2FU5C

Structure of rab8 in complex with mss4
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
176
structure length
146
Chain Sequence
KTYDYLFKLLLIGDSGVTFISTIGIDFKIRTIELDGKRIKLQIWDTTTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKVNDKRQVSKERGEKLALDYGIKFMETSAINVENAFFTLARDIKAKMDKNWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanine nucleotide exchange factor MSS4
publication title Nucleotide exchange via local protein unfolding-structure of Rab8 in complex with MSS4
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 45
structure length 146
sequence length 176
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2fu5C00
1O87A 4DCSA 4FCTA 3GFPA 2R44A 2OLJA 1I2MA 1GRNA 4AYWA 2ZI9A 1S1CA 5FUVA 3A36A 3O8CA 1W0KD 4UJ5A 2V54A 4DZZA 3EZFA 4FXPA 4YMSA 5FUWA 4KVGA 3SU8A 2PMDA 1OLOA 3NH6A 5DHFA 2GAOA 4TL7A 1DG1G 1SXJD 3GEHA 1RKBA 2CMKA 1R8SA 3C5HA 4JJKA 1VCNA 1IOZA 3CRW1 4PSKA 4LY6A 1X8KA 1TU3A 4V0KA 3BFKA 1CR0A 3PUVA 1NMZA 4YONB 1M1YE 1XCMA 5EZ6B 2QM8A 2CJWA 3ASZA 1XPOA 1Z29A 1ZRHA 4H1UA 5DN6D 1XD2B 4RD2A 1WQ1R 4Q4HB 1CULC 1FUKA 1UKZA 1XMIA 2AFHE 2W2VA 4FI3C 4HYYA 5EZ5A 3LA6A 2YOGA 3GLHE 4TYPA 2TMKA 4CT5A 3EWAA 5IDVA 2WPDA 3U5ZB 1P9RA 1Q22A 4C0QC 1UAAA 4KXFB 4F7WA 4GMDA 1NVVQ 1E2MA 4PSAA 5AJXA 2IYTA 3K09C 3QPWA 4B74A 3THYA 1KMHA 4C30A 2C9CA 3N70A 3QKRA 3UG6A 1UKEA 3VR6A 4DWJA 4H9GA 1VMAA 1XJCA 5HZHA 1E4YA 4LBYA 2OXRA 2ZI7A 3DKPA 3I5XA 1FL9A 3AVOA 3FHOA 1KTVA 3QKSB 2H57A 2R6DA 2YNMA 3VU9A 2F9MA 1UKVY 3IPYA 2IXEA 3VX3A 1N6HA 3U7EB 2O0HA 2GF9A 2R65A 1KJYA 2VP4A 3N2IA 2IS2A 2YWGA 5JWRA 1KI2A 3TUZC 1N6KA 1OT3A 1AS0A 4AC9A 1XPRA 3TRFA 3DOEA 5DHAA 5K8TA 5FPSA 2FFBA 1XNJA 2GAAA 1D2NA 1DS6A 3CPEA 5JWHA 5EUQB 3RDPA 3FMOB 4F4JA 4LJ6A 1XXHE 3QG1A 3I73A 1DAFA 3CWQA 3JVUA 4M8NE 3TUIC 2VA8A 2ZS8A 2JDIA 1GKUB 4TWZA 4ZDIA 4OQFA 1VDZA 1YRBA 4NMMA 2BMEA 2X77A 3REGA 2JASA 1UDWA 2F1IA 2ZYVX 3FKSD 3WRXC 1EK0A 3A4MA 4IOJA 1FZQA 4BLQA 1YQTA 4JSYA 4URVR 3GJ3A 2V3CC 3KQHA 1TAGA 1N0WA 3EG5A 1JALA 1U8YA 3T12A 4HLDA 5K8IA 3VQTA 1DO0A 4OHXA 5KSZA 5KPJA 1SVSA 2GBLC 1EFRD 3OE7A 5CM8B 5GJBA 2OBNA 4FN5A 1T91A 1Q3HA 4RD0A 1DBSA 4Q1FA 3NDPA 2VO1A 2OAP1 1OF1A 4Q47A 4O3MA 4A8JC 1CR2A 1UJ2A 3K0AA 2GZAA 4GOXA 3TGPA 5BQ5A 2FSGA 3C15C 2WVJA 5HTKA 2GILA 2C03A 3SQXA 1RE0A 2QM7A 1OE0A 5B2ZA 3W5IA 3EIHA 4FMDB 4HLUC 2NO1A 3HDTA 4IVPA 3QVUA 2RH5A 1ZBDA 3AQ4A 5EE5B 3A1SA 1ZD9A 3KTAB 4GT1A 5JLJA 1R5OA 1W47A 4W5WA 5LB2A 1IN4A 1Q0UA 3WNBA 2D7DA 2GZDA 2GESA 2J7PD 1ZD1A 2ZIAA 4Q1CA 3SYKA 4B3FX 1U98A 2Y8EA 3BOSA 4D80A 2VTKA 1ZNXA 3D6TB 1SVKA 2WM9B 1XU4A 1M7GA 3OEHA 1P9NA 2XZPA 4XH9B 3C14C 3HYRA 2J5XA 1Z0DA 4NONA 3SQWA 1K6MA 2WKQA 4BEJA 1EESA 1D9ZA 1FMLA 1OHHD 4G5OA 4NP6A 3IQWA 3CF2A 2PCJA 3NIBA 1YKSA 2ASEA 3TK1A 3TLXA 3FMIA 2ZRMA 5AUPB 2FF7A 1LY1A 4Q4AB 3GLIE 2NIPA 2OLKA 4Q7KA 4V0NA 2DY1A 1GKIA 2CHGA 1RW4A 1HT1E 1KZGB 2P2LA 3KQNA 1N0VC 4PZZA 4TT3A 5EE1A 3B78A 1XMJA 3THWB 2NGRA 2ZSFA 1KK1A 3Q3JB 3WBKA 2A7QA 1H8HA 4MGZR 4NKRA 2FWRA 5EXXA 2GK7A 1U0HC 3QIAA 1VG9B 3WNCA 1JQJC 1FP6A 1N2CE 4PQYA 4LJYA 5FTLA 3GPLA 1YZTA 2ORVA 4HI0E 2ZS9A 3LH5A 3K8YA 5AJVB 4B3XA 5KO2A 1QG2A 4BE7B 3EXAA 1UEJA 1YZQA 2G77B 3JZMA 4PO1A 1OPXA 3K0EA 2QE7D 4V0MA 1F3OA 2PEYA 2ZI6A 4CEIB 2I1VB 1KI6A 3FFAA 4IOMA 2W0SA 1MABB 2B6HA 1O3YA 3KB2A 3CIOA 3LLMA 3K0FB 4DIEA 3AF3A 1EFHA 1TX4B 2C5LA 5KSOA 4ARZB 4V02A 3KUDA 5J5CA 2QQEA 3PENA 4CRWB 2DWPA 4Z8XA 4CZ2A 4TZ0A 2VIIA 3FKQA 2QMUA 1XMVA 4RZ3A 2XNDA 4HEJA 4Q9KA 3QQ5A 1ZIOA 3LVRE 1E98A 1II0A 2BBWA 4FMCB 4A15A 1OB5A 2WWYA 1MKYA 4P4SA 1NJFA 2W2TA 5AR1A 1KDPA 1G8YA 4JBWA 4KLZA 4QNRA 3GLHB 4ESHA 1KAGA 3FKSA 4RZXA 4HB3A 2XOKD 4C0HA 2OCBA 1IXRC 5J40A 5IF9A 4PX9A 5FPTA 5D3MA 2JCSA 1UF9A 5JECA 4Z1MD 5JBQA 2PEZA 4TQAA 1KI8A 1IY2A 1CKEA 2ZAMA 5E95A 3BH0A 2FFHA 2JGNA 3P32A 3CPHA 3VR2A 4L8GA 1FTNA 4YMUA 1BO6A 4A6XA 3ZZTA 3HP1A 3CH5A 3GD7A 2ZSBA 3KXKA 1NBME 2KE5A 1ZJ6A 4B71A 3UXMA 4DSUA 2ZR7A 4Y0AA 5FOUA 4ZIRB 2NO0A 4QGFA 1PLLA 2OT3B 3PUWA 5B30A 4A2QA 2FZ4A 1E69A 2H5EA 3ND8A 3LW7A 3NKVA 2MSEB 1UDXA 4MYUA 4EPTA 4R2HA 1JJ7A 3AV0B 4HAYA 5EE0A 2J3EA 4OBEA 3BBPA 1ETUA 2CBZA 2P5TB 3P27A 5F9FA 2IXFA 1A1VA 2VQSA 4WZ6A 3NWJA 2BDTA 2G0NA 1XXHB 3UWOA 2WMNB 1Z63A 2J0QA 1H65A 2CCGA 1IN8A 1JXMA 5KSPA 4BLOA 3ZVMA 1BIFA 1MO5A 1VECA 1U9IA 3DL0A 1YR7A 3MRSA 3CZPA 5FUXA 4URWR 4MYHA 2ERYA 1RFLA 3BGWA 3KX2A 1S1MA 3I4LA 4LWZA 3K0CA 3ADDA 3A1VA 4FW9A 4L15A 3GP8A 1D2EA 3TMKA 3R7WB 2QAGA 1GP2A 3DOFA 1J7KA 2ODBA 3B6EA 1IHUA 1A2KC 1DAKA 4TTQA 3W34A 3AM1A 1KKLA 4L4UA 1DO2A 2L0XA 3BH6A 1W5TA 1S4QA 1KGDA 1UBGA 1HUQA 3AKCA 4TSFA 1QHSA 4DUGD 2AR7A 2W83A 5J4VA 2GCOA 3ETLA 4DDWA 4PQRA 5SZIA 2D2EA 2IWRA 3O47A 1G4UR 4LV8B 3GLFE 4TYYA 4DDUA 5JMTA 1S8FA 1E2HA 2FV8A 4QBGB 2JLYA 4KI0A 1KO4A 1S3GA 1II8B 2WSSA 4M1OA 4NYJR 5LD2B 2G88A 3OFND 1OW3B 1D5CA 3K70B 2AKYA 2VBCA 3SJCA 3TR0A 2QY9A 3RC8A 1C1YA 3IGFA 3PEVA 4IVQA 5HE8A 4GOKA 2NZJA 4ZDJA 2CEAA 1Z0JA 2ZYUX 2N42A 2BCJQ 2GEVA 4D81A 3U7FB 1E9FA 2C78A 2ANCA 5L3QA 2OG2A 1QVRA 1NVXQ 3U7GA 5CIQA 2DPXA 4LK2A 1FQKA 3CRMA 1E0KA 1LF5A 3MWKA 3K0SA 3S1AA 3ZQ6A 3SYNA 1AQYA 4B43A 5DYIA 4O2LA 2ZSAA 1W48A 4POAA 1VTKA 2V6JA 4XJXA 5FI1B 1WBBA 4ZDWA 2FOLA 1AGRA 4EQ6B 2IUSA 1Z6TA 4FWTA 1XJQA 4IXMA 1Z6XA 1Q1ZA 4C0JA 2WIBA 3QXSA 3QE0A 2HV8A 1YZNA 1YU9A 4XWOA 3UANA 1K8RA 4L9WA 3OZXA 4QJ3A 1KAOA 1G7SA 2W0MA 1WBDA 2FN4A 3NH9A 4XOIA 4CGZA 2OFOA 3B1XA 2R6GA 1KMQA 3PITA 1RYFA 5CJPA 4XVRA 4XIGS 3GLIB 4G5GA 1IN6A 1EFUA 2A5GA 1E32A 5FR2A 3SI7A 1HV8A 1W46A 2V1UA 1N6PA 5H1YA 3RS3A 3CNNA 1OYYA 2QGZA 1WDTA 4A8JB 3LX5A 1P5ZB 4KSBA 5FFMA 5C1BA 1W4RA 1HA3A 2Q21A 3X1WA 4BRUA 1ZYUA 2C04A 3KQKA 1CS4C 2WWGA 1OH8A 3FYHA 4GI7A 2EFDB 4B6EA 3PJRA 2PH1A 1E9CA 2ZJ5A 3TVDA 2BJVA 5JRZA 2DCUA 1YVDA 5FL7A 2QTHA 4OHYA 2R62A 3GJ5A 1GNRA 3MCAA 3T5GA 4W5JA 3AP2A 3L0OA 821PA 3LAWA 2OUKA 3FHTA 4QBFA 1G8PA 3DVLA 5FTKA 1W5SA 4QOSA 4DSOA 3RSOA 4JYCA 1P7CA 3CNOA 3QF7A 2GVZC 3LQQA 5H68A 1JB1A 2YWHA 1QRAA 3DZDA 1FMJA 1PLKA 1AQUA 1E9BA 2J45A 3B82A 4NCHA 3T35A 3ONWA 1W0JD 2QP3A 2CK3D 3KJGA 2J46A 2IF2A 4XTRA 4BFZA 4BEBA 3U44B 4BFTA 5CDFE 1KY3A 1NY6A 2F3TA 4EPVA 2H7VA 2W6ID 3EIQA 5SZKB 2F1RA 4QGAA 1E96A 4V0LA 4LYFA 4BLTA 4B32A 4AKHA 1E1RD 4LV6A 4MDEA 3G0HA 1T3LA 4RFSB 1LFDB 1ZU4A 2AK2A 1AS2A 4TMVA 3LBHA 3QPUA 2D06A 4IDNA 1ZM9A 3LFUA 3FGNA 3Q8XB 2XSZA 2OCYC 2Z6VA 3LQRA 3P4XA 2F9LA 3BFVA 721PA 3AB3A 4AI6A 1CF4A 4A6PA 4V0OA 2CL7X 3GEIA 2J0UA 2DFKB 5DI3A 1LTQA 1SULA 4K46A 1G7RA 2A5DA 3AGQA 3SR0A 4FWIB 2XZLA 4NHOA 2E87A 2VHCA 5A0FA 1OSNA 2CVHA 1JEDA 4PC7A 2GXSA 4EAQA 5LPNA 4HDQB 4PAOA 1TADA 1QHIA 2RAPA 1HY3A 2BEKA 3H0KA 4DSTA 1KSJA 3TAHA 4LBVA 4E03A 5GVSA 1A4RA 4B3DA 5CIWA 4ZO4A 2X2EA 4PHGA 4QBIA 5EP4A 3ZVLA 3ICQB 1TUIA 1YZLA 5TB5A 3IBGA 1E2EA 3U2QA 1Z8FA 2WAXA 5CK5A 3QEJA 3SBDA 1T4GA 4Q19A 1VCMA 2HLDD 4Q00A 2DWOA 1RJ9A 1G21E 1FUUA 3PUZA 2JJ1A 2V4ZA 6Q21A 5ELXA 1YZGA 1J8MF 3FPAA 1G3RA 4KBGA 4I1UA 4M1WA 4O25A 3THXB 1FNNA 1Z2CA 4QL3A 1IN7A 2VHUA 1ZC3A 3NEYA 5DE3A 1P2SA 2RB4A 1DAEA 3ADKA 4UNNA 3FB4A 4URZR 5E4FA 4Q1DA 4B3BA 3QY0A 3I1FA 1OXTA 2A78A 3AVXA 2OCAA 1P2VA 2EFEB 2RHMA 3FHCB 3B1WA 3QKUA 5CK4A 5JJKA 2Q3FA 1NRJB 2JAQA 3SC3A 3VHXA 2V9PA 3RWMB 2H8KA 3NEJA 1OYWA 4RD3A 1DELA 4ACAA 3BJIC 5CYPA 3TJZA 1G7CA 4EUNA 4NYMQ 2LKCA 2PT7A 4BASA 4PTLA 4EPRA 4B3CA 1QHXA 4HDOB 2ZITA 4OQLA 1OV4A 2A5YB 4IFBA 5C46F 1S0UA 1XTRA 2WWWA 1TF2A 3BC1A 3H1TA 4HZIA 4X8LA 2GK6A 4UXHA 1SVIA 5B57C 1YZKA 2GJ8A 1XDBA 2ZI4A 2P6UA 3GLFB 3R9XA 1DAMA 2Z4RA 3W3AA 5M04A 4V03A 2AKAB 3GLGA 1EWRA 4MRNA 1E0SA 5G53C 4QKQA 3U3RA 1JR3D 5KDLA 2IC5A 2DBYA 3V4FA 4C9BA 3B1ZA 4JL6A 3U61B 1ZMXA 3ZVNA 2ZJZA 1KO5A 4Q66C 3VMFA 1OFUX 1UADA 2VP5A 2IYRA 4YMWA 3W6NA 2GXUA 3HR7A 4FMBB 4NU0A 2QQ0A 2EFGA 4CYMA 1JR3E 3KXIA 2YHSA 2WWIA 2ZU6A 3LNCA 4US0R 1XBTA 4JBXA 4KSCA 2V55B 2CHVA 3W90A 1HQCA 1N5IA 4EJSB 3E70C 4ZI3A 5EXTA 1GZSA 5DIFA 3X1ZA 1ANKA 1L4YA 3EPLA 4JLAA 2BV3A 1W4AA 1OFTA 4IVRA 4F38A 3M0EA 4IOLA 2HXYA 2BM0A 4I1OA 5BXQC 1N25A 1RRPA 2KBFA 2V6IA 3IHLA 2IUUA 4CF7A 2QP4A 4RKEA 4ABYA 4D82A 4GSYA 4DEXA 5KPDA 5HCNA 3ZQJA 2RKOA 1SVWA 3CF0A 5EP1A 3IHWA 4G5SA 4OHZA 4RKFA 4IHQA 2IBMA 5IT5A 1Q1BA 4PC6A 1ZUNB 4HDCA 1W2HA 4C7OA 3T61A 4JLMA 2LCFA 2WOOA 1G5RA 5CM9C 1VPLA 4LCBA 2EFHB 1G41A 2O5VA 2QTFA 2BMDA 1SGWA 1G9XA 1CU1A 1SVMA 3H86A 4TLBA 2YC2C 3M6AA 1CIPA 3FMFA 5FBVB 1DE0A 4FMDF 4M22A 2QGNA 4NYIQ 3ZZ0A 4A2WA 2ZRDA 5AUOB 5JSZA 4TLDA 1EGAA 2DFNA 2ORIA 4DLYA 3RVBA 1TUEA 4WZBE 3Q85A 1XFAA 1DEKA 1G3QA 2RGXA 3SJZA 4MKFA 4RY2A 2VSFA 1ZUHA 2BMJA 1BMFD 2QBYB 3IDQA 3KFVA 1GFIA 1FX0B 1X8LA 3MUFA 4Q1AA 4B3GA 4KV9A 3U3JA 3IEVA 2DWQA 1AIPA 2NZ8A 4QJ4A 4TL6A 4EFLA 2ZPTX 1SKYE 4UKDA 1Z6GA 2EWWA 3KFXA 3D8BA 3ZVRA 1FTSA 1NVUQ 4LSGA 4QHSA 2OFXA 4L5BA 1R8QA 2RGDA 2IUTA 2XXAB 4DSNA 4AURA 4JT2A 1VHTA 1QVAA 5HZKA 1E9DA 4Q02A 2I1QA 4D0LB 4AK9A 2HJVA 3WP1B 5LD2C 2GXAA 3MFYA 4JBYA 3LVQE 3K70C 2R8RA 4CEJB 2V8OA 4TMWA 1X6VA 4GZLA 5F98A 2ZYWX 3SS8A 4B44A 1W2GA 2P0EA 2AWOA 5KOYA 2ZE5A 4GMXA 4LC0A 3V9PA 1Z0AA 2F43B 3HWSA 1QZXA 1ESMA 4EPWA 3KKPA 1Q1EA 4A0HA 2ZQ5A 2KJQA 4E09A 2D74A 2WKPA 2RGNA 3CX6A 1OKKD 121PA 3QXJA 5FPKA 2WMOB 4V0ME 3VR5A 3T1QA 4H1VA 5EE9A 1XEWX 1RYHA 1KJWA 4I1VA 3C7KA 4OHWA 4EFNA 4LJ7A 2ZJ2A 2HEIA 1ZC4A 1K5DA 4PC1A 1Z5ZA 4AG6A 1PUJA 4NDZA 3MD0A 2A5FA 4D4JA 3IKJA 3BH7A 1E2NA 4XD7A 1MO4A 1TTTA 1U94A 1XEFA 3J81k 3SNHA 3U3KA 4ASUA 4BFXA 5JEDA 4GOJA 4JKIA 4M1MA 4M0LA 4LYAA 3ZJYA 2WZQA 3W8NA 1T3HA 3CPJB 2VLIA 4D4KA 4BZPA 4Y0VA 2CJWB 3K70D 1VIAA 2KSQA 1XEWY 2IYVA 3QBVA 1E9EA 1F6BA 3DEFA 4FMCF 1HT2E 3ADCA 3AH8A 4CVNA 1F5NA 1SQ5A 2XTNA 5FOXA 2QAGC 4M1SA 4NCKA 4A2PA 3HU2A 4D26A 4OQXA 2JJ8A 3OAAA 4B75A 4BLPA 2B92A 4HZUA 2NPFA 5KNDA 1G8GA 1F2UA 2O8DB 3A4NA 3K53A 4LX0A 4GNKA 5J47A 1KMHB 2PLRA 1N5LA 2ODEA 1T8UA 3QKRB 2R6AA 2QG6A 1MABA 4C0AC 5G3ZA 4DRZA 2OE2A 4PO8A 3VU9B 5KNBA 2J9RA 2DYKA 4BFWA 4DT1A 3A8TA 2GVDC 4L16A 3QI2A 4LJ9A 2NO9A 1W7AA 1KI3A 1XX6A 2SHKA 1P3JA 1XZPA 5JS8A 1W0KA 3U6KA 4KYUA 3SBEA 4PPNA 1V43A 5JFGA 2J1LA 3WP0A 1P2UA 1UPTA 2X8AA 4GP7A 3SJAA 5IK2D 1XB2A 4CEHB 4DBLC 5FPYA 1BH2A 3PG5A 4K81B 1SXJA 4XWAA 3KL4A 3Q5EA 5G41A 3UMFA 2CL6X 1XMSA 2JLUA 1VHLA 2GKSA 4ZKEA 1ODFA 4MDFA 2ODWA 4MH0R 1MR3F 1N5JA 1GSIA 1COWD 4P3YA 4ZDKA 5DN6A 3B85A 1XEXA 1E99A 3MLEA 3A58B 3HYTA 3B60A 1NL3A 2VHJA 1GVNB 2QT0A 4G5QA 5G3YA 1NIJA 3QXCA 1G5PA 3KZ1E 1AN0A 1X1SA 1JAHA 3EZ7A 1QHHB 2CLCX 4URYR 1R6BX 4JLKA 1KDTA 3SDZA 1KI1A 1XTSA 2ZJOA 3SN6A 3NTUA 1CRQA 2YOFA 2FU5C 5FOTA 1P60A 2QORA 5L3SB 2VH5R 2RGAA 2YWEA 4P0TA 1NVWQ 4QFMA 1SKQA 1TL7C 2ZTSA 2YINC 5JHHB 4RD6A 3A1TA 4U02A 3V4RA 5FOWA 2I4IA 2IK8A 1DPFA 4WA7A 3I72A 3B5JA 3I3SR 3KXLA 3VFDA 1JPJA 3K0AB 4MQBA 3E5HA 4AKGA 1YR6A 4URUR 4MITA 3CO5A 3MJHA 3FOZA 2ZVQX 3ZH9B 3ZDQA 5J4LA 2QPAA 1W49A 2JJ2D 5JWOA 4B48A 3AF2A 4D4LA 1P62B 1N5KA 1J70A 2VL7A 4FCWA 4ZKDA 3RS4A 1KO7A 4ZI2A 3QXHA 2FX3A 4TLAA 2VYFA 5TY0A 2ZAOA 1P4SA 2NG1A 4JZKA 5AJWA 1XTJA 4BLSA 4BZXA 2BOVA 3CBQA 3ADBA 2IF0A 3BIFA 5GJVC 1HE8B 4OYHA 2X2FA 4E5UA 3LBNA 3K09A 1G3UA 2AK3A 2ZUBA 2PT5A 1V5WA 3I32A 4US1R 1GWNA 4OI2A 4BGDA 4DIDA 1E2JA 3LO5A 1NBMD 1U2RA 2EVWX 3BB4A 1TQ2A 1OB2A 3D7MA 4S2EA 2IYYA 1SKYB 1OXSC 1WXQA 2H1LA 3OIVA 3EX7C 4LHZA 1N6LA 3C16C 4URXR 1EFRA 1GOTA 2AN9A 1FP7A 1KI7A 2EWVA 3PR1A 2LWIA 2PZFA 4DDVA 5HPYB 3SJBA 1VKJA 4M9XA 4TMXA 2IS1A 1II8A 4LPKA 4TL8A 1JBKA 621PA 3SFVA 1W4BA 2GRJA 3Q72A 3BXZA 1GIAA 1GNPA 1J8YF 3QUSA 1E4VA 3WYAA 4OK6A 1XWIA 1LS6A 2CE7A 2R9VA 4MRSA 2XJ4A 1CJMA 1I2DA 4ZV4A 2CDNA 3OEED 1CLUA 1VYTA 4DCVA 221PA 3L0PA 2FMXA 2WWFA 2PJZA 2QAJA 1XPUA 4PZLA 4Q4LA 4DCUA 2XTMA 4P33A 1F60A 4RVCA 4DLXA 3EPKA 4IDOA 4MGKR 1Z83A 5GADl 1IAQA 1GL7A 1LF0A 4JLJA 5FBRB 1R5NA 4AKIA 2WWXA 2BEJA 4AYXA 2IYLD 2J7PA 5DO9A 4Q4JA 4C0KA 1KSHA 2JIZD 1AM4D 3BB1A 5FL3A 2X19A 2ZS7A 4EJSC 5GJWC 2G0TA 3TAUA 1R7RA 3C5CA 4YC7A 1KI6B 1HQYE 3IEUA 4JT4A 2QSZA 1UBFA 2VEDA 2HCJB 4JVNA 4LRWA 3CUEF 3IIJA 2C96A 1OHHA 1H8ED 2G1KA 2Q6TA 2UZ3A 1TEXA 3VR1A 1TF5A 4AY2A 4P4TA 2G9NA 4IDQA 4IOKA 1KO1A 4HB2A 1KK0A 4NCJA 1FOEB 4RJLA 4US2R 2ZSEA 1US8A 1XZQA 3PFIA 1I4LD 3UIEA 1A2BA 2HCBA 4HAWA 2ZR0A 4P4SB 4FD2A 1VYVA 3GJXC 1OH7A 4Q21A 2ZJYA 4HLUA 1GL9B 1W1WA 3AP3A 5TDHA 4D4MA 4LI0A 4Q01A 5FBWB 4MA4A 2YOHA 1XTIA 4KU4A 3TUJC 4NL4H 1ELOA 5BN3A 5D3MB 1ZM7A 1E1QD 3KKOA 2ZRGA 3WHKA 5CB8A 3CX8A 2GJSA 3U3OA 3TSWA 1VG0B 3PUYA 5SZHB 1AGPA 2W00A 1TNDA 4ITRC 2QZ4A 3JZAA 4IW3B 2RHDA 3HJNA 4WOPA 1N6RA 2GA8A 3AKYA 4RZUA 4EPYA 1MO3A 2P3SA 2QE7A 3E1SA 2B8TA 3F5FA 5FPHA 3IUYA 1E0AA 1JEEA 2CVFA 3CW2A 3K9LA 4J0QA 4OKSA 2Z83A 2GHIA 4HSEA 4HUQA 2OAQ1 3TNFA 4B2IA 4B73A 3CR7A 5JS7A 4Q1BA 1MOZA 1AA9A 4UXJA 1XF9A 1MT0A 2CXXA 2YC4C 3GJ6A 2IYWA 5BN5A 1CTQA 3PIRA 2JJ2A 2FPMA 2YV5A 3R8FA 2ORWA 2N46A 3L8ZA 3VHLB 4QM6A 3EZ6A 1TQ6A 3EPJA 2HXSA 2ODNA 2Q3MA 3UATA 1TEVA 2W58A 4UXIA 4DVGA 4D6PA 2BJWA 4Q03A 1YR8A 2CNWD 2BBOA 3RAPR 3WY9A 1IJFA 4B34A 4LJ4A 2IHYA 3F0TA 2FEOA 3R20A 1XP8A 4C0BA 4WW0A 2VHQA 3T5DA 1WA5A 3TE6A 2AD5A 4D0NA 4RSGA 4JMPA 2D4HA 2XOKA 1PUIA 2O8FA 1G8HA 1KY2A 2JLSA 2OSBA 2W6JD 2XITA 2ZRIA 3ZS8A 2IHBA 1VG1A 3B8HA 3EAQA 4YMTA 4Z51A 3QNUA 2QAGB 2ZRHA 5AJZA 4Z1MA 4OI0A 5EE3A 1K5GA 2C98A 3RYTC 2QI9C 3NHAA 1JI0A 4E22A 1MRSA 1HYQA 2ZREA 2WTUA 2QMHA 4NYMR 2NQ2C 4P4UA 1WB9A 1U8AA 2QROA 4LDJA 2P6NA 3QG5A 2GJ9A 1TU4A 1HURA 3W6OA 3BD9A 2OBMA 1OXXK 3I8SA 1CXZA 1E3MA 1GG2A 2GCOB 2JLVA 1WE2A 3RS2A 3EPHA 1SHZA 4CT4B 3UMRA 5FUYA 3RC3A 3PXGA 1AKYA 3B9PA 1E2GA 4N0EA 3VTKA 3GLGE 4BQSA 1QF9A 4YXWD 4OK5A 2QRNA 5P21A 4QJ5A 3THXA 4Q5IA 2CCJA 5BWMA 3LLUA 4XVQA 3ICEA 1G20E 1NLFA 2GZHA 2NOAA 2YVUA 4XTCS 3U4QA 1G3IA 3MG9A 1D9XA 2IYQA 4Q7JB 5HKKD 2B7BA 5KDDA 1ZNZA 3ZIAD 2A5JA 1ZINA 4BPBA 2EQBA 5L3QB 1F48A 3EARA 5JZVA 2IYZA 1E79D 2G6BA 3MGCA 1E94E 1R2QA 5TXGA 3CZQA 1XCGB 1XD9A 3G82C 2V7QD 2GWHA 2ZSDA 4G3XA 1W36B 1J99A 2D3WA 1P61B 2OXCA 4MKIA 3HU1A 3NBZC 4C3ZA 2XZOA 5KDOA 1Z07A 4A4DA 1A5TA 5IRCD 1M6NA 4N0DA 4QC2A 4B33A 3F8TA 4JL8A 4M1TA 1Z0IA 1EFCA 2ZRJA 1F2TB 3CRQA 1YHNA 3GCGA 2F3RA 5KUTA 1QHYA 4EDHA 2RCNA 5AWFC 1EXMA 5E3HA 2O8CB 2IXGA 2O0KA 2A2ZA 1TF7A 3DHWC 3L8YA 2CLSA 3FVQA 4BLRA 3ZGXA 4DUGA 1Q44A 2QEQA 4P32A 2ONJA 4LOAA 2FPKA 4Z8YA 4M2LA 4AKEA 3RS7A 2IA5A 1JECA 2CE2X 1M74A 3SOPA 2ZI3A 4A0FA 2ZXUA 1T0JB 3LV8A 2A9KA 1II9A 1NG1A 1ZU5A 2PZEA 3DMNA 3TSZA 4LZZA 1G18A 1IXZA 2CCKA 3OFNA 4LJ5A 2FFQA 3CR8A 5SZJA 3GFOA 4KO8A 4M4SA 4NYIR 5LDDC 4ZPXA 1QHNA 2ONKA 1L4UA 2P5SA 1R0YA 1NF3A 5BN4A 1R0WA 4M9QA 4YDSA 1ESNA 4C0LA 2O8BA 5JJLA 3VKGA 1RVDA 2RGNC 2WPDD 1A82A 1MO6A 1Q20A 4PFSA 4WVFA 4TZ6A 1Z6YA 4TMKA 1X8JA 3GJ8A 4LC1A 4HUTA 4MGIR 3SE0A 1FNMA 5UKDA 3EIEA 3IO3A 2JATA 3NC1C 3TW4A 4EFMA 1NN0A 2UZIR 2WJHA 1E6CA 1NVVR 4PHFA 2RGGA 3NBFA 3KJIA 5FOSA 4HB0A 2R6CA 4N3NA 2IWHA 2FG5A 2QENA 4KBFA 1L8QA 1OFIA 2PLFA 2REBA 4OQNA 3BE4A 1IONA 1QG4A 4S35A 2ZEJA 3BAFA 1E9SA 4F92B 2G83A 4PAMA 3N2EA 2HT1A 4O2RA 4KCGA 1CJVC 2RGBA 2KB0A 5CLLA 3W3ZB 1GRRA 4JKYA 4KHZA 3AGPA 1D2MA 2G1JA 3UPUA 4LJ8A 2H17A 4UNRA 2EYQA 3QF4B 1AJEA 1Z6AA 3O8DA 4KYIB 4ACBA 1NLYA 5EXSA 1D6JA 4U00A 4JLPA 1XD2A 5TV2A 3LW8A 4NBSA 3ZYCA 4BECA 2JDID 4Q4HA 4GZMA 2H92A 4DHEA 2XTZA 2OM2A 4Q9JA 3U60B 2YWFA 2MMCA 4PPFA 2H16A 2HF8A 3KJHA 1NSFA 2J0UB 4KFRA 3VAAA 4DB4A 3OESA 5DI3B 4E07A 4RCZA 1NMYA 4TTRA 1KSFX 1TMKA 4YMVA 3DO6A 4M1KA 4A1FA 1Q12A 3C4JA 4Z54A 5TARA 2QMOA 5AJYA 4LBWA 1NI3A 1RRGA 2VRWA 1G1MA 1E2IA 3OE7D 2ZJBA 4HLQB 4M9SA 3QKSA 5CDFA 1E2DA 4F91B 2FGJA 2WSMA 4F4CA 2C99A 1SXJC 2P67A 3QJYA 1CRPA 2Q0HA 1W0JA 2XB2A 2ZUCA 2R2AA 1ZW6A 2CK3A 3KKQA 4D25A 3ECCA 1U0LA 2BWJA 2J0SA 2ZR9A 5F2EA 4OQMA 1WMSA 8OHMA 1RJ9B 3VKWA 1N6OA 3NBXX 4XSHA 4B35A 2W6IA 1G64A 4DXAA 1TQDA 4YDHB 1W44A 4TYWA 1YR9A 2R6FA 4UNPA 5KHOC 4FIDA 1DARA 2D2FA 3I92A 3SZRA 2MSDB 4JYBA 1GTVA 1ZNWA 2F55A 1E1RA 1OIWA 3AVPA 3MWYW 4DC9A 4ZCIA 3KKNA 3AVTA 3P1JA 2BVNA 2F43A 5JHGB 5DNYB 3QVVA 2Q9AA 4PR0A 3NBYC 5DYGA 1MV5A 5H70A 4KFSA 4CW7A 1OXUA 2BHRA 4AYTA 5CB6A 3HU3A 3VNVA 2PZGA 2QL6A 4U5XA 1S96A 4WXPA 3CM0A 1Q1QA 2YYZA 5JEEA 1N6IA 2XB4A 3B7GA 4IDHA 3OEHD 1EWQA 1T9HA 3EW9A 4QHYA 2ZRCA 3IIKA 2JEOA 3K1JA 3KB1A 3WHLA 2FSFA 3E2IA 5AUQA 3H84A 3D31A 3QEOA 2BBSA 1A7JA 1NJGA 4IXNA 2IEYA 4PHTA 2D7CA 1WP9A 1GDDA 3TVTA 5JRJA 2PCLA 2O8EB 1BOFA 2OFWA 4W9MC 1MH1A 2QN6A 4TN1A 4L9SA 2XAUA 3GJ7A 5D3QA 1JNYA 2QRZA 4IEEA 3GLGB 1GKYA 3A1WA 4IJMA 3RS5A 4MKGA 4PQFA 3JVVA 1SXJE 4KFUA 2WBLC 1G5TA 2HLDA 4TT3D 3IO5A 3GEEA 4JLDA 3KJEA 3QENA 4YQFA 1U90A 2OZEA 1H8HD 3RANA 4TYNA 4NTZA 5J4YA 4PSVA 4C4PA 2C8VA 3X1DA 1G17A 4W5HA 3KTAA 2O8DA 3CLVA 1P9WA 4AIIA 2FGKA 1NKSA 3LRPA 2J41A 3DKVA 1GRQA 3LWNA 3Q5DA 5DH9A 4A36A 5F3WB 4B2PA 2NMVA 4C2TA 3NXSA 2IT1A 2F1HA 2DHRA 1SVOA 1M34E 2JLXA 2OHFA 5E7IA 1M2OB 1PZNA 4X8HA 1CEEA 3FWYA 1CBUA 1Z2AA 1ZIPA 3L0IB 4CEHA 2F7SA 4PAQA 2GDJA 3RRMA 4MRRA 3GFTA 521PA 1KYIA 1LW7A 5EP2A 3TR5A 3FE2A 3L2OB 4NE2A 3RS0A 4C7OB 1GITA 2REXB 2XNDD 2WJIA 4Q4AA 5L8VA 1X86B 3BK7A 4BRWA 2WAYA 4LGMA 1JR3A 4Q9HA 4I1SA 3V00A 1FQJA 3THWA 1IN5A 3IPXA 2ZUDA 1T5IA 1Y63A 2ZRPA 3AKEA 1ZM4A 4Q7LA 5JSZB 2WICA 5AK0A 1U9IC 5DI9A 2C9OA 4RD1A 3LY5A 1QHHA 2PX0A 2CHQA 2EU8A 5KNCA 2CL0X 4QRHA 4Q9LA 2XX3A 2V1XA 1Z06A 1E2PA 3GQBA 2KWIA 3K9HA 5E7MA 2VSOA 3K0CC 4JIMA 3R8CA 2J59A 2AFIE 3WYFA 3ZZUA 5L3SA 2ERXA 2DFLA 2H18A 4GFDA 3A4LA 1FPMA 4G01B 4O0MA 4ON9A 4Q1EA 4CEIA 3THYB 4AG5A 2ZM5A 4KITB 2OILA 5JCPA 3LX8A 3PVSA 3DM5A 2MMGA 3T34A 3MJRA 3KQUA 3K0FA 3EZ9A 3LDAA 3NC0C 3H4MA 4I81A 4MUBA 3I61A 3O8RA 4ARZA 3PV0A 3BB3A 4M21A 3PEWA 4I4LA 2OEPA 2EFCB 1HE1C 4A0GA 1NN3A 2N1BA 4YLGA 1P75A 1UEIA 3CB4A 1AK2A 4R2IA 3QOFA 3UKDA 2B21A 1X1RA 2VF7A 1VIYA 2JLQA 5LBIA 5BW8A 1N6NA 5BYJA 4WZAE 2JLWA 4A92A 2ZRBA 1PVOA 3RSLA 3BWDD 3GLHA 1M8PA 4UQOA 1DAHA 4KJZA 1XTKA 1E9AA 3AUYA 3C41J 4R7ZA 4QG7A 4BZQA 4TQ9A 2XEXA 2GXQA 2ZYTX 4OHVA 2ZRAA 1W36C 4C0SA 3BFXA 4DLSA 3QPVA 3Q7QA 3W5JA 2ATXA 4BFYA 2NTYC 2Z0MA 1OH5A 5B58C 1Z0KA 1E0JA 1VCIA 5DLQC 4LPSA 3CX7A 1BMFA 3ND9A 5FOVA 2IYSA 1S2MA 4IEIA 1ZD8A 3AVQA 4TSFD 4X8OA 3PQCA 4ZIRA 2IEZA 2RGCA 4DLVA 1DAGA 2AXNA 4DB2A 5FTJA 3L82B 2WKRA 4DLTA 1HH4A 2OCPA 3EA5A 1GNQA 3U3MA 5KTYA 2RGEA 2DR3A 4R98A 1KI9A 2WSSD 2IS6A 4JLNA 4B47A 3TQFA 1CJUC 4A0RA 2QSYA 4M53A 2HJGA 3RABA 2XJ9A 4I99A 3CRRA 2OO7A 1YJ5A 1PLJA 5AUNB 4GDFA 1XXHA 3RWOA 2Q9BA 4KLNA 2C77A 2QMEA 4DLRA 4JVMA 3TIFA 1GL6A 4DCTA 3I62A 2C2HA 3TW8B 4XWKA 1NY5A 3T1VA 1FW6A 2Z4SA 2BKEA 1JJVA 1P2TA 4HZUB 3VNUA 3OHMA 1W36D 1F2UB 3M1IA 3BRWD 4BUJA 5GVRA 1AZTA 4BWYA 2OBLA 2ECKA 1NMXA 3R7WA 1IQPA 1BYIA 2QP9X 1OKKA 1NG9A 1UFQA 2DB3A 4MRPA 4LV5B 1TPZA 2EW1A 4OI4A 3NVAA 3EZ2A 4DT1B 2ZRKA 5IHPA 4UNQA 3CONA 1AS3A 3PCRB 4HB4A 1E2FA 4TTPA 3VR4A 2WOJA 5FBQB 2XGJA 1ZM3A 4G5RA 1CJKC 1IJEA 1G4AE 2GJAA 1G3MA 3N5CA 5E7JA 3UWKA 1JR6A 3BS4A 4LHWA 1LV7A 1SXJB 2Q9CA 3SHWA 3HPQA 1WRBA 3OIYA 5K8LA 1RRFA 4DLWA 1L7VC 1TQ4A 2FNAA 5CITA 1YZUA 2UVQA 3WNDA 2Q3HA 4HATA 4FCVA 2IW3A 5JCZA 1FFHA 4PO9A 3REFA 2PJRA 1WCV1 3MWLA 3EC1A 1G19A 2IL1A 1XEXB 3LXRA 3A6PC 3DM9B 3EA0A 421PA 3LD9A 3K9NA 4NCNA 1S3SA 2IYXA 4QHTA 5FL7D 1IBRA 1YRAA 5FH9A 4ERNA 1Z28A 2ANBA 2VP2A 5EQTA 1ZVQA 1OFHA 3O8BA 3KDSE 4EQ6A 1T3SA 5EUMA 1ZCBA 1ZNYA 1SVLA 4GBMA 4W7SA 1DTSA 2DFTA 3AEZA 3UG7A 3I8XA 1KKMA 1U99A 1M7BA 2GETA 4BFSA 3AF1A 2JA1A 4EIWA 3VR3A 3SHFA 1P6XA 1OJLA 2NO7A 4MRVA 2GNOA 2REOA 2WIAA 4D0GA 1ZUIA 3RNLA 3AF0A 5H8WA 5C2JB 1B0UA 2QPOA 4B6FA 2GBLA 1Z47A 3LBIA 3GLIA 5IK2A 2FEMA 5TVKA 2YJTD 2GJKA 3W6PA 1U81A 2FFAA 4B76A 1T5LA 5K8UA 4PC2A 4QM7A 1OIVA 2HYIC 4A8JA 3VKHA 2WJJA 3Q7PA 1KK3A 3D3QA 4GL2A 4DCNA 1KIMA 1COWA 1Z22A 2CLDX 4KODA 1CJTC 1ZCAA 2XSZD 4UJ3A 1KSGA 1Z08A 5TMPA 3B1YA 2GEDA 2BC9A 3KKMA 3THOA 1XCPA 1XJ0A 3AVWA 1R0XA 4C2UA 2W2XA 4ZCLA 5HE9A 2ZE6A 1WF3A 2QA5A 4PXAA 2O0JA 4PANA 1ZM2A 3CKLA 2O52A 2XNSA 2YKGA 3P4YA 3MWJA 4MUAA 2Z43A 5FTNA 1VYUA 3WMGA 3KUCA 3DMDA 2FZLA 2HUPA 1G7TA 3PEYA 1R10A 1DG3A 4RD4A 4LYHA 3T1OA 1RIFA 2A30A 4R71A 1XRJA 1RPZA 1P73A 3EWSA 4IKEA 2ZE7A 3C8UA 5EP3A 1LNZA 2ZVPX 4TLEA 3ZLJA 2GF0A 2ZROA 3WYGA 4TLCA 3U44A 1E2LA 5EXPA 3AUXA 3RLFA 1KNQA 2BIFA 2VSXA 5CLQA 3ZD6A 1KO8A 2JJ1D 2OV2A 3TQCA 4RZ2A 1X3SA 4DJTA 1SZPA 1NN5A 2VP6A 3IQXA 4OJKA 5CYOA 1IM2A 2KBEA 2FSHA 2HT6A 4JLOA 4II7A 4B2LA 3HPRA 3LXXA 5BYKA 1IY0A 4RFSA 2FE4A 2ZE8A 5HR5A 3IIMA 3R9WA 3P26A 1YE8A 4N1AA 3HR8A 1KHTA 4TMTA 5DSZA 2GTPA 4HLCA 4MYTA 3R9IA 4LHXA 1JAIA 2AX4A 4F93B 2X1VA 4PC3A 1KJZA 3X2SA 3WBJA 4P31A 4Q4JB 1OH6A 1N3BA 2JLRA 3TBKA 1F2TA 4NZYA 4CDGA 2IS4A 1AKEA 4KVAA 1P72A 1EX6A 4MKHA 2ZRNA 2O8CA 2VPPA 4NH0A 4QXAA 5LB4A 4QNMA 1NLZA 1NBMA 3AP1A 5C4GB 4M1YA 2ZU0C 5L3VA 1EX7A 1R4AA 2G3YA 1J90A 2KI5A 2QT1A 2RMKA 2ZJAA 3FMPB 5JI2E 4DLUA 4JLVA 5FTMA 3DDCA 5HCIA 4RCYA 4Q9IA 4DKXA 3RRZA 5J4KA 1GAJA 2HF9A 2MSCB 2WWHA 3MSXA 1US8B 5DGXA 1KNXA 1R0ZA 2IYUA 4QBHA 4U7DA 2NPIA 3U7HB 4ZCMA 1VCOA 1JXOA 4HAVA 3X1XA 3MMPA 1G6OA 1W4CA 3OEEA 1T0HB 3TKLA 4FINA 4OL0A 5CJ2A 3VX4A 5JI3E 3T15A 1KDRA 5DISB 1MRNA 1Y3AA 2LKDA 3DZ8A 3RRNA 2AXPA 2FJUA 3GJ4A 4KFTA 4LYJA 4LJAA 4WAUA 4TL9A 4EKDA 4XSGA 4JJZA 1SHKA 2VP0A 4IFEA 4BFVA 4DEYA 2QPTA 3S1AB 3M4YA 3L0SA 2NO6A 1VG8A 2B7CA 2JIZA 5A5GA 3AVUA 3TSOA 1KOFA 3GJ0A 3FFBA 2P6RA 4TMZA 3P20A 4JL5A 1C4OA 3SFZA 2ZETA 1QDEA 2VF8A 4HUQB 2BCGY 2ZJ8A 1NSTA 4GRAA 5F9HA 1E2QA 4LUCA 1KZ7B 2QU8A 1UBEA 1ONBA 2I3BA 4PPQA 4WXRA 2FA9A 4OJQA 2J87A 4LBZA 2J0VA 1JQLB 3PEUA 3PUXA 1H8EA 3T1TA 2HYDA 5A4JA 3B9QA 2ATVA 4JVSB 3GLFA 2ZANA 1UM8A 5L3RA 3GMTA 3EC2A 2C95A 2IX3A 1G16A 3QF4A 3W9YA 4JLBA 2FDCA 2AD1A 5FBLB 5EJEA 3I5YA 2OESA 1R5BA 2GEUA 3ASYA 4NYJQ 2VP9A 4HAUA 1IXSB 3QXXA 4JSTA 3B2EA 1L2TA 3OIWA 2E9SA 1E9RA 4PHHA 1S9HA 1XTQA 3RRYA 1LVGA 1AZSC 4K8OA 3WXMA 2FSIA 3AKDA 5JJIA 1Z0FA 3B13B 3OF5A 4QGGA 2FPLA 3AVVA 2O8FB 2WV9A 4OK3A 3BERA 2E1RA 3QSYA 3NHBA 3W8RA 1DADA 5C18A 1RRCA 1E1QA 4NPHA 1NIPA 2D62A 5FR1A 4BFUA 4XVUA 1NNEA 3ZS9A 3IBYA 1Z3IX 3KQLA 1N0UA 2P65A 1I4DD 1CP2A 1UKYA 4EJSA 4WIAA 2C9YA 2QNRA 1Q57A 3OIUA 4GPTA 4LHYA 1PJRA 1HTWA 3CH4B 4ILEA 3SYLA 4PPGA 4UNSA 4GP6A 2EYUA 2K5UA 3CF6R 5FI0B 1U0JA 3UMSA 4D2IA 1HEIA 3F3YA 1ZP6A 1T8TA 4M9ZA 2PX3A 2BKUA 4IDPA 1G6HA 2B8WA 3WRYC 3L43A 2WJGA 3T06B 1DOAA 3NDBB 2BMFA 3AVYA 1NP6A 5B64A 3ZD7A 4ESVA 4TYQA 3NG1A 4DDTA 3U4QB 2WJVA 4HAZA 1XD8A 1G291 2AL7A 4QGHA 4WBSA 3RHFA 5KU1A 1KK2A 2QUZA 2PBRA 4AWXA 1GUAA 1J2JA 2AHOA 3WMFA 2CNWA 3BORA 4A9AA 1Q3TA 2GCNA 2F6RA 5KYKA 2VHTA 4RFVA 1BYUA 1LS1A 3G5UA 4TQUS 5G40A 3B1VA 4A82A 3U6BA 2Z5FA 4NCIA 3TH5A 3H2YA 4MYCA 2W6JA 1CR4A 1RC8A 2PL3A 5KSYA 4R9UC 1LB1B 2ZRLA 4Q48A 4F4IA 1RZ3A 1UBCA 2FH5B 3EASA 2PMKA 2UKDA 4KAXA 1KDOA 5ANRB 2J7KA 2QBYA 3CWZA 2O8EA 3K9GA 1FX0A 3CNLA 2GCPA 1GILA 3DPUA 1M7HA 4LHVA 4X8MA 3UK6A 4AD8A 1BS1A 4XD7D 3FTQA 3A1UA 4MGYR 1ZAKA 3Q9LA 2QTVB 1EFTA 4ASUD 2AWNA 1G8FA 1BKDR 4G0NA 1C9KA 4JVLA 2XXAA 1Q21A 4EPXA 3IILA 4CIDA 1IY1A 4YXWA 1NN1A 3WMEA 1QBKC 2BM1A 2YZ2A 4PZYA 1EG7A 2WHXA 3QBTA 1DAIA 3CRVA 2JLZA 2BBTA 4HAXA 4DLZA 1DVRA 1NKTA 1OIXA 3QKTA 4IRUB 5HKKA 3ZIAA 4CEJA 1U8ZA 1JPNA 5GJCA 3MAAC 1GM5A 1QHGA 1PV4A 5J4HA 4JS0A 1CR1A 2F1JA 2ZRFA 2O8BB 1I4TD 2WJYA 4Q7MB 4G1UC 3SEAA 1B23P 1OXVA 2A3RA 3OAAD 1E79A 1S9DA 3A37A 5C4MA 4OI1A 3FDIA 2V7QA 1KI4A 1E2KA 3AF4A 1T6NA 1D8TA 2ZI5A 4Q18A 2HDNB 3X1YA
chains in the Genus database with same CATH superfamily
4IIVA 4H16A 4QU9A 4QFCA 6REQA 1AK9A 1FRFS 1B76A 3KTOA 3VM6A 4W5OA 1ZJ5A 1E7RA 2ZI9A 5FUVA 4AJ1A 2VTEA 1YS1X 1W0KD 4UJ5A 1JVNA 3KL2A 5FUWA 4R1QA 2GCIA 1Y8RB 3SU8A 2RHTA 1U0BB 4HDSB 1XYGA 3NH6A 4MUEA 3KZKA 5DHFA 3RAJA 3JQGA 3RHSA 1SXJD 4KJXA 4AO6A 1GQQA 1R8SA 1UBHS 3DYIA 5DNAA 5K5EA 5KQMA 2F8SA 2BSQA 2R8ZA 4N76A 4V0KA 3TNLA 4D9IA 1TXGA 1CR0A 1VL0A 4BB0A 3GNQA 1PTJA 1DWUA 2GEFA 2IZ6A 3GCXA 3PD0A 4G5YA 4KQ2A 4O2AA 4BMSA 5JYCA 2R86A 1PEDA 4MRMA 1Z29A 1XD2B 5CA0F 4KACA 2B1IA 1CULC 1PZEA 2H4JA 2W2VA 1JQDA 3HBAA 1VBNA 4FI3C 4GF5A 2JD1A 1NE2A 1SH7A 4QREA 3TW0A 5DX1A 2O3SA 1V7ZA 3ULKA 4WXHA 3AUSA 4TYPA 1QZTA 5K0ZA 3U81A 3OUZA 3R5XA 3RTGA 2WPDA 1SWVA 3FA2A 4J03A 1P9RA 3D8UA 5B7PA 1TZMA 3ZTWA 4F7WA 5DMXA 1YFJA 1I4EB 2VK4A 1JDUA 4I4TB 4M8LA 4U7TB 2Q6KA 4PLHA 3NWBA 4PSAA 5AJXA 3E53A 3K09C 3G8DA 4U7WA 4HNAA 3V4SA 2J4FA 4C30A 3VSCA 5I9TA 4BNJA 3OIDA 5HZHA 3G2NA 2XBLA 1UODA 1IZ9A 1DI0A 2ZI7A 4DIUA 3CG4A 4HADA 4BNIA 4EW2A 3QKSB 2R6DA 2M32A 3UJNA 1JDPA 4HYTA 5DNCA 3EIXA 3VX3A 5DXJA 3GHHA 4K1XA 1V16A 1JHOA 3ICOA 4Z3DA 4IGKA 3U7EB 5LVAA 3PXDA 1DBPA 1DJOA 2CKMA 3BSFA 3HCAA 4HGPA 4OOFA 5EHQA 5TJ9A 2I9KA 1AOXA 2R65A 2VP4A 4PM4A 4UD6A 1XAHA 1V3QE 1GRCA 1NF8A 2BD0A 1RBYA 4PG5A 1IEQA 3L05A 4UHDA 1XZMA 4MIEA 1AS0A 3HXQA 2O1WA 3EBLA 2WFAA 3PWKA 1E63A 1WW3A 4BNYA 2FFBA 1X7WA 3H2BA 1XNJA 3CUSA 3CPEA 4KRYA 4QVIA 3GI1A 4PYMA 4LJ6A 5JCOC 3AFGA 3QG1A 1DEAA 3PHHA 4Z7OB 1NMSA 3ESXA 1DWPA 1ESZA 3MTAA 2RHHA 2VT7A 3KVNA 4UBJA 4MVWA 4BV9A 2LW7A 1W88A 1GV0A 2JDIA 1GKUB 3E7XA 4TWZA 3IHKA 1RWBA 4KW7A 1VDZA 1YRBA 2WFLA 4NMMA 4IJ6A 3AUJB 4R2WA 4RH0A 5CXSA 3FCAA 3A9SA 1EK0A 4JUIA 4UATA 4LYEA 1EEXB 2OV8A 3V3KA 3WRXC 3H5VA 4ZCQA 1X94A 2JAUA 3GJ3A 3R3VA 1XGKA 3PICA 2OCGA 3AR9A 1N0WA 3G8YA 4FNMA 4JNKA 1SXPA 5SV2A 1IOLA 4FZ5A 2HF2A 2ZYRA 4IIEA 2W93A 5E6RA 4WRRA 4OJNA 4OHXA 4XD2A 1DC7A 2GSWA 2ETXA 3IBFA 4KN9S 1SVSA 5KPJA 1U3UA 5DYWA 2GBLC 5IFLA 3OE7A 2Q4RA 3OIGA 1AKTA 3U31A 3QFTA 1Q3HA 2O1SA 5A7HA 1EE1A 4RDXA 5I9LA 1TZKA 4Q1FA 5B6JA 3VV2A 1B00A 2QJTA 3NDPA 4NX2A 1ITZA 4PYQA 4KPGA 5EMLA 1TM7E 1J22A 1V5GA 1TM4E 2C5EA 4PCLA 2J0EA 2HQBA 2PFSA 3TGPA 1P45A 3OTWA 1RM0A 3C15C 3MXTA 3BXFA 1EJBA 3HL0A 2GILA 4XEHA 3G9TA 1RE0A 1OE0A 5B7NA 4W5QA 4B6RA 4D98A 1SU6A 4WBNA 1JJBA 1RIIA 1VMDA 4IVPA 5KREA 3ZWWA 5FEMA 5FB3A 3UAYA 1ZD9A 2ZBDA 3C3CA 3I4CA 3KTAB 3OLXA 1R8JA 4MQ4A 2ORYA 2ZWIA 2YZKA 4FQ7A 1XZGA 3HB1A 1IZYA 3FJOA 4K6GA 5KWVA 4BPRA 2FPPA 2P9YA 4NJOA 2J7PD 1ZD1A 1U98A 2Y8EA 3B20A 2IVZA 1UPBA 3WYEA 4ZGWA 2E5LB 2JCVA 4KGDA 1ZNXA 5AVYA 3SC2A 1FRQA 3O2SB 3ZTYA 4U7FA 2OK7A 3UENA 5CM2Z 1ENZA 3ZUGA 4CF6A 3V8RA 4ZJUA 1Y1KE 1EJ6A 1QGUA 1P9NA 4G5HA 1V5IA 4XH9B 3PF8A 4BEJA 4BNHA 2QLNA 1YRQA 1OILA 2OOKA 4G5OA 2BE7A 3UJCA 3CFYA 3WFJA 1MJHA 2I8AA 3OEYA 3SZLA 3T7RA 2QD2A 5TQ0B 1YKSA 2ASEA 3BMQB 3A6EA 3TLXA 2XUHA 1N78A 2AQIA 3RJ9A 2Q49A 1PL0A 2QRMA 4XJSA 3D4IA 1E61A 3OQOA 3QEKA 4BUCA 2EQ5A 4Q4AB 3IDFA 2RI1A 4XVCA 2OLKA 1PR2A 1YA8A 1MDFA 3CMMA 2QW8A 3MMSA 4Q7KA 4BVLA 5KTTA 2H4XA 1GKIA 2OC4A 1BCRB 4I5FA 5IDYA 3UAGA 2IE8A 2P2LA 2BI8A 5AHKA 2AZ4A 3WIDA 3B78A 3P8ZA 3O4HA 1T9BA 3Q3JB 2QL9A 1W75A 3A1CA 4KQ6A 5EJ4A 1FDSA 4KPUB 1U5BA 2CLEB 2IUYA 2VTDA 2OLEA 3PQ3A 2FWRA 1HOTA 3WLOA 1PV1A 2ODTX 3C6QA 1TD1A 1U0HC 4OAOA 4ZT2A 3W2EA 5BXYA 3H8JA 5IHXA 1HX7A 4DA6A 1N2CE 3QHPA 4KN6A 3T9CA 5FTLA 1IZ8A 3W78A 1YZTA 1WW8A 2ORVA 3V6MA 3GPLA 1I3NA 2HPAA 3I5MA 4H7HA 1QG2A 1GTL1 4J7UA 2AG8A 1QH0A 2W2QA 1RP1A 4PV7A 3EXAA 3H8WA 3O83A 4NOKA 4EI7A 2QTRA 3QELA 4H35A 3RLIA 2G6TA 1LLDA 5BR4A 3K0EA 1F3OA 2PEYA 3PC7A 3O4VA 5A9SB 2YIMA 1A71A 1Y89A 2ZI6A 3EXIA 4CETA 2ZKIA 3IOMA 4IOMA 2DWCA 3KVYA 2W0SA 9ATCA 1WXGA 5FRDA 4ND5A 1A9PA 3GY0A 3KB2A 3NAZA 4ID3A 1P1BA 2XLCA 2FMIA 4IQ0A 4YV7A 5M34A 1E8MA 2IEGA 4DIEA 1GNTA 1CJBA 1TX4B 5KSOA 3HO1A 1NF9A 3IJ5A 3KUDA 4GLBA 4F06A 4XWGA 2DWPA 4NFSA 4QT4A 1T4MA 3S2GA 3H9BA 2FX5A 1Z6PA 4RF2A 3RYIB 2DPYA 3CVWA 1P5HA 2GM5A 1P33A 5CFMA 2JGAA 4Q9KA 1ZIOA 3LVRE 4YT5A 1ECFA 1YQEA 4FMCB 3A1EA 1ILWA 2GB4A 2WWYA 1GVHA 4C08A 4YCDA 3EF0A 5AR1A 1VMKA 3I6ZA 1G8YA 2HADA 3HP4A 4NDAA 4K6OA 4KQXA 5BSGA 3FKSA 2DAPA 3QLJA 2V8BA 3GT3A 3IT1A 4I08A 4Q3DA 5I5EA 1D09A 1HT3A 1U1DA 1DWQA 3EGOA 3N2ZB 1CDDA 2ZAGA 4PX9A 1EFDN 4R9RA 2Y76A 4Z1MD 2NLOA 4HL6A 5CH5A 3UAZA 2BEVA 1DIGA 1GCIA 4W1PA 4BQQA 1IY2A 5HVNA 1CKEA 1Z7WA 2ZAMA 3MEQA 2Q46A 5E95A 2ZUTA 2R7MA 2AF4C 5IXJA 2ZAIA 2H85A 3DYVA 1PQWA 2FFHA 3CPHA 4JUAA 3VR2A 4AX4A 4P86A 4FSHA 1M83A 4HTAA 4R41A 4RBNA 1BO6A 4YMUA 5JROA 3ZZTA 3HP1A 1K9SA 4FJ0A 3Q8WA 4BWVA 1SXQA 2CB9A 3G8AA 1BVHA 1JT2A 4Q6WA 1WXIA 4F6RB 4REMA 4DSUA 1KY5A 3QUAA 4QGFA 4MB2A 2OT3B 1NQAO 5E4YA 2B0CA 3PYLA 1RM3A 5D1HA 3STUA 4MUJA 1JHUA 1XHEA 4GQIA 2IHTA 4UVIA 1V37A 4E6EA 5A5EA 5JD5A 4KAFA 4XEUA 4OSPA 4EPTA 1JJ7A 4B8YA 4V0QA 5EE0A 2Q29A 3RIYA 2B7LA 3RYCA 2J3EA 1NZDA 5KYXA 5F9FA 1ETUA 2P5TB 1G60A 3WGJA 1A1VA 1XYYA 2VQSA 4WZ6A 1VKRA 3NWJA 1XRNA 4QWMA 2BDTA 5JR3A 5KYUA 5MGBA 2WMNB 3PFFA 3VJLA 3IALA 2E49A 4NIMA 2GFIA 3BICA 4KLAA 2SICE 4AJIA 1Y1TA 3OTOB 1BIFA 2Q9UA 1MO5A 2C00A 3DL0A 1VLLA 4IDDA 1YR7A 2W2MA 4YDRA 5GMOA 5FUXA 3VDXA 2LE0A 3AL0C 4MYHA 1C0IA 1MX1A 1RFLA 3GZNB 3HB9A 2E5WA 4Y2PA 5DGDA 3KX2A 3RB8A 1YAHA 1ST2A 3QMPA 1FJXA 2J4DA 1DQYA 3I4LA 3EWIA 2VF2A 3MQ4A 3K0CA 3I0MA 2YY5A 1I4OA 3A1VA 4AXBA 4EG4A 5A4AA 3D3NA 2P4QA 4FGJA 5LBUA 3QTBA 3DOFA 3UPTA 2R2GA 1J7KA 3C6BA 4OUDA 1O0CA 4AWAA 2YJ3A 4FHGA 3LC7O 1W85A 3WLIA 1A2KC 1DAKA 1E1NA 4TTQA 4YP1A 2BHTA 4KQIA 1N33B 4Q0MA 1QLWA 3IUBA 1DTWA 3F6EX 1W5TA 3QSGA 4M0MA 5DLPA 5MDHA 1GPH1 2O50A 1HUQA 3AKCA 1QHSA 2PSHA 1MAHA 1T4CB 2AR7A 3N3AC 4MB6A 5TQ2B 5LNK6 3EDYA 3RVKA 3PZRA 4DLLA 5AD1A 4PQRA 2D2EA 1ADCA 2Q6VA 3B36A 3O47A 4TYYA 2IY9A 5BQXA 3F97A 2R96A 2FV8A 4QBGB 1YL6A 4L76A 1TFUA 2XWQA 1II8B 1Z5NA 3OFND 2NAPA 4FYWA 3K70B 1CF2O 1SAYA 2AKYA 2VBCA 2X76A 4M0EA 3KP1A 1MNQA 3SJCA 3ZGLA 1C1YA 3IGFA 5J2TB 1FBTA 3A9CA 3KQQA 3KB6A 1Z16A 3QVLA 3EULA 4HEA1 4OGGA 4Q82A 1YHYA 5EZYF 5L3QA 3DTVD 1J39A 3N0VA 2DPXA 3OJLA 4LK2A 5JD3A 1LF5A 2ZRQA 4EHIA 3S1AA 1GPYA 1XVLA 4POAA 1W48A 1VTKA 4RZIA 3TM5A 4JC4A 3TE7A 4EMTA 4J0HA 2FOLA 1KMNA 3HWRA 4QPJC 2XB9A 4CCWA 1Z6TA 3MT7A 3HB0A 1RXYA 2PJDA 4BXOB 1D1SA 3AHEA 4C0JA 2PMFA 2E21A 1HRKA 2HTFA 3FX2A 5JATA 3JZFA 3WWDA 4LJKA 2HIAA 2UYYA 4PGAA 3N6XA 4HNHA 1DSSG 2BFWA 2JIRA 3D1LA 3EISA 3HJBA 3KLOA 4LY3A 3NH9A 4XOIA 2WIDA 3CGGA 2Z4TA 1Y4SA 2X5OA 3OSUA 4JUBA 2W48A 3EGDA 3DDZX 2R6GA 3G0IA 2WNSA 4R7TA 5AK3A 5K0LA 3RR2A 2FP4B 2C92A 1ISGA 1NM5A 1WS6A 4CL0A 1NXQA 3C98A 3FUCA 1EI9A 5JQGB 3GLIB 1EFUA 1IDOA 1RRKA 1T35A 2VUTA 4RWZA 4EMBA 2RI0A 3Q1LA 3SI7A 1P31A 3UMMA 3ETEA 5H1YA 3LU1A 3P9NA 2XH8A 4O4HA 4EHBA 1E7SA 1HWYA 1P1FA 3PPVA 3ROQA 2R84A 5LP6C 5JS2A 4A8JB 1O5OA 4HGQA 4I1IA 5IZCC 3PNVA 5FV4A 3PPWA 2XZOA 4IQ4A 2YXNA 1HDXA 1C9NA 1G0OA 3X1WA 5MHTA 1ZBQA 5AP9A 1KAQA 3X44A 1ZIYA 3DLPX 4P7FA 3F9CA 3FYHA 4W4TA 4GI7A 2GN0A 2EFDB 3ODPA 4J0IA 4N9QA 1RWXA 1K6IA 1A96A 1GFWA 2PH1A 3OG9A 2VAPA 5IVHA 1L5SA 2BJVA 3G8BA 1WZ2A 3FNHA 2DCUA 5A5FA 1NUQA 3VJRA 5A0TA 2H48A 1NVGA 2AJTA 3H9UA 3UOAB 1T25A 1WB4A 3PX2A 2WABA 4LGVA 5I8PA 3DHVA 2C97A 3ZLVA 1JDSA 4IIYA 3E7DA 1INLA 1RCFA 3QUCA 2YHUA 3RSOA 5AW9A 1LVHA 3OPNA 3KPVA 4Y2UA 2XGGA 5FBHA 3VPAA 3V9AA 2EIHA 1MIOA 3PIDA 2BF7A 1SD1A 1WPGA 2J45A 3BWXA 3U9SA 2R68A 2VK2A 3ONWA 1W0JD 3QMMA 4HNGA 1JIUA 5CVEA 2CK3D 5BUCA 3D0OA 4G65A 4BFZA 3TL3A 1J09A 1SU4A 1WG8A 1YT5A 2P8SA 1Y3DE 2VP3A 2XKBA 3ICCA 4RLHA 5EIFA 3N2YA 1G5HA 2W6ID 3X3HA 3PLNA 2C0QA 5TLSA 4AJ4A 4LYFA 3EEOA 4CHTA 2WHYA 4AKHA 2PU7A 4YRNA 1R16A 2ZPAA 5MN6A 1OLUB 3E8XA 1T3LA 2B35A 2I03A 1CUVA 3LBHA 3PNQA 3QPUA 4LSZA 1Z8NA 4TMVA 2BT4A 3LC0A 4BNWA 5CTAA 3PA8A 3N75A 4F1KA 2Y93A 2AR9A 4LOHA 1TU0A 4UUAA 4QVKA 5E0KB 3MHPA 2Z6VA 3ZWOA 5EJMA 5JVDB 4YUAA 2VUUA 5JW6A 2BJHA 4F21A 4JYAB 4AI6A 2MR5A 1ACJA 3WK4A 4NZMA 4A6PA 4DMMA 2P1RA 4RHXA 5IC4A 1K06A 2IHZA 4QOEA 3FDZA 3BG5A 3SKXA 2YNMC 5DHQA 4RTKA 3BE6A 4K9OA 4LJLA 3TSYA 4BBZA 5BWOA 1G7RA 2A5DA 2H11A 4W8OA 4PYNA 2HNKA 3D2AA 3ECAA 1MB0A 3BHIA 2O2JA 1OWLA 2E18A 4G37A 4OFZA 5CLIA 2EKZA 4R31A 1UFKA 2CVHA 2ZWVA 2WJ6A 5A0FA 1KZ1A 3U4HA 5CDTA 1O94D 1TD9A 1E1CB 1NYTA 2GXSA 3B1FA 4DOMA 4EAQA 5LPNA 4HDQB 3IAAA 1FFEA 2QT9A 4JA0A 1TADA 1J4AA 2RAPA 1HY3A 2BEKA 3H0KA 3JVDA 3N8DA 3PXEA 3GBPA 4UC0A 5GVSA 3SOZA 4E5VA 4KUGA 1WIWA 3ROEA 4PHGA 1E6EA 1KQGA 1SK9A 1E1KA 2OBFA 3ICQB 4RMJA 1YZLA 2AA3A 3AI2A 5IAJA 3TIXB 4ENPA 3P94A 1XZHA 5TB5A 3VYTB 4DG9A 1RXSA 1XRQA 2B1QA 4V3BA 1OOEA 2K6GA 2HLDD 3BULA 5IXYA 2DWOA 4RZQA 1DOZA 3QIVA 2GYYA 3COPA 3T9EA 1TTPB 3QKWA 2V4ZA 4FC7A 1SQFA 5EMMA 1Y4ZA 1J8MF 1E8NA 1SG0A 1UFVA 4KBGA 5BR7A 1OASA 4OH1A 5KWSA 1H0RA 4XI9A 2JFQA 1IN7A 1XPJA 3HVKA 3NXKA 4U5QA 1QIEA 8LDHA 1ZC3A 4U39A 1P2SA 3E6AA 2ISQA 4W5NA 1F06A 1K63A 5FWAA 3Q3GE 3D2LA 1ZLYA 3FB4A 4JASB 4URZR 2VQDA 4ZODA 3I9JA 3FYCA 1N7IA 1R6XA 3H4VA 1QRRA 3VC3A 3PLRA 2A78A 4DMCA 2VCEA 3I39X 4RDCA 1P2VA 1U2DC 2EFEB 2RHMA 2Z98A 1E3LA 5L9AA 2ZZMA 1ZSYA 5CK4A 3HQ4O 4OBXA 1YQQA 1Y9JA 4HNUA 1JEQB 3OA2A 3SC3A 2YV4A 4QT0A 3CE9A 3IKVA 4UDXX 2V9PA 4I4TF 5EYPA 2CDCA 1BOOA 1F9EA 3CCCA 1FMCA 4NESA 1Q7RA 3TJZA 3WBBA 4CWAA 2HA4A 1KVSA 1M2EA 2BFCB 2LKCA 1ZGJA 3CZCA 3FPGA 3GG9A 2FQYA 2IIVA 2PT7A 2Q41A 3MUNA 3UWMA 1IVNA 1A5AB 2XRFA 4BASA 4HDOB 2ZITA 4OQLA 5B2EA 1J0BA 1OV4A 3CCBA 4GXTA 4P81A 1FU7A 1S0UA 2X4GA 4NMLA 4RPKA 1UWCA 1VL8A 4P3NA 4HZIA 4G8JA 4UHHA 4X9XA 4IFIA 5FV7A 2PVCA 1BS9A 3RC2A 2VKTA 3T3HA 1ZI6A 1SVIA 2C4TA 1J1ZA 3OFVA 1YZKA 1YS6A 2GJ8A 5B57C 2ZI4A 3GLFB 3WK6A 3W3AA 2E7ZA 5IYZF 1E0SA 1S7GA 4L2IA 3SS9X 3U3RA 1OBOA 4X1YB 2EGGA 3TTUA 4CIXA 4P5DA 2JGKA 3B1ZA 3AI7A 3EOBI 3LDUA 4RV4A 5EIAA 5LFAA 3R3UA 3EEBA 4JL6A 2O2EA 1RZRD 1ZMXA 3WKCA 2QHXA 1QK4A 5I7HA 4K9PA 1VSUA 2GXUA 2NVUA 2EFGA 2XUOA 1RS0A 3N2LA 3NDJA 2JFPA 4KRFA 2YHSA 4ZXPA 3ZZNA 5THKA 5F9MA 4G4JA 3RUAA 3U7RA 3OO0A 3UHAA 3H5AA 1U2QA 4KSCA 3DTNA 2V55B 3L6OO 2CHVA 3VV3A 1HQCA 3SMQA 2ZIFA 2C4HA 3AG6A 3D7SA 4EJSB 3DUFA 3HKBB 1EVKA 1RLIA 4ROSA 4A27A 4TMFA 5EXTA 5DIFA 3X1ZA 4ISCA 4PRZA 4TZ6A 1PR3A 3ER9A 1FP1D 1LI7A 3L8EA 4NFLA 4Z4CA 4M99A 4LVNA 1G5FA 1IYZA 1ENPA 1WMAA 1OFTA 2EW8A 3LF2A 4IVRA 4D9CA 2EKBA 3TG8A 2A3NA 4HMPA 2F17A 1JQKA 3SP1A 3UT0A 4DWOA 1YU6A 1CZRA 4YRGA 1N25A 3IHLA 3RJ5A 1X92A 5CVDA 5IPFA 4ABYA 1CC1S 2HREA 5F51A 2AS0A 1JG1A 2QQFA 1EZ4A 3KE9A 1C30B 1OFUA 3IHWA 2H0AA 2Z2IA 4WVLA 2NUAA 4RKFA 5JY1A 1BDBA 1NHWA 4UDYX 5EJ2A 4C7OA 4Q4DA 4DCPA 3PL5A 2WOOA 5CM9C 1APBA 3JSAA 1VPLA 3QJGA 1G41A 1U8TA 4N8SA 4QEZA 5BW5A 1SGWA 4M88A 4FQ8A 4KPFC 3V8EA 5CNMA 5BMVB 5LZ7A 4CQMB 2R11A 4E1VA 4YY3B 3ONNA 4YCAA 3BT7A 3C1OA 1AURA 5BRJA 5FBVB 3ZZ0A 2QGNA 5FCDA 2O3UA 1B1CA 2VOEA 2XW6A 3HCWA 1LSJA 5FYQA 3CG0A 4QO8A 1K1EA 2FPOA 5HF6A 1EGAA 1JN0A 1PFKA 1RQRA 2DFNA 3GVCA 4FOLA 3ENKA 1UDCA 4IV8A 4PZAA 5JSHA 3Q85A 2O20A 1XFAA 1M72A 3IH5A 4RVNA 3GA0A 1SELA 5CLHA 5E6SB 3GMSA 2Q1WA 2GPWA 3HV2A 5BQOA 3X43A 1U2GA 3KOWA 4AKSA 2BMJA 4JLWA 4HXYA 4D92A 2CJYA 1BMFD 2DPGA 2QBYB 3IDQA 5BVGA 4LQDA 4B3GA 1EP2B 4OX9Y 1YOVA 4XQ0A 2I66A 3IPCA 4EFLA 1EM6A 3DFUA 3FN4A 3VSDA 4UKDA 3N2NA 1PE0A 4FU0A 4PZCA 5ALPA 3IP1A 4FS8A 4JMLA 2C5AA 4XASA 2JIPA 3O75A 5K2MA 4IIXA 1YR1A 5BRAA 1UKAA 2UV8A 4FFSA 5IJXA 2AJ8A 5SY4A 4PLVA 4YCCA 1VHTA 4KREA 1CZLA 4L8LA 3RS9A 4DJ5X 4PTZA 1V4NA 3SXPA 5HZKA 2H1IA 4L27A 4D0LB 3UV3A 3MFYA 4MQ5A 2EX1A 3F3SA 4GMHA 4QDZA 5EMJA 5CA0A 4L7VA 3RIMA 3S55A 3I42A 2HQSA 3SF8A 4FN4A 4CLOA 5KMGB 4CEJB 8MHTA 2FHSA 5SYAA 3L1VA 1RJGA 3I6MA 2R5WA 1X7YB 1YMVA 1AY0A 3BX1A 1QCZA 2H2IA 1MVNA 4YASA 1QGAA 1QZXA 5KTSA 2ZQ5A 2WF9A 1VM6A 3I23A 3RU7A 4JXKA 4BJHB 1W8IA 3KBBA 4CM5A 2AN1A 2FI1A 1J06A 2GN4A 2QX7A 4CF4A 1JR2A 2H1RA 4V0ME 1I33A 2ON6A 3UUFA 4DAEA 2CMHA 1Q19A 4NBTA 2BELA 3TSCA 2PE5A 1GA1A 4EFNA 3FG9A 4LHEA 1Y7HA 4O1IA 1JMYA 4FZJA 4KMRA 4DLPA 3C85A 3VR4D 3CKKA 3O26A 4I6GA 4DPKA 2WW8A 4MI3A 1PUJA 2AFRA 3MD0A 2CXOA 4OREX 2A5FA 3RVPA 1QSGA 3E9YA 3TTXA 2P9QA 3LHIA 5IFKA 5GV8A 1MO4A 4ENQA 1T29A 1BDIA 3JQ6A 1BQEA 3KJZA 4XOUA 5DGCA 2O54A 1P7WA 4NFYA 3JR3A 3SNHA 1LK5A 2I55A 3M1YA 2ZSHA 4IKPA 3ZWYA 1G21B 5CVJA 3TL2A 2HHLA 2J6IA 2WZQA 3W8NA 1OA0A 4BB6A 3P5SA 2OC9A 4LF5B 1JFVA 2GAJA 5IAAA 1X15A 2A9JA 3DV0A 3URMA 4DW8A 3K70D 2MSWA 1L6RA 1RRVA 4FMCF 2XRYA 3QBVA 4G41A 4ICIA 5IWCA 3G1WA 5JALA 2PKQP 1H42A 4CKBB 2VQEB 1J49A 3AH8A 3LCJA 4HNQA 3WLPA 3SK0A 4EZIA 1F5NA 4U0KA 1A9XB 1ULUA 4YWHA 2PJUA 2QAGC 2GO7A 2OMKA 4E2FA 4NCKA 3Q7TA 3CC8A 3CVUA 2JIOA 3T52A 1E3IA 2JJ8A 3IUPA 3OAAA 1UOEA 1JEOA 2B92A 3LKBA 2NPFA 5KNDA 2HJWA 2QTNA 1XQYA 4IYRA 3A4NA 3K53A 5J47A 2OCLA 4GNKA 2NYAA 4BO7A 4MW5A 1KMHB 1N5LA 4Z0TA 1L5QA 5PNTA 5KNBH 4RULA 1N57A 3EVCA 2Q4TA 4FFLA 2QG6A 4M36A 4AJ9A 4C0AC 3T5PA 4FYMA 5G3ZA 2C61A 4DRZA 4DDKA 3D8HA 5U4QA 3CBGA 1ZH8A 1T8SA 3VU9B 4BX3A 2WRZA 4BFWA 1P4JA 3KSMA 5EN4A 4BNXA 4L16A 3RC7A 3Q6IA 4JEIA 4LXGA 2H1WA 2NO9A 4CR7A 3KQTA 5MFPA 3ET4A 1TJ4A 1W0KA 4Z4GA 2GPAA 4L8VA 3UJDA 1V43A 3HA7A 3K8OE 5JMWA 5M2QA 1X7ZB 1RI2A 3AXSA 4XJVA 3RYFB 4YJ3B 1AT1A 1D5WA 1ONPA 2BSXA 4RK1A 1B7GO 4DBLC 4XR9A 5BOSB 1ZWKA 2DJIA 1P9LA 1Y9EA 5BPHA 3AESA 1SXJA 1T1RA 2AH5A 3O1IC 4XWAA 1W8DA 2JLUA 2AQ8A 2AFHA 2CL6X 3SHVA 1VHLA 4GOMD 3I2YX 4GR4A 5M5BA 4BEVA 3ABOB 4R2KA 2YMLA 2NXWA 4AP9A 4E5DA 4EVIA 3RHZA 1GFSA 4MH0R 2X0DA 4UZFA 3OD5A 4IIGA 2OTCA 4EJ2A 1YFLA 2Y05A 4AS2A 4DCGA 4B3SB 4KXQA 2F9FA 2QIOA 4ZI5A 6LDHA 1ZN7A 4ND4A 3PC8C 5K0TA 1EFVB 1XEXA 1CZNA 2JHPA 4W9RA 1J2RA 1YFZA 1D4AA 2PRYA 1YL7A 3GJZA 4GSLA 2BP7A 5U9CA 2VHJA 1GVNB 3ZDEA 3Q2KA 4HF7A 3K05A 5DBOA 3IIIA 3WR5A 1Q7CA 4ML3A 4JAVC 3EZ7A 2QLLA 3MWEA 3PT9A 3V2GA 1TKCA 2PA0A 3LCCA 3A04A 4GL4A 5IXSA 1KVQA 2WU0A 3EAFA 4E3ZA 4F3TA 5JZSA 2H2AA 4GX2A 2RDMA 3VU1A 3R7AA 4PGFA 1TCBA 4YCSA 1V95A 1MGPA 5FOTA 4DXAA 2QJRA 2PYIA 1SBNE 3O8OB 1DRUA 2VH5R 3C3MA 2W6ZA 3EHDA 3NHFA 4NEGA 5AKGA 4FFPA 4P0TA 2J3JA 3QWIA 2W70A 3RUDA 3SSAA 4FB4A 1AKQA 1FYVA 4B3IA 1NTOA 1M54A 2VBGA 3TZ6A 3KQOA 4PFQA 2OORC 3K3PA 4RV5A 4MW6A 5LQRA 1V39A 3DEZA 4NULA 3W8FA 1H6AA 2VDKB 1VL6A 3L8FA 1Q92A 4E13A 4LE1A 1M67A 1UUFA 4JDPA 5AVRA 3ANYB 3G0DA 2MDTA 2Q5IA 1WPXA 2JNWA 4OXIA 3R0VA 1E3WA 1GG9A 3BE5A 4DHWA 2FTKE 3CNEA 5TGTA 2OA0A 3ZWBA 4L8WB 5HFNA 4YRMA 2JJ2D 4MVCA 1K3TA 3OU2A 4B48A 3AF2A 1BXRA 4KEAA 1P62B 3TBFA 4DV6B 2FPUA 3I53A 3IAS6 4FCWA 5CT5A 4DCOA 1KO7A 1UJMA 4ZI2A 5J2TF 1M5RA 1UL1X 2GK4A 4FOTA 4OHKA 3SMVA 1LX6A 3PNPA 4MRAA 3II6X 3SJUA 3ZU4A 3OZAA 3HVUA 3H13A 4MLZA 1M9NA 5A9TA 3PEEA 3S3TA 1JMKC 1HE8B 2DE0X 4GPEA 5E1DA 2XUQA 5GJVC 2AFIA 1LZKA 3T9FA 2WNHA 4P7JA 1SHJA 1ZVVA 3U4MA 4KXUA 3K09A 4GBED 1G3UA 2A88A 2X3FA 2ZUBA 2PT5A 1V5WA 3TQTA 3I32A 1VE5A 3WK5A 1GWNA 1KJ9A 3DMTC 3ED1A 2PZKA 3EY9A 1DUSA 4ZAXA 1QQ6A 4L50A 1E2JA 4ND1A 2ZWAA 1U2RA 2IPLA 3SYTA 3ZLTA 2QVGA 4YP6A 4RTMA 2IYYA 1OXSC 1WKBA 3ACDA 1KEPA 3THSA 1T43A 3QE3A 4DBVO 4LHZA 2I3ZA 5CRIA 3UQYS 1KI7A 2EWVA 4QLBA 1Y8QB 2JAHA 2LWIA 4X54A 5CR9A 4H1WA 3WLMA 1VKJA 4M9XA 4PXYA 2ZVJA 1V8PA 4F0JA 1ZDMA 4MR9A 1SUEA 3A4TA 1BZYA 4IHAA 4FDTA 3BIJA 2DUWA 3Q72A 2WF5A 2YV2A 1D8AA 4KNYA 2GWRA 3G17A 2NU9B 5JQGF 3ZCXA 2BZ0A 3STTA 1J8YF 5MN4A 3HUTA 2G63A 3TJMA 4OK6A 3S2FA 1QIJA 1XWIA 1FUYB 4OVKA 1U8FO 2CGEA 2CE7A 3H4IA 3PE3A 5EEGA 2FG6C 4E51A 3UMBA 1DLIA 5AKIA 4D9BA 2CSUA 4DCVA 4WZAA 3T41A 3O3CA 2PJZA 3WL3A 2EJTA 2WA2A 4L5YA 2ZBQA 4P33A 3RV4A 3V1NA 4WDRA 4IJUA 4MGKR 1I30A 4B8ZA 5GADl 4HPXB 4N7MA 3Q1KA 2XTJA 3JVEA 5FBRB 4UUBA 4CT0A 2WWXA 4GIBA 5B3JA 3M89A 2WNIA 3GJSA 4BP9A 3WRXA 3CX3A 3G0GA 2J7PA 3TEFA 2ZSJA 4HJXA 1SPBS 5EJIA 2EFJA 1KSHA 2JIZD 2H1FA 1QIDA 3ZY5A 3BB1A 2I87A 3DSRA 4EJSC 2WIFA 4UCQA 1U9ZA 3IEUA 3U0VA 1PBNA 3FSJX 4DN6A 1U8CB 2CFCA 2UVPA 4WESA 4I1RA 4M0FA 3FLAA 1SCQA 1GQFA 4LKOA 4ZRMA 5C31A 4LRWA 4DJAA 3CUEF 1H3FA 5L6LB 4FIZA 5BNFA 3MJSA 5HIIA 1CV2A 2BISA 3L9WA 1CUZA 4H2DA 4DJEC 1WABA 3NM5A 4Y9TA 4OMUA 3FWZA 1ZKDA 1KO1A 1X70A 4RMHA 5I48A 1RYMA 4Z99A 1XKQA 2A94A 2JVKA 2X58A 3N07A 4HS9A 4RJLA 4US2R 1FFBA 1OCEA 5FWXB 1F8UA 3PFIA 1QU3A 4S2UA 1DX9A 2JFZA 5GM1A 1NJSA 3R7NA 4LYGA 3UB3A 4C1BA 3ELUA 3RTCA 2ZUWA 4ZQEA 4Q21A 1LTKA 3AP3A 4HDNB 5JADA 4M49A 5TDHA 5AW0A 1JDTA 5DWDA 2Z1DA 2GARA 2YJ5A 3KG2A 3R5FA 2WTXA 3P2MA 3L5KA 3I3OA 4KU4A 4HMQA 5IJWA 3IIEA 3INYA 1XV5A 4GM0A 4NL4H 2W2KB 3A6HA 2LTAA 1E1QD 4DR1B 3ESRA 4FLFA 3WHKA 3JQFA 1U0RA 2OD9A 3IDSA 5CB8A 4P98A 3CX8A 3U09A 5EHXA 1OLSA 4FHFA 4JB0A 4PX2A 3TSWA 3ZHTA 4H27A 2W00A 3LPAA 3K6KA 4BL5A 1LKZA 2EG5A 3JZAA 1W5EA 3EEFA 4YJFA 5FUBA 4J75A 3P2KA 5HRUA 4G89A 3HLYA 4A6EA 1FVOA 2PTHA 2OMEA 3HCPA 2B8TA 1JR4A 2HK8A 5FPHA 4RQBA 3G2OA 2JFUA 1JEEA 1PJLA 2HJ9A 3ESBA 1XXLA 4EGJA 4HSEA 1YJQA 4HUQA 3WTCA 4B2IA 3RTEA 3H2IA 3QNMA 2C42A 3HYNA 3BGSA 2GOYA 3H3JA 3ZX4A 3GJ6A 3EVAA 1G8SA 1TA9A 1ULSA 1R50A 2IYWA 3AETB 3UYKA 2FVXA 3FMGA 5F5LA 2E4YA 2IHUA 2NQTA 3PIRA 2LIVA 1CE8A 1S6YA 5AVJA 5DM70 3VHLB 2C3UA 3T9DA 4QM6A 1TQ6A 5REQA 2HXSA 4PN3A 2ODNA 3I1IA 4RGQA 2Z58A 1N9GB 3OE5A 2WSLA 2X5KO 4D6PA 4NENA 5LIPA 3RAPR 3WY9A 5LQCA 4CXMA 4CQMD 5AOVA 3BPSA 3NYIA 2JGIA 3M7IA 1MHPA 2FEOA 1Y7PA 2PWYA 1XP8A 4ZYYA 3RBXA 3MLBA 5ALRA 1L7BA 3HB4X 3T5DA 1WA5A 2FFJA 5BSTA 2AD5A 4RSGA 1FDVA 4JMPA 4UCWA 5F12A 5LM3A 1PUIA 2HV9A 3B3GA 2JLSA 2G08A 1CVLA 2OSBA 2ZRIA 2IHBA 2V7PA 1THZA 3EAQA 4PWZA 4RK0A 4D42A 4YIKA 3DDWA 4DTIA 3QNUA 2XHEA 4LS3A 4Z1MA 2PLWA 5EE3A 4ALLA 2C98A 3VZDA 1AXRA 2FPGB 3HJUA 1J9ZA 3IJEB 1KP9A 3L7OA 5EERA 5I7OA 5AKJA 2CJFA 4F3RA 2DH5A 3MWFA 5JYBA 4F5WA 2ZTLA 1YS9A 2GYVA 3LLSA 4B3JA 1U8AA 1U6IA 4W8HA 3F6CA 4TKVA 5HIJA 4P7KA 1SC6A 9ABPA 4LCJA 3ROXA 1HURA 3A32A 4GEGA 2X9VA 3WLLA 2RHJA 1EBUA 4FDMA 3UY4A 3UN1A 4F8YA 2WYHA 2DUMA 3P0IA 4CF3A 5KC8A 2P2DA 1E3MA 5GIOE 2NU6B 1SB8A 4HCJA 4CT4B 3UMRA 3IPRA 3OP4A 4KN5A 5FUYA 3RC3A 6NULA 2AJDA 5KOHA 4UM8B 3KV1A 1O1YA 4EM6A 2QGFA 3EVTA 3O4JA 3RTAA 1VE9A 4JUCA 4ARAA 1M6VA 2YMPA 5P21A 4BQSA 4DILA 4YRIA 3WGIA 3THXA 1E2BA 5AW7A 2OGSA 4E7PA 1QFJA 4HGZA 3C3JA 1SEVA 1G20E 2OYCA 3TTTA 2NOAA 2YVUA 4FFOA 4DC0A 3U4QA 2IDJA 1YDHA