2G9NA

Structure of the dead domain of human eukaryotic initiation factor 4a, eif4a
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
216
structure length
202
Chain Sequence
GVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEPSAIQQRAILPCIGYDVIAQAQSGTGTATFAISILQQIELDLATQALVLAPTRELAQQIQVVMALGDYMGASCHACIGNVRAEVQLQMEAPHIIVGTPGRVFDMLNRRYLSPYIMFVLDEADEMLSRGFDQIYDIFQLNSNTQVVLLSATMPSDVLEVTFMRDPIRILV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparative Structural Analysis of Human DEAD-Box RNA Helicases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Eukaryotic initiation factor 4A-I
total genus 57
structure length 202
sequence length 216
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2006-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2g9nA00
2WZQA 1US8B 1X8KA 1YZTA 4LBZA 3I8XA 1ZNXA 4GZLA 1W2GA 4IXMA 1QG4A 1QHIA 3PUVA 1M1YE 1QDEA 3CO5A 4KSCA 1ZCBA 1FNMA 2QE7D 2ODEA 3DMNA 4WBSA 5H1YA 1EFTA 5LB4A 1E4YA 1ZUHA 2V3CC 3S1AB 3AQ4A 3QBTA 3CM0A 2P6NA 4A15A 1MABB 2R6CA 4JKYA 5DE3A 2PJZA 4ZV4A 5B58C 4M1KA 2KWIA 2DBYA 3TK1A 2IS2A 2VTKA 2FPLA 2WJIA 4V0NA 1W47A 2PMKA 2YVUA 4JYBA 4KVGA 1IXZA 1E69A 1GAJA 2ZE6A 5EUMA 5KDOA 3U3OA 2ZJAA 4JLOA 2VL7A 1W2HA 4P4UA 3B60A 4IXNA 4M22A 1LTQA 4QG7A 5FBVB 4S35A 1YKSA 2NTYC 3WBKA 4CEJA 1XD9A 1M6NA 2IK8A 3GJ3A 1XB2A 3GJ5A 4QRHA 1Z3IX 3SE0A 1KK3A 4LV5B 4NCJA 2ECKA 1TQ2A 4N3NA 4Z1MD 4HZIA 4OYHA 3F3YA 3KKMA 4Q7KA 1DARA 5CB6A 2ODNA 3N2IA 3ZVNA 2GBLC 2OCYC 3QG1A 1UFQA 1XF9A 5IDVA 3EWSA 4MRVA 3KQLA 2XGJA 3ZS8A 3GLIA 3SBDA 2E9SA 3CKLA 3ZVLA 2ZJ8A 1IQPA 2KJQA 3V9PA 4EAQA 4AI6A 2VQSA 4FXPA 2OG2A 5KPJA 4UXJA 4B3DA 2JLVA 3H0KA 3RWMB 2X2FA 4G5RA 1T0JB 4NBSA 3K1JA 5CITA 2WPDD 2QRZA 4RD3A 1HY3A 4Q4AB 3VR3A 3TH5A 2QP4A 3TSOA 5E7JA 1XD8A 4GDFA 3FMPB 2PT5A 5HCIA 1FFHA 1G19A 2IC5A 1TQDA 2JEOA 1FPMA 2QSZA 5TB5A 5FI1B 3WMGA 4IW3B 2CHVA 2WMNB 521PA 1VCNA 1PLJA 3SJBA 3BRWD 3M4YA 1J70A 3GQBA 5H68A 1F2UB 3BFVA 2B7BA 1E2GA 3VR1A 5JWOA 5DISB 1D2EA 2PZFA 5B57C 4P4TA 5FBRB 4PC6A 1G7TA 3HWSA 2QROA 1G9XA 1TEVA 2D2EA 1OFIA 2REOA 3LVRE 4IDQA 4DEYA 2IYXA 2O8EA 4D82A 5EXTA 1SKQA 2QG6A 4A0GA 3T5DA 1XPOA 1G8HA 1Q57A 3OIYA 1Z07A 3LXRA 1CR1A 4HYYA 2ODWA 1R8QA 3IO5A 3TBKA 3D8BA 4WZAE 4TLAA 5B30A 1NNEA 4NPHA 2WKPA 4DLRA 1RE0A 2F6RA 4V0LA 1DAIA 2GETA 3HU1A 1N2CE 2UKDA 3LV8A 5E7IA 1J90A 3GLGA 1MH1A 1JR3D 2RAPA 1ZM4A 2Z43A 5DI3B 1Z6GA 2JLQA 1U0JA 1BYIA 4HUQB 3KFVA 4XSHA 2GCPA 2IUTA 3B9QA 3ETLA 3TSZA 3RS3A 1UDWA 2IUUA 1L7VC 2G0TA 3HYRA 3AKDA 5J40A 2ANBA 3UATA 2PZEA 4LYJA 2Z4SA 1E1QA 4MITA 121PA 3T61A 1W4CA 5AJYA 1A82A 4OI2A 2D74A 1I2DA 2G83A 3PQCA 5JJLA 1YE8A 4ARZA 3TVDA 4ZIRA 4WW0A 1KI8A 1OKKD 1W36C 2O8CA 1P9NA 2AKYA 4AK9A 2HT1A 1BS1A 3SHWA 3VAAA 2NMVA 5FTKA 1Y3AA 1P9WA 5SZJA 1E4VA 3LA6A 2E87A 2ZQ5A 4PHFA 1P75A 4B47A 2CL6X 4PPQA 2Z5FA 3B5JA 2ZSFA 1OH6A 1II8B 1NN5A 3OEEA 2GDJA 4JVSB 3EIEA 3QXCA 3BORA 2LKDA 4KODA 4NYJR 1BIFA 4EIWA 1C1YA 1G8PA 4YMWA 2OCAA 2IYTA 2HYDA 5AWFC 1NVXQ 4G5OA 1KKLA 4QBHA 1P2SA 4K46A 4DIEA 5FUXA 2JLZA 2RGNA 3MUFA 5JMTA 5TV2A 1NSTA 2ZI7A 4MRSA 1VYUA 4FCTA 1NRJB 3UMFA 2BHRA 4MYUA 3LW8A 2AD5A 3UXMA 3GP8A 3ZVMA 1ZD8A 1KAOA 1E9CA 4RZXA 2WOOA 1SXJC 5KNCA 2FFBA 3RC8A 1HH4A 1B0UA 1KI1A 2FGJA 2NQ2C 1E2KA 3UMSA 3DKVA 4TLBA 5CIWA 2ZS9A 3NH6A 1E2LA 2RGCA 2GA8A 1Z22A 2ZRCA 1XU4A 4RZUA 4YXWA 3PUWA 1YU9A 3WMEA 4HAZA 1ZRHA 3W90A 2CXXA 3QF4A 4QGGA 1X8JA 1Z5ZA 4QJ5A 3BFKA 2XEXA 1ZUIA 3IEUA 4YQFA 2WHXA 3LX8A 1UEJA 3NH9A 3KXIA 5JWRA 3BE4A 3DM9B 1T3HA 1E1RD 2FG5A 4XIGS 4DSNA 2FFHA 2VHUA 3QENA 1GNPA 1GOTA 4DLWA 2FFAA 4PSAA 2VP5A 1N5LA 5EQTA 3T06B 2RHMA 1Q44A 4JBWA 4HAUA 4OK3A 3T1VA 2F1RA 4FWIB 3L0SA 2IW3A 4CEHB 2J9RA 2C78A 1JR6A 1GKIA 3G5UA 1UBCA 2XTMA 4AG5A 3PEWA 5L3QA 1E98A 4TYQA 1S3SA 4P4SA 3I5YA 4D25A 5F3WB 1SXJE 1E9SA 3E2IA 4QGFA 1ESNA 1II0A 1E2HA 4NKRA 2ZE7A 1OW3B 2EW1A 4POAA 4DSUA 1E2QA 4QNRA 2J1LA 1G41A 4B73A 2ZJYA 2H92A 1DO0A 1R0WA 2JJ2D 2R9VA 3L82B 1IBRA 3KKQA 1GWNA 4Q4HA 1U94A 1UADA 4QL3A 2ONJA 5L8VA 3OESA 5FOUA 3BGWA 4NCKA 4IOMA 2JDID 2RGAA 2V6JA 1Z0JA 4TSFA 4TSFD 3MCAA 1GDDA 4HAVA 2ZVPX 1N6HA 2ZU6A 5AUNB 3C5HA 2GJAA 2QEQA 5GVRA 1F2TB 4J0QA 1KHTA 1N5KA 1PLKA 4BLQA 3QKSA 2YOGA 2YC2C 1NG9A 2HF9A 3KJGA 3MD0A 1EFRD 1M7HA 2IYRA 3BD9A 3R9WA 3OFND 4WOPA 4A6PA 2FDCA 2BMDA 2EFGA 4OQNA 4MKGA 2A5GA 1RZ3A 3QF7A 2G3YA 2ZVQX 1SVIA 4TLEA 4RJLA 4UKDA 2H8KA 2QAGA 4Q7LA 4FWTA 2XOKD 2EWWA 2W83A 1R5OA 3QXJA 3W8RA 3K70C 5TY0A 2RGNC 3CH5A 2D06A 3WHLA 2OAP1 4W5WA 1FNNA 2IUSA 3EXAA 4HB2A 3WMFA 2ZM5A 1I4TD 2G6BA 1VIYA 4OK6A 4PAMA 5AJVB 1NY5A 4Q18A 3K53A 1DVRA 4BWYA 2O8FB 4LJ7A 4N0EA 5G41A 2IYLD 2WTUA 1ZYUA 1VCMA 4MYTA 3TUZC 3BS4A 1UBGA 5HKKA 3J81k 1FUKA 3ND8A 3Q3JB 4JLBA 4O2LA 4Q47A 3VU9B 1AZTA 2YC4C 3EZ6A 4RD0A 4NYIR 3ZIAA 1H8HA 3CNOA 2JJ1D 1GL7A 1E2PA 3SJZA 1HV8A 1RKBA 3B2EA 4B75A 4BFSA 3U7EB 1L8QA 1OB5A 1VG1A 3B1WA 2J0UB 3FMOB 2V7QD 4BPBA 5KHOC 1X6VA 2DYKA 1CXZA 1I4DD 3D6TB 4PO8A 3BERA 4Z8XA 5FPTA 4FMDF 1DS6A 3AVOA 2NIPA 2OILA 3IIKA 4RFSA 2DFNA 2R6AA 4EJSA 4UXIA 4ZO4A 3O8CA 4L4UA 3HP1A 1ZM9A 4MUAA 4DSTA 4PZZA 4WVFA 4PFSA 2I1QA 1P60A 3C7KA 1J8MF 5AUPB 1NBMA 2BMJA 4PANA 3Q5DA 2XZOA 1LF0A 3QNUA 1VHLA 3TR5A 4AG6A 2J7PD 4TN1A 4CT4B 3LX5A 1FUUA 3WNBA 2GVDC 1U98A 4RKEA 3ZD6A 5K8IA 1WE2A 1ZD9A 1SHKA 2L0XA 2O8FA 1IN4A 3C41J 1BYUA 1NLZA 4PHTA 3LNCA 1XEWY 2Q9CA 4QBIA 1YVDA 4JVMA 1ZUNB 4ZDIA 3LQQA 2VIIA 3AP2A 4JLMA 2R6FA 3OEED 4LV8B 4DUGD 821PA 3W6PA 1VPLA 3F5FA 2G9NA 2F1JA 1W0KD 4LJ6A 2WWFA 2AXNA 1ZIOA 2BBWA 1GFIA 2HLDD 2VF8A 3DMDA 4F7WA 1L4UA 2YKGA 5DHFA 4V0MA 2ERXA 3CPHA 2AD1A 5IK2A 4YMUA 1H8ED 4V02A 1X86B 4G5SA 3W34A 1HURA 5JHGB 2P3SA 1XCGB 1FW6A 2NPIA 2B92A 3X1ZA 3K9NA 4NTZA 3GLHA 3IPXA 2BBOA 4LOAA 4DDWA 3UMRA 2V1UA 1CLUA 1CU1A 3K8YA 4D4LA 4I1UA 4TTPA 3ZS9A 1OXVA 4RVCA 1KY3A 2QPAA 1TX4B 4KJZA 4OHYA 3QOFA 4PTLA 1Z2CA 4QHSA 1T8UA 1NIPA 4F4CA 5AJZA 4RKFA 2Q21A 1G6OA 1N6RA 1XMIA 3ZD7A 3GLIE 1S4QA 1G291 1MABA 3IILA 3SJCA 1TF7A 3U7HB 4ZPXA 1YRBA 3U3MA 2ZXUA 4US1R 2DWQA 3LFUA 1M8PA 4OHWA 4ZDJA 1GSIA 4CEHA 4A0FA 4C7OB 1BH2A 2G77B 1CTQA 1CR2A 2IYQA 2QP3A 3WYAA 2C5LA 3ZDQA 4HB3A 5L3QB 3CW2A 4AY2A 2KBEA 5DN6D 2Z0MA 4PPNA 1P7CA 4URUR 2HJGA 1OYYA 4DCVA 3B82A 4EPWA 1N6PA 2WOJA 5TXGA 3ZVRA 4GP6A 4C3ZA 2H1LA 4TQAA 4KAXA 2GESA 2CCKA 1MO3A 2GJ8A 1CJVC 3R8FA 3U5ZB 2X8AA 1QZXA 2XJ9A 4PX9A 3GEHA 4DZZA 3IHWA 3HR8A 4O0MA 3IEVA 1D5CA 2Q3FA 1AA9A 3THYA 2FSHA 1KDOA 1RRCA 4DBLC 3K09C 4HATA 3R8CA 1TL7C 4RCYA 1S0UA 4Z1MA 5EP3A 5IRCD 3GLIB 1E2NA 3EIHA 3MRSA 2EVWX 1P2TA 5FOWA 2PX0A 4XWOA 3NDBB 3CBQA 3IQXA 3LO5A 1KK1A 4TMXA 1XPUA 4HZUB 3TW4A 1YR6A 2RGBA 2FEOA 1KO7A 2W00A 2ZSEA 4M0LA 4GZMA 3HU2A 3IHLA 1Z28A 2GCNA 3UK6A 3AVUA 2CK3A 3PVSA 3SEAA 2YOFA 4HDCA 1Z8FA 2YWGA 4TL9A 2FZLA 3QEJA 3TAHA 4BUJA 1KI6A 1DAFA 1R10A 4II7A 3VKGA 2CHQA 5D3QA 3IPYA 3B8HA 3ICQB 2BKEA 2CVFA 4EPXA 3QUSA 1W36D 1N6KA 1JEEA 3L8YA 4NYIQ 1CIPA 1WXQA 1NP6A 2FF7A 1G6HA 1JPJA 3AF4A 3B1YA 1M74A 1SVSA 2BEKA 2A9KA 5CM8B 3TE6A 1KI6B 4LHXA 4DLUA 1E2DA 1OF1A 4GBMA 5JJIA 1G18A 4A2PA 2P0EA 2VP9A 2VP6A 3SC3A 3L0IB 2QSYA 4BRWA 1JI0A 2QRNA 4PQYA 2R44A 1P2VA 2GWHA 1VYTA 1W44A 1E0JA 2ZJBA 1H65A 3H1TA 4ZIRB 1IN6A 5FPHA 5GJBA 1KOFA 3RAPR 2QPTA 2ZREA 1GL9B 4AYWA 2ZRAA 2IF0A 2HT6A 4C0KA 3REFA 3D7MA 5F9FA 4V0KA 1I4LD 3N70A 2VHQA 3LY5A 1K8RA 1GRQA 3I4LA 1W46A 4XH9B 3GLGB 1PV4A 2ZETA 2F3TA 2GJKA 2PL3A 1E1QD 1G7SA 1KDTA 2PMDA 2ZRBA 2ORIA 2ZRKA 4HLUC 4IDNA 1O87A 5FOSA 3FTQA 4TMKA 2DPXA 2NO6A 2DCUA 4US2R 1YR7A 4RFSB 1EFUA 2QP9X 5JI3E 4B35A 4URVR 5LBIA 4H9GA 3I8SA 4LHWA 1VCOA 2GAOA 3K0FA 3EPKA 4ZCIA 1PUJA 3NEJA 2JLSA 3GMTA 2YINC 1DG1G 2BBSA 2SHKA 1MV5A 4XWAA 3GLFE 2OT3B 5CYPA 3SI7A 4FINA 3GLGE 5BYKA 1OB2A 2GCOB 4PHHA 4Q1FA 2HYIC 2W0MA 2IYWA 1LVGA 2J7KA 5HE8A 3AKEA 1NVVQ 5G40A 4DJTA 3A1VA 1KJYA 2JASA 3VX4A 1ANKA 2VSXA 5D3MA 1LW7A 2FX3A 4H1UA 5CK5A 3C8UA 4HAXA 4I4LA 4B3GA 1ZM2A 4EPVA 4P33A 4E03A 3ICEA 2DWPA 2W0SA 3EASA 3U3KA 1U2RA 2OAQ1 3S1AA 3NBZC 1EX6A 1KTVA 2D7DA 1KK2A 3QKTA 1HE1C 2F7SA 4TMWA 5J4VA 4FMDB 2ZRFA 2Q0HA 1COWD 3FMIA 3LDAA 3QJYA 1JXMA 2BVNA 2IHYA 3T1OA 1U99A 3A8TA 4D0NA 1N6NA 2YWHA 3PFIA 2ZTSA 4LHYA 2PBRA 5A5GA 2V6IA 4CYMA 1WCV1 1XFAA 4B76A 4B2IA 3NC1C 3AVXA 1T3LA 3VR4A 3KUDA 4DLSA 4QBGB 1WP9A 2BJWA 4GL2A 3TUIC 2WJHA 4TLDA 5JSZA 5K8TA 1XEXA 3BJIC 2WSMA 4HLQB 5IK2D 4URZR 1NI3A 1JAIA 1ZNZA 2AK2A 2NO0A 3GD7A 4KV9A 3IIJA 2OHFA 1E2IA 2W2VA 4QGHA 2VHCA 1YZLA 1AJEA 2JA1A 4M2LA 3JVVA 5FFMA 2YZ2A 2ZRDA 2WAXA 4CVNA 1P9RA 1R8SA 4BASA 2QTHA 5FR2A 1JECA 4OBEA 2J46A 1PZNA 4D4MA 1IOZA 4NYJQ 2VHTA 2QPOA 1ZC4A 2FH5B 4HUTA 1U9IA 5EE1A 3SOPA 3T35A 5JRJA 2MSDB 4DDTA 4BFTA 4LYHA 5JECA 4A0RA 5C46F 2ZPTX 4M1YA 2QMHA 4BLRA 5IT5A 2JIZD 5P21A 2C9CA 3MAAC 4UNSA 4EQ6A 3EAQA 3H86A 4GRAA 3U6KA 1XTRA 3LAWA 2BCJQ 3LH5A 4KHZA 1RJ9A 4TL8A 5AUOB 2X77A 1ZBDA 3GLFA 5KOYA 1ZMXA 2AXPA 1E9RA 2W6ID 2ZYUX 1NIJA 1XP8A 3CRVA 3DOEA 3RS0A 2QMUA 2UZIR 4OI0A 1KO8A 5EP2A 2YOHA 2QGNA 1G8FA 2PEZA 2XX3A 3THWB 4PPGA 1NG1A 4KFUA 5E3HA 5JEDA 1MOZA 1Q20A 2XTZA 4JKIA 2GXUA 1XEXB 3I5XA 2IYVA 2F9MA 1XXHE 3AKYA 3FMFA 4OJQA 2V7QA 5F98A 3RDPA 1NLYA 4DCSA 2LWIA 4EPYA 3CF6R 3OIUA 4QKQA 1PUIA 5FOVA 1XTQA 3IDQA 5G3ZA 3OEHD 4BE7B 1JJ7A 2CL0X 4B6FA 3SQWA 2XNDD 1IY2A 3B1XA 1GILA 4FN5A 3Q9LA 5HPYB 1LY1A 4MRRA 4AKHA 2QT0A 1DTSA 2ZSDA 3VMFA 4JLPA 2XSZA 3A1WA 1GVNB 5EE5B 4M1SA 1D2MA 3VQTA 5C4MA 1DE0A 3L0PA 1CJMA 4IDPA 1NVVR 3I92A 2EFCB 4QHTA 4HSEA 4BFYA 2QU8A 2IYYA 3ZZTA 4IEEA 1Q3TA 4TMTA 5H70A 2QQEA 1FTNA 2IYSA 3FFAA 2A5JA 1ZW6A 1AS3A 1RRFA 4G01B 4MRNA 3KQHA 1E9FA 1A1VA 2PLRA 1F5NA 3UWKA 4EJSC 2DR3A 1N6LA 2H17A 2GK7A 1N6IA 3BB1A 4CZ2A 4XD7A 1UKYA 3B9PA 4Q4JA 4ABYA 1G8YA 2ZYVX 4IVPA 3BK7A 1X8LA 2C04A 4Y0AA 5JS7A 1S3GA 1GKYA 2AN9A 4HLDA 3P4YA 2W6IA 1E2FA 1LFDB 3LLUA 2JDIA 5FUYA 3EX7C 2IS6A 3KQNA 5CJ2A 2XOKA 2JLWA 1QHHA 4V0ME 721PA 1KGDA 4TL7A 1ZIPA 1OXUA 2ZRHA 4F92B 2WWXA 1KNXA 2BKUA 3ADKA 1BMFA 3NTUA 1E9AA 2JIZA 5A0FA 1N6OA 1NN3A 3C4JA 2BOVA 5F9HA 1VIAA 2ZI3A 1WA5A 1H8EA 1XZPA 3AF0A 3CPJB 1FL9A 4PC3A 4TZ0A 3QQ5A 1S1CA 1W0JD 3OE7D 4NYMR 4OJKA 4OQFA 2ZUCA 1OH5A 3AVQA 3BOSA 4IOKA 1W0KA 2LCFA 4NCIA 3VX3A 3Q8XB 1EWQA 3TKLA 2IA5A 3THXB 3K09A 3NIBA 3RVBA 4R2HA 2PX3A 1U8YA 4MKFA 3AV0B 5DLQC 4GI7A 3BH0A 3RRMA 3O8BA 4U00A 1TTTA 3K0FB 1QHNA 4NE2A 2OM2A 5DYIA 4M9ZA 4B32A 4A1FA 4EPTA 4XWKA 5CDFA 2REXB 1OIWA 4EUNA 2B8WA 1D6JA 5KSPA 2YYZA 5FL7D 2GJ9A 4Q01A 2QNRA 4MA4A 3HYTA 1ZINA 3CH4B 2WWHA 4G0NA 3UIEA 2IHBA 1CP2A 3MJHA 4MGIR 3O8DA 4ZCLA 1E79A 3AB3A 4Q4LA 2A7QA 5JWHA 1W5SA 4IRUB 5KYKA 1SGWA 3HDTA 3LVQE 1TEXA 1KDRA 1MO5A 2ZRLA 4L9WA 3QKRB 1SZPA 2P6RA 2ZRNA 3EA0A 2OESA 3U3RA 5JRZA 3EIQA 4Q9LA 2GF9A 4OKSA 3ZJYA 2F1IA 4A6XA 4WZBE 2ZI9A 3K70B 1OH7A 4EFNA 1KI3A 1A5TA 2O5VA 3FGNA 3OIVA 2JLUA 1P5ZB 4A0HA 1LF5A 5FL7A 2YWFA 4B3FX 4LWZA 1E94E 2VP0A 4IKEA 4CIDA 3VKHA 2EFDB 2CLSA 1HTWA 1ETUA 3HU3A 3IBGA 3QKUA 4YLGA 4JVNA 5AJWA 5SZIA 2A5FA 1CRPA 2VP2A 2O0HA 2ZUBA 1U81A 5JI2E 2HLDA 4D6PA 3TR0A 4B74A 4BRUA 3VHXA 2P5SA 1WBDA 3KJIA 1FX0B 2RB4A 1XWIA 4UNPA 4CT5A 1JJVA 2BJVA 3GJXC 2O8BA 2NOAA 1DOAA 4GOKA 2JLRA 3ZYCA 3X1WA 2QZ4A 2Z6VA 4K8OA 2R2AA 2A3RA 4GNKA 1B23P 2CJWA 2ZANA 2AFHE 4L9SA 3P4XA 3U3JA 5FH9A 2P65A 2OFWA 3SYLA 1YR9A 4DB2A 3K9GA 1P4SA 1MO6A 2DHRA 2R8RA 4NYMQ 2FJUA 2VRWA 3EPLA 2QTVB 1FP6A 4FIDA 4HEJA 5CB8A 2WM9B 2OFOA 2D2FA 2ZR9A 4X8LA 5FTNA 4DCUA 4KU4A 3HJNA 2HDNB 4K81B 5BWMA 5KSOA 2CE7A 1P6XA 1OHHA 1KZ7B 3QPWA 5SZHB 1SULA 4Q1CA 5TDHA 2BWJA 2J5XA 2KE5A 2FA9A 5TARA 5IF9A 1JBKA 3BH6A 4B71A 2FV8A 1XCPA 3NHBA 4A8JA 4BZXA 1XTKA 1IONA 4Q48A 2GXSA 4OQMA 4NONA 1R6BX 4ZKEA 1WB9A 4Q02A 4ILEA 2WAYA 5KNBA 2NZJA 4A4DA 4GT1A 3D3QA 3TLXA 4TYNA 2ORWA 2OSBA 4PQRA 2WWIA 4PPFA 5E4FA 1G7CA 4PO9A 3NEYA 5UKDA 4MGYR 4C0JA 2AWOA 2WIBA 4B2PA 1G20E 1Z83A 3LXXA 3F0TA 2ZR0A 1HT1E 1TUIA 4PAQA 5EXSA 2FE4A 3KB1A 3ASYA 3PUXA 1U90A 1V43A 3PR1A 5B64A 4MQBA 3P32A 2YV5A 1N5IA 2DY1A 3GJ8A 3CRQA 3ZQJA 1T5LA 3KB2A 4PHGA 1SKYB 4A82A 4I1VA 3H84A 3GJ7A 1XPRA 4Z54A 2V8OA 3FB4A 3TMKA 3U7GA 4AURA 3ZQ6A 4RD4A 4Q03A 2QBYB 3VFDA 1EFRA 4Q4JB 4KI0A 2J0SA 3KKPA 3OFNA 2ONKA 2WJGA 3A58B 4TT3A 5DO9A 3EZ7A 4LDJA 3PEYA 3PV0A 2HV8A 3T1QA 4F93B 2QAJA 4DKXA 5E7MA 4UXHA 1UDXA 1II9A 1A2BA 4Z8YA 1U9IC 1KYIA 1AM4D 1L4YA 3MJRA 4FMBB 5ANRB 5BQ5A 1L2TA 4OK5A 2NO7A 3SNHA 1XMSA 4JJKA 1R4AA 1YZGA 3BFXA 3DM5A 3K9LA 3V4RA 4B33A 2CLDX 1UKVY 4US0R 1T6NA 2BMEA 2R6DA 3FKSA 1XBTA 5JJKA 4I1OA 1EFCA 2GCOA 4M9QA 1DO2A 4JLAA 1D9XA 4BGDA 3PIRA 3IBYA 2D62A 4BEBA 1VG0B 1WRBA 4XVQA 4LI0A 1K5GA 3P26A 2OBNA 1I2MA 4LPKA 1YR8A 3NHAA 3FOZA 5CJPA 3DKPA 4YDHB 4L15A 3LLMA 1S9HA 1NF3A 2Q3HA 4YMTA 1KZGB 2QTFA 1XXHB 2IEYA 4B48A 3QI2A 2WBLC 1ZD1A 3WYFA 1G4AE 2OV2A 4NU0A 2CCJA 1CKEA 3LQRA 2P67A 5EXXA 2GTPA 4Q7MB 5DI9A 2QMOA 3A37A 1ZP6A 3H2YA 4IHQA 1UM8A 2O52A 2QAGB 4JLKA 3PEUA 4HDOB 1RYFA 1X1RA 2C77A 3THXA 3UPUA 3EC1A 3AGQA 1SKYE 3WP1B 2OBMA 4D4KA 1UKZA 3TGPA 1KMHB 1JQJC 4ESVA 4QHYA 4JZKA 3AKCA 2CJWB 2IS4A 1KNQA 4NP6A 1R7RA 4Q9HA 3BXZA 2FZ4A 3QKRA 1S2MA 1BO6A 4JLJA 5H8WA 1COWA 2VBCA 2RGGA 2ODBA 2RH5A 2IWRA 4DWJA 3IIMA 3ZZUA 2FNAA 2ZE8A 5JCPA 5FOXA 2CK3D 4PZYA 4MDEA 4L8GA 1RJ9B 1M34E 1Z0IA 2WSSA 1OT3A 4TYPA 1ODFA 4M1TA 3KKOA 1IXSB 3RSLA 4LBYA 3I62A 3C15C 1XMVA 4JJZA 1AGRA 2ZE5A 4M53A 4GOXA 4TMZA 4C0LA 4EQ6B 2WWYA 2XB2A 4L16A 3VTKA 1LV7A 3ASZA 1G3QA 2VLIA 4JS0A 5KTYA 4MYHA 1RVDA 1TUEA 5JEEA 3MMPA 5HE9A 3SYKA 1Q22A 1XTJA 1KI9A 2GZDA 2ORVA 1IXRC 3FHCB 4XOIA 2D3WA 1DADA 2Q3MA 2WJVA 2F55A 4DLXA 3SFZA 2GXQA 5AUQA 2J0QA 1X1SA 4C2UA 4RSGA 4CRWB 4Q1DA 3K9HA 3EPJA 4XTRA 4IJMA 5FPKA 2XNDA 3QSYA 4OQLA 1E1RA 5GJWC 4BLPA 1GIAA 1G64A 2ZSAA 1YZQA 5AJXA 1W49A 1NY6A 3VHLB 2O8BB 2VP4A 2ZYWX 1VECA 1J7KA 4F38A 3ADCA 5FUVA 2Q9AA 1SQ5A 5CIQA 5FUWA 4HDQB 3CLVA 1KDPA 1XRJA 2V4ZA 4LJ4A 4QGAA 5AK0A 2PZGA 1OFUX 2W6JA 3DVLA 4YXWD 5KO2A 5DH9A 3CZQA 5B2ZA 2A2ZA 3QBVA 3THYB 2OCBA 2Q6TA 3QY0A 3CX7A 4RCZA 2F43B 4W5JA 2ZITA 2H57A 2AWNA 4LC0A 1OHHD 2EQBA 1N25A 3NXSA 4ACAA 3OHMA 3T34A 2BDTA 3MWYW 1TF2A 1W5TA 4H1VA 4HAYA 4MYCA 5G3YA 2VSOA 4E07A 2JLYA 3DL0A 1YZKA 4PZLA 5BYJA 3OAAD 4G3XA 1IHUA 2F1HA 5GVSA 1JEDA 1Q0UA 4QNMA 5FTJA 3RS7A 5KDLA 1ZC3A 3U60B 3W5JA 2REBA 2LKCA 1FP7A 2EFEB 1UJ2A 1G3UA 2VSFA 2DFTA 2EU8A 3EG5A 3OZXA 4YC7A 3ZLJA 4PC2A 2XAUA 1XEWX 3H4MA 2XITA 2CNWD 5KDDA 2OLKA 5EE9A 3KJEA 4ERNA 1S9DA 1OV4A 4DB4A 1KSGA 1DAHA 5G53C 2WSSD 1R5NA 1F48A 3CNLA 4LJ9A 3X2SA 1AIPA 4I81A 1E9EA 4QM7A 1QBKC 4B3CA 221PA 4CEIB 1OSNA 1T0HB 4DHEA 3L43A 2IBMA 1KIMA 3NVAA 5FPSA 1E2EA 2HXYA 3E1SA 1MT0A 1W4RA 4P31A 4JYCA 1VTKA 1ZAKA 4D0LB 4I1SA 2OEPA 4C30A 4DRZA 4DVGA 1Y63A 3W5IA 1BMFD 3QEOA 4KBGA 5L3SA 3NBXX 1QHXA 1AZSC 3AF3A 4GMXA 4HAWA 4LX0A 1HYQA 4V0OA 1QG2A 3X1DA 1CR0A 4B3BA 1TQ4A 1VKJA 3QXXA 4B44A 2W58A 2ZAMA 4TYWA 1M2OB 2C8VA 3T1TA 2H5EA 4C0QC 3ECCA 5KU1A 2QENA 3A4NA 4DDUA 5FPYA 3U44B 2P5TB 4LC1A 4BFVA 4BECA 1N0VC 1WDTA 4DDVA 1U8AA 4IFBA 1DG3A 2KBFA 1KI2A 3CB4A 1KI7A 2B21A 2FEMA 2X2EA 5DSZA 3GJ4A 2ZJ5A 3KDSE 2MSCB 5SZKB 4U02A 1Z6TA 4PC7A 4DCNA 3GJ0A 1NLFA 4DT1A 3EZ2A 4D0GA 2RHDA 5EP1A 1DAKA 1Z0KA 4M8NE 4TQ9A 4AKEA 1P2UA 3RNLA 1ZU4A 1XDBA 4JBXA 3OF5A 2OUKA 5JSZB 2PCLA 1P72A 3CPEA 4JT4A 4UNQA 5EZ6B 3Q5EA 3Q85A 4TTRA 4ASUA 3CWQA 5ELXA 2H7VA 3SHFA 4C0HA 3GJ6A 4LHVA 1RC8A 2Y8EA 1E32A 1Z06A 1XJCA 1MRSA 4ARZB 5J4YA 3RS5A 4AD8A 4IOLA 4LCBA 4P0TA 4XVUA 2WMOB 3AUXA 2NO1A 5FI0B 3MLEA 4Q1BA 1UAAA 2PEYA 3P20A 3QXSA 5JBQA 2AFIE 4LUCA 2IL1A 1TU4A 4QC2A 1CBUA 1T9HA 2QE7A 4JSTA 2J41A 1GITA 2HCBA 2GF0A 3P27A 1SVLA 3W3AA 4PO1A 1N0UA 3P1JA 3EARA 4WAUA 2BMFA 1II8A 3LWNA 4RY2A 4M4SA 4TLCA 1IN8A 2RGEA 2IXEA 1AQUA 3TRFA 5HZKA 4LY6A 3WNDA 2KB0A 3M6AA 3CRRA 1IJFA 1R0ZA 1LNZA 5BN5A 3GPLA 3PENA 3Q7QA 2GZAA 4HI0E 5C1BA 3FKQA 421PA 1NBME 5GJCA 1EX7A 2H18A 4FI3C 1U8ZA 3MWKA 4UNNA 3PEVA 5DN6A 3EWAA 4UNRA 3PG5A 3QG5A 4M9XA 3SBEA 2FGKA 3NKVA 5EJEA 1GKUB 1KJZA 3ADDA 4TZ6A 3T5GA 1NVWQ 3MWLA 3EZ9A 2FFQA 4KLNA 4Q19A 3B1VA 2QM8A 5JZVA 3KFXA 1IN5A 4ON9A 2QT1A 2BEJA 1T5IA 4B6EA 2ATVA 4OI4A 1NMYA 3X1XA 1AS0A 3DDCA 1W1WA 1IY0A 2AKAB 1K5DA 5AR1A 4M1WA 1GG2A 2ZYTX 3BIFA 2E1RA 3AF2A 2F9LA 2JCSA 4R2IA 4AIIA 1XCMA 3FE2A 4O2RA 3LW7A 1NJGA 1NKTA 1NN1A 4MKIA 2RGDA 2GEVA 5DYGA 1AK2A 5FL3A 2BM1A 4HLCA 4D81A 4MH0R 2JJ1A 3GLHE 1KSHA 3SQXA 1F3OA 1PJRA 2VA8A 5TVKA 4Q9IA 2CEAA 2GRJA 2ZRIA 3E5HA 8OHMA 2OCPA 2Z4RA 1F6BA 1CRQA 1NMZA 2RCNA 1IN7A 5LD2B 3QXHA 3FWYA 4GPTA 3ZGXA 4BLTA 4BQSA 1GRRA 2P2LA 3PUZA 4ZI2A 3RYTC 1W48A 6Q21A 1QHSA 1Z63A 1RFLA 2W2XA 2JJ8A 4URWR 5C2JB 2FU5C 1TAGA 3ND9A 2IYUA 3UWOA 4RFVA 1ZCAA 2C99A 1SVKA 1CS4C 4DUGA 1ZJ6A 4GOJA 3I61A 4BZPA 4JLDA 4Q1AA 3QIAA 4L5BA 1XJ0A 2NGRA 3RRYA 4CEIA 1RYHA 1N3BA 2AL7A 4Q21A 4UJ5A 2DWOA 5A4JA 4GFDA 1HQCA 4D26A 3IGFA 1SXJD 4JLNA 5EXPA 3TSWA 3G0HA 3AVYA 5FTLA 1HT2E 3VNUA 1FMLA 1AKEA 4LHZA 4B34A 1F2TA 2V54A 1NBMD 3Q72A 1Q3HA 2A30A 2IYZA 2QBYA 1Q21A 1S8FA 1DBSA 5J4LA 5KSYA 5FBQB 2XZPA 4HLUA 2VH5R 4LV6A 2ANCA 3K0AB 3RWOA 1VYVA 4XD7D 3SYNA 2DB3A 2WV9A 4DIDA 1EGAA 1WMSA 2IEZA 3RS4A 1D9ZA 2FPKA 1Z29A 2DFKB 4M1OA 3U44A 1KO4A 2QA5A 3WRXC 5FOTA 1G3IA 1Z08A 1AKYA 4DLTA 1DELA 2ZUDA 4IFEA 1Z0FA 3K0AA 4EFLA 4P3YA 1Z0AA 4ITRC 1ZNWA 4C0AC 2HEIA 1ZU5A 4A36A 2ZEJA 5DIFA 4AC9A 4GMDA 2XXAA 3QVUA 1KMQA 1A4RA 1E9BA 2EWVA 1KMHA 3B85A 1T91A 3GLHB 2IWHA 4TMVA 2X1VA 2D4HA 4URXR 4B2LA 2IXFA 3BB4A 2C95A 3EW9A 3K0EA 2HJVA 2O8DB 2ASEA 2VO1A 4PC1A 1K6MA 4PR0A 4YONB 2CHGA 3QPVA 2ZSBA 4JL6A 4PSKA 1OJLA 1W0JA 3MSXA 1J2JA 3OE7A 3PUYA 5CYOA 1EXMA 3NDPA 3UANA 3A4LA 2QI9C 1Q1EA 1G4UR 5M04A 1NJFA 4WA7A 4KFSA 2ATXA 1DEKA 2X19A 3IUYA 4FD2A 4IEIA 3W8NA 1OIXA 4IVRA 4DC9A 3T15A 1FQKA 2J45A 4YDSA 3VR2A 4DEXA 1CJUC 2WICA 2ZJOA 3FYHA 4F4IA 1TNDA 4YMVA 1OIVA 4KYIB 3C14C 4FCWA 2A5DA 2GEUA 1YZNA 2ZU0C 3MG9A 4JT2A 3L8ZA 5BN4A 4KCGA 4ZI3A 3N2EA 2EYUA 2I3BA 3HPRA 4DCTA 2NG1A 3R9XA 4MGZR 2J59A 4AYTA 4R71A 2GVZC 1XJQA 2FSFA 1WQ1R 3ZH9B 1E2JA 5JFGA 1E79D 4C0SA 4XTCS 3WBJA 3BC1A 3CX6A 2VEDA 4JVLA 2UZ3A 3TW8B 2XXAB 3TAUA 1JB1A 2ZRPA 3KTAA 2J3EA 3PCRB 1GRNA 4FMCB 2WJYA 3WNCA 1NL3A 1UEIA 3A1UA 4GP7A 5FR1A 2OO7A 5K8UA 4LYAA 1E2MA 5GADl 3M1IA 4AKIA 2QM7A 3AVPA 1UBFA 5HTKA 1A2KC 3AUYA 1S1MA 3ZIAD 2XTNA 4NMMA 1HQYE 4BFWA 1CJTC 4JLVA 1OXTA 2NO9A 4DLZA 4TWZA 3A1SA 3GCGA 2XSZD 3VU9A 3AF1A 3B13B 1XNJA 2XZLA 2IXGA 1XTIA 3T12A 1FOEB 4NCNA 1G5PA 2ZR7A 3C5CA 4X8OA 5GJVC 4BLSA 4ZCMA 2ZI5A 4KO8A 2O8CB 5HR5A 2CL7X 2VYFA 5IHPA 2WWWA 1EESA 3U61B 2G88A 1AN0A 2WKQA 4C4PA 2PJRA 4CGZA 4X8HA 3I3SR 4BFUA 1ELOA 1KO5A 1FX0A 5DNYB 1CULC 1SVMA 2F43A 4AKGA 1EK0A 3L0OA 5HZHA 1QHHB 3I32A 1YQTA 4LJYA 2A78A 3BB3A 2J0UA 2C2HA 3PITA 1BOFA 1G16A 3JZMA 3NC0C 3HPQA 4AYXA 4O3MA 4BLOA 4S2EA 4Q7JB 3NBFA 1OXXK 4CDGA 4CEJB 1SXJB 3CUEF 2FPMA 4QBFA 1FZQA 2C9OA 4TT3D 1JAHA 1EWRA 1Z47A 1G17A 2PCJA 4LYFA 3UG6A 1KY2A 3CR8A 1YRAA 1ZVQA 1W36B 3IO3A 3AVVA 1JNYA 1AQYA 1UBEA 1QRAA 4JSYA 4MRPA 2IX3A 1KI4A 3Q7PA 1GUAA 1VMAA 2P6UA 5EP4A 4W7SA 3DEFA 5HCNA 2AX4A 3U2QA 3UG7A 3DO6A 1XD2A 5L3RA 2FSGA 1E6CA 2OXCA 3W6NA 4JBYA 5BXQC 1RIFA 1ONBA 4XVRA 4O25A 3QKSB 2FOLA 3PXGA 2O0KA 1EG7A 4HB4A 1XTSA 1OH8A 4X8MA 2V1XA 1Q1BA 5J5CA 3SN6A 1E0SA 1QHYA 3GEEA 3AP1A 3F8TA 4Q9KA 4EKDA 2WJJA 4QXAA 3TUJC 3CR7A 4P4SB 4EDHA 2BCGY 2GILA 1TQ6A 4IVQA 4ZDWA 3JZAA 2MMCA 1E0AA 4ZDKA 2C96A 3SU8A 2C9YA 3ZZ0A 2ZRJA 3MFYA 2W6JD 4G5GA 3WXMA 3VR6A 4G5QA 2GEDA 3LBHA 4NDZA 3RRZA 3THOA 3E70C 1S96A 1OLOA 3MWJA 4D80A 4NZYA 2W2TA 1ZM3A 3AP3A 2ZI4A 1OFHA 2WVJA 3KL4A 1O3YA 2B8TA 3N5CA 1Z2AA 1N0WA 3WYGA 3FVQA 1P61B 1Z6XA 1VDZA 3DPUA 1CF4A 3WHKA 1BKDR 1OXSC 1SVWA 2ERYA 2YJTD 3CF2A 4A2WA 3THWA 1DAMA 2O0JA 2QMEA 2ZRMA 5L3SB 5C4GB 3L2OB 4QFMA 4PAOA 4LRWA 1W4BA 3A4MA 2WIAA 4Q9JA 1AGPA 2VHJA 3EC2A 5L3VA 2WKRA 3DZDA 3CIOA 3GFOA 3PJRA 2QN6A 2MSEB 2RKOA 1KO1A 4W5HA 3SDZA 3M0EA 4I99A 1T8TA 2YHSA 1GNRA 1G1MA 3R20A 1KJWA 2CNWA 1XXHA 2V55B 2R6GA 3BBPA 3CX8A 4JL5A 2FN4A 1NVUQ 4DXAA 1IJEA 2YNMA 4KLZA 3I73A 4IDOA 5FBLB 1TU3A 5BW8A 4KFRA 4C7OA 1KAGA 2IF2A 2ZI6A 4NHOA 4R7ZA 3SZRA 4JMPA 2BC9A 3U4QB 1P3JA 2B7CA 5EE3A 4URYR 4HB0A 1WF3A 4W9MC 3R7WB 2O8DA 2ZJ2A 1F2UA 4DT1B 5EUQB 4OHVA 1GP2A 4Q1EA 3NBYC 5JS8A 3B6EA 4D4JA 1FQJA 4ASUD 2PLFA 2F3RA 1RW4A 1T4GA 1KKMA 3A36A 4A9AA 2AHOA 2O8EB 2C98A 2XJ4A 1EFHA 2CE2X 3RC3A 1NSFA 2ZJZA 3G82C 4M1MA 4E09A 1D2NA 1P62B 1GL6A 1PVOA 5DI3A 2ZRGA 4RD6A 1QVAA 2JGNA 4A8JB 2KSQA 3KKNA 4D2IA 1VHTA 2WPDA 4F4JA 3VR5A 2DFLA 4RD1A 4A8JC 5CK4A 1E9DA 3FHOA 4RZ3A 1SHZA 1US8A 4KXFB 621PA 3GFTA 1E3MA 4IOJA 2QQ0A 2V9PA 1ESMA 4HZUA 5F2EA 5HKKD 3DZ8A 5LD2C 1HE8B 3BAFA 4KYUA 1LS6A 4PXAA 3KXLA 2GJSA 3DOFA 3U7FB 2N42A 3RABA 1VCIA 1G5RA 2HCJB 4IDHA 1OFTA 3I72A 4NCHA 2VPPA 2QY9A 1G7RA 4AWXA 3U4QA 1FMJA 1RRPA 4BEJA 1GTVA 1JPNA 2KI5A 4OHXA 3D31A 4WIAA 5CLLA 2XB4A 1DAGA 4ESHA 1MO4A 1R0XA 1LS1A 2ZROA 1P73A 4LPSA 1QF9A 4V03A 1X3SA 4PSVA 1Z6YA 3FFBA 2ZS8A 3LD9A 3REGA 2PT7A 4F91B 4KITB 3KXKA 3K0SA 1XZQA 4Q5IA 4XSGA 2OBLA 4DSOA 3WY9A 1HEIA 3NG1A 3U6BA 2NZ8A 4WXPA 5EZ5A 1XD2B 3MGCA 3QPUA 1G5TA 1KSFX 1JALA 5JLJA 3RHFA 2A5YB 2YWEA 4CF7A 5TMPA 3AEZA 2Q9BA 4FCVA 4EFMA 4EPRA 3QE0A 4BZQA 5KPDA 4QOSA 4JL8A 3TJZA 4C9BA 1NMXA 1XMJA 3CZPA 4N1AA 1FTSA 4FW9A 2GZHA 3OEHA 3KX2A 2BM0A 1SXJA 2CLCX 5CDFE 3DHWC 2PH1A 2GNOA 4LJ8A 4BFXA 3B1ZA 1IY1A 1Q1QA 3FHTA 3IQWA 3QVVA 4N0DA 1E96A 1Z0DA 1Z6AA 4KBFA 3CRW1 3EA5A 3AH8A 4G1UC 1KK0A 2VF7A 1OPXA 5K8LA 1OE0A 3BH7A 3EZFA 3V00A 1G3RA 2QAGC 3AVWA 5KNDA 4LJ5A 3CNNA 4P32A 4C0BA 4GSYA 1WBBA 1NN0A 2CBZA 2N46A 4DLYA 2N1BA 4KFTA 1QHGA 2RGXA 4Q4AA 3O47A 2OE2A 3B78A 1NKSA 3CWZA 4TTQA 3FDIA 3CRMA 1TADA 3JVUA 3LBNA 4FMCF 2UVQA 4LZZA 4NH0A 1ZM7A 2FSIA 2GKSA 2HXSA 3B7GA 3CONA 1U0HC 3LRPA 4KVAA 1OKKA 4PQFA 1D8TA 1G21E 1MKYA 3RSOA 4M21A 2EYQA 1XX6A 2XNSA 3C16C 2ZIAA 3OIWA 2OZEA 2NPFA 1V5WA 2TMKA 3TVTA 5KSZA 3TQCA 2G0NA 4RD2A 2AK3A 5J47A 3OAAA 4U7DA 1YJ5A 5CLQA 4OHZA 4MUBA 3SR0A 2MMGA 1G8GA 2R62A 1RPZA 4MDFA 1E0KA 2ZS7A 1JR3E 1W4AA 4TQUS 3X1YA 4C2TA 1YZUA 4OL0A 3WP0A 4BFZA 4ZKDA 1TMKA 1Q1ZA 2J0VA 4OI1A 1CEEA 4A2QA 2GK6A 1KSJA 4OQXA 4QJ4A 2FMXA 5LB2A 4M9SA 4B43A 2BIFA 3LBIA 3RS2A 3AVTA 4Q66C 2H16A 4ACBA 4LJAA 3UKDA 4A92A 5FTMA 4UJ3A 2QL6A 3HR7A 4DLVA 3V4FA 2G1JA 4LSGA 3ADBA 1JQLB 2BBTA 4CW7A 3TNFA 1H8HD 2FWRA 2GHIA 2EFHB 1OYWA 2K5UA 2C03A 2QUZA 4Q4HB 4HUQA 4KSBA 1DPFA 4WXRA 2QORA 4RZ2A 2AR7A 3KUCA 4R98A 1J99A 5FBWB 2BV3A 2JAQA 5J4KA 2HF8A 3W6OA 1C9KA 1AS2A 1PLLA 4NL4H 1R0YA 4QJ3A 4B3XA 5DGXA 1G3MA 4TL6A 3W3ZB 2CVHA 3FPAA 1E99A 2GXAA 4E5UA 2J87A 4MKHA 5EE0A 5DHAA 3KJHA 1Q12A 4Q00A 1CJKC 3O8RA 2IT1A 4XJXA 3EPHA 5LPNA 3SFVA 3BWDD 3AGPA 3CF0A 5C18A 2CMKA 3AM1A 3KQUA 5E95A 2I4IA 2OXRA 3R9IA 1F60A 1IAQA 2Z83A 4WZ6A 4EJSB 3TIFA 1DAEA 3WRYC 1SVOA 1XEFA 2R65A 2J7PA 2ZAOA 2JATA 1R2QA 3ONWA 3R7WA 1YHNA 3W9YA 1HUQA 3K0CA 2GAAA 5JHHB 2GBLA 1GZSA 1TF5A 2OLJA 3A1TA 1A7JA 1N5JA 2RMKA 1GM5A 1RRGA 1TPZA 4R9UC 1W7AA 4E22A 1M7GA 5D3MB 2CCGA 4UQOA 2HUPA 2CDNA 4U5XA 3KTAB 1JXOA 3SS8A 3NWJA 5KUTA 3VNVA 3GLFB 3RRNA 1VG9B 4YMSA 4QM6A 4LBWA 2B6HA 2G1KA 3VKWA 3RLFA 1GNQA 2JJ2A 3K70D 1R5BA 1UF9A 4LBVA 4MGKR 3KQKA 4Y0VA 3RANA 1M7BA 3IKJA 5BN3A 1T3SA 4LGMA 3SJAA 3TQFA 5CM9C 4Z51A 1MRNA 1IM2A 5LDDC 3A6PC 1UKEA 3FKSD 2JLXA 3K0CC 1U0LA 1MR3F 4LK2A 4JIMA 1LB1B 2QGZA 1JR3A 1UPTA 1VG8A 5J4HA 2WWGA 3GFPA 3QF4B 3KZ1E 1CR4A 1ZNYA 2D7CA 1HA3A 5JCZA 1C4OA 1QVRA 4TYYA 3GEIA 2I1VB 2OFXA 3I1FA 2IS1A 1J8YF
chains in the Genus database with same CATH superfamily
2R5WA 5KU7A 2CXOA 3GRAA 3MW8A 5ALUA 2XQFA 2Q8NA 4L22A 3O2QB 3ROMA 1XNQB 3SXPA 2JLCA 1CFJA 4RULA 1QG4A 1QHIA 4B2YA 1M1YE 4I1YA 4MTCA 2GDZA 4DWOA 4WBSA 1AG9A 1JBQA 2FYTA 4R41A 1JSLA 1D2HA 3VR3D 4TVSA 1D1TA 1U3TA 3LY7A 4JWTA 4H7DA 4UCFA 1CQXA 1GQ2A 1M2OA 5IAAA 3ELYA 1T2UA 1P9LA 2X1LA 1I4OA 3EGCA 3GRPA 3VRHA 4XFJA 2R6CA 4A73A 2PJZA 3KJFA 4M1KA 4J76A 3A2LA 3PJEA 2IS2A 3VTZA 2VTKA 2FPLA 2WJIA 1XV5A 1QKIA 2MSKA 3BRWA 3C8ZA 3IXQA 4RDXA 5JNRA 1GAEO 2BE9A 1REQA 2YVUA 4NPAA 3PDCA 2QLNA 4KVGA 5JARA 5ILQA 1IXZA 4O59O 4RHYA 1QMPA 4KYTA 1TFRA 2UZ4A 1GLNA 4F46A 4MJ7A 3QP9A 1F8GA 1Y1KE 2F2TA 3FCSB 3B3JA 2ZYRA 3B60A 1W73A 3PYMA 1HFWA 4JITA 2BGTA 1JA1A 1RXSA 3JD2A 4MX8A 4P22A 4S35A 4RHXA 1GPAA 2IK8A 2Z8XA 4FOLA 4WKGA 1H69A 1XB2A 2VA9A 2PZMA 4JWKA 2EKQA 1Y3FE 1G5FA 1Z3IX 2HL6A 4KIJA 5HKOA 3K6SB 1KK3A 1MVLA 1TQ2A 5LWHA 4WERA 4M0CA 4OYHA 2IPNA 3PD1A 3TSAA 3HB7A 5FPPA 4FQ7A 5CB6A 4MRMA 2H4YA 2P9YA 3BCRA 3JWEA 3OOJA 4GLFA 3ZVNA 1ECPA 4LZNA 3RU3A 1ESDA 5ALLA 5H4HA 5CDTA 1CY6A 3AR8A 4BV2A 3KQLA 2XGJA 4F3TA 3DYVA 3ZS8A 3ICOA 3DZGA 3GUHA 1U4NA 3CKLA 4HAIA 4E1VA 3ESZA 4U63A 3V9PA 4C4RA 3C3EA 1YA8A 4QAQA 4GBJA 5JXWA 5K8VA 2PLNA 4JBIA 1AZWA 5E9QA 3KQWA 1KPIA 4BBAA 1X92A 2H51A 4C76A 3RWMB 4HQ0A 4L28A 4O1IA 1QANA 5J23A 1QRSA 3TJRA 2PSHA 2A0WA 3F6BX 1O6FA 3E9CA 2XA2A 1Q0HA 4KLRA 3T1HB 4L5JA 1JIVA 1RFGE 1XD8A 3PS9A 3FMPB 5E7JA 4YP5A 4J3FA 2PT5A 3Q6NA 2TRSB 3IKLA 4X45A 8ABPA 3CU5A 1XQWA 1YB1A 2VK8A 3BTVA 2INGX 3IR7A 5BSVA 1PLJA 2NYUA 3AF6A 3BRWD 1NHWA 3OOYA 3LHDA 5H68A 1P18A 4O2BF 3SHOA 3ZWBA 1E2GA 1WUYA 2CW5A 4QYXA 4DQVA 4DSOA 1D2EA 4XR9A 4TXHA 3VAYA 1YA6A 3N2KA 4C14A 1K75A 3AG5A 1OFIA 1K06A 2FLKA 1C50A 4L8LA 3RFCA 4C03A 4HDAA 2QRUA 1OFUA 4YRMA 2GEKA 3NHRA 4HC4A 3OKCA 1NZDA 1DC8A 2QG6A 3ZW7A 3CR3C 2XDWA 3T5DA 2BEVA 2CV1A 3OIYA 1DAOA 2OHVA 5CD1A 3MJFA 1JKFA 1N2JA 3I5AA 4K1XA 1ZY2A 4F21A 1CR1A 1R8QA 3P0HA 4NAHA 2FR8C 3LYUA 3EFBA 3MCZA 4PYOA 2ISCA 4YJKA 2GZSA 2OBFA 4YRPA 5LYJF 2PUJA 1PR0A 3KD2A 4V0LA 4WRRA 3RJTA 4D45A 3CEPB 1DAIA 1UBJS 2BMAA 1N2CE 5CNJA 1TW2A 2D13A 2HM7A 5E7IA 1C8LA 3GA0A 4TZKA 1D2AA 3LHFA 3GLGA 3AF5A 1EWTA 5KYWA 2C2KA 4EJFA 3PXEA 4M8LA 3P9RA 2AIRA 4DLNA 4GZ5A 1C8BA 4MV3A 4AWBA 5DWDA 3DE2X 4KACA 1A77A 1NQWA 5CDGA 4JYZA 2GNAA 2KHZA 3RS3A 2WUDA 1ADBA 1UDWA 4BDTA 5CB0A 4DBLE 1L7VC 2G0TA 4FSXA 2I62A 4EY8A 3NOQA 4DMFA 4LYJA 3MTGA 1UFVA 121PA 2G9VA 4DUYB 4B80A 5REQB 2QAIA 4KVFA 2G83A 1V9SA 1DDOA 3VPBA 4B7XA 3HCNA 3F6CA 4S1TA 4ZIRA 1ZD4A 3AHGA 4HP8A 1W36C 1BS9A 2Y1OA 1TLFA 1MOQA 1V1RA 1X1QA 2W2PA 4HFMA 1W5FA 2CY0A 2M98A 4G0PA 1EJ0A 1BKSB 4QNNA 4EBFA 1P9WA 4YO7A 5H81A 3TRHA 4CMBA 3EIUA 4I1RA 4L2IB 4GR4A 5HBGA 3TIIA 4MQUA 1D5WA 1HDIA 3O8OA 4J4BA 1USWA 2Q4EA 2SKDA 5DOZA 1Y1TA 4B47A 1CQJB 1VRWA 3OBIA 1II8B 1NN5A 4BO5A 1KETA 2GDJA 4JVSB 2FX2A 1CETA 2H31A 4NBTA 1IHYA 4M37A 2QV0A 4H27A 5JWOA 2DHQA 4M98A 1J22A 4AP9A 4DFDA 3E9MA 1ZOIA 4G5OA 2PHZA 5ER6A 3EQ7A 1NYTA 1P2SA 4AWAA 2XB9A 1CG6A 1SCUB 2F3QA 3PDWA 5F73A 2JLZA 4Z49A 1RHMA 3VO1A 4H7FA 2GUGA 1M2JA 1EQUA 4KPEC 1NSTA 4DR6B 1L1RA 5T7BA 3Q1LA 4L3VA 3BDVA 2IEAA 3FWHA 6GPBA 3UMFA 4MYUA 1NVMB 3JCZA 1Z6QA 5JD3A 3LW8A 1N1DA 1SR8A 3A26A 4RMHA 5HGJA 3GP8A 1YMUA 4NARA 4UDXX 3CEHA 4KXWA 2FFJA 1RYYA 2XUGA 3QVGA 2JIMA 2I4NA 3W7VA 2VAMA 2P30A 4LNHA 3KXPA 2RGCA 5E1DA 4J2TA 1MC5A 3UBTA 2YQZA 5EAIA 5LU8A 1QQ7A 1C3OB 3IA7A 3KYBA 4YRLA 1Y33E 1QZZA 4QYTA 3HCBA 4ND2A 4GOND 4QGGA 5E2IA 4IJVA 2FPOA 1G66A 5AVVA 3B9RA 3BFKA 3ZDYB 2WFMA 2YJNA 1ZUIA 2ACKA 5LQJA 3IEUA 4YQFA 1IJKA 3CO0S 3LX8A 1UEJA 3I2IA 3NH9A 1U02A 4HWSA 4XDYA 4BWFB 5B4UA 1T3HA 4QGSA 4KWIA 3SC4A 2XMGA 1FVOA 4INJA 2VHUA 2TMYA 3BMCA 2PH5A 4ZQGA 4DWVA 4NCAA 2PKYX 3HRHA 4IS3A 1A9XA 3F47A 1GOTA 2WJPA 3QENA 2B4AA 1AA6A 4UEKA 5C51B 4MV0A 3W78A 1N5LA 3D0QA 1P1JA 2YS6A 1N1GA 2B4TO 3SICE 1YQQA 3D2CA 2Q5LA 3WKCA 1SA0A 4KFCA 1F6WA 2F1RA 2NP6A 1IY9A 2D3TA 2QTRA 3ZG6A 2E6KA 2DM6A 3H6HA 1KMCA 3UUWA 4QRDA 1SC4A 1JR6A 3IP3A 4LVCA 4UUAA 5CP8A 1JLLB 5LNK6 3BWYA 3WNVA 5CFQA 2XTMA 3G49A 1C3XA 4WGFA 2P4QA 1VJGA 1K66A 1J56A 3HZRA 4ZAYA 5FD8A 4AG5A 4B3TB 4EG0A 4P4SA 3I5YA 3OETA 3VNBA 2BSQA 1SXJE 2Q9UA 4UE3S 5C5CA 3DHNA 1ESNA 4LTNA 3AEXA 3KR9A 2NZXA 1DMSA 1IEVA 1J49A 1LZLA 1M0TA 3AG6A 4RFVA 3O0DA 4DSUA 4BNYA 2DBQA 1EUYA 1JVSA 1X1DA 1UBUS 3EDCA 3WIEA 4N9WA 4RHTA 2OSVA 4B73A 4XVCA 4BFCA 3CNBA 4XLTA 4W63A 2BEUB 1VXOA 2O6LA 1YFZA 3JATA 4UE6A 4GE3A 4ENVA 3WGOA 1PK9A 2IZ0A 3BK2A 1UADA 1YIAA 1PI3A 1AU9A 4YCDA 4EB3A 1Z2EA 4CL2A 3UW3A 5FOUA 4NCKA 4E4TA 3MJSA 5ESWA 1T4BA 3PT9A 1JEJA 5CCBA 5TIIA 1KXJA 2EIXA 1IZYA 3ADOA 3MCAA 1KERA 4HAVA 2XCLA 4UUMA 1TTPB 1N6HA 3H3JA 1XJWA 1L6IA 2OC9A 3M49A 2GJAA 2K4MA 3O9ZA 1DBPA 4YPVA 5HQ3A 3OX2A 1F2TB 4J0QA 3RLIA 4GAEA 4DIUA 4X61A 3NBUA 3HXMA 3FTEA 2C3MA 4C7JA 2YC2C 3FPEA 3R5XA 1BC5A 2P8JA 1EFRD 3TTTA 3VUEA 3M8KA 1QS0B 4TV8A 3OFND 4JR2A 4YA6A 1NW8A 3ZWMA 3QYPA 2YCLA 4YHHB 2F1OA 4ER5A 3K9WA 1NUHA 1PFGA 1SVIA 2BW0A 2CL5A 2H8KA 4JGIA 4EYEA 1PK7A 1R0SA 5K0ZA 1L1EA 3A6FA 4XM2A 2W83A 2FW0A 3WWPA 1ZH4A 2IHUA 2LE0A 5A3VA 5TY0A 5LQAA 4X66B 3KQYA 1OBOA 2BEWB 3WMFA 4W5WA 1FNNA 4B9EA 2ZM5A 4NDNE 3QUQA 2BFNA 1XU7A 1VIYA 2G6BA 4MVJH 4RFLA 2GB4A 5DGTA 1N7JA 4PBRA 5DTIA 2EX1A 2O8FB 1LLDA 1M66A 2FK7A 2Y6VA 4CG1A 4ZGBA 1AV6A 2SKEA 2GPSA 1KIAA 2PBZA 5JPIA 2IYLD 2LTAA 1MH9A 4BP9A 3TLMA 3PICA 4WVLA 3Q11A 4ZI7A 3F4KA 4BBZA 4GM4A 2YWXA 2MHCA 4O2LA 4JLBA 4R51A 4JI1B 4Y2GA 4DYHA 4EP1A 3EQ2A 3V7FA 4FFWA 2PQ0A 3H2JA 4OLHA 3LDHA 3W04A 1J6UA 1PTJC 1TYCA 1RKBA 3RTAA 4B75A 3AU9A 1FLNA 4RKQA 4BB6A 5C8VA 1QX3A 4BJ5A 1OB5A 1RLMA 3O95A 4GWGA 3OT5A 2GD6A 2PFGA 5KHOC 4KKVA 1JDBC 1CXZA 1I4DD 3D6TB 1BRTA 2PMFA 3BERA 4Z8XA 2HC9A 4AMGA 4NXMB 2NIPA 1LQUA 5JSKA 2RK3A 2B4RO 3IIKA 4RFSA 1MDFA 1R74A 5G1NA 3WSTA 5KWVA 1ZVMA 2QXTA 3QWFA 1FFXA 1HG1A 4ZO4A 5EJFA 3MWDB 3OLXA 4QQKA 2IV2X 3RQSA 3VNSA 5JZ9A 4YV7A 4G1FA 2ZB4A 3UT5A 4FYIA 2P9TA 4O63O 3WDKA 3CTPA 4XSVA 2I1QA 1P60A 1U1IA 3C7KA 3T52A 3TQQA 3BCHA 3OX1A 4RTRA 1BN6A 1NBMA 1NVDA 2QJOA 1JEAA 2ALJA 3G85A 2WWRA 3TR5A 2XB8A 4AG6A 4CT4B 4DN6A 4JK3A 3Q40A 3BCSA 3JYOA 2GLTA 1RAIA 4K87A 4DR4B 1XKQA 4MVWA 3C87A 3VNAA 1ZJJA 1T6XA 1SHKA 3D8NA 4KR7A 3C41J 4DPMA 3V2HA 2X5XA 1XVTA 5KC8A 3VNRA 4BE9A 1DEHA 1ZUNB 4W5TA 1DJOA 2KW5A 4ZO9A 4MV4A 1P5HA 3LQQA 3M1LA 4LV8B 2R6FA 1J0DA 3K2QA 3LBYA 3OEED 4DUGD 1W85B 1XRLA 3W6PA 4PNEA 5B55A 4FEEA 3JTEA 4LZLA 2HNBA 2F1JA 5CFOA 3MK31 3QTTA 4OHMA 1JJBA 4JBLA 3ANTA 4CG3A 1DQYA 5JPCA 4YCSA 3HFGA 3EUAA 2CFIA 4BQPA 5BW5A 4GI2A 1GFIA 3HP7A 5EUCA 5K6RA 1T5DX 1Y5IA 1L4UA 2VT7A 3OM9A 2WTXA 1CK4A 1CY8A 1JQDA 2LRHA 1KOJA 3CPHA 2YKGA 3NP7A 3HL0A 3QUCA 3R3YA 1MVOA 4BNJA 5JHGB 2XUIA 2P3SA 3OTWA 4O4HF 1YNSA 5JFTA 5IJWA 1VSBA 2NPIA 3LGXA 4IJ5A 4NTZA 3ROEA 1ZHFA 4Z7NB 1HDGO 3B6MA 3HSSA 5SYNA 5FHRA 1T0UA 4L1KA 4P82A 2QN8A 1Y5RA 1EUZA 4I1UA 2BUCA 3ANNA 1GKKA 1K8QA 3D6VA 4I5DA 4B3MB 4P38A 1W94A 3PSAA 4XRRA 1UBTS 5J3JA 3AIKA 4OHYA 3TZKA 3MQFA 3RSCA 4LXIA 1NIPA 3KEMA 3DE0X 4F4CA 2FMUA 5LQMA 3CN9A 3PQ2A 3BUSA 3HLYA 3QE3A 1G291 3IILA 1OZFA 1TF7A 2Y0DA 3MTIA 3Q6MA 1SIWA 4I55B 5C1IA 4DA6A 5BURA 1EU1A 1XDZA 3R0JA 3L7MA 1YS7A 3U3MA 1QH8B 4US1R 2Y1XA 4JUBA 4WTOA 2DJ5A 1KYWA 1PJ8A 4JN6B 1UK9A 1KEWA 3T6KA 4F2GA 4A0FA 1M8GA 3CNQS 4M7RA 3A4YA 1D1SA 1H6BA 4E5DA 4LGVA 1EGQA 3FDJA 5ERGB 3ZDQA 4OPMA 1Y3HA 2PWBA 1Z73A 5EQDA 2QF7A 3L6RA 4J16C 5ALFA 4WINA 4BGUA 2DXIA 1RI3A 3GP5A 4LK3A 4O4LF 4PX3A 4URUR 3L84A 3SX2A 3F3MA 4ZV7A 5TXGA 2AEMA 4YCCA 2EF1A 2H59A 2HX1A 3LKZA 2Z9CA 4YWHA 5T5QA 1PNVA 2GESA 2RG7A 5GOTA 3ICCA 2CCKA 3FYUA 5JQGA 1V4VA 1CJVC 1DTEA 3N6XA 3NEPX 3O4FA 3WI7A 4CLRA 2YN4A 3R8FA 1QZXA 4MRMB 4OB8A 1MJHA 3GMSA 3EIOA 4M0FA 4GNRA 1L7XA 1XNRB 1NMEA 3B53X 1ZEJA 4O0MA 1VE1A 2YH2A 3BPSA 4QUKA 4ETNA 1IEXA 2OD2A 3N8NA 3THYA 1KDOA 4WK6A 1RRCA 4OEHA 1CUEA 3DZHA 3P9QA 1S0UA 4QVIA 1JHQA 1Z5VA 2HLPA 2AG8A 1KBZA 3IBTA 1XG5A 4JI5B 3SZOA 3FYUB 3L41A 3WLOA 4KO1S 4YIHA 5TQ0B 3LYAA 2O05A 4IYJA 3NDBB 5DGHA 3IQXA 4NOMA 2DHEA 1KK1A 1XPUA 1MG5A 2CZQA 3O31A 1QC5A 4OOFA 4P92A 2YFHA 4GZMA 1TE2A 1Y89A 4OA8A 2EXXA 1Z28A 1KZ4A 4WK0B 3Q2KA 4PG8A 3AVUA 1F0PA 4MIOA 3SEAA 4HDCA 2YWGA 1U65A 2FZLA 4BUJA 1BDJA 5BT8A 3DMPA 5TVGA 3AEKB 4E2ZA 4J2HA 4H0CA 2FEPA 4ZYYA 1M6VB 5LIPA 5E1MA 3AHJA 4NBKA 3THSA 4G2TA 1VJ0A 1UOPA 2CVFA 2QW0X 2VQDA 3CVJA 3GXOA 1AMOA 5FP0A 2FB9A 4DMRA 1WXQA 1Z5UA 3KZNA 1G6HA 1WW3A 5F7JA 3B1YA 5JUWA 3AEKA 4LHXA 1Z7YA 4QVGA 4XQEA 1OF1A 5FYDA 4B0OA 4DKJA 3KLMX 2HCFA 1PN3A 2NU6B 4EW3A 1UDBA 2VP6A 1FXWA 2ZSJA 3GJQA 1DDGA 4O6VA 4XGKA 4BRWA 2AA3A 1SIOA 2MR6A 2PSEA 2HIHA 1THTA 1UPUA 4K3UA 4PQYA 4XGIA 4Y1RA 1ENOA 3ML1A 1X39A 2CXPA 3H1TA 5E2BA 5EEHA 4R7TA 5E7QA 3UMGA 3P0FA 4R1QA 3VKHA 3I1JA 3QX8A 3FCXA 3HCRA 4M0MA 3BE5A 4AYWA 3H8VA 4C0KA 2VWHA 3REFA 1FSFA 2GAJA 3V7YA 5F9FA 2QXUA 1WLYA 3O8QB 4V0KA 4FC7A 2Z5LA 5T4HA 5EJGA 4ER0A 5EHZA 3BRQA 5JD5A 2A94A 2X9NA 3CZ4A 3UQZA 5KYYA 3CUYA 4JI4B 4ZC8A 1SK9A 3LSYA 3AUUA 1XK6A 3GLGB 5IVKA 1PR4A 1E1YA 4DUZB 1PV4A 3NJ8A 2ZRKA 1E1QD 1KDTA 1YOBA 3ENNA 4PC2A 4QM6A 4U4AA 1M1NA 1O87A 3NC4A 5FOSA 5COBA 2NO6A 1PHRA 4US2R 2O0LA 2EKBA 2YUIA 4F1WA 2PMBA 1EFUA 4TVOA 1RPTA 5JI3E 3OOSA 4B35A 3UHFA 3AM3A 4H9GA 3UJPA 1A96A 1VCOA 4D74A 3MQ4A 2JAUA 3EPKA 3TFOA 3L92A 2BFMA 2SICE 4IP0A 2NV2B 4COKA 5HKAA 1FJXA 2H11A 2RGRA 3HG7A 4LHEA 4QULA 3G8DA 2O20A 4HWTA 3DSRA 3GLFE 2P69A 5CYPA 4EHNA 5D2CA 2IFTA 1IE3A 3A2MA 3Q9SA 4NHEA 1QTIA 3KCQA 1Y34E 1XCLA 1EJ6A 1CZRA 4PHHA 4UUQA 1ATZA 5TT0A 1W85A 2IYWA 1NZJA 1GUZA 2W0MA 3GNSA 2GD1O 3G79A 4FZ5A 1CP3A 5HE8A 4DDKA 3NVMB 1QTQA 4YP9A 3LUBA 1XP5A 1R16A 4MS1B 2B4KA 1NQOA 5K20A 5SY4A 2Z1DA 4GYJA 3DOHA 4NU6A 5TPWA 5D3MA 1EJ2A 1BCSB 1WUKS 1USIA 2IIBA 2W6MA 4LRSB 4MQEB 5CK5A 3MT8A 4BYMA 2I2XB 2P6MA 4EPVA 4F8YA 4P33A 1VL8A 2DWPA 2PIAA 3Q87B 4OATA 2W0SA 4XE5A 1FP2A 5IWCA 1CUJA 3ZVKA 4EAAA 1TZKA 2M32A 2Q6KA 1KTVA 2RONA 1PJ3A 4R2JA 5E38A 2ZRFA 1ZH2A 5I9SA 4F11A 3ZWKA 4B6PA 4GQBA 2PWZA 1PG2A 1JXMA 2IHYA 3FNIA 3KLBA 3NHWA 4JP3A 4KL8S 2J4CA 3R7FA 5IM4A 4MUHA 3A8TA 1GUDA 3JD0A 4AF7A 2ES4A 4KZPA 2YWHA 5BSTA 4ZCTA 2I54A 1EDZA 1SXGA 1N5MA 3JQAB 4C7KA 5A5GA 4OJNA 3PNOA 5AVOA 5JVDB 3AVXA 3NC1C 3VR4A 1JAZA 4PY2A 2BJWA 4OBXA 5JSZA 3B70A 3R5FA 2CSXA 4I19A 3Q3CA 3BJIC 2J07A 5GM2A 5HF6A 4OM7A 1CYEA 1JAIA 3L04A 4JELA 3I3OA 3L4JA 5BXYA 1ORVA 2Y9MB 3V4OA 2Y0EA 4F9EA 5FFMA 4OGKA 2YZ2A 5BPFA 3VVMA 2Q29A 4CVNA 1RWPA 1DQZA 4I8DA 2QTHA 5FR2A 1JECA 4KQIA 4W6QA 1FU8A 4XCVA 1E3WA 2J46A 5A04A 4A91A 4LDQA 4DILA 2VHTA 1OASA 1ZC4A 2CFTA 2GJ4A 1JSZA 2X5OA 3NUGA 3DDOA 1R12A 2X0NA 3IQGX 2B2CA 4RVFA 5F78A 3W79A 2B1IA 3FYCA 4LX8A 1JSRA 2L19A 3BTSA 2P7IA 5EHNA 1AUVA 1QV9A 1WXEA 3CNHA 4H7PA 4X41A 4M1YA 4PS0A 4J3NA 5P21A 5IT5A 4MQ6A 1A3CA 3MAAC 3A06A 2H4FA 3NFYA 1YB6A 3PGKA 3H86A 1SOMA 2XOEA 4J0FA 4DJ5X 1FXSA 5EVCA 4YJ2B 1GGKA 3C1OA 3JR3A 2DTDA 3FTNA 4KHZA 1RJ9A 4TL8A 2CB9A 3Q41A 2J5QA 3L7JA 3PFHA 3P71T 4DR3B 5I5EA 2W6ID 2CXQA 2A0YA 2P62A 4GF5A 1KO8A 2XE4A 1RQ2A 2YOHA 1G8FA 5EP2A 3RROA 3O8NA 3WE7A 3STXA 4FJ2A 2XCOA 2IP2A 4PPGA 1QP0A 4TOIA 5IASA 1YHZA 2GXUA 1XEXB 4OV6B 3LXMA 4TS4A 5U4QA 1LK5A 2CB0A 2O2CA 3JWJA 3SNKA 3FMFA 3CGWA 5CD9A 3RU2A 1YBFA 3RDPA 1NLYA 3GROA 3MWFA 4EPYA 3EDOA 1DRVA 3CF6R 3OIUA 1PUIA 5DM1A 4QKQA 3KETA 1XTQA 4GH5A 5G3ZA 3OEHD 2I65A 1HI9A 1EVQA 1ZOSA 1R18A 2C8JA 4PAGA 4EO7A 5HEKA 3LKVA 3D6UA 2XNKA 3ANMA 1N8NA 3B1XA 1MT3A 2NU7B 1HX7A 1M1ZA 4NABA 3UOGA 5KB3A 3GEPA 1Z82A 2WJAA 4ZVOA 3EXG1 3QWHA 2BYTA 1CUXA 3O9MA 1DTSA 3VMFA 3A1WA 1MTOA 5GGXA 3IRUA 4MJLA 3AT1A 1QDUA 1D2MA 1QIDA 3L0PA 3NGXA 3U4HA 1GRVA 1NVVR 3I92A 2EFCB 3B89A 3NNSA 2R8OA 4BFYA 5LDDC 2PUDA 2XQGA 3UPTA 5DM70 3EMKA 1KP2A 1ND6A 1Y7IA 4TMTA 5EIBC 1EUCB 3KPVA 3WKAA 5B7GA 3NBAA 3P0RA 2IYSA 1RS0A 4KPUA 1F5NA 2WYUA 3TTWA 3UWKA 4EJSC 4LXQA 2RIPA 3UXYA 2BI8A 2H17A 2G07A 3BXXA 1CY0A 4IUDS 2EJBA 1RADA 3MT9A 1UKYA 4Q4JA 3T4PA 5HJ5A 5EQJB 1G8YA 3P2JA 4IVPA 2I76A 4MEBA 2CD7A 4Y0AA 5GIPE 5JS7A 5F4ZA 3N58A 1GKYA 1SHLA 2AN9A 5F5XA 1QP8A 5KQSA 1FFYA 3NCTA 5JBNA 1OX4A 4TV9F 1OAAA 4WZZA 1HGXA 1EBUA 4YCBA 4PE5B 5FRDA 5DU2A 4EL5A 5C35A 1QHHA 1RWXA 4BO6A 1CZUA 5D7BA 1TD1A 3NWOA 2WWXA 1UQUA 4LQCA 2DQSA 1PR2A 4AMYA 1BMFA 5KTMA 1WY7A 3L7BA 2JIZA 1FX1A 4F3NA 1N6OA 1KAEA 1PR1A 3DP7A 1R4NA 1ZLXA 1U3FA 1VIAA 2ZI3A 3SBOA 1C30B 1XA0A 1USVA 2UZ1A 1VRVA 3AF0A 4JB0A 2CDAA 3H9QA 5L45A 4TZ0A 3R3UA 4UULA 4RQTA 1S1CA 5ERYA 1CDZA 2C8LA 3KVOA 3OE7D 1Y6ZA 2C92A 1K7EB 3QVMA 4HGNA 4MPDA 1X7HA 4KO2S 4MQEA 3TW6A 3BOSA 4MVXA 4IOKA 1P7WA 1OREA 1R4NB 4RHCA 4NCIA 4RVGA 1YH3A 4CE6A 4GBGA 4PRLA 1N7HA 5CFMA 4MS1A 2BZSA 2C0CA 4RDHA 3H9CA 4MKFA 3H5NA 5DLQC 4A8HA 1ILEA 3RRMA 3VZSA 3O4RA 3O8BA 3PP8A 4YUZA 5K6TA 3K0FB 4EPTA 2XCUA 2OM2A 5DYIA 4M9ZA 2XLBA 4A1FA 1DOHA 2FUCA 4XWKA 1SKMA 2I8CA 1THMA 2HDHA 1VHQA 1VL2A 2H63A 5IT4A 4BFLA 4EG3A 2QUAA 1WKVA 1DI0A 3TDNA 2O2JA 4FFBB 1KYTA 2GEJA 2GJ9A 2ZBPA 4Q01A 2QNRA 4YJDA 5EJ5A 1ZINA 2K2QB 1QIEA 5ALJA 1OI2A 1JHVA 3I34X 3ZNNA 2JAHA 3U56A 3K94A 1V48A 1Z0UA 3WQHA 2IHBA 3AW9A 3KOWA 4PCVA 5DYNA 5IAKA 1E9VA 2R25B 3O8DA 4MGIR 2DJIA 2Y3IA 3I2KA 2HNKA 4OQ4A 4HD8A 3AB3A 5JWHA 6REQA 5A6SB 1XALA 4OSEA 1W5SA 4IRUB 3SJ7A 3DKRA 3HDTA 3LVQE 3MCWA 1KDRA 1MO5A 2P6RA 4L9WA 3QKRB 1I0ZA 4JBGA 2ZRNA 3U3RA 3EIQA 4BC1A 4I2NA 4KDFA 4REOA 1WTCA 2F1IA 4HGYA 3ZJYA 4WZBE 4ZRNA 1R0LA 3GGDA 4FQ5A 1UXOA 1E1KA 1KI3A 3PQ6A 1ZESA 3L1HA 4GRDA 4GXNA 4KQ6A 4MVJG 4UOZA 5MFZA 1P5ZB 1UOQA 2HSDA 2JLUA 1T1IA 4PLFA 5C5EA 1SUAA 4DIFA 5A62A 1REQB 4N7MA 3KR0A 4O2BB 3NYQA 4HR7A 2EFDB 3UHAA 7MHTA 3EG9A 3R76A 4F72A 3PDIA 3QKUA 1V7CA 2X1MA 3QTBA 4HDKA 3WA6A 4B4UA 5K0BA 2X2OA 4GPIB 3SDSA 1UMKA 2IEGA 2XVMA 3LDGA 2Q5QA 3F5MA 5ITVA 4ARCA 1P7PA 1Y3BE 4JJ4A 5P8WA 1KRWA 2DETA 1EKXA 1JJFA 2WYIA 3T9AA 3SZGA 3OECA 1PO7A 3IQHX 1IOWA 3VHXA 4JJ8A 3LM8A 1WBDA 3E7DA 1MG0A 4FNAA 2IBSA 2O9JA 1CVLA 2RB4A 4M88A 1JJVA 1QK5A 2BJVA 4O8CA 4CT5A 4JV5B 2AXEA 3EIXA 1XNHA 3SQMA 4B8WA 4RVHA 1DUSA 4O4JB 3ZYCA 4YJ2A 2QR5A 3LMKA 3RU7A 3VJLA 4DYVA 3ONFA 4P08A 2VTBB 2C7RA 5JSFA 2CJWA 2AFHE 1NVTA 4ZI5A 3BZUA 4L9SA 3UFBA 3P4XA 4H08A 4NV0A 2FSPA 1U7XA 3U3JA 4FEGA 2OFWA 4OFWA 2PDAA 3H2HA 5A4AA 1TYDE 5K0CA 4DB2A 4HNUA 3AUJB 3GBVA 1ODCA 3EF3A 3ETJA 2VWGA 4NYMQ 2VRWA 1QFJA 4MUNA 4EI2A 5CB8A 2D2FA 4HWKA 5AQ1A 4WX2B 2W9XA 3V3TA 4KN9S 3W2IA 5BWMA 1X13A 5DW0A 1DX4A 2WB4A 4IHAA 1CUVA 3E9QA 3QPWA 4KEAA 2ZYDA 1TQ8A 1XDSA 5TDHA 1M5RA 1CUGA 5TARA 7ADHA 2AHRA 1JBKA 3DAPA 1RSZA 4XPIB 2NUPA 2FV8A 5JOQA 2PYZA 2PANA 1O57A 3F1KA 4QWWA 3WGNA 3LK7A 2XUAA 4Z0NA 2A0KA 3FOBA 4EK9A 1R6BX 3NI2A 4XLZA 4ZKEA 2QW1A 1I51A 4R1PA 4MW4A 2Q1SA 1EPUA 5BUQA 4I36A 3RAJA 2NZJA 4W1PA 3WZMA 1YB2A 2IEDA 3AB7A 4I14A 4ZEVA 5KKNB 4TYNA 4QPCA 4ND6A 2G82A 2P79A 2OSBA 3H5TA 4G36A 3CZ9A 2AOUA 1G7CA 4PO9A 3D1LA 3KOZA 3OE4A 1A5SB 3K05A 4MGYR 3LK6A 1VJDA 5DEOA 1RM0A 2IHVA 3SXUB 4DG9A 3P2OA 2YJ3A 3DULA 2AWOA 3P5SA 4P8RA 5JCOA 3ZTWA 1ETHA 5ARCA 5BN1A 3R2JA 4FYYA 1GRCA 3UAXA 4PAQA 1M2FA 5I48A 1HT1E 1V1MB 1YU6A 4TV8B 4WXYB 1U9CA 4BJHB 2G09A 2RKBA 4NMXB 2NVUA 4MKXA 3VC3A 4D9EA 2YN0A 3CEAA 3UWPA 1XLWA 3GGOA 2YV5A 1N5IA 2DY1A 2NXCA 4MLPA 3CRQA 5AVQA 3RUHA 3H84A 3RE1A 1PL7A 3B8EA 1TM7E 4AJHA 3DVRX 4NNPA 2VQFB 3FB4A 3ZDRA 3V7WA 1IXYA 3IXLA 4LE0A 4NEGA 3WLMA 3ZDXB 3ZQ6A 1R6UA 4RD4A 3VFDA 3OMLA 4KHPB 4KI0A 4PNZA 3IODA 3OFNA 1N7GA 2VXBA 4J3JA 1PNRA 4XYBA 4BN4A 4AL4A 5LXTF 1FDUA 1WZUA 2HCRA 2EKZA 5DO9A 2EW2A 2VLBA 3EZ7A 3MGAA 1EM8B 3NZEA 3K9CA 3RV3A 3MYYA 4HNTA 5AI0A 2W6OA 2AXQA 3T1QA 4KREA 4JQSA 4YO8A 4DKXA 1U3GA 1A8HA 3RTEA 1U28A 2GKGA 4Z8YA 5C8YF 1QWOA 3KL2A 1Z4IA 2P5YA 1W19A 4CL3A 2NO7A 3WKEA 4R5MA 4TS9A 3HA5A 3LPNA 4JJKA 3DM5A 3BFXA 4J0HA 3V4RA 3S3TA 1JHMA 4US0R 3FKSA 2R6DA 1S8OA 4MV8A 3KPWA 4M9QA 3WBFA 1AZLA 16PKA 3EZYA 3IUBA 3O1LA 2UYCA 4JLAA 2PRIA 2WV7A 3ONVA 3JY6A 3AI2A 2M6RA 2Q7XA 2P90A 1KBOA 1VG0B 1R4ZA 4Q9DA 2W7TA 4Y9DA 5B36A 1Z74A 3D1VA 1K5GA 4N8DA 1SBYA 1A9QA 4ZT5A 2HMUA 1I3MA 2OBNA 3HJBA 3L79A 1I2MA 1MXHA 4E08A 1JH9A 1ZVVA 3KSZO 2NAPA 1PQ4A 3EGXA 1XZ8A 4LPKA 3FOZA 1H5UA 3DKPA 3OY7A 5BV7A 4RK7A 2ATEA 4YV0A 5BSFA 1NF3A 3WZLA 1Q2XA 4YMTA 1KZGB 2QTFA 1NXXA 4B48A 3KOUA 1G4AE 1V16A 1G5IA 2ECQA 4CMIA 2GSWA 1YOVA 1PT5A 3VGJA 2P67A 4Y2JA 4Q7MB 1FS6A 3OUUA 2QMOA 3PFFA 3A37A 2HK8A 1ZP6A 4IHQA 1CERA 4JLKA 2QAGB 2EP7A 2B34A 3PEUA 2VQEB 5DBFA 1Q3KA 1RYFA 3KAQA 1X1RA 4IWXA 2C77A 1Z6PA 3TQOA 1KYZA 4AY3A 3UPUA 2HRDA 2WHRA 1XN4A 3WP1B 5K05A 2OBMA 4N6GA 4CM3A 3TGPA 1P0CA 1FJ2A 2AN1A 1E6EA 1I2CA 1JMKC 3UXHA 4HL6A 4JZKA 2O3SA 1T15A 4L4SA 1QIKA 4FFPA 4BTVA 4C4TA 3F8SA 4WECA 2ODBA 3OZAA 2H4XA 3IIMA 2CHEA 4J2OA 4ZPJA 2ZE8A 5DGCA 3S2SA 1V35A 3E8XA 5KTTA 4HH4A 1YRLA 3SP1A 3EGOA 4IO0A 4GC5A 1KE2A 2OVBA 3GH1A 1Z0IA 2EGGA 1Y3DE 2WSSA 4KGDA 5IBRA 3LUHA 2VUTA 3W9UA 2AYXA 5EJ4A 4M1TA 2IOFA 1IXSB 1M5TA 1TVKB 2I34A 3JAWB 3C15C 4MVCA 1SXIA 1Z56C 4ICIA 5BSRA 4EQ6B 1WOYA 2EKLA 5F1OA 1EZ4A 4B31A 1UC9A 3DMYA 1NFFA 4L16A 4MARA 4RTMA 3OUZA 3VTKA 1G3QA 4Y3UA 4BVFA 1FYEA 3RSGA 1BDMA 2BI7A 4E5PA 4N40A 1Q22A 4QUGA 2XOXA 2BISA 2I78A 5DYYA 4AF6A 2OCLA 3GG2A 2OQVA 4O4IA 2DFPA 1A04A 3MQ2A 3WV5A 4P0PB 3ESDA 3JALB 1F1JA 4K9MA 4KWTA 4PG7A 4CM6A 3AWDA 2D3WA 1T36A 2GSDA 2Q3MA 2ZYGA 4ERXA 3GF4A 2F55A 2RCYA 4DLXA 2J30A 2B69A 1E5QA 1S01A 1EFPA 3ABSB 4ZHQB 4BNNA 1OAOC 4G0OA 3NM5A 1R3DA 2C4TA 2WJZB 3AFIA 3K9HA 5D6OA 3ZWQA 1K5PA 1KIFA 4KI7A 4OQLA 1E1RA 4RA9B 4JODA 3WQRA 1OOEA 1P5FA 1T36B 2QVGA 5AJXA 1NY6A 1XVIA 1OXMA 1U1EA 2XD4A 2DVMA 3FVTA 5GAJA 3UJNA 2GM5A 3KHKA 3IVAA 4AJLA 3G9QA 2OUIA 2BAGA 1I36A 1WZCA 3K4HA 1BGXT 5CIQA 7ABPA 3CLVA 1KDPA 4QGAA 1DJQA 1XZCA 2F9FA 1CUHA 5B2ZA 2OCBA 2Q6TA 4JNCA 2AOUB 3EBLA 1GPNA 3DB1A 4W1RA 1RACA 3W05A 4X20A 3VOTA 1AKVA 1G21B 3PX7A 3B12A 4RW0A 3AQIA 4ACAA 1GNLA 3MWYW 5G3YA 4UU0A 2JLYA 4E7OA 1Q7CA 4PZLA 5BYJA 1IHUA 2F1HA 4FD3A 3SHVA 3IT0A 5GVSA 2PV7A 5EZYF 3O8QA 4KH1A 5HUQA 4K1LA 3JYHA 2FWPA 1ZO8A 4QDOA 5LA6A 4XX0A 2WIKA 2CHFA 3U0BA 3WIOA 4Y98A 3FTFA 5KDLA 1MB9A 1UK8A 3W5JA