2G9NA

Structure of the dead domain of human eukaryotic initiation factor 4a, eif4a
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
216
structure length
202
Chain Sequence
b'GVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEPSAIQQRAILPCIGYDVIAQAQSGTGTATFAISILQQIELDLATQALVLAPTRELAQQIQVVMALGDYMGASCHACIGNVRAEVQLQMEAPHIIVGTPGRVFDMLNRRYLSPYIMFVLDEADEMLSRGFDQIYDIFQLNSNTQVVLLSATMPSDVLEVTFMRDPIRILV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eukaryotic initiation factor 4A-I
publication title Comparative Structural Analysis of Human DEAD-Box RNA Helicases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 57
structure length 202
sequence length 216
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2006-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2g9nA00
2JIZD 4PO8A 4EUNA 1IY0A 2YZ2A 2IYWA 4LYAA 3RRYA 2P6NA 1W1WA 4XSGA 1NJFA 4MRPA 4LYHA 2GEVA 2VSOA 4ESHA 3GJ0A 4FW9A 3V4RA 5JS7A 1TU3A 2YNMA 2XSZA 1BYUA 2EW1A 4HATA 4K81B 4XJXA 3B1VA 2VF8A 3SI7A 2PL3A 4O2RA 1Z28A 1VCIA 1XTQA 1VG8A 2CJWA 4XD7D 3OEHA 4PHFA 3T34A 3B9QA 4P3YA 2ZE7A 1JALA 4B75A 2ZU6A 1X1SA 4MRSA 1QRAA 1US8B 5JHHB 1XZQA 3NEJA 3DOFA 4WZAE 1GKIA 2IUSA 5FPSA 3ADCA 2R6FA 4D82A 3B6EA 4HLUC 4DRZA 1GFIA 4BFYA 2OXCA 3FHCB 4KBFA 3DPUA 4YONB 1E9DA 3F3YA 5JCZA 4FCWA 1LS1A 1E2DA 2OCAA 3SEAA 2WWWA 4Z8XA 1IN5A 4QOSA 4LGMA 2EFHB 1ZAKA 2WM9B 2WPDA 3AM1A 1EFRA 1QZXA 1FL9A 3AF3A 3JVVA 2O8FB 4D81A 2ZRHA 4G5RA 2IA5A 1PJRA 1YQTA 2FPMA 1G8HA 3W34A 3UWOA 4JVNA 4LJYA 3M6AA 3CPJB 3I61A 2GEDA 4Q00A 4LV8B 2G9NA 1NMYA 1NKSA 1R0ZA 2OCBA 4W9MC 4NDZA 4NPHA 1FQJA 3D7MA 4XVQA 1XEWY 1NMXA 1W0KA 3SJBA 3GLIE 2ZI6A 1TNDA 1KHTA 3PITA 3HU1A 3T1OA 4NYIQ 4Q4JA 3NBZC 2ZI3A 3LRPA 1ETUA 3CH4B 1R5OA 1NIJA 5J5CA 2RKOA 1FW6A 2CMKA 3REGA 3J81k 3RC3A 1KI7A 2DPXA 4G5QA 2QSYA 4GP6A 2Z5FA 2REBA 2XITA 3KKNA 2EWVA 4KHZA 3R7WA 4JLVA 2Z6VA 4MYCA 3VKHA 1X86B 1XD8A 4XVUA 5KHOC 2FFQA 4LC0A 4AD8A 1Z0IA 4C0LA 4NBSA 4Q4AB 5FBVB 1SXJE 2C9YA 2HLDD 1UEJA 2XX3A 2ZRIA 2VQSA 3WP1B 1ZCAA 3H86A 1SVIA 4GP7A 5GJBA 5LB4A 2JDIA 3IEVA 3Q8XB 1KI9A 3VHXA 2QP4A 4LJ6A 3K09A 2ORVA 4V03A 1QHHA 2YINC 1KTVA 3EARA 3I62A 3EA5A 2V4ZA 3MCAA 1N6KA 2AL7A 4JLDA 4A0HA 1CBUA 1ZP6A 2KJQA 1U8ZA 3VKGA 1S4QA 1IAQA 5J4HA 3L2OB 4D2IA 1E4YA 3GFTA 3CH5A 4AYWA 5K8IA 5HZKA 5DI9A 5KUTA 2ODNA 3GLFA 1YZKA 1G5RA 1OXSC 3V9PA 1U2RA 3ECCA 4KJZA 1KJZA 3GJ3A 5LB2A 4JLBA 4M1KA 2C98A 4B2PA 3Q72A 1ELOA 1KK1A 1NI3A 1ZUIA 4JT2A 4MA4A 1XPRA 1CJKC 1OHHD 1XCPA 1QHIA 1SXJD 1ZJ6A 1Z0KA 1N5JA 2WMOB 2QTFA 1ESMA 3KFXA 3NXSA 4KITB 1LFDB 4AYXA 3PVSA 5C2JB 2N42A 4LBYA 5EUMA 2ZRAA 3A4LA 1RRGA 4TYNA 5JEDA 3PQCA 2SHKA 2VHJA 3AF1A 3QENA 1W2HA 1I4TD 1KDPA 1LTQA 3QE0A 5H1YA 5LD2B 2VHQA 2B8TA 3TIFA 3VAAA 4YMTA 4HAYA 3LV8A 1S1MA 3T5GA 2V54A 1R4AA 3LQQA 4EJSA 1GILA 2Q3MA 3SDZA 4JSTA 2B21A 2GVDC 4HAWA 3U5ZB 4TL9A 4JL5A 1CJUC 3CKLA 4TTPA 3RYTC 3L0IB 5JLJA 4HUQA 1XJQA 3DMDA 3QXJA 3X1WA 3PG5A 4F91B 1T0HB 1M34E 5SZKB 5JECA 4LYFA 1ZINA 2FOLA 3THYB 1G3IA 3FFBA 4IFBA 2ERYA 3KB2A 3N70A 5BYKA 4EFNA 3OEED 2PJZA 2R65A 2W0SA 3O8DA 1VYUA 2F43A 5L8VA 3RRNA 5KU1A 4HB2A 4CYMA 4Q21A 3FKQA 4LHYA 1TU4A 1W0JD 1E9FA 4DLXA 3GLHE 3R9XA 2GETA 3AVYA 1KI1A 2OEPA 4D0LB 3PENA 2YHSA 1UBEA 1DAKA 4Q01A 4X8LA 4ZO4A 4QBIA 2EWWA 4PQRA 4BWYA 5J4KA 3GLGA 1OH7A 1G20E 4HYYA 2HXSA 4MITA 2V7QD 3ZZUA 1PLLA 3CZQA 4F4CA 4QGFA 5AUPB 4CVNA 1CS4C 4ARZA 1NBMA 3DZDA 2F1JA 3HYTA 2CL7X 2QT0A 4L15A 1ZU4A 3VQTA 3GJ4A 3QY0A 1EX7A 1II8B 1H8EA 3AVVA 4RCYA 3LFUA 2OFWA 1OPXA 4HI0E 121PA 3TMKA 3SFZA 1P61B 4ZV4A 2O8CA 3VX3A 2NO7A 1NY6A 1KOFA 4L5BA 3MWJA 1P9WA 3BERA 3OIYA 4MQBA 4C0JA 2NO0A 1L2TA 3DM5A 4DT1A 1E0KA 1Z0JA 4Z54A 1CULC 4CW7A 4DIDA 1SKYE 1E2GA 3NG1A 4E5UA 5DI3A 4BFZA 5LD2C 3H84A 2RGEA 4GDFA 3QOFA 4XH9B 3VR3A 5F9FA 1DADA 2UZIR 3TUJC 1GOTA 4IRUB 4WVFA 3FB4A 2IUUA 4LV6A 5FUVA 3AH8A 3EIHA 2IK8A 2QORA 4XWKA 2OBNA 2PZEA 2JLQA 4AYTA 2GCOA 3CRW1 1KSHA 1VKJA 4ABYA 2VF7A 2YV5A 4Q9IA 5LDDC 1XWIA 3FHTA 2LKCA 4QM6A 4D4JA 2CCGA 2PCLA 6Q21A 4OQNA 4PZLA 2J0UB 2G0NA 1DELA 4QJ4A 1Z0AA 3TW8B 3LW7A 5L3SA 2WAYA 1OLOA 3QEJA 2R44A 4KCGA 1ANKA 2DY1A 2GBLA 2WZQA 3P27A 1XTJA 1VECA 4LJ7A 2ODBA 1G3QA 4TLBA 2ZVPX 3IKJA 2XOKD 4ZIRA 3LNCA 5BW8A 4PO1A 2JLVA 1II9A 2WHXA 4POAA 1T5LA 1Z08A 2CHVA 4X8HA 2CHQA 4EPTA 3ADDA 5AK0A 4C0AC 2BCGY 3P4XA 4TN1A 4IDOA 4TWZA 4ERNA 1MR3F 3ZH9B 1E1QD 3R8FA 5IK2D 1E9CA 5EP1A 3QKSA 1T3HA 5KSYA 2P3SA 4US1R 2ANCA 3GCGA 3X1YA 3NBYC 5C4GB 3AKYA 1EWQA 2QGNA 3LLUA 1OB5A 3IEUA 1YZQA 3AP1A 4P31A 4BZQA 1OSNA 1IONA 4G0NA 1DO0A 3U2QA 4IKEA 3T06B 3QPVA 4L16A 3MMPA 4A8JB 3IIKA 1DAFA 2AX4A 3E5HA 2ZEJA 5AJWA 2A5DA 1HE8B 1UFQA 1MABA 3AF0A 4TQ9A 4LRWA 1OFIA 2FMXA 3K9NA 1PV4A 5EZ6B 2VRWA 3B9PA 1YHNA 3U6BA 1JR3E 2ZAMA 3KKMA 4AKEA 1KKMA 2C99A 1N5LA 2REOA 4RFSA 3SNHA 2G83A 2QBYB 1FNMA 2AXNA 4R71A 2GAAA 3VU9A 3OAAA 4HLUA 1T6NA 2C96A 2WAXA 2VL7A 3GEHA 4KFTA 4DLSA 4C0KA 3IGFA 1GL7A 4XWAA 5FPTA 1YZGA 2QT1A 4M1MA 2D3WA 4QBHA 4IOJA 2O0JA 1TPZA 3WRYC 2YKGA 4UXJA 2QEQA 1M74A 3CB4A 5IF9A 2IS2A 3LXXA 2NQ2C 3EPHA 3IQXA 4FMDF 2CHGA 5FBQB 2DHRA 4WXRA 3K53A 5D3MB 3PIRA 2FPLA 2CNWD 3QXCA 4H1VA 3T61A 4B71A 2Q3FA 2ZS9A 4LBZA 3THOA 4KBGA 3K8YA 2F55A 1JR3D 2RB4A 4ILEA 4M0LA 4LYJA 4A4DA 3EZ2A 2GEUA 2C8VA 4UKDA 5GJWC 4EPVA 2OAQ1 3VFDA 2EFGA 1E0SA 1LS6A 1Q1QA 5M04A 4NCKA 1I2DA 2B7BA 3MUFA 1D2MA 2QSZA 3M4YA 4B33A 3I8XA 3KQKA 4GMXA 1E99A 3KZ1E 2FV8A 5KNBA 1GL9B 1XEXB 5A4JA 2WWFA 4PSVA 3AVOA 1ZM7A 4Q1FA 4TMTA 4ZDJA 1DARA 2GJ9A 5FBLB 2NZJA 2J0SA 1U98A 2YJTD 4H9GA 4N3NA 3CRQA 1P9RA 2CE7A 2FZ4A 4A36A 1V5WA 4BLQA 2HT6A 4KLZA 4JLOA 4URWR 2ZRCA 2BV3A 5JEEA 5CB8A 2PT5A 5JCPA 1KIMA 1K8RA 4PPGA 2C5LA 1NLFA 1E2EA 3Q7PA 4UJ5A 1KO1A 1X8KA 3U3JA 4PC7A 2YC4C 1E98A 1C4OA 1OV4A 3ASZA 5FL7D 1ZD1A 3LQRA 3JZMA 4XVRA 1U0HC 5DYGA 2GILA 2O5VA 1E9AA 4MKFA 5L3RA 5CYPA 1NLZA 1M8PA 4G5SA 1GM5A 1US8A 2JJ2D 5FUWA 3B7GA 1BOFA 4DCVA 4TMZA 2GJKA 4HAUA 4ON9A 1UM8A 2OAP1 1WE2A 2IC5A 1E0JA 2XJ4A 3WMEA 2J7KA 1C9KA 4WA7A 4DB2A 3I8SA 2FE4A 2R8RA 3B78A 1IXRC 1MV5A 2CXXA 2W6ID 3FMOB 3GD7A 3IO3A 3OFND 1GITA 3FPAA 4M21A 1F2UB 3NH9A 3R9IA 3EXAA 3QKTA 1VDZA 1FX0B 1S1CA 4EKDA 3GJ8A 2C04A 1F5NA 1MRSA 3BK7A 2F9LA 3C8UA 1KKLA 1G21E 2W83A 4E09A 2DBYA 4OK3A 1OIVA 1OYYA 3W6PA 2ATXA 2O8FA 1T0JB 1Q1BA 3SN6A 1OFHA 4TTRA 1SKQA 3MGCA 3BRWD 2QQEA 1JBKA 2JLYA 1Q21A 3CPHA 1MO4A 2VP9A 1ZM2A 1DAGA 1NIPA 3IPYA 3ZVNA 4AKHA 1IJEA 2JGNA 2EYQA 1KDTA 1PLJA 3O8RA 1H8ED 4A2PA 3ADBA 4S35A 5GJVC 4JLJA 1P72A 2FX3A 3MRSA 2I4IA 2CVHA 1ZNYA 3RWMB 3UMFA 1XBTA 1N2CE 4N0DA 3KQLA 1E1RA 1A2KC 3AGPA 4PXAA 2ZSFA 4LJ4A 5CITA 3SQXA 4D26A 3BORA 4EPRA 1EWRA 1G8GA 4OI1A 4ZDIA 2AHOA 5G3YA 1JR6A 5JBQA 2QI9C 1WDTA 1CJTC 2D62A 4OHYA 4DXAA 1S8FA 1KO4A 1CRQA 4UXIA 4D4MA 4TYYA 4MDEA 5HE8A 4URZR 4MGZR 3TW4A 2WKRA 2R62A 4KODA 5FPYA 4TMVA 1YU9A 2P6UA 4TTQA 2JJ1A 3ASYA 1ZC3A 3EG5A 1NVVR 3A1SA 3BFKA 3EZ6A 1OXXK 5AJVB 3RSOA 5JI3E 1IY1A 4GOKA 4Q7LA 2IWHA 2ZJAA 1FMJA 4YMVA 1KSJA 3VR6A 3DMNA 4C2TA 2DFLA 5FTMA 2VA8A 1AK2A 4V0MA 2D7CA 1E6CA 3KTAB 2Y8EA 2A9KA 2IYQA 4PC3A 2BIFA 2ZR9A 3CWZA 3CX7A 3KJEA 4IHQA 1RRCA 2NTYC 1WA5A 2OCYC 2IYZA 2WWGA 2QPTA 5L3QB 3LVQE 2HUPA 1H65A 2BKUA 2H8KA 1YR9A 4FD2A 1II0A 1O87A 4MKIA 2OG2A 2WJVA 4D4LA 2JLRA 1JECA 3NKVA 2MSCB 2QN6A 3RDPA 4MYTA 1KJWA 2D06A 5FTLA 2PMKA 4AY2A 1W4RA 2PLFA 4XTRA 2FPKA 3BBPA 2ZVQX 3VMFA 4Q4HB 2WIAA 2NPIA 3LO5A 4CT5A 2DYKA 5DHAA 1H8HD 3HWSA 3MLEA 4X8MA 1HY3A 1F3OA 2BVNA 3OHMA 3QXSA 1XZPA 3D6TB 5DO9A 2ZTSA 3T5DA 1JQJC 5E7JA 1G18A 4DLWA 2G88A 2RH5A 1OH6A 3IDQA 1UKYA 3BB4A 3ND9A 4OQFA 4HAVA 3OIWA 2ZS7A 4B6EA 3WP0A 4J0QA 3DL0A 3U44B 1PUIA 4B35A 1G6HA 4EQ6B 2QGZA 4RZ3A 4ZCLA 4W7SA 1YZLA 2Z0MA 1OYWA 4P4SB 3SC3A 1LF5A 4LV5B 1SVOA 4M9XA 4M9SA 1NLYA 1GUAA 3RS0A 1E2LA 1TTTA 3GFOA 1G4UR 1Q3TA 4A0RA 4V0OA 4B2IA 4YXWA 3THYA 2GZAA 1TQ6A 4A15A 1SVKA 3ZIAA 4EDHA 1T8TA 1AKYA 2YWHA 1AIPA 1KI4A 5EXSA 3A1WA 2RHMA 3TR5A 4UJ3A 5DISB 3EIQA 5BYJA 2XGJA 3R8CA 3Q85A 1B23P 1XCGB 2H92A 2ZI9A 2JCSA 4GBMA 1OFUX 3X1XA 3LD9A 2KI5A 5KYKA 1DOAA 3CF0A 4XOIA 2HDNB 4BEBA 3BGWA 5FH9A 1Q1ZA 2ZYVX 3FGNA 3K0AB 4QBFA 5J4VA 1S3SA 3SS8A 4QGAA 1DPFA 1SHZA 3U61B 4GZLA 4TSFD 3X2SA 1E2QA 2CK3A 3Q7QA 4ZI3A 2WBLC 2XB2A 3NC0C 3HYRA 4MH0R 4R9UC 2QRNA 2V55B 3H2YA 5EE0A 1ZM9A 1KNQA 5GVSA 8OHMA 3CF2A 4DUGA 1G64A 3WYGA 4CEJB 1II8A 4BFVA 4DSNA 3KQUA 1P2SA 1QHSA 4C9BA 3GJ7A 4LWZA 1HT1E 1N3BA 1LY1A 2GXSA 2PEYA 3L82B 5DHFA 5TDHA 3SE0A 3FVQA 4QJ3A 2A5YB 3K0CC 3GPLA 4M1TA 4ITRC 2I3BA 3PCRB 4LCBA 1IN4A 3ADKA 1UEIA 3T35A 3TE6A 5BN4A 4TZ6A 2ANBA 1M7BA 2XTMA 1WP9A 2J7PA 2WMNB 4QGGA 5DGXA 3I5YA 2XZLA 1MRNA 1E2NA 3MAAC 2RGAA 1NRJB 4TLEA 2H7VA 2BBWA 2FSGA 4D0NA 1NNEA 2AK2A 5EE3A 3UG6A 2VHUA 5FOUA 1KAGA 4JIMA 3CNOA 2OESA 1HQCA 3EPJA 1GWNA 4KSCA 2JEOA 3NIBA 3BB3A 4HZUB 2PZFA 4JZKA 3C7KA 4DZZA 5IT5A 3FMFA 4TL6A 4IOKA 2QM8A 3A4NA 2NMVA 2ZSEA 1XEWX 2GVZC 5J47A 5F9HA 5HKKA 4BLOA 3RRMA 1I4DD 3QPUA 2J0UA 2QAJA 2ZR0A 1JPNA 3DO6A 2FN4A 2C9OA 4KYUA 1Z47A 1AS3A 4GZMA 4JYCA 1U90A 4TT3A 1J90A 3OESA 3DDCA 4P32A 1YVDA 4GSYA 3BJIC 2QA5A 1RW4A 1E96A 2KB0A 3CRMA 5FOXA 4ZCMA 5EE5B 3TR0A 2DWOA 1VHTA 1VG0B 3MG9A 1COWA 1N5IA 2EYUA 4OJQA 5JWRA 3RABA 1OXTA 1FQKA 2F1IA 2EVWX 3L0SA 4P33A 3SJZA 3NEYA 2NZ8A 1Z6YA 2Q9BA 2AR7A 2OBLA 2W58A 3L8ZA 3PEUA 2VYFA 4R2IA 2C95A 2XB4A 1UBFA 4PC6A 4ZPXA 1EFTA 3DEFA 2A78A 1WRBA 4D4KA 5DSZA 4NYIR 3A36A 3MFYA 4KV9A 4B44A 4GNKA 2HF9A 1BH2A 2IHBA 3TLXA 1IOZA 1MO6A 4PHGA 1QG2A 2HT1A 2BM1A 4PO9A 2ZRFA 1RFLA 1J70A 4JLMA 2QE7A 3RAPR 3AKEA 3GJXC 2ZRMA 5AR1A 2MSEB 2OFOA 2X8AA 2QBYA 1N0UA 3ZD6A 1LF0A 4WOPA 1W5TA 5B57C 3AVPA 4B73A 2JAQA 2ZI7A 1GRQA 3SYLA 2UZ3A 2ZIAA 1TF2A 1R8SA 4QG7A 3W8RA 2O8DB 2WSMA 1YJ5A 1FTSA 4R98A 5BQ5A 1OH5A 1IM2A 1HA3A 1G8FA 1G9XA 2A3RA 1KGDA 2FF7A 2PEZA 4C7OB 4DLVA 1F60A 1L7VC 5D3MA 4C3ZA 3WMGA 5E7MA 3QF4B 5KDOA 3O8BA 1IN6A 1UDXA 4IVRA 2BWJA 4OBEA 5CIQA 1JXOA 3W5JA 2V1UA 4BGDA 2KE5A 1E79D 2W0MA 4TL8A 3VR4A 1UKZA 2ZE6A 2GXQA 4YMUA 1FUUA 1R0XA 1Z2AA 4MRNA 2FZLA 4ZDWA 5KDDA 4A6XA 1R0WA 3PEYA 2OLJA 4MYHA 1D2NA 4L8GA 5K8TA 4KXFB 1XEXA 2ODEA 3SYKA 1D8TA 1ZRHA 4DLRA 1P75A 1G3UA 4OQLA 3X1ZA 4L9WA 3UKDA 3NHBA 1DAIA 5FUXA 1E0AA 2ZUDA 4Q7MB 2O0KA 3B60A 4TYQA 3AUYA 2VP6A 1IXZA 1OKKD 1SXJB 2QL6A 5FR1A 3RS5A 3REFA 4BFWA 3SR0A 3K9GA 2G3YA 1F2TB 2DB3A 3VR5A 4FWTA 1E2FA 1G19A 2PX3A 1P6XA 5JMTA 2XNDA 3KKOA 3A1VA 3M0EA 3RS3A 1G7CA 3GEIA 2V6JA 5H68A 5DYIA 1P5ZB 2YVUA 5KO2A 2JA1A 3NHAA 3EW9A 1M6NA 2WV9A 3X1DA 2ZJBA 4P4TA 4JSYA 3TQCA 2ZREA 4FINA 4M9ZA 4YXWD 5F3WB 4UNQA 1UADA 5EQTA 4PSKA 2AFHE 5EJEA 1MO3A 3ZIAD 4CEHB 1E2JA 4PC1A 2CL0X 4FWIB 1BMFD 3LLMA 3SZRA 2IXFA 4ACAA 4NCNA 1M1YE 4PPNA 2ZRKA 3QBTA 4DVGA 5JI2E 3RS4A 4RD0A 3U3RA 4Q1DA 4LY6A 4RZ2A 4G5OA 4R2HA 2P6RA 3G82C 1F2UA 1HUQA 5A0FA 4URUR 1FX0A 2MMCA 2ZE5A 1W46A 3ZQJA 1XB2A 1CF4A 5C46F 2QQ0A 3U7GA 2ZETA 3V00A 4P0TA 4AK9A 2IBMA 2J87A 3FWYA 2FEMA 3LVRE 3QKUA 3QEOA 4DEXA 3UANA 2IYLD 5IHPA 4ASUA 3PUWA 1UAAA 1GG2A 2YWFA 3KUDA 4H1UA 4U5XA 1N0WA 3C15C 5CDFA 1P73A 2CDNA 1R5BA 3WYAA 5LBIA 1E2IA 4PFSA 4V0LA 2OBMA 5ELXA 4JLNA 2F1RA 2ZXUA 3VX4A 5CJ2A 4RD2A 2FFAA 1R0YA 4URVR 2XTNA 1BS1A 1M7GA 1NN3A 2XSZD 3A1UA 4PZYA 1VIAA 2IF2A 3OEHD 1D2EA 3K0FB 1Z6AA 1ZBDA 4DSOA 3BH6A 4MGYR 3CLVA 1G5PA 4W5WA 2AWNA 3IHWA 3PUZA 1NMZA 4TMKA 3PV0A 3MSXA 4OHVA 1NP6A 4YDSA 3B1YA 3QBVA 1G8PA 3GFPA 3GLHB 2E9SA 2DFKB 3W8NA 3EWSA 1Q3HA 4LHVA 3NTUA 1JAHA 4AG5A 4D80A 3CONA 4QGHA 3T12A 4QJ5A 4E22A 1I4LD 3NBFA 2V6IA 1TQ4A 2ZSBA 4MUAA 2IS1A 1T91A 2RGCA 1ZC4A 2GXUA 2N1BA 2QTHA 3KTAA 2DWQA 1P2UA 2QRZA 2RHDA 1XMIA 3BAFA 5IRCD 2D4HA 2WPDD 1EFRD 3EX7C 1AJEA 5AJXA 1E94E 2Q3HA 4BASA 4NYJQ 4UNRA 3DVLA 2HV8A 4W5HA 5FTJA 1XU4A 5HZHA 3Q3JB 1XTRA 4NYMQ 1KO7A 1TAGA 2H17A 4LI0A 4EPYA 1CKEA 2JJ8A 2PT7A 1ZVQA 4NONA 4OI2A 5JRJA 4NCIA 1OIWA 3UK6A 2IL1A 3BH7A 4O2LA 1P62B 5C18A 1SKYB 3O47A 3U3KA 2QAGB 1XPUA 3K9LA 4Q9KA 2X19A 2G1KA 1W0KD 1P2VA 1CU1A 4Q4HA 4HEJA 4WBSA 4DKXA 3K0CA 1KYIA 4AWXA 3HP1A 2FH5B 1W4BA 1HT2E 4Q66C 4F7WA 4IVQA 4JYBA 1V43A 3H4MA 4C30A 4C0QC 2OV2A 3PJRA 4CRWB 3U4QB 4V0KA 3GLFE 1MT0A 4UQOA 1RKBA 2VO1A 2BOVA 3W3ZB 1U8YA 3F0TA 4XIGS 5KDLA 2GNOA 3U44A 2ORWA 1VCOA 3IBGA 4M4SA 4NKRA 2P5TB 2R6DA 1G3RA 2FSIA 4DJTA 1EX6A 4EQ6A 2R2AA 3NH6A 5G41A 2ECKA 4P4SA 5J4YA 1LVGA 5E3HA 4GI7A 2J59A 4QNRA 3TSWA 1DAMA 3PFIA 4I4LA 4LC1A 2GF9A 1XTSA 1EG7A 3AB3A 2JDID 2QP9X 2D2EA 2CL6X 3K70D 1U99A 1AGPA 5CIWA 3TNFA 1F6BA 4KO8A 1NSFA 4RVCA 2Q21A 2LKDA 2GRJA 3ICEA 4LHXA 5EP4A 1JXMA 1TF7A 4Q1AA 3CF6R 4PC2A 1Y3AA 2QY9A 1ZUNB 2YOFA 3I3SR 1KI2A 4YLGA 5K8UA 4FIDA 2GHIA 2EQBA 5FBWB 1W36D 4Z1MA 1HURA 3LBHA 3QKRB 3VKWA 1JB1A 2BDTA 3U60B 3THWB 4PQFA 4OYHA 4B43A 1K6MA 3FKSA 1CR1A 2FG5A 3K0AA 2QG6A 3EIEA 2AK3A 2I1QA 2NO1A 3LX5A 2XXAB 2VSXA 3W6OA 5EE1A 4AIIA 1E3MA 5BXQC 4A6PA 3BFVA 1G1MA 2IYXA 4IEIA 5FFMA 1FMLA 1GKYA 3C5HA 2QTVB 3GQBA 1KDOA 4OL0A 1KI3A 4O0MA 1G16A 2GJAA 5D3QA 4DSTA 2X2FA 3OIVA 4CEJA 1NG9A 1KZ7B 5DIFA 5FPHA 4A92A 1KNXA 1ZIOA 5CLQA 5JRZA 1NN0A 2QAGC 3HPRA 1KY3A 1YZTA 1KSFX 1G8YA 3CX8A 2RAPA 5UKDA 4EIWA 3BOSA 1Z5ZA 3RSLA 3HR7A 1Q44A 5HCNA 1QF9A 5AJZA 1HYQA 1J8MF 2RGXA 3FYHA 3CWQA 5SZIA 2QENA 3THXB 3UWKA 4A8JC 3MJRA 3ZS9A 1VG9B 2G0TA 1E2PA 3LBNA 3GLGE 1U0LA 4EFMA 5B2ZA 1XMVA 2JIZA 5E4FA 3T1VA 1Z06A 2GK6A 2BMDA 2CEAA 2J1LA 1T8UA 4K46A 4AKIA 1NBME 1UKEA 3LH5A 1AKEA 4IDQA 2GF0A 4IFEA 4M1SA 4LDJA 2J0VA 4JJZA 4GOJA 1FFHA 4HZUA 2XEXA 4C2UA 4RSGA 1KI8A 3I1FA 4GT1A 2WJYA 4A0GA 4II7A 4XD7A 3SOPA 3KFVA 4NHOA 4PPQA 1G6OA 2FNAA 4PTLA 4B74A 2ZS8A 3AVUA 3QQ5A 4IEEA 2WJIA 3KXLA 2ZYTX 3P20A 4M53A 3BXZA 2OFXA 5K8LA 2C2HA 2OT3B 2NG1A 4NCJA 4QKQA 2EFCB 4LPSA 2OCPA 2PMDA 1XDBA 5EXXA 2V8OA 1Z6XA 2DWPA 2AWOA 3IBYA 5KPJA 3A6PC 2WSSA 1LV7A 1WBDA 3LX8A 4I1VA 1ZIPA 1NBMD 4KFUA 5TY0A 4ASUD 2ORIA 4D0GA 3WYFA 1CJVC 4O3MA 2ZSDA 3PUVA 3AF4A 4HAXA 1FP7A 3CUEF 3A4MA 421PA 4B48A 2VP0A 3HU3A 1GNQA 3R20A 2VTKA 2W00A 2XTZA 2NO6A 4M1YA 1G7RA 1G5TA 3IIMA 3C14C 3A8TA 4KLNA 2R6GA 4RJLA 4PAQA 4DBLC 1ZUHA 3WBJA 2VSFA 5P21A 4FN5A 4HB0A 3VNUA 1SQ5A 5CM9C 3WNDA 1Z0FA 2RGDA 2FGKA 2ZQ5A 2Q9CA 1XTKA 2J41A 3QVUA 4E07A 2ODWA 4M9QA 2O8CB 5FBRB 1VYVA 3FFAA 4KU4A 1NF3A 1RRPA 1IN8A 3QIAA 1GRNA 4AG6A 3B85A 2RGGA 4Q4AA 5DH9A 2FWRA 4I1SA 3B1XA 4BLPA 3I4LA 1XD9A 4IXNA 4OK6A 1N6IA 2OE2A 2WWYA 1QHNA 1UDWA 4F4IA 3EZFA 2O8DA 2ZI5A 1GL6A 2C78A 1OF1A 1XJ0A 1Q22A 2A5JA 1OE0A 3HPQA 1KMQA 3C5CA 2GXAA 3N2IA 5J4LA 1P2TA 1PVOA 4P4UA 4C7OA 1X6VA 1W44A 3PEVA 1K5GA 4OI4A 4Q02A 5HCIA 2O8BB 1JEEA 1Z07A 5F2EA 2HLDA 4EAQA 4CEIB 5CK4A 1P3JA 1J8YF 3EPLA 3QF4A 2AKAB 1XCMA 1OT3A 3ZVRA 2CLSA 1NKTA 1WXQA 1Z3IX 2G77B 2HYDA 1TUIA 2QPOA 3N5CA 3UMSA 4HDCA 3EAQA 4YQFA 3RS7A 4BRWA 1F48A 4US2R 2FJUA 2HJVA 3KJIA 4KFRA 3B13B 2HF8A 3BE4A 4QBGB 1VTKA 3P4YA 3WXMA 4PANA 3EZ9A 1JPJA 4Z8YA 3K9HA 2R9VA 3FE2A 3ZJYA 3SHFA 4C0SA 2ZE8A 1LW7A 1DEKA 4Q9JA 1KSGA 3TQFA 4ZI2A 4ZIRB 2JLSA 1SVWA 1XD2B 4PSAA 3PXGA 3EASA 1D9ZA 3AV0B 4M1OA 4RCZA 1E69A 1GTVA 1CXZA 1GZSA 2O8EB 1DAEA 4B34A 5KNDA 2ZU0C 1KDRA 1G17A 1RZ3A 1M2OB 3U7FB 1FOEB 3IHLA 1NG1A 2FSFA 1HV8A 1F2TA 3Q9LA 5JFGA 1G3MA 4B2LA 1YE8A 2OZEA 4DDUA 3RC8A 2F1HA 1AQUA 1G291 4DC9A 2HXYA 3K0EA 5FR2A 3VNVA 4V02A 2IS6A 1L4UA 1VCNA 4IVPA 2V9PA 2IWRA 4BQSA 3A37A 2ONKA 3LAWA 4JL8A 4KVAA 3UMRA 2J46A 1T9HA 4CDGA 3OAAD 5E7IA 2QP3A 3KJGA 4JLKA 2C9CA 5KPDA 3D3QA 3S1AB 4S2EA 4UNPA 1X8LA 1DO2A 1P7CA 3DKVA 4G3XA 3ZDQA 1Z0DA 4CEHA 1E9BA 1XMSA 2C03A 3L0PA 3K1JA 4TQAA 2NGRA 1RJ9B 4OQMA 3WHKA 5HPYB 5KTYA 2OLKA 2UKDA 4F4JA 3BS4A 2QNRA 4JS0A 1JQLB 1P4SA 1D6JA 1QG4A 2ZYWX 4LJ5A 5J40A 4DLTA 4U7DA 3BFXA 4L4UA 4MGKR 4RD4A 1EK0A 1R7RA 4QHSA 1IN7A 1XNJA 2DCUA 4MKGA 1S96A 1ZD8A 3UXMA 2W2VA 3OEEA 1ZM3A 1YR7A 5B64A 3CW2A 3IIJA 1OH8A 1SGWA 3CNLA 1IQPA 2BHRA 1W49A 2OUKA 2QPAA 4NZYA 2RMKA 1OB2A 3KXIA 1NN5A 1W0JA 2F3RA 4TL7A 4DIEA 3G0HA 4M8NE 4NE2A 5KSPA 2ZJYA 3BWDD 3UATA 4JKYA 2IYYA 4IOMA 4B3DA 4QM7A 1JNYA 1GNRA 2WWHA 2CLCX 2W6JA 3F8TA 4X8OA 5TMPA 3KKQA 1VYTA 1YZNA 3KQNA 5H70A 4RFVA 3TJZA 4U02A 3TSOA 2ATVA 4FMBB 3FMIA 2VP5A 1HTWA 4DCNA 4BPBA 2A2ZA 4HLQB 3SJAA 5CB6A 3BD9A 1XXHB 3L43A 3NDPA 4GRAA 1QHYA 1A7JA 3K0FA 4WZ6A 1FPMA 1AGRA 3LBIA 1EESA 2YWGA 5G53C 3QG5A 4C0HA 1Q1EA 1M7HA 2GK7A 2B92A 3GLHA 4YDHB 5LPNA 4JLPA 1AZSC 4HB4A 4XSHA 1KMHB 1HH4A 4OHZA 2QMEA 2F9MA 5CLLA 3MWKA 2C77A 3PUXA 4A0FA 3AVTA 4PZZA 2FFHA 1DE0A 3AP3A 3CIOA 4KSBA 4DSUA 1U81A 4LK2A 2OO7A 2QM7A 1C1YA 2ZJ8A 1VPLA 221PA 1WBBA 4C0BA 4OI0A 3H1TA 1Z29A 3KQHA 2JLUA 2BBSA 2J9RA 2P67A 3CRVA 4LOAA 2XZOA 2PX0A 3AKCA 2V3CC 1RC8A 2WSSD 1SVSA 3KJHA 2KWIA 3H0KA 4ZCIA 4OQXA 1GSIA 2QMHA 2ZJOA 2GESA 1KY2A 3SYNA 2QMOA 3TUIC 1MKYA 1OJLA 2QAGA 3CPEA 3SFVA 2YWEA 2CLDX 3IPXA 2EU8A 2XOKA 1SZPA 3ZQ6A 1O3YA 3O8CA 1FUKA 2PLRA 2GCPA 1N6PA 3IO5A 2ZROA 4V0ME 2P2LA 2D7DA 1E1RD 2MSDB 3P32A 4WAUA 4A8JA 2D2FA 2VHCA 4QL3A 3NDBB 4AURA 2J45A 2FA9A 4R7ZA 1CJMA 4Q4LA 3TSZA 3I72A 1ZU5A 2Z83A 3SJCA 3U4QA 1YR6A 1E1QA 3MWLA 4JVSB 4TQUS 5IK2A 5A5GA 2PCJA 3W9YA 2D74A 1CR2A 1DBSA 4CIDA 1MO5A 2HJGA 2W2TA 2HCJB 4U00A 1YZUA 3WRXC 4B3XA 2RGBA 4KI0A 4Q5IA 3ICQB 1TADA 2QUZA 5BN5A 1R8QA 4TYWA 5G3ZA 1U9IC 2JJ1D 3NVAA 3QUSA 1X8JA 2ZJZA 1PZNA 4I1UA 1BIFA 1E2MA 2N46A 1B0UA 1MOZA 3C16C 4JJKA 1Q12A 3IUYA 1GDDA 2FFBA 2IF0A 4DCSA 1BYIA 4WZBE 5BWMA 4IDNA 1I2MA 3AQ4A 4A1FA 4GL2A 3EC1A 5FOSA 1QVAA 4D6PA 1Q57A 5JJLA 2ZM5A 2UVQA 2PZGA 1QHGA 1TF5A 5CJPA 4UNSA 3W6NA 721PA 3QF7A 1DG3A 3Q5DA 4LX0A 2BJVA 1W7AA 1UF9A 3QKRA 3E70C 5JS8A 5DLQC 4JBWA 1DAHA 3THWA 3GLIB 3OIUA 1G7TA 3QJYA 2H1LA 1GIAA 1QBKC 4DCUA 1KI6B 2XXAA 2NOAA 5GADl 2ZPTX 2JLZA 4B3GA 2PBRA 4MDFA 3I5XA 1AQYA 1TL7C 4B76A 2CNWA 1OXUA 2NIPA 1A5TA 2B8WA 2TMKA 4MKHA 4CF7A 1IHUA 4F92B 4B47A 3GMTA 3U3MA 3TVTA 3F5FA 1JR3A 4JKIA 3QSYA 2QMUA 2Z4RA 2A7QA 2MMGA 4F93B 3HR8A 4PQYA 1QVRA 1PLKA 1ZD9A 1ZCBA 2IS4A 3AKDA 2A5GA 2WIBA 1OXVA 3THXA 3D8BA 5FOTA 5G40A 4Q9LA 2RGNC 2Z43A 3B8HA 1NY5A 4TMWA 5SZHB 1NSTA 2GCNA 2X2EA 2R6CA 3U7HB 1CR4A 3I32A 3TBKA 2GAOA 4NTZA 3UIEA 3Q5EA 5L3VA 3T1TA 1JJ7A 1OW3B 2WICA 3AVXA 4L9SA 4TLCA 4NP6A 3GEEA 4BECA 5CM8B 2BC9A 1CR0A 1TEVA 1Z2CA 2WKPA 2OM2A 4RD1A 3W3AA 2HCBA 2J5XA 2IYUA 1JI0A 3B2EA 4NU0A 4KYIB 621PA 1YR8A 2J3EA 2NPFA 2EFEB 5FL7A 3ETLA 3ZYCA 4Y0VA 4M2LA 4IDPA 5FOVA 2ZRGA 4BE7B 1HQYE 1WMSA 2IT1A 3T15A 3FTQA 1JAIA 4ESVA 3E2IA 2FDCA 2JJ2A 3DZ8A 3QXXA 5JSZB 1FTNA 2XJ9A 3QXHA 2VLIA 4NH0A 3ND8A 5AWFC 1R2QA 1QDEA 3TAHA 1Z8FA 4JVLA 1ZNXA 1W4AA 1VMAA 5DE3A 2J0QA 1OFTA 3P26A 1ZNZA 2IHYA 3JZAA 5F98A 2W6IA 1N6OA 3TH5A 2V1XA 4EPWA 2CK3D 1XMJA 3OFNA 2GKSA 4W5JA 4Z51A 2YYZA 2YC2C 5EE9A 2CE2X 1TEXA 3UG7A 1HE1C 4DUGD 1N6LA 4DDTA 3HDTA 2FSHA 2REXB 2ZRNA 4KFSA 1CEEA 5KOYA 4TLAA 1RRFA 3AUXA 3WNBA 4A82A 2W6JD 4JL6A 2H57A 2CBZA 1ZNWA 2WOJA 3ZGXA 4LBWA 3AP2A 5AUOB 3RS2A 4WIAA 2J7PD 4LHZA 2X77A 1CRPA 1SXJC 3WNCA 1JEDA 2OSBA 3ZD7A 5FL3A 1L4YA 3LW8A 1N5KA 4IJMA 5H8WA 1SVLA 1RYFA 4RD3A 4FMCF 4CGZA 1IXSB 3B5JA 5FTKA 2WWIA 2CJWB 3AEZA 3W90A 1XF9A 3ONWA 1GNPA 3EC2A 3AVQA 1AS0A 1XJCA 2WOOA 3BIFA 4AKGA 3NWJA 1TQ2A 5HKKD 3AF2A 4GPTA 3LDAA 1CP2A 4LZZA 4Q19A 3U6KA 3RHFA 4TZ0A 1EFUA 2W2XA 2O8BA 4BFUA 4FCVA 4B3FX 3OE7A 4CEIA 1W48A 4BEJA 2IYVA 2AN9A 5L3QA 3VR1A 5TVKA 1J99A 3RVBA 3LWNA 4TT3D 1CTQA 2DR3A 3FDIA 4FXPA 4I81A 2WVJA 2XZPA 1VHLA 3VR2A 2GZDA 4QNMA 1KAOA 3OZXA 1KK3A 4YC7A 5FI0B 4D25A 4NYJR 2JASA 4BLSA 4DCTA 1HEIA 2OHFA 4PPFA 2ZUCA 1DG1G 1UJ2A 2IUTA 4NYMR 4HB3A 3ZZ0A 1COWD 2ZRPA 3QI2A 2AFIE 3K0SA 3L0OA 3ZVLA 2DFNA 3AVWA 4BLTA 5E95A 4B3BA 2WWXA 4AC9A 2JLXA 1XD2A 1N6HA 1Q20A 3PEWA 3SU8A 3RRZA 4JT4A 2GJ8A 4DLZA 2O8EA 2F7SA 3CR8A 2VH5R 2WTUA 1T5IA 2O0HA 4Q1BA 2ZANA 3FHOA 1E9SA 3KX2A 5GJCA 1AA9A 1FNNA 1VG1A 1S0UA 5EXTA 5SZJA 4A2QA 4QRHA 1U8AA 4JLAA 4HDOB 4N0EA 4Q4JB 3NBXX 1H8HA 1J2JA 3CZPA 1UPTA 4IDHA 4DB4A 2VIIA 2QE7D 1U94A 1SULA 4OK5A 4RZUA 3SHWA 5FPKA 3CRRA 3DHWC 521PA 2KBEA 3RNLA 1PUJA 1SHKA 4K8OA 2OILA 1L8QA 3R7WB 3LXRA 5GVRA 4OKSA 3S1AA 1ZW6A 5EP2A 5EP3A 2P65A 1P60A 4LJ9A 5DN6A 4C4PA 5FI1B 1KO8A 4MYUA 4Q47A 3KXKA 2H18A 3QNUA 2IYTA 4PR0A 3U7EB 1A82A 1RJ9A 5TB5A 1RYHA 1WF3A 2GWHA 1FP6A 1NL3A 1ZYUA 1AN0A 2ASEA 4E03A 1A2BA 4YMSA 3K70B 1D9XA 3TAUA 3KKPA 4IXMA 3DOEA 2KSQA 4Q7JB 1QHHB 4HAZA 4NCHA 5TARA 4F38A 4LUCA 2WJHA 1A1VA 4XWOA 1OIXA 4GFDA 3BH0A 2B7CA 5JJIA 1G4AE 2ZSAA 2PJRA 5C1BA 1W36B 5C4MA 2CCJA 4IW3B 1SVMA 2WKQA 3D31A 4NMMA 1GAJA 1QHXA 4PX9A 4OHWA 4MRVA 4O25A 1N6RA 5TXGA 1A4RA 3GLFB 2H5EA 1EFCA 1E2KA 4YMWA 1P9NA 4MRRA 3EWAA 4GMDA 4EFLA 1KJYA 1ZM4A 2OXRA 4JVMA 2QROA 2YOGA 2R6AA 3WY9A 1CIPA 5CYOA 4Q1CA 1ZMXA 4QXAA 2WJJA 4N1AA 1EXMA 4TSFA 4LPKA 2JATA 2BMEA 4GOXA 4HDQB 4PAOA 1NN1A 1U0JA 4Y0AA 2F6RA 1XTIA 3TRFA 1XXHA 3AGQA 3FMPB 2WJGA 2AD5A 2H16A 1KZGB 1U9IA 2GTPA 2XNDD 2ONJA 2P0EA 2Z4SA 3G5UA 2I1VB 4PHHA 1XPOA 1E4VA 1WQ1R 5AUQA 1AS2A 5AJYA 3MWYW 5CDFE 2EFDB 2VHTA 1N25A 2QU8A 3CM0A 4ACBA 3C4JA 4US0R 1W4CA 2AD1A 5B58C 4BFSA 2VBCA 1E9EA 2IYSA 2ERXA 1NJGA 4QFMA 1VIYA 4BUJA 4EJSB 1K5DA 4RKFA 5KSOA 5DNYB 3B82A 1AM4D 1KMHA 2BJWA 2ZJ2A 2ZJ5A 4BZXA 2YOHA 1T3SA 4HLDA 3MJHA 2O52A 1KK2A 1S9DA 2BEKA 4HZIA 4RZXA 4RKEA 1GP2A 5EXPA 4DHEA 4HUQB 3DKPA 821PA 2JLWA 1GRRA 3CX6A 3QG1A 1VCMA 4G1UC 3CNNA 1W5SA 3IQWA 4Q7KA 1S9HA 1R5NA 5JWOA 2ZRJA 2Q6TA 2GJSA 3TKLA 3LA6A 2X1VA 2GDJA 4DDWA 1R10A 1JJVA 2F43B 4BFXA 2RCNA 3K70C 2XNSA 2ZR7A 4FMCB 3K09C 4CT4B 4IOLA 1LNZA 1S2MA 1UBCA 4TYPA 3TUZC 2Q9AA 2BBTA 2GA8A 1IJFA 4AI6A 4WW0A 2LWIA 3B1WA 4WXPA 1E32A 3KL4A 1W36C 1G41A 1XFAA 1BO6A 3N2EA 3GLGB 5HR5A 4JBXA 4Q1EA 4HLCA 4ZKEA 4BRUA 1S3GA 2BBOA 4BZPA 3GP8A 1J7KA 1GKUB 2G6BA 3LY5A 3CO5A 4QC2A 4ARZB 2E87A 2RGNA 1T3LA 3T1QA 1IY2A 3EA0A 2CCKA 2E1RA 1Y63A 3QVVA 4HSEA 4EPXA 3EPKA 1WB9A 1LB1B 3L8YA 1Z22A 4DLUA 3I92A 2VP4A 1N6NA 2B6HA 2AXPA 1T4GA 1UBGA 2A5FA 4Q03A 1Z6GA 2VEDA 3VTKA 1IBRA 5JHGB 3E1SA 5TV2A 4OHXA 4DT1B 2L0XA 1Z63A 1FZQA 4A9AA 4B6FA 3BC1A 5DI3B 3EZ7A 1D5CA 3V4FA 5IDVA 1Z6TA 3ZLJA 3W5IA 2IX3A 1NVVQ 5KNCA 1RE0A 4EJSC 4HUTA 4DDVA 2FEOA 3GJ6A 3OE7D 1BKDR 2GCOB 4Q9HA 4RD6A 1E9RA 1EFHA 5JWHA 1TX4B 2BEJA 1G7SA 2BMJA 2A30A 2LCFA 3BB1A 1ODFA 4KAXA 3GJ5A 3GLIA 2QZ4A 2ZUBA 1AZTA 2CVFA 4LJ8A 3RANA 1KI6A 3SBEA 3I73A 4BFTA 4LHWA 3TVDA 3UPUA 1Q0UA 5L3SB 4DEYA 4DWJA 4DLYA 2VPPA 2BKEA 3WMFA 5FUYA 2BMFA 2AKYA 2IXGA 3PR1A 1N0VC 4B3CA 4UNNA 4V0NA 4G5GA 1DVRA 1ONBA 5JJKA 1YKSA 2IEZA 4FI3C 1X3SA 4OJKA 5JZVA 1RVDA 1E79A 1OHHA 1SXJA 2ZRDA 2KBFA 2ZITA 3OF5A 3QPWA 4QHYA 4I1OA 4FCTA 1TMKA 3QKSB 4MUBA 3SBDA 4BLRA 3C41J 1EGAA 3HJNA 3ZS8A 1W2GA 2NO9A 4FMDB 4G01B 3KB1A 1NVXQ 4JMPA 3KUCA 2DFTA 1WCV1 2G1JA 1Z83A 2ZYUX 3U3OA 1E2HA 4LSGA 5FOWA 5B30A 1TUEA 4PAMA 1XRJA 4LJAA 4PHTA 5ANRB 2ZAOA 1OKKA 4MGIR 1RPZA 2HYIC 3TK1A 1MABB 5EUQB 3WBKA 3RWOA 4TLDA 2F3TA 1RIFA 2VP2A 2BM0A 3CR7A 3B1ZA 5DN6D 2FGJA 4RFSB 2K5UA 5AUNB 5HE9A 1MH1A 5HTKA 2IW3A 3SQWA 2IEYA 3A1TA 4Q48A 4TMXA 3VU9B 4URXR 4Z1MD 1DS6A 4Q18A 5JSZA 3M1IA 1ESNA 4CZ2A 4UXHA 3FOZA 3ZVMA 1XXHE 3FKSD 4JBYA 3KDSE 2Q0HA 3CBQA 3P1JA 1UKVY 1XX6A 4A2WA 1BMFA 1XP8A 4M22A 3VHLB 2P5SA 3ZZTA 4URYR 1W47A 1R6BX 1YRAA 5BN3A 5KSZA 3IILA 4XTCS 2PH1A 2IYRA 4M1WA 4LBVA 1NVUQ 1GVNB 1X1RA 4I99A 2BCJQ 3MD0A 3JVUA 1CLUA 3DM9B 4NL4H 3TGPA 1KO5A 2XAUA 2IXEA 3A58B 1TQDA 2GBLC 3WHLA 1NVWQ 4KVGA 5CK5A 2V7QA 2HEIA 4B32A 3HU2A 1YRBA 1XEFA 2ZRBA 1KK0A 5FTNA 3RLFA 2GZHA 4ZDKA 3R9WA 2FU5C 2ZRLA 1DTSA 4RY2A 5EZ5A 4ZKDA 3NC1C 4QHTA 3PUYA 2ZI4A
chains in the Genus database with same CATH superfamily
1NR1A 2J5RA 1R12A 4K9LA 4DILA 3CLUC 4BBPA 1M2JA 2ZK7A 2DLDA 3F74A 3PEEA 3WNVA 1M1YA 2I65A 3QVGB 4OSOA 4FDVA 4IUYA 1VJCA 3GJ0A 4BVBA 1J4AA 4PS1A 4ZT7A 2IZ6A 5HG0A 2XSZA 3N8KA 2EW1A 1T1JA 4WINA 1KPHA 4XQGA 5IN5A 3DLAA 2C42A 1CNFA 2VF8A 2PL3A 4O2RA 5H8WA 2A33A 1E1MA 3OEHA 3FBTA 3NTQA 2R11A 2WB4A 2QR5A 3ZK8A 4DTIA 1LZLA 4IIHA 3G2QA 1U80A 2AN3A 1T25A 1G20A 3TG2A 1JALA 4B75A 4RTJA 3GAAA 5BXQC 2ZSKA 4YRCA 5J1TB 1RYDA 4XX1A 5I4CA 4F4HA 4KFCA 3DOFA 3TXAA 5BUZA 3UUEA 3IDOA 4HL6A 1USWA 4RVNA 1QH8A 1SG0A 5JCOC 3GEGA 1W88A 4I5DA 4B5LA 5J23A 3WLRA 4AVYA 4UHDA 1T2NA 1UOQA 4QQKA 2XWJI 1GFIA 2X4GA 1CIJA 3HWRA 1Z6QA 4ZAZA 3RKSA 2QRMA 4FS8A 1CY7A 4R54A 4YONB 1E9DA 3CLKA 1EK6A 2BFCB 2IEGA 3UA3A 1LS1A 2QVLA 2L18A 4DUPA 4Z8XA 1IN5A 4QOSA 5HBRA 2B82A 2OFFA 4HOYA 5AP9A 5GMOA 3AF3A 2I33A 1V7PC 2AOWA 4KN8A 5T5QA 3U4AA 1ZLXA 4ZVKA 2QPLA 4MWEA 1MCZA 4X6XA 3M6AA 1KMNA 3I61A 2G1PA 1PT5A 3E3LA 3S1SA 1BG6A 4BU0A 1W2WB 1TVEA 4LV8B 1ESEA 3CN9A 4L5IA 5CD9A 5ENZA 1NKSA 2OCBA 4E2ZA 4F3CA 3PHBE 5KVSA 2B1GA 2EX0A 2Q28A 2BGJA 2WR8A 2C2KA 3QVJA 3GMIA 3HU1A 4EB3A 4PLYA 3C3AA 1VLHA 5EHNA 3KU1A 2FR0A 3DBLB 1R5OA 1J24A 1X74A 2RKOA 1C7JA 3COWA 3FCEA 1YZFA 4J0IA 3TX2A 3RC3A 3J81k 4RK7A 1PZXA 4DRXB 4GP6A 5LP6F 2Z5FA 3DYVA 2DPLA 1U4OA 2DSNA 5KX5A 4HC4A 4P36A 3KKNA 3D7LA 4MB2A 4KHZA 4O33A 2W98A 3FF1A 4LZNA 3ZU3A 2DZDA 4BB9A 1M8GA 1TM5E 3DAPA 1PQ4A 1KMIY 4P5EA 5CG2A 1T13A 1WZUA 4CMAA 1L9XA 3K9QO 2Q4OA 5KNCD 1OVGA 4OHCA 5G2OA 4C0LA 3QLUA 4BO9A 2C9YA 3IVAA 3UWSA 1DINA 2XX3A 3HUEA 1QO9A 2VQSA 4LXGA 1DIAA 1ZCAA 3H86A 2F8LA 4RELA 4GP7A 4W8OA 5FX2A 2JFXA 2VDLB 4BX8A 5GJBA 2NVOA 3QPCA 1C8LA 1M67A 1JKJB 1KU0A 4FHGA 4OU5A 5CFMA 3K09A 2R60A 2YINC 3EARA 3HBJA 5G0SA 3T3IA 4L2IA 3I62A 2ZBVA 5FQNA 4Q12A 2NP6A 1UT5A 1ZP6A 2NU7B 3MERA 5GM1A 1NATA 2KJQA 4U8HA 1U8ZA 4KR3A 1LBQA 1XYVA 1IAQA 1VZ2A 2P8JA 1WPXA 3DC7A 3L2OB 4KQ1A 5FNVB 3CSUA 5J4HA 1XDWA 3CH5A 4ML3A 1DX4A 3NOVA 4AYWA 1OBVA 1QXSA 2WLTA 2JVKA 2O2SA 4JUAA 4MB6A 3UK0A 5K8IA 3V8QA 2HWWA 1Q6ZA 1ZIXA 3E48A 4RMNA 2X0RA 1ATZA 3ZNQA 1CIVA 1U2RA 3ECCA 4G84A 1TC1A 3OZFA 4IMJB 4KUGA 1S5PA 4JWKA 4EZEA 4FOPA 4M1KA 2UUAB 3W5SA 3DXFA 1ELOA 1KK1A 1VKNA 5EHIA 1P4JA 1OHHD 3T0IA 1V6AA 1XCPA 4IZIA 3DYIA 3QH4A 5KNDD 2VPZA 2WMOB 2J9YB 2PH5A 7REQB 1BMTA 1JLHA 3NXSA 4D9FA 1QK3A 4LRTB 3G2KA 2QSJA 1JDUA 1QDUA 2WK1A 3OE4A 3PVSA 4R8VA 3AZPA 1BFDA 3D0KA 3DWEX 3D4LA 3AEXA 4YPOA 1D4OA 3A4LA 1BEEA 3H18A 4WZBB 3GUCA 3T3NA 2SHKA 1THTA 2JA2A 2NUAB 1W2HA 3IAFA 3R4CA 3DQQA 1KDPA 1T4CA 2QS9A 1KARA 3IESA 3QE0A 3TIFA 5CM2Z 4CU2A 3GZTB 5KCZA 2VQEB 1X9IA 3ZCQA 4DJ5X 2XUAA 3V1LA 1YDWA 1NZJA 1R4AA 3EBLA 4AS1A 1Y4AE 1GILA 1QGAA 1SRQA 4JSTA 1JWBB 4EA9A 1XDSA 2FZGA 3BJRA 2BTQA 1CJUC 4TTPA 1AKRA 2YJ5A 1XLTC 2GWRA 4OP1A 4U63A 3RYTC 5JLJA 1CJSA 3DMDA 4UM9B 3QXJA 3X1WA 1YI0A 3HBLA 3ROXA 2FB9A 5SZKB 3EGXA 2QJWA 4CODB 3L8CA 1G3IA 3FFBA 3OE1A 3PFKA 1EJBA 4IFBA 1A27A 2WD9A 1M6VB 1SC4A 2ZUUA 1RU3A 3QVSA 1MB0A 1IVYA 4FONA 5BYKA 5B37A 2WJAA 1EWKA 2OYCA 4S05A 4MVXA 2DC1A 3VZPA 1GTZA 1PS0A 2P6PA 3O8DA 4JMLA 3RRNA 5KQSA 3RVSA 3A7EA 4Z4CA 2II6A 4OHMA 5FP0A 4AUKA 5KU1A 2HHLA 3PVCA 2PRJA 2W71A 4JP8A 1W0JD 1E9FA 2B78A 4JODA 4DLXA 2HYIC 2GETA 2WUVA 3ZV5A 4JP3A 3ZZNA 5KEIA 3WADA 3IMFA 1OZGA 2YHSA 1R8YA 1EZZA 3O2SB 4E4YA 4GKBA 1K98A 2FDRA 2PY6A 5DNCA 2XGMA 1M2HA 1R9GA 3W6UA 4BWYA 2OPBA 3CZRA 1QOPB 3QVXA 4MITA 2NW6A 3HADA 3PKZA 4D57A 4G4SP 1VMDA 1GPUA 4QGFA 5HZGA 3DZDA 1BNCA 4WY2A 4AMUA 1TT5A 4L15A 2QT0A 4U5QA 2OORC 3QRWA 3VQTA 5EJAA 3TPCA 1FTGA 3GJ4A 3T5BA 1H8EA 4M38A 1YS7A 4RCYA 5JV5A 5B3JA 3EF3A 1TFUA 1PNQA 4K6FA 1OPXA 3AETA 3TMKA 2O8CA 4J3NA 4YT2A 2NO7A 3ONVA 2QTRA 1NY6A 5CH8A 5BPFA 3OQMA 3SBOA 2V9ZA 3KNZA 3H9JA 1KEVA 2PRZA 4MQBA 3NBAA 2Q0QA 2OYSA 1RI2A 4CTMA 2NO0A 1O54A 1XUOA 2WYHA 5HM6A 1L2TA 3DM5A 4X6UA 2WF8A 1SKYE 4KLCA 4DC0A 4E5UA 1G21A 5EIFA 1ZH6A 3SIWA 4RKQA 1EFPB 2RGEA 4FI3F 4XH9B 5EEHA 3UB2A 4RLSA 3FBGA 4UOZA 4GI3A 1V1RB 3QZUA 1NDHA 3U39A 4YP5A 3V4OA 5EGNA 3TUJC 2J5QA 1GOTA 1Y3HA 2FMKA 1PU2A 4HD8A 5LOVB 1L4HA 1T0IA 2CYCA 1EP9A 3G0GA 4M0KA 2QORA 4BVEA 3C3JA 2EDCA 4D98A 2PZEA 4PTZA 3H2BA 2IH5A 4F5YA 4CM9D 2HF7A 3CRW1 2HU5A 1KSHA 3DJFA 1EM6A 1IUNA 3NHKA 2C94A 2YV5A 3K32A 4N01A 4OB8A 1YTUA 1M3SA 3KSDO 2I78A 3RHTA 1PWYE 2LKCA 2LRHA 2RH4A 4N47A 4QM6A 3KJNA 4RMGA 4IF6A 4E88A 5L51A 4KPUA 1T2DA 2GR9A 2PCLA 4PZLA 1GLGA 1A1SA 4I55A 1DELA 3F46A 1X7XB 1J1ZA 4GX2A 4GX1A 1YMQA 2FR8A 2WAYA 3WGNA 2XNHA 3GAZA 2YJ4A 5H7XA 3TEMA 2BISA 1QZZA 2HDOA 2CFSA 4YLYA 5HILA 4LJ7A 4CF5A 2DFPA 3NIGB 2R7KA 3OE5A 4L7VA 5LZ8A 3UB3A 2QTAA 1II9A 3RVNA 3RVJA 1X87A 1YC2A 4R1PA 3TL3A 4NCBA 1T5LA 4HMQA 1Y6RA 3HB0A 4ZTBA 5HQTA 3MBOA 1FFWA 2Q8QA 2AZMA 2R6ZA 5K6AC 3B48A 4ZAGA 2P4SA 2QIOA 5E2AA 2P3SA 1NVBA 1Z75A 3DZJA 4HDSB 4KYVA 3JZIA 5AI6A 5AW9A 1T1EA 1SH7A 4V2IA 3LLUA 4RPKA 1OB5A 3FHLA 3IEUA 3KCNA 4PY2A 5LM3A 4P31A 2WD7B 4G0NA 1DO0A 3U2QA 1ORRA 3KLOA 5K45A 3K0HA 4IKEA 1E2BA 5BNFA 3WLSA 1JEAA 3UICA 1NUPA 1EQAA 3LDUA 4I6EA 3H87A 3X2EA 1DDOA 3QLVC 2NSHA 3MHTA 2NU9A 5T57A 1RC1A 4FFNA 4RA9A 2R3SA 3B38A 1CUXA 3HVIA 1UIRA 3U1TA 1PT6A 1VMEA 3KKMA 2REOA 3PICA 4S1OA 4YWHA 5JCOA 1BE0A 2ZIVB 3JTEA 3SNHA 3UT5A 4F6CA 4DKJA 5L6LB 10MHA 4UU1A 4R71A 1IULA 2GTHA 1KDZA 5F7ZA 3OAAA 4Q9AA 4KWCA 4NOJA 2WAXA 2VL7A 3R3UA 4DLSA 1ORTA 4U6QA 4YUAA 2YWJA 5FPTA 2QT1A 3PC4A 2FUCA 3BULA 4L02A 3K2IA 4BUCA 3ZY3A 5CBPA 1TPZA 1JDTA 3AW9A 1LA2A 1P0MA 3DMRA 4TV8F 4U2FA 5G1NA 5TJHA 1MD9A 1M2VB 2ZB2A 3CB4A 3EY9A 1A76A 1E8NA 4WDRA 3IQXA 2TECE 4Y9TA 1XCJA 2DHRA 1JFVA 3RRXA 1RWMA 1KJNA 3KHUA 5D3MB 1WXFA 1THZA 3GCDA 3DV0B 2CNWD 3IOEA 3T61A 3WLQA 5AT1A 3LY9A 3H7AA 3ZGYA 1IEWA 2YWCA 2QVZX 3G2IA 4KBGA 2Q4EA 3T6KA 1LTKA 2CFRA 1Y48E 1KYXA 4M8SA 2RB4A 4JITA 4IX9A 4A4DA 4Q05A 2WIKA 2GEUA 4DCOA 5IJWA 5GJWC 1ZJJA 4KR7A 2OAQ1 2VJMB 1C2TA 1E0SA 1Y80A 1Q1QA 2PS0A 4A7PA 1JEYB 2C5SA 1C30A 2B4TO 1VHJA 3MMXA 2WYWA 3ACBA 5A5EA 3P96A 1GEEA 1IY8A 1X19A 4HNAA 1WPQA 1T2EA 1TECE 4G4GA 2G9QA 2FV8A 3ZGNA 3CSSA 3ZPXA 1EVJA 1JJBA 1QJCA 3ADOA 3L46A 4PSVA 3V8BA 4EW3A 9LDBA 4KOEC 1ZM7A 1CFZA 4Q1FA 2APJA 1DARA 2Z1NA 2IVZA 2QN9A 3ETDA 3PB3A 2V7UA 2UUPA 2YJTD 3QVOA 5AHRA 3RFXA 4B3TB 3EEYA 1BWRA 3CUVA 2FZ4A 2LDBA 5JXWA 4A36A 2ZQZA 3AOGA 2BEUB 3QVGA 2VPWA 5JCPA 3E9RA 3RVPA 1NXTA 1K8RA 4PPGA 1NLFA 4UJ5A 1P7YA 1KJQA 2Q5JA 1X8KA 3PSAA 1I1QB 4FSXA 4UBLA 1VZ3A 2Y2UA 1Q7GA 2QYHA 3GLQA 4K28A 3U3JA 2WF9A 4NIMA 4Y9UA 1R4ZA 3EGVA 4PC7A 1AKMA 1E98A 1NW7A 2O2YA 2O3UA 1U6JA 3N2GB 1ZD1A 4CN9A 4KX3A 5JATA 2HRRA 2LTAA 5DYGA 5M5BA 1MFPA 2GILA 5IJ9B 4O4IF 3HUFA 4ZV9A 5JQGF 4FOOA 1NLZA 1UDBA 2JJ2D 4HMOA 3TIXB 4EY7A 4YJDA 3B7GA 1BOFA 4E1AA 3JU3A 1VPEA 1JJFA 3QELA 1L4NA 5B7NA 1FS5A 1UK9A 1E0JA 2IC5A 1QPZA 1UAYA 4RJ2A 1C9KA 1USVA 3C3PA 3EVBA 3X44A 1HL3A 1QKKA 2Z95A 1PTKA 4FDUA 4L9RA 1JNXX 2CXXA 2W6ID 3G0OA 4OGWA 1H4TA 5JPIA 5AJHA 1YH3A 2OB1A 5HIIA 3FD8A 3OFND 1HFEL 1V6SA 2BFCA 3NH9A 5CR9A 5A4MS 3ANTA 4XRGA 1MNAA 2WA1A 1VDZA 3P0FA 4B6GA 2HW8A 4M8LA 1JHQA 2C04A 3VKHA 2FEPA 2C2XA 1MRSA 1R88A 2F9LA 3GL9A 3KOWA 3OHSX 4QECA 1KQFA 2KHZA 3NJ8A 3RU2A 1R8XA 4ZVLA 4E09A 5K3AA 4MV5A 3FNGA 3W6PA 1G8SA 1OYYA 3INNA 3U31A 4F97A 1EUYA 1SD5A 3DV2A 4W4TA 1HEUA 1SKQA 4LCJA 3JYPA 2R5NA 3MGCA 3BRWD 2I03A 2W2PA 2JLYA 3DOCA 3CPHA 2FWMX 1DAGA 1NIPA 2AJLI 5EPOA 3PC8C 4BNJA 1TA9A 5B7PA 3ZDAA 2H7YA 4G8DA 1QH1B 3S0JA 5K01A 1PLJA 2COEA 3ADBA 1W6RA 3EGDB 4P2GA 4LG1A 5IKMA 3MRSA 3SFTA 4GR9A 1J8FA 1LBSA 1XNGA 1ZNYA 2H4ZA 1ZMOA 3DQPA 3UMFA 2V7GA 1YD7A 3LQFA 1PT9A 2QY6A 3UFBA 5CFLA 2E5WA 3KQLA 1KR2A 1VGRA 1A2KC 2BI8A 3DBLA 4GP9A 2DETA 4BMOB 4MKZA 3LUFA 4WL0A 1DX6A 2C9ZA 1ACMA 1E1KA 1GV1A 1YE5A 3BORA 4RMIA 4RQTA 3VPSA 4EUFA 4YACA 4KQFA 5CVJA 4ZDIA 3M6IA 2AHOA 5HRCA 3QX7A 3ZHZA 1JR6A 4RTPA 1XLTA 1WDTA 1RLTA 3R0QA 4OHYA 1EFVB 5K1ZA 1S8FA 1EE1A 2HREA 3NHWA 4UXIA 4DXAA 4MV0A 1IB0A 5AI9A 1Z2DA 4URZR 2NZWA 3F6RA 4GMKA 4X91A 3SF8B 2R62A 4KODA 4JJFA 5LQDA 3L79A 4OOFA 4RACA 4F9GA 4RANA 4D7AA 1CE8B 3ASYA 1AHHA 1N57A 3EG5A 3O1LA 4EYSA 2JFYA 3EZ6A 3A1SA 1VRVA 1RZVA 1XQ1A 3ZI4A 1CYEA 1O9BA 2O2JA 1C4WA 1U2QA 2QV0A 4X90A 4D6XA 1IY1A 1JKJA 1OI7A 3DKRA 3OMWA 4Q9DA 5KWJA 2JCGA 2UXCB 1ZH8A 5FADA 5AOVA 4DNOA 4PGMA 4G5HA 2HGSA 2J30A 1EJ2A 3OSZA 2VA8A 1AK2A 1RI5A 3L6OO 3FOBA 3O8NA 1E6CA 4KACA 2NU7A 2X1HA 4DRYA 4G65A 2C4NA 3SKVA 5F12A 2ZR9A 3CWZA 3RVRA 3G1WA 3ZGOA 2F3PA 2YMPA 1RRCA 2NTYC 5FNVA 1WA5A 1XDGA 3VZCA 3DUWA 3PDUA 2WUEA 3LVQE 4G0PA 2HUPA 2BKUA 2H8KA 3H5TA 2XECA 3L07A 4HYTA 1HNXB 2CNDA 4MKIA 4CM5A 1K6IA 2Z2JA 4NBKA 4LDQA 5CFZA 1C0IA 2E37A 2I2WA 2OORA 3SS7X 3OQBA 4GI1A 4JC4A 5ALHA 2H0QA 3W9BA 2MSCB 3UGJA 1E64A 1H9BA 2YQ5A 2D06A 2FR1A 3ZI7A 2F64A 3O74A 2UYCA 1M5RA 4IZHA 4M7OA 3BN3A 4OTZA 1YB5A 7REQA 3JQGB 4GW3A 2ZVQX 2WIAA 4Q4CA 4D0SA 2DQZA 4ZVNA 2DYKA 4K87A 2WJWA 4FDAA 1CNMA 4X8MA 3OHMA 1QX3A 1FNCA 1OFVA 2GPYA 3LIPA 3MBIA 3D6TB 4WZBA 1IHYA 2PWYA 1JQJC 2FLVA 3F9RA 5E7JA 3T5DA 2X40A 3W7AA 1YTLA 4E14A 3HBNA 3TLYA 4MGHA 4JCCA 5AVZA 4DC1A 4DCCA 5MFZA 2GZ1A 2CHEA 4HPJB 4OYYA 3DE1X 1P1BA 4G1BA 2N0SA 4YECA 5TVGA 2NUTB 3WGVA 4EF5A 4J9UE 1YBMA 4TS9A 1F3LA 1PUIA 3QEMB 1ZCFA 4LSZA 3MAJA 1JHOA 4I6GA 4ZCLA 1YZLA 1JT2A 3WIOA 2GBIA 3TLBA 2F9FA 5EL0A 5KYNA 3CJTA 5C34B 5B2EA 4KK4A 1BE1A 4WWHA 1NLYA 1O6GA 3GB9A 3BK1A 4RYLA 3S2EA 4A27A 2IEDA 4CFSA 1TTTA 3W04A 1YBHA 4J90A 3N0XA 3H5AA 2DU8A 1C9YA 4X45A 1SVKA 3LOPA 1M6VA 3SGLA 4H6PA 4HMPA 1PJBA 4EDHA 3LCRA 5IU6A 3LRTA 1AKYA 4R68A 3TX6A 5HX7A 1H3EA 1BMDA 1KI4A 1MVLA 3JQCA 4XGRA 1FLVA 3LF1A 4UJ3A 2ZRQA 1XRNA 2XKKA 2XGJA 1G2QA 3ASUA 5B1EA 5CCBA 1X7DA 3HJFA 1YQUA 2H7CA 1PWEA 4RK4A 1JBQA 3L0DA 4ARUA 3C74A 2C0PA 1JYFA 3KYCB 3IQFA 4K3UA 3GJZA 4BEBA 2QVGA 3ANMA 2ZYVX 4PBTA 4RHFA 4TVSA 4EKYA 4EP1A 3NTLA 2NAFA 4J0KA 4MVJF 4JI3B 1SBHA 1DPFA 1RWBA 1SHZA 3H7IA 5LYYA 3BWXA 3OA2A 3V4ZA 1E2QA 2X3YA 3S2IA 5K6AA 2AIRA 5GY7A 3Q7QA 1WUKS 3L4EA 1QIFA 1IU9A 4WV3A 3VNRA 1XTZA 2QRNA 1QDLB 2RH9B 2AYZA 3D8SA 3H2YA 5KMGB 5D85A 1VE7A 3L7YA 1ZR4A 1EGMB 3Q7TA 4DSNA 3SYRA 4CPDA 3WB1A 1T9CA 1OXBB 2J3DA 2I80A 4BL5A 2GXSA 5DHFA 4AO6A 4LGVA 1B6GA 4QJ3A 1QRRA 3N8NA 3QLVA 3WTCA 1ZIDA 1KZ1A 4G1FA 3ADKA 2IZ5A 2JI8A 3C5VA 5HRUA 1AB5A 1S2OA 3K8ZA 4I19A 4OHRA 4OSEA 4RXUA 4WNYA 3SE7A 1MRNA 5E0OA 3MAAC 1QYRA 5A71A 4HTFB 5BURA 2BBWA 3L84A 1EFPA 4D0NA 1JLSA 1JVSA 2FPWA 4RNCA 3L6CA 1ML4A 1NNEA 3K6SB 5T3YA 1Z4KA 1T9DA 1V1RA 2PO5A 3MUNA 4NBVA 5F5NA 3UG6A 3WFIA 1KTIA 4JIMA 3CNOA 1TAHA 4WMLA 3UW3A 2OESA 4DA8A 3DDOA 5B5SA 5LOVA 4QUDA 2VDKB 5CT9A 2XD9A 2ZBFA 2XT6A 4QRDA 3WL7A 3QWFA 3VYUB 3ZCUA 5ADWA 2NU8B 3ICWA 3BB3A 2PZFA 2OZKA 4I4CA 1RD4A 4AZ3B 3LXUX 3O4JA 4BFLA 2FUNB 5FWNA 4IOKA 1YWGO 4IIBA 4UTZA 5ALGA 3A4NA 2NMVA 2EEZA 2DLCX 1YDMA 4GBED 5CPBA 3P9QA 3RRMA 5JZSA 2WM3A 4PG4A 4A73A 4E2YA 1H5UA 1E1NA 1X7XA 3QEKA 2F48A 1J39A 1Z47A 4DIUA 1JW9B 1S3FA 1KU6A 3NDJA 3ODGA 4H35A 1Z17A 3FVTA 4GZMA 1UBNA 4JYCA 4CF4A 1QP7A 4CQNA 3IT2A 4TT3A 1J90A 2AXQA 2OGTA 5LQSA 3QFHA 2JK0A 2JI9A 3DDCA 3RSFA 1YVDA 5B7QA 4GSYA 4XARA 5F2KA 5T4HA 4Q3OA 4YY3B 2JKZA 5TGDA 1O03A 2KB0A 1DV2A 2VJYA 3C6MA 1YIDA 5EE5B 1YB1A 4ZEOA 5IM5A 3TR0A 4F11A 1F8YA 4IG4A 2XI4A 3WZMA 1JHUA 5TJ9A 3MG9A 4UUNA 3UK1A 2QZSA 1N5IA 2EYUA 4HDSA 3K9FC 3O9MA 5IULC 3N2YA 2EVWX 3FTCA 3LUDA 2AVNA 3NEYA 4JOQA 1D0VA 1Z6YA 2Q9BA 3S29A 3PEUA 5DTQA 1R3UA 2IXBA 2VYFA 3EF0A 2XMBA 2WD7A 3I12A 3QU9A 2NNLD 4FP9A 4IKPA 3UXEA 3A36A 3OP4A 1ND5A 3GAFA 3IVCA 4GNKA 4HFNA 4GZ3A 2WT9A 2GFQA 2FW6A 3FOAA 1E6UA 1X8XA 3HG7A 4NXMB 1TTHA 3TLKA 2K4MA 4O2AB 2VUIB 4X41A 3AHCA 2FZ5A 1MO6A 4PHGA 1BA3A 3ROEA 4PO9A 4QOEA 1C8BA 1J70A 1UJNA 2QMYA 3H04A 1SY7A 5AR1A 1J25A 2X8AA 2ZBDA 1H5QA 3IAAA 1EXDA 1DBQA 4DY4A 4Q3BA 1XZCA 4EI9A 3I58A 1GRQA 4N7BA 1OBFO 4JU8A 2FQQA 5T4FA 2ZIAA 3SY8A 3CBGA 5DNWA 1R8SA 2XDYA 2WSMA 1B00A 1YJ5A 3ABSB 3LX6A 2CF5A 3LKZA 4OMUA 3PHLA 4TM7A 1IM2A 5BQ5A 1HA3A 4AJHA 5L4NA 5F52A 1G9XA 2A3RA 2JAPA 1KGDA 1M9NA 3DC2A 1M2VA 4KDRA 5FTWA 1LBHA 2PEZA 1ORIA 4DLVA 5FT9A 5D5HA 2ZB3A 2RBGA 1MPTA 1XZAA 2R84A 2V59A 5D3MA 5KDDA 4C3ZA 4BFCA 5E7MA 3OU7A 2PX6A 3DV0A 2PUHA 4FE7A 5A9RA 5KDOA 1PP4A 2GAIA 1QQ6A 3OD1A 1E6MA 3KL2A 1DEHA 2BWJA 2JLAA 1IRXA 4NLLA 5FWXB 5TLSA 4EAAA 3KZCA 1JXOA 3ZWQA 4U9HS 3NBMA 5K3DA 1AUQA 3F97A 4UD6A 2EP5A 1CK4A 5DSXA 2X0FA 4CG0A 2W6ZA 2Q8NA 4U7JA 2KE5A 3PC8A 3Q9NA 5AKJA 2VJMA 5F5LA 3BXXA 1TZ2A 3DHNA 4BRZA 5L6MB 1Q0QA 4YMUA 1JEYA 4OP2A 1UIMA 1XNRB 4MYHA 1B2LA 1GUZA 2FUEA 1IM5A 2HHJA 2IHTA 4TKZA 5JCJA 3FI9A 5EJ8A 2VDPB 4KXFB 2ODEA 3OPMA 1D8TA 3L92A 3TQIA 1ENYA 1TTPB 4DLRA 3KFLA 5JBNA 3QTBA 4ZJZA 3UKDA 3BCHA 4LE2A 5IXJA 2QNBA 5JS6A 1E0AA 2B8EA 3UTDA 1H69A 3GWZA 5HS6A 2O0KA 3B60A 2BEUA 2JAUA 3WBBA 4CIBA 1IXZA 1SXJB 2PX8A 4HH0A 1RAAA 3RS5A 1ZA1A 4Z4FA 1BJKA 1X7YB 4BGEA 3C5EA 5D86A 4PYRA 2XT0A 3F6CA 4OEHA 4CV0A 1DT5A 1KP3A 3NFRA 2RGRA 2Q41A 2VF2A 2RG1A 1EWYA 2H4XA 1J2YA 5B1SA 3N2GA 4P22A 4UEQA 3RS3A 3GEIA 1FIUA 1TW2A 5DYIA 1ONPA 3V80A 2XUFA 3DTVD 2FHPA 4MHTA 5KO2A 5IJ9A 4AP5A 4E08A 3NHAA 4EUKA 1Z5NA 2QRUA 3EW9A 1MF7A 2P78A 5E4YA 3X1DA 1WDWB 4JSYA 1CVIA 2J85A 3L5OA 5F3WB 4NULA 1H3NA 5EJEA 5JAOA 2ZBQA 4XM0A 2CL0X 1BMFD 1I0ZA 1PQPA 1N1GA 1QCZA 3ORYA 2IXFA 4M7RA 4P7GA 3GJTA 3ZZ1A 5IC4A 1M1YE 2WDZA 4K3VA 5SY9A 2ZRKA 3QBTA 2BFAA 4DVGA 3E2MA 2MSLA 4YHBA 3CVXA 3RT9A 3U3RA 2WJ3A 4LY6A 1WB5A 2CBXA 4G5OA 4R2HA 3G82C 3ZDCA 1ZK0A 1HUQA 1ZVKA 1XVVA 3JY6A 3NM4A 3KAQA 3PRYA 4JBGA 4URUR 3U9TA 3FNQA 1LX7A 4EA7A 4L76A 3IUMA 4F0JA 2PYIA 2CSXA 1DLIA 3NALA 2QQ0A 5TQ2B 5K8VA 2JGAA 2ZETA 5AIAA 2ZUFA 2Q07A 4P0TA 3EULA 4YQEA 3UF0A 3VBEA 2EFYA 3WDLA 3GY0A 1KRWA 1L3IA 3T52A 4NCAA 5JNTA 1NRXA 3KVVA 1XLWA 4W99A 4ASUA 4BATA 2I34A 2P9TA 1P6QA 2I3GA 2YWFA 3KUDA 5CDFA 1N0WA 4BO6A 1P73A 2WU1A 3P2MA 4WRRA 4CLDA 3M33A 1G59A 1R5BA 3I9MA 5KHAA 1B43A 1QH1A 3WYAA 3TLZA 4MWGA 2BR5A 1E63A 5JXGA 1J09A 5LBIA 3RGWS 3EGDA 1A4XA 3PZRA 5ECWA 3TNYA 4V0LA 4AZ0B 4A2CA 1CYDA 4JLNA 4C3UA 3I4FA 3K5PA 4XPIB 4C87A 2CYBA 1U2DC 1V95A 3J81A 4LFCB 1QFSA 1OLUB 5AW6A 3A9WA 2XTNA 1M7GA 2R8ZA 2AGVA 2XSZD 4Z99A 3W77A 4LAFA 4DMGA 1M34B 2PUTA 3A1FA 1IMOA 3USZA 3DE7X 4K8RB 3D3NA 4JR1A 4YAKA 1H05A 4DZTA 1BE6A 1KQNA 3AI2A 1D2EA 3OEHD 3H6KA 1NPDA 1Y1RA 4FFOA 1P5JA 1ZBDA 5HKAA 4DSOA 1EFVA 1L5VA 4GSKA 1TEZA 1L7OA 1W5BA 2AWNA 5JSHA 3HM2A 5ALDA 2HLHA 1VI2A 3SF8A 1SOUA 3MD9A 4OHVA 1D09A 4GQBA 1NP6A 2R1VB 3OTIA 3WZ2A 4QT4A 3ROQA 1CE8A 2RHGB 4E1VA 2IP1A 2ERCA 3D2LA 3GFPA 3S27A 2FQXA 1KPGA 1Q3HA 4E5MA 4LHVA 4KNWA 4NAVA 5CP8A 1J06A 3NNDA 4D80A 2ZYAA 3IAUA 3T12A 4QJ5A 2EBUA 3NBFA 4XVHA 2PL9A 4CFZA 2RAVA 3ZWCA 5DHPA 5C8YB 1KXZA 4JASB 3NP7A 1FDUA 3DNMA 3IH5A 2N1BA 1PW7A 4UULA 2JBHA 3AYZB 3O8OB 1Z5WA 3LQ1A 5DBIA 2ILTA 1NQUA 3GK3A 5J59A 1XMIA 2XNKA 3SN6A 3BT7A 5EY5B 1QVZA 3BMQB 1G8AA 2GRAA 4IH1A 1AJEA 4PYJA 1QJ4A 2I76A 1RBYA 5HQ3B 4YN3A 1SCJA 4CLEA 5J2UB 4UNRA 2FFJA 2HV8A 1YL6A 1N34B 4W5HA 1DJLA 1Q15A 1VE3A 3I1JA 3LFHA 5FTJA 4Q7QA 1DIRA 1GZ4A 2VPXA 1GDHA 1A5ZA 1CC1S 1MPXA 3MJCA 1U63A 2DR0A 2H17A 1T10A 3OCZA 5F77A 4EPYA 2W93A 2EDAA 4JAVC 3ZW9A 2B2CA 1CKEA 1G63A 1O2DA 1ZVQA 2PT7A 2Z58A 1VOTA 1OIWA 3N2ZB 3J7TA 2PXXA 2FSUA 2Y0CA 2HRDA 4XYEA 1S8AA 1P62B 5IW8A 5C18A 3QX3A 4JGIA 1NT2A 1C7EA 2IYFA 1B76A 2QAGB 2VT7A 3JQGA 3K9LA 3N0RA 4RQAA 4Q9KA 1K88A 5ALYA 3TO5A 4WBSA 1V11B 3A0UA 3V7FA 4DKXA 1RPNA 1KYIA 1UBHS 4N6NA 4HNVA 5CG1A 2H4WA 5KYXB 2W43A 1GGVA 3OJWA 3GBPA 4Q66C 5TMEA 1U5BB 4JYBA 1FDIA 1N4AA 3UK2A 2AHRA 4LOIA 1P0CA 3H4MA 4QUHA 4XAQA 5FBHA 2NYRA 2OV2A 3PJRA 4L7QA 1KEZA 1PJCA 4V0KA 1ZD2P 1RI4A 2CXTA 1BCSB 2YASA 2XUHA 5IVDA 4UM8B 3IJ5A 1HDEA 3PUIA 2NUTA 2GNOA 3QOYA 2ORWA 3C7AA 3QEMA 4NATA 4NKRA 1WHSB 2C9BA 2BGGA 4DJTA 2R2AA 5CX4A 5G41A 3WK5A 5BN5B 2NX2A 1D3AA 2Y27A 4D92A 5ER9A 4C4XA 4NJMB 1Y5IA 4I4LA 1E2UA 2GF9A 2LBPA 1LKZA 1ZXBA 1RYNA 2H11A 2OVFA 1IY9A 2QP9X 2D2EA 2XMDA 3IUBA 4JJ6A 4HX9A 3R5KA 5A2QA 3GRRA 2QX4A 4HJRA 3O83A 4KO8A 2BY4A 3MJVA 2Q21A 3L0CA 4PX2A 4WCVA 2C61A 4Y2RA 4U7GA 5C37A 1YB4A 2D4AA 4LY3A 4PC2A 1DKNA 1PUXA 1XU7A 4OGGA 4G9EA 1SKBA 1P7VA 3UJPA 4YLGA 1B6TA 4BLVA 3MYRA 1WUTA 4U6NA 1RHQA 1PK9A 2OOKA 1QO0A 5C9ZA 3E23A 3LBHA 1NTOA 2C8JA 2TMDA 4QASA 1JDVA 3MJSA 3KYCA 1F51E 1L6RA 4PQFA 4OYHA 4L5AA 4RXTA 4Z2YA 5DB4A 5COBA 3DMGA 1SKUA 1S89A 3AY6A 3OJEA 4FC6A 3A10A 2I1QA 2YR0A 5BPHA 4RY0A 1SU6A 3RC9A 4LWOA 3H3JA 4MS3B 4PE5B 5E4JA 5U9CA 3ZJUA 2VSXA 3ABRB 2MHCA 4QWWA 4AX8A 4CG3A 4GXNA 2PWBA 3BFVA 2PGDA 1JTFA 5LIRA 2VZ8A 4B6PA 1FMLA 1ZISA 4G89A 5DHTA 4BO4A 1ZQ1A 1HLDA 2QTVB 5KMGA 1OQAA 3VZRA 3OIVA 1FRFS 5FPHA 1H6AA 1XVLA 1IVNA 1KNXA 3PFFA 4RHUA 2H1IA 5AI0A 2WD8A 3NTOA 1RI3A 1D4AA 5JRZA 1NN0A 1F7VA 2QAGC 2D5LA 1YZTA 2AW3A 1IRIA 1VA4A 4NICA 1X38A 3B3AA 3VAYA 3RSLA 3HR7A 4DPKA 1KY5A 3FYHA 1OAOC 2CXSA 1UUFA 1E1YA 1KVQA 3UWKA 2XKAA 1DCKA 4ECEA 3ZS9A 1LDNA 1TZJA 3LBNA 1I2BA 1QAMA 1QFXA 4TKMA 5DM70 5K0TA 4EFMA 4HTFA 2FPPB 3TBHA 4B3MB 1JKFA 1Z06A 2BMDA 3K6SA 3P5BA 4EG7A 2GA9A 4JLUA 1WDKA 1A9TA 3RUEA 3EZLA 1UKEA 1R1DA 1KEWA 4M1SA 4UHKA 1I6KA 1WNFA 5JH7B 2WHPB 2J0VA 3H9UA 4JJZA 2YY6A 4MQMA 5BY2A 1RRMA 2NU8A 1TLLA 2WFLB 1M5UA 1QIIA 1QYIA 4B3IA 3I1FA 3DCYA 4EG1A 4NZMA 3GP3A 4H7FA 2IPXA 1JMKC 4II7A 4AZ3A 3VI3B 3UBMA 2GZ2A 4ER6A 2ZM6B 4DIMA 2AUTA 4PTLA 2DEUA 3GUHA 4LZPA 2VTVA 1U8UA 4IEEA 2WJIA 2GHRA 3SYMA 1UXJA 2Y1LA 2V3VA 4MW9A 4U6SA 3U16A 1UFRA 3K5WA 2QW8A 4V39A 3FHJA 2NG1A 1MX3A 3W78A 1NQWA 3ZJTA 1RS0A 1PR5A 3AZOA 4GXQA 4MEBA 2OCPA 1YRYE 3LHKA 5EEGA 1VJTA 4L27A 3VC7A 1DCMA 4AY3A 3KYIB 4HUJA 1E6EA 1LV7A 3H5RA 4A91A 4I1VA 1PGJA 1UMKA 1AUVA 2ORIA 1CQJB 1XZIA 3EY4A 1CJVC 4JXJA 4CQMB 2AEEA 2ZSDA 4H3VA 3PUVA 4HAXA 4RU1A 421PA 3CUEF 3A4MA 4B48A 2VP0A 3L7NA 2W00A 3RV3A 3OPNA 5ENDA 2NO6A 1GN9A 1Y8CA 2E49A 3A9VA 4IGEA 4KQHA 2PRIA 4IIEA 4Q37A 3WKBA 2R6GA 2V7VA 4JJIA 3DVRX 2ZIUB 1CY8A 3EIFA 4DMUB 1SKAA 4DBLC 3KT3A 4FB5A 4FQ8A 2AMFA 3QEBZ 4FFBB 4ER5A 5ICCA 5ICSA 1CY4A 3VNUA 2H2IA 1L5ZA 1I3NA 3NYRA 4YALA 3KB6A 4DUYB 4RDIA 5CM9C 1O58A 1X39A 4RY9A 5IPFA 1VSVA 2FGKA