2G9NA

Structure of the dead domain of human eukaryotic initiation factor 4a, eif4a
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
216
structure length
202
Chain Sequence
GVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEPSAIQQRAILPCIGYDVIAQAQSGTGTATFAISILQQIELDLATQALVLAPTRELAQQIQVVMALGDYMGASCHACIGNVRAEVQLQMEAPHIIVGTPGRVFDMLNRRYLSPYIMFVLDEADEMLSRGFDQIYDIFQLNSNTQVVLLSATMPSDVLEVTFMRDPIRILV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Eukaryotic initiation factor 4A-I
publication title Comparative Structural Analysis of Human DEAD-Box RNA Helicases.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 202
sequence length 216
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2006-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2g9nA00
2C9YA 3CX8A 3MG9A 4TL9A 2QUZA 4XD7A 2IF2A 3QXHA 4XOIA 1XTKA 3KKQA 2OM2A 2CCJA 3P1JA 5H1YA 1KI6B 2Z83A 3AVOA 2OV2A 2QNRA 2LKCA 3WNBA 4LBVA 3ZDQA 4A2WA 4F93B 1CP2A 3T1TA 1TUIA 2PH1A 1W4RA 4MRPA 2O0KA 1I4LD 3DDCA 3BFKA 1MABA 2AD5A 2H7VA 2WPDD 3MGCA 5CDFA 5C4MA 4DDVA 2DHRA 4L9WA 3QPUA 4G0NA 4RD4A 3U7EB 1UJ2A 2PCLA 3A8TA 1HE8B 3CH4B 4HEJA 2G1JA 3THXB 1FX0B 1XDBA 3CB4A 3P32A 3EIEA 3OESA 4AY2A 5CYOA 4ZIRB 4OHXA 1KO5A 4QNMA 4YMVA 5JRJA 3H2YA 2IBMA 1LNZA 4A8JB 1AJEA 3CNLA 3T1VA 1T5IA 1A2KC 1R5OA 3HP1A 1VYVA 1CJKC 5KDLA 2D62A 2Q3FA 4X8MA 4D4LA 4C0AC 3VU9B 1GM5A 5E7IA 1PV4A 1Z08A 3C14C 2ZRLA 4QRHA 5F3WB 4XWKA 5C1BA 2GRJA 5FTLA 4O3MA 2K5UA 2G3YA 4A2PA 2IS4A 1SVLA 3TLXA 1KMHA 3O8BA 2RKOA 3LWNA 5GVRA 4ZI2A 2ZJYA 1FQJA 2AD1A 1GNQA 2BCGY 4X8HA 1Z83A 4TMTA 3AKDA 2VRWA 4L9SA 4C0SA 4XD7D 3VHXA 1G6OA 2F1HA 3K0EA 5FBRB 4EAQA 1WB9A 2RAPA 1TL7C 1P2SA 1UKVY 2HCBA 4BLOA 1D2NA 3UMRA 3PV0A 4EPVA 4BFYA 2R9VA 2YJTD 1G7CA 2ZRIA 3KFVA 2QI9C 3GEHA 3W8NA 3F8TA 3A4NA 2RHMA 2FZLA 1N5JA 3K9NA 4EPYA 3VR4A 2F55A 2VEDA 4MKFA 1W0JA 4I1OA 1KI6A 1SXJE 4KFSA 1G3UA 2UZ3A 4URUR 4ARZB 4TLDA 2YOFA 3BAFA 2C5LA 1T9HA 1ZINA 1XCMA 3DM5A 1X8KA 2Z4RA 1T91A 3T12A 2HV8A 1S8FA 1R0XA 1D9ZA 1QVAA 2J7PA 3U3JA 3VTKA 2F43B 4XSHA 4R71A 1T4GA 4M2LA 4JLKA 5E4FA 1EFHA 2WJHA 3W9YA 3DVLA 1DAFA 3TBKA 5JWHA 4M9ZA 4PC6A 2XNDA 5D3QA 3NC1C 4OK6A 1WXQA 1MKYA 1KDPA 3VNUA 1Q12A 4HB4A 3B60A 1C9KA 4L15A 3KB2A 4TMXA 3IILA 3AVWA 4HYYA 3ADCA 1EK0A 4MRRA 3EXAA 4ZKDA 3CWZA 4B3CA 1FL9A 4Q1CA 4F4IA 2O5VA 4M1MA 1R0WA 2A5DA 3CBQA 4A8JA 3T06B 1UKZA 2V1UA 2BEJA 4UQOA 2IL1A 2A5GA 2IWRA 1N5KA 1U98A 5JI3E 3R20A 3EZ9A 1N5IA 1VMAA 1KO7A 3B1XA 3KDSE 4B3XA 2FDCA 5GJBA 2WIBA 1D5CA 1XJCA 2B6HA 3GLHA 3VU9A 2ERXA 5FPSA 1O3YA 2WVJA 1F48A 1W49A 4NDZA 4KAXA 2VHQA 3CR7A 1EX6A 4WXPA 1Z06A 2PCJA 4LGMA 2V7QA 4Q7MB 3PJRA 1K6MA 3X1ZA 2ZI6A 1IXRC 1G8HA 3OZXA 1GP2A 4IW3B 3AF4A 1FQKA 1EFCA 2ZRKA 2CHQA 4HLDA 4O0MA 1XTRA 2ZRFA 1W0JD 4F38A 2EWWA 1DAHA 3AUYA 3QKRB 4MKGA 2ZU6A 4DLXA 3KQUA 3HR8A 4YQFA 4GZMA 5FH9A 1CKEA 4OHZA 1IJEA 5FOVA 2WMNB 4PTLA 5GVSA 1HURA 2RGEA 4TZ6A 3NIBA 2NMVA 2A2ZA 2J7PD 4DIEA 2ZI3A 1S3GA 1XD2B 1RIFA 3IEVA 4JKIA 1Q1BA 3B9QA 2B8TA 5HZKA 1W2HA 5EP1A 2Q9AA 2XNDD 1W2GA 1WF3A 1ZMXA 1HA3A 3UMFA 2QGZA 3KTAB 2HDNB 4Q7LA 1E69A 2XITA 3HPRA 2HF9A 3MJRA 2RGGA 4G5RA 3U3MA 3VR5A 2QMOA 2F7SA 2FPKA 4GI7A 4F7WA 4Q7JB 4AYXA 4DZZA 4RZ2A 2J1LA 4P33A 4PQFA 2J5XA 4HATA 3LRPA 1AS3A 3PR1A 1YU9A 4HSEA 1WCV1 1XTIA 5DE3A 2R62A 2ZQ5A 1GZSA 3DM9B 3I1FA 3X1XA 4AC9A 3PG5A 3CF6R 4P4UA 2CLDX 3W5IA 1JR6A 2RB4A 2V7QD 1HY3A 1XNJA 1TUEA 2OUKA 1W47A 3F5FA 3R9IA 3SQXA 1FUUA 1N6OA 4DHEA 2JGNA 3CF0A 2XSZA 2QT0A 2QBYA 1WMSA 4DCTA 4NYIR 2X77A 4V02A 3A1WA 3KQNA 2GBLC 1ZBDA 2CJWB 3R8CA 1U0JA 1KDRA 1YR9A 3ADKA 1W44A 2ORIA 4NE2A 4Q9IA 4LJ5A 1TMKA 4B75A 1J8YF 1VG1A 2IW3A 3GPLA 4DVGA 5IHPA 4C0KA 1HYQA 3BE4A 1Q1EA 3TIFA 1VYTA 2YKGA 4GPTA 2NO1A 3UPUA 2HEIA 1IHUA 1DBSA 3X1WA 1FP7A 4LBYA 1YJ5A 2WAYA 3NXSA 1DG1G 5CJ2A 1MT0A 4IOLA 1S4QA 1VECA 1E9BA 3OIUA 2AWNA 2IF0A 3DZ8A 4MH0R 3SE0A 1NN3A 3TGPA 1E1QA 1SVMA 2ZS8A 3MUFA 1E96A 4FW9A 1XB2A 4LOAA 1HT2E 4ZI3A 2F1IA 4EJSC 1RKBA 1T3LA 3QI2A 2ZPTX 1MOZA 2Q9BA 3EA0A 1R8QA 5HZHA 2ZE6A 5AJVB 4TMVA 3Q3JB 2R6GA 2AXPA 3MWJA 3MWYW 3NH9A 4B44A 1OFUX 4U7DA 5E95A 2OE2A 2UVQA 4P4SB 3R7WB 3TUZC 4IVRA 1FFHA 3HJNA 4GRAA 4MYUA 5FPTA 2Y8EA 1KK0A 2J41A 3EPJA 2W2XA 1E0JA 5TMPA 4NPHA 2JLUA 3ZIAA 3GLIE 3C5HA 4I99A 3EW9A 1RJ9B 2UKDA 1E4VA 4BFTA 4HAXA 3PIRA 4JL8A 4XWAA 1U81A 2NOAA 3N5CA 1Z47A 4Y0AA 1JXOA 2F3RA 5DI3A 5F2EA 1M2OB 5EZ6B 4HUTA 2VF8A 5A4JA 2QT1A 1UEJA 3HYTA 4PZZA 4RD0A 4LJ9A 1OH7A 2F1RA 4JVNA 3W6NA 2Q9CA 2H16A 1GL7A 1KGDA 3SC3A 3SS8A 4ACAA 3AP3A 4Q01A 1G6HA 5DNYB 4BPBA 1P2VA 1KKLA 1SXJA 1HE1C 2KSQA 3F3YA 1I2DA 3K0FB 4GSYA 2IYRA 4EQ6B 3K9LA 2H1LA 3U7FB 1Z6XA 3SU8A 1G5TA 5IRCD 2EVWX 3IHWA 4JBWA 3U4QA 1U0HC 4OJKA 2PLFA 2C9CA 3NHBA 5H8WA 1E9FA 1N25A 3VMFA 1E1QD 3RRYA 5TXGA 1DAEA 1ZM7A 1W36B 4M9SA 2ORVA 4ZDWA 3OEHD 1VCOA 2YWGA 2QM8A 3UG6A 3N2IA 1R4AA 4NCKA 4OKSA 1D6JA 3SI7A 2OXCA 2Z43A 2ZVPX 3AKEA 5G3ZA 2IS2A 3U44B 3NWJA 1KNQA 3MWKA 4KSCA 2P5SA 1Y3AA 1T3SA 1RRCA 2CBZA 2ZE5A 3QF4A 2ZM5A 5JJKA 2QAGB 1I4DD 1W4AA 4IFEA 1LV7A 1NI3A 2GVDC 4UNSA 2FOLA 5LB2A 3ZVMA 1NKTA 2QAJA 3THYA 2FGKA 2O8DA 1GWNA 3GJ7A 2ZTSA 3NBYC 3R7WA 4BRUA 3D3QA 2W83A 3KL4A 2O8FB 1KY2A 2J0SA 4C7OB 3AKYA 4DIDA 4Q4LA 4DSOA 2CDNA 1P6XA 5KSPA 1ETUA 4KJZA 1QG4A 3RRNA 4C4PA 2GESA 1YZNA 4QBGB 3AVUA 1RJ9A 4TL8A 3JZMA 4RKEA 5BXQC 4XJXA 2E1RA 4Q9KA 1XTQA 2WKRA 2Z0MA 3C4JA 1WQ1R 2C9OA 3TSWA 1SXJD 4C9BA 4A92A 3NC0C 1AZTA 4OHWA 2GAOA 2Z4SA 1XJ0A 2OCAA 3G0HA 1G8PA 3RDPA 2HYDA 5DYIA 1NVVQ 1JJ7A 5TVKA 2XB4A 1RVDA 4CF7A 2IYXA 1M8PA 5AUNB 4HLQB 1NN1A 3KX2A 2IYZA 4UJ3A 4TTQA 4XIGS 3SBEA 1RRFA 4E07A 2VP5A 4JLPA 4LZZA 3RWMB 3BK7A 4DLUA 2PLRA 1BMFA 3A4MA 3OFNA 1D9XA 2DR3A 1OYYA 1Q22A 3QKTA 4JLJA 1ZNWA 1VG0B 2BHRA 4IDHA 1NIJA 1NRJB 2J45A 1G1MA 4QXAA 4QJ4A 3AP2A 4KSBA 5K8LA 4GZLA 4UXJA 1GFIA 3FMFA 2BDTA 4JSYA 1E32A 3THWB 3AVVA 1M6NA 1T0HB 3LVRE 4X8OA 4II7A 4Q1AA 3P4XA 4NP6A 3EZ6A 3B2EA 4LPKA 5FFMA 5SZHB 3DHWC 4WAUA 2CCGA 2CE7A 5G53C 3TK1A 3T5DA 1OFTA 3FE2A 1QBKC 1Y63A 3TUJC 1N6IA 2SHKA 1OFHA 3DZDA 4HLCA 4BFZA 4TSFA 2P67A 5AUPB 1TPZA 4IJMA 3CRW1 3UWOA 4BE7B 4DCSA 3GLGE 2YYZA 2ODBA 4AIIA 1NVUQ 1PZNA 1MR3F 2F9LA 2R6CA 4IOMA 4NH0A 4WBSA 4C2TA 1NLYA 4JVMA 4F92B 2ZI9A 2D06A 5TARA 3SR0A 1J99A 3FOZA 1K5DA 1NVXQ 2GZAA 5GJWC 2O8BA 1G4UR 3W5JA 2A5FA 4GOJA 3GEEA 4DLYA 4QGFA 2GCNA 5KDOA 2JJ1A 3B1VA 2W2TA 4V0OA 2C8VA 5CIQA 1S9HA 5AUQA 4LRWA 5FL3A 4B47A 5JSZA 4BLQA 3FFAA 2GHIA 1U8YA 1NY5A 4ERNA 3C7KA 1UKEA 4DBLC 3OFND 2XZLA 3EC1A 4D0GA 5AWFC 4OQMA 4YDHB 4CEHA 3CPJB 2WWFA 2XAUA 3FHCB 1TTTA 2EFHB 4MRSA 4PPFA 1C4OA 2EFGA 4LY6A 3KQKA 1UBEA 4JYCA 1OSNA 2EYQA 1JJVA 1KK3A 2REOA 3I73A 2BVNA 4RD2A 1ZVQA 2CVFA 2IHBA 4IDNA 4LDJA 3IEUA 3EWSA 2GVZC 4HDCA 4YXWA 3FPAA 3H84A 1RYHA 2HJVA 3B1ZA 3TR5A 2RGNC 4QHSA 2OAP1 1PUJA 4A2QA 3NG1A 4BLRA 4EPTA 4XWOA 1OV4A 1N6KA 4M0LA 5DSZA 4B3GA 4TSFD 1KI1A 2G6BA 3LQQA 3THWA 1EESA 1N6PA 2OCBA 2JLWA 3DOFA 2PMKA 1XX6A 1Z63A 1E2QA 3GLIA 2WV9A 1L4YA 3D8BA 4P32A 3B85A 3W8RA 3ADDA 3BS4A 3HWSA 2DWPA 3A36A 1CF4A 5K8IA 3DEFA 4JL6A 2EU8A 2ZRBA 5E7JA 2GTPA 1Z07A 1DADA 1P2TA 1JBKA 4DCNA 2C78A 2JJ1D 5JHHB 5L3QA 4BLPA 1GNRA 1ZM3A 3OIVA 4K81B 4LI0A 3H0KA 4BZQA 2I1QA 3GQBA 1OT3A 1JNYA 2WSMA 3IPYA 4RZXA 5FPHA 1IM2A 3BWDD 1ZRHA 1A1VA 4FCWA 1ANKA 5IK2A 1CEEA 4V0ME 4Q9HA 2E87A 3OIWA 4BFUA 4Q9JA 1LB1B 1NJGA 1ZJ6A 1KSJA 2BIFA 2J0UA 4JMPA 4MUAA 3ZVLA 3ZZUA 3WP0A 1NMYA 4C0HA 2IYSA 5FUXA 3TUIC 1MABB 4BWYA 3CZQA 2GBLA 2QSZA 3QVUA 1CIPA 4YXWD 3ASYA 2TMKA 2P6UA 4EFMA 4PHHA 1E6CA 3QENA 4M1WA 1MO4A 4Q48A 3PEYA 3CRMA 1EFUA 1OXVA 2JLRA 1CU1A 1KO8A 2QEQA 5EE9A 3MSXA 2QMUA 3H86A 4PAMA 2NGRA 4H1UA 1G3QA 2NTYC 3WMGA 1U8ZA 1PLJA 1Z3IX 3QE0A 4D82A 4PQYA 4URZR 4ITRC 1J2JA 4PX9A 1BS1A 2CVHA 1G4AE 3QG1A 4FMDF 1YZKA 1NVWQ 4ZO4A 4YMSA 2A30A 2XTZA 2A9KA 4LUCA 4EJSA 4BASA 5TDHA 4DXAA 3LA6A 1Z0FA 2AKYA 3BD9A 4U02A 5JEEA 2V4ZA 2X1VA 2D7CA 1ZCAA 4LV8B 1AM4D 5JWRA 1KMHB 2ZAOA 1P60A 1HQYE 2BMDA 4EIWA 2B21A 2RHDA 3RRMA 1XF9A 2JA1A 4KU4A 4HAYA 1G16A 2KBEA 2I1VB 4DSNA 3UG7A 4AKIA 3GMTA 3U6BA 2WMOB 1S3SA 1TAGA 4PC3A 5KTYA 1XWIA 2DWQA 3JVUA 3LLUA 1YVDA 3A1TA 4KBGA 4Q19A 2EFDB 5IK2D 1OFIA 2KBFA 2C04A 1KI2A 2IYLD 4W9MC 2D2EA 3MLEA 3B8HA 4A0RA 4MDEA 3KXLA 4M9QA 4PAQA 1NN0A 1GSIA 4F4CA 2PT5A 1KY3A 2ZSFA 1GRNA 3IUYA 5JRZA 5ELXA 4B2IA 1LY1A 1D8TA 4MYTA 4OBEA 2G0NA 3JVVA 3LBHA 1ZNYA 3QXCA 2BOVA 2HCJB 1PLKA 1SKYB 3RNLA 4CEIA 3AQ4A 1SVKA 4CZ2A 5L3SA 2GILA 4A0FA 2DPXA 5AJYA 2QROA 5KU1A 1P73A 1W0KA 2PEZA 4TLEA 1B23P 2QP9X 3FWYA 3GEIA 4DKXA 4BRWA 1FZQA 3TE6A 1DVRA 4IDOA 4KO8A 1SZPA 1WRBA 4UNQA 1GUAA 1QHHB 2OFOA 4KXFB 2ZI4A 1DTSA 4JIMA 4D0LB 3GLGA 4TT3A 1OLOA 1ZUIA 4LHYA 2XGJA 3ZD7A 5D3MA 3VR1A 4PQRA 2H17A 2AN9A 2W00A 4K8OA 4PHFA 1TQ6A 2QP3A 4HAWA 4MYHA 4NCNA 1OW3B 2ONKA 1TADA 2PL3A 2ZS7A 3GLHB 3TQCA 2ZVQX 4BFXA 1KSFX 3KXIA 4KHZA 3X1DA 5M04A 3B1WA 3QKSA 2CLCX 4Q1FA 2NO9A 2QTFA 4TZ0A 5F9FA 3EZ2A 3LBIA 4M21A 1P9WA 1LFDB 1L8QA 1SQ5A 2GJSA 3FGNA 3UATA 1SVIA 3L8ZA 2ZYUX 1RE0A 1VCMA 1DE0A 3FMOB 1VKJA 1E9EA 3WNDA 2V3CC 3AUXA 3VFDA 1A4RA 4IDPA 4OQLA 4X8LA 1P3JA 1N3BA 3ASZA 3LY5A 3CF2A 3RWOA 4TTRA 2GJAA 3F0TA 1E2PA 1MO5A 4PC1A 5EJEA 2Q3HA 2WOJA 4GOXA 2GXQA 5BYJA 2WIAA 1OPXA 2HUPA 3LW7A 4KFUA 4CT4B 5KO2A 2IHYA 1Z6GA 1B0UA 5KSZA 1M7GA 3AVTA 2QGNA 1SVOA 4G3XA 2PZFA 2C95A 1W0KD 2W0SA 1MO6A 3CPHA 1II9A 1F2TA 4B2LA 2L0XA 1HUQA 2H18A 4LHZA 3U61B 4S2EA 2ZAMA 4W5JA 4TT3D 4AI6A 4FCTA 1N0UA 2YWHA 5J4HA 1Z5ZA 3W34A 1VG9B 2EW1A 1GIAA 1N2CE 1UBCA 1AKYA 3CUEF 3K0CC 1FNNA 3A58B 4YONB 2DB3A 2P5TB 3N2EA 1FMJA 2FMXA 1QHHA 1P5ZB 4NYMQ 1D2MA 1S2MA 1GVNB 2G77B 2VSFA 3Q9LA 4Q21A 1W46A 4LJYA 3CKLA 3EIHA 4CRWB 2RH5A 4N0EA 3KZ1E 1XMIA 2QY9A 4JZKA 4M8NE 2CL0X 2Z6VA 5JS7A 1TU3A 1X8LA 2REBA 4M1TA 4GMXA 1S96A 1AIPA 2NIPA 3VKHA 2QBYB 4MGYR 3LVQE 2YC4C 2FFHA 2XTNA 1W5TA 2FG5A 1ZU4A 2O8EA 1EWRA 1UF9A 3LO5A 4LX0A 4PPGA 5L8VA 1EX7A 3B13B 1RC8A 2JCSA 2JLYA 1IXZA 2OLJA 3QUSA 4GBMA 5FBWB 4V0MA 2RGDA 3MJHA 2WHXA 4A15A 1RRGA 3ONWA 2D4HA 1PJRA 1LS1A 1OE0A 5LD2B 2RGBA 3I8XA 4CIDA 5SZJA 1EWQA 1VG8A 1IQPA 2IXGA 2VHCA 5JCPA 4HAVA 4HUQA 4L8GA 3QOFA 4FCVA 1ESNA 2J0VA 2QENA 2I4IA 3RC8A 1DS6A 4XVRA 3CM0A 2AK2A 1W5SA 2ODNA 5CM8B 1KTVA 2F6RA 2LKDA 1F3OA 4AK9A 1GDDA 3KQHA 4NL4H 4XSGA 2IS1A 4WZBE 4O2RA 1OB5A 4UNNA 1EFTA 4Q47A 4LV6A 2R6AA 2W6ID 5HTKA 2O8CA 5DIFA 4WIAA 3AVXA 1TQ2A 3C16C 4EFLA 5JJIA 2B8WA 1QVRA 3BH7A 3T35A 3FMPB 4B2PA 1DAGA 1XRJA 5KPJA 3QJYA 2XJ4A 3IKJA 2W2VA 1KZ7B 3IBYA 2WJVA 1XEWX 4QFMA 821PA 1N6LA 4OHYA 3FVQA 2QPAA 4TWZA 2OEPA 3UIEA 2QA5A 3WHKA 4B6EA 3PITA 1G64A 4N1AA 3AB3A 3B6EA 5FL7A 4DWJA 2RGNA 4NZYA 3O8CA 3GLFE 2FN4A 1KI3A 2CHVA 3HPQA 5DI3B 3PEUA 4B48A 1ZIPA 3ZS9A 2ZU0C 4B34A 3AF3A 3TQFA 4GP7A 3TVTA 3T61A 3SFVA 3LDAA 1DO0A 4MQBA 5JS8A 2WBLC 1CTQA 2PBRA 4YDSA 3FMIA 3P27A 1Z28A 2PT7A 3ZGXA 2ZS9A 2VL7A 3CNNA 4M53A 2FH5B 2GCOA 4PHTA 2YHSA 3K70C 4MRNA 4DB4A 2WM9B 1F60A 1J7KA 1SXJB 3I3SR 3L0OA 1XEXA 4NMMA 4ABYA 5EP2A 1VCIA 5JEDA 5J40A 2CNWA 2GJ9A 1Q3HA 1OF1A 4AG6A 4ESVA 1YR6A 4PO9A 1L2TA 4XTCS 3U4QB 3O8RA 1G7SA 1T3HA 4QJ5A 3TVDA 1ESMA 3VAAA 3LBNA 4D2IA 3ICEA 2JAQA 2FE4A 3NKVA 2X8AA 4QKQA 3TW8B 3P20A 1V5WA 4BEJA 1U9IC 1XPOA 3BB4A 1OJLA 3G5UA 1KK2A 2NZJA 1LF0A 4B6FA 2ZANA 3RS0A 4D80A 1A82A 2ZJ2A 3MMPA 1KI4A 5E3HA 1RYFA 1ZUHA 1TEXA 3BBPA 4D0NA 5C2JB 5AUOB 3QF4B 3EWAA 3OEHA 4A1FA 2BMJA 3K09A 4D6PA 1CJTC 1K5GA 4G5GA 1G8YA 3UKDA 5DHFA 3AGPA 3M1IA 1Z0DA 5CYPA 1GKIA 2HF8A 3THYB 1WE2A 4I81A 3CO5A 4A0GA 4DLRA 5BN4A 3L2OB 3GJ3A 4C0LA 2CE2X 2O8DB 2QU8A 4JSTA 2BV3A 3OAAD 5FL7D 3PVSA 3EAQA 5EUQB 1UDXA 1XD9A 4I1UA 1ODFA 1E2MA 4Q4JB 4W7SA 4TL6A 1J8MF 2YOGA 3QSYA 2AFHE 1II0A 4LV5B 4Q1EA 4WA7A 1YZGA 2BKUA 2FZ4A 5HE8A 5CB8A 3SYKA 3U2QA 2GXUA 3B5JA 3EZ7A 1HTWA 1BKDR 1Z0KA 4KBFA 2QPTA 2CNWD 4KCGA 3I92A 2X19A 2ASEA 4FIDA 4POAA 4Q4HA 2EWVA 2BWJA 2PZEA 3RS4A 3MFYA 4IDQA 1RRPA 5JLJA 1U2RA 4CYMA 3O47A 1QG2A 1G18A 1G8GA 4CEJA 2WTUA 1R5BA 3FYHA 4PHGA 1UAAA 1R6BX 5KSOA 5LPNA 2G83A 2A78A 1XPRA 4JS0A 4D4KA 5FUWA 1KSHA 1SHZA 1XXHE 4TMZA 4I4LA 2C2HA 1GL6A 2QSYA 2ZITA 1AQYA 1UKYA 5JI2E 4TQUS 3EPLA 1FTNA 1EXMA 3WY9A 1JAIA 4JBYA 3NVAA 4LCBA 2ONJA 4UKDA 5EE0A 3PUZA 3KKNA 1XMJA 5JFGA 3K0SA 5EXTA 4U00A 3QVVA 2H57A 4Q1DA 1YQTA 2XZOA 5SZIA 1E2DA 4QBHA 5B57C 4C30A 1YZLA 5EZ5A 4RFVA 4PR0A 4FWIB 3TNFA 1I2MA 2W0MA 2X2EA 2ZR7A 4MRVA 1XP8A 1P7CA 2HXSA 4DLTA 2VHTA 1QRAA 1DAKA 2KB0A 2VPPA 3DL0A 3LNCA 1XCPA 2JDIA 3M6AA 3SOPA 4HLUC 2R6FA 5B30A 1OIXA 2JLQA 4JBXA 2X2FA 1E99A 3QXJA 4MGIR 5FR1A 1DAIA 1QF9A 5L3RA 2VA8A 4KI0A 4RVCA 2WJYA 3PXGA 3S1AA 4M9XA 4PZYA 4AYTA 2IWHA 3KQLA 1DPFA 3FDIA 2O8BB 2CHGA 1GKUB 2FSIA 1A7JA 2ORWA 2XZPA 3L8YA 1DOAA 3SEAA 2CMKA 1C1YA 4Q4JA 4A0HA 4C2UA 1ZYUA 4FXPA 5FOUA 1R7RA 1G7TA 2GK6A 5JSZB 2D7DA 1CJMA 3KB1A 4IFBA 1IXSB 4PPNA 3TAUA 3THOA 1A5TA 2KE5A 1Q0UA 4IEIA 1TX4B 5CK5A 1JI0A 1ZM4A 2FV8A 1SULA 5FTKA 3RS5A 4AD8A 3IBGA 3QEOA 1T8UA 3X2SA 5E7MA 2J46A 1P9RA 2WWXA 4M1KA 4QNRA 3B1YA 5EE5B 4NU0A 2GAAA 3PCRB 4M4SA 4TYWA 2VHUA 4CEHB 3REGA 2VYFA 4PANA 1NBME 2ATVA 2NQ2C 1N5LA 3T5GA 4O2LA 1ZD9A 2P3SA 3PQCA 4PAOA 5A0FA 5DH9A 3NBFA 2JATA 4EPXA 2DFNA 4OL0A 5FBQB 1G8FA 4NYJQ 1T6NA 5EUMA 4DLSA 2I3BA 3GCGA 3DKVA 4JYBA 2W6JA 4A4DA 1ZUNB 3RS7A 2JDID 2D74A 2FFBA 5HCIA 1ZC4A 3QIAA 1V43A 1MRNA 3QY0A 1WDTA 2J87A 1QHGA 3EA5A 1NLFA 5HKKA 2YWFA 3GLIB 4MKIA 1KAGA 1QZXA 2NZ8A 4CT5A 3JZAA 4HB2A 4B33A 1Z8FA 1ZP6A 4Q1BA 4NTZA 3MWLA 2MSCB 2YZ2A 3GLFA 2FF7A 4PZLA 4RCZA 3DMNA 4UNRA 2ZREA 4B3DA 3C41J 2QQ0A 5F98A 2QTHA 1OKKA 2WKPA 1JEDA 1ZD1A 4H1VA 4ACBA 4US2R 5L3QB 2BJVA 2MMGA 1AS0A 4TQAA 1LF5A 4UNPA 5H68A 2IA5A 2ZUCA 1U94A 3BIFA 3K0CA 3A1VA 4HB3A 4CW7A 5JHGB 4TN1A 3TRFA 3PEVA 4HDOB 5FOTA 1Q1QA 1H8HA 1G19A 3K0AA 1XXHB 3RLFA 1DELA 2XXAB 3U60B 1E4YA 1MH1A 4B32A 2DFKB 2VBCA 3IIMA 2H8KA 1IN4A 5KNDA 2J0UB 4DEYA 3BH6A 2P6RA 3GJ0A 4DEXA 3B9PA 1E98A 3HU2A 3T34A 3LX8A 4TLAA 2ZR9A 4UXIA 3L43A 3FHTA 4KYUA 1JQJC 4HZIA 1AA9A 2ZJAA 4MGKR 5BN3A 5P21A 2W6JD 2ZRAA 3UMSA 1UFQA 5HCNA 1VDZA 1M7BA 2DBYA 4TL7A 1WP9A 3ZH9B 3EC2A 5FTNA 1UBFA 1JQLB 4Q4AA 4BEBA 1Z2AA 1J90A 4NCJA 5HKKD 4OQFA 3A4LA 5LDDC 3MD0A 2IYQA 2GDJA 4G5SA 2OSBA 2J59A 4KVAA 4ZPXA 2ZE8A 1G17A 1GG2A 1M1YE 1YZTA 3AEZA 4DUGA 2ZJBA 3TH5A 1OKKD 1TF2A 2FFAA 4V0KA 1KZGB 4ASUA 1RW4A 1U90A 1DG3A 1X1RA 3HR7A 3IHLA 3KJGA 1IN8A 3L82B 4IKEA 4RD3A 3U7HB 1NSTA 2JEOA 3FFBA 4Z54A 1CS4C 1CJVC 1IBRA 4Z1MA 6Q21A 4D4JA 1OIWA 1TEVA 3CZPA 3C5CA 4MA4A 2ZIAA 5CITA 3QEJA 4D81A 2ZROA 2OXRA 5IF9A 1H8HD 4DDUA 4L16A 1VIAA 5FBVB 1LVGA 3PUYA 2R6DA 1JALA 3CRVA 2DY1A 1IOZA 2IYUA 3QKUA 2PJRA 2AX4A 4Z8YA 3U7GA 1KSGA 1YZUA 3I5YA 4JLBA 1U99A 1U0LA 3T1OA 3LD9A 1S0UA 4DT1B 1KKMA 3FKQA 5AJXA 1XXHA 3IO3A 3VKWA 2FSGA 2XXAA 1NL3A 3BB1A 5DLQC 2BMEA 1BYIA 2O0HA 4Q02A 1NKSA 5FTMA 4WZAE 4BZPA 1G7RA 3CRQA 5CM9C 2ZRCA 1XTSA 4LYHA 3GJ8A 1NMXA 4R2IA 4CEIB 3TR0A 3ND8A 1IONA 2BBWA 3GFTA 4A6PA 4JVSB 1G41A 4IRUB 2OT3B 5L3SB 2ZJOA 3ZZTA 3KKMA 2N1BA 2ZEJA 2ZRDA 3RABA 3FTQA 4J0QA 3W3ZB 1X3SA 2WWWA 3RVBA 3PUXA 4US1R 2JLSA 3CWQA 4IEEA 2BM1A 3AF1A 4P31A 2AXNA 2IYWA 1NNEA 3OEEA 4DUGD 2PX3A 4JT2A 4RD6A 4ASUD 3GLGB 4JLAA 3TKLA 5JBQA 1E0KA 5D3MB 221PA 2GEUA 3NBZC 4QC2A 3RSOA 1U9IA 1J70A 1P2UA 1QHNA 3PUWA 3W6OA 1Q1ZA 1FW6A 4Z1MD 2XX3A 1BH2A 3GJ4A 3NEYA 1VPLA 2V1XA 4UJ5A 4M1SA 1JEEA 1QDEA 5DGXA 1BO6A 5FTJA 4F91B 3PEWA 5EXXA 4QGAA 4FMCB 1NP6A 4RFSA 1XFAA 4LBWA 2ZYTX 4Q18A 3QKSB 5FI0B 1AZSC 5K8UA 2B7CA 4LYFA 1G9XA 1US8A 3WP1B 3WXMA 4TYPA 1KJYA 1AGPA 1JB1A 5J4LA 4LHXA 2GF9A 3LX5A 4QL3A 2F3TA 2OCPA 3A1SA 4LC1A 1NBMA 3SJCA 4LSGA 1KYIA 4U5XA 1OXXK 4XTRA 3SN6A 8OHMA 4BFVA 4LJ6A 4DT1A 1W48A 3K70D 2VH5R 1E2LA 4LJ8A 3FKSA 4Q66C 1XTJA 3I62A 2GK7A 4GMDA 3SJZA 5FPKA 3RSLA 2HT1A 3REFA 1NSFA 3KJEA 4CGZA 1P4SA 5GJVC 1R10A 3OE7A 521PA 4B73A 4QHYA 5DN6A 1F2TB 3DOEA 4HB0A 1N0WA 4OI0A 2XJ9A 3OEED 1BOFA 4OI1A 3ICQB 3D6TB 1OHHA 2GKSA 4B43A 4ILEA 3VR6A 1EFRA 2Q6TA 1XBTA 2VSXA 2AWOA 2FSFA 3LXXA 4NKRA 3QF7A 4RD1A 3NDBB 1AGRA 4M22A 1A2BA 1AS2A 1G3RA 3ZYCA 1XD8A 1OB2A 3W90A 1NN5A 4FINA 1GL9B 3HU1A 5CLLA 3TSZA 4C0BA 1KO4A 2GJ8A 4EKDA 4NCHA 1NLZA 3V00A 5C4GB 4DSUA 2RGXA 3ZLJA 1LS6A 2XNSA 3NBXX 2IXFA 4WOPA 2IYYA 2QRZA 3IIKA 1YHNA 4PXAA 2MSDB 1ZCBA 1II8A 5AJWA 2FJUA 2UZIR 3IO5A 4OQXA 2F1JA 4LJ4A 2VTKA 2O8EB 4QM7A 3GFOA 3CW2A 1E3MA 4HLUA 1T0JB 2ZSEA 3DKPA 2R2AA 1NBMD 2IEYA 1FOEB 1XJQA 2ANCA 4D4MA 1R0ZA 1D2EA 1FPMA 4ZCMA 2ODWA 3P4YA 3KKPA 3ETLA 2ZJ5A 1IN7A 4AKHA 3FKSD 4G5OA 1KI9A 3BH0A 4HUQB 3TW4A 2P2LA 3NEJA 4CDGA 2CCKA 2J0QA 1X1SA 4ZDIA 2O52A 4IOJA 1KOFA 1UPTA 2IC5A 1X86B 1CLUA 2AFIE 5JCZA 3OE7D 3VQTA 2MSEB 2IYVA 3U5ZB 3IDQA 5DN6D 4TTPA 1S9DA 2REXB 1KI8A 3IQWA 5H70A 3AGQA 2VO1A 2MMCA 1IY0A 3QNUA 2WWYA 2JLVA 5KNCA 3WMEA 1R2QA 4KLNA 3WYAA 3H1TA 1OHHD 3KUDA 2NPFA 1VIYA 4B3BA 2O8CB 1YE8A 2ECKA 1EFRD 721PA 4HZUA 1YRAA 1DARA 1IJFA 1ZW6A 2NO6A 2OO7A 4GOKA 3Q5EA 2A5JA 2EQBA 1CBUA 3UANA 4EPWA 2DCUA 4QGHA 1GNPA 4V03A 3EPKA 2QPOA 3TAHA 3AP1A 621PA 3QG5A 5FBLB 1W36C 2GEVA 4JLNA 2W6IA 1U8AA 1RZ3A 1XZPA 3R8FA 3SQWA 4YC7A 4AKGA 1W1WA 3GJ6A 1KMQA 3QBTA 1E0SA 1G291 5CJPA 1UEIA 2IX3A 2NO0A 2EYUA 3RANA 2FSHA 3MCAA 2BEKA 3SBDA 1NG9A 4BQSA 3EIQA 1G5RA 2QAGC 3KXKA 3Q8XB 2J3EA 1CR0A 5K8TA 1ZAKA 3Q7PA 2C96A 1Z0IA 2OZEA 3E5HA 4LJ7A 5FUYA 3D31A 2FU5C 5EXPA 3U3RA 1N0VC 1CULC 1FP6A 3LQRA 3A1UA 4LC0A 3THXA 3RAPR 1FX0A 1CXZA 2GCOB 2QTVB 4TLCA 4JT4A 1RPZA 1IN5A 4DCVA 3OHMA 4JLVA 3I4LA 4HI0E 4ZIRA 3A37A 1UDWA 1XEXB 1NVVR 1NG1A 2CL7X 4JJKA 4FMDB 2Q3MA 1SVWA 2BCJQ 4QHTA 1GITA 1R0YA 2ODEA 2QP4A 1QHIA 1G3IA 3BXZA 4RJLA 1E1RA 3KJIA 1E9SA 1OXUA 1VTKA 2RGCA 1E79A 4NYJR 4R2HA 2P65A 2OBNA 1G5PA 4LHWA 1P61B 3AKCA 3I5XA 1WBBA 2AR7A 3QPWA 4JJZA 1IY1A 4P0TA 3SNHA 2R44A 1JPJA 1Z22A 3E2IA 3WYFA 3K9HA 4OI2A 2BJWA 2BM0A 3O8DA 4DSTA 4R9UC 1DEKA 2J7KA 3ZQJA 2O0JA 2GZHA 4P3YA 2IXEA 2OFXA 2ZI5A 3L0SA 2PEYA 2FPLA 2QMEA 3VX3A 3LV8A 2OILA 2IT1A 3PFIA 2NPIA 3LLMA 1OYWA 2GWHA 4OQNA 2RMKA 1ZU5A 1FMLA 3EG5A 1TQDA 1COWA 1CR4A 2DWOA 4LHVA 4W5HA 5FI1B 3WNCA 4BLSA 4GNKA 2OG2A 2GXSA 2G9NA 3D7MA 4OHVA 4ARZA 4JLMA 5LBIA 3SDZA 5J47A 3OAAA 4KV9A 4B35A 1PVOA 5EXSA 3ZVNA 1GRQA 2ZYVX 4H9GA 4E09A 2WAXA 2WSSA 2ZR0A 1TNDA 5C18A 2F43A 1MV5A 4MUBA 4QOSA 4D26A 4TYQA 1VHLA 3SFZA 1P72A 2C98A 2VSOA 4Q4HB 1EGAA 4TQ9A 3TSOA 3ADBA 2OAQ1 1HQCA 5JWOA 5TY0A 3QPVA 2B7BA 2YOHA 4C0JA 2BC9A 2FGJA 2WWGA 2EFEB 4L5BA 1Z0JA 4CEJB 4DLZA 4R7ZA 1UBGA 1ZNZA 4WVFA 4IHQA 1E1RD 2OESA 4KVGA 3DPUA 4GP6A 1G3MA 3RC3A 1E79D 4UXHA 5JECA 1Z2CA 1E2HA 3WHLA 4JKYA 1OIVA 2OLKA 2ZRHA 1XMSA 3EZFA 2CEAA 3K53A 1TU4A 3ZQ6A 5GJCA 4BZXA 3N70A 3WRYC 4MKHA 4E5UA 4KITB 1ZC3A 1SGWA 2B92A 4QM6A 2VF7A 3ECCA 4A82A 2WWHA 2VP2A 1CR1A 3EX7C 4Z8XA 5J4VA 4S35A 4B76A 2WOOA 3PENA 2WJGA 1M7HA 2HYIC 4Q5IA 3U3KA 3AVQA 3L0PA 3WRXC 3ZJYA 4YMUA 2HLDA 1CR2A 4FWTA 3NH6A 1N6NA 1E2JA 2R65A 4GL2A 3HYRA 5G3YA 2CXXA 4LBZA 1R8SA 4G1UC 1E2IA 4OK3A 1MO3A 4TLBA 1COWD 1IY2A 2IYTA 2Q0HA 3QKRA 2JLZA 5EQTA 2WKQA 1NY6A 3DMDA 5DYGA 5TB5A 1E9CA 1NMZA 1E94E 5LB4A 3BJIC 4RCYA 1Z29A 4FN5A 3S1AB 1XEFA 2ZSBA 4IOKA 1NF3A 2CLSA 2WSSD 4JL5A 1XD2A 2XOKA 3FB4A 1E9RA 1H65A 2WWIA 3Q7QA 1TF5A 2IK8A 1QHSA 2Q21A 4IXNA 3GD7A 2ZRGA 2VLIA 3I72A 1BIFA 1ZNXA 2AL7A 1E2KA 3BFXA 4PC2A 4AKEA 5IT5A 5KDDA 1OXTA 2JLXA 3VNVA 1VHTA 2P6NA 1GAJA 3KTAA 1QHXA 1OH8A 2IS6A 2Z5FA 3C8UA 3AF0A 5AR1A 1CRPA 3WMFA 5C46F 5BW8A 4DB2A 3B7GA 3SJBA 4EUNA 2EFCB 5FPYA 2QZ4A 1M34E 2CK3A 3W6PA 3U3OA 4EFNA 1I4TD 5G41A 4AG5A 3HDTA 5SZKB 2RGAA 2IUTA 4WXRA 1E9DA 3Q72A 2OCYC 4AYWA 2XSZD 1G21E 2JJ2A 3VR3A 2KWIA 2VP0A 5JZVA 1AQUA 2W58A 5HR5A 4PO1A 2FWRA 4HAZA 4M1OA 1E9AA 3LFUA 4ZCLA 4QGGA 2HLDD 2ZUBA 3UXMA 1Q21A 2FA9A 5A5GA 4PSKA 4XH9B 5KNBA 2GA8A 3RHFA 4ESHA 5FUVA 2BMFA 4L4UA 1KO1A 1JR3E 4YMWA 5B64A 2PZGA 3E1SA 3NHAA 2WZQA 4LPSA 5GADl 4NHOA 3QXSA 2CJWA 4URWR 2ZRPA 2V8OA 4Y0VA 2V55B 2OFWA 2OBMA 4NCIA 1XCGB 2RCNA 3GLFB 5IDVA 4A9AA 3CLVA 2GF0A 2XOKD 4BUJA 4KODA 2H5EA 2VP6A 1KHTA 3RS3A 2FFQA 2HXYA 2ANBA 2YINC 3Q85A 2A7QA 2A3RA 3LW8A 1JECA 1G20E 2BBOA 4QJ3A 2A5YB 2BBSA 4BFWA 3PUVA 3K0AB 2FEMA 4URYR 2QQEA 4G5QA 4E22A 2CK3D 3Q5DA 2OHFA 2YC2C 2ZSAA 1Z0AA 2ZI7A 5L3VA 5BYKA 3K9GA 5HE9A 3ZIAD 4BECA 2JJ2D 1Z6YA 4Q7KA 2GETA 3KUCA 4WW0A 1WA5A 2NO7A 3BB3A 4ZV4A 2VHJA 4V0NA 5DI9A 4P4SA 2C99A 3WBJA 4DDWA 2G0TA 2QE7A 1DO2A 3V9PA 3K8YA 4DCUA 3C15C 3ZD6A 3G82C 4MYCA 3SHFA 4AURA 3GJ5A 4URVR 3VR2A 3WYGA 1ZD8A 4PSAA 4GDFA 2YV5A 2QL6A 5KYKA 1BYUA 4RZ3A 4DDTA 5JMTA 2H92A 2WICA 4G01B 4PPQA 4Q4AB 4CVNA 5B58C 1TF7A 4YMTA 5JJLA 1TQ4A 4GT1A 2HJGA 3IQXA 1E2EA 4DLWA 2ZE7A 1LW7A 1XEWY 1AK2A 4B74A 5AK0A 4DJTA 3VKGA 1P9NA 3B78A 4NBSA 1W4BA 1NIPA 1SVSA 5AJZA 4MDFA 3K0FA 5EE3A 4EQ6A 4W5WA 1F2UB 3X1YA 1E0AA 1E2NA 1N6RA 3KFXA 4TMKA 1FUKA 4QG7A 4MGZR 3BGWA 4FMCF 4PSVA 3V4RA 2ERYA 4XVUA 4KFTA 3QXXA 4EJSB 1S1MA 4DC9A 2VP4A 3RS2A 3DO6A 3VX4A 4A8JC 3U6KA 2N42A 5FOSA 3UK6A 2ZXUA 3NTUA 3T15A 3LXRA 4B71A 3V4FA 5CDFE 1KJWA 5KSYA 1N6HA 2XB2A 5KPDA 3U44A 5DO9A 2GXAA 1JXMA 1HV8A 3LH5A 3BRWD 2ZSDA 1KI7A 5F9HA 3B82A 5BQ5A 2QAGA 1KNXA 2QE7D 4IXMA 2XEXA 3CH5A 1ONBA 4PO8A 2GJKA 4D25A 1Z6TA 3UWKA 4A6XA 3EPHA 3J81k 4C0QC 4ZDKA 1HEIA 5FOXA 2KI5A 1OXSC 3CX6A 2HT6A 2VIIA 1R5NA 4RKFA 3K70B 4TYYA 121PA 1FNMA 3AF2A 3RRZA 3CR8A 2QORA 1SKQA 4C7OA 2O8FA 2ZYWX 1YRBA 1NJFA 1XZQA 4TMWA 4EPRA 1KK1A 1XU4A 5G40A 3EASA 3MRSA 3K1JA 3SYLA 4RY2A 1PLLA 2N46A 5CIWA 4WZ6A 1YR8A 2YVUA 3A6PC 4QBIA 4E03A 3KKOA 2GEDA 2YNMA 5KOYA 2YWEA 2J9RA 3BERA 2WJJA 1VCNA 1FTSA 5CK4A 3GJXC 3AVPA 4DLVA 3SJAA 4NYIQ 4AWXA 2JIZA 3CONA 1BMFD 1LTQA 2C77A 4NYMR 4BGDA 2R8RA 1L4UA 2V54A 5DHAA 2CL6X 1RFLA 3QBVA 4LK2A 3BOSA 3AM1A 5TV2A 1W36D 3QQ5A 1KIMA 4RFSB 2ZUDA 5BN5A 3H4MA 1F2UA 4HDQB 1XPUA 421PA 4M1YA 2IEZA 1KAOA 1IAQA 1US8B 4BLTA 5DISB 3FHOA 4JVLA 3AV0B 4LWZA 1CRQA 3VHLB 2G1KA 4QBFA 5ANRB 2GNOA 4OYHA 4PC7A 1SKYE 4RZUA 4A36A 3BORA 2AHOA 2C03A 4Q9LA 4Z51A 2ZETA 4ZDJA 2F9MA 3GFPA 1JAHA 1M74A 2ZRMA 1K8RA 2PMDA 2FEOA 3ZS8A 3P26A 4OI4A 1GOTA 3ZVRA 2FPMA 3SZRA 3AH8A 1Q20A 4TYNA 4I1VA 2D2FA 3OIYA 2LWIA 4LYAA 2ZJZA 1F6BA 4MITA 4IVQA 1IN6A 5B2ZA 2PX0A 4GFDA 1UM8A 2GZDA 3CX7A 5CB6A 4BFSA 1ZM9A 2FNAA 3TMKA 1Q44A 3M4YA 2DFTA 4HAUA 5LD2C 1JR3A 1ZIOA 2VQSA 3I61A 1KDOA 2IUUA 4N3NA 1P75A 3KJHA 3GLHE 1F5NA 2G88A 2QM7A 5BWMA 1T5LA 2ZJ8A 4P4TA 2WJIA 4O25A 4ZKEA 1E2FA 1ZM2A 2JJ8A 3R9XA 2GCPA 4OK5A 2JIZD 3SHWA 3CIOA 4FI3C 2AK3A 2ZRNA 2ZRJA 3CRRA 1WBDA 1H8EA 1T8TA 1Z6AA 3T1QA 2KJQA 3L0IB 4RSGA 5J4YA 3W3AA 4OJQA 1O87A 3AVYA 4R98A 2V6IA 2FX3A 3RYTC 3K09C 5CLQA 4KLZA 2DYKA 4FMBB 4N0DA 5EP4A 1VYUA 4ON9A 1SHKA 3TJZA 3LAWA 1KDTA 1II8B 4DRZA 3ZZ0A 1HT1E 4LJAA 3R9WA 1OH5A 1UADA 4KFRA 2AKAB 1Q3TA 1W4CA 2PJZA 4KYIB 4LYJA 3CNOA 3WBKA 2WPDA 4JLOA 4C3ZA 1X8JA 1X6VA 1YZQA 3M0EA 4YLGA 5EE1A 1GILA 3GP8A 5FOWA 1PUIA 4K46A 2JASA 3I8SA 2BKEA 3IIJA 1L7VC 4XVQA 1AKEA 3NDPA 1XMVA 1EG7A 4Q03A 5UKDA 5EP3A 1KJZA 2OBLA 3ND9A 1CJUC 3HU3A 1S1CA 3IGFA 1P62B 4EDHA 3OF5A 4F4JA 2QN6A 5J4KA 1AN0A 2QMHA 5KUTA 2P0EA 2VP9A 1ELOA 1JR3D 1MRSA 2E9SA 2ATXA 4I1SA 3SYNA 2IUSA 3EARA 5KHOC 4PFSA 5HPYB 4US0R 1W7AA 4V0LA 3MAAC 3E70C 1SXJC 2NG1A 1GTVA 2QRNA 3IPXA 4B3FX 4URXR 2V9PA 1DAMA 2V6JA 1GKYA 4IVPA 4NONA 1GRRA 2DFLA 4HZUB 1YR7A 3BFVA 1E2GA 5FR2A 1HH4A 3I32A 1OH6A 1H8ED 3CPEA 4Q00A 4ZCIA 1YKSA 2BBTA 3BC1A 1QHYA 2QG6A 2XTMA 1Q57A 4JLDA 1JPNA 5J5CA 4FD2A 2LCFA 2D3WA
chains in the Genus database with same CATH superfamily
4TKVA 5DKFA 3N3AC 5C1IA 3JQRA 3MG9A 3REQA 1I3CA 1GR1A 4MYDA 1XTKA 3KKQA 2OM2A 3FJOA 3P1JA 2Q6IA 1KI6B 2I1LA 1VC2A 2OV2A 4GC5A 5AKXA 3TDMA 1WCIB 3FB1A 4I14A 3IUSA 4I4TF 4F93B 2BGJA 1JFFB 3QE3A 4GC9A 1JSCA 4V0QA 1GAWA 1U2TA 1ZJYA 1C3OB 2F8SA 2PH1A 2O0KA 4C6SA 2JIPA 4NK4A 1E3LA 2Z1MA 2YFKA 3M2PA 5DHPA 1QIKA 2WPDD 1XNGA 2PTGA 3ZLTA 5CDFA 3HJCA 4AQ7A 1T2CA 3OBIA 4HGPA 4L9WA 3QPUA 4G0NA 1Z0ZA 3JQBA 5E2IA 4RD4A 1CRLA 1VBFA 4O02B 4N47A 3U7EB 1UJ2A 1X1BA 5A6SB 3W4IA 3WFJA 5KINB 4KPGA 3B8EA 3THXB 1FX0B 5T7BA 3P32A 1HL3A 3OESA 4ND8B 2MYTA 1MDFA 1RCTE 3EBLA 2ZTUA 3K5HA 5CYOA 3LY8A 1UBMS 3ETDA 5JRJA 2C7QA 2XUJA 3H2YA 1U3VA 2I99A 3OIDA 4Q7EA 4YJ2F 4YP5A 5A62A 3R76A 1GKKA 5JDIC 3DZGA 3EMKA 3CNLA 5FNZA 4ALIA 4JXJA 1OGYA 1DSSG 1J2EA 1T5IA 1A2KC 1SB9A 3OLYA 3B3GA 3PNSA 1CJKC 5JCXA 4FOLA 8ABPA 1EUDA 4C0AC 1LX6A 5E7IA 2ZJ4A 3QHQA 3EDQA 1K4MA 3KV1A 3ZGVA 1Z08A 3KUUA 4UREA 2CUTA 2ZRLA 4QRHA 4IRMA 4E7PA 2GS9A 4TRRA 4XWKA 5EIOA 5JPIA 1JG4A 1QCCA 1Z6ZA 4LI3X 2K5UA 2G3YA 1EWVA 3AEYA 3CNQS 3GNTA 1F3LA 5CVDA 3WWZA 2IS4A 4GPD1 5J58A 3O8BA 2G4CA 1A97A 3UGKA 1Y7TA 4C20A 3W5BA 2CEKA 1VE3A 1MNQA 3VV3A 2JFNA 4RWZA 1MTZA 4X90A 1YFJA 4ZTUB 2EATA 2DE0X 2ZAGA 5FBRB 3VZPA 2RAPA 3COSA 3R6WA 5JZSA 1D2NA 3UMRA 4YHBA 2UYCA 4BFYA 2R9VA 1YB4A 2PWAA 2ZRIA 4BBJA 4C3UA 5LQJA 3GEHA 2CVOA 2HBQA 3A4NA 2RHMA 5AKEA 3HO6A 2FZLA 3QWBA 2DWCA 4YIKA 3VR4A 2F55A 1Z5GA 1EUCA 5B7GA 1L5GB 4F9FA 5IEBA 3JVEA 3TMAA 2MSNA 1JSZA 2ZJ3A 1SXJE 1YMUA 2L2QA 4H7IA 3RVRA 3RRJA 3ZDYB 5F64A 1G3UA 4B82A 1KFCB 3IALA 4ARZB 4LRYA 4Z0TA 4XWTA 1YZVA 3DGEC 3FOWA 1BX1A 3FF4A 1OAOC 1T91A 4G6ZA 2A6PA 2JBAA 2BTQB 4YCLA 2HV8A 2ZJ0A 4MK4A 3N2ZB 1R0XA 4NZOA 2J7PA 1QVAA 3U3JA 3UQZA 3VTKA 4B6GA 5CNMA 2ES4A 4NFSA 1QOZA 1V71A 3WRVA 3STVA 4P22A 3W9YA 5HUHA 3VNAA 2WTMA 3BKXA 5DB4A 5DP2A 4BX8A 1ZESA 5B7QA 4CCYB 3RSCA 1QXSA 2A14A 5D3QA 3R7BA 2XNDA 1L5FA 1FCJA 1MKYA 1QIDA 1WXQA 2O2HA 3SEFA 4F8EA 2AFVA 4GNRA 2FPSA 1X7YB 1C9KA 2WYHA 2Y92A 3O4VA 1MA3A 2R7KA 4TMXA 3LLVA 4PYLA 5F3DA 4MRRA 3CWZA 4Y67A 1NLMA 1FL9A 3GT0A 3PPYA 4OFBA 2HBZA 4Q1CA 4B3CA 1R0WA 4B8ZA 3G8YA 1ZY2A 5D5QA 3T06B 1KHHA 3TBHA 10MHA 1OA1A 2IL1A 1F8YA 3FRJA 1U98A 1X1EA 5BV0A 1B26A 2IEAA 5GJBA 1VMAA 1KO7A 3B1XA 3IOYA 3KDSE 4H16A 1I01A 2Q1XA 3KXPA 2BFNA 4CHGA 1OILA 3PKIA 3ANMA 2CLFB 3AYXB 2ZG6A 1EX6A 3K0BA 3L1IA 3LUGA 1XVAA 3NNDA 4Z9BA 4LWOA 5JS2A 5CG2A 1KAMA 5BSKA 2PCJA 3LGAA 1DLIA 1RIIA 3NMUF 3G0IA 3OJOA 3VGPA 2H1OA 1GP2A 3UXYA 1F1JA 3N75A 2ZRKA 1L5ZA 1LVHA 1Y8QB 2CHQA 2O9JA 4HLDA 3W1WA 2D59A 5F7XA 5KC8A 2QNIA 2ZRFA 1OX6A 2IFTA 2LV8A 3F4LA 4AX4A 3BWYA 4WBNA 1SZCA 4MKGA 4EA9A 4DR3B 1J25A 4BQNA 2F62A 4HH3C 2P11A 5CIYA 3NOQA 5KAMA 3AY0A 4GZMA 2DLDA 1RWVA 3RKSA 2MWMA 4HDAA 3SM9A 4QTZA 2WMNB 4RL6A 1HURA 4LJSA 4TTIA 4KWCA 1V6AA 3KTFA 2A2ZA 3BG5A 3G1UA 4EYSA 5KYYB 3BMOA 2NMVA 1S3GA 1JLRA 3RJ5A 3IEVA 3EE6A 3MWEB 2G76A 1Q1BA 1L3IA 4M7OA 1W96A 3KS9A 4R0VA 1K08A 4XYBA 4CF4A 5FUWA 5IJ0A 5T64A 4PINA 4I3FA 3P5BA 1WF3A 5ERXA 5FWYA 1E5XA 3UMFA 5HZMA 2HDNB 2F3UA 5DNDA 1E69A 3GEGA 3HPRA 1WVMA 2HF9A 3LOPA 4RJKA 1BFKA 4F84A 4G5RA 3DE0X 3U3MA 2QMOA 4F7WA 4JA0A 2P5UA 1W5EA 3IQIX 5ELMA 5A4FS 2IEIA 4DMCA 1MV8A 1GQYA 1R8JA 2AFIB 1U0GA 1DIHA 2XF8A 2YY7A 4RZ2A 2NXCA 4GUDA 4WQMA 1IVNA 4PQFA 4XLLA 4W9RA 1FJXA 2H4FA 2J5XA 1XCBA 2O3SA 5A7GA 1X7GA 1EFLA 3CG4A 2WU4A 4WX2B 3RYCB 4KIFA 3I1FA 3TZQA 4OX9B 1F7UA 2F4NA 4HDNB 3ZDCA 1OWPA 3PG5A 1I7SB 5HF5A 2A35A 1U7OA 3AONB 4OQEA 1MIHA 9LDBA 1BMTA 2C57A 3F5FA 4RZQA 1FUUA 2C9ZA 2H2DA 2YQ5A 1ZZGA 3M1AA 1KWKA 1Z8DA 1OTXA 1PYDA 3CT6A 1HO3A 3IAM6 3KQMA 3OVMA 4MARA 4LZJA 2VCYA 5FEMA 4ARUA 2BKLA 3AETA 3DZCA 4CUZA 2NU8A 4EF6A 4OFWA 3QVXA 3B5IA 4CL0A 3PX7A 1CUVA 1X15A 1DXQA 4KR0A 3KQNA 1ZBDA 2CJWB 3R8CA 1I5RA 1L8XA 1QQ6A 1U0JA 1YR9A 3ADKA 4O33A 5DBEX 4ZU3A 2ORIA 5BN1A 4Q9IA 4B75A 1RNLA 1J8YF 1V3QE 2MYPA 1Q0QA 4JI4B 4DVGA 4F2PA 5TGDA 4C0KA 4IHJF 4HWOA 1NC1A 3LC1O 1EZ4A 2Q1TA 3A14A 4HP8A 1ULZA 2KPOA 4FHCA 4OPMA 3UT5B 2VWHA 1UDRA 3HA7A 2GN1A 4BNUA 1W9HA 3NXSA 4ESOA 5CJ2A 5FLXA 3LNTA 2BGRA 2VVTA 3ILYA 1Z62A 2DWUA 1H6BA 4KQ9A 4X60A 2AWNA 4ZARA 1T6ZA 3COPA 4WOJA 2WSYB 3MUFA 1FFDA 1E96A 1Z4QA 2FX5A 5DTMA 1XTZA 1HT2E 1B16A 3E9RA 3KCNA 4AROA 5L45A 4E4RA 1HMYA 3CA8A 4EJSC 2KS6A 2PIDA 5LUBA 1BVUA 1QR2A 2K2WA 2Q9BA 1CF2O 4NOJA 1DV2A 1PT5A 3NNSA 3HV2A 3Q3JB 2R6GA 1I6LA 2AXPA 3MWJA 2DF8A 3OETA 4MAAA 1QV9A 2PMFA 3C70A 3FPJA 1OFUX 4G0QA 5REQB 3UMCA 2EV9A 2BUBA 2IQ5A 2UVQA 4WZZA 4N01A 2I9KA 2NVBA 3WFZA 4D8WA 5IANA 3AERA 5CTJA 4BO3A 1KK0A 3PNLA 4AJHA 1E0JA 1AV6A 4DPLA 3QKWA 4NPHA 4O59O 2JLUA 4IWNA 4NBNA 3R3ZA 1YONA 2D5IA 1U9ZA 1PWXA 4FU0A 3L7MA 5LZ9A 1TO1E 1RJ9B 2UKDA 3EW9A 4JL8A 4XWAA 2R5WA 4MCAA 4IJVA 3OHSX 2Y2VA 3N8IA 1M9NA 3N0XA 5BOSA 2OQRA 4GPEA 1MIOA 4Y0AA 5DI3A 2HPVA 1QF6A 1RLTA 4XVCA 4S3MA 2Z1DA 3KEOA 3PRJA 3HN7A 1VGQA 3E9DA 1GGHA 1Z7WA 3BHJA 2QT1A 3BWXA 3GJYA 3GMDA 2A88A 3P9PA 3UF0A 1SUEA 4RD0A 3PUKA 3OZCA 4PZZA 4F9GA 2JGMA 4ND3A 4G8CA 4RTNA 5AKLA 1OH7A 4DVJA 2ZWOA 4ACAA 1F38A 1R6UA 3AP3A 3CXRA 5K3SA 4WFIA 3BD8A 2HKIA 4HVTA 3C8ZA 5DNYB 4R2MA 2KSQA 1HE1C 2GPAA 4M0UA 1I2DA 1GPAA 5IDYA 3SSMA 1C3EA 3KYCB 1QTQA 8LDHA 1J33A 1S3IA 1RYBA 3SU8A 2EVWX 1WXXA 1EDDA 5A9TA 4LXHA 1WXGA 4PHCA 5BWBA 2PLFA 1JVSA 3BHMA 1SZDA 3PQDA 5H8WA 2NXEA 3I6YA 2FPRA 3RF6A 4XWOA 1E1QD 2VBFA 4F86A 2FZWA 3I2HA 4EG5A 2ORVA 5BQXA 3CLSD 3OEHD 2PGJA 4BHTA 4RE6A 2YWGA 3BFPA 2BFMA 4OKSA 1LK7A 5LQDA 3VNBA 2WSLA 1E0DA 2VHYA 2Q4EA 2GHRA 2OCXA 1RRCA 4DMGA 3W5HA 3KCQA 2IZ0A 4TM8A 4EAAA 3WC4A 2HLPA 1EWKA 1YOVB 1PYOA 1W4AA 2FUNB 2WHQA 1LV7A 4YMGA 4UNSA 2EG9A 5LB2A 3VR6H 1LPAB 5CT5A 3ZVMA 1SHLA 2QAJA 3THYA 2O19A 1GRVA 3G2MA 3JYHA 4MV0A 4HXYA 4YBRA 5BNIA 5DYWA 1T34A 4ZVQA 1MC8A 4CKEA 3S44A 3O95A 4EJ0A 1WHTB 4JJGA 3LIPA 3QWFA 4YP7A 5HQTA 2GKOA 1BVHA 5TSDA 1KY2A 1VKZA 3JAKA 3AKYA 4RGVA 3U81A 4DIDA 2CDNA 2JGKA 1FBTA 3G3EA 4H7EA 4MYRA 2TMGA 5KSPA 3IT1A 5IAAA 1WR8A 3RRNA 2GESA 3TVYA 4EIWA 4Z86A 1YZNA 3GRCA 2YQZA 3U4IA 4QBGB 1V4VA 1CY2A 3F5MA 1Y3DE 5JD4A 3DO8A 1MQSA 4H77A 3ZWAA 1ODCA 4GEKA 4MAMA 2C9OA 4LGYA 3TSWA 2WMDA 1W5AA 4A92A 2OYCA 2ON6A 3X0DA 3OX1A 4C9BA 5K8CA 4L8VA 1AZTA 4QJBA 3WGKA 3LGSA 4LXIA 3TD6A 2I54A 3M5DA 4G0VA 3G0HA 1RYYA 2R8BA 4B7ZA 1A8QA 2NSYA 4X1OA 4MS4B 5DRYA 5JSQA 5TVKA 4AN1A 3ZHVA 4DTCA 2J5BA 4U2EA 4ENPA 1WZNA 1T9CA 5I3ZA 1YA4A 4R8KA 1YACA 2EZ9A 3UHAA 4B3JA 3GZNB 1RRFA 1YHYA 1MP0A 3OX3A 5ALWA 1XLTC 1E3DA 4FD3A 5LXTA 3BK7A 4YLYA 3SHOA 5I8WA 4MVJA 3P2IA 2GD1O 4K6FA 3OE4A 1XPJA 2A5LA 2DR3A 3NWPA 4HXEB 5LM3A 1OYYA 3QKTA 3E8MA 1ZA1A 1ZNWA 4LDZA 2J5KA 2BHRA 3D3WA 1NRJB 2EBHX 2W7TA 2VDRB 1T9BA 1F8FA 3C6ZA 4QXAA 1DGQA 4QJ4A 3AP2A 3IDZA 4GZLA 2Q5EA 4UXJA 4BLVA 2BDTA 4EEZA 5IS2A 3K6SA 2QLLA 1N2IA 1TLTA 1ADJA 3P9QA 2O0MA 4LPKA 1MHPA 3A7DA 3B2EA 5FFMA 4C07A 1OVMA 1IULA 2NW6A 3DHWC 2GRUA 1IHOA 3TK1A 4MV8A 4PRLA 2Q45A 3EUWA 1NBWB 1BDJA 5K0SA 1OFTA 1QBKC 3T5BA 2NTEA 2SHKA 3K0KA 3ZV5A 4HLCA 4ZQGA 2HJWA 3FOFC 4TSFA 2CDBA 4F45A 4MLCA 1RI3A 4L7QA 4Q4CA 5KMGB 2GUGA 4C4YA 1XQ9A 2AC4A 2YYZA 2R6CA 3E3MA 4NH0A 4K2AA 1SBCA 1C3LA 2ZI9A 3ISJA 5G1NA 5TARA 4HG2A 3AR4A 3FOZA 3CZ4A 4ZK6A 5GJWC 5ILOA 1Z7YA 3W5JA 2QVYX 1CHDA 4GOJA 6REQB 1QJ4A 1YJBA 1A77A 1SCUA 1GLGA 3OX2A 4FHEA 4XFJA 4XAQA 5ILQA 2GCNA 1ZL0A 5KDOA 5KHLB 3FR8A 3R9XB 3N2LA 4DY4A 2WFLA 1XAJA 5CIQA 5M2QA 4LRWA 5JSZA 4BLQA 2P41A 1FTQA 2R751 3OKPA 2IUFA 4BV8A 1VBMA 3DJFA 1T9ZA 4H7FA 3ZVKA 1KETA 1X19A 6ADHA 2CXSA 2WJ6A 1NY5A 2V7BA 3CE9A 1NQOA 1CZUA 2RJOA 3OSUA 1IRXA 3OFND 2XZLA 1E7MA 2I62A 1SCDA 3EC1A 4OU4A 1BD4A 1EHIA 1SIWA 4G25A 4YDHB 3RTDA 3T3DA 4BKOA 2FZ5A 4CF3A 4K9DA 3V4OA 1EAYA 3G85A 3FHCB 1QFSA 4PNHA 2HJSA 4PPFA 5TS2A 1RZRA 1FTWA 2FN3A 4LY6A 3NXKA 1H2AS 1HC7A 1JJVA 3I73A 4LMPA 4BVEA 5TF4A 2H4HA 1GARA 4IDNA 3PK0A 2K2QB 2EAUA 1KP2A 1TRKA 1FW8A 2RE8A 1RLOA 2EBFX 2I80A 2HU5A 2DECA 3FPAA 5CVCA 3BL5A 5ALOA 3RG8A 3NYQA 2HJVA 4IICA 3SQOA 4EKNB 4RYLA 1OV4A 4GR9A 1WB4A 1QQ7A 3UCEA 1IOVA 4A26A 3LQQA 4ZAVA 1QYXA 3O4IA 2LPMA 4JDPA 5CD1A 2MJLA 2OCBA 4BFLA 2HFKA 1RAIA 2PMKA 3CF4G 1Z63A 1H4VB 3N8NA 4JN6B 4FGLA 1FS6A 4ZQFA 3ZWKA 2FX2A 2EKBA 4G67A 1H0SA 5ESDA 2WV9A 3X44A 3WGTA 2FSSA 4BRZA 1L4YA 3T4PA 4FYJA 4DV3B 4EL0A 1RP1A 4OUDA 1L3CA 1GU0A 2HHLA 1BEEA 1KJNA 1P3DA 3G5AA 2ZRBA 4RVDA 1FRNA 5JFOA 1LDGA 2KHZA 5BWCA 5F5NA 3ZY4A 2CNNA 3N2NA 5T57A 5ALKA 4DCNA 1C30A 2WE8A 4PGGA 1DBWA 3L0YA 4F4UA 2RJNA 1NC3A 3L7NA 1ZJ5A 4BLPA 3EDYA 3OIVA 5L3QA 2E18A 3H0KA 1RABA 5E7QA 3RKUA 2RIRA 3HYCA 5DIZA 4BZQA 4HBGA 3LT0A 4EMUA 1WPRA 2O6HA 4MI9A 3C6YA 5DNCA 1AA6A 2HK8A 1RQRA 4QTTB 5HBGA 4RZXA 3UUFA 2P90A 2PUDA 1XNRB 4WDQA 4I1IA 4G0UA 1X1CA 1CPYA 2PVCA 4HZGA 3HJRA 3AY7A 3D2AA 2FR0A 3BWDD 4AZ3B 1ZRHA 3BQ9A 4GKBA 3MK31 3B3QA 4Y2QA 4ZT2A 3QEBZ 1HGXA 1IXYA 4FCWA 2GPSA 1NYRA 4GZ5A 4PXYA 4UTRA 3T4EA 3J7AC 1LQTA 5ADWA 3EEFA 4Q9JA 3FTFA 3WB9A 2BIFA 2J0UA 1KSJA 2IY8A 2ECOA 5K03A 1NMYA 4DCOA 5FUXA 2WRZA 5EWLB 5B58T 3LI2A 3QVUA 1PU2A 1CIPA 1V39A 3QE4A 2XD9A 1GN9A 4YXWD 2W2OA 4RMGA 3MOIA 3MT0A 1WNFA 4IMRA 2P9TA 2R87A 4GM1A 4Q9NA 1AY0A 1XI2A 5ECWA 2ACVA 4Q48A 4GLLA 3BMCA 5I5GA 3PEYA 4KRFA 4HWSA 1OXVA 2RAFA 2V0NA 4IH1A 2E4VA 4MWTA 2FWJA 2O3QA 1KO8A 1YC5A 2HMAA 1WKCA 5AOCA 4QREA 4RW0A 3RVSA 3D5QA 3TD9A 8ADHA 1F7VA 1OZHA 3TG2A 1Q7TA 3B36A 1A1SA 1Z3IX 4LJKA 4QPPA 4OFZA 4PQYA 2FUG1 4URZR 1M2FA 5C9ZA 1PJ4A 2O4CA 1BS1A 2IX9A 2PGOA 1RC0A 3UAOA 4QDUA 3YASA 3RASA 4G23A 4JEHA 1NVWQ 4ZJYA 1E66A 1EHCA 4YMSA 3H8SA 1XROA 4I55F 3E15A 3L6BA 1ENZA 3T3MB 1L7PA 2CGEA 2A9KA 1VLQA 3INYA 5K4AA 3O82A 3C48A 2AKYA 3C1AA 2V4ZA 9GPBA 2X1VA 4K9PA 1ZCAA 3UEOA 1S8NA 3S70A 2ZAOA 3UAXA 1YR2A 2B21A 2XA9A 4Z4CA 3MILA 5DCWA 3E0QA 3DT8A 1XMQB 4IAOA 5CUQA 1G16A 2IYPA 3P2EA 2NVWA 3UG7A 3N8GA 1DQZA 3QWAA 3HO8A 3ZGLA 5B36A 3L4KA 4I9GA 4MGEA 3MJFA 1Z33A 3OTGA 3TM5A 4UVHA 2GCEA 3HXOA 4KBGA 1CZLA 2HO5A 1LSSA 3JW8A 4R8MA 4RVSA 3JYPA 4HWKA 4YWHA 5BSUA 4U3JA 1FDVA 1JV2B 1KI2A 5EJMA 4R68A 5D6OA 2WV7A 5EJ8A 1D3AA 2FWMX 4W9MC 5A3VA 3CSSA 2Q5HA 4QPCA 2DPHA 4CDMA 2ZBDA 1CJSA 4MDEA 4L5JA 5HWSA 2XMZA 5AJHA 1GSIA 3OPXA 4YASA 4G4GA 1KYYA 3H87A 2JD0A 3RIXA 4X20B 4F4CA 5ELXA 2NTNA 2WYVA 4C08A 4MYTA 1Z35A 1QTRA 4M8IA 1ZNYA 1VE5A 4H0NA 5AI4A 5LMCA 5AW7A 2RGRA 1XSEA 4GLJA 1LX7A 3RNLA 2HB6A 3NAZA 3N6XA 1LSUA 1CQPA 4TXLA 1Z4PX 4DNOA 4C4XA 3KLMX 1ICIA 2GPYA 5L3SA 1U3WA 1D2GA 1VPVA 1I9GA 1IZ9A 1GXSB 2YY5A 3PIDA 2B2XA 1A9SA 1LI5A 1CERA 2I2FA 2PGIA 5IYZF 4OHMA 3HHEA 1B23P 4GEGA 4G9GA 1LTHR 3UN1A 3TE6A 1SZPA 4KQ2A 5FO1A 1U0FA 1Y6RA 4KXFB 5IWCA 2UZ0A 1LGYA 4E5UA 4MR9A 2FMTA 4J9VA 4AP9A 1V2GA 3V6MA 4QG3A 2YWXA 4D0LB 5BWOA 4TT3A 5BW5A 2F90A 3I23A 4B3DA 4EW2A 4W8OA 1DOHA 3L4EA 4KK3A 5D3MA 4PQRA 3NZEA 5IXSA 4PHFA 2QP3A 2C29D 1M2GA 2FW9A 3HY3A 4ZC1A 4MYHA 4AICA 2RHWA 4JJIA 3FUVA 2OV1A 4J2TA 2ZVQX 3ZR4B 5K09A 4O2BB 1WEHA 1RJDA 1S2NA 1XQYA 1F0KA 4F9TA 4CV1A 1QFXA 5MDHA 4KHZA 4NQZA 1KOGA 3IE1A 2YFYA 1GUZA 4Q1FA 3VSEA 4AO8A 4D9GA 3KKLA 3NW9A 2DEUA 2QTFA 2WW8A 3IVRA 2PR7A 1LK5A 1YE3A 2VYND 3GUYA 3VAZA 2ZBQA 2FP4A 4N41A 1O95C 1WULS 3LBIA 2Z2JA 3MYYA 1KC1A 3PNKA 2YY6A 3HKEB 1SQ5A 4ZO7A 3A6KA 4ZZ2A 4ZAWA 4E33A 1SVIA 1EJ0A 2PM8A 1Z4JA 1RE0A 5K3BA 2OL4A 1TM3E 4JKOA 1IIRA 3F6SA 4W1QA 2LR0A 2YHIB 3WNDA 3AUXA 4GBGA 4UU1A 4IDPA 1Y7PA 2OWDA 3EUEA 4K86A 2ST1A 3AEQA 2R6JA 3ASZA 1PWYE 4B0OA 2PUWA 3ZKWA 3B38A 2PUJA 1JU4A 3AEUA 2WOJA 1GNVA 4LX8A 4DQVA 1V7QA 2GXQA 5BYJA 4ECAA 3F4BA 4JI8B 1QRDA 2CJPA 4TTSA 2NP6A 3MZ0A 1YS9A 2WZCA 5IVIA 4V1CB 1SVOA 3SQNA 1T9KA 2DH6A 3ITDA 1ISGA 3SJUA 2WR8A 2PZFA 3IDAA 3MJDA 4NSNA 1DMSA 5DX8A 1XK6A 3Q41A 5JV5A 5K99A 2OZKA 4N8EA 4Z4HA 3ZDEA 3QMVA 4BO9A 4YRAA 4OHPA 4LHZA 1VRVA 3ONVA 4R40A 3WIEA 4E2XA 1U3FA 1FTGA 2IZ6A 2BT4A 3O8OA 4HQRA 3MB5A 3TLZA 1EAMA 1N0UA 3G8DA 2D5AA 4WKBA 3VVLA 1Z5ZA 1E63A 2P9EA 4WWHA 3OLXA 5EYPA 5JANA 4YEDA 5KX5F 4AQYB 1DIGA 2YRWA 2FAXA 1HRKA 2M32A 2DB3A 3T7KA 1ISJA 2FMXA 1QHHA 5F4BA 4D43A 1D2MA 3Q3CA 3BHNA 1H69A 1CY6A 3W2EA 2F67A 1XG5A 1CUZA 5HKAA 2YIJA 2PS1A 1DT5A 1ZMBA 4NXNB 1FDUA 4CRWB 1SBHA 1X94A 2RH5A 2Y0BA 1XMIA 4I50A 3C2QA 4WKCA 2CL0X 2ZWVA 1TU3A 1SOVA 3DW1X 3ETNA 3UW1A 3KSBC 3VKHA 3TXAA 4OMDA 3S5UA 5E4JA 4BB0A 3GPDG 2YC4C 3TPZA 2CMDA 2FFHA 4Z6KA 1W5TA 5INTA 2QBYA 4M46A 3S2FA 3VTAA 1UJBA 3PT5A 1EX7A 2C5BA 3I2GA 3UT6A 4YXFA 1IXZA 2GTHA 1KC3A 1A9XB 4GBMA 4PO3X 1DC7A 3NHSA 4U7WA 4V0MA 4RDXA 1TGVA 2R96A 2RGDA 3JQEA 3ONWA 1Z2EA 3OD1A 1CUUA 4A15A 1PJRA 1QP0A 5CX4A 3U0VA 1Z5PA 4XYGA 3N2KA 1FVXA 1OE0A 1ZLYA 2RCYA 4OY3A 4NAUA 4XQ9A 4LY9A 1VG8A 4MUYA 2HY7A 4XQCA 4FYYA 4L7VA 3S68A 1G0OA 2PGLA 4RS4A 4QYIB 2OAEA 2ZYRA 4OHFA 2AK2A 2PYZA 5CR9A 2LKDA 1DRUA 1F3OA 2P75A 3O73A 3OM1A 3KQHA 4C7MA 4F3CA 3A0UA 4DR5B 1GZ6A 1K3TA 4H3VA 2IS1A 3TNDA 4CMHA 2C7BA 2O8CA 2QVLA 1JSRA 4WIAA 1JDJA 1VA5A 3C16C 4GE0A 5HF9A 1KYXA 2P62A 4JAVC 1J0EA 4W99A 2V0GA 4WXHA 4KVFA 4UU0A 5CEJA 5JJIA 4Q0MA 3BH7A 3T35A 3FMPB 2VF2A 2I4OA 2DC1A 3UY4A 2VQFB 4YJ3A 1RWNA 2EL9A 2NX2A 3PYLA 4Y9UA 2CFRA 2AIRA 3RREA 3IKJA 3PU6A 4RXTA 4I4TB 5ALTA 1GPNA 2WJVA 1C3XA 1SKAA 4I08A 2FK8A 5EI5A 4BNZA 4EY6A 1O94A 1M54A 2P2GA 4ND7A 1F06A 1V3UA 1CK4A 3Q2KA 3OT1A 2EIHA 1QTIA 4OOFA 4I3HA 3D3KA 4LVCA 1PR0A 1XU9A 4P5PA 3TD2A 3JQGA 1V48A 3IQDB 3ANTA 5K8JB 1G64A 4DWJA 2Y1LA 3KKEA 3ND6A 3GLFE 1WWKA 2J9FB 1IMJA 3WKBA 1XP5A 2CHVA 3ZLVA 1QC5A 4ZVKA 4HK4A 1ZIPA 4FEYA 1HZJA 4WK2B 3ZS9A 2BE9A 4NVRA 4RY2A 3Q0EA 3T61A 1NWHA 4EX6A 3LLCA 4D99A 3R0JA 5H16A 4YDSA 3C39A 1Q7CA 1XC7A 2NU6A 3D8UA 4YJ2B 3CE6A 3LL7A 2O2ZA 3L92A 1K4KA 2NSJA 3MMNA 3P71T 2ZPUA 1F60A 3A25A 3I3SR 4KX3A 1QGZA 3TRJA 4M36A 2O1EA 4ITVA 3UV6A 1YS4A 1HDEA 5I7WA 16PKA 1ZGHA 4F4HA 4BTEA 1T3HA 5EERA 1BNCA 3TVDA 4JQOA 1HBJA 5DTRA 1JDPA 4D2IA 1KU6A 4MVJP 2JAQA 3RTAA 1Q0TA 4J1NA 2QV0A 2QXTA 2X8AA 1R5JA 1ORDA 4H3KB 4WNCA 2O2IA 4X61A 4X94A 1J0AA 5M29A 3E1GA 1VLHA 3I9MA 1E3EA 1V5WA 1MW8X 3O8NA 3P7MA 3BB4A 1CB0A 3WR5A 2NZJA 1LF0A 3CZRA 4GQIA 1UOQA 2VHVA 4B6FA 3I5UA 2Y2UA 3RS0A 4D80A 2ZJ2A 3HI6A 3MS4A 2PMBA 1ZUHA 3BBPA 1XRSB 3F5QA 3O8LA 5LZ8A 1X92A 4A3SA 4D0NA 2GBPA 2IJGX 3EWAA 2DKFA 3K09A 3S7TA 4PQGA 4D6PA 1CJTC 2HJRA 2ZBUA 4N12A 5DHFA 2NN3C 4UEKA 1SU6A 2HA4A 1Z0DA 1QYDA 3GRFA 2EHDA 2OZVA 1U0BB 3CO5A 5BN4A 3ZTWA 3GJ3A 4A2CA 2AZDA 4TS4A 5JVDF 2FJPA 3P2OA 1JDZA 1K2VN 1S6YA 2B36A 1U1EA 2W6CX 2XRYA 1EDBA 4MULA 1M2VA 3UCFA 3PPXA 1ULUA 2AG0A 3T3OA 1QQTA 3CGWA 4AF6A 3A6JA 1F4VA 1FXSA 1Y6QA 3DNFA 4O0LA 4X1YB 2W5UA 3GDGA 2B9EA 3TCKA 2QNBA 1J8MF 3PWSA 1TM4E 4ZZ0A 1UXKA 2D4AA 2V5AA 5EPEA 4FYIA 3U62A 3ROQA 5LQRA 3ONEA 2AFHE 1II0A 4LV5B 4Q1EA 1YZGA 2ACKA 3OIGA 5CB8A 4P4GA 4HFMA 3EOZA 4JBNA 3VU1A 4EENA 1XV5A 5EVJA 3TCNA 1UK8A 1TM1E 4F71A 3G5LA 5IZCC 3NWOA 2WD8A 4Y9RA 2ARKA 2QPTA 2PUTA 5A6VA 1SZJG 3M4XA 1LXCA 5C8YB 3MXTA 4WVLA 3V97A 2SCUB 5KIAA 3BWMA 1RRPA 4F1WA 3I45A 2VT3A 4MHSA 2EJUA 2H31A 3WJ1A 3PHCA 3WLOA 4CYMA 3EVDA 3AKZA 5HRCA 3CKKA 3FYHA 3VBEA 1UDCA 5CVTA 2G83A 2H9YA 4C4AA 3IODA 1X0VA 1ZEMA 2AEMA 3OLWA 1SHZA 3FIJA 4TMZA 4HT3B 4XDYA 1ZG3A 3NWBA 3ZXSA 1MJGM 2YICA 3WJAA 4N18A 3SSOA 1BXKA 3L6DA 2V4MA 1JAIA 3KR2A 4X54A 3HCFA 3WY9A 4JI0B 3O8QB 3PUZA 4PG7A 4O2AB 4U00A 3EVTA 4YMLA 4UHHA 2H1RA 4G41A 4E3ZA 4RVFA 5KQRA 5HTOA 4WRRA 4Q1DA 2B5VA 1ZGCA 3T3IA 5CYFA 3EEOA 4C30A 5DYTA 2JGDA 5HK8A 3GLRA 3AHFA 2LCIA 2VK1A 2Y67A 1Z4NA 5CA1F 1EGQA 1XP8A 3RCBA 5E0OA 1VLJA 2XD4A 2B6NA 2H7CA 2O4UX 2PZBA 1XCPA 2HLNA 2BI4A 4A23A 4MUHA 3SOPA 1HFEL 2YWCA 1VDMA 2HNAA 1U0NA 1JLHA 3HBNA 1OIXA 5FNVF 4JBXA 4QBKA 2ET6A 1JKJA 4PGAA 1DEXA 5ITVA 3DEJA 1SWWA 2PLWA 5TLSA 4ARCA 3QXJA 3U9LA 5L3RA 2X7XA 1L9XA 2WJYA 1NUTA 1F0NA 1QANA 3SXPA 1PKEA 4EG7A 3JQPA 4Q12A 2J85A 2CHGA 4L8LA 1Y8AA 2E48A 4XD2A 3K2QA 3N07A 1QIJA 1BEZA 3SEAA 4NF2A 1Q91A 2CMKA 2QX8A 4A0HA 1IB6A 1ZYUA 2ONZA 4IIJF 4J16A 4CM6A 5CBPB 4C2UA 5A0TA 1R7RA 4G07A 1FSPA 2YHBA 3DXYA 2MDTA 4I8DA 4R31A 3WYDA 4HRXA 3TAUA 4MWGA 1IXSB 1K8XB 4PPNA 3THOA 3W8FA 4CLOA 2HBRA 5CK5A 1P7YA 1ZM4A 5D2CA 1SULA 2G25A 3MW8A 3L7OA 3OJEA 5EJ2A 4AD8A 2I33A 3O31A 3LPNA 3QEOA 4JB8A 5BURA 1TKCA 4XUDA 1FVFA 4U9UA 4M1KA 4QNRA 2G06A 1QBGA 2YXEA 3X1KA 4A27A 3E2PA 1MOPA 2IX3A 2GAAA 2HZBA 3WADA 4TYWA 3KOWA 1SEPA 4D8XA 1S7GA 2APJA 1EP1B 4HQKA 4PANA 4IINA 1ZD9A 2P3SA 4KXLA 1JIIA 5BN3B 4MVWA 5A0FA 1CUXA 1UOOA 4MEAA 5EA2A 1I0LA 4X1KB 5LSAA 3NBFA 5FWAA 4EPXA 3F6EX 3IT2A 3PF8A 1W93A 2WF8A 2D1TA 4KR3A 5IC4A 5FF9A 1P1JA 2PO5A 3WMXA 1BS9A 4NZ9A 3RB8A 3FCCA 3C8DA 3DUWA 4IEFB 3BGIA 2JIRA 5CHEA 1G8SA 1DIOB 3EXFB 4BVLA 3JASA 1OREA 4FC6A 3KJFA 2JDID 2ZDQA 2FFBA 3RS7A 3QIAA 2W6PA 3QY0A 1T2DA 2F3SA 1T9GR 3I2FA 4CKWA 4BAZA 1XL1A 2D8MA 3EA5A 5HKKA 2OHIA 4IHJB 1TA9A 4MKIA 4W9NA 3V1UA 3PEFA 1MQAA 4CT5A 5HVNA 2I8AA 4B33A 1HDCA 4IQFA 1E1DA 4KOAA 2YIMA 2Q7DA 3MF4A 3VGJA 4F85A 3MCWA 3RW9A 6GPBA 1FJHA 5GAJA 4HDRB 1JLLB 4TTAA 4UNRA 4RULA 1MF7A 2VPYA 2XMDA 3PYMA 4HYTA 4G56A 1OKKA 2WKPA 5KJ1A 1XMXA 1OY1A 1JEDA 2OV4A 1YC2A 1YMQA 1KZYC 4AZ0A 3AEXA 4MUMA 3IKVA 3UMGA 4TQAA 4CM8B 4CQNA 2PTHA 1PNTA 1W59A 1U94A 4ZHQA 5JHGB 4HB3A 1H9CA 4NS4A 1KGSA 1J22A 3P96A 4BY9E 4RY8A 1JT9A 3DAFA 2D54A 2W93A 1Q1QA 4HPXB 3UA4A 3CYFA 1T3TA 1PNVA 2E82A 2QTGA 2ZB3A 1FDSA 1VJTA 1WDLA 4WLUA 4BGEA 3DF9A 1LKZA 6YASA 3H75A 1UP7A 5E2BA 3RIYA 4BPRA 4NAHA 1MH1A 4QNNA 3IAXA 4CEHB 3O74A 2JS7A 4RGYA 4V3CA 4KLCA 1RXVA 1R4NA 4HY3A 1G9TA 4GG1A 4JQCA 1EDOA 5A9SA 5KNDA 1CUSA 4X7MA 2P6RA 1TK2A 4X1IB 2JAUA 2HRRA 3B9PA 3QBDA 1FP2A 3QVGB 3LX8A 2EJWA 2EKLA 3KLPX 4TLAA 4TV8A 2E2WA 5AQEA 1I30A 3JD4A 3T95A 1OJ7A 3JZIA 5TMEA 4FPXA 1RRMA 2YV3A 2VJQA 3WLTA 5B1SA 3HN6A 3FHTA 3GLQA 4RA6A 4MGKR 1JQJC 3GGJA 2ZJAA 4G65A 4GI2A 2EEPA 4A91A 2R4QA 5E1MA 5P21A 4RIIA 4LXUA 4TWBA 4U1RA 4KXNA 2WYUA 3F71A 1M7BA 3F46A 2XNJA 4YAIA 2DBYA 3RR2A 3O03A 3PGXA 4NCJA 2QVCA 2G9ZA 1WMEA 3A28A 3A4LA 2IYQA 2JRLA 4DV4B 1MLDA 3D9QX 4INPA 2GDJA 2DTEA 4G5SA 3L01A 3GVCA 4S1TA 3HVHA 1ONNA 3BUSA 2QYSA 5J2UB 1W5FA 4PBTA 4TV9A 3ZEAA 4HRYA 1QHFA 1AKUA 5M34A 2JZOA 3DCIA 5ALHA 3HNPA 1RTKA 1U0EA 3LU1A 1G66A