4LKRA

Crystal structure of deod-3 gene product from shewanella oneidensis mr-1, nysgrc target 029437
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
233
structure length
233
Chain Sequence
TAHINAQPTDFAETVIMPGDPLRAKYIAETYLTDAVEVTNVRNMLGYTGYYQGQRISVMGHGMGISSMVLYGHELINFFGVKRIIRIGSLGATQQHVEMRDVILAQAAGTDSPTNAKRSSGYHMATSATFSLLHKAYTKANEKGISVKVGNVFSGDLYYDPDEDMIPALERFGVLGIDMEVAGLYGLAHQQGIESLAILTVSDHCLTGEETTAQERQLSFNNMIELALETALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of deoD-3 gene product from Shewanella oneidensis MR-1, NYSGRC target 029437
rcsb
source organism Shewanella oneidensis
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase DeoD-type
total genus 73
structure length 233
sequence length 233
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2013-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lkrA00
1RCTE 4TXMA 1K9SA 5B7QA 3MMSA 4TTAA 4TTJA 4U2KA 4OJTA 3T94A 3DJFA 4MCIA 5C80A 2XRFA 1A9SA 4F2PA 1JYSA 4DA6A 3NM6B 1ULAA 1ECPA 1M73E 3P0FA 1SD1A 2QTGA 3BSFA 3PHBE 4QARA 4OF4A 3INYA 3K8OE 4BMZA 4TS9A 4GLFA 4LKRA 4WKOA 1Y6RA 3OZCA 2HWUA 1Z35A 4D8VA 1RYZA 1PR5A 2OECA 4TXJA 1V3QE 4TXLA 1XE3A 1YR3A 2ON6A 1U1CA 1PR6A 4LNHA 3D1VA 2RJ3A 4WKPA 4DABA 3FNQA 4MARA 5EUBA 4IP0A 3OCCA 1U1GA 4QAQA 4M7WA 4TXHA 3E9RA 3FB1A 3E9ZA 3UAYA 3UAXA 1TCVA 3MB8A 2HSWA 2QTTA 1JDZA 3PNSA 3FUCA 2OXFA 4EARA 4X24A 1Z5PA 4GKAA 1RSZA 4DAOA 2I4TA 4D8YA 5EPUA 1LV8A 3NBQA 4TYMA 3EEIA 1U1FA 1LVUA 4DA7A 3LA8A 3LBAA 3GB9A 4TS3A 1Z39A 4WKCA 4DA8A 4L5YA 2AC7A 5CXSA 1YBFA 4DARA 1V41E 3KU4A 4PNPA 1B8NA 4QEZA 5F7ZA 3KVRA 2A8YA 5CXQA 4R31A 5IU6A 4M1EA 1RXYA 1JE1A 3PNPA 1ZL2A 1Z5OA 4G8JA 2PGAA 1T8YA 1JPVA 4YJKA 1Z5NA 1N3IA 1Z33A 4RJ2A 4QASA 1SQ6A 1V2HE 2H8GA 5B7GA 1QE5A 1VHWA 2A0XA 4YNBA 3F8WA 1OTXA 4WKBA 4F2WA 2GUWA 1T0UA 1U1EA 3KHSA 1CG6A 1A9PA 4QATA 2A0WA 1NW4A 4BN0A 2QSUA 3TL6A 1NC1A 3DPSA 1PW7A 1JE0A 4LNAA 1ULBA 3UAVA 1CB0A 3GGSA 1Z37A 3IOMA 2HRDA 4JOSA 1A69A 4TXNA 1PR2A 2AI1A 2I8AA 4DANA 3O4VA 1TD1A 1OV6A 1G2OA 4YMLA 3UAZA 1FXUA 3BL6A 3DP9A 2AI3A 2IQ5A 3LGSA 3FOWA 5F7OA 4JWTA 4G41A 4LDNA 3K8QA 4GLJA 1V4NA 4D98A 3KUKA 1PWYE 1ODIA 4NS1A 3EUEA 3NM5A 3P0EA 1Z34A 2P4SA 1T8RA 2Q7OE 1ODKA 1ODJA 4L0MA 4FFSA 2BSXA 1NC3A 1PR4A 3DF9A 1OTYA 3UT6A 4P54A 4EB8A 1U1DA 1RXUA 5F78A 1A9OA 1Z38A 3UAWA 2OC9A 4BMXA 1Q1GA 1Y1TA 3ENZA 1PBNA 5CCDA 4OEHA 1A9RA 4OGKA 1JP7A 1RXCA 1T8SA 1SD2A 1B8OA 4GMHA 4H1TA 4M3NA 1OVGA 1ODLA 1I80A 1Y6QA 4WKNA 1PKEA 1RFGE 1JDSA 4F1WA 5IFKA 1T8WA 3EUFA 1PR0A 1JDTA 3O6VA 1RT9A 2ISCA 5DK6A 5EFOA 2QPLA 4KN5A 5CCEA 4D8XA 3DDOA 1PK9A 4LZWA 3NM4A 1WTAA 5B7NA 3FAZA 4ECEA 1V45E 4E1VA 1C3XA 4L5AA 5ETJA 1Y1QA 3SCZA 3OF3A 1K3FA 5KB3A 4R2WA 4I2VA 1VHJA 4QFBA 1PK7A 1VMKA 3ODGA 1Y1RA 1PR1A 2A0YA 3E0QA 2B94A 4F3KA 5CYFA 3FWPA 4L6IA 4PR3A 2AI2A 1YQUA 1A9TA 1YQQA 1ZOSA 3PHCA 4NY1A 4R2XA 4UC0A 4OGLA 5F73A 1VFNA 5F7JA 4TTIA 1JDVA 3OZBA 3OOEA 3OOHA 3OPVA 5CYGA 5FAKA 5B7PA 3OZEA 1A9QA 3OZDA 5F76A 1SJ9A 4F3CA 1TGVA 1TCUA 4YO8A 4K6OA 5I3CA 1K27A 4MCHA 1OUMA 4D9HA 1Z36A 1PF7E 4NSNA 2QDKA 2OC4A 5F77A 1RR6A 3C74A 2HN9A 4DAEA 1TGYA 4OY3A 3IEXA 1Y1SA 3ONVA 5JPCA 3U40A 1V48A 3BGSA 4DA0A 1RXSA 3KVYA 4L5CA 1YRYE 3EMVA 3QPBA 1OU4A 1LX7A 5K1ZA 4G89A 4BMYA 3BJEA 5F7XA 4JP5A 3KVVA 1JDUA
chains in the Genus database with same CATH superfamily
3WS7A 4FM9A 3FCSB 1WPXA 3WLPA 1X7DA 3WNDA 2GM5A 1KI6B 1S2MA 3OQIA 3EH2A 4CLRB 1LJLA 1T2EA 1L4BA 2QD4A 1PT6A 4FFBB 4FU0A 4RPGA 2JLVA 1MJNA 2MU1A 3LQ2A 2OFWA 3I9V6 4FIDA 4BVJA 3RLFA 3HZZA 4EGQA 1OVMA 4YQFA 1IXYA 3JQ8A 3QWHA 1DWQA 2QTZA 3DDZX 4GX2A 2FGJA 4OJTA 4JL6A 1NNI1 4Q05A 5DHTA 3I5XA 4JT8A 1ZUNA 3AUXA 2Z8YM 3LDUA 3PIDA 1P5ZB 4HX5A 4UM7A 2PKQO 4EL0A 2ZRPA 4ND1A 4WV3A 1HTBA 2IXTA 1PJCA 3RYFB 1FFEA 1UADA 2O2HA 1SD1A 4HUQB 2PL9A 3CEHA 4DUPA 2WDPA 1T5DX 3HP7A 3C8UA 1E59A 4QARA 2V7WA 1CZLA 1G8HA 3W5IA 2GBIA 4NOMA 5EIAA 4G9GA 1DU4A 1FDRA 2HXYA 1R0ZA 1UZUA 3BMOB 4PO8A 4MA4A 3S28A 1XVUA 2FHSA 2LZ0A 4GLFA 5JY1A 3H97A 1ZCJA 1HSOA 1RYHA 1W34A 1O97D 2R3SA 1QAMA 1RCUA 3DMGA 4KSBA 1U3UA 1C1XB 2NO1A 1NMZA 4X20A 2ST1A 4CDGA 4XSGA 4G37A 5KX5A 1AMNA 1Z28A 2P9HA 5ELLA 3DFIA 1I2DA 1C1HA 3I9NA 3ESAA 2WILA 1CCWA 2J5RA 3C85A 2WIFA 1GZ4A 2QTAA 3OZIA 4K9SA 4NULA 5HA5A 1GZHB 4R1PA 2QM3A 1SC1A 5FD8A 5B58T 5TPWA 4IO1A 3G2PA 3N2ZB 3W5VA 2OK8A 1R8JA 3E53A 3D1VA 1S2GA 4ZI2A 2GO7A 3PEWA 1MT0A 1V25A 3O94A 1EGMB 1WP4A 3KOOA 1XTRA 2C2XA 2HRQA 1AK2A 4R4JA 3A6PC 3CZ4A 5DNYB 4KQ2A 2I4RA 2EZ4A 5LD2C 1Q2UA 3NHFA 4FGLA 5EUBA 2QRGA 1BVRA 3I2FA 3JQFA 4MS3B 3RIHA 1XG5A 5LP6C 3T3GA 2FZLA 3U0VA 3WTBA 3PDHA 2BEWA 2X0IA 2YVUA 2ZI7A 4TYQA 4BLPA 5F2OA 2UVPB 3KKEA 4BEJA 4D6XA 5LLDA 1RBYA 3VC1A 4KNWA 3V8QA 5IUJC 1Z29A 3PNKA 4Q24A 5HQTA 4XDGA 2P6MA 2FPPA 3PPXA 3G9QA 4B17A 1NM5C 3HUEA 4X95A 2QT9A 1YFZA 1C1YA 3DV2A 1U80A 2CVZA 1IJBA 1Z4IA 3MPUA 4WE3A 5ALYA 4E03A 4LOLA 2OV8A 4HTAA 3CLSC 3L7JA 5CCXA 1SCBA 5IXJA 4ZVVA 2IU4A 3DJYA 3P0RA 5DM70 3WGVA 3AR5A 2VF7A 1JRLA 2IYUA 3CUKA 3PIIA 3CVJA 4TMTA 2DYKA 4HQLA 4PFSA 3FD8A 3CSDA 5DBGA 2VDOB 5AK6A 2VK4A 4HNVA 3OU7A 4W7HA 3K6KA 5A9SA 1Z4NA 2F3QA 4HEA6 5ITZB 2P75A 2FNAA 3MTEA 3B3AA 1OLUA 3B82A 4UQLA 1QQ5A 3HI6A 4CKYA 5AFSA 4DR1B 5E7JA 1P0PA 3M82A 1YRHA 2W6JD 2XYQA 4O2AF 3E7FA 3Q41A 3FW1A 1JEAA 1SZPA 2JFUA 3RSQA 1H5UA 3GGJA 1MX9A 5JSKA 2RBEA 2HQ1A 2O7RA 4X41A 3FYUB 1GTG1 1CE8B 2V3VA 3GROA 1M2FA 3HZRA 4OG2A 2AFVA 4K9QA 5ERGB 1GAXA 1QTRA 1PGQA 3R74A 2Q1WA 4OGFA 1KEZA 2DULA 2MSCB 4IXTA 1WMBA 2EW8A 4DARA 2EFJA 1Y48E 3IRUA 2MIIA 4CMJA 1FE8A 1Z82A 1QF9A 4I46A 2UXDB 4BNFA 3W3ZB 5A04A 5A2GA 5JSQA 1G38A 4BDSA 1J56A 5JJCA 1N2CE 4C05A 1KAOA 3VJRA 3HR7A 2AOTB 3SFZA 2Y6VA 4WH0A 2R8RA 4NZNA 3LW8A 3P9IA 4OIFA 5U1PA 1R5BA 3SC2A 1T4CB 2YJNA 5K8VA 1DKNA 2J3MA 2FP4B 1EP1B 2RGEA 5FPTA 5JZVA 2E89A 4J3JA 1I24A 2HIAA 2HIGA 2FEWB 3DAOA 3PXXA 4M53A 5ARDA 1JFVA 5TT1A 3JD3A 4UCFA 4OKNA 1ORIA 3QEJA 2A9JA 1MOSA 1NJSA 4HB0A 3VV3A 2NZVG 3MEQA 1NUPA 2DP4E 5CNIA 3D2AA 4BO0A 4EHKA 1E8MA 2G0NA 3C0KA 3HPRA 2AD1A 1YBAA 2ZETA 3OEHD 4XPIB 1QE5A 4UNRA 1FPQA 4R3NA 5ALKA 1N6PA 2HHLA 2VDNB 4WA7A 2ZE6A 1FS6A 2JASA 1RNLA 2OORA 2J7PD 2Q3BA 4QU5A 1DXYA 4UUMA 4OFZA 4QPZA 5IJ0A 4P0TA 1BEEA 3TTWA 2Q3DA 2EWVA 5KQSA 5LDGA 1XZAA 1PUJA 1WJGA 4KU4A 3LM8A 4F4HA 5CAEB 3KHSA 4YUWA 1ZGBA 4O33A 5HIMA 2Q3HA 2H0RA 1YQEA 4PHGA 5A05A 2JJQA 1NVBA 5IKEA 1RRKA 5B57C 3HO1A 1OGJA 5EMNA 4BN0A 3BRWD 4UVDA 5IK2D 1CHNA 3E3AA 2HBYA 2VYFA 3ZY5A 1OZAA 1ZINA 2OG2A 3CNLA 1DQPA 4FDUA 4FUQA 2Q49A 3ONDA 4DSUA 4HFMA 3UMYA 3P2KA 2I1QA 4XR4A 2R8EA 4D3ZA 2C07A 2EERA 3W2IA 3SXUB 2BGIA 1I7QB 2Y77A 2D59A 3RUEA 3UY4A 1FFHA 3QYFA 4CR6A 2JFOA 2Y1FA 3V6MA 3HJTA 1OZGA 1A88A 3WGOA 1W44A 2DJIA 3T0GA 1BDBA 4NQZA 1AU9A 2XAAA 4EGAA 3U6BA 1RRMA 1ZSVA 1QLWA 1D6SA 4OYHA 2MWMA 1BH2A 3PPYA 5HW0A 5K03A 1UPXA 3KELA 3WSWA 2B92A 4IGFA 4HRVA 2AVDA 2QN9A 4ZTUB 4B6OA 1YONA 1C81A 2O0MA 2UYGA 2PDAA 3A4VA 5EAIA 1NMXA 3BMCB 3LWNA 4BV3A 4D3YA 4J7XA 1CYDA 2HJVA 5JJKA 4AICA 2DU8A 3W6ZA 2G80A 3OEWA 2FSPA 1T5HX 1UBGA 2GK4A 5EGSA 1Y5MA 2PTGA 2J9GA 3O74A 2H29A 1E2JA 3FOWA 4I1SA 4MYTA 2XF2A 2OVBA 1T1EA 1A97A 3WIEA 1N3BA 1BX3A 2QN3A 5IABA 3SVLA 1AZLA 4MYSA 4MUMA 1FX0A 2HYDA 4R0NA 3LY9A 1V43A 3EIEA 3ET5A 3C3AA 4UTNA 4X8OA 2H3HA 4BC0A 3JYQA 4AUKA 1AXEA 3C3WA 4G36A 2PBRA 4DLXA 2VS1A 3AEZA 3MRXA 4ZD6A 1GT6A 2XRYA 3E23A 3RHFA 1Y4SA 3AJEA 5KYXB 3H18A 1HRKA 3ZDXB 3QKRA 4BQFA 1JIQA 2WFLA 3SHWA 1IAQA 4A8JA 4QBHA 2D5IA 4OQEA 3EZNA 2PO5A 2JAWA 3H5TA 4R7ZA 3TQOA 3AL2A 4I4NA 3RVQA 5AYVA 2CJWA 4N6NA 4XB6B 1XXHA 5LJIA 4TZTA 3AVUA 1OZ0A 4M8SA 1G9TA 3HO6A 4MVJP 1VECA 4Y6GB 5UKDA 1OYYA 2VDWA 4FC6A 1XR3A 2A2ZA 2D5AA 3BCUA 4M0UA 1ODKA 2VHWA 5IAJA 2K2WA 4ZMSA 2D6FA 1A2BA 3AX6A 5GGXA 1RDFA 1S0UA 1KDZA 5AMXA 3ZUGA 4G07A 3U3MA 2XCTB 5L7YA 3IAS6 2F9MA 1MC1A 2I7CA 1II8A 1GYQA 4LDAA 2TRSB 4RSHA 1PR4A 1XB2A 2WHXA 1MV8A 2B6HA 4ER3A 3S2YA 3HN7A 4B31A 3DD5A 2WHYA 1B0PA 1US8A 3A4MA 4RV5A 3T06B 3WLOA 2CUZA 1XN1A 1UIRA 2JGJA 1GGVA 4ME6A 5EMLA 5K0LA 5LDHA 4QDJA 2ZRGA 4K81B 2I6QA 4L8VA 2XI4A 5K3DA 2WIDA 4INOA 2FG6C 3BJZA 1DJQA 3IQXA 4ZV7A 3SYTA 1PHRA 1W36C 3I5YA 3DUFB 2X86A 1RFLA 1E2PA 2NSJA 2ZT7A 3NKFA 4DDKA 4AKHA 2FOLA 2X6RA 3S2EA 2NSYA 1F48A 2IPMA 4L9WA 3C4VA 4I1RA 4LDRA 1U0LA 3V4PB 3R8FA 3EXHB 5JMOA 1MPTA 1C3EA 4TLMB 2B1JA 1VLQA 2C31A 2YW2A 4JV5B 4BIMA 2ZB8A 1HG0A 5JBQA 1B23P 3PGMA 5IAAA 4X1KB 1BW9B 2DR0A 3VZRA 1WPGA 2QQ0A 1SA0B 1UEXC 1WW8A 4RD6A 2GBLA 3NRBA 2RCYA 1XGKA 4R51A 2UUPA 3G5MA 3E15A 4YJHB 4OHMA 1PKEA 4CKEA 1FFBA 1R9GA 2Z5VA 3CNNA 2GVDC 4ZQEA 4UNIA 1RYNA 2EZTA 2Y1KA 4FIZA 4MW4A 3ZBQA 2X5JO 4B2IA 1JHZA 1ID1A 3I72A 4M0LA 4YCJA 5EPEA 3IQDB 4EJ6A 2C0PA 1JDTA 4K6MA 5HRUA 4ARIA 1SK9A 3QHAA 2OHXA 2CHEA 1QIEA 1F2UB 1R0XA 1Y80A 2WAAA 1SNYA 3HCCA 4Y6SA 5BYKA 1OPXA 1TKAA 3D3QA 2GEVA 1OXTA 4PINA 4B1FA 3JWIA 2CFOA 2DETA 1AUOA 1DEXA 2WU3A 2UZ4A 2WUVA 3FJOA 3G0DA 5DO9A 1KO8A 5IS2A 3I8XA 5E2AA 2WG0A 2NQTA 3EPLA 4FFLA 3CRNA 2CLIB 4YV2A 3B9PA 1O5TA 4P3PA 1B2LA 2LNDA 3IMFA 3L7NA 4BMOB 1O58A 2D1SA 1SQ0A 1KEEA 1P7ZA 3ZHTA 1RWPA 1WUKS 5EKDA 5K2OA 4W99A 1UC9A 1WHSB 3FYSA 3G2HA 3OF3A 2ORVA 1KVTA 2EF0A 2A0FA 2QHXA 4D4LA 4TKVA 4DPLA 3AM1A 4B5KA 3FZQA 3RGGA 5G53C 5HQ3A 3L0SA 3AHEA 3ETGA 3BFPA 3KZCA 4RS4A 1QOQB 4OXKA 4DCJA 3ZVKA 3DOCA 4LJ4A 2JGDA 4Q37A 4OYYA 4G0YA 2PQ2A 2TS1A 8ATCA 3SE7A 4B3IA 4DL9A 2ANBA 4I2VA 5ALGA 1SBTA 3E58A 2H63A 4AJHA 3WNVA 1QDEA 3UUEA 1ETUA 4MUEA 4B7XA 1V7QA 3FOBA 4ENPA 5KWJA 1HDCA 2GJ8A 2JD2A 3ILSA 4CHTA 3M34A 5A5VA 3T3MB 2H1LA 3QKTA 5B53A 2F00A 3NDBB 4DYDA 2GO1A 1EX1A 2F2TA 1R5NA 1I7SB 2C84A 2SCUB 3DFZA 3V9PA 3PI7A 1WO8A 1VKRA 2AUNA 2RC6A 3LHDA 2JB9A 2C57A 3FWPA 4TN5A 3Q1KA 1WD5A 4M37A 2L19A 1V6CA 4I8XA 2FPXA 3PL5A 3DOHA 2XA2A 3QF4B 4E2FA 4QO8A 5J2UB 4PFQA 2IX9A 5KDLA 3CJTA 3RTAA 5FTLA 1EG2A 5EE0A 1PJZA 3C15C 1ONNA 4XLTA 2XSZA 2Y0EA 3C3EA 1YCGA 2KLBA 2EKPA 3NNDA 4IDNA 5F7JA 3TDKA 1YU6A 4EB6A 2MMGA 5KVCA 4BWGA 5KYTA 4NHOA 1MJFA 4TLLB 3ZD9A 4FMCF 2PZJA 1E9VA 1G3RA 4AYWA 4S1NA 5LA6B 2CBZA 4JEIA 3M9XA 1UZLA 5LMUB 4DUGD 2J4FA 2M9MA 2PVSA 1A96A 4CM9D 2O7QA 1D2MA 1UOOA 3PFKA 2EJVA 4OOFA 4NCBA 2B7CA 2G88A 1H1LA 3ZZMA 4CT5A 4JT2A 1BQEA 4Z3OA 4KRXA 4K6OA 5FR2A 4F6RA 4G5SA 4I4TB 3E9EA 3GVCA 4M0FA 4CPDA 1XTZA 4RVFA 3KZMA 3ZBPA 1RTKA 2P1ZA 5CLLA 3FTQA 3B1YA 4MV4A 1PYGA 2WG1A 3TZHA 3W9UA 2F64A 3CCBA 1GCUA 3KAPA 5KTSA 4C89A 1RQNA 4RTOA 3R9XB 3EQ7A 1ZK3A 4ALKA 1P2BA 4O5AA 4CN8A 2EWWA 4MWTA 5CLQA 4DW8A 3PEVA 1GUFA 2Q9UA 2Q6LA 4JSYA 5TARA 2PRIA 1HX7A 3SGLA 4YJFB 2WU8A 4IAOA 3UB2A 3L4SO 1TNDA 2HA2A 4ADSG 1O5IA 2PT7A 1RPNA 1MH9A 2EKZA 2GN4A 1WDKA 3ONVA 1BROA 4DHWA 2DWQA 3KPVA 1ZN8A 5D5HA 2XGJA 4JGGA 2M6RA 1NUAA 1E9DA 1MFPA 3L3BA 1UZMA 4GO1A 4BNHA 3PS9A 4KNYA 1YB7A 4Z2AA 3Q9SA 4WOKA 1XNQB 4MVJG 2RGDA 4WLUA 1OU4A 3SP1A 1VSQA 3BHMA 3RIGA 1CJBA 5AOVA 3TIGA 3FOEC 1K7SN 3EY9A 3Q7QA 4DRXB 1PYDA 3FUUA 4LOAA 4JP5A 1AXGA 1ZMXA 4ZN6A 1LLFA 5JXGA 5IT5A 2XCOA 3RBZA 3O8QA 2A7QA 3EIFA 4O4LA 1U8UA 3RWOA 3U4CA 5HYVA 2ATEA 2WSSD 4Y2JA 5AKIA 5JZBA 3WMEA 2JGMA 2QTHA 4LCJA 3EZ9A 3M6WA 3QE0A 1DKLA 2WD7B 4JVSB 5LBTA 4D9MA 3PEEA 4NONA 1D1SA 1FBNA 2R65A 1VIMA 2C1XA 1G41A 1LRKA 2DTXA 2OCDA 3L7MA 4NBKA 2G7MC 6NULA 3TEFA 5JVDF 5JXWA 1L4MA 5FNVB 4KXVA 3DJFA 5JLAA 4DM7A 1HETA 3C16C 3MS7A 1GLVA 3QLTA 4LRXA 4XEUA 1O0SA 1WXGA 1G4HA 5LYYA 2ZUFA 2WYWA 3ODPA 3Q85A 2CDBA 2PSJA 1EPUA 5DHQA 5DM60 4X65B 4XGNA 2P1DA 2H5LA 4L76A 4P82A 4LWOA 2FN4A 3BKWA 1LBHA 3DT9A 3QA9A 1XKTA 2RAUA 3PUVA 1I3MA 5DISB 3ZCPA 1ZHOA 4KQIA 4IIJF 1IH8A 5EZQA 3HGQA 1U0JA 2J6IA 3DWFA 5ED0A 3PHGA 4BMSA 1EZZA 5DEIA 2QIOA 3DXZA 3EVGA 3RO7A 1M3SA 3VDQA 3ZLJA 1YZQA 2QL5A 4HH3C 4QUDA 5KNBA 2FN9A 2H4FA 2V4UA 1OAOA 3KXKA 1CVRA 4M9SA 4P80A 4ZJUA 4L27A 3P9QA 1DC5A 1T15A 2HWUA 4HDMB 1F8UA 3L7BA 3IIEA 4WZZA 5HMLA 4FOOA 1YKSA 1L7PA 2QORA 3OQMA 4J4HA 4LTMA 8GPBA 4HAOA 3NO4A 4LXTA 5A3RA 3TW4A 1CQIA 2CMHA 1NBWB 3BD6A 3O8RA 1MG5A 3OAAD 2ACVA 2Q5FA 2ON6A 3NV9A 4G97A 3H1TA 4MVJD 4PS1A 1HMYA 1FCJA 4TOIA 4WN9A 3T3EA 3NIWA 1Z5VA 4R84A 2ORIA 1NPTO 2CEAA 3FN4A 3O8LA 4FSXA 2AOTA 1Z4OA 5D1HA 1YR8A 2E5LB 1DJMA 1TC1A 2PMDA 4RELA 1VLLA 4C4RA 3QI7A 2Y1LA 1P77A 1ZU4A 2ZUSA 4V1CB 1LSOA 1GKYA 2ZIXB 3FNEA 3HYNA 4RFSB 1CY2A 2LKDA 2I6SA 4LKOA 2D62A 2BTEA 4R0VA 3AP1A 1D04A 1VJ1A 4TTVA 4GOJA 1G3IA 1TVMA 2JS7A 3ICOA 4AP6A 1Z4QA 2JCBA 3M6UA 5TJHA 3M83A 4QTYA 2DMRA 3TKLA 1EVZA 1QB7A 2E6KA 3UT0A 3AU9A 1YR6A 2P7HA 5EWLB 2DBQA 4DB2A 2XPCA 1D6MA 1AUQA 1K06A 1W4AA 2YVQA 1PFKA 3DBHA 3NCHA 4ZEOA 5IN5A 5JNVA 4LS3A 1DUIA 4MO2A 4OAOA 5IH3A 4H0FA 1OI2A 2JDID 1QIIA 3WLJA 2HI0A 5IF3A 1ZEMA 3S6JA 4Q9KA 1VJDA 5CA1A 1N1EA 4MVJH 4I1IA 2J4DA 4LOKA 4D8YA 3ORSA 4D43A 1R7RA 2PX8A 3KJNA 1QHGA 2H1WA 2PV7A 4DWJA 5JAMA 3QXGA 4FYXA 2YXNA 3PZBA 3LBFA 2EFEB 1YZGA 3PR1A 2FWIA 1GNLA 2G4VA 1XF9A 2H11A 1PJLA 4FLEA 4J03A 4MEJA 1CJMA 3AUAA 2P2CA 5THXA 1B4DA 2VEDA 3BIJA 1PVOA 1NMQA 1R4MB 5KTNA 1GR0A 4W1SA 3JRWA 1ZKDA 2QJRA 1NN5A 4EG0A 3HBJA 2GVZC 1N2OA 4PVDA 4RZQA 5KQLA 1YZFA 3FFWA 1HTTA 3DEJA 4YWJA 1NX9A 3FUTA 2FWMX 4ZU3A 4AF7A 1EHYA 1JMKC 5T4HA 1DKUA 2FLVA 2P91A 3HCPA 3K0FB 3PD0A 4WFIA 1JIUA 2DKNA 2HK6A 4IZIA 2IZ5A 4X00A 1Z6XA 1JJAA 1NI5A 1Z4PX 2C94A 2CSUA 3PE3A 3IXMA 1Y8QA 1V41E 3QU4A 1DPFA 4A2QA 1R0SA 1BMQA 4JVOA 3IIJA 2Z09A 5EEHA 1C80A 1UT5A 3MJVA 1W19A 1O95A 1SMKA 4WJLA 3FWKA 3RH0A 1ZJZA 4I5DA 1P1FA 2ZROA 4O4JF 2GCPA 2W2TA 2ZR9A 3N53A 4JZYA 5CHYA 5DV9A 5TPWB 4FPXA 1P3DA 4BTLA 3H83A 2RG1A 5AW2A 1QRSA 2JGIA 2X1HA 4E08A 5BRAA 4UNPA 3DZDA 2CHVA 2WW8A 1G5FA 4V0KA 3G8AA 1ES9A 2W58A 3VJMA 5DGIA 3V4VB 1O89A 2RAVA 3T1HB 3JAMA 1DAHA 1AHNA 4CV3A 3ANTA 3A0UA 4FKZA 4Y9TA 4AJIA 3M4XA 5ALMA 2W2VA 3LVFO 4M8KA 4OH1A 4K2AA 4WEQA 3FYTA 4HT3B 2J1LA 1MJHA 1GTRA 5HUHA 1NQVA 1V0JA 3IILA 4JU8A 1V4VA 3OM0A 1RE0A 5DBFA 3WWZA 4HWTA 1JR6A 2B20A 1OSNA 1WLSA 1VL5A 4NBWA 1TZBA 2QP3A 3LIIA 3DZHA 2ONYA 3DL2A 1LDNA 3AUJB 2HLDD 4MWZA 3QUQA 1UT6A 5EJ8A 3L93A 4HUQA 3IAS1 4PLHA 4KE7A 2IXGA 2OAP1 1ADYA 3F49S 3PNQA 4G25A 3IV7A 4MVXA 4X63A 4WERA 1DXQA 2BCGY 4FP9A 5ALEA 4MQLA 3TOXA 2B0CA 4FD2A 3Q0IA 5EVCA 3LGAA 1I0LA 1KHHA 2NXNA 4HEA1 3I6MA 4IIDA 4GLBA 3T3DA 2YWEA 4QXAA 3ZWPA 3FMIA 1FNBA 3UQZA 3KJQA 4ZEVA 1D07A 1WU7A 3SPXA 1PYOA 1IZ7A 5J4KA 5EIBC 4Z2YA 4NPCA 4OQFA 2C5EA 1UZAA 1I4TD 3RAPR 1E7RA 3G85A 2W6ID 1GA4A 3GA5A 1L4KA 4NK5A 1ZESA 2WPDD 3D8NA 5TS2A 3L8FA 4EJSB 4F6CA 5BQ3A 1U28C 5H8WA 3QRWA 3A1NA 3JQDA 2P77A 2A86A 2AYZA 1A04A 1GXSB 2VPIA 4B3HA 4PCUA 1P4SA 4B7UA 2OPBA 1TVKA 1H6BA 1UK8A 2Q0XA 3K4PA 1P1BA 3FCCA 3HRHA 1FSPA 1FUIA 2HWWA 2B5VA 4PYMA 4CF4A 4ERNA 3X1JA 2H52A 3DKPA 4IZHA 1FXUA 4O4HF 4WBNF 3AY3A 4YONB 2FFQA 5BNTA 5K0GA 3G1TA 4LK3A 4AJ9A 1GWNA 4GD3Q 4CKXA 4WK0B 1YOVA 4IDGA 1HNWB 3DHEA 1XTTA 2VAWA 2QM7A 3NTQA 5FIUA 1BN6A 2BGLA 3L4JA 2B4TO 4JBWA 2ZJYA 1P0QA 3SYMA 1ZJ5A 3O7MA 4CKBA 5LN1A 2WEKA 3SSOA 1FUKA 4LWQA 1XJCA 4P83A 1QG2A 5EOVA 3T7EA 1CZKA 1EQ2A 1P9NA 3AJAA 3VI3B 5AXDA 3E3OA 5JQWA 1GKUB 1U8FO 2CVPA 3ZS9A 2I71A 2O2GA 4FHDA 2FG7C 3GV0A 1LXCA 2P3QA 1V4NA 1WPQA 2CLLB 1CK4A 1DWOA 1JB1A 1JIJA 1OIVA 3HWRA 1CJUC 3IQFA 4ISCA 2XMZA 4ZOEA 3E82A 5I9SA 3TR5A 2GZSA 1NN0A 4K6CA 3EFOB 2HJRA 3X1XA 3WB2A 5AJZA 4RF3A 3L18A 2D5BA 5IVKA 3AVOA 4P3XA 3VR5D 4ESHA 2C3PA 5EJ6A 1NM5A 3GJ8A 5FULA 5H80A 3G13A 4EY6A 3J80A 5LZ8A 1ZH0A 4U0JA 2WUFA 3RYHB 4MV8A 3AG6A 5DASA 1HE8B 4NJOA 4LYHA 3WX0A 3KZ1E 4H15A 2HLDA 4DJDC 3NOVA 4BECA 1NWHA 2BSXA 1DKQA 1UC4B 1QTIA 2FR8C 2FN8A 4GWKA 4J2TA 5FTKA 3K1JA 2GM4A 4W8OA 2ZXEA 1SVOA 4LXUA 5L3QA 2M1XA 4N18A 4Z4HA 2E1PA 1GSAA 2QM0A 4DXHA 3UGQA 4AWAA 3UJ7A 1PG0A 4NMHA 4YYEA 2AE2A 3CX4A 3PYLA 4LJYA 4MINA 1EM8A 2NNLD 1QB8A 1TF7A 3F3SA 3KXLA 3U4AA 1LNQA 2CXQA 1DC8A 1T5SA 3Q7RA 2EATA 3UAWA 4DNXA 5A5EA 5JAPA 4BMXA 4ZZ1A 1RHJA 3A27A 4ZIRB 2GA8A 4YMTA 1JKMA 1Z5GA 1X9HA 4A92A 5A6SB 4POAA 1GCAA 4MGZR 3GY0A 4PLPA 1L4NA 3W6UA 3UFXA 1QE0A 1C0IA 5DVZA 1HT2E 5K3OA 1NRWA 3A1WA 3MBOA 1ORWA 1H2YA 1UBOS 2RCNA 2Z9BA 1ZD5A 4BP1A 2O7NA 4F1JA 3LAWA 3DLIA 3TBFA 2E4ZA 1MXHA 4GMHA 3RK1A 4I81A 3E7PA 3IT2A 3HV2A 2HO5A 3UUWA 4QUHA 2YWBA 1QRDA 4AZVA 2AMJA 3IUQA 4OLJA 2QN2A 4MRSA 2ROQA 3C6XA 3OLXA 3T9CA 4DUZB 1N9GB 5FOSA 4P84A 1XHEA 2PGJA 2JEYA 4LFAB 2G8LA 4DLPA 1G21A 3ZE1B 3FDFA 1U2DA 2C1ZA 2FZGA 1NUQA 1PZMA 4AKTA 4QPPA 4H7JA 2QOEA 5K6TA 5KNCH 4BO8A 1GPKA 1KA9H 3IUPA 5GPBA 5JSZA 1ODTC 4NMWA 4RW0A 3WYAA 4DCUA 2BE7A 2IA5A 3Q5DA 1OFUA 1OU0A 1RPJA 3L0DA 2DHRA 4TT3D 4OLFA 3S5JA 4JN6B 3RUAA 3GAFA 2H2WA 3GRAA 3QTLA 4JB3A 4R2KA 5EKSA 2JA1A 5FWDA 5TPZD 3P32A 2BR4A 1X1RA 3V4SA 2CLKB 4HRAA 3KB1A 3L4BA 4Q1EA 5DNUA 4FK8A 1DFGA 1U0FA 3JARB 2XTJA 2PT6A 3EPRA 5G0TA 1BQ4A 1U4NA 3M4NA 4FGSA 2WZDA 4S05A 3O2SB 3IEMA 3GNTA 5JR3A 3H5WA 4WGGA 4YMSA 5G1PA 1Q77A 2C4MA 4M9RA 5CM8B 4WVFA 2VTBB 4C01A 2VF8A 2PZ8A 3I6QA 1ISIA 3KIPA 4Q39A 3Q4GA 4NU6A 1Z06A 1J5PA 3G89A 2X9GA 3D8SA 1BU8A 4X54A 4B6QA 1OBHA 1E9EA 4OFBA 2I3ZA 3FPGA 3KLPX 4U7TB 5CGQB 5B2EA 3P97A 1YBHA 2YN2A 5C8XA 3OCXA 2W37A 4DXDA 2TYSB 4ZCQA 4PSDA 1GGFA 1HORA 1XWWA 4RH0A 4G4JA 3W9YA 4OMDA 2GZ2A 2YIDA 3UOGA 1JSRA 4TMXA 2WJ3A 4YCSA 5CDYA 4CEJA 3T3OA 2IYVA 3MJCA 4QO7A 1D03A 4DVGA 4CGZA 4HFNA 3M8KA 4NENA 3FKQA 2QG6A 2JFHA 4Q1CA 5J2UA 3GEEA 4DR7B 1Y3AA 1KPGA 3PD7A 1UFOA 4J9UE 2YNMD 4ZOQI 1QR6A 1CQJB 3WGMA 3N2YA 3OBBA 4J0CA 2W6MA 4YRJA 3OMXA 4Q7QA 4M76B 4KIJA 3ENKA 3COSA 3GGDA 4HAWA 3A9WA 2CBGA 2JAUA 1P3Y1 1I1QB 4U2EA 1EINA 2R6ZA 4IHKA 3OQVA 4NATA 4BNIA 2XCQA 4KQ1A 4J1NA 4OGLA 3OOYA 2PT9A 1T0IA 4N5IX 1L2TA 1N6OA 1P72A 3B36A 4HUJA 1HT3A 1VFNA 2KWIA 4C0JA 3IXQA 3AETA 1W96A 5SYMA 5LUAA 2ZT5A 2FSUA 4YV1A 4F8JA 8ABPA 1R6VA 4XCVA 3KJEA 2PUGA 4CM3A 1YRAA 3HA3A 2WFMA 5SZIA 2BISA 2QJTA 4R3WA 2ZAOA 2P3SA 2EGHA 3OJ0A 3MM4A 2ZTLA 1ZGGA 3QE2A 3UK6A 2GEFA 3NMUF 5IDXA 2DBYA 5I7SA 3NJ8A 3MBIA 2TSYB 2AUMA 4RWZA 1PJ3A 4UHCA 4Z7NB 3PCXA 3GRVA 4UBJA 4XZ3A 3IHKA 3VNBA 3HS3A 4MAFA 2GARA 3SLRA 4BKPA 4D9HA 1KY5A 3IEIA 4GLOA 1U8TA 5LP6B 2OC4A 1CT9A 2NX2A 5HIJA 1YRLA 5LKAA 1MA0A 4MV1A 1UKBA 2IHJA 4YJGA 5B4VA 3HU5A 2XKBA 4NMLA 4A4DA 2IXFA 3KPJA 4H6XA 1X6VA 3ZY2A 4JVNA 4WN3A 1M8KA 2Y27A 2W2PA 3IEXA 5FUYA 4P7FA 1GTMA 3ILYA 3P9PA 2FLWA 3TFQA 1QQBA 4RTMA 3GN2A 5FPYA 4LZNA 4RAQA 4Q1FA 3J7TA 3HLTA 3TW0A 3UXHA 3WDLA 1NLYA 5A1TA 5FBLB 3KQHA 3IAXA 3LWZA 4RDIA 3E7XA 2J5BA 4YN3A 3RUFA 4Z9YA 1WQ4A 5FXMA 3PR3A 3K92A 1Y5NA 1XZFA 5I9BA 1N6HA 2C3OA 3QQPA 4G1FA 3VH1A 1SY7A 1WTCA 2A0KA 1AQLA 4Q3CA 5F7XA 3DV0B 3PDUA 2B4KA 3DOJA 4IXDA 1SFRA 1ZOPA 3IE2A 4KZKA 5CGZA 3VKFA 5CBPB 5IWAB 3ETDA 2WWXA 4YRTA 4ZI3A 5L7TA 1XRSB 1BW9A 2CGEA 4GOLD 1QOPB 1NXTA 1N8SA 4L3VA 3VUEA 1FUUA 2A9FA 3OIDA 4G09A 5JD3A 1U0RA 1VCIA 4NBRA 1ZIDA 2EC5A 3D6AA 3O03A 4GL4A 4WOPA 2JPDA 5CH3A 1JIKA 3VR4A 3WR5A 1DIGA 4N7RA 4XYMA 1E96A 3NBXX 1AC5A 2V4ZA 4V0NA 4R8RA 1DBWA 2FW9A 1RI1A 3AEYA 3FUXA 4I2NA 4N7JA 5CT9A 4ZARA 4F2PA 2MT9A 3MB5A 3F71A 1BXGA 3C3MA 2A9RA 2J5KA 1Z8NA 2V6IA 2Z3ZA 3GLHE 3GRCA 3P0FA 2D7CA 3QUSA 4MIOA 4NE7A 5E6RB 4LV5B 5KOYA 1ISPA 1X7WA 4LEIA 3U09A 1L4YA 4QYIB 4MIYA 2IS6A 4CM4A 3H2SA 3B1WA 3IQHX 2PLWA 1EWVA 3VZDA 3FPKA 3JWEA 4KK3A 5HCNA 2VUSA 3OZ7A 1JG6A 3PFHA 1CYEA 1QKIA 1ZITA 3HB7A 4PZ9A 5D86A 1W47A 1HR0B 3A32A 4CMEC 1DQRA 5BW8A 1CE8A 4R16A 1N3YA 1ZD8A 3REFA 3Q0TA 3U26A 3ON5A 4RH3A 2WJAA 4J7AA 2QPTA 4NL4H 2JLZA 4NFSA 2HB6A 3PC2A 1PR5A 3AHCA 4RVNA 1T1IA 2HOQA 4JYZA 2XY4A 2C20A 4D8UA 3HO8A 3SX2A 1KK3A 1T2AA 3FMVA 5AI0A 1IQUA 4P4NA 1Z6AA 3TS1A 3SLKA 3WL4A 3ICEA 1EFRA 2IC5A 3ESYA 3UJ9A 4JP2A 1V16B 4Q48A 3EA0A 3RVDA 4P53A 1N1GA 1XJQA 3ME5A 2WSYB 2WA2A 4LGCA 2OAQ1 1N2CB 2JGKA 2EQAA 1TCBA 1UMCA 3GJ7A 3V32A 2E7ZA 4ZVLA 3TLJA 4D0SA 4IPTA 2X8JB 2JJ1A 5CNKA 1J2UA 4KRGA 2D0DA 3RHTA 4BX3A 1G1AA 1MG0A 3DMYA 2Q2NA 2NWQA 2QLNA 2XE8A 3U7JA 3B12A 4FD3A 4II2A 4UE2A 4A03A 4B3TB 2W2QA 1CJKC 3TSOA 5D3KA 1Z75A 2QL7A 3IEVA 2X9NA 5GWXA 1ANKA 2FE1A 4QWMA 4XJSA 3D7KA 3AOEC 5EE1A 3ZI7A 1D6JA 1K4YA 4IIJB 1J8DA 4M7WA 4WTOA 1QVWA 3EA5A 4GOND 2Z1NA 2Z3VA 3E9ZA 1QG6A 2V7BA 3CUVA 2XUIA 1DRJA 3EBPA 3CNHA 1PWZA 5ERYA 3LDHA 4EUKA 3KT6A 3NYWA 1RM3A 1WV1A 2IZ0A 1JDZA 1S2OA 2A0UA 1IPEA 3FYUC 3OJLA 5J2TF 3D4LA 4NC9A 2AUTA 4MV3A 4TV9A 4GX0A 4LJ6A 1QCDA 3GLHB 3KDSE 1N5MA 2JK1A 1PL0A 1P45A 1BJTA 1X94A 4GM0A 4EAAA 1V47A 4EFLA 4Z4CA 3O2NA 1KI9A 4ZDWA 2RIPA 2KI5A 2DLCX 1FU7A 3KUCA 4G1CA 3TEMA 4A0RA 5A2QA 2IH2A 1IYZA 3ND8A 4LRWA 5BPHA 1NP6A 1Q1NA 1DBSA 2IQIA 3EHDA 1D09A 3IDAA 2QTNA 3T9DA 1EQUA 4URXR 1U31A 5I3ZA 1L7XA 2JANA 2RB4A 3A9VA 2JFNA 1YS7A 5LQAA 7ADHA 2JI9A 4PLGA 3BJIC 3EEQA 2X0NA 3H0EA 3DT6A 2OUIA 3N0WA 3Q8XB 1DAEA 5ILQA 1G3UA 1G8FA 1Y1LA 2WYHA 1LPAB 1C9YA 4GQIA 4UARA 1K98A 2BFBB 4N3BA 3QJYA 1Q14A 1FK8A 3CX8A 4CIBA 1MABB 1PJ8A 4EG6A 4B3CA 1P39A 4H7FA 4ZHQB 3GPLA 4WXEA 3IA2A 3I28A 4EG4A 2H1RA 1W6RA 4ZO7A 2Y05A 5G4KA 4QOHA 1J22A 3L1JA 3LPLA 1C3VA 4NAHA 3QVSA 4GYWA 5ER6A 1WHTA 4OJQA 5H68A 1KAHA 2PX4A 1DRUA 4JT4A 1A9ZA 3E2IA 4NJMA 2CLOB 2GHRA 4IRUB 3ZV5A 1QPZA 3DZBA 2CZCA 5HK8A 1KJ8A 2PD4A 5JI3E 5JY6A 1TYDE 1SC6A 5A71A 4LHWA 4XWTA 4PNEA 3AFGA 1OH7A 2VT2A 3KWLA 1G5HA 4HQ6A 3VR2A 1GILA 3ROEA 3LPAA 4JLNA 4LC9A 1FLVA 2ODBA 1PIWA 3UH0A 2O8BB 1QGYA 1UMBB 4M89A 3Q7EA 3AV0B 3Q3VA 3NZEA 4C04A 5E7QA 1UBTS 3RQIA 5B7GA 2NO7A 4NICA 1HNXB 4A6EA 3CWCA 1UP6A 2FFAA 4RANA 4EHLA 4QDZA 4M88A 2A0XA 4WZBB 4A91A 1YJAA 4MYUA 4D8WA 3I4CA 4KWTA 3QI2A 1FRQA 1Y7PA 1Y3FE 2P79A 2ZSUA 1CD5A 5HILA 3RASA 3QXSA 4DFDA 5CFQA 2PJUA 4AVYA 1RRPA 2AQ8A 2RGCA 1J39A 2AA3A 2X2FA 1VE7A 5ALFA 4OQLA 3FOFC 5FX2A 5JSYA 3FH0A 3WQRA 4CR7A 1U6IA 2GNPA 3ASYA 1NBMA 3B53X 1X7GA 2F3TA 2L2QA 1A9PA 1KU0A 4IHJB 5ANRB 4JJKA 3OPNA 2AKEA 1P2GA 2P7IA 2QKYA 2FQ1A 1DCTA 3KQPA 1YVUA 3OWHA 4NECA 3EEFA 1L7EA 5T57A 4ARAA 5K3CA 5B3LA 1DHRA 1YF3A 4D9GA 4FWBA 3LHFA 4MRAA 4OYRA 1PBTA 5DGHA 1X19A 1ZO8A 2QE6A 3ACCA 4L4XA 1TQ8A 2WSIA 2IGBA 4QQRA 2Q29A 2QM8A 1KWKA 5J2TA 3DXYA 3BULA 4L2IA 5D84A 1MTZA 3LLMA 3RUDA 4EQZA 3TNJA 5EINA 1YB1A 1XLWA 1THGA 3FZYA 1IY1A 1E7QA 1YAJA 1LPNA 1A8IA 3TSZA 4BVLA 421PA 3OUTA 4R6WA 4ASUA 4ONEA 4PG4A 2PUBA 3I3OA 1Q7RA 1NASA 3WLNA 2H85A 1VC2A 2PLRA 1TD1A 2QTVB 3RVOA 4BFVA 1OV6A 4BV9A 1Z2OX 4YMLA 3TOVA 4L02A 3ZDEA 5LQMA 4HDKA 5CBPA 2D54A 3IYLW 1IPFA 2GAJA 1EE1A 1KPIA 2ODWA 4AYXA 5HX7A 2ZVPX 2ZYRA 3IP9A 3NHUA 1W0KD 1G291 2PZAA 5FHRA 4BEVA 3L2OB 3OE4A 4YT8A 1LUAA 2DSTA 2YQZA 3CMMA 3V7WA 5H9WA 1E7YA 4FQ5A 2P8JA 3CH6A 1SH7A 3CMCO 4EG3A 4FB5A 2XMQA 5IT9A 1Z4KA 2WHRA 1F2UA 121PA 1NLMA 2NACA 1I6KA 2HJ9A 3K1TA 3WRVA 3F5MA 2CFIA 4H16A 3KV3O 4WESA 1WBDA 2YXDA 4QGGA 2BZ1A 2Z2JA 4INAA 3A9SA 2WOJA 4MUNA 3FBGA 4URVR 3QA3E 1M2OB 2V7UA 2LP4Y 2AJLI 2V7EA 2WT8A 1PKXA 2C42A 3T1QA 3LL7A 4Z0PA 3LQ1A 2VF2A 3QZUA 2QI9F 1GGMA 1ODIA 2WHPA 3BRWA 2OLKA 1R0YA 2VBFA 3CX7A 4KVGA 2AGVA 4URUR 4DG8A 4JP3A 4PPYA 4K7JA 4MA0A 2IOFK 1Z7GA 2ZB3A 4OLBA 4EVIA 3SJCA 1NHGA 3T1NA 3V3TA 1NP7A 4R9SA 3KLOA 1KO5A 4U2GA 1HE4A 4E5KA 5BN4B 2FQWA 4KN6A 3TRHA 3GQBA 1IEQA 3P0JA 3ELWA 3C6KA 1V26A 1ZAKA 1ULTA 3AR4A 4DCPA 2AG8A 3QFSA 5H3HA 2H9AA 3IOCA 2WIBA 4H7IA 4KREA 1AXRA 3B7WA 3D31A 5JCOA 2ZR7A 1JJIA 1XCMA 1N6RA 3ZV7A 3JZIA 5CX4A 4YJ2B 2CF6A 2GILA 2HFJA 3VZSA 5JOQA 1W88A 3AYXB 3NH9A 1XRLA 4KV9A 3IIMA 2YBDA 4HLUC 3IBFA 3UPUA 5KREA 1QQTA 4F6LA 3WGHA 4YT5A 5AKXA 3FJ1A 3QBVA 2XLCA 5G1OA 1PBNA 1Y8CA 2NVBA 3HP4A 3TVYA 4B6EA 4DPKA 1JVSA 3BF8A 4ZT6A 3DNPA 3GBSA 4TVSA 3QSYA 1GXSA 1NSFA 1K08A 4X1YB 4EHHA 4I8IA 5FLKA 1MORA 4DRXA 1JP7A 1RIIA 1RXCA 3RC3A 2XQKA 3GBVA 2XMCA 1QC5A 2EFCB 4MPDA 4WCVA 5FOTA 1E7MA 2PEYA 4RTRA 4BTEA 1YMVA 1AQNA 2FMUA 2I7DA 2VDUE 3ZWQA 1RBQA 5FLXA 3R6TA 5DWVA 2HHJA 1ODLA 3R24A 4TV8A 1YD7A 1CZUA 2A14A 3QY0A 2YHSA 4GRDA 4LYFA 4BNXA 1T2VA 5B2FA 1IVSA 1RFGE 4G2TA 5IFKA 1IEWA 1INLA 1ONSA 1DJLA 1FP4B 3D0OA 3TZBA 3WIOA 4J90A 2FDCA 2XYPA 1IUNA 1JKJB 4CDRA 1KMCA 5U4XA 1KKMA 4FGWA 4B87A 1MAAA 2A1UB 2ISCA 2JCSA 3ESRA 4TTPA 2J0EA 2WJHA 4NFLA 1U99A 2FSVA 4PLVA 5DK6A 3GMSA 1NVKA 3ZHZA 5I9NA 1TL7C 2HTEA 2WINI 5EJMA 4MQFB 2GI4A 5AVVA 1L3IA 4RDHA 5TEVA 3GMTA 4NFHA 3W5HA 1PQYA 1WULS 2ZWVA 2E55A 3VNSA 1P18A 4FFVA 1I30A 3O7WA 3K9WA 1TI7A 1SOAA 2FKNA 1C3XA 1UBRS 2E4WA 2VZEA 3FPCA 3O82A 2Z8YA 3W8EA 5LP6A 4E5NA 3HCWA 3QU2A 4BCCA 1CY6A 3CUTA 2F62A 3KTAB 3P20A 3TLGB 4YUVA 1DG1G 4X84A 2ONZA 1YKFA 3HNPA 4YQYA 5AVZA 4EI9A 1K3FA 3ZWWA 4PHTA 4AG6A 2I6FA 4CODB 1YK1A 4H3SA 1QDLB 2JLQA 2RH5A 3E05A 1R64A 3TUJC 5DHRA 2XGMA 1E2KA 3H7IA 3OX4A 1C2YA 1ZRMA 5KINB 2TECE 3QK7A 3H0CA 5G3ZA 4DMGA 1T0JB 1I1OA 4Q21A 5IJZA 3HY4A 1CP2A 1PD1A 4EHAA 3TAUA 2BH9A 1HYEA 2NLOA 4YHBA 4PGHA 2X5NA 5HS6A 5TQJA 3UJPA 1U5CA 3L82B 1G8JA 3NAMA 2BDTA 4RZHA 2V5VA 1A82A 2FMFA 3ROKA 2XB2A 1XJWA 4RCZA 1XWFA 1DOHA 3ROZA 1ESNA 1YR9A 3EIQA 3SHQA 1C0EA 5CTAA 5AXCA 5M04A 3VA7A 3K70B 3EAQA 1RI2A 3B13B 2JGAA 1IBSA 3BTOA 3EVBA 4I55F 4BBPA 5B4TA 5CYFA 2WM3A 3TOZA 3SQOA 1QHIA 1E9BA 3TB6A 1J09A 4ETMA 2WF6A 2YCBA 3B7GA 3ZI4A 1XTQA 1B73A 2Z5GA 3LX5A 4U5QA 4NZOA 3E03A 3GK3A 4YROA 3ZHXA 3OLCX 1W36B 1U94A 4UTOA 1E5LA 3Q5GA 5HE9A 4ZHQF 4LHEA 2VZ9A 1Z74A 1VRVA 2O2XA 4ZODA 3T1TA 1EBUA 1PS8A 5TF0A 4IMRA 5D7NA 3JX9A 5EJ2A 2L17A 3HYTA 1W1WA 3ET4A 1VOTA 4LECA 4XD7D 1TD9A 5B7PA 3I52A 3O1IC 2R84A 2OFFA 5CA1B 4GI2A 2IEYA 1ILWA 5CM2Z 2EBFX 2AN1A 2OV3A 4WFJA 1K75A 3VFDA 3M6VA 3DR3A 2NAPA 1PNRA 2GJ4A 2C1EA 4LBZA 5FQOA 1UCFA 4BV8A 3QV1A 3T6KA 3Q6NA 1CRQA 1QK3A 4BB9A 4BNYA 4ZO4A 4IHQA 3NNNA 4UVHA 1L5HA 2JCVA 1DDIA 2YY5A 2LKCA 3R7NA 3V1KA 2HN9A 4DAEA 2YDXA 4E33A 2CLFB 4BKMA 4TWAA 5DSTA 1NXOA 5J2TB 3N76A 4KFSA 2GEJA 4EA6A 1LA2A 1SWVA 1Y1SA 3WZLA 2IHNA 2HHAA 1V7PC 3WBJA 3ZD6A 3K0HA 4YDSA 4PIMA 2CXTA 3W2FA 4EA7A 5K6AA 5EZSA 1YHZA 3OX1A 1TADA 4FSDA 3WL7A 2PVCA 1ZMBA 2IIVA 4L5CA 1F6DA 2Q5QA 2Z83A 3O0DA 4HN2A 2H65A 2QNIA 1ZOOA 3TJMA 3ZDRA 1ZC4A 4BAZA 4F3YA 5IEJA 3GLGA 1LX7A 1P8JA 5GTDA 4GE3A 1CNFA 2H16A 4BGIA 2E4UA 4BTVA 4P81A 2ZCUA 1CY1A 1XMPA 4X1IA 2PUAA 1CRWG 4LVUA 4P9NA 5FL7A 1LDBA 4FI3F 4Q3OA 5AVYA 1H6DA 2JIQA 5FPKA 4JHXA 4BXOB 1E4VA 4YRFA 3SBOA 1JAZA 3OY7A 2Z58A 8MHTA 4V0QA 1GN8A 1JEOA 2OCGA 3K35A 4E7OA 4U4AA 1XMXA 5FPPA 1Z07A 3MQFA 1LZKA 3KBBA 4QPJC 4EHFA 1H1TA 4E2WA 1K9VF 1JQBA 1XDSA 1C41A 1KYTA 3A10A 2VQEB 1P1RA 1Z0IA 2OGUA 1PFYA 5CFNA 1CQZA 5K0EA 1XEXB 1LS1A 3H4IA 5L4SA 1JYSA 1T9ZA 4V1CA 3QU7A 5D2CA 2MSLA 3CG0A 2WY2D 3IMKA 4Q9HA 4RY9A 2LDXA 3WDSA 1DAPA 1EE9A 3E7WA 3LP8A 2H2HA 4K46A 3G2OA 1JDBB 2FTKE 2GK6A 1EB8A 3BSFA 1UBLS 1ND6A 2QY9A 3GCDA 3LPMA 2OYCA 2O59A 1IZZA 1YDMA 5LFAA 3D6HA 3FX2A 2FPUA 3MJ4A 1DWPA 3FAKA 2DQYA 1FTWA 3QHQA 3NUZA 4RSRA 1YS2X 4Q9DA 5DFAA 3W5UA 1EP2B 3HA5A 3ZU5A 2X41A 1DO8A 3L8MA 3N2KA 2W2MA 5DWQA 5J40A 5H4GA 5L95A 2NXCA 2F9LA 2QY6A 3E9DA 4ENUA 3ITKA 2DEUA 2OFXA 4PTLA 5L3ZA 3JSAA 9ATCA 1LBIA 1O4WA 2WD8A 1N57A 4G4GA 4QXPA 4P4UA 1OB5A 1HFEL 3QFRA 3B20A 5JE8A 3GUVA 4GXTA 4BO7A 1SUFA 2NO9A 3UWDA 4YAIA 3AVVA 4ZZ0A 2NP6A 3WFZA 3FSRA 4M8NE 1QNFA 4TM7A 1NT4A 4MQUA 1LRLA 3H8SA 3UZUA 1FXWA 4ID9A 1JMYA 4C7MA 3RBVA 4DBZA 4DMCA 2OHHA 3EOAI 3G3EA 3D6MA 2ASVA 4MULA 4UPEA 4TUYB 2TMGA 3OX2A 2QD1A 3LPNA 3NWBA 2ZVJA 1EK5A 2EFDB 1FW6A 3ABIA 1ESEA 4WMLA 1FLDA 2K7FA 2Q9CA 1ML3A 3ZJ4A 1HL3A 3J7AC 1MVLA 2V7TA 5JS7A 4GZMA 2QZPA 4WY5A 3VTFA 5FV4A 5KSYA 1VM6A 2YYYA 1U1GA 2IU3A 1BRMA 4DQVA 5C5EA 2D06A 1ZVVA 3RYFA 1PNOA 1GY8A 5E4YA 2YJ3A 1PLLA 3OE5A 4AUMA 1VIAA 3I34X 5CLJA 2DXIA 4QT0A 4GXNA 3LHIA 1D4ZA 1XTKA 2E87A 2P9JA 1X1BA 3FPAA 4GOXA 5J9FA 5LXTF 3T3PB 2QTTA 1Z0UA 4R3UC 1KMIY 4BDTA 5LKRA 3W7VA 2SBTA 4G0NA 5C8DA 4KKVA 1HE5A 1P73A 2VNKA 3IAM6 1SKQA 1GZ6A 1AGXA 5AHRA 3T5PA 2WWFA 5LOVB 2OCBA 1APBA 5DSZA 5EJIA 1R0KA 1I5EA 1ILEA 1CZNA 2QE7D 3D4PA 3X43A 5IASA 1VKJA 1LV8A 1CP3A 4KMOA 2REQA 1LJ8A 3AZQA 3LV8A 2Q9BA 5T3UA 1V9LA 3SU8A 3R8CA 1YR2A 4RMGA 4E7PA 5D5PA 3T0FA 4RJTA 1OH6A 1P74A 1W2HA 2X8WA 2EXXA 2AZTA 2ZCVA 5E6UA 4ZK2A 2E4VA 2ZK7A 3AVTA 3GD5A 4TZ6A 1PDOA 3C98A 3OQJA 4ZCLA 5C31A 4ER5A 3ZCVA 2XNCA 2O8VA 1ZYUA 2I4NA 1IB6A 3H3JA 5AXAA 4L4ZA 4FDVA 2F1JA 5HGJA 3WB1A 4E30A 2ODTX 4LFBB 4EABA 4J16C 2VJQA 2VT3A 2KE5A 3PITA 3IPLA 3HB9A 1PL6A 3THSA 4C06A 4L1KA 2XZDA 3HSYA 4YRRA 1J0AA 2JIPA 4KUHA 4AF6A 1QAQA 4OMCA 2RI0A 4RK0A 3THXB 1JSLA 4YRCA 2V9CA 2VEOA 3N87A 5JCJD 1NZFA 4NH4A 4QJIA 3SYRA 3V7FA 3GJRA 1RKXA 3UJ8A 2PLNA 4IV0A 3SD7A 4OFXA 4L73A 2F8LA 1GU1A 3MWDA 1P4RA 1XZLA 3PNPA 4YJ3B 2YFYA 2PGAA 4R9NA 4J3NA 1OX6A 2D1QA 4A9AA 2WKQA 1EH5A 3PQDA 4QXQA 1KVQA 3FSGA 1M2GA 1Z12A 3RRXA 3RS3A 3EODA 1JPVA 5KTRA 3LX6A 3BFVA 1RWOA 3CURA 2PZBA 1IXSB 1OV4A 4X91A 1YJQA 1VLMA 3ETJA 1BA2A 1R2QA 2Q9AA 3QFFA 4HDRA 2BFFA 4UE6A 4B44A 3QMPA 2JBWA 1P9WA 3TIFA 2AOUA 3IPXA 2X0EA 1N0HA 5C7YA 8ADHA 5ECGC 2HK8A 5DNWA 5IT4A 4W5QA 5GOZA 4HN9A 2Q6IA 4PC2A 1A9XA 1Q3HA 3BJMA 2FN3A 5EZ6B 1Z7BA 2HW8A 3Q1LA 2VJMA 5YASA 4DT1B 3DLAA 2QVXX 1WEKA 1JILA 1E64A 3T4XA 1IG3A 3Q3GE 4RMIA 3GDGA 2I5PO 3LIPA 5LZ9A 1L4EA 3PV0A 4H0CA 2QZZA 1KJQA 2JJ2D 2MINB 4CL8A 5AM2A 1C14A 1OLXA 3HWWA 3KEFA 3PWSA 3Q6IA 4ND2A 1GJRA 2NTYC 1RLOA 3DOIA 3YASA 3GLFE 1VE1A 1FDSA 1YR7A 2JIDA 2VJOA 3NBAA 4MR7B 2H7VA 1FQOA 2QRJA 4R01A 5ENVA 3EQ2A 5LLSA 3TH5A 1NW4A 2OCAA 3LD9A 3PSHA 1C9DB 1MB2A 4I1YA 3GC6A 3WLAA 2JGFA 1JDBC 2G4LA 3K9GA 2GHIA 4HRXA 4KPUA 3WK6A 2X5XA 4HCJA 3LCUA 4TSKA 4F4UA 1TMYA 2DWPA 4QGFA 3SR0A 4PLFA 5LB4A 1X7XB 4JLVA 3U9SA 6GPBA 5KJ6A 3SICE 3ZLTA 4WASA 2RK4A 3KBOA 4URZR 3RE1A 3A6EA 4PZZA 1J20A 3T9BA 5ADUS 3A7DA 2ZTSA 3OTGA 3FRJA 3KR1A 3I0MA 5AJXA 4EY4A 1RM0A 3R20A 1S4QA 1OC4A 4B3MB 2ZBPA 3HCBA 3RVNA 1G16A 3ELDA 4D7AA 1NOJA 4LF9B 2V5AA 5JG7A 2RKOA 2HRRA 2DKFA 2SKEA 2ADMA 2VVTA 2IOHA 2YXBA 3Q9UA 4LY9A 3I2KA 1HF3A 2J85A 3ELYA 4LSGA 3VMFA 3WFJA 3B9QA 4ZZ3A 4JI4B 1HC7A 4CJXA 3W8NA 2WUDA 4DJEC 2P5SA 4TYWA 2FH5B 3C8HA 5COBA 3UK2A 1LSJA 2CXHA 4C7VA 1U5BA 4EENA 3ACBA 3ADKA 2L42A 3M9LA 4HGPA 2C96A 4I36A 3IP6A 2ZYAA 3OQIB 4CLRA 1KYYA 4YQEA 1AUVA 2OILA 5AW6A 1L5SA 3BE8A 3PA8A 2QTFA 1J0EA 1VIDA 2WLTA 2Q4TA 2V3CC 2ZS7A 3N07A 4KCGA 4W9NC 4F46A 2ZSFA 1WXXA 4YRBA 4J6EA 4P08A 4NZMA 5F35A 1NWCA 1G64A 1JXOA 2OBMA 2C0CA 5BQPA 4NBLA 1HZZA 4KQJA 5KHOC 2V7PA 4MEBA 2W98A 1N2IA 3NHPA 4U7DA 4UVGA 1U0HC 2KMLA 5H81A 4BJ3A 3I9KA 3FCXA 4KLRA 4PYLA 4QM6A 4M6WB 2GCEA 3ZVRA 4EY5A 4ZEMA 3C8DA 1QZZA 1RQLA 2OGZA 1SCUB 5H9VA 1XKXA 3FFAA 4RGBA 1Z34A 4N0PA 3VX3A 1FMTA 4NOKA 4ODIA 3S2FA 4RIIA 4D96A 2A59A 4Y2PA 2Y8EA 4TSFA 4X3PA 5KVSA 3W5DA 4MHTA 5EQTA 1R00A 1XRJA 1MA3A 4A73A 4B43A 4YUYA 1EUCA 2HMUA 2XMDA 1TJNA 1JN0A 4QODA 4KPFC 4RY8A 2X0DA 1ZR4A 3NKLA 1EXNA 3IH5A 3FWNA 3KOXA 3DFFA 4M87A 4OQYA 1HLPA 1KP2A 3P1JA 2YHBA 2ONCA 2C9MA 2QGZA 3AM5A 3BSWA 1S3FA 4P54A 1AK1A 3QKSB 1FSGA 4V3BA 2G9ZA 2O50A 4LN1A 4MVYA 5E7IA 1XIVA 1EVLA 1E7SA 3I37X 4YMHA 2PKQP 4M0DA 3GJQA 1Q1GA 2O0KA 3G9ZA 3WP1B 1BXRA 2HEGA 5FNZA 2I2XB 1BWQA 2H1FA 5CVTA 3S2GA 2HMAA 2ZOSA 3K4HA 2AX4A 4Y0NA 1H22A 4LXHA 1H2FA 1IBMB 1F7UA 4XIJA 3FVVA 4RLQA 2PUEA 4M1QA 5BSGA 2POQX 1AM4D 3RFCA 3SQMA 3C6QA 1OY1A 4YY3B 3H1BA 4PQEA 3O3MB 1CXZA 5IHXA 3A4TA 3LDFA 3EUAA 1CUVA 1UJ4A 1SWWA 3L79A 4CV2A 1GSOA 3AB8A 4R41A 1BMFA 3LUDA 3T7SA 4H1WA 3A6DA 3PPWA 3GLIE 1KE2A 4F1WA 1TUEA 3ILHA 1YNOA 4D45A 4O3MA 2WU1A 3WK7A 1LQ2A 3TMKA 3GEPA 3ZQ6A 4BQEA 5KJEA 2CC2A 1U8CB 2P9GA 3PVSA 5KOHA 4WZBA 3BIOA 1SBIA 1R0BA 2C2GA 1M0EA 13PKA 4PRYA 3EGDA 4U2BA 7ABPA 3GDOA 1XLTC 3BICA 4K0RA 4Q7LA 4TKMA 1KJIA 1S9HA 3KJZA 1PJRA 4GNKA 2OXIA 4FFOA 1YRQA 2GPWA 3UJ3X 4PN7A 1KQ3A 4X93A 2ATXA 4GT1A 1ZX1A 1JFRA 1Q0TA 2ZQZA 4LZWA 3NM4A 1WTAA 3QYPA 1KJWA 1BAPA 1IXRC 2C9CA 2PSDA 2QSZA 2WNIA 3NTXA 3NEJA 4UM8B 3W34A 1M0SA 3VVCA 1E4EB 5ADHA 2XB6A 4LNUB 4M0PA 4BRSA 4OHRA 2COKA 2GRUA 4BX2A 1Q5PA 1MEEA 2V9ZA 4PPFA 4EKGA 2YWDA 2AVNA 1L7AA 3AINA 3VM6A 1SKYB 1D8TA 1PEAA 2ZDGA 4WK4B 4C0LA 5GJCA 4KPGA 2V9PA 4G24A 1KYXA 1EEHA 2FRXA 5K8CA 3DBVO 4FYKA 4G8BA 4X6YA 1GEGA 1YC2A 4W5WA 5CR9A 1Y9ZA 4AS3A 3GT4A 1IN5A 4W63A 1FUYB 3HKBA 4OHCA 4HLQB 4U3JB 2CNNA 3HXTA 1JR4A 2BM8A 4D46A 4OSOA 2P62A 2Z04A 3JQ9A 2J3LA 4AURA 4CMKA 4RTLA 5HM6A 2CKMA 1GAEO 1GPDG 2GWHA 1Y1RA 3AK4A 4GOOD 3VDMA 3HC7A 4NAVA 2UXBB 2Y4NA 3UJHA 3A3KA 3GAAA 1J6UA 2A0YA 3KCNA 1I4EB 4N9WA 4QHYA 3T5TA 1RVDA 4L07A 1STOA 1MAVA 3UK7A 5KKNB 3OOJA 1RBZA 2HADA 1NPDA 2IHKA 2X4IA 3W3AA 3SHVA 1MB4A 4GI5A 3O90A 3ZK8A 2AIRA 1QTNA 3MT7A 1XQXA 3TF5A 1YQQA 1ZDMA 3EULA 3O26A 3DE6X 1RXWA 5JWHA 4MLZA 1G5IA 3V1LA 1JQ3A 4IKEA 1ZGAA 2JEOA 2XUGA 2H06A 4TTIA 4XWKA 1O8BA 3A6FA 1GU7A 1KAQA 3OOEA 4QOIA 4P35A 3VKGA 2QTLA 1GAQA 1JBKA 1O77A 3FTNA 1V35A 5IXSA 1TM5E 1M2JA 1U8XX 1O03A 1G4AE 1QP7A 4KO1S 1UJ2A 3EDRA 4Q19A 3EGOA 1ZM2A 4CMEA 4HH0A 1HTWA 4GVLA 4BWVA 4Q4AB 2IPAB 4YO8A 3LQFA 4G5OA 4YP0A 4B8YA 5I3CA 3OLVA 4RF5A 2JIOA 4UDNA 3BILA 4C5CA 3H65A 1OFHA 3QE4A 1GGEA 1VG8A 3KQNA 1CUBA 1YZHA 2H3EA 2HJWA 2X19A 3GGGA 4ILKA 4Z6KA 1PF7E 3W2GA 3N2KB 2VXOA 1KZHA 2HHCA 4XIYA 1TMOA 3C74A 3VVBA 2PCJA 1KZ1A 1VCNA 2QW8A 2WT9A 3ELUA 3M1YA 2D5CA 2OO5C 5BSHA 3BWYA 3TX2A 3OM1A 3ASUA 5B3JA 2NU7A 4IILA 5DI9A 5I7RA 3ZVLA 3JVVA 2G82A 1V48A 4UDOA 4IYJA 2IW1A 3STWA 5CFRA 1OBOA 4OV6B 3DH0A 2GLUA 3UKJA 4OHFA 5CB8A 2I9KA 4HDNB 4LW8A 5EXEA 3WMWA 4TWBA 4F5ZA 2IS1A 2B8WA 3M1IA 4IBOA 2PKYX 3JAKA 4BATA 4BMYA 4EW3A 2VDRB 1BCSB 4GPD1 2ECQA 4RM3A 1EXMA 2LDBA 2ZAGA 3KG2A 1OWLA 3LSYA 5JMTA 1LRJA 2R96A 1UBCA 2NXEA 3NNSA 2QTBA 5AOAA 1NQTA 4X6LA 2HYIC 3DWEX 2V4MA 2XDAA 3LUFA 3H0KA 4QJ4A 3LWBA 5EKTA 2YL2A 4EMSA 2UVDA 1PU2A 1QU2A 4WFQA 2HA7A 1W5TA 2H08A 2PH1A 1G3MA 3BIFA 3O92A 4S2EA 1M2EA 1SVLA 4CI0B 3D3NA 3UMCA 1NG9A 1T1GA 4D4IA 2VHXA 4X45A 2DPLA 3SFVA 3HKCB 1C1DB 3CCFA 5EJGA 3RUPA 4C5AA 1SU8A 4CIXA 5I4IA 4RZSA 2QSYA 4Y0VA 1VCOA 4CLHA 3A9RA 3BFJA 1O0CA 3DTNA 4TKUB 3UMSA 1IC6A 2CJWB 4TL6A 4UM9D 1RAHA 3IE1A 1TO6A 1X87A 2NU6B 5HTOA 5DCYA 4ZI7A 2X9VA 4BHTA 3LZDA 2VAVA 4D3FA 2HHHB 2O5CA 4B6RA 1B93A 1MC5A 3OIGA 4FR2A 4BMVA 1YE5A 5HEKA 1KPHA 1RYDA 1XL0A 1L5NA 4IDFA 1ZHFA 4IJVA 4TS9A 4Y18A 1UOPA 1E5VA 2P2ZA 2O2DA 1SU4A 1AQYA 1N9KA 3BKXA 3QMVA 4LKRA 1H85A 2XWPA 3OI7A 4MICA 4OHUA 5BV1A 3IGFA 5KOJA 1QS0A 3EWSA 1WW3A 4HBZA 2O5VA 2A9VA 3WNZA 2WSBA 5HXAA 3U31A 2GB4A 3VDXA 3TVDA 2OECA 1V1RB 4RUKA 1N2JA 4DQDA 2D2VA 5F9MA 3TKAA 5L40A 2ZIGA 5KYUB 4N5LA 4HGYA 4MP8A 4IEEA 3CIFA 5CVUA 1TEXA 6REQB 3K31A 2VSOA 1T4GA 2ZI4A 1GTJ1 1UDCA 2AH5A 1JKFA 5TVGA 2BBOA 2H31A 4MZXA 1GTL1 4CCWA 3IESA 4MCAA 4X7BA 4B84A 1AN0A 1IEXA 2AFHB 4RYLA 4W4TA 3NVKI 3I1IA 4KAXA 1BXZA 2XTMA 3GEMA 2WZCA 4ARBA 4AULA 1L7QA 4EKDA 3L8EA 3R0XA 4IG4A 5FBKA 3OU6A 3SZRA 1E2HA 2IHVA 2UDPA 5JAZA 1X7YB 2EFGA 3C5HA 1T4CA 3T9FA 4DLYA 5HJ7A 5CX1B 2AF3C 3IUYA 3HVUA 2VJCA 4IP0A 5BSVA 1P9RA 5KYGA 5A0FA 4HEHA 5KYWB 4F97A 1YVEI 2B4AA 2IUFA 3M5DA 3NBMA 4B7AA 5I9IA 4YJ3F 1H93A 1QP0A 1AS2A 2KW5A 3AUTA 1HDYA 4LOHA 10MHA 4ZYVA 4IJWA 1PEYA 5EUQB 1H69A 3GI1A 1TJPB 3N7AA 3VPHA 3D7RA 3NTLA 2R8ZA 3UAXA 3B2QA 4HG2A 3SS8A 3VKVA 2ZSHA 1NFQA 2Q5HA 3VOAA 2LV8A 2AFIE 4AMVA 4M6WA 5HRCA 4ZV9A 2ECOA 4OA5A 2IDZA 3X2SA 1OAOC 1QH8B 2J9YB 1ATZA 2UZ1B 4ZICA 3KM0A 3I45A 2OENG 2B1IA 4AT1A 2PMCA 4GKAA 3MA0A 4GPIB 1YQTA 3GLTA 3HDGA 3DM9B 4H6WA 3CNQS 3NFRA 2XRMA 2DUWA 2YY6A 2IWHA 1J21A 3WC4A 2BGKA 2DTDA 2ISQA 3LLSA 3TM4A 3RVMA 2XDWA 3FXAA 5L4LA 2XYGA 2YTZA 1P1JA 1WUHS 2YMLA 3GB9A 4YRLA 4WKGA 1QU3A 2RH8A 2NSDA 3RJTA 1Z39A 3L41A 1CUEA 3MGKA 3TW8A 1SXJB 4Z54A 1P0FA 3DBLA 4K9NA 1QCYA 4OXNA 4XX1A 2BHRA 1K6EA 2DY1A 3ZEIA 1SB8A 2D8MA 2BUCA 2OR3A 3CQ9A 2PD3A 2AOVA 2W2LD 1HDOA 3C1TA 1Z16A 3LT5A 3HBMA 4GLLA 3U7QB 3WIUA 4JA0A 2J07A 4X66B 3LOUA 4PIVA 2CJFA 1J23A 1G6Q1 1WDLA 1DOZA 3DDWA 5LQCA 3BAFA 5EP1A 2IX3A 3EXFB 1B8NA 1C0PA 2RHDA 1GHTA 3HK2A 4IM7A 4UU8A 3P45A 1M6WA 4HYYA 2AYXA 1SA0A 3OQBA 4NMMA 1E5XA 2IHUA 3AO0B 3CKYA 3V46A 3LFHA 2XQVA 4Y2RA 2KHZA 5HKKD 5EWLA 4OQDA 2HO4A 3FDXA 4JJEA 3NRCA 4BNNA 1T6BY 2QL9A 3AUSA 4F6RB 1G20E 2Q28A 2I2BA 2V54A 4CNQA 1WSDA 5K6AC 2QQEA 3NHKA 4YJKA 4W5TA 1P3JA 2LIVA 4GG1A 1FX0B 2JJ2A 1UMDB 2BM1A 1Q19A 1KKUA 1QHFA 4JC4A 4TV8B 2ZM5A 4IOKA 1E1LA 1C8BA 1G18A 2G07A 3CZPA 2XX3A 4ZQCB 2OPHA 1M1YE 1YTLA 4BE7B 4R9UC 3RV4A 1W5EA 1AKRA 4JI3B 3VBCA 1GRRA 1FTQA 1XVTA 3PDIA 4J0HA 1BE6A 2PZEA 2OB1A 1J00A 1FSSA 4PXYA 3V80A 5K09A 5TXGA 1UBMS 3AEQA 3N0TA 1U0OC 2GWRA 2OXCA 4GSYA 2AFHE 1T3ZA 2RHJA 4GSLA 1NHWA 3WZMA 3EEOA 3OFSA 1NBHA 3ZN2A 4CQJA 4EJ0A 2JH8A 4HD8A 3CLRC 5E8JA 3C5CA 4BGEA 3AJDA 4C7OB 4XGQA 3FYCA 4B9AA 1GNSA 4B45A 2JKZA 4R2LA 3CLVA 5DW0A 3THWB 4BFLA 4OSEA 4CEIB 3T5DA 2ET6A 4YMIA 1DKPA 1Z83A 2H4ZA 3NWJA 4JWKA 4NYJR 5BRJA 1UWKA 1K5HA 3PNVA 1T6XA 3EDMA 4ETNA 4TVBA 5E4TA 2PCLA 4NEHB 4D5EA 5AUPB 1EFUA 3RU9A 4L4SA 5G0VA 3WHIA 4CUZA 1IN1A 4FVTA 1OFGA 2QD3A 4KOAA 3H4MA 1UT8A 4IOLA 4DNQA 5KVVA 1U2DC 5HZGA 3CT6A 4Q18A 5JXHA 3D6NB 3KCQA 3QLUA 1NXSA 2HF9A 3IIKA 2ZXUA 1B6RA 1H2ZA 1T2NA 1ABFA 2CZGA 4RXTA 4XJVA 1KQGA 2GAIA 1V8DA 3OTWA 1FRZA 1CWUA 1OXUA 2AKAB 4NU5A 3UWOA 1CQWA 3AF3A 4N6OA 4ZT3A 2INGX 2XUHA 4N3AA 2NU9A 5C8YA 3CV3A 3HDYA 3S2IA 3VU9A 1V4BA 3OVMA 4KR0A 2W8ZA 3ETCA 5BXQC 5E9WA 1ISSA 1G2OA 1SC9A 4ZMBA 1Q7TA 3IKTA 4PCAA 2X13A 1X1EA 2VJNA 3GJ5A 3X0DA 1JQEA 3Q5EA 4I5GA 5TPZA 1W5AA 1ZMRA 4M21A 2IQ5A 1HK7A 5FBWB 3WRWA 4BO3A 5CLGA 5JH7A 1DG3A 4YJ3A 4GOKA 3PUIA 3LOPA 2CN1A 3U56A 1Z8HA 4AIRA 5F7OA 3M3PA 3GCZA 3KALA 2IY9A 5C5IA 1LI5A 4YCMA 1WWKA 3MTIA 2L82A 1HQDA 3R2JA 4Q1VA 4ZAZA 1NW3A 2AC4A 2H4HA 1KVRA 3N58A 4F5DA 3NYRA 1KDOA 1SURA 2IXBA 1SUAA 4MQFA 5DHSA 5JMPA 2BFWA 3HADA 4HSGA 2QG4A 4UXJA 2KYRA 4F8EA 2QX8A 3RAEC 2YUTA 3R6GA 2ZR8A 2P4QA 3DPIA 5IEBA 1JU4A 5ADWA 4JGBA 3K2QA 5DMHA 1PWYE 3OKPA 3P4YA 4KB5A 2OFOA 4MHOA 1Z3IX 1H8HD 1ZW6A 2O48X 1KSGA 4Y1RB 3LKVA 3GELA 1V8FA 2V7QD 4MW2A 3LY8A 4A5OA 2BFMA 3P0EA 2K2QB 2BI8A 2R25B 3DULA 2BKLA 3KTDA 4G5XA 2FSVC 4DGQA 1VLHA 1O0BA 2VQ3A 3BZWA 1SB9A 1ZM3A 2PH3A 3MVEA 4FZRA 2OO5A 2PGNA 4C76A 1ZGJA 2CW5A 2ZQYA 3G5LA 3C5VA 4I1VA 5AKGA 2GCIA 3WLIA 3ZZ0A 1Z18A 1VRCA 3ZLVA 3NB0A 1UKCA 1TTPB 1JWAB 4FGKA 2F1RA 1EE2A 1H4VB 3GX1A 3KTFA 1KY3A 2PG3A 3UO8B 3UCFA 3CH5A 4MQEA 2FETA 1YAHA 2FWBA 2MJLA 3H2BA 4LJLA 2XZPA 1WB6A 5DM0A 4B76A 3I04A 2QVLA 3ZWNA 1UBSB 2WIJA 1ZM7A 3ANXA 3IRVA 5LC1A 1ZC3A 2FFJA 3E8SA 5J4LA 2X58A 1NURA 1RC0A 2EIHA 4LE2A 2ZRAA 3O5AA 4B9EA 3NIFB 4EB3A 5LYJB 2DY0A 2HA5A 2UUOA 3L06A 4WLFA 3IC5A 3F3KA 4X64B 3AQ4A 2Q5LA 3AVPA 2J67A 3U13A 4P86A 2ZUTA 3DBIA 2B8JA 2OQIA 5L53A 3KXPA 5J5CA 5BSMA 5HFJA 4XASA 1D2HA 4AZ3A 1NTOA 2FEOA 3QX8A 2IPNA 2XVXA 3VR5A 4IIHA 1SQGA 4WZAA 1PTJA 1PZGA 3SS7X 5KU1A 1U6JA 2Q8PA 1TU0A 3F6SA 1E69A 1IOWA 2ZAIA 3EVDA 2I6XA 1DQYA 1OHHA 1SCAA 1TECE 3G0GA 3MCUA 4KAFA 3AERB 3CS3A 5PGMA 3TMAA 4UMDA 2PX6A 3RVRA 5I7VA 3OUZA 2FEKA 2ZS9A 3U9LA 4CM7A 3I9FA 2WMYA 4ESOA 1J2TA 1YZ3A 1HDXA 2BFNA 4K28A 4OU4A 1E2QA 2YDYA 4EG1A 3AM4A 4FHEA 4WLNA 5EHNA 4ZT4A 1TAQA 1D1QA 1Z6YA 2CNOA 2L0XA 3A4IA 2NYVA 3MRSA 4MITA 2ZJ8A 4GR9A 4FMPA 5EKUA 3ZJYA 1KZ7B 1CJVC 3HB4X 2Q1UA 1L5QA 2VTBA 2BBSA 3L5KA 3PXGA 4L50A 1XCOA 2QAJA 3EVZA 3X1DA 4KITB 4A0GA 1REQB 2C92A 4XDYA 2OZPA 1RQGA 3DDOA 3U4MA 5AK0A 1KZ6A 2H17A 4R1OA 4TRJA 3L0IB 4TTSA 1TM4E 4WLVA 1O95C 2V59A 5CUQA 4KFRA 4L4YA 4CVNA 4CEHB 1X8JA 1VDMA 1WAMA 4UOQA 1YS1X 2QSJA 3DMDA 3G5UA 4DDVA 1DTSA 1E3TA 4JHLA 5DTQA 3E9MA 4G4IA 1NDQA 5CIQA 1SKYE 3PT9A 1UBJS 4EAQA 2J30A 2G25A 4TWIA 5JYDA 3A2LA 5HQJA 3O3NB 1SCUA 4C4YA 2XADA 1SHTX 5HZKA 1Y8RB 2WNHA 3TZLA 5DE3A 1FFDA 1C3OB 1ICEA 1O9BA 2J09A 1TF2A 2AJBA 3PXEA 4HLDA 1C7IA 4TLEA 4YJFA 4B82A 4F38A 4UEQA 1E9AA 3SEAA 1U2ZA 5CVJA 4C3UA 4JNKA 2HT1A 3W4KA 3CY6A 1K3UB 2XGGA 1YHNA 2ZRFA 5E1OA 2PHZA 2VP2A 4URYR 4ZVKA 3TQSA 3O4FA 4JB8A 4AMZA 2WM8A 3Q9NA 4U5XA 1R74A 3EASA 3LHSA 3F67A 4MRMA 5IJAA 2F8MA 2GFIA 3K09C 3O4GA 4DMFA 4Q47A 4Q3NA 1RZRA 2B0JA 3EPHA 4EUEA 3V8BA 3JTEA 1K6JA 2C7PA 1I8TA 2DC1A 3U3DA 1VMKA 3ONFA 2I78A 1J4AA 2SHKA 4ZOBA 4OMFG 3U7HB 4WCFB 3VAAA 1FDUA 1M34B 3OCYA 3E0QA 2IV2X 2R97A 2B94A 3AR9A 4Q34A 1W75A 2Z8ZA 4CQMD 1IRXA 4CG1A 2Z5LA 4JEUA 2PANA 3W6OA 1GYPA 4OB7A 5K99A 3TZQA 5CD1A 2ETXA 2YYSA 1A9TA 1GPWB 1S3SA 5DLDA 1DDOA 1TA0A 3F7MA 1IY2A 3V2IA 4IJ6A 2PK3A 4ZTBA 1JXMA 1UH5A 4P8RA 4FHZA 3SLGA 4AJ1A 1HKHA 1JTEA 2VZLA 2GDJA 1PQPA 1JDVA 2GGSA 4QUGA 4J3FA 2Z6AA 2ZBFA 3OPYA 4XEHA 5K3BA 4A8HA 3NC1C 5KKCA 1UM9A 3WIDA 1WDWB 3VVMA 4EM6A 5KDOA 1OHHD 2DFDA 5JNSA 5D3MB 1NTRA 1NKSA 3MD9A 1DUSA 1U81A 2AL7A 3MJFA 9MHTA 1E7WA 4B6SA 1XSEA 1QPBA 4EJ2A 1KK2A 2CL0X 3AUFA 2QIPA 4IS2A 3ZH2A 3ZBUA 1OBCA 4B5LA 2F59A 3I9LA 2ZWMA 4D6YA 2CV0A 3V00A 2CXUA 2H1SA 3L1HA 2GHTA 5LSAA 1I4DD 3DMFA 4IIGA 4M1OA 4RHTA 4QTTB 4LBVA 3H9QA 2E2WA 1JJBA 2IYYA 3PKZA 4GP7A 4JBNA 5ARCA 3U3JA 4EKEA 4CT0A 2EP7A 5BNZA 1SD5A 1ZAYA 1XTSA 3WBBA 1VBKA 3GIDA 3L8DA 3MWJA 4C6HA 4PYJA 2QXTA 4I4TF 5BR4A 5IDWA 1L5WA 5FOVA 2XUDA 1HLDA 3HRKA 5ENZA 3SF8B 1P2VA 1EFTA 4BC1A 2YC2C 1BD3A 2WYVA 5DGCA 4Q1AA 4UUOA 3F9CA 4RJJA 4XM0A 2HZBA 2PX0A 1ZH4A 3F98A 4BEWA 2X76A 1YC5A 1A4UA 1RW4A 1D5WA 3KVYA 4H6PA 4M2LA 2XB9A 4B34A 4C1BA 5JD4A 1BDHA 3H75A 1L1FA 4FR0A 1YE8A 4NZ9A 4Q7KA 3S99A 3OLWA 3EMVA 4ER6A 2IBSA 3DAPA 5B5SA 3FCYA 1T6YA 2PN1A 3HTXA 4B3SB 2Q07A 1L6RA 5J59A 5L8VA 1W5FA 2VYQA 2AX3A 3E48A 1FYVA 2L18A 1O87A 2P9ZA 4U8GA 1VPLA 5J5AA 4B2LA 3RTGA 2RKWA 1DBIA 1LDYA 1LX6A 4UPVA 3C5EA 4EI8A 5HF9A 5C8ZA 5J2UF 2WTUA 3OT5A 3HUDA 2JGEA 2OCIA 4RCVA 1C1DA 1G20A 3GHHA 1PWHA 4OQZA 4Q4JA 2PMBA 3MFQA 4TV9B 2BHNA 4LYAA 5C7LO 4LJ7A 3FKSD 2HT6A 5AIAA 2FPRA 1SHZA 4UBOA 4MUBA 1A2KC 1X3LA 5CG1A 5K4GA 3E9NA 3VAZA 2GZHA 3N74A 3AXTA 4BIIA 4OI0A 1A7JA 1P17A 4MW0A 2C2MA 4LVNA 1GEEA 4MUHA 3QVUA 1UK7A 3HGTA 1YFKA 3K8YA 1RYYA 1S7GA 4CEIA 4AQDA 3GZTB 4PHFA 4CFSA 2EZ9A 5IRCD 1M73E 3GEHA 1E61A 3IMEA 1FJ2A 2B7LA 1N77A 3PDJA 2ZKLA 2Q3EA 1ECGA 2PLAA 4KQMA 1ONPA 2XUFA