4LKRA

Crystal structure of deod-3 gene product from shewanella oneidensis mr-1, nysgrc target 029437
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
233
structure length
233
Chain Sequence
TAHINAQPTDFAETVIMPGDPLRAKYIAETYLTDAVEVTNVRNMLGYTGYYQGQRISVMGHGMGISSMVLYGHELINFFGVKRIIRIGSLGATQQHVEMRDVILAQAAGTDSPTNAKRSSGYHMATSATFSLLHKAYTKANEKGISVKVGNVFSGDLYYDPDEDMIPALERFGVLGIDMEVAGLYGLAHQQGIESLAILTVSDHCLTGEETTAQERQLSFNNMIELALETALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase DeoD-type
publication title Crystal structure of deoD-3 gene product from Shewanella oneidensis MR-1, NYSGRC target 029437
rcsb
source organism Shewanella oneidensis
total genus 73
structure length 233
sequence length 233
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2013-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lkrA00
4G41A 3EUEA 1FXUA 1V45E 1LX7A 1XE3A 3OF3A 4I2VA 4JWTA 1Y1QA 4LNAA 5JPCA 1PR1A 4DAEA 1YQQA 3UAXA 4OGKA 4WKCA 5IFKA 2A0WA 1LVUA 4OGLA 4TXMA 4BMZA 1A69A 3DDOA 3D1VA 1V4NA 4R2WA 4F1WA 2OXFA 2A0XA 4BMXA 3BSFA 3OPVA 4R2XA 4YNBA 5IU6A 1M73E 1TGVA 5CXSA 1Y1TA 3GGSA 2PGAA 5B7GA 4TXJA 2OC4A 5F78A 1N3IA 1VHJA 1Z5NA 1YRYE 4BN0A 4L5AA 2QSUA 3PHBE 3EMVA 1RFGE 1RT9A 4UC0A 4F2PA 2I4TA 5CCDA 2HSWA 4QARA 1JE1A 4MARA 1SJ9A 1U1EA 1U1GA 1Z35A 3F8WA 5CYGA 4WKOA 4LDNA 1C3XA 3BL6A 4DANA 1PF7E 1Y1SA 1V3QE 2GUWA 1VMKA 5I3CA 4QEZA 4D98A 1OU4A 4WKNA 4PR3A 1K9SA 1JP7A 4DABA 5B7NA 4G89A 3PNSA 4R31A 4M3NA 1ULAA 3KVYA 1YQUA 1LV8A 4G8JA 4DA7A 1PR2A 1ULBA 4DAOA 1B8OA 3FB1A 4F3KA 3KU4A 2XRFA 1RR6A 1JDVA 3DPSA 4TXNA 2QPLA 4IP0A 4YO8A 3UAYA 5F7JA 4QFBA 2B94A 1A9QA 2HRDA 1JPVA 4JP5A 4NY1A 4M7WA 2AI3A 2HWUA 2QTTA 3OOHA 1B8NA 3EUFA 1PR6A 4L5YA 3PNPA 4OY3A 2H8GA 5CXQA 1RXYA 1NC3A 4D8XA 1T8SA 1K27A 1SD2A 2I8AA 1T8RA 3O6VA 4H1TA 4X24A 1Q1GA 4LKRA 4EARA 3BGSA 1JDUA 5CYFA 3FAZA 2IQ5A 4LZWA 4L6IA 4WKBA 4YMLA 1Z5OA 4OJTA 3NM4A 3NM6B 4TXLA 3KVVA 1JDTA 4U2KA 2A0YA 2OC9A 3LGSA 3FNQA 4DA6A 2AC7A 1YR3A 4K6OA 4JOSA 5EFOA 1A9TA 3C74A 3NM5A 2P4SA 1PKEA 3FUCA 4QASA 5F7XA 4BMYA 3K8QA 1YBFA 3TL6A 5CCEA 4DARA 2RJ3A 1RSZA 4QAQA 3OZCA 1A9SA 4DA0A 1OTXA 1PBNA 1CG6A 3UAZA 1Z37A 1K3FA 3UAWA 1PWYE 1RCTE 4YJKA 4F3CA 2AI1A 4ECEA 1ODKA 3E0QA 5F73A 3ENZA 1Z38A 3NBQA 1A9OA 2AI2A 4D9HA 1RYZA 5F7ZA 3DJFA 4TXHA 3UT6A 2QDKA 4OEHA 5F7OA 4PNPA 1Z33A 3ODGA 2HN9A 1TCVA 5F76A 1Z34A 5B7QA 3EEIA 3E9ZA 4D8YA 3U40A 4RJ2A 1JYSA 3INYA 1V2HE 2ISCA 4LNHA 1V41E 1U1FA 4MCHA 3KHSA 3OCCA 4F2WA 4P54A 4OF4A 5ETJA 1I80A 1JE0A 3E9RA 4L0MA 1PR5A 3P0FA 3MMSA 1Z5PA 1PK9A 5F77A 1TGYA 4GLFA 3IOMA 4GMHA 2Q7OE 4TS3A 2BSXA 3MB8A 1ODJA 3OZDA 1ZL2A 1OUMA 1Y6RA 1PR0A 4NSNA 3PHCA 4FFSA 1T8YA 5EUBA 3SCZA 1NC1A 4M1EA 1OVGA 3OZEA 4GKAA 4L5CA 4NS1A 5EPUA 2A8YA 1A9RA 4TS9A 3LBAA 3DP9A 3K8OE 1NW4A 3FWPA 1PW7A 3OOEA 4EB8A 3KVRA 3KUKA 4TTIA 5FAKA 4TYMA 1A9PA 1Z36A 3FOWA 3O4VA 3GB9A 1V48A 1Z39A 4D8VA 1SQ6A 1U1DA 4TTJA 3T94A 1ECPA 2OECA 3LA8A 3UAVA 3P0EA 1PR4A 1PK7A 5DK6A 1QE5A 1VFNA 1JDZA 1VHWA 1ZOSA 3QPBA 3IEXA 1ODLA 5K1ZA 1WTAA 4DA8A 1OTYA 1SD1A 4WKPA 1TCUA 1G2OA 1CB0A 5KB3A 5B7PA 4QATA 1U1CA 1JDSA 2ON6A 1T0UA 3DF9A 1RXUA 1RXSA 3OZBA 2QTGA 1T8WA 4KN5A 1Y1RA 4E1VA 1OV6A 1RXCA 5C80A 4GLJA 3BJEA 1ODIA 3ONVA 4TTAA 4MCIA 1Y6QA 1TD1A
chains in the Genus database with same CATH superfamily
1WV1A 1Y7IA 4G41A 5BURA 5IZCC 3P2YA 1V45E 3GNTA 2F59A 1EDZA 2P2ZA 1UXKA 1K4KA 5BSKA 1GR0A 4PSUA 2OV3A 3O1IC 4CIAA 2AW5A 4Q1FA 1HT1E 2YXEA 3GVXA 2XY4A 3FSGD 2JF0A 1E3TA 4J3FA 3SKVA 3HP7A 3Q6MA 4DLXA 2B4KA 4NAVA 1Y1QA 3JZAA 3TKAA 4B5LA 3AJ9A 3WAJA 1L8AA 2Z98A 1PZNA 2GZ1A 5AQ1A 4PICA 3LXRA 3SF8A 4ZDKA 1A97A 1OGIA 4JB3A 4RA9A 3UJ9A 1MA0A 4YCMA 4YECA 3ETDA 1PLLA 1QCZA 4HDKA 1I7DA 5ELLA 3TQFA 4BBAA 2WUEA 3I32A 4GX5A 1GPUA 3JCZA 2F9LA 2CJPA 1GFSA 2R751 1TO6A 3C3JA 2XYPA 5F98A 2VSNA 3QVTA 2WT8A 5DP2A 3D6MA 4OMCA 1P73A 3MTQA 4ESVA 4NU5A 1LVUA 4OGLA 3CZPA 5FF9A 1T0HB 3PC4A 5HGXA 4HGRA 1SXJE 2B1RA 3ICVA 2BM1A 2C5FA 4RENA 2O7RA 1C3OB 4MUKA 4O08A 5FI5A 4MYCA 3D2CA 3I42A 4I5EA 3FJ1A 5EIBC 1U7DA 1D1QA 5CG1A 2C5BA 1Q0TA 1DEAA 1DJLA 4KN6A 1YONA 3GD5A 4Q3CA 4YFVA 5KKNB 4YJ2F 3RIHA 4RKEA 1PX2A 2Q3DA 2YFKA 5CU7A 4OYLA 3S7ZA 1G2IA 2V1UA 2YN0A 1OFVA 5B6JA 3TNJA 1U2SA 4YNBA 3H1PA 2CB0A 4G0ZA 1ZIYA 1Z63A 1T0JB 3D4BA 3LCVB 3RS8A 2UU9B 4J29A 5D87A 2XWQA 2O06A 3CVXA 2MSKA 4HAUA 3ACDA 3OZAA 4JUFA 3FGZA 5K0NA 2BBOA 3W6NA 4D0LB 4ZGBA 5H9WA 1IBRA 1RKBA 2FUEA 5EMKA 2CSUA 4M21A 3ZQKA 1K2VN 1QUEA 2JHAA 2ZUWA 5G4LA 2NSLA 4RHEA 1D4OA 2VCHA 1W19A 5SZJA 1RMQA 4D44A 1GU1A 2PS0A 3EN0A 3NHWA 4LISA 5PGMA 4WACA 1N3BA 4O4HF 4JLPA 1QDUA 4Q12A 1UBMS 1Z6ZA 3WLQA 2YXNA 3MIIA 2WP8J 2GZ3A 2J5QA 2CMDA 3MZ0A 3T52A 4EITA 4FWTA 3L7JA 1XXLA 1T26A 2R62A 3C7DB 1YFLA 2FCAA 4HVLA 5JFTA 4RGQA 4FNGA 4O25A 4O3MA 3F8TA 2MCFA 2AEFA 1D1TA 2C9DA 2O3TA 4HVAA 4P53A 4LF8B 1JQAA 4YPFA 4CV2A 4FDLA 3F8WA 4XD2A 3E0XA 4FCTA 3ZDQA 2WT9A 3ZWOA 3BL6A 3QLTA 1N7GA 3JAKA 3E1GA 3LUAA 3L2OB 3OJLA 2H5JA 1K5PA 1S8NA 3G8CA 2YJNA 4EBBA 1VMKA 3DLTA 2O59A 3P27A 1EUZA 2GS9A 4XDHA 3OD1A 3TRFA 2KI5A 5EHIA 3BM5A 2HAEA 3PVSA 4WKNA 2RAFA 4GSLA 4BS9A 4YAKA 4HB4A 4US2R 1DAIA 1XEWY 5HJ5A 2FY8A 4JMPA 4Z7NB 1PGJA 1X7ZA 1XELA 2BIFA 2FEOA 3GVHA 3HXQA 1MR3F 3N0XA 5CFPA 3VR4A 3FMOB 3AG5A 3LXUX 3NIDB 5DTEA 3EZ2A 1NVWQ 4KAFA 2V0GA 1J2EA 4BNXA 5GAJA 2XUFA 3QFTA 4NQRA 3A4MA 3QY9A 3KKEA 4RO0A 1WUIS 4AZ3B 3B1JA 3BMCB 4FOTA 1N34B 4RANA 3NKFA 1P4JA 2BJHA 2FN3A 2BC9A 2A0KA 3ZGVA 7MHTA 1PWEA 2QV7A 4KJXA 3CWQA 3W6ZA 1U0NA 3C6XA 3FNFA 3A9RA 3EGOA 3HFRA 1MJFA 2IYAA 3LW8A 2BGMA 5SZHB 2R6AA 2ZAOA 3HLYA 2O5RA 3SOZA 4LSWA 1A4IA 1P1JA 2QUZA 4J7XA 4TXNA 4R3UC 4LOKA 1P39A 3V00A 2A58A 1BN6A 1Q1EA 2FMXA 1G3UA 2IHKA 1XCOA 3PG5A 2Q1WA 4AW9A 4C4XA 4PR0A 3UJCA 5JVDA 1VE6A 2A1UB 1SIBE 1YBVA 3L6RA 2HRDA 3DEFA 4OP1A 5ITWA 4C87A 1J9EA 5CCBA 2WILA 5DX1A 1EJ6A 2I99A 4TMTA 3PDWA 1HYEA 4FPXA 4IDHA 2FEAA 2GFIA 2HBZA 1KDOA 1MTOA 1PG5A 1J2TA 1N6NA 1QCCA 2PSHA 3MWFA 4JEIA 4OXXA 4R3NA 2BGUA 3HM9A 4Y0NA 4TKUB 4KR2A 2ETVA 1KYXA 4HD8A 1BX0A 3S2SA 4M7WA 3IOCA 5TJHA 3RUEA 4G65A 3KVOA 2ES4A 3THSA 1VQ1A 1WTCA 4NIMA 2E4AA 1QPBA 4TT8A 1II8B 2J4CA 4HAOA 1QYXA 3SJZA 3TQTA 5B4VA 1HNZB 1G21B 3O1LA 4QTTB 1ATIA 2CY0A 3ZKAA 3D0OA 1OBOA 2VFAA 4WCDA 4YACA 3ZD8A 1V8BA 2VJLA 3R41A 4YRNA 4HNSA 3B6EA 3AB7A 5IJ0B 3ER9A 2OCKA 3IMFA 3WLIA 3IQWA 3L1HA 4JBIA 2YW9A 3VZDA 2NO4A 3STHA 3WL3A 5EQDA 4YI3A 1SD2A 3OKFA 4FZJA 3O6VA 2PX2A 4JYZA 4IWNA 2O2IA 1SB8A 3KVNA 2PANA 3WFZA 3OZXA 3DDNA 1Z22A 2CHVA 2BKLA 2V5VA 4RJJA 1AQYA 2EX0A 4I1SA 3QQPA 5JDCC 2I9KA 2JLCA 5K3SA 1ZM4A 4PG8A 1R4MA 2QX7A 2RB4A 1RRPA 2NU7B 2Z0MA 5DSTA 2R25B 2Q2NA 2WAXA 1U0LA 1MKYA 3NM6B 1PYDA 4GVXA 4E5YA 1QIEA 3CJTA 3JD4A 2Y1XA 1D2AA 2VTEA 3N1UA 5FNVF 5K99A 2GJ4A 3EHEA 3P1JA 4TQ9A 4D41A 1JDTA 2H00A 2HEIA 1QGAA 1EM6A 1ULUA 1C0EA 2MSDB 4QPCA 5DW0A 1IK4A 4PIMA 1D8TA 1ENPA 3R6TA 2H18A 2UXBB 4BVGA 1KI8A 2NUTB 5LJIA 1DBIA 1NM5A 3HN2A 3QEMB 3QLUC 5JFGA 4GQIA 5EKXA 4AZ3A 1QP4A 3FIUA 5GV7A 3OX4A 4HFNA 1P9NA 4ZRNA 3DVLA 4U2GA 4YUWA 1W87A 2UXDB 1IPFA 1W85B 3L04A 1BCRB 2DWPA 3DOJA 1VJ0A 3NHFA 4RLFA 1VCNA 1DC6A 1LY1A 2CFTA 2EWVA 4WOJA 4U7FA 1PVDA 1XEAA 4TTPA 1H2YA 2WF5A 1CK4A 1CR4A 5JJBA 1QP0A 1NVMB 4CKXA 3T1HB 1CUYA 3IR5A 3NOVA 1VMEA 3OICA 4MS1B 5TPZA 1QGZA 5DE3A 4HQOA 1YC2A 3PWSA 4U9UA 3T5AA 2NO7A 4GNKA 5CLJA 4MMZB 2G0NA 5F2OA 3WDLA 2E9SA 1WSDA 1N2OA 1SUCA 2GBFA 3CX8A 3QEJA 4I4IA 4M4SA 5EJFA 4WPGA 4BO4A 4GYWA 5DLPA 5ECDA 3FA2A 1F0NA 4XLZA 3LCUA 3VR2A 3TLYA 1GOTA 1G3MA 3CRQA 4E46A 1LPPA 4W5OA 1O58A 4BU0A 2RARA 2AEEA 4Y67A 2AI1A 4ENUA 2DWOA 2H0AA 3A14A 1M34E 3UYKA 4CMCA 1M6VA 2YUIA 3BGIA 4TKUA 1MF7A 5FFNA 4EPXA 5ICMA 1CY7A 1FYFA 1FJHA 2Z1NA 2LW7A 3HU5A 1I2CA 2ZYTX 3LDAA 2WYUA 1UP7A 2ZU6A 5B58T 4TKZA 4C7OA 4YV0A 5BN4A 1O95C 5BYBA 4CMBA 2Y4NA 2FEPA 1TAHA 1Z33A 2OAGA 2JAPA 1YCGA 3CNOA 4IHQA 2NPOA 2HDOA 2VPIA 5K3AA 1F2DA 2P2DA 3UFBA 3UMVA 4ZT2A 5IJ0A 1I7QB 3E9CA 2AFVA 2DLCX 3M81A 2X8JA 3EEIA 3NTOA 1JDNA 2C59A 3KX2A 2HU8A 4PE5B 3TFWA 1FDVA 3WZ2A 4DL9A 1NUTA 5I7EA 2Q2OA 2Z9CA 3L7DA 2I2BA 3QWHA 5AR1A 3G0IA 4FN5A 1M3SA 2VIIA 3ZNPA 1TQ8A 1EXVA 4LZAA 2GAIA 1LF0A 2R79A 1XZDA 1QIDA 4L4ZA 4S3MA 3ADCA 1QFXA 1A2KC 3I04A 2RKWA 1CY4A 3R0IA 3KM0A 2BHRA 3PCRB 5JQGB 4F4HA 1JQBA 4BVEA 1H5NA 3KLNA 3SMVA 4RVGA 2XMDA 3NUQA 2EYQA 2V4MA 4UTZA 3VSAA 1WMAA 2BFNA 2PZAA 4P7KA 1QAOA 3IBFA 3OC0A 1XMSA 2H7XA 3FVWA 4E4TA 2VWQA 3DTNA 3SE0A 1ZKMA 5AD1A 2XEDA 1T2EA 3FKSA 1U7TA 2OT3B 1JJAA 2OGTA 1I80A 1JE0A 3GLSA 3ORYA 4GZ3A 2QRUA 2NOAA 1AQNA 1ELOA 1XLTC 2BFEA 2FOLA 2B4QA 4JQYA 4H35A 5FD8A 4YAOA 3U60B 1QO7A 2W00A 4HY3A 3KT6A 2OCXA 3PSHA 2WR8A 3G5TA 3MA0A 3NPAA 4M87A 4JIGA 2NUTA 2HWXA 3MXOA 3GZTB 1CUHA 4Q39A 3VKFA 2BI4A 2OO5A 3ZY2A 5AVXA 1NBEA 3ZE7A 2CGEA 2DC1A 4FQ7A 2GCGA 4Q9NA 1P1KA 1XVIA 2KWIA 3AMVA 4TM7A 3QG1A 1OCEA 4EMSA 2P4UA 4RTKA 5IN4A 1XEXB 5IAKA 4YRDA 3GN2A 1W85A 1FQWA 1BCRA 2C77A 3LLSA 3ND6A 3RRJA 2E4ZA 2TECE 1L5WA 3T61A 1L4NA 2A5JA 4B3FX 4Y2YA 4MAMA 1ECGA 3FNEA 4YAJA 2YJGA 4MGZR 1JB9A 1Y4SA 4NJMA 4QO8A 2WYHA 1YVEI 4FOPA 4H2DA 4K5QA 4NHEA 1BH6A 3R5TA 4XX1A 1ZITA 4PVDA 4DQUA 1H2AS 1VA5A 3PK0A 3RRFA 2HHJA 4XVUA 3OZEA 4J1QA 4KXVA 2GK7A 2FR8C 2CLFB 1G17A 2EQAA 4LVCA 1G7CA 2Y6UA 5B2ZA 2QROA 1DLIA 1T0BA 3ETNA 1I3CA 3BGWA 6REQB 3ESCA 5AI6A 3FN4A 1ZSNA 4JGGA 5EI5A 4B8ZA 1E0SA 2C9MA 2EATA 3HWSA 3SYKA 2RCNA 3AFHA 4X90A 1QTQA 4U2BA 2XMPA 3BWCA 4EB8A 2BR3A 5F64A 2C29D 3EX7C 3C7KA 5C31A 1E4OA 1MP0A 2P1DA 2JJ1D 4YN3A 1YA8A 3G2LA 4AM8A 5KYUB 5DGHA 1K97A 2P3LA 3F0TA 1JS1X 1UDWA 3UC9A 3RVSA 1WZIA 1T1JA 1XKXA 2B30A 2Q4OA 2VUHB 3BZBA 1XL1A 3FR8A 3IOYA 2P90A 4Q7QA 2QVXX 3CX3A 1U7XA 2VDMB 3DTTA 3HEAA 4XIYA 5FTKA 4KR9A 3ZVNA 1AUOA 1E6MA 1FNBA 3EVGA 4XDZA 4UU1A 4ZYTA 3D6UA 4D8VA 3HBJA 4TQAA 2IVZA 1G3QA 4DLNA 3LG2A 1SQ6A 4BQIA 1K8YB 4J2OA 4ED9A 3DZDA 5FKJA 3T4XA 1DHTA 5K2OA 2WQ6A 5BV8A 4L4SA 3I53A 3ZLTA 3C8ZA 2B37A 2RCYA 1RJGA 4OBXA 2H92A 1GG5A 1ZRHA 1GL3A 1Y3AA 3L8DA 3P32A 1W4RA 1JXMA 2W2QA 5JD4A 2OEPA 3CISA 2XCIA 5J9FA 2Y1CA 2HUNA 4EFMA 5JQGA 2Q5QA 2XNDD 1HNXB 3K0KA 3A05A 1P4HA 4BVAA 2IEBA 1IBCA 2VZ9A 3OOSA 3HKDB 4LZNA 4S24A 2BCJQ 4QGSA 2VRCA 5BP7A 2HJGA 3USCS 1NF3A 2PG3A 1T3ZA 3R09A 4E5KA 4C7MA 2HIHA 2P5TB 5K0CA 4G0WA 4DV4B 2EKDA 5IDQA 3O21A 2C7PA 1JIKA 3P9NA 1L0BA 3RC8A 1Y1LA 3NEPX 3LP6A 3V8RA 1HY3A 5K1ZA 1R3UA 4HNGA 4LJ9A 3BDAA 1QCDA 3KB2A 2VK4A 3K4HA 3EPJA 5DHUA 2B21A 3DUWA 4FHEA 1Q16A 1TUGA 2QSYA 1ENZA 1T5SA 3UQZA 2GFHA 5KZMB 1IHDA 1JDSA 2QM0A 1H05A 3H9BA 4DJJA 1BGXT 4NE9A 3PGVA 4JJ4A 1TM3E 3MS4A 1N2BA 1O6ZA 5DNAA 4JI8B 3M49A 2HXSA 3AP3A 1LVHA 1OFUX 2C4KA 3NVAA 1D9ZA 3HXKA 3PUHA 4N82A 2P65A 4G0MA 4IEEA 5FOXA 2NYRA 3K1ZA 2M6KA 2P6RA 1GTL1 4L22A 3EG5A 3NH6A 2QXYA 2YYSA 3R0VA 4EZIA 1J8DA 4FSXA 10MHA 1HQKA 4LGCA 1VKOA 2J7PA 3FH0A 2NNWB 3D8BA 2EU8A 1HDCA 2RHHA 3K2QA 4NU8X 2I2XB 1MAAA 2ZRKA 1LGYA 3MWEA 1I3KA 3EF3A 3ONVA 4IFBA 4IUDS 4NYMR 5BWLA 2ANBA 4HWPA 1KI3A 3AVPA 4BKQA 5FLXA 1DAMA 1ZXXA 1R8JA 3E23A 3EUEA 5I47A 4K9SA 4E5VA 3U4GA 1YA4A 2HHLA 4Z4GA 3I23A 1XE3A 3B6JA 3WV4A 3H1AA 3BL8A 3D1JA 4PQYA 1JEEA 6REQA 3TO5A 3ECCA 4Y2PA 5CDFA 3TZ6A 1WNTA 1YDHA 3WE7A 4HG2A 3LUGA 4NS4A 1PR9A 3H5VA 2ZDGA 3CPSA 2DLDA 2IZ5A 3I01A 3M4YA 3SEAA 3CWCA 3IDZA 3L3BA 4B71A 5C53B 1ZFNA 5AM1A 4GBMA 2YOHA 3RSLA 4BC0A 4WGGA 5KYUA 1RD4A 2CW5A 4AVYA 1R1DA 5AM3A 3PQ7A 4U0JA 5JZOA 5CNMA 3DZFA 4BJ5A 4G56A 1PI3A 4LV8B 3FKSD 2GEKA 4DKXA 2G1AA 1Y4AE 5GV8A 5AHRA 3HC7A 1I7PA 2WV7A 4L95C 1U2PA 3RJ9A 4D25A 1IJFA 1JHYA 2VP4A 3MMNA 5CVUA 4LXIA 3RVJA 4BQSA 2J33A 2B78A 3DE7X 3RU7A 2ZU0C 1NW7A 4YJDA 2YY7A 3MLBA 2HFJA 1EFHA 1I6MA 3KKQA 1CUCA 5IWCA 1SWVA 3BD8A 3CZMA 4G4GA 1CDEA 1R66A 2A9QA 2WJHA 2Y77A 3DB1A 3F2IA 4Y1GA 4IG9A 1U04A 3E5RA 3AEYA 3L8ZA 3PEUA 5A0VA 2JIBA 3QEAZ 2VDLB 2GTHA 4YQFA 3HXMA 3E7WA 4WUTA 1MZPA 1DSSG 1HE1C 1IJKA 3FG9A 2C2MA 1GZDA 1JQ5A 2XKAA 3BULA 4LGYA 3A2LA 3W5UA 4E5SA 5J4YA 3MQ2A 4LFCB 1FX0B 2G9QA 4P93A 4IW3B 4B3CA 1MO6A 3ZPXA 3OE7D 1D4ZA 3FETA 2C07A 2DKOA 4PZCA 4L27A 2XUQA 2IPNA 3WMGA 3NYWA 1DX6A 2HCRA 2ZBGA 2PGAA 1C4OA 1DV1A 2P6OA 2R7AA 1DDOA 1E2BA 1A9YA 3AESB 3KZXA 4IDEA 3V9PA 4DCNA 3KQYA 4INAA 2QTLA 4OKIA 3SQOA 1KGDA 2RKOA 3D7KA 3LQ4A 4XYGA 1YR6A 2RH8A 4BN0A 1MG5A 2EP8A 2WQZA 3FLEA 2IGBA 4XB6B 3K09A 3RGWS 1KBQA 1XFDA 2QHXA 1UOEA 4FZVA 4BIIA 1U2ZA 4UVGA 5BT8A 4C76A 1HF3A 4BGDA 1FVOA 2BL4A 2A9JA 4EGAA 1Q22A 2H51A 1PFUA 2WAMA 3M6XA 4OXKA 4UPVA 1H8HA 1PZGA 3NT5A 4MV6A 1V5WA 4NKRA 3GJQA 4IFEA 2O8CA 1VJ5A 5B5SA 1KL7A 1XF1A 5B12A 1I10A 1GADO 1N1DA 2V5UA 2VJAA 2B5VA 1P0PA 1Z7GA 3HRKA 1M1NB 4Q4AB 4I1UA 5GONB 1W2GA 5CTJA 5ALUA 3AQ4A 1H69A 1XJCA 4XSGA 4ACAA 4ESHA 5IX8A 1JJBA 2NZUG 3PD1A 1ARZA 1EFVA 4MWDA 4NESA 2IS2A 2ZS8A 1XTJA 3AB3A 4C5AA 1Z7BA 3LUHA 4UXIA 3E81A 5CPBA 4ZEVA 3N3AC 2C5AA 4EI7A 4DJDC 1MX3A 1W49A 3A25A 5DX8A 5DXJA 4LXHA 5IHPA 3CUUA 2WT4A 1XPRA 1FJXA 3HBFA 2QW8A 4FE7A 4FXOA 4QYSA 3NTXA 5LLTA 2NU8B 2UYCA 3VAAA 4C7XA 2H2WA 2QF7A 1UFOA 3QX7A 3VYWA 3UK6A 2FSGA 1UPBA 2GZ2A 3JWJA 3RROA 4CR8A 5C7YA 1LNQA 1ULZA 4GE0A 1YBHA 1UMCB 1L5QA 4TMYA 4ZTUB 1GEEA 3ZWBA 3VU1A 5EZQA 5HS6A 4E32A 2BMDA 4MQEB 3KQNA 4RIIA 3T9FA 1X8KA 3R9WA 3AL3A 3OZ7A 2OVBA 4GEGA 3DQPA 5F35A 5ILQA 3REOA 4TOIA 1HDZA 3C8MA 4BVLA 2CBZA 2WEKA 1DKRA 4G6ZA 2GHIA 3WL6A 1ID1A 1SMKA 1U0GA 4QVKA 3F3KA 5I4KA 1M1YB 2XRFA 3G6WA 4GWKA 5FB3A 3WQBA 2IYQA 5K0BA 4ZC8A 1LWOA 3EEYA 2Z30A 3Q5GA 3TI9A 5HX7A 2Y0DA 1MGOA 3IUMA 3OPQA 1J00A 1U8CB 1UDAA 2JFVA 1SOUA 3AM5A 2FXIA 4DIUA 5KTRA 2NV6A 4HEA1 4QU0A 3RK4A 1N2SA 2Q1YA 1LB1B 1VSUA 1ZR2A 2YWFA 1W1WA 3CF4A 4HLUA 4E03A 2AQ8A 3RE1A 3C3KA 3EEOA 1FX0A 4KQHA 2J7PD 4QODA 1SY7A 4N18A 4CCYA 1CXZA 1ZLYA 1H0HA 5GVSA 3X1KA 4WJZA 4FYIA 3WYGA 4TSKA 2WJPA 3GRAA 4UHKA 3B1ZA 5KVAA 1LA2A 3ETJA 3KC2A 3DNFA 4NRDA 3VC3A 1O1YA 2QNIA 3AESA 3KKNA 4PGAA 3RUCA 2QUKA 1QH9A 1ONOA 2AOXA 4IOLA 4D4JA 2XYGA 1G5TA 1E9FA 3TOCA 1XMOB 4JH0A 2DFDA 3W5IA 4BO3A 2WZQA 3DVSX 4L5YA 5H5JA 1NJ2A 4DUYB 3ELDA 3K9LA 2F2TA 4FB5A 2Q5JA 2FZEA 2Q8PA 3EXEB 5DISB 1GZ5A 1XD2B 2MIIA 2Y6VA 3QUQA 3QBTA 1REQB 5KYXA 2J5KA 2W6JA 3GIDA 3IDFA 4CDRA 3AKYA 1Z82A 3MJRA 2VZLA 2WF8A 3S8MA 1E1LA 3ILHA 5AI4A 2JHFA 1GCIA 2YYAA 4KACA 3X2EA 4JS0A 4Z4HA 1VPVA 1BMDA 1KJNA 1SHKA 2OKCA 5COQA 2XF2A 4Q4AA 4YUXA 5HRAA 4YAUA 4IQ8A 4PG4A 1GM5A 5GONA 3RSGA 1T13A 3DXZA 2NN3C 1Q1GA 4AWBA 4D9BA 3CZQA 1IHYA 1L1EA 3OLVA 3L1IA 4MW9A 4R1PA 1V25A 4UHFA 5L8VA 1NBMD 3ZXXA 1QTRA 2FW0A 2Q21A 2BYTA 3JQPA 1ZA1A 3HR4A 1AZTA 3C6YA 2AKYA 4QHTA 1C0PA 2OMKA 4YMVA 4TX1A 4OOFA 2PYDA 3GUUA 4NMLA 4NV1A 4HMOA 5EJ8A 2OBBA 1M54A 1YS2X 2I87A 4E70A 4FQ8A 4RV4A 4QBGB 4KNYA 4IJKA 2NU8A 4BX2A 2ILVA 3CHYA 2EX1A 1YK1A 1HPLA 1TYCA 3MK31 1DOZA 1ORWA 4KWTA 4R2JA 2PXHA 1N0IA 5FLEX 1BE8A 1LK0A 1MNQA 1CEQA 2ISSD 3CLKA 4L3WA 4J6EA 4J7CA 5EWJB 4RDXA 5K0SA 1Y6FA 2HHHB 1H94A 2IYYA 3WMFA 1JFRA 1JTEA 2H31A 5JATA 1OHHD 3U0BA 3MMPA 1MRZA 4S1TA 5EXEA 4NP6A 3SVZA 4DMGA 4IIJB 1V8DA 1RYDA 4YXFA 1DQNA 4OYHA 1VG0B 5HZHA 2C88A 2GM5A 2P4EA 3CKYA 1VBNA 2FEMA 1RE0A 4DCTA 2B36A 4ENRA 1T9CA 2IF0A 2UXCB 1BMFD 4L8GA 2FWMX 4QHSA 2GN8A 3GO4A 2J7KA 3ZS9A 4AZTA 5ALVA 4MV5A 4QGFA 3K35A 1BCSB 2A5YB 3G2IA 4PWYA 5K3FB 2QVYX 3UGQA 1JB1A 5B36A 1GWNA 1NXQA 1PBNA 1QKKA 4DG5A 4B3SB 3W34A 4PQRA 3IULA 4WTOA 1PGPA 3ZBPA 3PHLA 4NULA 1IUPA 1Z28A 2ID8A 4D6PA 5IF9A 2Z43A 3A2MA 4A4DA 4FQ5A 2I22A 5L9AA 2GHTA 3AEXA 3KTAB 5TGZA 3TSAA 3MGCA 3BF8A 5IMBA 4UCQA 3E0QA 5G2OA 3RUPA 2JL1A 5AT1A 3ZX4A 5EP2A 2POQX 3I4FA 4N0DA 3V3KA 4NBTA 3MOIA 2PX8A 2BFWA 4I5GA 2C4MA 1QHHB 3RASA 1NUHA 2DF8A 4EAAA 3O2QB 3SZGA 3KDPA 3L6EA 3EXEA 4BUZA 5LMUB 1XD2A 5F3DA 13PKA 2ZWVA 5F76A 2CNWA 1J5XA 1W5BA 2BJWA 2QD3A 1KZ1A 4PQFA 4B4KA 3GLIB 1BHJA 4GP6A 4UARA 4OQMA 3TUIC 4PYLA 1Q1ZA 2ZBEA 5AWFC 3VO2A 1JQLB 4J91A 4B9EA 4QELA 1T5HX 4PYOA 4RD2A 4WOKA 1V16A 2VBCA 4AJNA 4DLRA 1QORA 4NX2A 2PTHA 1S1MA 2BN4A 4OQZA 4PCVA 5ESXA 2I4IA 3L0YA 2CVZA 2D2XA 5BOVA 5G4KB 5HMLA 1DAPA 1JRLA 1HKHA 4MB0A 3SZ3A 1CEYA 2FHPA 3ROXA 2P35A 3B13B 3EQ8A 1NAIA 3NIFB 4RJ2A 3WMRA 3IERA 1OXMA 2HGZA 3D6TB 2G71A 3A1NA 2XB4A 3UPTA 4C05A 4K8OA 2FRXA 4Q47A 5KC8A 1V41E 2V7QA 3VZPA 3PJRA 3AM4A 2VN8A 4OF4A 1E61A 4HKTA 2QLMA 1ZVMA 2V8BA 2HK7A 1RKVA 3LD9A 1CUJA 2B8NA 3AF1A 2JLQA 2K4MA 2BKEA 5IAEA 3TOSA 2NAFA 4RCVA 2R1TA 1CNMA 2D74A 1LTHR 2ZJAA 4D9NA 5LQJA 1CHDA 2R8ZA 4AP5A 4ZCRA 1B23P 1PWHA 2I1LA 4XM0A 3RSOA 3ZGYA 3RYTC 1RHJA 1U2DA 4GPTA 3EJWA 4MGIR 1FB5A 1UJ2A 5EWJA 4AX8A 5C1OA 3LP8A 1NZFA 3BXZA 1C8KA 4MS3B 4X20B 4M9RA 2LXNA 3V8MA 4S1PA 2GETA 3HCCA 1VE1A 3U4AA 2YUTA 3RC1A 4CMIB 1OF1A 4GKBA 2ZAGA 3T5TA 1YGPA 3TG2A 2ZSUA 1WXXA 3I28A 2CZGA 3OZDA 1TPZA 2F6RA 4NZNA 2VHYA 4M1SA 5C8YB 5K7SA 2CJFA 1FP6A 3KFLA 3K96A 1BCSA 4MQUA 5FPKA 4OFXA 5K3FA 2F7SA 1PTKA 1YL7A 3FWNA 1UBOS 1JQ3A 3M1LA 4NPAA 1WUKS 3K6KA 1IUKA 4WRRA 1GUBA 3GLFE 1EVJA 3LK7A 5C1BA 1Z8DA 2BISA 3HYLA 4QZVA 4UNNA 1YACA 2P9EA 3D31A 3GRCA 3SK0A 3T3HA 2AUNA 2FVXA 2VQSA 3WWEA 4ZHQF 3R3XA 3MGAA 2K7FA 1GLGA 5JJLA 5CFOA 2IZOA 3R4CA 3P2OA 1UJ4A 1MW8X 2UUPA 3KTAA 5CB4F 5KNDD 3OOEA 3DBHB 4MDYA 3CLUD 4ZCIA 2Z09A 2HCJB 3Q41A 4E5UA 4ENSA 3JVEA 4FEAA 3O8QB 3BCSA 1JT2A 3KD2A 2O20A 2QAJA 3W79A 3GU3A 3JTMA 2D06A 2PPVA 4OAOA 4WNCA 4EYQA 5LU9A 1QHHA 2GZDA 1UK9A 4I5IA 5FAKA 1TTHA 1DS6A 1W2HA 4KB5A 1PL6A 3B9QA 2AN3A 2ZYDA 3K05A 2Q8QA 3HYRA 4Q3DA 5AHKA 3L46A 1FC0A 1T9ZA 1X1DA 2BFAA 1IZ7A 3T9AA 2ONJA 1KFEB 2CMGA 2O8NA 5AKGA 2R7LA 3BD6A 1JG4A 3MJ4A 2QTRA 4LOJA 3O8RA 1VI6A 1K1EA 2I34A 2FUKA 2XAAA 4L8WB 5KWIA 2I7VA 1ZOLA 4ODIA 1IN5A 3LLMA 2VDJA 3TKLA 5K0EA 2GWRA 4UAGA 1RPNA 1E7YA 2A94A 3LQFA 2GZSA 4Z3KA 2JA2A 3R7LA 5G4KA 3ADPA 1N92A 2RHWA 3E2PA 3LUCA 3SAJA 4OFBA 5M3BA 4FX5A 3W2IA 1ZH8A 3R8CA 2CV0A 1T91A 1TIKA 4R2IA 3O0DA 4WD3A 1UXOA 1BRTA 1OZFA 2G0TA 5I5GA 5LB2A 3UCFA 4QDUA 3QYPA 1X7GA 2ZREA 4P38A 3MYRA 2JVKA 3U1VA 1T0PA 2IF2A 3Q2IA 1HNNA 2H8KA 3DTVA 1NG9A 1VIMA 3QPBA 1OAOC 1N4AA 1T29A 1WAMA 3CX7A 3OOJA 2JIZA 1SAYA 2Z4RA 3N5KA 2J0SA 2P79A 1RKXA 1AQIA 1W581 1XN4A 2TMGA 2WSLA 3GFFA 1JIIA 4J03A 4QDJA 4QD3A 3RT9A 3ZNOA 1HMYA 3U61B 3TLGB 5KB3A 2UKDA 4OXQA 1FRZA 1X70A 1CUVA 1QAMA 1IM8A 2WE8A 4XYMA 2IUTA 2XUAA 4BRZA 4A0GA 1QJ4A 1JHZA 4MS3A 4P34A 4X20A 5D3KA 3W6UA 1JU4A 3WL7A 3BMOB 4PSVA 1WXQA 2OGSA 4D9KA 2F1RA 1J8MF 3NOQA 3O94A 2BFMA 3PF9A 3G5AA 3K0EA 2Y1DA 4KN5A 4N48A 1OAKA 4C0KA 1TYDE 4ZODA 3REGA 1FUKA 3VYSB 5C8YA 2OXRA 1C41A 1MENA 1Y5LA 2PMKA 2CNWD 1OV6A 2CEKA 4WX2B 2ZBQA 2CXSA 2C42A 3K32A 3OIGA 5BQXA 5JYCA 3K0CA 4C3VA 2CJWB 3IUJA 3HWWA 2AZMA 1Y9EA 3RTCA 4DB4A 3ORSA 4XDYA 1DAHA 4FHGA 1ADBA 2R4TA 4MI3A 3DEYX 1R00A 3G0GA 1FDTA 4CU5A 2ZB3A 3TZKA 3AL0C 1XIVA 3K6RA 4IG4A 4AWAA 1NXWA 1W0KD 1X0VA 4BV8A 4I2VA 2IS6A 5JSZA 5LZ9A 4LRYA 2PZEA 1AHIA 3NP7A 2FH5B 3TLBA 2B82A 3P9CA 2ZUFA 4DR5B 2IKSA 1PL0A 3DBHA 1T25A 2VTBB 2F62A 4Q34A 4DLKA 4IDAA 2XTNA 4ZP1A 3QVVA 1DKQA 3PLRA 3WRXA 5K0JA 4E21A 3KUDA 2VC2B 3JWIA 3IIEA 2REBA 2ZUUA 4D02A 3L8FA 2V7QD 4R01A 1ORRA 4ENPA 5DNVA 3PR1A 1KU0A 1S2LA 1XN1A 3SXPA 1XK6A 1U9IA 4K2HA 2BEWB 2QSJA 5DLDA 5J4KA 2ZRHA 2ZT5A 2G5TA 1GG9A 5CAEB 1R8SA 4L8YA 4W5JA 4WV3A 4RWEA 3HGMA 4NZYA 4JIMA 3QKSB 4F3YA 3HQ4O 2I3BA 4BTLA 4H17A 3GMDA 1D7OA 3VGPA 2QZSA 1LSSA 3DF7A 5DRYA 5FA8A 2RHMA 2IHTA 2NO0A 3R3SA 2ZATA 2C2BA 2BHTA 2OKGA 3K5PA 4LS3A 4LV6A 4KIWA 2PN1A 2O2GA 5HKAA 3QVXA 3W1WA 1JLKA 1KSFX 1BWRA 4DA9A 1DCFA 2YJTD 3DOUA 4G0NA 4UBIA 2HXGA 5FUYA 4YRCA 1G5IA 4P4TA 4BO2A 4TV8B 2XITA 3NBUA 5LWHA 3MCZA 2VYCA 4DNQA 1ZLXA 2NU9A 4RSRA 4B6GA 3UWPA 1P2BA 5K8IA 2JGIA 1P1RA 5ALOA 1HDYA 2A3RA 3EIWA 3NYQA 1CUDA 2ZSAA 3DKIA 3N2LA 2WFZA 4K9LA 3UJ6A 3LGAA 3Q2OA 1WA5A 3JQ7B 4EDFA 2ZEJA 1XX6A 3LC7O 2VOEA 4PFQA 3D6NB 3G89A 1SA0B 4MV7A 3TCKA 3L4BC 3CU5A 3FBWA 3HM2A 4FJ1A 4RNDB 4Q3OA 2VLBA 3QUBA 2I4RA 2I55A 4QNNA 4X97A 3FLBA 4I46A 3ZGLA 4EGQA 2I6XA 3FW1A 3KYIB 4LRUA 3THOA 3WO1A 4DSNA 2VDPB 3I64A 2YOFA 5EGSA 4DNPA 3TI7A 3JASB 3I9V6 2UUAB 4NYMQ 6LDHA 2H4JA 2XUZA 4DZTA 821PA 1T6ZA 3CLTC 4CW7A 5E2BA 3C43A 3KE8A 2E18A 2OQVA 1V7QA 4ZJYA 4YDHB 3TCXB 3BMOA 1W52X 5LIRA 3ADDA 3A4IA 5FRDA 1GZVA 5DMHA 2VRBA 3FRIA 4DNXA 5HCNA 1FSGA 1ZMTA 1LD3A 3LQKA 5FEMA 5H8WA 1NXVA 3KL4A 1PNVA 2HO5A 1XAJA 5IBQA 1JDJA 1TLLA 5CLGA 5AVUA 5G0VA 1Q1AA 1TAQA 4QBIA 5AO9A 4DEYA 2BMVA 2HMWA 2VO1A 1QKJA 3IP9A 2YWJA 3GYBA 3A1UA 4ND5A 3NHBA 3TQCA 1O3YA 4LXQA 1NU8A 4WOPA 3SJAA 4DSAA 3JQGA 2GYYA 4WKOA 5EZ6B 3AWDA 1ZONA 4ROSA 2FPPA 2ZE8A 4CKCA 1VSTA 1ZCFA 2V7GA 5CH5A 1YNSA 1NUSA 1GQFA 2DFKB 1HO3A 3R0XA 2CL7X 3HGQA 3EYWA 2GN1A 1WIWA 3O4JA 3K31A 4FTWA 5B1DA 3VRHA 1V47A 2XWSA 3DOCA 3WIOA 4HUQB 1QYDA 4DABA 4DBVO 1F06A 2J3IA 4KK4A 2WHPA 3KJIA 1WPXA 2AVNA 2L69A 3C16C 1KEKA 3A9CA 3I9MA 3KYBA 3UJ3X 4O1MA 3OQMA 4QG3A 2UUCB 4ZAXA 1HRKA 1IN8A 1OLUA 3K9CA 3NG1A 1DARA 2BEWA 2J3QA 3LOQA 4C0BA 1ULAA 1B8VA 3EEFA 4OBWA 3SLKA 2QXUA 1T36B 2O2EA 3GFTA 3L93A 3U13A 3NRCA 1RVDA 3MUOA 1TF2A 1C1HA 3I9JA 3C14C 3U7QA 2QQ5A 2XHZA 2E5FA 1FFWA 2TRSB 4QFCA 2EJCA 2GM3A 4BGUA 2PS1A 5HJ2A 1YL6A 3FB1A 3NTLA 3T9CA 3WYBA 2F1HA 4D4MA 1WMFA 5LBIA 1O4WA 4FFWA 1NVGA 5CR9A 4OQEA 3RSHA 3FMPB 2PFGA 3PKJA 1XZNA 3DS8A 4F1JA 1D5WA 4F5DA 3AM3A 3PNQA 5DHTA 1G63A 3DPSA 2DSTA 1YR2A 1DLJA 1ZQ1A 2C3YA 1KQGA 3CKLA 1VL1A 2IUYA 1FQJA 4OHFA 4ALLA 4QFBA 1ES9A 1Q1BA 2Y67A 2QMYA 4MINA 1T3SA 4ZO8A 1QZ3A 2HPZA 3R5SA 3D4IA 1QPZA 1RWVA 5LP1A 3OQ6A 3OPMA 2F3SA 4XWGA 4XZ3A 1U3DA 5IUNC 1T2DA 1FTGA 4YCNA 2PPLA 3ASYA 1SA0A 2RGYA 3GJ6A 2MOKA 4D9CA 3O95A 3LX8A 1JFVA 4I50B 5JJKA 1KJYA 1SIOA 3ND7A 4W4TA 4ZOEA 2NM0A 2YIVX 3F49S 1P0CA 3NXKA 3PYMA 3C6QA 1IM5A 4GICA 4GMGA 4I7EA 4OJQA 3L05A 1I7LA 3KAJA 2QR3A 3FPBA 3PRJA 2WPNA 3C8DA 3QU9A 1B8NA 4KPUB 4OQLA 4Q16A 1OI7A 2Z83A 4MUAA 3TD9A 5A1TA 3PQEA 3B9PA 1EK0A 4HAYA 4X91A 1EX6A 1X7WB 2QZJA 3WIDA 3KT3A 1JN0A 3E5MA 3K4PA 2CBXA 1J06A 7GPBA 5F3WB 2GTIA 4TSFD 4EECA 3ZU6A 4KBGA 1Z68A 2WG0A 1P0FA 4KUEA 4QUBA 4ZO9A 3K15A 5JR3A 2J31A 1WHTB 4G24A 4X1YB 1FFBA 1W4AA 1NC3A 2IODA 1VJCA 4P4GA 3ZCXA 4EPRA 4J0IA 4RDIA 2QS9A 4ZVQA 1Z4KA 4GIBA 4H1TA 4X24A 1BX1A 4X8OA 5EKSA 4KXXA 3RKUA 4XUCA 3SQLA 5JNRA 1QE3A 5LQSA 5TEWA 4DT1A 2CLOB 3CMMA 1X9GA 3CR3C 4B4VA 1QU2A 2FUNB 1KS9A 1PT5A 2HM7A 3RREA 3W9YA 5LOVF 1V95A 4IEIA 1D2HA 4I8XA 3WB1A 4A8JA 1D7AA 3GMSA 3M9LA 4M76B 2NNLD 3EGXA 2M1XA 2ANCA 5K8CA 5FV4A 1BIFA 1N3YA 3WHLA 3MWKA 2C8KA 3IUSA 4OFWA 3BFXA 1TA9A 1GTMA 1C14A 4MV1A 2VJQA 2H1LA 4NJOA 2KM1A 1WW8A 1WR8A 4CMGA 1QGUA 4HC4A 4KSBA 4BNUA 1B00A 2KYRA 3A6DA 5HQTA 1D3AA 1VHTA 1B4DA 3LRPA 4ND8B 4U4AA 4BYMA 3OTHA 3ZCTA 1M2OB 3M1IA 4YQZA 3I9NA 3DL4A 4NARA 2ATIA 1XKTA 2GR9A 2ORWA 3TCNA 4DVJA 3CYFA 4ZZ1A 2WHRA 3AHDA 2JVJA 3QE0A 2EF1A 4JQOA 3QELA 4K6OA 1WVIA 4FINA 4QT0A 2DWUA 3JU3A 1W2WB 5FBVB 1T36A 2UYQA 3KR9A 1OIWA 1R0BA 4C21A 3O8BA 3QX9A 4RA6A 3WV5A 4B3XA 3WYDA 3BK7A 2HA5A 1GPDG 5FBWB 1PU2A 2Z3VA 1ABBA 2ZE6A 1J56A 1M2HA 1DRVA 5CVTA 2PM8A 2WFAA 1ECLA 5BWCA 2E2WA 3T9DA 2JFYA 1QHIA 4MR7B 4WZ6A 1NMXA 2C4VA 5JS8A 1T9KA 1EGAA 1JR3D 1P8AA 3PRHA 3WB9A 2B69A 3BCUA 4LGMA 4V38A 3ZUPA 5DCWA 1B8PA 3L7MA 1V96A 3M4ZA 2J5BA 2J07A 3MWLA 4V0LA 2VL7A 4ZICA 3A28A 3EUAA 1UJ5A 3IFSA 1G9TA 3SHWA 1ZHFA 1C0KA 5JRJA 2IPXA 3R75A 1RI2A 5DM4A 3J81k 1T4CB 1DJQA 2FR0A 1ZJYA 2WWIA 4AZSA 3GC6A 1K75A 1P7YA 1HNWB 1L5HA 2AJ8A 4Z2AA 4RTRA 3DLIA 1BU5A 1UPFA 2DUWA 3MRSA 2NVOA 1VJTA 4MUFA 2PUGA 2CFIA 2VP2A 1YS9A 1ZK1A 1MLDA 4I50A 3GAZA 3Q3VA 4WCFC 3TX6A 1Z6GA 4ECEA 2GZMA 4QKQA 4RELA 1PZFA 1JF8A 4XJVA 2X4LA 3HDJA 4JJEA 4HS4A 4D56A 1UWLA 4UTNA 2DPXA 1L7RA 4QFDA 3AUYA 3QUAA 1XMIA 4NDZA 2DBYA 4RZUA 1N6PA 1VKRA 2J6HA 3EWIA 4BNDA 4RTOA 4M6WA 3R0ZA 2WKSA 2FZLA 3SJBA 4XWWA 1H2BA 1BKDR 3IODA 3EA0A 2AZDA 3DMNA 2BVNA 1TAGA 1TK9A 3EOBI 1NOJA 4JD5A 4QU8A 3SKXA 3T3PB 1AX9A 4JYPA 1BVRA 1C2TA 1KO5A 2Q9BA 1QIJA 1ZIXA 2YC2C 1FSSA 1DQZA 3A4LA 3HUUA 3OECA 3RRXA 1TCCA 3D4PA 4R1OA 3LFHA 4WZBB 1N5IA 4X1YA 5ARBA 2Q1SA 2V7TA 5FJIA 4FKBA 4HVCA 2FKAA 1TA4A 3MOGA 4D42A 5LMZA 3EFOB 2W6IA 2QUJA 2YMMA 2HNKA 3S55A 4AYXA 2EQ5A 3MN1A 4PLPA 2OCPA 3A9WA 4JMLA 3OQNA 5E9QA 1GITA 1O97D 3FPKA 2X1VA 2B1JA 2Q3CA 2GDJA 4OJMX 1CJUC 1Z2EA 3HVKA 3BERA 3HZOA 4A73A 3K30A 1XQ9A 5JCOA 1I1NA 3RDPA 4FC6A 1XU9A 4EVRA 4IVPA 1E96A 4LQLA 4N49A 4DR6B 5HFJA 4LDJA 1N9GB 2DTXA 3H0EA 4XCXA 1ZU5A 4ABYA 4B31A 4AN1A 5LA6F 2ENWA 2YJ3A 4FC7A 2P4HX 1YOVB 3W3AH 2JFOA 2XT0A 3QMWA 2PGXA 1ATZA 1BGVA 2QM8A 2WUVA 5FBHA 2DERA 3T12A 4UFPA 2P6UA 3KR0A 4E30A 4F8EA 2XD9A 3NC0C 4RY9A 2BR4A 2XCTB 4KUHA 3DM9B 1U31A 1X0XA 2R11A 2R4UA 3MC1A 3LQ2A 4KODA 4L1KA 4KXWA 8MHTA 4INOA 2C2WA 2R6ZA 2VPXA 4E7OA 4GLFA 4RFSA 5JTUA 4B6PA 2CE7A 5MGNA 1WB9A 5F21A 4D26A 3QV1A 4J0JA 1KS2A 4KO4S 2JARA 4XGKA 1ZVKA 2FPXA 4GD3Q 1MT0A 2ZTUA 4BLWA 4GFDA 4JEUA 5DSZA 4FR0A 4L9AA 4M0LA 1A3CA 1C7QA 4MR7A 4LUCA 1UPUA 1S0UA 4WA7A 1AV6A 4ZI7B 3M83A 2VS1A 2HQOA 3Q7PA 5HRUA 3FR7A 1YVUA 1RHMA 1T8YA 3Q1KA 1VPLA 2O3RA 3T3DA 4G01B 3O84A 3RS9A 3C3XA 1EHYA 2XUPA 3HDHA 1UK6A 1P7PA 3N7TA 1AG9A 1P7VA 1ZNXA 2C82A 4RD1A 3BXFA 1UM8A 3KOXA 4EX7A 2C0QA 5AXBA 1LQUA 1MC1A 1X9HA 2IBTA 4MQ4A 3QA9A 1OH6A 3OU6A 4RPCA 4E1AA 5HILA 4F6RA 1OAAA 2IJGX 3WGHA 1GCGA 1T1RA 3W6OA 3CVUA 2LDBA 4EJSB 1EVYA 1U65A 1WP4A 3H8JA 1P4GA 4I6GA 1NI4B 4DV2B 2Z2IA 3FPGA 5C8DA 2GT1A 1NXTA 1TUBB 2HQ1A 3AVQA 3G88A 2ERXA 3IDQA 4AY4A 3AUTA 3TRKA 3KUKA 3QLVA 1Z6TA 3VNQA 3SZRA 5KPDA 2Z2KA 4BP8A 1Z0FA 2BD0A 4QPDA 3A9VA 4N7MA 2LR0A 1KO4A 1BE0A 4TYPA 5DXAA 3U3RA 2A5LA 1HV8A 4JBGA 1FCJA 2YHIB 1UWVA 1AXRA 4EL0A 1U9ZA 3AR4A 3WIUA 4XW2A 3HTXA 3WMWA 2PX6A 4MQLA 2GOYA 4WZBA 1SBYA 2WKRA 4ZEOA 9GPBA 1KTIA 1Y7PA 4J9UE 2ZAYA 1B1CA 3WIBA 2BBTA 4JBNA 2P11A 4TTJA 1RTTA 1DU4A 3EFOA 4RVNA 1M34B 4JDUA 4J0QA 3CT6A 4XTRA 3L40A 3QKTA 1NRWA 5FORA 2D54A 5JIBA 7MDHA 3A31A 1ISFA 3ADOA 1KI6B 4DR3B 1T1IA 3ZDCA 3LA8A 4BCBA 4EJMA 1QZZA 2V1XA 3QE2A 4O59O 5ESWA 5JCXA 2EOAA 1C8BA 4HYYA 4F2GA 5GM1A 4OATA 4F21A 3H8SA 4OD0A 2ZTSA 1Q2XA 4UUOA 5GP1A 1TVKB 4NCXA 1JU9A 1E0KA 1ZOSA 4RJTA 5LXTF 4FGWA 2CLCX 3PL5A 5EERA 3G7NA 2ZRLA 3KXIA 3L7KA 2OYCA 3I76A 2Q7DA 3SR3A 1FJGB 2AYZA 2DPHA 5AI8A 1WTAA 4ZTBA 4P2BA 1E2EA 1QZXA 1KAOA 1XTZA 1ZD9A 3S3TA 4FUTA 2GX6A 1K7XB 2LNDA 3VPAA 1RI3A 4Q9JA 2DWQA 5DT9A 3HSKA 1WEKA 3K92A 3HP4A 4HEHA 2NXJA 2KLBA 1VMDA 3DZJA 4ITRC 1NRJB 1DIAA 4I08A 5ENZA 3FZYA 4PLZA 4EIWA 3WYEA 4GH5A 1EG2A 1GTVA 3SQDA 2ZXUA 3F73A 3PGLA 4GOND 4OXNA 4MVJA 3COYA 4D5EA 2Q1UA 4K46A 4UQPA 1W88A 1ND5A 2H5EA 3FMGA 1MHPA 4M2LA 4W8OA 2J5XA 5AKKA 5EJ4A 4RHXA 2G82A 1QNLA 1CJTC 3OZBA 3PPWA 3TLEA 5DW3A 2J9ZB 1KETA 2A4KA 2P9HA 4QPPA 2Q3EA 5GTDA 1ORIA 2X8BA 4V0KA 4ZI7A 4DTIA 5KDLA 1A27A 1D1PA 4BFUA 2ZSFA 4ZPXA 2CUKA 3A0UA 3QTLA 2ZCUA 4G5SA 4L4XA 3EULA 3JW8A 1K9VF 4PW0A 3N86A 2YWDA 3NPMA 4CM8B 1PL7A 1DXHA 1A69A 1T4BA 2O2CA 3D3QA 1CQPA 5IYZF 4K88A 3O3OB 1EHIA 1BA3A 1M10A 1SELA 1VBKA 3TLZA 1JQDA 2G6TA 3K53A 2C78A 3PRYA 4FBMA 4RHYA 3UK0A 1E2KA 1BD4A 4E31A 3UMJA 1VGVA 3SBDA 1E3IA 2JKZA 3DV2A 4LOHA 2PK3A 1KK2A 1WNFA 1TUBA 1Y48E 3KSZO 2IXAA 5ALRA 5ERXA 3VKWA 4FOLA 3JX9A 5EPEA 2P77A 4NE7A 3UK2A 2E55A 4G5YA 4I1OA 5A3VA 4O4JF 4BFCA 1D4AA 1CUFA 3CY6A 1OI4A 3D8SA 4RM3A 5HDQA 4MUEA 5DTMA 3PD0A 1U7OA 2X23A 4I5DA 4NONA 4OL9A 5IVDA 3TZHA 2IFTA 2GJAA 5IK2A 2C9CA 4AJ2A 1WHSB 2YHIA 2FZWA 2VSQA 3SE7A 1PLJA 4BKUA 1IHPA 3NIWA 5K01A 1RQGA 5ICEA 1GIAA 1HG1A 4HWGA 4BUJA 4KFTA 3EW9A 1XTIA 1XVUA 5CIYA 3RUHA 2NSJA 3PUVA 1JEQB 3N8HA 2BSAA 4RESA 3THXB 1OVMA 4XLLA 4ENTA 3CRW1 3QV2A 3KBBA 2WFLB 1B6RA 2XYRA 3AIIA 3M70A 4A1FA 4BMZA 1P1FA 5AVRA 3Q6NA 4QTXA 4WDQA 5BW4A 4HAXA 4TWIA 1QR6A 1XQYA 2VYQA 1E3WB 1YKGA 2AG0A 2X9GA 3LPNA 3SIWA 3U7IA 3ZXIA 5F1YA 4YR7A 3EGDB 2EJBA 2OXFA 4ZV7A 4JI3B 3WRYA 2AD5A 1TVKA 1BVHA 4JJKA 4ZANA 2L0XA 1XHFA 4C6TA 4MMYB 3GEEA 3JRXA 3SR0A 3T15A 3AUSA 3VO8A 2B0JA 1G6OA 4HLNA 3N8DA 1S2IA 1Z5WA 4NHOA 3T4EA 5HS4A 3I73A 3U7HB 2OC4A 3AFIA 4CE6A 2NQ2C 2JGRA 2K2WA 4KK3A 3GR6A 4LPSA 5AOCA 1L3BA 3SHOA 1GA1A 4GGPA 3VM6A 5KBYA 5M29A 1ZIPA 4J90A 1UC4B 3EWNA 3MAGA 2F43A 3R2JA 4BP3A 3FI9A 3ZQUA 2GN0A 2UVPB 4E12A 1RFLA 5AXDA 3B1VA 5TIIA 3UMYA 2NAPA 2C1ZA 2ODWA 4KQEA 2C9OA 1WCV1 2BEUB 3HDGA 1HORA 1R0LA 1QVVA 4FYWA 5EZYB 3I2GA 4LMPA 4OMFG 5KQMA 5DHAA 5TVGA 3E8XA 3KJGA 1N8TA 1LRJA 4D74A 1DCTA 2Z3WA 3QOWA 4Z4IA 1Y3HA 1O9BA 2JFQA 3T3EA 3G7UA 4YV1A 3KSUA 4EKNB 1YCDA 2AR0A 3HU2A 1FW8A 3V2IA 3B2NA 1YZTA 2Q6IA 3KCQA 3IEMA 3WKCA 4ARZB 3ESDA 4A82A 2JFNA 2QU8A 4OU4A 4XFJA 4DLBA 1UT6A 2HB6A 2P8SA 4I4TA 1L4GA 3J80A 1KYZA 1EPUA 1G42A 3W2TA 3FBTA 2ZSJA 1BHO1 1HT0A 2QRMA 3ISJA 1JDBB 5IKMA 5T7BA 3DE0X 1Z88A 1G16A 1Q7CA 1MIOB 2Z8ZA 1N2CE 4PR3A 3RNOA 1JP7A 3ZH9B 3LK6A 3D02A 3VR6H 2GARA 3I3OA 4CXMA 4AY3A 4DDTA 1WCYA 4MCJA 2JPDA 3AU9A 1TJ5A 1ZVJA 2GKOA 4H7FA 4KYIB 4LHZA 3RUDA 2WAYA 3ZCPA 5HP4A 2I0FA 2YRXA 3TWOA 4U02A 3CA8A 3JWPA 3EARA 1RYYA 1WHSA 3GRKA 4RVSA 1W94A 3H13A 4QJ5A 4GSKA 2R9VA 4G9BA 3K71B 2Q2VA 3N3BC 3VQTA 4RKWA 3LQYA 2BTOA 3BIWA 2P4QA 2VPPA 2WVHA 1MGPA 4KGXA 3UTCA 3THXA 4DREA 2VHJA 2BGNA 2AOUA 5IN5A 4DEVA 2WFLA 4F3KA 2JLAA 3ZW9A 3PNBA 4QRDA 4WH0A 2YVUA 2CLLB 2EP7A 1NM5C 2JHPA 4ZMBA 4Q7JB 2R1ZA 3GFOA 3KTOA 4HDRB 4YWHA 1XXHE 2PJDA 1UDBA 2CFSA 4JENA 5HGJA 4Q4CA 4Y3UA 1L1FA 4UMEA 3GRUA 3GELA 4MUGA 2JLVA 1V26A 4UHCA 4XQGA 3P94A 5H3CA 3OLWA 4BE4A 2NGRA 3ETHA 5BSVA 3F97A 4MHTA 3VC7A 2JIOA 2IS4A 3IIJA 4AIRA 2ZBVA 3DDZX 1JECA 4ND1A 4R8KA 4EKYA 1WY5A 2OO3A 1S7CA 3P2EA 1MC8A 1UANA 3RHSA 3KEFA 1T4MA 3ZBUA 1MPTA 3UXEA 3A4YA 1B42A 5CVDA 5AJVB 3ST7A 1DWOA 2BGIA 4LX8A 5G3YA 1QLHA 2H3HA 1XQWA 5E9AA 3TDNA 4CM6A 2ETXA 4IQGA 5B30A 3L7OA 1L4EA 4EVSA 5A1JA 4RTLA 4RH0A 2UVPA 4JI6B 3G2JA 1KOGA 3ITNA 2HBYA 4ZOCA 3O31A 4IUCS 4RF4A 3IT3A 1JSZA 2WU8A 4EABA 1BDIA 2DQKA 2BEUA 2NVBA 2VK8A 2XCUA 3AETB 5T64A 4I9UA 5EZYA 3VZQA 1TFUA 2VHVA 2QYSA 2YV5A 3GZJA 3RUIA 1YC5A 5JHGB 4KV9A 4DBZA 1EXMA 2FV8A 4MJ7A 4WADA 4DEXA 2D2EA 3ZY5A 5A3JA 4WBXC 5KTSA 1E79D 4K86A 1AQ6A 3EFHA 4JP2A 2HLHA 3WLLA 1Y98A 2O2ZA 4PPYA 4ZVSA 5B3LA 4RTNA 4ARZA 2WW8A 3WYAA 2QM3A 4IHJB 4QDZA 4QL3A 1TO1E 5DO9A 5CYFA 2PLNA 1Q6ZA 3CJRA 3H7IA 4YYZA 2E5LB 4M1QA 3W5HA 1DC3A 5A0FA 4MW2A 3SFTA 2FP3A 4FYJA 5ECWA 4Z2YA 2BZGA 1YZLA 1OSNA 4KVFA 1SC9A 4N39A 4XGIA 4JT2A 2WWTA 5ALFA 3AQIA 5ALMA 1E58A 3Q9LA 5AICA 1EVQA 2RI6A 2XPCA 2FDCA 4CPDA 2ERYA 3F6YA 4EB3A 3VKVA 2B1QA 3ESQA 2NP7A 2YWRA 4Q7EA 4DZRA 1S3SA 2TMDA 4ZVNA 4CMAA 1HYQA 2CMHA 3KJNA 5JLJA 3KAKA 4DA6A 2W2PA 4QLOA 1C81A 2IOFK 4P92A 5AM0A 1C7IA 2IEIA 1CCWA 3HLKA 3GFSA 1DFGA 3OEED 2EJUA 3JALB 1FS4A 2H08A 1L4BA 2JGEA 1P7ZA 2EZ8A 1M0EA 1G5PA 5HTKA 3C4QA 3F7NA 3PFCA 2AJLI 1QM5A 2AOTB 5CLHA 4IBOA 5FUVA 2QAGB 4CZ2A 1QTIA 2OO5C 3WYCA 2BTQB 3NHUA 1PWXA 3H5RA 1CUXA 1B43A 1SKQA 2OFXA 1AK1A 3P4XA 4P1ZA 4BNTA 4HDRA 3WR5A 1QH1B 2DQZA 4YT4A 4PAOA 1UFQA 1YFZA 2G28A 4MYRA 1D6MA 2QN3A 3MJHA 1QHYA 3HU1A 3KFXA 3NHPA 3I2JA 4JR0A 2DG2A 4RMNA 5B1HA 4BVKA 4DA0A 3L0PA 3ZY6A 1EFKA 3WFIA 5IK2D 5LDDC 4MKFA 3MXTA 1XWWA 1YRQA 2CNKA 2VHTA 1G0NA 2X7JA 1YIOA 2WZDA 2DTDA 3A6JA 3Q40A 2YNMD 3K0AA 4N7RA 3ZE0B 1D2MA 4MIEA 1ODTC 4JP3A 5AW7A 1NFRA 1XCLA 1EIZA 3HL0A 5FA6A 3RUAA 4ACBA 1G2PA 2Y1KA 2YR0A 1C1XB 4MP3A 2FEWB 1BDMA 4PC6A 5KTYA 4CV3A 5AKHA 2QG4A 1RYZA 2IDJA 4V0ME 8AT1A 3CCFA 1J2JA 1G38A 5JJ5A 3WRVA 2QDKA 4L6CA 4L8LA 3ZWYA 5F7OA 3CO5A 3QE4A 5CT4A 3W2FA 4NENB 3WHPA 3ACBA 1NW8A 5CT9A 4BCCA 4CT4B 4LY6A 4QM7A 3AETA 3UUFA 1RTKA 2HMVA 2E21A 3KT0A 1TEZA 2JFPA 1YZHA 3QYFA 4GBGA 4RACA 3E9ZA 1YFJA 1HX7A 1FSZA 2HA4A 1F1JA 3R20A 5DGCA 4W5WA 3TXYA 4TMFA 1P6XA 2XGOA 1EINA 1WLSA 4YA6A 5E2AA 1CSEE 1Q0SA 2CFOA 3AR3A 1KZHA 1ZC3A 4Z51A 2C97A 3A1SA 2AG8A 5F52A 1EP1B 5ESRA 4IHJA 1PO7A 1XTTA 1PYGA 4C4YA 3WK6A 1ML4A 2ODPA 3OBBA 2ZLBA 2EZUA 3OZTA 3QHPA 4NG5A 1VJRA 2WYOA 3H9UA 3T5CA 3BE4A 2VYVA 4A92A 5JVDF 3BIJA 1ZGGA 1QF9A 3L6CA 1Y82A 2Q5HA 3HKCA 1F60A 5CHYA 2BUAA 4G0YA 4MTCA 1KDZA 2K87A 3U2QA 4OAQA 1H22A 4Q4JB 4AZ0B 5JO9A 3TZCA 2H2GA 1OILA 4XR9A 3UH1A 3B1YA 1CIJA 3OPYB 5LLSA 1PR5A 5CDTA 1W47A 1GLNA 4M0MA 2HRZA 2QD1A 1YRHA 3BXOA 3ZQ6A 1DCKA 2YRWA 1C9NA 1Z25A 4CTMA 1T24A 3QBJA 4J49A 4J0GA 3WGGA 3E9MA 1NBHA 1ISRA 3JALA 4BWFB 1T2VA 1CDZA 3BFKA 1WPQA 3CZRA 3ONWA 2P9YA 3QOXA 4U0KA 3GFRA 2ZZMA 4C0AC 3C15C 4LE1A 4TL6A 3S99A 4DLAA 3LP5A 1EU1A 4EUNA 2QAGA 5T4EA 1ACLA 2CUNA 3N8KA 1T2AA 3SVLA 2XIJA 4WA8A 4B6RA 2WPDA 1QH1A 2HNBA 4I3HA 1YQ9A 3GNQA 3W2EA 3MVEA 4C0SA 3CMCO 4KMMA 1NOIA 1XDWA 3QRWA 1VIYA 4X60A 3HA5A 5BQOA 3UAWA 1DQRA 5B1SA 3ZWCA 3CKKA 3H84A 3GEPA 4DRYA 5EIFA 1O0BA 4DIFA 3CVWA 1GCUA 3RTGA 3IVGA 1UAYA 1A5BB 1ZBDA 3OFND 1QZUA 2I1VB 4DQ0A 5CNIA 2GLXA 4LW8A 3EJ6A 3LQ1A 3G9QA 3EVNA 1PW7A 1W35A 3IEKA 2LTAA 3OUTA 1C1XA 1OX4A 4YX9A 5ICSA 1RZUA 3DNMA 4AZVA 3STTA 4XWOA 5C5EA 5JV5A 3WNZA 1ENYA 4PZZA 2PKYX 3OLCX 1Y8ZA 4R8LA 4BX0A 1UQUA 2GBCA 2XKBA 3CM0A 4M86A 1CY0A 2VP3A 3FOCA 1AUQA 3GJZA 3MW8A 4TTIA 1NJSA 3EDMA 2D1TA 1YR9A 3DVQX 5FOWA 4NENA 3BA1A 5H3LA 5T4FA 1IOVA 1GZ4A 3BFPA 1A2OA 1IG3A 2VXBA 3AVWA 1OA1A 4UDXX 2JGDB 4FFVA 2WJIA 5GZ6A 3EDOA 1NT4A 2BFFB 3RTEA 2AE1A 3GJ8A 2WHQA 3HZZA 3DC7A 4RLQA 5E8JA 2NPFA 1KP2A 4JLJA 3ZIAD 1TRHA 1SNYA 2QB5A 4BC1A 1M6HA 1OFTA 2C54A 2X9VA 3T6KA 3AOEA 1C29B 1T43A 2AZ4A 3DZBA 1OYWA 3OEWA 1KHTA 4LJRA 1JG2A 4PAGA 1QGOA 3TH5A 2WINI 3ZGXA 3FDZB 5INTA 4F4JA 5DK6A 1ABFA 2QP4A 4POAA 4X92A 5T5QA 3OTIA 1P17A 3ZDEA 1E9RA 1O4VA 1FMLA 2JJ8A 3VX4A 3FHOA 2CF5A 4X6UA 4OX9B 4Q4JA 4HWOA 1NF2A 3TPZA 4JL8A 1L5OA 3OKCA 2NIPA 1X1SA 1ZSVA 3DL2A 2H2IA 1EK1A 1V9SA 3WGTA 4BGVA 1A71A 1EX9A 1QRDA 1TE2A 3H5TA 3IVMA 3T7EA 4WKPA 4ISBA 1F3LA 1CS0A 3A1EA 4D6YA 2C94A 4QIHA 4CV0A 1W7AA 1XKLA 3CBQA 5TY0A 1KOFA 4Z53A 2R6GA 4MULA 3AINA 3SI7A 2C5EA 4P7JA 4QULA 4UBKA 1OWNA 1FFGA 1Z26A 3HV0A 4UMVA 2XZPA 3ZHXA 2O8BB 3JATA 2B7LA 1KI2A 2FWAA 5FOTA 4GLLA 3C3YA 4ZI3A 2I29A 5TB5A 2W6CX 3HO8A 1NVUQ 2HMSA 3JQQA 1ISMA 3WJ2A 2WDZA 1U4NA 3U3ZA 4O2AA 2QTMA 4E13A 4II2A 3K09C 2GNPA 1KVRA 3LFTA 2LIVA 4BY9E 4AKGA 4KQFA 1L5LA 1NXPA 2JK1A 4G9GA 3RT7A 1NUQA 1X3SA 3F2VA 3C85A 2O52A 3QPUA 4Z5XA 1DTWB 3V1KA 3SHFA 5CG2A 4XE5A 4EY8A 4IEFB 3JTEA 3SQNA 4AG3A 4B48A 4YRFA 4RQBA 4A0SA 2Z8YM 2D1YA 1BNCA 1IM2A 4FYVA 3S5UA 2BFBA 3IOEA 5TS2A 3ROPA 1DBWA 1TW3A 3OUZA 4K9MA 3N2KB 4D4LA 3JZMA 1DWPA 3MJEA 2GAAA 2ZE5A 4CTJA 3VNAA 4DCJA 4CQNA 5KTOA 4HEA6 4LY9A 1ZD1A 3T7CA 3HEBA 1EB9A 3IQGX 1PJ2A 1ZI9A 4AQDA 5A5EA 1QE0A 1GLVA 1U9CA 4Z0TA 1FTYA 2VEOA 3AGQA 3AR6A 1JHQA 3DE1X 1R18A 3ILSA 1E7MA 4X65B 1A1VA 2BTEA 1PQYA 2HY7A 5DM1A 1JLSA 1FW6A 2Q5FA 1MX1A 3LE8A 4R7GA 2WIAA 3NANA 3UYLA 4MDFA 4K0KB 2BMAA 2HI0A 1SHUX 3QHQA 4L9WA 4MHOA 4X3OA 4CM1A 1JZSA 4RW0A 3FB4A 3GLQA 4HTFB 1F4PA 4YBZA 1Z6QA 1H2XA 2HRCA 1H6BA 2OV8A 2KBFA 3JXEA 3RV4A 3V9AA 5C5CA 2HW8A 3MM4A 4PCUA 1IH8A 5ALZA 4A23A 1ZS9A 4TXMA 1K4MA 1RABA 4H1UA 5HJ7A 4W5RA 5AVKA 5AVZA 2B4TO 3U7GA 2CLMB 3ZJTA 1DKUA 3OX3A 2OK7A 4P3XA 4HZGA 4NZZA 4R2WA 4CDMA 3EODA 1K5HA 3ESZA 4D4KA 4FNOA 1PGQA 4K1LA 4QWMA 1A98A 1OIXA 3AHIA 1W5TA 2RHOA 4YRRA 5LCXA 4CIYA 2XB6A 4PNEA 3KYDB 3KEQA 1PFKA 5A4MS 5DT2A 2OY0A 3DDUA 2VDOB 4X6YA 4XIJA 1HGXA 4G0VA 1G20B 4CT0A 1LBEA 3T8YA 4R69A 1OH8A 4N1AA 3HH8A 4M0EA 3FKJA 1JNXX 4UNRA 4LOIA 1NWCA 4WESB 2Q28A 2QTZA 2XZDA 4HLUC 1LZKA 3QUSA 4DF3A 3AJDA 2AG6A 3K3PA 3ZDRA 1YRYE 1UT8A 2PLRA 5HHTA 2VP5A 4J4HA 3RG2A 3SF0A 1SUSA 4LJYA 1P4AA 5AJUA 4H3SA 2AKEA 3VNUA 4BPBA 1XV5A 2G88A 5HYVA 3VKGA 3FVRA 4RKYA 5D3MB 4IGKA 4LRSB 1TPYA 3PA8A 4M55A 3GQVA 2L17A 3SC3A 1RLIA 4XYEA 4EUKA 2JIMA 4N5NA 2DETA 3LRTA 2WTBA 2V03A 2KW5A 4FGKA 1E77A 1GRNA 1YJ8A 3KHUA 4PCAA 4H1WA 5BQ3A 5AK5A 2ZB4A 5COBA 1BXGB 4YRIA 3BHJA 3PLAE 2YJ4A 4HAWA 1DTWA 3NGXA 1NWHA 2PV0A 1X1RA 5PNTA 5JADA 3NBAA 1E9EA 1JWAB 4KYUA 1ORHA 5JQGF 1OXUA 5DPMA 1ITZA 4OUKX 1RJEA 1IEQA 1PRYA 5CFRA 3QFCA 1K92A 2I7XA 3H9EO 3N2KA 1YB2A 2Q4RA 2W6NA 4H16A 4B2LA 2E7ZA 4O8CA 4ZEMA 1HDOA 1EXWA 1S9DA 3Q7EA 2O19A 1U2GA 4GXTA 4LJKA 1IY0A 2GF9A 3I52A 4GUDA 4QPZA 3V42A 2CL0X 2QZZA 1S2OA 4U7WA 5SZIA 1OY1A 1Z2OX 4H6XA 1QVAA 1W34A 4HJXA 1ZVVA 4G89A 4R31A 1Y5MA 3W0LB 4Q9HA 2BGLA 2VAPA 2OENG 2HTFA 4C6SA 2REOA 1DC7A 1VM6A 2I3DA 2JIQA 1KBOA 3CRRA 3NUZA 4KYTA 4MUBA 5IDYA 2ZUTA 4BN5A 4CQLA 4B4WA 1KH2A 2OD2A 3FYUA 2G63A 5BSTA 3E15A 3COJA 5HE8A 2C5HA 1WSWA 3HNPA 1ULBA 2MYTA 3MHPA 2Q6KA 3WTCA 3HVRA 2G9ZA 3PPVA 2LUOA 2F9FA 2X77A 1JIUA 5JZBA 1IBLB 5C4GB 5TGTA 1F8FA 1G8PA 1KF0A 4JB2A 2Q5IA 4LFBB 3HB1A 2ZUVA 5CBPB 2QYTA 3KU4A 1KMQA 1XEWX 2ZJ6A 3MT8A 3TW8B 3UMGA 2Z5GA 2YV2A 2NPIA 5ALNA 1FDIA 1WM1A 1VFPA 2AG5A 3N9IA 1PLKA 4MRMB 5KNCA 2N75A 2QPLA 2WFMA 3CFYA 5AW5A 4TZKA 4FDUA 3PVCA 4ME6A 4ARAA 2QIPA 4S1OA 3OLYA 1J99A 2IY8A 2W48A 3B1XA 3RVDA 2P5YA 1R4NB 1Z4JA 4A2WA 4WOBA 5ALTA 2PJRA 2ODQA 4ZD6A 4IIUA 4EHBA 1PFVA 3IPLA 3GUCA 2QN6A 4PAQA 4AO7A 4BVJA 4I36A 1GO2A 2ZYAA 3JQCA 1P80A 1G20A 1X7XB 3C3PA 5ENDA 4B0OA 5CH3A 3CVOA 3EQ6A 4E88A 3UBMA 2AIRA 3U7FB 3UJPA 2SNIE 5ED4A 4PM4A 4JR1A 2BT4A 3R9KA 3LSTA 1EFPB 1B0UA 3E22B 4H3HB 4WESA 2J0EA 4L3OA 1OQAA 5LJLA 5LUBA 3KZCA 1WBDA 1B6GA 1P4RA 3KQTA 5FADA 3EDCA 4C5BA 3K16A 3NO4A 2ZI6A 1OXSC 2ZI5A 2IHZA 3KRTA 5I45A 2AHOA 2LKDA 1L3IA 2FRDC 1Q0HA 1NKVA 4PO1A 2R6JA 2FDXA 3A26A 4WMLA 1NP7A 3R0JA 4JLAA 2HSJA 3I4LA 4IRMA 4OMDA 1P2UA 2CF6A 3ZE8A 4G4SO 3O9VA 2XT9A 2WTUA 3UW3A 5FPYA 2VHWA 4YHHB 4E4YA 5CLLA 5H70A 2RHCA 4Q6WA 3ZVMA 3RW9A 3TEJA 1OROA 2XYVA 4LJSA 3TLMA 4P9NA 5FI3A 2V9ZA 3CRMA 2H5IA 2XVYA 4MEAA 4E5MA 2ZGVA 2OP1A 3K0SA 5K3CA 2QJWA 4PXSA 3V1UA 3VSDA 1Z0JA 1MQAA 1T5IA 3K2EA 4AO8A 4X95A 1GY8A 3QWBA 4TLDA 4UEOA 4YDRA 4D6XA 4J0CA 1UBEA 2A5FA 2F00A 1HOTA 1VG9B 3D3EA 2HYIC 2V6MA 4ZGGA 1Z12A 1VHDA 2X2FA 2Y1FA 4IRUB 4R8VA 5CJ2A 1PDOA 4TXLA 3OQOA 1XQ1A 2C7GA 5ALYA 4YCAA 2BGKA 4MW1A 4G8BA 4ID3A 1S2DA 5FI0B 2GN2A 4B7AA 3VGJA 4IS2A 3N07A 4MI6A 2XBMA 1B0AA 1F4VA 4H6VA 4DV5B 2XRYA 2AC7A 4TRRA 5IP5A 2H6EA 1LZLA 2IHYA 2AH5A 1SKMA 4F6CA 4EUFA 1SU7A 1A9XB 2YASA 4HPJB 4RIHA 1LSOA 2Q7XA 2DMRA 2XMSA 1MIHA 2JVIA 5C1IA 3TPFA 3ZTTA 2CXRA 4DQDA 2RGRA 1NVBA 1VMAA 5HE9A 3P5BA 2BFPA 3KOZA 2DE0X 3FUCA 4NC9A 4PXYA 2JIRA 1TMOA 3DL7A 1U2DC 3ESRA 1P2TA 1IOZA 1L8LA 4MRSA 2X6TA 1UBSB 1FUYB 3S2ZA 3T5BA 5C7LO 2HMUA 2AZXA 5KYYB 3SIPA 3P97A 2NZ2A 4K9KA 2FN9A 2YVKA 4KZPA 1YBFA 2FHSA 3TW8A 2PA3A 2QMUA 1A4RA 2VF4X 4EA6A 5MFPA 4FILA 3GNSA 4QAQA 1Q6YA 1K63A 5JXWA 1J0XO 1J9ZA 2V3VA 4MV0A 3LBNA 4Z3OA 4YQYA 2Q5CA 1PDVA 4PO8A 3ONDA 4BLSA 2EG9A 3MD9A 1K6JA 1R4NA 3D8NA 3I1JA 3ZWVA 1PT9A 3OQBA 2OQIA 2V6GA 2C2KA 5LQDA 1VCOA 1AKVA 3DH0A 3G1WA 4GI2A 4W5QA 1X7XA 4Q37A 4LC1A 4F11A 5KJFA 3LPMA 1XTBA 1Z83A 2WWVD 3ME5A 5KO2A 5H81A 5CX4A 3VSBA 1ST2A 2C5LA 1TLFA 1V8OA 2BHNA 3A3KA 2R8OA 2Y0CA 3GAAA 3IMEA 3LKDA 1E1CB 2AFIB 4X7RA 4B7ZA 5F7ZA 4YWJA 3DJFA 3VPXA 4I6EA 2O0LA 3CUEF 3QY0A 3CUWA 1E1NA 3IMGA 3PD7A 4LNUA 4RF5A 1X3LA 1V9LA 4IZOA 5T41A 2AT1A 3A06A 3F90A 2Q3FA 3TQQA 5DYYA 1RC0A 2K2QB 4F9EA 5D1HA 1T3LA 1SEPA 3M4XA 1VE9A 2IK8A 4QXAA 5DF1A 3Q5DA 4BQEA 2FSSA 4JC5A 4MLPA 4AJJA 3CNBA 3H1BA 1SCIA 1ULTA 1YZVA 3PZRA 4KWCA 3R4VA 1G2QA 4XX0B 2VDKB 1KVUA 3ND8A 5AHWA 3KB6A 3CLRC 2XNCA 3EH2A 3KV3O 5TMBA 1W59A 3OM1A 2JGLA 3WIEA 1WLYA 3HB7A 4YBRA 3I2KA 4GBED 1XALA 3SVTA 4B3MB 1GNTA 1J09A 2BFOA 4M9QA 1KYYA 3UWDA 2GN4A 4MQFB 3U44B 2V3WA 4KIJA 4UM9B 5HTOA 3KUXA 3SR4A 1K5DA 3B5IA 4QUEA 1SO8A 3EK2A 5AW6A 5H7XA 2O0KA 3SHQA 2O14A 4M9ZA 4COOA 5K4AA 3INYA 5KCMA 2OPHA 4CMHA 1FDUA 4D92A 4YRMA 5JSQA 3I6IA 4W5NA 4IPTA 1Z2PX 5CT8A 3SEQA 4X94A 2Y93A 2IPOA 1Z73A 2QLTA 5EHQA 4LHWA 3WYNA 5HSGA 2HDNB 4R9SA 1YVPA 3QTBA 1Z8FA 3A6GA 3DOFA 4JSYA 2V4UA 3ZBQA 2PSJA 4R71A 4Z0HO 2AEJA 1ZUHA 3MTGA 3Q88A 5L3QB 2XRZA 2Z5LA 2ZQ5A 4YT8A 3M89A 4ZAWA 2FWNA 3EY9A 2O3QA 4QU9A 4AK9A 1MVOA 2PUWA 1J90A 1YUNA 3AYZB 3QLJA 4NVRA 5A5FA 3EZFA 1JI0A 2CZCA 2G72A 4RMHA 2UUBB 4S1VA 4BEWA 1FFCA 3HJAA 3HUEA 1A9XA 2EFDB 3IOMA 2KX7A 4PO9A 2A7QA 1D2EA 1TCAA 3WL8A 4Y1RB 1NVTA 2FSVC 3ROTA 4V0RA 1AKUA 1E18A 3INGA 1Y6JA 3HCFA 1O54A 2D5LA 3ZHTA 2OESA 3A6HA 4N6NA 5FCDA 1MFZA 4LJLA 1OWMA 4C88A 4DY6A 4BFWA 2XCSB 3KZ1E 1VLMA 3W8NA 5JCJD 4DLPA 4IGAA 1QYVA 1ZK2A 2EKPA 2WMNB 3K5IA 5F3RA 3SCZA 5GONF 1T9HA 2QX9A 4OSEA 1V2GA 5DBIA 4HT3B 1N78A 2HF8A 1OVGA 2HDHA 3OCVA 4FD3A 4L5JA 1KEEA 2IPMA 4WXEA 4HDQB 1A9RA 3F7MA 1IOLA 1KQ3A 3AP1A 1FVHA 1Z62A 1SK9A 1CC1S 3AFGA 4CKZA 3DP9A 5I8ZA 1EMDA 2AC2A 3K0CC 3PV0A 2IE8A 4ZJPA 4XPIB 3TNFA 1YTLA 3ICQB 3WDMA 1JSLA 3T3OA 3FLMA 3VDXA 1LKZA 1IG0A 1MVNA 3KZKA 4GM1A 4TLCA 5CLIA 5I7VA 5TMPA 4DMUB 4HSGA 1YB1A 2REQB 4O02B 3QXSA 1E1CA 2AFIA 4NK4A 2GO7A 1HDXA 2GBLA 3EF0A 4DQXA 5HKKD 5L7YA 1YJXA 3DO6A 5B3KA 3SIRA 3QSYA 4FSDA 4LTDA 2Z95A 3VV2A 3UV7A 3JQ8B 8ADHA 1MQSA 5JNLA 3JQ9A 1I51A 2YDXA 4TYMA 1PUIA 3EPPA 3JQAD 5E6UA 2P67A 1COWD 3IYLW 1XCBA 3FTQA 3VOAA 3QVOA 4MPTA 3WRXC 3PEFA 4FNMA 3ZK7A 3N28A 2RGCA 5B3JA 2VA8A 4G0XA 3EDQA 4ZAYA 3V7NA 4A0FA 4F2WA 4MW5A 5JXIA 2ZJFA 3LX4A 1P0MA 4XX0A 1U9IC 2HZBA 2JI9A 2JJYA 2VHQA 4JB0A 4AP6A 4KR6A 1LPOA 3BH0A 3AZPA 1J23A 3L7BA 4JUAA 2WF9A 4IMIB 3EFBA 3H2HA 4R84A 4LDQA 4NF2A 4KQKA 1JWBB 4MQFA 3CUSA 4FONA 4DMFA 1CLEA 3UGJA 3RYFA 2Q6TA 4EX6A 2X13A 3ZC3A 2EKBA 2GMWA 1GTG1 1LLUA 2IIVA 1B0ZA 2ZSHA 5E4YA 3B36A 4TSRA 5EFZA 1YL5A 2PDAA 5CUQA 4UNSA 3K2IA 3H42B 4HP8A 2X0DA 5A62A 1JHMA 3RABA 3OJFA 4DJ5X 5JAIA 4DUPA 3G8DA 4KO8A 4NV3A 4MDHA 3KQHA 1CU1A 1ODLA 1Q11A 1VGQA 5J2TA 2AV6A 1UKBA 4ZO6A 2HMYB 5IAJA 4BQFA 1V8FA 2GZRA 4X8LA 5BWOA 4Z49A 5L3QA 4TVBA 5KVSA 5JU6A 1KGSA 2PUJA 4QUDA 1RCUA 2WIBA 1CB0A 2C4WA 5EJ5A 2JCSA 2OMEA 4G37A 1ADYA 2QVLA 2H1HA 3DYVA 4AYWA 2HIGA 1KMIY 3AB8A 1GGFA 2Q4TA 2PGOA 2ON6A 1NVFA 1Q0QA 3SYLA 4QPNA 5AM2A 1E2IA 2OTCA 3X1WA 5B4TA 5E6SA 4AS1A 1CRZA 1QIFA 3DF9A