2FU5C

Structure of rab8 in complex with mss4
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
176
structure length
146
Chain Sequence
KTYDYLFKLLLIGDSGVTFISTIGIDFKIRTIELDGKRIKLQIWDTTTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKVNDKRQVSKERGEKLALDYGIKFMETSAINVENAFFTLARDIKAKMDKNWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanine nucleotide exchange factor MSS4
publication title Nucleotide exchange via local protein unfolding-structure of Rab8 in complex with MSS4
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 45
structure length 146
sequence length 176
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2fu5C00
1JR3A 2LKDA 3KXLA 4KYUA 3OIVA 3P4YA 4Q9LA 3KUDA 1L4YA 1KKLA 2YOGA 1KMHA 3TKLA 1RFLA 4P4SB 3ZJYA 2O52A 3LLMA 3TH5A 2RB4A 2ZJ5A 3RSOA 1II8A 3GJ5A 4XOIA 5ELXA 2ZREA 4YC7A 5HZKA 2R65A 1CEEA 1US8B 3VX3A 2D06A 2KE5A 3PG5A 1TX4B 3MD0A 4JL8A 4LY6A 3SDZA 2A9KA 4JYCA 3ZYCA 3U4QB 4POAA 4HAUA 5BQ5A 3OE7D 4V0KA 3NC1C 1JAHA 4RKEA 3B6EA 4LJYA 4KBFA 1XEXA 1XU4A 2CHGA 4MH0R 1KO7A 1T91A 2B21A 5KSYA 3U60B 3VAAA 1BOFA 1KIMA 3OHMA 5JECA 3RC8A 4TL6A 3NBYC 4DLZA 4L9SA 2EFGA 4BGDA 2C98A 3FPAA 3GLGA 5LB4A 4TYYA 4GT1A 3REGA 3SEAA 2HXSA 2GCOA 1KYIA 1FMJA 4AYWA 1F2TA 2QU8A 4EPYA 2B92A 1IOZA 2EWWA 3DZDA 3LQRA 1QVAA 3CO5A 2GJ9A 1XCGB 2IHBA 1IN5A 2EFCB 1OYWA 3PITA 3NDPA 1NJGA 4A8JB 1P72A 4DCTA 1G5PA 2GCNA 5CK4A 4G5SA 1CJMA 1G4UR 3D7MA 3H0KA 4GI7A 3PXGA 4DCSA 1Q3TA 2FV8A 2DFKB 3RRMA 3AP1A 4BQSA 3T1OA 3CX6A 1ZJ6A 2IYTA 3H2YA 1DG3A 1KSHA 1P9WA 1ODFA 1ZCBA 1QHNA 2JIZA 5G41A 4PHFA 5GADl 4HEJA 1W48A 1P2VA 3CLVA 3JVVA 4LZZA 2C5LA 4EPTA 2JLWA 4A9AA 1L2TA 3U3MA 3B8HA 1OIWA 3QKTA 1TEVA 1Z0AA 4CEHB 3KQHA 3FKQA 3WNDA 1UKYA 2D3WA 3ZZ0A 3PENA 4NL4H 3BFVA 2DCUA 4Q1AA 4ARZB 2BWJA 3DO6A 3RC3A 2DWPA 3K0AB 2GK6A 2O8EA 2CNWD 3L82B 1XRJA 5CDFA 4ASUA 3SBEA 2QAJA 1BO6A 5P21A 5HE8A 1FX0A 1UF9A 2FH5B 2LCFA 5FBWB 2W6JD 1GWNA 1C1YA 4RSGA 4BFUA 4LBVA 3TUJC 4EKDA 3MGCA 4MYCA 2MMGA 2DPXA 1HT2E 3TUIC 1ZM9A 4PQYA 4Q1DA 5F9HA 1TF5A 1A4RA 4L16A 3GFOA 4TSFA 5DE3A 5DI3B 3EXAA 5KPDA 3D31A 2QTVB 2REOA 2G6BA 3E2IA 2H18A 4TLBA 2ODNA 2HDNB 4URUR 3UKDA 2VEDA 2XXAA 1OXTA 2IUTA 1KJWA 5JI3E 3P4XA 3ASYA 1R8QA 3UK6A 1RIFA 1V5WA 1KAGA 4M0LA 3IILA 2C9OA 2ORIA 2XJ4A 1GG2A 1MO5A 2Q0HA 2W2XA 2P5TB 3BAFA 3I8XA 4RJLA 3RS3A 2Z43A 3P1JA 2ZUBA 4J0QA 3IIMA 721PA 1XEWX 4P32A 1G8GA 4G1UC 2IUSA 2ZSFA 3V4FA 2FDCA 3K0CC 4ERNA 3CZPA 1T9HA 4QBFA 5HZHA 1YZQA 1DE0A 3CH4B 4OHYA 4QGHA 4RZ3A 5JRJA 1A5TA 1GRQA 3LV8A 4BZPA 1DAMA 3NEYA 4Q7LA 1T6NA 2G83A 4OQLA 3W8NA 3AF4A 1OXSC 3GLHB 1Z3IX 3ADCA 4WXPA 4Y0AA 4D2IA 1W4AA 3KZ1E 2H92A 2E1RA 2WV9A 4TQ9A 3D8BA 4D4LA 5M04A 4II7A 3IGFA 2XOKA 1A1VA 3BGWA 2GZAA 1AKYA 4QRHA 1TEXA 4BFVA 3VHXA 1NLFA 1EFRD 3DVLA 2BOVA 1GL9B 4B3CA 3H1TA 3ECCA 2PEYA 2LKCA 4M8NE 1D9XA 3D6TB 4XWAA 2RGEA 2PT5A 2J59A 4Q48A 1GITA 1G8HA 4PC2A 2BBOA 4PC7A 1DEKA 3QNUA 2QL6A 3KJHA 1OIXA 4DLXA 3ZS9A 2ZU0C 3OEHA 2JLUA 2N46A 5JWOA 3QY0A 1S4QA 3KTAA 1SVKA 3AVTA 1GM5A 1EFTA 1R0WA 3CNOA 4RVCA 3VHLB 4Q5IA 2FF7A 3CIOA 4NYMR 4GDFA 3QJYA 4FI3C 3L43A 2QT0A 4Q1EA 2IXFA 5FR2A 2WM9B 3MJHA 3WMEA 5KO2A 4IHQA 4DLYA 1OJLA 2GWHA 4HAZA 2RHMA 4PXAA 2JJ2D 1UBCA 1EFUA 4KI0A 5E7IA 4WW0A 4XJXA 5F3WB 4B76A 2J7KA 4P4UA 1GP2A 2Q9CA 5LD2C 5FBLB 3HR8A 3IKJA 3ZZTA 2OFOA 2F43A 5J4HA 4M21A 2VP9A 4JKYA 3BERA 2X2FA 2XSZA 5JBQA 1SXJD 4A2WA 1GKYA 2QMUA 2XITA 3IIJA 1NL3A 5A0FA 4DRZA 4URVR 3THXB 1R8SA 3I5YA 4F7WA 4DDTA 2HXYA 3QENA 4MGIR 2H7VA 2XNDD 1NY6A 2EU8A 1XCPA 2EQBA 4PC6A 4A0RA 1TU3A 3PR1A 4QHTA 3NC0C 4EPRA 4AYXA 1O87A 4URXR 1GUAA 2UZ3A 1R5BA 2O8DB 1AS2A 5FTJA 2VLIA 3WRXC 1N6KA 3B13B 4TTPA 4NHOA 4X8HA 2PMDA 1Z0IA 3BB4A 2GTPA 4YMVA 1N0VC 4FCTA 1BS1A 4U7DA 3PUZA 4C0JA 1Z6TA 2O8BB 1PLJA 5JCPA 3NEJA 4PPQA 3LX5A 3B5JA 1OT3A 4TL7A 2GK7A 3X1ZA 5JRZA 3K53A 2GJKA 3KUCA 3OEEA 5KPJA 4F38A 4TTRA 5KDOA 3W5IA 2I4IA 1VG9B 3U3RA 1NI3A 1LS6A 4PHHA 4A6XA 3B82A 1KDRA 4CDGA 4A1FA 5FBVB 1M74A 3C8UA 3UATA 1EESA 4Z54A 1UJ2A 2JCSA 3HP1A 4L9WA 3EZFA 4XTRA 2C2HA 2QA5A 5IT5A 5F9FA 1LV7A 2IYSA 1YZUA 4R9UC 1A82A 4C2TA 3P32A 1M1YE 1N3BA 4I99A 5GVSA 3M6AA 1N6OA 1QF9A 2MMCA 3AVUA 4H9GA 5DIFA 4M1TA 1IJFA 1Q1ZA 2IT1A 3PUWA 4IVPA 4IVRA 3IBYA 4B3DA 4LHXA 4DKXA 2PL3A 4Q00A 2ODEA 2G0NA 1ELOA 1R5NA 5E7JA 5EZ5A 1OFUX 3N2IA 4LHWA 2J0UB 2QMOA 5EJEA 4DDVA 3QEJA 3LBHA 1E2NA 1HV8A 5FL7D 2HUPA 2OG2A 4NYMQ 4OI2A 2WSMA 1AZTA 2GXQA 2QM8A 1Z2CA 4LV8B 1I2DA 3CUEF 1XD9A 3DOEA 2ZEJA 4M1YA 2GA8A 1A2KC 3VNUA 1ZNWA 1IHUA 1MO4A 1U8YA 2PX3A 2YWHA 3WNCA 1NN0A 3MUFA 1NSFA 1W0JA 1AGPA 2G77B 2WJIA 2ZE7A 2ZVPX 3OAAA 3GJ8A 4MRNA 2YC4C 4K81B 1UDWA 2BC9A 5GJWC 2OSBA 5DHFA 3T15A 4B3BA 4NCNA 8OHMA 4US2R 1CF4A 1ZUNB 2ZJZA 3UMSA 2WKPA 1HURA 3DKPA 4MA4A 3CRQA 2ONKA 3ADDA 2ZRBA 3PV0A 3QXCA 3OIUA 4G5OA 4OI4A 4DSTA 3THYA 5EXTA 1QHSA 4TLEA 1NN1A 4IDPA 1ZC3A 3N5CA 2ZITA 2J1LA 3PQCA 3Q7QA 1QHXA 4ZPXA 5B58C 1T3SA 1HE1C 4PANA 1E1QD 2N1BA 3KQNA 1KGDA 4PTLA 5TDHA 2OHFA 4HDCA 4Q4LA 1UEIA 4OHXA 3TMKA 2H57A 3OE7A 1HA3A 1F2UB 1RJ9B 4I81A 1AM4D 1IONA 2RGGA 3TVTA 1KNXA 2CEAA 2VHQA 3FHTA 2F1JA 5DHAA 1BMFD 3C7KA 3PUXA 3RDPA 3NDBB 2BEJA 3T1QA 3RABA 2OV2A 1KK2A 2ZU6A 2QROA 5J4KA 4PFSA 4AYTA 2CK3D 4WZBE 4DCUA 3IQWA 5DNYB 4TN1A 4ZDKA 4IEIA 2AWNA 1GSIA 3CF6R 3TBKA 4JSYA 1E9DA 4QOSA 4B2PA 4BFYA 2ZI9A 3VR2A 3Q9LA 3FB4A 4DLRA 4CZ2A 1IN7A 3BRWD 4JLPA 4OJQA 2H1LA 2JLQA 5LD2B 3TE6A 1VPLA 4OJKA 1S0UA 5GJBA 2GRJA 2QT1A 4Q7JB 2ZE6A 4U02A 2IYRA 4HI0E 2N42A 4B34A 4DCVA 1IQPA 4US0R 4PO8A 2ODBA 1CR1A 1CJKC 1KOFA 2AKYA 5HKKA 2BEKA 4D81A 1XTQA 2C96A 3RRYA 4LX0A 1U8AA 2Q21A 2FPLA 5JFGA 5L3SB 3AKDA 2FFQA 4URZR 4DB2A 2CMKA 3GJ6A 1GOTA 2E9SA 4HZUB 4AURA 4W5WA 1YZLA 4MRVA 4Q9IA 1X6VA 2FPMA 2K5UA 4B2IA 2WAYA 4K8OA 4CEJB 2FEOA 3MG9A 5TB5A 3U61B 2ONJA 3GLHE 3LLUA 4NTZA 2GKSA 1KY3A 2CNWA 4KU4A 3HPQA 5AR1A 2FZ4A 3JVUA 2W6ID 4LV5B 4Q7MB 4P3YA 2KI5A 5B64A 1XMJA 2CE7A 2ZRKA 2P6RA 4QBHA 2EVWX 3F3YA 3SNHA 2QSYA 3Q3JB 3QKUA 1IN8A 1RVDA 4OK3A 3AKCA 4Q4JB 4QJ3A 4ZDWA 1KJZA 4PAMA 3GLIB 2YOFA 1E0JA 1G7SA 4PZYA 4RCYA 1IY1A 2G88A 1VECA 2QAGA 4A82A 1T3LA 3AF3A 2FSHA 3UG6A 3DMDA 4B6EA 5LDDC 2XTZA 4A2QA 4DJTA 5IK2D 1G8PA 1ZUIA 1SVLA 2IS2A 3LFUA 2AL7A 2FE4A 3ZS8A 2JJ1D 3BH7A 4GP7A 1JAIA 3K1JA 4LV6A 4QGFA 3R20A 5BW8A 2YOHA 4FW9A 2JEOA 3WRYC 1YRAA 2HLDD 1YR9A 2IF2A 3B2EA 4B71A 1DVRA 1AZSC 4RFSA 1JECA 5TMPA 2XB4A 4C0BA 4FN5A 2W83A 4MRSA 1B23P 3QPWA 1X3SA 2QENA 5J47A 1OV4A 3E70C 3W5JA 1J2JA 3G0HA 2CHQA 4TL8A 1G19A 4HAVA 1ZNYA 3W3AA 3IO5A 3CWQA 1AK2A 1RRFA 2QRNA 3VX4A 1QVRA 4B2LA 1W4RA 4YDHB 1CRPA 2ZI4A 3QBTA 4LPKA 3VTKA 2XNSA 3O8BA 5FUYA 1TTTA 5FFMA 4HUQA 1WE2A 3ND9A 3X2SA 4OYHA 5HTKA 2JLZA 4LJ8A 1COWA 4JYBA 5CJ2A 1N6NA 1E2LA 2RGNA 5EXXA 2ANCA 2GEVA 3SFVA 1ZCAA 2I1QA 4TYWA 1EFRA 3ZVNA 3AVPA 3KB1A 3P27A 4S35A 2ATVA 3A1WA 3LAWA 1D2NA 4JVNA 4V0ME 2RGXA 1P4SA 1V43A 1XBTA 1G21E 4O2LA 1NKTA 1JR6A 1KDOA 3RS0A 3SC3A 2WTUA 2WVJA 4B75A 3TAHA 1H8ED 4ZIRA 1NIPA 1OFIA 2GCOB 3T5GA 2WWWA 1E99A 1JNYA 4URWR 4Q21A 1XEWY 1TU4A 4E03A 4B43A 4KFSA 3A4MA 3B1VA 4AY2A 1QG4A 3K70C 4XSHA 2QTHA 4JBYA 1ESMA 3TR0A 2H8KA 2HF9A 1RRCA 4LRWA 5CLQA 2O0HA 3BBPA 4OK5A 2FPKA 2X1VA 4FCVA 2YWGA 1WXQA 3CW2A 2QGNA 2TMKA 5FUVA 1E2HA 1EX7A 3NH9A 3NKVA 4JJKA 2GETA 2OE2A 4XVQA 5DH9A 4B74A 4HSEA 2JJ2A 4BFWA 3IHWA 3L8YA 1RC8A 1G3UA 5J5CA 5F2EA 3LD9A 4MRRA 1OXUA 4RY2A 2J45A 1LS1A 3K9GA 4OQMA 1R0YA 1ZVQA 4N1AA 5J4LA 1CJVC 1Z6GA 2FU5C 4XD7D 3C4JA 5E4FA 2OCBA 4XTCS 1SXJA 4JIMA 4UNNA 2GXSA 3AP3A 1SVOA 3VKHA 1DO2A 3TQFA 2O8EB 1CU1A 4D4JA 2G1JA 3GJXC 2X77A 4LJ6A 2WJGA 1NJFA 1FX0B 2GF9A 3AP2A 4JL6A 2F3TA 4GZMA 1N2CE 1YR7A 3VQTA 1GKUB 2BM1A 2C04A 1KHTA 1N6RA 3PIRA 1TADA 3K8YA 3K0SA 1NVVR 3U3JA 1E2IA 2W0SA 1U9IC 4ZDJA 2G1KA 4M1MA 4V03A 4YMSA 2WWIA 3QE0A 1E94E 5BN5A 1D5CA 2OXCA 1NF3A 1A7JA 5CIWA 4AC9A 2XXAB 4NE2A 4NP6A 2XGJA 3RNLA 4JT4A 1XX6A 5J40A 2PMKA 4LYAA 4RD3A 1OKKA 1GILA 4MGKR 2WIAA 3VU9A 2J0VA 1E6CA 2JLYA 1PVOA 5SZKB 1FPMA 1G5RA 2IBMA 3S1AA 5TY0A 3NHAA 2WSSD 5FOWA 3BD9A 4E09A 3B78A 1DAHA 4JLNA 4Q18A 4DZZA 1Q0UA 2WJVA 3QXHA 4PZLA 4RCZA 1VKJA 2A3RA 4NYIR 4B32A 4BZQA 4BLRA 1IN6A 1FUKA 3AUXA 4NZYA 4OHWA 2YWFA 1KSJA 1E9FA 2AR7A 4CT4B 2DHRA 3I72A 2F55A 1UBGA 4C3ZA 2HYIC 3KKQA 1JXMA 3QSYA 4M1SA 5FPKA 1ZD8A 1FP6A 4EIWA 1CLUA 4LHVA 1CP2A 3TSOA 5FL7A 5FPSA 1E9RA 1YR8A 2NO6A 1Q57A 2OXRA 2VYFA 3GCGA 3Q8XB 2XTMA 2ZI5A 4U5XA 2AHOA 5FBRB 3SYKA 5KSZA 1XPOA 1DAEA 4YMWA 1NBME 1E2FA 1ZM4A 2OBNA 3SJCA 4QKQA 1NN5A 3AM1A 4Q1FA 5KDDA 3TGPA 3K09A 4FINA 4KCGA 1N25A 2C9YA 4TT3D 2ZS9A 5J4YA 2ZAMA 1D2MA 2ORWA 2QMHA 1WF3A 3CPEA 1WBDA 2ASEA 4G3XA 2XJ9A 1EFCA 4Q01A 521PA 2WICA 3AB3A 3RS4A 4OBEA 3ZVMA 3QOFA 1P2SA 4BLPA 1MRSA 3EZ6A 3LA6A 4KAXA 5FUXA 3ZIAD 3C14C 1IXRC 5DISB 2ZR0A 4HB0A 2NZ8A 4GOJA 2QE7D 4EPWA 4QFMA 4KFUA 1T5IA 1SKQA 5AK0A 5K8LA 1YZGA 2O8FA 4B73A 121PA 4TMXA 2R2AA 5AUNB 4UNQA 3FFAA 1GRNA 2QP4A 5DYGA 2IYXA 2QPTA 3UPUA 1NP6A 2IYVA 2V7QD 4OI1A 2J41A 4CVNA 2ZSBA 4Q19A 4EJSA 1DOAA 1K5DA 4Q02A 1QHIA 1JXOA 4M9ZA 1NVVQ 4RKFA 4L4UA 1YHNA 1DADA 2WPDD 4BFTA 2ZE5A 4G01B 3QVUA 3F8TA 5G3YA 2QPAA 3W6OA 2H16A 2GJAA 3WP1B 3LDAA 2QSZA 3KKPA 3RWOA 3TRFA 3UANA 5DSZA 4MKGA 2W58A 5E95A 2CJWA 3K70B 4C9BA 4Q66C 4JLDA 3X1YA 2EYQA 3BB1A 3LWNA 3NWJA 4Q7KA 4NYJQ 3SZRA 4C7OB 4KODA 4BASA 1FTNA 1XNJA 5HR5A 3GLIE 1ZD9A 1YR6A 1VHLA 2FA9A 1T0JB 2X2EA 2ZJAA 1T4GA 1N5LA 2IEZA 1E79A 2Z4SA 3KKMA 3ZD6A 4PO9A 5JSZA 3VR4A 4O3MA 1OIVA 5JHHB 5AUPB 2A5FA 4NYIQ 2CBZA 1J8MF 3U44A 4PAOA 2G3YA 4UXJA 3HR7A 3VR1A 2WIBA 1CJTC 2CL7X 4AWXA 2YV5A 5EZ6B 3T35A 2CLDX 4IOJA 1L4UA 3A1VA 4Z8YA 2VL7A 4ON9A 4KJZA 1NVUQ 1JR3E 4UNPA 2EYUA 1PZNA 4TZ6A 3VFDA 4B3XA 2BV3A 5AUQA 5AJZA 3I61A 4XSGA 1M8PA 2ZJ2A 1W2HA 1E9CA 2GNOA 2BJVA 1DAGA 1VIAA 2FJUA 3W9YA 4DXAA 3O8CA 2QAGC 3AVWA 2GCPA 1W2GA 3KXIA 5JHGB 1KTVA 1KY2A 5AJVB 1TF7A 3PUVA 1F60A 1E96A 1AS3A 1J99A 3CH5A 4LOAA 3EZ7A 2VSFA 3EIHA 1XEFA 3BFKA 4CRWB 1OB5A 3HYRA 2AXPA 3AKEA 4M22A 1S9DA 3THOA 1P7CA 4HAWA 3NHBA 2O0JA 1YRBA 2FFBA 3ZQJA 1UADA 1AKEA 4R7ZA 4UJ5A 3SFZA 3VR6A 3EA5A 4NDZA 1G6HA 3DDCA 1ZNZA 1DG1G 4P33A 4MGYR 1YZNA 4LSGA 4TWZA 3CX7A 3MWLA 3RYTC 4W5JA 2ERXA 4LJ4A 4HYYA 4BLQA 2YC2C 1M7HA 2WWHA 5CK5A 3UXMA 1BYIA 4FD2A 4Q03A 2BM0A 2NPIA 3L2OB 2ZANA 2JJ1A 1NNEA 4PZZA 3BH6A 4CF7A 3SR0A 2V8OA 3L0PA 1QHYA 2BJWA 1KI1A 2AD5A 3KB2A 4O2RA 2HLDA 3KKNA 2P3SA 2QMEA 4EPVA 4JVMA 4TMWA 3FWYA 2IWHA 4UNRA 1N5JA 3U4QA 5KYKA 1G7TA 1PJRA 2RGNC 2BKUA 2R6CA 1JPNA 1WDTA 2XZOA 4YLGA 4F4IA 4LPSA 2ZROA 4FMCB 5H70A 4DHEA 4ZKDA 3THYB 4H1VA 2ZIAA 2AFHE 4D80A 4R71A 2IX3A 3GPLA 2A5YB 3GMTA 1N6LA 3TK1A 3RLFA 4WA7A 1F6BA 1VDZA 1XZQA 2YJTD 4NPHA 5L3QA 3AF0A 4HLCA 1GTVA 3GLFB 1OYYA 4IJMA 3BIFA 3MCAA 4M53A 1NBMD 4FMCF 4KXFB 2OBLA 4YXWD 5EUMA 4QG7A 3AGPA 5KHOC 2J0QA 3MWKA 1XXHA 3P20A 3I73A 1S9HA 5FOXA 1BKDR 3QKSB 4PSKA 1RKBA 1ZIOA 4A8JA 4XVUA 5G3ZA 3SYNA 4JMPA 2OLJA 1Z0JA 3AF2A 1W1WA 4EFLA 3LQQA 4TYPA 2D7DA 1DAKA 4HDQB 2EFDB 5FTLA 5BYKA 1KK3A 2GF0A 1MR3F 2A7QA 4KITB 1GL7A 3PJRA 3W8RA 6Q21A 4R2IA 3ZGXA 1H8EA 2A5DA 4FMDB 2V4ZA 1KI6A 2YYZA 4FWIB 4G5GA 1G3MA 4RD2A 3SQXA 3BB3A 1W4CA 3TSZA 4GP6A 2QI9C 1Z22A 5CB6A 2WWGA 3B1ZA 1FNMA 4M9XA 5UKDA 3QG5A 1R0ZA 4LYJA 2B6HA 3MWJA 1SXJC 1SZPA 2V1XA 4IOKA 4FMDF 4GZLA 3SJAA 2F9LA 4HDOB 4ARZA 5E7MA 4Q9HA 1Z0KA 2PT7A 3K0AA 1TUIA 2R44A 1S8FA 2W2TA 3SHWA 3TIFA 2QORA 2JDID 2H17A 4EFNA 1FQJA 1G8FA 3HJNA 2HV8A 3K0FA 3MMPA 4IRUB 3ICQB 5JJIA 2NQ2C 1KKMA 4LJ7A 1G64A 1BH2A 2IW3A 1XJCA 4XD7A 4MDFA 4B3FX 2VHJA 5G53C 1KI3A 2QPOA 4IDOA 2BCJQ 2DFNA 3WBJA 4I1UA 3RSLA 3LY5A 1YQTA 1E69A 1Q1EA 1Q20A 3OZXA 1JJ7A 2WAXA 4DLSA 3QKRA 3TW8B 3GP8A 2EW1A 2KBEA 4XIGS 2V6IA 4L5BA 3B85A 3FKSA 1K8RA 2ZTSA 2REBA 1KO5A 4E22A 1Z2AA 4Z1MA 1BYUA 1MO6A 3WHKA 4NBSA 3V9PA 3UG7A 2QAGB 3NBFA 3X1WA 1E1RD 3AKYA 4NONA 1JR3D 1OLOA 3WHLA 4ZCLA 1E2QA 3U7GA 2ZSAA 3QVVA 2PJZA 1D8TA 1VHTA 4CEIB 2Z0MA 5IHPA 3CWZA 3HU2A 3EC2A 5KSOA 5CM9C 3BWDD 421PA 4Q4HA 4QBGB 2D74A 2NO0A 2ZYVX 1XMVA 2WHXA 2ERYA 1QHHB 3TNFA 4ILEA 3KQKA 2V54A 2WSSA 1P2UA 3G5UA 1FOEB 2QY9A 3EWSA 4PSVA 5FTKA 1AN0A 1GNRA 3CF2A 4IXMA 4HAYA 2ZRDA 4N0EA 1XD2A 5FUWA 3K09C 1MOZA 2QTFA 3GEIA 2CLCX 4LDJA 1S1MA 3AUYA 3FOZA 5JEDA 3CM0A 4IW3B 5IF9A 1VCOA 3SE0A 4D25A 1P9NA 4GNKA 4QGGA 4TTQA 4HUQB 2FEMA 5JI2E 1XFAA 3C16C 2ZSEA 2VHCA 4P0TA 4URYR 4G5RA 4D6PA 2ZI6A 3BJIC 1UDXA 2Z6VA 4TQUS 5CIQA 1UKVY 4B48A 3LVQE 1E2EA 4MQBA 3VR5A 4DBLC 1S1CA 1HE8B 1KO1A 2FFAA 2EWVA 4KO8A 1YU9A 2BBWA 1UKZA 5CB8A 1T8UA 3I62A 2OFXA 1NMYA 1IJEA 1W0KD 2R62A 3W3ZB 5B30A 4EJSC 4V02A 4BZXA 1FL9A 3G82C 1J70A 1W49A 2FG5A 1LY1A 1U81A 4TLDA 3W6NA 2ZM5A 1GL6A 4ZIRB 4TQAA 1LF0A 2JIZD 3ZIAA 2D2EA 3KQLA 2GJ8A 4X8MA 3UMFA 3BFXA 2QE7A 4BEBA 1UM8A 1Z07A 4CW7A 5DN6D 4QM6A 3A1TA 4HAXA 1OFTA 2QQEA 1E2DA 1E9AA 5FOUA 1AQUA 4AG5A 4AKIA 2V7QA 4E07A 4ESVA 3THXA 2BCGY 3QXJA 2PH1A 2FX3A 3QBVA 2Q3FA 1XTKA 1SQ5A 2OAQ1 3SJBA 3IDQA 1LW7A 5C4MA 5BWMA 2J7PD 4ASUD 1R5OA 3DKVA 1P9RA 2GESA 4MYHA 1SHZA 1M34E 2V9PA 5FTNA 1CBUA 3LXXA 2RAPA 2O8DA 4QGAA 3AVXA 2R6DA 3T34A 5EXPA 3R7WA 2XZPA 4PSAA 3RVBA 3T06B 2PEZA 1M7GA 4CIDA 5KNCA 2IYUA 4KV9A 5D3MA 4JT2A 4TSFD 1NIJA 2Q6TA 2O8BA 1Y3AA 5G40A 4NCHA 1Q12A 1GAJA 3EC1A 3PEYA 2BMJA 4A0FA 1ZINA 1TF2A 2FOLA 3WYFA 5JWRA 3RHFA 3M1IA 3MSXA 5DYIA 4GL2A 1WBBA 1E9EA 2W6JA 2ZS8A 3LRPA 4HLDA 4DC9A 2JJ8A 4ZCMA 3NTUA 1U99A 3THWB 2GEUA 1NLZA 2RMKA 2QBYB 4M4SA 2ZRMA 4JLMA 4LBZA 1IY2A 1XJQA 3FHCB 4JVSB 4IFBA 4I1SA 1EG7A 1II0A 4W9MC 2J3EA 1OFHA 2QQ0A 1VG0B 2ZJYA 2C77A 4BUJA 4JLJA 2CCGA 3WY9A 4UXIA 4RD1A 3BXZA 4B47A 3ND8A 2XAUA 1CS4C 3QF4A 5FOTA 3GEEA 2GZDA 2WBLC 4WIAA 3S1AB 2OFWA 4UXHA 4K46A 3ICEA 1XTJA 1ANKA 5SZHB 3GLFE 1W36C 1SVWA 3ZD7A 4AK9A 2XOKD 1MKYA 1KK0A 3KJIA 1H65A 1KMHB 3AQ4A 4NCKA 1XTIA 2ZRIA 5HE9A 4EAQA 1II8B 1E98A 2VIIA 4IKEA 1NMZA 5B57C 5KTYA 1ZM3A 3A8TA 3AF1A 3QXSA 2E87A 3PEUA 5K8IA 4AKHA 4BLSA 2ZRPA 1N6HA 3IPYA 3BOSA 1DTSA 2ZJ8A 1AGRA 4WVFA 2BDTA 4BRWA 2OZEA 1WQ1R 4HUTA 1S96A 2RCNA 3I4LA 1EWQA 1OXVA 1TL7C 5L3RA 1XEXB 3OEHD 4P31A 2VPPA 2RHDA 4H1UA 1N0UA 1KI2A 4RD6A 3V4RA 2WWFA 3RAPR 4TL9A 1YJ5A 1XWIA 1HY3A 4Q4AA 1IY0A 3EPLA 1N6IA 2GILA 3L0IB 2YINC 1OHHD 3FVQA 5FTMA 3GLGB 2KSQA 3AVQA 1F5NA 2IS4A 2VP5A 1SGWA 5LBIA 2ZRGA 3U6BA 1M6NA 3DOFA 1NKSA 3I5XA 1F2TB 1VG8A 3NH6A 1F2UA 4JLBA 1W5SA 3KX2A 4MYUA 2JLVA 3BORA 2EFHB 4XVRA 5KOYA 3IO3A 4BLTA 1HEIA 1R10A 1U98A 3EG5A 3KXKA 4A8JC 1G18A 3K70D 5JS8A 4PAQA 1TUEA 2XSZD 1VYUA 1HTWA 4UNSA 3AVVA 3C5CA 1U90A 2VHTA 1XTRA 3EW9A 1XDBA 2GXAA 4V0OA 2ZRCA 4I4LA 1Q1BA 1M7BA 3FMPB 1LFDB 2ZVQX 4RD4A 3B7GA 1H8HD 5TARA 3WP0A 1UAAA 3ZH9B 1MH1A 3N2EA 3REFA 4A6PA 1HYQA 3KFVA 2P6NA 4ABYA 3ONWA 2ZETA 3TLXA 1ZC4A 2OESA 3X1XA 2BMDA 4JLVA 4ZO4A 2FZLA 2CJWB 1I2MA 1E2KA 2GHIA 2DY1A 4A4DA 4DUGD 2WZQA 3SU8A 3R9XA 3DEFA 1CJUC 3SS8A 3UIEA 4B33A 2ZUDA 3OIYA 5AUOB 4HLUA 1RRPA 4Q47A 2F3RA 1E2PA 2XNDA 4V0NA 2JATA 4L8GA 1EWRA 3W6PA 2ORVA 2ZR7A 3PEVA 4WAUA 5L3SA 3IIKA 4TMKA 2J87A 3C15C 4IDQA 4R2HA 5JSZB 4A0HA 1MRNA 3U44B 2MSCB 5IDVA 1EGAA 3ASZA 2HEIA 2RGAA 4ZKEA 4GMXA 3DM5A 3M4YA 1E9BA 1W4BA 3KJGA 4C4PA 3FYHA 2OO7A 2D7CA 2WWYA 1MABA 5JCZA 1KMQA 3LBIA 1G5TA 4QM7A 2OAP1 3OIWA 5EE1A 2NO1A 3QUSA 3O8DA 4KFRA 3PUYA 1OH7A 4GOXA 3K9LA 3R9IA 3QPVA 4TZ0A 2R6FA 3H84A 3T1TA 1X8LA 5E3HA 2CL0X 3AV0B 1HQYE 2A2ZA 3PCRB 1VG1A 3FMOB 1E2GA 4DLUA 5JJLA 1NMXA 3MAAC 3WNBA 2QN6A 1G20E 1S3GA 3KDSE 1SVMA 3QF7A 2P2LA 3TAUA 1I4TD 3U3OA 1Q21A 1R4AA 4Y0VA 2IXEA 5EE3A 1XP8A 1E0AA 4NH0A 4X8OA 2LWIA 1FP7A 2PZFA 2FGKA 2ODWA 3LVRE 4MKIA 5FL3A 4DLVA 4OHZA 4V0LA 4XWOA 2DB3A 4C0KA 1EXMA 1N5KA 3LBNA 2I1VB 1Q1QA 1WCV1 2O0KA 3Q5DA 1E4YA 1X8KA 1ZW6A 2A78A 5EP1A 2BKEA 2HJGA 3WMFA 4JBXA 3TR5A 3O8RA 1EX6A 1II9A 3SQWA 1FUUA 3FMIA 4GRAA 4JS0A 4O25A 2RGBA 1W36B 2NZJA 2QP3A 2D62A 4E5UA 1Z0DA 2VP6A 1KZ7B 1NY5A 1U94A 2RGCA 3GFTA 1P2TA 1ONBA 5LB2A 1RW4A 1N0WA 2ZI3A 3MFYA 1KI9A 2AXNA 4AKEA 2GAOA 4OQXA 3SJZA 4TMZA 5H8WA 3SYLA 3C41J 2ZXUA 3CNLA 1CIPA 1GNPA 1Z0FA 4MYTA 3VKWA 3GFPA 3PEWA 3IEUA 3Q72A 1FQKA 1NSTA 2B7BA 4YDSA 1JQLB 2WKRA 3CRRA 4KVAA 1TMKA 2OCAA 2IS6A 1T3HA 4DEYA 3AGQA 1PUJA 4FIDA 1KNQA 2C9CA 3KTAB 2KB0A 2HF8A 2PZGA 1U0LA 3CX8A 3IQXA 1NN3A 4HB4A 4JLOA 5FPYA 5JEEA 4U00A 5SZIA 3W34A 1RYFA 2WJJA 4DWJA 5L3QB 2W0MA 2P0EA 1E1QA 1P3JA 3PFIA 4MKFA 2I3BA 4OHVA 1SXJE 1T0HB 2ZQ5A 4D0NA 3R9WA 2D4HA 2ATXA 4DB4A 2C03A 3WMGA 1W46A 3TW4A 3MJRA 1GNQA 4KBGA 1XXHB 2P65A 5AJYA 4ACAA 1GFIA 4TYQA 4JSTA 1ZRHA 3KJEA 3VKGA 2R6AA 2PCJA 2F43B 3OF5A 4DT1A 2DWQA 2O8CA 2ZRHA 2AN9A 1BMFA 1BIFA 4LJAA 2P6UA 1W0KA 3T5DA 2IC5A 1G17A 3FMFA 5AJXA 2YWEA 5DO9A 2RH5A 3GQBA 2WOJA 2CLSA 1P60A 1G291 2CK3A 4BFSA 5HKKD 2IUUA 4DIDA 1SVSA 2IYWA 1KI6B 3EARA 2CL6X 2MSEB 4IFEA 5FPHA 1HUQA 5DN6A 2ZYTX 1UBEA 4LYHA 4GPTA 1G3IA 2QNRA 2ZAOA 1VCIA 2FSIA 4MDEA 2AFIE 1VMAA 3WYGA 3AVOA 3D3QA 4LUCA 3GJ0A 5KSPA 3A6PC 4W7SA 1OF1A 1CXZA 2J7PA 4PC3A 3NXSA 3SOPA 4C0HA 2W2VA 3QQ5A 4GFDA 3K0FB 2F1RA 4M1WA 2ZE8A 4Q9KA 3I8SA 4OQNA 3RANA 4XH9B 3HYTA 4RZUA 2VF8A 2GDJA 4HLQB 3ZLJA 2P5SA 4EQ6A 1Z06A 1ZYUA 5CJPA 4F93B 2DYKA 4WBSA 1AIPA 1HQCA 2AWOA 4YONB 3BC1A 5BN3A 4LK2A 2J46A 1XF9A 1TQ4A 3QKRB 4JKIA 1OXXK 5J4VA 2ZYWX 2W6IA 2ZUCA 1FNNA 1IAQA 1KO4A 3HPRA 5BYJA 1GRRA 5EE5B 3OFND 4QNRA 4D0LB 4LI0A 3RRZA 1R2QA 1JBKA 2VH5R 1EFHA 3MRSA 2GXUA 1N6PA 1YKSA 1X8JA 2DWOA 5GJCA 3ETLA 1TNDA 1TPZA 4ZI2A 2OLKA 2VA8A 3CONA 1T8TA 4A2PA 1TQ2A 3GLGE 1LB1B 3CF0A 5KDLA 4DDUA 1A2BA 5IK2A 3IPXA 1CKEA 4PC1A 1SHKA 4P4SA 1IN4A 4ESHA 2VF7A 1HT1E 3GD7A 1IXZA 1NVWQ 3GJ7A 2G0TA 2WMNB 2Q9BA 2BIFA 4PQRA 1W44A 1US8A 2B8WA 3ADKA 3CRMA 4UQOA 5FPTA 4Q4HB 4LJ9A 3CRW1 1RYHA 3Q85A 4PX9A 1U0HC 3EPJA 4RFVA 1E2MA 5IRCD 1YE8A 2FGJA 1FFHA 2ZR9A 3EWAA 1COWD 1R6BX 3T61A 3B9PA 2NOAA 2NPFA 3TVDA 4C0SA 1XMSA 4TMVA 1KDTA 3EZ9A 1G9XA 1XD2B 3DL0A 5EQTA 2GZHA 2OM2A 2GJSA 2Q3HA 4IEEA 4KFTA 4QXAA 3B1WA 4DIEA 2VHUA 1QDEA 2B7CA 2QEQA 4GOKA 5KNDA 3X1DA 2WKQA 4C0QC 5JS7A 1TAGA 1CR0A 4JZKA 4GMDA 2Q3MA 1DO0A 1JB1A 3JZMA 2BBSA 2NGRA 2CHVA 3TJZA 3TUZC 3CKLA 2FFHA 3LXRA 5CYOA 5B2ZA 1KO8A 2IA5A 2JLXA 1Z47A 2AK2A 4IVQA 5CDFE 1G3RA 2R9VA 1X1RA 5AJWA 4OK6A 2YZ2A 4QBIA 621PA 1Z63A 2SHKA 1R7RA 4PHTA 4MKHA 2V1UA 4C2UA 1ZUHA 4KHZA 2PBRA 1OHHA 4NMMA 2IWRA 821PA 2KBFA 3EIQA 1O3YA 4AIIA 1ZD1A 4PR0A 1T5LA 2PZEA 3H4MA 3U3KA 3PVSA 1P73A 2GEDA 4JLAA 4HATA 1SKYB 4IXNA 4MUBA 5LPNA 3U6KA 1ZAKA 4D4MA 4DVGA 3R8CA 1C4OA 5TV2A 5SZJA 1ZIPA 2J0SA 1G4AE 4W5HA 1U8ZA 1UEJA 2DFLA 1UFQA 1E4VA 5HPYB 3EPKA 2JAQA 1E2JA 1QG2A 2IHYA 1RZ3A 2PLFA 3P26A 1QHGA 4C7OA 1G8YA 3FTQA 3Q5EA 4B44A 4JVLA 4CEHA 3ZQ6A 3RRNA 4DDWA 1DELA 4HLUC 4C0AC 3EIEA 3QG1A 4CYMA 1GDDA 1I4DD 1H8HA 5L8VA 2KJQA 3RS5A 3I32A 4IDHA 3KQUA 1DARA 4BRUA 1Z6AA 1Z6YA 5C4GB 1NVXQ 4PPNA 3ZDQA 3R8FA 3DMNA 4OQFA 3R7WB 2GVDC 2H5EA 2CCKA 5A4JA 3U7HB 3DPUA 1JQJC 4BFXA 1G3QA 2OUKA 2PLRA 1W47A 4DUGA 1WP9A 4NKRA 5D3MB 2J5XA 5DI3A 1RE0A 4F91B 1PLKA 3L0OA 4OL0A 4PPGA 5BN4A 2VRWA 1P75A 1NLYA 3U2QA 4AG6A 4WOPA 2JLRA 1GZSA 2F7SA 2IEYA 5EP3A 4F4CA 5TVKA 3EASA 4KSBA 2GBLA 1XMIA 3E5HA 1K6MA 2UZIR 3MLEA 4YMTA 1X86B 3QEOA 3TQCA 1C9KA 1ESNA 4RD0A 1JJVA 4B3GA 2QZ4A 3B60A 4I1VA 3KFXA 1RRGA 4P4TA 3LO5A 4EDHA 1OKKD 2WJYA 2UKDA 1CRQA 3E1SA 1KK1A 4UKDA 4BE7B 4YQFA 2Z5FA 3I3SR 4DSNA 4XWKA 1YZKA 2BHRA 2GAAA 3NG1A 4IOMA 3ADBA 1U9IA 1QRAA 3QI2A 2XZLA 5EP4A 1XZPA 4I1OA 4M1OA 5HCIA 2ZS7A 1F3OA 4LJ5A 3MWYW 3NBXX 1G6OA 3I92A 4NCJA 3FFBA 2HT6A 1WB9A 2QP9X 3UWOA 4D26A 1WRBA 4LYFA 2ZPTX 3GJ3A 5C1BA 3L8ZA 2Z4RA 2MSDB 1I4LD 1XPRA 4EUNA 1CTQA 2J9RA 1D9ZA 1KSFX 1B0UA 1L7VC 2WMOB 4F4JA 2BVNA 3GLHA 3QF4B 4OI0A 3ZVRA 1XJ0A 4RFSB 2PX0A 2PJRA 1DPFA 2Z83A 5F98A 2VO1A 2RKOA 1K5GA 1QZXA 3KL4A 1ZU4A 4ACBA 1SULA 1DAIA 2VTKA 1VTKA 1Q22A 3GJ4A 2YNMA 2P67A 2VSOA 4N3NA 2VBCA 1XXHE 5C2JB 2DR3A 4ZDIA 3K9HA 4Q1BA 3EX7C 4A0GA 4DCNA 2QUZA 1ZU5A 2ZRJA 3AEZA 3N70A 2IS1A 2UVQA 2R6GA 4KVGA 1DAFA 2BBTA 1W5TA 1JEDA 2B8TA 4NU0A 4B35A 4QHSA 2NMVA 2VP0A 1M2OB 3SI7A 1G7RA 2CE2X 2C95A 4BECA 2IYZA 1E9SA 2NG1A 1D2EA 4ITRC 3RWMB 1G1MA 4TT3A 3UMRA 3H86A 4Q4AB 1OSNA 3HU3A 5HCNA 4JL5A 4JLKA 1P62B 1ZM7A 2DBYA 1CR2A 4QJ4A 5A5GA 3GLFA 4AKGA 4TMTA 3M0EA 2AX4A 2CVFA 2Y8EA 3A58B 2QGZA 2HT1A 1TQDA 2XEXA 1ZNXA 3BS4A 5DGXA 2Q9AA 3EAQA 2OT3B 3U7EB 1Z28A 1DBSA 4D0GA 2YKGA 3NBZC 2QG6A 1LTQA 4HB3A 3QKSA 4HZIA 1IBRA 1ZP6A 3A36A 1GVNB 3LW7A 1AQYA 2C99A 2ZRAA 1FMLA 1PLLA 2X19A 3A37A 2V3CC 2EFEB 3B1YA 1PV4A 1KJYA 2VSXA 2V6JA 3K0EA 2VP2A 3KKOA 5CM8B 2WPDA 2D2FA 4DLTA 2FMXA 2XB2A 1FZQA 1LVGA 1VYTA 4OKSA 2R8RA 1NG9A 1E79D 1JEEA 3F0TA 5EXSA 2C78A 4MRPA 5L3VA 2L0XA 2O5VA 3LW8A 4V0MA 3WYAA 4Z51A 3A4LA 2FSGA 3U5ZB 2BMFA 1E0SA 1SXJB 5ANRB 2ECKA 5C18A 5DI9A 1P61B 3SN6A 2JA1A 3C5HA 1P6XA 3Q7PA 1LNZA 2G9NA 4MITA 1LF5A 1OB2A 1OW3B 1OE0A 4FWTA 4KYIB 1KSGA 1X1SA 1WMSA 1KI7A 2WWXA 3CB4A 3CPJB 3B1XA 4M9QA 1E0KA 3CBQA 3CRVA 1KZGB 2BMEA 4G5QA 4LBYA 3I1FA 4BPBA 2X8AA 4AI6A 1JPJA 2ANBA 5GVRA 2F1HA 3DHWC 4AD8A 2HJVA 3GEHA 4DLWA 5CITA 4US1R 1AA9A 1Z6XA 2W00A 2V55B 1CR4A 1MABB 2IYLD 3HU1A 2OCYC 3K9NA 1OPXA 3BK7A 1XD8A 1F48A 4LC0A 2IYQA 4A36A 1XCMA 4QJ5A 4O0MA 4HB2A 1YVDA 3RS7A 4C30A 1YZTA 4MUAA 1XPUA 4Q9JA 1ZM2A 2CDNA 5K8UA 3VMFA 2VQSA 2FNAA 3FE2A 4KLZA 5CYPA 2J0UA 4FCWA 3IEVA 4JJZA 3VU9B 4YMUA 2NIPA 1IM2A 2AD1A 5TXGA 3LH5A 4L15A 4FMBB 2C8VA 4LWZA 1W36D 3HDTA 1VCNA 1Q44A 5BXQC 5FOVA 2FSFA 3AH8A 3EA0A 4WZAE 3A1UA 1KI8A 3K0CA 5KUTA 4CEIA 3U7FB 3CZQA 3OFNA 2CCJA 4LGMA 3T1VA 1KDPA 2YHSA 2ZJOA 4FXPA 5KNBA 2IYYA 1ZMXA 2OCPA 4UJ3A 3DZ8A 2PCLA 1QHHA 3F5FA 4QHYA 3CR7A 2HCBA 2DFTA 4GSYA 1IXSB 4N0DA 1J90A 4QL3A 1U0JA 4A92A 3FGNA 1W7AA 4S2EA 4EFMA 1SKYE 1KI4A 1U2RA 4TYNA 1Y63A 4B6FA 2F1IA 2JLSA 2XTNA 5JJKA 1OH5A 1AJEA 4NCIA 4RZXA 2IXGA 1XB2A 4DSOA 1L8QA 5FI0B 1JALA 2IL1A 3W90A 3O47A 4G0NA 2IK8A 4BLOA 4R98A 1HH4A 1RJ9A 2OILA 3CNNA 3V00A 5D3QA 1ZBDA 1Q3HA 1ETUA 2O8FB 5H1YA 4LCBA 3T12A 1WA5A 3VR3A 1OH8A 4IOLA 2WOOA 4CT5A 1R0XA 5FBQB 5KU1A 1UPTA 4MGZR 2QRZA 4M1KA 4EJSB 2JASA 4M9SA 1NBMA 3BH0A 4YXWA 3J81k 4Z8XA 1SVIA 3HWSA 4C0LA 5GJVC 3FDIA 1N5IA 2NO7A 4BWYA 1J7KA 4TLAA 3A4NA 1G16A 1RPZA 4GBMA 2CVHA 2WJHA 5FI1B 5H68A 1Z83A 4DT1B 3WXMA 2O8CB 4KSCA 5FH9A 1DS6A 3QPUA 3NIBA 4LBWA 1PUIA 2A5JA 4X8LA 1FTSA 1VCMA 4RZ2A 4IDNA 2FWRA 2ZI7A 1E32A 5EE0A 3OEED 4BEJA 5FR1A 1E3MA 2ZJBA 1VYVA 3UWKA 3ZVLA 2F6RA 3NVAA 4KLNA 4D82A 3A1SA 1S2MA 3BE4A 4WZ6A 4HZUA 4BFZA 1TQ6A 2OEPA 221PA 3SBDA 5JWHA 4ZV4A 1JI0A 4F92B 4CEJA 4PPFA 5AWFC 4DEXA 1G7CA 2YVUA 3CR8A 2F9MA 5JMTA 1GKIA 2NTYC 4JBWA 4Q1CA 1UBFA 1EK0A 3CPHA 4DSUA 2AKAB 1G41A 2JDIA 3QXXA 2GBLC 3IBGA 1FW6A 3OESA 5FOSA 2KWIA 5JLJA 2ZRLA 3FKSD 2HYDA 2OBMA 3AVYA 4WXRA 3DM9B 1J8YF 2HCJB 3VNVA 3FHOA 1XTSA 4ZCIA 2FN4A 3THWA 3WBKA 4Z1MD 2ZSDA 4Q4JA 3IHLA 4M2LA 4LC1A 2QBYA 3GLIA 3LX8A 4EQ6B 1AS0A 2AK3A 3IUYA 2IF0A 5EUQB 2VP4A 3L0SA 4EPXA 3EPHA 2QM7A 1Z8FA 2NO9A 5C46F 1P5ZB 2CXXA 5K8TA 1OH6A 5CLLA 4PHGA 3JZAA 1MO3A 1CULC 1NG1A 1NRJB 1Z5ZA 3RS2A 4A15A 1Z29A 1D6JA 5EP2A 2XX3A 2ZRFA 3SHFA 1KAOA 1MT0A 1Z08A 2GVZC 4D4KA 4NYJR 2JGNA 3EZ2A 1S3SA 2ZYUX 1W0JD 1GIAA 2A30A 3QIAA 1UKEA 2REXB 3OAAD 4LHZA 3ZZUA 5EE9A 2ZRNA 4QC2A 4TLCA 3TSWA 5JZVA 3LNCA 4CGZA 5DLQC 4PO1A 2RGDA 4QNMA 1VIYA 3B9QA 2A5GA 1QBKC 4ZI3A 4PQFA 1E1RA 1MV5A 4LHYA
chains in the Genus database with same CATH superfamily
1GZUA 3TNYA 1XCOA 3KXLA 2QN8A 4KYUA 3OIVA 1OD6A 1E5TA 1NNLA 3HWX1 2X0JA 4L8WB 4NECA 3JSXA 4UVDA 1RFLA 1H1LB 3KPWA 2BZSA 3TH5A 2VT7A 2ZJ5A 3U7IA 3GJ5A 1W8DA 3OIDA 5AKGA 5FULA 3S2UA 3TFWA 1PK7A 3E53A 4DV2B 3NUZA 1NUSA 1US8B 3AW8A 4CKCB 3SCZA 1INLA 4IGEA 2UUBB 2G06A 1TX4B 3KCNA 4J1NA 4CLEA 3BPSA 3ZYCA 2GN2A 4HAUA 4JASB 4TN5A 4QO8A 1CVLA 4V0KA 4DCMA 1JAHA 3OCWA 1VJTA 4RKEA 2C7QA 1L0BA 5TQ0B 1GZ4A 2VK2A 1YOVB 2PUFA 1S3FA 2ZTHA 1T91A 1BW9B 3L0DA 5E1DA 3U60B 5LMUB 1U0TA 1QK4A 2Y67A 3IHKA 1E62A 4W5NA 5FKJA 3A6GA 2Y1EA 3GNQA 5LP6A 3UTDA 1IBMB 4L9SA 3RBZA 4RQTA 4TMFA 1H2AS 2G4CA 4H77A 5LB4A 4DNQA 4V0RA 4K6FA 3E7PA 4GC5A 4GT1A 4YJGB 4CMIB 1FFAA 1EDZA 3AETA 3OFVA 3SEAA 2WHPB 1V6SA 3ZLTA 4CLHA 1Q5PA 1EK6A 2J3KA 4R69A 2XYQA 2QU8A 1WM1A 4EPYA 2B92A 4C4YA 5BWCA 1QVAA 1GNLA 3BREA 3CO5A 1GTJ1 4IJQA 1N2EA 4CJXA 1A5ZA 1WHSB 2WG0A 3MQFA 4B31A 1G5PA 3ESCA 5CK4A 4G5SA 3R7DA 4HWSA 3ZWWA 2F2TA 3D7MA 2H31A 1YKFA 4GI7A 4EY4A 4FFVA 3PXGA 3T52A 1Q3TA 2DFKB 3GT7A 2FP4A 1ZWLA 2DFDA 3CNBA 2AG8A 4FOPA 4JUCA 3HCFA 4BQSA 2ACWA 3R8XA 4U2BA 3AB8A 3STWA 3T5AA 3A7EA 1EWKA 1YDFA 1P9WA 1JYFA 3H8SA 3LCJA 4PQGA 3D1JA 4M6WB 5DLDA 5G41A 3CF4G 2AFHA 4PHFA 3EUWA 3QOWA 2KHZA 5GADl 6PFKA 1CY2A 1XU7A 3ROFA 1OA0A 4CU5A 1HYHA 3INYA 2XQVA 2VDWA 4HDMB 4LZZA 4QDZA 3EDCA 1EKXA 2FR8C 2JAOA 1OIWA 3B8HA 4Q9AA 3QKTA 1Z0AA 3I53A 3WNDA 2D3WA 1R4MB 1WW3A 4M8SA 2N47A 3BFVA 4NL4H 2DCUA 2AEEA 4G4SO 4ARZB 2BWJA 4NBVA 3GWZA 2DWPA 1DHTA 3K0AB 3TZBA 2CNWD 3EOAI 3SK0A 1F8GA 1JHDA 2AMVA 1XG5A 1KJNA 2ICAA 3SBEA 3GJTA 3K9CA 1BG6A 1BO6A 2J6HA 2OO5A 2VP3A 5HE8A 5I7RA 2FH5B 1YRLA 5FBWB 1I2BA 4H3KB 4P53A 4BFUA 4LBVA 1KYXA 4EKDA 4ZT2A 4MYCA 1EG2A 5FWYA 2Z5GA 4BKRA 4YDQA 3A2KA 2DPXA 3I1JA 4B2LA 4PQYA 3EK2A 4Q1DA 2B1IA 3IDAA 4L16A 1QYCA 3EVGA 5DE3A 5JO9A 3K9BA 4NFYA 4BGIA 3S7ZA 4Q9DA 3LQFA 5CD9A 2VCYA 4KN6A 4R2KA 5DP2A 1YBHA 3IX7A 1HDRA 3TTTA 1QANA 2HDNB 1RQNA 2O1WA 2VEDA 3CSSA 2H5IA 1KJWA 3ABOB 3ANMA 3GN1A 3OZFA 3ASYA 3JARA 4B6JA 1Y8QB 2CFIA 1BE6A 1RIFA 3ANTA 4M0LA 4UATA 3Q3IA 3SWWA 3O8OA 2IIPA 3IILA 5LQMA 1KRXA 4L8VA 2Q0HA 1PJ8A 3A4YA 5ALXA 1JHVA 3P1JA 3ZN2A 4YRMA 3NHMA 1IRIA 1RM5A 1Z5UA 1EK2A 4P32A 3AFNA 5AVVA 5EJ5A 1G8GA 5A2QA 1XL1A 5J4LA 5KVSA 3EFHA 3K0CC 4QEDA 4QRDA 3MPOA 4QREA 3A27A 3CH4B 1JILA 3L8HA 1A5TA 2MYTA 1W30A 2UVPA 3KV1A 4MKZA 2DUMA 4BZPA 3AINA 3N76A 4BVHA 1DAMA 3A9CA 3M1LA 4U3JB 4Q7LA 4YGXB 4OQLA 3W8NA 2W2OA 1Z3IX 4HFRA 3VV2A 4ARVA 2EIHA 4WXPA 3G7UA 3HKBB 5K5EA 2DE0X 2ZYSA 4I2VA 4JYMA 3GBPA 4JA2A 4E12A 1HDIA 2XOEA 3KZ1E 4HRYA 2E1RA 3RSFA 3V1NA 5IHXA 2P6MA 4EM6A 2GZAA 4EGCB 3WISA 2Q5IA 2BGLA 3W7BA 3HLTA 3MJVA 3DW3X 2CUNA 4LMRA 1YBAA 2WM8A 2GBCA 2QJWA 4FYVA 3IPCA 1E59A 3ECCA 2PEYA 4FHZA 2EFYA 3MJSA 5BQ3A 3LS2A 2I4LA 2RGEA 2YN2A 2MYPA 1Z2EA 1ABBA 2PQ6A 4W1QA 2XQJA 4EO9A 2P78A 4Q48A 4UU7A 5HQ3A 1VPDA 3MOSA 4MVJE 5HRCA 3G5MA 1XQYA 4ND8A 3KJHA 5JMOA 4DLXA 2V7EA 2UZ0A 3BL6A 4O3FA 2JLUA 4GLBA 4LOJA 2Z3VA 1N92A 2N46A 4E3WA 5JWOA 4FYXA 5CH5A 5I7HA 5D01A 3KTAA 3UN1A 1TAQA 1GM5A 3TTVA 3INGA 3N8DA 3VHLB 1K6IA 1YS4A 1KEEA 2D5LA 1LLQA 2PUCA 5DBOA 2YHIA 2D54A 2DETA 1BJRE 3WMEA 4KRGA 5KO2A 3OPYA 4KQGA 3EBPA 1JSCA 1OJLA 5IKEA 1Z7GA 1I10A 1T5BA 1KERA 2FCRA 2JHCA 2OWDA 3NUQA 5T8KA 1BVRA 1ONPA 2VNHA 4RVDA 4WW0A 3TD9A 3PTLA 2J7KA 2PD4A 3NOQA 3BZBA 5ALEA 1GP2A 4WLFA 1S7CA 1ISFA 2J8ZA 2Q9CA 2X7HA 4C1BA 5FBLB 3HR8A 3ZY6A 3ZZTA 5C7YA 5J4HA 1XVTA 2Z1NA 2CXNA 3OQIB 2XYPA 1TM2A 2NVOA 4MVJI 5CW1A 3AO0B 4GI5A 5IBPA 1N1DA 4HKTA 4HOYA 2QMUA 4CKWB 5K0NA 3THXB 1JF8A 4I6JA 3ZLUA 1PRYA 2WD8A 4B7XA 5K09A 4WERA 2VHWA 4CI9A 2H7VA 2EU8A 4IX9A 3N8KA 4R84A 1NFFA 1RZUA 1T0PA 2X58A 5HUHA 2HLHA 2UYHA 4I8IA 1O97D 1WX1A 2GZ2A 1GUAA 2UZ3A 3DAYA 4I2NA 1HQKA 1R5BA 2CBGA 4R6WA 4BMCA 1QYVA 2ACEA 5BMVA 5FTJA 3H1EA 1CQXA 1K5PA 1N6KA 2R2GA 2ZCJA 5A7FA 1M8KA 1G21B 5D1NA 4QFBA 4X8HA 2XA1A 2PMDA 2BD0A 1XNHA 3I9JA 4YMVA 4RTJA 1KP2A 3ZE0B 1L3BA 2A1UB 1C2YA 2HHHB 1L3IA 4GX1A 2X0RA 2VPWA 2C61A 3NEJA 4PPQA 3O3MB 4TL7A 4DQVA 3X1ZA 1H4SA 1IIRA 1F5SA 1TM4E 1RI1A 5KPJA 3OEEA 3Q11A 1J07A 3PRJA 3W5IA 2BELA 4J0FA 2W2PA 1LS6A 1VGQA 3D7KA 4Y6SA 4A6XA 9GPBA 2EP7A 3B82A 3OURA 1RVV1 2QYHA 3AFHA 5FBVB 5JXWA 3GFQA 1PQYA 1Y4AE 2C7BA 4WFJA 3UATA 3ZWOA 3ESYA 1O6ZA 5J5AA 2JCSA 1RLMA 2Y77A 4XTRA 3YASA 1N7IA 2QA5A 3F8WA 2YY5A 2YVLA 4I3HA 1C30B 4OLFA 5I01A 3TGWA 1YZUA 4V2IA 2GPSA 1A82A 4R9UC 5AESA 1N3BA 1XNRB 4BLVA 3ADOA 1Y6FA 4R7TA 2ON6A 2IZZA 2NAPA 4JHLA 2AUNA 3OTOB 2MMCA 2IOHA 2Q1UA 1Q1ZA 2ENUA 3PUWA 3IBYA 2YFYA 3CVJA 4PGHA 4DKXA 4MULA 2PL3A 3BIWA 3FSRA 1JMYA 1ZVJA 2G0NA 1ELOA 4HG2A 9LDTA 3LLVA 3BICA 1XPJA 3ZV6A 2W2KB 3GEPA 3DDHA 4KIWA 2J0UB 2YV1A 4II3A 1T34A 3GY0A 1THZA 4WFKA 1UZUA 4BGVA 4E5KA 2P9YA 2CBXA 4HWKA 4ZVUA 4NYMQ 4OI2A 5KTPA 4KR7A 1AZTA 1CUWA 4NS1A 4LV8B 4TXHA 3ZDRA 1J9ZA 1QH8B 3GZNA 4M1YA 4YALA 1QSGA 1RJGA 1IHUA 2PX3A 3DMFA 2KQUA 3WLFA 3WNCA 2H4WA 2II6A 4DNPA 1F1BA 5CT4A 1NSFA 4I5DA 2QJRA 3OAAA 4FCCA 5EKTA 1F2DA 2ZW9A 4MRNA 5DT2A 2QRUA 1KEPA 5GJWC 3QELA 2Z2XA 3UC5A 3ZNNA 4EGAA 3AEKB 4EF4A 1CF4A 3ASVA 2Q3EA 4ZZ2A 6LDHA 4GU5A 5A03A 2WKPA 1HURA 4I5GA 4LWQA 5BWLA 3QEAZ 1Y5NA 5HOEA 2ONKA 2XTAA 1QIEA 4DAOA 1HO3A 3LPDA 3HVIA 1JQKA 4G5OA 1C9JA 3THYA 1GGNA 3JQCA 4TLEA 1PWEA 4JC4A 1R00A 1YR2A 2QUIA 4UC0A 4LF6B 1OXMA 2P9BA 1ISRA 1OWNA 1V37A 1J42A 1UFVA 2F59A 3N5CA 2WQ7A 2DUUA 3L7CA 1A76A 4NBWA 3TOSA 4OJTA 4ZJYA 2OAEA 2EKDA 1NNUA 4Q82A 4PANA 4BNDA 2OCLA 2Q5QA 2EW8A 1PJAA 2V7WA 5KNDH 4ER7A 1FYVA 2AYXA 1ISGA 2OHFA 3BWMA 3IR6A 4M0MA 5T64A 4E1AA 1X1BA 3TMKA 4ZMRA 4WZAA 3ZBPA 4ZK6A 4PIVA 3BMNB 2SECE 4I81A 2GN8A 1KNXA 1UK9A 2W70A 2CEAA 3B36A 4D9BA 1YR3A 1TW3A 1G5HA 1QQ5A 1XLUA 4LJLA 2FJPA 1Z2PX 1NASA 1SZJG 1BMFD 2FW6A 1RWKA 3C7KA 3SEQA 3DMPA 4PFJA 3T1QA 3TLJA 5D8DA 3AUUA 3BKXA 2KYRA 2OV2A 3NWBA 1KK2A 5DZSA 4PFSA 4AYTA 4ZU6X 3ZLVA 1BC5A 2CK3D 1CUVA 2VYCA 2W2MA 4ZDKA 3DVQX 4IEIA 4AAYA 3BSSA 4N3BA 3QLTA 1OZFA 2BHNA 2IFTA 2WT8A 5D87A 3DTVA 4EW6A 2Q6LA 3AR4A 2ZI9A 2B1QA 3PNQA 3FB4A 3QU7A 4G0ZA 3VR2A 4CZ2A 1IN7A 2ZVDA 4AG3A 2IHVA 3AERA 4OJQA 3KSAC 1ZH6A 5LD2B 3GT4A 3INRA 4CMCA 1AKWA 2R6ZA 3W78A 5GJBA 4L4YA 4Q7JB 3BYZA 3R9XB 5JY1A 4CV0A 1EUCB 2N42A 5FEMA 2I4MA 3NU1A 3ZHZA 2O5RA 4NATA 5A1JA 8GPBA 3PQ5A 4UHFA 1MA3A 3OECA 4Q6WA 3ZHXA 4TS9A 1KOFA 4MV4A 3R3JA 4D81A 5LXTA 2C96A 2H7XA 2ZB8A 4C07A 1JFSA 3RRYA 3RRJA 4Q3LA 4Y1GA 3AKDA 3DZBA 1U9JA 1C3LA 1LC0A 1NF9A 3UO8B 1N5RA 1NRXA 2XMDA 2CMKA 3B6KA 1GOTA 1DBWA 2H2AA 3CLTD 2E9SA 1NUAA 3GJ6A 3K5PA 4MV3A 4RK4A 5E6UA 4ERXA 5EIXA 1PR1A 1LZLA 3WDMA 3EYAA 4P5EA 2K5UA 4MCJA 2WAYA 4NBKA 2F8LA 1F38A 5TB5A 4LZPA 1CW2B 2YW9A 3LLUA 1YS2X 3O4RA 4KI7A 4IUBS 4E21A 5KIAA 3TF5A 3WQQA 3IRVA 2VQ3A 1Q50A 3HPQA 5AR1A 3K73O 2W7TA 5FRDA 3Q0TA 4LV5B 3R09A 1CERA 4P3YA 2KI5A 5B64A 2VS1A 2O7NA 2ZRKA 2PQMA 1BCRB 4ARSA 5JTTA 2P6RA 5T7BA 4IDGA 2ZBGA 1ST3A 2QRJA 3Q3JB 5MN4A 3K0KA 3MIIA 3QJGA 4J9UE 5DNUA 3ZE1B 1DC5A 2FVYA 4GL4A 2BTQB 4NI5A 3E3LA 1JQEA 1OAAA 2XVAA 3TI9A 4QJ3A 1KJZA 4PAMA 1E0JA 3N8IA 4PZYA 5E3JA 1DKLA 3OP4A 1AVTA 1BEUB 1RR6A 2A9JA 2G88A 2NUPA 2VYND 3ID6C 4MR7B 2VATA 2GSWA 5DRTA 4A82A 2FSHA 1X1QA 3EVEA 2DULA 4R3NA 4JROA 4BMYA 3NATA 4UVGA 4WXYB 4OFXA 3GNLA 1G8PA 1ZUIA 1F8FA 4FSXA 4G09A 2AZTA 4YRPA 1GTZA 3DB1A 2AL7A 3PHIA 2BT4A 3LY7A 3LC1O 5JSKA 3VOSA 3ZS8A 4JLUA 2FETA 3W5HA 1FFBA 4IMJB 1HG0A 1ZHFA 3GA7A 2VQ6A 4QGFA 3DV0B 3R20A 5BW8A 3EZGA 2COEA 2VDUE 4FW9A 1TECE 4B40A 4EVRA 4KG7A 1Z4LA 2XLBA 3TIXB 1VJRA 2IF2A 3WRYC 1MORA 4BPRA 3RIEA 4B71A 2W90A 2Q9UA 3D3JA 3DMGA 4AF7A 2H07A 5F73A 2YY7A 3L0BA 4MRSA 4RYDA 4F7DA 2IYEA 4AF8A 5I8PA 2P79A 4DLPA 1XNQB 4FOSA 4ATNA 2YJ6A 3E70C 4J0HA 3JR7A 4DCPA 3COYA 1VJDA 3G5AA 1G19A 3OM8A 4HAVA 5CT8A 1S02A 1ZNYA 5LJLA 3ISJA 3W3AA 3IO5A 4YRFA 5LMNB 4BVAA 1AK2A 1LDGA 1RRFA 1ZS9A 3JRXA 3LPMA 4J7UA 1QVRA 4LZOA 4REMA 1GAWA 4W8OA 4YDHB 5EPUA 1P3Y1 2ZI4A 3LQ2A 3QBTA 4RVOA 3OLWA 4KMRA 5AJUA 1KS2A 1MW8X 1X80B 1MJGA 5FFMA 4J07A 5JSYA 1KFJB 4OYHA 5JDIC 1Y5IA 5JCJD 2JBAB 2JLZA 3GI1A 1COWA 4GMHA 4PHCA 2FEPA 3ILHA 4OUDA 2JK0A 4PX3A 1GHTA 2N9UA 4PG4A 1BOOA 2X2OA 4UW9A 5EMJA 2ANCA 1C1DB 2GEVA 3SFVA 4UBNA 3AQIA 4WNIA 1M0WA 3IKVA 3RADC 4ZZ3A 1MBZA 1KEVA 2O0LA 4QD3A 3OO0A 3AVPA 3P27A 3PICA 3Q1KA 4JFRA 1EXVA 2X7XA 3A1WA 3DJYA 3LAWA 3NDIA 3W77A 2YJNA 5CURA 1OGYA 5CHEA 4V0ME 5B5SA 1HTTA 2HNAA 1G21E 4O2LA 3F1KA 4C4OA 4DJAA 4BXOB 3OTQA 2L69A 1JR6A 4U7HA 4YP0A 3FYTA 4HNUA 3QBDA 4TKLA 3TAHA 1H8ED 1PSWA 3BMCA 3HH8A 4ZIRA 5ALPA 3PB3A 2NU6B 3T5GA 2WWWA 3SNKA 3WRVA 2YS7A 3CUTA 4H6XA 1TU4A 4L57A 5E3IA 3UPDA 4LSWA 3A4MA 3B1VA 3DE1X 3LVBA 3WLAA 3E9MA 4XSHA 2B7LA 2EQ5A 3OZGA 1ATZA 2ONYA 2HF9A 1RRCA 4LRWA 4LKOA 3IJEB 3BBPA 4KIJA 1WAMA 2Q46A 4OK5A 1UZNA 2PWZA 4I55B 4RJTA 2YWGA 3LCVB 3QU2A 4OJMX 1BMQA 3IAUA 3KLPX 3NH9A 5DH9A 4QLOA 2OE2A 5DGCA 2QX7A 3MN1A 2JJ2A 4GM4A 3IHWA 4HSEA 4PYQA 3PWZA 4ZAFA 2XT9A 3U1BA 1G3UA 4POOA 2FPXA 2GD2A 3LD9A 2DP4E 13PKA 2J45A 3B89A 3K9GA 5KOHA 3D0KA 2FPIA 4N1AA 2EX0A 2Y1DA 3R5KA 2F90A 2FU5C 4I55F 4UHHA 1XZCA 4F96A 4FNMA 4MZDA 2IYFA 5B4TA 4DKJA 4XGNA 2ZBPA 4GSLA 2GA9A 3KV3O 2O20A 2BKAA 1ZRNA 1SXJA 1QHEA 1UZAA 4MS4B 5EVCA 5TGDA 1B2RA 1YRWA 4J4HA 1E2BA 4UNNA 1NT4A 3TXYA 1SVOA 3VKHA 2XDWA 4ZOAA 2K6GA 4D4JA 3PXDA 1NUUA 4XLZA 2LP4Y 5BVGB 2X77A 3O8QB 3KQVA 1SK8A 1FX0B 4EOGA 4WCFA 3SLKA 4YA6A 4TM7A 1V3UA 5AKIA 3EF3A 3PQ7A 2MSNA 2H5LA 4CMKA 3VQTA 1GKUB 2BM1A 3MXTA 3PIRA 1ZIYA 3QSGA 3RVSA 3K8YA 1KRWA 2F1KA 3U3JA 2Q5JA 2G72A 4IIFA 5IP5A 5JD6A 3DLCA 4CM9A 2BFMA 3V2IA 4EMSA 4BATA 2Q6KA 1J1IA 1UDRA 2JIQA 3F46A 3JQEA 1JEAA 1I7PA 4OQ4A 5BN5A 1WCYA 2P2NA 2VUHB 5L6MB 1D5CA 1PT6A 2NNLD 3B6MA 4AJIA 4UCXA 1NF3A 5AK4A 5CA1A 1XLTA 2D1QA 4AC9A 4EW2A 2XXAB 3R77A 3GFGA 3A6FA 4FLMA 4BNJA 4DWVA 2CT8A 3DT8A 3RNLA 4JT4A 1AGYA 2PMKA 1JIIA 1FYDA 2CXPA 2AOVA 1EQUA 2FR0A 3DBLB 5IVPA 3CB2A 2FHSA 1BX1A 4G07A 4IAOA 3JVIA 3DWEX 1A5SB 3OJXA 4EZEA 4ZYLA 2DQ4A 5TY0A 1BGXT 3JD4A 3FN4A 2WWVD 3HB4X 4QIHA 2WSSD 4OQYA 4BB6A 3T5PA 3RTAA 2XKJE 4NFSA 1KE1A 5MF6A 2CXSA 4Q18A 1VLHA 5AVJA 1MQSA 4G8BA 1ID1A 2YNMD 3HV0A 4RCZA 1GG8A 2A3RA 2HGZA 3PYLA 4MVJP 4BZQA 1MZPA 4FLEA 3FROA 4NZYA 1A2QA 4F5YA 1N9KA 5K6RA 4ZCPA 2AR7A 3ZCUA 3QM1A 2GCGA 1G5IA 2DHRA 5HMMA 2X14A 5GM2A 3IR7A 3QSYA 2MYUA 5KNBH 4TPKA 3U1TA 3F6RA 1T10A 1ZD8A 3DVRX 3FPSA 2X8WA 5I9SA 2O4UX 3H65A 4K6MA 2WT9A 4Y9DA 4BAZA 4IWXA 2NO6A 3VGPA 4V38A 2L17A 3GCGA 3ZBUA 5A4IS 2XTMA 3MLAA 4MB2A 4U5XA 2XCIA 5FBRB 4N4AA 1IQRA 3SYKA 1NATA 3AEQA 3ZHQA 4BUZA 5LP1A 1ZIXA 1ZM4A 3GV0A 1AC5A 5EWMB 2Z5LA 3FNFA 3SJCA 2FSSA 1EXDA 4FMPA 2PRSA 3PHLA 5ALQA 2IKSA 4EQZA 3C39A 5KDDA 3BQMB 4KCGA 1FDUA 1N25A 4JELA 3JQRA 3JYOA 4TT3D 5FHQA 4ZVSA 4XVCA 4MXDA 1F17A 2ZAMA 4EUEA 1I32A 4OATA 1H2HA 2I1WA 5CVDA 2XJ9A 2GS9A 3RS4A 3IAS1 3JQ8A 4BLPA 4GI2A 4CL2A 4KAXA 1ZMOA 2GBFA 1QGAA 3ORRA 1BDHA 5LMZA 1O94C 1QJCA 1BFDA 1QVZA 2F8SA 2O14A 3JASA 4HB0A 3HC7A 1J0AA 4GOJA 3SHVA 1T5IA 5AK0A 2JIPA 3IDZA 4UU1A 1CPYA 4FQ5A 1U8EA 2R2AA 2ZIEA 3LHFA 4UNQA 5AW5A 5DYGA 2QP4A 1EK1A 1RIIA 3UPUA 1NP6A 4LRQA 4J6EA 1GV0A 3D7LA 2ZWMA 1QOZA 4N65A 4FD3A 4JJ7A 1P1JA 3VU0A 5REQB 3E22A 4M9ZA 1AHIA 3HI6A 2LPMA 1YHNA 1DADA 3H0EA 2HWYA 4H7JA 4G01B 4YHBA 5G3YA 1FU8A 3WP1B 2FLVA 2JCBA 3LDAA 1F1JA 1YTLA 4W8GA 2JANA 3ROMA 4YONB 3PVCA 3ZHRA 1JLKA 5E95A 3V9AA 2QL9A 1ULUA 4GGMX 3WO0A 5B55A 4OXNA 4Q66C 4JLDA 4DIUA 4I4CA 3BB1A 4Q7KA 4R2JA 4WLOA 2HA3A 2HB6A 4NYJQ 4YN3A 5DNVA 5H9VA 3SZRA 1QQ6A 1QFMA 2ZYRA 1NDUA 1NU8A 4BASA 3FETA 1LX7A 5A0VA 1ORTA 3E3AA 3TQCA 1GDTA 1QE0A 1VHLA 2M6RA 2X5XA 2VJYA 1T0JB 4J16A 5SYMA 3C85A 1I36A 3UAOA 4B0OA 2YWXA 3FPCA 1OCEA 1T4GA 1P91A 3MS4A 1IDOA 2AJBA 4RVHA 2SNIE 5K0JA 4QTZA 3QMMA 4YCMA 3RSSA 4N76A 3VR4A 1TCAA 3R7BA 1OIVA 1HSOA 2I71A 2PNFA 2X0NA 3LF1A 4P7JA 2NO5A 3C3JA 2CBZA 5C5IA 5JY6A 2PL1A 4Z9YA 3VO1A 3B5EA 4PAOA 3IV6A 1NYRA 3QRWA 2EP5A 1C3VA 4FK8A 1UM9A 2WMYA 5EZ6B 4G1VA 4ZICA 3O95A 3WLRA 1UK8A 5CFNA 1L4UA 3A1VA 5K01A 2TMYA 3ZWKA 1DJPA 3HP4A 3L4JA 4MR8B 5FWXA 3K71B 1FXWF 1SRRA 3D8RA 4NAUA 4UNPA 1P18A 2EYUA 2PDAA 3LK7A 3RJTA 3WLSA 4B83A 3NP7A 3GH3A 3ZDYB 4DA7A 4ZVRA 2PL5A 3MCUA 3VFDA 1WEHA 5F2KA 5AUQA 4NXMB 4P0PB 1AKMA 4ZAWA 4WY2A 5I47A 2PN1A 1ZNQO 4JP2A 5GV8A 1M8PA 2ZJ2A 1E9CA 1IOVA 1HBJA 3FI0A 4OO3A 5FNVA 1VIAA 1UXOA 3AVWA 2Z5VA 1UK7A 1J06A 2QAGC 4RE5A 5A62A 1W2GA 2Z57A 2P90A 2D3TA 2QTLA 3KXIA 5JHGB 1TF7A 3A10A 1F60A 2XYVA 4L28A 4UE3S 4LOAA 1UMCB 3EZ7A 4JGGA 2PRKA 2OYSA 1LSOA 3TR6A 1XEFA 3QX3A 4CRWB 3Q7RA 5ICFA 2ZBVA 2HQBA 2AXPA 2BFBA 2PMBA 3RSQA 4DVJA 2W11A 1P7CA 3DDUA 4N47A 4BKQA 2XUGA 3KR9A 5AMXA 1FYWA 2EBWA 3LK6A 4RL6A 1SIOA 1UADA 4R7ZA 3NTVA 4BNIA 4UJ5A 3M3PA 1ACJA 5HKOA 1JHQA 5ALFA 1DG1G 1QGUB 4MGYR 1YZNA 3CG4A 4LSGA 2IHKA 1BHO1 4M0DA 4HK4A 3AHIA 3GW8A 2ERXA 4AMZA 1U2GC 2YC2C 2WWHA 5TMEA 2C2WA 4YCJA 5HVNA 4FD2A 4TKVB 3V34A 3OQHA 5A71A 4UBLA 2Q5EA 1DU4A 2NPIA 5EZYA 4Y2UA 2ZANA 1O6GA 3M4ZA 3FPBA 2CWWA 4CF7A 3PEEA 3C6XA 5AICA 3AYXB 5AW2A 3BGDA 3ETGA 1F6WA 1LBIA 3LQYA 4KTVE 3JQAD 2ZDQA 4AL4A 2BFCA 4P4GA 1AQJA 3H17A 3ZV4A 3FWYA 1N5JA 3P0FA 3TRJA 4HC4A 1G4HA 4TXNA 3L8GA 1TAHA 5H82A 5ADHA 4YLGA 3C7CB 4ZKDA 5HMLA 4NJMB 3TEMA 1NBOA 4Z9BA 2ZFUA 3FZNA 4HS9A 3PGVA 1HFWA 3NTLA 2HOQA 5DCLA 4Z4EA 2BEUB 2HJRA 4CKEB 1O0BA 2JFQA 4EBBA 2VRNA 5I5EA 3GMTA 1N6LA 1QRRA 2ZM6B 1V11A 2HDHA 4WA7A 4Y1EA 1F6BA 3M9LA 5L3QA 2YJTD 3GGGA 1U8XX 3QQPA 2OCDA 4HLCA 3IL2A 3E7WA 1Q11A 4Y2GA 4IJMA 1BQ4A 1JHAA 3EHEA 3U62A 3VDMA 4D9CA 5AM2A 4KXFB 4NWIA 3S1SA 2OBLA 2QLFA 1KQGA 3AGPA 2HXGA 1DXYA 2FUG1 2JCVA 3HRKA 4KXMA 4YR9A 5KHOC 2J0QA 1MX5A 1OROA 3FUCA 1JG2A 2O07A 1EEXB 3GT0A 3QKSB 1OLSB 3KT3A 2YYSA 3AW9A 3MSCA 5F9MA 1ND6A 1HRDA 2FEAA 2JGEA 1QDUA 4BTVA 1A4UA 1SNYA 2ZWIA 1XNGA 5ITZB 3LQQA 1DAKA 4EYKA 1JYEA 2EFDB 1PQUA 1Q91A 1LRLA 2ODQA 4QLAA 4RSMA 4F60A 2C9ZA 5BYKA 3CG0A 2Y05A 1ULTA 4XJTA 3W8RA 3E0QA 4R2IA 1CUEA 1RI2A 4BE9A 4NESA 3WJ7A 5TVGA 2YYZA 4FWIB 4RD2A 1WXGA 3SQXA 1QIHA 1W4CA 3CNHA 5JFOA 1PP4A 1Z22A 1Z16A 4YO7A 5KWIA 3HBNA 3GXOA 3LF2A 1FNMA 4X1IB 2IBTA 4GGPA 4HAOA 5UKDA 1ZIDA 1IJBA 1WHTA 1SR8A 1G0OA 4GXTA 2V1XA 2FCAA 3NJ4A 4R1OA 2M98A 2XE4A 1JAXA 5LYYA 4GZLA 5B6JA 5LQNA 2YASA 3UWMA 4JMLA 3PQFA 3MZ0A 4Y18A 1QPZA 2PT7A 1RLUA 3SHWA 4HGYA 2RC6A 3BF8A 2JDID 1FQJA 1O97C 4I46A 1SCJA 3WLHA 4JJ4A 4IRUB 2NQ2C 1C0PA 1YXMA 2WP8J 4ZQCB 1BNCA 4LJ7A 3H2BA 4B6GA 2IW3A 4MDFA 1WXFA 1W6RA 4B3FX 2VHJA 4WXHA 5G53C 2BW0A 3Q8LA 3REQB 1Q0RA 2QPOA 1WKVA 3OQPA 2BCJQ 3L6EA 3RRXA 3WBJA 4AY4A 5K45A 3N59A 2O7QA 5DV9A 3LY5A 1Z26A 5IVHA 3OZSA 1U3FA 2QTVA 2B36A 4HFNA 5JV5A 3OZXA 3QHQA 5B1SA 4FFMA 2DPGA 1IHPA 3ASUA 3HA5A 3CCBA 2EW1A 4LSZA 5TGZA 4MUKA 4IIDA 1XJWA 5CMLA 3VSBA 4RLHA 1M5RA 4MK4A 1NP3A 2MSKA 3N39C 4DIBA 1H6AA 2ATIA 3GRCA 2REBA 5DHPA 3PQ4A 1I3NA 4E22A 3GGSA 1OTXA 3V4OA 3TOXA 1F12A 2BGUA 2XB8A 2IOFA 4ZU3A 4Z3DA 1QCCA 4BU0A 3BWVA 3B6ZA 1IXYA 1JNXX 2XGSA 3X1WA 1KL7A 2OR3A 1LH0A 2IPAB 4NONA 4QNNA 3BGIA 3FUUA 1RI5A 2XHEA 1OQAA 3TZLA 1XCLA 5A9SB 4R9RA 4ZCLA 3U7GA 1XUOA 1QYIA 3PWKA 2PYDA 1ODLA 5U4QA 1VHTA 3W7VA 5IHPA 3ND6A 5J58A 2Q5OA 2D13A 2XCLA 3WHPA 4RGVA 3V2UA 1G8KA 2CC2A 1Z45A 2D74A 3EEFA 3QU9A 1V8FA 3CH6A 1XMVA 5A3VA 2Y1FA 4PIMA 5JARA 3QFCA 3F5QA 2A0WA 1P2UA 2IELA 2WNSA 2JFGA 3ENWA 2QY9A 4CM1A 3EULA 1GNRA 4JOQA 3K0BA 5GZ1A 2WD7A 1B74A 5FUWA 3X3HA 3GZTB 4BOYA 3B5IA 4FIZA 2CLCX 3QVOA 1MEJA 2X3YA 4I5EA 5JEDA 1F9AA 4R83A 3CM0A 4HTFB 4IW3B 5IF9A 4B46A 1SOWA 5AOAA 2RC5A 4KYTA 4XFJA 2CNDA 1SMKA 4EKGA 4AQ7A 2W4IA 1PR2A 1J0BA 1DO8A 1UMDB 1XFAA 2ZBFA 3NDJA 4P0TA 2EDCA 3VYRB 2RKWA 1JJBA 1DX9A 5DWVA 1W2WB 1UDXA 2RGUA 1NJ8A 2WVHA 1VBFA 4TQUS 5CVTA 2G71A 1ODIA 1U4SA 2HCTA 4FDMA 2VYVA 2FQWA 4MQBA 3PNKA 1S1CA 3BF7A 3OCVA 1HE8B 3WGLA 1A8IA 4QUKA 4ZEOA 2Z9BA 5J2UB 4ENVA 2BBWA 2PGIA 1UKZA 3C2QA 1UPCA 4G5FA 3ZWXA 1FFXB 1Z35A 2R62A 2VDNB 3W3ZB 5B30A 1U1CA 4BZXA 1NDQA 2FPSA 2FG5A 2JGRA 1LY1A 4LOKA 1R3UA 1U81A 1QS0A 2B4KA 3FOFC 3TDKA 2ZM5A 2H0QA 1GL6A 4U6QA 2OM6A 2QW8A 3WLPA 3ZIAA 2D2EA 4U2GA 1FUIA 5J2UF 1V2GA 2GJ8A 2NVBA 3C7AA 4X8MA 1PT5A 2YCLA 2VZ8A 4XWGA 4ALMA 4CBVA 3RVDA 2XGMA 4BEBA 2IW1A 4CW7A 4HQLA 2PV7A 1E6WA 4MLZA 3A1TA 3JWJA 2ID8A 2I4TA 2HWKA 1T5OA 4E6EA 5FOUA 4EABA 1AQUA 4RY9A 2BCGY 1Q3KA 3QFSA 3K1AB 2FX3A 4LECA 2Q3FA 4WK0B 1SQ5A 4Y1RB 2FUNB 3QVJA 2OAQ1 3SJBA 3UWSA 1LW7A 3W2GA 1SCAA 3EIWA 3ODPA 4LVUA 1R5OA 1B7GO 1UC4B 2AQ8A 1RBMA 3CLUD 4QICA 3U7QB 1SHZA 2DTXA 2V9PA 3UJHA 2FQXA 3LXXA 5IULC 3UT0A 1C1XB 3C5EA 5GOTA 1U7UA 1Z2DA 5DM70 4HQ6A 3AG5A 3TNLA 3U9LA 3RHZA 1GPJA 2P2DA 3FPEA 1ZJWA 1KZ9A 1H2WA 2Q1XA 3FLAA 5IZ4A 3KD2A 2QYSA 2O8BA 3O03A 3GOHA 4KW7A 2HQRA 2PT9A 2VH2A 3PEYA 1XQWA 4ZOLA 2YS6A 4XQ9A 2BMJA 5JIBA 3CNQS 3O73A 1TF2A 1E3SA 4B3IA 4KGXA 5EL0A 1DQNA 1JKJA 1B4DA 3M1IA 4MTLA 4CMJA 2CJPA 5LWQA 5LQCA 2ZS8A 4IXTA 3FCCA 3LRPA 3IAHA 1CUFA 3PJEA 4HLDA 4W7HA 1ZI6A 3THSA 4CE6A 2QVZX 4QQRA 4CQLB 3IKLA 1Z4NA 2RMKA 3Q3GE 2FZVA 4M4SA 3IOBA 1Y1KE 3V6MA 2VQFB 1ZO8A 2VPQA 4ZYZA 3LCRA 3QLJA 4XE5A 3SSNA 4E46A 1XQ9A 4OXRA 1LQ2A 3RT7A 4KLRA 3WKEA 3QEKA 4I1SA 5CDGA 4U6SA 1II0A 1XZLA 1OFHA 2M6SA 3F9RA 5TRTA 1VG0B 4BUJA 3ILYA 2H54A 1E6KA 4YWHA 5GIOE 1FLNA 1H2XA 4UXIA 4RD1A 5ERXA 5TQJA 3TBHA 3OX2A 2GK4A 1UC9A 3EUFA 1JIJA 1Z8HA 3E23A 3EMKA 5FOTA 1YA4A 3U48A 3E9RA 5E38A 1XCJA 3A3YA 2ZYAA 3TDMA 5CRIA 5TEVA 3S1AB 4H27A 3P9XA 1VI5A 4B85A 3O7WA 3DDSA 1NV9A 2AN3A 3FDFA 1U2SA 4FDAA 4CFYA 3ICEA 1EP9A 2Y1XA 2YQ5A 1PJTA 3Q15C 2PL9A 1QPGA 3N3BC 1SVWA 3C1AA 4QARA 1PS9A 3Q8KA 1MKYA 2AI3A 1TRHA 1YR1A 2FW9A 1ORRA 3DLAA 1P6UA 5CTAA 1VHJA 5AVYA 2APJA 2IDMA 4EAQA 4Y67A 2QIPA 3KOZA 4NH4A 1NMZA 5KQPA 2HTEA 3DHVA 1RYMA 4KKVA 3AF1A 3VZCA 3QVMA 3CU5A 1S6YA 3LY9A 2JARA 4RANA 3BOSA 4DLNA 3KYJB 2FOIA 3AU8A 3EN0A 3FDZB 3ABSB 5KX5A 3R0IA 2NXCA 3ROEA 5CLFA 1JEJA 4C5BA 3WB1A 5B7NA 1B93A 1YK1A 3I4LA 2FMHA 1E3EA 1B26A 1OXVA 4G0XA 4A91A 3OU6A 1H9CA 4MUXA 3TW0A 2RKBA 1M2OA 4UM9D 1LA2A 4P31A 4ALNA 3GVIA 1W5BA 4UD6A 4CM4A 3I09A 1D0VA 4CLXA 1ILEA 1Z4MA 2OD9A 2XIJA 3GLUA 5LP6B 5DCUA 3KQTA 1K97A 1ISIA