2FU5C

Structure of rab8 in complex with mss4
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
176
structure length
146
Chain Sequence
KTYDYLFKLLLIGDSGVTFISTIGIDFKIRTIELDGKRIKLQIWDTTTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKVNDKRQVSKERGEKLALDYGIKFMETSAINVENAFFTLARDIKAKMDKNWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nucleotide exchange via local protein unfolding-structure of Rab8 in complex with MSS4
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Guanine nucleotide exchange factor MSS4
total genus 45
structure length 146
sequence length 176
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2fu5C00
1E0JA 1ZM9A 4AYWA 3BRWD 4P0TA 4AK9A 2DY1A 2FPMA 1Y63A 4QC2A 1JJ7A 3BE4A 4WIAA 2VHTA 2ERXA 2WAYA 2BCJQ 3BWDD 1XTKA 1D2MA 5IF9A 1Z83A 3Q5EA 4Q7JB 5CJ2A 4L9SA 3SS8A 2ORVA 2IYQA 3ZVNA 3OEHA 1HA3A 4PAQA 2WOJA 2XJ4A 1OE0A 4MH0R 2ZEJA 3MD0A 3LAWA 4IFBA 1CBUA 3B9PA 1U8AA 4QNRA 2AKYA 1SKQA 4QJ3A 3VHXA 3LBIA 3IILA 2BCGY 4GP6A 4Y0AA 1GRRA 4A4DA 4QHSA 1M7HA 3IO5A 3AUYA 3NH9A 621PA 3SN6A 3TE6A 3EW9A 2PJRA 4EAQA 2GETA 4Z51A 1NMYA 3DEFA 2B7CA 2BDTA 2VLIA 4GOXA 3HP1A 4JLMA 4Q7MB 3SJCA 3TKLA 3UG7A 1NVWQ 4NE2A 4H9GA 3VR5A 3QKTA 4C0HA 1KJZA 2P2LA 3CRQA 1F2UA 5LPNA 3C4JA 2FZLA 4D82A 1VIAA 4OQLA 3KKNA 3H0KA 1XPUA 3IIKA 1ZVQA 3AF4A 5EXSA 1JPJA 4W7SA 5A5GA 1CLUA 1SZPA 2H17A 4B73A 1OFUX 5F2EA 2N42A 4F4CA 4O3MA 3AM1A 4DCTA 4WZAE 1NJFA 4NCHA 4M2LA 2ZXUA 1ZNZA 2ZRBA 2ATXA 4Q4JA 5LB4A 2GILA 1OXUA 3EC1A 3GLHA 1YZTA 3TJZA 3PUXA 5DLQC 2ONJA 3Q3JB 5JWHA 4PZYA 4HUQB 3ADCA 3VU9A 4WZ6A 1W5TA 5L3SA 2ZI4A 3NEYA 3TMKA 3GLFE 5KSZA 3FPAA 3B2EA 3WY9A 2J0QA 4EJSA 3QE0A 3VKGA 2XSZA 1G3IA 3LBHA 3QBTA 4CF7A 1XD8A 3RS4A 3DDCA 4MITA 4JJKA 3PIRA 4II7A 2R65A 3TBKA 3EWSA 4CW7A 1GL9B 3AH8A 3NBXX 3QUSA 1VTKA 4PX9A 3PEVA 3ECCA 3UMSA 3THOA 2O8CA 3SQXA 3M4YA 2QAGC 3SBDA 1V43A 1NIJA 2AN9A 2ZRHA 1FUUA 3NHAA 4QRHA 2R6DA 5CM8B 3RWOA 2IYZA 4LYFA 1DG3A 4ZPXA 1EX6A 2NO7A 2OAP1 4B32A 4B6EA 2I3BA 3W3ZB 4NYJR 1GM5A 3L82B 4DWJA 1TEVA 1GNRA 2JGNA 3CF2A 1J70A 4Q00A 2ZJYA 4P33A 3R8CA 5CITA 1SXJD 4EPWA 1DS6A 5J47A 2VHQA 4PC2A 4C0LA 1GL7A 4P4UA 1G21E 1W48A 2AKAB 4FINA 1D9XA 2XNDA 3B78A 4NU0A 4BECA 2OCAA 1RE0A 1A5TA 4URWR 4A0GA 2ZU6A 3K0EA 4CT5A 2WM9B 3EZ7A 4OQXA 1E2MA 3DMDA 3DOFA 3CUEF 4Q9HA 3GD7A 1KGDA 1JBKA 1ZUHA 4FW9A 2FPKA 1R2QA 2VP2A 1WQ1R 2ZUDA 1AZTA 2IHYA 2ZS9A 3GPLA 1G19A 3KKPA 3OAAD 4MRNA 1JAIA 3W5IA 4QBGB 1X1RA 4Z1MA 1T8UA 1MRNA 2A2ZA 4Z8XA 2B21A 4HB2A 3JZAA 4KFUA 4M0LA 1SHZA 2X2EA 2JJ8A 4DEYA 1UKYA 4PQYA 1M2OB 4UXIA 3B6EA 4LI0A 5FUWA 4B2IA 3SHWA 4URYR 2A7QA 2C96A 2GK6A 1J8MF 4D4JA 4HB4A 3TQFA 2WPDD 1E3MA 1KI6B 1Z0KA 4BZPA 3AP2A 3LVRE 4BFVA 5E4FA 2QRNA 1OW3B 4DIEA 4F7WA 4B3BA 4M9ZA 4B3CA 4EFMA 4B75A 1JEDA 4LOAA 5FOSA 1GUAA 5J4YA 4LJ5A 4TTRA 4IRUB 3SE0A 1YZGA 1OF1A 2JLQA 1PLJA 1U8YA 4CEJA 2PLRA 4I1UA 4LUCA 1GAJA 4OI0A 4WW0A 2HF9A 1NY5A 2P67A 2WJGA 3QEJA 4EKDA 4J0QA 3O8CA 1SXJE 2VP4A 1CRPA 1LFDB 3QIAA 4FCVA 4PHHA 2AFHE 2J0UA 2ZI9A 1X3SA 1BMFD 2GCPA 1J7KA 1YZLA 3D7MA 4R71A 4F91B 1JXMA 3K9LA 1N5KA 3A1UA 4GFDA 2FU5C 4W5JA 2QBYA 3KUCA 4ERNA 1OHHD 3SJBA 1OIVA 1DAKA 3QI2A 1E2JA 2J7PA 2W6JA 2PLFA 5FPYA 3LW7A 4URVR 4JT2A 1QHYA 1VG1A 1R0ZA 3VNVA 3T1QA 4ASUD 4DSUA 1ZU5A 3F8TA 3SJAA 3I62A 2P3SA 5EXXA 4KYUA 1DELA 3U4QB 4D25A 1N5IA 4KODA 3K9NA 3SQWA 1XMVA 1N2CE 1XWIA 2C8VA 3GP8A 1CR0A 2EWVA 3OESA 4LHXA 4Q1FA 2IA5A 3CH4B 5A4JA 2MMCA 2EFGA 3AGQA 1R0YA 2PEYA 1P9RA 2REOA 4L9WA 3MRSA 4LBVA 4PC1A 3ZS9A 2ECKA 3E5HA 2IL1A 2FH5B 1TQ4A 5AUOB 2ATVA 1CJTC 1II8B 5B64A 3B7GA 3K0FB 4PSAA 5BQ5A 2QTVB 1HQCA 1DARA 1Z6TA 1G64A 3VTKA 4Q1CA 2DFTA 3UMFA 2GEVA 2WWYA 1KSFX 5HKKD 2R8RA 5EUMA 2QMOA 2VO1A 2A5FA 4DLVA 2EQBA 2O5VA 2IYUA 1H8HD 3IUYA 1CXZA 3ASZA 5DN6A 3RWMB 2AXNA 1P73A 2CVFA 3RS2A 4EJSB 2B8TA 2C99A 1CS4C 1E2KA 2Z83A 1OIWA 4KLZA 5HCNA 4TTPA 4JYCA 4A1FA 5L3SB 2NZJA 4G01B 3UATA 3QY0A 1ZUIA 4JL6A 3ZVRA 4YC7A 3JVVA 2RB4A 3TIFA 3O47A 2CL0X 1T91A 2KI5A 4ZDJA 3DKVA 2A5JA 2F1RA 4NCIA 2ZYVX 1I4TD 2IUTA 1FQKA 3SFVA 1A4RA 4HLUC 4W5HA 1NVVR 3SJZA 1E69A 2I1QA 3PJRA 4M9XA 4BRUA 2J1LA 2WSMA 1T9HA 3VX4A 1G16A 4BEJA 3GQBA 4A8JB 3CR7A 2P5TB 1U0LA 1GILA 1LF0A 2CK3A 1GRNA 3LQQA 1XMSA 2HYDA 1CF4A 1JR3D 1Q3TA 4DSNA 1I4LD 4GOJA 2MSDB 3U3MA 3A58B 3TW8B 5H68A 2GZAA 4F4IA 1CTQA 1JXOA 3GJ6A 3IKJA 4KLNA 1G4UR 4URZR 1OXXK 5DISB 3C8UA 1J2JA 2PMDA 5IK2A 5C1BA 1YZNA 3B1WA 3QKRA 1HE8B 2FFBA 3B1YA 1RC8A 4B71A 3FTQA 3L8YA 1KAOA 3K9GA 4UQOA 1AQUA 4DLSA 3CPEA 1Q21A 2OEPA 1ZIOA 1UDXA 1SVSA 1QF9A 5G3ZA 5JS7A 3AP3A 3CRRA 2ASEA 4U02A 4BPBA 1MR3F 5FBLB 4LBZA 1IN7A 2DBYA 5F9FA 1A2BA 4K81B 4DT1B 5DI3B 3EA5A 3FMIA 1GVNB 4GOKA 3U60B 4EQ6B 3RS7A 4A36A 4BQSA 1XEWY 3N2EA 4K8OA 4NCJA 4OYHA 2B7BA 1XPOA 1T4GA 2J3EA 2YJTD 4N1AA 4TSFA 1BO6A 4C30A 1XEXA 2OFXA 2X19A 4GZMA 5JFGA 1PLKA 1MABB 3I5YA 2XB4A 4Q7KA 4NONA 3E1SA 3H2YA 3CR8A 3HR7A 4PC7A 1U94A 4DIDA 2EYQA 2YVUA 3Q85A 3QF4B 1W4CA 3C41J 3QXJA 5DHAA 3NKVA 3KB2A 2H8KA 5JEEA 2Q3FA 3GJXC 3GJ3A 2IHBA 1N0WA 3V4FA 2GBLC 1OJLA 4HATA 4JLDA 2G1KA 3BS4A 4M53A 3DM5A 2P65A 1GKYA 4JBWA 3U5ZB 4AYXA 3A1WA 2NPFA 1WBDA 4B2PA 3I8SA 4LV8B 4TLDA 1II0A 1GWNA 1A7JA 4XJXA 2OCPA 4LJ6A 1HUQA 3AUXA 3AEZA 3OIYA 3WXMA 4YLGA 3QKRB 3THXB 2REXB 1WDTA 1AZSC 1XTRA 3CZQA 4Q02A 5L3QB 1ZNYA 3M0EA 2JAQA 3R9IA 2VSFA 1NVXQ 3WHKA 3P1JA 1R0WA 2YWFA 3O8DA 1UBGA 4TLEA 1JECA 4YXWA 1OFTA 4DB4A 3VQTA 1N3BA 3PEUA 4UKDA 4QJ4A 2FG5A 4JL8A 4MYCA 4BFUA 2JLZA 2Q9BA 2EFHB 4TL6A 3L8ZA 4LWZA 4UNSA 5FBQB 5B58C 1QHNA 5F3WB 4JLNA 2ZR7A 2QZ4A 5L3RA 4EPRA 1IY1A 4PO9A 3UG6A 1UAAA 3AP1A 4AG6A 2JLYA 5GVRA 1KMQA 3DL0A 4JL5A 1ZD9A 4FI3C 5EE1A 3O8RA 1R5BA 2DFKB 2VP6A 5FR2A 2CXXA 4V02A 2YWGA 4XTCS 1QHIA 5DYGA 1MV5A 4TMKA 4FWTA 3U6BA 3NBYC 1XZPA 1QVAA 1KNXA 2IXGA 2OBMA 1E9EA 3PUVA 1CJMA 2F1JA 4TMTA 4B6FA 1S9HA 4QG7A 1T8TA 1G7SA 3B1VA 2H1LA 1US8A 1ZMXA 2AWOA 1JR3A 4KVAA 3X1XA 4MDFA 1IXZA 1RRGA 4PHTA 1WBBA 3MFYA 4JLAA 1G4AE 1MT0A 1NMXA 4KI0A 5SZKB 3E70C 2WKPA 2HDNB 4XWOA 1E0KA 1P2VA 1KSGA 1AS0A 1FZQA 3I73A 1XU4A 3WP1B 1ELOA 2XTNA 4MGZR 4PFSA 4M1YA 3JVUA 4X8HA 3VR2A 4IDOA 3KTAA 4NYMR 1J99A 1E4VA 3R20A 1Z3IX 2NTYC 3KFXA 2ZI5A 3PCRB 2D7CA 4MYUA 1TMKA 5HE8A 2RGNC 2ZR0A 4D0LB 2D4HA 2XX3A 1F6BA 2HLDD 3KL4A 1ZJ6A 3K0CA 4NPHA 1DAMA 1AA9A 3GEIA 3MWYW 4ZIRA 2G6BA 1HH4A 3I72A 1TQ6A 1C9KA 3EARA 2IF2A 5FL7A 3KDSE 2QORA 3K70D 4XVUA 2DB3A 1Q1ZA 1SVLA 2GAAA 2VIIA 2GEDA 1P4SA 4JLBA 4PC3A 2DR3A 3SZRA 2ZJ2A 1CU1A 4FN5A 4JVMA 4HZUB 5JMTA 1U2RA 2QAGB 2RKOA 1ZRHA 2BOVA 4UXJA 3LY5A 2DWQA 3U7FB 3TQCA 1VDZA 3IBYA 3ND8A 1OIXA 4NCKA 4LZZA 5D3MB 1Z07A 1MKYA 1TF5A 4YMTA 2VBCA 4O25A 2QNRA 3GEEA 2WBLC 2PX0A 4EPVA 3WP0A 3HPQA 2EFDB 3P4XA 2NPIA 4Q4LA 4WA7A 2V4ZA 4A0RA 5HE9A 3QSYA 1ANKA 3NHBA 5EZ5A 3WHLA 5KPDA 4D81A 2ZS7A 1NL3A 1P9NA 3F0TA 3HWSA 3M6AA 4LY6A 3GLHE 4IEIA 2OLJA 3AKDA 1KK1A 3PR1A 4LHZA 2O8BA 3I3SR 4RD6A 5ELXA 3LQRA 3VAAA 2ONKA 2ZJZA 3IPXA 4CZ2A 4L5BA 1GITA 1VIYA 2P6NA 2BMEA 4JZKA 3PV0A 4PPFA 2WSSD 2W6JD 5JECA 4TLAA 5KNDA 4NKRA 5AR1A 4IDHA 4BGDA 3B1XA 4K46A 3KB1A 2O8DB 4IOMA 4MYHA 2ZJ5A 1ZD8A 2D2EA 3TUJC 1N6PA 4BE7B 3CF6R 3EWAA 3ZVMA 2CJWB 4JSTA 2UZ3A 4DB2A 2QSYA 4RKFA 4UNNA 1W36C 3L0OA 1CKEA 2QMHA 5HZHA 4BFXA 5KU1A 1KNQA 4Q4HB 4TN1A 2ZRAA 5FPSA 4H1UA 2NG1A 3EZ9A 2GBLA 1AN0A 5G41A 3CB4A 1YHNA 4TL7A 1C4OA 4WZBE 1Z08A 1R6BX 3C14C 1RW4A 1KDRA 1S9DA 4B48A 4LPKA 4LC1A 4N3NA 2FN4A 2QTFA 5C18A 1VYUA 4AWXA 2RGNA 2XTMA 3KXLA 3G5UA 4LK2A 5KYKA 1Q44A 2DWPA 3RRMA 3MWLA 1E2QA 1Z06A 2AD1A 1KOFA 1YZKA 3LLUA 3QJYA 1DO2A 4OBEA 2XOKA 4OHZA 1COWA 3EZ2A 2IS2A 3A4LA 1BIFA 3RHFA 1R5NA 3X1WA 1ESMA 2QG6A 4R9UC 4C0BA 1VG0B 2W58A 4HAUA 1E1QA 4JVNA 4TMZA 2FFQA 3QENA 5K8TA 3QXXA 1OLOA 2IYXA 2VYFA 3MSXA 3CW2A 4V0LA 3MUFA 1DOAA 3U61B 2C95A 1ETUA 2EFEB 4Z1MD 5HCIA 5JRZA 3RNLA 4ARZB 4YDHB 2QMUA 2Z4SA 4CGZA 2IXFA 4L4UA 2WWXA 4LHVA 3W5JA 3ADDA 2F9MA 4XOIA 3T15A 4IOJA 4JS0A 2CE2X 2FDCA 4C0JA 2OLKA 4W5WA 3GLFA 5AUNB 5IHPA 4A6PA 4UNQA 1KO4A 1UF9A 4LCBA 2JLSA 4RD3A 1ZP6A 4C2UA 4GPTA 2XNDD 2WZQA 5KTYA 1GKUB 4EIWA 1OFHA 2ZUCA 4RZXA 3U7HB 1R4AA 3Q9LA 4CRWB 2ZRKA 4FMCB 5L3VA 3S1AB 4V0MA 1SQ5A 2LCFA 1ZUNB 5K8IA 3QKSA 4TMWA 2FSFA 2IWHA 2BHRA 2IK8A 2P0EA 1TF7A 2ZE6A 2V55B 1ZAKA 1G3UA 3KTAB 1PLLA 3UK6A 3AVQA 1QBKC 2CCGA 4BZQA 1Z6YA 3LFUA 3PVSA 1IN4A 2ZRIA 2F1HA 1OH7A 2JLVA 3CM0A 3HU2A 4QM6A 4BLQA 1OT3A 2HJGA 4BUJA 1WF3A 2QM7A 2OV2A 4G3XA 1T0HB 4QM7A 3X1YA 3PEWA 3N5CA 2FFAA 5BXQC 3U6KA 3REGA 5DSZA 2JIZA 1I4DD 3B85A 2C9OA 1CJKC 4ARZA 3ADBA 3BH0A 3W6OA 1VKJA 5F9HA 3FKSD 4DLUA 2WIBA 4S2EA 4TWZA 1KDOA 1OFIA 2BBOA 4YMSA 1UBCA 4XVQA 4B34A 1E79D 2OESA 2VF7A 3QF7A 1EFUA 4QKQA 4QFMA 1RKBA 1RVDA 2KJQA 3OE7D 2AWNA 1M7GA 1X8JA 2KE5A 3CF0A 4KFSA 1CP2A 1GDDA 5DHFA 3OAAA 2W00A 2PJZA 3IDQA 3JZMA 1E9DA 2CHVA 2CE7A 1UDWA 1T0JB 1MOZA 2QY9A 2FV8A 4RSGA 4A9AA 4ZI2A 3P32A 3HU1A 1VCIA 4XWKA 1YRBA 2BMDA 3WBKA 1PJRA 2JEOA 4MA4A 3MGCA 4N0EA 4A2WA 4I99A 2PBRA 3RYTC 3GLGE 5JHGB 1X86B 2QEQA 1KKLA 3RDPA 4GMDA 2QTHA 3TGPA 4HI0E 3I92A 3LWNA 2HLDA 1D2EA 1LVGA 2QP3A 4BZXA 1SXJB 4DBLC 3GJ8A 4NYIQ 1CEEA 1IY0A 4NCNA 4WXPA 4KITB 1VYVA 721PA 3K0AA 1N5JA 2CEAA 1F3OA 3KQUA 2IYSA 2J45A 4FMCF 1KDPA 1H8ED 3MWJA 3SNHA 1JAHA 5J4HA 4A6XA 2FZ4A 3KQHA 1CR4A 3LH5A 4F4JA 2EFCB 3BORA 4MRPA 1OXSC 3WRYC 1W47A 4Q4AA 1R5OA 4IVQA 2JA1A 1DTSA 1NKTA 3UANA 1NVVQ 2N46A 4TYPA 1G8HA 1FNNA 1E2IA 2YOHA 4M4SA 3WNDA 1FQJA 3CIOA 4LV5B 1L2TA 4D4LA 2IX3A 2FX3A 4NBSA 4TL8A 2GXSA 2HUPA 2O8EB 1E2PA 4WVFA 1KK0A 1XB2A 2QROA 3TRFA 1SULA 1VG8A 3EIHA 1H8EA 4CT4B 5FH9A 1J8YF 4RZ2A 3ZGXA 2CCKA 1LY1A 1NI3A 5FTKA 2XB2A 4B3GA 4LYAA 2QSZA 1Y3AA 3DO6A 2CCJA 3NEJA 1K5GA 4GSYA 1EX7A 1AJEA 1NG9A 3FE2A 2X2FA 1UEJA 4GP7A 3SOPA 4F38A 4KV9A 3J81k 3AVYA 1G7RA 1ZNXA 4OKSA 4YMUA 1VCOA 4PXAA 2ZRGA 3AF3A 1OB2A 2CHQA 4CVNA 1XP8A 2R6AA 4EJSC 1VCNA 2G1JA 4TMVA 3SHFA 1PV4A 3LX5A 1H65A 1YU9A 3QNUA 5CYPA 4EFNA 3GLIB 4CEHB 1NVUQ 3EAQA 4IVRA 3ZIAD 3GLGA 4A0HA 1Z28A 2NO6A 5FL3A 1NKSA 1G6OA 4KAXA 3GFPA 4LJ7A 2GKSA 2HYIC 3ZDQA 2VRWA 1OYYA 2J9RA 2GRJA 1G8FA 5D3QA 1XF9A 1EXMA 3BFXA 4NTZA 2BJWA 2RGCA 2V1XA 5J5CA 5AWFC 3DZ8A 5LDDC 1W7AA 3W6NA 1Q1EA 4HLCA 3T06B 3H84A 2YOFA 4EFLA 5TXGA 1GZSA 4PZZA 1W4AA 2Z4RA 1EFRD 3FFBA 4BLTA 3WYAA 4TYQA 1IXRC 3LDAA 2CNWD 4FMBB 3AKYA 5CK5A 5KNBA 4PAMA 1N6RA 1VMAA 2OXCA 4KCGA 2EWWA 2QL6A 3WMEA 3BIFA 221PA 4U7DA 4RFVA 4GL2A 3GLIE 3EZFA 2FSIA 3K0CC 2SHKA 1ZCAA 1VG9B 3K70C 5JI3E 3PFIA 2O8BB 4TLBA 2XSZD 2FFHA 4EDHA 2LWIA 4EPYA 2VF8A 2XZLA 1MH1A 4E07A 4QGHA 1XJCA 4KXFB 4PSVA 3AVVA 1FL9A 1TQ2A 4E03A 3VR1A 3CWQA 4Q7LA 5E7IA 1FOEB 1F2UB 3RS3A 3RRZA 4YXWD 3FHTA 1OYWA 2A3RA 1JR6A 4Q4HA 2B92A 4AKEA 1B0UA 1X8LA 2PL3A 1R8QA 1S4QA 5JJLA 3Q8XB 4V0ME 4DC9A 3A36A 2A5YB 2WKRA 3AF0A 2FE4A 1S2MA 1LW7A 3ZD6A 4HZUA 2W6IA 1ZC3A 3RS5A 1NBMD 2E9SA 4QL3A 1FPMA 1KK2A 3ZIAA 2ZRCA 2YHSA 4HAYA 3PQCA 1N6IA 2GDJA 1XTSA 4A15A 2JASA 1Z6AA 2QPTA 2P5SA 2H7VA 1PVOA 1E2DA 4M1MA 2ZQ5A 4R2HA 4ACAA 1WE2A 2CLSA 4JIMA 5FPTA 1N6NA 3G82C 3RSOA 2F7SA 2QQ0A 5AK0A 2XZPA 4YMWA 5FOVA 5EE3A 4MRVA 3TSZA 2TMKA 2YWHA 2H57A 3ZQJA 2IYYA 1OXTA 4L16A 4LV6A 4LSGA 4PSKA 2G77B 1XEWX 1P5ZB 3P20A 5K8LA 5JJIA 1XEXB 1IBRA 4JJZA 1Z63A 2G0TA 3BC1A 1F60A 2C9CA 1UBEA 4MGIR 4Y0VA 1KI6A 3PXGA 1YE8A 4DUGA 5JI2E 4JSYA 4IEEA 2FOLA 4PZLA 1SKYE 1TU4A 4PO1A 4B35A 3GLFB 3TSOA 2V7QD 2Y8EA 4Q4AB 3BK7A 1JI0A 5P21A 2AHOA 4P4TA 4C2TA 1E1RA 1M74A 2C03A 2ZRNA 2VA8A 1AGRA 2ZTSA 2GJKA 1W36D 2C77A 2VP5A 3OEHD 1VCMA 2RHDA 1GNQA 1EK0A 2J0UB 2XOKD 3L0SA 3N70A 1QHGA 3EIEA 3FHOA 5JCPA 4C0SA 1NBME 3VKHA 1KY3A 3A1VA 1P6XA 1WMSA 2BJVA 2CVHA 4LJ4A 1G8GA 4DUGD 2W2TA 1PUJA 4XSGA 4NP6A 2QP4A 4A2QA 1UKVY 4YQFA 5IK2D 1W44A 4TQUS 1E9CA 3UPUA 3BB1A 1EWQA 1R7RA 2JJ2D 1QRAA 3NWJA 5TY0A 4G5OA 4IDPA 2QPOA 1TPZA 4KVGA 2AX4A 3WNBA 4BASA 3V4RA 1KYIA 1OXVA 121PA 1BOFA 1Z6GA 1YKSA 4G5QA 3W8NA 2X77A 1NLFA 1G5RA 1KIMA 5FBWB 2REBA 3M1IA 3DM9B 1UKZA 2FGJA 4MKFA 4US2R 3CZPA 3GJ0A 1EESA 3DMNA 2V1UA 1KI3A 4G5GA 5FOUA 2GEUA 3VX3A 5EE9A 2ZYTX 1E0AA 3MMPA 5FI1B 2QBYB 1P61B 3EG5A 4RVCA 3LD9A 4G0NA 3TVTA 4AC9A 1G20E 1AK2A 3OFNA 2ZSDA 1NBMA 4YDSA 4C0KA 4JBXA 3QVVA 4MUAA 1Q0UA 2NO1A 2VQSA 4URXR 1BYIA 1IM2A 2V9PA 4X8OA 2GAOA 4DKXA 2W6ID 2VL7A 2D2FA 2GWHA 2F9LA 3HU3A 3REFA 5K8UA 2IT1A 1HT1E 1L8QA 4XH9B 2OFWA 4TYYA 3SYKA 1LS6A 4LPSA 1XNJA 3Q5DA 1D6JA 1KTVA 2B6HA 2E1RA 4DEXA 1V5WA 2RMKA 3KQNA 4B33A 2PZGA 3B1ZA 5HKKA 3ICQB 3FKSA 3OIWA 2W2XA 3OIUA 4EPTA 4E09A 4TTQA 4AKIA 4TL9A 4P4SA 1HE1C 1T3HA 1XXHA 2XITA 4QGFA 1RJ9A 2JLXA 3FOZA 1W4RA 2GESA 2XAUA 2BVNA 1GSIA 3B8HA 4HEJA 2NMVA 1DADA 1BS1A 4TMXA 2BIFA 4DVGA 3U44A 5CIWA 1S8FA 4BFZA 1S96A 2NQ2C 4PQFA 2HT6A 4JLPA 1BKDR 4OQFA 2OCBA 1US8B 4LJ9A 3NBZC 4LX0A 2IWRA 2HXSA 4JT4A 2F43A 2EYUA 1VHTA 3CO5A 2YZ2A 2QI9C 1Z0JA 2V3CC 4G5SA 4TT3A 2KBEA 4BFWA 2ZETA 4XD7D 3N2IA 4B43A 2KB0A 5AUQA 3LO5A 5TARA 1XRJA 1OPXA 3RVBA 4BFYA 2UZIR 3EZ6A 3PENA 4LRWA 4O2LA 1ESNA 2BKUA 1KI7A 4C7OB 3QOFA 2OFOA 1O87A 1ZM4A 4B76A 2OUKA 4GZLA 4FIDA 5EUQB 4F92B 4TQ9A 4V0OA 5CDFA 2ZI3A 3D8BA 2WTUA 1MO3A 4US0R 1IN8A 2W83A 1RRFA 3U3OA 1DE0A 4JKYA 4BFTA 1KZ7B 1TADA 4YONB 1FX0B 2V6IA 1ZM2A 1P7CA 1UBFA 2Z6VA 4IFEA 1H8HA 3C16C 3U3KA 4OK6A 5DN6D 2WWFA 2R2AA 5FOXA 1XTJA 1HY3A 2QENA 2X8AA 1NSFA 2JDID 2FMXA 4Q1DA 1P62B 4M21A 4A8JA 1SHKA 2ZRPA 2WIAA 2JJ2A 1I2DA 1S3GA 3IIMA 2ZJBA 5JWOA 1XXHB 2OHFA 4XIGS 3FMPB 2GZHA 1HYQA 2FNAA 2GVZC 2XEXA 2WJVA 1AIPA 3O8BA 3W34A 1DAHA 2E87A 1LTQA 1N5LA 2IW3A 2QN6A 4LJAA 4C0AC 2PCJA 3OIVA 4S35A 1E9BA 4JBYA 4NMMA 2BBWA 2JLWA 2ORIA 2R6FA 1NMZA 3TAHA 1IAQA 3SU8A 1IONA 3BFKA 3TUZC 1II9A 2ODEA 1L7VC 5C46F 3PUZA 1G9XA 1XTQA 1II8A 2C78A 3ASYA 1MO6A 1TUEA 1E9AA 3BGWA 2HF8A 3IPYA 1JR3E 3Q7PA 4DCNA 4CEIA 3U3JA 5E3HA 1LF5A 2BEJA 2Q3HA 1XZQA 4M22A 3IEVA 5DYIA 3BH6A 2BBSA 2VH5R 1MO5A 3K09A 3ADKA 3CNLA 5KUTA 4JLVA 4DLZA 4KJZA 3U3RA 1L4YA 4ASUA 3FWYA 3GLIA 1SXJA 3MCAA 1S3SA 2RGXA 3UWOA 2J7PD 4V0KA 4XTRA 2P6UA 1TNDA 2FSGA 3NVAA 5BYJA 4FMDF 5FR1A 2WAXA 4FCWA 5TB5A 4D26A 3AKCA 1U0HC 3GFTA 5F98A 3VKWA 4TZ6A 1KI9A 1G7TA 5FBVB 1KY2A 3BXZA 5KSPA 3QPWA 3KQKA 2IYWA 5FPKA 3CPHA 1AM4D 3SR0A 4ILEA 2CL6X 3QF4A 4G1UC 5J40A 1NJGA 4POAA 2IYRA 1CIPA 1F5NA 1UKEA 1S1CA 1HT2E 3P4YA 4P31A 4CIDA 2CHGA 2IF0A 2FPLA 2ZE8A 4RCZA 1SVOA 1Z2AA 5EE0A 1XTIA 4WBSA 5GVSA 3GLHB 2WJIA 5FTJA 1U0JA 3AVWA 4OK5A 1GTVA 3EC2A 3EIQA 4US1R 4Q9LA 3BH7A 3ETLA 5KDDA 1KO5A 3RLFA 3RANA 3TR5A 1HURA 3CX8A 1YR9A 1ZYUA 4FD2A 3KXKA 2CMKA 3U44B 2QM8A 3CNNA 3K53A 5L3QA 1E2EA 1DAFA 2PT5A 2AK2A 3F3YA 1ZC4A 3VMFA 1XCPA 1KSHA 1E94E 1T3SA 4BLOA 3CRMA 1RYFA 1KAGA 4CEIB 2P6RA 2ZREA 4M1SA 2HT1A 1YR6A 5JHHB 3KJIA 2FGKA 2ZAOA 1U81A 2OXRA 4KFRA 4MYTA 4ZCIA 2R62A 5DIFA 2ERYA 4RZUA 3T12A 3P27A 1ZIPA 1FFHA 3NIBA 1E2NA 5JRJA 2B8WA 2OBNA 2XXAB 2EU8A 2KSQA 3Q72A 4C7OA 2GCOB 1L4UA 2C5LA 1FP6A 4Q21A 2YINC 5B30A 2HXYA 4EUNA 3E2IA 4TQAA 4U5XA 4ZDWA 4IVPA 3AB3A 2IEZA 3BB4A 3CH5A 5SZHB 3BERA 4Q1BA 1DG1G 2ZITA 4KU4A 4PQRA 3QBVA 5EP3A 2IUSA 1KHTA 1Z0FA 1YRAA 1K5DA 5HTKA 2CDNA 2CK3D 3W9YA 5BN3A 1UPTA 3WMGA 1T5LA 3BJIC 1EGAA 3RC8A 1UJ2A 4FMDB 1A82A 2WOOA 3WMFA 2GXAA 1XJQA 4QBFA 2BWJA 4W9MC 5FTMA 3QXCA 421PA 3GCGA 2ZJAA 1UFQA 5J4LA 1VHLA 1T6NA 1HEIA 1U99A 1P60A 2R6CA 3AVXA 2ZJ8A 4OI1A 4B3XA 5CB8A 4XSHA 4HAZA 5JBQA 1GL6A 3IEUA 3CRVA 3K9HA 4TLCA 2I1VB 3HPRA 2MSEB 1FNMA 2WSSA 1SKYB 3P26A 4I4LA 3TVDA 1E9FA 3ZZTA 1IXSB 1WCV1 4OI2A 1P72A 2ZE7A 2W0SA 2Z0MA 4IHQA 2O52A 3OFND 4M1OA 3LV8A 1JEEA 3THYB 2PZFA 5EZ6B 1P75A 2GHIA 5LD2B 1DPFA 2ZRMA 5EP4A 2IEYA 3T34A 2IS6A 1WRBA 5GJVC 2Q0HA 5FUVA 6Q21A 4OHXA 2GCOA 3VNUA 3H86A 2ZJOA 2GJ9A 4PPGA 1O3YA 3R7WB 4UXHA 3OHMA 4OI4A 1LNZA 4JYBA 4QXAA 2ZI7A 1P3JA 5JCZA 3LXXA 5FOTA 3C5CA 1W2GA 1DAEA 1XD9A 3ZS8A 2H92A 2WMNB 5JWRA 2BEKA 3GJ4A 3U2QA 1KO7A 1U98A 5CB6A 1JNYA 4RJLA 2DPXA 4X8MA 2MSCB 2D62A 3AV0B 1NY6A 4V03A 2ZPTX 5EE5B 5EJEA 2H16A 1ZD1A 2MMGA 4Q66C 1KK3A 1M6NA 1EFCA 3NTUA 4GT1A 4IOLA 3R9XA 1TU3A 3B82A 5FL7D 4D4MA 1X1SA 1XD2B 5TV2A 4ZDIA 2ZRFA 2I4IA 3CLVA 3T35A 4AURA 4DLYA 4TYNA 1Q12A 4NYIR 4Q03A 5JLJA 3K09C 4HUTA 1YZUA 2QAJA 1XFAA 1GIAA 2GXUA 1G3QA 2WJJA 3L2OB 4QHTA 2Q9AA 3ZZ0A 4H1VA 2OZEA 4E22A 1ZM7A 1Z8FA 4PAOA 4QGGA 2OG2A 1XX6A 5IT5A 3I4LA 4MRRA 3NBFA 2VSXA 3LA6A 3NXSA 4HB0A 3RRYA 5AJZA 1E0SA 1W46A 5E7JA 4ACBA 5FUXA 4QBHA 1CJVC 1P2SA 2NO9A 3I8XA 4GDFA 3MG9A 4OJKA 4P4SB 4MGYR 4PHGA 3ZZUA 1KJWA 4OK3A 5DH9A 1DAGA 3FMFA 4QJ5A 4M1TA 5DO9A 1AGPA 2QT1A 5KOYA 1TTTA 4Q9IA 1RFLA 4M8NE 3FFAA 5H1YA 3UMRA 3THWB 2FEMA 2LKCA 1GG2A 5JJKA 1AKYA 2C2HA 1DBSA 2ANCA 4DDVA 2RCNA 4D4KA 1IQPA 3B13B 1G6HA 2WMOB 2F43B 1AS3A 4DSOA 2ZRJA 5BYKA 3EA0A 2ZRDA 2GVDC 2WKQA 1VECA 3VU9B 4HLDA 1ONBA 1GKIA 1KZGB 2RHMA 1OSNA 3DVLA 3QQ5A 2WWWA 4D6PA 2R6GA 2QT0A 2ZRLA 2ZVPX 1VYTA 4C4PA 2WVJA 1YVDA 1W1WA 3GFOA 3KXIA 2ZSFA 2YWEA 3EPLA 3THYA 2QE7A 1FX0A 1XJ0A 4RD2A 3K70B 1RRCA 3FMOB 3PUWA 4PHFA 4MDEA 4HDQB 1TAGA 5DI3A 1GFIA 4Q9JA 1N6OA 1UEIA 2HEIA 5EP1A 1W0JA 2RGEA 2GJAA 3A6PC 2OBLA 5KSYA 1BYUA 1EFHA 2YYZA 3BAFA 3KJEA 2HCJB 3L43A 5G53C 4DJTA 3KKQA 3RABA 3DZDA 3OZXA 1E79A 5KO2A 1IJFA 2AD5A 2JCSA 1D2NA 2CBZA 4L15A 4CDGA 1QHHA 4RD0A 1KSJA 2ODWA 3KQLA 1N6HA 5J4VA 3FVQA 1XPRA 2GTPA 4HAVA 1CJUC 2QUZA 5JSZA 4ZCLA 3T1TA 2NOAA 3QG5A 4ABYA 2OAQ1 4C0QC 1G8PA 3U7GA 3AVTA 2JIZD 5CK4A 3H1TA 5KDOA 4MKIA 2F1IA 2XZOA 1QDEA 3WYFA 1K6MA 2BMJA 2DHRA 3CKLA 4KFTA 1FW6A 4DLXA 3MAAC 2JATA 4N0DA 5GADl 2YKGA 4PPNA 2GF0A 3FKQA 3RS0A 1CRQA 3BB3A 1T3LA 2J0VA 5BN5A 4HUQA 2H5EA 4R7ZA 3L0PA 3MLEA 4GRAA 5GJBA 4U00A 2ZU0C 4KBGA 3W90A 4LYHA 1SVKA 3K0AB 5L8VA 2FA9A 1XBTA 4UNRA 3LW8A 2VEDA 5G40A 1RZ3A 4KSBA 2JJ1D 4NL4H 3UIEA 4GNKA 1NN5A 4B44A 1F48A 1KDTA 2AR7A 2QMEA 3FYHA 4OHYA 2PCLA 1U9IC 4HAWA 3TK1A 2PH1A 1D8TA 2EVWX 1F2TB 1HQYE 4GMXA 3GJ7A 5C2JB 2UVQA 4LBYA 1TF2A 3KX2A 4HZIA 4B74A 3QKSB 5M04A 1GRQA 1J90A 3I5XA 8OHMA 5AJVB 4ZCMA 2Q9CA 2ZVQX 1WB9A 3AVPA 2BMFA 1DEKA 1W5SA 1ZINA 4CEJB 4MRSA 3TLXA 3IO3A 1KI4A 1Q3HA 2RGDA 1XCMA 2BM0A 4DZZA 4M9SA 3BFVA 1E1QD 3SI7A 2IS4A 4DLWA 2VP9A 1E4YA 2OCYC 1OKKA 4R2IA 2A5GA 3S1AA 3B60A 4LHYA 3A1TA 2F55A 2V6JA 4ZO4A 1OH8A 1Z0IA 1DAIA 1S0UA 4BEBA 2QA5A 3KZ1E 5C4GB 4OQNA 1E9SA 5KDLA 3WRXC 1FUKA 2AXPA 1UM8A 2ZUBA 4DT1A 4IDQA 2D3WA 2PMKA 3IIJA 1G18A 1NF3A 1DVRA 2FF7A 2XTZA 3SBEA 2ODBA 4RFSB 4JLOA 2HJVA 4PR0A 1Q57A 2J0SA 4O0MA 5E95A 2VPPA 2ZSAA 3CX6A 2JDIA 2KWIA 4RZ3A 1XXHE 2IC5A 3K1JA 2VTKA 2DWOA 1G3MA 1JJVA 1W0JD 1EWRA 5ANRB 2O8FB 1TQDA 3QEOA 2V8OA 2ZANA 2WWHA 2QP9X 1FMLA 2D06A 5GJCA 4WOPA 3UWKA 2QE7D 3B9QA 1G41A 3QPVA 4LJYA 4X8LA 3VHLB 2GK7A 1M1YE 1YR8A 1N6LA 5G3YA 3ICEA 1KO8A 2IUUA 4BLRA 2A9KA 5FFMA 4TYWA 4Q1EA 3KJGA 3F5FA 3U7EB 4FWIB 1AQYA 5AUPB 4UJ5A 3AVUA 4DDUA 2J59A 1Q20A 4LYJA 4Q18A 2BV3A 5KSOA 3R9WA 2QU8A 4KO8A 3SEAA 2ANBA 3TSWA 4YMVA 4HSEA 3HYTA 1W4BA 1NG1A 1KO1A 4L8GA 3EPHA 4MKHA 4EQ6A 3GEHA 3IQXA 4RY2A 3R7WA 2AK3A 2ORWA 2J41A 3BOSA 3KKMA 5CM9C 3X1DA 5BN4A 1TEXA 5UKDA 3QVUA 5B2ZA 4MKGA 1Z47A 1GOTA 2NO0A 4M9QA 4ZKEA 3Q7QA 3PUYA 5DE3A 2A30A 4IXNA 1JQLB 1PZNA 3EPJA 3EASA 2CJWA 1E99A 1UADA 4CYMA 3LXRA 2V7QA 1XMJA 3DOEA 3ZVLA 5JSZB 1ZCBA 1AS2A 4JLJA 4XD7A 1WA5A 4Z54A 2JLUA 5EXTA 4IJMA 3AF2A 1PUIA 2RH5A 1WXQA 1NLZA 1QHXA 3RRNA 2L0XA 2YOGA 4B3FX 1YQTA 1XCGB 1JALA 4M1WA 5GJWC 1KMHB 4MUBA 3I61A 2PEZA 3ZLJA 1G5TA 4B3DA 3IGFA 4G5RA 2Q3MA 2PT7A 2ZSBA 1W0KD 4JMPA 1KI2A 3H4MA 2GCNA 2A5DA 4DHEA 4DSTA 1U9IA 521PA 3MWKA 5DGXA 4Q5IA 1D9ZA 1VPLA 3CWZA 3B5JA 1X8KA 1E32A 2J5XA 4PC6A 3SFZA 1QHHB 2CLCX 2GJSA 4D0GA 5CYOA 4I1OA 3A8TA 2F6RA 3I1FA 1R0XA 2DFLA 3AGPA 5C4MA 4JVLA 1A2KC 3DKPA 3QKUA 2R9VA 5E7MA 4JVSB 1SVWA 5CLLA 5FI0B 4RD1A 1EFTA 5CIQA 2O0JA 2NZ8A 2G9NA 5KHOC 1KJYA 5EP2A 1QG4A 4JLKA 2ZROA 4HLQB 1G7CA 2BM1A 2NIPA 2DFNA 1BH2A 3L0IB 2WWGA 1AKEA 1R8SA 3LBNA 3X2SA 4BWYA 1G17A 3VR3A 5LD2C 4R98A 2GJ8A 3FDIA 1ODFA 1JQJC 1QZXA 3CPJB 4NYMQ 1RYHA 3D31A 2RGAA 2YV5A 2AFIE 1OHHA 3D3QA 3KJHA 1SVMA 4AI6A 2C04A 3SYNA 5LBIA 5HPYB 1BMFA 3CNOA 5D3MA 3EXAA 3HYRA 1OV4A 3TNFA 1NRJB 4HYYA 2QGZA 4ZV4A 1FTSA 4PTLA 3NDBB 4B47A 3BBPA 4DCUA 3QXSA 2OM2A 2WJHA 4D80A 2D74A 1CULC 4HAXA 2RGBA 1SXJC 4MGKR 3CONA 4LBWA 1NN1A 2IYTA 3LX8A 3V00A 2XJ9A 4D0NA 4ON9A 4Q48A 5DI9A 4GI7A 821PA 2IS1A 2BC9A 5SZIA 1RIFA 3AF1A 4RD4A 1W36B 1IHUA 1U8ZA 2ZI6A 3VR6A 3KKOA 4A2PA 2UKDA 5FUYA 4OL0A 1E96A 1IY2A 1OH5A 3RC3A 3X1ZA 3TAUA 2QRZA 4IW3B 4A92A 2Z5FA 3QXHA 4AY2A 4LJ8A 4I1SA 3WBJA 2Q21A 2ZIAA 5B57C 5IDVA 1LV7A 2FWRA 1A1VA 1ZW6A 3HR8A 4PANA 2X1VA 2VHCA 3T1OA 4OQMA 1QG2A 2VP0A 2F3RA 2WV9A 2O0HA 2YC4C 3HDTA 4XWAA 5AJXA 4AD8A 4DCVA 5DNYB 2C9YA 1OB5A 3ND9A 3AQ4A 4I1VA 2XGJA 1Q1BA 4TSFD 3A4NA 3FGNA 1IN5A 1NIPA 2J7KA 4MQBA 3ZJYA 4A8JC 2D7DA 4RFSA 3T1VA 3T61A 2W0MA 4ZDKA 1Q1QA 1TL7C 5AJWA 4Q19A 1G1MA 2VHUA 3TR0A 2GXQA 1W2HA 2G88A 2XNSA 2OSBA 3WYGA 4QOSA 3NG1A 2IXEA 3KUDA 2CL7X 2LKDA 4Q9KA 3T5GA 2OE2A 1E2HA 5FTNA 5BWMA 1IN6A 1P2UA 1U90A 4A82A 1Z0DA 1KKMA 1T5IA 1Z0AA 2Q6TA 1M8PA 4NDZA 1SVIA 1F2TA 4IXMA 3PEYA 2QQEA 4IKEA 1NP6A 1ZM3A 2FSHA 3WNCA 3NC0C 3NDPA 4EPXA 1E1RD 4NZYA 1WP9A 4DLTA 4ZIRB 2OILA 1IJEA 4HDCA 4F93B 2QAGA 2WICA 4I81A 4Q1AA 1Z22A 4XVRA 4AYTA 1E6CA 3FHCB 1JPNA 2C98A 3CX7A 1QVRA 4P3YA 2ZYUX 3UXMA 4B2LA 2NGRA 3I32A 1M7BA 3W8RA 3FB4A 2ZR9A 3BD9A 3SC3A 4BRWA 4LGMA 1E9RA 5JS8A 1EFRA 2QGNA 5EXPA 3SYLA 3TW4A 4ZI3A 1TX4B 2ZE5A 2O8FA 5H70A 1E2FA 4OJQA 4FXPA 4QBIA 2ZYWX 1ZNWA 4AKHA 3ZYCA 1NNEA 2K5UA 1GNPA 2WPDA 2AL7A 2WWIA 1E2LA 1E2GA 2DCUA 2O8CB 5SZJA 2XXAA 2J46A 1Q22A 2QPAA 2RAPA 3D6TB 4NH0A 4DRZA 1S1MA 4KBFA 5EQTA 3QG1A 1W0KA 2O0KA 4AG5A 4DDTA 1LS1A 4LC0A 1P2TA 1NN3A 3OE7A 4URUR 2ZS8A 3W3AA 3R8FA 1RPZA 1JB1A 1Z6XA 5JEDA 2HCBA 5J4KA 2O8DA 3GJ5A 2Z43A 2ZM5A 3W6PA 2IBMA 1B23P 3PITA 1Z5ZA 1G8YA 1RJ9B 1ZU4A 5CLQA 3LRPA 1XMIA 2V54A 1MO4A 3ZQ6A 5HR5A 2BKEA 3IHWA 3QPUA 3EX7C 1OH6A 3C15C 4QHYA 2GF9A 3DHWC 2CNWA 1CR2A 4Q4JB 1DO0A 2OO7A 2VSOA 4DDWA 2YC2C 4LDJA 3NC1C 1X6VA 1NLYA 1MRSA 3ZD7A 4WXRA 1G5PA 4NYJQ 1ZBDA 4HLUA 5TDHA 3A37A 3OF5A 5TVKA 3NH6A 4D2IA 2W2VA 1RRPA 3DPUA 3SDZA 4KYIB 1XEFA 1G3RA 3RAPR 4TZ0A 2EW1A 1EG7A 4C9BA 1NSTA 3KFVA 4QGAA 2J87A 4FCTA 3K0SA 2YNMA 1XD2A 1KI8A 4RKEA 2G3YA 3MJHA 4M1KA 4UNPA 5FTLA 5IRCD 4C3ZA 4TT3D 2RGGA 5H8WA 1P9WA 4ESVA 2FJUA 4HDOB 3LNCA 3CBQA 4HB3A 4DCSA 3CRW1 1Z2CA 2ZSEA 1NN0A 2IYVA 3LVQE 3C7KA 1SGWA 5A0FA 3T5DA 1N0VC 4NHOA 1E98A 2JJ1A 1YZQA 4AIIA 2ODNA 4QNMA 3V9PA 2ZAMA 1MABA 1N6KA 1FP7A 2BBTA 2CLDX 4IDNA 2N1BA 1G291 2GZDA 4V0NA 3RSLA 2HV8A 1CR1A 4OHWA 3HJNA 4PO8A 4PPQA 3VR4A 4P32A 1LB1B 3OEEA 1GP2A 1K8RA 3AKEA 4IOKA 4A0FA 3IBGA 5CJPA 4Z8YA 3THWA 3VFDA 4ESHA 2JLRA 2KBFA 5JZVA 3K0FA 4E5UA 3EPKA 1FTNA 2VHJA 4KHZA 2WJYA 5FPHA 3G0HA 1R10A 1FMJA 4KSCA 5HZKA 4DLRA 3UKDA 1COWD 1HTWA 5TMPA 3A4MA 3TUIC 2G0NA 2O8EA 1IOZA 2R44A 4RCYA 3THXA 4LHWA 1YR7A 2GNOA 2IYLD 4UJ3A 5AJYA 5FOWA 3U4QA 1W49A 1C1YA 4O2RA 4BFSA 1HV8A 2F3TA 5KNCA 1KMHA 1QHSA 4BLSA 4BLPA 1Z29A 4DXAA 3OEED 3TH5A 3IQWA 3IHLA 3K8YA 1N25A 3GMTA 3ZH9B 5KPJA 4ITRC 3ONWA 1I2MA 1N0UA 4GBMA 1KI1A 2PZEA 4Q01A 4AKGA 2WHXA 5FBRB 3PG5A 1OKKD 4Q47A 5BW8A 2OT3B 3GLGB 2A78A 2GA8A 1TUIA 4WAUA 1XDBA 3AVOA 5CDFE 2PX3A 2FEOA 4CEHA 2H18A 3LLMA 3C5HA 4OHVA 3A1SA 2DYKA 5LB2A 1D5CA 4ZKDA 1YJ5A 2G83A 1M34E 4JKIA 3MJRA
chains in the Genus database with same CATH superfamily
1ZM9A 3BPSA 4AYWA 3BRWD 4P0TA 4AK9A 3S2UA 2EIHA 4QVIA 2DY1A 1OZFA 1QP8A 1VL0A 4B4WA 2WAYA 4YRLA 5MGNA 3TLMA 2J3LA 3HNOA 3HJRA 3F1KA 1F51E 4C6TA 3PFCA 2I6SA 4G4SO 5IF9A 4WESA 2VSQA 4WXHA 4ZANA 4Q7JB 4JP8A 1A27A 1GPDG 2C92A 3OM9A 1DKOA 1YZYA 2IYQA 4PAQA 5EYPB 1QUEA 2WOJA 2XJ4A 1Y1SA 2PKEA 4J16C 1PDWA 3LAWA 3M5DA 3V4SA 5KWEA 1CBUA 3F9IA 3IVGA 4PX2A 3B9PA 1U8AA 4HCJA 3K35A 1SKQA 2WK1A 4QNRA 1JQAA 2RONA 4MQ6A 3FXAA 3TXYA 5JMTA 3AUYA 3NH9A 1JDVA 1KMCA 1T9KA 3EW9A 5TJ9A 2PO7A 5JNTA 5T4EA 3ZKAA 3DEFA 3IL2A 4U2FA 4FCCA 3WOHA 1PSZA 1Q2UA 4QYIB 1FU7A 1ESCA 4ZOLB 1LFAA 5A71A 3RRJA 3V1NA 3HVHA 4GOXA 3ZWOA 2ACKA 4Q4CA 3DW1X 3TBHA 3SJCA 1BKYA 4GMKA 5DNWA 2D5LA 4ND8A 4H9GA 4D3XA 2OD7A 3VR5A 3ESAA 4Q05A 3WZLA 1N8NA 1F2UA 1WSBA 3J7AC 1W0CA 1E3TA 2XMBA 4FZ5A 4MZDA 5FNZA 4D82A 1Z2DA 3QVSA 1FTQA 3KKNA 1SUEA 5E2BA 4RL4A 3BBLA 3VPHA 4F6RA 2XD4A 4MRMA 4YB8A 1U1CA 2H17A 4F7DA 1OFUX 2QR5A 3JALA 3DXYA 3LC0A 5F2EA 1DBPA 3AHJA 3VV3A 1I7SB 2WZDA 1SPBS 2LD4A 4B0OA 4WZAE 1NJFA 4PVCA 3T3MB 1ZNZA 2V8BA 1W59A 2GK3A 2ATXA 3H16A 3QELB 2GILA 4Q4JA 4RYDA 5LB4A 1V95A 1SUDA 1IJKA 1QFMA 1X1CA 1X1BA 4NEQA 1J8VA 3Q3JB 3HBFA 4WX2B 4HUQB 3ROQA 3ADCA 4WZ6A 1W5TA 1JNXX 3E22A 3EODA 5L3SA 4GX5A 3TMKA 1GT91 4DMCA 3F9CA 4F3CA 3FPAA 3WMXA 1S2NA 5HKBA 5KSZA 2O3UA 2WYWA 3O0DA 1Y81A 4U0JA 3N2YA 4AN1A 3F3SA 4ITVA 3SZOA 1G3IA 4JITA 3Q9NA 4NE9A 3FAZA 5DW0A 2Q5EA 3RS4A 4MITA 4ZHSA 4ZI5A 4JJKA 1B0ZA 2H85A 2WU3A 4CW7A 4BO1A 5T3YA 1WVMA 4EGAA 3WYCA 4PX9A 5H5JA 4EM6A 3WE7A 3FJYA 3PEVA 3ECCA 3MXOA 1RBZA 1M73E 4QEKA 3L4SO 3AXTA 1BDHA 2WTAA 3NHAA 2PWZA 1EP9A 3EGCA 2Y6UA 2GCGA 3BE8A 4LYFA 2C8LA 1EX6A 1YVEI 2OAP1 3AHDA 3GCXA 3W3ZB 4NYJR 4AMUA 3KPYA 1GM5A 1GNRA 3QVOA 4D57A 4CNQA 4FONA 1D04A 4EUFA 3R41A 4BDTA 5FRDA 1P3DA 3HCPA 1R0SA 3KOOA 1TKRA 1GL7A 1XLWA 2EP5A 2XUFA 2AKAB 3OUTA 4P4UA 5FQNA 1D9XA 5FXMA 2FRDC 2P27A 5B58T 1K06A 1I0IA 1MJNA 2OCAA 4BECA 3GLRA 3A9SA 5DWDA 3GWGA 2IU6A 2VAXA 1ZRMA 2ZU6A 2IYEA 1YOVB 3MVEA 1Y5IA 1Z26A 2XCRB 5JYBA 1E62A 4CIVA 3CUEF 1A7KA 1GLGA 3MRVA 2FPPA 3MMSA 4Y1FA 1GHTA 1ZISA 1MVOA 1RAAA 2P35A 1JBKA 3DB2A 4QX6A 2QE6A 4EKNB 2VP2A 3KL2A 3ABIA 4GWLA 4QJBA 2P9FA 2H2GA 5HIIA 3UJPA 1MRNA 4CIAA 3GAMA 3IOCA 3P4UA 1PEKE 2PD6A 4HB2A 2QAIA 4N49A 4RTJA 2O6LA 3GARA 2A1IA 4NS4A 4M0LA 4PRKA 1BH6A 2B1RA 3GXBA 5KTRA 4NFYA 1UKYA 3I09A 4EW1A 4BMZA 3PVZA 1T24A 4UXIA 3V4PB 2ZBEA 1XTZA 1YKGA 1Y8QA 2JAPA 4K9LA 5JG7A 5F3RA 3SHWA 3T3GA 4YAGA 3RI3A 5I45A 2GK6A 4K9OA 2WPDD 1KI6B 1NURA 6CHYA 3DLAA 1M5TA 4UHFA 1FU8A 3QBDA 5LP6C 2R8BA 4N47A 4D9NA 3I53A 1NVGA 1OLUA 2QRNA 4HQNA 2ACEA 2RAVA 1Z6QA 2OV3A 3O94A 3DDWA 1YJCA 5FOSA 3MAJA 2PQ0A 2VS1A 4JR1A 2B1JA 4LJ5A 1WDLA 4W6QA 3SE0A 3L8DA 2JLQA 4B6GA 4D4GA 3A3PA 4ESOA 3PRKE 2VNJA 1P81A 1M2EA 2PLRA 2QVCA 5T4BA 4GEKA 4L02A 2DLNA 3W8EA 2BE9A 2HDWA 3HQ4O 4J0QA 4DW8A 2XDAA 5JTTA 2VP4A 1GDTA 1E89A 4J29A 4IDBA 2VXYA 2G28A 4OJTA 1O96B 4WCFC 5TE9A 1NUSA 3DMHA 1YZLA 3ICOA 4K3VA 1PEAA 4R71A 4F91B 5I7EA 1DFGA 2WM2A 4GRIA 2D1TA 2FU5C 1G20B 4ZU6X 4OX9B 5BQXA 4B6PA 4HAIA 1OHHD 1HEYA 1UXJA 1OIVA 1EUDA 1X2BA 3QI2A 4N3AA 1H2EA 4YRCA 1RS0A 4D98A 5FV7A 4YCNA 1GYRA 4G4IA 1P39A 1ZU5A 4ARUA 3F8TA 3GN1A 3I62A 2G9QA 3PUIA 4OQPA 1UQTA 1DELA 5T4FA 3U4QB 1CUUA 1N5IA 3NHUA 3SIXA 1I2CA 2H51A 4ENUA 5CB4F 4IG4A 2B0CA 4RPGA 3S4YA 3SQWA 3QW4B 4P8RA 4DJEC 1XWIA 4KG7A 2I87A 2WD7B 2EWVA 4NK5A 3U1BA 1KZ1A 1LLQA 2IA5A 1DAPA 2OA0A 3LGAA 3VSBA 2EFGA 2I3GA 3FNBA 4P7KA 1VFPA 4CMEA 2BGUA 3AW8A 2REOA 1JIIA 4L9WA 4QUHA 4XPIB 1IEXA 4EP1A 4V1CA 3GDWA 4H4DA 3T38A 3ETDA 1FE8A 1W19A 2YJNA 1IH8A 2VTVA 5AW5A 2PGNA 5EWLA 4YNBA 2HXGA 2HMWA 4KUEA 5KCMA 1DARA 4IRMA 2VJMA 2DFTA 2O2CA 3Q15C 3ZHYA 3KPWA 3RIHA 4OOFA 1KSFX 1J4AA 3LWBA 4Q39A 1FF9A 2ZPAA 1Q7BA 3PDCA 4RC9A 4WD3A 2Z1MA 2BHNA 5EEHA 2QMOA 3O9VA 2VO1A 3LPLA 5F77A 2YFQA 1SKBA 2O5VA 2MWMA 1A95A 4JB0A 4TKVA 1WZCA 4BO5A 3J7TA 1KYQA 1KA9H 2HRBA 4KQ1A 2C9MA 3JXEA 2Z83A 3KYBA 2BF7A 2PRIA 2JHAA 2X5XA 4KBYA 4N12A 5DBFA 2QZ9A 2WU1A 4FT2A 4RE5A 5LQDA 4CDNA 3JR3A 3KHKA 4JL6A 1KMMA 5GINE 3JVDA 2BR4A 3SCZA 4JI2B 1SCBA 2XNKA 3IKVA 2JK0A 3OHPA 5C4IA 4L6IA 3CWCA 3B3FA 3GRUA 3QUTA 4AS3A 1T91A 2W9XA 4TTAA 4MCHA 4NCIA 4FFBB 5F35A 1T2DA 2IUTA 4BNUA 2H4HA 4YMHA 4HLUC 4W5HA 1NVVR 3IQDB 5KOJA 4B7AA 3HBAA 4BAGA 3L0ZA 1FXWA 2E18A 2LUOA 1FSPA 1Z5OA 5E2AA 5CW1A 4GR4A 3P0HA 4J0EA 4I5EA 4WN9A 1Q7CA 2VYCA 3GQBA 4A8JB 5LQCA 1J6UA 1HDCA 3CR7A 1U0LA 3L6BA 1LF0A 1MOPA 4FUQA 5EJ2A 1GRNA 1NUTA 3G13A 1CF4A 1Q3TA 2H11A 1QONA 1E7RA 4XXHA 1I4LD 4N3BA 5KIAA 4MW4A 2C2WA 4JOBA 4KLCA 4P5DA 4QTXA 5H68A 4H3KB 3ZV7A 3SLGA 4FBMA 4P84A 5EKTA 4F4IA 3DTVA 1CTQA 3Q9SA 2P4EA 4MR9B 2Q3DA 3FNFA 4UFPA 1M0TA 1U1FA 5DNUA 2DECA 1ZA2A 2Q3BA 2OZVA 4RXTA 4NMLA 1G21B 2BGLA 4EUSA 3ND5A 4YP6A 1C0KA 3QKRA 5C1BA 4Z4GA 1V7PC 1CUYA 2DTEA 2VPXA 1C1XB 1Q0QA 3B1YA 1RC8A 4HYEA 3CG4A 4UQOA 4D92A 3CPEA 2B4TO 1K6EA 1LU9A 3A05A 1T5BA 1KDVA 1ZIOA 3HEMA 4DF3A 1MFPA 2AOVA 1SVSA 1K5HA 1N2HA 4IQ0A 5JS7A 1SJ9A 5DEIA 2LIPA 1CVIA 3CRRA 2BHTA 4FS8A 1MR3F 3F49S 4K2AA 3DOUA 1G9TA 3RT7A 1A2BA 1Z16A 1GUZA 1XI2A 2IKQA 2JHFA 2XXJA 1YHYA 4MYRA 3EVZA 4YK7A 4ZC1A 3RRXA 3D3EA 3EA5A 4INZA 4U2DA 4ZALA 3O7WA 1WX1A 4R1OA 3Q5GA 1R15A 1XEWY 3N2EA 4K8OA 1Y6JA 3BF7A 4Y2RA 2J3EA 1H0RA 4TSFA 3WK6A 2BEWA 1H1LB 1XEXA 2OFXA 1EBFA 5L4LA 1MABB 1SUWA 1N33B 5A5EA 2BI4A 4F97A 3BXHA 2HLNA 3H2YA 3QRWA 1MDBA 2VJPA 1ULBA 2PSJA 3EH1A 1PRYA 4FOPA 3QXJA 1SQGA 1W4CA 2EKDA 2PZKA 1FUEA 2J6HA 3C41J 4XX0A 4RYLA 4B3IA 2O5CA 3KEMA 1O5IA 3HRHA 3IURA 4BNFA 1TM3E 5DNVA 4JI5B 4KLAA 4UPEA 2O3RA 1CB0A 2Z04A 1OJLA 3LUFA 4JLDA 3QQPA 3TLYA 3BS4A 4MWDA 3RQSA 2FB9A 4HL6A 5A5FA 4X66B 1UBSB 4HPJB 4NJOA 3QKWA 2V5AA 3KK0A 4JBWA 3A31A 2QZPA 1MC1A 2K7FA 1WBDA 1YHZA 2CVQA 3I8SA 5CM2Z 5BNFA 1T9GS 1GWNA 4QXRA 2OCPA 2ZJ1A 3X3HA 2GBCA 3AEZA 3GUCA 4LKRA 4MXDA 1F8YA 4X9XA 5SYMA 4YLGA 4DUYB 3DAFA 1CFJA 2EATA 4E2FA 1AZSC 1XTRA 4Q02A 2QL5A 1OZGA 3A1DA 1ZL2A 2CJFA 4PIPA 1LBIA 4P53A 2JAQA 2IU4A 2VSFA 3RHZA 1NVXQ 4U7FA 3WHKA 3QJ5A 3ROGA 3M1AA 3NNSA 5IFKA 1FLNA 1YRLA 4XM2A 3UWPA 4ALLA 2F8SA 1G60A 3PHIA 4HRVA 3TNDA 4AWBA 1OFTA 5I51A 1FDOA 2A9JA 1M6WA 5L4SA 3VQTA 3QY9A 3QE3A 2CYAA 3ANXA 4ZVTA 1BS2A 1N3BA 3PEUA 4FVTA 2FG5A 1MF7A 1PT6A 4JL8A 4UKDA 4Z9XA 3EH2A 3DFZA 4X6UA 4UNSA 3JQ6A 1KE2A 1QHNA 4B82A 3NT5A 3QZUA 4ND4A 4JLNA 1HDRA 1JXAA 1FVOA 4EPRA 2JGMA 3I1IA 3WLOA 1UAAA 4JQSA 5GVRA 2IEAA 4OXIA 3WS7A 2FLKA 2PMFA 3M82A 3INRA 4U9IS 5H4HA 3S2IA 3UB4A 4O4JA 1FDVA 5EE1A 3WQQA 4LWPA 4DLBA 1J21A 1YACA 2DULA 2HA7A 3FWZA 4PTZA 3ZWCA 3ONEA 2YWGA 4PSCA 2AIRA 2E82A 4K9RA 3T5MA 4JA2A 4ZVVA 3VJMA 4FYKA 4Y2JA 4FWTA 1W5AA 4RM2A 4ZJPA 2GYUA 2B9VA 5DNDA 1DG9A 4UFNA 1IOWA 2JBHA 1JILA 2XDQB 4TMTA 2QM0A 4AX8A 4BFLA 4EG7A 4NXNB 1IZ8A 3LIIA 1CZLA 1G7SA 1UBNA 2NNWB 2ZB7A 3B1VA 1A2QA 1RTTA 5BV0A 1CS0A 1ZMXA 1JR3A 4E30A 4MDFA 1IXZA 1YB1A 2NYRA 4XM0A 5K05A 5EYPA 2QJWA 2LBPA 1YMVA 4UHBA 1MT0A 1UXIA 4LDZA 5SZKB 4AN4A 1EM8B 4ES6A 1C4XA 5JH7B 5L6LB 2V6FA 3BCRA 1A8PA 4YRMA 1CW2B 5JCOC 1JIVA 4F06A 2HLHA 3WLTA 2X2PA 5AW1A 1AS0A 1WVGA 1NPTO 3UPDA 3IH5A 4UEOA 2VH2A 3GAAA 4HDMB 4CCWA 1EP3B 2OAGA 3A1EA 4QSMA 1HQKA 1H3FA 1Y9JA 4N9WA 4UUNA 1HYHA 1E9VA 1OI4A 4OHCA 3UH0A 1AOXA 2FPUA 1ELOA 4ZOLA 2W8BB 1P6UA 1ITZA 4PFSA 1XYYA 4UM5A 2Y92A 4EHDA 3QW2A 3F5SA 1SEPA 3WB9A 4XYEA 2D1YA 4C03A 3BL5A 3R20A 1Z3IX 4MYUA 2ESRA 2G09A 3QUAA 4UBNA 1T2NA 2RGNC 4NMXB 1OQAA 4R6WA 4D0LB 3I23A 5D85A 2Q1YA 2A8YA 2HLDD 4NFSA 1EK1A 3GEIA 2Z57A 2VXOA 2O0LA 1PFKA 4F6CA 3N59A 2G6BA 4YRGA 1CQWA 1G2OA 1N75A 3OM1A 3CZ5A 3AIOA 3EB9A 2QORA 4TXMA 2DB3A 3T41A 1T1EA 1U04A 4YCLA 3ZCSA 1Z5PA 5FWAA 3E61A 2ZT6A 4JVMA 2IOQA 1W5BA 3R5TA 4E51A 3IAM1 2HA2A 2RKOA 3ITNA 4E4YA 1YJBA 4QT4A 5A3JA 5ICEA 4PSUA 2X8JB 3GUUA 3TIIA 3VVCA 2OLEA 3W79A 1N2XA 2JJYA 4OG2A 3TQCA 3ZXYA 3ORRA 5FWYA 5FNVB 2NUAB 2ILTA 2QRHA 2QRGA 4CUKA 4G0WA 5GM2A 1GXSA 4BBJA 2G07A 3TRHA 2COUA 4NLLA 3L6UA 2QNRA 4P4GA 5HFNA 5JZSA 2WBLC 1UXGA 2EFDB 3P0FA 1EFAA 1DB3A 2HD4A 1ZK1A 1NJ8A 2V4ZA 1ANKA 1IUPA 3WHLA 4AJ1A 1N5MA 4M86A 3ICPA 3NWOA 1NL3A 3CNEA 3F0TA 3N5KA 1TB4A 2D5IA 1O94C 2SKEA 3OE5A 3NHPA 4PM4A 2PG3A 4LHZA 4MUHA 3I3SR 2POQX 1UFVA 3LQRA 3VAAA 1TXGA 1SBQA 2B30A 2CLLB 2ONKA 4KO3S 1CZOA 1RP1A 3LPNA 1X1EA 4MP3A 4JJGA 4GKKB 3BT7A 4IS2A 2Z2ZA 2OMEA 4L5BA 5LXTA 4NZPA 2P6NA 2BMEA 3GRCA 4PPFA 3AY3A 3B3QA 2BGIA 4XLZA 3SXUB 3TFWA 2WA1A 1SY7A 7ADHA 1F38A 5JECA 5KNDA 3F7NA 3QI7A 5EY5B 2EQ5A 3ABOB 2V7TA 1HC7A 1MJGA 2QRPA 3HCFA 4K46A 3D54D 3ISJA 1ZD8A 3TUJC 5FULA 1JG7A 1GARA 2Y27A 1VE5A 2Y4NA 4OFWA 4D9BA 5IT0A 3HABA 3ZVMA 1SU6A 4AJPA 1PR1A 2BFFA 1WV0A 2R7KA 1XZNA 4PO3X 4PXSA 3K8QA 4BPRA 4AKSA 7MHTA 3HM2A 2HGSA 2X6RA 2ZRAA 1MW8X 2VZ9A 4H1UA 3W8FA 3EZ9A 3ZDDA 1JS1X 4D44A 3B9BA 4HT3B 3LUAA 5AO9A 4CQLB 3CMMA 4ZGWA 2VEOA 4L8YA 3QEMB 3ROZA 1C9MA 1CCWA 1X7WB 4WZBE 1I7DA 2X3FA 3WA7A 1NMSA 5A6SB 4CPDA 1JFFA 4EF4A 2PQ2A 1M2VB 1VYUA 2RGNA 4LRXA 5BSUA 1X39A 2XTMA 3KXLA 1FVXA 2D8AA 4G81A 1TRHA 4X7PA 3T4XA 4ZTZB 4TTTS 5B6PA 4QLOA 4MEAA 4HTFB 5CXQA 1L3BA 4U7PB 1KOFA 2BM9A 3JQRA 3HI4A 4YJHB 2ZIVB 3H3FA 1DO2A 4Q3AA 2XOKA 3GFQA 1T9DA 4OHZA 3GI1A 1R5NA 2PTGA 4JIGA 1ESMA 2QG6A 2HBYA 4FE3A 4QYTA 3X1WA 1KBZA 3AEKA 5A03A 3PX2A 1S4MA 3O9ZA 1VG0B 1I8TA 3FCEA 2W58A 3H11A 1QTNA 3LQ4A 3IXLA 4HAUA 4NENA 1W34A 2HHLA 2XTAA 2ZAYA 1W4ZA 5K8TA 2I1LA 1H4SA 2ZBPA 4J0IA 1C9YA 2VYFA 5B7PA 2FSVA 4YXWD 2HK8A 2EFEB 3DQPA 1K08A 3ONNA 4ZRDA 2VQ6A 4ARZB 2QMUA 2O2ZA 4JKOA 2ATIA 4KIFA 3G2OA 2IXFA 1O6BA 3TD6A 3U3XA 3OPYB 1KDZA 2WWXA 5CW2A 4CKBA 4JAVC 2I5PO 3ADDA 2F9MA 4NPAA 1QAMA 4ENTA 3ZDAA 1BNCA 4JS0A 4CMKA 4G0PA 2CE2X 2AJLI 2R96A 5MGBA 2FDCA 2OLKA 3O2NA 4W5WA 3GYBA 4B8ZA 3W9UA 3L92A 5IHPA 4N48A 2WJPA 4UNQA 3UCEA 1RQGA 1WMFA 3IJRA 3KE9A 3U0VA 1WBJB 2JLSA 3I28A 3LBAA 3AFHA 3Q3VA 4C2UA 1HRKA 1UQRA 2XNDD 4KQGA 4C1BA 5A2GA 3ICWA 4LE2A 3U7HB 1R4AA 1WMAA 5IVPA 2QU7A 5DVZA 4L5JA 4CLDA 2WUGA 3TLEA 3S1AB 4XIJA 4B45A 2LCFA 1IXKA 2CV0A 2A9RA 3PK0A 1EFPA 4XDZA 5K8IA 2VJBA 3QKSA 4KIUA 2ZYHA 1O89A 4QGBA 4W99A 4TMWA 4DG5A 1QMGA 1VSQA 4AJLA 2CF6A 3ZH2A 5HZMA 4FPXA 1IC6A 5DPMA 3ZU5A 1L5OA 2IY8A 2QQ5A 2BHRA 2WFAA 2ZE6A 1A9PA 2V55B 4G0ZA 5SV2A 2DG2A 1ZAKA 3DUFA 3RSGA 4IF6A 4ZT2A 3A1FA 3QHAA 3W9SA 1EXVA 3NUGA 1UBJS 3KD2A 3L1VA 4X90A 1QBKC 1DKRA 2CCGA 1Z6YA 4QPJC 2HIAA 1KS9A 3VZSA 3WKDA 2J8ZA 1INLA 2CZQA 2YZMA 2ZRIA 3IALA 3DA8A 5I9IA 3FGPA 3WFZA 2UZ4A 4C4XA 3OICA 4YROA 4S1VA 1WF3A 2R86A 3QMMA 2OV2A 5BQ3A 1KEZA 3EBPA 3UO8B 1U7WA 3PEWA 3U6KA 4B9AA 3REGA 1OWMA 1I4DD 4CIBA 4CT0A 2GF2A 2XB6A 4TSKA 3ZQ4A 2H1HA 3H8VA 1ULHA 3ZX4A 4EI8A 4ARZA 4BWFB 2FP3A 2GAJA 3BH0A 1Y4ZA 3W6OA 4NECA 3ADBA 2WJ6A 3KSZO 4DLUA 4S2EA 3P9XA 2B8NA 2BBOA 4B40A 4EUKA 3DGEC 1UBCA 4BVGA 5DCLA 4EJ2A 2VF7A 1YTUA 1WOYA 3FROA 2AW3A 1SRRA 3I6MA 3TOCA 1X15A 2AWNA 4EY3A 4MW7A 1E5XA 1VGVA 4BP9A 1I0ZA 1QLJA 1Q84A 3OAAA 3SJ7A 2W00A 2ZP1A 1MAHA 4K1LA 1MOZA 4RSGA 1ZJ5A 5ED0A 3HU1A 4GF5A 1WP4A 1T9CA 4XWKA 2BMDA 1U63A 2V45A 3ERCA 1E63A 2WZCA 2WQZA 3HB1A 2R4TA 4B3MB 3R6LA 5J63A 3GMDA 3MGCA 4E94A 1WLSA 1WVIA 4KE9A 4C7XA 3GLGE 5JHGB 3E9DA 3RDPA 2QTHA 2Q6KA 1YB5A 1WD5A 3I92A 4KRFA 2QP3A 1SXJB 2GPJA 2D59A 4BCCA 2V7EA 4FZRA 2CF5A 2HWKA 3U49A 4CUJA 5JVDB 5D7BA 2K6GA 3BUSA 3WWYA 3O2QB 3KQUA 4PLVA 5THKA 2PK3A 1PZGA 1H8ED 3KOYA 4L74A 3MWJA 4FDAA 4MDYA 2Q8PA 5TX7A 3PGA1 5DNCA 4LQDA 2FZ4A 1VXOA 4IKPA 4X24A 3LH5A 1GUDA 1GXSB 4DNPA 4EA7A 2ZM6B 5LP6B 2OXIA 3WMRA 4K26A 2HMAA 3BORA 3QOYA 4Q3EA 3CISA 4I1RA 3TLGA 3AX6A 4YUWA 2XWPA 3RIMA 4B4UA 4XQCA 1EE2A 2ZT8A 3QVMA 5EIEA 1NKTA 2VDNB 3UANA 3EDRA 3ZCVA 2N46A 2XYRA 1NAHA 1V4NA 4L75A 4TYPA 1XO1A 1ARZA 1J20A 2HSWA 4YP1A 4XYLA 3ECAA 1OT5A 5J1TB 5CEJA 1RI1A 4M4SA 4E5YA 1FQJA 3EOAI 4UEJA 3BULA 5AK5A 2FFRA 3EFBA 3EPRA 4LV5B 5DK4A 4DMLA 4EBBA 1VRVA 1JVBA 4TL8A 2ASVA 5AKKA 4CKXA 2P90A 2DGDA 5C5DA 2XYPA 4WVFA 5EPEA 3JQBC 2XYGA 4K6OA 3TRFA 4QIHA 1TT5B 4LYGA 3UC9A 5FH9A 2CMHA 1J8YF 2XF2A 3FYUC 1ECGA 5DHRA 2CCKA 1NI3A 2Q1UA 3MA0A 5AHOA 2HZBA 2AT1A 3G8CA 5D00A 4HGYA 2A58A 1M72A 2PGXA 4LYAA 2BKVA 2VYVD 3H42B 3NEJA 5K9ZA 3S28A 5FWYB 1EX7A 3INYA 1KPGA 2CDRA 2X2FA 1UPFA 2P9EA 4BS9A 4HGPA 4FYPA 4LGYA 1PT8A 1ZNXA 5TS3A 3AVYA 4YMUA 1SU8A 4AJNA 5BPHA 2ZRGA 3HVJA 3OZVA 3D1VA 4HFMA 5IAGA 3UFXB 4GQIA 4NEHB 5IJWA 3SHFA 3LX5A 1M2HA 1WWKA 1J25A 4MI1A 4CKEB 1EM6A 3G85A 4D3YA 1NBIA 2GNPA 1AKVA 2EJVA 4Q93A 3ZHSA 3VM6A 3CE9A 2M2IA 1DCKA 1ZIXA 4LNUA 1Z28A 2FZEA 3U4DA 5FL3A 5JANA 3HJBA 5KYUB 3P19A 4D9IA 2C59A 3P9YA 3FI0A 3I2KA 2E7ZA 3PJGA 4FLFA 2VRWA 3ZDQA 3U09A 1JAXA 2J9RA 3I64A 3NONA 4YJGB 3IR6A 5D3QA 4CR7A 3O4VA 1XF9A 2HREA 3BFXA 4MQEB 3UK2A 1Z7WA 2V1XA 5J5CA 2O7RA 4FFRA 2ZK7A 1NVFA 1RM5A 4ZQEA 4DS3A 1PS0A 2GZMA 1F0PA 5ILGA 5DGIA 4PZUA 4I14A 4L57A 3A26A 4HLCA 1B16A 4XGRA 1ISHA 3OM0A 1ZJYA 3FTCA 3FYDA 3LKVA 3S3TA 3TN7A 3TNJA 5L7WA 1KOGA 3FFBA 1C4WA 4RK6A 3RCBA 4X71A 1IXRC 4WZBA 4AF6A 3L07A 1DT3A 2J30A 3UK7A 3AKYA 3A6KA 4PAMA 4QPDA 2PKYX 4LE1A 4P98A 4V3BA 5KNBA 3LHDA 3C8MA 4KCGA 2VYQA 1AE1A 3JVIA 3BIFA 3H8SA 1H2RS 5K01A 1Q91A 3JQAD 4WLUA 3FWNA 3ZWVA 4IQ8A 1L5MA 4PW0A 3C85A 2PMBA 3K0CC 4G9GA 4IQFA 2QZZA 1L5KA 1VG9B 2J6CA 1WPRA 4BNLA 4K87A 2O8BB 3KVYA 1E4OA 1SZDA 4OM8A 5LSAA 2P9CA 1XN1A 4EDHA 2LWIA 3QPAA 4JDUA 2I3ZA 3O8OA 4OD0A 5HK8A 4G25A 2UYHA 1NBHA 5AESA 1RM0A 4KXFB 1PK9A 3LXMA 4UCFA 1Y1KE 4C07A 4B4OA 4Q7LA 4JROA 5HGJA 4YUVA 3H65A 1UWLA 5BSHA 1Y6GA 1LPBB 3VOBA 1PVVA 1UM9B 2PRJA 4FR5A 2VJYA 4JNCA 1TQ8A 3P96A 1UPCA 4YAKA 2A3RA 2VQDA 5KNCH 2PGOA 3EVDA 4Q4HA 4UVGA 1X8LA 4MVJH 2PL3A 1ODSA 2WIKA 3DAYA 3IB6A 1FYDA 4O63O 4OXNA 4M0FA 3Q8XB 5AKEA 1E6MA 1W9MA 2IPNA 3HKBA 4O1IA 4V0ME 2WKRA 4MVJP 3D4PA 1JF8A 1SHUX 3TQTA 1Z7BA 4MR9A 4HZUA 3HXOA 1ORIA 2PR2A 1ZC3A 1RCUA 2JHCA 3LDUA 4J2HA 1JE0A 3EUWA 4F9GA 2ZRCA 1N8KA 2PAAA 1U3CA 3BJMA 2YHSA 4UHCA 1GFWA 4LA4A 4QDKA 1N6IA 1B6TA 2JASA 4TLMB 1Z6AA 3RYIB 2P5SA 2JZOA 3OC6A 3OU7A 4CM8B 1V7CA 1PNTA 4QVKA 1AY0A 4GQBA 1OGYA 2GZRA 4M1MA 3WB2A 2V7PA 3PSHA 4ACAA 3G82C 4LOHA 3RFUA 1PFWA 5IJ0A 4BUCA 2FOXA 3TRDA 3F7TA 4MR7B 5E1BA 3ZQJA 3CVWA 1UCFA 4NQRA 5K99A 4FFWA 4L16A 2BUCA 2ZBUA 4LV6A 3UUGA 5CYGA 1P5ZB 2QM3A 3W6UA 5K20A 5BOSB 1ONSA 1OGIA 3EISA 3PGJA 1IBRA 3UF0A 3QE9Y 4JJZA 2IIVA 1TRKA 4J2OA 2C88A 3V97A 4KREA 3QVXA 1F60A 2CLEB 3V6LA 3GBSA 3PYXA 3B6KA 3TTVA 1A72A 1NDUA 2LV8A 4JB2A 4LZLA 5JJ5A 3KLOA 5JTUA 3GHHA 4FGKA 5AVUA 1NYTA 3GT3A 2ADFA 4DIBA 3GLFB 3G68A 3OECA 3MINA 1KRHA 1G0OA 3QVLA 4LFAB 1QX4A 1RLJA 2O2EA 1NVTA 2BMWA 2QI9F 3AHIA 1B6GA 3C6YA 3KVVA 1CUSA 1UP4A 4LXQA 4PGAA 2CXQA 2C03A 1TDJA 5J1SB 1BXKA 3Q10A 3NKFA 2W22A 2AC4A 5BUCA 2VA8A 4NVRA 2VQEB 1BAPA 2B3DA 2Q7XA 4BJHB 3HJTA 4WY5A 1C9DB 4H7KA 1GZ7A 4FGSA 1E3WB 4CG2A 2GFHA 1P17A 3F8WA 3SYTA 4BGIA 4NIMA 4MUFA 4L4RA 1T6BY 1E1NA 2WFMA 3ROTA 1S8OA 3FHOA 1EWTA 4ZAGA 1KH3A 3OA2A 2Q8QA 3GVXA 3TOXA 3TTUA 3A1VA 1P6XA 3DUFB 1T9ZA 2QVZX 1WMSA 3B3GA 4I6EA 3UJCA 3QX3A 2BJVA 2CVHA 4B87A 1EZ4A 1DT5A 2ZYDA 5KAPA 3V8PA 4BP3A 4DUGD 4EA6A 1QV9A 1AVTA 1JDBC 1T4MA 4RHUA 3PHGA 1I6MA 4AULA 4XRGA 1U7UA 1GGVA 2K87A 4FHCA 3UPUA 1Q83A 3BB1A 3HSYA 1JN0A 1A9XB 1QRAA 3IAEA 3NWJA 5IAEA 4G5OA 4IDPA 3TL6A 3L7JA 4AUNA 2AKEA 3G17A 5EIBD 3UAYA 1K3FA 1TPZA 2P5YA 1BJRE 2VT3A 3K2BA 3H5OA 3LGXA 3QVKA 1G42A 5TQJA 3WNBA 2WD7A 1M1XB 1BOFA 5FUMA 1QVZA 4ZJZA 1EB8A 1REQB 1QNFA 3AFNA 4OAPA 1WY7A 1U1IA 3EGDB 1G5RA 1I0LA 2CNOA 1KIMA 4R51A 1DX9A 1FVHA 2WEKA 3OO1A 3QWBA 2REBA 3R6TA 4KQHA 2UUOA 3OSZA 3N07A 4AMYA 1SOVA 3M1IA 2FGJA 4MKFA 4OATA 6NULA 3CZPA 3E8MA 2YY5A 3GJ0A 3L7LA 2RH4A 3NX4A 4YV2A 4UVDA 1XZGA 1B6RA 1W5FA 1X8XA 1KI3A 3HUFA 2NYAA 3I9NA 4G5GA 5C0OE 5FOUA 2GEUA 3D81A 3S8MA 5CFOA 3B36A 5KBYA 3ANLA 1IBMB 1UOOA 3B5IA 1G20A 3MMPA 1FDIA 2CXHA 5FI1B 3P2JA 5HA5A 1Z74A 3NWPA 3DDSA 4KVFA 1EWYA 1M67A 4AC9A 3TNYA 4WSOA 3OFNA 4YDSA 1NBMA 4AZ0A 3AJEA 4C0KA 3V33A 5A3QA 4MUAA 1ID1A 4X20A 1BYIA 1QSGA 1IM2A 3UJDA 3KWJA 2VL7A 1PJZA 4KYVA 4EB8A 2H9AA 3T5BA 1HT1E 5A5DA 5K8UA 2DETA 1FSFA 4TV9B 2OFWA 1JHMA 3P52A 2YVAA 3SYKA 4XM1A 3RS8A 2B6HA 1W4LA 2E1RA 5F1YA 1YO6A 2GPAA 3I9V1 5LU8A 1IHPA 3F96A 2FMUA 4HGRA 2FK7A 5E8JA 3DR3A 3FKSA 5CFZA 1B43A 1H6AA 5K3BA 3OMLA 1CDEA 4A73A 4E09A 4AKIA 2A88A 4DBVO 2Z95A 4U9UA 1K89A 1DIHA 4PYQA 1T3HA 4QGFA 4AZ3A 3O21A 3Q11A 3NB0A 3X43A 1JL3A 1EP2B 2XAUA 3QNMA 2E6KA 1L7OA 4WA8A 3FM9A 3WHPA 3ZDEA 2NMVA 1L7NA 4U7WA 1GG9A 2CYBA 1BS1A 2HQBA 4TMXA 4Z3KA 5KREA 1PNOA 4IGFA 4DVGA 2P7IA 4WKNA 3U44A 1P6QA 3HCDA 4OUKX 5DKFA 4DADA 1US8B 4LJ9A 3SQDA 4DV0B 4NATA 2GN9A 2HXSA 5KTSA 4YP9A 1NT2A 2EYUA 3CSUA 3A4IA 4TN5A 1VHTA 5LZ9A 3ZU6A 1M66A 3CO5A 5CDHA 1R64A 5MHTA 1Z0JA 1K88A 1U1GA 2NN3C 1JR4A 1R74A 3ED1A 3JQ8A 1U9YA 4L4XA 4GVXA 4MAAA 4YJ3B 5AW9A 2ZETA 1DBRA 1S01A 5I4BA 3F78A 2XA1A 3WYEA 3QWHA 4QUAA 1X7XB 3LO5A 4BNTA 5EA2A 4CJXA 4LOKA 3ZEAA 2XWQA 1D4AA 4O2LA 2OWDA 5HWSA 1ESNA 1KI7A 2HX1A 1J9EA 1ODTC 2IOFA 5KVSA 1P7WA 1K2VN 3OT1B 4JP2A 2XE8A 3UB2A 4V0OA 2ZI3A 4MO2A 1F5SA 4US0R 4BMSA 4ITUA 2AG0A 2H2HA 2W83A 3V7NA 4FILA 1DE0A 1MOSA 4CLXA 3D4NA 1Y7PA 5I7OA 4YONB 3P8ZA 1VSTA 3L3BA 4X1YA 5KVQA 5AW4A 5IYZB 1DLIA 2IEBA 5BR8B 5AKLA 2HQ1A 2PUWA 3BDAA 2NVUA 4MQMA 2H63A 3HHPA 1Y7TA 2O2HA 2WWFA 1YC2A 4CV2A 1BX0A 1HY3A 1Q6ZA 3P0RA 4RF5A 4BOYA 4X62B 2OORA 2JIRA 3FNGA 4N40A 3RJMA 4Q1DA 4F3TA 3VXKA 4WNAA 3AZPA 3IQHX 3OPYI 1Y33E 2W2LD 2ZRPA 4X94A 1QR6A 4BHTA 4RVDA 4CMJA 5JWOA 1FS6A 1P91A 4RV4A 1ECPA 1QGOA 3GPIA 1HYQA 1Y3BE 2FNAA 2GVZC 3EVFA 2XEXA 3CX4A 2BGTA 3CEMA 5DLDA 3SD7A 3UWSA 2GRUA 1N5LA 1ZH8A 2PJDA 3B6ZA 4LJAA 2IZZA 1VLJA 2JLWA 2XR1A 3GZ4A 1DRJA 1KYYA 5CHEA 5HBRA 2AH5A 3ZN2A 1MC8A 3NBKA 2BDEA 2PD4A 5DHSA 1HZZA 2M6SA 4RJJA 3WWDA 3SU8A 3UQZA 1AKNA 1II9A 2XMPA 1Z6PA 3RFXA 2YWRA 4NBWA 1HLFA 1SB9A 4FYYA 2XNCA 2W11A 1SFRA 1II8A 4Y6LA 4YQEA 1C0IA 3SSNA 2D1QA 2XUKA 1TUEA 3HXTA 3UZUA 5B7NA 4MCIA 5LQMA 2XMCA 3Q7PA 2FPRA 3JQGB 3K8OE 4FQ7A 3JQBA 2IE0A 3I4FA 4M22A 4EZIA 1KC3A 4QO8A 4KXQA 2X0RA 2G4CA 1MO5A 2JFXA 3K09A 4PYIA 2F3PA 4IMPA 2V7UA 4A0SA 3CVXA 4YMLA