNQA 1CLEA 4ITVA 4MQMA 1VJ5A 1YB7A 1XFDA 2WIGA 4UHCA 1P0PA 3KWJA 2X5XA 3FSGD 4H77A 5YASA 1RP1A 4Y2QA 1R1DA 5K3CA 4AN1A 4LXIA 3G0IA 2JGJA 3F8SA 1BCRA 4M0MA 3WJ1A 2XB6A 4PW0A 3SK0A 1ETHA 4EA6A 1BU8A 4OB8A 1W76A 1IUPA 3R41A 2ZJ7A 5AO9A 2WTMA 2ROQA 1R4ZA 5AI4A 2B4KA 2BJHA 3I6MA 3QZUA 3FLEA 1ZGBA 1VXOA 1L7RA 2YXPX 1QFMA 3ICWA 4UBLA 1QONA 3L1HA 2GYUA 5DTJA 1C7JA 4X7BA 1L7AA 5ALWA 4X91A 5LP1A 1EB9A 4L9AA 1XROA 4X6XA 2C5FA 4BCBA 1DQZA 2WM2A 2JBWA 3H1AA 1GKLA 5ALRA 3LS2A 1WOMA 3KD2A 3WYNA 1PJAA 2HA5A 3WK5A 4DIUA 5CW2A 5F4ZA 1W52X 4JNCA 4P9NA 4AN0A 1LZLA 2G63A 2QRUA 1UZAA 3AJAA 1UKAA 4Q3OA 3IUNA 4KEAA 2OAEA 5ALFA 4DTCA 5E2IA 1HKHA 1UOQA 2FJ0A 4IH1A 2QOEA 5T4FA 1GXSA 2AJLI 4B80A 3UUEA 2WHRA 4EY8A 4QDTA 5DYWA 4C89A 2IIVA 1MTZA 5AI6A 1AX9A 3I28A 1GZ7A 4A5SA 4H7JA 4Y2TA 1QJ4A 1ZD2P 5JYCA 1ZD3A 1N5RA 2V9ZA 3IA2A 3CCCA 1BEEA 4ETWA 5FV4A 5ISMA 4BAZA 4Y7DA 2ZSHA 4KE6A 5FPQA 1Z68A 5I7UA 2XMRA 4V2IA 1XLUA 4PF1A 3H2IA 3VKFA 1EHYA 2O7RA 4RE6A 1XZIA 3G02A 3M3DA 5K3BA 2VTVA 4Y2RA 1JT2A 2WJ3A 1EB8A 1OILA 4K6HA 2GBCA 2WJ6A 4B0PA 2AXEA 3PF8A 3STWA 4MYSA 3S8YA 4B81A 1XZJA 5C8XA 3LP5A 1THTA 2HU8A 1RWQA 2WFLA 2QUAA 1EXWA 3WWEA 3MVEA 5LZ9A 1VE6A 5JZBA 2WIJA 1ORVA 4UBIA 5ALUA 1KEZA 3H1BA 3ZPXA 4Y2XA 4FNGA 1EINA 1R50A 3F97A 3FYUC 4X71A 3AIMA 1RYYA 1U2EA 3G9XA 1QIIA 4G5XA 2XUOA 1VZ3A 1VZ2A 2RAUA 4BP9A 5EFZA 4GBGA 5AOAA 1QO7A 1LPOA 2XQFA 1QIHA 3X3HA 3C8HA 4UFPA 1AMNA 1QIEA 5ALSA 3S2ZA 3D0KA 5HZGA 4QA9A 3V1KA 1UK9A 3FYUA 3T52A 1OXMA 4N5HX 2DHDA 3WMRA 4LKOA 2RI6A 5SYNA 3W04A 1VE7A 2OG1A 3PE6A 1XRNA 5A6VA 2DR0A 2AJCA 3KSRA 1PFQA 1GPLA 2OGTA 1CUFA 3I2GA 1J1IA 3ESBA 1DT3A 1PV1A 2VA9A 4B83A 3FVRA 4LYDA 1BCSA 1K6EA 2LIPA 3PUHA 4RPCA 2WFLB 3MUNA 1YR2A 1HDEA 1Q83A 3G0DA 3HLKA 3SX4A 4DMHA 4BVJA 3E3AA 1LPMA 4L0CA 5CXXA 4J0CA 5EHZA 4EY6A 1YS2X 1NU8A 5FP0A 3WL8A 1H2WA 2HRQA 5AICA 1WB6A 4XVCA 1DX6A 4BE9A 1FFBA 2QKYA 4BDSA 1UWCA 4NVRA 4K6GA 4KE9A 3A6ZA 2VEOA 4DSZA 4UHBA 1CUHA 2PSFA 3QPAA 1CUDA 4W1SA 2XT0A 2ES4A 1ZGCA 3FYUB 1AZWA 4B7ZA 2V98A 1UK8A 5AKGA 1MNAA 5CURA 4BDTA 3V1LA 1IZ7A 1P0IA 4BATA 1QIGA 1GQRA 1LPSA 3STVA 2QUBA 2WIKA 5HFAA 3A2NA 2PSDA 3WA6A 5A7FA 3LLCA 4WFKA 4MYDA 2BKLA 2H9YA 5E4YA 4G4GA 5FXMA 1G66A 3ESAA 1Q0ZA 2HA0A 4INZA 5HFNA 4HTAA 3FLBA 1R88A 2V96A 3ICVA 1HBJA 5D3ZA 4BAGA 4G8DA 5DJ5A 3FAKA 3I2JA 2XUIA 1UK6A 5AM4A 1E89A 4Q34A 2JGKA 1ACJA 3O95A 3C6ZA 4HXEB 2NW6A 3GZJA 5AK4A 1ZJ4A 3ZLTA 3WYDA 1W6RA 4GLBA 4BZWA 1R3DA 2VAVA 4GXNA 4BP8A 3D5EA 2QTBA 3IUJA 4EUSA 4GHWA 2EEPA 3QMWA 1XQVA 1XZBA 4H7KA 1U4NA 5A7GA 1LPNA 1TCBA 1ZJ5A 1GPKA 2CUTA 4BRSA 3DYVA 5D6OA 1XZKA 2WU3A 4WDRA 2PL5A 1KU0A 1N8SA 4ZV9A 4B9AA 3OOSA 1WPXA 2H7YA 3STXA 4FTWA 3R3VA 4XJVA 2XUKA 4DMCA 4KR0A 3AILA 4KACA 1XLVA 1UOPA 3N2ZB 1H22A 3HACA 3H2KA 5AM2A 2PX6A 1DU4A 1QTRA 3ESCA 1UKCA 3JYHA 1I6WA 4BBZA 1LPPA 4N8SA 2RHWA 2YYSA 2BGRA 1XRLA 3C87A 4PSUA 5LLSA 2Z8XA 4Y2SA 3ANTA 1QE3A 2XMZA 2VSQA 1FFCA 3WWPA 5AM3A 4KAFA 1VKHA 3WI7A 3DJYA 4UHFA 3TEJA 1XKLA 1H2YA 5JASA 2HA4A 2BAGA 4X95A 5ALPA 4QE3A 4ZREA 4L72A 1O6FA 4QEKA 4Q05A 1GKKA 3VVLA 4DNFA 4Q3LA 2YH2A 3DCNA 1MAHA 5D3KA 1LNSA 2CKMA 3BF7A 1C7IA 5AIAA 2OQVA 1VXRA 1TIBA 1DX4A 1HPLA 4I4CA 4B0OA 4GW3A 4QWMA 4F5ZA 1K8QA 3FCYA 5A62A 3WKAA 3B3QA 5A7HA 2CEKA 5AKKA 4UBNA 4N8DA 2CJPA 4CG3A 1SOMA 3O4HA 4Y2PA 1JU3A 2DCMA 3WK6A 1AGYA 1UT6A 3IUQA 1E66A 5BV7A 4QLOA 4WFJA 1CUYA 5IH7A 4ARAA 4IHAA 3UMJA 1YAJA 2QM0A 1XZGA 4IH4A 5AKLA 1GPNA 4W1QA 4DNOA 5ALLA 1QO9A 5FUMA 1E5TA 3TJMA 4F21A 4BVLA 3WK7A 3A2LA 1D07A 4ZI5A 3AZPA 4H7FA 5ESRA 4ZWNA 4B6GA 5LZ4A 3NWOA 2I03A 1XZCA 4LIPD 2JIDA 3C6XA 3WIBA 1A8QA 3Q0TA 5AI0A 3O0DA 4H7IA 2XUJA 4ZRDA 4BE4A 1CV2A 2OCLA 1IZ8A 1USWA 1Q84A 2XMCA 4C01A 3HXKA 5LKAA 3D3NA 1FJ2A 3NOXA 3DS8A 1AURA 4MEAA 1AKNA 5BOVA 4AMYA 2VF2A 3D59A 5DTIA 1LBTA 3BJMA 5HK8A 3BIXA 5ALEA 5K3AA 4W1PA 4DMKA 4TGLA 2GBGA 2DSNA 3ED1A 1LPAB 5FOQA 1XZHA 3WK4A 3WZLA 3G0BA 1CUWA 4WCVA 4ARBA 3STYA 3L1JA 3R40A 2O7VA 3I2IA 4U2CA 5AKYA 2RIPA 5JADA 1CUJA 4K5QA 3WA7A 1XZEA 3FOBA 1XRRA 2G5TA 3RM3A 5AHXA 3WJ2A 5ALGA 3U1TA 2JEZA 2XI4A 3QPCA 4J03A 3HRHA 2WQZA 2QZPA 1H23A 3R3ZA 4JH0A 2VATA 3I2KA 2O2GA 1CQZA 2RHTA 5HF9A 1K4YA 3Q8WA 1MPXA 3HJUA 3C8DA 2WUEA 3C5WP 5ALKA 4N5IX 1T4MA 5A71A 3FBWA 5CMLA 2XUQA 4DNPA 3D4LA 1R9MA 3M81A 3ZWQA 3ZI7A 4P08A 2BFNA 2VAXA 3PF9A 4UPDA 4C87A 4UBOA 4DM7A 1ZIYA 1AC5A 4CG1A 4YK7A 1FSSA 1W1IA 3HSSA 3EQ9A 4X97A 3V1NA 4KE7A 4CCWA 3WLAA 2J3QA 4Y2YA 1CEXA 4NS4A 3PICA 3N0TA 4OUKX 2WUDA 1B6GA 1M33A 4RGYA 4H7DA 5K3DA 4PNZA 3VDXA 1TCCA 2XQJA 4U2BA 3R0VA 1JI3A 3H18A 4I19A 1GQSA 4FFWA 3YASA 3BF8A 3I1IA 4DYHA 3AIKA 4J0HA 3ZLVA 5CT6A 1QIJA 2PBLA 4M0FA 2WIFA 2VT7A 4BC1A 1XQWA 2HRRA 4EBBA 3NUZA 4J7AA 4Y2VA 1CQWA 3VJLA 4H18A 4MXDA 1VOTA 2CBGA 2J3DA 5AJHA 2XUGA 1H2XA 5FPPA 5AOBA 5AM1A 1B41A 3H2HA 1ZI6A 3AIOA 1X2BA 3ANSA 5CT5A 2AJBA 1CVLA 1MX1A 5AKXA 3CXUA 2BCEA 1XZAA 1SCKA 2VJDA 3VISA 1EVEA 1EK2A 3SC2A 3STUA 1JJBA 1A8SA 3KDAA 2JGEA 4YASA 1XZMA 4L3WA 2DQZA 1MO2A 4QDUA 2WIDA 5C81A 3EBLA 2O2HA 3W05A 5DNUA 3BJRA 3VJKA 1HQDA 4W63A 5CH8A 2OCKA 5AK6A 5LYYA 1BN6A 3R3WA 4BTVA 4RNCA 4A23A 1LLFA 5DLPA 1TQHA 1HLGA 1ODCA 5LZ2A 1WB5A 2ECFA 1UKBA 3WQHA 2JF0A 3VVMA 3WL7A 1J07A 3I2HA 3BWXA 4X94A 2QXTA 2D5LA 4AO7A 1TKRA 1WHSA 4AB1A 1DWOA 5FLKA 1MAAA 1R9NA 5EHNA 1LPBB 3G9UA 2P8SA 2QMQA 3PDCA 4MJ3A 4DLNA 1IUNA 3BIWA 1A88A 2JGMA 5DWDA 5AIBA 2Y6VA 3HC7A 2J4CA 1ORWA 4DSAA 4H7HA 4HAIA 4YX9A 5ALDA 1E8NA 3W9UA 2Y1KA 2Z3WA 4XWGA 4S0XA 4X93A 1XQXA 2XMSA 3A70A 3H19A 4U2GA 4NZZA 1TAHA 5ALXA 2OXEA 1WM1A 4FLEA 4BCDA 1OCEA 5ALVA 1JMYA 1SCIA 4FLMA 5JZSA 1ZICA 4H35A 5CH3A 3VXKA 1U8EA 4AZ0A 3FCXA 1CUGA 4FKBA 2JGIA 2WFZA 4AXBA 5IVHA 3DLTA 4QLAA 1UFOA 2WFMA 2BUAA 2RONA 4CFSA 1VA5A 3QITA 3D2BA 5DNWA 3DNMA 4QDZA 4G8CA 2HM7A 3QYJA 2OGSA 4F60A 1A7UA 1K63A 1MT3A 5IVDA 5IVKA 1WHTA 1EDEA 4XIIA 4J0GA 3WL6A 4CI9A 3OTQA 3LIPA 4KRYA 2QJRA 5EHXA 3H04A 4M0EA 4PQEA 4X6YA 3JWEA 3DD5A 2DHEA 3QVMA 5AH0A 4J3JA 2HA7A 1K5PA 2QVBA 1ISPA 3I2FA 2DFPA 3C6YA 3EQ8A 4NMWA 4MQLA 2BGNA 1CUUA 4F0JA 3G0CA 2EDAA 1L7QA 1CIJA 2ZVDA 2BUBA 4G9GA 5HKAA 1XZDA 3WK9A 4DGQA 3BXPA 2DHCA 4UHEA 5JD6A 3C6BA 4WY5A 2PU5A 2HFKA 2RGUA 2VT6A 1AUOA 4LXHA 3HEAA 3IURA 3P2MA 2XDWA 4OU5A 2WSLA 4CIBA 2G5PA 5E4JA 1JKMA 4X6UA 3QBJA 4XX1A 4AQDA 5ALOA 3ILSA 3BL8A 1UK7A 1MU0A 3F96A 3OURA 4X90A 2E3JA 1JFRA 3W2TA 1QFSA 5ALTA 4UBKA 2EDCA 4OPMA 4P92A 2H7CA 4C88A 5EI5A 1C4XA 3EF3A 4HS9A 1JMKC 7YASA 1TK3A 4C4XA 4N8EA 1BS9A 1FFEA 1F0PA 4OYLA 1IVYA 3DKKA 1DT5A 3ZV7A 5CT9A 5EIEA 3FYTA 3GFFA 3IDAA 3K6KA 5C7YA 3QM1A 1EDBA 2PPLA 4Y2JA 2B9VA 5BWBA 1FFDA 4FOLA 1EVQA 3G0GA 4Z49A 5I8PA 3O9MA 5JAUA 1XRPA 5JIBA 2Y6UA 1QIKA 2WHPA 4X00A 2CB9A 2PSHA 1N1MA 1QIFA 4OSEA 4A16A 3FNBA 3WL5A 1QTIA 2WJ4A 5ALHA 5E4TA 1CUVA 2WU4A 3R3YA 2ZSIA 5JAPA 3V9AA 3SWWA 1EK1A 5CH5A 3LIIA 4BB0A 1A8UA 3F9CA 3C70A 1ACLA 2G4LA 4ROTA 1MN6A 4GWLA 3JW8A 2PM8A 2WILA 1DWPA 2GBIA 1QOZA 3I6YA 2XMBA 5JD5A 3M83A 3WWCA 1WCYA 5AKEA 4EB0A 4H0CA 1F8UA 4KAJA 5DNVA 4C4YA 2XUHA 2GYWA 1Y37A 3GROA 5CTAA 4I3FA 1XRMA 2XUAA 3HYSA 1YSCA 1QZ3A 4IH9A 5LIPA 2XLBA 2PSJA 5ALMA 1P0QA 2C4HA 4QDXA 4GDMA 5AKHA 3FLAA 3KXPA 2Z5GA 1E8MA 5AKZA 1CUSA 1GT6A 1WB4A 3G9ZA 3E1GA 5AI5A 3G7NA 2O2IA 3DEAA 3O4IA 1EH5A 5ALZA 2HDWA 1DQYA 2W22A 2GYVA 2WHPB 1T2NA 1IUOA 1WPRA 2PUHA 2OQIA 5J3JA 5AOCA 5JARA 2HA6A 4Q82A 4HZGA 4LYEA 3DL4A 1YB6A 3PUIA 1YS1X 1G42A 2WG2A 1G4HA 2C7BA 5AKJA 2XMDA 1SC9A 4DNQA 4EY7A 2JGLA 5JANA 4FFVA 1EX9A 2ZJ6A 1YAHA 2XE4A 4OYYA 4O08A 5ALIA 1X2EA 4G1FA 2HADA 4GI1A 4BC0A 4OCZA 4Y2UA 2D0DA 3K2IA 5HCUA 4BCCA 2GZSA 2AJDA 4E15A 4QDOA 4TVKA 2GBFA 3D7RA 2X8BA 3WIOA 1VA4A 4PSCA 1X70A 1CUZA 4FMPA 5HF8A 2HA2A 3D2AA 2Y2VA 2FUKA 5T4EA 4FHZA 3PFCA 4FLFA 3AFIA 4WDQA 5CXUA 4BRZA 1MX5A 1IMJA 4X92A 3WKDA 5K5EA 1F0NA 3K9BA 5JAOA 1ODSA 3U0VA 2VJBA 1KU6A 4PV7A 4AX4A 4K2AA 2OAGA 2GZRA 3DL7A 1ZI9A 4KRXA 3B12A 2PKYX 4EHBA 4FNMA 3RK4A 1QGED 4E11A 2I3DA 1W4LA 2HIHA 2ZYIA 3V48A 5ALNA 5AKIA 1QLWA 4JUIA 1CUEA 1BE0A 4U2DA 2XMGA 3E4DA 2JGFA 2PSEA 2XUPA 4B85A 4J0JA 5HK9A 3KWFA 1CPYA 1J06A 2XLCA 4B82A 3WK8A 3GELA 2Z8ZA 5T4HA 3EQ7A 3CN7A 2PU7A 1GGVA 1VLQA 3RARA 1ODTC 3PI6A 1ZD5A 4EZIA 3T4UA 5AM0A 1YA4A 3FVTA 3MGAA 5KBYA 4DMFA 3TGLA 2IX9A 3AUKA 1XZFA 5KREA
chains in the Genus database with same CATH superfamily
1ZBQA 4PNEA 4B43A 1Q7CA 3CCBA 5BSUA 5JS7A 3ZCPA 2XWJI 3HA2A 3PR2B 2FK7A 4Y2HA 3W3AH 3AZQA 1HDYA 3GY0A 4A0GA 1W0KD 3I9OA 5HQTA 5JFOA 1UJMA 4MUBA 4HNRA 4H4DA 3OJCA 3OPQA 5L3VA 2B7CA 3MW8A 4RLQA 3TL3A 3K5IA 4DV5B 1IM5A 2WWFA 5F5LA 1A27A 4ZVKA 4F4HA 3EZYA 2GBLA 4GZ5A 1PFVA 4NQZA 1ADYA 4HUJA 1LBQA 1KI2A 3F8TA 2FSGA 4FVTA 3SXUB 2NAPA 3N1UA 4X64B 5K0GA 1E1MA 2DLDA 5B4UA 3BDAA 5IXYA 4L57A 3HDQA 1CWUA 4MO9A 3LSYA 4I55B 5BN5A 1SCDA 1Y7PA 2A14A 4IQ4A 1SVWA 4FFSA 4RPLA 1VE3A 4RZSA 4RS3A 5HE8A 1EUCB 1GRCA 3H3JA 1BIFA 1Q0UA 4HXGA 7REQB 3IPXA 4WOKA 5B1SA 3DEYX 4QASA 4K9RA 5KTRA 5DM0A 1O5IA 2VXCA 2RG1A 3K2BA 1S8OA 3B6ZA 1ATIA 1MX9A 4TVBA 1GNTA 4URWR 1ZMBA 3DMPA 5KI6A 1I2ZA 2C0QA 1QDEA 1QHHB 1RXYA 1SXJD 2Y2UA 3D5QA 3FTEA 3KQTA 3QLVA 1BJKA 1EFPA 2CF5A 3BRWA 3FHLA 1GNSA 2YICA 4NAVA 4PLVA 4NCBA 1YT5A 4LWOA 5F12A 3BDIA 2IITA 1UQUA 3D0QA 4FQ7A 5DV9A 1ZMOA 1J9GA 2W2VA 5DPMA 3H1TA 3U17A 3PX7A 4R1PA 3H8JA 4FDMA 5AXAA 4JJAA 1W75A 3GBSA 4MI6A 5A6SA 1KSJA 1H5UA 4UAGA 1DE0A 1NUHA 1KS9A 3AT1A 4JVNA 4N6GA 2O5VA 3KG2A 4JEIA 1CVIA 2YW9A 2VJKA 2R751 4JA2A 1E1KA 5A4JA 1ZRHA 3UAXA 2REXB 1C3OB 4BVHA 1OH8A 1GTRA 2G7ZA 3UV6A 1VKOA 5IYZA 3GJQA 5A2GA 2ZPUA 4C7JA 3AR9A 3I9KA 1Z38A 2I1LA 4UUQA 3VO9A 1OLUA 3IDZA 1XKXA 2FUCA 4PR3A 3W6ZA 3CT4A 3IE0A 3SVLA 2WU0A 3RREA 1PLLA 1PJ4A 1YI1A 2H1FA 2YQZA 3D2CA 5KDOA 4G9BA 3L49A 4LJYA 4KAAA 1ZN2A 1HDOA 5AHKA 3TLGB 4IDDA 2XRZA 2ZJYA 3TZKA 1IY8A 4IRXA 4TS9A 1G8KA 3LLMA 4GLJA 3R6DA 1FPMA 3EW9A 2DTXA 2C98A 2WFAA 2BSQA 2BWJA 1Z2PX 3REQB 4B3XA 2DT5A 4EGAA 1SHTX 1WOYA 2VTEA 5SYMA 2AF3C 1BS2A 2ID7A 4NESA 3RYFA 4C0LA 2YOHA 1MB9A 4KIWA 2OCGA 3FGOA 4OD0A 1HL7A 1QC5B 3IOCA 1PDVA 5CU7A 3K0FB 2Q1XA 5JAMA 2JJQA 4OGFA 4OJQA 4YQZA 1JEDA 3UW3A 4M0DA 3DV2A 3WGJA 2GESA 4NZPA 2RH4A 3MQ4A 1GQYA 5JXIA 3Q88A 4ZGBA 1FDWA 2J4FA 3WGYA 3NXSA 4BB9A 1DFHA 4EUFA 3G7UA 3HUDA 1J49A 4MWZA 2WJJA 2YQ5A 1IJFA 2EOAA 1X94A 4ZOEA 5HQ3B 3O9ZA 3V1MA 4YRTA 3TYXA 1SULA 3W6NA 1CRLA 2CXQA 4QXPA 3OX3A 1G21E 1ICEA 2YVQA 4ZD6A 3LT1A 1S3SA 1Y1PA 2GJ9A 5EXPA 2IHVA 1E3SA 2OB1A 4O1HA 3RF7A 1OAOC 2CLSA 4CTKA 4H1WA 5CX4A 2LKCA 4ZQFA 1NONA 2N1MA 2V7PA 2BTEA 4WGGA 3BDVA 3TTWA 1MQSA 2ZROA 4KFSA 1SKAA 1JQAA 2ZUSA 1N1GA 3KWLA 1UDWA 2ZKLA 1NI4A 4J43A 4L4RA 3TAXA 1R0SA 1BHJA 1YZYA 2WG0A 5KQRA 1E2LA 2WF6A 1VG8A 3GDGA 2CL6X 3MOSA 3NYIA 3PD7A 3DF9A 3IV7A 4HB2A 3ZYZA 2C8VA 2OSBA 3LPCA 1SFRA 1SXGA 4GP6A 3R76A 1A5BB 1L7VC 4YCAA 3U44A 1T0BA 1KNXA 5E95A 2F3SA 4MGYR 4DDTA 3RIYA 1LS1A 2VCEA 4ZP1A 3QJ5A 1YJBA 2EL9A 2Q5FA 4Z5XA 1O03A 1NSYA 1UR5A 1DG9A 2X3YA 3CEHA 1Y4ZA 4DLZA 2QNBA 2ZQ5A 2BFFA 1DCFA 3ECAA 4K26A 4Z1MD 1NT4A 3AMVA 4E94A 13PKA 2QM3A 4FFNA 1ISJA 2DPMA 2R68A 3NEPX 4CT4B 4JJFA 4TYWA 3ER9A 3FDXA 1XDBA 2FUG6 1Z4MA 3CWZA 3H2GA 3PSHA 3DEJA 1WMFA 3E3OA 5JCOC 2FFJA 3THYB 4W99A 4LF5B 4I4NA 2Q9CA 4PVDA 1DZ3A 4EI2A 4JOQA 2OFFA 3TQIA 3GVXA 4ARIA 5U1PA 4D9KA 4EBFA 5SZKB 4F8JA 1S6YA 3ZE9A 2Y05A 5A3RA 1PJ3A 1B2RA 3LRPA 2FSUA 4IIUA 5KPDA 3KE8A 3LKBA 3JWJA 3QWBA 1JYSA 3FWYA 3KXKA 5FRDA 1NUQA 3N8KA 4M1EA 3RRXA 1GGKA 1DKUA 1PIWA 2C31A 2CMFA 3A9WA 3EGIA 1U9IC 4Y1EA 5EEHA 1D2AA 3UUFA 5EP4A 5AK5A 3UB2A 1VCHA 2W6JD 1Z26A 3W6PA 2Q3EA 4HEJA 4OHBA 3BH7A 3C14C 3WGQA 1HXHA 4OJTA 4N6OA 2ACEA 3NHJA 2WTXA 4AYXA 3B7WA 5IBPA 1E3QA 4FI3C 2RH9B 2V6FA 4QBHA 1KEUA 2J5QA 4ESOA 5JNTA 1ZD8A 1EUDB 1FXWF 1PS0A 2AL7A 2PCJA 2VPPA 1V1RA 4JLJA 2WF5A 5LA6B 3A3PA 1S89A 5B5SA 2C20A 3TKAA 1SUIA 3B1KA 4B7XA 2PS3A 3ZBUA 2BGJA 1OZHA 3MOGA 4D99A 2LD4A 5CLLA 5CYOA 4D3ZA 3LYUA 4PFJA 4QHYA 5I9IA 1RNLA 2PNJA 3QPDA 1GRNA 3OG9A 4UCQA 2RK6A 3AF3A 2ZS8A 2PMCA 1L7BA 3HV0A 2BUCA 3QMVA 5C5EA 1AB6A 4YT8A 2CVPA 3TRDA 3W2GA 2WOJA 1XWWA 1VGVA 4RACA 3QI7A 4LC9A 1EGVB 2HNAA 2L18A 4Q4LA 4MQBA 4G8BA 2H0QA 4LMAA 3AY6A 4BO0A 2G0NA 2REQB 3ZCTA 1ZAYA 5HIMA 4HWOA 4W8GA 4AG5A 5KTMA 5K7SA 5DBIA 2FLWA 2FX5A 3MHPA 2ZSJA 5LSAA 2QXYA 5EOVA 1ECBA 3TECE 2X4GA 3IBTA 4KJXA 4HMPA 2G8NA 2PFGA 1YIDA 1EBUA 1MJ5A 4FZRA 1RDFA 1RS0A 4UXHA 4KQKA 1BN7A 4B84A 2AYYA 3WGOA 4E13A 2G5GX 4EHJA 1NM5A 4OMCA 3V8MA 1D04A 1YUMA 4C4AA 3CKMA 4RFVA 4FYVA 3RUCA 1ZU4A 1RQ7A 2DWCA 1J0CA 4M0CA 3C45A 3IKLA 4RJLA 3I32A 5BNZA 1UBSB 4LHEA 3V7WA 1BDBA 3NBMA 4KIGA 1NW7A 1PJQA 3IDFA 4HRYA 5SY9A 5K8LA 3FTCA 3PYMA 2FCRA 3GUUA 5HM6A 3SM3A 3UATA 1I3LA 2IS2A 2NTEA 3GT4A 4RAOA 1QZXA 1XIVA 3LQFA 3K73O 1LV8A 4TPKA 4IHKA 2VHJA 2RHOA 4JLOA 1MXHA 2YASA 3SYLA 2D1SA 3L9WA 3NC4A 4QUIA 1G3IA 4OB6A 3RLIA 3G9QA 1B1CA 5BSHA 1Z28A 4BUJA 1KYWA 2C99A 4I5FA 4KN8A 5FTWA 1IK4A 4PLHA 1SC3A 1K98A 2FOLA 1I36A 2E4YA 2IPAB 3C39A 2IYSA 4ENRA 3T95A 1TQ6A 2QNIA 4DWVA 1FEZA 1P60A 2APJA 2P2NA 2OQRA 1EDDA 3WWDA 1I5EA 1BS1A 1N4DA 4DG5A 1E7RA 2HX1A 2XYVA 4PAMA 1RVV1 5TMBA 4FYMA 3W90A 1D5CA 1QG6A 1JLRA 1P31A 2QT9A 3R7WB 5GWXA 4W1RA 3IDOA 2LNDA 4DJJA 3CRMA 3L1KA 2H31A 2DPGA 4BEBA 2YV2A 3U49A 3RJZA 4QZVA 3P0HA 2VDQB 4HDRB 4YTEA 1H2BA 2YJTD 4RMGA 1WKVA 4GLOA 4R2XA 3RRJA 1ISFA 3VZRA 5DYTA 4L2IA 4NSNA 2CE2X 4I1SA 5MGNA 1KO8A 1U3UA 1ZJWA 3UT5B 3MB8A 2OO7A 3VR6H 5KVSA 1NF2A 1WDWB 3OKFA 2W9XA 4E51A 4EG0A 4CIYA 4O3MA 2QJWA 5CT4A 3CRZA 1A9QA 3H1EA 2CNWA 2IXTA 2F3PA 3QH4A 1ZKMA 2QAGC 3BMNA 2EJTA 3WZMA 5AVTA 2O2XA 1NYQA 2XAUA 4DBLE 1LC0A 2BFDA 2YXNA 1L4KA 2YJNA 5EJAA 4TROA 3R3SA 5H3HA 2PZBA 3EIOA 3ZLUA 2WY2D 4HD8A 1B0PA 1RXCA 3OZUA 1GNLA 4WKGA 5D1HA 5JH7B 1G7SA 2OGZA 4Z4FA 3PC2A 1Z2DA 2BEJA 2ZUVA 4AO6A 2ZRHA 4RA6A 5ADUS 2D74A 4HFNA 4EJ6A 3P9QA 4LNAA 5EGNA 2ZYSA 4KW7A 1WZEA 2EFJA 3SHQA 3UOGA 3L40A 4IDQA 4IVRA 3F2VA 4KQXA 4Q3KA 5CD9A 3F5SA 1ZI8A 3AZOA 3HA7A 2CMDA 2D1TA 3OZIA 3BQNB 4U2FA 5E1DA 3C1AA 4A0QA 1YZLA 5HOEA 1JG6A 4BTLA 3HM9A 4M7RA 2FUNB 5I4CA 1K4MA 2VNAA 2AJ8A 4JJIA 3C4QA 2OFWA 3TG2A 1XDSA 1CZLA 1I7LA 1I2CA 2EQ5A 2IZZA 2ZIFA 3Q1KA 4OK6A 1GGMA 4PXYA 4P93A 1CZOA 1JU4A 2C57A 1TRHA 1W4CA 2I7DA 3AOEC 1NQTA 2E37A 4TZKA 5EA2A 3V00A 4DJAA 1ULSA 1V7PC 1JAXA 1I33A 3DYIA 4HGPA 4KKVA 4WHMA 4XIYA 1OYOA 2WNHA 2PCLA 3R3XA 4XGIA 3BT7A 3W77A 4MWGA 3I8OA 3ENVA 1DJNA 1ZC4A 3O4GA 4JJKA 1TM3E 2Q0HA 2WKWA 3P27A 4A92A 5BRJA 3PT5A 1FC0A 4XXHA 5C8DA 1J0XO 3KJEA 2FW0A 4UBMA 2AGVA 1W2HA 4K05A 1T8RA 1GPJA 4F5EA 4Q66C 1P80A 1V8OA 1E69A 3OQJA 5CB4F 3FSJX 5G2OA 1FY2A 4J4TA 3EDYA 1QCDA 4GL2A 2CSXA 2NNLD 4KXNA 4I9NA 3CF2A 4XJSA 1M74A 3AHIA 4BZZA 3BQ9A 5AM5A 5A4KA 3MWKA 5A5EA 5BOSA 2JRLA 3W9BA 1N3IA 4AP5A 5LQCA 3NKLA 1JSRA 4KQFA 2B37A 1YCDA 1L8OA 5FR1A 3ACBA 1UBMS 4Q12A 1FZTA 2PANA 1HSZA 3CN9A 3K6JA 3DLHA 1MOQA 4HXFB 5SYAA 5GJVC 3VHQA 4G0OA 1P7WA 1WS6A 3HCRA 4PVCA 4ITVA 4X1IB 3U7QB 1YB7A 2J30A 1R15A 2BCJQ 3H9EO 3X2EA 3OHSX 2Y1FA 4M1KA 3ADPA 2V9CA 4OH7A 2WIGA 1YC2A 3B6IA 2JFYA 4RTMA 3BERA 3OESA 2XZPA 1WQ1R 2FP4A 2AEJA 4TLBA 2HCBA 2O8NA 3FSGD 3LP8A 3UJCA 1GP2A 2MSNA 3IQFA 5YASA 4Y2QA 4PWZA 5TPWA 5ICSA 1R1DA 3RVSA 1QVRA 2J8ZA 4LGYA 1XPUA 4PCVA 1NQVA 1TU3A 3VO2A 1J2JA 4Z9FA 1EK5A 3I4FA 4M0MA 2XB6A 5KU1A 3O4RA 1T2AA 3I9FA 1ETHA 3P97A 3RS5A 4RWEA 3D02A 4AWXA 3W8FA 1EX6A 1EFHA 3PFKA 4V0RA 2UYHA 5AW5A 2GRJA 3ELBA 3HXPA 4LCBA 4MYTA 4RORA 4WN3A 3T15A 1CQPA 4A6EA 3R41A 2ZJ7A 4L28A 1O4WA 4JDPA 3R9IA 3ROPA 1FNDA 4RESA 2WTMA 3SXJA 3W4JA 5JZOA 4PZZA 2A94A 1I1OA 5LBUA 3A3KA 5MN4A 4DIBA 3UK7A 4QECA 3TMAA 3LZ6A 2QVLA 2X0EA 4XWTA 3A36A 1LBEA 4C7OB 2JFVA 1X19A 2C5BA 4JLWA 4IJ6A 2PS9A 5KX5A 2PT5A 4PC1A 1IHPA 4FFBB 4FEGA 1S2OA 1ZX1A 3SQXA 2J33A 4BP1A 1V9SA 2PUFA 4TQUS 1V4NA 1RBZA 3P4UA 3K0KA 1PVDA 4ZCIA 2VTBA 2O07A 2OO3A 1COWD 2JLRA 2QU8A 1X14A 3IMEA 4W5OA 2JFWA 5H68A 4GH5A 2ZWAA 4UBLA 4P34A 4TXNA 1NHGA 1G20B 2QRLA 3NC0C 1FSPA 4TYMA 5EESA 1USUA 2XEXA 3KTOA 4JQYA 5LP1A 3RAFC 3F7OA 3M9LA 3P1JA 3QEOA 3QHAA 3CISA 5TQ2A 1L9XA 1NP6A 1FK8A 4AUNA 3K72B 1BJRE 4GOKA 4XI9A 1N57A 3BMXA 2AOWA 1YL6A 1J70A 2QRPA 1ZJ6A 1OLSB 3KX2A 1Z12A 3AVTA 1Z8HA 3HNRA 4MWBA 4BQFA 1XDGA 2ADMA 3H1AA 4XM2A 3FVQA 5BR7A 4LJ8A 1DDIA 2W2KA 4HZUA 4BLTA 4G0UA 1H5QA 2JANA 4FKMA 1QGYA 3JQQA 3KVNA 5ALRA 3G5UA 3KD2A 5IAJA 2IT1A 3LC2O 1EFVA 4J8PA 5CDFA 5CDHA 1C3XA 3MGBA 2FPRA 5F76A 1S3FA 1UPCA 2CJFA 3TB6A 3ASZA 2GTPA 2QLMA 1DZIA 2X2EA 2YBDA 3O7MA 4YDHB 3A58B 1WQ4A 4QQNA 4TWRA 1W52X 1U0OC 2YJ6A 3EY4A 5JXGA 4OEHA 3D6MA 4DLBA 5JRJA 4GGOA 3U60B 1KF0A 2H7VA 4V0MA 2IK8A 2G5CA 2AN4A 3KYDA 2G63A 4OJMX 4AF6A 4XUDA 1M5UA 1RFLA 2ONJA 4RQAA 1WLYA 2OCBA 1DUSA 2R2GA 1T3TA 2WAYA 4HCJA 1SRQA 3GIWA 3H6GA 3LNCA 4L5YA 4QPZA 4D3XA 1PKXA 1Q95A 4NKRA 5A9SB 3JQAD 1PZGA 3WQRA 1GSHA 2DF8A 2RK3A 3ZK7A 3WY9A 1XA3A 3AJ9A 2A33A 2O48X 4PE5B 1E3DA 1NXVA 1MO5A 2CVFA 3AF0A 4PAGA 1XHEA 4CQLA 3NM4A 1ZH6A 1I5RA 4EY8A 3L7NA 2V7GA 3PFNA 5DYWA 3R8CA 4FFRA 3ZHRA 5TJ9A 4XIJA 2AZMA 2B36A 3P9YA 4OQZA 4GIBA 4E32A 1G5HA 3K32A 3D4OA 1EA7A 1IN6A 2I3GA 3EQ6A 3EULA 1GZ7A 4JT9A 4U39A 4Y2TA 5IMSA 1JKXA 1JG4A 1N0WA 1OJ7A 1BWPA 1TE2A 1TUIA 2VBIA 3KPVA 2FPLA 3U4QA 3UJ9A 1ZD3A 2IQIA 1N5RA 3JD2A 4K9SA 4OIMA 3AW9A 9GPBA 3HK2A 1HDXA 1M6WA 3GEIA 4URZR 3CCCA 1XX6A 4NS1A 2VTDA 3SHFA 3PYXA 4CMCA 1AKRA 2HUPA 2ZYUX 3Q8XB 4ETWA 1K7YA 1H3NA 1Z2CA 1ZNZA 4TV9F 5JCPA 5ISMA 1SC1A 1Y1SA 2GEVA 1QQBA 4U7GA 2EYQA 4XVRA 3VUFA 4KE6A 5FPQA 3X43A 4CT0A 1OB2A 3VC7A 2DHRA 4CDMA 4V2IA 3GLSA 2HLDA 4A26A 3E9DA 4I6GA 2QL5A 1NR1A 5DOZA 3VKFA 4ZRNA 4Z54A 4UTVA 2NUTB 4YMHA 1ZZGA 4ENSA 5FNVB 5LU9A 1ORTA 3W7AA 2E2WA 2BYTA 2O3TA 1IRXA 3CX6A 3QWAA 3M3DA 1H4QA 4RBNA 2GN4A 2VTVA 4G84A 4V0QA 4Y2RA 4BWVA 4L6AA 2PZ8A 3W1EA 1XKQA 1MJFA 5B3LA 3NH6A 3EGXB 4DV3B 2PUEA 1K4KA 2PSSA 3KZKA 4C07A 3MTIA 4KXFB 4BZPA 2QLFA 4KBGA 3UAVA 1OILA 1SCBA 4POAA 3BSYA 4XRRA 2RHDA 4ECEA 2XGGA 4B3DA 1YE3A 4WESA 3W78A 5JV5A 4AUMA 2WKRA 2JZNA 3MPOA 2WJ6A 1F1JA 2NZXA 1XEFA 2P6MA 1N2JA 4LAFA 1AE1A 2O0KA 3EIFA 5HJ2A 4G0QA 4MK4A 1JBKA 1RXWA 2EZ4A 4OJNA 3PF8A 2FPPA 3LY5A 2EARA 3F9IA 3RTCA 4NI5A 1ZK3A 2B4RO 4BLQA 3PL1A 4B81A 2Z8YA 1XTUA 3D4BA 3HCPA 2DETA 3R7SA 3ZXSA 5HIAA 1THTA 2QPAA 3RVPA 3EXHB 3HBNA 1XRJA 3FUCA 3LY9A 4LXXA 4ZQGA 3TD6A 1F5SA 4XYMA 4AQYB 3WWEA 1CLUA 4QFCA 4ZK2A 5JZBA 4ANFA 3B3FA 4RGBA 1ORVA 1TC2A 2GDJA 4MS3A 4KXQA 2JBAB 3IJ5A 3O92A 1G1AA 1OI3A 4NMXB 1GV0A 5CVCA 4D1YA 3GZNB 2DX7A 1TZMA 5D85A 4MW0A 3QKTA 3BB3A 2E49A 3VGPA 2M32A 1SQ6A 4X9XA 3SSMA 2AN3A 3F97A 3ROKA 2VQSA 1NQAO 2FWNA 3FYUC 4KC0A 4O2AA 3SMQA 4P1ZA 4JBLA 2XZDA 3DCIA 3BD8A 1VLMA 1E1CA 4M55A 3UJBA 3U19A 1G21B 2H5IA 2WMYA 2P9EA 3H86A 4OQMA 2XUOA 1B3RA 2ODWA 1OXTA 3PQ2A 2RAUA 4JQCA 4RY2A 2CUZA 2G1KA 1R0WA 2VBCA 2OHJA 1RACA 5EGSA 3I76A 2BKUA 2G36A 4YALA 4B35A 1QO7A 2EX1A 3AY7A 4ZCLA 4IAOA 2QM8A 4MPTA 4HO1X 4JLVA 2R6R1 3IFSA 1QG2A 1O6CA 2B4YA 3T7KA 1XNHA 2WE7A 3IB6A 3LHIA 2OM2A 4FI3F 4JX9A 1ODKA 2FN8A 5ALSA 5F77A 3URMA 3FGNA 2XNDD 4GGPA 2XCRB 2WICA 2WJYA 4QBIA 5CAEB 5HZGA 3CLVA 3GX1A 1T6NA 4Z4QA 4CM1A 1TZJA 4C4RA 4HLNA 4NNPA 4E31A 4NATA 3WYBA 4YRKA 3WGVA 3WLLA 1KAQA 1G98A 3BMOA 3L7MA 4LKOA 3ZJTA 1I0ZA 4FPXA 3KEMA 3TZLA 1RTKA 3FBTA 1VIYA 3F3KA 4FWTA 4OFBA 1V2HE 4RXUA 4B76A 3L02A 5C8YB 4YYEA 5C37A 2DR0A 5F64A 1U8XX 3D43A 3KSRA 3MJ4A 1GPLA 3LBFA 3NTLA 3TLYA 2IS1A 1XO1A 3OJXA 1J8DA 2JAOA 1CUFA 4EATA 4DARA 1G60A 1Z6PA 3IJPA 5LQAA 1W85B 3PQ7A 2WD9A 2OVBA 4FD2A 3ESBA 3ZHUA 4WN9B 2I7XA 2IELA 4AC9A 4KXWA 4IBOA 1PV1A 4EB6B 3RGWS 3SQDA 5FOWA 4A8JB 3O8QA 3NT4A 1WDMA 1NVGA 3KLPX 4AJEA 4DLSA 3D8BA 1VMEA 1K6EA 1FZQA 3I42A 2ID8A 2UU9B 4U6QA 3SHOA 3RRYA 4BUZA 4RPCA 4J91A 4EA8A 4QJ5A 3LQYA 2WFLB 4QAJA 4OV6B 2ZRKA 3OFSA 3L6BA 2XYPA 5I4IA 3G0DA 1S8AA 1DDGA 3RADC 4RU1A 4BVEA 5EP2A 1AF7A 4ZO6A 2YZMA 1E9VA 4FOOA 4HPXB 4RYDA 2EVWX 4L22A 4TTRA 1ECLA 3GAFA 3O3NB 5E6RB 4C22A 3A26A 4ZJYA 2QL6A 4P80A 4L5AA 3V1YA 4MJ7A 2B1IA 4M53A 1P81A 4MQFB 3MLEA 3PJFA 4NYMQ 5EJ2A 4ER5A 1XMSA 5TT0A 4IQ8A 2R25B 1SGWA 1EEXB 3M6VA 5CJ2A 1YS2X 1U80A 2PL1A 4IWNA 4JA0A 5BVGB 4X24A 5EYPB 2HRQA 3R23A 1KOJA 3D4IA 4GZMA 1DX6A 5BPFA 4RTJA 4AULA 3EWSA 3PYLA 1RYEA 2C95A 3MWJA 1NYLA 2VOJA 2ZKIA 3HEMA 4GPD1 3DV0A 3F4KA 3OI7A 4IS3A 2J6IA 4B45A 1Q19A 4CU2A 4AJOA 1GG8A 1YVRA 4DIEA 4AJ4A 1XZQA 1B14A 2J9RA 4R40A 4M1SA 4D4GA 4XQ0A 1F0KA 4DADA 1SBHA 4JR0A 3RFTA 1W5AA 5BNIA 2A2ZA 1R4NB 2FE4A 5TGTA 5CFRA 2Q1UA 3FMPB 3LO5A 2C4WA 1I14A 2ES4A 2A59A 2JD2A 3M5DA 5EZYA 2ZE6A 2UZ1A 1ZGCA 2W0SA 4P98A 5M5BA 1KJYA 5BSRA 4CVNA 3CO5A 2HK7A 3VV3A 4ZZ0A 1AZWA 3NHLA 5C5CA 5F2KA 4FE4A 2WE8A 4R98A 2ZE5A 4N3BA 5K4GA 4ER6A 4A7PA 3HG7A 1MNAA 2DUUA 2ZWVA 3NBYC 3QSGA 3EEQA 2EP5A 2IHZA 2HQBA 2RE8A 2B2NA 3C1UA 2OXCA 2ZBVA 1BMDA 1VKNA 5HKLA 4RTPA 2Y1LA 4BATA 1JHXA 1QIGA 1GQRA 1U04A 1LPSA 2DBYA 4JC0A 1IL0A 4OVKA 5I48A 4ZT6A 1MF7A 4XZ3A 2PYDA 3CW9A 1YDHA 5L51A 3RV4A 1N8KA 2O59A 1A2BA 1ZVVA 1CQJB 2PSDA 3WA6A 1KEKA 3ZBQA 2WI8A 3T3HA 1FSZA 5BQXA 4MYDA 2K4MA 5H02A 1FCJA 3X2FA 4G4GA 5KNDH 2CV0A 1FYVA 1YRBA 7ADHA 2YZGA 1NRXA 3MD0A 4G0PA 2Q2NA 2GILA 2GYYA 3QEMB 1G66A 1W5SA 4IXWA 4R01A 1KH1A 2RIRA 5HFNA 5I8WA 3E3NA 4R2IA 2O4CA 1R88A 2I80A 4RCYA 2O8DB 2Q6KA 4ZEXA 3ES9A 3ICVA 1ADGA 1H1LA 3HCAA 4CLEA 2D54A 1AA6A 3C5HA 4O4IF 3GEPA 5D3ZA 1I4OA 5EE9A 4BAGA 4ESEA 4FGKA 4BXOA 3KYBA 3Q4GA 1DTSA 5DJ5A 1TVCA 1T9DA 4AZWA 1ULTA 1WL8A 1HDCA 1UK6A 2WSSA 1RZUA 1T24A 3E9YA 4V24A 2OORA 5AM4A 4F1JA 2AXPA 3C48A 2BGIA 4JHXA 2JGKA 1HORA 2BFMA 3C5CA 4EUNA 1NQUA 3O95A 3GRUA 4OHPA 3AL0C 2G28A 3OT1B 1DGQA 3C6ZA 4HXEB 2HJHA 2N0SA 2NW6A 3GZJA 3KT3A 3MWDB 4KODA 4KQIA 4COOA 1ZJ4A 3I04M 2BKEA 2O14A 4RMJA 2JIOA 3DZBA 1RADA 3NANA 1W6RA 3P94A 4LV5B 5CPBA 5NLLA 5LMZA 3GGGA 1PFKA 2G1UA 3QENA 1U5BB 2WWIA 3I0MA 4M87A 5DTRA 4BP8A 1U9IA 2GXUA 2B2XA 2EEPA 1WZ2A 4PG5A 4KDEA 3EVZA 1Q0SA 1XQVA 1XZBA 3GUYA 3GF4A 1JR3D 1U4NA 3A4MA 3BA1A 3LI2A 3AESA 6Q21A 5IJAA 5KQGA 4ZOAA 1TCBA 3VR1A 1U28C 1WZNA 3HYLA 3HCEA 4OBXA 3GJ0A 2H48A 5CEEA 5KOJA 1EXDA 1QQTA 1FRNA 5KQLA 2YN0A 3DYVA 5D6OA 4D97A 4BB6A 3WNZA 2IYVA 1XZKA 1N9GB 2Q3DA 1G59A 5FA8A 3QHQA 4L27A 2P5SA 4KQEA 2XCOA 3SNHA 5DP2A 3KK0A 1G0OA 4ZARA 1Z6YA 2R7LA 4HGZA 2C84A 3LY7A 1WV0A 2GCOB 3FPSA 1ZNWA 4NE2A 4TWIA 3W34A 1ZHOA 2QZ4A 3PNMA 4GFDA 3LSTA 2QQ0A 2QTVA 1CC1S 2ZIEA 4C0SA 5FTJA 4B9AA 4K9QA 1D0VA 2P3QA 1H9BA 2JLBA 2QLNA 1WPXA 2WV9A 4B4VA 1AA9A 2CMGA 3MTAA 4NG4A 4MVYA 4HWGA 2FAXA 3L0BA 4PNHA 3IT1A 1IAVA 1IPFA 5E9WA 3W8NA 3X1JA 3QSYA 1AV6A 1XLVA 3DR3A 5F7JA 1BDHA 3N5KA 1OH7A 1X80B 3MCUA 3EFEA 2O1SA 3N2ZB 1FS4A 3ASVA 1QP7A 1UFQA 5INTA 4I8DA 1CP2A 3B9RA 4YI3A 4QKQA 1HUQA 3OC6A 1PR3A 3KFVA 4OLBA 4Z4EA 3N2KB 2PX6A 3RU9A 2IUTA 1QTRA 4U4AA 2BMWA 4EF4A 3KKMA 3OJ0A 4LGCA 1V39A 2ZCUA 4RQUA 4RZIA 1XSEA 5GMOA 2ZI3A 4C2UA 3I62A 4PHHA 2QL9A 1GSOA 1M8PA 3GRCA 5IKOA 4IDGA 5KYYB 3TN7A 1YACA 2PV0A 3ETHA 2YKGA 4K28A 4M76B 5IXSA 1IEQA 2FRXA 4MW1A 4MP6A 1OYYA 3KUXA 3H13A 3PC7A 1QAMA 1RRPA 2BELA 3FZEA 9ATCA 4LTDA 1IHYA 2FMHA 2QQ5A 2LP4Y 3GR6A 5BNFA 4M1QA 1MC4A 3V3TA 1M7HA 3ND6A 4XEHA 1B26A 3L6RA 5GZ3A 2CUNA 1G0NA 3F5DA 3TWOA 5IMBA 3ZWXA 1VKHA 4PLZA 4ZJPA 3A14A 3WI7A 4TTSA 1XU9A 4Z4IA 1XKLA 2JLUA 2R8EA 2IYFA 1TPZA 4C0HA 5JASA 5B7NA 1ST3A 2QF7A 2DQ4A 5DULA 1E79D 1NMXA 1F48A 2FN9A 3M6WA 4JBWA 4L72A 5FLYA 4PYMA 2Z04A 3DWFA 1K89A 1GKKA 1QCCA 3KUCA 4Q05A 3VVLA 4RJ2A 1T3GA 3VZSA 4B3JA 1W8DA 1G6HA 3ITEA 1B8NA 4Q3LA 5EKDA 5JAQA 1HOTA 3DL0A 2BGUA 2ZAYA 4O4JF 1Q92A 1VGQA 3P9IA 3ZE1B 1LNSA 4CUZA 3R8FA 2QR3A 3K92A 4LRXA 1NVUQ 5ARDA 3B38A 4F3CA 3UTDA 1C7IA 3MTDA 2P4UA 2E4XA 3E1SA 5AIAA 2O05A 1QKKA 3VBCA 3ZCSA 4BNJA 2D2EA 1DX4A 1KDRA 1ZRSA 2XWQA 3GC6A 1Z5UA 3JQ7B 4TKMA 1FVOA 4I4CA 1G3MA 3ZG6A 5FFNA 2I9KA 3GJTA 4AN4A 1D6SA 3ZCXA 1G5TA 5BSKA 1CY1A 2NXWA 4F5ZA 4FUTA 5L3ZA 5HX7A 5TQVA 1VTKA 1X8JA 2GUGA 4UVGA 1GNPA 1T26A 2VL7A 3QA3E 5D3MB 1XJ5A 3VI4B 1CS0A 2QN9A 1CB7A 1SXHA 2YWJA 2ATVA 1B0AA 1TIKA 4UVDA 1SD5A 1XHFA 3V8RA 4N8DA 4CV3A 4CG3A 1AUVA 3BB4A 2GB4A 5HPYB 4DV1B 1SOMA 1PT9A 2OHVA 2GWHA 1HC7A 1BC5A 2VYCA 3I58A 1ICIA 2FEMA 4JCCA 4QUJA 1NFQA 1UDAA 2QAGA 3SKXA 1Y1KE 3QOYA 2PO5A 5FL7A 1HDRA 3Q6NA 1F6DA 1N9KA 3DBVO 3K0BA 4HH0A 3WK6A 3TLBA 2NTVA 3G2JA 3Q41A 2H2IA 3N75A 4ZDKA 1YV9A 2JGDA 3PTZA 2OB2A 1LSJA 4B3CA 1XOIA 1TC1A 4JB3A 3IVRA 4GPTA 1CRQA 1P8JA 2V6JA 3CRVA 2HXGA 3HN6A 3RWOA 2NZJA 1N2CA 1P3JA 5A4DA 1KO4A 5FPYA 4A2WA 1YQ9A 4IH4A 3SDBA 2XRFA 3VR3D 2B83A 2AXQA 2VS1A 1GCAA 2W7TA 4F5YA 3K0CC 3DLIA 3CJTA 4BFZA 4PLYA 4Z7NB 3A1DA 3AEKB 3KT0A 3O8OA 4TKUA 3MRSA 4W1QA 1U8CB 2ZYTX 3T6KA 1WD7A 2CLIB 2JI6A 5FUMA 3T5PA 2R97A 5A2QA 1QG4A 1UT8A 3IV9A 3TRJA 4F38A 3IMKA 2FFRA 3DZKA 4H0NA 1O89A 5FI0B 4NV3A 5T67A 4BVLA 2DFNA 5CVJA 2O0HA 4DVJA 4G1VA 4H7FA 3Q7IA 4ZEMA 3OAAA 3TK1A 3ZY5A 1PZMA 1IXRC 1ZDMA 2B2CA 1RT9A 3AOEA 1NN1A 1Q15A 1LI7A 3NWOA 4DAEA 5IABA 3ILHA 4FK8A 3C6XA 4NDNE 4I4TF 3WIBA 4UUAA 1CE8A 4CIXA 1AB5A 3Q0TA 5AI0A 5IK2A 1KY4A 2JZCA 1Y1TA 3LT4A 1K97A 1ZM4A 4M7WA 2XUJA 1SVOA 4JX8A 3ZDYB 1CV2A 2NG1A 5LCXA 2YVKA 2ZPAA 3GJ3A 5D51S 1M6EX 2ZBRA 1JZSA 2OCLA 4DIDA 1K9SA 3PXUA 4TX1A 1IZ8A 3CRW1 1CERA 4UTPA 1AGRA 1F12A 1Q84A 1YH3A 2F1KA 2QSYA 2QVZX 3A04A 4GPBA 4P7FA 3UXHA 3P20A 2VXYA 4ITUA 5KQSA 2MYNA 1DG1G 3HMQA 2MHCA 3QG5A 2VDOB 4MKZA 3UAOA 3D3NA 1ZR4A 3GQVA 4D5GA 4PZUA 3TLKA 3W7BA 3D4PA 4LSGA 1EXMA 4LZWA 3ABRB 4QDJA 5BOVA 5FO0A 1BG6A 4X61A 3IX7A 1P5RA 2A9FA 2WJZB 3D59A 4JKYA 3BRSA 1LBTA 3NNSA 1I3MA 2DWPA 4HQRA 1FBTA 4R69A 3E1KA 2O8CA 1T8PA 1A82A 3BIXA 1N6RA 3ZE0B 1DEOA 4AX8A 3KNZA 4W1PA 3O90A 3ZWMA 4TGLA 4WASA 2DSNA 1JA9A 3GU3A 2YXBA 3B9BA 4C78A 1I24A 2Q8NA 3S2GA 3ED1A 2LVBA 1ZHHA 1ZVJA 3EQ2A 1LPAB 1JKJB 3URKA 1U5AA 2Z5LA 3PQ6A 4TKLA 1UMCA 1XZHA 4NJMA 2CLCX 4CL0A 1FF9A 1Z5NA 2VJLA 4RFSB 1EIWA 3GLFA 1AOXA 4HWTA 3GMIA 2AMVA 4I3HA 4YJ3F 4WKPA 4Q7QA 1FNMA 2PL9A 4C05A 4ARBA 2AOTB 5HCIA 1RQLA 4NOJA 4F3NA 3STYA 5BSGA 3E9RA 3F6BX 3PGXA 2VDKB 4NBWA 3S3TA 1BXKA 3JYPA 3KQKA 3WRVA 1BXGA 3SD7A 1ENYA 3I2IA 3WYFA 2HMWA 5AKYA 5JADA 4LRSB 4WKBA 1M2NA 1XZNA 3MAAC 2LCIA 1ONPA 2AVNA 3UUWA 1LLUA 1TLTA 4DE5A 1FJXA 3ABZA 5BN3B 2VXBA 2PZAA 3EW7A 5AHXA 1RM5A 3LK7A 4H6VA 3PHGA 3MIZA 3WJ2A 1R2QA 4AMUA 3U1TA 4FUQA 3HKCB 5IAAA 2OT3B 1K5HA 4RZQA 3W2FA 3HNOA 2BC9A 3NXKA 4E70A 4G97A 4GMKA 1BAPA 4RHCA 3VH4A 3RAPR 2ARKA 1VIMA 1VE5A 2WQZA 2W2NA 1YNSA 3IH5A 3AVXA 4G1CA 3DYBA 4RWZA 2ZB2A 1DC7A 4ZA2A 2UYOA 1B4DA 4JH0A 1UC9A 2H85A 2YZ7A 3CPSA 4OP3A 4IOLA 3ONDA 1II8A 1T3HA 3I2KA 1CQZA 4ND7A 4ED9A 2I55A 4UZEA 4IINA 1WP9A 4MIOA 1AHHA 4XA8A 5BV2P 4CR7A 5LYJB 1IZZA 3RTGA 1C0LA 4IGIA 3SZ3A 3GCXA 3SR4A 2H0RA 1PF7E 1FQOA 2GSWA 3GN1A 4K9LA 4RVFA 4RH0A 4RHUA 2MT9A 1EUZA 1LJUA 1SZJG 2WUEA 2ZU0C 4G85A 5EP3A 1R9JA 1LNQA 2CUKA 3C5WP 4KBFA 1EJ2A 1G5RA 5ALKA 1OIVA 1XCLA 2VJMA 1IBCA 4QVGA 5LOVF 1O5TA 1P7YA 1T4MA 1GPH1 1F2UA 1PR0A 2H4XA 2VNSA 3L7KA 2NUAB 3SICE 4D0RA 1ONSA 2OYSA 4BQEA 1IQUA 2HBYA 3O4VA 4Y0VA 3WVNA 3L4JA 2GLTA 4TXHA 3MJCA 5T41A 5L45A 2PXXA 3FBWA 3NWBA 3MLAA 3FUVA 2G6BA 4P6VF 3BZUA 3IILA 4UM7A 1WXHA 1R9MA 2DUMA 4D4JA 3RAGA 4P4SA 1U7WA 4ZCTA 5IKEA 3M81A 5KS2A 2DKNA 2B21A 3IE2A 3KQWA 2WWRA 2E18A 2J6BA 2XVAA 4RKRA 1S1CA 3ZI7A 1A5ZA 1X74A 4DQDA 4EG1A 1J0EA 1GFIA 4NNOA 1HR0B 4KRFA 2DFTA 1VBKA 3G8CA 3OP1A 1QS0B 2VAXA 4ND6A 1YVUA 2QMEA 4M60A 4R8MA 4G01B 1RD4A 4FFOA 3E9EA 3KOUA 3N5CA 2K5UA 4HH4A 1C3VA 1DXQA 2QJOA 3B9PA 1JAZA 1WRBA 3KZCA 4IFIA 5HSGA 3BXFA 2HRCA 1GNRA 3QLTA 2W2LA 4UBOA 3RO7A 4IDFA 4J29A 4YK7A 3KHKA 3AV0B 1KAOA 2IF2A 1Q1EA 3GD5A 4FSHA 2PDAA 3BIJA 2AV6A 3B82A 3GUVA 2WYIA 3D2LA 4H1HA 1WBJB 1USIA 3HSSA 4GKJB 4PGHA 3BSSA 1DTWB 1SQGA 3EQ9A 1GTG1 4ICIA 1AMUA 3NX4A 4FNOA 1DAGA 1B8UA 1G5QA 1SC4A 3O2JA 4CMGA 1DPGA 5JROA 2Z2IA 2I4NA 4Q47A 1I1QB 2H8KA 5C51B 2H4WA 1D4AA 4ND3A 4KE7A 2LCQA 1QX4A 2FH5B 3K6SA 4C2TA 2PZKA 3GNSA 4KQJA 2NU7A 3FNFA 2DAPA 3QPUA 4Y2YA 3ICOA 3RSLA 1NF8A 4OUKX 3N0TA 3RYCB 3T5TA 4LRYA 2ZRIA 3ZR4B 3P0FA 2I1QA 1M33A 5K3DA 4ND2A 3TOXA 2ZUFA 1EZZA 2B94A 2W48A 3KVOA 4CMIA 1LQUA 3A6GA 1CQIA 3D6FA 3CUVA 3SBEA 4U2BA 2FZ4A 4Y6QA 5JWOA 1P1HA 4GX2A 4PHFA 5H0IA 3MF4A 2QQGA 1JN0A 3H18A 4IZHA 1AK2A 4RLSA 3H16A 3OMLA 1X1EA 1X7ZB 2GPAA 4QGGA 4YAOA 1U2GC 2O3SA 2VJOA 3GFSA 4X7RA 3OHMA 1CYDA 3NHPA 2HW8A 3P45A 521PA 2IYTA 1JFFA 3NRCA 4CN8A 3GARA 1BFDA 1OTHA 2A0KA 4J16A 5JSYA 3OM1A 1MVOA 4LW8A 4DLRA 4OKSA 4DNXA 1MHPA 3F4LA 5A4FS 5FTNA 1HFWA 3HJTA 2ZUTA 4F11A 5DN6A 1LW6E 1N5KA 3QVVA 5IH3A 1XCPA 5JMOA 4J0HA 3X1YA 3C6KA 2ZU6A 2W2XA 1QIJA 4EMBA 3QEAZ 3BBPA 5I3ZA 2PBLA 3EG9A 5JXWA 1F5NA 4YCSA 2ZIXA 5KNCH 4KHPB 4YXWA 3D3JA 1N75A 1J2RA 2A6PA 2GR9A 1R0LA 2J9ZB 2QRHA 2XWBF 2OFXA 3F5FA 3NUZA 3HB4X 4IWYA 1M7BA 4J7AA 4EBBA 5FUVA 3I45A 4NV1A 4XCVA 2ZATA 1KI7A 4AS3A 1QNLA 1WXGA 4MI3A 1U0NA 2HXYA 4K86A 4WV3A 2WABA 1M0EA 3H5AA 4F56A 2X9VA 4X1KA 1XP8A 3A6DA 2QMYA 4JC5A 1OH5A 3E8SA 4JCOA 2GCEA 2DUNA 2OV6A 2AR9A 4ODIA 2PH3A 3N6VA 5IC5A 4DKJA 4YIKA 2J3KA 1ESZA 4QAQA 4QYIA 2UYYA 3PUXA 1NAHA 1UANA 1C80A 1JQEA 3AETB 3Q8KA 1ODJA 4YMIA 1Z06A 2XCUA 1CVLA 1MX1A 3N6RA 3QEJA 5TQ0A 3LXRA 3ZHZA 5T64A 1UZUA 1H8HA 3MK31 1A4UA 2F59A 3AUJB 2HJRA 3JQEA 1SCKA 1U9YA 1MG0A 2OP0A 1EVEA 3I5UA 4GOOD 2FPXA 4KQMA 1DXHA 1OASA 1SEPA 2Q3MA 4LV8B 4KH0A 4ZQHA 4ZVSA 3SE7A 4EMTA 2PA0A 3Q5GA 4NPHA 3ZVKA 2BEWA 1UPBA 2ECQA 2YWDA 3STUA 3KDAA 1KSGA 5BWOA 4YASA 4QTZA 3VTFA 3SF0A 4FHEA 4YLGA 5FUBA 1Z29A 3ZZUA 4AY6A 4R1QA 4G1EB 5CX1B 1ZS9A 4IRMA 4LISA 4DG9A 2A1IA 3G2PA 3G2LA 4Q19A 2HBZA 1EVYA 3U81A 5IEBA 3EGWA 3TCNA 5AD1A 3UANA 2C7PA 4JXZA 2ZYWX 4NH0A 5C81A 1O0BA 3D0OA 4QPPA 5EMMA 4QNRA 3UOAB 2C5AA 2GFQA 4GD3Q 5TB5A 3GFTA 2VWHA 1DDOA 5HHTA 2FP3A 1JA1A 3BE6A 3SSAA 3WOVA 1U2TA 5JS2A 4ZVNA 1M72A 3OCYA 4HEHA 1XAJA 1NRWA 1NULA 1H2RS 1U3DA 3CVUA 1VJTA 5DGHA 3W1WA 4E3ZA 5B6IA 1WDTA 1I2DA 4B7UA 1BE6A 2AOVA 2A9KA 3PNQA 4OGKA 3K9FC 2YS6A 4CE6A 5DXJA 1E2MA 1PX0A 5F21A 2QIPA 2E9SA 5EMJA 1AM4D 4R3NA 4GAEA 2NYVA 3DW3X 1TM7E 5AK6A 1GSIA 3QTTA 1BN6A 1QE5A 2NO5A 4MPPA 2OYRA 3VR2A 5F73A 2NUBA 3MPUA 1JG2A 3NNNA 5GV7A 1YE8A 5TR9A 3ZWDA 4KUHA 3UMVA 4BTVA 3ZD7A 1XNQB 3GFOA 3IPRA 5BWNA 4CKXA 1Q91A 3L04A 2C9ZA 1W4RA 3HB7A 4FX5A 1FQWA 3LCMA 2VK1A 2NZVG 5DLPA 5I5GA 3V97A 1L4LA 1QX3A 1Z08A 4HFRA 4P33A 2J41A 4WXHA 4YR7A 1WB5A 2OCAA 4PG8A 5LZ2A 1A97A 1J0BA 4AP9A 4WI1A 1ISHA 2ECFA 1DKMA 4NXNB 1U0RA 1B1AA 2B92A 2QW8A 5FTLA 3AL2A 1ZSVA 2ZTVA 4BGEA 2J3IA 4GOND 4WKCA 3TH5A 5C1DA 3EB9A 4IOJA 5I01A 5DTQA 4TV8A 4OUDB 1K0FA 3UIEA 3H5NA 4JLAA 5B1HA 1I80A 2QYHA 3AB7A 4PR0A 1I7SB 3GDFA 2Y3IA 3NETA 4IGFA 4X94A 3GOQA 4CXMA 3V4FA 2AHRA 4QUKA 2RHMA 1COZA 1DAIA 2REBA 3B7GA 2PMFA 3RB8A 3VHRA 3CF4A 3VPGA 3UBMA 3F7NA 4L4ZA 2ISSD 2IEIA 4RHEA 1J5PA 3P9CA 2DY0A 1GRVA 3IIEA 3TRKA 3OZBA 1PGNA 5CDFE 1MH1A 4YY3B 1GWNA 2VQFB 2EWVA 4AZSA 4EECA 5CVUA 4GE0A 3ZWBA 1TKCA 2O2ZA 3ZNQA 4CM9A 2GS9A 4J7XA 4NFYA 2AOUB 3GLIB 1K2VN 2NSLA 5JCJA 1KFJB 4N0DA 4LFAB 5JYEA 2FK8A 1IUNA 4N3NA 4V0ME 2NU6B 1NVKA 4O63O 4IIEA 2QW1A 1G2OA 1E6CA 3PR1A 3TX6A 2YHSA 2F8SA 2QQEA 1HEYA 3EC1A 1RWXA 2WNIA 3PQ3A 1FOEB 1UUFA 5FYQA 1P77A 1JDJA 1A88A 4N0PA 4HNAA 4MEJA 1QWOA 2C9MA 4U7TB 1NLFA 3AUYA 4NYJQ 5AIBA 4YLEA 5JS1A 2Z9CA 2J4CA 3HC7A 2JW5A 1ORWA 4DSAA 2OPBA 2NPFA 1FYEA 2NZYA 2FWRA 1E62A 1G17A 1E1NA 4BNXA 3GLVA 1SU6A 2IEBA 3LT2A 8ATCA 1IYZA 1JDSA 1PE0A 2NT4A 4QQKA 5EPOA 2IYAA 3C3PA 1I2BA 2AXNA 3DUFB 4KL8S 1EUYA 4AY4A 4KQ6A 3IUBA 5LDHA 5IBCA 4G3XA 3G1TA 3IQXA 4YMLA 1E2GA 5LMUB 3RUHA 1XQXA 3EBPA 1YBVA 1K06A 4E1BA 2O7NA 3H19A 3OA0A 4U2GA 2AIRA 2IIBA 3PGJA 4UEJA 1V95A 4FLEA 5ENZA 3PPYA 1OCEA 1ZM3A 5ALVA 5DM4A 5KMGA 2J45A 3NAGA 5TVGA 3O21A 2E55A 2IXFA 3M9WA 3MUEA 3T4EA 4EKNB 5KNBA 5DCLA 1XEAA 4WZAE 1WMDA 1QK5A 5J4VA 3SE0A 4S1NA 3SQLA 5BUSA 2WKQA 4R1NA 1LQ2A 4G1BA 4EPYA 2HF7A 4OXYA 1CUGA 3BE4A 4A8PA 4D4KA 2WFZA 2P4EA 3O8RA 1D5WA 3F3MA 2J0VA 4TLMB 1IULA 2JAUA 3JR3A 4OSPA 4Q21A 4Q9NA 4MR7A 5ARCA 4MHOA 1E5QA 5FEUA 2Q27A 3ZWWA 1J56A 1PR1A 4KTVE 4M99A 2RONA 3D1JA 4F7WA 4YYZA 3BGWA 1VBNA 2IHNA 2B69A 4M9RA 1PQ4A 1VP3A 2GZMA 1XTPA 2JIPA 3EUAA 4WEQA 3D2BA 2W43A 1XF9A 2P3SA 1NLUA 1VJDA 1Z0SA 2YDYA 1JFVA 3H4IA 3H3XA 5C4GB 3NTRA 3ONEA 4GUDA 1V16A 3FRJA 3WQBA 4ZGWA 2HHJA 3S1AA 1YJ8A 2P2SA 1KJWA 1WHSB 1JMVA 1DB3A 3N53A 4HDOB 3AKZA 2QX4A 4F2GA 1VL0A 2PZJA 4CN9A 1K63A 1QHYA 3D8RA 1V45E 2HDHA 2H51A 3KEFA 3TQSA 2CLKB 3S5UA 5IVKA 5K0JA 1JXOA 1JEEA 1NP3A 3C3CA 4F92B 3F90A 5K8TA 1N32B 1BSVA 1E9RA 1WHTA 2HXSA 4PEVA 4B79A 4PICA 5CLJA 3G3EA 4IO1A 3MELA 1ZA1A 2H29A 4L08A 2PUWA 4WBXC 4ZCPA 5DLYA 6AT1A 1U2PA 2HLHA 5JVDF 4GGMX 2V5AA 5HF5A 3VDNB 4YCDA 1ZUNA 2JJMA 1R5OA 4M98A 2P40A 2JLXA 2MYPA 3R44A 1Q7BA 4MYHA 4RVUA 3T7RA 3V8EA 3BH6A 2FW1A 3UK0A 3ADCA 1Y6ZA 3VHLB 4WW0A 4JXXA 1YULA 3L1VA 4FFMA 3ZDZB 5FPKA 2HK9A 4RD1A 3WR5A 3ZZTA 3KQPA 4LY3A 4M88A 3L0ZA 4CV0A 3LF1A 3H04A 4PG4A 4LF8B 1DQPA 1NGSA 3O31A 2C3YA 1NJ8A 3HA3A 1F8YA 2DHEA 2JA1A 1G8MA 4PG6A 3CU5A 5DNAA 5JNRA 1R74A 1YQXA 4G81A 2VPQA 2VH5R 4UTRA 3RFXA 2H2GA 3DXXA 3K9GA 1SPBS 4GI7A 4GRAA 3LCJA 4J2OA 5KINB 1KY2A 4IDBA 2A1TS 4Z99A 1EJ0A 3IMFA 3I1FA 4YRPA 2CL0X 2R00A 4MRPA 4TTTS 4AROA 4DBVO 1ITZA 3TQHA 3U7IA 3ZU6A 1U7PA 4CDGA 4PFSA 3VH3A 2YHBA 1KVSA 2IYXA 4TYYA 2HWUA 1PJ8A 3N2NA 1QE0A 1CZKA 2WMNB 4JQZA 4F0JA 4IMPA 1KEWA 2EDAA 5A03A 1L7QA 1CIJA 3CWQA 4RDIA 4BIIA 1ZSYA 1SO8A 2BUBA 1WBBA 1BXRA 4QYXA 4IUDS 2WD7A 4LNHA 2ZRMA 1EE9A 3DMRA 1SQSA 1CZRA 4PX2A 4ENTA 3KBOA 4YRMA 1I0LA 221PA 3H3FA 5DDIP 2CXPA 5G0WA 2OO5C 2WMOB 2YMMA 3K6RA 4INAA 3V8QA 2ZI5A 5TLSA 2H1HA 1H42A 3IQIX 1FDVA 3LQ4A 4MRSA 2ZIZA 4CMJA 3C6BA 3X1KA 1G55A 2PU5A 2HFKA 2RGUA 4FDVA 3C2QA 3HBFA 3SJAA 5FQNA 4RMHA 3S2YA 3A9UA 4Q1EA 1HYBA 2TMYA 1P1CA 3A1CA 4XB1A 3OBIA 3T5BA 4QFMA 1MABB 1IQPA 1QGZA 3RHTA 3OJOA 4QEDA 4RENA 5CG2A 5L9AA 2VNHA 3MINA 3WE7A 2EXXA 1E7QA 2HUNA 2IP2A 1US8B 3ONNA 3ZDQA 4F7DA 1ENZA 5GIPE 4NU8X 4BPRA 3GPCA 3KYIB 3FPHA 3K9CA 3OQVA 1SU8A 3ZY4A 4F1WA 1KYQA 4NENA 3EHEA 2PKXA 1MJNA 3T3GA 2WLTA 1KYZA 5L7WA 1IH8A 3BKXA 3TIXB 1UK7A 2EJBA 3CSSA 4W4TA 2GTHA 5E0OA 3JQ9C 4FOSA 4J7UA 5CA1F 3I9JA 1GCGA 1UBJS 2VZEA 3WC4A 4MUHA 3WDKA 3MJEA 1YDGA 2OECA 5HDQA 2CMHA 4E12A 1RKBA 2VTKA 4QLBA 3ABQB 3W3AA 5H4HA 3W2TA 4D02A 4XFKA 4UBKA 5ALTA 4UEKA 4E33A 4OPMA 4YJKA 5HMMA 2H7CA 4QOEA 4AL4A 1A1SA 4C88A 4EMSA 2CEAA 4NMLA 2PNFA 5EJGA 1YS7A 4P4NA 3T7TA 3A28A 2LPMA 3BIFA 5BQFA 4YHBA 2H4JA 1FTGA 3UHJA 4B32A 1I7QB 3ZIUA 2COEA 2XOKA 2AMYA 4OXQA 3QELB 1KMHB 1ZMRA 3DBHA 3IBCA 2CDBA 2LCFA 3L8HA 4I46A 4RUKA 1T8UA 2AR7A 3AFGA 3PC4A 4C5BA 2SECE 4KLRA 3IIMA 4OYLA 2ACWA 1LTKA 1NPTO 2NQ2C 3L7JA 3QWHA 4UDNA 4DSOA 3JQFA 1Q6ZA 3KJIA 4XASA 3IUYA 2HMTA 1OX4B 1GZ3A 5C7YA 3QM1A 1EDBA 2PPLA 1X7YB 2Z6QA 1YZTA 5A5GA 3TFOA 2B3DA 4HDMA 4CL2A 3SBOA 2ZAGA 5EIBC 1DKLA 2GFIA 1IMOA 1EVQA 2VHZA 4Y7CA 3UCXA 1XU4A 4O4HA 2MINB 5EZ6B 3VVCA 1QH8A 3IEMA 2PWZA 3ETNA 5HR5A 2IA5A 1UFKA 3K9WA 1GARA 2R1TA 5DIFA 1W36C 3PK0A 1XRPA 1Q12A 2CB9A 2ENUA 4BKQA 2I2AA 2PSHA 1MQ9A 1QAQA 1OC4A 2Z43A 4MVJD 4MZXA 3L4KA 3QXHA 2JD0A 3GI1A 1QIFA 3OU7A 1I6KA 1PJLA 2Z95A 2PLRA 4QBFA 4TWBA 4B5KA 4BEJA 3FNBA 3WL5A 2AJTA 2X1HA 1W47A 3JD4A 3PC3A 3EGDA 3GOHA 3R6GA 1ZQ1A 2V0CA 2AN5A 1JHQA 3ABSB 3R3YA 4WZBA 3SLKA 3TXYA 3WB2A 2YINC 3IQEA 3JARA 4Q93A 1YBAA 3SWWA 3R09A 2VWGA 2VHVA 1XRSB 4GUAA 2BGLA 2HWXA 4JB8A 1Z6QA 2I8AA 5A0FA 2W2QA 3LIIA 3PHHA 3LKVA 5E3HA 4P5DA 3ER6A 4H31A 3M49A 1UP4A 3WGNA 1J6UA 1RBMA 3I34X 4B33A 2RGRA 1MN6A 2PWPA 1CX9B 5GONF 5K2MA 1HLDA 1P9WA 1Y3BE 3NGXA 4L8VA 5BVHA 5BQOA 1XQ1A 2WILA 1M0WA 2C7OA 2V58A 1DWPA 4JGIA 4MUNA 5FB3A 2PKWA 2YV3A 3P71T 1Y4SA 1LRKA 3N8NA 2WVAA 4QTXA 2G76A 2A35A 3LFHA 2AZXA 3FMIA 1IBKB 2XMBA 3VR5D 3RFCA 3AQ4A 1MGPA 5AKEA 3WWCA 4GQIA 4EB0A 4UMVA 5DEOA 4ZHQA 2QVXX 4IJKA 1N2BA 1TJ4A 4W9NC 2X4IA 3CH5A 3VX4A 4CMAA 3JQBA 2WF9A 2DLNA 1KZ4A 3A1SA 4Z0HO 3VFDA 4YRDA 4WFQA 4BX0A 2XYRA 4Y1FA 3D7KA 4LYJA 2GMWA 1T3SA 1ZCJA 3MD9A 2RGEA 4GMGA 2CV2A 1Z5WA 2LRHA 4HWRA 1U1GA 2GYWA 1Y37A 3NHKA 5CTAA 4PZEA 1FQKA 1JX6A 1XRMA 2N1BA 2CJYA 3H2ZA 3IXMA 1NT2A 2VZ9A 4PFKA 3TW0A 4F8YA 5GVSA 2XLBA 5LIPA 2I1VB 5FBLB 5J2TA 2IOQA 4JLPA 4R4JA 1P0QA 5ALMA 3SJUA 4LNUA 2VO1A 4GDMA 2NPIA 4HYTA 4DCNA 5ITSA 4EG5A 2FMTA 4G26A 3C3YA 2AG0A 4Q1DA 1TT7A 3CNBA 4G63A 1E8MA 4R7GA 2WZDA 2CBZA 5KDLA 1CUSA 1GT6A 2X4LA 1ABEA 1DO8A 3BXZA 5AI5A 3QXGA 1UDXA 3VZDA 4H2DA 4X3OA 1Z4JA 1M3SA 1E20A 3NVMB 2CMKA 4HX2A 3T7JA 2HDWA 3LZCA 2BGWA 1L4FA 1V3QE 4NP6A 1JF8A 2V3WA 3G2IA 1RI4A 2GYVA 3T3OA 2R6HA 2RHBA 4MB6A 4YJGB 2VHTA 3QUSA 3E9CA 1YRYE 2IYOA 2V6GA 2I3AA 1VHDA 2HWYA 3JYOA 1S2GA 2C2XA 1FU4A 4IICA 4FR2A 1TGYA 2XHZA 4LI0A 4N82A 2WWTA 1DBSA 4AYWA 3K2EA 3DTVB 2QP4A 4NJEB 4LX0A 1U4OA 1JVNA 2FR0A 3OT5A 2A3RA 4ZO4A 5HUJA 2AI1A 2BDTA 2QB5A 3V42A 5JARA 1W1UA 2XECA 5EJFA 1DKPA 4HZGA 4LYEA 5JWRA 1X6VA 10MHA 3DL4A 5TS2A 3Q3GE 1RMYA 3MRVA 1LTQA 1YB6A 2BFBA 3ZKWB 1SHZA 2GEKA 5KB3A 1RHKA 5JXHA 2IQ5A 3VPBA 4RA9A 2C7BA 2P4SA 2GZ2A 3REOA 4QULA 5KSZA 5K0NA 4DNQA 3CUTA 2CVZA 3S6JA 4ZZIA 3DM9B 5JANA 2BEVA 4FFVA 2CT8A 4AKHA 1WUHS 3EEIA 1ML4A 5F3RA 1GG2A 1NNEA 3HKBB 3S2UA 1CZUA 3EXHC 3FNQA 5E6UA 4OYYA 4JI0B 1XLTA 1IEXA 4FIDA 4YJ2A 4OMFG 1OSNA 1FXUA 1PCXA 1H0KA 2XAAA 2AZTA 1X2EA 2DE0X 3F3SA 3SOZA 4G1FA 2HADA 3SPXA 6REQA 4RGVA 5JNSA 2RI1A 4BC0A 4IHJA 2ODTX 1X3SA 3L0IB 1E3LA 3FCAA 3TIFA 1B23P 1EWTA 3THRA 1RHQA 3OX4A 1DBPA 2GZSA 4BCCA 5KYUB 2AJDA 1DLIA 2CY0A 4HN9A 1YR3A 4D80A 4BEVA 2V03A 2D4AA 4G07A 5BUQA 3NAQA 1BYUA 3HTXA 1JIIA 1UJNA 3FB4A 3JQRA 3KDPA 4F2HA 4PSCA 5EG5A 4AECA 1DKQA 1CUZA 3KKZA 4KGVA 4F84A 4CM8A 5FUWA 4K9MA 2QRJA 2XRYA 3NV7A 4GM1A 3MXOA 4ZEWA 1U0EA 4ZQEA 1OTYA 3RVLA 1ULBA 2WT9A 2E4ZA 2Z6VA 3O6VA 1PGQA 3KPYA 3N70A 4CRWB 1U8ZA 2Y68A 4GS5A 3RBVA 4XYLA 3PFCA 3G0HA 4Y9TA 3NBQA 4BNGA 5JAZA 2JJYA 3UH0A 3OM9A 2GAAA 5T8KA 3L4BC 3UMMA 1TD9A 1TZKA 1SKYE 4YCJA 4ZIRB 2VRBA 3CB2A 2ZBGA 3WGUA 3NYQA 2HCTA 4HDKB 4ZT7A 2F9MA 4N47A 2Q41A 4BIMA 5BSWA 1DLJA 1RAAA 1SUCA 1MX5A 2QE6A 1GN9A 1H66A 3KLOA 3SXUA 2Z30A 4TT3A 1K3UB 5JSZB 1IMJA 3VNBA 3H5TA 4CIDA 4RVGA 4U9UA 4I55A 3K9BA 4YRLA 1F8FA 1ODSA 4JJ6A 5AK0A 5CDTA 1EUCA 3K09A 5KWVA 2KWIA 1F60A 2CJWB 3B3JA 5KSPA 7REQA 4D44A 4C7KA 1C0IA 1OXKB 3I72A 3OJEA 1SXJB 3PXBA 1B73A 4TT8A 2GZRA 3DAYA 1W9MA 4QPDA 3H0EA 4ALKA 1Z9BA 1ZI9A 2CNDA 2E82A 4F2DA 5JLJA 3LX4A 3B12A 3FWZA 3HY3A 4KYTA 4ALLA 4B6SA 1LEHA