2FU5C

Structure of rab8 in complex with mss4
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
176
structure length
146
Chain Sequence
b'KTYDYLFKLLLIGDSGVTFISTIGIDFKIRTIELDGKRIKLQIWDTTTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKVNDKRQVSKERGEKLALDYGIKFMETSAINVENAFFTLARDIKAKMDKNWK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanine nucleotide exchange factor MSS4
publication title Nucleotide exchange via local protein unfolding-structure of Rab8 in complex with MSS4
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 45
structure length 146
sequence length 176
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2fu5C00
2ZE7A 1TPZA 2CDNA 4MGZR 3BXZA 4HLUC 1JR3A 3MCAA 1KJYA 4NONA 2V7QD 2L0XA 1KZGB 3FKQA 2YHSA 3FMOB 3VNUA 1E2KA 2OFOA 5UKDA 3ZD6A 2F7SA 5D3MB 3SHFA 2Q21A 1ELOA 3EZFA 4UNNA 1FNNA 5EE3A 2NO9A 1OH5A 3IIJA 3RDPA 5BYKA 1RIFA 3K9GA 5EXXA 5KSPA 5CJ2A 1FQJA 3DM9B 3EASA 3IPXA 2R44A 3N2EA 4JYBA 5BN4A 2CLDX 1E4YA 1NF3A 1XMJA 3BGWA 3P4YA 2X1VA 1VMAA 3ADKA 1JR3D 3H1TA 2B6HA 2AN9A 1R0YA 2BM0A 1S8FA 2FSHA 3AVWA 4XSGA 2GZDA 1IHUA 4LV8B 4P4TA 1UBGA 1G9XA 2QE7A 3P27A 4UNQA 1Q57A 2VL7A 1YRAA 5JZVA 4Q1FA 4ZI2A 4IFBA 1RRFA 1F60A 4MKIA 2VP0A 4LSGA 1E2IA 2ZS9A 3CF0A 3GEEA 3LVQE 1EESA 3R7WB 1RJ9A 3LY5A 4DRZA 3PEWA 4TQAA 3C16C 1SULA 2OM2A 2GXQA 1Z2AA 2OXRA 3LV8A 4A15A 2YVUA 5CIWA 1GWNA 4PTLA 2ZAOA 2IEYA 1P60A 4A6PA 1VG1A 3GLGE 2WJIA 1S3GA 3I5XA 5FI0B 2QE7D 4CEHB 5KPJA 2CCJA 2Y8EA 2NZ8A 3I92A 1G4AE 4BQSA 2A5YB 1YR9A 1SHZA 2F1JA 4X8LA 1E1QA 3K0CC 3REFA 3U3OA 3CPHA 1GZSA 5GJVC 2ZRNA 2QBYB 2V54A 3WYAA 3CRMA 1LY1A 2IW3A 3LD9A 1F2TA 3HPQA 4LBWA 5LPNA 2JAQA 3AH8A 3VR1A 3NXSA 5CIQA 4C0SA 3F3YA 2EWVA 4PHTA 3AF2A 1H8HA 2BKUA 1W4BA 4TMXA 4KJZA 3WNDA 4B6FA 3WRYC 5CK4A 1UBFA 1DAEA 2FX3A 4IDNA 2N1BA 1CU1A 2FEMA 3GLHE 5FPYA 5ANRB 1YVDA 3PJRA 1E1QD 3TR0A 2F43A 4WIAA 4Q9IA 3W6PA 4C0JA 2Z6VA 1R6BX 3J81k 2HT1A 3EARA 1ZCBA 4UNSA 3B9QA 4XH9B 4RCZA 2O0JA 1H8HD 2QM8A 1UADA 2IHYA 2P6NA 4AKEA 2EVWX 1HUQA 2YNMA 5EP4A 5B2ZA 2AXNA 4P4UA 2CNWA 4BZQA 2F1IA 2K5UA 1Q12A 3A1UA 4II7A 3TVTA 4BFTA 3WNBA 4RJLA 3IKJA 2F3RA 1R5BA 1TF7A 2ZXUA 4ZCMA 2X2FA 1GUAA 1VIYA 5HCIA 5JFGA 4F38A 4URVR 4ZIRB 1QF9A 1XEXA 2W58A 4URWR 5P21A 1WMSA 4YMSA 1Z06A 2C04A 2CE7A 3GFPA 3NH6A 1DAKA 1E2EA 1E2DA 3CF2A 4OKSA 5L3VA 1A4RA 2TMKA 2QTVB 4B2IA 4BLQA 1X8LA 2O52A 4TYNA 4F4JA 1OXXK 4ZDJA 2CCGA 2CNWD 4FCTA 3U3JA 4OK6A 1TU3A 4BPBA 1D2MA 1NMXA 2GEVA 2VSFA 3A1SA 4WZBE 4BASA 5GVSA 1VG8A 3AP1A 4C0AC 1Q20A 1X1RA 1Z08A 1E2LA 1E4VA 1TL7C 3B5JA 1U8ZA 4TQ9A 3SYKA 2WWYA 3UPUA 2NZJA 4QC2A 2G9NA 4PHFA 1G64A 1ZNWA 4E22A 4ARZB 4Q00A 4KAXA 3HDTA 2RCNA 1M2OB 4GPTA 3GCGA 4MKFA 5DHFA 4M2LA 4A0FA 4EPXA 3NHBA 2AL7A 1GL6A 2ODEA 4EFMA 2LWIA 5EJEA 2WAYA 3ICQB 1JR6A 4IJMA 2QN6A 3R20A 3P4XA 4QGHA 4JL8A 4BFWA 4CEIA 1E2NA 1GL7A 2PJRA 2HYDA 4RFSB 3R9WA 3L43A 1OE0A 2IYZA 4D82A 1NBME 4EDHA 3AKYA 1KZ7B 3AVVA 3VKHA 3K70D 2Q6TA 1NKSA 2RMKA 1NVUQ 4V0KA 4HI0E 2IXFA 1Q21A 4K8OA 4M9ZA 1YZUA 2HCBA 2ZI4A 1Z0FA 2ZJOA 4GP7A 1D8TA 4PC1A 5KHOC 2R6GA 4L9SA 4H1UA 3RRZA 3EWSA 4JLNA 4BLTA 5C18A 3BS4A 2V3CC 4OBEA 1QBKC 1JXMA 1NJFA 4MITA 2O8DB 4HDQB 1RPZA 1TF5A 5EE5B 4KVAA 4BLOA 4URXR 2EWWA 4OI1A 1P2UA 3T12A 3DOFA 5TXGA 5JWRA 1E98A 5EZ5A 4LPSA 3GFTA 1VCOA 2BMDA 2UKDA 4ACBA 3HYRA 4PFSA 2BJVA 1E9AA 4DLUA 2DR3A 4Q9LA 2IXEA 3SJAA 2GTPA 4HB4A 2AKAB 5CK5A 4M0LA 5CITA 2GDJA 5AUPB 3CM0A 3THYA 4R2IA 3WYFA 5DE3A 5DN6A 1FFHA 2BBTA 1ODFA 1KNQA 2GJ8A 2YWFA 5IDVA 4D80A 2JJ2A 4PQRA 4CEJB 2XEXA 3MG9A 2FGKA 4AYXA 1OXUA 1MR3F 2NPIA 3CX6A 4TLEA 5J40A 2DWQA 4B73A 4Q4HB 2W6IA 2CVHA 4A82A 2ODNA 4JBXA 3MWJA 3QXHA 1OB5A 1UDXA 4ITRC 2QNRA 4DXAA 1KSFX 2RH5A 3BH6A 1OPXA 4BLSA 1S9DA 3A8TA 1NNEA 5JECA 3HU1A 4AI6A 3A1TA 5IT5A 2J0UA 4Q4AB 2WWWA 1JPNA 2J1LA 5KO2A 3NWJA 1P62B 2R2AA 1AKYA 3KKQA 3A58B 4FINA 2PZFA 1D6JA 2GESA 2GKSA 2QT1A 1LNZA 2WBLC 4LJ9A 3PUXA 3LXRA 4EAQA 2ZANA 5DN6D 3CH4B 3EPKA 2WZQA 5DI3A 2JJ2D 3AVTA 2ZQ5A 1YR7A 1E0SA 4QG7A 1N6RA 3BERA 1E0KA 3W5IA 4KVGA 1CULC 2F9LA 4TN1A 1CF4A 1E9CA 2R6AA 2W6ID 1Q0UA 2E9SA 3QBVA 1GL9B 3OIVA 2FEOA 4W5HA 2NPFA 1EXMA 4N1AA 4POAA 1T8UA 4ZKDA 1KSHA 1RRPA 2QMOA 3LQRA 1IXRC 3QNUA 3TJZA 1Z5ZA 2RGEA 4NDZA 3H84A 2ZSAA 1OB2A 2GAOA 4M1WA 2ZITA 2CHQA 2D7CA 4YLGA 2FPLA 1NIPA 5IF9A 4EPRA 2DPXA 1OSNA 1R0XA 2FFQA 2GZHA 2QG6A 1JECA 1PLJA 4LYAA 2VP6A 1SXJE 4XWOA 5CLQA 4LOAA 2VLIA 4GMDA 1XXHE 4ESHA 4TYYA 2PJZA 3PIRA 5DGXA 1RYHA 4JSTA 1OYWA 5FR2A 4RD1A 221PA 1TUIA 4Z8XA 3GLIE 4Z54A 4YMWA 1A7JA 2ZS7A 4LK2A 1W1WA 2H7VA 3SBEA 4HAWA 5CLLA 4EJSC 2YC2C 3QVUA 4Q03A 1XCMA 4I81A 4LDJA 3CNOA 3CB4A 4CVNA 2YINC 1P9RA 1WRBA 3SJBA 2J0SA 2AKYA 2R6FA 3QXCA 1G6HA 1UDWA 2IWRA 2PCLA 3AQ4A 3BJIC 5EQTA 3UK6A 3OEEA 4UKDA 2YZ2A 2ZJ2A 2I4IA 4TZ6A 3UATA 4OI2A 1IN4A 4DSNA 5FUYA 3AVQA 2RGGA 1NG9A 1Q1QA 5FPKA 1HE8B 2N42A 4DBLC 3I1FA 1Z2CA 3QVVA 4GNKA 1PVOA 1FP6A 4DIEA 3KXLA 2WHXA 3LLUA 3UWKA 2KE5A 1ZJ6A 2IT1A 4EJSB 4G5SA 1GKYA 3D31A 1XCGB 2BBSA 2OEPA 3OEHA 2Q9BA 4PO8A 1Q1EA 1RJ9B 5J4YA 5CYPA 4IOLA 1U9IA 5BYJA 4NYIQ 2D62A 2BBWA 3A4LA 3CPEA 3E70C 3OEED 4XD7A 5KUTA 3B1WA 1HT2E 2YJTD 1U2RA 1D5CA 3AKEA 2EFEB 1T3SA 4KHZA 1T5LA 1YE8A 3TQFA 4JSYA 1Q44A 1NSFA 1S96A 4PO9A 5DYIA 2VPPA 2QQEA 3VAAA 5B58C 1DG1G 2VF7A 4PANA 3B60A 4LHVA 3X1WA 821PA 3AF1A 1BOFA 5G53C 1WDTA 2QAGA 4B75A 2VRWA 5FOSA 3KTAB 3LBIA 3W6OA 5JMTA 2ZJ5A 4KXFB 4XOIA 3OEHD 1DEKA 3L82B 1UBCA 4FMCB 4HLDA 3OIWA 3OE7A 3H86A 1DELA 3L2OB 5KNDA 1E79A 4HAYA 2YV5A 1JBKA 1IY0A 2HJGA 2G0NA 2OAQ1 1OIVA 4MYCA 5FBWB 4XD7D 4YONB 4L8GA 2GJKA 3FHTA 1ZRHA 4WXRA 1J8MF 3A4NA 4MGKR 4Q7MB 3BH7A 4U00A 5G40A 4B2LA 2ZROA 3GMTA 2PX3A 2VO1A 1E94E 3VQTA 2XOKA 1QHGA 3KXKA 4MRPA 2EFHB 4MRNA 5CM9C 2O8EA 4O25A 3RS3A 2F43B 4J0QA 3CR7A 2PCJA 4PC3A 3ZYCA 2ZRCA 4IDQA 3WMEA 1R5OA 1P5ZB 1Q3HA 2B21A 4DC9A 5FTJA 3NC1C 3LNCA 1T0HB 1TADA 1UBEA 2ZYVX 3OE7D 2ONKA 2JLYA 1E79D 1GIAA 2ZETA 3WYGA 2UZ3A 3I8SA 4C3ZA 3TSWA 4EFNA 2WV9A 2O0KA 1MOZA 2OCYC 1OFUX 4OQNA 2HUPA 1EFRA 3DDCA 4KFTA 3K70C 3QUSA 4EIWA 2V9PA 4AKGA 4KBFA 2XOKD 4HATA 1CBUA 2RAPA 3AVOA 2OUKA 2QA5A 5EE9A 4LPKA 1XDBA 3SOPA 2ZR7A 2A2ZA 2XTNA 1U0JA 4GZMA 2O8BB 1BYIA 5GJCA 5B57C 4G0NA 4LHZA 2CMKA 2PMKA 3I73A 2F1RA 5C4GB 1E6CA 1KK2A 1XTRA 3KKMA 4ZCLA 4NYMR 3EZ2A 1FTSA 3B8HA 2BM1A 3VR4A 2H16A 2CJWA 4E07A 4B3BA 2ZU6A 3Q3JB 4HEJA 2ZJZA 3MJHA 3MSXA 3Q85A 5HR5A 2WPDA 4AG6A 5JLJA 1X8KA 1SKQA 1T91A 4LWZA 4O0MA 1GNPA 2ZYUX 3FMFA 3LDAA 1EFRD 1JI0A 1W44A 2G6BA 5EUQB 3I5YA 4W7SA 4MDEA 1US8B 3VNVA 1KMHA 3DOEA 1Z22A 2ZRIA 3JVUA 3K70B 1NMYA 1W47A 4B3GA 5GJWC 4LJ7A 5FH9A 1E32A 2P3SA 4NKRA 1FUKA 4G5QA 3TLXA 1DO2A 3EC2A 3UMSA 4RZXA 1K6MA 4HZUA 1N5JA 1JQLB 4JMPA 3EPLA 2FOLA 4URUR 4URZR 2WSMA 3WRXC 2ZYWX 4RZ2A 5FTKA 3QEJA 5EXTA 4QKQA 3NBZC 2BOVA 2RHDA 3HYTA 2WPDD 4PAQA 1SVWA 3M4YA 3SN6A 3FWYA 5KDOA 4PHHA 2V6IA 2FNAA 4NHOA 4NP6A 5F9HA 1XPRA 4V0LA 2EYUA 4RCYA 3GLHA 2J5XA 1ZP6A 2A5GA 4LGMA 3SI7A 1Z6YA 4Q7LA 4B43A 2HJVA 1Z0DA 2CLSA 5EP1A 4F7WA 2RGXA 4I1VA 4Y0VA 2P6RA 3GLFE 4QHTA 2NO1A 3EW9A 3U4QA 3QBTA 2GXAA 1PV4A 2ZEJA 1DAFA 1S9HA 3IQWA 2DFKB 1OF1A 3NBXX 1KKMA 4C0LA 1L4UA 2JLVA 1O87A 3OF5A 4LX0A 3L8YA 4Q5IA 2IYTA 2UVQA 2G77B 1YQTA 3WP1B 4JKYA 1B23P 3QKRA 3L0OA 3A4MA 4G5GA 4L4UA 3VR2A 5F9FA 3DHWC 3SJZA 2CCKA 1F5NA 3WY9A 3M0EA 5J5CA 4DUGA 5A5GA 3VKGA 3P20A 4V0ME 1KOFA 4FCWA 2ZRDA 3N5CA 3THWA 4B33A 2IYWA 4KLNA 3QENA 1NLZA 1KTVA 3C14C 4BFYA 1XZPA 1HQYE 4M53A 2ATXA 3QPVA 2NQ2C 4WAUA 3THYB 3K0AA 5C46F 2XZPA 2WOJA 3GJXC 5DH9A 1VIAA 2A30A 4TTRA 4FMDB 5AJWA 3NC0C 3QKTA 4HB3A 4QFMA 3NVAA 3W9YA 1UM8A 3NKVA 4LC1A 4QBHA 1VYVA 1H65A 5HTKA 4IVPA 1W49A 5DNYB 1RKBA 5FOVA 4DUGD 1AQUA 4A4DA 2JLRA 2X77A 1CTQA 1JEDA 3QKUA 3THOA 5HPYB 2GXUA 4GMXA 1SVOA 1E9BA 3RANA 3DL0A 4EPWA 3NG1A 1ZMXA 2CXXA 2NGRA 2J0UB 1X1SA 4XJXA 4NYJR 2C8VA 5AUOB 1CR4A 4W9MC 1N0VC 3W6NA 4EQ6A 1LW7A 1FX0A 4OHWA 1L8QA 2HLDA 3HJNA 4QGGA 1DE0A 2X2EA 5HE9A 3HR8A 1T0JB 2WJHA 4DLRA 3RS7A 2QPAA 2BJWA 4Q4LA 2CHGA 5DI3B 1ETUA 5JBQA 1KIMA 2QL6A 3DPUA 3PEYA 4KV9A 1TNDA 3K1JA 4LBVA 4E5UA 4US2R 1W2HA 1Z29A 4EPTA 1C4OA 1WE2A 3GEHA 4IXMA 2ZI6A 2WMNB 2QMHA 1JJ7A 1S4QA 2GK6A 3GJ8A 5LBIA 2G0TA 3THXA 4Q19A 4KITB 3EZ7A 3GQBA 4MUAA 2WICA 4TYPA 5H70A 2WWIA 5F3WB 4KO8A 5TVKA 3AB3A 2HLDD 4XWKA 2BWJA 3GJ6A 4URYR 1ZD9A 1OFTA 3CH5A 1B0UA 4LBZA 4D26A 3AUXA 1R5NA 2YOFA 4DWJA 2RGNA 4X8HA 2C95A 2ZS8A 3V4FA 3KQHA 1KK3A 3K0FA 3ZZUA 1E2HA 3LH5A 4TLDA 4UNPA 1WXQA 4PC7A 4DB4A 4LHYA 2FZLA 4WZ6A 5GJBA 5IRCD 3VFDA 3CRW1 2B7BA 1DS6A 2WJGA 4YMTA 4TZ0A 2PT5A 4TL8A 1XZQA 3WP0A 2YWEA 1W36D 1SVIA 2QSZA 4OI4A 4Q1DA 4RKFA 1JQJC 1U99A 2AFHE 5G41A 1KGDA 1U9IC 2X19A 3RVBA 1Q1BA 3QKSA 1ZNXA 1U98A 2IX3A 3PR1A 2Q9CA 3A37A 5DI9A 1N6OA 4ABYA 3B1ZA 1U81A 3ASZA 1W5SA 1ZC3A 1ZVQA 2DHRA 3E2IA 5KNBA 2BIFA 2C5LA 1U8YA 1TUEA 3BAFA 2AFIE 1GRNA 2OLKA 5SZIA 2BC9A 2VYFA 2WOOA 3QI2A 3SC3A 1LV7A 1EWQA 1ZW6A 1W4AA 2R8RA 4OQFA 4P0TA 4V0NA 3NIBA 1CJVC 2QAGC 2P0EA 5AUNB 1GM5A 3FB4A 2GK7A 3U3RA 2LCFA 2GCPA 1HA3A 1DPFA 1M8PA 2NTYC 1CJKC 1ANKA 1GP2A 5BQ5A 4NE2A 2EU8A 1RRGA 1KKLA 1KI6A 1I4LD 2RGDA 4R9UC 5FOWA 3RSLA 4B47A 1LF5A 2GCNA 2X8AA 1JNYA 4JLPA 3W34A 4PPFA 3SR0A 1E2MA 1XJQA 1G3IA 3UIEA 1VHTA 1PJRA 3DO6A 3H0KA 3W8RA 3FYHA 1KO4A 2F1HA 4CDGA 1NI3A 4D25A 3K09A 3WBJA 1VDZA 3WBKA 1SKYB 2OHFA 1KY2A 2PT7A 3AKCA 3GP8A 5A4JA 3ADDA 4X8MA 2GBLC 3OHMA 1C1YA 2QAGB 4B76A 5CB6A 4RFVA 4D6PA 1T4GA 1BIFA 3L0PA 4G5OA 2ERYA 1WF3A 4TMZA 2FFAA 1NVVQ 2R6DA 3QPUA 1R7RA 2OBLA 2QROA 2QPTA 3PVSA 4CYMA 1IY2A 4NU0A 2WJVA 3GLIA 1XTQA 2G1JA 3NDBB 2C03A 5KSZA 3FMPB 3I32A 3OESA 1AGRA 1LF0A 3TE6A 3KQLA 5CDFE 1OV4A 1UFQA 2WWFA 2ZUDA 2ZRJA 3LA6A 3R9IA 3UANA 4Q4JB 1S0UA 2GJSA 1TEVA 2IBMA 5GVRA 2KBEA 1YZNA 1A1VA 2FV8A 3V4RA 3LBHA 5FL7A 1FL9A 4M1KA 5FOTA 3WHKA 3ZJYA 2GXSA 2GVDC 3JVVA 1N5LA 2V8OA 3DKPA 5IK2A 5AJXA 1E69A 1E9EA 2EYQA 4YC7A 3UG6A 3RS4A 1ZM4A 1QG2A 5C4MA 4Z51A 3LWNA 4US0R 1JALA 4LYHA 2B7CA 4CF7A 4JLMA 4V03A 1XTKA 3CX7A 4TQUS 4M9XA 3TMKA 1KI1A 4MDFA 1NN0A 2MSCB 4JLKA 2P65A 4DLVA 1HH4A 3BOSA 2AWOA 3MD0A 5FL7D 4B74A 5KPDA 3CZQA 1N0WA 4A8JA 3T06B 2AK2A 5EXPA 1HV8A 4IDOA 2CL0X 1XEFA 2EFGA 1E0JA 5CYOA 1A2BA 1II9A 3KJIA 1OH7A 4CT4B 5IK2D 2OLJA 1RVDA 3E1SA 4QM7A 3P32A 1IXSB 2DYKA 1W48A 2QUZA 4DEYA 1F2UA 3K9LA 5C2JB 1COWA 4XVQA 3R9XA 3ZIAA 2ORVA 4OK3A 4N0EA 3HP1A 4LZZA 4FWIB 4HB0A 1G7SA 1OXTA 4QBGB 4TTPA 4BFVA 3X1ZA 1KMHB 4IEEA 3CWZA 1EFCA 4Q7JB 3TH5A 3NBYC 4B32A 5HKKA 4HDCA 4AYWA 1RE0A 2FU5C 2A5DA 3E5HA 4IDPA 1GG2A 1K5DA 3KUDA 3QSYA 4C7OA 4HZUB 1NRJB 2ODBA 2LKCA 1NLFA 3U6BA 1H8EA 1AA9A 4I1SA 4HUQA 2WIAA 2ASEA 1IXZA 3Q7PA 2ZREA 2Z0MA 3B6EA 4IDHA 4AKIA 4LV6A 3PFIA 2DB3A 1C9KA 1VYUA 1WBBA 1OW3B 1COWD 3GJ0A 3GLHB 4TMWA 3ZIAD 1GAJA 2SHKA 2XJ4A 3BRWD 3IQXA 4Q1EA 4Q9HA 4FMBB 1R0WA 3AVUA 1LS1A 4GI7A 4NH0A 2DFTA 2QGZA 1Z8FA 4V02A 2KWIA 3U4QB 1HYQA 2QMEA 1KHTA 5HKKD 3W90A 1KI4A 4BGDA 2GAAA 1JR3E 5HCNA 1QHIA 4MQBA 2GJ9A 2D4HA 1ZM2A 3CZPA 2EW1A 3BB4A 1H8ED 2D06A 3WMFA 3ZS8A 1XBTA 3GJ7A 2OBMA 2Z5FA 2I3BA 4HAVA 5BN3A 5JSZA 1G3RA 3IIMA 1ZBDA 2ZSFA 1X3SA 2ZVQX 1WB9A 4IXNA 3ADBA 5L3SA 2XXAA 1R2QA 4JVMA 1TQ2A 4R7ZA 3VU9A 3TUIC 421PA 3O8RA 4I99A 2Z4RA 2PLFA 4WBSA 1M7HA 3LFUA 4HLQB 4CGZA 5KSYA 1IN5A 2JATA 4LBYA 3RRMA 2XSZA 1JXOA 3THWB 2DWPA 1Z0KA 2FN4A 2JLWA 4KCGA 2H92A 3DVLA 1XMIA 3Q72A 1ZAKA 4WXPA 1A82A 3K0AB 4AC9A 1FZQA 3KJGA 4OHXA 4NPHA 1YZKA 1T8TA 2WWXA 1E2JA 1OHHA 2I1VB 4RD6A 4R2HA 2E87A 2PMDA 4A2WA 1IN7A 5KDLA 4B3DA 721PA 1VCNA 3BFXA 3RWMB 2V4ZA 1YZLA 3HPRA 3WHLA 1NP6A 1ZCAA 4XTCS 2QRZA 3UKDA 5EE1A 3S1AA 4O2RA 1E2PA 2W83A 4BFUA 2VIIA 1W36C 5DO9A 4PPQA 1CJTC 1JB1A 1ZINA 5L3QA 2W2VA 1DAGA 2XSZD 1G3UA 1QDEA 3PUWA 2RHMA 4DT1B 1XD2A 1KNXA 4BE7B 4UJ3A 3VR5A 2QAJA 2YC4C 5FBQB 3QEOA 2IEZA 5FTNA 2QP4A 4BFSA 4EQ6B 4AWXA 5CB8A 2HT6A 3TW4A 1XTIA 3TSZA 3TVDA 2REBA 3NBFA 2RGNC 3Q5DA 1OHHD 4GFDA 4PX9A 1N0UA 4F4CA 1VCMA 2OCBA 2BCGY 5BW8A 4LUCA 2WMOB 2IL1A 3C5HA 4B3CA 4M1TA 3GLFA 2ZRGA 1M34E 3EPJA 1EFHA 5E4FA 1GTVA 5E7IA 3U44A 2AWNA 3CRVA 3UXMA 2W00A 3FHOA 3THXB 1KY3A 2ZRHA 1W36B 1FUUA 1YZQA 4ACAA 1M1YE 1AM4D 2V1XA 5AR1A 1BYUA 3VR6A 2IYYA 3IGFA 4C30A 5B64A 2J3EA 3U7EB 3U7FB 4I1UA 4DLSA 3KFVA 3SS8A 1W0KA 4GZLA 2O8CA 5J4VA 5D3MA 2ZSEA 4TLAA 4LRWA 3SZRA 2CLCX 1DG3A 3LX5A 1X6VA 4C9BA 1N6IA 4P4SA 4PZYA 3K8YA 2O8FA 4JLAA 1XD8A 1OT3A 2HEIA 1LS6A 3QXXA 5FL3A 1E2GA 4OJQA 5JWHA 1T9HA 3VMFA 5KDDA 1IJEA 2VHQA 3HWSA 1X8JA 3B9PA 1CIPA 1FP7A 4ASUA 1VPLA 2JIZA 4OI0A 1E3MA 2O0HA 1UEJA 2REXB 2WM9B 3BIFA 1JEEA 1YKSA 2A78A 4JIMA 5AJZA 2WJYA 1P6XA 3IDQA 5TDHA 1W0KD 5KU1A 1PLLA 3AM1A 1QHXA 1SVLA 4GDFA 3QKSB 4DLZA 4BLRA 4LY6A 3EZ6A 1CRPA 2Z83A 1VKJA 1UEIA 3RS0A 1M6NA 1N6HA 3EA0A 1KO7A 2XJ9A 4TL6A 2OZEA 3R7WA 1OXVA 4MRSA 2ECKA 3K09C 1WA5A 4O2LA 4US1R 3ZQJA 2Q3MA 2QRNA 1R10A 1GDDA 1NVXQ 3TR5A 3I4LA 1GFIA 1CR1A 2ZI3A 2V55B 4ZI3A 4ASUD 2D74A 2JIZD 1HEIA 3KDSE 4NBSA 4NZYA 4UXJA 2AD1A 2GHIA 1JAIA 1AS3A 3SDZA 3K53A 1NN5A 2ZVPX 4BRUA 3BBPA 1CEEA 3BWDD 2IUUA 1GOTA 1AS0A 1ZIOA 4TLCA 1W0JA 2CL6X 1IJFA 1Q3TA 3B7GA 2UZIR 5JJLA 2GILA 2QQ0A 2QBYA 2AR7A 4W5JA 3T1TA 1F2TB 2J45A 2ZRAA 4L16A 121PA 1P9NA 1FPMA 1CS4C 3CR8A 5L8VA 1K5GA 2C9CA 1Y63A 4IW3B 3KJEA 4DDTA 3U60B 1BH2A 4U7DA 1FQKA 3AVPA 4JBWA 1BMFA 2OG2A 5TARA 3B1XA 4I1OA 4IOMA 1OYYA 5FBRB 2YKGA 4Q9KA 3IPYA 2IF0A 1TQDA 3RC3A 4TSFA 3QY0A 1E9FA 4A0GA 4JZKA 1QHHA 4E03A 2AD5A 1W0JD 2ORWA 1HE1C 1G3QA 4YMVA 1SVSA 1G3MA 3K0CA 1PZNA 4V0OA 5JI3E 2G3YA 4LJAA 4GOJA 4H1VA 4EPVA 5IHPA 1TU4A 3IILA 4Z8YA 4IOJA 3GLIB 1EX7A 1OXSC 1GITA 1P7CA 2RGAA 2OCAA 1AJEA 3ZD7A 1G21E 3NH9A 2GF0A 2JLXA 1I4DD 4HYYA 4LJ4A 2D2EA 5FUVA 3SBDA 1BMFD 3ASYA 4A92A 4DLYA 2XX3A 1G16A 2XNSA 4A8JC 4DDWA 1UJ2A 3ETLA 3H4MA 1IM2A 3DMDA 4KSBA 4TSFD 3NDPA 1XJCA 1DVRA 3KFXA 2J7KA 1LB1B 4DVGA 2C98A 4DCTA 2JLZA 4PR0A 4JYCA 3A36A 1XEXB 5FPTA 4ZIRA 1RRCA 1Z6AA 2IC5A 621PA 4DKXA 4G3XA 4QHYA 4M9QA 4BZXA 3DM5A 4FMCF 1OJLA 3T1QA 3GLGA 1GNRA 2VTKA 4MGYR 1TTTA 4Q48A 4M4SA 4M22A 1MO6A 1DAIA 3QG5A 3SFVA 2BVNA 5J47A 4MKHA 4DCUA 1T6NA 4L5BA 4OJKA 2CVFA 3I61A 1TQ6A 2VQSA 4Q1BA 4O3MA 4OHYA 1W5TA 2ZR9A 4JJZA 3FKSA 1JPJA 2HV8A 4A8JB 2GNOA 3LQQA 4WVFA 1FW6A 4JBYA 1ZU5A 5JCPA 2ERXA 2FH5B 1G7TA 3FDIA 2HXSA 1CP2A 3NEYA 1MRNA 3ZS9A 1GRRA 2QU8A 4XTRA 4PPGA 4JT4A 2GVZC 4IFEA 2ZI7A 3F8TA 5AJYA 5F2EA 4C0HA 2GA8A 4ESVA 4NCNA 2IS4A 2GEDA 5LB2A 1EFTA 2OESA 1DO0A 2XTZA 4CEIB 2KBFA 1DBSA 1UAAA 3Q5EA 4XVRA 3FVQA 1I2DA 1IN8A 3KQKA 1UPTA 3U7GA 3ZLJA 3BORA 4K46A 1NY6A 4TYWA 1FOEB 5D3QA 4ZCIA 4C2TA 3FKSD 2W2XA 4C7OB 3QXJA 2VHTA 3KB1A 2CEAA 4XSHA 3ZZ0A 3DZ8A 1Q22A 3DZDA 4PQYA 1M7GA 3QIAA 2AX4A 3MLEA 1P2VA 4HUQB 4UJ5A 3KZ1E 1GVNB 1VG9B 1ESMA 1D2NA 2ANCA 4GOXA 5FUWA 5JCZA 4G5RA 2BEJA 4HB2A 1QRAA 4IOKA 4BEBA 2OE2A 5H68A 3QPWA 1WCV1 4JVLA 1JAHA 1NJGA 2RGBA 4L15A 1XU4A 3BB1A 4QXAA 1XNJA 1E96A 4YDHB 3BC1A 3SNHA 4NTZA 3TGPA 1JJVA 3BE4A 3ZVMA 1NN3A 1GNQA 1T3LA 2P5SA 3ZDQA 2MMGA 3T34A 2ZJAA 1IAQA 1PUJA 3B1YA 4OHVA 2J9RA 2B8WA 1UF9A 2QEQA 3IBGA 4Y0AA 1V43A 3AF0A 3KB2A 4FD2A 2KB0A 3SYLA 3BFVA 3OAAA 1EWRA 3HR7A 2PL3A 2PZEA 1T5IA 4JLDA 4D4MA 1U94A 3VHLB 4LI0A 5TB5A 4ZDKA 2Q3FA 2CK3A 4A9AA 4PSVA 5JSZB 1KO1A 3X1YA 3HU2A 5L3SB 1TAGA 2XXAB 1LTQA 2IS6A 2A9KA 1W46A 4TYQA 4ZPXA 4QL3A 5DISB 3UMFA 3VU9B 4F93B 2DY1A 2BDTA 4B6EA 1ZNZA 4PO1A 4EPYA 5M04A 4Q4HA 1DAMA 2ZRMA 2H18A 1EGAA 4LJ8A 1J90A 1O3YA 4PC6A 2VP5A 4ZDWA 1IQPA 3OAAD 3V00A 1XEWY 3P26A 1D9XA 3W5JA 5KTYA 4GBMA 4JL5A 4LC0A 2JDIA 1KO5A 4MRRA 2ZE8A 1KSJA 1P73A 1KDOA 2CK3D 1QHYA 1W2GA 2OFXA 1RFLA 4TTQA 2OAP1 3U7HB 1AQYA 3GJ3A 1ESNA 5H1YA 4JLVA 1S1CA 2QY9A 1AKEA 3S1AB 4Q9JA 5EZ6B 1NBMA 2XGJA 3B13B 2IYUA 4A36A 4FIDA 2ONJA 1II8A 4TL7A 5EE0A 1I2MA 1G17A 1XD2B 2QP9X 4RVCA 4KODA 3VX4A 1V5WA 5JJKA 3K9NA 3AF4A 2NO0A 4PSAA 5E7MA 3CWQA 2JDID 3EIHA 1MO3A 4BFXA 5JRJA 1SKYE 3RNLA 2JJ1A 2H8KA 1MABA 1OIXA 4CT5A 3LBNA 1Z83A 1XB2A 1KK1A 2J7PA 4LHWA 2ZR0A 1E9RA 521PA 4M8NE 3LLMA 5FBVB 1Z63A 4FMDF 4RZ3A 2DFNA 3O8CA 4DCSA 4ERNA 2PEZA 5FOUA 1NBMD 4B48A 4KI0A 1RYFA 3C7KA 1YR6A 3KQNA 1R4AA 1DTSA 3QQ5A 4PAOA 4BUJA 4DZZA 1OH6A 3RLFA 4B44A 4PXAA 1CJMA 1IY1A 4QRHA 4UXHA 2O8CB 4MA4A 4KU4A 2IWHA 3OFNA 5JHGB 1G5TA 1N3BA 2W0MA 3SJCA 3RYTC 1ZIPA 2HXYA 5K8UA 2A3RA 4Q66C 3FGNA 2F3TA 1XCPA 3IHLA 3X1DA 1E1RA 1N5KA 2QTFA 2JJ1D 3ECCA 4KYUA 4P4SB 4RY2A 4EFLA 2JLUA 2ZI5A 2J7PD 3NTUA 4D2IA 2O8FB 2OBNA 1KYIA 3CW2A 2IUSA 2ZE6A 4BLPA 2WAXA 1KI3A 2IK8A 4DJTA 2NO7A 2OCPA 2ZRBA 3CO5A 2GEUA 2WSSA 3KUCA 1G4UR 3EAQA 4LJ6A 1HT1E 4NYIR 2Z43A 2ZI9A 3HU3A 1NY5A 4GRAA 3W3AA 3KX2A 4BECA 3OFND 2PZGA 3SHWA 5FPSA 1KI2A 2GZAA 1NVWQ 5BXQC 3TUJC 2A5JA 3TUZC 1MO4A 1E1RD 3KJHA 2ZRKA 2EFCB 3LVRE 4CW7A 4EJSA 3O8DA 2ZE5A 5JI2E 3GJ4A 4QOSA 4NCJA 4AYTA 3SEAA 4X8OA 3FE2A 2FDCA 2IYRA 1SQ5A 1G18A 2IYVA 3TRFA 1NIJA 3U2QA 6Q21A 2WSSD 5K8LA 4KLZA 2Q3HA 4JVSB 2CE2X 4QGAA 3T1OA 4E09A 4LYJA 5A0FA 5HZKA 1XFAA 4Q7KA 1PUIA 1CR0A 4UQOA 1AN0A 2BV3A 4IKEA 3GPLA 2RKOA 2KI5A 2C9YA 3TIFA 1ZC4A 2Q9AA 1SXJA 3PITA 4NMMA 4RZUA 2VSXA 4B3FX 2BHRA 3KTAA 1XWIA 3RWOA 1XF9A 1KDRA 1DOAA 3A1VA 3CF6R 4IVQA 1YHNA 1XXHA 2J59A 1UKEA 2ZJBA 1J70A 5CJPA 1XMVA 1L7VC 2O5VA 3U3KA 2Q0HA 3ZGXA 3LXXA 4A2QA 1Q1ZA 4C4PA 1G8FA 1QVAA 3FOZA 4RD2A 2IHBA 3PEUA 3PEVA 1N6KA 5AJVB 1GILA 4QM6A 2O8EB 2XB4A 4PHGA 4S35A 3MUFA 1P72A 4C0KA 1QHHB 4F92B 5EXSA 1KDTA 2Z4SA 2ZAMA 4AURA 3U3MA 4BFZA 3SQXA 4MH0R 3AF3A 3QJYA 1SXJD 1XD9A 2WVJA 2QI9C 2C2HA 4AY2A 1QHSA 4PZLA 1ONBA 3H2YA 2WIBA 3CKLA 4TL9A 4F91B 1ZU4A 3B1VA 4KFSA 1N5IA 4RD3A 1J99A 4D4LA 2HCJB 1G5PA 1NL3A 1Z0AA 3C8UA 4UXIA 1G19A 2DBYA 3ZVNA 1UKZA 2JJ8A 3W8NA 3CNLA 2OT3B 1NMZA 2ZYTX 4OQXA 4HAXA 3M1IA 1VTKA 3MGCA 4TLBA 4GT1A 2FWRA 1X86B 4OQLA 2QP3A 5JEEA 1SZPA 5FFMA 1GKIA 2W0SA 3C15C 2O8BA 4PC2A 2FSFA 3O8BA 4Q1CA 4N3NA 3SU8A 3QOFA 2CJWB 1IONA 4W5WA 1WQ1R 1YJ5A 4OYHA 4HLCA 4CRWB 4Q02A 1ZUNB 3GJ5A 1W4CA 4Q1AA 3GLGB 2DWOA 1Z47A 4MYUA 2QORA 1RW4A 3WXMA 1RC8A 4XWAA 3EWAA 2XZLA 4QBIA 2PEYA 5KSOA 1KAGA 3RRYA 2GWHA 2C99A 2ZRFA 2AXPA 3G5UA 5J4HA 2N46A 3CRRA 1US8A 4YMUA 4HAUA 4NYMQ 4A2PA 1MKYA 1N2CE 4QGFA 2A7QA 3ADCA 3IO3A 4DSTA 2QSYA 1R8QA 3MWYW 4BWYA 2D7DA 5G3ZA 2ZJ8A 2J0QA 1WP9A 2QENA 3EIQA 4M21A 3QE0A 1CR2A 1TEXA 4U02A 3JZMA 4PAMA 1G8PA 5KYKA 3F0TA 3O47A 4DIDA 4JVNA 1U0HC 1XEWX 3NEJA 4G01B 1VYTA 3TAHA 4B3XA 2DCUA 3DKVA 3W3ZB 1IN6A 1U8AA 1Z6XA 2A5FA 1G6OA 3AKDA 4WW0A 2OV2A 2AK3A 2H5EA 1VECA 3LRPA 2D2FA 2VBCA 3Q8XB 4RD4A 3D6TB 3ICEA 2IUTA 4ON9A 5L3RA 4MYTA 2IS2A 2PLRA 1IOZA 1Z6GA 2BMEA 5H8WA 4FN5A 4M1OA 1XTJA 1KDPA 1XPUA 4HSEA 3EC1A 4GOKA 1TMKA 4GL2A 3VHXA 1E9SA 2BBOA 3P1JA 1XRJA 4A1FA 2MSDB 3QKRB 3RSOA 1CRQA 4DB2A 2ZRPA 5FOXA 2GCOA 2G83A 1MRSA 3IEUA 4D81A 3L0SA 5DYGA 3PUZA 1NSTA 2E1RA 3PENA 3FTQA 4QJ4A 3MWKA 4BZPA 4AD8A 4BEJA 4DCVA 3X2SA 3TSOA 2IXGA 1T3HA 3EG5A 1AGPA 3V9PA 5KNCA 5AWFC 4EKDA 3B85A 3FPAA 3R8FA 1GKUB 3MWLA 2BEKA 1NG1A 5LDDC 1YZTA 2EQBA 1MH1A 2XTMA 3QF4A 3DMNA 1Z0JA 4MRVA 2XNDA 3X1XA 4AG5A 5EP2A 3VR3A 1NKTA 4MUBA 3UWOA 3CNNA 4KFRA 1G8HA 3CX8A 1QG4A 2FPMA 5LB4A 1HQCA 2QGNA 4D0NA 2VHJA 2YWHA 2FSIA 2R65A 4PPNA 2ANBA 3EA5A 4Z1MA 2XZOA 2P5TB 4PSKA 1VCIA 3RRNA 1Y3AA 2WJJA 3NHAA 4GSYA 4B35A 2VH5R 4QBFA 2G1KA 2VHUA 2QT0A 4CIDA 3LW7A 3QG1A 4B71A 2YOHA 1E2QA 1KO8A 1FX0B 1RZ3A 2FG5A 2KSQA 4I4LA 5JWOA 3DEFA 4DLXA 2ZSDA 3KL4A 3EZ9A 3C5CA 2CL7X 3LX8A 4OQMA 4TMTA 2XNDD 1OIWA 2LKDA 1YRBA 4PZZA 2ATVA 1ZM7A 1J8YF 3VTKA 1II8B 1J2JA 5F98A 4DSOA 3CRQA 3PV0A 4RD0A 1Z0IA 3FHCB 4DCNA 4NYJQ 3WNCA 3WMGA 1M74A 3B78A 4Z1MD 2MSEB 3VKWA 4JLJA 4DDUA 4LYFA 1MO5A 2ZU0C 4P3YA 1K8RA 2C9OA 4IRUB 3T1VA 2ZM5A 5FPHA 2VP4A 1DADA 4LJYA 2BMJA 1E0AA 1OKKA 2C96A 1MABB 3T5DA 1MT0A 4KBGA 2IA5A 3RS5A 3TKLA 2AHOA 2GF9A 5J4LA 3K0FB 3C41J 1AZSC 1ZD8A 4V0MA 4TT3A 1G1MA 3QF7A 3D7MA 4MGIR 4DLWA 2H17A 2J0VA 3I3SR 4RSGA 1F3OA 4S2EA 5HE8A 2REOA 4DEXA 4WOPA 4OHZA 2FZ4A 1P75A 3M6AA 2HYIC 4QNMA 2QM7A 4AKHA 1CXZA 2OO7A 4DDVA 1EX6A 1YR8A 2EFDB 1BKDR 3FMIA 3TNFA 1N25A 4HAZA 4HLUA 2C78A 3IBYA 1SVMA 5AK0A 3ZH9B 4LCBA 2ODWA 4M1YA 1OKKD 4D4JA 2FJUA 3N70A 2W6JA 3SFZA 3AVXA 4MKGA 3SYNA 1QVRA 2FMXA 1UKVY 1G5RA 1KI7A 1M7BA 4H9GA 3BH0A 1IBRA 2ZUCA 4TMVA 1KK0A 4LV5B 5KOYA 5FUXA 2JCSA 5ELXA 1L4YA 1ZYUA 4IEIA 2R62A 4TT3D 4A0HA 1G7RA 2P2LA 2YYZA 3KKNA 5HZHA 4FWTA 3MAAC 1VG0B 3KKPA 3T35A 4N0DA 2JASA 4B2PA 3GFOA 2QMUA 1SXJC 1P4SA 1W4RA 1ZM3A 5DHAA 5E95A 2JLSA 2IYXA 4KSCA 1PLKA 2P6UA 3PXGA 3IEVA 4C0QC 4CEHA 5DSZA 5EUMA 1XPOA 1R0ZA 1KI6B 4B34A 1EG7A 2W6JD 4P33A 1A2KC 4LHXA 1UKYA 3FFBA 1NLYA 2PX0A 1Z28A 2WKPA 1LFDB 2JGNA 5FI1B 2V6JA 1DAHA 2ZTSA 1KI8A 4KFUA 1NVVR 2BKEA 2FFBA 1D9ZA 1HTWA 4QJ5A 3U61B 2QZ4A 4MYHA 1A5TA 1F48A 3KXIA 2RB4A 5FBLB 2QPOA 5FR1A 3LO5A 4IVRA 1G8YA 4KYIB 4Q47A 1D2EA 4AIIA 1SHKA 2DFLA 4ILEA 3T61A 4JJKA 5TMPA 2FSGA 4D4KA 2ZUBA 3EIEA 2H1LA 4WZAE 1KAOA 1N6LA 1SXJB 3PUYA 5BWMA 1FNMA 4HDOB 2WWGA 2YOGA 5J4KA 2OFWA 1XXHB 4D0GA 5TV2A 3CBQA 1E9DA 2FPKA 4JKIA 1LVGA 5EP3A 2NMVA 3RAPR 1FMJA 3IHWA 3PCRB 4NCKA 3UG7A 2G88A 3OIUA 4QNRA 1KSGA 3ZVLA 3ZZTA 1HY3A 3A6PC 3MFYA 3N2IA 2BMFA 4Q01A 3ZVRA 4TWZA 3QXSA 3UMRA 3L0IB 3CPJB 4Q4JA 4U5XA 1KMQA 1N6PA 5LD2C 5SZKB 4DSUA 2H57A 2W2TA 5JJIA 3C4JA 5SZHB 2GBLA 1GSIA 1II0A 3ONWA 1OH8A 4FXPA 4GP6A 3GEIA 4JLOA 2ORIA 2NG1A 2I1QA 3BK7A 5E7JA 4ZV4A 2QTHA 1I4TD 3SQWA 4XIGS 2J41A 2IF2A 2R6CA 4NCHA 1L2TA 2F55A 1S2MA 2B8TA 1W7AA 4C2UA 3ND8A 1Z3IX 1AZTA 4IHQA 3TW8B 2VF8A 2VSOA 4DLTA 1P9WA 1MV5A 4ZO4A 3LW8A 2ZSBA 3SE0A 4LJ5A 1GRQA 1P3JA 1OFIA 4FI3C 1TQ4A 4JS0A 2VP2A 3KKOA 1BO6A 3FFAA 3TBKA 2PBRA 3BD9A 3T5GA 5LD2B 1G291 3RABA 2IYSA 3VX3A 2NIPA 3AGPA 4OL0A 4ARZA 2D3WA 2JA1A 1F2UB 5DLQC 4JT2A 5CM8B 2J87A 4M1SA 1HURA 2F9MA 1XP8A 3BFKA 5BN5A 4Q21A 2RGCA 2F6RA 2BCJQ 2XITA 3R8CA 2FGJA 1EFUA 1ZNYA 4RFSA 1E2FA 1P2SA 4R98A 3RHFA 1KJZA 4YXWA 2FE4A 3G82C 4NCIA 1Z6TA 2J46A 1ZD1A 3AV0B 1TX4B 3B82A 1FMLA 1SGWA 3AP3A 8OHMA 1U90A 4OK5A 2IYQA 4ZDIA 4C0BA 4JLBA 5CDFA 5JRZA 3LAWA 3I62A 4BRWA 1CKEA 2VHCA 3U6KA 3MJRA 4AK9A 2CHVA 1E99A 2O8DA 1DARA 1OFHA 1AK2A 2IS1A 2IYLD 4HUTA 2OSBA 4EUNA 1P61B 4M1MA 4TMKA 3TK1A 4L9WA 5B30A 1G7CA 3REGA 2JEOA 4YXWD 5DIFA 1YU9A 2YWGA 3K0SA 2OXCA 2ZPTX 3AVYA 3PG5A 4K81B 5E3HA 2FFHA 3IO5A 3AUYA 1Z07A 5JHHB 3GD7A 1AS2A 4XVUA 1XJ0A 2JLQA 1KI9A 2XB2A 3G0HA 5K8IA 3T15A 1S1MA 2HF8A 4UNRA 2GCOB 2KJQA 3PUVA 2ZRLA 4R71A 2XAUA 3OIYA 5SZJA 2GRJA 3IUYA 1FTNA 1QHNA 4HZIA 1QZXA 2V1UA 1NN1A 3Q7QA 4CEJA 5AUQA 3U5ZB 2HDNB 2NO6A 2ZJYA 1S3SA 1XMSA 4Q18A 1XX6A 3BB3A 2NOAA 4CZ2A 3CONA 4NL4H 3EPHA 4G1UC 3K0EA 1U0LA 3A1WA 2WWHA 3EX7C 2WKQA 2OILA 4PQFA 1ZUIA 4D0LB 1KJWA 3EXAA 4QHSA 5FTLA 4WA7A 2MMCA 3QF4B 4P32A 3TQCA 5C1BA 4Q4AA 1WBDA 3D8BA 1TF2A 2PH1A 3CIOA 3RS2A 3I8XA 3MMPA 1R8SA 1BS1A 1N6NA 3ZQ6A 4A6XA 2B92A 2FA9A 5GADl 1XTSA 3AEZA 4M9SA 4YQFA 1G8GA 4A0RA 1EK0A 1ZM9A 1CLUA 3AP2A 2CBZA 4QJ3A 5JS7A 1SVKA 2VEDA 3CUEF 5L3QB 1VHLA 3ND9A 3TAUA 2FF7A 2WTUA 3L8ZA 3MRSA 2HF9A 4DT1A 2V7QA 1CJUC 3D3QA 4FCVA 5G3YA 2C77A 3B2EA 1OLOA 2WKRA 1F6BA 3F5FA 1G20E 2VP9A 2R9VA 4FW9A 3JZAA 3RC8A 2GETA 1AIPA 1ZUHA 2GJAA 2VA8A 4YDSA 5JEDA 3OZXA 3Q9LA 2ZIAA 1P2TA 4F4IA 3KQUA 4JL6A 5TY0A 5JS8A 5K8TA 4DHEA 3AGQA 3K9HA 3PQCA 4P31A 1J7KA 3CLVA 4ZKEA 2P67A 1YZGA 3GLFB 3IIKA 1G41A 4RKEA 3I72A 5FTMA 3U44B
chains in the Genus database with same CATH superfamily
4NFYA 2CDNA 4HNQA 3DV2A 3EJ6A 4MGZR 4HLUC 2O2DA 4JUFA 5EKUA 4OFXA 1JFLA 4MTCA 3MCAA 4AMGA 4NONA 1GPLA 3NCTA 3AJAA 3CR3C 5KYXB 3BA6A 5CLHA 1FC0A 4I2NA 3HY4A 2YHSA 3CXRA 2CYBA 3PICA 2OFOA 1JSLA 3ACBA 3T3GA 2O1EA 1X39A 2Q21A 2Z09A 5CJJA 5ALQA 2NO9A 4X20A 4BNYA 4QQRA 3RDPA 3SY8A 7ABPA 1QJ4A 5FT9A 4BNNA 1NP3A 4C7MA 4GI2A 1IIRA 2R44A 3QELA 4ZCQA 5BSRA 3UBMA 4YCCA 3I2KA 1IXYA 1T9KA 1VKOA 2WSLA 2VSNA 2D0DA 2YW2A 3SGLA 1E4YA 1P7PA 1U2DC 1RQRA 3BGWA 3QKIA 1JR3D 4YT4A 3H1TA 1G5HA 4N3CA 4UMEA 1Q0RA 1SUAA 2P1DA 3MQ2A 1R0YA 2FSHA 3FJOA 5JPDA 2O4UX 2ZPUA 5TQ2A 4XSGA 1IHUA 3MT7A 5C51B 1PQ4A 1UBGA 1E7YA 2QE7A 3HUEA 4IQGA 4FK8A 2VL7A 5HKLA 3P0FA 2QDKA 3DMTA 3OLCX 4U7TB 3BG5A 3EGCA 2FUCA 3UJ7A 1T13A 3RVJA 5B3KA 4ZO7A 2KW5A 1VI6A 3KAPA 4NU5A 4AJ2A 5K8JB 4LDPA 2GS9A 3ZHBA 5KIAA 4OHPA 1JQ5A 2CYCA 1YIDA 4JLUA 1R27A 5EEHA 2Q5CA 4RABA 1DX9A 4WASA 1Z2AA 2YHBA 4OU5A 2JZCA 1XVTA 4FGSA 3H9JA 4A15A 1SG9A 3IJ5A 2YVUA 2QRUA 1EFPB 4G36A 1RACA 3LUAA 4MLPA 3U3XA 1Y98A 4PTLA 5IXSA 4QTZA 1P60A 4E08A 3UMVA 2AXQA 1S3GA 1JS1X 3MQ4A 3NWEA 2DPHA 3OZUA 4J4HA 2FEKA 4MQEA 3I5XA 5FI0B 3V34A 1PWXA 3QPAA 2Y8EA 5K9ZA 2NZ8A 3PKZA 2IV3A 5KPJA 3NHZA 1UH5A 1NBOA 1SHZA 3REFA 1V3QE 3K0CC 1UBLS 3RVRA 3ENQA 4P7BA 1J00A 3CVJA 3U3OA 5B6JA 3T7AA 2ZRNA 3WYAA 1Z33A 3BXPA 3NONA 4L2IB 3LD9A 2D0IA 2OZKA 4LBWA 5JO9A 3AM5A 3I01A 3VR1A 7REQB 1Z3CA 1H1LB 2FYTA 4ECEA 5BNWA 1ADBA 5JDCA 1QU3A 4TTIA 5EKDA 2PNFA 4BVFA 1FVFA 2Q6KA 1W4BA 1CF9A 4KJZA 1V1RB 4FMPA 4B6FA 1V4BA 1D4AA 1C7QA 4FDLA 1X9IA 3BMNA 1M1ZA 5CK4A 1KQNA 1DAEA 2XOEA 2A4MA 1FX1A 4TKUA 5AK3A 4HVAA 3LPLA 4AAYA 1WG8A 1ZXXA 1CU1A 4DFDA 1PR4A 4A5SA 2ZKLA 2I2BA 2FEMA 1MQAA 3OP4A 4KYTA 1AN9A 3DR5A 1T3TA 3S68A 2PSSA 1JFFB 3TR0A 1R6UA 2JARA 3IKLA 4BNHA 1KIAA 4WIAA 4AZWA 2P2ZA 4BKOA 3H6KA 3W6PA 3PXAA 4C06A 5HOEA 3N8DA 4O2AF 4XIYA 1Y4AE 1GO2A 3F5SA 4XX0B 1B8NA 2G76A 1R6BX 1Z5PA 1MX5A 1ZI6A 1DCTA 1Q14A 2A1TS 2GZMA 2JBHA 4L5CA 4RLFA 3Q1LA 4PG6A 2PN1A 5JCJA 4A6DA 2QHXA 2X0KA 2WM8A 2P6NA 4Y2RA 4ZARA 3TTTA 4Y1GA 1PT9A 4JK3A 2AFHB 3PEFA 1HDEA 1ZI9A 2PV0A 4P4UA 1BXRA 2MR5A 4TPKA 2K5UA 3F5QA 1Q12A 4GD3Q 5A7GA 2YX1A 1NHWA 3GJSA 4BFTA 4U2DA 2PUGA 1R16A 1UBSB 4EVRA 3F4BA 3LDUA 1E4OA 1R5BA 1TF7A 5FULA 5KKNB 1HZZC 1VIYA 3NT4A 4LOIA 3UOWA 5FV4A 4GPD1 2WD7A 4WGGA 3HBFA 4Y1FA 2AFIB 2BI7A 2HL6A 3E58A 1SUPA 1ZLYA 2P2CA 1Q3KA 2GCIA 1Y33E 4MMZB 4YMSA 2B83A 5P21A 1ZAYA 2R11A 4OTZA 1E2EA 3OTWA 1ZGZA 3KSZO 5L7WA 3CF2A 4K9NA 1L1RA 2TMKA 2QTVB 4ABTA 2ZYIA 4B2IA 4X6UA 2DLNA 3D0OA 3L7DA 5MN5A 1X8LA 3RU9A 3E9YA 4QULA 1AU9A 3NOVA 4IDAA 5CA1A 4Y6RA 1A95A 1LDGA 1V11A 4OXYA 2BEVA 2CCGA 2CNWD 1VC2A 5FWYA 1XRQA 4LVOA 1ECLA 4AZSA 5HGJA 4BV3A 3UJNA 3MTAA 2QMZA 2VSFA 4BASA 3MMXA 1YR1A 1TYCA 1Q20A 3AUAA 4C0AC 1E2LA 3B5JA 1TL7C 4ZOCA 2JIDA 3T1YB 4Q16A 1C9DB 4KE6A 4BGVA 4QPDA 4CMJA 3AZOA 4JAVC 2Z9DA 4PHFA 1O94D 1ZNWA 2C1XA 1GTL1 2ZDHA 3AR9A 3MCZA 4J1SA 3AUKA 4QASA 4RVUA 1CF2O 2VNIA 4GPTA 3LOUA 4GQBA 3T54A 2Z1MA 4MKFA 3LJKA 4B4DA 1QH1B 2H5LA 4H0CA 1CUCA 4WHMA 3UK7A 3NWBA 1P29A 1MV8A 4MUEA 4OSPA 5CX1B 1D07A 4ENTA 3TECE 3NHBA 1DIAA 3RUHA 2AL7A 2P9FA 3HCNA 4ZOLB 2LWIA 4JI2B 2H54A 2OGSA 4LKOA 2QN6A 3V1KA 1C7EA 1E2NA 1LPAB 4LXXA 3T94A 1WD7A 1OE0A 2IYZA 3JPYA 3ESBA 4GVXA 4X1KA 5F35A 4B81A 4EDHA 1ORDA 4YUAA 5CG2A 1KZ7B 1NVUQ 1RBZA 2E4AA 2DM6A 2O8DA 1Q21A 1MQ8B 1W4ZA 3MINA 4L9RA 2PZ8A 3I53A 3QVXA 4KWEA 3MOIA 3HO8A 6PFKA 2X9LA 3BMQA 2Y1KA 2YY6A 3IMKA 3VR5H 2J6BA 1G21A 3HVKA 4JLNA 4BLTA 3JZDA 2EW8A 5JYCA 1Z4KA 5L6LB 1DKRA 3GB9A 3PT9A 4MITA 2O8DB 2IXAA 3N58A 4GDMA 3CMCO 2BL4A 3NDIA 5AKJA 4BLOA 2CY0A 1YAJA 2VRCD 3ITDA 2V5UA 3MJTA 1QONA 4P7JA 1SD1A 3ITEA 5JWRA 1IUKA 1GQQA 2XRYA 3GRVA 3PRHA 2VHEA 5EZ5A 2X13A 2B8EA 2X40A 2ZWIA 4XGQA 3UUGA 3OZIA 3KOZA 4ACBA 3UHOA 3I6IA 4QUIA 1MN6A 5CEEA 4DA9A 5KVCA 2GTPA 1D0SA 3SZOA 1S2DA 2AB0A 2M32A 4JA2A 3DBIA 4R3WA 4CCSA 4UM9B 4R4JA 2DOKA 3S55A 3VYTB 1M2KA 2P9HA 4PZDA 1LLQA 3VR6H 2J3IA 1U1EA 2DH6A 1Y5IA 2VQ3A 4G63A 1NC1A 1YJ8A 4HRAA 1XZGA 2BM9A 3D3KA 3QVLA 4P8RA 1GUDA 2FQWA 1SBZA 3ILXA 2Z04A 4ND2A 3MGBA 1I6MA 4IH4A 1WVMA 1PF7E 2PFKA 2HMYB 3U1BA 4DDMA 1T9DA 1OXUA 3CX6A 4CKEA 5ECDA 4RH0A 3GGCA 3JQ6A 4Q4HB 4A82A 2Q3BA 4WBNA 1M8KA 1YXMA 3MWJA 3D1VA 3P2YA 1UDXA 4LI3X 3T7CA 1F4VA 1EP1B 2ATIA 4BMYA 3BH6A 3ADPA 4TTAA 4BO5A 5AICA 1S9DA 4BLSA 4R84A 2XYHA 3CCBA 3N2GA 1M75A 1BN7A 4AI6A 3N7AA 3WAJA 4FYYA 5CDYA 1H1TA 1JPNA 4NATA 2J1LA 4HFJA 5IZCA 2HUNA 4N5LA 4HX5A 2A9JA 3X43A 4FINA 1NUPA 3KKQA 4G8CA 4J9VA 1QZZA 2PZFA 3N7TA 4XQGA 2GESA 4EHKA 5F7XA 2WBLC 2FLWA 1BQ4A 5I7WA 3GV0A 4EG4A 3W2FA 1CUUA 4Z0NA 4FB5A 3V80A 2FMIA 4RWEA 1E0SA 3WMWA 3WGLA 1CHDA 3OKFA 3RBZA 4B4OA 2CLFB 1B0PA 4ODIA 1YI1A 4OHFA 1ZOPA 5JSYA 1CULC 1ORIA 3LCMA 1IYZA 3MS4A 3BJMA 4TN1A 4GLJA 4G81A 5EWMB 5K3FB 4PE5B 4JXXA 2FEOA 2FXVA 3I83A 4W5HA 4EZEA 4A91A 1T8UA 2YIMA 1JEQB 1T3GA 4V0SA 2AZ4A 2GOYA 3SVLA 3GPIA 1VM6A 2AUNA 4KGXA 4NDZA 4H0FA 2QZPA 3BE5A 5E6SA 1G2OA 2GAOA 2BGLA 4S1NA 5BUCA 2RONA 1HM5A 4FOTA 2D7CA 2FPLA 5K4AA 3HDHA 2DPXA 2PGXA 1NASA 1XMPA 4F21A 4DADA 3WKCA 4IX1A 4KW7A 4Z86A 1JECA 3HCFA 4LYAA 2VCHA 1RQ2A 4XWOA 2NVWA 2FWBA 3TX2A 5K0ZA 2Q9UA 3DCJA 1XXHE 3HCOA 4Q6BA 2H08A 2M1ZA 3ZLBA 2PJZA 4Q7QA 4W82A 1F20A 1C7ZA 1RYHA 3H9GA 3TJRA 3U4IA 4ZC8A 5BT8A 3G13A 1A4XA 1GZ7A 1C0EA 3UAVA 4Z54A 3EHEA 2VYNA 5IJ0A 1LC3A 2ZS7A 2ARKA 1W1WA 3GLRA 3I64A 3L1IA 4CTKA 1OFGA 3NVMB 2DHEA 3GFVA 1CY1A 1XZEA 3VI3B 1U2TA 4X20B 4AX4A 4RHXA 2BZ1A 1ZSNA 2AJDA 3IR7A 2DJ5A 3D6HA 5BRNA 1XDUA 5TMEA 3QELB 4QODA 1VKRA 3MM4A 3DFZA 2R6FA 3QXCA 2OCXA 3GRAA 4D9CA 2PCLA 3ADOA 4IDDA 3BK1A 1JR2A 1TIKA 4BKMA 2R1VA 2ZJ2A 2CUTA 1Y5LA 2P62A 4OI2A 2K87A 3MUNA 4TRMA 4WFIA 1L9KA 3VYUB 3UK2A 4DSNA 5FUYA 4I36A 5EJ5A 4DZRA 3JAKA 3FMGA 5TQ2B 3AG5A 3PE6A 2RGGA 1GPDG 3PHJA 4BAZA 3NTOA 1PR3A 5FPKA 3K2EA 3QVVA 1PVOA 3WLSA 5EIBC 5C8VA 2H29A 2VUUA 3NS7A 3DMPA 3R3SA 2NTEA 2WHXA 2AZMA 1ISRA 1WF6A 1LSSA 4FOOA 4MCJA 5GPBA 4ZWNA 2W70A 4YLEA 2DPYA 3SAJA 3UWKA 5K2OA 3NC4A 3FUCA 3OC6A 3C74A 1ZMBA 2BBSA 2DFVA 3OEHA 1MP0A 2WV7A 4PO8A 1LU9A 3K32A 4UASA 3AYZB 1T36B 5IAKA 2O2YA 2ZUUA 1RWPA 3USZA 2OVBA 2XRZA 3Q2OA 2J3LA 1LSUA 2QVCA 4OVKA 3G2PA 3ZK8A 5KQLA 4XD7A 3OJWA 2ONYA 3B1WA 5KUTA 5LNK1 2YJTD 1C5KA 2VQDA 1KIFA 2Y6VA 3OCJA 4JEIA 5D3ZA 3C43A 2PUEA 2C3OA 4MQEB 1LA2A 2GN8A 1ZVVA 4MVJF 3G1WA 2Q6VA 1DG1G 2BHNA 1PSZA 2XGMA 3CX3A 3MLBA 3TN7A 2H1SA 3OECA 3AF1A 3V1NA 2IPNA 2P4SA 2PYZA 1ECJA 1XYYA 2ETVA 1M34B 1N2SA 2QAGA 3KJFA 2D1FA 2VRWA 2A58A 3B3GA 1VRWA 2FHPA 5FOSA 3RBVA 4KMMA 1I2CA 4KQ2A 2QUJA 4MW1A 4X97A 5JMTA 3IUMA 4KXFB 4RGQA 2QXTA 4FMCB 3D1JA 4X7BA 1K5PA 3Q6IA 1Z4JA 2C94A 2F1OA 3KM0A 3LYHA 3OE7A 4AIRA 3L2OB 2WIKA 2YNMC 4EYEA 4NVRA 2ZFUA 4HAYA 1OIVA 4MYCA 5AJUA 2XLCA 3KEMA 4B5LA 3JRXA 4YJHA 5C1PA 3FHTA 1Y6ZA 3BMNB 1HF3A 4FZ5A 4UC0A 2BGRA 4TKUB 4B2LA 4F6RB 2ZROA 4CM4A 3OT5A 2PX3A 4PSDA 4WFJA 2FMUA 1E6MA 3I37X 5E3IA 4HNGA 3BULA 2EFHB 5ILOA 2VK4A 4B4WA 1U3TA 4O25A 1M5RA 1PR0A 1MIOA 4J0QA 3TFWA 4ZGGA 4QQ8A 4ZD6A 3IFSA 3SJ7A 2G04A 1GPJA 4AJLA 4BEVA 4DTCA 6CHYA 1FU8A 1ZZGA 1R5OA 5TC4A 1BEEA 1QK4A 4WXMA 1FRZA 4QDKA 4E13A 1T0HB 5AVKA 1TEHA 2CLLB 2ZYVX 4MRMA 2ONKA 5FRDA 1LPSA 3OC0A 4HC4A 2VF4X 4RDIA 1S4MA 2PMCA 2RAUA 3GCWA 3PFCA 2ZETA 3QSGA 5LL6P 2UZ3A 3I8SA 3KBBA 3TSWA 4C3ZA 5CTAA 1J9ZA 2OCYC 1MORA 1JV2B 3HCDA 2B1IA 1OVGA 1U0RA 2PG3A 3ECAA 4UULA 3V4ZA 3DDCA 4BE4A 4EIWA 1Z25A 4KBFA 2XOKD 3QVJA 5H7XA 3NNDA 3AVOA 2RAPA 4R9NA 5EE9A 2QA5A 4AQ7A 2H59A 1S8AA 4I4IA 4M8IA 3FI0A 1UOQA 3OJFA 4CG2A 4GZMA 4IUBS 2O8BB 4G0NA 1LBSA 2BHTA 2O7NA 5LUBA 2H7CA 3I73A 1Y8AA 4CHGA 1E0DA 1E6CA 1GKKA 4ZCLA 5GV7A 5ILGA 1OPRA 4EENA 3EZ2A 2O2CA 4TTVA 3B8HA 3DHEA 5IFLA 1SIWA 3VR4A 2H16A 4CMGA 2G5TA 3EDYA 3DF7A 5HR5A 3MSXA 3Q85A 1BJRE 2WPDA 1JKJA 1MAVA 4QO7A 1X8KA 2BFWA 1T91A 2JFVA 4K0RA 4DIKA 3C70A 1I1NA 1V37A 5AM5A 3SK0A 3LXMA 1GNPA 4AB1A 4YAKA 2BEVB 3KYCA 5FWYB 2G6BA 3QUAA 4R2JA 4GM4A 4W7SA 2CWDA 1JHMA 1ZZEA 2FY8A 2H4WA 2WF5A 1DB3A 3AB8A 4L50A 5DT9A 3JVUA 5ULLA 4ZYYA 2HIAA 1NMYA 4ZOBA 4NX2A 3RUCA 5EJFA 4ARAA 5GJWC 4B3GA 4BGEA 1E32A 2P3SA 2ZIGA 1N7HA 1NR5A 3GBPA 3RK0A 4Y6GB 3TLXA 4L6CA 2CZGA 3I45A 1LPNA 2NX2A 1DEHA 2X5XA 3ON5A 1K6MA 1RXIA 1TCCA 1SUDA 4G9BA 4HZUA 5K0GA 4JMPA 1C29B 3EPLA 2PVCA 2PKCA 4URUR 1PGJA 1RQPA 2VDVE 2RFLA 2ZYWX 1OYOA 2MYTA 4BO9A 4AF6A 1Q0HA 2DBVO 3ZHSA 1X9HA 2RHDA 1SVWA 5K1ZA 3LYAA 4PHHA 1IBCA 4NHOA 4QRDA 4PLFA 4BNUA 1AMUA 1FVXA 1M66A 1VL0A 2D5CA 4W1SA 1H0HA 4GYYA 1XPRA 1ZP6A 2J08A 4X1KB 4YLYA 2F4VB 1ZK2A 4MB0A 2RGXA 2P6RA 3HVJA 5F33A 3OH8A 2G09A 2W8BA 1DAFA 4KUEA 4Z7JA 2G06A 4NAVA 3C6QA 4IJKA 4CU5A 3BMQB 1MBZA 2HHHB 1LZKA 3D6UA 2QLFA 1B00A 1G21B 5EIOA 2H52A 4LX0A 2IY8A 1MW9X 3CE9A 2OYSA 2G70A 1V4NA 1KZ1A 2UVQA 1QP0A 4F9GA 2VZLA 3NM5A 2G77B 4OB6A 1YQTA 4KZKA 3WP1B 4MUIA 3C24A 1M5UA 5JFOA 3J7AC 4NNPA 2J9FA 2C4HA 1QR6A 3L0OA 4G5GA 4L4UA 3ETGA 3OTHA 4N6GA 3M1AA 1YRHA 4KWIA 5F9FA 3RQIA 2FR8A 3M0EA 4ZQHA 1C4KA 1XQ1A 5DTEA 5IM5A 1ATIA 2VSYA 1E8MA 4JKOA 1KOFA 4RAQA 3QV1A 1G5QA 1Q15A 3MCUA 2W2OA 3ZKWA 2GFIA 2GKGA 4D97A 2UUAB 2QZSA 1TB4A 2Q8QA 2F62A 3SBXA 4OG2A 4B33A 2IYWA 2EGHA 3DDUA 1NLZA 1KTVA 1K8ZB 2C2KA 5AM4A 5JYEA 4M53A 2WWVD 2I2WA 3QPVA 2NQ2C 4K0KB 4HP8A 3LX6A 3T3OA 2WOJA 3NRJA 1N8KA 2AJTA 3IX7A 4TKVA 4TTRA 1OGIA 4FI3F 4WKGA 1U04A 2GZ2A 1C3VA 2AQIA 3F7OA 3KSUA 2FLKA 4U0JA 1P2DA 3IRVA 4CKEB 1ZOIA 4LC1A 4TUYA 1PTJC 2JGEA 4WBNB 4IVPA 1RKBA 3K5PA 1SBTA 4LQLA 4DUGD 2PZJA 5BSKA 1VJCA 5BUQA 4A27A 1HWYA 1CTQA 2EKLA 2YIDA 1HFKA 4KH1A 1W581 3U17A 3V1MA 3DL0A 1R0KA 1KFCB 3N2GB 1T2AA 3GUZA 1VMKA 5DP2A 1F4LA 3GCZA 4NYJR 5AUOB 4X62B 4UPDA 3W6NA 1I3CA 2X3UA 1LW7A 1UZNA 4B4KA 4S24A 4EQ6A 1BQ3A 5E8RA 3HJNA 4KR9A 4JI6B 1DE0A 2Q6IA 5HE9A 4YRGA 1T0JB 3THSA 3W3AH 2RH9B 3RS7A 3W5SA 5JR3A 2BJWA 1G1AA 2C7GA 3ROPA 2CF5A 5M5BA 3OHSX 5TPWB 1MXHA 3TXYA 1TJNA 3DPUA 4FNGA 3IT3A 1V1MA 1X1BA 3P2OA 4KV9A 3PEYA 3FPHA 1TNDA 1ZY2A 3ELYA 3QHAA 2MYPA 2RBGA 3BK2A 3ZQKA 3NHRA 4E5UA 1Z29A 4F1WA 1R5JA 3LL4A 4ZT5A 1JG4A 4YWJA 2QMHA 1JJ7A 2GK6A 5E6SB 3H65A 1Y1PA 1ZXBA 3CLTC 1QO7A 2GLTA 3Q2IA 2WICA 3VVMA 5D2CA 4FDMA 2WWIA 4BYMA 3ER9A 2Z5VA 3SLGA 3OSUA 1VPWA 2HLDD 3INTA 1G42A 2IZ7A 3GJ6A 4M89A 1ZD9A 4URYR 5IBQA 4BQIA 2G9UA 1OFTA 3CH5A 1B0UA 4LBZA 5DTIA 3AR4A 2Z2YA 1H0KA 4D26A 1KERA 3A27A 1YQUA 2AA3A 2RGNA 1EDEA 3BEOA 5DW0A 3BGOS 4FUQA 2AG6A 2O05A 3VOAA 3VYSB 2O19A 3H75A 3LH5A 2VJQA 4TLDA 4UNPA 2JZOA 2VK8A 4X71A 3ZD6A 2ACVA 4LHYA 3FFXA 4EJ2A 4CTMA 2ZW9A 2X2OA 1OX4B 2BMVA 3ZHZA 5IRCD 4CL3A 2VDRB 3A25A 5IJ0B 1FRVA 3DKRA 4BXOB 4YMTA 3T9EA 3K20A 1PWEA 3SXJA 3ZE0B 4TL8A 4Y8VA 1WZIA 1L5QA 4BWVA 4Z4QA 1Q0QA 2EEZA 2JGAA 1YL6A 3BZWA 4COKA 4BNXA 1S3IA 3FTFA 3ZXYA 1U99A 2AFHE 5CXXA 4RVSA 1HI9A 1XHEA 3T5CA 4Q24A 4FNOA 4C6HA 3RSSA 3QKSA 4R6WA 1LWOA 5EHXA 1U98A 4NZZA 1UAYA 1ZJZA 1NZDA 4YRAA 1ISMA 1D0VA 1KAEA 2FRDA 4ZGWA 2QYTA 2R1VB 1HE2A 1DKLA 1EIZA 1U81A 2JK0A 4EI7A 2DHRA 3E2IA 3PU6A 3Q3HA 5KNBA 1U8YA 1ZMRA 1TQHA 2AFIE 3JAKB 4OP1A 5GONF 1Y0BA 4BNVA 1UINA 1SVNA 4CE6A 1EWQA 4V0NA 4HDRA 3NIBA 5JBIA 4J3NA 3ABSB 1YB7A 2P0EA 3E4DA 1UZLA 3OA2A 2XT6A 1CY6A 1M8PA 1CJKC 4QXRA 2FZ5A 2EU8A 1IQUA 1KKLA 1WDLA 2RGDA 2VNAA 3OU7A 4R9UC 2JHGA 3KPYA 4F7WA 2X8AA 4WKCA 1JNYA 1QMPA 4IHAA 1LXCA 4JLPA 4Y9UA 4RDXA 3SR0A 4WH0A 1FRNA 1C50A 1HDCA 1G3IA 1PJRA 3T5MA 4G41A 3TTXA 3QVKA 3H0KA 3ZWYA 3L1KA 1BDMA 3FYHA 2XOXA 1IRIA 1TZKA 3T9AA 2A0XA 3DO5A 4BQNA 5KQMA 2NTJA 2G0AA 2LCQA 3RC7A 2O1WA 2ZIXB 3WK8A 3QE3A 3LOPA 4FW8A 1J1UA 3AKCA 1T2UA 2M6KA 3A3YA 1XTUA 4G9EA 3GP8A 1BAPA 4NV0A 1B1CA 3PXUA 3D8TA 4X8MA 2GBLC 1QV7A 1C1YA 2EZ4A 2QAGB 3GPBA 1JHVA 3FVWA 3BGDA 4GXTA 4RFVA 3LSTA 3SM3A 1T4GA 1BIFA 2CLMB 1UK6A 3GMDA 4Z9BA 1JG2A 4O33A 4ICIA 2OZPA 3I0NA 1NVVQ 3DC2A 2R6DA 2RHLA 4I8XA 2FQXA 4D45A 1FS5A 1S2LA 2DX7A 2CHUA 1IY2A 4JZYA 1TRHA 3LHSA 4Q4DA 5CYFA 1IZ8A 4UHJA 4YJHB 1SC4A 1C8KA 1Y6GA 1NYLA 4N3BA 3NDBB 1Z74A 4F86A 1GAWA 1SWWA 3OESA 2PMFA 3TE6A 1K7CA 3PYLA 1EFVA 3KQLA 3BA1A 2JAWA 2J3KA 3H11A 3IQEA 4ND5A 2GMWA 1QQ7A 4O2BB 3LQYA 1DRVA 1VL5A 2YJ6A 3LA6A 4INAA 1RZRD 1XTPA 2GJSA 1P3Y1 1MIOB 1Z5UA 1TEVA 1UT5A 2IBMA 2R3SA 3P45A 3TL6A 4E5NA 4UQLA 1ESEA 2FV8A 3JD1A 2OHJA 2ZG6A 5FL7A 2XA2A 1AD2A 1U4NA 3WHKA 2GN2A 3AXTA 4IH9A 4U8HA 3ROEA 2GEBA 3ZWCA 1NLMA 4WK6A 2X76A 3JVVA 5BORA 2ZCJA 3HNOA 3T5BA 3WYCA 5CPFA 3DFMA 2I3AA 5EKXA 3R7DA 3RC1A 3FDJA 2II6A 3K6RA 3NHKA 1E69A 1E9EA 3HWWA 1N2EA 3TKAA 2R48A 3UG6A 3RFFA 1ZM4A 2WT8A 4XASA 4ZI7A 3UY4A 5A03A 5AVVA 2B4AA 2H0RA 4Z51A 1GCGA 3LWNA 4US0R 2Q4RA 3W5UA 2DQYA 1JG1A 3DW3X 1GUFA 4I50F 4EA6A 3MWGA 4JLMA 4FJ1A 4V03A 1XTKA 1KQFA 4Z2AA 4DRXB 4TQUS 2C7BA 1T1JA 2A88A 2NAFA 4DQUA 2MSCB 4D9KA 2KS6A 5JXGA 2CBXA 3BOSA 2HZBA 4E2ZA 5KPDA 1N0WA 4DXHA 2AK2A 1SIOA 3EVEA 1HV8A 4EGQA 4IDOA 4CFSA 4OBBA 5KNCH 1ORWA 1YC2A 2NYRA 1RVDA 2MSKA 3E1SA 2XWPA 3VHRA 4DW8A 1YHZA 5EHIA 4I4CA 2WUEA 2QUZA 1M2VA 4LK2A 3TIIA 1N5DA 1F2UA 2OUIA 2WF8A 3NB0A 4IJQA 4B8YA 3BCUA 1YFZA 1L7NA 2R79A 3MZ0A 3IQZA 3ZIAA 1FDTA 4L3WA 2EEPA 4HR7A 3HP1A 3QHQA 4PZ9A 2I33A 1OXTA 4QBGB 4BFVA 4EP1A 1DTEA 3LYUA 2ODTX 4IQ4A 4WZAA 4Y2SA 4E30A 2WIGA 5ARCA 2POCA 3TH5A 5IANA 2EZTA 1WX1A 1CG6A 5IX8A 2XWSA 3L4SO 3WKAA 1HEUA 1RE0A 2XCQA 1D1QA 1K5DA 2J0EA 4P2BA 1SHTX 5BSUA 4DA7A 3A4IA 1SZDA 3DCYA 1M73E 4JBHA 4HZUB 4IDBA 5IM4F 4ALLA 2NQTA 3FF4A 3WWYA 2PTGA 1RE1A 4HUQA 2WIAA 2EL7A 4ZAXA 1KE2A 2Z0MA 4L22A 2JD1A 3AR3A 4MQMA 2NZ2A 4H27A 4AKIA 1DNPA 3PFIA 1C9KA 5CDHA 2EHDA 4PS1A 4TMFA 1MAWA 1TZ2A 3C8ZA 3JQQA 3OFJA 4BWFB 3MHTA 3GJ0A 2YASA 4HPWA 5TF4A 3BRWD 4X44A 2EOAA 2XJ4A 3JQCA 3R23A 1EXNA 4Q9HA 1B6TA 4IIBA 3UUWA 2VTBA 1R0WA 1O2DA 2BPOA 2JI9A 3AWDA 4GI7A 2VTEA 3EEQA 1KAMA 4A7PA 3PNSA 4X6LA 3I6BA 2W8BB 3M33A 2DECA 3WK4A 2VG8A 5JZSA 1BCSA 1M6HA 2RBEA 2YWJA 1KI4A 5I9TA 1NDQA 4FLFA 3DT9A 2C58A 4NENA 5HCNA 4MQBA 1Y6RA 2AKEA 2IEBA 3CZPA 4R0MA 1EX1A 3HDQA 2B94A 3EOAI 3NOOA 3OIDA 5LQRA 5CFZA 4NQRA 1OWNA 3AK4A 4UDYX 2Q0SA 2P2YA 4ZYLA 3IQIX 2JGDA 5JANA 5AW5A 1QIFA 2UDPA 4RY8A 3HKDB 3IUNA 3V00A 2ZSFA 2YRXA 2ZVQX 5LQUA 1WB9A 2REQA 3C5WP 3ADBA 1EYZA 3ESRA 1D6SA 2JH3A 3KJNA 3AR6A 4JVMA 3PNBA 5ALMA 4R7ZA 4CGYA 4BTEA 3VNQA 5C8ZA 4I99A 4WBSA 4TWIA 4I4NA 4MV0A 1M7HA 1R00A 4HLQB 2H5JA 1IN5A 4KIUA 1VJRA 1JXOA 2XSZA 1TA4A 4JXKA 4OP3A 2HB6A 5TVGA 4LG1A 1ENZA 3D2AA 5KQGA 4KCGA 4AMZA 2H92A 5CFPA 4GR4A 1BW9B 5EMKA 1ZAKA 3VKUA 1PZFA 1L4HA 4F72A 3KJGA 4RIFA 5D51S 4TKVB 3PWSA 2B7LA 1YZKA 4UOQA 3TXXA 3Q6MA 1C2YA 1E2JA 3TIVA 4XE5A 3X44A 3R5HA 4RJ2A 2E87A 3RSCA 2R8OA 4JC5A 1USUA 3HCRA 721PA 2PL5A 4B09A 3RWMB 2ORED 1HLPA 2HA0A 1YZLA 4DLPA 1SXPA 4EBFA 1Y5MA 4TUYB 1U8XX 2HF7A 3OQHA 1NP6A 1ZCAA 5T6BA 4E0BA 2YMLA 1A4UA 5BOSB 2I6FA 2YWBA 3FOAA 4RAOA 2QRZA 4I0WB 5EE1A 3UKDA 1E6LA 1P4RA 1MIHA 5D8DA 4I2VA 4BFUA 5JFGA 1W36C 1QRDA 5DO9A 4PPQA 3H2BA 4J91A 1YS9A 4FFPA 1ZINA 4RACA 4WTOA 1DAGA 4IUCS 1QG0A 1PTKA 1UOOA 5ICCA 4OH7A 1XD2A 1KNXA 1NVFA 2B5VA 4KPFC 3VR5A 4G26A 5FBQB 4BY9E 2BFFA 5HQJA 3WLEA 2L19A 4EQ6B 3TW4A 2X6RA 3G2LA 1RXYA 3H1PA 3OEWA 5AM0A 4BQEA 4YRCA 4ZMRA 3T52A 1MB0A 2ZBQA 4KWTA 4GFDA 4HFNA 4F4CA 4N5DA 3TQOA 5BXYA 2GHQA 3TQRA 1VCMA 2OCBA 1LV8A 2XDQA 1KYWA 4XLTA 4E32A 3U39A 4E2WA 1V1MB 4C6SA 3KZKA 4DBLE 2FG6C 2IL1A 4HSGA 3ZDEA 1BDBA 3QEMA 3EEFA 5CM2Z 1M34E 3GLFA 1Y7TA 2JKYA 2W5UA 3AHEA 1ZOSA 1Z18A 4F5DA 4QPZA 2QX8A 2Q1TA 2AWNA 2CXOA 3CRVA 3V4OA 2BTQA 5E1BA 1RWOA 2W00A 4Y1EA 2XE7A 4YPOA 1QMGA 1GG8A 3ZE7A 3N59A 1UWCA 1ZK1A 3IULA 1YZQA 4J6EA 2JHCA 4UTRA 1ECCA 1BYUA 2P79A 3VR6A 3NHLA 2J3EA 5LZ8A 3GZ4A 4I1UA 2W6OA 3WGNA 1NQVA 3F5DA 3PFNA 1T35A 5LYYA 3PC4A 4LOLA 1MJGA 4U8GA 5D3MA 2O8VA 1Q2UA 1KOLA 3R7AA 4TLAA 3ND5A 4I7EA 5KHLB 3A9CA 3CO0S 3SZRA 1DG3A 3CVUA 1U1FA 4RKWA 4Z99A 3GF4A 3BREA 3FPJA 4W8GA 5DX1A 3JRWA 4HYEA 2OCDA 3MYYA 3GCXA 4JLAA 4JX8A 1OT3A 4R0NA 4S3MA 2BEUA 2Z98A 3DTVA 3MJCA 4PFKA 1XLTA 5EWJA 5L40A 2KM1A 5JWHA 1T9HA 2NYVA 4KN9S 4QARA 3VMFA 2V65A 4FB4A 4QBKA 4ASUA 1FP7A 2FRVA 2NUPA 1VPLA 2JIZA 4OI0A 1QVZA 4OQDA 2O0HA 2WRZA 2XUJA 1BHQ1 2IHVA 1JEEA 1LPBB 5FXMA 1RMTA 4CM7A 2A78A 5AJZA 3N3BC 3NPAA 4MVJP 3NAMA 3IDQA 1C3XA 5TDHA 1F8YA 2QVYX 1PEKE 1W0KD 2YICA 4D96A 4EMTA 3QKSB 2GCEA 2PA3A 4TWRA 4LWOA 2K6GA 2PZBA 4LY6A 2VT3A 5H59A 4GBED 3DMHA 1NBWB 3A9RA 4EL5A 1ND5A 3FUWA 5DT2A 3ZY2A 3ZW8A 4CIAA 3AKZA 3WGKA 1SEVA 1VL1A 3OCYA 1Z8DA 1LFAA 2J9XB 3EA0A 2W90A 3MGAA 5L4SA 1UDCA 1XDZA 2DETA 2QF7A 2FWIA 3S2ZA 2OY0A 3WK7A 1O9HA 4CV2A 4O2LA 1WA5A 2QLJA 2QRNA 2QX7A 4ZU3A 4C03A 4Z49A 3TR5A 1GFIA 1HRKA 4G97A 1CR1A 4F11A 4MR8B 4I1PA 1Q19A 3CSDA 5ALHA 4NS4A 4HDRB 4KWHA 3EGXA 1RD4A 1P45A 4TSKA 1ONOA 1NUHA 4B8WA 1ESCA 1SRQA 2C2ZA 2ZVPX 4EUEA 1XMXA 1NBEA 2BLNA 2ZJ0A 3D8HA 3NWOA 2R7KA 2IUUA 2Z58A 1BX0A 1NONA 1HK7A 4RK7A 3T1HB 2CL6X 3AR8A 1VGQA 3L4BC 4ZVUA 2C2OA 3FX2A 1UT6A 4L8VA 3JV7A 4RM3A 4F4UA 2B61A 2IEGA 3ENWA 2DAPA 4R9VA 4N0MA 5A9TA 3MTEA 3RF7A 1Y63A 4IW3B 4DDTA 2R00A 3U60B 1Q1GA 5JSFA 3HYLA 4WY5A 2GYYA 2ZSKA 1BMFA 5DYTA 1CZKA 2IGBA 2GBFA 4C2AA 4P4LA 1U0BB 3F46A 3VC2A 2AI3A 2HOQA 2MHCA 1QIJA 1XIVA 4IDCA 5FBRB 4CMBA 4DM7A 1AURA 1N2GA 1M8FA 1CP3A 3AI1A 3RSFA 4D9IA 1GRCA 1KC1A 3RAEC 1Y6QA 3QY0A 1K7YA 3NP9A 4UFOA 2PM8A 5AW7A 4DSZA 2ZPAA 1ZCFA 1Z15A 1M2FA 2JH9A 3TMYA 1W1IA 1SVSA 1ONSA 3DMYA 4CL8A 3IBCA 1PZNA 5JI3E 3IPLA 1WPXA 2ALJA 4M9UA 4GOJA 3BMCA 4EPVA 3IILA 3UMJA 4IOJA 4JI5B 1XZJA 3TGWA 4E12A 2GI4A 2RGAA 2XD9A 4LVNA 1AO3A 4G1CA 2X7XA 4M0MA 5IZ4A 1G21E 3NH9A 3H11B 1YUNA 1ZA2A 3TINA 3ZD7A 5ENVA 3N39C 1FK8A 5GIOE 1D4ZA 4P0QB 3I0MA 3FVRA 2XX3A 4A8JC 1QB7A 4BQRA 4DDWA 1RLIA 3ETLA 3CCFA 2BGGA 3DMDA 5CT8A 4PZCA 1W6UA 3ZE2B 1HQDA 3NDPA 3G59A 3W78A 2D5AA 1GQFA 3A2NA 1LB1B 1RCTE 1LSOA 3QU7A 4DVGA 1EE9A 3IAFA 4FBGA 4PR0A 5C7YA 1X7WA 2WT4A 4GVLA 4X3PA 3A36A 1P2GA 3DSRA 3OOHA 5DX8A 4F9FA 3PDCA 4P7GA 3E8SA 2BEWA 1ZGGA 3FPLA 2IC5A 3AILA 3DG9A 3QWFA 2DUWA 4DKXA 621PA 4QHYA 4ZI7B 1FJ2A 2GD0A 2Q0QA 4QXPA 3WR5A 4GKAA 5BSVA 1LDNA 1T24A 1ZUNA 3T1QA 3GLGA 1CV2A 3S7TA 1P2FA 1QXSA 3D0KA 1TTTA 2JVIA 1QPB