3S3TA

Universal stress protein uspa from lactobacillus plantarum
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
145
structure length
145
Chain Sequence
NARYTNILVPVDSSDAAQAAFTEAVNIAQRHQANLTALYVVDDSAYHTPALDPVLSELLDAEAAHAKDAMRQRQQFVATTSAPNLKTEISYGIPKHTIEDYAKQHPEIDLIVLGATGTNSPHRVAVGSTTSYVVDHAPCNVIVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleotide-binding protein, universal stress protein UspA fa
publication title Universal stress protein UspA from Lactobacillus plantarum.
rcsb
source organism Lactobacillus plantarum
molecule tags Chaperone
total genus 50
structure length 145
sequence length 145
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00582 Usp Universal stress protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3s3tA00
1NYLA 4DDKA 3MLBA 5TGTA 3Q4GA 5J5AA 4MUIA 3MMXA 1FYDA 4ZCTA 3QE4A 1N2BA 3RK1A 4U63A 3CLUC 4JZYA 3ZXIA 5K0SA 1B6TA 2D5BA 1T9GR 1OD6A 2Z08A 3UK2A 1WY5A 4PBTA 1TQ8A 1WXFA 3SZGA 1N2EA 3KT6A 2JAXA 1O94D 4XFDA 4ZT6A 4FZJA 4PY2A 2RD2A 3JXEA 3G5AA 4EFKA 5KWVA 2PZBA 1QQTA 1EFVB 2G36A 3K32A 1M8PA 5J59A 3TZLA 1WZ2A 1J1UA 3VRHA 2AKEA 4ARCA 5FNZA 1VBMA 1IHOA 3KT8A 4K03A 3H97A 1JZQA 1SURA 3PXUA 1N2JA 4G6ZA 3DLAA 1VLHA 4MVXA 1IH8A 3K9WA 4MW5A 1JILA 2EL7A 2E89A 3G59A 3HFJA 4DNXA 1NUTA 1N2GA 2E0IA 4G5YA 2IJGX 4MUNA 1XNHA 1MJHA 3UC5A 3VU8A 1V47A 2OQ2A 5H7XA 4MWBA 4JYZA 1Q19A 5DB4A 1WQ4A 1T6YA 1NURA 4MUJA 1JECA 2PXHA 3IUEA 4MWCA 1CT9A 2X0KA 3LOQA 2H2AA 3A2KA 4EG5A 2CYAA 2CV2A 1O6BA 1U3CA 1U3DA 3UY4A 1H1TA 3MLAA 4QBTA 5H16A 1N75A 1OWPA 1H3EA 5TEWA 2J5BA 4NAUA 4EG3A 1OBCA 2PZAA 3CR8A 3N05A 3IMCA 1PFUA 2YXNA 3KT0A 4MVWA 3TQOA 4A91A 2IELA 2AG6A 4F4HA 4H3SA 3RK0A 3X1KA 1EXDA 4MW0A 4MW2A 1IFXA 3CVXA 3C8ZA 5BNZA 4NDAA 4ZT2A 5EKDA 1PFVA 1IQ0A 1O97D 4XSVA 1V8FA 1IQUA 3FOCA 4JXZA 3ILVA 1JZSA 3FHJA 4QREA 3KFLA 1KH3A 3FNRA 2X3FA 1QTQA 5F23A 3COVA 1TYDE 1O96B 5HUJA 4MW4A 1TYBE 3ND6A 1QJCA 4KR9A 2RE8A 2I1LA 4L2IB 1MAWA 3ELBA 3IVCA 1ZJWA 3E27A 1ZH6A 1M1ZA 1WXHA 4BWVA 3RBAA 3ZJTA 1M8GA 4YBRA 1X8XA 1F7VA 5LM3A 2CT8A 5DASA 2EJCA 1G8HA 1N2HA 1O96A 1D2RA 1KH2A 3ISJA 1YIAA 2NZ2A 4L2IA 2QUHA 3D6VA 1YUMA 1PFWA 4WNYA 3ND5A 3CLRD 3QTBA 3KT3A 2B7LA 1KAQA 5K0TA 2A84A 1N2IA 1QRUA 1H3NA 1KAMA 3IOBA 4EG4A 1ILEA 1N78A 1QRSA 3LCJA 1U7XA 3P52A 3BL5A 3DV2A 1GN8A 1JHDA 1VL2A 1Y42X 1RQGA 4OJMX 1Q15A 3SEQA 4U8HA 3NV7A 4R2LA 3UMVA 1KR2A 4EG1A 1GZUA 3RHSA 3AG5A 4J75A 4KR6A 1KQPA 3FH0A 5HUHA 3FG9A 1J70A 1XJQA 3CLTC 4HJXA 4KKVA 2CSXA 3COZA 2WQ7A 4EG7A 5LLTA 4JXXA 1NZJA 2ZP1A 1M83A 1X6VA 1DNPA 2IP1A 4RUKA 1MBZA 1WJGA 1O95C 1I6KA 1G8FA 4I6GA 1NUQA 1NSYA 1EFVA 4MVYA 1I2DA 4NATA 2DPLA 2J09A 1EUQA 2DUMA 4J76A 1J09A 3TNJA 3SYTA 1MB9A 2HZ7A 1QNFA 4U7JA 1XNGA 4MWEA 1T6XA 1MAUA 4YP5A 3PNVA 1OWNA 1GAXA 2AZXA 4EF6A 2A1TR 2BYTA 4MQ6A 4GU5A 2J08A 1KH1A 1N1DA 2V0GA 3CVYA 4OUDB 1JIIA 4R0NA 4ZT7A 1XNJA 3FI0A 4MW1A 4I6JA 2WB2A 4ZCSA 3ZXSA 3RJZA 1O94C 5IJXA 5FO1A 1NUPA 3FY4A 3AIIA 3MUEA 3P0JA 1UFVA 1YULA 1LI5A 4JFAA 3X1JA 1MOPA 4DDMA 1JIJA 3ZJUA 1ZH0A 1N3LA 1WXEA 1TYCA 1PG2A 1G59A 2WSIA 4OUDA 3P0IA 3CLSD 1EE1A 3HGMA 2V0CA 3QTTA 3SDBA 2H29A 1O5TA 1G8GA 3LE8A 2XRYA 2QUJA 1WQ3A 4YMIA 1M8JA 1F9AA 1TFUA 1MC1A 2A86A 3HZRA 1H3FA 2QUKA 5JBNA 1MRZA 3NBKA 2HGZA 3HV0A 4HK4A 1PG0A 1P7PA 4MW9A 1M8FA 1ZUNA 2QJOA 1A8HA 1R6XA 3CLUD 3NBAA 2QTRA 4DE5A 2BTEA 1JIKA 1JMVA 2OV4A 1S4MA 2PFSA 4G5FA 4NZPA 3IMEA 2YWBA 2CUZA 4ZT3A 4ZCQA 4EG8A 1K4KA 1KQNA 1J20A 1EFPB 2A4MA 3DPIA 3L93A 2QTMA 3TS1A 5TEVA 1PFYA 3OP1A 1WKBA 2QTNA 4DLPA 3CVVA 1LI7A 2GKSA 4ZT4A 4XFJA 1K92A 1TEZA 2DXIA 4KPUB 2ZUFA 4K0RA 4ND6A 4MUFA 4UZFA 2WQ6A 3M5WA 1O97C 4ND7A 3G6KA 3COYA 3CVUA 2CFOA 1OWOA 3H9CA 3FIUA 4AQ7A 1Q77A 4MW7A 4YP6A 4DDHA 2R5WA 2NSYA 1R6UA 4KPUA 1T6ZA 1O0BA 4UZEA 2VTBB 2D13A 1GLNA 1TYAE 2DR2A 2X1MA 2JA2A 3U1VA 3SP1A 1WXIA 1I6LA 1KORA 3DO8A 1QU2A 4CT0A 4HPWA 3A05A 3N8HA 1GPMA 1YIDA 1OWMA 3GMIA 1N2OA 4MUEA 2CYBA 5AHWA 4GRIA 1HYBA 3S3TA 3CVWA 2VTBA 2DEUA 2J07A 5TS2A 3GLVA 3UOWA 3IMGA 1KP2A 4E1AA 3CLRC 3COWA 2QJTA 1JEDA 4EG6A 2O8VA 1R6TA 2A7XA 3P0HA 5LFAA 1EUYA 1NUUA 4AS1A 1BS2A 1M8KA 3MXTA 4I6EA 1T9GS 1IRXA 1QU3A 3A4IA 5KCMA 1MB2A 4QRDA 3X1MA 1GTRA 2HMAA 4MVCA 2J4DA 3ZUGA 3L92A 1NUSA 4ZCPA 3SZ3A 1K4MA 3FETA 4F3RA 3PNBA 5IHXA 3AG6A 2GOYA 4MWDA 4NX2A 1F4LA 3HMQA 2E21A 4ARIA 3PNYA 3FWKA 3VGJA 1LW7A 3AFHA 1KP3A 4S1OA 2X1LA 4ZT5A 2DERA 2CYCA 3AL0C 3IDFA 2PIDA 2O5RA 4MULA 2QUIA 3I05A 4WSOA 2D54A 3ND7A 1J21A 1FFYA 2ZUEA 3IUBA 4DJAA 2GM3A 3PRHA 2C5SA 4TS1A 3A04A 1J1ZA 3CA8A 4HJRA 3FDXA 1QRTA 2XRZA 1VBKA 1COZA 1K97A 3IOCA 4MUHA 4R2MA 1N77A 3IH5A 1YI8A 3D6UA 2Z09A 2A1UB 3TZEA 2A1TS 3H99A 3Q10A 4PBSA 3RFFA 1I6MA 2E18A 3IVXA 4MLPA 2CV0A 1WOYA 1JGTA 2VXOA 1Q11A 3GUZA 3N9IA 5DK4A 1OWLA 4NAHA 1F7UA 3IOEA 4ZCRA 4MUGA 2YWCA 4X0EA 1U7DA 5FO0A 1YUNA 3INNA 2PZ8A 4PBRA 1ULHA 5HG0A 4MAFA 4Q16A 4KR7A 2A1UA 2PG3A 1O0CA 3ZJVA 2A88A 1VBNA 4CDMA 2TS1A 4MW6A 3SEZA 4YP7A 4MUKA 5DEOA 2QJFA 5KHAA 3OTWA 5J58A 3H05A 1GTSA 3ZIUA 1NP7A 3CLTD 1KQOA 4RPIA 2DLCX 4EGAA 1KKUA 2DETA 3IVGA 1IQRA 3IODA 3Q12A 1EFPA 3CLSC 4CQNA 2CV1A 1WXGA 4CDNA 1JEEA 1O95D 1OBHA 2JANA 3F3MA 1NI5A 1U0BB 2YY5A 3N2YA 3TQIA 1EJ2A 1IVSA 3HL4A 3ZGZA 4P2BA 2Z3VA 3AKZA 3H9BA 4Q93A
chains in the Genus database with same CATH superfamily
1E7RA 1GVNB 1O6FA 1XF1A 4J0CA 1JVSA 4PIVA 5K2OA 3WYGA 5A4IS 1FFBA 1ONOA 5K3BA 4DG9A 1FQWA 2QAGA 3LECA 1P8AA 5IRCD 1U1DA 3OCUA 4MUIA 5BSTA 3OUTA 3V7WA 4BO3A 4K8RB 3BKWA 1V4BA 2BDTA 1TMGE 4K6KA 4J3NA 2DFPA 4D3DA 4C4TA 2F64A 5K0LA 5ESWA 1DQPA 1CQXA 5JAUA 2NXEA 4H4DA 1TM5E 2BBWA 4C0XA 2OCAA 1WD5A 1EMDA 3I01M 3ECCA 1O9BA 1NVWQ 5EZYA 5A9SA 4IX9A 1J33A 1F5SA 4NI5A 1Y8CA 4PY2A 2RH4A 2VHWA 4TLAA 1E6LA 2AB0A 2VQDA 4BMOB 5HM6A 1TO2E 1V9LA 2RHCA 1TAQA 1VLVA 2J67A 1WLSA 2PZBA 1VSTA 1P4HA 2DQ4A 4HWTA 4YIKA 1QVWA 2X6RA 1VCMA 1ZMBA 3RGWS 5ICCA 3T1HB 3FE2A 2RG7A 2B92A 4RIIA 4TMXA 5CCDA 2IEBA 3MWDB 2FAXA 3OX4A 1H8ED 1WU7A 1F8GA 4BJ6A 2O8NA 4ZVSA 4ZEOA 5A71A 3VDXA 3DLAA 1A9XB 2BGGA 5AK5A 3K9WA 4UD2A 4EB8A 2EL7A 2V8OA 4K9QA 4PS0A 2YUIA 1M2FA 4G5YA 4IDAA 3RG2A 1XNHA 1XCJA 2HT6A 4LJSA 1V47A 2I4OA 3SM3A 2PSFA 1GY8A 2ZBGA 3H4VA 4J1TC 3SFZA 4CBVA 1OGYA 2A14A 5IJWA 3X2EA 2H1OA 1PZHA 1CEXA 2XCLA 3V55A 1WQ4A 3NRJA 6GPBA 1NJ8A 4NV3A 1T6YA 2HCFA 4H16A 2OVBA 4HRYA 3HSSA 5EMMA 4TN5A 3Q5GA 3ZHXA 2VBCA 1NVAA 1T36A 4YJHB 1IZ9A 1DWPA 3PS9A 2PSJA 3L4EA 4GR9A 5JCJA 4BFTA 5KKNB 4MUFA 2UDPA 5KYKA 1E9VA 5GV8A 1RMQA 1SCQA 3VR6A 5LCXA 2HUNA 3OA2A 2TYSB 1NC1A 1GA1A 1J2JA 4KW7A 3F6CA 4OG2A 1OWPA 3EXIA 1DPGA 4GMKA 3LW8A 3QEAZ 4YONB 3OTIA 3L06A 3G8AA 4M9QA 4PG4A 1OBCA 5FBRB 4D3FA 4D45A 3B6IA 1VYVA 3JR3A 3DZCA 1PFUA 1QANA 3ZHZA 3GDOA 4TKMA 5J43A 2IYUA 4WXRA 1F20A 2YFHA 1Z5OA 3NHRA 3U4DA 4Q21A 4ZRMA 1PVVA 2O52A 3STWA 2IYZA 2JASA 1ZGBA 3HHPA 4FPXA 1A7UA 1K9VF 2D62A 2R1VB 2WKRA 3K8OE 5KSOA 2O8BA 3T9DA 4JLBA 1QGYA 4RJ2A 1I51A 4MPTA 1VL8A 3S7TA 5A03A 3L8HA 3CU5A 2CEAA 1EDZA 3B6JA 5KSPA 3LOUA 3CVJA 3WLMA 1V2GA 3EPKA 1XDZA 2O3SA 2P8JA 2DHCA 2WPDD 2XKJE 4HG2A 3PLAE 3FHJA 3C5HA 3ZDZB 5AW5A 1PL8A 1QIHA 3OFNA 4WAUA 3OT1B 3IT3A 1QBKC 1FQKA 3B85A 1Q1QA 1U0JA 1QS0B 1GCOA 1DFHA 3PXEA 4LYAA 4YCCA 5KIAA 3QFRA 2R1UA 3SM9A 4F4IA 2F55A 2E4XA 4DLYA 4KVFA 1WUJS 2YHBA 2OILA 3MHTA 4OMCA 4RESA 1VG1A 2QRQA 2R44A 3IEMA 2HPHA 3I1IA 4A0HA 3E9RA 4DPKA 4AU1A 4O33A 3NOXA 4BFUA 4KREA 1OCEA 2HK7A 4YXFA 4CMCA 5B4TA 5BSUA 4RGBA 3TNFA 4ZQIA 4MDEA 3B9PA 1O87A 5CAEB 2NO4A 2JI7A 2Q5QA 2WWWA 5GQSA 4MV0A 2H3EA 3OX2A 1NN0A 3NHJA 1RQ7A 1WM1A 4DV6B 1QTRA 4YNBA 4Z1MA 4WNYA 3UQYS 3ZQKA 4JB0A 5I45A 3GLFA 1B8OA 3CZAA 2LDBA 4R7GA 2FUNB 1NQAO 1FNSA 3HZZA 4NCKA 4HAIA 3RFXA 4BMXA 1XK7A 1K7SN 2J6HA 3A6JA 3FRJA 4WEQA 3TCKA 4BFZA 3ACCA 3MAAC 1G21B 2EBUA 2R11A 2QTFA 1NT2A 4NP6A 4ZVTA 4RY2A 1U7XA 4IIJB 1A5ZA 4J9VA 5GONB 2AR9A 5BV1A 1DBVO 2DY1A 4IW3B 4H7KA 4J94A 4WBSA 4BB9A 3VVCA 4PTZA 4R4JA 1Q6YA 1Z39A 2RCYA 1MABA 1PS9A 2VG8A 3LVBA 4BE4A 5H9WA 2P65A 4X62B 1J0EA 3G49A 5AHKA 4FINA 5KTTA 3DW1X 4BLOA 3SMVA 2IGTA 4EUHA 2OZEA 3BCUA 3BXGA 1E1CB 2C9DA 4LK2A 5F73A 1TM2A 2W2OA 1JALA 5FP0A 4LF9B 3BIFA 4ZWNA 3FDZA 3JASB 3K4PA 4EFDA 3OCVA 3IRVA 1E9FA 3CIOA 3DO5A 5ALIA 3WHLA 4HWSA 1S2GA 4IIJF 1SZPA 3H5VA 5GONF 3ZI4A 2C0PA 2ZM5A 1NBAA 1MA0A 3MJVA 1RAFA 2Z2JA 2ZIGA 4LTMA 4EG7A 1XU4A 621PA 3ICPA 4OBXA 4DWWA 1B1CA 3TAHA 4ZZ1A 1DNPA 4B81A 1WJGA 1TM1E 3ZD7A 4IWXA 1GGEA 3ZZ0A 3O95A 5FA5A 3HEBA 4JJKA 2JDID 5FORA 1BCSB 2VTKA 1DAMA 1LDMA 3LWBA 1NQUA 1E79D 1CUXA 2MR6A 2O0HA 3ONEA 5AJUA 3ENWA 3IAXA 1H05A 3DZBA 1IDOA 2PV7A 1PEDA 4MLZA 4PFSA 2OKCA 4P86A 3INYA 4RQTA 3G9ZA 4IFIA 1M76A 4ATNA 5LP1A 1SVWA 3FOEC 2EATA 4ZQHA 4PYLA 3AERA 1XMSA 1MP0A 4LOAA 4AF8A 4ZJYA 3B52X 4BN5A 4NV0A 1NNUA 1PKXA 4HZUB 4I55B 1CFZA 2K2WA 1PJ4A 4FU0A 3VHQA 3ZTTA 1OAOC 2HPVA 5JAIA 1E0KA 3PL1A 2CLHB 1EK0A 3GYBA 3FTDA 1SA0A 4ZGGA 4LGCA 1V96A 2OE2A 1Z0KA 3A4TA 1EUDA 3D9QX 2PMEA 5K6TA 3PUXA 5YASA 1BD4A 3TL3A 1MJ5A 3ANLA 4MHOA 1C8VB 1UADA 3KKZA 4RF5A 1VJ1A 4A8JC 2WVJA 3NDPA 4GX1A 1FP6A 3AJ9A 2VJBA 3G0BA 3KXIA 1D5CA 3T1NA 4I55F 3IHKA 3I04A 4YRNA 4URFA 4GUDA 3B1ZA 3BIOA 1S1MA 1AMNA 1DJNA 1NG1A 2Z9DA 3QLEA 4MS1A 3IBTA 4F1KA 4A73A 2BL4A 2TMKA 5D51S 5DHPA 5FWXA 2ZVDA 2JGIA 1XD9A 2DFNA 4MGHA 5KYVA 4CM8A 1ZRHA 2QP3A 1JQDA 3EZXA 3GA7A 2HV9A 3RLIA 1O95A 3QV2A 4CKCA 3R6DA 4N49A 1XTRA 2V0CA 3KTDA 4GP6A 4WNAA 3PU6A 2I3ZA 4A7PA 2NZJA 3BERA 1PCXA 2JJQA 3K73O 5H8WA 1TAUA 1YI0A 1AQ6A 2FRDC 1WKCA 5A1TA 2ZBFA 2BEWA 3W6OA 2I03A 5AM0A 1JQ5A 1L1FA 2NN3C 2PSEA 4GXRA 1YDMA 2DFVA 1EEHA 3ANXA 4TLMB 2Q3JA 5F4BA 3HDQA 4FTWA 3R7WA 1NL3A 1TFUA 1T0HB 3E7WA 1P80A 1FXWA 3LGSA 4HH1A 3U7EB 1HG1A 1T5LA 3O82A 1RAAA 3R5SA 4X3PA 5CVVA 5AJVB 1Q1AA 4O4JA 3HCOA 3NT5A 1SJ9A 4F1JA 4LISA 1GJRA 4QOIA 5HBRA 1RWNA 1ST2A 5JCJD 1FMTA 2YV3A 3EE6A 5GGYA 3HFGA 2E4WA 2JZNA 4BVKA 3SQDA 5SYMA 4KLAA 3VR6D 2YOGA 3T54A 4M0LA 4HWKA 2VFAA 1G8KA 3QMVA 1NXTA 4EJFA 3LYHA 2GSWA 4S2UA 3DPIA 3L93A 3S2UA 1WVGA 8ABPA 2JKYA 3JR7A 4B83A 1UFOA 1ZC4A 3FNGA 5TEVA 2VDJA 1A9TA 2X2PA 4Z0HO 1XRLA 2GXUA 2O05A 4CI9A 3HACA 1YI1A 2Z8YA 2GN4A 1W73A 3L77A 2RIPA 4HNAB 1PHRA 5CRIA 1XEFA 3DE3X 4ZT4A 3OT4A 3PGA1 4BJ5A 4IH4A 1WPXA 4D4HA 1JJBA 4K88A 4Q7JB 1Q50A 2GEKA 4N5IX 2EP7A 3KCNA 1QVAA 5E4JA 1QCCA 3U81A 3RHTA 1G8AA 1YV9A 3SJZA 5ITVA 1UBRS 4F86A 1L0BA 2Q50A 5AVUA 1ID8A 5HCUA 2AFHB 1OWOA 5BNFA 4FQ7A 1JEJA 1MHPA 5JO9A 4G4IA 4IZ6A 1FLDA 2WJIA 5A4DA 1P1FA 4GBED 3OFND 3LX6A 1XZAA 2NU6A 2DBZA 3DQPA 4BNNA 1Z3IX 3I64A 1G9TA 3WLFA 4HDRA 3AIKA 3ZVKA 2ESRA 4OTZA 1TJ5A 4ZOAA 4PNPA 5IBRA 3GJQA 1Q21A 2QGZA 1M7HA 4MRAA 1EFLA 1QO7A 4EUEA 3RYHB 4AZVA 2BKUA 4IFEA 4E09A 2Q6OA 1HE1C 3EXG2 3IHLA 3MD9A 2HB6A 1U0RA 1EGQA 1XGKA 2X7XA 1B4DA 1SQGA 1OWMA 2CMDA 2WE7A 2C7GA 2CLOB 4HLUC 2JFVA 1IATA 4KNVA 3BN3A 3ULKA 3JV7A 3BMCB 5IABA 4JKIA 3M5CA 3BTOA 3HU3A 3PXDA 4IGAA 3ZHBA 3ESBA 3ZIAA 3KQQA 3L41A 4RSRA 4Z1MD 4ARUA 1KO4A 4J6EA 1CIJA 2JLXA 3WOHA 2CNLA 3WB0A 4WE3A 3RS9A 2YS6A 4U2GA 5EG5A 3ZDXB 1NPTO 4KVAA 3AW8A 4DR1B 5MN4A 5KHOC 3M7IA 4CIVA 2VSYA 1UZLA 3EW9A 2NO9A 4QNMA 3EF1A 4MV5A 3T4EA 7GPBA 5AK4A 2I8AA 4DY4A 5EA2A 4AG5A 3IGFA 2F17A 4DCGA 2G0AA 3E3AA 1CJUC 4OYLA 4TXMA 3ETGA 3MWEB 4RBNA 4DR4B 1ZM9A 3KG2A 1PT7A 3D43A 4ND2A 2I91A 2YBEA 3K0BA 2OAGA 3IQXA 3EK2A 1ZCFA 3WLQA 4KBGA 3M1AA 3CHYA 2B4AA 4HO1X 2CF6A 2HF7A 3SLGA 3AI7A 3FUTA 2UKDA 3ILSA 2GYWA 3O9MA 4KFCA 1EFKA 3CMCO 2RARA 3EVTA 2K87A 1KY3A 3G0OA 1U63A 3IDFA 4ZJPA 1CJVC 4GG1A 2FSIA 5AJZA 1WABA 4I1YA 4ID9A 5DCWA 5BV2P 3STYA 5BQPA 4I5GA 4P81A 4X92A 3BRWA 1KMNA 3BB1A 3WV5A 2C54A 2GF9A 2WHXA 4CM4B 1AOXA 1E92A 2VDPB 2W4QA 1NGSA 2WY2D 4EEZA 5B3JC 5HJ5A 4BGIA 2PXAA 1K2WA 2UZ3A 3MCAA 1K5GA 5I51A 4HGZA 2WIFA 5G0WA 1W34A 4E11A 3OEYA 1H9BA 3EGCA 1W47A 3W6ZA 3GZTB 2QYSA 3J80A 4U2EA 4JN6B 4KIUA 3QQ5A 3LJKA 2QUAA 5DYYA 1IUKA 5DEIA 4OB6A 1V2HE 5FOVA 3S1AA 2ZR8A 1M6NA 3J7AC 4YRRA 1V6AA 1QC5A 2AFHE 2VDWB 3GA5A 2DRIA 3QPWA 5LZ7A 3C74A 3U3KA 4EO4A 1OFGA 4MUMA 1YBHA 2VXOA 3FMPB 3LBIA 4TV9B 3FAZA 3V1NA 4YRGA 4HN4B 1XLUA 4HXYA 1LW6E 4PAWA 4WOKA 2E5FA 3CE9A 1OXSC 2AN1A 4QUHA 4XX1A 1U9CA 4URVR 1E6WA 1KVUA 3A9RA 4RH1A 4ERNA 1ULHA 4Q16A 3OIUA 2IY9A 1TMOA 1JNYA 4BFSA 4CM9A 3VZBA 2YMMA 4XKJA 1G18A 2YFKA 3OJXA 4Z8XA 4P4TA 3IBCA 4DA6A 4NHEA 1L7DA 1YBAA 5FPHA 1OV4A 4ZFNA 2VK4A 3HJFA 2JH3A 3T06B 3PVSA 3WY9A 4YH1A 1Y0BA 1A9OA 1GRCA 1YQWA 3U6BA 3E58A 4ZZ2A 1QH8B 4TV9F 2A5FA 1KQOA 4RPIA 4P7BA 3NHFA 4UUNA 2DLCX 4EK9A 1XTKA 3CFYA 1X7WB 5K2MA 3ML1A 4C3ZA 3UHAA 3TKYA 1F8UA 3Q12A 5EHXA 5LBUA 2LE0A 3GPLA 3CLSC 4MI9A 4DXHA 3QI2A 3D5QA 4PYMA 1M33A 1O95D 1JHMA 1OYVA 4UBMA 4HDQB 4MQ4A 2G76A 1IN6A 4KDCA 1JXQA 4OFXA 3SU8A 1BHQ1 4AECA 3LYLA 2XBUA 3GARA 2G1UA 2UXDB 2FZCA 4JI8B 2ZS8A 3MSCA 4RDXA 2BUAA 1CZKA 2CHFA 2BE7A 3ECAA 4KQMA 4NYMR 4M8NE 3I5AA 4XJSA 1GSHA 1XDWA 4NCBA 3WK4A 2E4UA 1Z7YA 1FU7A 2FUG1 1XROA 1Q0SA 1RAIA 1D6NA 3G0CA 3NWPA 4TXJA 4E14A 1FFDA 4IXWA 5A1JA 2W6MA 1CDEA 3DKVA 2OLKA 4TMVA 4F2HA 2EZTA 4H15A 1J6UA 3GRZA 1DINA 3H9EO 2KYRA 1E18A 1CRWG 3GJ3A 1GQSA 5SY9A 5T6MA 3KJFA 3W8EA 1WRBA 4B3XA 5IYZB 4FHCA 2PVPA 4YAGA 4QUJA 1CJTC 2QVLA 4OEHA 4RACA 4Y6SA 2XUGA 1X1SA 1WY5A 4NULA 1HDGO 1HORA 1OIXA 3HN2A 4HADA 1XTUA 1TQ8A 4R2JA 2FMTA 3NKLA 3SXUB 1WZNA 4X44A 4Q34A 2GUGA 2VNJA 4D8YA 5HFJA 5KSWB 1NSTA 1DBPA 1PZNA 2H07A 3BD7A 3HL0A 3NKVA 3VTAA 5C1OA 4P3YA 4AFNA 3LQ4A 3OTQA 4K1XA 2AJ8A 4B6QA 3GBSA 1LXCA 2WE8A 5U1PA 4OX9Y 2G36A 4DABA 5KYNA 3D4PA 5H59A 1KDRA 4Y7DA 1EVEA 1HMPA 3IOMA 3NIWA 1E2MA 1TK9A 3LBNA 4IXMA 2XLBA 2G9ZA 5IYZF 5AM3A 3R6WA 3KSZO 2HSZA 4N5HX 3IQIX 3TTWA 5EFOA 4QICA 5LDGA 3E9DA 4KJXA 4B7CA 2BFEA 1LUAA 3A4VA 3PXUA 2HCRA 2RGNA 3BZWA 3RYCA 1KYXA 1CRQA 3UG7A 1CS4C 4MRVA 4FJ0A 3G17A 5G4KB 2QE7D 1KFKB 3DEJA 4UEWA 1CJKC 4RLSA 3ZQ4A 4YRIA 1XLVA 2BP7B 2ZI5A 1N36B 2O59A 5TMEA 2O2CA 3G2LA 4WLEA 4MWBA 2QRJA 1PJLA 5KJFA 2CFSA 5IVKA 2WHEA 2YN0A 4TKVA 5TS3A 4HYYA 3RVJA 3RPEA 4JGGA 3IPLA 4KXQA 4YJ2A 1D2GA 1L5KA 3NWBA 5BSGA 1ZPDA 1YJBA 1EU1A 3HXOA 2XYRA 3TR0A 2V0NA 2X0KA 3AYXB 3LOQA 3Q5EA 4AZSA 3N8NA 4DM3A 3OF3A 5HMLA 5ITSA 1PW7A 1O6BA 1U3DA 5AVTA 1LDGA 4L07A 5DM2A 4MQFA 2YHIB 3NPAA 1AS2A 4TX1A 4E4RA 4LQ4A 2IODA 4K9SA 3IV9A 3Q2IA 1U2EA 4Z99A 2WT8A 4CJXA 1XQXA 1P1JA 3DUFA 3KQTA 4OLBA 1JLRA 1E3IA 2JS7A 2C88A 3TLYA 2HT1A 4EKEA 1DJPA 1LEHA 1M7BA 2OO3A 3E7PA 2XVYA 3HDGA 3ZIAD 3EA5A 5A6SB 4ZOBA 3VX3A 5I9NA 3ESAA 4RCVA 5DGTA 3H3XA 1C30B 4WZAE 2AEFA 2ZK7A 4MW0A 4DR6B 2HDNB 2XRFA 3PNMA 3CVXA 2ZSUA 5BNZA 4NJMA 1USVA 4GP9A 5JSZB 2PVCA 5I7RA 2DB3A 4D9MA 5CD9A 5IAAA 3FUUA 3RNLA 4EZIA 4MWZA 1O97D 4KV7A 2ZDHA 2R60A 1JLKA 3D1LA 4UNNA 3FOCA 3FFAA 2CZCA 2WBLC 2FHSA 3NW9A 3JALB 1X19A 3GQVA 1E6UA 2B1JA 2OO5A 5L7TA 2K5UA 2X3FA 3EX7C 2EBFX 3K53A 4U9UA 3LG2A 1UEXC 1NHGA 4QAJA 3DFKA 4MHSA 1Z7WA 3FHCB 3DT9A 3I0MA 4MCIA 3KQWA 4OQFA 2VWHA 1SVKA 3UT0A 4EHNA 1N3BA 1X38A 1X77A 1IBMB 1V4NA 2QVXX 3U3ZA 4EJSA 3ODPA 1VIVA 1XRJA 1Y9ZA 5FPPA 4ZV7A 4TTSA 2H4XA 3VYVA 2G5TA 2EHDA 2R84A 3OZWA 2P68A 4QOGA 4JP5A 3RBAA 2I1QA 3SSAA 2VH1A 1EK5A 3N39C 4FX5A 4YCSA 2ANCA 4EB6A 2EBWA 4HH0A 4FFRA 1TYEB 1QXSA 2E6UX 3BRWD 3QI7A 5DNUA 2UUAB 4E70A 1UZMA 1S4QA 4M76B 4NZOA 3OY7A 2BFFB 3P27A 3V8NA 2Q4BA 4LYEA 2J7PA 3P20A 3K0CC 4OI4A 1YS7A 4GKJB 1P4RA 4JVLA 2JLBA 2CCKA 2I71A 4B9AA 3FWNA 4PO1A 3WIEA 4V0SA 1KAQA 3DV9A 4DARA 4I5EA 3PXXA 3BWDD 3ETCA 1USKA 4UNRA 3M4JA 4FFDA 4PC6A 1H9CA 3PC6A 2B21A 5C5EA 5IZCC 5ECWA 3DG9A 4EPWA 1NQVA 1QG6A 5D85A 5BQ5A 4ZO7A 1R6VA 2Q5FA 4I2VA 4LZOA 3MZ0A 4S1PA 5HFAA 2WD9A 2PKRA 5BRAA 2PRYA 2YJNA 1ZC3A 3K0FB 3NOQA 3TUIC 1KZYC 3SEQA 3V4PB 1E1YA 1U4SA 3S5JA 3AONB 1O9GA 2PA3A 4MEAA 1KPIA 4H7JA 1F60A 4NAVA 4ZO6A 5AVKA 2I7CA 2D2VA 2OCIA 3UMVA 4CM9D 2CLDX 4P58A 4WXPA 4UJ3A 1SXJA 2F9MA 3WKAA 2PGIA 3MJRA 4ZEVA 3L1VA 4QLOA 3IXMA 4KXYA 4KRFA 4LXQA 1J70A 2E55A 5T64A 2XVMA 3V2HA 1Z7GA 2OKGA 3A6KA 4C1BA 3NI2A 3T3NA 3HRHA 2C8LA 2D74A 2O1XA 1YGPA 4O0MA 3IAEA 4D02A 5IDXA 3KR9A 3KWFA 3WQSB 2F6RA 4B6SA 2WC1A 1J23A 1NZJA 1UPBA 4TM7A 1WL8A 1VJ5A 4HBGA 1IPHA 1HYQA 4IVNA 3JYQA 3SYKA 3VPCA 4EI9A 5AM2A 4KGZA 3C1TA 3WIVA 3ZU6A 1UT6A 3RVRA 4HQLA 4KTVE 4EKIA 4MVYA 5JV5A 1U2PA 3RROA 3WLIA 4OQLA 4BLQA 4AZ0A 3ZGXA 2O9JA 1SRRA 4F2WA 1J09A 3AR6A 3GMSA 3PTAA 2DHEA 3NT4A 5EYPB 4TGLA 3JTEA 3ZD6A 4X60A 3UVEA 3O8QB 7YASA 2G8NA 5EIWA 2YASA 2YWXA 2PUBA 2F3PA 4M1YA 4Y2YA 1L5ZA 1RE1A 3A9CA 4PX9A 3F5DA 1T5BA 2K4MA 3SHWA 3HY6A 4OHCA 3RANA 1O54A 3RJTA 2GBGA 4I7EA 2GNOA 1R2QA 4JCOA 1GZ6A 4YY3B 1OI4A 2B98A 2FVXA 1DEKA 4RGVA 1RZUA 1E2FA 3OJEA 2FPIB 1CRZA 5TV2A 1Y3HA 2IV2X 1WA5A 3P32A 3QLUC 1T2NA 4JT4A 3KAKA 2XVAA 3L0IB 4ZT7A 1E7QA 1FMLA 1I0LA 1Z5ZA 1Z2EA 2EERA 2BGTA 1RKXA 1B16A 1ZCAA 2Y3IA 2HIHA 1GZ3A 5FO1A 1TKRA 2BJWA 1NUPA 4GOKA 5JNVA 2QVGA 4CN9A 2VPQA 3K0AB 4EJMA 4R51A 3MILA 2WKQA 1JXAA 5BN3B 1V45E 2H8KA 2MSKA 4L51A 5KAMA 4KE8A 1E9AA 1C1XA 3DOCA 1PG2A 3G82C 3GT7A 2YMQA 2WAXA 2ZSDA 2G63A 4N3CA 4CE6A 1NBMA 2J7KA 3IE2A 1VG0B 3PUJA 3WL5A 4IG9A 3NJRA 1H0HA 1QOPB 4BC0A 1IHXA 3L43A 1GUDA 5GJBA 1FX0A 4URWR 3DOOA 5I5GA 3AGPA 3O47A 4XYLA 2ZWVA 3FWPA 3R8FA 4MVJM 4N76A 1OI3A 5J23A 1YZYA 1O2DA 2H0QA 4XCQA 2YZGA 2FPUA 2WYWA 3D0KA 4U6SA 4DUYB 2JIDA 1MC4A 2I3AA 4YMIA 3TF5A 4HAUA 1DT5A 1ZD1A 2OCPA 3DCNA 3DPSA 1N5LA 2F43A 4EG0A 4K2AA 1O7JA 1AB5A 1QIIA 3TTVA 4TRNA 2A9FA 2ZJZA 3NJ8A 4N0PA 1N7JA 1P7ZA 3DMHA 4Y1GA 4MPRA 2PGAA 3VR1A 1R6XA 1PW5A 2GEFA 2ZRAA 1B3RA 1LQ2A 3B7PA 4E5KA 2RKOA 4CFZA 1UM8A 2BI7A 2ZW9A 1II8A 1R15A 4RVSA 2PFSA 1T2CA 4H1VA 2Q7DA 4E22A 5K7SA 2LVBA 3IMEA 1TVMA 3LY5A 4ZT3A 1LF0A 4PYNA 3WLKX 2PMWB 3STHA 5FI1B 2FDRA 5IC5A 1UR5A 1RLIA 1R4NA 3AF0A 1FFCA 4OREX 4H4CA 3OLQA 1KL7A 3O3MB 3DXZA 2WHYA 5CFPA 1V11A 4Y2XA 5JZ9A 3E0XA 4RTPA 4WN9A 1OIVA 1A0OA 1LSOA 1GQYA 3L8CA 4XWKA 3C3DA 4OPMA 1KR5A 1NQOA 2ID8A 4K6HA 2ZSEA 3A4MA 2YFQA 1X42A 1SVIA 1C41A 2DXIA 1SK9A 3VNUA 3VAYA 3H6KA 3HR7A 3DVAA 2PU7A 3NYWA 1KO8A 3EXEB 1MAHA 1RI3A 4JB8A 1ZI6A 1XHLA 4FIDA 3W2HA 3WRXA 3ZKWB 4ND7A 5CXXA 4FDUA 3DTVA 4ZXFA 2DWCA 3TI7A 5K0FA 1K8QA 4E2FA 2ZSIA 3MT0A 1CVIA 4X95A 5K0EA 1T9ZA 3QHAA 4UCFA 5JXHA 4O1IA 4NL4H 2WSYB 2XCQA 4F0JA 1IK6A 3DGEC 5G1NA 2OP0A 4JUAA 2ICAA 4C2TA 2GQ0A 3T6KA 1RYNA 2V5UA 4ZYUA 4MQUA 1N9GB 2DAPA 2CVHA 1LPSA 2BFBA 3BD6A 5F5XA 2XMDA 1N8SA 3SK0A 2AXPA 2BD0A 2CNKA 1FRVA 1GIAA 4CU2A 4EB0A 4K3VA 3EEFA 3BRQA 2VJNA 1J90A 3GPIA 4FT2A 3DV0B 4B7XA 5J2UA 1GTZA 2GD0A 3SQLA 1Q3TA 2OZKA 3GMIA 3IO5A 3TOVA 4AJNA 4KTTE 3S3TA 4BFYA 1MO2A 2A57A 2Z43A 4HB2A 1PZGA 5AW8A 1Y1KE 1WB4A 3PC8A 2J7PD 1A76A 3T95A 1Z4PX 3GJ6A 3UJ6A 4REMA 1ZVKA 3CLRC 2F1RA 5CVCA 1Q1ZA 4P38A 2XF8A 4YLEA 1KP9A 1SB8A 1XALA 2LWIA 2JI6A 3Q72A 4EGFA 1N32B 3TZQA 1G1MA 3I9V1 1N5JA 4GMGA 4N0EA 3ZH9B 1DT3A 4IUCS 4BWYA 3AUKA 3OX3A 1UXHA 2OEPA 1KERA 3GLGA 3SR0A 1BXZA 3RSZA 1Q95A 1B42A 4AY5A 2C95A 3MWGA 4QRDA 2GK3A 2BEUA 3Q0TA 4KXXA 4P4LA 4E2WA 3UV3A 3RSSA 2PWZA 5L3SA 4EJ6A 4JXJA 3F1KA 3RYIB 3L92A 4HQKA 1VLJA 4YPOA 1V1RB 3PCRB 5TT0A 1F8XA 4OSEA 3SZ3A 1K4MA 4K6FA 1H2WA 4YAJA 4Z9AA 3GLTA 5NULA 3DMYA 1PYGA 4C6TB 1P9NA 1SBZA 2GN2A 3IAS6 4TVBA 3D6MA 3EN0A 3MWFA 4ENRA 1SXJD 1Z5WA 2XF2A 1LWOA 3JAWA 2Q2QA 3RJ9A 2O8FA 2ZPAA 4YJFA 3KUDA 2A8YA 1NXXA 2OWEA 5GPBA 5LJLA 1UKVY 1FJ2A 1K3TA 2JGLA 1QH1B 1D2HA 2NTEA 2QUIA 3RSCA 1ZA1A 4LYJA 2LIVA 3F4LA 4WSOA 2D54A 5KJCA 1J21A 3KZVA 1F4VA 2ZYGA 3W1WA 1WVIA 4LXXA 1X1RA 4XSHA 1XAGA 3RVNA 1VMKA 1RPZA 3IUQA 3NHZA 1J24A 3NBZC 1XB2A 2OP1A 4TS1A 3ZS8A 3U37A 4Q82A 2DPYA 3TB6A 3KOMA 4M1TA 3GRKA 4IJ6A 1QQ5A 2HQOA 4M99A 5E9WA 5LSAA 2J0UA 4TL8A 3TO5A 2F90A 2YHUA 4QYXA 1LY1A 3EVDA 5I4IA 3IH5A 3KXLA 3ADCA 1L9KA 1YHNA 3GP8A 4HDMA 3EPPA 2ZRNA 4JENA 4W5TA 5JAPA 3JZFA 4XB6B 7MHTA 3BWMA 2H5IA 1ORDA 4O4LB 3K31A 4G0QA 5FTNA 9GPBA 3DB1A 1SC4A 4CHGA 2WYVA 3EB9A 1YE8A 4L78A 2D06A 2HXSA 2VP9A 4C0BA 4ER6A 2GAAA 1IY2A 1EJBA 4II3A 3W4IA 1N1MA 3DBLB 4IHAA 1UPFA 1W4ZA 4MIEA 3I01A 5F51A 1A97A 5JSYA 2DCUA 3IAAA 1YXMA 1BGXT 3MS7A 4IIYA 2OBBA 3I30X 4N8EA 3PGMA 4QHSA 3SEZA 3WZLA 5IT0A 3TLGA 3KP1A 5KHAA 3TL2A 3WIBA 2XNSA 4O4LF 3MRVA 1SIOA 3QU5A 3CLTD 4R0VA 4XR9A 2G1PA 4J7XA 1C9EA 1WAMA 1DEHA 1OC2A 2JCSA 3IVGA 4LZNA 1EFPA 3IXLA 4XM2A 3CSSA 1NBMD 4US2R 4QBGB 5KC9A 3ZWNA 3HKCB 3LXXA 2GNAA 2BFNA 2VPYA 3U7JA 2EKPA 4DBZA 4AMYA 1ENOA 1DMSA 1E6MA 3FPKA 3HL4A 2JFBA 1UZAA 2MINB 4FXPA 3KB6A 3O74A 1VJCA 4NFHA 3S8MA 2AOUA 3V3TA 3UAOA 5KOIA 1Y1SA 3VYTB 1W4AA 3OQIB 4UE2A 2Q3DA 4DDKA 2VJCA 5GVRA 5TC4A 2YZNA 3L7CA 5LQAA 4FM9A 6LDHA 5KX5B 3WGLA 1BVRA 4UTXA 4H31A 3QE4A 1YB6A 2CNOA 1W5TA 3C1AA 4H7PA 5GOTA 3RUEA 4I19A 4MYDA 2D5BA 3WP1B 1Y6ZA 1KEVA 3PIRA 3PXBA 2GJ9A 3RUCA 2Z08A 3PUYA 4IS2A 4ENTA 1GZDA 3O2JA 4D42A 4UNSA 5H4GA 2AQ8A 2H5JA 2HMWA 5ALNA 5C8ZA 1YR6A 4RK4A 4IDDA 1A9QA 5TQ2A 2C77A 2QPOA 1ZK0A 1R4ZA 1W88B 4HYQA 3W5AA 4MS4B 3VSAA 5KX5F 3NRBA 3H11A 2RD2A 3GPCA 3JQRA 5ISMA 4GPIB 2ZB4A 1KDPA 1QQTA 1WPRA 2W6JA 2NUPB 3AIOA 3D7MA 1J1UA 4Y9UA 4UVDA 4CF3A 4G5RA 2AKEA 1WEKA 4QPJC 2OZVA 4ZHSA 3MIIA 4XGNA 2FPGB 5I3ZA 4RF2A 4IOJA 5I7FA 1QGUB 2QTTA 2O6HA 4E5YA 2IW1A 1N2JA 3CRZA 4Z4QA 1Z2AA 1JI0A 3WA6A 1RWBA 1QG4A 1AG9A 3WO1A 1GPYA 2E0IA 3F3SA 3OI7A 2IJGX 1BJRE 3D2CA 3KOUA 2OZPA 4JJIA 1C5KA 4L08A 2FK8A 4QUAA 3ZWDA 3QWHA 2UYHA 2PM8A 4GOXA 1ZBQA 1ZOLA 1K4YA 2W2TA 4H4EA 2I7DA 5B64A 4JLDA 1WHTB 4AD8A 2GN9A 4URXR 1V16B 4HYTA 4PO8A 2SECE 3W3AA 1ONSA 3QUTA 4L72A 1ZAKA 4KVZA 2O2YA 1A9XA 2WT4A 1LSSA 5TDHA 4HL6A 1PJZA 4NG4A 1NKSA 1WD7A 4GLOA 3DFUA 3CV3A 3EJ6A 3A2KA 2WICA 4DPLA 2AG8A 1OX4B 2XT0A 2HR1A 4KGDA 1SOWA 2IYYA 1GYQA 1KI8A 5BQFA 1OAAA 1VHJA 2RGXA 2WAOA 4PV7A 5DM70 3S5UA 1RXWA 3LUGA 4PLVA 2EP8A 4CM7A 3MB8A 4JOCA 4TS3A 1IUOA 3AF5A 4OHVA 3WLHA 4NG5A 2ZJOA 4HDKB 4KE7A 4EG3A 4F3KA 4RTQA 2ZBDA 1I24A 1LVUA 3DF7A 4TQ9A 4U4AA 4BMZA 4L9WA 1E77A 1S8NA 3C0KA 2O2XA 1QH9A 2TMDA 4YJHA 3LP8A 1BU8A 3PQ2A 2ENWA 3CUUA 2RSLA 3IV6A 1BVHA 2PQMA 1ZUWA 3Q88A 5HS4A 5LQKA 2G06A 5TQ0A 2FZKA 4EVRA 1CERA 2DG2A 1M1YB 3Q8XB 4E07A 4A1FA 2PTHA 7REQB 2BVNA 3I6YA 3K0KA 4J16C 3DXFA 4N40A 2OPHA 1E7SA 1JHPA 1YL5A 1PR2A 1P73A 3GT3A 3ILVA 4NARA 2CL0X 3GGOA 1CR6A 3CKYA 4RD6A 3TMAA 4P84A 4R98A 2M1ZA 3L4SO 4NQZA 2R1VA 1ODCA 1YONA 3K2IA 1EAYA 3QXXA 4DF3A 2IS6A 1FYXA 4BQPA 1QZUA 1SXGA 2O54A 4KWTA 3LUHA 1OY1A 3ZHCA 4L2IB 3R2JA 4A0FA 5EIFA 2BEJA 1SCUB 5LZ2A 2IH2A 4FYPA 2HAEA 3AV0B 5C7LO 4GLJA 4BVGA 4DOMA 5JWOA 1FUUA 1M8GA 1MB0A 1XQ1A 1UK9A 2CNWD 2P79A 2XUKA 1Z62A 1XQWA 1TOAA 4I08A 3OT1A 2RI1A 1E2HA 5CDUA 5LR6A 4FT4A 4FVTA 4LJYA 4AIRA 1IB6A 5TT1A 5J4VA 3A58B 2QVZX 5GOZA 2P9ZA 2QMHA 2O14A 3D81A 2NADA 3M1YA 3STUA 3LZDA 2AV6A 4OQXA 4F8JA 4XDGA 4RAQA 5FI3A 4ZDWA 5I8PA 2H08A 5IM4A 4ZTZB 4NWIA 4Y1EA 4FW9A 5AI0A 5LP6C 3L9XA 4TMTA 4YJKA 5FBQB 4FOOA 4ADSG 2NT3A 3BHJA 5CAEA 1PV4A 1GXSB 3JSXA 1V5WA 5FTMA 4IXTA 5LZ4A 4OQYA 3QEBZ 2HU5A 5CGQB 1IG3A 2XCUA 1Y9DA 4PFQA 3GOHA 4JFRA 4C1NA 3H1TA 4D1YA 4DA4A 1DP4A 3HYCA 3GEGA 1T15A 4LZWA 2QXTA 3G6WA 3GD5A 3ZV7A 4DMHA 2WHRA 5IPFA 1M5RA 3LIPA 4Y2TA 2VDVE 4JOQA 3AG5A 3I4CA 3L6DA 1T1EA 5H4HA 2RCNA 2HIMA 3OZXA 1G21A 2Q29A 3FG9A 2IPOA 2QPAA 4C7MA 4CV1A 3RFUA 2Q6IA 4IIJA 4UBJA 1QK4A 4ND5A 1HV8A 2X8LA 3SC6A 3H2YA 3SF8B 3V97A 4B31A 3CCCA 1I3MA 3ESZA 4HJXA 2NYUA 3UJHA 1CD5A 2O8CA 1U6KA 3ZCSA 4B6PA 1NW9B 4HYEA 3VU3A 2YICA 2H1WA 2XDYA 2XXAB 1E6KA 3BCRA 1B2RA 1ODLA 1E1CA 2ZE8A 4LJ7A 4DSUA 1FFAA 2EIXA 3F8SA 3GLHE 1X7DA 1T3ZA 3JASA 4OHXA 4QC2A 3G9XA 3IKLA 5HUQA 3FZEA 2VNKA 2GK7A 4RTJA 3QF4B 3L8ZA 4YECA 4YMVA 1GCIA 1Y82A 1EUQA 4QT0A 3R20A 2BDUA 4TL6A 4XUDA 3EGVA 3S8YA 1JG3A 2P9HA 1J97A 4TZKA 1EWYA 1SUPA 3M1IA 1U8AA 3SIWA 4QPCA 1FFGA 3A25A 2C9MA 2ZBVA 4GPEA 1POXA 3HCRA 5KNLA 3K70D 2YJGA 1K8YB 1C3XA 3D8SA 1N2SA 1ORTA 3C6XA 5B1IA 3UK7A 3L0ZA 2CLLB 1DFIA 2GERA 2Y1EA 2ZCUA 1CTQA 3EDCA 1EEXB 5KTKA 3UJCA 3RC7A 2JIPA 5AW9A 1M73E 2PH5A 2GEJA 1ZRMA 4F2DA 3ND9A 2QVBA 4O2AB 2AZXA 1Q3HA 4NFSA 4HEQA 4PVCA 2PLNA 4M83A 2GH1A 2VF7A 3VU0A 4EZEA 2W93A 1Q14A 4OUDB 4F8EA 2Z1DA 2BKLA 3HA5A 4DT1B 1DAPA 1KY2A 1LS6A 1XZJA 2IDZA 3H8VA 3K15A 3QY9A 4HZUA 4I55A 5DLQC 3HJAA 5IJXA 3TLCA 3CINA 3GYGA 1N2ZA 5CFLA 2IFTA 3DFFA 5KQSA 1CRLA 3P0JA 1DKPA 4MARA 2W6JD 3N87A 3TLZA 1MLDA 4QU5A 1LI5A 3UKDA 1L8OA 1SUIA 1AHIA 2P2LA 5ER6A 1CJCA 5HK9A 4YCAA 3PNSA 2ZB8A 2XTAA 3GJ4A 3U19A 3HXMA 1SUSA 4BLVA 2O8EB 1SKAA 2WMDA 2VK2A 4KFSA 5DH9A 4JJFA 1G20B 1I2MA 4M4SA 4IVRA 2C4VA 3T61A 4B85A 1II0A 4TLDA 1XTTA 2AL7A 4MDHA 3S81A 2BCJQ 3TWOA 3CYFA 3UT5B 3VBCA 4RVHA 3IURA 2XOKA 3L0OA 1R9GA 2F59A 3R3SA 4WDRA 3RVPA 5L7WA 2NP6A 1GCGA 3FVTA 3V34A 1RKBA 2WMNB 3G23A 3LDGA 4GM4A 1WQ3A 1QFZA 3H1FA 4QO8A 4GKKB 2VAMA 3C5WP 1EGHA 2I99A 5GM1A 2HGZA 4AJPA 4A36A 4K9KA 1X13A 2H06A 1BMFA 1XOIA 3EOZA 2JLCA 1P0QA 2Y68A 5A4FS 3SHFA 1YRAA 2F1IA 3ROQA 4G86A 2DKOA 3LV8A 1J06A 3EGEA 2IL1A 3D31A 4FBMA 4JB3A 3T4UA 3ZBUA 3RSQA 4ALLA 4CWAA 3QWIA 5HF8A 1N57A 1X3SA 3R5JA 3HO1A 1V1MB 4L8LA 1E0SA 2WAYA 5J2TB 4QXMA 5IC6A 2WMYA 4K0KB 4NZNA 1K4KA 2OPBA 2NPIA 3AY7A 4YI5A 2BHRA 3FZGA 4G0ZA 4GX5A 3SI7A 5K09A 1O94A 1Y4SA 1NW8A 1NR5A 2VDQB 1QTIA 1U11A 1HX7A 4HDAA 3D7KA 4GWKA 4M8LA 2H54A 3O4HA 1UBTS 1RC0A 2BFPA 2X0FA 4B82A 2X23A 1W1WA 3PHCA 3THYB 3PQDA 2FWBA 1NTRA 1UF9A 4NTZA 1GFSA 2OHXA 2ORYA 2QD1A 3SVTA 4KLNA 4M22A 2XZPA 4BQQA 4PX3A 5JY1A 5AOAA 5BW6B 2DFTA 1KXZA 3G13A 5J2TF 1A2KC 1JRLA 2LCQA 2EZUA 5HQTA 2Q6VA 2WQ6A 3F78A 3NP7A 2V54A 3ONVA 4D8WA 2J6IA 4ZOQI 2IUUA 5C4IA 2JCYA 4UMDA 5AH0A 4P35A 3ENKA 4S0XA 2H4YA 4CMGA 1NTOA 4V02A 4PC7A 3BGDA 2BLLA 3FIUA 4FFLA 4HNAA 4MUBA 5EP2A 5L3QB 5A7HA 3AP3A 4MW7A 3CKLA 3FROA 2NSYA 1R6UA 3C4JA 3I52A 3FNQA 1L3CA 2EJBA 5DP1A 4EUFA 1SOMA 4GM1A 4HUQA 3K1TA 4PVDA 4KPFC 2VTBB 2QLNA 3W5VA 1YKFA 3HLTA 5K0NA 1GL3A 2XE7A 5BRJA 2RJ3A 4QTUB 4Q7MB 4NJEB 3MELA 1MO5A 4WK6A 3E3MA 3BTUA 2D0OB 5DM1A 4NOJA 3T7KA 3TSCA 2ZUUA 3NCTA 2IHKA 3KQOA 4G0MA 5BY2A 1UC4B 1ODFA 1TA4A 1MQAA 3ZGYA 2EU8A 3N07A 4X6XA 5AHWA 3OQJA 4ZIRB 4NH4A 2QR2A 1R88A 3K9QO 3B6ZA 2ZCJA 2GZSA 5IJAA 3ZYCA 3NIGB 4GOJA 1E63A 1FTYA 1CS0B 1DADA 2ATXA 2HHAA 3LRPA 4K9PA 3N7AA 4PM4A 3RF7A 3VTKA 3MGGA 4NS4A 3DZKA 3RYHA 4F6RB 4C7VA 1A98A 1G20E 2PN1A 2QS9A 4U39A 4A6XA 4RHEA 2MOKA 5G0SA 5L8VA 3DYIA 3LWZA 3OHMA 2CFCA 4HSGA 4NYIR 4AS1A 3Q7TA 1AH2A 2ZUBA 3NLLA 3Q8KA 3ADDA 2CVZA 4QX6A 4ZYLA 4ZN6A 5ELLA 1NOJA 5F7JA 1IBLB 1QAMA 3FTEA 5BN5A 1IOZA 3A06A 2J48A 3OLWA 4MVCA 3INGA 1G41A 4JSRA 4EF4A 4L22A 3GBVA 3MCTA 1A71A 1P0MA 5I7SA 3U6KA 4XWWA 4BV2A 1INLA 3B3QA 3HXTA 4UHFA 4EJ0A 2CEKA 4Y6GB 2Z8ZA 1GUFA 1FZQA 3IP9A 4J0DA 2AF3C 2YUTA 4FDAA 3ENVA 1B6RA 5CA0A 4RSHA 4NEGA 4RVUA 4CKZA 1SGWA 2ZRJA 3SYLA 1U90A 1YR3A 4ZQEA 3PZBA 3QJYA 3KL2A 3WLPA 5ILQA 5AWFC 3BGIA 4IAOA 1HDXA 1CR1A 3MWEA 2UVDA 3P9NA 3FPLA 1CW2B 4G0VA 1PGQA 5TJHA 5JWHA 1T8TA 2I2BA 4LHYA 3TIIA 1VE5A 4BO2A 2AG1A 5KO2A 2X86A 3VR3A 5E1MA 3F97A 3HU5A 2VJLA 1N0HA 1G2OA 2C5SA 3JQFC 4IZIA 4XWAA 4Y18A 1VPDA 2JL1A 3RCBA 2SICE 4D9JA 2I3GA 3K16A 2GD2A 1Y4ZA 1L7PA 3FPFA 3KWLA 1RKQA 3TIGA 4AKTA 1VMEA 1M6EX 2CXPA 4W7IA 3STVA 3OZTA 4RORA 3S70A 1Z0JA 2KBFA 1XTVA 3K0EA 4RVNA 2ZWIA 1CDZA 1JAIA 2FLVA 2I76A 2QZ9A 3R77A 4PPNA 2AH5A 3RIMA 3AKEA 2XWPA 2X5NA 3Q2KA 4OSPA 5JJBA 2P6OA 2W43A 4JELA 2VKTA 1E7MA 2CE7A 3E05A 2CSUA 4OAOA 4U6NA 3RE1A 1YFKA 2RAFA 5GJWC 2PJRA 3BFPA 1JXOA 3KBBA 5IDVA 1JFFB 2FZEA 3D02A 3QVWA 3HA2A 2PUWA 3FBGA 3Q9SA 2KHZA 3UMSA 4MUGA 3M82A 2HWXA 1O9HA 4FE3A 2MYPA 2VRBA 3C6MA 4NU6A 1JR3E 1ZMXA 2QN1A 4XD7D 2CY0A 2H4WA 1P60A 4EGSA 1CUWA 1IAVA 4Q3AA 3JQ6A 5A0FA 2VDWA 4XVCA 3RUHA 1SEPA 4JS0A 4C0SA 4CDMA 3KSDO 2FP4B 3G1WA 4PWYA 5ADHA 1WULS 3NHAA 3RHZA 3GLQA 3F6EX 2CWWA 4UCQA 5C34B 3O83A 3U26A 1RYFA 3Q11A 5H83A 2FW0A 3FR7A 2C3PA 2OSBA 1XN4A 4E7PA 4HX9A 4EGAA 2DETA 1BO6A 1XMJA 2GLUA 4BQSA 2XA9A 2D8MA 1N6RA 2V9ZA 1DQNA 3A4NA 4X97A 4BLRA 1P29A 2XR1A 4EX7A 4CQNA 1F2DA 3TLXA 2GVNA 3QGMA 2JANA 4KDRA 1JA0A 3GBPA 3E22B 2WWXA 3T7JA 4AVYA 4XCXA 1S1CA 3KSUA 2NXWA 2XOKD 2IS2A 1Y6RA 3LYAA 1FJGB 1QH8A 3T35A 3KSBC 2ECOA 3LPMA 2FPMA 1BN7A 3AXSA 2O1SA 4QJIA 1X7WA 3ZDBA 1RLJA 2Q5EA 2NVOA 1QG0A 4X7BA 4PYIA 3R5FA 2UYOA 3JQ9C 2J41A 4S24A 1MZVA 1MDBA 4RW0A 1BMFD 4WHMA 2Q1TA 1U0FA 2IOHA 1I2AA 5KTRA 2C3MA 4XX0B 1L5NA 3QXSA 2OYRA 4HNUA 2ADOA 2X14A 5ABPA 1XX6A 2EKDA 1MT0A 4W1SA 5AKXA 5K8JB 4QE3A 3K9HA 4EW1A 4MDYA 1MVOA 1FYWA 4EENA 5EGNA 1RWWA 1AM4D 1G291 3B5EA 3B9BA 3N6VA 4A0SA 3KT6A 1RQRA 1IK4A 1U5BB 1UEIA 4LYDA 4P3PA 4PC3A 5CK5A 4E5NA 4C20A 1ATIA 1O94D 2GBFA 2ZSFA 3H87A 4U2DA 1P9WA 4OI2A 1L8XA 1W581 4PANA 3OOWA 4TSFA 3Q1KA 2ZB2A 5B7NA 3AZOA 2WM9B 1VHLA 2DCMA 3K32A 4LSGA 1M8PA 4B0PA 1WZ2A 3E5RA 4PZPA 1E0DA 2CXHA 2EFYA 3LRXA 4PLFA 3WJ7A 5GIOE 1T1JA 1C4XA 3RS7A 4HOYA 5DMHA 5JWRA 1HDEA 1XLWA 2PCLA 2AMLA 3CZMA 3H97A 1KOLA 4Q15A 3SXUA 2QHXA 4BFXA 4G6ZA 3AI2A 1Z9BA 1AY0A 1KYYA 3PQ6A 3QVMA 3NBUA 4TTIA 2ONJA 3UCXA 4O2BB 3F49S 1JILA 3WK7A 3PC2A 4GL4A 4BE9A 1APBA 4PIPA 2V7EA 5C52B 1PJSA 1GDHA 4GOMD 3VO1A 1H4QA 1G6HA 3LPLA 1GPJA 4FDLA 4IIVA 5JPDA 4RDIA 2NQTA 5CM2Z 2VATA 3PEWA 3FCCA 3P2OA 4AXBA 2YYYA 1T5DX 3K1YA 4GEKA 3EUFA 2FXVA 1J99A 3QKTA 4DEYA 2FOXA 1K7XB 3CUTA 1NR1A 1NWHA 1SBHA 1DX6A 1QM5A 5IDYA 2G3YA 3RC3A 4C3OB 5FBLB 2LBPA 3JZAA 1DVRA 4CHTA 1IU9A 3LLVA 1I5EA 4YMSA 1HDZA 1M2KA 1ZD3A 3QXCA 4O2BF 4XYGA 5G4KA 4EG5A 3NTLA 2BP7A 2BRUC 2B4QA 2GCIA 4KFRA 4JUDX 1IM8A 3B51X 1XKLA 1GAQA 2X7JA 3KUUA 4G4SO 1H3EA 4NBVA 2ZYUX 3A9TA 3KR0A 4QGSA 4ZC8A 3F2IA 4WY5A 4JI4B 1E1RA 1FSGA 4QGAA 1T35A 2GDZA 1NI4A 4NAUA 4BJ1A 3CW2A 4I1PA 1EDEA 1O1YA 5COBA 1PGNA 5G1PA 5MFPA 4QFBA 5AQEA 1OUMA 1NBEA 4QUGA 2CJYA 1DJLA 1SZDA 3ILHA 3UF0A 2IVFA 2YHIA 4XI9A 4S04A 1XMPA 5E6UB 3T9BA 2XUIA 3K1AB 3BXOA 1DQZA 3PNQA 2C7QA 2JHGA 5C0OE 1MENA 1G42A 2CXRA 5CPBA 4Z3DA 4TYQA 2BW0A 5K1ZA 2C31A 3MRXA 4UM5A 3FTPA 1GFIA 4IDFA 4N54A 4EQ6B 1L7NA 2QRZA 5HIIA 3A6HA 4JXZA 1QYCA 4FDTA 4W8GA 3VMMA 4CT5A 1ADGA 4M7PA 5C8XA 3OFJA 3QVTA 4IFBA 1C30A 4RU1A 1JDZA 3CT4A 2WTAA 4HXFB 2RGYA 3RVDA 2YWDA 5HGJA 1T8WA 4BIMA 2HMUA 4QVIA 3U4IA 4XVRA 3AM1A 2PXCA 2NV6A 4OKNA 2ZZNA 5JSZA 1XNRB 1HBJA 2Q4TA 1RZRA 3R3WA 4TKLA 2ZJ3A 3KKOA 3N8KA 2Y27A 5T57A 4H7EA 4IGFA 4A92A 4ENVA 3KPUA 3OH8A 1U8UA 1ZJWA 1ZJ6A 2W7TA 5AESA 3CH6A 4OYHA 2MHCA 1XFDA 4BWVA 3JALA 1XEWY 2VPXA 4YQEA 1TUEA 4ZVRA 2CT8A 3D2BA 5M29A 2YJ5A 2AEMA 1TZJA 1X7XB 3L1IA 5AI6A 5EIOA 2Q21A 3GFVA 3WYBA 1OH6A 1KH2A 1G1AA 3P9XA 3TK1A 3PFWO 2BSQA 3TPCA 3VI3B 4PLWA 1K3FA 3QELB 2G7MC 2HGSA 3WYDA 1OHHA 4L5YA 1P2DA 2GRUA 2QUHA 2GCOB 2Q4EA 1IEVA 2WG0A 1NNSA 3FFBA 3QJ5A 1BU5A 3DCIA 4BAUA 5GVSA 2XGOA 1ZK1A 4KAXA 1U3GA 4TWBA 5DIZA 3RHFA 3UZUA 4AWAA 1X1EA 1PGPA 1L5RA 5AJHA 5DHTA 4AN0A 1RNLA 1BE6A 1AO3A 3BWXA 3RBZA 2HK8A 4D0GA 1CUYA 5KYWA 2BFFA 1JG1A 1IHPA 1RQNA 1Y6JA 3CSUA 2VDRB 4QBKA 4D46A 1S3GA 5C32A 3EC2A 3SGLA 4RGQA 3DOIA 3L1HA 1GN8A 3MC1A 3W9SA 4B2PA 1Q20A 1SOAA 2O0JA 4LK3A 1PNQA 3QBVA 3D1JA 2QRGA 4RVOA 5FF9A 5CM8B 2XADA 2EKBA 3EFEA 5LU9A 5IANA 3ZDAA 6NULA 1HE3A 3RH0A 2YNMC 2B0JA 1KR2A 2FUEA 1GZUA 3W78A 2R68A 3X1WA 4EELA 2VJPA 3HKDB 5HTOA 2P67A 1H6BA 3FYUB 1Y9JA 1ZMTA 13PKA 1SXQA 3PWKA 1L4BA 1BA2A 1WUHS 2H00A 3A3OA 4WINA 2ET6A 4E51A 5A4AA 2JLVA 2YX1A 3EISA 3C5VA 3K0FA 3PHJA 1JIXA 4JDUA 2DYKA 1EVQA 2EJVA 2FEPA 3TAUA 4HVAA 4JLNA 4W6ZA 5IK2A 4O6VA 3T4XA 5SZJA 1KGDA 2BGRA 2BZGA 2X5OA 3BAFA 4FEYA 4R68A 4CL0A 4Z49A 5A06A 3DHYA 2B83A 3IA2A 1KETA 4LKRA 1G8FA 2ZE7A 1IBRA 3ZEIA 1G7CA 4ZAVA 1NSYA 4LOIA 2OORA 1I2DA 4CQMB 3JWPA 4N0QA 3D3JA 4MVJA 3W4JA 3EUEA 5CLJA 1OFIA 4Z4EA 5ITZB 1JLHA 4TYMA 1DRUA 4ZJZA 1QK5A 1O03A 2A1IA 1RYDA 2G5PA 3CNBA 3OZSA 4TQGA 3AVWA 1UODA 2QT1A 3VJLA 2YV1A 1RRPA 2WIDA 4I1VA 4RMHA 3QNUA 3W3AH 2JHAA 5CDHA 2OSVA 4E30A 4TZTA 4FLEA 4BU1A 4RL6A 1THGA 3O4JA 2PKQO 1MAUA 1VHWA 3EXHB 1OI2A 1W5EA 3M49A 1PLLA 3QEOA 3UYLA 2Y1OA 4EPYA 4TTAA 1YDGA 4NK4A 2J08A 2JFWA 5EYPA 4ZEWA 1CP3A 3FMFA 4KO2S 3WAKA 1NZDA 3FI0A 2QX4A 3O8QA 5F5NA 2EIHA 2JIRA 4NECA 1P4GA 3KALA 1EK2A 3S2SA 4HC4A 3CRMA 3SG0A 4EA6A 5IFLA 2IBTA 4TSFD 3GFTA 3KYIB 4GC9A 3WAJA 1JVBA 5JEEA 1G5RA 1WOMA 4UC0A 1Z6YA 2ZWMA 5TGDA 1N3LA 3S29A 3ICQB 3UMRA 1AKUA 2OV2A 1S2NA 2Y1KA 3LNCA 3M2PA 3TJRA 1EXMA 4B79A 2H1FA 3UPUA 4B33A 4OH7A 3SBEA 3M9WA 3S8EA 2XAUA 1XVVA 4BLUA 1ADCA 4Z51A 1ENZA 2BCGY 2Z6UA 4IEEA 3K8QA 2OCXA 3TTYA 1YU9A 5KNCH 4GOND 4TS9A 1T29A 3IQWA 2PY6A 4R1QA 3VOTA 5BN3A 5EJ7A 2C99A 4BDTA 2XCRB 2ZJ1A 2BPOA 1WBBA 4LVCA 3GCZA 4JUBA 2HO4A 4OGWA 5IHPA 3HZRA 1A7AA 5JBNA 3RASA 2GCEA 1Y48E 2D7JA 3DYBA 4K5QA 5CBPB 1FJHA 1X15A 3K2QA 1K6MA 1WQ1R 4B4UA 3CEPB 4HQNA 3B7WA 5B2ZA 3VYSB 3R9WA 1PJ8A 5IBPA 1MZPA 3NBAA 1XRMA 2EW1A 3CJRA 1JIUA 2VS1A 3RS2A 1N5OX 4GMFA 1LDYA 3H1GA 3GFPA 4J0KA 1JF8A 4KXWA 3RUFA 2ODQA 2BI4A 4YCNA 1CYEA 4RLQA 2CKDA 4B32A 5EHQA 3HEMA 1JAYA 1OJLA 3FCAA 2I29A 5C1IA 1CJMA 4MCHA 3C8HA 2IY8A 3R5HA 4MWGA 4ZPJA 5HOQA 1E1RD 4C43A 1ZIYA 3DLTA 3AW9A 4PN3A 1N3YA 2XD4A 4HRAA 1RXUA 2M2IA 1X2BA 2R5NA 3H2ZA 1TGVA 3T3GA 1W7AA 2WSSA 4N7MA 1PQ4A 1X92A 3R7FA 3PX2A 4RPGA 3SJBA 3VM6A 2GKSA 3ORHA 4INAA 1W2WB 3MT7A 5EUCA 3OBIA 2OXTA 3ZWPA 4CMIB 3NCHA 1ZGGA 2XODA 4K9OA 5DJ5A 1TTHA 4FEAA 5B58T 3B13B 3RRNA 4HUTA 5ENVA 5HW0A 2ZUFA 2QNIA 2VK8A 3WGOA 1G3RA 2AFIE 2Z2KA 3RVKA 3RVBA 4KQ1A 3LHSA 4TYWA 2Y0EA 4JJ8A 3CS3A 2GS9A 1TU4A 4B46A 1JDUA 2GPNA 1LRKA 4JEIA 2OV1A 2W6CX 2EZ8A 2WVAA 2QZPA 3CRRA 2WWVD 4ZXPA 1CZUA 2WYIA 1DAOA 4L8YA 4QGBA 3TRFA 1TVEA 5LU8A 5LNK6 4V0LA 4C29A 1JG2A 3FOAA 4IQGA 4P34A 2WWHA 4G1VA 2UXCB 5DCYA 2BGKA 1WP9A 3LY7A 1G55A 4WNCA 5E7MA 1O0BA 4A82A 2VWGA 3EXEA 5HK8A 1PU2A 4JWTA 1RZRD 2A3RA 3ZKWA 2XDAA 2WAAA 5DNDA 4RSGA 1GCUA 3ZN2A 3A6GA 1QTNA 3PDWA 2YDYA 1E2NA 4B2LA 1SQ5A 4CLEA 5EJGA 4B87A 5KWSA 2CB9A 1OAKA 4ZZIA 2AVNA 2HSDA 3M81A 2TMYA 2EG9A 4DWVA 2JEOA 1N9GA 1Q7TA 4BB6A 1B6GA 2YL2A 3KZ1E 3TX2A 3LWNA 5EJ6A 3V4FA 3E81A 1OHHD 1Z12A 1DCFA 3KPYA 3WADA 1KP2A 4GLFA 1OF1A 2QTWB 4NMXB 2Y4OA 4QSHA 2ZTHA 2AOVA 3AJEA 1DFGA 3DV0A 1BCRB 4EG6A 2VCHA 4U9IS 3MERA 1K6XA 2JB9A 3A8TA 3WL4A 2DLNA 2NP7A 1IWBB 3ESXA 1LDNA 4ZVOA 3KZNA 4CLRB 1ZJJA 3GVIA 5DX8A 3D7LA 5D7BA 5DO9A 3K5WA 4Q3BA 2LR0A 4JGIA 4L57A 1IJBA 3E7FA 3GJXC 4LRQA 4ZAGA 4XEHA 5ESRA 2YC4C 3BQ9A 3EF0A 3UUWA 3PE3A 2OTCA 5TQVA 5F9MA 2AN9A 4R1SA 2HHJA 3AM4A 3PTZA 4GI7A 4PS1A 1C3VA 3HLKA 1HYEA 3RU7A 3H13A 3TZ6A 4BNYA 4Y67A 2GXQA 1E2LA 3IEXA 4IO0A 1L5YA 3GZNB 3KD3A 4H17A 4IEIA 4A23A 5JZVA 4ARIA 4PQYA 3KVNA 2FMFA 4W9MC 3K71B 3D4LA 4HAOA 4CF7A 1PK9A 3C43A 4WDQA 3KQNA 3O31A 3UENA 3O4FA 4ARZB 4CT4B 4X6YA 2E85A 1MG5A 3RYIA 2PD6A 4FSXA 3NFYA 1ZN7A 1QFXA 1V1RA 1RPAA 2O5RA 4M1SA 2FGJA 2MJLA 3HBJA 1DBIA 4E4YA 3E1GA 1C9NA 3EWNA 4C6TA 3A4YA 5IK2D 3WBBA 1ZSYA 1EXVA 2ZUEA 1ICIA 1NMEA 1W0KA 2DZDA 4KP7A 5CW2A 3PRHA 1N8TA 4LF6B 3ZUPA 3WDKA 1YR7A 3SZRA 5DX0A 2DUUA 3VZDA 4EQZA 3WGTA 1JFLA 3KZKA 4JU8A 1JH9A 3PT5A 4MVJD 3NIFB 1QH1A 3P0RA 4PX2A 4E3WA 2ZUVA 3LUJA 1RCFA 3EVAA 2AN3A 2B3TA 3IAS1 2REXB 1P4SA 3G2HA 1S2LA 2C2KA 4KFUA 4RKWA 3V4OA 4ED9A 1R5JA 4GFDA 3TGPA 2IYWA 1TQ2A 2O2IA 3TZEA 1TCCA 4P80A 1B74A 2P3SA 4FEGA 4I46A 2E18A 4BKRA 1J2TA 2QAGC 5JMPA 4JI1B 3ZU4A 3AGQA 4F06A 1BYIA 5HPYB 1IZ0A 5IDWA 2QTGA 1YD7A 3THSA 5EIEA 1HI9A 3RADC 2OCDA 1R4MB 1FB5A 1ESNA 1A9ZA 1ZO8A 1CETA 2J8ZA 3K4QA 5CJPA 3WLJA 1AXGA 3W77A 2X0JA 2E37A 1W25A 1V6CA 2I54A 1IUNA 2IE8A 4YFYA 2PLFA 1FFXB 4URZR 2GBPA 5JLJA 2XT6A 3C70A 3GP3A 1Z26A 3G2MA 3NX4A 3WMFA 3CBQA 4IWNA 4V1CB 2EGHA 1LJUA 1FUKA 4O4LA 3GLIE 3IP8A 2VTVA 3OTWA 3AEQB 3H05A 3HDYA 1RTTA 2P1DA 5L95A 4LHZA 1SVMA 3EVBA 1KYQA 2QD5A 4D26A 1DTWB 1BDJA 1FNCA 1YWGO 1BX3A 1XDUA 4BP3A 5CYGA 1UMDB 3J81k 2EX4A 2FY8A 2B5OA 4KUHA 1AHPA 1DLIA 4AF6A 4EARA 3N7TA 4HT3B 2RFLA 2OD2A 1JN0A 2SBTA 4M86A 4KK3A 3SKVA 3MJTA 1EZ1A 3F7OA 3ZZTA 3ZV6A 4CLXA 2NZ8A 1NJGA 2I87A 1R4AA 3DFMA 2OGUA 5A3VA 1EJ2A 1KPHA 1RJWA 3ABZA 1KSJA 4IDCA 1JSRA 3EGDB 4OL9A 5G0TA 2GRAA 3RS0A 1OA0A 1T4BA 4Y9RA 1MPXA 2IHTA 3PQCA 4YPVA 1F48A 5HRAA 5AW2A 4MB6A 5KYYB 4B6FA 4Z4CA 5BR1A 1L6IA 5H5JA 1TZ2A 3HKCA 2WW8A 1PR9A 4B40A 3LDUA 3GY0A 5TPWB 1Q16A 1P2BA 1B73A 1N2BA 4ZYXA 1FSPA 3T1OA 2DF8A 1YQXA 3JZDA 1N25A 3OJOA 4JZYA 1QE5A 1T2VA 2MINA 5ALDA 1B6TA 4TZ0A 1Z7EA 2FJ0A 3D8UA 1T9GR 3VVMA 4PLGA 1FYEA 1OD6A 2GPAA 5KDOA 3IUYA 4DJTA 1KIFA 1T43A 4GLBA 3K92A 1BJKA 1QWOA 3L5OA 3MBOA 2BGLA 3KB8A 1WXFA 4X84A 1OXBB 3LA6A 4P0TA 1F6BA 1HWYA 5K3SA 5JT1A 1XJCA 1E2QA 1GNQA 2L17A 2ZDGA 3I3SR 4JJ6A 3AUSA 4K7JA 4XARA 5KX5A 3T3OA 2RHWA 3CUYA 2VYVD 4M9SA 4U7TB 3T3MB 1GGHA 2GEDA 4NYIQ 4PGAA 5EKUA 3ZHRA 2FYTA 1UBKS 3TZLA 2GYYA 1RI2A 2WSSD 4RM2A 1Y5MA 2C2ZA 2W00A 4LZPA 1J5PA 4LXIA 5FNZA 1I4DD 3J81A 3UANA 3QKSB 1SZJG 3KT8A 5C8YA 3RS5A 1JZQA 3BSFA 4ZU6X 4WUVA 2FW9A 3L6BA 4ZAYA 4L8GA 3TDKA 3OZGA 3HM9A 3ZCUA 1E1KA 3HO8A 3G59A 4KO3S 5KVCA 1X9HA 3SLKA 1BKSB 1D6SA 2OECA 3QIVA 4JQZA 4Q9KA 3Q3HA 1PDWA 4IMIB 4TMWA 1QRAA 5SZHB 1DDIA 2NUPA 3I6IA 4MUNA 1BMQA 3G8CA 1MJHA 4WOBA 3UC5A 3VU8A 5D5QA 3CSDA 4TN1A 3N0RA 2C7RA 1LCIA 1YRWA 3LCMA 5DB4A 1PL7A 2FPGA 5TF4A 4NSNA 1TZKA 4HMOA 1QGUA 1FLVA 1KJQA 2GI4A 3FFWA 4L4ZA 4JBGA 5EINA 4INOA 2VF4X 5AR1A 3V7NA 3KYDB 3VAZA 1WHSB 1NURA 3PUZA 4JEHA 1O4VA 1VRCA 1V95A 2BMJA 3IUEA 3N75A 2P6PA 4PZCA 4GL2A 2W2LA 3FM9A 3H6GA 2O48X 1AZLA 1DG9A 1KJ9A 3A0RB 3I53A 1ADBA 1YNSA 3P2MA 4I1IA 2Z57A 1A96A 1SK8A 4RK5A 1O6CA 2JVKA 4UAUA 4CKWB 3SX2A 4IHQA 1P81A 1CJSA 1T0BA 1WHTA 4AQDA 1K75A 1V16A 2VP3A 1TVCA 4MEBA 1UDXA 1D4AA 1MN6A 2G6BA 4MP3A 3TRHA 4TKUB 2WIKA 1SXPA 4P5EA 4D41A 3GR6A 2W6QA 1CJBA 4AG6A 1OXMA 3KETA 2GWHA 4HVTA 4JL6A 1OX4A 1CV2A 1SUEA 1R9MA 1EXDA 1KRXA 4P4NA 4GRDA 1IY1A 1G5HA 1UOPA 3ZIDA 4EHAA 1S2OA 1WUTA 2RB4A 2IHNA 1FNNA 4JLWA 4LV6A 1SXHA 3AO0B 4AKIA 4HHEA 2YRWA 5DIFA 5DISB 3P96A 1NW4A 1KIMA 2DPMA 4G07A 3N2IA 4HDKA 1X9IA 1FP1D 1BMTA 2O7VA 2OM6A 1U0TA 2R8XA 1T2EA 1YR2A 3BMNB 3ZK9A 2E1RA 3MYRA 3DMNA 4J7UA 2L19A 3U4QB 3F67A 2OOKA 4MR7B 4L50A 3BS4A 2F1KA 1PUXA 2XDQB 2PS3A 4LHEA 5E3HA 1GKLA 5JZSA 1BDBA 1M1YA 5K8CA 4FCCA 7REQA 3TECE 2AI2A 3GEHA 1EA5A 4C7JA 2RE8A 5A4MS 3A26A 1GKUB 4BYMA 1N0UA 1XFAA 4HAWA 4H1HA 5TPZA 4JYBA 2IDKA 3TLMA 4F5DA 4JI2B 2R8BA 4I1OA 1GP2A 1ZGCA 3HWWA 1G66A 3DBHB 1OB2A 3S4YA 3GPDG 3GH1A 4EWLA 2P1RA 4FCTA 4UU1A 4JITA 2YV5A 1RI4A 1YFZA 5IDQA 3VUFA 2G4LA 3PFGA 4L2IA 2E5WA 1PP4A 3CR7A 1D8AA 1SCUA 1ACLA 5BUZA 3OT5A 3NATA 1WE2A 4IKEA 3N2GB 1MAAA 1A2OA 2O8DB 2WTBA 4I5FA 2EW8A 1YMVA 2FR0A 1NX6A 4J91A 2QTCA 3LPDA 3PJRA 5HR5A 5I8ZA 2H0AA 4EYGA 3SE0A 3TOZA 4JNKA 4BO1A 1Z4QA 2HLDA 1YASA 1BH6A 3V7FA 1ZZGA 2PZFA 5G2OA 3JAKB 4LFBB 4LWQA 1QOQB 4C7KA 3RR2A 3GAZA 1XD2B 4B75A 2NSJA 2PR7A 3QWBA 2EVWX 1Y42X 2P4EA 4MP8A 5CVUA 4I5DA 4DZZA 1M34E 4M55A 2AG5A 4G0XA 4G5QA 1VL6A 1GILA 1CR0A 2XGSA 1RQ2A 1V8BA 3F2VA 1GXSA 1KTVA 1J2UA 1XJQA 3MJFA 1KTIA 4RZHA 5KREA 1C80A 2XTJA 2JK0A 4UHHA 4WGFA 1I36A 1R18A 4JQCA 4YV0A 1VI6A 1E59A 5BWBA 4ZYYA 3RYFB 5DLEA 1Y7PA 4I9GA 4B17A 4YJ3B 4EAAA 1RJGA 3E3OA 4RV5A 5BMVB 1FSFA 2C4TA 1U0NA 5LLSA 1LLUA 3ADBA 1VA4A 1BWSA 1DELA 1HE2A 1MDFA 4I36A 1QCDA 1O95C 4RKQA 2ZTVA 2G07A 4AQYB 5CYFA 1MKYA 3LP5A 1EGVB 4KBFA 4MR8A 1DARA 1Z63A 2QROA 2O0MA 2OGTA 1MJFA 5BWLA 3SF8A 4NFYA 3SIPA 4U6QA 1QYVA 1TE2A 4TMFA 4EDFA 5K8TA 1ZEJA 3ZE2B 2LKCA 2L82A 5LMUB 4YJ3F 1DXQA 5BMVF 2W37A 1L7MA 1SCJA 4DKJA 1Y6QA 2XXAA 1E4YA 2ZJ6A 2TMGA 4MS3B 3HNOA 3X2FA 1QX3A 1UXKA 2HNBA 3H2HA 5G41A 4B73A 1NW7A 1N2CA 3EEQA 1CUIA 3F8WA 3KOWA 3OX1A 3EMKA 4UXIA 4YP5A 2M6KA 3RB8A 3U3RA 5JDCA 1KK2A 1W5AA 3BGVA 3GJ0A 1FIUA 4GYJA 4UVGA 5EE1A 5SY6A 4PGGA 1X14A 3LWDA 3NIDB 4DMGA 1G5FA 3EHDA 3FSGA 3U7QB 1XG5A 2VUHB 3EJWA 4Q39A 4AC9A 1IBCA 4MRNA 4XIIA 5HKLA 4HD8A 5DHFA 3BXPA 5EGSA 4BO7A 5JH7B 1P9RA 1XVAA 3L05A 4BVLA 7ABPA 3PT9A 4C7XA 1ZH8A 2GN1A 3NXSA 4O2AA 3ELWA 3AEKA 5FA8A 1E2JA 1P5HA 3DDOA 3N3BC 4A6DA 2WYHA 3QIAA 4KQJA 2IEYA 1VPEA 4XWOA 4OUDA 2XB6A 4LNUB 3HMKA 4FNAA 1SG9A 3FWZA 3H16A 4Y6QA 3MINB 3K0SA 4JUFA 2PUEA 2JLWA 2Z2ZA 4QDUA 4I4TA 3ZVRA 4DADA 4D56A 2BZ1A 5JH7F 1DDOA 2NU7A 1JJAA 3S1LA 2HHHB 3EGWA 5GJVC 1CCWA 3V48A 4AYWA 1WSBA 2OAEA 4P1ZA 3PSHA 1X74A 2HDOA 2V5AA 2NVWA 2C0CA 2JLAA 3R0JA 1AIPA 4KWIA 4MPPA 4PLZA 2AX3A 1XA3A 3VNRA 3W5JA 1VE1A 1EXNA 1W35A 3EQZA 2RAUA 3IKVA 1G20A 1PG0A 3K94A 4IV8A 1SKUA 2J3DA 4KQGA 1M8FA 4PSAA 4BBJA 2FDCA 1Y8AA 3DDWA 4WFKA 3DO6A 2RGGA 3DP7A 3FBTA 3UT5A 1XJWA 5BWNA 1XPRA 2ZKLA 3EOBI 4JU9A 2W2LD 2ZB7A 4NZ9A 4E5DA 3X44A 2N3ZA 4YRZA 5JAHA 3I9OA 4ITVA 5JYDA 1P3Y1 4ZYTA 4J0JA 2W42A 2YWBA 1Z6XA 4M8IA 3AILA 2HRCA 1L5LA 3FLEA 1U0HC 3RUPA 5DXFA 4CL8A 1NW3A 4QPZA 3X43A 1KI4A 2R6HA 3IAHA 1WY7A 3AL3A 2B8JA 3ROFA 4WV3A 4BLWA 2ODPA 1IWPB 2FF5A 2NXJA 4M98A 1YZUA 4GBMA 5F1KA 3RDPA 2WJHA 1T4GA 5CXSA 1VKJA 4CL2A 1KDVA 3D8TA 4MVJI 3X1ZA 5KNDA 4RJJA 1NNEA 4RQAA 2F8MA 3WXBA 4BX0A 4JY7A 3O4VA 1ESDA 1VP3A 4N01A 3O1HB 4ZDKA 4WOPA 5AUOB 1THZA 2Q9BA 4U7WA 3USCS 2ONKA 3WL3A 2BKVA 2I22A 5JNUA 4K0RA 1RJ9A 4FS3A 5EERA 2ENUA 3MCVA 1CZLA 4L85A 4EYEA 1O97C 1CXZA 2JAUA 3AB8A 1P7CA 3IYLW 4IINA 4TOIA 2B4KA 5CNKA 5H3LA 2GDJA 1M54A 5FUYA 4EECA 3K4HA 4CNBA 3O38A 4C0QC 3T7CA 2ZTMA 3QA3E 1Q77A 2J3IA 3ZD9A 2XMCA 2G83A 3V1YA 4IIEA 3DAYA 1W9HA 2CVFA 1DQRA 2ABWA 3ROEA 2JLZA 3OVMA 3SHTA 4UVHA 1R8XA 3KHTA 1QHXA 2HA3A 4OOEA 1VKOA 5IUKC 1OFUX 3MWJA 1D1TA 3AY6A 5EZYB 3TLKA 1OASA 1G0NA 1GNSA 1I6LA 3D8RA 1QU2A 2ON6A 4IHJB 3RFCA 5TPZD 4QUIA 4R1UA 2BFDB 4Q1DA 4IIHA 5IBCA 3EMDA 3LL4A 1CC1S 1ATZA 3DE1X 3OWOA 4A2PA 1D09A 5L3QA 1C2YA 3A05A 5G0VA 3HCNA 1GRVA 1YR1A 3GRAA 3BJRA 2W2NA 4F96A 4BFVA 3N8IA 4U5XA 1HYBA 1X39A 4UBIA 3KSAC 1D1PA 2ZIXB 2ZRQA 3V8EA 3ZX5A 2VTBA 1RC1A 2FUKA 3X0DA 1DWQA 1UEJA 5EZYF 5KJ1A 3NVAA