2FU5C

Structure of rab8 in complex with mss4
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
176
structure length
146
Chain Sequence
KTYDYLFKLLLIGDSGVTFISTIGIDFKIRTIELDGKRIKLQIWDTTTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKVNDKRQVSKERGEKLALDYGIKFMETSAINVENAFFTLARDIKAKMDKNWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nucleotide exchange via local protein unfolding-structure of Rab8 in complex with MSS4
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Guanine nucleotide exchange factor MSS4
total genus 45
structure length 146
sequence length 176
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2fu5C00
3ZQJA 2P0EA 5IK2D 2YNMA 4KVAA 1U98A 3PUVA 1JI0A 2QQEA 1E1RD 3TVTA 1P60A 2QAGA 1IXSB 4KLZA 2VSOA 3GPLA 4QRHA 1ZIPA 1OKKD 1E2NA 3A1VA 4QHSA 4DJTA 1G1MA 4LPKA 1RVDA 4IXNA 1ZUNB 1KAOA 4EPXA 1R2QA 2WJHA 3CWQA 3EZ7A 4ILEA 1DAMA 4DLZA 4MKHA 4FMBB 4F38A 1CJTC 1T3LA 1Z0FA 1CJKC 3AKEA 1KDRA 4Z1MA 2D2FA 2D4HA 1A1VA 5FBLB 5IK2A 4EDHA 1ESNA 1G5PA 4LUCA 2V1UA 2ZRNA 1NNEA 1U8ZA 4PC6A 1OHHD 4H9GA 3GCGA 3U44B 3GLIB 4LV6A 3TBKA 1U9IA 3MRSA 3P20A 2N46A 1XWIA 3A1UA 1E2KA 4ON9A 1J8YF 2HJGA 1NMXA 2ZS9A 1CRPA 4URYR 4UJ3A 1XX6A 1KOFA 2ZS7A 1GRQA 4PPGA 2VP4A 4ZCLA 4X8LA 4U02A 4L15A 1UF9A 3VFDA 2IUSA 3D3QA 2FF7A 4B33A 5JWOA 4FMCF 3B6EA 3TSWA 2CE7A 1Z2AA 2CHQA 2HLDA 1LVGA 2OE2A 2W6JD 4TLCA 4A9AA 2EFCB 2HF9A 4R9UC 4TLDA 3IQXA 2W2XA 1CF4A 2WWYA 1G8FA 2WICA 2D62A 2V4ZA 4MGIR 1M7BA 2YINC 4BFYA 1Z8FA 3WMEA 4M53A 2Z0MA 1UFQA 1TNDA 1KMQA 1GKYA 4NBSA 4YONB 4LBZA 5KSZA 5AUQA 2HYDA 1G6HA 3EZ2A 4GP6A 4QHYA 2EFGA 3LA6A 1Q21A 3VR4A 5ELXA 2QP4A 4W9MC 3CR7A 1FX0B 1XF9A 3UIEA 1KZ7B 2XNSA 2FGKA 4FD2A 4BWYA 1Z08A 3B78A 3GJ8A 4Q1BA 821PA 3UG6A 5HCNA 1N6KA 1KHTA 2J3EA 4I1OA 1TADA 4V0LA 4BZXA 5JJKA 1JNYA 3KJEA 4RFSA 4I4LA 2QM7A 3I4LA 1GNRA 2BDTA 1HTWA 1GKIA 1IY1A 4PHFA 4FIDA 4GL2A 4B75A 2ZRBA 2WTUA 4TT3D 5KYKA 3H2YA 4IOMA 1YJ5A 3LW8A 1ZMXA 2EQBA 1N6HA 3DOEA 3SFVA 4LC1A 4JVNA 4DXAA 2HUPA 3PEYA 1R0YA 3BE4A 4BRWA 1U8YA 1CR4A 1VG9B 2CHGA 3CF2A 2QTFA 3T5DA 4JL6A 1IN5A 1KSHA 2B92A 1ZUIA 3K0EA 4HUQA 5LB2A 1AS2A 4TMTA 2W2VA 4YXWD 2VYFA 3R8CA 1CTQA 3VU9B 2JAQA 4IDHA 2VEDA 2ZJ5A 3K70B 4CEHA 3FGNA 3MWYW 3Q5DA 3RWOA 2LKDA 3J81k 2YWHA 2FGJA 2WOOA 2RGXA 1OHHA 2RGCA 2IYXA 2RMKA 2XTNA 3X1DA 2XXAA 2VH5R 2ZITA 2MSDB 1QHIA 3GFPA 3AKCA 1Q1BA 2VO1A 1TMKA 5EUMA 3RNLA 2ZE6A 2GEDA 1E99A 4BLOA 5DNYB 4B43A 4AYTA 1IHUA 2WWWA 5AJZA 3C15C 5CJPA 3W5JA 2CCGA 3GEEA 1GRNA 3CO5A 4NZYA 2J46A 4CVNA 1AS0A 5HE9A 3FKSA 4DVGA 2IHYA 5CB6A 4LK2A 3B7GA 4C0SA 4P4TA 2W6IA 1NN5A 4E09A 2RAPA 4U7DA 1AKYA 1BYIA 3QY0A 1Z63A 2GAAA 3A1TA 1JECA 4MYCA 2QT0A 1WDTA 2LKCA 1JALA 2C99A 2F9MA 2JGNA 2C8VA 1QDEA 2RGEA 4CW7A 2O0JA 3FMPB 4PQFA 2ZRJA 5EE3A 2JLUA 1E0KA 2XGJA 2IT1A 1G64A 4BE7B 1E2MA 3B8HA 2FFBA 1IXZA 1W46A 2QMOA 1QG2A 2W58A 4WA7A 4ZDWA 1VMAA 2WJVA 2IK8A 1K8RA 3B82A 3K9HA 3Q3JB 1SVLA 3FFAA 1KK3A 5E95A 4C3ZA 3GLFB 1XCGB 3NBZC 3GLGA 4AURA 2Z83A 2OBNA 2A78A 4RZ3A 2NZJA 2MSEB 3OAAA 2VSFA 2PBRA 1XB2A 1CR2A 4CT4B 3K09C 3NH9A 3S1AB 1MR3F 4RD6A 4XOIA 3K0SA 1XEWY 3NEYA 2GJ9A 2N1BA 1YR8A 1DAHA 4OHXA 1Z22A 1YZKA 3SDZA 3U7EB 1DO0A 1XMJA 2IXGA 2Q6TA 1KI6B 2WM9B 2ORWA 3NHBA 4BRUA 4FN5A 4D80A 4EKDA 3ZYCA 3ADCA 2VP9A 1VCIA 2IF0A 4PX9A 3VMFA 4JJKA 3TKLA 3GLGB 1N0WA 3CX8A 4LRWA 3Q7PA 3SBDA 4LJ8A 2FN4A 3T1QA 2VQSA 2ATVA 2DWOA 1N6LA 3T34A 2ANCA 5AK0A 3SFZA 1Z6TA 4OQXA 3D8BA 5EE1A 5H70A 1E0JA 2XZLA 1W4BA 3TIFA 3TMKA 3E2IA 5EP1A 1RRGA 4LZZA 2OESA 1WRBA 4P33A 5FFMA 4IDPA 3EWAA 3BH0A 1EFRD 3ND8A 4Q48A 5BQ5A 4OYHA 2LCFA 2QE7D 2C04A 3OEHA 4PAMA 4LDJA 1J99A 1X1RA 4DT1A 1P9RA 4XTRA 1KTVA 3EG5A 2BHRA 2OCBA 2FPLA 4PSAA 1E2IA 4XSGA 1M2OB 2GBLA 2G1JA 4LYJA 4DWJA 5JS8A 2G9NA 4A92A 4IFEA 2QENA 4MKFA 2G0TA 2YVUA 1NVXQ 4JBYA 4EPYA 5FUYA 4BLRA 4C0BA 2VHTA 1WQ1R 3THXB 4TZ6A 4KI0A 3AEZA 2OFXA 1GNQA 1JAIA 2KBFA 4R2IA 4DSOA 1Z29A 1Y63A 2QQ0A 3K8YA 4DLUA 1E9AA 3LWNA 5LDDC 3CPHA 1CJMA 4TL9A 2JJ1A 5IDVA 1GM5A 2RCNA 4IDQA 1B23P 1XD2A 4NYJR 1EGAA 2C96A 5CIQA 1TX4B 3VX4A 5L8VA 2GBLC 2LWIA 3O8CA 2P6RA 1TU4A 3DL0A 4PO8A 3QKUA 4QNMA 4BFZA 1N5JA 3TW8B 5KPDA 1N25A 1AKEA 3A4LA 2WPDA 3QENA 1X3SA 3LBIA 3GMTA 5DIFA 4MGZR 3SYKA 1R4AA 1Z07A 3IBYA 1YR9A 2AN9A 3PR1A 4Q4AB 2QP3A 1P2VA 5FUVA 3ZZUA 4DKXA 5HKKA 4M22A 3W6NA 3I5XA 4QM7A 1CULC 3L82B 4QGHA 1BMFD 1UBGA 3SHFA 2PEZA 1V5WA 4WAUA 1D5CA 2XNDA 5KDOA 4CEIB 3WHKA 4PZZA 4AC9A 4M0LA 2JLRA 1G3UA 3N70A 5KTYA 1Z2CA 3N2EA 1FW6A 2CLSA 4JKIA 1NBMA 4IVRA 1T0HB 1OT3A 1ZCBA 1ZNYA 2ZR9A 3I5YA 3QE0A 3RSLA 4A2PA 3ZVLA 4TYQA 4TSFA 1DAEA 2QG6A 2DFKB 1S1CA 2ZE8A 3AGQA 1F60A 4NL4H 3BB3A 3AVUA 5G3ZA 1YRBA 4IJMA 2R2AA 2AKAB 3BAFA 1CR1A 3P32A 3PEUA 4S35A 5DI9A 2YC2C 2IS6A 2BBSA 4A8JB 2R6CA 4M4SA 2OV2A 3DM9B 5DN6D 3FMFA 5K8TA 4JBWA 1FTSA 3CRMA 5JLJA 4ARZA 2YJTD 2F43B 3BORA 5BXQC 2FOLA 1E9CA 1ZVQA 4MDEA 4TLEA 4DLRA 3QF4A 2KB0A 5DE3A 1S8FA 1XZQA 2ZRDA 3PFIA 3D7MA 1NJGA 5K8IA 3AF0A 2IS1A 1P9NA 2PX3A 3KFVA 2H5EA 4PSKA 3LV8A 2ZJYA 4NH0A 2PZGA 3EPLA 1H8HD 1SXJA 5FR2A 3LRPA 3JZMA 1HQCA 4GDFA 4ESHA 5HCIA 3QG1A 2GXAA 4G5OA 2WV9A 3QF4B 1EK0A 4D0GA 3TR5A 3SHWA 1G3RA 4BFVA 2CLCX 5LBIA 4V03A 4HAXA 4OI0A 5C46F 2DB3A 2ZI7A 5EXPA 5JJLA 2FNAA 2F3TA 1JR3A 4HEJA 1HA3A 2I1QA 1NG1A 2XSZD 3ASYA 2ZJBA 4YMSA 3RDPA 3THWB 2ORIA 1VTKA 1M74A 2ZETA 3AGPA 3NEJA 5KNCA 4TYNA 1LB1B 3IPYA 2IWRA 2AK3A 1YZTA 3VHXA 1N0VC 2A30A 1KI1A 3CRVA 3GFTA 4F4CA 1LY1A 3AKDA 4JLBA 4FCVA 4CEJA 1XRJA 1A2KC 3N2IA 2GDJA 2RB4A 4NMMA 3GJ7A 5GADl 3WYGA 1OE0A 4JLDA 2IW3A 5H68A 2H1LA 3EZ9A 5DYIA 2A5JA 2OO7A 5A0FA 2IX3A 5DYGA 1RRCA 2JIZD 1KMHA 4Q7MB 2NGRA 8OHMA 2WOJA 2DCUA 1HE1C 2P67A 3QIAA 2GAOA 3JVVA 4A0HA 4O2LA 4LJAA 2ZRIA 1NL3A 2EWVA 2Z6VA 2J0UA 3CZQA 3IO5A 4TQAA 4AKIA 1W7AA 2QM8A 4KHZA 4A6PA 4LHXA 4UNPA 4WBSA 5TXGA 4BECA 5J5CA 1DELA 4NYMQ 4BZQA 2FA9A 1T0JB 1NKTA 2NTYC 1T91A 4MYTA 5ANRB 4BFXA 2J0QA 1MABB 3LLUA 4EFNA 2QA5A 3GJ3A 2OBLA 4NHOA 5C1BA 2WVJA 1JEEA 5FTKA 3K0FA 1ZCAA 2ZM5A 4TT3A 2NIPA 4UNQA 1HH4A 1S3SA 4Y0AA 3K0CC 1NIJA 3B1WA 2BJWA 3CLVA 3RS2A 3JZAA 1XEXA 1IY2A 3A8TA 1JPJA 3DMNA 1N5IA 2XB4A 4LI0A 2XOKA 3OE7D 3X1ZA 4XD7A 3EW9A 1ZP6A 3BJIC 5EP2A 5AJWA 5L3QA 3NIBA 4NCIA 4EPVA 3RRNA 4X8HA 4LBVA 1U9IC 4Q4HA 3C8UA 4Q4LA 4QJ5A 1NBME 3VAAA 3O8RA 2X77A 1SQ5A 1SVMA 2YWGA 2O8DB 3CPJB 2XTMA 4TYWA 4PAOA 4LBWA 4UXIA 2VL7A 1ZM4A 2CNWA 4M1WA 3UMRA 5KU1A 3P26A 4BQSA 1XP8A 4Q03A 5JEDA 1HT2E 2ERXA 2XZPA 3K9NA 2ZYUX 4EIWA 2O8FB 2ZAMA 4OQFA 5C4GB 3THYA 3H0KA 4HB4A 3K09A 1A2BA 1WB9A 3BH7A 5JS7A 3G82C 3QXJA 4JYCA 4KAXA 4C2UA 2GVZC 3OIYA 4P0TA 3WNBA 3FHTA 2HDNB 3Q8XB 2ZSFA 3M1IA 4F7WA 2FFAA 2CJWB 1G3IA 3LXRA 3ZH9B 1PZNA 1KI8A 2OXCA 3PQCA 3MD0A 2F55A 3CPEA 4V0NA 4LYFA 1KAGA 2IS2A 1P62B 2O0KA 3KTAA 1B0UA 5FOXA 1OB5A 3GLFA 1DS6A 2JLZA 5FOUA 3GD7A 3M4YA 3DMDA 1SXJE 4MKGA 4C7OB 2QTHA 1U90A 3RABA 4TL7A 4MA4A 3ZIAD 4AYXA 3RLFA 3ZZTA 2REXB 2HXSA 2OFWA 4DDTA 1S3GA 4U00A 3P27A 2WWIA 1FUKA 2GTPA 3WP1B 1VYVA 4X8OA 1YZUA 1DVRA 2FSGA 2ERYA 3HPRA 3MWJA 4Q18A 1E9EA 4HLUA 2WSMA 4B2IA 3ADDA 3BB4A 4FW9A 1L2TA 4DUGA 1ZNXA 3QUSA 5KOYA 1JR3E 3SC3A 4ZDIA 2JLXA 1AGPA 2K5UA 3SZRA 1C4OA 2XJ4A 4B3DA 4CF7A 1SKYE 1Q1QA 3F0TA 1P4SA 1Z83A 1MH1A 3FVQA 2IBMA 3W3AA 1T9HA 3OEEA 1MRSA 3I32A 1W44A 2ZSAA 4JLOA 3X1YA 5FTNA 3VX3A 2A7QA 4LHYA 1GRRA 3SN6A 5K8LA 3AB3A 1WF3A 3NG1A 5DN6A 1NLYA 1YVDA 4K8OA 5D3MB 3DO6A 4URWR 5A5GA 2ZJZA 3R9IA 3U5ZB 5L3SB 1VG1A 4EQ6A 1E2EA 2NO0A 2B6HA 3TNFA 1VCNA 2V6IA 1ESMA 4US2R 2CL7X 3C5HA 1PJRA 2Z4RA 1N6PA 3SJAA 3FFBA 3IILA 1OSNA 4L8GA 3LX8A 2GCNA 1SZPA 1HT1E 4BFTA 1KDPA 4XVQA 5DH9A 2FMXA 3QJYA 4TZ0A 1G8PA 5KDDA 4M9QA 2RH5A 1E9BA 1D2NA 4LY6A 3CNNA 1SVKA 3I92A 4UXJA 1WA5A 2CK3D 1PV4A 2O8EA 1Z0DA 3QEJA 2WJYA 5C2JB 1K5GA 4HZIA 1E3MA 2NO6A 3RSOA 4ABYA 1JPNA 1TEXA 2XX3A 5HR5A 1ZRHA 1MO5A 2J0VA 2XSZA 4RD0A 4LHVA 4B74A 3QXCA 4M1OA 3LQRA 4YMWA 2OLKA 1G17A 2ZJOA 1XZPA 4NDZA 3PITA 2QROA 4OK5A 3L0IB 5F2EA 4TMKA 3EZFA 2IS4A 3CZPA 3K0AA 4DUGD 4ZIRB 1E2FA 4C0JA 4HI0E 2O8EB 3O8DA 4AG6A 1XJQA 1XD9A 3QG5A 2CXXA 3EXAA 2D7DA 4YDSA 2CCJA 4ASUA 1YE8A 1U0JA 2ZRAA 3OIWA 1P9WA 4GBMA 5GVSA 2O8BA 2P6NA 1E2JA 2WSSD 1XPUA 2BBWA 2MMCA 2WIBA 3L0OA 1Z3IX 1E9SA 5BYJA 1HUQA 3NH6A 1TPZA 1NLZA 2KWIA 2XB2A 1OXVA 1YZGA 3U3KA 5F9HA 4DB2A 1T5LA 1ZD1A 4G5SA 3ZQ6A 3HYTA 4A4DA 4LV8B 5FI0B 1TF7A 1XTJA 721PA 2ZRFA 4FCWA 2KBEA 1US8A 1OFIA 5AJVB 3SOPA 3A37A 4B73A 1P7CA 2W6JA 3PUYA 1WCV1 2IYTA 4NCNA 2GWHA 3BERA 4D2IA 1HY3A 2UZIR 5KNDA 1M7GA 1N6NA 2AX4A 1KI2A 2WIAA 3GLFE 1CU1A 1JR3D 1BO6A 4A36A 2B7CA 2ZYTX 3IKJA 3L8YA 4KYIB 4TSFD 2QBYA 2WKPA 3RVBA 4W7SA 1T3HA 1XJ0A 2EU8A 3RS0A 4OQNA 3TSOA 1IBRA 1W47A 2VF8A 1E0AA 1E94E 2GESA 2F43A 3BC1A 3CNOA 3PXGA 3W5IA 1NY5A 2XJ9A 4OHYA 4TWZA 5AUNB 2JLVA 3ECCA 1QHHA 1SXJD 3AF2A 2JJ8A 4BLTA 4MGYR 1OFHA 3KZ1E 4JBXA 2A5FA 1FZQA 5E7JA 4AI6A 4CDGA 3H4MA 3BS4A 4FWIB 4PZYA 4KO8A 4PPFA 3TSZA 1Z0KA 1ZU4A 4URVR 4Q1DA 1UKZA 5FBWB 3F8TA 4BLPA 1ANKA 2ASEA 4Q1CA 3ICEA 1U2RA 1KK1A 4DZZA 2V8OA 3CX6A 3DOFA 3WRXC 1CKEA 3KKOA 3I8SA 4Q1EA 3W8RA 3U7HB 3C14C 4MUBA 4CEIA 1UM8A 4L5BA 1IN6A 1IY0A 1H8ED 2NO9A 3P4XA 4PC3A 1FNMA 1MOZA 2B21A 4LJ4A 3NWJA 2PCJA 4D4LA 5G3YA 3B1XA 1JQLB 3OESA 4C30A 2QGNA 2ZRLA 2JLYA 1WBDA 2YHSA 2ZR0A 3SE0A 3VKWA 4B3GA 1KO1A 2OZEA 4KFSA 2Z5FA 2PH1A 2RGGA 2WWGA 3NC0C 2IYUA 1FNNA 2OAQ1 4CEJB 4G1UC 1Q20A 5E3HA 2HCBA 1YR6A 5FL3A 3A4NA 1UKEA 2X2EA 4DIEA 3AUYA 2GHIA 4MGKR 3T1OA 3U7GA 4I1VA 4PR0A 1YZNA 1S4QA 3IBGA 4H1VA 2FG5A 4ARZB 4UQOA 3AVTA 4E03A 5E7IA 1XXHA 4KCGA 2FPMA 4HAZA 2KI5A 3U2QA 5FBQB 2ZJAA 2P6UA 3FDIA 1XEFA 3KJGA 4F92B 4L9WA 5JMTA 1XDBA 4O25A 1W48A 1JJVA 4I1SA 4WIAA 5FBRB 1UBCA 1VHTA 1Z47A 3IHLA 3D31A 3TH5A 1G7RA 1X6VA 3QOFA 2EFEB 4LCBA 3K0CA 2JEOA 3KXIA 1KY2A 3UG7A 2RGNA 1JXOA 3QKRB 3ND9A 4WZBE 3TQFA 1COWD 1T8TA 2C2HA 4MRNA 1MABA 2Z43A 3GLIE 5HTKA 2IC5A 1TEVA 2H92A 4FWTA 2GK6A 3R9XA 3DEFA 2Q9BA 4TLBA 2R9VA 2JDIA 4ZI3A 2WWHA 5EJEA 2IA5A 1UBFA 1QRAA 1IXRC 1OF1A 2WAYA 3AVYA 3O8BA 2EVWX 4DIDA 5BYKA 1W5SA 3FHCB 2CBZA 3GLGE 5CB8A 2NO1A 5JECA 3U60B 4LSGA 1D8TA 4DLTA 4DSTA 2PCLA 4LOAA 4HB3A 1EWQA 2DFNA 2H7VA 4L9SA 2GCPA 1VYUA 4JLPA 2OAP1 4QXAA 4ACAA 3LVQE 3OIUA 1HYQA 1DBSA 1FP7A 4BPBA 2IXEA 4CIDA 2ECKA 2ODBA 4M2LA 4MQBA 5CJ2A 1TL7C 4HLDA 1G3MA 5G41A 1QHYA 5FR1A 5IT5A 5TY0A 3EPJA 4MRSA 4IOJA 5B57C 2GCOB 4D82A 3RAPR 5FOSA 3PUXA 2VHCA 4D26A 1OJLA 4LJYA 3ZGXA 4LBYA 1N0UA 4KFUA 2IYLD 2I1VB 1E69A 2QRNA 2ZVPX 3AVPA 2D2EA 4XWAA 3K53A 3UATA 2VHUA 1NBMD 3CF0A 4PZLA 3LX5A 1G8GA 4P4SB 1G21E 2D74A 2W6ID 4OHWA 1F6BA 2G1KA 1Q44A 1RIFA 4I81A 2WZQA 4UJ5A 1C9KA 4D4JA 2BC9A 3L8ZA 1GG2A 4JT4A 3TUJC 2VRWA 2OXRA 2W83A 3GJ5A 2CVFA 3KXKA 3I72A 2F9LA 3AVXA 4B3CA 1Z0JA 5JFGA 3NBFA 2IEYA 4AY2A 4R7ZA 2P65A 4B2PA 4M9SA 5P21A 5SZIA 2YYZA 1GZSA 2DHRA 2NZ8A 5F98A 2QMHA 5M04A 3AP1A 3CB4A 2BM0A 2GF9A 4A8JA 1W2HA 2ODEA 2REOA 3QBTA 3FOZA 4UKDA 1NN1A 3MFYA 1A4RA 1N6IA 2IEZA 2IYZA 4IRUB 4A6XA 2WMNB 1W4RA 1W36B 3OFND 2VBCA 3Q7QA 3T06B 1JB1A 1HE8B 1XNJA 3ADBA 5KPJA 1DO2A 4HAUA 2J87A 2IL1A 4AIIA 4F91B 3RS3A 3ZS9A 4JT2A 3REGA 1XXHE 4JLKA 3EAQA 1N3BA 3L43A 4MRRA 5CK4A 3RC8A 4IXMA 3U3MA 4TYYA 4Q7KA 1GKUB 1E32A 3OEHD 3QEOA 2R6DA 4IOLA 3LD9A 3R7WA 3R8FA 1KI6A 4HDOB 3AVVA 1P61B 4HUQB 2AFHE 4TMZA 5CIWA 3W9YA 4WXPA 1D2MA 2ZEJA 3UWKA 1N5KA 2GETA 2WSSA 4A82A 3GLIA 3LXXA 1R0XA 2P5SA 4ASUD 3DZ8A 1R0ZA 4Q9KA 1G7TA 1CP2A 1VCMA 5EXTA 4NYJQ 4LYHA 1G16A 5CLLA 5J47A 4XSHA 1LW7A 2RGDA 2W00A 3R7WB 3WBKA 3HYRA 3CUEF 1DG3A 5KO2A 5JWHA 3UMFA 2FH5B 1G7SA 4RD2A 5FOVA 2AD1A 4NYMR 4HSEA 5CM9C 2QTVB 1OV4A 3EA0A 5DO9A 1W36C 3HU2A 4WXRA 2BCJQ 4JL8A 4OKSA 2WJJA 1HV8A 4DCSA 1XMIA 1EESA 2WJGA 4DSNA 4J0QA 2FSIA 3BRWD 1DG1G 1W1WA 1XTIA 4GPTA 4P32A 3X2SA 4PSVA 3WNCA 2ZI9A 5H1YA 3UWOA 1BYUA 1M7HA 2VP6A 1SGWA 4I1UA 3VR5A 4OQLA 1XPOA 3K70C 1NY6A 2J59A 1OIWA 5DI3B 1MO4A 4G5RA 3IEVA 3BOSA 1DTSA 1MV5A 3RC3A 4W5WA 1GOTA 1FOEB 1GL6A 4CGZA 3OHMA 2EW1A 2GXQA 5KSPA 1FP6A 3UANA 4QBGB 4Q4JA 1Z06A 4TQ9A 2AXNA 4C0KA 1RE0A 1G8YA 3AP3A 2VP5A 3IDQA 4EJSA 2C98A 3T1VA 2UKDA 3FB4A 2A3RA 4MKIA 5J40A 5FH9A 2KE5A 1X8JA 4GNKA 3S1AA 5G40A 1CBUA 1NN0A 1Q1EA 2C03A 4XVRA 2ZI3A 4CZ2A 2VF7A 4IKEA 4TTQA 2QBYB 3KKNA 3TJZA 4Q19A 2BKEA 1BS1A 5J4VA 3T5GA 2V7QA 3LH5A 4KV9A 1TUEA 4LHZA 1M34E 2YWFA 2NOAA 1E2HA 4DEYA 2CK3A 1IJFA 4C4PA 4WOPA 4LV5B 1KO5A 2AK2A 5SZHB 2HLDD 5TARA 1QHHB 5JCZA 4BASA 3VR6A 1GFIA 4KITB 1IJEA 3GQBA 2QPAA 4RVCA 4TL8A 5CK5A 4UNNA 4KBGA 1II0A 1G20E 1OXUA 3U4QB 1NVVQ 2PT7A 1AIPA 4NCHA 1LNZA 5GVRA 1OPXA 1G6OA 2BJVA 3OFNA 1DAKA 4R98A 2A5YB 1E1QA 1KO8A 2GJSA 4N0EA 2ZUCA 3CRW1 2MMGA 2XXAB 3EPKA 1WE2A 5TVKA 1SVWA 3HDTA 4D0LB 2N42A 3FKQA 4PTLA 3SYNA 3T12A 1H65A 1F2TB 2ZI6A 1P73A 2J5XA 2GF0A 4OHZA 2F1RA 3NVAA 4HDQB 1G3QA 1KO7A 4DRZA 2C9CA 2ZAOA 4PPNA 3ZLJA 2J41A 3U61B 3FMIA 1NKSA 1RFLA 4B35A 5C4MA 3F5FA 3H86A 4D4KA 2AKYA 2GXSA 5CYOA 2DBYA 5EE9A 5HE8A 4NE2A 1EXMA 1MT0A 1J2JA 1GDDA 3IPXA 3BXZA 4IW3B 3TUZC 1L7VC 1R0WA 2BIFA 1OKKA 2CNWD 4M1SA 2FZ4A 4GSYA 4HDCA 3RYTC 4Q1FA 1AQUA 1OB2A 1ELOA 1CIPA 1RJ9B 4G3XA 2ZTSA 1CS4C 2XITA 1UBEA 4EPWA 1G4AE 2J7PD 3TK1A 4DT1B 4D4MA 621PA 4L4UA 4TN1A 2NMVA 3U6BA 4QNRA 1DOAA 4ZCIA 3ETLA 5AJXA 4D6PA 3TQCA 1Z0AA 5IF9A 2VP0A 3QQ5A 1TQDA 4HZUB 1LTQA 3A4MA 1T3SA 1PUJA 1T6NA 2ZI5A 3NTUA 4D81A 4ZDJA 2QAJA 3THXA 1DEKA 1SKQA 4PC2A 2AXPA 1W4CA 5J4YA 1NMZA 1TU3A 1RJ9A 2C9OA 2FJUA 3OIVA 4O0MA 3LW7A 4A1FA 2Y8EA 1D6JA 3CNLA 1IN8A 1M8PA 2A5GA 2BCGY 1G7CA 1LF5A 4URXR 1W4AA 4G5GA 2YWEA 2ZVQX 3K9GA 3KL4A 2TMKA 2G6BA 2V54A 3QKSA 4DBLC 4M8NE 1P2TA 2ODWA 3BGWA 4JMPA 4WVFA 3HU1A 2VA8A 4JKYA 4FCTA 4KU4A 2AWNA 2IYQA 3VHLB 1ZC3A 4PHTA 3V4RA 4V0MA 1SHKA 5AUPB 4XJXA 1E1QD 1L4UA 4UXHA 1NRJB 2G77B 3U3RA 1IM2A 4G0NA 5JRZA 1LS6A 3EIHA 1Q0UA 1RYFA 2RHMA 2ZRGA 3H84A 4QL3A 4RZUA 1QVRA 3PEWA 2J7KA 2P3SA 3A1WA 1ZM3A 3ZS8A 3NBYC 4YQFA 2ZUDA 3SS8A 1D9XA 3MWKA 4XD7D 1QG4A 4LX0A 1I4DD 3QNUA 1NVVR 2CLDX 4POAA 3W8NA 3E70C 2QL6A 1FL9A 3OEED 4QFMA 1DAGA 3AVQA 2A9KA 2EFHB 1SKYB 4LWZA 4P4UA 3GLHA 1X8LA 1Y3AA 4AD8A 2RGBA 3DM5A 2VIIA 2ZU6A 5CM8B 1OW3B 4IEIA 4Q1AA 4XH9B 3LFUA 3LBHA 4LHWA 2QPOA 3HJNA 1W0KD 3TE6A 5B64A 4ACBA 2GJKA 2QAGB 3QF7A 2PJZA 1W0JA 3QXSA 1E2DA 3W34A 4FMDB 4G5QA 2ANBA 1IN4A 1XTSA 3T35A 1OIXA 4DCUA 2DWQA 5CDFE 5FUXA 3IHWA 5FOTA 4CYMA 1LF0A 4GRAA 2H16A 4M9XA 2HT1A 1US8B 3VQTA 4Q9HA 2QT1A 1Z5ZA 4MYHA 3E1SA 5AR1A 5LD2C 5DGXA 3RHFA 1KSJA 3QPWA 4JVMA 4YMUA 3GJXC 2DFTA 1NF3A 5TV2A 3I61A 1ZU5A 1GIAA 4HYYA 2G0NA 1MRNA 4B48A 4BFSA 2JIZA 1Q12A 3E5HA 4MUAA 4Q9IA 4K46A 5EP3A 1AS3A 2F3RA 2HJVA 4GI7A 3U44A 1XCPA 4OI4A 5TMPA 3IIKA 2H17A 1KJZA 3B1VA 4C0HA 2HXYA 1CRQA 1OXSC 2BM1A 1W5TA 2QAGC 1SXJB 3PEVA 4XVUA 4AK9A 2BOVA 4Q7LA 1GP2A 1SVOA 1KK2A 4B47A 5FPYA 5GJWC 2R44A 1NVUQ 1HQYE 2PEYA 1XBTA 3I73A 4M1TA 5KNBA 1AK2A 1S9HA 3KKQA 4HB2A 2IF2A 4JJZA 3CONA 5DISB 1EFRA 3CW2A 1NSTA 1QHXA 3BH6A 2OG2A 4DC9A 5B2ZA 4QHTA 4DLWA 2QP9X 3ZD7A 5JCPA 4Q47A 3FPAA 3GFOA 4AYWA 4XWOA 2V3CC 1Z0IA 5EP4A 2JLWA 3BB1A 4DLVA 1E98A 2FWRA 3V4FA 4RJLA 3KQKA 4NYIR 3AUXA 2W2TA 3MWLA 3SEAA 4ZV4A 1C1YA 1FFHA 4JLAA 2E1RA 3NC1C 3WHLA 4HLQB 1II8B 3W6PA 2CVHA 5K8UA 2FEMA 1I4LD 4BUJA 1RW4A 1QBKC 2C95A 2FFHA 4IDNA 4JLMA 1S1MA 4KVGA 1O3YA 2RKOA 1FMLA 4B71A 3WMGA 1I4TD 4U5XA 3QXXA 1IOZA 1FPMA 2JJ2D 3KUCA 4OQMA 3I3SR 4DCNA 3CR8A 3C41J 3WXMA 2QI9C 3PVSA 1NI3A 2FDCA 1ZINA 2BV3A 2ZUBA 3PG5A 4OL0A 1YHNA 4LYAA 5UKDA 2CHVA 1W2GA 2V6JA 4KFTA 5FTJA 5FUWA 3SQWA 1ZD9A 2CE2X 4KLNA 3U3OA 4EFLA 1CEEA 2IWHA 4EPRA 4OJKA 4PAQA 1UKVY 4W5HA 4EQ6B 2R6FA 2BEKA 1NVWQ 1VDZA 5KUTA 4OBEA 4F93B 1K5DA 4Z8XA 1KJWA 2XAUA 3RRZA 3VTKA 2ZPTX 3SR0A 2JATA 1GSIA 3ZVRA 4NONA 3B60A 2FEOA 1E6CA 2FSHA 2GRJA 1TAGA 5JSZB 4A0RA 1Q57A 4BZPA 2O0HA 4ITRC 4TYPA 2QU8A 3HU3A 4WZAE 2BMJA 1GAJA 3AVOA 4DLXA 2ONKA 2ZRMA 3I62A 4KJZA 2GJAA 4UNRA 4JLJA 5G53C 5L3QB 2G88A 4JLNA 3VNVA 1NSFA 1JR6A 3KB1A 1TQ2A 2QE7A 1JJ7A 4XWKA 3MGCA 4P3YA 1YZLA 1UDXA 2Q0HA 2R62A 5J4LA 3ZZ0A 4GT1A 3KKMA 2NPFA 3PIRA 4YC7A 4IDOA 1XFAA 3CF6R 1KIMA 2IYWA 4BEJA 5FTLA 3AF3A 1G5RA 2ZRHA 4S2EA 4PO9A 4QGAA 4EJSB 2ZI4A 4GFDA 3RRYA 3WBJA 1GWNA 1KMHB 3MCAA 2GEVA 3DKVA 4RSGA 1F2UA 5AUOB 1II9A 2J0UB 4O2RA 2V55B 4YLGA 1VIYA 4DCTA 1OFUX 3QPUA 1DE0A 2PLRA 3A58B 2JLSA 4IVPA 2O5VA 2VLIA 5FPHA 4PQYA 2B8WA 2H18A 3B1YA 1OXTA 1HURA 1GTVA 2J1LA 3FWYA 4LJ9A 4M21A 1VCOA 3Q72A 4QGGA 4Q7JB 1F2UB 5JWRA 5H8WA 3VKHA 2IYRA 2GXUA 3FHOA 4RFVA 4TL6A 4C7OA 1GUAA 2ZSBA 5HPYB 5BN4A 4A15A 1E9FA 3TGPA 2ODNA 4KYUA 1KSFX 4P4SA 4JLVA 4BFWA 1KDOA 3SJCA 2YOHA 4II7A 2FU5C 2ZYWX 1AN0A 4PO1A 1EFHA 4JVSB 1VHLA 1FX0A 4RKFA 1Q1ZA 3C5CA 3VKGA 3X1WA 4JS0A 5SZJA 4A0GA 3NHAA 2V9PA 1EFTA 1WP9A 3BK7A 3WRYC 5DLQC 1SVIA 4PC1A 4O3MA 2ZANA 3RWMB 1AZSC 3ZIAA 1Q3TA 2GVDC 2YZ2A 3IIMA 4ZPXA 2C78A 3R20A 2BMDA 2IXFA 2JCSA 3SI7A 5EZ5A 1P5ZB 1Q3HA 5HKKD 4PC7A 1QZXA 3I8XA 3AV0B 1Z6XA 2VHQA 4PFSA 1N6OA 4NKRA 4DB4A 3GEIA 4FMDF 1EX6A 3HR7A 1KJYA 1MO6A 4JVLA 4KODA 2H8KA 3EA5A 4Z54A 3NDPA 3AM1A 3BD9A 3ZVMA 2O52A 2WPDD 2JA1A 4QC2A 5LPNA 4B3FX 2YKGA 2C9YA 3KUDA 2Q9AA 3KDSE 2ZJ8A 4I99A 2VSXA 3UKDA 3K0AB 2OT3B 3OAAD 2HCJB 2YC4C 1UEIA 2KJQA 4HATA 1ETUA 2ZRKA 1P75A 1E96A 3HP1A 1FMJA 1J90A 2ZRPA 1PVOA 1T4GA 3G5UA 5C18A 1G19A 2J0SA 2REBA 2EFDB 1PLLA 3PCRB 4C0LA 4DHEA 2BWJA 5J4KA 1AGRA 3NXSA 4TMVA 3RS5A 2OCYC 4YXWA 3LVRE 4LPSA 3D6TB 4P31A 3W6OA 5CYPA 4LJ5A 4KSCA 4B3XA 1U0LA 1TQ4A 4HB0A 1E0SA 2WWXA 2BKUA 2X2FA 4LGMA 4NYIQ 1XU4A 3VNUA 4TMWA 4MDFA 1F5NA 2QGZA 1PLJA 4GMDA 4RD4A 4ZI2A 3DVLA 4BGDA 5JHHB 1KGDA 1F2TA 1ZJ6A 5TDHA 4ERNA 3OE7A 1D9ZA 4KBFA 1TUIA 1LFDB 1ZNZA 2XTZA 4JL5A 4C0QC 4GZLA 1F48A 3RS4A 1S96A 3M0EA 4Q01A 2BMEA 2F1IA 1IAQA 1E2GA 5E4FA 4ZCMA 3C7KA 3EX7C 5GJBA 2OCPA 3LBNA 2ONJA 2ZU0C 2YOGA 2DPXA 2OFOA 2BBOA 1QVAA 2IYVA 1OLOA 5L3SA 4QJ3A 1V43A 3MG9A 1R5NA 1G18A 1S0UA 1R7RA 2KSQA 2QY9A 3IUYA 1L8QA 1P3JA 3GJ6A 5AJYA 3U7FB 3EARA 4B2LA 2QSZA 4A8JC 4Q4AA 2CMKA 1UDWA 4WZ6A 2ZR7A 4QBHA 4NPHA 5FPTA 5BW8A 4OK6A 4DDWA 4B32A 4NTZA 2PZEA 5EXXA 5FTMA 5LB4A 1E79D 3ZJYA 4HZUA 3ICQB 1LV7A 1M6NA 3LO5A 3KJIA 1A82A 1KDTA 2CEAA 2AR7A 1I2MA 3BIFA 2WMOB 3EZ6A 2D7CA 2OHFA 2QNRA 3SU8A 5CLQA 1RYHA 1ZM9A 4HUTA 3ASZA 3MUFA 4E22A 4NU0A 5JRJA 5HZHA 4AKHA 2E9SA 2AD5A 1E79A 2WAXA 4IVQA 5F3WB 4B3BA 3LQQA 3O47A 4A2WA 2OSBA 1GILA 1R8SA 3QI2A 3IO3A 1XTKA 3C4JA 4G01B 2FE4A 2GILA 4BLSA 1R6BX 1KSGA 1E9DA 1CJVC 2E87A 1RZ3A 4DDUA 2QMEA 3PJRA 3V9PA 1DPFA 221PA 4Y0VA 4B44A 4Q5IA 2J7PA 4LJ6A 4AG5A 1FUUA 3V00A 2YOFA 3SJZA 3A1SA 3QVUA 3W90A 1FTNA 1AZTA 4MRVA 5L3RA 1UAAA 1R5BA 2PMDA 4H1UA 1WBBA 1W0JD 1SHZA 2AL7A 3CRRA 3M6AA 1IONA 3TR0A 1FQKA 3AKYA 3LY5A 3MLEA 2R65A 2HV8A 4NCJA 1AA9A 2HYIC 1VECA 1ZM7A 1KK0A 3L0PA 2Q9CA 3B5JA 3K0FB 3W3ZB 2V1XA 2QEQA 4FINA 4B76A 4QJ4A 1E1RA 3K1JA 1XEWX 1JQJC 2ZE7A 3QXHA 5J4HA 2IUUA 1QHSA 3CBQA 5JI2E 4RKEA 4IHQA 4LJ7A 1U8AA 4X8MA 1OXXK 1T8UA 2AWOA 1W49A 1F3OA 3QPVA 2ZSDA 1T5IA 3C16C 2ZROA 4XIGS 2OUKA 1GITA 2ZQ5A 3K70D 5IHPA 1NG9A 3TVDA 1UKYA 5CITA 4HLUC 4XTCS 1OH8A 3BWDD 2PL3A 2ZE5A 5KSYA 1ZNWA 5B58C 4PHHA 1GL7A 3TAHA 2C77A 1WMSA 1AM4D 4M9ZA 4HAWA 4M1KA 3BBPA 1J70A 2X8AA 2GNOA 3Q9LA 2IUTA 1GVNB 1J7KA 4TTPA 3SJBA 1GNPA 4KFRA 1NIPA 2HT6A 4ZDKA 4CEHB 4MYUA 1DAIA 1JBKA 3FMOB 1KI9A 3OF5A 1S2MA 1EWRA 4AKEA 3R9WA 4US0R 2VP2A 1KO4A 4M1YA 3THOA 2B7BA 3MAAC 3KQNA 3WP0A 2H57A 5BN3A 1G4UR 2ORVA 1SXJC 4JZKA 1CLUA 2FX3A 4L16A 4TTRA 4F4IA 2UVQA 4D25A 1TF2A 521PA 1UEJA 4FMCB 2RHDA 1JXMA 2ATXA 4ZO4A 3EIQA 2L0XA 2AFIE 3SNHA 4FI3C 1S9DA 1A5TA 5HZKA 1R8QA 3KKPA 3GEHA 3U3JA 3AH8A 2A2ZA 5EXSA 3HR8A 2O8DA 1BOFA 4B6EA 4BEBA 1DAFA 3TW4A 4PANA 1G41A 3GJ0A 1G8HA 3GJ4A 3IEUA 3ADKA 3AF4A 1XCMA 1ZD8A 2BEJA 4C2TA 3NDBB 5DHFA 2BVNA 1KYIA 1EX7A 3DHWC 1IQPA 2OLJA 5GJVC 3RS7A 1AJEA 1VYTA 2F7SA 4ZKEA 2R8RA 4EFMA 4MITA 3VR1A 2QZ4A 4Q02A 3WMFA 1XD8A 4QM6A 4AWXA 1VKJA 1Q22A 1XMVA 3JVUA 4EAQA 1KNXA 1TF5A 2R6GA 3MSXA 5DI3A 4BLQA 1ZW6A 1YU9A 4HAYA 2W0MA 3GLHB 3KB2A 3EIEA 2C5LA 4Q00A 4MRPA 4EUNA 1I2DA 4Q9JA 2D3WA 2ZRCA 2ZREA 2G3YA 2Q3HA 5SZKB 1KY3A 2O8CB 5JSZA 4Q21A 1OYYA 3FYHA 3PUZA 2B8TA 1U99A 4YDHB 2XOKD 3K9LA 3LLMA 1P2UA 3Q5EA 1PLKA 2JLQA 2QN6A 3EC1A 3THWA 1E4VA 1YZQA 3AVWA 4Z51A 1ONBA 3MJHA 5EZ6B 3QBVA 4QBIA 3UMSA 4QKQA 4ZKDA 3WYAA 3SQXA 2PMKA 1P2SA 1OFTA 2DFLA 5EUQB 3KQHA 1VG0B 2VTKA 2O8CA 4URZR 1O87A 2OEPA 4RZXA 2CL0X 3CIOA 1UJ2A 2CDNA 421PA 1QF9A 4DEXA 4A0FA 3LAWA 1VG8A 2HF8A 2UZ3A 5D3QA 1ZBDA 4QGFA 2QUZA 2CCKA 2VHJA 2OILA 3KTAB 5JZVA 2RGNC 4N1AA 3P1JA 5AWFC 1N2CE 4V0ME 3KFXA 5JBQA 1Z6AA 3CX7A 4RCYA 1N6RA 4CRWB 4WW0A 1FQJA 3FTQA 2DR3A 4EPTA 3BFVA 1U0HC 2OM2A 2QRZA 4RZ2A 3UXMA 3SBEA 2EYUA 5JI3E 3GP8A 2F1JA 4V02A 2OBMA 2GJ8A 4JSYA 2ZYVX 5EE0A 1ZYUA 3B1ZA 5GJCA 1PUIA 2XNDD 4RD1A 3TLXA 1OH7A 1W0KA 2ZS8A 4A2QA 1MKYA 3FKSD 3RRMA 1QHNA 1U81A 4TQUS 5FL7A 2GZDA 4OK3A 1W36D 1N5LA 3GLHE 2WKQA 3BFXA 1U94A 3B9PA 4K81B 4RFSB 1XEXB 1RKBA 1ODFA 4W5JA 1X1SA 1IN7A 2PLFA 4DSUA 1II8A 4N3NA 3REFA 2RGAA 4V0OA 2JDID 4RY2A 3T15A 1UPTA 5D3MA 3B13B 2IYYA 2NO7A 2EWWA 2X19A 4M1MA 3TRFA 2ZJ2A 5CDFA 3WYFA 3I1FA 1Z28A 4OI1A 2Q21A 4GMXA 1ZM2A 4EJSC 5L3VA 1E2QA 3CH5A 1H8HA 1NLFA 3CWZA 3ZDQA 4HLCA 5F9FA 1R10A 2QORA 1OIVA 2O8FA 3KX2A 3BFKA 3THYB 4DDVA 2IYSA 3QKTA 4NP6A 1NP6A 3VU9A 3DKPA 5FL7D 1K6MA 2DYKA 1D2EA 5FPKA 2BMFA 5IRCD 3EC2A 4UNSA 3KXLA 2PT5A 2VPPA 2I4IA 1Z6YA 2CJWA 5FOWA 3IQWA 3TUIC 1XTRA 2BBTA 2WBLC 1DARA 1OH5A 4Q4JB 1RC8A 2NG1A 4Z8YA 3F3YA 2JJ2A 3EPHA 2GZAA 1ZUHA 4B6FA 3A36A 3B85A 4GOJA 3A6PC 3QVVA 1CR0A 5BN5A 5DHAA 4Q66C 1ZC4A 1CXZA 3U4QA 2F1HA 3IIJA 2Q3MA 2ZIAA 2GA8A 4ZIRA 2J45A 1KI4A 4NCKA 4YMTA 2F6RA 2GKSA 2GK7A 1G5TA 1KI3A 6Q21A 1X86B 1VPLA 4PXAA 3T1TA 3CH4B 4OI2A 2DY1A 3PENA 3AQ4A 4C0AC 3VR2A 3Q85A 5KSOA 1YRAA 1NN3A 2ZXUA 5EQTA 1COWA 2JASA 1OYWA 1XTQA 2NPIA 4DLSA 1KI7A 2ZSEA 1BMFA 1NJFA 1AQYA 4GZMA 1E2PA 2HEIA 1BIFA 2Z4SA 3OZXA 3LNCA 5EE5B 1CJUC 1RRPA 4JYBA 5FPSA 4KSBA 5KHOC 3KQLA 3HWSA 1BKDR 5JJIA 3UPUA 3FE2A 5TB5A 1RRFA 2QMUA 3H1TA 4MH0R 2PX0A 2QSYA 3LDAA 5E7MA 5A4JA 4QOSA 2DWPA 3DPUA 4V0KA 2IHBA 3AF1A 2NQ2C 1SULA 3IGFA 4Q9LA 1EFCA 3ONWA 1L4YA 2GEUA 3QKRA 1DADA 2FFQA 1YR7A 1EFUA 2JJ1D 2R6AA 2X1VA 4FXPA 1J8MF 4DLYA 3G0HA 3PV0A 5JEEA 2XEXA 5FBVB 4B34A 4F4JA 3EASA 4RD3A 2QPTA 1KKLA 3X1XA 1ZAKA 4GOKA 3AP2A 1EG7A 3VR3A 1E2LA 1H8EA 1VIAA 2P2LA 2SHKA 1YKSA 2J9RA 4OJQA 1QHGA 4RCZA 3WY9A 4Z1MD 5DSZA 2W0SA 1GL9B 1XPRA 2Q3FA 3ZVNA 3MMPA 3TAUA 2V7QD 3N5CA 3QSYA 3ZD6A 1G9XA 1KZGB 2AHOA 3L2OB 5FI1B 4PHGA 3QKSB 3SYLA 3CRQA 3CKLA 2D06A 4ESVA 3T61A 2WKRA 3MJRA 4QG7A 4OHVA 4R2HA 1E9RA 1BH2A 3EWSA 4JSTA 4N0DA 4E07A 2CL6X 2EYQA 3L0SA 4GOXA 1A7JA 2XZOA 3KJHA 1G291 2I3BA 4URUR 2O8BB 4PPQA 3RANA 3B9QA 5LD2B 3KQUA 1UADA 2WHXA 1P72A 3WNDA 1ZIOA 3DZDA 1M1YE 2MSCB 3NBXX 2FZLA 4C9BA 1MO3A 1KKMA 3PUWA 3DDCA 1X8KA 4DCVA 1R5OA 4D0NA 2PZFA 2FSFA 3HPQA 1Z6GA 4CT5A 1OH6A 2PJRA 1TQ6A 4AKGA 2P5TB 4BFUA 4LC0A 1P6XA 1YQTA 2FV8A 4PQRA 4GP7A 3P4YA 4Q4HB 2OCAA 2FPKA 1WXQA 1XD2B 4TMXA 1SVSA 1XXHB 4R71A 2WJIA 5B30A 1NMYA 121PA 4E5UA 3NKVA 1JEDA 1XJCA 1TTTA 2WWFA 1XMSA 5JHGB 4IOKA 4US1R 4IFBA 2A5DA 3CM0A 1JAHA 1RPZA 4YMVA 2G83A 4HAVA 2GZHA 1HEIA 3B2EA 3UK6A 1LS1A 4JIMA 2YV5A 4QBFA 4IEEA 3U6KA 5BWMA 4KXFB 1KNQA 4TLAA 5KDLA 2GCOA 1E4YA
chains in the Genus database with same CATH superfamily
3G2KA 2YRFA 3HHEA 3KLNA 3U80A 3NVMB 4MVJM 2IKQA 1U98A 1WKCA 3RTCA 3PUVA 4KIJA 1JDBB 2QAGA 3QA3E 3R0VA 4KLZA 1NX6A 2Z5VA 5EWLA 4QRHA 1YVRA 3OECA 3HCDA 2ZT8A 3A1VA 5BQXA 1PK9A 1UL1X 4QYMA 4EGSA 4BV8A 2WJHA 3CWQA 3EZ7A 1JLLA 1T6ZA 4ILEA 5CT6A 2LNDA 3OZGA 3PSHA 1GAQA 4N49A 4FZ5A 3WIOA 5IWAB 2DUMA 2QMQA 3WZLA 1LPMA 2RHWA 3ZGNA 1T9KA 1Z15A 2J4CA 1M2KA 4J76A 4CLHA 3VMMA 3TW0A 1A1VA 3WNQA 1T4CA 1IDOA 5FEMA 4EDHA 1M2HA 1P7VA 1RQNA 2B0CA 1U8ZA 2DBVO 1NP3A 2ZUVA 1ML3A 2BN4A 4PC6A 4H9GA 5HBRA 3VR3D 2HHCA 3W5SA 2NU6A 3KLBA 3GLIB 4LYGA 1QH8A 3FTCA 2IEIA 2N46A 3A32A 1H1DA 1E2KA 1UBKS 2YS6A 3N7TA 1RR6A 3EIXA 3GAFA 1QFJA 3GD5A 5G4LA 5IDWA 5F64A 1U3CA 2QTAA 2KLBA 3BXGA 3RVLA 4DC0A 2X4LA 1TYAE 3RREA 3WWYA 2WHPB 4AUKA 3CISA 3KD2A 4DR6B 4HX5A 5K0BA 1OI2A 4L15A 4OM8A 2XHEA 1DCKA 3GOQA 4MTLA 1QKKA 2Z98A 2G76A 3ERCA 1EXWA 4V2IA 3ZXYA 2CHQA 4DQXA 3BRCA 3U7QA 2FRDA 1FP2A 2QUJA 5ENVA 2HF9A 2G17A 4NU5A 3QHPA 1VKRA 3TSCA 1U65A 1G8FA 2D62A 4LOIA 2P4QA 2XCRB 1WBJB 3BL5A 2EKBA 4DLKA 1XZMA 4BATA 4PCLA 3VVLA 4BO0A 1UFQA 1TNDA 4DKJA 4LQ4A 3GRRA 4YONB 3WWOA 1H2FA 2O3SA 3L6CA 5AO9A 5KSZA 3STHA 1Z16A 5JQWA 1G6HA 1M1XB 2D2VA 1T2AA 2ISCA 3SLKA 3CLSD 3GFBA 3KKZA 4E5KA 1KMIY 2QP4A 2YY5A 3DOIA 1FX0B 1KZ7B 2CLEB 2XNSA 2FGKA 5JCJA 3DLBA 1YQWA 4PLTA 1ZUD1 1A8SA 1JYSA 2WM3A 3GJ8A 4KX3A 4HQLA 1NW8A 1RI2A 5EJMA 4NQZA 4JROA 2AI1A 2D0DA 3HA5A 5HUQA 3GW8A 3O4HA 3UMVA 5JJKA 5CCBA 3I4LA 1EUDA 5I9LA 2HREA 1U2DA 3LQKA 2BEVA 1WXWA 1JFFA 1YO6A 2GZSA 2JFBA 2YS7A 3KQOA 3EXEB 3OZUA 3SBOA 4LY0A 1E5VA 1JA1A 1VBFA 4CGYA 5A02A 1IY1A 5A1TA 5HRCA 3GGPA 4FIDA 1GSOA 4U2EA 4P54A 3KB8A 3P5BA 1YS6A 4JAVC 3SFVA 3EEBA 2R751 2V0GA 4DXAA 5CMLA 3QMWA 3GLTA 2HUPA 3TIXB 1ZXBA 2GLUA 2J6IA 1DRJA 1R0YA 2ORYA 3BE4A 3FKJA 5DLEA 3GYBA 1V8DA 2OP0A 3HA7A 3JS5A 3KWJA 3RKRA 4BRWA 5DSTA 1XZGA 2GBGA 3EYAA 2AS0A 4X7PA 4J2HA 1XROA 1U9YA 4BNYA 1K92A 3G9TA 3EXFB 1RZRD 2QTRA 4D9CA 4BX9A 1IN5A 1KA9H 3TBFA 1ZUIA 5A1JA 3AW9A 1TUGA 4L0MA 2VNHA 3ORRA 4WVLA 5T7BA 3QOXA 3B1FA 3NAMA 5H81A 2PKCA 4O63O 3DV0A 2CB9A 2VYFA 3QLVC 4WLUA 5ECGC 3FWHA 1CTQA 4UUOA 2JAQA 2CKDA 2ZJ5A 4PYOA 1AQLA 1F6DA 1WX1A 3FGNA 4GGOA 3SJUA 4ENQA 3ZVKA 1MDBA 2HJSA 1QO7A 3S1SA 1BHSA 3CKYA 4J94A 2LKDA 1M8FA 3OT5A 1GZ6A 1PU2A 3NTOA 4PZCA 2RGXA 3E27A 3X1DA 2IYXA 2P9EA 2RMKA 2O2SA 2ZITA 1I3KA 1SC4A 4I9GA 4IDAA 3SQDA 2D1FA 5EUMA 3RNLA 5D87A 1SUBA 3BWEA 4DMHA 3ANSA 1XK7A 1OCEA 1IZ9A 4GDMA 4BWGA 4B43A 1XVIA 3AIKA 3JPWA 1FDUA 1IHUA 5AJZA 5K99A 3FOFC 2QUHA 5BQFA 1S7GA 2CCGA 3F7NA 2H7CA 3V1YA 4C4ZA 1GRNA 4G0UA 2J46A 2FETA 1AS0A 4M0MA 3GVHA 1GUBA 5JARA 2H08A 5D00A 1CEQA 1XKTA 2MSWA 3FUWA 2C29D 4LK2A 5TQJA 1E3IA 1MOSA 2D8AA 3FMVA 3JWJA 3K0HA 2YIVX 5ICGA 1T9CA 1WZNA 3BE8A 4G4JA 2OC9A 4Y1FA 3A1TA 1Z63A 4Z9YA 3MELA 5K3BA 1JSXA 1Y9EA 3IE2A 1JALA 3HCRA 3RQSA 3DVAB 2X0FA 1G5FA 1AD2A 3VNRA 2QTWB 1ACLA 4CW7A 4D56A 1GPMA 4PQFA 2RGRA 1A8QA 1BJRE 3TWOA 2JLUA 1E0KA 1JKMA 2VAPA 4W5QA 1NDHA 1G64A 4M86A 3L0YA 3PD7A 1E2MA 3COZA 3UJ6A 1QG2A 3B82A 5FWAA 2CSUA 1K8RA 2V3VA 3K9HA 3NGMA 4MO2A 3ZE6A 4RENA 3NBZC 3E8XA 1T1SA 4GQIA 1J07A 1RPJA 2Z83A 3IP9A 4RZ3A 3VTAA 4YDQA 2NU8B 4N8SA 4X91A 3RJZA 4WOBA 2VSFA 2PBRA 4KPUA 3HB0A 4IDEA 1PR3A 3K09C 3NH9A 1QGYA 4CQLB 3FJ1A 3K0SA 1XQ1A 3KR0A 3ENQA 4MPDA 5AVVA 4RA6A 1DAHA 1YZKA 2ZCUA 1MW9X 1TVMA 4IUCS 3U7EB 2ZJ6A 2QZZA 2Q6TA 1KI6B 4NOKA 3NHBA 1Y1KE 3HS3A 3K0KA 5CYFA 4CV1A 4HYEA 4WBXC 1VCIA 4BVLA 2DTDA 4G84A 4PX9A 1NATA 3VMFA 1N0WA 2JGDA 4I4CA 3CSUA 1HE2A 1JYFA 3CX8A 3P2MA 4AJJA 4LJ8A 5KOIA 1QIMA 4X1YB 4N54A 5ALLA 1HC7A 4B3JA 2AOVA 2ATVA 3P2YA 4CFSA 2VYND 1PIWA 1M0SA 5BV8A 2QJRA 1L8LA 1YACA 4QQ8A 4DV7B 1IIRA 1THGA 1CK4A 4CM3A 3H9UA 3O4FA 3VISA 1Z6TA 3D8BA 3C8ZA 5DP2A 5EE1A 1KZ9A 3TIFA 3TMKA 1IEXA 3E2IA 4LRSB 2GF2A 1NVDA 2O7VA 2OESA 4JA2A 1Y3CE 4IDPA 4KBYA 4P33A 3UCEA 4TRJA 5A06A 3OQOA 4FJ1A 3ND8A 1RCFA 5KBYA 4LX8A 4MP3A 4Q48A 3M49A 3X2EA 1V11B 1M2GA 4N3CA 2HBRA 4MQ4A 4CCYB 4RKWA 4ZODA 2QVXX 2C04A 4K0RA 5DTEA 5LP6F 4LDJA 1J99A 3WKCA 1EVIA 4DT1A 2Z57A 1Y5IA 4M0UA 3HN7A 4JJFA 3F98A 3PDUA 3HZZA 4PSAA 4XSGA 3CEMA 2CN1A 1QV7A 3IQHX 1T2UA 3WL7A 4C22A 2A88A 1H2HA 2V7UA 3IPRA 3KOOA 2YVUA 1QRRA 4LK3A 5DEOA 1DT5A 2HRQA 1JVSA 4BQRA 3DE4X 5K20A 1A4IA 4JC5A 3THXB 3BCSA 5U4QA 4DSOA 1GZVA 2VPYA 2DGDA 4HWPA 1V16B 5CXXA 2J3MA 2WAAA 4HFNA 1RI1A 4XQ0A 5ALFA 3WL4A 4EG1A 5LDDC 1NBOA 1NF8A 2WFZA 2GPNA 5FWYB 4O5OA 4R1UA 4NYJR 4UCFA 1MVNA 3EGDB 1I1QB 1B23P 5CIQA 3EG9B 1WLYA 4LRYA 3PXCX 3GA5A 1M83A 2OFFA 3A26A 2I1LA 2FZ5A 3VX4A 2GX6A 2QLFA 3QKUA 4IQFA 3CXUA 3RBAA 3K71B 1T1RA 1N5JA 1QNLA 2WJ3A 2NV2B 3N5KA 3V8RA 3CR3C 3ZHCA 1N25A 4CT4B 1DBQA 1G5IA 5E2IA 4BNVA 2WPDA 3ZHYA 2QY6A 3QK7A 2VWPA 1X3SA 1Z5NA 2V0CA 3GMTA 4JJ7A 2PRSA 5DIFA 1RZVA 1JU4A 2QJWA 1VB3A 5EMHA 1KRWA 2GHQA 4FBMA 2AN9A 3PR1A 4BVEA 3D6HA 1DHTA 2BD0A 1P2VA 1ID1A 1KIAA 5FUVA 3ZZUA 3GEMA 4DKXA 4M22A 1U0BB 4QM7A 5ETJA 3QMVA 4TT8A 4DG5A 1JH8A 3F71A 3HY3A 4M37A 1RYMA 3C3DA 4NOLA 3SHFA 4X66B 1V5WA 4WAUA 1D5CA 1CIJA 5KDOA 1HZZA 3WHKA 4G86A 4IHKA 1O0BA 4LQLA 4M0LA 4CEIB 2JLRA 1G3UA 3A6HA 1L8XA 3G89A 1GZHB 1JA9A 3NBKA 4QQNA 1D1QA 4S1NA 1KWGA 2NTNA 1DCFA 2A0XA 4JKIA 1NBMA 1QUEA 1CB0A 1T0HB 3BVPA 4AROA 2ZR9A 3QE0A 3RSLA 4A2PA 2MT9A 3P9XA 4KQGA 3ZHQA 1GL3A 3AGQA 4MCJA 2XWJI 3OOHA 1F60A 2G25A 1P81A 1YRBA 3OLYA 2FUG1 3DFMA 3T7KA 2Q2VA 3ABQB 3P32A 4YPOA 4EGCB 2D59A 5AM1A 3E7FA 3IIEA 5E0OA 3AI2A 1C3XA 5DI9A 2OKGA 5E8RA 3SVZA 3MCUA 3F1KA 3KZKA 4V0QA 4C06A 2VF4X 3N2KA 2EP5A 4ND5A 1EXVA 1KYTA 1Q2UA 3EXIB 1XL0A 4D9EA 3NHUA 5BXQC 3DPSA 3DZHA 4MEJA 1JT9A 1ZVQA 3TX2A 1SU4A 1H2EA 3E6AA 2ZZKA 1T0PA 3HJHA 3V4ZA 4ALIA 3S5JA 3DO8A 3QF4A 4RJ2A 1S8FA 1UPCA 4MWEA 4C3UA 2M6KA 4G67A 3PFIA 3D7MA 3ZE0B 2PXCA 4E6EA 5KQSA 2VJDA 3NP7A 4O2AB 4C7JA 3AF0A 5K8IA 1P9NA 5BWNA 3P0RA 1EBFA 3KFVA 3G59A 2NX2A 1PVVA 4M8KA 4PSKA 4J0HA 3LV8A 3FYUB 4N01A 1FUIA 1I7NA 4KQMA 3EPLA 4A6EA 4I1IA 2G4LA 1WY5A 2R6ZA 3WLEA 4ZU6X 4KREA 2BFWA 2IZOA 5CVDA 1G59A 4G5OA 2VHWA 1GZ4A 1YBVA 3FFTA 1D2RA 1ZY2A 1PG2A 1EK0A 3QF4B 4YVFA 5AXDA 2JFOA 1IPHA 4LDZA 1SCNE 2QDXA 3TLYA 1KPIA 3QBJA 3H2GA 3V8EA 4DV1B 5AW7A 1G3RA 4BFVA 5B4TA 2GYYA 3LRXA 4WFJA 4F6RB 1Y4DE 1KQ3A 2YWCA 2Q7XA 5JJLA 2ZI7A 5CVVA 5EXPA 1WMAA 3JW8A 1RYZA 1JR3A 5A3RA 1NJ6A 4KWEA 3HV0A 2I1QA 4NS4A 4O33A 4EVSA 4YMSA 1XAHA 3THWB 1E5DA 2H2HA 2ZYDA 2F90A 1VTKA 1ZH2A 1LSSA 1ECLA 3DLTA 3BD6A 3BMXA 3LCUA 3NEJA 4HQFA 4OFXA 5AVJA 3VHXA 1UJ5A 3T6KA 1PN3A 3L7AA 3CRVA 4DV3B 1YB7A 1FFXA 2FQQA 2HQOA 2IDJA 3O73A 2OPHA 1EP2B 2V0NA 2BGLA 4GM1A 3C3XA 3WWZA 3HB1A 5DGHA 4MWTA 4NMMA 3GJ7A 5AQ1A 5K0EA 2ID8A 5GADl 2XY4A 1A9RA 4MW4A 1SXPA 2B8EA 4Y67A 4PU0A 2H1LA 5LQAA 3PHBE 4OP1A 3KLOA 3E4CA 1CDOA 4GKJB 4RVUA 5DYGA 1RRCA 2B9VA 2HX1A 4Q7MB 1I9GA 1TO2E 2NGRA 4I8IA 3HSKA 2VPWA 8OHMA 1P4GA 1HE1C 3QIAA 1HBJA 3E03A 3OX4A 3VHXB 2F00A 2Y05A 4LJAA 4TKUA 3DZJA 1AU9A 2J85A 2J0UA 3CZQA 4RNDB 2XGOA 1P2FA 3IO5A 4XFKA 3VU8A 3W2IA 2QM8A 3I76A 2O2DA 2GM9A 1N2HA 5BRAA 3LTNC 4JYMA 3PNKA 3DHVA 1DELA 2IEAA 3IAFA 4NYMQ 3UENA 3QE4A 2I80A 3I9KA 5M7EA 2NTYC 4MYTA 1AKWA 1DAOA 2MDTA 2J0QA 2RGWA 1FDSA 2IUYA 4UCWA 4I3HA 5COQA 3CLRD 1LTKA 4K8RB 1CQWA 4TRMA 2Q07A 4BQPA 4KE6A 1LLCA 4HC4A 1DC6A 3K0FA 5H3LA 1DRKA 3Q7RA 5LZ4A 5LJLA 2ZM5A 4TT3A 2GR9A 4C6TA 1S3SA 3A4YA 1JH9A 2C58A 1WVGA 3VI3B 1XEXA 4UVIA 4DW8A 2ZVJA 5ICMA 1BN7A 5ERGB 3RK0A 1VCHA 5GY7A 2AOWA 2C3OA 3VU3A 2JI9A 1C2YA 4LBVA 4NEGA 2G5GX 1U9IC 4UUAA 1WB5A 2ZAYA 3BT7A 2HAEA 4KXYA 2GKGA 4Q4LA 1NBME 2X77A 2PGLA 2QPLA 3H1EA 3CJRA 3LPCA 3MTGA 4L0DA 1PL6A 4EA8A 4EY4A 2P2CA 2EBFX 4M6WB 2XTMA 1U7WA 1CJBA 2FZWA 2CNWA 3ROKA 2VAMA 3H04A 1TTPB 3H11B 2PLAA 2PZBA 4Q03A 4YRPA 5JW6A 4UOQA 3QA9A 3BN3A 3NX4A 4WNYA 1VLHA 1XZDA 3QHAA 4H7PA 3PXEA 3L84A 5IT0A 2VJCA 2X5JO 3JQDA 4GXRA 1C4KA 4JCOA 2OWEA 2R79A 1VRWA 3VNSA 5AW8A 1JEQA 5JS7A 1KH2A 1K6IA 1L5MA 2OHOA 2V5UA 3G82C 3OIYA 1CB7A 4JYCA 4KWIA 4P0TA 3WNBA 1AH2A 3COVA 4B6SA 1Y6FA 4L4SA 3U37A 3MYYA 3M1IA 1KDVA 4UMEA 4W1QA 2JGRA 4YIKA 2IEDA 4ZZ1A 3IRVA 1FP4B 2VBFA 1M1ZA 3LXRA 4MV6A 1VE3A 5KNCD 1KI8A 2PU7A 2WSLA 2QN2A 1K1EA 3PQCA 5HVNA 4Q3EA 3MQ4A 4PLVA 1PJZA 3WGOA 3WR5A 1E8MA 1QIHA 3D4PA 3UMYA 4U7JA 3MCZA 3U0VA 1OB5A 3GLFA 2MJLA 1OAOC 5FOUA 5BN5B 2I5PO 2PYZA 4CMJA 3BQMB 4QBTA 1P77A 4MKGA 2FXVA 4OFZA 1VL1A 2EJBA 5FB3A 2AN5A 1KZHA 2PTGA 4MVJD 3VO2A 4OGWA 3NB0A 4ZV7A 3RLFA 3K2EA 4EHAA 2REXB 3A27A 2O2ZA 4EKNB 2DU8A 5A4KA 4MROA 3HJGA 1GNLA 3BIOA 4QUKA 2Q5CA 3ZV5A 2H2AA 4KGVA 5EJGA 5EKTA 5KTPA 3QVXA 4HGRA 2FSVA 4O8ZA 3RKUA 1TK3A 4Q18A 5L9AA 4B2IA 2XBLA 3ADDA 1QDLB 3BB4A 4CUJA 2DKFA 1VP3A 2K4MA 1MB9A 3I53A 5GIOE 1V1RB 3IH5A 1NQXA 2J3HA 3KT8A 1TLTA 3SC3A 4ZDIA 5IAGA 5CBKA 1XLWA 4NOMA 4XD2A 1C4OA 3L5KA 2XJ4A 3QPAA 1GZDA 4CF7A 5JNLA 1QZUA 3UFXA 2FUNB 1FLNA 3NJ4A 3O92A 1Z83A 4GI5A 2IBMA 2CLKB 1T9HA 2QU7A 3EMDA 3N28A 3W3AA 3ROQA 1MRSA 3VR5H 4BLVA 2AV6A 3ICOA 3X1YA 2W22A 5I8WA 1GRRA 4EG8A 2GEFA 4O4LF 1LPSA 1DBPA 3LDFA 3NG1A 3ZBTA 5JJCA 4COOA 1NVKA 2OG1A 5D3MB 2AJCA 2ECPA 4URWR 5AI8A 2I87A 5BNFA 5A5GA 4M36A 5J2TB 3U5ZB 2FR8A 2BFBB 3EUWA 4LS3A 2X5NA 4P7KA 3MCTA 4FKMA 5T8KA 2PUHA 2QXUA 1B6RA 2YVAA 2NO0A 2B6HA 2HRRA 3TLJA 3TNFA 1LPOA 1XNHA 4L02A 4US2R 1ZH6A 3CNBA 2GWRA 4L08A 5CDTA 2ZIZA 1OSNA 4BNJA 3SP1A 1GO2A 1R4NB 1BVUA 2WIDA 1N78A 1JL3A 4BFTA 4C2AA 1SO8A 3QJYA 1ZRMA 5G2OA 4TZ0A 1G8PA 5KDDA 4M9QA 4QXQA 2BFBA 2RH5A 1E9BA 3I6YA 4U2DA 4UCXA 3KOUA 4NEQA 1X9GA 3LWZA 1C2TA 1WA5A 3I52A 4L3VA 2IYPA 2MR5A 4O1HA 4RX1A 4CKYA 3KIPA 3VU0A 3FAZA 1WDLA 3QEJA 2ZG6A 1JSRA 2BMVA 1QORA 4N7JA 5IFLA 3FOBA 4ABYA 2XE8A 1JPNA 1R4NA 1TEXA 5FJJA 1ZRHA 2J0VA 1UKBA 4RD0A 1VKHA 4BE9A 3IUBA 1L1FA 1FLAA 4I6GA 2YH2A 4BTEA 2QTCA 3LYHA 2YZMA 4FX2A 2ZJOA 4Y7CA 4YMWA 4KUHA 3TQQA 3PITA 3HKCB 2QROA 4AZ0B 4C21A 4D3SA 2JB9A 1GZUA 1CZRA 3A1NA 3DBRB 3OU7A 3CZPA 4DUGD 2IS4A 1UXOA 4ZIRB 2I4LA 5BUCA 4PZ9A 3L6BA 2CYCA 2WF7A 3EXAA 4E2YA 2HU8A 4DM4A 2UUBB 4YDSA 1EYZA 1H85A 2HF7A 2K87A 2P79A 3U56A 4DQKA 4ZGWA 3DMRA 1U0JA 2ZRAA 2O8BA 2C5BA 4K6KA 3H8WA 1BN6A 2WSSD 3RYIB 4TUYB 2MMCA 3L0OA 4FGLA 1Z3IX 4I50F 3R3SA 3UK2A 2Q0QA 4BBZA 3CLTD 1Y1LA 1NLZA 4GM4A 1NM5A 3OZDA 2XB2A 4E6PA 4ER7A 3D1JA 4RK7A 2RE8A 3MILA 4DB2A 4MUHA 1Z4OA 1ZD1A 4G5SA 1M67A 1IUNA 3HYTA 3HYCA 1G2IA 3GLVA 4OHKA 4WXMA 3UA4A 4G4IA 4D3DA 3NTQA 4FCWA 2EIXA 1US8A 2EGGA 4AULA 4PCAA 4CM9A 1A9TA 2DE0X 3FSRA 3A37A 5AJVB 3PUYA 4JQYA 1N2JA 4DDTA 2IYTA 3DB1A 2C7RA 4F3TA 2UZIR 3K5IA 4JUIA 4BCDA 1ULUA 1L5OA 1Z0UA 3S8EA 4KR7A 2PRKA 1CU1A 2P35A 5SV2A 3SG0A 1BO6A 3STUA 4A36A 1RBZA 1SCQA 2B7CA 3EDQA 2LDXA 5FQNA 1M8JA 3ENZA 2XB9A 1M76A 2BR5A 3GUHA 4JBLA 3RS0A 4P3PA 4K86A 5CNIA 1OLSB 1W47A 3TSOA 1PE0A 2OB1A 3W7VA 4BO7A 1E94E 5FT9A 3WDKA 3GEBA 1YC5A 2RIRA 1MA0A 3EGIA 3ML1A 3P2EA 3W5IA 3PXGA 1NY5A 4R1QA 2AX3A 2XJ9A 1TO1E 4BB0A 4UUBA 5AUNB 1K8XB 4D0SA 4LE2A 3H17A 1SXJD 3CJTA 1RJWA 1P5JA 3EB9A 4M7WA 3D4OA 4LVNA 4YLYA 4YMHA 1OBOA 2JRLA 1AA6A 4JBXA 4RY9A 3MW8A 1A9QA 4CDGA 4YV2A 1ND6A 4FZ3A 5DGDA 1Z0KA 1ZU4A 2C83A 1TJ5A 1UKZA 5FBWB 3F8TA 1YBHA 4Q37A 4Q1CA 2XQKA 1ZHHA 1WR8A 3ICEA 2BM8A 5K03A 1KK1A 3H83A 1T24A 1Y42X 3CX6A 3WRXC 2UZ0A 4E3WA 2O5EA 3WRVA 1EWTA 4IMJB 2X22A 3U7HB 1PJLA 3C14C 1XN1A 4MUBA 4A8PA 4P22A 4R5HA 5IDQA 4CEIA 3DBHA 4BLQA 3ZXUB 1MOZA 4LJ4A 5H3HA 3HUTA 5ERYA 4D4LA 4MVJH 4GX0A 4TV9A 4ED9A 2QGNA 1XVVA 4A8HA 5JAZA 3GUCA 3O2QB 3T3OA 5C80A 2HRDA 2JHAA 1NXTA 4MQ6A 1H22A 2AF4C 2ES4A 3VKWA 1DEOA 4DY6A 1LQ2A 2YR0A 3KVNA 4JBGA 2ISSD 4PG6A 4CF3A 4WX2B 3UH1A 1UFRA 4CEJB 2LTAA 3H6HA 1E4EA 1TKAA 1LI4A 2R7NA 2A9JA 4C4RA 1XCLA 1YR6A 3A4NA 3E9ZA 1GD1O 4DV2B 3N8HA 4DMLA 3AUYA 5G1OA 5IJZA 1WCIB 4LQCA 4MDHA 3CUUA 3PI6A 1GTZA 3O2JA 4PR0A 1YZNA 3IBGA 4H1VA 4DIKA 3AUTA 1HEUA 3UF0A 4HQOA 1IMOA 1W87A 3DL2A 4Q6WA 1UKAA 1DPGA 2R25B 2FPMA 3K1AB 2P9JA 4HAZA 1H3NA 1YGYA 1SC6A 3KJGA 5AM3A 4L95C 5IXSA 1XDBA 1JHAA 1ULHA 2O20A 4ICIA 2AZXA 3GWGA 3UJAA 3IHLA 3HA2A 3D31A 1G7RA 1K75A 3OCZA 3V1TC 1EGQA 2QL5A 4Z0PA 2QHXA 1KY2A 3JSAA 1QR2A 3UG7A 1I9CA 3A11A 3ND9A 3QKRB 4PIVA 4EWLA 1YDEA 4RA9A 4MRNA 1MABA 5KJFA 4UTVA 4BCCA 4I46A 4EECA 1RNLA 2IC5A 1TEVA 1M2OA 4L28A 3DEFA 2O19A 4KVZA 2Q3CA 1ZS9A 2Q9BA 1QGUA 3C43A 2AW3A 4WUVA 3WWCA 2R9VA 2Q3LA 3C3KA 2JDIA 3PNYA 1Q1GA 2G1UA 3SD7A 4X7RA 4BGVA 2Y1EA 4F6RA 2IA5A 4MQFB 3A70A 1LC3A 4XRGA 4CQMA 4KQKA 3O8BA 2EVWX 4INPA 4DIDA 3C1TA 4WY5A 3JVIA 4AY4A 4E5NA 3SF0A 3TRJA 5JXIA 3FHCB 4IV8A 1XQWA 3ZHRA 1L7OA 4LSGA 1ECPA 2NSHA 2R86A 3J81A 1YUNA 3G49A 1QIDA 1EDDA 5L7WA 1V96A 2AJLI 3RRFA 4JLPA 1UBOS 3F49S 4BP3A 3R9XB 1DL5A 1JHRA 2XVZA 3WZ2A 2OC4A 1LDYA 1IPEA 1HYQA 1FP7A 1OU0A 3LPAA 2ECKA 4MQBA 3QITA 3IEXA 1DIAA 5CJ2A 1E9VA 3IC5A 3BMNA 1N1GA 5B4VA 4RSMA 2OAGA 3WGQA 3KZCA 3DR5A 1KL7A 1SZDA 1TW2A 1RDFA 2C1ZA 2ZBEA 2GCOB 2Q6KA 2X8LA 3RAPR 1OZAA 2X7XA 2VHCA 3PTLA 3C6MA 4WLEA 4RYLA 2WMDA 1YE3A 2ZSUA 3H9JA 4LBYA 3SC2A 2WG0A 2HMAA 5K05A 3ASVA 4PYMA 3QYAA 1QB7A 4FVTA 4XWAA 1TVCA 2B1IA 3C3WA 3K53A 4I5GA 4UDYX 3VYUB 3SR4A 2OBBA 3CF0A 2ODQA 2P30A 3HGTA 3VO9A 4EHLA 1UXJA 1X39A 1G8GA 1LGYA 1N4DA 2WLTA 2ZBFA 3BF7A 4RIEA 4ZVNA 3KB6A 4OHWA 1OTHA 4GPEA 2G1KA 4UJ5A 1V71A 2E6UX 4FSXA 4CF5A 4PLGA 4O4JF 2BC9A 3IKTA 3HRKA 2H11A 2GZ2A 2PQMA 3IV6A 3M4ZA 1GUFA 1GTMA 1K63A 3G8DA 4N82A 3AR7A 3TUJC 2OXRA 2W83A 1QK5A 1XZAA 4U8GA 5IFKA 3GJ5A 5EJ8A 5KNBD 1G60A 3UB4A 5J5AA 1QC5B 3HFSA 2F9LA 3CUTA 4YCBA 4YYEA 3NPMA 3AVXA 1KRXA 2H1FA 1Z0JA 4WK0B 2X7JA 4J1NA 4KPYA 2ADFA 1CUHA 2F4NA 3G0CA 3L6EA 4R7ZA 1RACA 1M34A 4QAJA 5P21A 4BDTA 4ZEMA 1ENOA 2WU8A 1Y9AA 2YZKA 1W73A 2ENUA 5M04A 3RW9A 5FYQA 2BM0A 1UPXA 1T13A 3A6FA 4A8JA 4RJIA 4I0WB 1PTKA 3S28A 1C3JA 2PUVA 1G20A 3VZRA 3FNEA 2WG1A 2IEZA 3CZAA 1DEXA 2HK9A 1W4LA 3FUXA 5EPEA 3C3PA 4EEKA 1V8OA 1YQQA 2WNIA 3OFND 3P7MA 3PQ4A 3Q9SA 4R9NA 4YV7A 2Q6IA 4HH0A 4KR2A 4RIGA 4LSZA 1U5BA 4QPPA 4WCVA 1GCGA 1GU0A 3ANXA 4OB6A 5HIMA 1RZRA 4YP7A 4RY0A 1TO6A 1V25A 3MB5A 1F1BA 2JBHA 3PDHA 4GX2A 2Z2YA 1MX9A 3IS3A 4F91B 2XCQA 3AFNA 4JT2A 3ZS9A 1XZHA 2RFLA 4K9MA 3KC2A 1L5GB 1PNRA 4RQTA 5C8YF 5A05A 3MD9A 1Q7CA 1RM0A 3RC8A 1Y6GA 4FYWA 3ZJ5A 1TT5B 3UJ8A 4TYYA 4Q3CA 4Q7KA 3UMGA 4TS9A 4DHWA 3ROXA 3D3EA 3NCHA 2X15A 1F9AA 4C29A 1G8AA 1PQUA 1XZIA 3DV9A 3JQEA 1J0CA 2QUIA 1H5UA 1MQ9A 3B8EA 3ILYA 2QM3A 3NHPA 4HUQB 1NKVA 1GARA 1YHYA 2NADA 2ZTUA 3FPGA 4GLBA 4WXPA 1QAQA 2G28A 2ZEJA 2QSUA 2YJ4A 3UT0A 3ZWCA 5KCMA 1U0SY 3TLGB 2C2BA 2P5SA 1DJMA 4XQ9A 2WILA 2C00A 3HSYA 3ER6A 4NNPA 3ZCUA 1EDEA 4CDNA 3H5TA 2XLCA 6LDHA 1G16A 1XWFA 3O94A 5ALOA 1EDBA 1EM6A 4UU1A 4C76A 2RJ3A 4C7VA 1BDBA 5HP4A 4LAFA 4F8JA 1CUSA 2Z2KA 2W00A 5AVXA 2QUKA 3HYRA 3CUEF 3EJ6A 4RANA 1F9EA 3UMFA 2FH5B 3IUEA 4MVJE 4FUTA 4PG5A 1FDRA 5D86A 5JAHA 3MYRA 4XWTA 3F8SA 5FOVA 2AD1A 4NYMR 3PEFA 1T2DA 3DTVB 2QTVB 4RK6A 1QH1B 1J6UA 1TYBE 2ECOA 2NACA 3EA0A 5DO9A 1W5AA 3SYRA 2YWDA 3WGZA 4OKSA 1EESA 4ZAVA 2R3SA 2WJGA 1R3DA 1F0YA 3ORQA 3A3OA 4DSNA 3JASB 4WRRA 5H02A 1JHUA 1M8GA 4J0QA 1EI9A 5D2CA 4FDAA 2FUG6 3JWHA 1JQ3A 5K8VA 4QFBA 1W1WA 3FZGA 4KHPB 1AF7A 2AZMA 3I6BA 4ZVQA 2XE7A 5DX8A 2AN1A 3N75A 3WNCA 4H0NA 4C4OA 2ZI9A 3UWOA 2VP6A 1SGWA 4RKRA 4XYEA 2VHYA 4DZTA 3F6SA 3PDIA 4F46A 4UM8B 4OQLA 1E6KA 1AHPA 4R05A 3K70C 3OT1A 1MO4A 5T3YA 4U0KA 2O6HA 3OJXA 5ADUS 4BJ1A 4YN3A 4CGZA 1VJGA 3OPYA 3JARA 4IUDS 1JP7A 2FPPB 1FP6A 2GXQA 4MUEA 4TGLA 3TNJA 2W4QA 4Q4JA 2WAOA 3AO0B 4KO1S 2XDQB 3A14A 4JC0A 4C0KA 4LE1A 2EF0A 4WK6A 3T5TA 3IDQA 5FYDA 3UQZA 2IP2A 4R7GA 3FCYA 5AW9A 4B79A 4FLFA 4EP1A 5DNAA 1IATA 3FB4A 1BHQ1 2A3RA 3F2VA 2ROQA 1OWLA 4IG4A 5J40A 1BX3A 1A5BB 1LBIA 1C81A 2CNDA 2FW6A 4JJ6A 1X8JA 1WDKA 5GQSA 4BMPB 5G40A 2GPTA 2CMFA 4UAGA 1N8NA 3S2SA 1QX3A 2H85A 2Q6LA 2VF7A 4IKEA 5K1ZA 4GPAA 3TJZA 4Q19A 3CBGA 2OV6A 3U81A 2QL7A 3AC0A 3LH5A 3RVSA 3L9XA 1DV1A 2YWFA 1E2HA 2Y3IA 4UAUA 3IAEA 1PFQA 3IAS6 4UZSA 5JNWA 4C4PA 4GZ5A 3LYLA 3VR6A 4RVCA 3IQEA 3EH1A 5CH5A 1RAIA 1WULS 1II0A 1MTZA 1NVVQ 2NU8A 2XYVA 3PQ2A 4KPUB 2OECA 3JYQA 1OTYA 3SIWA 4FUQA 3ZN2A 4EBBA 3Q88A 5IF3A 4KGXA 4EHKA 4QJIA 2BLLA 1SCJA 4DV4B 3MJTA 1UMBB 1MU0A 2JW5A 4KFCA 1BE6A 1E6UA 4ATNA 3IVMA 3EPKA 4FJ0A 1B8OA 1D2GA 2BFCB 3HDTA 2N42A 3LZDA 4IIJB 4PTLA 1MEJA 3DE6X 3BL8A 3UB2A 3UTCA 4JBHA 1F2TB 2OHXA 3OURA 5DNWA 3BA6A 5TGZA 3EOAI 1HFKA 1KP9A 4OHZA 5IWCA 2F1RA 4HDQB 1YDHA 2A59A 4BMCA 1QPBA 4E14A 1OASA 3M2PA 3ZLJA 1EXNA 5AM5A 3MINB 4HPJB 1SU6A 4HPWA 2HJ9A 1T1GA 1CY7A 3L1HA 1AB6A 3L6RA 1U8TA 3H86A 4XUCA 1GV0A 3UJ3X 5IKMA 2PNFA 2NYVA 1YUMA 1TA9A 2WI8A 3AETB 5CYOA 4CTNA 1UC4B 1DX6A 2BF7A 4YWJA 3EVNA 1BG6A 4RV4A 3WJ1A 1L7VC 1R0WA 2VTVA 3DTNA 3F7TA 4NESA 2PSSA 2CNWD 4M1SA 2FZ4A 2PUJA 4F5EA 2FMTA 2NP6A 4B3IA 3D0RA 4GSYA 3WDLA 5JZBA 1C0KA 1VIVA 1ELOA 1Q7EA 1JUDA 1UP6A 3FX2A 2XITA 4KDCA 1TVKB 2FQXA 3FD8A 5JDIA 4D4MA 1YZ3A 4TN1A 1D0IA 4UUNA 4YROA 5JNUA 3U6BA 5CJJA 2PX6A 5BPHA 5KNCH 3ETLA 1AO0A 1J7JA 5A7HA 1FA9A 4HNGA 3VR4D 4AMYA 1H69A 3AY7A 3R5XA 1I7QB 1MP0A 4I08A 4N8EA 1Z0AA 4TPKA 5EWJB 3A9VA 4KN5A 5BV2P 1T3SA 1PUJA 2X6RA 2Y76A 2WJ6A 3HN2A 4ZDJA 2QAJA 2IY8A 4Y1EA 1SKQA 3HBLA 4HGPA 4P6VF 1NMZA 2FJUA 4J1QA 3UWPA 2IXAA 4A1FA 3O8OB 1TMOA 1F3LA 2P41A 5IBCA 3OEWA 3V2GA 3VUEA 4DR7B 4J4BA 4M7RA 1G7CA 5A9TA 3VBCA 4FX5A 5U9CA 4RULA 4E5SA 2O1EA 2G6BA 3FA2A 3VZQA 3MXTA 5JROA 3CVYA 1Z8HA 3LUDA 3M89A 2ODWA 3BGWA 3HU1A 5TE9A 5AW3A 2M1XA 3GROA 4LMBA 3WI7A 4EUKA 2HMUA 2DFDA 1Y3HA 3N3AC 3K9WA 4V0MA 4ZQCB 1SCUA 1KERA 2H1IA 3D54D 5GGXA 4F45A 3QVSA 1L4LA 4EKEA 1NRJB 4UTRA 2IELA 4O0LA 4HDNA 4CMCA 3OQMA 3PRHA 2I29A 4PNHA 1T0UA 3A1WA 3MMNA 3AB8A 1CT9A 3BIJA 5BSEA 1Z62A 3OQVA 1IB0A 3KBOA 4AN1A 1U1CA 1TRKA 4KXXA 4XD7D 4EK9A 4LX0A 4BY9E 4GECA 4DV6B 1VMDA 5DM4A 2IV2X 2OV1A 2ZRQA 2NPOA 3ICVA 3OEED 2XR1A 3AVQA 2YJNA 3OX3A 4MGHA 4H2DA 2EFHB 1O89A 4AQDA 4KK3A 4KQJA 1GR1A 3ZOZA 3L4SO 4RTSA 1Y3AA 1SH7A 2C31A 2HK6A 2VIIA 2P0YA 2ZU6A 5CTAA 1NBAA 1X94A 5JD3A 1NYTA 3VH2A 4LHWA 2P7IA 2J9FA 1ZA1A 2NU7A 3TE6A 3SZLA 4Z4GA 5JYEA 2GJKA 4B3SB 1PG5A 1RAHA 3GNQA 4OXXA 4RKQA 4FMDB 3JVEA 3GN2A 1IN4A 1JU3A 4NWIA 1TZMA 3UMCA 2VN8A