2FU5C

Structure of rab8 in complex with mss4
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
176
structure length
146
Chain Sequence
KTYDYLFKLLLIGDSGVTFISTIGIDFKIRTIELDGKRIKLQIWDTTTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKVNDKRQVSKERGEKLALDYGIKFMETSAINVENAFFTLARDIKAKMDKNWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Guanine nucleotide exchange factor MSS4
publication title Nucleotide exchange via local protein unfolding-structure of Rab8 in complex with MSS4
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 146
sequence length 176
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2fu5C00
1YZGA 1E2HA 2VH5R 3LXXA 1FFHA 4Q4AB 4II7A 3EX7C 2YOHA 3Q7PA 4IDOA 4AG5A 3THOA 1AZSC 3AF4A 1G7SA 4PFSA 4ACAA 1DAMA 4TYNA 5H1YA 1JQJC 1YVDA 2QE7A 3KUCA 1ZVQA 5L3SB 1CJKC 1NSFA 1ZD1A 2F43A 2FF7A 2JLRA 3QI2A 1CTQA 1E2JA 3A1VA 2I1QA 4DRZA 5JRJA 4LBVA 4QNRA 2BHRA 3VX4A 3NIBA 4BZPA 3JZMA 3NHAA 3NC1C 3C5HA 2OXCA 1I4DD 3IGFA 3QXXA 5CK5A 4WZ6A 5KSOA 1PLKA 1ZD9A 2BMEA 4TT3A 2FFAA 3BOSA 2NO1A 3FKSA 2ZI7A 1UEIA 2WKPA 5EE9A 1II9A 3R9WA 4GPTA 1T3HA 2AK3A 1LV7A 1VKJA 1W1WA 5IRCD 4I1UA 3EG5A 1GRNA 2BVNA 4M53A 1SXJE 3N70A 4G5QA 3KKMA 3AKEA 3GLGA 4NE2A 2OAP1 2O0HA 3W6NA 4D25A 3I62A 2A7QA 2Z43A 5UKDA 5DYGA 3DM5A 4DT1A 3TW8B 3QXJA 2WIAA 5EP2A 3CH4B 1TADA 4B2PA 4JSTA 1RIFA 4Q19A 1U94A 5FL7A 2R6FA 3CKLA 2W0MA 3I61A 3M0EA 1EFTA 4C0LA 1OYYA 4EDHA 3OEEA 2BMJA 5FTKA 5DE3A 2REBA 4B3BA 2QMHA 3CWQA 3FGNA 4ZIRA 1Q1BA 5EXXA 1GZSA 1G8PA 2DYKA 2DFNA 1C9KA 2V4ZA 3WP0A 4O0MA 1XD9A 1WF3A 4UJ5A 2BBSA 4W5JA 2O8BB 1DAEA 4L4UA 4A0FA 1U0LA 2ZRHA 5DSZA 2WOJA 3HR7A 4QC2A 4AG6A 1W0JA 4TWZA 4D6PA 1J70A 1G8YA 2WJIA 2ZYUX 1KDOA 5CDFE 3THXA 4IJMA 4V02A 2LCFA 3SNHA 2B7CA 3X1YA 4M1TA 4FXPA 1NN5A 3K09C 1KI9A 1JR6A 1KI4A 4OJKA 3D3QA 4DLYA 3FHTA 4KODA 1IOZA 4CT5A 2P3SA 2J0SA 4QGGA 3E2IA 1CEEA 1CJVC 5FBRB 3DOFA 1M7GA 3OIYA 4D4LA 2CBZA 1CJTC 4V0NA 3PVSA 4HAWA 2FPLA 1IN8A 2VSXA 2ZPTX 3Q8XB 2C77A 3AV0B 2QP3A 1BH2A 1E79D 3AF1A 4QBFA 1Q20A 3SOPA 2E87A 3HU2A 2C03A 3BFKA 3R7WB 2PZEA 2CK3D 2EYQA 2HXSA 3B7GA 4J0QA 4JLVA 1T9HA 1P73A 2A5DA 1IBRA 3F8TA 3QBTA 1MV5A 1E0JA 5J47A 3WMEA 3E70C 4BRUA 2QPTA 3LNCA 3QKRB 2XSZA 5GVSA 2GETA 2BV3A 4PO1A 3LLUA 4B74A 2D2EA 5BXQC 3KXLA 2SHKA 4ITRC 1F3OA 4PPNA 1CF4A 4MUBA 2ZAMA 1KAGA 3BWDD 5TMPA 4NMMA 1XU4A 2JLZA 3VHXA 3GLFE 1N6IA 3SN6A 1Z07A 5AR1A 4Q1EA 3X1XA 3LXRA 1XXHB 1KHTA 3NBZC 1P3JA 5DGXA 4D0NA 1LNZA 2WWHA 2QGZA 2V1UA 5JECA 5AJVB 4Q21A 1Z6GA 3EARA 3CIOA 3A37A 4MGIR 1XPUA 1L7VC 3GJ0A 1KMHA 1ZBDA 2R62A 4PC3A 1X1RA 4YXWD 1ODFA 2AXNA 4D4JA 1ZP6A 1KZGB 3A1SA 4UNPA 3LWNA 2FFBA 4HATA 4QGHA 2VHUA 4M1OA 2IYRA 4GDFA 3X1ZA 3U7GA 2OLKA 4RFSA 1OH7A 1KI6A 1NIPA 1YU9A 2P5SA 4G01B 2ZM5A 2H18A 1XJ0A 3KDSE 4BFWA 2YC2C 5EXSA 2V3CC 1GFIA 4YMWA 2QE7D 3B1VA 2QAJA 4DDTA 1ANKA 2JLVA 2WWIA 3LQQA 3GEHA 1XD2A 1G21E 3PQCA 4NYJR 4U5XA 5C4MA 1I4LD 4XD7A 1VCMA 3M4YA 2ODWA 2NPFA 1E9CA 4OK6A 4TT3D 1LW7A 4JYBA 2O8CB 4ZI3A 421PA 4DXAA 1G4UR 3FKSD 4LBWA 3JVVA 2ZRMA 2OFXA 4OHZA 4QJ5A 1XWIA 2PLFA 1BIFA 1U8ZA 4QHYA 4HUQA 4NDZA 2Q6TA 3U44A 4RD1A 4DHEA 2C96A 1JBKA 3FFBA 4G5GA 5EP1A 4Q03A 1NBME 3NVAA 3AQ4A 4EFMA 5FUWA 5E95A 1OW3B 3FMOB 2CVHA 2JLWA 1AGRA 2O8FB 2D62A 4IEIA 2FEOA 3FMPB 1N6NA 5FL7D 1RJ9A 4LJ8A 2ZS9A 5EP4A 2XJ9A 3DO6A 4P32A 5FFMA 3ZIAD 5HZKA 5ELXA 2WIBA 3OEED 3AVYA 3OHMA 4GMDA 3K70C 3QKTA 5SZIA 4Q4HA 1WB9A 3SR0A 1SVMA 2IYSA 1ETUA 2GWHA 1NJFA 4ZDWA 2ZTSA 4WA7A 3EXAA 4DJTA 3W8NA 3K0FA 3OIWA 2ONKA 2OM2A 2R6GA 1W0JD 4A4DA 3GLHB 4YLGA 3RRZA 5J4KA 2NO7A 2ZRIA 3T06B 1QHYA 1XZPA 3PUZA 4A2WA 4B48A 2HUPA 1KY2A 2B8WA 4YC7A 5DH9A 2J0VA 2OV2A 1WXQA 4IEEA 4C0HA 3CB4A 3MWLA 4AKHA 2C04A 2FZLA 3EAQA 5IT5A 4OI0A 1F48A 2ZSEA 1E3MA 1CS4C 2VLIA 3EC2A 3GFPA 3BAFA 3WMGA 1PZNA 5IDVA 2V7QA 4IXMA 4CEJB 2NTYC 2XJ4A 4OHYA 1KDRA 2DHRA 1QF9A 2R9VA 5JSZA 2XB4A 2GXAA 3LV8A 2C2HA 2REOA 3KTAB 4ABYA 4C9BA 3K70D 1CR0A 3FFAA 1T4GA 1EFHA 3U6BA 2ZVPX 1HYQA 4NKRA 5L3SA 3UXMA 4EPYA 4BFXA 4EQ6B 2XSZD 3QEJA 1Z08A 2AKAB 1C4OA 1HQCA 1NY5A 4LGMA 4TL8A 1GAJA 1GG2A 2CJWB 3GJXC 1KI2A 4V0KA 1H65A 3CPEA 1IJFA 4UQOA 4JT4A 3WYGA 5CDFA 1WRBA 4DDUA 2VYFA 2W6IA 3DHWC 4BFTA 3PEWA 1T8UA 2C98A 2B7BA 3T12A 2O8EB 3K1JA 1FP6A 4UJ3A 3RWOA 4ZV4A 1TNDA 5EE5B 2JASA 5CM8B 1VCOA 4YMSA 2WAXA 2WTUA 2QAGA 2JJ2A 1N2CE 3FB4A 1T3LA 1GL6A 1KOFA 1E69A 1E98A 5TVKA 2BIFA 2RGGA 2PJZA 1DEKA 3CF2A 2HYDA 4Q4JA 1JJVA 3UMSA 3C8UA 4B34A 4QM6A 3K0EA 4I99A 3NXSA 4DCNA 1XP8A 4Z51A 2FH5B 1XEXA 2DFLA 4GOKA 1BS1A 3T34A 3BH6A 1HTWA 5JFGA 4M1KA 2CVFA 5LDDC 4IVPA 4MGKR 5C1BA 3MJHA 2O5VA 1QHIA 2ODEA 3GLFA 2VO1A 3CBQA 4B75A 1G6HA 3LA6A 3PEVA 4LJYA 4F38A 2Z4SA 2RGXA 1IXSB 1U2RA 1P75A 1COWA 2IL1A 5IHPA 2RB4A 1NRJB 1R7RA 1XCGB 2YWFA 4DVGA 3AKDA 4RZ2A 2ZYVX 3FOZA 1G6OA 1D6JA 1UKZA 2DPXA 2E1RA 3CWZA 2IF0A 1JJ7A 4A6PA 5DHAA 1G18A 1T8TA 3EASA 5J5CA 5M04A 4RZXA 5DN6A 2LWIA 2ZJOA 1SXJC 2XNDD 1PLLA 3L8ZA 4URZR 4EKDA 5JS8A 1X6VA 1A2KC 1KSFX 2EU8A 4P4SA 1ZNWA 1T0JB 4JKIA 2JDIA 1NVVQ 3K0CA 4EIWA 2ATVA 2VHCA 1CR4A 4PPFA 1XMIA 4XH9B 3UPUA 2FU5C 5BW8A 4R9UC 2ZE6A 3ZYCA 2A5FA 2Z83A 2DB3A 1F6BA 2OSBA 5E7IA 3O8CA 4R2HA 2REXB 1RE0A 3AF2A 4AWXA 4PC7A 1TPZA 4NPHA 1OXTA 4HB0A 1OXSC 2ZJ5A 4S2EA 5CJPA 4LHXA 2AK2A 2ZYTX 3QNUA 4C3ZA 3WNBA 2CE2X 1QHHA 5CITA 2IYUA 4W7SA 4PHFA 5EJEA 2ZSDA 5FOTA 1A2BA 4FMDF 3X1DA 4MRSA 5AJXA 1GRRA 1I2MA 2F43B 1N25A 3TBKA 2BMFA 3H86A 3U4QA 1VG8A 1UADA 2QENA 1NBMA 1M74A 2G0TA 4RSGA 2IBMA 4H1VA 2V7QD 1GRQA 2BEKA 1FP7A 1ZM9A 1SZPA 2GXSA 5FL3A 2QG6A 3EIEA 5J4VA 3ZS9A 3OF5A 1E94E 2UVQA 1Z83A 2X77A 4C30A 2OBMA 3NDPA 3SE0A 2ZRNA 1Q0UA 3P20A 1XPOA 1CIPA 2ZRDA 1AN0A 3R9IA 1ZCAA 4V0MA 4C0JA 2BCGY 3QEOA 2DWQA 2ZQ5A 2X1VA 2MMGA 2VTKA 4GT1A 1OH5A 3GLGB 1G5TA 4NONA 1KSGA 2RGBA 3THYA 5ANRB 3QJYA 4YONB 1N0WA 3TIFA 4LCBA 2WPDA 4DB4A 5BQ5A 2W6ID 2WMNB 2GA8A 4TMTA 4DT1B 5G3YA 2ZAOA 4DZZA 3VKGA 1OJLA 3WNDA 1M7HA 3RVBA 4WOPA 2VSOA 1DARA 2MSCB 2WV9A 5GVRA 4RKEA 1CRQA 3KB1A 5CIWA 4Q1BA 3RDPA 1G7RA 1H8HA 3P1JA 1GSIA 2GCOA 1P4SA 2Q3HA 3AUXA 3K9LA 1G19A 4ZIRB 2JJ2D 4Q00A 3B1XA 1SQ5A 1GIAA 4NCJA 4YMUA 1CR1A 4NCKA 4G3XA 1QBKC 3PEUA 3PV0A 2O8FA 1QHSA 4UKDA 2YV5A 1N6LA 1TX4B 3MWJA 1JAHA 2OHFA 3U5ZB 4DSUA 4JVNA 1JPJA 1AS0A 2CLCX 4RD3A 1Z22A 3ZGXA 1B23P 1E2IA 1DOAA 3RS3A 1G17A 2V6IA 1SHKA 1U90A 3PUXA 3ICQB 1R2QA 3B6EA 1ZIPA 5B58C 3NBYC 1JQLB 2HEIA 1YR7A 4L9WA 2QM7A 5FUVA 4LPKA 5C4GB 2RH5A 3C15C 1KI1A 1UF9A 1FQKA 4JLKA 3REFA 3KQLA 2CLSA 4B6EA 3K70B 2MMCA 4Q02A 3OESA 3NKVA 2ZU0C 4TMXA 3ADBA 4TZ0A 4PAOA 1SVWA 5KOYA 2R65A 2WKRA 4K8OA 2FSHA 3ZVMA 1ZNZA 4PXAA 1UKYA 2FG5A 2IYYA 2IYXA 2C78A 1CKEA 1J8YF 1KSHA 4B47A 4KVAA 4BLPA 4PX9A 4XTCS 1ZJ6A 1YR6A 3NWJA 4E07A 4B3DA 4TTQA 4PAQA 5AWFC 4M22A 4Q4LA 1FUUA 3BB3A 2QU8A 4F91B 2VP2A 2WWXA 4KXFB 4KSBA 3RS4A 4TN1A 1YQTA 3EZ7A 3H1TA 3K9NA 2WHXA 3IIMA 2KBEA 4I1OA 2IHBA 4O2RA 4DIDA 5TDHA 4AKGA 4A1FA 1KMHB 2CJWA 5KDOA 5JMTA 3NTUA 2VP6A 3T1VA 1U9IC 3GJ5A 5EE1A 1KY3A 5IF9A 1G3RA 2Z4RA 2GNOA 4AI6A 3UIEA 1XF9A 2QMUA 4RFSB 1KI6B 4GMXA 4Q01A 4GNKA 5AUOB 2ZYWX 4QFMA 2WAYA 2WJJA 4UXJA 3U2QA 1EGAA 2JLXA 1VECA 4A0HA 4WVFA 4Y0VA 1P5ZB 4ZKEA 3SDZA 5JEDA 3TW4A 5C46F 3IIJA 2HCBA 4NL4H 1NVVR 3PUWA 4FN5A 3QVUA 1GTVA 1NBMD 1ZNXA 3QENA 5E7MA 4C0BA 1Z0FA 3DL0A 4ESHA 2O0JA 1XD2B 1SGWA 1ZM4A 521PA 4CDGA 4X8LA 3CO5A 1ZU4A 1KK1A 4D80A 2OFOA 3EA0A 4HLCA 4CEHA 2FPMA 2N42A 2V1XA 1G20E 1BYUA 1NP6A 2V8OA 2Q21A 2P6RA 1JI0A 2D3WA 1ZD8A 2FWRA 3K53A 2FMXA 2ZRBA 4HUQB 5KPDA 5JI3E 4KJZA 3U44B 3F0TA 1DE0A 1P2TA 4ZI2A 3IIKA 3FTQA 1MRSA 4FD2A 1TTTA 1E79A 1LTQA 2CXXA 2KJQA 2J5XA 2WPDD 2QI9C 5JJKA 3KQNA 4Q9IA 3FKQA 2O8DA 4Y0AA 5G41A 1H8EA 1CXZA 2CK3A 1P61B 4TTPA 3B82A 5F2EA 5FUYA 5G53C 2BJWA 1RJ9B 3KXIA 3QKUA 4EJSC 4HYYA 1DAFA 4ZCLA 1H8HD 4PZZA 4Q18A 2L0XA 4M21A 4JL8A 3C14C 4Q4HB 4JLDA 1XRJA 1Z2CA 3CF6R 3BFVA 2WJYA 4IDPA 3CLVA 3TAUA 3L0PA 1RFLA 3K09A 4M9XA 3DKPA 4PQRA 2KB0A 2VP9A 1AGPA 1E2MA 3K0FB 1GWNA 3TMKA 4NYIQ 2KWIA 2GEUA 4MITA 4BE7B 5J4HA 3BD9A 1YR9A 3X2SA 1FTNA 1G41A 4TLCA 1VG1A 1GUAA 2B21A 3W8RA 1E4VA 3HPQA 4KHZA 3AVUA 2YKGA 3PJRA 3G5UA 1NMXA 2AX4A 3TR0A 2FSIA 1VTKA 2H57A 2AR7A 3THWA 4ZPXA 5JSZB 1E9AA 4ZDIA 4PZLA 2G1KA 2ZSAA 1YZNA 2J59A 4JLMA 4XOIA 3SBDA 1V43A 3ND9A 3DOEA 5D3QA 4PC2A 1EG7A 1RYHA 2OESA 2ZI4A 3QXSA 4TYQA 2HCJB 4BLOA 4W9MC 4BZQA 2IT1A 4F4IA 3IHLA 1AIPA 1XBTA 3FE2A 1MKYA 4Q7KA 2GILA 3DEFA 1S1MA 3IBYA 5FI0B 3K9HA 1D2NA 1G3QA 2FSGA 1G5PA 1PUJA 1TU4A 2E9SA 1R0XA 2W2TA 3CRRA 1HH4A 1XEWY 5JHGB 1GP2A 2H16A 2HLDA 3CX6A 5KDLA 4ZDKA 3RS2A 2EWWA 1XFAA 1DAIA 4Q1CA 2GJ9A 3ICEA 1YJ5A 3KUDA 1BMFD 3OIUA 4DCUA 3L8YA 2PT5A 1W46A 1D9ZA 1UEJA 4XVUA 5GJBA 4JLOA 2QAGB 2AD5A 3SC3A 3EZ9A 2P6UA 3TJZA 1EWQA 1AKYA 2ZROA 3KKNA 1WDTA 4ILEA 4IVRA 1IXZA 2H8KA 2QT0A 2FEMA 1CJMA 4YMTA 4NCIA 4HI0E 4I81A 2FOLA 4Q4JB 5LBIA 1F60A 1ZNYA 3RC3A 1VYTA 1US8A 3CR8A 1OLOA 4TL7A 2HT1A 1X8LA 4XJXA 1G291 3SU8A 1PVOA 4DC9A 2OEPA 3KX2A 1R0YA 5B30A 3ZIAA 1XEXB 2VP0A 1BO6A 1OKKD 4ARZA 5JHHB 4ZO4A 1VHLA 2GBLC 4A8JC 4HAXA 3FPAA 2G9NA 4DCVA 3SQXA 1L4YA 3VKWA 1ESNA 3K0AA 4WXRA 4JBYA 4BWYA 2WSSD 4BPBA 2OUKA 4JIMA 3GLFB 2GVDC 1S9HA 4CZ2A 1OIXA 4PTLA 3A36A 2ATXA 2IYVA 3H84A 4OI4A 3U7HB 4B3XA 1KKLA 3RABA 4PHHA 5DO9A 2WWYA 3FHOA 2CHQA 2NOAA 3SYNA 2J87A 3TLXA 1UBCA 1NI3A 4LJ9A 4XWOA 4TMVA 2XZOA 3NC0C 4GL2A 3RWMB 4URYR 1W49A 4G5OA 4MKGA 1G9XA 2PMKA 1ZM7A 3AKCA 5A0FA 4QNMA 3TR5A 4GFDA 4JBXA 3WMFA 2RMKA 4BFVA 3QG5A 3HWSA 3MJRA 3SJCA 1H8ED 3ADCA 3A6PC 3OEHA 2FDCA 3SS8A 1E0AA 2HF8A 4A0GA 3CM0A 1X8JA 3BS4A 3FDIA 4L9SA 1HA3A 4P4SB 2JJ8A 2EW1A 3OAAD 4LJ4A 4TL9A 4B44A 2GJSA 3B5JA 3GLIE 4L8GA 1YHNA 4RD0A 2YWHA 1LS6A 2GEVA 3A58B 1DELA 3TE6A 2ZR9A 2CDNA 1D5CA 4MGZR 2YJTD 1RYFA 4LC1A 1KIMA 2B92A 3IDQA 1EFCA 3KJHA 1VYVA 3AVWA 1XEWX 3MWKA 1KNQA 1QHHB 3Q5EA 1LFDB 1UKEA 3O8RA 1WQ1R 4TMWA 3BB1A 4OHVA 5FOSA 2D7DA 1K5GA 5GJWC 3B85A 4BLQA 3SYKA 2IS6A 2GF9A 1SKYE 3E5HA 2IXGA 3U4QB 4LY6A 1KO7A 4LWZA 1NSTA 1J99A 4US0R 4CT4B 2VBCA 4HLDA 4LHVA 1R5NA 4LYFA 5FR2A 4HSEA 4OI2A 3ZDQA 2ECKA 1YRAA 1QVAA 3LW8A 1Z0JA 1W47A 5FH9A 3EIHA 1OXVA 1IM2A 3SYLA 4NYIR 2GKSA 3PCRB 4G5RA 5FOVA 3T61A 1OXUA 4JT2A 4I4LA 3WYAA 5F3WB 3Q9LA 3EA5A 4M8NE 4TL6A 1JECA 2FSFA 3OZXA 2YWEA 2C8VA 3OFNA 2GXQA 5G3ZA 3THYB 1IXRC 2PCJA 1AK2A 3HR8A 4CF7A 3QF4A 4KBGA 5SZHB 1DO2A 1XEFA 2RGEA 3CNOA 1NG1A 1I4TD 1R5BA 1TAGA 1M7BA 5K8IA 3QXCA 2HLDD 5A4JA 3LO5A 2QN6A 3ECCA 5CLQA 5J4YA 2ASEA 2GCOB 3RYTC 2JA1A 4TLEA 4C4PA 1FOEB 4D82A 5L8VA 4AC9A 5FOUA 1J8MF 3EPHA 1CU1A 1GOTA 4LV8B 2GF0A 5CB8A 3MCAA 3HJNA 2NMVA 1HE8B 2XNDA 3UKDA 1XD8A 1S1CA 4M9ZA 5AUQA 2FE4A 3KZ1E 2IUUA 3AP3A 3V9PA 4BFUA 3D8BA 4E5UA 1VCIA 2DFTA 4DLWA 5JZVA 1KYIA 1MABA 2F3TA 3VU9B 1KO8A 3KJEA 4HUTA 1P72A 4TMZA 4V0LA 3IO5A 1Q1ZA 2EFDB 4PR0A 1HT2E 1GILA 1IJEA 2ZS8A 4R2IA 821PA 3KQHA 2V54A 3KKQA 4D0LB 2YWGA 2P6NA 1E2KA 2Q3MA 4EJSB 2WZQA 4ASUA 5HCNA 3CRMA 1W44A 2X2FA 3CZQA 4NH0A 1ZYUA 1XDBA 3KQKA 4IDHA 3Q7QA 4IXNA 2F1HA 4MYCA 3L2OB 1TF2A 4OI1A 2Q0HA 1SXJA 2OILA 2C99A 3EWAA 4EAQA 3M6AA 3IUYA 5JJIA 3I8SA 2NO0A 4LV6A 1KO5A 1Z47A 1J7KA 4XTRA 5FPSA 3SJAA 2R6CA 3TGPA 3SJZA 4QGAA 3SBEA 1Z6TA 3OEHD 2ZR0A 4CIDA 2WWGA 5C18A 5JWOA 1CBUA 1WCV1 4UXIA 1XTQA 1XTIA 4AY2A 1FMLA 1W0KA 2QORA 3U3MA 3AVOA 1DADA 3A4MA 3G82C 1T5IA 2J7KA 4LRWA 5FR1A 3X1WA 4DLTA 1DAHA 3W90A 4R71A 3P26A 2BC9A 2DFKB 2DY1A 2JATA 6Q21A 3U7FB 1L8QA 3CW2A 1T0HB 4UNRA 1GM5A 2VPPA 3AGPA 4KAXA 3A4NA 4DLUA 4NBSA 1S0UA 2CHGA 4PSKA 3D31A 1XB2A 2IWRA 4RCZA 1G4AE 2ZRAA 5CLLA 3DMNA 1N5LA 3VR2A 1SVLA 2BMDA 1XMVA 1U8AA 2Q9CA 2VF8A 4LOAA 4AKIA 1KAOA 2V55B 5DYIA 1N5JA 1VIAA 2G0NA 2QTFA 3BH0A 4Q9KA 3LDAA 3PG5A 4A6XA 4URWR 1E32A 1G8FA 2ZJ2A 1OH8A 3IQWA 5FTMA 3GLHE 1E0SA 4OL0A 1AZTA 4ZDJA 4CEHB 2EVWX 4EFLA 2ERYA 1KJYA 1MRNA 2WBLC 4LHZA 2IYLD 4CRWB 4URVR 4GP6A 3RRYA 2PCLA 3LAWA 3GLIA 3K8YA 2IS2A 2QZ4A 4QRHA 5JWRA 2OCBA 2RGDA 2CMKA 1GNQA 4IW3B 4ESVA 2GJAA 4JLAA 3T5GA 1S96A 1T91A 1T5LA 3SHWA 1Z8FA 5LD2C 4JL5A 2QPAA 5BN4A 1EX6A 2Q3FA 3OFND 1N3BA 1YKSA 4LHYA 5EUQB 3RS7A 5JI2E 5F9FA 2YVUA 4F4JA 2O52A 1IHUA 2PX0A 3Q72A 4Q1FA 4KFSA 2VP4A 4AD8A 2O8DB 3SQWA 3R8CA 2FGJA 4LYHA 1F2UB 2WWFA 4WW0A 5FTLA 4RD4A 3QF7A 1NVUQ 1UM8A 221PA 2JGNA 5FOXA 1RC8A 1II0A 1KI3A 5DLQC 1SVIA 3NEYA 5KU1A 4Q66C 3C16C 3AP2A 1KSJA 4X8HA 4DUGA 1VMAA 3ASZA 3VNUA 5HKKD 4OQNA 4MUAA 1KJZA 1MO4A 2G83A 2QMEA 4IOLA 1NY6A 2ZI3A 5DI3A 3MAAC 2BKEA 4ON9A 3ZD7A 4PZYA 3GFTA 4AURA 1DG3A 5E4FA 5F9HA 1LS1A 2A30A 1J2JA 2A5GA 4EPXA 5KDDA 5KSZA 1A82A 3KB2A 4QJ4A 3GEEA 4GI7A 2RAPA 2N46A 4N1AA 2CCGA 4HDCA 1UBFA 3A8TA 1P9NA 4JL6A 3M1IA 1QVRA 5HPYB 3QPVA 1XNJA 1D9XA 1Z0AA 2XB2A 5HTKA 4N0EA 5EZ5A 3AVTA 1YZUA 3N2EA 3THWB 4ASUD 2QL6A 1W4RA 2NZ8A 1UDXA 2HJGA 1OPXA 4C2UA 1M34E 3GP8A 1W4AA 1TEXA 1E4YA 2XTNA 2DWPA 4LI0A 3AF3A 4NCHA 2D06A 3UATA 2J0UA 1SXJD 4PAMA 3CPJB 2ZRGA 5CM9C 2A9KA 4AYTA 3A1UA 1N0UA 5C2JB 3RRNA 1TF5A 2FNAA 1ZC4A 1XTKA 1G8GA 4OKSA 4P4TA 5TY0A 1N6KA 3U3RA 1Z29A 4MH0R 1Q3HA 3CNNA 5EE3A 4EFNA 1ZAKA 2K5UA 3BE4A 4EPRA 1O87A 2HYIC 3VR6A 2BBTA 4PHTA 4D26A 2GXUA 1W0KD 1U9IA 1KDPA 1P2SA 1SVOA 3RSLA 3W3ZB 1E1QA 1GKUB 5GJCA 1IONA 4D2IA 1HURA 2NQ2C 5G40A 1ZU5A 4I1SA 4Q5IA 2IXFA 2QM8A 3B1YA 4XIGS 3P27A 3I1FA 3TAHA 1US8B 2JCSA 5FPYA 2ORWA 4NZYA 2GZAA 3W5IA 1EWRA 3I8XA 1PLJA 2FX3A 4DLZA 1WMSA 4ARZB 2QGNA 3B9QA 1UDWA 1XTJA 2GCNA 1Z5ZA 2QT1A 3ADKA 5DIFA 3EPKA 1U98A 2YOFA 4D4MA 5JS7A 2RHMA 4KYUA 1ZUHA 4M9QA 4NU0A 1G3MA 3K0AB 1VIYA 5TV2A 2W0SA 3TRFA 4F93B 4NHOA 5DNYB 4XVRA 5JCZA 2GK7A 1LF5A 4MKIA 1Q3TA 3ZJYA 4BASA 3I5XA 1X3SA 2A78A 2FA9A 2QY9A 4M1WA 2YC4C 4YQFA 1UAAA 1GKIA 1XJCA 4FWIB 3VU9A 1Q44A 4LJAA 1T3SA 4MQBA 2BKUA 4Q7MB 1OF1A 4E03A 4DEYA 4DSTA 1IQPA 2MSEB 3HP1A 4MYHA 1R6BX 4PC1A 4Q48A 4EJSA 1ELOA 2FJUA 4JJKA 5CJ2A 1Z0KA 2ORIA 3LVRE 2LKCA 4MYUA 5DHFA 4L16A 4QGFA 4JKYA 3BERA 4WAUA 1IAQA 4FW9A 4JSYA 2I1VB 4ZCIA 1YE8A 5JRZA 1KNXA 2HXYA 2OBNA 2ZJAA 1GDDA 1Q1QA 3B8HA 5EUMA 4BUJA 2ZJYA 1Z6XA 3NEJA 2ZI6A 2WJHA 4DUGD 2IW3A 3PFIA 4MKFA 4B3CA 3GLGE 3HPRA 4D81A 4RCYA 2RKOA 3HU1A 1E0KA 1NMYA 2IHYA 1SULA 2C95A 4TYWA 2ZUBA 2Q9BA 3LRPA 1MH1A 4M2LA 3KFVA 1UBEA 2J9RA 3WHKA 3PUYA 3P4XA 5BWMA 3BH7A 4U7DA 1R0WA 4BRWA 4CVNA 1A1VA 1CR2A 2AFHE 1BMFA 3MUFA 5H70A 1EFRA 1OFUX 4KCGA 2W58A 1E2LA 3B9PA 2OCAA 1QG4A 3P32A 4FMCF 1XMSA 4YDSA 2XGJA 2OCYC 1XTRA 3EIQA 4BFZA 1QHGA 2NO9A 5JLJA 1G16A 5L3QA 3U7EB 4Q1AA 1R8QA 4FWTA 4BQSA 4KFUA 3H2YA 2RGAA 3GJ6A 4B3GA 1W7AA 3A4LA 1CLUA 1VG9B 3WBJA 1Z28A 1OKKA 1E99A 4LSGA 5FPTA 1HV8A 5EXTA 4HLUA 1NIJA 2XZLA 1W5TA 3T1OA 2RGCA 5F98A 4HAZA 3VHLB 3I3SR 2GDJA 1NL3A 2JAQA 4H9GA 2FV8A 4HZUA 4PSAA 2WSSA 2GZHA 1AKEA 2G3YA 3BJIC 3MSXA 1NNEA 1KO1A 3TNFA 1GNPA 2IEZA 3B60A 1KK3A 2WOOA 4KYIB 5E7JA 5EP3A 4UXHA 3ZQ6A 3QF4B 1P9WA 2ZR7A 1UKVY 3EPJA 2AWNA 2JLSA 4QHTA 1NN3A 3AEZA 3O8BA 3DZDA 4A2PA 2IUTA 3GCGA 3NH9A 1U0JA 4TSFA 4LYAA 1E1QD 3U3OA 1A4RA 1OSNA 3DPUA 4P33A 3HYTA 3ZH9B 3W6OA 3PIRA 1YZTA 3C41J 2TMKA 5KTYA 5SZKB 4EPWA 4OQLA 2H5EA 2QSZA 4CEIA 1ZM2A 4OQXA 2GCPA 3T1QA 4L5BA 1ZIOA 3GD7A 3CF0A 4ZCMA 2OO7A 2GBLA 4A8JA 1RRGA 2NG1A 1P9RA 1VDZA 4BEBA 3PEYA 3RC8A 1F2UA 1OYWA 3WHLA 5AK0A 3OAAA 1MABB 4C0QC 4V03A 2GVZC 3VNVA 2R6AA 2ZJZA 1IY0A 1RPZA 1YZKA 3TSZA 1OHHD 4IFBA 2V9PA 2ZXUA 2IF2A 1N6OA 2CL6X 2ORVA 3EC1A 5K8UA 4QJ3A 3MGCA 3KKPA 3BXZA 3NBFA 1KJWA 2QTVB 5FTJA 3UK6A 3MLEA 2CCKA 3UG6A 4M1YA 2UZIR 4HLQB 3ZVLA 2Z5FA 4KBFA 2ZS7A 3NHBA 5JWHA 5LPNA 1W4CA 3MG9A 1KI8A 2XNSA 2RHDA 1JEEA 4U02A 3VR5A 1F2TA 1SXJB 1NN1A 4HEJA 3F3YA 5GADl 2QEQA 1E9EA 4US1R 3U3KA 3PENA 5CYPA 4M1SA 1IY1A 4D0GA 4B3FX 2PL3A 2RGNA 2AN9A 3L82B 3ZZ0A 1HY3A 4AIIA 2WM9B 4US2R 4FIDA 4KU4A 4DBLC 1XTSA 4XWKA 1DVRA 2OT3B 1IN4A 2I4IA 4Z1MA 3RS5A 1LB1B 1ONBA 2R2AA 1JAIA 4HB4A 4RZ3A 4DCSA 4CGZA 4RD6A 1OIVA 2ZANA 2D74A 2IUSA 721PA 3CRQA 5DI9A 5E3HA 1PJRA 3LFUA 3W6PA 1G1MA 2F1RA 1AA9A 2D4HA 3U3JA 3WYFA 4HLUC 1ESMA 3D6TB 1BOFA 4DCTA 4B71A 4IRUB 1OXXK 4RZUA 4OYHA 1E2EA 3CRW1 3FYHA 3GQBA 2F1JA 1JR3E 1G64A 2JLYA 2JIZA 4LHWA 1Z63A 2IEYA 1EFRD 4M9SA 2VA8A 5HE9A 3L0IB 2IWHA 1D2MA 4IHQA 3RRMA 2EWVA 1BYIA 5IK2A 4OBEA 4BLSA 2W2VA 3O47A 3I4LA 3HYRA 4JLNA 3QBVA 4WZBE 4Z54A 3R20A 1NVXQ 3FMIA 2J7PA 4G0NA 2XTZA 1JB1A 3REGA 2JJ1A 1Q57A 1RRFA 4KO8A 2HT6A 4PC6A 4QHSA 3VR3A 3SI7A 2VHTA 621PA 4B2IA 3GLIB 1N5IA 1O3YA 1LF0A 2NIPA 4JJZA 4QXAA 3AVVA 2ZREA 1TQ2A 3E1SA 3NBXX 3Q5DA 1RW4A 4FMCB 3OIVA 3BB4A 1KMQA 5JBQA 4P4UA 4BFSA 1PUIA 3TQFA 3I92A 3QXHA 5KO2A 4O3MA 3BBPA 3ONWA 4FCWA 3PXGA 5KSPA 3LBHA 3KJIA 1OB5A 3I5YA 1RRPA 3BIFA 1CP2A 1J90A 1MR3F 4GRAA 3W34A 2J0QA 2J46A 1U81A 1OIWA 4GBMA 2FZ4A 1SKYB 3GJ4A 4TSFD 3WBKA 2FFHA 3KXKA 1KK0A 1ZCBA 3TQCA 3VQTA 3W5JA 5BN3A 3CH5A 1N5KA 1II8A 1TUIA 1W48A 3QOFA 3KFXA 4LYJA 1JALA 3TKLA 5DI3B 1E1RA 3DDCA 4KVGA 3T35A 1P2VA 4JVMA 3K0SA 4EUNA 1Z6AA 1FTSA 2RGNC 2HDNB 1YZLA 4NYMQ 1HUQA 4MKHA 4A0RA 2F6RA 3RLFA 1Y63A 1E9BA 4B33A 4HDQB 2W6JA 2B8TA 2NGRA 3V00A 2QA5A 4EPVA 4JBWA 4P31A 2UKDA 4RVCA 3SFVA 2ANBA 2FN4A 1FMJA 3AH8A 1SVKA 1NN0A 1ZUIA 2ZE5A 3CX7A 3G0HA 1E2PA 2PEZA 3V4FA 1FX0A 4Q7JB 4OHXA 3U6KA 5EXPA 5DISB 3C5CA 1Z0IA 1TL7C 2J0UB 3QKSA 5FUXA 3LW7A 2OG2A 2XXAA 1AM4D 2PMDA 2G77B 1VG0B 2G1JA 1N0VC 2C5LA 2ZJBA 3KJGA 1NKTA 3VX3A 5KPJA 2A5JA 2QPOA 2EFCB 2C9YA 3T1TA 4UNNA 4W5HA 2WWWA 2ANCA 2BWJA 1A7JA 2VRWA 1Z0DA 2GEDA 1E96A 5K8TA 4Z1MD 2ZI9A 2CNWA 4TTRA 1L4UA 4ACBA 3BRWD 1ZUNB 1W2GA 3DKVA 2KBFA 4B2LA 3QY0A 3FMFA 1IN7A 1IY2A 1YZQA 3JVUA 5HE8A 3MWYW 2GAAA 4L15A 5D3MA 1GVNB 3H0KA 5KHOC 2ZSBA 4H1UA 2W2XA 4QKQA 3C4JA 4OJQA 3SJBA 1E2GA 3RANA 2AFIE 3VR1A 4KLZA 1RZ3A 1WBDA 4DSOA 2PZFA 2GTPA 2P5TB 1WA5A 4DKXA 1VCNA 2JIZD 1SHZA 2F9MA 3J81k 2ODNA 5HR5A 1D8TA 2CE7A 2ODBA 4DSNA 1XCMA 4GP7A 4Q9LA 2CL0X 1AS3A 5HKKA 1DPFA 5IK2D 4QM7A 1R4AA 1T6NA 2FPKA 3CUEF 2BEJA 2QQ0A 1Y3AA 1KZ7B 1KKMA 4GZLA 2ZI5A 2ERXA 2J7PD 1YR8A 5HZHA 3FWYA 4FMBB 4IOKA 1WP9A 1XXHE 1MO6A 2JJ1D 2QBYB 4C7OB 2ZRCA 3LX5A 4Q9JA 3GPLA 3GMTA 2IC5A 5B2ZA 4P0TA 4XSGA 1G7CA 1MO5A 2EYUA 1V5WA 4TLBA 1G7TA 1NJGA 1S3SA 3EPLA 2ZUDA 3RS0A 3UWOA 1GITA 2AKYA 2HV8A 3AP1A 2AD1A 4OK5A 2QP9X 4MDEA 2GAOA 2IYZA 5BYKA 1Q21A 4KLNA 4K81B 4NTZA 1JXOA 2BCJQ 4FI3C 3RSOA 1R0ZA 1JR3A 3QVVA 1E2DA 3B13B 4ZKDA 1NLZA 4LZZA 4DLXA 1KI7A 1G5RA 2P0EA 3UMRA 2AXPA 4JS0A 2W00A 4V0ME 4RD2A 3DM9B 2VIIA 4C0SA 2F55A 1KDTA 5EZ6B 2QRNA 1KK2A 1DS6A 2PJRA 3CR7A 4X8MA 1P7CA 1E1RD 3GJ8A 4KITB 2GRJA 3HDTA 2J45A 2PEYA 2ZVQX 4HDOB 4TMKA 3CNLA 4IDNA 4X8OA 4MYTA 1OT3A 1Q12A 4LDJA 4AK9A 2JLUA 4M4SA 3AKYA 4MRNA 3TH5A 3GJ3A 2B6HA 4Z8YA 4FCTA 2W6JD 1JPNA 1OB2A 2MSDB 4BEJA 4YMVA 1G3IA 3N5CA 1CULC 1DTSA 5TXGA 2G88A 1XPRA 1EK0A 5L3QB 2Y8EA 4Q4AA 2ONJA 5JJLA 1RRCA 2XOKA 1IN5A 3U60B 4N3NA 4XWAA 1Z3IX 2ZE8A 4AYWA 3KQUA 2GESA 2GK6A 3BFXA 3LVQE 4LJ7A 1M6NA 3ND8A 2YZ2A 2KI5A 4O25A 4HAVA 4NYMR 3R9XA 5A5GA 2XAUA 2G6BA 2N1BA 2ZETA 3CPHA 2X19A 3PITA 4R98A 3R8FA 3AVPA 3LQRA 4HZUB 2XTMA 3S1AB 4LJ6A 1ZMXA 1S2MA 4KFRA 2YNMA 1NLYA 2CLDX 3ZVNA 3IHWA 4Z8XA 4OHWA 2GJ8A 1Z2AA 2YHSA 1YRBA 3GEIA 1JEDA 3LX8A 2IS1A 2WICA 4BFYA 2CNWD 1DG1G 1QRAA 2AWOA 2Z6VA 2BJVA 3NH6A 4QBGB 5KYKA 2VHJA 2CL7X 1XJQA 1DAGA 3IKJA 5GJVC 1FQJA 1TF7A 1DAKA 4BECA 4MRPA 3LBNA 2Q9AA 5B57C 2IYWA 3N2IA 1XCPA 4CEIB 3IEVA 1JXMA 5J40A 3IO3A 2PT7A 4V0OA 2H1LA 2XEXA 4WIAA 1OE0A 1ZM3A 2C9OA 4WXPA 3WP1B 3T5DA 4A8JB 4Q9HA 3V4RA 5L3VA 2VF7A 1NF3A 4IFEA 4TLDA 8OHMA 3IPXA 4QG7A 5TARA 4IVQA 5HCIA 4A36A 5AJYA 3VAAA 2ZIAA 1KGDA 5JEEA 1E2FA 4Q47A 4KI0A 2LKDA 5AJZA 3SHFA 1OFTA 2NO6A 1KTVA 5TB5A 2O8BA 4A2QA 2GJKA 2WMOB 1BKDR 1QG2A 2F3RA 5CYOA 1I2DA 4XD7D 3T15A 3MD0A 3NG1A 2OCPA 1VPLA 2QSYA 2OLJA 3IPYA 3ZZUA 5AUNB 1LVGA 1TEVA 2XITA 3AB3A 4RKFA 2GHIA 1FZQA 2ZRPA 3B1WA 1P62B 3ZZTA 1MOZA 4PHGA 4D4KA 1UBGA 1OFIA 4JYCA 4IKEA 4HB2A 4HB3A 3AUYA 1MT0A 2A2ZA 2YOGA 3MMPA 4O2LA 3LD9A 5H8WA 1W36C 1F2TB 1Z6YA 3ZQJA 2ZE7A 3VTKA 3TUIC 1HQYE 2OFWA 3QIAA 1GKYA 4JZKA 4OK3A 4CW7A 3MRSA 3TVDA 5SZJA 4B6FA 5KUTA 1NMZA 3B1ZA 4DB2A 4WBSA 3WNCA 5CIQA 3R7WA 2A3RA 2C9CA 4LX0A 4MRRA 1Z06A 1AJEA 2IXEA 4XVQA 1JR3D 2NZJA 5AJWA 1VHTA 2QQEA 1OFHA 2YINC 1E9SA 1AQYA 3P4YA 1OH6A 2QMOA 3L43A 3QKRA 4LV5B 2VL7A 5J4LA 5FBLB 3IEUA 4M1MA 1WE2A 2J3EA 1ZC3A 2IX3A 4G1UC 1LY1A 5KNBA 1S4QA 4BLRA 4F7WA 3QPWA 3I32A 4BZXA 1K8RA 3DMDA 4IDQA 5FBQB 3NDBB 1XXHA 3LH5A 2OZEA 4LBZA 1W36D 3VR4A 1HT1E 1RVDA 3O8DA 4A92A 3KKOA 4F4CA 1DBSA 3AVXA 3LBIA 1R10A 1OV4A 2CHVA 2GZDA 2WKQA 1TQDA 3CZPA 3TUJC 2H7VA 4BLTA 4DLSA 3CONA 5K8LA 2BM0A 4TLAA 2O0KA 2FFQA 4MGYR 2VP5A 4LK2A 3DVLA 1XX6A 2YYZA 2QAGC 2P2LA 4LC0A 1PV4A 4Q1DA 2H92A 4E09A 2ZRLA 2EFGA 2FGKA 4FCVA 4A15A 2XOKD 2BOVA 4LUCA 4W5WA 3TSWA 4DLVA 1U8YA 2Z0MA 4B76A 1SVSA 1FNNA 3IQXA 3QG1A 2BM1A 1UFQA 4K46A 3VMFA 1FL9A 1U99A 5FI1B 1OHHA 5P21A 3ZS8A 2D7CA 2ZRFA 2ZRJA 2WJGA 2P65A 3RNLA 4UNSA 2BBOA 2IYTA 4EPTA 2ZSFA 2DBYA 4NP6A 2O8CA 5KSYA 4TYPA 3WRXC 2VEDA 2DR3A 4TZ6A 3FHCB 4IOJA 4RY2A 1CRPA 2R8RA 4JVLA 3GFOA 2QBYA 4C7OA 5FPHA 3F5FA 1P2UA 2KSQA 2IK8A 1R8SA 2R6DA 2QNRA 3BORA 1M1YE 2XX3A 4PSVA 1B0UA 2J41A 1C1YA 1E2QA 4RFVA 2EFHB 1N6RA 1FPMA 3JZAA 1W5SA 3QUSA 1II8B 3AVQA 4G5SA 1TUEA 1E9DA 2RCNA 4HAUA 3UWKA 2IS4A 1QHNA 1EESA 1M8PA 2AL7A 3THXB 3Q3JB 3EW9A 1VYUA 2WVJA 3H4MA 3VKHA 2VHQA 3TUZC 3LLMA 2F9LA 3C7KA 3KL4A 4ERNA 3DZ8A 4A9AA 4C0AC 3OE7A 5AUPB 4OQFA 4GZMA 2X8AA 3BGWA 3UANA 3I72A 5KNCA 1F5NA 1S8FA 4FINA 3LY5A 3K0CC 1ZRHA 3EWSA 3IILA 4JLJA 3TK1A 4B43A 4PO8A 1HE1C 5FBWB 3B2EA 3AGQA 5BYJA 2KE5A 4CYMA 3VFDA 1D2EA 3GLHA 4PANA 4JLPA 2ZEJA 2OAQ1 1DO0A 1EFUA 1Q22A 1COWD 2WJVA 3SZRA 2OE2A 1N6PA 4LPSA 5FBVB 1FX0B 1XZQA 3TSOA 4QBHA 1AQUA 3IBGA 4YDHB 2X2EA 2ZUCA 3CRVA 1NLFA 2R44A 3ASYA 3QKSB 5LB4A 2OXRA 2IYQA 4B32A 2XXAB 1G3UA 4CEJA 5DN6D 5FPKA 5EQTA 2ZU6A 3CX8A 2QUZA 1EX7A 1M2OB 3HU3A 3KTAA 1AS2A 4N0DA 4Q7LA 4E22A 3QE0A 2QTHA 2CEAA 1IN6A 1QHXA 4GOJA 1UJ2A 4MRVA 5KNDA 2F7SA 2WSMA 1GL9B 1K5DA 4QBIA 2JEOA 2JDID 5L3RA 1X86B 3ZVRA 4C0KA 3QPUA 4EQ6A 4POAA 2D2FA 3MFYA 2HJVA 3I73A 3RAPR 1SKQA 4DWJA 1N6HA 2NPIA 3WXMA 3W3AA 2PBRA 4R7ZA 3B78A 1S3GA 1X8KA 4PPQA 3S1AA 4P3YA 4TQAA 4IOMA 3EZFA 3W9YA 3ETLA 1G8HA 5D3MB 2J1LA 5B64A 1X1SA 2O8EA 3WRYC 5BN5A 2QP4A 3GJ7A 3QQ5A 3TVTA 4GSYA 2AHOA 3SFZA 4GOXA 1E9FA 1E9RA 1TQ6A 2ZRKA 1WBBA 2DCUA 5JCPA 1P60A 1RKBA 4MDFA 1CJUC 1GL7A 2PX3A 2W83A 1KO4A 1TQ4A 1W4BA 2PH1A 4B73A 2I3BA 4MA4A 3A1WA 5LB2A 4JVSB 5FOWA 2VQSA 4DDWA 4PQYA 4HZIA 3L0OA 3EZ6A 3PUVA 4UNQA 2QRZA 3ZLJA 4NCNA 3ADDA 2OBLA 4TYYA 1A5TA 1L2TA 3UG7A 4KSCA 1FW6A 1QZXA 5LD2B 1JNYA 1XMJA 2ZJ8A 3U61B 1GNRA 4FMDB 2UZ3A 1UPTA 3AF0A 2EFEB 2H17A 5FTNA 1NVWQ 3BC1A 4QOSA 4C2TA 1K6MA 2BBWA 2PLRA 2XZPA 1P6XA 1MO3A 4URXR 1ZINA 3WY9A 1TMKA 4PQFA 1W2HA 2JLQA 1NG9A 3K9GA 4PPGA 4U00A 3SEAA 4DIEA 3RHFA 1TU3A 2VSFA 4QL3A 4TQ9A 2IA5A 3PR1A 4LJ5A 2PZGA 4OQMA 3UMFA 4B35A 1EXMA 2HF9A 4JLBA 4TQUS 2QROA 4A82A 3AM1A 3FVQA 2ZITA 4JMPA 1QDEA 3D7MA 4URUR 5EE0A 4WZAE 2A5YB 4PO9A 4AYXA 4XSHA 3EZ2A 4DLRA 4BGDA 2BDTA 3ZD6A 1ZW6A 1NKSA 1FNMA 2F1IA 4KFTA 4KV9A 3BK7A 3QSYA 2P67A 3L0SA 5CB6A 1W36B 5CK4A 4DEXA 1E2NA 1R5OA 1HEIA 5H68A 4M0LA 3A1TA 4F92B 4LBYA 2V6JA 2CCJA 2EQBA 2DWOA 1U0HC 4NYJQ 3OE7D 4RJLA 1FUKA 4AKEA 1E6CA 3Q85A 4YXWA 4DDVA 4HAYA 4S35A 121PA 1Q1EA 4I1VA 1S9DA
chains in the Genus database with same CATH superfamily
3ZQKA 2VH5R 4AMGA 4NEHB 1GTRA 3NV9A 4BZWA 1XL0A 3OJWA 4K0RA 2C54A 4MEBA 5TS2A 5FBHA 4AG5A 3THOA 1BN6A 3RSQA 1DAMA 4H6VA 4Q7EA 5H1YA 5LXTF 2EBUA 4MUYA 1P1BA 3TW0A 2Q9UA 1CJKC 3AEUA 3QI2A 2UAGA 4K0KB 1R37A 3C3PA 3WJAA 4EHDA 3WLSA 3NBKA 2PNFA 4DRZA 4LBVA 3ZCRA 5WRFA 4LF4B 2BHRA 1RLJA 3NIBA 3VX4A 5IG2A 4G0VA 4PXSA 1K66A 1XZNA 1I4DD 3C5HA 3IGFA 3NTXA 1JMYA 4JVOA 3RHTA 3TQSA 4EO4A 1Z35A 3CX3A 1ZD9A 2BMEA 3I83A 4TT3A 3ITDA 2BFWA 3A9UA 4QQKA 4F5YA 3BOSA 3DYVA 2BDUA 2QW8A 4E51A 3WLRA 3NAQA 3FKSA 3OG9A 1GUYA 5A4IS 5KKNB 1ZL2A 1OBCA 3EBOA 3VZQA 2WEKA 4D8TA 5T6BA 1H69A 4OJMX 2VPIA 1VKJA 4KDEA 3T7KA 4AROA 1PHPA 1UBOS 2CZQA 1NQTA 3M4ZA 1MV8A 3UEOA 5I7HA 5K0NA 3N70A 1QV6A 1TYEB 2QRVB 4CCYB 1Y7HA 1H3NA 3PNBA 5JPIA 1ZL0A 3RBAA 3GLGA 4JUCA 1Y33E 3W6NA 4N41A 1JPUA 1B1CA 4URFA 2Q45A 1LC0A 2OXFA 2JCBA 2MYPA 4RLSA 2IDZA 2FOIA 5CDHA 5EP2A 3CH4B 5C7OO 3P9YA 1RIFA 2VK2A 2SCUB 5FL7A 1FRFS 2W0MA 2AFHA 4C0LA 4EDFA 4G9GA 3OEEA 3K05A 1EUDB 2BH9A 2JI8A 2QMHA 3FGNA 3ON5A 4LOLA 4QT0A 5AKGA 3EUEA 4ZIRA 1FDOA 3DONA 1VE9A 1G8PA 2YJZA 2NACA 1HDIA 2NZWA 1C9KA 4HGNA 3RBXA 5CFOA 4W5JA 3G8AA 2BBSA 1P17A 2NVWA 4KUHA 5BSKA 3BDIA 5C80A 5HHTA 1FMFA 1IVYA 1RWVA 1U0LA 4GPIB 1MJNA 2ZRHA 5DSZA 4ZYVA 2E1PA 4Q39A 4YLEA 3N3AC 4TWZA 5AICA 5G0WA 3THXA 2B20A 4D3SA 1MTZA 3LTNC 3RAGA 1O9HA 4JIGA 3X1YA 5IXJA 2MIIA 2NUPB 5JPCA 2Q7XA 3K09C 2FP4B 1KI4A 4OJKA 4JNCA 1IOZA 1YZ3A 2P3SA 4B6PA 2YQZA 3AR6A 3E2IA 1XALA 1Z4OA 2ZW9A 3AU9A 3MT9A 1CUHA 1TB4A 2CBZA 3OLWA 4ZVVA 2G67A 2CMHA 2GERA 2QN9A 2VK8A 4HXEB 2VSXA 4LY9A 2A6PA 3F5SA 2PIDA 3DTVA 3AV0B 1E79D 3U4CA 1B42A 2H2WA 1B8VA 4HWPA 2BEWB 2C5BA 4F3YA 2YTZA 2PD3A 3NASA 1I1OA 3H5AA 3S2YA 3SOPA 1C8LA 2C03A 3R7WB 2BGGA 2PZEA 1Y98A 2EYQA 3AESA 2RJOA 3ORFA 1PJ8A 4U4AA 1T9CA 3E70C 1RD4A 3LNCA 4YRPA 3BXGA 1A2OA 4PO1A 5G0TA 3KQQA 4RETA 5ER9A 3F8WA 4DS3A 3N6VA 3KXLA 5LDHA 2SHKA 4PPNA 1F3OA 4I50F 3TNLA 3PPIA 3RYHB 3GJTA 3OZEA 4EZEA 3T9FA 1Y4AE 4ZHSA 1G55A 2JIRA 4NMMA 2Y1EA 1Y48E 3GLFE 3GFVA 3BE8A 2FWIA 2ZIUB 2FW6A 4LZPA 3HO8A 1Y0BA 1SC1A 3OF3A 5IS2A 4IICA 5DGXA 4D0NA 1ULUA 1USIA 2QGZA 4X5OA 4E5KA 3CW9A 3EVGA 5JECA 2P2DA 1JE0A 5HX7A 2HPAA 5K1ZA 3ELUA 1KFJB 4AZWA 4MGIR 3A9WA 2VJNA 1XPUA 3N39C 5ICCA 1KMHA 2R62A 3K30A 2EKQA 1X1RA 4JGGA 4PC3A 2DG2A 3B6JA 4X6UA 1PN3A 4FHGA 2CLOB 4JDUA 3A1SA 4WLVA 3URMA 3LWZA 5AOBA 5DLDA 5DWVA 5HS4A 2XYPA 5C1DA 3QELB 3LWNA 1T9GS 2W9XA 1Z45A 1D1TA 2NTNA 5CT6A 3RVRA 4OMUA 4GRDA 1T2DA 1X74A 1L5NA 1IFXA 3H04A 4H6PA 2VXCA 2BFDB 1VL0A 1NIPA 2OCKA 2WVHA 4G01B 4MIYA 2G63A 1Z88A 3DXZA 1ZN2A 3ZHSA 4DIFA 2OKGA 4GO1A 2V3CC 1GFIA 4ZYTA 1QWOA 4LCEA 2QE7D 1AO3A 1RABA 4DXHA 5JNUA 4MCHA 2VDOB 3IDAA 4WV3A 3HDGA 4K1LA 2GN8A 1QOPB 3PIDA 4OXYA 5DGTA 2WWIA 3PIIA 4WZAA 3LQQA 4R2WA 3PUHA 4CTKA 3Q7TA 4ZK2A 5C4MA 1I4LD 3VSEA 2FN8A 5AHWA 4FFRA 1WULS 4ZQIA 7REQB 3GW8A 1TM2A 1LW7A 4MLZA 4B8WA 3I0NA 4KB5A 1FDWA 2J9YB 5AHXA 3TTYA 421PA 2CLEB 4AP9A 2HGZA 4LBWA 4DXAA 1B0AA 4ID3A 3BMNB 5COAA 4QJ5A 2QTWB 1HLPA 1JT9A 3UYKA 4GPBA 1YJBA 5CNMA 3AILA 1F6WA 5CB0A 1CT9A 2GEFA 4RD1A 4ZCSA 4FOSA 1U1GA 4AJJA 4UVDA 1TIKA 4Z0NA 3HNPA 1ZJ5A 4MV4A 3NVAA 1A88A 1O95D 1OX5A 2EP7A 2FXVA 3CLSD 5HQJA 4J75A 5CLHA 3FMOB 3GCXA 2Q7DA 1AGRA 5J63A 2H1VA 3LQ2A 2KX7A 1NBIA 4IEIA 4YYEA 1N6NA 1X7XB 2AG8A 3IULA 1IN1A 5CFZA 4J2HA 2ZYDA 5DKFA 5FFMA 5BNIA 3AIMA 3ZJTA 1H0KA 1L3IA 4AY6A 1T36B 3D59A 3U0VA 3BQMB 3O3OB 2PSJA 3OHMA 2NZ2A 1M83A 5ITZB 3JALA 4Q4HA 2XZDA 3AO0B 3QLTA 1ETUA 1V45E 1NJFA 4ZDWA 3B2NA 1SURA 2WA2A 2NUTA 3ROPA 3VBCA 3S81A 4GPAA 3R8XA 3GMDA 4DJTA 2VTDA 3DYIA 2I67A 2K87A 3OIWA 3OCUA 1PJBA 3GN2A 2QJWA 1W0JD 3AEKA 3FJ1A 5F7JA 3SC2B 2ZLBA 1CQPA 3EQZA 4TN5A 5J4KA 3FOFC 3NGXA 4RESA 1QPBA 3CLUC 5C8YF 3PUZA 4IXWA 1TPYA 1SBTA 2QXYA 5DH9A 3NOQA 3C5EA 3C3XA 3GV0A 1WXQA 3PNPA 4IEEA 4Z9BA 3MWLA 4AKHA 1KXZA 3DMPA 1FE8A 2QS9A 4TV9F 5AI4A 2VLIA 2AUMA 1PZNA 1NDHA 3UJBA 3K2IA 5IDVA 5AFSA 3FTCA 1T5SA 4CEJB 2GLXA 2B83A 1D3AA 4PN7A 4NZNA 5T3UA 1BW9B 5DM70 3TOVA 3W06A 1GGEA 1KDRA 3R23A 5JSZA 4EW3A 3LV8A 4MQUA 2REOA 1AF4A 4C9BA 4F9FA 3RRFA 1LPPA 2DBQA 3K70D 1EFHA 5DK4A 3NW9A 1SBNE 4ZP1A 5IZ4A 2K4MA 3RNOA 4NKRA 1HYQA 1O9BA 1V3TA 1XLVA 2XNJA 3LT2A 3TOSA 1TZJA 4QE3A 2HWYA 3UXMA 4PONA 4RPCA 4HT3B 4HNAA 4BFXA 4F3CA 3KZNA 1JHVA 3I2IA 1W5AA 1BQ4A 1U28C 2PX8A 3AJ8A 4MMYB 4PNHA 1GPLA 5I5GA 2CT8A 1NX6A 4J4TA 1IJFA 4JT4A 5JXJA 3LFTA 1PBNA 1WRBA 1Z7YA 4IJWA 4QFBA 4UFOA 4DWWA 3A1DA 1VL8A 3PJFA 1T8UA 4L5YA 4NZOA 2O8EB 2F3PA 3BGSA 3HJRA 2XCUA 1ZX1A 2XMGA 4OFWA 2Q2NA 4RM2A 5EG5A 5BN5B 2HPHA 4ZV4A 2BW0A 2VH1A 4DYVA 5BORA 3PF8A 4YWHA 4KHPB 1RM5A 3WHPA 3AI2A 3HFRA 4X6YA 3OT1A 4YMSA 3DDSA 2ISCA 2WAXA 4JOBA 4DAEA 5LN1A 5IAGA 4GLJA 4JLSA 2PWYA 2PJDA 5AJHA 4NJEA 1L5QA 4EYEA 5TVKA 2RGGA 4BKRA 3ZZ1A 1FX1A 1PGQA 3STHA 2EF0A 3EF3A 5KVCA 4I55F 3A6ZA 3UV3A 4I99A 2EZ4A 2PX6A 5EKSA 4DV7B 4WKGA 4GOKA 2EFJA 1YDWA 5DX8A 4LGVA 4TVBA 3BH6A 3DL2A 2JRLA 2ZZNA 2EJUA 2NP6A 2IGBA 2R1ZA 2R5WA 2X2OA 2A9FA 3CC8A 1V8FA 2NW6A 2X86A 4HQOA 1LQUA 2EIHA 3AU8A 1GRCA 3MCUA 4MGKR 3A9RA 5ITVA 4YJFA 4ZFNA 3WWDA 2XE8A 4JHXA 4B3HA 3GLFA 3LZDA 1G6HA 5DBHX 3G9TA 1LQTA 2RGXA 1H0SA 4L4XA 3K6SA 1OJ7A 2D2VA 5B1HA 1FRNA 2XB8A 4RELA 2PS1A 2YZ7A 3EDOA 3O4JA 3WSVA 1TYCA 1NRJB 1R7RA 4M1EA 1Z8HA 1WUYA 1IEWA 3OM1A 1ZH0A 4WUTA 1ZIDA 3P9SA 2NVOA 4RDIA 4J7AA 4V0QA 3WYCA 5BV2P 1D6JA 3E0XA 1AD2A 3TRHA 1UOOA 3E5RA 5H59A 4CMEC 1V6SA 1RDFA 1TYZA 2IF0A 3MJEA 4XOUA 3MLAA 3MYRA 2OCIA 5M04A 3NCTA 3JRNA 4RZXA 4CTNA 4RA6B 5K5EA 4EWLA 1V35A 4MW7A 2ZJOA 2XNDD 3C7CB 4KXLA 5EIAA 1ADCA 4B4DA 4BU0A 1W85B 4R1SA 4Y1FA 5JS8A 1TMOA 4LGCA 4WTOA 3WL4A 5CVVA 2EU8A 3PUIA 3LLCA 1C4KA 4P4SA 5TRTA 3ETGA 4JKIA 4EG3A 4X1KB 2D5BA 5E7QA 1ETHA 1L5OA 2VT7A 3EXG1 5J59A 5T64A 1Q5PA 2ADFA 3I09A 4XH9B 1ECLA 1MB4A 2WJ4A 4ZD6A 3TKAA 3QEMA 4ECEA 4EJFA 5G0UA 3UPUA 4CLEA 1V8BA 5D6NA 5E7IA 1HC7A 1R6DA 4R2HA 1BCRA 4JB2A 4R05A 3RR2A 4AJ4A 1BEEA 2DXIA 1UMBA 1OXSC 2ZJ5A 5HJ5A 5CJPA 5GV7A 5I48A 1G59A 3SVZA 2IOFA 3TDMA 4J6FA 5AI9A 3JCZA 4AFNA 2VAWA 1T35A 3QBJA 3HCEA 4F86A 2Y67A 4HH4A 3L46A 4FBLA 5IAAA 1PWEA 4Z9YA 1O0SA 1WTCA 3EGVA 1U8XX 2JEZA 4MRSA 4QULA 2PGDA 5K0GA 5IUKC 1KDYA 1N25A 5AYVA 4HQ0A 1VG8A 1UADA 2H1IA 3B12A 3FYUA 3I64A 4GLLA 5IVHA 2C5GA 1BGWA 3AB7A 4DA7A 4JJ4A 3KCQA 1EK6A 5ALKA 1J22A 4K05A 5FAXA 2BLNA 1TGVA 3KYCA 2V7QD 1GRQA 4IMIB 4IGKA 3JATA 1SZPA 3GJZA 2EZ9A 2PL5A 1ZI8A 5FL3A 2ATEA 3DNFA 3OF5A 3EJ6A 3ZS9A 1DKUA 1NXVA 1NVMB 3BIOA 4C30A 3EBPA 4YUWA 2NV6A 3G2LA 4TS3A 2F8LA 1ISRA 5JBQA 2Q07A 4AURA 4BNNA 4YT2A 2HLPA 1R3UA 2ZRDA 4C43A 1AN0A 1DT3A 1ZGCA 2Q5IA 1Z4IA 4MKXA 4U0JA 4ZVRA 4DIUA 1UMDB 1CS0B 1JLMA 1T2AA 1Y82A 2IOYA 2E48A 4X7PA 3L7LA 4OQPA 2X1VA 1RT9A 2OYSA 2VTKA 3LPNA 3Q88A 4GT1A 1G9TA 3WRYA 4RTNA 3KJZA 4YRQA 1OH5A 4PS1A 1RXWA 3QJYA 1EJ6A 3UH0A 1EDZA 2WPDA 3IUPA 3Q7SA 4W7IA 3ZVKA 5BOVA 5BQ5A 3EEBA 2GA8A 3W7VA 2QLJA 1BDJA 3S8MA 2N1MA 3JSAA 1LRKA 3OTIA 2DPLA 2WAOA 4MP3A 4YJHB 1DARA 2Q41A 3AOEA 3EZNA 3RVBA 2XKKA 2E7ZA 4EKYA 4RKEA 1P29A 3KB1A 3GLRA 1MFZA 5CIWA 3RDPA 4BQEA 4KREA 2PO5A 3INYA 1EFAA 1Z38A 3HVIA 2Q3HA 1FZTA 4RIIA 3K9LA 1HL3A 4AJHA 4B0OA 2VTBB 2X41A 4Q00A 4ZT3A 1PS0A 5CA0F 2A1TR 4JT8A 2HIAA 4MVJF 3DZIA 4ZALA 2DPMA 3W5SA 1LTHR 1SIUA 5FOQA 3T3NA 4KE7A 4QFDA 4PX3A 4I19A 3PV0A 1QHSA 4UKDA 9MHTA 2AMVA 1E64A 1TX4B 2Z30A 3MWJA 1JAHA 1V25A 2AE1A 5DLYA 1B7GO 3QPBA 3U5ZB 3L05A 5HYVA 2CLCX 4L7VA 4M0UA 2C7GA 1XMPA 2GUGA 2JARA 3HB9A 2VQDA 3RS3A 1N2JA 1Y3CE 2V6IA 1T15A 1LX6A 1UP7A 4H3VA 4M87A 4O2AA 3W0LB 2NTEA 2YHIB 1IB0A 3NBYC 3K16A 5B58C 3NJRA 2AVNA 1QP7A 4KP7A 1YR7A 2NPOA 1VRVA 2QDXA 4UHCA 1S89A 2QM7A 4FDAA 4U7HA 4LPKA 4QUIA 4ENSA 3GJYA 2WTBA 5A06A 4HTAA 4CMJA 3C15C 5I47A 3QMPA 3I53A 3PUKA 4P54A 4AO8A 2W8BB 1TRHA 3O6VA 4JQOA 2CLSA 1RBYA 1WEKA 3FLMA 3I1JA 3K70B 1ZKMA 1D03A 2X4GA 3CZMA 4R2LA 3V80A 1AKWA 2HZBA 3MJSA 4A16A 3NKVA 3DHYA 1U4SA 2CVZA 3KD3A 4JJ8A 4WCFC 5IAKA 4CEIB 1GARA 2FSUA 4TZ0A 1SVWA 1EVIA 2WKRA 2BFAA 3H65A 1JEJA 2R8YA 4DA8A 4NBTA 3ZVMA 3AUAA 4M83A 3WGYA 2IYYA 3EF1A 3TLAA 3DVAB 2WNHA 3TLGB 1DDGA 3ANXA 4BFLA 1KSHA 3PLRA 3M5WA 1IY8A 4BLPA 1BCSA 1CY6A 4D0SA 2F90A 4Z6KA 2O1EA 1UINA 4TTQA 1Q91A 1DRJA 3C8HA 3QHQA 5DU2A 3VHXB 3VSCA 2J3KA 2IW1A 4WNYA 1NJ1A 1UDAA 2ECQA 1B3RA 2GLTA 4F91B 2QU8A 3ZE8A 1HLFA 2WWXA 3G88A 4KEAA 2UXDB 2ZTVA 3ER8A 5ALIA 3H1TA 4MB6A 2APJA 3EAFA 1CF2O 3CLRC 2PBZA 4V1CB 3BEDA 5TDHA 4AKGA 2OG1A 2WM2A 3FTNA 4S2UA 2BAGA 4GOND 4PTZA 5HRCA 1BA2A 2ZWVA 1DTEA 2CJWA 2D2IA 4RGBA 4MQFA 3GJ5A 5EE1A 4FHCA 3N1UA 2I2WA 2QR5A 1WETA 3GARA 4QWWA 3CF4G 3VH1A 1W6RA 1JHQA 1XF9A 4AI6A 1L4EA 3LQKA 4NF2A 1KI6B 1T9BA 2VJLA 2Q49A 3G9UA 3C70A 1M6VB 1G5FA 4FJ1A 2HMTA 3NBMA 3NNSA 1PR3A 2WAYA 4IX9A 3GAZA 4J3JA 3U2QA 4FB5A 5B7GA 4B6GA 1CEXA 1RSZA 4WVFA 5A5DA 2JLXA 1EWVA 2XCLA 4YHHB 3BF8A 3QEKA 3PC8C 5KX5F 1Y3IA 3PUWA 3GHHA 4GHWA 2PX5A 1GTVA 4JJFA 1NBMD 1NUAA 1BA3A 4Y2GA 4PBSA 3DL0A 2O0JA 4DLBA 1JIJA 1Y37A 4I5FA 3DAOA 2XODA 4W8GA 4CDGA 2Z6QA 1EDEA 2D4AA 2X40A 5FF9A 4OHRA 3BDAA 4PWZA 4J43A 3RASA 4D80A 1RYZA 4LOHA 2WD7A 2V1XA 4NPAA 4QGSA 5BNTA 1GU0A 4HDSB 4DR1B 3T0IA 2WUWE 4ZVPA 1NP6A 3GUYA 1FMTA 3PDIB 3FG9A 2FSVC 1MD9A 2WHEA 2FMXA 1V3UA 4FLFA 4PYIA 1CNEA 3RYCB 5KPDA 3KO8A 4L3OA 4WK6A 3U44B 2V7VA 3KZKA 2CBXA 2P8JA 5I9MA 1P2TA 2H2DA 1FP2A 3MB8A 3FTQA 1MRSA 2KYRA 4CM5A 3CQ9A 3VUFA 3QE2A 3GEGA 1SCKA 2QI9C 4R54A 2PUWA 5CA1F 3FKQA 2JA2A 1TZKA 1Y9EA 4G89A 1CXZA 2CF6A 2QM3A 1Z33A 1VPTA 5K0SA 3GVPA 2PT9A 1E20A 2XGSA 4Q3NA 1KXJA 3FRHA 3QKUA 4MQ6A 4HYYA 4JBHA 4XB6B 1H8HD 5GGYA 1T0PA 4C21A 1N57A 3TG8A 4HDNB 3OP1A 3LYHA 3NUGA 2OQVA 1P7YA 3MT7A 1KFCB 1JG6A 4JLDA 5JQWA 2WJYA 3TAUA 2YWXA 3DS8A 3FHJA 4D74A 1R9NA 4WZBB 1AGPA 1JG3A 3HCRA 3K0FB 3LUBA 3TMKA 1NT2A 4A5OA 5LP6C 3NOOA 4MITA 3BD9A 3WGTA 1Q0RA 4L0CA 3IBSA 2WVAA 1YR9A 4GEGA 4DPKA 2CZCA 1IRXA 1E1DA 1FNCA 1FTNA 4BRZA 4TLCA 3B6ZA 2B21A 3UY4A 5CX1B 2RAVA 3REOA 3HPQA 3J7AC 4E2YA 2PL1A 4KACA 3UA3A 1KYVA 3PJRA 1IDN1 3BJZA 2H9YA 1YI8A 4O2BB 2OQRA 5BWBA 3F9RA 1QB7A 3NJ8A 1L0BA 3EGDA 3ETDA 2QVLA 5JO0A 4J7UA 2A92A 2AR7A 4QPZA 4ZPXA 2EHJA 4P9NA 4ZDIA 1GCGA 3KOMA 5JZBA 4S05A 4PZLA 3O1HB 5F1KA 4XOIA 4MTCA 2WD9A 3PQ4A 2OA0A 2HQOA 1M1YA 1EG7A 3QXSA 2MSLA 1NVBA 4TYQA 4MMZB 3MCTA 2P7IA 1D1PA 4UDNA 2WJZB 1IEVA 5FUBA 1R1DA 2DHEA 4F4IA 2IT1A 3IHLA 3E82A 1XBTA 3AUUA 3FE2A 4Q4DA 4OX9B 1FFXA 1C0LA 3OA0A 4LFBB 3W7AA 5A3JA 1JUDA 4JZYA 1D2NA 1J7JA 1G3QA 1USGA 2HDWA 4TKZA 4V3CA 1TU4A 2E9SA 3SXPA 4BS9A 1L9XA 1XEWY 5JHGB 2C2MA 4NICA 4PQEA 2HLDA 1VLQA 4K9KA 4ZDKA 1OLSB 4W6QA 4J16C 3IAS6 3RS2A 2EV9A 3KVYA 3UJAA 3VUEA 5LZ4A 2ZSIA 3ICEA 2ZBFA 1BMFD 1DV1A 3E5MA 3DL7A 3FYTA 1T1JA 1I7PA 4MPPA 4F6LA 1BE0A 3UUFA 2QAGB 2AD5A 3IA7A 2AZXA 4O4IB 3JXEA 4RC9A 1EHCA 1RCUA 2J5KA 1T0UA 4YCDA 2BKLA 3EVCA 3SDBA 1JAYA 1JA0A 2HD4A 3C3AA 3F98A 2QT0A 1Z6QA 2WYVA 1DC3A 4NY1A 4EPRA 5KVSA 4HI0E 2RHTA 2YCBA 3RC3A 2V03A 1US8A 1DJNA 2P79A 4B4UA 4GP9A 1X8LA 3SU8A 2E49A 2OO5C 4C89A 4IJ6A 3N05A 4S1TA 1YRYE 4BN4A 2ET6A 2HC9A 2JD0A 4KX5A 2FW9A 2Y1GA 1C1XA 3ZIAA 3OQOA 3N2LA 4YI3A 5JHHB 4UMVA 1T2NA 3OF2A 4LNHA 4XPZA 2HU8A 3L41A 4XGKA 1U8TA 3LY9A 4C6TB 2W6CX 2QSJA 5BUSA 3VKWA 1WR8A 1EHYA 2G08A 3NAZA 3K0AA 2Q8PA 3L0ZA 2QL9A 3PS9A 4WXRA 5LP1A 1J49A 3AETB 3CXRA 1GTL1 2OUKA 2Z2IA 4IH1A 4AG3A 4BPBA 2HNAA 2VOJA 3E27A 2HBQA 1Z39A 4L72A 4PTLA 4WNAA 4PRZA 2D0DA 3A36A 3TZ6A 2Z8XA 2ATXA 1JX6A 3KLNA 3U7HB 1QH9A 1IZZA 1NC1A 1O1YA 1UBSB 2DKNA 3RABA 5GIOE 2VF4X 2FY8A 1CUIA 4EI7A 3TFOA 3FHOA 2CHQA 2NOAA 2GARA 4MV6A 5H4HA 3SYNA 2J87A 3ZD9A 1K8ZB 2Z8YA 5AJTA 3C3JA 4HUJA 4MWTA 1WLYA 5A1TA 3F4KA 1XI2A 4LJ9A 4XWOA 4X7RA 4BJ3A 5K45A 3IT0A 1L5WA 3HSYA 1DKNA 1DQSA 4YAFA 4F72A 1G9XA 3AKCA 3PDWA 4ENQA 4QNMA 13PKA 2C5EA 3GGCA 2RMKA 1NXOA 3HYNA 2EKZA 1KYYA 2XNCA 4BJ5A 5FFFA 1ZLXA 2HF8A 2YVAA 3CM0A 3ACCA 4G1FA 1BD3A 5F5XA 4A0GA 4MUMA 3G9ZA 2J07A 1K8XB 5LL6P 3CLHA 3LKBA 1Q1AA 4HNGA 3BSSA 1PWXA 2JGEA 2H65A 4TL9A 1G38A 2GJSA 3GLIE 1E6EA 1JYFA 2BDEA 4P22A 1YHNA 3MNFA 2YWHA 1WDWB 2XGMA 3HO6A 4FOPA 2JJYA 4FZ5A 1HX7A 3CUSA 3OZSA 2CDNA 1D5CA 4MGZR 2YJTD 2BGUA 1Q74A 4ENTA 3GPDG 2OHGA 4KPEC 3IDQA 1EFCA 1FS4A 3KJHA 5EMKA 5THXA 4RTPA 5TJ9A 2RC6A 1Z5WA 3M6LA 1EX9A 3MWKA 3ZLVA 4WBNB 1KNQA 1P1KA 2EATA 1LFDB 2VTVA 3KD2A 3O8RA 2I66A 2O50A 4TMWA 4FR5A 2YV3A 3TEFA 3V1UA 5FOSA 3LHIA 5AK4A 3EVNA 1K5GA 1LDYA 4BLQA 4EEXA 3ZU5A 3RHZA 3KTDA 1ZI6A 4F60A 3KP1A 1BE6A 2GM3A 2BUCA 4ZAZA 3F1LA 1P74A 1WXGA 2BZGA 2D13A 5DOZA 4CT4B 2OAEA 3JQEA 3KEOA 4L76A 3ZWOA 3KK0A 2CXOA 1Z62A 3ZDQA 4GSLA 1DJOA 2HK8A 3Q2KA 3EIFA 3DWEX 2DU8A 4W99A 3RG8A 4ER6A 4MR7A 1YJQA 1OXVA 4PAWA 3IEIA 4D99A 3MXOA 1BJRE 3L0YA 2LCQA 4DADA 3SYLA 4TKVA 4NYIR 5BR8B 5DP2A 3V8MA 1SOMA 1BWQA 1DQRA 3IKVA 1TJYA 1OXUA 2E3JA 3HR4A 3O8OA 4G5RA 4AMVA 3DNPA 3L5OA 2PVSA 3RSSA 1WUHS 3HDQA 3EA5A 4IIGA 4M8NE 1WKVA 3AINA 4TL6A 2B9EA 2AN4A 4NOJA 2YWEA 2GXQA 4XRGA 3ZW7A 1NLUA 2O7NA 5BRAA 2E5LB 2QN8A 5CB4B 4N8DA 3VC2A 4KBGA 4FT4A 1YZHA 5CH3A 1NG1A 2WSYB 3JQCA 1M7BA 2QRKA 5REQA 1HQKA 3RK0A 2AQHA 3ZUGA 5HQTA 3D4OA 1QO0D 4C4PA 2JA1A 1TM7E 1BMTA 1CUBA 2I6QA 1JL3A 1KEEA 4KBYA 1Q17A 3EPHA 2OP1A 5LZ8A 3SQMA 1T5HX 5CB8A 2NTJA 4E2ZA 1SA0B 4LXIA 3MCAA 5T8KC 3G79A 3PX3A 4R1NA 1XD8A 4K86A 1GTSA 5AUQA 2HZ7A 2F8MA 2YBDA 3QV2A 3DZBA 3HSKA 3QITA 4NOLA 4KAFA 4C78A 5C8DA 2DFTA 5JZVA 1KYIA 2BZSA 1TMYA 1QU3A 3RIHA 4WINA 2F3TA 5HS6A 1N75A 1CDEA 3VU9B 4H3KB 2PUHA 4QT4A 2WJ6A 4Z4GA 3SS7X 1UEXC 3WK7A 1P72A 3N7AA 1AQNA 2V74B 2F48A 2OP0A 3AFHA 4U2BA 1ISIA 5IX8A 5KYWB 3K9QO 1ZXLA 3F5MA 1ADFA 1F8XA 1HT2E 5BUCA 2X1HA 4JR2A 3WRVA 3FFTA 821PA 3KKQA 4KQMA 1DKMA 1HYEA 1E2KA 2P6NA 3QK7A 1XA0A 1QMPA 5DIZA 1XCOA 5HCNA 3EVFA 1V1MB 2YV4A 3AEQB 1X80A 3A0RB 3BWYA 1BXGA 3G1TA 4RIEA 2Z95A 2J6BA 4DRYA 1CZKA 4NABA 3RU2A 2F1HA 2WSLA 4MUJA 4BTLA 1REQB 3SLKA 3NVMB 1USVA 3ZJVA 4OI1A 1VRCA 4RACA 1SXJA 3QA9A 4J03A 4Z4HA 5I01A 1K7CA 4MCAA 4EAQA 4OYYA 3IUYA 1D6SA 1Z47A 5FPSA 4NZ9A 4XTRA 5HEKA 4NV0A 3N6XA 1KEWA 3L7MA 1MG5A 1OTHA 4AQDA 2DFDA 4JU9A 1GNTA 3SJZA 2Z09A 4OBWA 3V1TC 5AHOA 4NFYA 2H9AA 3P97A 2PU5A 4OFXA 2ZR0A 2IITA 1I36A 1O58A 4CKWA 4HN4B 1DT5A 2MT9A 2B1JA 1C50A 2J32A 1DB3A 1W0KA 1VBFA 2YV2A 3PEEA 8LDHA 2QORA 4MTLA 4Z3OA 4NBLA 2PSHA 3B7WA 3ESDA 3TTVA 1DCFA 3H7IA 1EM8B 2LNDA 1O0BA 3FAZA 3GGSA 1MT3A 1TCUA 3O2NA 3OZAA 4KXNA 4L4SA 3W90A 5C52B 2M6RA 2R7NA 3CX4A 3KQTA 2Z57A 3CLUD 2C8KA 2Z1DA 3ONVA 5J2UF 2XBMA 4BGUA 1SWVA 2H0AA 4EMTA 1VSQA 3AGPA 2XUJA 4KAXA 1EIWA 3OM9A 1X13A 3RRBA 1D0IA 2CGEA 3MRTA 4DLUA 1S0UA 4BNKA 3HKBB 3BYZA 3DUFB 3HUUA 2O2XA 3KQMA 5C4IA 2DBVO 4MS1A 4RCZA 1UC5B 2I6SA 2VBFA 4DEVA 4M6WA 3IQEA 3CO0S 1Z74A 1UR5A 2GZSA 1V2HE 1PYOA 4QJBA 1Q0QA 1WZCA 3SZOA 3D2BA 2BGMA 2IYAA 2V55B 1ZESA 4KAAA 1Y4UA 2VH2A 5JCJA 1SC6A 2C3MA 2WAMA 1RYDA 4GC9A 5FYDA 5T5QA 1JGTA 1TKCA 1WW8A 2PMCA 2BFEB 3HN6A 4P7FA 1E32A 2GYWA 2J6CA 4MI3A 4PWYA 3NV7A 1U7PA 2BFBA 4IHJA 1JLLA 3SR4A 3ZGYA 2FZGA 4EGSA 3VTAA 4MB0A 1ZD2P 1OD6A 4QPPA 3G2QA 3RJ9A 2OORA 3STYA 1U0NA 2I7XA 1KJYA 3CKMA 1UOEA 3NOXA 4LHZA 2FXIA 4R1TA 1PR5A 3RRYA 3LAWA 4CRWB 2VNSA 4FC7A 2JZNA 3GLIA 2QZ4A 4J1SA 4QRHA 2OCBA 4ESVA 2CMKA 2XYQA 1RWOA 4IW3B 2GJAA 1WXFA 1NVKA 2PD4A 3H75A 1T5LA 1FDTA 1W88A 2L19A 4JL5A 3RT1A 5BN4A 3OFND 5EUQB 5F9FA 5SY9A 3SX0A 3IBFA 1BU5A 5EEHA 1OAKA 1B74A 4P7KA 4Q1FA 1WVGA 4E13A 3OE4A 3FLEA 4B4OA 2Q27A 2VP4A 4I36A 3DPSA 1POWA 2DKFA 1XTUA 4KXXA 4NHEA 4ZOLA 3R8CA 1CQIA 2H2FA 1HE2A 2FGJA 5BN1A 3OZFA 5TNXA 1SCAA 1LSUA 5FEMA 2Z2ZA 4RD4A 1NVUQ 3HZZA 4QO7A 5FOXA 1SR8A 1MQAA 1II0A 1KI3A 1P6UA 3GPIA 4URHA 5HCUA 1SVIA 1XQXA 4L95C 5KU1A 2NZYA 4CLRA 3C16C 1Y9AA 2JAWA 3AP2A 4DA9A 1JEYB 4ZU1X 1DIGA 2FKNA 4IUCS 2JHAA 3MWEB 4PNEA 2C0CA 4MW9A 1T1SA 1EJ2A 2ETXA 1IEQA 2POQX 1MO4A 2QMEA 2RHGB 1HKHA 3A28A 3LOUA 1W5FA 4INOA 4IOLA 5JDCC 1M33A 4Z7NB 1P1CA 2BKEA 2JLAA 2EKPA 3L9XA 3G2MA 4ON9A 4PS0A 3GFTA 1P0QA 1DG3A 2LIPA 4PZYA 5G4KB 1ISHA 1J42A 1J2JA 2WJWA 4GC5A 1GT91 3LCUA 4X20B 3VSAA 5KOHA 1YAJA 3GEEA 4YB8A 1QIHA 1MTOA 2N46A 2IBSA 2G1PA 4MA0A 2TYSB 3L4BC 1JYEA 3ZXUB 5AVQA 5GIPE 1JKMA 3HYSA 1I33A 1G21A 3M1IA 2HQBA 3FW1A 5HPYB 3QPVA 3AWIA 1XNJA 4AJOA 2PKQP 1D9XA 1YR2A 2FJPA 2SKCA 5F1PA 2ZYIA 5JH7F 2HRBA 4DY4A 4HFRA 4YFVA 5HTKA 4X84A 3CUVA 2F3UA 1LRLA 4WSOA 1GLNA 4XJVA 3VKFA 2OXTA 4ASUD 1W4RA 2NZ8A 3THWB 4O0LA 4C2UA 2XIQA 1T6ZA 2ATIA 3AF6A 5FA8A 1YDEA 1AKVA 1OQAA 3AF3A 1M1NA 2VYCA 3Q0EA 3F6SA 2D06A 4NCHA 3SWWA 2Y99A 4QJIA 5BOSB 1J9GA 1ZLYA 3FZEA 5E9AA 1UIMA 4HD8A 1GKLA 2ZRGA 5CM9C 2PZMA 1FEZA 3A1UA 4KO2S 1N0UA 2QV0A 3EXEA 5GONB 3VAZA 2QVGA 3RRNA 2H1OA 1TF5A 2FNAA 2C0PA 3IV6A 4ZC1A 2VT6A 1HDGO 3C1UA 3C6MA 3KT6A 4OKSA 3U3RA 2FQQA 1Z29A 3ETJA 3MOIA 4ZV7A 3Q12A 1CZHA 1X70A 4CG2A 1XMXA 4G97A 3S2UA 1XKQA 2R7MA 1OI4A 3NAGA 1ZAKA 5FA6A 4C01A 1G63A 1SU6A 2JBAB 3LC7O 4X54A 2N0SA 2BCEA 1S7CA 4YO7A 1EXNA 1PQYA 3I34X 3SMQA 4A6EA 4QATA 5I9IA 4PHTA 3D7NA 3H5WA 3A2KA 4GLOA 1SVOA 3RSLA 2AE2A 4KQXA 1NQOA 1UANA 3VYWA 2G0AA 2YNMC 1IONA 1KMMA 5EEGA 4ND3A 3HXOA 5B12A 4ABTA 2NQ2C 5G40A 3T9CA 2HJHA 1U2SA 1B6RA 5HIMA 5EKUA 4V2IA 4MUXA 5KJCA 4QDZA 1M2JA 1TAUA 5IC5A 1O5OA 1U6KA 3IXLA 1N2GA 2OHIA 3B1YA 1FDSA 2J3JA 3P27A 3PC3A 4L7QA 3CB2A 4C87A 2YYSA 1G8JA 2JCSA 3C2QA 1PEYA 1H05A 4FYXA 2CNKA 3EK2A 4NZYA 4QVGA 2VBGA 1F3LA 1EWRA 4OLFA 3H11B 4C6HA 1E4OA 3NT5A 3Q0IA 3C39A 2QGNA 3B9QA 4GWKA 1L7DA 3VR2D 3ZEAA 2FDRA 3O9MA 1Z5ZA 3MUEA 3K96A 3SS9X 1J21A 4HVAA 4D4MA 4DQVA 4KDRA 2RHMA 2AEEA 4TUYB 2CFOA 1RC0A 4F56A 3MWFA 4LFAB 1NJ5A 1VIYA 2CJYA 2WU0A 5KREA 1RQRA 3TQQA 3I6YA 1IMJA 3OPYA 5I8WA 3HYLA 4FEAA 4MKIA 3ZJYA 2BN4A 2O3SA 1X3SA 3WICA 2ODQA 1RKQA 2QY9A 3E7WA 4M1WA 1RHKA 4DR4B 2YC4C 1Y42X 3K5PA 4G1EB 1UAAA 1IC6A 4I3FA 1ONNA 3DQQA 1T3SA 3W2IA 1XJ5A 3GPCA 5C37A 1M5TA 4EQZA 4Q7MB 4E03A 1NHGA 3QLEA 4BQFA 3D6NB 5B58T 5CGZA 3BXXA 2P9EA 1IQPA 4KIFA 4YMIA 4NBKA 1Y8AA 3K7EA 3G5TA 3DLHA 3JPYA 4KOAA 2JVIA 3JZDA 4X92A 2BI4A 3N8IA 1KS2A 5DCLA 1NI4B 5JS1A 5CJ2A 1DQZA 2EDAA 1SEVA 3E7PA 2HN9A 5F52A 3WLHA 1G5IA 3F