4LKRA

Crystal structure of deod-3 gene product from shewanella oneidensis mr-1, nysgrc target 029437
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
233
structure length
233
Chain Sequence
TAHINAQPTDFAETVIMPGDPLRAKYIAETYLTDAVEVTNVRNMLGYTGYYQGQRISVMGHGMGISSMVLYGHELINFFGVKRIIRIGSLGATQQHVEMRDVILAQAAGTDSPTNAKRSSGYHMATSATFSLLHKAYTKANEKGISVKVGNVFSGDLYYDPDEDMIPALERFGVLGIDMEVAGLYGLAHQQGIESLAILTVSDHCLTGEETTAQERQLSFNNMIELALETALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase DeoD-type
publication title Crystal structure of deoD-3 gene product from Shewanella oneidensis MR-1, NYSGRC target 029437
rcsb
source organism Shewanella oneidensis
molecule tags Transferase
total genus 73
structure length 233
sequence length 233
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2013-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lkrA00
1JYSA 3FB1A 3FWPA 4JOSA 4L5YA 2H8GA 4TTAA 1Z33A 1ULAA 1U1EA 1PF7E 1PBNA 4MCHA 1SJ9A 1Y1QA 1OTYA 1TCVA 2QTGA 4WKPA 2QDKA 4M1EA 2IQ5A 1A9TA 4F3CA 1Z35A 3GGSA 1RXSA 3T94A 5F77A 5EPUA 3OZCA 4DA7A 1SD1A 3K8QA 3NM5A 4LZWA 4OGLA 1JE1A 4G8JA 3TL6A 4LNAA 1YR3A 1Z34A 3KU4A 1A69A 4JWTA 3O4VA 1TGYA 3DP9A 1PW7A 1PR4A 4DARA 4QEZA 3KHSA 1Z38A 1OVGA 2AI2A 4F3KA 2ISCA 1SQ6A 4TXNA 3MMSA 5DK6A 4BMYA 1Y6QA 5KB3A 2XRFA 1JP7A 2PGAA 3EMVA 4NSNA 1Z5OA 3UAVA 4BMZA 3U40A 2OC4A 2AI1A 1RCTE 5CYGA 1QE5A 4NS1A 5K1ZA 1V3QE 1A9RA 5FAKA 2P4SA 4TXMA 4WKOA 4D98A 1A9SA 3BSFA 3LBAA 4QASA 1ECPA 1ODKA 4H1TA 5F7XA 3NBQA 5IU6A 1PWYE 1YQQA 3BJEA 1ODJA 1U1DA 1RSZA 4X24A 2OECA 5IFKA 1ODLA 5EFOA 1A9QA 3K8OE 3OF3A 4L5AA 1Y1TA 3EUFA 3MB8A 3UAXA 1PR0A 4TS3A 4GLFA 3F8WA 5B7NA 1NW4A 2A8YA 1TGVA 3DPSA 1C3XA 4GMHA 4DA0A 5CXQA 2A0XA 3INYA 1K3FA 5ETJA 3NM4A 3PNPA 4EB8A 5CCDA 4GKAA 1JPVA 1T8SA 3BL6A 2HN9A 1JDVA 1V4NA 2HRDA 3FNQA 1ULBA 1SD2A 4TTJA 5F7ZA 4L0MA 3SCZA 3PHBE 1RFGE 1CG6A 3ENZA 3ODGA 4YNBA 1VMKA 4G89A 2OC9A 1LV8A 3OZEA 4MARA 2HSWA 2A0WA 1Z36A 1G2OA 5F7JA 1U1FA 3ONVA 1NC1A 2RJ3A 3IEXA 1FXUA 4U2KA 4TXHA 4OY3A 1T8YA 1V45E 3EEIA 1PR1A 1JE0A 3GB9A 3PHCA 3BGSA 3O6VA 5I3CA 3IOMA 3OZBA 1RXCA 3KVYA 5C80A 1LVUA 1ZOSA 4OGKA 4LKRA 1Z5NA 1CB0A 1PK9A 3P0FA 1Y1RA 4OF4A 3FOWA 3KUKA 3NM6B 3LGSA 1U1CA 1V48A 2QTTA 3FAZA 1RYZA 5F73A 1YRYE 5CXSA 2I8AA 5CYFA 3KVRA 4KN5A 3E9ZA 4DAOA 4DAEA 4WKNA 4MCIA 2OXFA 2GUWA 3QPBA 2B94A 1B8NA 4DABA 2QSUA 4GLJA 4IP0A 5JPCA 4BMXA 4TTIA 2AC7A 1PR2A 1Y6RA 4JP5A 4G41A 1JDSA 1VFNA 2QPLA 1V41E 3DJFA 3EUEA 4M3NA 4RJ2A 3P0EA 4YO8A 2AI3A 3KVVA 1U1GA 2I4TA 1Y1SA 1YBFA 1RR6A 4E1VA 4BN0A 5B7PA 1Z39A 3PNSA 1JDTA 4FFSA 1K9SA 1VHWA 4K6OA 5F78A 1YQUA 3OCCA 1RT9A 1I80A 4D8YA 4YMLA 4I2VA 1K27A 1ZL2A 4P54A 1OU4A 1N3IA 1T8WA 1VHJA 1NC3A 4PNPA 4M7WA 4DA6A 1A9OA 3C74A 4F2PA 4TXLA 4D9HA 4ECEA 1T0UA 5F7OA 4QAQA 3D1VA 4QATA 3OOHA 2Q7OE 1PR5A 1Z37A 1OV6A 1WTAA 2BSXA 4WKCA 5EUBA 3E9RA 3FUCA 5B7QA 1PKEA 1T8RA 5B7GA 1B8OA 1PR6A 1LX7A 4YJKA 1Q1GA 3OOEA 1JDZA 5CCEA 4L5CA 4R2XA 1TCUA 1RXUA 4D8XA 1TD1A 3UT6A 2ON6A 4TXJA 4F1WA 4PR3A 3UAWA 3OZDA 4UC0A 1RXYA 1V2HE 4OJTA 2A0YA 3UAZA 1JDUA 4D8VA 1OTXA 4NY1A 3DDOA 3OPVA 1M73E 5F76A 1XE3A 4R2WA 4DANA 3E0QA 4WKBA 2HWUA 4DA8A 4F2WA 4QFBA 1A9PA 4OEHA 4LNHA 1PK7A 1Z5PA 4QARA 3LA8A 1ODIA 4LDNA 4TS9A 3DF9A 1OUMA 4EARA 4R31A 3UAYA 4TYMA 4L6IA
chains in the Genus database with same CATH superfamily
2FFRA 1H8ED 3COPA 4KGDA 1MVOA 3T7CA 3WLIA 3PGA1 4WESA 4BOYA 2HLDA 4PPNA 1O9HA 4EKNB 4OM7A 2LTAA 4RGQA 3U56A 3HPRA 1NP3A 2R84A 4WT7A 1KNXA 3A14A 4DMFA 2BKUA 2GXUA 2PQ6A 1N9ZA 4IXNA 3TAUA 3VR3A 5KWIA 2H8GA 4ND8A 5BW5A 4WNCA 4HDNA 2IH5A 2QTWB 1MBZA 5EINA 2JPDA 4AJLA 3O8NA 2H1SA 4BZZA 1YAHA 4UM9B 2FN4A 1PS9A 3BHMA 4I4NA 2ZIXB 3SLGA 4FVTA 3VBCA 4BAUA 2QTGA 2BFWA 1GNQA 4BATA 2H2WA 4ON9A 1GZ6A 5J43A 3HRIA 4EVQA 3PQEA 3F6SA 1D4AA 3H1EA 4CCAA 2H6EA 5AOBA 2MSCB 4DCNA 3KV3O 5KYGA 2C5LA 2VNKA 3LO8A 1D0SA 1ZIPA 1ADBA 3HYCA 3OZCA 4G0NA 3T3HA 3GBVA 4I14A 3RSQA 3ZNOA 4B40A 3H6GA 3DYVA 2V5AA 1A5SB 1TAHA 4Y18A 4G8JA 4EBFA 4R8SA 1FBTA 4EY8A 5AW7A 4B7CA 1KKMA 1OI4A 5DCLA 5JEEA 3MTBA 4JSTA 1DBRA 4ZK2A 4G0WA 4OX9B 4GNKA 1FB5A 2JKZA 1B2LA 4RV4A 4E31A 1KQ3A 3AVPA 5C35A 4ISBA 2FSHA 3WB2A 1AXGA 1IUPA 1T0HB 3DZIA 4TMFA 3O4VA 1QK3A 1TGYA 3G5TA 4JGIA 2QRGA 1C7JA 4K8OA 5REQA 3CJTA 3QW2A 4K6GA 4NQRA 1Q7GA 1Z2DA 4OHXA 3O93A 3INRA 3HC7A 2NGRA 2GX6A 4X1IB 3DZFA 3PXCX 1Z4NA 4QEZA 3LCVB 3QE0A 1DPFA 3GLTA 4YT8A 3OIDA 4BJ6A 4DIOA 3BJMA 1AQLA 2P1DA 4NFHA 2QVBA 4PU0A 2NACA 1W2GA 2Y0DA 1WB6A 2MINA 3TAHA 1ISHA 4L5IA 3THYA 1Y6QA 2VH5R 3JQ7A 1RRKA 1V1MA 4IIVA 4Y9SA 4RE6A 4IIJA 2HNBA 2RONA 3MS2A 4JBHA 2H5JA 4DDMA 3OQBA 5AQ1A 1EXVA 2IHJA 4MVJH 1NSFA 4OI1A 3L7NA 5HTOA 4WESB 2YRXA 4MZXA 4AJKA 5K0FA 1AUXA 2FMXA 3TEFA 4EY5A 3VAZA 1QKIA 4QT0A 1S1CA 3ZXYA 4KYVA 2VLBA 5K2OA 1TM1E 4BKQA 4F38A 2GAOA 2RHRA 2W98A 4LPSA 1QE5A 5JSUA 3A6JA 2X0KA 4U39A 3CN7A 3NEPX 3ETEA 5TT1A 2O50A 4DB2A 4KW7A 3UWPA 1M0EA 2WV7A 1MLDA 1ADGA 2HMSA 1TEXA 1W75A 4ZKDA 3TFOA 1Y9DA 3L5KA 2YN2A 5JSHA 5JVDA 3OQHA 3TDMA 4EG1A 4LNUA 3W6UA 4R1TA 2VP0A 4XXHA 4BDSA 5EMJA 2XIJA 1OGIA 4G5OA 3N6XA 5AYVA 3EVTA 1WZEA 2XY4A 2FRDC 3RU7A 3NHKA 4DR6B 1OXXK 4M49A 1YS2X 2I2XB 5FBRB 1EG2A 1O89A 2Q0SA 2W6NA 1BX0A 3M83A 4JZYA 5JZ9A 1GCUA 4JJAA 2ZYHA 3RS3A 5BSFA 2WVJA 4WZ6A 1W87A 4MRVA 3D2BA 1J2YA 2IDMA 2ZREA 3C6BA 4L02A 4R68A 2YC2C 2CSXA 4B0OA 4YP5A 1KJYA 2GNOA 2Z2KA 4I46A 3TLZA 1QPZA 4DBVO 1AZWA 2XR1A 5REQB 2ZI4A 1NMYA 4YUXA 3VR5A 5A1TA 4PXSA 4D3YA 3A11A 4UNQA 1N77A 3GH1A 4F4IA 2H1RA 5I45A 2KLBA 1X87A 3TBFA 3QVKA 4ZI5A 1UBHS 3LDFA 4RK0A 1DBPA 1Y4ZA 4IRMA 5JBQA 3LXRA 1ZN8A 4W5OA 2NP6A 2YMQA 1TGVA 4QQKA 2JFHA 2H4XA 1WBJB 2YQ4A 3OZUA 3AZPA 4PCLA 5DNUA 2XZOA 2MINB 4IWXA 1Y33E 4NLLA 1BH2A 4HH0A 3FTDA 3THYB 1WP4A 2P9BA 3JQ7B 1YIAA 1V1MB 4I66A 1DC4A 4LUCA 3MCAA 1DHTA 2XCUA 1C9DB 2GZ3A 4JROA 3GRVA 1QYCA 4XUDA 2BV3A 2C3YA 3H5NA 2GM3A 5IT9A 4AS1A 3JW8A 5CCDA 3AX6A 1P1IA 2VHQA 2XMRA 3KEMA 1SURA 1T8SA 3FNBA 4R3UC 3O7MA 3RDPA 5JHHB 1E5DA 3HBNA 1SUPA 1U63A 3V7WA 2HO4A 3D4LA 2ADOA 4Z4QA 2P6UA 1FYEA 4J0IA 5LB4A 4UEJA 5F7ZA 1UZMA 2FSUA 5AJHA 3UNXA 1ZXBA 1G9SA 1RAIA 1YQXA 1CB7A 4PHCA 4JP2A 4WMLA 2ZM5A 4B3HA 3IVCA 2JZOA 2YZGA 3BCHA 4N9QA 3KFXA 2J0SA 2AJBA 1A8IA 1QO0A 1SOVA 1WXEA 2RGEA 2WWFA 3CEAA 3E7WA 4K6HA 4LHYA 2PMDA 4LNUB 4UHBA 3T95A 2VJDA 1Y9JA 3LQ4A 4KHPB 4KXLA 3WICA 3NWOA 1TK2A 5A71A 3WWCA 3NVMB 3LFHA 3K1ZA 1R5OA 2XODA 3DFUA 4K40A 4A2CA 4D43A 2XGJA 1G2OA 1GGNA 1Q1BA 1SC3A 2PA3A 5HFNA 5IMSA 3PC7A 2IIQA 2FVYA 3MWKA 2ZANA 2VDUE 1V4VA 5COQA 4FZRA 2RJ3A 2D00A 3HCRA 1O87A 2V1XA 4BC1A 5IEJA 3UJNA 2ASEA 1O6CA 1WE2A 2FUEA 3T3DA 3N07A 5TPWA 9ABPA 1RKBA 1M7GA 3M70A 5JJ5A 1H2XA 2A9QA 2NXNA 2VPZA 2ZYUX 3DKRA 1DSSG 2BTOA 4R6WA 5DNEA 1RC0A 3GN2A 2FOLA 2Y77A 4FGWA 3V2GA 2B6NA 4OI2A 3E1SA 4H60A 1ZLXA 2A30A 4LECA 3V6LA 4HFNA 5DX1A 2HGSA 1ML3A 1V11A 3IBTA 1CUJA 1W44A 1Y1PA 5DM60 1NBIA 1N6LA 3CCFA 3GR6A 4MWEA 3S2YA 4IUCS 5F9FA 2I2BA 1M66A 3VDQA 3EZ9A 1T25A 1U2SA 2XCSB 2FSSA 2P9TA 1N4DA 1ENOA 1DU4A 4Z8XA 2PCJA 3KVYA 4HRVA 1KJWA 3PUXA 1H5QA 5HF6A 3TZLA 4ATNA 1HT1E 2CMHA 1MN6A 1HT2E 4BNGA 5LIPA 3FVQA 3REFA 1ZUWA 3WISA 1PUJA 2DKOA 2JBAA 3QWFA 1FW6A 2FW6A 1C8LA 1XHFA 4U8HA 1X92A 4LKRA 1R6XA 5CDHA 3IQGX 1CB0A 3U3JA 2YV4A 3PYMA 2FQWA 1W30A 5KQMA 1RWMA 3MMPA 4LMBA 4RV5A 3Q9NA 3H8SA 2QDXA 3KPUA 3KWLA 1H2RS 3QVGA 4AYXA 3AUUA 4S1TA 3N2YA 3HR8A 3WYNA 1GDTA 2X4GA 5EZSA 5BVGA 1N1MA 2V54A 2JLWA 2YASA 4TL6A 3ICQB 4KJXA 1W0CA 2H08A 3T1YB 1QJCA 2FPRA 3DZHA 3WWDA 4L27A 1W47A 4G37A 3FCXA 3UV3A 5CJPA 2B69A 4WAUA 3VDMA 4BX3A 4ZT6A 3E9EA 2H07A 1HSOA 3SVLA 2WPNA 5IVKA 1SWWA 1IOLA 4J43A 4WL0A 3VBEA 2IPOA 2EFJA 2VFAA 5K4GA 3KJGA 4YREA 3OY2A 4L7QA 2OHHA 3UMJA 1BQEA 4K9NA 4K28A 4LGYA 3GT4A 2R6R1 4PVDA 5AKHA 2D1SA 2BVNA 2HJWA 4KYUA 1YVEI 4NTZA 2PNJA 1RWBA 4P81A 4XB1A 5ANRB 3QE4A 1C1HA 3KQSA 1ML4A 3AV3A 1KAQA 2HU7A 5TPWB 1E2IA 3DW3X 3IP1A 2QAGC 4O5AA 2O8BA 5KX5A 1N6KA 3DLTA 3L8HA 4GSKA 3AINA 1T6NA 4JP5A 2HBRA 4TS4A 1T26A 5EESA 1J2EA 3FBGA 1VJ1A 1SO8A 1EFPA 4WV3A 2YIVX 4Y6QA 5JAMA 1V11B 3CX8A 1G0NA 1NBME 2ZVQX 3FGNA 3PA8A 4KYTA 4HC4A 3M3HA 3E48A 3NJRA 1XMQB 1R0RE 4ZAWA 3T54A 1ZGGA 3ECCA 4P98A 2OHJA 2RGNA 5HZHA 3EQ6A 1SHUX 2AI3A 1Q0PA 2X6QA 1P44A 2ZT5A 1ZUNA 4YRZA 4FNAA 4FFMA 4OHCA 1FLAA 4PO1A 2JFFA 1IZ0A 2Q3CA 3TQSA 3KTAA 2X2FA 3S2EA 4HYYA 1P5JA 4J1SA 3LDAA 5ERGB 2JBAB 3ELBA 5EIFA 1EAMA 1AQNA 5E8RA 3AB7A 1ZXLA 1QFZA 4MYDA 4YP1A 4LDQA 1TW3A 2C2ZA 5IC6A 1W34A 4ERXA 3Q9UA 4XDZA 3D0RA 3K8ZA 3UIEA 1SZDA 1AZTA 2ZW9A 3DXFA 4C7VA 1T9KA 5BSVA 2UUBB 3F8TA 1YQUA 3HCPA 1S8OA 3TSAA 2XUFA 2GCPA 3WAJA 3QVGB 2JLZA 2V7EA 3WTCA 5CLFA 2XOXA 3CVYA 2ZCJA 5KOYA 2Q29A 1E3SA 1DMRA 1G5TA 2I66A 4FFOA 4MUGA 3S29A 1TTTA 2XXAA 4F9FA 2AD5A 5BVGB 3CG4A 1J5EB 4A10A 1VC2A 5IVDA 1P1FA 3RI3A 2E4UA 4OGGA 2WQZA 2ZBUA 5JXJA 2BTEA 1TEVA 2W6MA 1EE2A 4P54A 3JYOA 3I6BA 3ML1A 4Z6KA 5J4LA 1RXVA 2VAVA 5EHIA 4X7BA 3O1HB 3ZCSA 3ASYA 4JR1A 1RIFA 1UEJA 3PQ4A 3R0JA 1JG7A 3GG2A 3R7AA 2X5JO 1E58A 1YZLA 4FFRA 4OQXA 1ZD8A 2UDPA 3Q9LA 4OPMA 2BR5A 5KCMA 4JV5B 2GVDC 4HQRA 1SIWA 1WETA 2GCGA 3OZXA 3AR9A 3OF2A 4LVOA 1ZCAA 4DC1A 1AUVA 5JATA 2QL7A 1ECCA 2VJKA 1RWKA 4AX4A 1ZU4A 1T0UA 3H4TA 5K3AA 5T4HA 3T1QA 1JHMA 1W29A 1XVVA 1GFZA 3OCZA 2IFTA 1NF3A 3Q1KA 4A26A 2G1PA 2IYSA 5KIAA 3FTFA 2O8BB 3D1VA 5KX5B 5IN4A 4A0QA 4HDKA 1L7VC 2HPAA 1L5RA 2I55A 3AG5A 3MRTA 5TQ2A 2O2CA 4N76A 1EFPB 1CJUC 2Z2YA 3RARA 5JCJA 4BN4A 2P90A 5KYKA 4PZLA 2K7ZA 2FWPA 2JFNA 3LP6A 1WTAA 4M1MA 4YQYA 3VQTA 2EKZA 2GRUA 3WNCA 2XYRA 3DVAA 2HHHB 3SP1A 1DLIA 3C3MA 1AE1A 4ONEA 4ALLA 3K71B 3WNZA 2QD5A 3FCYA 3EWNA 4XWTA 5B7QA 2IH2A 3QPAA 2IYLD 5IFLA 1YDHA 2QTRA 1L7EA 2UUPA 4S12A 5JCOA 3EA0A 2P27A 4AP5A 2Z5LA 1MKYA 3OT5A 3FZNA 10MHA 4JU8A 4R2MA 2PV0A 2VTBA 3KTAB 4FGKA 4UNSA 5B7GA 1EYZA 5K8CA 2GJ9A 5FOTA 5AFSA 4AECA 2C4VA 1B8UA 3W7BA 1BCSA 4UREA 3PL1A 3ZDRA 3BN3A 1UIRA 1K6EA 2PMFA 4PQEA 1F0KA 3NGMA 4FR2A 5CCEA 1FDIA 3VH2A 1PHPA 1VOTA 4H08A 1P73A 4AK9A 3NTVA 2D1TA 2Y76A 4ALJA 5HQTA 2HWWA 1O5OA 4IRXA 4RFSA 2JKYA 5A7HA 3MN1A 1NJ5A 2JHFA 2TMYA 4NCXA 4XRRA 4KOEC 2HMUA 2X13A 4PAMA 5AIAA 4Q03A 1DG9A 4PR3A 3MJRA 3H6HA 3WGMA 3G13A 2A3RA 1GZ7A 1QK4A 4P58A 4FP9A 4QWMA 4UHFA 2Z8YA 4QODA 3EYAA 1NUQA 5EE1A 3WLEA 3AM5A 1S5PA 1OTXA 2J09A 4R2KA 2ANCA 4AYTA 1SUAA 2RGWA 5FL3A 3WIOA 4ZHQA 1WPRA 3F6EX 5CDGA 3WC4A 5IXSA 4LJKA 4TKZA 3BD7A 3V32A 4LVNA 1AUQA 1ESEA 1K9VF 1DC7A 1PL6A 3EQZA 4HQ6A 4OYYA 2O54A 4TM8A 4S0XA 3O31A 5EMNA 4G84A 1BHSA 1KOJA 2W6OA 4N8SA 3SBOA 3BMOA 4B6JA 3T7DA 4H59A 1TO2E 5BMVA 1A3CA 4BECA 2R5FA 4UFOA 4YRJA 3U4DA 2BBSA 5DU2A 4HDKB 3NAGA 1PR3A 1ZI6A 1I6MA 1PL7A 2PU7A 2VXYA 3I83A 4UZFA 5TQ2B 1XNJA 2VWPA 4B8YA 1Z6YA 4OBEA 4Y6RA 2VXOA 1QH0A 2BDUA 2G4LA 1P91A 3FE2A 3FVRA 4HR7A 4FHGA 4LQCA 4UU0A 2BGKA 4JYCA 4ZJYA 3E4CA 4EENA 1UAGA 1I33A 3L82B 1XZNA 1ZHFA 4EHKA 2I1VB 5EHZA 5CFNA 1LC3A 5IT5A 5KBYA 1V43A 1ONSA 3E84A 1IHDA 1V35A 2D7JA 3COJA 2AWNA 3O3MB 4TMZA 3RSOA 3NV7A 4AG3A 2JEOA 3AF6A 1LPNA 4DLRA 2VTBB 2XWSA 4URXR 4AJ2A 3P0JA 3KDPA 2YL2A 5A0FA 2BTQA 3R3YA 2GF2A 3B70A 3DCYA 1L5YA 5CEFA 1BDIA 1WB9A 2O5EA 3WYCA 2XMBA 3O8RA 2X14A 1BCSB 3QXJA 3LECA 4MJLA 2JKVA 1KSJA 1SC9A 2YJGA 4QBIA 3U4QA 1C7EA 3AKEA 1UBTS 5B53A 1Z6PA 3W1VA 4NBVA 4Z49A 1YS4A 2Q9AA 2XV1A 3I3SR 4OXKA 1Y1QA 4YQEA 5K03A 3I1YA 2I67A 1NV9A 4FCTA 3U31A 1FRVA 1A27A 1KZHA 1TCVA 2KB0A 4RFSB 4ZV9A 4PGMA 2RKBA 2FKNA 1JU9A 3NATA 1QHFA 3L9XA 1ZZEA 1NI5A 1ZRNA 2M2IA 2WVAA 5KTYA 3A3PA 4HAVA 4LX8A 1Y8CA 4Q82A 2IYTA 3UJCA 2B9EA 3IEPA 2QXTA 2NZJA 3NMUF 1KEEA 2PX8A 4M98A 2GETA 5A4JA 3DAYA 1MT3A 2WOJA 4OB8A 1QZTA 3PFIA 1N9GA 1YJXA 5CCXA 3FDXA 4FMDB 4N5MA 4WBSA 1JL3A 2XECA 3FRIA 4JUBA 4D9JA 4YMHA 4J91A 5CT6A 3NHYA 4D0LB 5DBOA 1TKCA 3ZG6A 4NYMR 4PN7A 2IC5A 3HY4A 4MV5A 3GRRA 5IBCA 3PE3A 4PVCA 3VU9A 2J3EA 2HQOA 1PW7A 2F8LA 5BMVB 1Q7RA 3OPMA 4WXHA 1ZX1A 2RJOA 2BFOA 3UB4A 1V8FA 4ZMBA 2UZIR 4RGYA 4MKFA 3ROFA 1AH2A 2VYNA 4HB3A 5DMXA 2ZXFA 1JPNA 3KOWA 4LF6B 3ZDCA 4LZAA 4KQHA 5KKAA 2CNWA 3C3PA 4BFVA 2BGUA 1E0SA 3H5RA 4YECA 5BYAA 3AB3A 4WLNA 1XZFA 5KHLB 1KKLA 1OVGA 3VX4A 3I61A 3KQNA 4XJSA 3FPAA 4GH5A 4H1UA 2Q45A 2CBXA 3ZV4A 3HVKA 2QBYA 2I3GA 2EP5A 1EJ6A 2BIFA 4WIAA 1TJ3A 3NHBA 1JAZA 4OL9A 5B36A 5EGNA 1G1MA 3VPFA 1L4MA 4RK7A 1GTJ1 4LX0A 4EIWA 3AR4A 3OM8A 3UT5B 4M86A 2QVGA 4FJ0A 2BTQB 4R1LA 4U0KA 5KS2A 5C52B 4OMUA 1UJNA 1W581 1ZMXA 1NE7A 3DKPA 4AY5A 3HMQA 5IH7A 2HA3A 1NVTA 3FI9A 3BFVA 3T3EA 1ZIYA 3BBPA 3TZBA 4MUMA 4X9XA 4ZVLA 2G5PA 4XEHA 3EOBI 5K1ZA 4HNAA 3ZCUA 5DHSA 1W2HA 2I7VA 2V6IA 4N0DA 4RGBA 1NW5A 4RH3A 3T41A 3V1TC 5BXQC 3KJNA 1D4FA 1PE0A 3C6ZA 3MCUA 1XXHE 4NFSA 4YWHA 4R71A 3OAAA 2NT3A 4LC9A 4ALMA 1TB4A 2ZYGA 1HG0A 3TIFA 5JSFA 3QE9Y 5DNAA 3VYRB 3G9QA 1R27A 2AN1A 2PFKA 4OXIA 3B82A 4BEJA 1W48A 1Z4OA 2AN3A 2CNBA 5DX8A 3WKDA 5LP6C 4RZUA 3NBQA 5DGHA 3T3MB 1KEEB 1HT3A 3E3NA 3TVTA 3QHQA 4DV2B 1N9GB 4BN5A 1A4XA 5DIZA 2OAGA 3EMBA 2AUMA 1E66A 2ZU0C 3I9JA 2Z8ZA 4KIWA 5C7OO 1G59A 4JENA 1C41A 1LPPA 2GYUA 4GF5A 4XPIA 2O0KA 4HGOA 4MPJA 1TF5A 4LOAA 4CHTA 3P8ZA 4F9GA 2DWOA 4I1OA 3UPUA 3FMOB 4EJ6A 1E7MA 1PJ4A 1BWPA 1VE1A 1XD9A 2GI4A 3FCSB 3L79A 5FPHA 2F9MA 2ZSKA 1J5XA 2IHBA 4QTZA 5FHQA 2X5KO 5KOIA 4LY9A 1XZAA 1SQSA 3E9YA 1DEHA 3IT3A 1EDZA 3MWYW 3TCXB 3DTYA 2J59A 5LZ4A 5K20A 3UAXA 1N75A 3KPYA 2ZWPA 5FUYA 4V0KA 3OIWA 2G83A 1EK2A 2J3MA 1P1BA 2YS7A 3DCNA 3N0RA 4QHSA 4WXEA 4O59O 2I8LA 1UXJA 3UGJA 3IKJA 4JAVC 3SEZA 2XQVA 2ZRNA 2FR1A 4OQ4A 1XN4A 4JODA 1R8XA 5ERXA 5HPYB 3C87A 1VSQA 3TEJA 2R47A 1ZO8A 3HL4A 2QBYB 4E5MA 3A2NA 5JWHA 2GK6A 4XGQA 4ZAFA 4MZDA 2KJQA 1IY0A 2O0LA 2WU0A 1HQKA 2HQRA 1PFUA 2A0XA 3QWBA 4R7TA 3S0JA 4A27A 4OV6B 2DY0A 1WOMA 1G8KA 1K7YA 1ZN7A 4E08A 1X86B 4KXXA 2DHDA 3RRXA 4QGSA 2QZSA 3BG5A 4QXRA 3V8RA 4B71A 5HF8A 3ZX4A 1U0EA 2FXVA 1P31A 4IG4A 5MN4A 1S7CA 3W2GA 5C46F 1KAOA 1JPVA 1VLMA 3TQRA 1XDGA 2IY9A 2Z57A 3MTJA 4L95C 4OP1A 3MCTA 1U2QA 1FRQA 4ZU1X 3FY4A 5JEDA 7REQA 3DHEA 4MP3A 1LSOA 2ESRA 4HNAB 2HCRA 2JCBA 5HWSA 3ZEIA 3A9RA 3ZYCA 1O6GA 3RVQA 4OAQA 1LDNA 3E1KA 3TD2A 3TNFA 2VYVD 3ZPXA 1OROA 3EMDA 4O2AA 3CUWA 2QM8A 4TL7A 4DC0A 1GCIA 2QN2A 1KERA 1I1HA 5IBRA 4MCJA 3OF5A 1LBHA 2PT9A 4LBVA 4P08A 4DSUA 3DYBA 1RHJA 1CK4A 3KOYA 1A8HA 1LV8A 1X7HA 1L4EA 1PGOA 2DR3A 1UDAA 3FYSA 1A7AA 1KFBB 2YRWA 4HHEA 4J4BA 2QRKA 3EB9A 2P9GA 2DFTA 2JASA 4IHKA 1GPUA 2CLSA 4PNHA 2I1QA 2O7SA 3BL5A 1EXWA 4FLEA 4WCFA 4X41A 5I9SA 3SD7A 2DGDA 1MABA 3KQMA 1ZK3A 1USWA 2Z56A 3NHUA 1UWCA 1EWQA 2EG9A 4JSRA 4KQ9A 4MITA 4XR4A 5ADUS 4PC2A 4XPIB 2XB6A 4EUEA 5HW0A 4NP6A 2WK1A 2OLEA 5DYGA 2AV6A 1JNYA 1LWOA 4R8RA 3KKNA 4C5AA 4CT4B 1KRWA 1KP9A 1T8YA 1HTBA 3PGMA 4AMVA 1V45E 2NSYA 4MV0A 4NCJA 4WKGA 3ZXIA 1I4OA 1DWQA 1NKSA 2G76A 5CBPB 1V39A 4JQSA 4MRSA 1PZGA 3GB9A 3Q88A 4J2OA 3U60B 3DULA 2NO6A 2ACVA 3FFWA 3IP9A 5FXMA 5C31A 4P22A 2P62A 2HHCA 4ZP1A 3EZLA 4JLKA 4EATA 4FB5A 3HDTA 2G67A 3QXSA 2HA7A 1E1RD 4RTJA 1CR1A 1Z5ZA 2F48A 4RH1A 5CYOA 5H3CA 3LXMA 3IOMA 1P4GA 1JDBB 4HAZA 3ZWAA 4M9ZA 4CDRA 1U4SA 2NU7A 4OQLA 4HRYA 5LLDA 1QTRA 3H9CA 5BVHB 3AVUA 3MJHA 4QXQA 1KXJA 5TGZA 4XQCA 5T41A 2NZVG 4BEWA 1ZP6A 2GYVA 2E5LB 3QWIA 5TMBA 3U39A 2CFSA 1Q16A 4DLSA 5IXJA 3K5HA 3LTEA 4LSWA 5B6IA 2YN4A 3OQPA 5FLYA 1K89A 2G63A 2GN6A 4PFQA 4RZ3A 3VTKA 2ZE6A 3PRJA 3S27A 2CD7A 7REQB 1PQ4A 4O1IA 1RZ3A 1TM2A 1ZHHA 5BQXA 5JU6A 2AF3C 4X71A 3DR3A 2F4NA 3EZYA 4ZQCB 2Q5CA 1E1LA 3NC4A 3ER9A 1OVMA 3OTOB 1JFTA 1WZNA 5DKFA 3IIIA 4O2AB 4GYWA 1XPJA 4FUQA 3ZY6A 5CT9A 3ZX5A 2C0PA 1XCPA 1W94A 1Q91A 2Z9BA 1HNXB 2BFCA 4RSRA 2FPOA 4RD0A 3K35A 5F2KA 1Z2EA 3LF2A 1HPLA 3LBYA 3MC1A 1VJ5A 2JFWA 2PBFA 5AM2A 4WCFB 1J39A 1R0XA 2H1CA 1NLZA 1MABB 2WJIA 3QIAA 2A7QA 3DKKA 5IJ9A 4G5GA 3NHAA 1W0KA 2F1IA 1HSZA 2WVGA 3C8ZA 1P7CA 2PWPA 4E32A 2WWWA 2IE8A 3BREA 3KPVA 1MEJA 1EVJA 3KZNA 3WYAA 1PJQA 2HV9A 4OXYA 4BO4A 1CQPA 1QFJA 3KELA 4DZRA 1UK7A 4KK3A 4EHLA 1P4HA 1QVRA 1AQYA 4I9NA 3VU3A 4BP1A 5I4IA 3STVA 3HBLA 5LUBA 1U65A 1CJVC 1Z7EA 1YVDA 4M22A 4QUGA 3HVIA 1VP3A 4YXWD 1VFNA 3I6ZA 1DC8A 3KAQA 4EX6A 1V41E 3R4VA 2H9IA 4JYAB 4MKHA 3RRNA 4HNHA 2QE6A 4MB2A 5KNCD 3RYTC 5BR8B 3U0VA 1MPTA 2QP9X 3B5EA 4EPYA 1BNCA 4Q9JA 1SEVA 2ZAOA 1NGSA 2H29A 2UUOA 4HGYA 4OU4A 4F56A 5DGCA 2G6BA 1T34A 4Q9HA 1RQPA 2FRVA 3GCZA 4P35A 2FPUA 4HEHA 1X3SA 1THZA 2J9GA 3PKJA 4BN0A 3D81A 2NU7B 1OZHA 2XIQA 2YZMA 4E1VA 3CPSA 1GCGA 4UKDA 3C6QA 3RVBA 3ABRB 3N59A 1WVMA 4Q12A 4EABA 1V8BA 2AYYA 4MTLA 5GVRA 1JJIA 1OLUA 2ZAGA 2E1RA 4RTMA 1ZS9A 4ZDJA 5C8ZA 1TQ2A 3H8WA 3NRJA 4EK9A 1MP0A 2YY7A 4LSGA 3U61B 1XPRA 1YI8A 4P36A 3Q85A 3IBCA 4GAEA 3WBKA 4BY9E 4YMLA 4GMGA 2R5WA 5E3HA 4GO1A 1Z7BA 2V97A 3GDWA 3L6BA 4H15A 3VVCA 1WUKS 1JIXA 1ZGAA 2VEOA 5M29A 3TQFA 5IDXA 5IPFA 3W5VA 4XDYA 5DOVA 3I6IA 2WILA 4Z3KA 1UF9A 2G6TA 3HGQA 3WWYA 5CVUA 1OR8A 1PWEA 1BMQA 1XQWA 2QT9A 3SOPA 3ETHA 1IOWA 3HMKA 2NUPA 3DDNA 3MCWA 2BFCB 5B4VA 2CLHB 4Y1FA 3TGLA 4M7WA 1IOVA 2E87A 4J0KA 4EG6A 4RYLA 2VH1A 1E18A 1HFWA 3K4PA 1KC1A 1DOAA 2A92A 3GP3A 2NZXA 4N5DA 1RPNA 4CQLA 1Z6GA 2N42A 5C34B 1I14A 1W4RA 5IJ9B 2P2YA 2FZ5A 4UTXA 2FPKA 1IPHA 4BNMA 5JWOA 3CVUA 4LEIA 3EUAA 3L06A 5ALEA 1Q1EA 5BSMA 2ZB7A 2XDYA 3FZYA 1PX2A 3HU5A 3AFIA 4UVEA 3RKUA 3DA8A 3WHLA 2VZLA 2R1VA 3HKCA 4RPJA 1X1RA 3HRHA 2YVLA 4N39A 1PR5A 1LDBA 4TGLA 1G4UR 2JD0A 3ANLA 5DBGA 3ACCA 1YR2A 4UM8B 3C8UA 2BKLA 3WJ2A 3IB6A 2A4KA 1GPAA 1UPBA 3TTVA 4DMGA 1F8UA 4KODA 1B6RA 1XAJA 2W0MA 1OYWA 1Q20A 3QVXA 4HBZA 1F4VA 4ND5A 5E9JA 3QU2A 4YCNA 5K6AA 3GVCA 5EUBA 1WBDA 1QGAA 2VPYA 3B6IA 3HABA 5FJIA 2X19A 3F9IA 1GGVA 1PS8A 1TOAA 1Z4IA 2AOTA 2BWJA 4GOMD 2IPLA 3LQ2A 3D2CA 3MSCA 3OPXA 5JYCA 3GT7A 4KG7A 4EP1A 2PS0A 1Z6XA 1ZJYA 3M2TA 3WFJA 1OY1A 1ZITA 3NC0C 1UINA 3WK5A 5AUNB 3ZCVA 1U2EA 4GNRA 5B1SA 1QC5A 2ZI5A 3OE4A 4FW8A 4YJKA 3LRTA 5FBWB 2OV2A 3B20A 3OJEA 1OLOA 4J7XA 4D0SA 4X1YA 1SN7A 4M0LA 3WLMA 2M32A 4N5HX 5ITVA 1Z7GA 1X0XA 1ANKA 1YA4A 4MGZR 4E5YA 2CFIA 4N5IX 1C0PA 3NR2A 4A8JC 5AW2A 2X0DA 2RHOA 4KQ6A 3BHNA 1E4OA 1R88A 3U7QB 1PWZA 4DSZA 3QTTA 3WK7A 4FE7A 3UT6A 2YZ2A 3DEAA 4P0QB 1X0VA 1SXIA 5AVTA 1ZGHA 2QZJA 3NDIA 3TUZC 3DEIA 5F12A 1QLWA 5FWYA 1CVRA 1JLHA 2Q6KA 3GEBA 3H13A 4GHWA 5LN1A 1LJ8A 4E13A 3ICOA 5B3AA 4MQ4A 5MGBA 2QMHA 2XF8A 3D6MA 3EZXA 1GHTA 3JQAD 4PFJA 3V4FA 1EUDB 5BW8A 2NUPB 5JS6A 3FUUA 4YRKA 2HHJA 5DW3A 3VOAA 1JVSA 3I76A 3F74A 3DFKA 1VLJA 4HZGA 4JY7A 3TINA 3V80A 3FKJA 4O2BF 5F2EA 5JS8A 1DUVG 1RI2A 4LIPD 5HQJA 5DN6D 4MVJF 4CQLB 2NV6A 1IJFA 3G2PA 1N2HA 3OPVA 3TAXA 1SEPA 2H4YA 4ABYA 2OFPA 5I5GA 1XTVA 2D2XA 4L16A 4OOEA 1XE3A 1ZPDA 1OCEA 2B4QA 4X92A 5DW0A 3UHAA 2HPHA 1DI0A 3COWA 2OGUA 3DT8A 4G9GA 1QR6A 2R1VB 1LB1B 3BXXA 3BIJA 3HKCB 3JQBC 4BX0A 1CY0A 1JSRA 4FMCF 5HKKD 4NCHA 1H2FA 3IO3A 2WKWA 4MQMA 4QHTA 4Z3DA 1YB2A 1WU8A 2OHGA 2H2FA 3LM8A 2AEEA 1BJKA 3ONWA 2XMDA 1QYVA 2QW8A 2JAHA 3KXPA 1Q7CA 1WMBA 1ZSVA 1PJ3A 1KL7A 4KXYA 3TTUA 2WJPA 1GZDA 1AK9A 2HC9A 4QU9A 4TS9A 3QPCA 4LV5B 1KXZA 4HYEA 2WA1A 3CRNA 2I78A 4J03A 3OCYA 4PLHA 5ALZA 5EZ6B 1O0SA 3HCBA 4BLQA 5CB0A 2AOTB 1RLIA 3DVQX 3I1JA 4MROA 3KZXA 5LJIA 3EBPA 1WXIA 2EZUA 3TBHA 4PYNA 2JI7A 3CH7A 1NXXA 2JGIA 3K16A 4P31A 4PPYA 4EF6A 1NQTA 3IQWA 1X7YA 4PTLA 5JD6A 5TQVA 4HXFB 1QV6A 3FYUC 2P2DA 5KTPA 1GAXA 4I9FA 4QUKA 3VHRA 3IE1A 1N9KA 3EQ7A 3OETA 1UFOA 3MWGA 1H93A 1ESZA 1J8DA 4R1QA 4DCPA 3EGOA 3QBDA 1BJRE 5CDUA 2DHQA 3HKBB 4TV9F 1PNTA 3LPCA 5DP1A 4FXOA 5LXTF 1NQ5A 4FJ1A 5H83A 2EL7A 3IVMA 1GDDA 3Q1LA 3UN1A 2FWAA 1GSIA 1XG5A 5FWYB 3SGLA 3G2KA 1DG3A 3BWMA 4RJIA 4F5WA 2P67A 4DMKA 4JLMA 2EJVA 1O6FA 4IJ6A 3ZGNA 4X66B 3FAKA 3KYDA 4NBRA 4ENPA 4NZOA 4IDPA 4CTMA 5C1BA 3ZEAA 4L6AA 3K8QA 2D2FA 5JD3A 4BBPA 1PZMA 2B7BA 4F91B 2HW8A 3B6MA 3USCS 1PKXA 3KXIA 5TEVA 3KU4A 1CS4C 4DWWA 5IANA 2DSTA 1WABA 2MMCA 3A32A 3H2SA 3K0KA 2D0OB 4JHLA 4UM9D 4CM5A 5CUQA 4RLHA 5EHNA 2R4QA 5EXXA 3WGOA 4JI4B 4US2R 1KWKA 4PX3A 4XVQA 5I4KA 4HBGA 2AQKA 2NTVA 1XTIA 2WF9A 1T9BA 1C7RA 2BD0A 3FKQA 4AFNA 4QPDA 3AI7A 2IXAA 5JH7F 4RADA 4BO5A 4Q01A 3IRUA 2CGEA 1I5OA 2W93A 3DMFA 5BYJA 4PZEA 1EWKA 1SRRA 3EYWA 3JQQA 2HJ9A 2V7UA 2ZE8A 4HUTA 5C1OA 3X1KA 1ZBDA 4EDHA 2PH3A 3DAPA 3G0DA 4B85A 2AI2A 5CFOA 1PLJA 2B92A 2OXCA 2Q9UA 2IF2A 1B6SA 1VE9A 4IGIA 4N0MA 5E1MA 5FBLB 1ZH6A 4BMYA 2YXLA 3EY9A 4GXRA 4JDUA 2V96A 4R0VA 2I34A 1UJCA 2W6JD 2GPBA 3E4DA 3PVCA 4KQ2A 5AMXA 1NI4A 1ST2A 4PIMA 3MTEA 5LCXA 2I6GA 3FPEA 2L17A 4M0EA 3VR6H 1XTSA 3ITKA 4FYIA 2BM1A 4GBMA 3S2UA 4RD4A 5H1YA 5CDSA 3OZIA 4XYMA 5FTWA 3U4CA 1OHHD 2V65A 1GQOA 1PD1A 1T2CA 3PT9A 5ALXA 3ROQA 4ZEXA 3E3LA 2GVNA 3K0BA 3A9CA 5D3QA 3EX7C 3C7AA 2EJWA 2P6PA 4DUPA 1TF2A 4E5KA 2XUAA 3LHSA 1EINA 5EAIA 1TVCA 3BE6A 1DHRA 1OWOA 4N12A 4EG3A 2C5BA 2FMKA 5EE9A 4N82A 4QASA 1L8AA 3AEUB 5CLIA 5BQOA 4UFNA 2FB9A 4DILA 1ODKA 3HKDA 1WXXA 2HHLA 3R4CA 2HLDD 5MN5A 3OQNA 3PXBA 4TMVA 3TQHA 3U3RA 4POAA 2CXOA 1WXFA 1YQQA 3KYDB 4AZSA 4H4CA 3RSHA 2DLDA 2PT6A 3WGYA 5BUZA 3GG9A 1J1IA 4A5OA 1JJBA 3R7DA 2NV0A 1M6NA 3ZHVA 4E4TA 3IX7A 5K45A 4FHEA 1U1DA 3DNMA 3U4HA 4ETWA 2HT6A 1UBOS 4JDPA 5FWXA 4BQEA 5J5VA 2HD4A 2WKSA 3UK2A 1W1WA 2EF1A 2QD2A 4BMPB 4CGYA 1JU3A 2ZUUA 4ZDWA 3AR5A 4HX9A 5IDYA 1EB8A 3T7JA 1T2DA 4CEIA 3EDRA 1PUXA 2K4MA 2OCDA 4XARA 5E9QA 4G5XA 2VJNA 1ZD3A 3WLFA 4HATA 1K7EB 4IIDA 2YQZA 3UKOA 3ZUGA 3ER8A 1SIUA 3H2GA 1XCBA 1XHEA 3GFVA 1JFFA 4FYJA 6Q21A 4ARZB 4CXMA 3SEQA 3LUGA 2JCYA 1NTOA 1RADA 4C3OB 1EGAA 1EUYA 3E05A 2A8YA 3ZGZA 4K9DA 2ZYDA 2QJOA 1HDZA 1RXEA 2Q3LA 4WK0B 5CIYA 2D06A 2C8KA 3VOTA 1OMOA 4B6EA 3OE7A 1T3ZA 5FWAA 2G1JA 3LY9A 4E5UA 3BE5A 1NW9B 2OL4A 3Q7QA 3RSLA 2LPMA 4HNGA 1SR8A 3VC2A 4MW6A 3I73A 2DETA 4NZ9A 1NI4B 1Z8FA 5ICCA 4B80A 2QX6A 3MGGA 3NPAA 4MEJA 4U5XA 3QPDA 4ASUA 2AZXA 1CVLA 1XFAA 3QFFA 5EMLA 3W8DA 4CIBA 1WRBA 2V45A 3P52A 4YBRA 4POOA 2P4HX 1XK6A 4RK6A 1QE3A 3PC2A 5AVOA 2WD7A 3IJ5A 2O6LA 3F98A 1SXPA 2FK7A 1X1TA 3T8YA 2AG1A 3L0DA 5HUQA 1C30B 3KNZA 3Q3IA 1DKLA 3NBUA 5HGJA 1RFGE 3A28A 4KRYA 1PZHA 1CLUA 3AVOA 1DEOA 3II6X 2PE5A 1Y4UA 1T1GA 3IJPA 5FI5A 4EFKA 1QB7A 5EUCA 3PCTA 4GYJA 2W2NA 4GX0A 4WLEA 3HKDB 3OOSA 3VPDA 2HSZA 3OZEA 4GI2A 1F12A 3QE2A 4PC1A 3SEAA 4LRQA 2HSWA 3WGZA 5J2UA 1X15A 3I6YA 3RB8A 2JFVA 1F8FA 4YCLA 3C5CA 4LWPA 2EWWA 2IHUA 2Y99A 1DB3A 3T9EA 5KTMA 4G09A 4IMIB 4KPYA 3GJQA 4RZXA 3DBOB 2FI1A 4ZC8A 2PSDA 2W90A 1O6ZA 3WFIA 2C5EA 1QHYA 1TI7A 1UBFA 4WDQA 1EMDA 1JZSA 4G01B 1WSAA 2OD9A 3UHOA 1Y34E 2BF7A 2DE0X 3BDVA 4M89A 4B2YA 1U6JA 4YY3B 1SELA 1DQSA 1G3IA 4P83A 1LFAA 1ORRA 4C4YA 1FVHA 4HX2A 1O77A 3DZKA 3E82A 4UNIA 1RMTA 1IAQA 1JQLB 2CHEA 2ODTX 2PZ8A 1QG2A 1JFFB 2AQHA 3U37A 3Q5GA 1V6SA 1CY4A 1NHGA 1Z0AA 1V7ZA 2V6JA 3LVBA 2VXCA 2XAAA 4IQ8A 3L7DA 2Q4OA 4CI0B 4O2BA 3HR4A 1AGPA 4GP7A 1BYIA 3O95A 1EX1A 4E7OA 3OZBA 4MVJA 1CZNA 1TU4A 2GPNA 4J7CA 2H7XA 4E7PA 5A04A 4OP2A 2VDPB 1XF9A 5DASA 5JYDA 4N3AA 2NZWA 4C3ZA 3FB4A 4JA0A 1XRMA 3PFWO 1MGPA 2CFTA 5GJCA 3VR5D 2JGKA 5A5FA 1KJIA 1W49A 4HGNA 1SUCA 121PA 1Y4DE 4RSHA 3SMVA 3QH4A 2LR0A 2RHGB 5DN9A 3NTUA 5CLGA 1OXUA 3RVLA 4F06A 4X6UA 5CD1A 4YJ2F 2WLSA 3LUHA 2WFMA 4YV0A 2GMWA 3L92A 2WD7B 4QTXA 3HCCA 5IT0A 4H27A 3CNNA 4TQUS 1G20A 2DPXA 3LK7A 4KNWA 1DXQA 4KE9A 2OB2A 1USGA 1YR1A 3WLRA 2IPMA 4C4XA 1I0ZA 5GZ6A 4GIBA 2B6HA 2H8KA 4N3CA 5B5SA 5CYFA 4YHHB 1ICIA 1TUIA 2Q3MA 3ZHRA 1WV1A 4QGFA 5CVDA 4FGJA 3QMPA 3TRIA 4AO6A 4B4UA 1YZFA 2R86A 1J9EA 4BUJA 2XUZA 4C5BA 1N2SA 4AQDA 4EEXA 4A6DA 5J2UB 3RPEA 1SKBA 1PI3A 2X5NA 4ZK6A 3A06A 2IXEA 1VRWA 3CVVA 4MMZB 4EFNA 3M4ZA 5BT9A 2HNKA 2I9PA 1E5VA 2B30A 1LU9A 3KG2A 1NAHA 2Z58A 2IBTA 2AFRA 3TWOA 4Y1GA 1AGYA 1NUUA 1CUVA 2P9FA 3VVMA 5I7HA 4MHTA 1GUBA 3UXHA 4ZYUA 3TSYA 2FE4A 1SBYA 2BZGA 1PGPA 1CRLA 4L9AA 3PIDA 1AKQA 5AW5A 4Q15A 1NJ6A 1U9IC 1QO0D 4URUR 2I54A 2ZYWX 3OZSA 2YBEA 1O8CA 3TKLA 3UOGA 5JDIA 4ETIA 2IH4A 4KR3A 5GJWC 5M7EA 1W59A 2YQ5A 3JVIA 4XX1A 1CFJA 3Q2IA 2Z5VA 1D9XA 2GERA 2OG1A 4I7EA 4PYOA 2F6RA 2MYUA 2XADA 4DLKA 4O2BB 1LZLA 4UVIA 1SBIA 5WRFA 5JAIA 4JI7B 4YLYA 3T1HB 2Y27A 3KVVA 1U1GA 2FDCA 4PYRA 1D1PA 3CF6R 1UPUA 3SYLA 5IAOA 4TWZA 2G4CA 2NTEA 4KWTA 1SD5A 1YI0A 1SIBE 3AHDA 4MWOA 5EHQA 5L9AA 2A9OA 4Y2UA 2IEBA 3BIOA 3LUFA 1ATZA 2AWOA 3PX2A 4FDUA 2BEWA 1UXGA 3CCCA 5JSQA 2A0UA 5EWLA 3VNBA 3MLBA 4RYDA 4V24A 3NOVA 3WHKA 3EXEA 1WPGA 1UM9A 4PQRA 3BJRA 3FHCB 3AOEA 1K7FB 1NYQA 5I7SA 4TRRA 4D8YA 5FTKA 1Z8DA 1A0OA 1JKMA 2ZQYA 3K5IA 1C3OA 4KDFA 1HH4A 1WZCA 3NUGA 2HDHA 1COZA 2MSNA 5KMGA 4V3CA 4XX0A 1ZRSA 5FJJA 2UXDB 3AHIA 4XI9A 4LMAA 2YHIA 2BISA 4RWEA 4PO8A 4ZYVA 3KKEA 2J45A 4H4EA 3K0EA 4K0RA 1FX1A 2BHLA 1W19A 4M1SA 2GFHA 2L0XA 3PGVA 4PTYA 4C14A 4Z4HA 3ZHUA 4B6RA 3HCAA 3D3QA 4G97A 1OI7A 1GEEA 1X2BA 3P9CA 1CERA 5FEMA 4ZU6X 3J81k 1QPBA 2BI4A 3QV2A 4UHEA 1GRQA 1X13A 2O2SA 4NU6A 4ZALA 4RU1A 3W2EA 1W36B 3MFQA 5CG1A 3K9GA 2WHEA 2OAP1 4U7TB 4ENUA 1FMJA 5ARBA 2VDNB 3N7TA 2ZUSA 3PFNA 4M9CA 1PDWA 1X1DA 3HLTA 4XM1A 2WQ6A 3QIVA 3I28A 3QLUC 4WA8A 1HF3A 2CMGA 3L7IA 3WGLA 1CNFA 3KRTA 4HADA 3WJAA 1SC1A 1HORA 3RHZA 1T2UA 3QKUA 1OD6A 3H3JA 2HF9A 4DRXA 4C21A 1ZESA 5AW3A 3ETLA 1ZJ4A 3NANA 4YJ3F 5DHRA 1GUYA 2Q4DA 3H11A 1O96B 2BCEA 4BLSA 4XEUA 2GRAA 3QXGA 2A3NA 3BFJA 5HE9A 2HA2A 3K2QA 5FRDA 1U0TA 1Q74A 3BH6A 1GLNA 1ZICA 1M2FA 4B3XA 3LLVA 2I33A 2YW9A 4V03A 2ZCVA 3KS9A 5FH9A 3WGHA 1LTKA 5E4JA 4R1UA 1H3NA 3ICCA 4GBGA 2XLBA 4R9NA 4L9WA 3WG9A 2W6QA 4PQYA 4J94A 5I01A 2JB9A 2XVZA 1GLVA 3RIGA 2DKNA 5E1DA 1T8RA 4M55A 2H1LA 2ORVA 4FGUA 4YAOA 3RD5A 3GUHA 2Y1GA 3V46A 5B6PA 1NP6A 4BV9A 5CB4F 5EWLB 3QLVC 4QPJC 1T9CA 3DBVO 3EXEB 1EHYA 1EFKA 1UM9B 2R0QC 3R9XA 3DL2A 4WOBA 1RTTA 3B5JA 4ENTA 1ZM3A 1IY8A 1CV2A 2WHYA 3I64A 3AK4A 3WL6A 2BZ1A 2FUNB 3E0XA 3N87A 5KZMB 1C3OB 1WDLA 2R7MA 1JHZA 2XNJA 2ZULA 4D74A 1EXDA 1YRAA 1YMVA 2GEVA 3AY3A 1ZWLA 3DZGA 4C76A 3QBEA 2Z9CA 4OAPA 5IABA 2AOUB 4IUDS 4XX0B 5KMGB 4OFWA 1XJCA 3ZBPA 1QQTA 3D1JA 1OTHA 5FPTA 4F1WA 5C7IO 4JOCA 3Q12A 1LTQA 3I8XA 3EVEA 1Q84A 2YHIB 4R2LA 3GJ0A 2WHXA 5CBPA 3AM1A 1L3CA 3MTIA 2OCPA 4FC6A 1BG6A 1E89A 5B1IA 3SDBA 2DR0A 5DF1A 2IP4A 2MSKA 2R87A 4RY0A 3SYNA 1G5RA 4G63A 4G81A 3UKJA 3JQ9C 4IZ6A 1UQRA 3Q2OA 4ZI3A 2XNSA 1AQIA 5BSEA 1J23A 3P4XA 3WV5A 1CF2O 1L6IA 1SBNE 2PLRA 4IS3A 4Q48A 3C0KA 2P9QA 5K3FA 4UBKA 1G63A 1AHIA 2F3UA 3FUXA 4IO0A 3V5NA 5I7VA 3DE6X 1XQVA 3ELUA 1M34E 3EVCA 1CIPA 2O0HA 4WK2B 4UDNA 5DULA 4B3CA 4DRXB 2GTHA 1E2PA 5FKJA 5CB6A 4ZRNA 4N48A 1UEIA 1UKZA 3H11B 3PV0A 3DFMA 2MDTA 2YJ3A 5ED0A 3EAGA 2R2GA 4KQXA 4JI3B 1K8QA 1KBZA 4GP6A 4ARIA 1MX5A 4J76A 3OQ1A 2QZPA 1PT6A 3GEHA 1ETHA 4AMUA 1RP1A 2AKAB 3AEYA 1TADA 2HUPA 1DKPA 4BMNA 3ZLBA 4PX2A 2LCQA 2BDTA 2KBFA 3GH3A 4R9VA 1IBSA 4DZZA 1MIHA 1YR8A 4MUJA 4WNAA 5HIAA 1QQ7A 2H2HA 3A9SA 3H8VA 4TYMA 3ZY2A 1QRTA 1YCHA 1B15A 1AD2A 4R1OA 2VWQA 1T5SA 1V3TA 2PUTA 1U7HA 4JVMA 5LIRA 4TZTA 4DLPA 1QKJA 1E6UA 1LGYA 2YKGA 3NIWA 3S28A 4LTDA 4JL8A 1T13A 1V9SA 5D3KA 1HDCA 1RJFA 1M83A 2IDJA 3ZE6A 1TQ6A 3HE3A 1KFCB 1MO2A 1NMXA 3TOXA 5JCJD 3UQZA 3R9XB 4QUIA 4JOSA 4L5YA 2AOWA 2Y3IA 3HWWA 2YMPA 4C03A 2FMTA 1FXWF 1L8LA 1CS0A 1Z18A 4PS0A 2C8VA 4I6EA 4QYTA 5FOQA 4KL8S 2ORIA 3E9NA 4YPFA 5C81A 2QWXA 4V0SA 4AP6A 4AN1A 4BFUA 1QP0A 3TXAA 1VA4A 5ESRA 3VKHA 1I1OA 1G8MA 2X8BA 2Q6TA 2WTNA 3UV7A 1P5FA 4L85A 4PPQA 3ZU6A 4XDHA 3IULA 3ESBA 2JDID 3TECE 2NTNA 4O1HA 4FHFA 1YKFA 4AN0A 3Q72A 1E9FA 3OLWA 1HMYA 3K9WA 4F3NA 1CP3A 2IELA 1EFUA 1EFRA 4PGHA 4PLPA 1SD1A 5JLAA 3WZMA 1XPOA 4HS4A 2AS0A 1B73A 4YMWA 4H6VA 4QRHA 1Q77A 2HK8A 3GA7A 1SBHA 3H1BA 1VB3A 2ZIVB 1LQUA 1XQ1A 2W4MA 3EVGA 1DKQA 3L07A 5SYNA 3W7AA 4CM8A 4DWVA 2BKEA 2J5BA 3C8HA 4L3OA 4CKYA 3R5FA 2DR2A 3T5GA 1P77A 2VCYA 2J3QA 1E3QA 5K3FB 3U48A 1GADO 1GY8A 2ZFUA 3ESCA 4CE6A 5HS4A 2JGFA 1Y80A 2H59A 1NT2A 1IEWA 2EWMA 4LS3A 1M8FA 4BMSA 3QEKA 5BUQA 4EB6B 3KPJA 3CNLA 3M6VA 3G8BA 5CDFA 3WQRA 1FYVA 5AVSA 5J5CA 3OT1A 5F4BA 2RK4A 1ESDA 1ISMA 3IKLA 4PGFA 3QPVA 4MGIR 5TXGA 3ZJ4A 3OX3A 1J1ZA 2IOQA 3P9SA 1GUAA 1TJPB 4BKRA 4Y6LA 5DK6A 3TM4A 4DTCA 2OBNA 4NC9A 3TR5A 4WNAB 3VOSA 2MR6A 5KB3A 1E8NA 1U02A 1ZJJA 1N2EA 2C4TA 4IV5A 4QU0A 3EMVA 4CYMA 4OXNA 4EHDA 4UVHA 5KO2A 5CFPA 2P3OA 1L5VA 3R77A 2R6CA 4AWBA 1KSHA 4ESEA 2VQFB 1L5SA 3A6LA 1Y8AA 5K8UA 2FPIA 1GNPA 4Q9NA 4DKXA 1J8FA 3SFVA 1G6HA 2QSZA 3KYBA 4XYBA 3TNDA 4MI1A 3V42A 2JGMA 2WU4A 1CS0B 1U3VA 3GEGA 4ZI7F 3FHTA 5EQFA 1V3QE 1XCGB 3E7DA 4DQUA 3HBFA 3JZIA 2WI8A 3HU3A 3D0KA 5EA2A 4BU0A 3P1JA 5HOEA 3H5AA 4W1RA 2JIMA 1KFJB 2GZDA 2V59A 3GLHB 4RSMA 1G19A 4IW3B 5JAPA 5AOAA 2ZR0A 3FCCA 1TEHA 1Z4JA 1C8KA 2C20A 4QXMA 2G8LA 1PEKE 1GT91 2XUDA 5IU6A 3KR2A 4RIHA 4DY6A 1FSSA 4DMUB 2AN5A 3U7HB 1QVAA 4TUYA 1H6DA 3RRYA 1LQTA 4XCXA 3AHFA 1PJBA 2JVIA 1DJOA 2WT4A 4B3SB 1FTSA 3OTHA 4Q9LA 1RHQA 4YJ2B 3UVEA 4CM8B 2V8OA 2SCUA 1ZD9A 4QUBA 1F14A 1LW7A 2GD6A 1KEWA 4D4MA 2CMFA 2ZUVA 3H86A 2DTXA 3ZXUB 2AL7A 3Q7SA 5KNBH 4A3SA 5CVTA 1RKXA 3A37A 4YFYA 3VAYA 3WLAA 1D0IA 5CA1F 8AT1A 4EJ2A 2OBLA 4B4WA 2C2HA 3N8DA 4Z9BA 4WPGA 3M3DA 1U8XX 2GO1A 1MB0A 1UJ2A 3KZ1E 5G3ZA 4U7GA 2OGSA 3NBYC 5GJBA 4YUAA 2JFYA 2J85A 1NW4A 2FU5C 3CHYA 4GGMX 5EP4A 1G20E 2GJSA 3OT1B 1IXSB 1ULUA 1WPXA 3AF3A 3Q87B 5E6SA 4X65B 1R5NA 3E5MA 2QVCA 1SBQA 1MO5A 3G0IA 4DEXA 3HB9A 3AY7A 2CXPA 5AVUA 1FMCA 3EQ2A 2C97A 3KSZO 5BV8A 2ZVPX 1SCAA 2D7DA 3LO5A 2WSLA 2PGDA 3A6HA 1JIQA 1Y7HA 4EB8A 2XTMA 1Q92A 2L2QA 2J30A 2LZ0A 2PSSA 3KTFA 4H1VA 4PZPA 3UXMA 5C2JB 1X7DA 1Y98A 3R3JA 2Z2JA 1QU2A 4XGRA 2VYND 2XMGA 4PICA 2FPIB 2NSLA 2HSGA 2YV3A 3OUZA 4Y3UA 3RABA 2BGRA 1LRLA 2VHUA 3HB5X 1EJBA 2B36A 1GZSA 1Q3HA 2CNWD 3B13B 4F6LA 3VPBA 5J23A 4KE6A 1KMCA 1LUAA 4W82A 5BUCA 2H0AA 3RT7A 5C5DA 5B30A 1JR3A 1ENZA 1KHHA 4AS2A 2I4OA 3ROPA 2XNHA 3LQKA 1Z07A 3GW8A 3LX5A 3T5DA 3CLUD 4DLVA 4JI2B 2JJYA 1QZZA 1GWNA 2DECA 1KARA 4DIDA 2XPCA 2KYRA 3H2YA 1YCDA 1YKSA 2C83A 2GILA 3BUSA 3I1IA 4LPKA 2GN8A 4ND1A 1FCJA 4U9UA 4BC0A 1OASA 3LXUX 1FK8A 2VJBA 1G2IA 3R6TA 1R74A 2YWJA 5I5EA 5FWDA 5JQGF 3BHIA 4C1NA 4EHFA 4P5DA 3BKXA 5DYYA 1YQEA 1HK7A 2PK3A 1F9AA 16PKA 3LWZA 4MS4A 4REMA 4X94A 5T67A 3T7IA 2SCUB 3K1AA 2CYCA 1R0ZA 2OCBA 3SC6A 3S3TA 4G5HA 1NJ1A 3OAAD 4LXHA 2QLJA 4MB0A 4PYMA 3A27A 4XJTA 3D6NB 1GG5A 2JA1A 5HCIA 4JVNA 2HRZA 1PGJA 1FDOA 3A05A 3WZLA 2WKRA 2H5LA 2ZJ5A 2OQVA 4A9AA 3WQBA 1TIPA 2PFGA 2VSNA 5ALPA 2IV2X 2EZ4A 3G23A 1GZ4A 1F4LA 3HN6A 2AIRA 1LPAB 3CX6A 1G18A 2H31A 3HLKA 5AKZA 2C8JA 3ZJVA 2X8JA 4QIHA 5E6SB 1Z7WA 2GCEA 2PZAA 2VTEA 2IHVA 3KQHA 2O5CA 4BNVA 1U0LA 3U4GA 3TL2A 4N3NA 1TMGE 3B6KA 1A2KC 1YU6A 1Z4LA 2JIBA 5JFOA 3VKUA 1SZPA 3UWDA 4I55A 4BP9A 4MPDA 2V03A 3GFTA 4DNPA 2FPGA 5G1OA 1YZYA 2B4YA 2QYHA 1UOPA 1L5GB 2GRJA 2RGCA 1YB6A 1FLVA 1XMJA 4X54A 2WDPA 1TMKA 4XSGA 3KJZA 1G291 2R7AA 2FEXA 4JEIA 2D4AA 4HFJA 5H4HA 2VL7A 1XQ9A 4B4VA 2XE4A 3ZJ5A 3CVOA 1GKLA 2Q3EA 1T1SA 1TCBA 2XVYA 1L7XA 3BWXA 2FG7C 3RYHA 3HH8A 4EKDA 3T3GA 3BHJA 4P4TA 2FJPA 1MORA 3RQIA 1EVZA 1E3LA 2DCUA 1DO8A 3GLGA 2ECKA 2Q4EA 4BJ3A 4TSKA 4XFDA 3RUIA 2PKRA 2IGBA 3IB3A 4G56A 3W34A 3QV1A 1DAMA 4I5IA 4KXQA 2HEGA 5EWMA 3R9KA 1Z5VA 3FF4A 4ZOCA 3LCJA 1QV7A 3DMYA 5G0WA 1MVNA 1ONOA 3MNFA 4JZKA 4UNPA 2R62A 2DWPA 4FQ7A 1U0HC 1R7RA 3MUEA 3ZZTA 2AK2A 4YR9A 3L93A 1Z28A 2IOYA 2XNCA 1HQYE 5JRJA 1T6YA 4EI7A 2V4MA 1RACA 3EZ6A 1P18A 1ZCJA 2ZPAA 4B79A 4AULA 2B5VA 1SPBS 3BM5A 2AFHA 1F9EA 4LDPA 2JGAA 1HRDA 2FPWA 2OCGA 2OORA 3W9UA 4BO8A 4DABA 4FZJA 2FG6C 3FR8A 4MS4B 1KH3A 2PKWA 1FXWA 5AI6A 3K1AB 1UZLA 4ZVNA 1ZQ9A 1RYYA 2FSIA 1KTVA 2QY9A 3JYLA 3WDKA 5KTNA 1VCNA 3O4RA 3K1TA 1ETUA 3ANMA 3VMFA 5A5GA 1CIJA 4HLQB 3WLLA 3GNSA 4A4DA 1U31A 1VG1A 3GLIA 4EYEA 4QG3A 3MBKA 3TW8A 4YJGA 1OPXA 4BFWA 3AR2A 1UZNA 2RB5A 3GIWA 3R75A 3HG7A 4MDEA 4PIVA 2VOJA 2X8JB 1KSGA 4OHYA 1AKNA 3NCTA 4OJMX 3UMRA 5HGXA 4U2BA 5F9HA 1NXPA 2DMRA 1G98A 1RMYA 4UMDA 4R7GA 3OOJA 4RJTA 1TLLA 4DV6B 4IZIA 4MP6A 1RR6A 1YBVA 3NIBA 4X1OA 4XWAA 2YRFA 1HM5A 3EN0A 1C9MA 4I55B 1L4GA 2CL0X 2FPGB 3S2IA 3TB6A 1AO3A 1XWWA 2A0FA 2A4MA 5EJ8A 1UBRS 4I8XA 5K3BA 1F7VA 4CM7A 3PX3A 5CT5A 3HNRA 5EXTA 4DYVA 3R0IA 2YVAA 2TMKA 4X60A 4UAUA 3KCQA 1XZLA 1I1QB 1HA3A 4I50A 1U8EA 1Z06A 4P3YA 4UU7A 3RYHB 4Q3DA 3E2MA 3V2IA 7AT1A 4NPCA 4WY2A 3B78A 1EZ1A 1KSFX 3PNQA 2E82A 2K2WA 3ORHA 2EP7A 2GHIA 2WVHA 2GJ4A 3B2EA 5AI5A 3T15A 3ILYA 4QTUB 2ZUTA 1IBMB 1HL3A 4N9WA 5EWMB 3JALA 4ZCIA 1L7AA 1R5BA 2P30A 1TQ4A 2QW1A 1T5OA 4MEAA 1L8QA 3VC3A 5EJEA 1SBZA 2VLIA 1C9YA 1COWA 3SKYA 5HKBA 5E6UA 1D6JA 4JMLA 4EVRA 3WRXA 4HP8A 2WDZA 4ROTA 1ADJA 2OZEA 2VQSA 3FHLA 3JQRA 1NKTA 4Q19A 4HRXA 2XWQA 3C74A 1USVA 4P0TA 4NZPA 3PL5A 3QEJA 2MOKA 1ODTC 2EVWX 2YVQA 1K3TA 1MA0A 1W5TA 2AZDA 2Y1CA 1D1SA 3QPUA 2QUKA 1UKVY 2NU8A 3STWA 2G72A 3V1KA 1YFJA 2QRNA 3CZPA 2VF5X 3M5CA 1RAGA 5TJ9A 1DKUA 1GITA 5FI3A 4Z9XA 3IV6A 1PEAA 1WMAA 4RPLA 2KBEA 2ES4A 2Y4NA 3ISTA 4EHNA 3LQRA 4MVJG 3VH1A 4Q02A 3GLIB 1G7SA 2DQSA 2PX4A 4YJGB 3TW8B 3WRVA 2ZYRA 1J8YF 3IQDB 2N3ZA 4DGSA 1R15A 1QGDA 3IEVA 3STHA 1UFQA 3IUMA 3S8EA 4U9IS 1D7OA 1I7PA 5F1OA 2P0YA 1A96A 1RWNA 3I62A 3TQTA 1C9EA 2J6IA 5IN5A 1W0KD 3NHPA 1YBHA 1KZ7B 3QA9A 4JN6B 5DI3A 4ZT2A 3CO0S 1HDOA 5C32A 1VIDA 2H1HA 2Q8QA 3ZTWA 2YUIA 4ZYTA 3EBOA 5T8KA 2ZROA 1IHOA 3IMGA 4JXKA 4IIGA 5E38A 4CMKA 1N2IA 5IAAA 3ZD6A 3AU8A 2FYTA 4G5YA 1ZOLA 3EFBA 4URWR 5LC1A 1L4UA 3B9RA 4MRMA 4A8HA 1QOZA 1YE8A 2C7BA 2WJJA 4QLBA 3HJAA 1WKBA 3ENQA 2RGNC 2VS1A 1NN3A 2XYPA 5F4ZA 5BPHA 3RFVA 2WG1A 1QSGA 3AGPA 3DDUA 2PL9A 2PJRA 3ZVNA 1HE5A 1JTEA 1ZUD1 2WKPA 2DUMA 4I50B 4JXJA 2HKIA 2PGJA 5I7FA 1OH5A 3D54D 2AOXA 4WJKB 2FUG6 4M9SA 2ZRPA 1KI9A 1L4LA 4G0UA 1XRPA 2IS2A 3OJXA 4MUHA 3ROKA 2EAUA 3VUFA 2V98A 3PGKA 3MGBA 2Y0PA 2ZIEA 3JALB 3HDYA 4R2HA 4YDSA 7MDHA 3R7SA 3HK2A 4AN4A 4L9RA 1Y81A 4QOEA 3VTAA 3ANYB 2V7GA 4IQFA 4CIVA 5E6UB 1AZSC 4EM6A 3TOCA 1DKRA 4Q18A 3T52A 5FTLA 4ZO8A 4NU5A 4IEEA 1PNQA 1OA1A 4E51A 2PUGA 1R6BX 1VYUA 1QP4A 5JWRA 3AILA 4U7DA 5LQAA 3QSGA 3G79A 5HXAA 2AR9A 5LD2B 2Y2UA 4RMNA 2PLAA 3LY8A 4C7MA 2NU8B 4PBRA 4JI5B 4S24A 1L3IA 1AGRA 2YTZA 2PH7A 4TL8A 3UWOA 5GGXA 1WO8A 2JIOA 4QDZA 2NVWA 4MOWA 3E18A 5L3QA 4KIFA 1GTSA 2VYQA 5FYQA 3ZLUA 4EO9A 5KJCA 4EG7A 4TSFA 1SZCA 4UDYX 1J33A 3CVJA 1RPTA 5AQEA 3MT7A 2IZ0A 1FDSA 1QRDA 3GFSA 3LC0A 1W73A 1JRLA 2AXPA 2VUHB 1A95A 5KYVA 3ROMA 3CZQA 4EAQA 2YJ5A 2VJLA 4FYKA 3IPCA 4ZPXA 2A2ZA 2IIVA 4KNVA 4AP9A 4O8ZA 3RJTA 3NWEA 4Y2VA 5MFZA 1G4AE 3L04A 3NT5A 3F3MA 3CA8A 3DF9A 3P94A 2JIPA 4LDNA 4U2CA 2O3RA 2UKDA 5DI3B 1B14A 2Q1XA 4CI9A 2DLCX 1E7RA 3VVBA 3RIMA 4HX5A 2UZ4A 2V8BA 2B35A 1UFKA 3E9CA 2F2TA 2RHLA 4IICA 1JV2B 2YINC 5H68A 5HM6A 3GLQA 4F11A 1H0KA 3TNYA 2EGHA 3UK6A 2ZRQA 5EIEA 1AUOA 4MRMB 4Q6WA 4MUKA 1DP4A 3R74A 4Q4AA 2BGGA 3AEKA 4XSVA 1IMOA 3DBRA 3STYA 2K6GA 1K2WA 3BH7A 2OD2A 3EJ6A 2PEYA 3L43A 1I4EB 2HF8A 1V5EA 3JY6A 2RJNA 3LYLA 1FTWA 5JCOC 5L3VA 5GPBA 3AR8A 1DT5A 3S99A 3NGXA 3I9MA 4XH9B 3PJFA 4RTSA 2ID4A 2PZFA 3N2NA 1HZZA 1T4BA 5K5EA 2PWAA 4MGYR 4PLCA 2QZZA 4JI0B 3EPHA 2IZOA 3LBFA 1A9TA 4F3CA 1IN7A 4XTRA 3LC1O 3PTZA 3K70B 1B3BA 1QIJA 2WP0A 3P71T 4NMLA 3TB4A 3ZHZA 3IALA 4EA8A 2H5EA 1RXSA 2C03A 1VRVA 4KFSA 2DT5A 2B4RO 1YVRA 2D5AA 5K01A 3KEGA 3UHFA 3N3BC 2F1HA 3LVQE 4O63O 1NVDA 2PS9A 3TMAA 3VYWA 1TK9A 1ZW6A 3M6XA 1FL9A 4MYCA 1CUFA 4HH1A 3IELA 2NQ8A 4A0RA 3PE4A 3DQQA 1RW4A 4IFBA 3PHIA 4NIMA 1HG1A 1V6AA 4G8CA 4EYKA 1XZCA 1E7YA 4JI6B 5J58A 1P19A 2B8WA 1RLJA 2A1TS 2QLTA 3WDLA 2CE2X 4ZMRA 5L3QB 3MGCA 3ZLJA 2D8MA 4NV3A 3WGIA 1LSJA 1KYQA 2P77A 4ZXFA 1YBAA 5KVSA 2E0IA 2GEDA 3V48A 1AZLA 3IODA 5A1JA 4BGEA 1NQVA 3BTOA 4ZARA 2J3LA 2XNDA 3Q7PA 4E1AA 1QBGA 1JR3E 5JQGB 4QNMA 1GPBA 4YC7A 4R8LA 3ZNNA 3BCSA 4TXNA 3TEMA 1OYOA 4W7SA 2VHWA 2ECQA 2YNMA 1UC5B 3PR3A 4FGLA 1CJCA 5CNKA 1UK6A 2TSYB 3FMFA 4UASA 2FSVC 1S2GA 2XZLA 3ZV6A 2ANBA 3A1TA 2WSYB 3ZXXA 1Q0ZA 4Y30A 5KHAA 4GPEA 2DPGA 3AEKB 4Q4AB 1HEIA 1DJLA 3QEAZ 2X7JA 1WDMA 3CW8X 3DBRB 3IKTA 1CEXA 1MX3A 3AHJA 1H66A 3U0BA 3GDGA 1OFUX 1AKMA 2C98A 2W2KA 1XRLA 3E7PA 1L1QA 1RHRA 2WABA 4JU9A 4AWAA 1IQRA 2R96A 4WKOA 1R4NA 1R4ZA 4V39A 4BNLA 3DOFA 4AJIA 2Z95A 4OXQA 3ZWQA 1NDHA 2O2HA 4MQ6A 1OQAA 3ICVA 1JIIA 3OKAA 3WL4A 5KQRA 4HS9A 3O26A 2ZIAA 2LP4Y 5E9AA 4H6PA 4ZAZA 3RS9A 4DIMA 1NVUQ 2J3DA 4PWYA 3FZQA 5GZ1A 4OQYA 2GESA 3DEFA 3BJEA 2QTCA 1U3FA 2B4KA 5CM2Z 4F4UA 4IMJB 1SOUA 1RM0A 1VI2A 3D4BA 1W0JA 4I36A 4YJHA 3IIEA 3FLEA 3K6RA 4Z53A 1IG3A 2FNAA 1XJQA 3PE6A 5EZYF 1RC1A 1Y3CE 4G9EA 1S02A 1TZCA 2FZWA 2VDVE 2ZITA 4WE3A 1BROA 1RMQA 2ZSBA 2HMYB 5EC8A 1NYLA 3EAQA 2VTDA 3HVUA 3F8WA 1OU0A 1C8VB 1U7DA 2WIJA 4J0EA 3UICA 3W5BA 3I23A 4K81B 1SVUA 4C89A 3BRSA 3PNKA 5BWOA 2PMKA 1N2BA 3A04A 2C84A 2JC3A 3AI3A 4NYIQ 3UENA 3M5WA 3VU1A 4BLUA 3DPSA 2ETXA 3RC1A 3WB0A 3LW8A 1HY3A 4EMSA 1E9VA 1W52X 4ZT5A 5DXJA 4YT2A 2OV6A 1M0WA 4ID3A 3ZZ0A 1CHNA 1G5FA 1N8SA 3TE6A 2I6QA 1U8UA 3JQGA 3N9IA 3OBIA 4IO1A 5AKYA 1S2OA 1RBMA 2CUTA 3HZZA 3R3VA 1C4WA 1BGWA 2RHCA 2Z98A 3EGCA 3JQ8A 4FCVA 1N7HA 3IDSA 1Z74A 2HK7A 2BFFA 1XWFA 2I6FA 2PR2A 1TYZA 2AFHE 4LTMA 4M88A 1NF9A 2HPVA 2LE0A 3CLUC 4YCBA 1XYVA 2QS9A 1FSPA 3H19A 1EPUA 4CF7A 4F4CA 2ZDGA 4BCBA 1AVTA 2OO3A 2W2KB 4EYOA 1KVRA 1T24A 2WHPA 3OKCA 3OP1A 3W6NA 4M0KA 5U1PA 1R4NB 1ZRHA 4DR5B 1QF9A 2JARA 4KUGA 3RJMA 5LUAA 1JBQA 1SOAA 1OKKA 5CITA 3RBZA 3GLIE 3DLIA 3KJFA 4GX2A 4WA7A 1XDDA 3I42A 3SSNA 2IEZA 3CEHA 2Q5EA 1I3OA 3FOAA 3HM2A 3L8DA 3R7WA 4DLZA 2PZJA 1HR0B 3O92A 1BA2A 3SJAA 2HRBA 4ILEA 3VJMA 4C08A 4PNEA 4V1CA 3DHNA 4R83A 4JJ7A 4X1KA 5CLQA 5GOTA 1PQPA 1I36A 4KR7A 2O3UA 1U7UA 4MLPA 3S2GA 1E2KA 4U2KA 4I99A 1XQ6A 4PG8A 4JB3A 4C3UA 4CMHA 3DVRX 4YJHB 1MQ9A 3L02A 1FX0A 1U5BA 2IU3A 2PL1A 4U3JA 3RFXA 5DFAA 3F5DA 5A9SA 4HEA1 1M72A 4RS4A 1YGPA 2N47A 4IZOA 2P69A 3ZDQA 4AG6A 1Z29A 4E94A 1DFHA 2VQDA 1JE0A 3LPMA 4IXDA 4CIAA 3V33A 1DAEA 1OZFA 3VO1A 2ZSIA 2YJZA 4CMBA 4UEWA 3I92A 1SUDA 3QKSA 5LSAA 4OK5A 1KFEB 4Q16A 2F3RA 1H6BA 2HIGA 4DNOA 3NLLA 4W4TA 3JD4A 5EIXA 3RV4A 1T1RA 3U4AA 3A25A 4N18A 3GA0A 5CVCA 2E85A 3B7WA 1YRBA 1NXTA 4JQZA 3VR6A 2VPPA 1P2FA 4X91A 3TLGA 1H6AA 3TX2A 3L4EA 3AT1A 3JQGB 1NVEA 3BMXA 3T1NA 3AR7A 3IHKA 1ICEA 1NBHA 3JQ8B 3WX0A 5DTMA 3F8SA 5JSZA 2EYUA 4BPBA 3KSBC 1PK9A 2GM4A 3B1KA 3DAHA 1JDBC 2BFFB 4RUKA 2OOKA 3TLMA 4F21A 2ZT6A 1ZR4A 2PUBA 2VA9A 1E1KA 2XWJI 4N6NA 4UBLA 1WLSA 2X76A 1QZ3A 3CTMA 2PPVA 2YYYA 3F7TA 4LHZA 1SKMA 3FI0A 3L7KA 1TVMA 1UT8A 3SQWA 4PBSA 2WHPB 1K68A 4FGZA 4B8ZA 3MYRA 2W2PA 3UK7A 4GU5A 3SFZA 3L8YA 4H7IA 3WBBA 4BQSA 2DZDA 4W99A 4LFCB 5KOHA 4BVHA 4QPPA 4NFYA 2C0CA 4IPTA 2COEA 2H2AA 4BHTA 1KRXA 2M6LA 4ASUD 1HQCA 4GBED 3R7WB 1LI4A 4RENA 2PKXA 4AJOA 1GNSA 4MCIA 5TX7A 2V1UA 4A36A 4PAGA 3GGOA 5D8DA 4GC9A 4RHTA 3X1JA 1DX9A 4V1CB 2FHSA 1BE1A 4X1KB 4ZVVA 5H80A 3ZLTA 2G1AA 5IZCC 3N8IA 1LV7A 1CY6A 2GXQA 1DE0A 1HDEA 1FP1D 1KBOA 3GRKA 4OKNA 3RODA 4YAKA 5JNVA 2X0EA 4UMEA 1DO2A 2QMYA 2X5OA 3GGJA 1JIKA 1FX0B 1U5BB 2ZBPA 4U3JB 5ALQA 1PFGA 1RI1A 4QDXA 4D8UA 2QVXX 3O03A 5TVGA 2FR8C 5A9SB 5JCZA 5JJCA 1Y8ZA 3MIZA 1IWOA 2XH8A 1JTFA 2C2OA 1CDZA 2GN2A 3Q40A 2VRWA 1KMNA 1SQFA 2PX0A 3CX3A 2O2YA 4LISA 4YA6A 3KALA 3ZY3A 2XEXA 1K0UA 1R8JA 3AFHA 4R8MA 4WLUA 1P1KA 3QKSB 4CQMA 4MW1A 1AB5A 3VAAA 5KAPA 5LNK6 4DHWA 2REBA 1MQSA 1NF2A 4FE3A 4N49A 4C0WA 2I4TA 3DV0A 1E9RA 2C9DA 3PWKA 3ZVMA 4KREA 4ZAGA 3DO5A 2IJGX 1PFVA 2QM7A 2EJTA 2J6BA 2P9EA 1IRXA 2DT8A 1JWAB 3BXFA 3IHTA 4IHJA 4PONA 4B34A 1TIKA 3NTXA 1Q1ZA 1LJUA 3ABSB 1Z39A 1A2QA 4MWDA 4RDCA 1J6UA 4JB2A 4P4NA 3H0CA 4FFBA 1KJJA 4Z0TA 5JSZB 4O4LF 3MT0A 1S8NA 4K6OA 2YXDA 4Z2YA 1UK9A 1R6AA 3PFCA 4L8FA 4O8CA 3U3MA 3BDIA 3LD9A 5DCWA 1VIAA 5LLSA 2Z6UA 2HXGA 5TF4A 2P5SA 4GGPA 4TV8A 4WVFA 5E1OA 2F55A 4X20A 4NYJR 4YN3A 3TO5A 1WKCA 2GZ2A 4KGZA 4MVJD 3VV2A 4J3NA 1WLYA 2VT2A 1I3KA 2RHHA 3F6RA 5JYBA 1UMBA 4B3TB 1LS6A 3A1NA 4RVUA 2O7NA 5KOHB 3WLPA 4FC7A 3ISJA 4EECA 4GKJB 4C0HA 1GGEA 4FT4A 3M2PA 4RELA 3RVKA 2WLTA 4FDLA 1WZUA 2I1LA 2X6RA 4M1KA 4WRRA 1J0CA 3UUFA 1UOQA 1KGSA 1W96A 3N0VA 3LY7A 2Z2IA 2G9NA 2CJWA 2E4XA 4EW2A 3WXBA 4D80A 4N1AA 3A4VA 1FNCA 1D6MA 4RDXA 2AFIA 1RQRA 4WOKA 5A3QA 1M2EA 1AT1A 2CY0A 4PSUA 1ZONA 3T5AA 4C5CA 3QTBA 4GBJA 5LNK1 1MO6A 2DC1A 2CJPA 2VRBA 3GJYA 2BGWA 2VNAA 4LHEA 3KC2A 1AG9A 1SH7A 1HV8A 1VYVA 3ED1A 2JLCA 4CG2A 1TD9A 3K9FC 3C39A 2VPWA 4UUOA 3SMQA 3B6ZA 4AL4A 1I7DA 4G8BA 3GY0A 1HE8B 2POQX 3AWIA 2I3ZA 3EBLA 4CQMB 2VF2A 3AEZA 3PJDA 1W36D 3AVQA 2AG6A 2RFLA 4M37A 5EP2A 1EP1B 2ABWA 1A2OA 3CEJA 2PDAA 3FUCA 5CK4A 4EBBA 2BSQA 1I2MA 2IYZA 3GAZA 1PWXA 3DV0B 4LJAA 2H4HA 4XB6B 3Q3JB 1SHTX 1NOKA 1OFHA 2D62A 3WL7A 1MW8X 2WIFA 4IHJB 3WYEA 3LPLA 2P9JA 4Q93A 1M6HA 1PJAA 5FO1A 1PYOA 1TUEA 5EZYA 1Q6ZA 1PT8A 1SU8A 3VV3A 1T2VA 4FFBB 5HP4A 1EWTA 1Q1GA 3PENA 4B9EA 3LWBA 5AVKA 4PLWA 3QFRA 1VYTA 1YKGA 1KETA 3HJNA 4CF5A 5TQ0A 2HQBA 1YHZA 1BMFA 1XIVA 1Y42X 2X2OA 3DWFA 4TV8B 4BGDA 4WNIA 4DMRA 4X20B 2HLHA 4A0HA 4AQYB 2XVAA 2VSFA 2P35A 2JGNA 3EISA 4LCEA 1FQOA 1O5TA 1REQA 1V95A 2J3IA 3A4MA 3OM0A 4AJ4A 4ZZ0A 3P9RA 3RU2A 1UMBB 1ZK1A 5TEWA 3PRKE 4G67A 4NESA 3UAWA 1Z6ZA 4YRGA 2OM6A 4UC0A 1JA9A 2RBGA 2XCIA 3LUDA 1F6WA 1H2YA 4FKZA 4P53A 2DQ4A 1FYFA 1R2QA 1BVRA 3RC9A 3NIDB 3SZRA 3VU9B 5A4KA 5JFTA 5L45A 1XNHA 1Z17A 3FFAA 2E9SA 4L1KA 1Q50A 3YASA 5IJXA 1FP6A 2CK3A 2W0SA 3PWSA 3NEAA 2Z9DA 1KO1A 3MWDA 4NY1A 4QO8A 4Q47A 1EDEA 1VZ2A 4J1NA 2CJWB 3PDJA 2VPTA 4YMUA 1P29A 1A4IA 4UARA 1QYWA 1ZXXA 4IBOA 4MX8A 3ZE1B 2AFIB 3QYJA 4PSVA 2WWVD 1GPYA 5A6SA 2RG7A 4PLGA 2VP6A 3HQ4O 1CZOA 4XYGA 1E2DA 4Y9TA 1WG8A 2ODPA 2Y0CA 3VZSA 4DV7B 1RKVA 4XYEA 1HWYA 4PS1A 1DXYA 2WW8A 3KB2A 5IVHA 1Z5PA 5AJWA 3WLQA 4G36A 1B93A 4LOHA 4XW2A 1K08A 1VKJA 2YHAA 3G2NA 3M9LA 1ZOIA 4V0LA 4JVOA 2AJTA 4DCJA 3C1TA 2WA2A 5FOUA 4ZOLA 1NVFA 3KAKA 1PQWA 3JZFA 4ZD6A 1DRWA 4JUFA 4KFTA 2ORYA 4PW0A 4TLLB 5KWEA 3LOQA 3TF5A 1JKXA 3F7OA