3S3TA

Universal stress protein uspa from lactobacillus plantarum
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
145
structure length
145
Chain Sequence
NARYTNILVPVDSSDAAQAAFTEAVNIAQRHQANLTALYVVDDSAYHTPALDPVLSELLDAEAAHAKDAMRQRQQFVATTSAPNLKTEISYGIPKHTIEDYAKQHPEIDLIVLGATGTNSPHRVAVGSTTSYVVDHAPCNVIVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Nucleotide-binding protein, universal stress protein UspA fa
publication title Universal stress protein UspA from Lactobacillus plantarum.
rcsb
source organism Lactobacillus plantarum
total genus 50
structure length 145
sequence length 145
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00582 Usp Universal stress protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3s3tA00
1G59A 3DV2A 4ZT5A 4ZT4A 2DXIA 4JXZA 2PZ8A 2R5WA 1YULA 4AQ7A 4WNYA 1BS2A 1KH3A 2A4MA 3S3TA 4DE5A 1U0BB 3CLSD 1O97C 2WQ7A 1A8HA 3NBKA 5HUJA 2CYBA 3BL5A 2E0IA 3ZXSA 2ZUFA 1G8HA 2DERA 3TS1A 3IUEA 2PZBA 1JEEA 1ULHA 3COWA 3ZIUA 3SEQA 1O95C 1PFYA 5FO1A 2J4DA 4CDNA 3CLTD 3COVA 3X1KA 1QNFA 2XRYA 3IMEA 2D5BA 4MAFA 1J1UA 3L92A 4K03A 4MVYA 2NSYA 4QRDA 1T6XA 4U63A 3HFJA 1WQ3A 4GRIA 4HK4A 3ND6A 3ZUGA 4L2IB 4KKVA 2A88A 3GUZA 1KR2A 3CLRD 4J76A 3X1JA 3IOEA 5K0SA 4EGAA 4MLPA 5KHAA 4EG5A 1YI8A 3KT8A 3TNJA 3CVWA 1I2DA 4RPIA 1Q11A 1LI5A 1VLHA 3PRHA 5K0TA 1GTSA 2EL7A 3F3MA 4OUDB 3OTWA 2JA2A 1Q19A 2QJOA 3G5AA 4H3SA 3CLTC 4MW0A 4PY2A 3UY4A 3FY4A 1OBCA 3ILVA 3FI0A 3HV0A 1QRUA 3ZJUA 3P0HA 1N78A 1O0BA 1MOPA 2G36A 3L93A 3C8ZA 1KQOA 1KH2A 1F4LA 4EG8A 3IDFA 4CT0A 1I6MA 3SDBA 3CLRC 3CA8A 3N9IA 4ARIA 4EG4A 3ZGZA 4DDMA 1OD6A 4P2BA 1GZUA 2QUJA 4EF6A 4Q93A 4JXXA 1N2HA 3K32A 4ARCA 5DK4A 3HL4A 1QU2A 1KAQA 2V0CA 2QUIA 3N8HA 4NAHA 2HGZA 4KR9A 4MULA 3CVVA 4MWBA 5TEVA 1N2BA 3RBAA 2DEUA 2YY5A 4KR6A 4MUJA 1J1ZA 3HMQA 3D6VA 2X1MA 3GMIA 2BTEA 1EE1A 2CT8A 5F23A 1MBZA 1KP3A 1TFUA 2J5BA 5HUHA 1IQ0A 4MUFA 5DEOA 4A91A 1GN8A 1H1TA 1JHDA 1WXIA 2CFOA 2O8VA 2H2AA 1P7PA 1U3CA 3H9BA 4NAUA 2A84A 4MW2A 5FNZA 1WXFA 3KFLA 2QTNA 1TEZA 4YP6A 1XJQA 2RE8A 3RHSA 3CLUD 3CVUA 4ZCTA 4R0NA 1KAMA 1OWOA 3P0JA 4WSOA 1M83A 3AKZA 1H3NA 2QUHA 1ILEA 4EG1A 2CSXA 4L2IA 3HGMA 1VBNA 1MC1A 3QTBA 5EKDA 1T9GS 1YUMA 2X1LA 1U3DA 2NZ2A 4JFAA 3FWKA 4UZFA 4F3RA 3VGJA 1NSYA 1X8XA 3RJZA 4MVWA 1NZJA 2OQ2A 1N2OA 4Q16A 4OUDA 4MVXA 1GLNA 1JIIA 1U7XA 3CLUC 1OBHA 3HZRA 3UC5A 1T6ZA 1EXDA 2QUKA 3FNRA 1JECA 4I6GA 3UK2A 1TYAE 1NYLA 4YBRA 2QJFA 1NURA 2X0KA 3KT3A 2ZP1A 1VL2A 1M1ZA 3FH0A 4S1OA 4MW6A 3PNYA 1M8GA 1ZH6A 4HPWA 3VU8A 4EG3A 4ZCRA 3CLSC 1N2JA 4MW5A 4YP5A 3M5WA 4MUHA 4EG6A 2PG3A 2GKSA 4GU5A 2TS1A 4DDHA 1N1DA 1V8FA 1WXHA 4YP7A 3A04A 4ND7A 1NUSA 3JXEA 4HJRA 4NDAA 4NX2A 1WZ2A 2GM3A 1OWLA 4ZCQA 5H7XA 1TYDE 1TYBE 4MUIA 3TQOA 2CYCA 2OV4A 5TGTA 4ZT6A 1N2IA 1X6VA 1WY5A 2I1LA 3I05A 4MWEA 2X3FA 1WQ4A 1N2EA 3CR8A 1EFPB 4YMIA 3AG5A 2XRZA 2J07A 5IHXA 4MVCA 3QE4A 5KCMA 1OWPA 1O6BA 5LM3A 4KR7A 1LI7A 1ZUNA 3ISJA 1KQPA 1T6YA 3PNBA 3DO8A 1K4MA 3PNVA 2Z09A 1G8GA 1MAWA 3AG6A 2CUZA 1ZH0A 1O0CA 3FETA 1YIDA 4JYZA 3FIUA 3A05A 3ZXIA 1WOYA 1VBKA 4QREA 3G59A 4MWDA 2B7LA 1QQTA 2J09A 3E27A 3UOWA 1GTRA 4CQNA 5DB4A 1JZQA 1PG0A 1R6XA 3RK1A 2QJTA 1NUTA 1I6KA 4EFKA 1FFYA 1J21A 1HYBA 3SP1A 1K4KA 1R6UA 2DUMA 1MB9A 1F9AA 3MXTA 2JANA 1YIAA 5HG0A 3Q10A 2VXOA 4KPUB 1KKUA 1VBMA 1MB2A 3COYA 2PXHA 2QTMA 1MAUA 1KH1A 4F4HA 3PXUA 1F7UA 1JEDA 1KP2A 1IVSA 2A7XA 2E89A 4FZJA 2GOYA 1XNHA 2PZAA 2YXNA 1T9GR 1JIKA 5LLTA 1D2RA 2CV0A 4AS1A 4MW7A 1B6TA 3IOBA 2O5RA 2PFSA 1JILA 3OP1A 3TQIA 3INNA 1JIJA 2IJGX 2DETA 1J20A 1O96B 4MW9A 1PG2A 2AG6A 3SEZA 2VTBB 3IVGA 4MUGA 2BYTA 1WXEA 2CV2A 2AZXA 4JZYA 4MUKA 4TS1A 1QTQA 3COZA 4R2MA 4DNXA 1EUQA 4ND6A 1IHOA 1M8JA 2A1UB 1EFVB 1JMVA 1S4MA 2V0GA 3FG9A 4QBTA 3N2YA 1I6LA 2Z08A 4UZEA 1IQUA 1NP7A 4XSVA 3IMGA 2QTRA 3UMVA 2J08A 1EFPA 2A1TS 4CDMA 4NZPA 1PFUA 3QTTA 5IJXA 3ZJVA 1NI5A 1Q15A 2IELA 4HJXA 5J58A 3K9WA 1DNPA 3VRHA 2WSIA 2YWCA 1OWNA 3MMXA 1IFXA 1NUQA 3FHJA 5KWVA 1JGTA 3ND5A 2WQ6A 1K97A 3SZ3A 3IOCA 4MUEA 5JBNA 3IODA 3Q4GA 1H3EA 1J70A 4MUNA 4DJAA 1U7DA 1Q77A 1MRZA 3IH5A 2JAXA 1EUYA 1YUNA 3H99A 4ZT7A 4I6EA 1XNJA 4ZCPA 1XNGA 5H16A 3X1MA 3LE8A 3SZGA 1PFWA 4ZT2A 4PBRA 3DLAA 4X0EA 4DLPA 3FOCA 2E18A 3P0IA 2AKEA 1F7VA 1SURA 4EG7A 3H97A 4KPUA 2IP1A 1GAXA 4OJMX 1KORA 1N75A 3AIIA 2CYAA 4XFJA 4U8HA 1K92A 2A86A 3IMCA 3LCJA 5AHWA 1NUPA 5TS2A 3SYTA 5BNZA 1PFVA 3IUBA 3IVCA 1M8PA 4G5YA 1QRTA 1N77A 3CVYA 1JZSA 4G6ZA 2D13A 2EJCA 1EJ2A 1LW7A 4XFDA 2Z3VA 1G8FA 4MW4A 3DPIA 1O96A 3LOQA 2H29A 5DASA 2VTBA 1WKBA 3A2KA 1FYDA 3AFHA 4ZCSA 3MLBA 3TZEA 4G5FA 1N2GA 1KQNA 1CT9A 1GPMA 2A1UA 4R2LA 2DLCX 3KT6A 3Q12A 1UFVA 1EFVA 3AL0C 3FDXA 4I6JA 4E1AA 4DDKA 1WJGA 5FO0A 3A4IA 3NV7A 1Y42X 3MLAA 2YWBA 1O5TA 3MUEA 1NUUA 3IVXA 2ZUEA 2WB2A 5J5AA 3TZLA 2HMAA 3D6UA 2E21A 4PBSA 1O94D 3ELBA 1V47A 2C5SA 1IRXA 4MQ6A 4U7JA 3U1VA 3GLVA 1TYCA 1ZJWA 3H05A 1J09A 1IH8A 3P52A 1RQGA 1QU3A 3KT0A 1M8FA 4ZT3A 4K0RA 1IQRA 1OWMA 1R6TA 3NBAA 3G6KA 4J75A 1O97D 4PBTA 4BWVA 5J59A 4MW1A 1COZA 1N3LA 2A1TR 5LFAA 2DR2A 2DPLA 3RK0A 2PIDA 1TQ8A 3CVXA 1WXGA 3H9CA 4NATA 3RFFA 1H3FA 5TEWA 2CV1A 3ZJTA 2RD2A 2D54A 1M8KA 1O95D 1O94C 1QJCA 2HZ7A 3ND7A 4MWCA 1MJHA 4RUKA 1QRSA 3N05A
chains in the Genus database with same CATH superfamily
3UKJA 4DGQA 4DG9A 2ODAA 4URVR 2ZQ5A 1QIMA 2P2DA 1SK9A 2RH5A 4HEQA 2IV3A 3O4JA 5HIJA 1W5FA 2PZ8A 3ZVLA 4W5NA 4K9RA 1YULA 4JP2A 1JLKA 5FBVB 3JVUA 4ZV9A 5CNKA 3OZUA 2OGTA 1OX5A 4IOLA 2DUWA 3N8DA 4L8FA 5E8JA 3M6WA 2FMKA 1UBCA 5D7BA 1FRNA 4YMTA 3ZZTA 3IAFA 2VJDA 3JWPA 4AMVA 2FG7C 2NO4A 4MGHA 1WZCA 2O7VA 3RYFB 5KNLA 5G1NA 1FP1D 2C5HA 3GH1A 5DULA 3VNAA 2PRSA 1W8DA 2WM9B 4TV9B 3QXJA 4U2BA 9ATCA 5CFPA 1QQAA 4IH9A 4QYSA 4RENA 5FUBA 3ONWA 5B3AA 3W8RA 4HVAA 2EAUA 3R7SA 4A6EA 1UFOA 3COWA 4FQ8A 4JXJA 4W1QA 3HN6A 3RVOA 3CTMA 2BFNA 1OOEA 3GQBA 3MGKA 2OEPA 4XWOA 4RLFA 2Z6UA 1EDOA 1KMHB 1LJUA 2BZSA 4H0NA 1VKNA 2Y93A 3ZY6A 4FE7A 4O4LA 5LXTA 1UMBA 3HXTA 4B33A 4XTRA 4C6SA 1SQGA 2A8YA 4X1OA 3TQSA 3UF0A 1OXTA 3W9BA 4B9EA 1LPMA 4J91A 1LC0A 4BX3A 1CG6A 4DQVA 1AKVA 1P2BA 1KR5A 2N46A 3N2NA 3THSA 1G8AA 3TZHA 2JFZA 2JDIA 3A6GA 3ZIAA 3ZQ4A 4GBMA 1QWOA 1C3JA 3VU0A 3OIUA 1E64A 4X85A 2FX3A 3LYHA 3G49A 1WHSB 3MLEA 1TK3A 3DB1A 4M7PA 2OBNA 2RHOA 4EYOA 1N2SA 3M8KA 4KQFA 4B35A 2BRUA 3IP6A 1K3UB 2WWGA 2GCIA 2P62A 1RYYA 1T2EA 2WUVA 1R3UA 1KJ8A 4HTAA 1A8QA 1Q11A 2ZWAA 4JEIA 3SEFA 4QBKA 4HWRA 4E1BA 3G9XA 1T9ZA 3OJOA 5K6TA 5EQTA 1XIVA 1KSJA 3Q9LA 1V4VA 4YJDA 2QR3A 1Q19A 3DFZA 3LHSA 1BA2A 1E92A 4RZ2A 1Z4MA 2R62A 3ANSA 2JVJA 3DTVB 4QX6A 4UNRA 3MJFA 3SYRA 5BSGA 3A1FA 4BZQA 4EYEA 4L08A 3ZWQA 1LZLA 2Y2UA 1X39A 1E1DA 4XE5A 2O3SA 1QRRA 3Q3CA 5AKEA 5FLEX 3WV4A 1KNXA 4KFSA 1P5HA 3DFKA 1XCOA 4G9BA 4RZXA 2WUDA 5BW8A 2QA5A 5CDTA 2XTZA 3ACBA 2XA9A 4PQFA 5KTPA 1N6OA 1I6MA 3VVMA 2X14A 1NVFA 4LOKA 4IIUA 1TZJA 3V8QA 1BQEA 4MB0A 3RHTA 2F64A 4UW9A 1CHDA 3R3UA 1NL3A 4HWGA 1N57A 1V71A 4OXYA 4XQGA 3G0HA 1KYWA 2L17A 3RREA 1OB5A 5GONA 4EF6A 5LMNB 1B1CA 4KDEA 4EHDA 3A26A 2FPPB 3HUTA 2ZR8A 2M98A 5SZIA 3U3JA 2PM8A 2ONKA 3H83A 3WZMA 2B6NA 5KX5B 1SIOA 4EX6A 1AQJA 3NP7A 1Q22A 3GEMA 1OQAA 1E3IA 4AZWA 1MTZA 2E2WA 1N2CB 3DNPA 2XAAA 3V1KA 2P9GA 2HIGA 4WWHA 1FP4A 1MDBA 2J31A 2I6TA 1FUYB 2ARKA 3D8UA 5D5PA 4HAIA 1M6YA 4L7VA 1RWMA 2O1EA 4Q9LA 2Q7XA 1U80A 3DV9A 1E89A 2IEIA 2WB4A 5ITSA 1JJVA 4II7A 1A04A 2C0QA 4BZXA 2C4NA 3ZGXA 3GLRA 4X66B 1WXIA 3AF0A 3E22A 4I1RA 1DWQA 4P53A 5CLHA 4UZSA 4KXQA 3UICA 1H6CA 1LJLA 3OOSA 4RK1A 1DBQA 2OZPA 5DXJA 1K9SA 1L7BA 1PQYA 4V2IA 3U7QA 3GAMA 2HPAA 2CD9A 4Q1FA 5ADHA 3CVUA 1QBGA 4NDZA 3EWIA 2WLTA 4Y9RA 1GPKA 2ZW9A 1CF2O 2I6UA 1ETUA 1ODJA 2XQFA 2ZEJA 4Q05A 3F71A 3HCEA 2OK8A 4B87A 3PGJA 3DDZX 1KS2A 1N1MA 3NJRA 3Q7PA 4N54A 1WPRA 3MG9A 3CXRA 2NO7A 3OF3A 3OIYA 1Q7EA 1UFKA 1C7QA 3C7TA 3E5HA 3ZI4A 1OGJA 1PR9A 1XXHE 2O50A 1AHHA 2GZ3A 4BNHA 3GG2A 3SHTA 1WVGA 2J6BA 5IUNC 4D26A 1GADO 2IOFK 2YS7A 5KOJB 4OP3A 1FFCA 3N8KA 3H9GA 3B82A 1PQ4A 4KQXA 1G63A 2C9CA 2W6MA 4UZFA 1E32A 4GXNA 1E2BA 4CMKA 1KS9A 1RD4A 3A6JA 3RNOA 3VGJA 3DDWA 3Q2IA 1SHLA 8AT1A 1OXKB 3EDYA 4MVWA 4DWWA 4ETIA 2W42A 1PFQA 5ALRA 4QRHA 4W6ZA 4D0SA 2O8NA 2AD5A 3O93A 1I4DD 1W9MA 2ZAYA 1I1QB 1OBHA 4G67A 3C8MA 4AF7A 4W5TA 3IQZA 3W7AA 1YDMA 2CBZA 5HR5A 1G21B 4GQBA 3F3SA 2WUFA 2P2SA 4P4SA 4GLJA 1WZEA 3TL3A 2BONA 1XC7A 1XMJA 3T3NA 1UWKA 2I8AA 3MBIA 4ARSA 2XH8A 1ZUHA 3E81A 5IZCC 3AGQA 4EW3A 2AX4A 3SF8B 3HYRA 1C3XA 3DVLA 3R5FA 4L5JA 1VRVA 4UATA 3C5HA 3Q9SA 1ZJZA 4N82A 3AHGA 5AXBA 4AWXA 3I8OA 5CT5A 3QFCA 4R2JA 3RSCA 2QRMA 4NULA 3RVKA 3TYXA 3QKIA 5DM0A 1VJDA 2R48A 4BE4A 1AMUA 2ECKA 1C1DB 1DG3A 1I3OA 1WXXA 2GCPA 2PZKA 5K01A 4IL5A 2BF7A 3D6HA 4XYEA 2PSFA 3DXZA 1N9ZA 2DKOA 3TR6A 4HS9A 4ZEXA 3VI3B 5I7HA 1AJEA 2R9VA 5LQUA 4CT4B 2ATEA 1ZWLA 4K46A 3P26A 5AI9A 1BD3A 2XOEA 221PA 1JE1A 1XD2B 3LV8A 4FYHA 4JT4A 3R3YA 5IBQA 4R51A 1AZLA 4YBZA 1GAJA 1XVVA 1H2FA 3PT9A 1N6NA 1S8NA 2AJLI 3AUXA 1WY5A 5AWFC 2FPKA 1PNQA 2WP8J 3NUQA 8LDHA 5ICEA 2VJCA 5CA0A 2OORA 3QRWA 3X2FA 1HV8A 1N2EA 1T5DX 2JLAA 4JJIA 1U2RA 1HMPA 3AEXA 3FB4A 3H2KA 4YMIA 1O89A 3ZV4A 1JP7A 3GVHA 5HW0A 3JWJA 3Q88A 1SZPA 2WT4A 2EBHX 4QG7A 5EIWA 2WEKA 1BXGA 1UPAA 2HCTA 3DEHA 1LI7A 4HGQA 1GG9A 4R8VA 2VJMA 1Y6RA 5JR3A 1BDIA 2VLIA 4QSHA 4LGVA 1R9GA 4QFBA 2SBTA 2Q3CA 4ZYVA 2EZTA 3L05A 4UOQA 3KB6A 1JFFA 4WADA 1EWVA 2CUZA 2ORED 2AOWA 2V5AA 3ZD7A 2HT1A 2X9GA 1UBUS 2ZIVB 2O2YA 2ZTLA 4GI3A 2DFVA 1B2LA 3PEUA 2DRIA 4XD2A 2Y0BA 2C61A 7REQB 4BAGA 2DM6A 5ESXA 5E6RB 2I1VB 4E1AA 3BORA 4X6YA 4P7BA 2FWAA 3PC6A 5DZSA 4OYHA 2CLMB 2AQIA 3MWEB 1NPTO 1OTYA 1PL7A 4LJSA 3KZXA 2BC9A 2RHDA 5F33A 1KDYA 4EFKA 2RG1A 4HZGA 2GXSA 2HY7A 3O83A 4C4PA 1U2GA 2K4MA 4K2AA 4RXTA 4QJ5A 4MS3B 3PUHA 4GVLA 3T41A 3DWIA 5ER9A 3QHAA 4Q5IA 4O4JF 2WDZA 1Z7GA 3E8XA 3FHLA 4IXMA 1VBMA 1VLQA 5JVDF 2CNDA 1E5VA 3KOZA 4U00A 5A4FS 2EF1A 2QTMA 3KQYA 5BVGA 1FVXA 3SY8A 3OEEA 3EXIB 3L7MA 5G3ZA 2GK4A 6ADHA 4R2KA 2ZPAA 1Z0IA 4GYYA 3NT5A 2PR7A 4GZ6A 3PUZA 2E89A 3BRCA 3F7NA 3IVMA 3L7AA 2J0QA 2AR9A 2NM0A 4FKZA 1CKEA 3BICA 4MVJI 1IB6A 5ITZB 3AERB 2IPXA 4XZ3A 1CRLA 1N1GA 1RKBA 2PWPA 2HBQA 3QY0A 4NZYA 1KIFA 2PFSA 3K0FA 1SC6A 4XUEA 1E1CB 4JT9A 3ZJ5A 5GAJA 4AD8A 5FFFA 4NZZA 1FCJA 3ACCA 1W47A 3PQEA 2X0NA 3ZVMA 3AFMA 5FULA 1BW9A 1O96B 1IIBA 4ALNA 3IRVA 5LL6P 2VTBB 2I6QA 2CV2A 1DC3A 4JZYA 2SNIE 2ZSIA 3DHWC 3AOEA 4LNUB 1FU4A 5BWNA 2XZOA 3F4KA 1QS0A 1JAIA 2W2PA 4LTMA 1GV1A 2Q3HA 2Y1EA 5F2OA 1ZHOA 3DDHA 5EE3A 1XRPA 1SZDA 4ZV7A 5KUTA 1OX4A 1GGKA 1ZAKA 3LT2A 4QHYA 3VR1A 4EO4A 1MH9A 2V0GA 4I3FA 1GZ5A 2WTMA 5CG2A 3L8CA 1V96A 4HWTA 3FZGA 4UZEA 1W59A 1SBIA 3N2EA 2FQYA 5C5EA 3KQPA 4Z3DA 3FUXA 2VKQA 3FYUB 2FUG1 1ZNXA 4D98A 3LOUA 3LBFA 4LYFA 4GHWA 3PQ6A 2VHQA 4M7WA 4MWOA 4M1MA 5L3VA 1JDPA 1DEHA 3OEYA 3AILA 3OURA 1AGRA 3ZHTA 1E1LA 2A9FA 4MMXB 3GPBA 3IEMA 4PGMA 2F3TA 3HRHA 3W6OA 3LBIA 3CRQA 5FR2A 5KWEA 3CZPA 2XUKA 3K20A 3EDOA 3RRFA 3EDMA 4CLHA 4EW6A 4HNTA 5GWXA 4CKEA 1WDKA 4Q4LA 4IXNA 5EL0A 2GEDA 3H18A 4EO7A 4ZFNA 3KZOA 3UNXA 1HR0B 4HEA1 3BSWA 3HB1A 1O5OA 1CS0A 3BXHA 1BXRA 3BUSA 3GI1A 1HA3A 3DE6X 5I9SA 3IC5A 1FTNA 4FJ0A 5DNYB 3FNHA 2EARA 1RZRD 3GBSA 1PU2A 2XB4A 1R5JA 3W4IA 1R10A 3HR8A 4I7EA 2JFPA 3ZDDA 4HN9A 1GPLA 1XNGA 2PX4A 3FWZA 3JQBA 5CT9A 1YHYA 3SZGA 1AMNA 5KSOA 1KSGA 3WTBA 4PBRA 3T7KA 5F76A 1XEWY 2CMHA 2TYSB 3LECA 4G1MB 3UT6A 4U2CA 1RJFA 5BWMA 3G2KA 5CTAA 1SCUA 1ISHA 3AZQA 1A9XB 3OZXA 1IZ7A 4TTPA 3TZQA 5JXWA 4OATA 4ZREA 3QVOA 3EGWA 2QD2A 4EUNA 4IVNA 3GMDA 1KJZA 1KORA 1R4NB 3KLOA 2YIDA 3QLTA 4XVQA 1LGYA 3W77A 5TS2A 3A9VA 3JALA 4TKVA 1GCIA 4YAFA 3EX7C 3FKSD 1P5ZB 3Q85A 3IUBA 3GNSA 4IQ0A 4NENB 4MYRA 3ZWBA 3ZVNA 1P4AA 5DNCA 4MX8A 4DPMA 3EMBA 1O8BA 1EI9A 3D3EA 3LLCA 1YIOA 2ZOSA 3W8EA 2TMDA 3B1KA 3STTA 4FFNA 5KTMA 1SJ9A 2VP2A 1EVKA 1T8YA 2ET6A 4PO1A 2R0QC 1VLLA 3KLNA 3VDQA 1A9TA 3UEOA 1UPUA 4Y2VA 3A2KA 1W88B 1UINA 3MT0A 2HJGA 1VL5A 2IHBA 1IG3A 1GFIA 3OE7A 3V1TC 5H82A 3CVOA 3UENA 1DIOB 1KC1A 5IM5A 5JC1A 5CK4A 1W0CA 1EP1B 1YE8A 3GQVA 2ZYGA 4HDAA 1IZYA 4EECA 1KXJA 2Y3IA 1S8OA 1F8UA 4CN9A 4B8ZA 2J5QA 2V9ZA 3G9UA 1N5IA 3K2EA 3MLAA 1PF7E 1F2UB 3E05A 4PZEA 3M81A 2JGLA 3TR5A 3RI3A 3ONNA 4JLSA 3DF9A 4FIZA 1VHWA 1OU4A 3AWIA 3T8YA 3A36A 5JADA 2BOVA 1RQRA 3AO0B 2FWRA 2YMQA 3THWA 1TAUA 2DPHA 2XRFA 3DPSA 3OZVA 4RNDB 4Q19A 4LXYA 3EYWA 3FYSA 2JJ2D 5IBRA 1RQLA 3WIVA 3F0TA 5K6AA 1RLJA 3OLCX 4BUCA 1J24A 3EARA 1TADA 2JBWA 2Z3WA 4V03A 5TRTA 5FV4A 4ZT3A 4GOOD 5I9IA 5KQRA 2FR0A 1SXIA 2LTAA 1K5HA 3GLQA 3N3BC 4H0FA 5COQA 4BP9A 1J7JA 1V8DA 1Z25A 3HDVA 3RS5A 1EE2A 2I4MA 1ODIA 3S2IA 2IYOA 1DBRA 4PX3A 5T64A 1NNUA 4B32A 4AKSA 1H2HA 4CMAA 3BQ9A 1PNRA 2JZOA 1Q57A 4LZLA 1Z4NA 3AESB 1K6XA 5D3ZA 3E3NA 3VPDA 4X1IB 3OIGA 4YRCA 3GA7A 1KEEB 2V6GA 1FDVA 1RADA 3QVXA 4JD5A 4RV4A 2YZMA 4J4TA 2WWXA 4MR9A 2F2TA 1D6SA 1WUKS 2JIBA 3BHMA 3RS2A 1BX0A 3ER9A 1TAHA 4HYQA 4PPQA 4DR5B 2WMNB 3F3YA 3UGKA 4KB5A 4PLPA 4YJ2F 4DM3A 3NB0A 3QI2A 2ZYIA 3TIXB 5CFQA 1HI9A 3CR7A 4XASA 1JDNA 3N3AC 1DKLA 4EI7A 3H1BA 3IIEA 3QMMA 2HQOA 4F5DA 3FOEC 4KFUA 1DRUA 1ZJ6A 5D84A 1X7YA 4CHTA 4E46A 3DMYA 5KYTA 3UBTA 1EVIA 3MMZA 1QE5A 1U0JA 3SNKA 1WWKA 2I03A 4C0KA 4US1R 4OFBA 1IXYA 4M21A 1ZGBA 5JWOA 3LFHA 3B13B 3V1MA 3C6KA 2X2FA 3G0BA 1I2BA 2G71A 4ZHQF 5LNK1 1P7CA 3BGVA 4R1QA 4K3UA 3DOIA 4N3AA 3IUEA 9LDTA 1PJSA 3MS4A 1T8WA 5BV8A 4I50F 2CF5A 4Q3CA 4EBFA 2L2QA 4IJMA 3FHOA 3I4CA 3QU2A 3VJKA 1VRCA 3U62A 3U7JA 1S2MA 4D3SA 1KYQA 2QT0A 1FX0B 4LGMA 1NMEA 1PFYA 2JFBA 4ZK6A 3SVTA 4HAZA 1PVVA 2ZIAA 4CDNA 3QUSA 4I66A 1GL9B 2ZVQX 3I6ZA 1KGDA 1IEWA 1NUAA 3L7YA 4BJHB 4BX9A 5KNBD 4Z4QA 2ZRGA 4ZHQB 4E70A 4HVCA 4JI8B 3PCRB 4KPFC 4Q4HA 4W7HA 5JRDS 4NJOA 1VJRA 2NU6B 2GZSA 3DE1X 4I50B 4HB4A 1UH5A 3T34A 3AYXB 2FRXA 3R7LA 3V7UA 1Q3KA 4EZIA 3GUZA 4OLHA 2VP0A 1Z28A 1KR2A 2Q50A 3T12A 4DUGA 4AJKA 3LX5A 3DZHA 4C01A 1WQ1R 3FGPA 1YDEA 1ZICA 5HMLA 1A3CA 4D82A 3QJGA 3WNVA 2OWEA 2QDXA 2ZT8A 3PFGA 4XH9B 5JNLA 1GSIA 1PKEA 4ZO7A 3PUJA 4PTLA 2Q28A 2P9FA 3PQFA 1X8JA 4DM7A 4U7DA 2ZRKA 4UU8A 1CUUA 3PCTA 3G1UA 1GUAA 5IDYA 1TJ5A 4G41A 4N5MA 4BVHA 5AVZA 4OPMA 5JZ9A 4FHGA 2DTEA 3CMCO 1ML4A 3HA3A 3PC2A 3HJBA 1J33A 4M0MA 3BZBA 3HV0A 3HYTA 4FIDA 1RAAA 2WLSA 4MI1A 3PTAA 3I6IA 3M3PA 3H16A 1CB0A 3FVWA 5DP2A 5CFOA 5JBIA 2CNKA 1U2SA 2FG5A 1XFAA 3MVEA 3AUFA 1M1NB 4EMSA 4KTTE 3O4RA 1H9AA 4Z99A 4B5KA 1WMSA 1P75A 3A1VA 1OXUA 3FUUA 4OHXA 1UM9B 2A59A 4IZ6A 3W2GA 4FUTA 1WKVA 4UE2A 1UAGA 3QXGA 4HLDA 5ERYA 1MZVA 3N9IA 4CL0A 5L45A 1JKXA 4X7RA 4QA9A 3TX2A 4UBMA 1ONNA 5M3BA 4QUEA 1UODA 2PUFA 4ARBA 3A28A 4GG1A 4XCVA 5JROA 1TZBA 3O8QB 2VDQB 4H15A 1E3SA 1VMKA 3GJYA 4JXXA 3C3EA 3E2IA 2J0SA 1OPRA 1U2PA 4PCLA 4Y30A 3TI7A 3WLIA 4WW0A 5B4VA 3CZAA 4LVNA 1ISGA 1JWAB 2F43A 1TPYA 2WAXA 3KYJB 1HNWB 4LKRA 3PHHA 4HGZA 5CRIA 2QUIA 4S0ZA 1QXSA 1Y3DE 4FB4A 2UVDA 1IY1A 2RGDA 4FFRA 4KR9A 1YV9A 2AJBA 2ZQZA 3SJUA 2VYFA 5D87A 1UOPA 3I2JA 4F46A 3JARB 5T3UA 4OX9B 1XJ5A 3CN9A 4II2A 1TVEA 1XYYA 1U7HA 3A9CA 3AUJB 4AXXA 5DCWA 4DIDA 5C3MA 3QYAA 4X20A 2BTEA 5AM2A 2XHEA 2I91A 3RSLA 2HHJA 5JAUA 5D86A 1EQUA 2CHVA 2ZT5A 3VU3A 1H1TA 1LSSA 3CINA 2FK8A 3JASA 4BJ5A 5KPDA 1DWOA 1NN0A 1RFLA 2PQMA 5HZMA 5JAMA 1MJ5A 3RFVA 1WXFA 3KFLA 4MRNA 1J6UA 2Y0EA 4AJ1A 5A1TA 3NHZA 3DE0X 4WZ6A 4HMQA 2FJUA 4S1VA 1W44A 3JVVA 3GHYA 3KJIA 4ZCTA 1YR9A 5JD4A 2KBEA 1GKYA 1PR4A 1IVNA 1OLSB 1ONOA 4A0RA 4AZVA 1R0BA 4XVUA 1MGOA 3BWBA 3SICE 4F86A 5HWSA 2QU7A 2CB0A 3GK3A 3BSYA 1M83A 4ZVRA 3ILYA 1F12A 4QBFA 2C9DA 2O7RA 2Q1XA 5DBOA 4YO8A 4AZ0B 4F1JA 3NH6A 2BFEB 1YDFA 4IFTA 4MJLA 4TMFA 3GFPA 5NULA 3S1LA 1JHRA 4BEJA 1VBNA 4U7TB 3BK7A 4RKQA 4NV3A 5HHTA 2IYAA 1GL3A 1J07A 1YVPA 4N5NA 1YUMA 5EJFA 3E5NA 5KYNA 1ZNWA 2O5VA 3O2NA 1NW7A 5ELXA 3UW1A 2PJUA 1EMDA 4BO5A 4L73A 4V3CA 2UYYA 3WICA 3DMDA 4Q16A 2AB0A 4QEZA 1L8QA 2GD2A 1KI2A 2YOHA 4AKGA 1BEZA 1Q12A 2XCIA 4HP8A 5EIEA 3MQ2A 2H5EA 5K3EA 1SBHA 4PCUA 1G8JA 5TARA 3CKKA 4ZCLA 1M2VA 1QX4A 2BD0A 3Q9NA 3I23A 2GTPA 5TY0A 3UK2A 3EVEA 4QGGA 4UFNA 5AVJA 3L1UA 4Y2JA 3ME5A 3ETEA 4E2YA 2Y1OA 1VL2A 1I24A 3RUFA 3A1SA 3C7CB 3NJ8A 4FX5A 1PJ2A 3AUSA 4RGVA 2X7HA 4S1OA 5LR6A 1PL8A 4JT8A 5A03A 1U6IA 2GJAA 2V58A 3GUYA 4G97A 4MNTA 1ES9A 1XLTA 2PRJA 3AB3A 1RYEA 1Z8FA 1US8A 4KWEA 3ZGNA 1WTCA 2PG3A 4B7XA 3DBOB 5A4AA 5K2OA 3OTOB 4NARA 2XKJE 1FVHA 1LX6A 1OI7A 3JW8A 1MNQA 2NTYC 2VLBA 1FIUA 5L40A 3AFGA 4LXQA 2F6RA 3ZVRA 3KP1A 1X70A 2VK8A 1USWA 1PT7A 4P0PB 3MJVA 1VDMA 1XU7A 4ZCQA 4F7WA 1OYOA 2HSZA 4BKRA 4OXNA 4CKCB 1QHGA 4ZT6A 1N2IA 4X3CA 5CH3A 1K8QA 3CH5A 3DW3X 2BM0A 4F4FA 4LXGA 1UP6A 3IS3A 1QCYA 3OI7A 2RGXA 3L0IB 2I7TA 1Z12A 5B7QA 2XUIA 2AG8A 3PYLA 4Y9TA 3PENA 1NP6A 5DLYA 5C80A 1G8PA 2ETXA 1XT6A 5AHXA 5JD6A 1QYIA 2VP9A 1ZRHA 1NC3A 2A78A 3ONVA 4YJGB 2P90A 5LM3A 1CZLA 1SB8A 1XTRA 1Y7HA 3LVQE 4NCAA 4M8KA 4M46A 3EXFA 4BJ1A 2CFRA 3QBVA 4BAZA 3AINA 4UHJA 3PNBA 1YVDA 1ODFA 1QGAA 1KQGA 3RC8A 1G6KA 3GDOA 4P98A 5FWXA 3LSTA 3UGQA 4ZI7F 3M0EA 3ZCVA 4DBVO 4DR1B 4W8GA 3E4DA 2XF2A 3C3JA 4RTPA 2BH2A 2G67A 3ZCXA 2WTXA 1E9AA 5GJVC 4PZ9A 4JJKA 3BM5A 4JA0A 3KKMA 3TDKA 2EWMA 4U2FA 1IHYA 1WOYA 2PKRA 3JX9A 1E8DA 1NQOA 3L7CA 4EVRA 5C46F 5LD2C 4LYYA 4RPLA 1NZFA 2F8SA 4KR0A 1W85A 1A5BB 3OJXA 2FWMX 4LW8A 2O8CB 1MIOB 1ZIOA 1K98A 1GXSB 2AEJA 2CXNA 3G8AA 2QJTA 1QRAA 3D8HA 1CU1A 3K05A 3O2SB 4JNKA 4QTUB 4WLUA 5H0IA 2VCHA 4EYGA 2Q1TA 4ZI7B 1T6BY 3GJ6A 4V0NA 4ESEA 1MB9A 1F9AA 2QRVB 1I2AA 2EW8A 4H6PA 2BZGA 2GN0A 3N5CA 4L02A 5A9SA 3I4FA 5BWCA 3AVYA 1PE0A 2RGWA 3CNBA 2AFHE 1QCDA 2QTFA 3WRYC 1CTQA 1J9GA 2FW7A 2QE7A 4OGLA 1XNQB 2AUNA 3IBGA 2ASEA 4QU8A 3D2CA 3I6QA 3VTZA 4JVMA 3EEFA 4F4HA 5JZOA 1TF7A 1U2QA 4C1BA 1NRIA 3GCDA 1IVSA 2QW8A 3B6ZA 5CAEB 5KCZA 1YL7A 2UVQA 5IYZA 2H3EA 1YT5A 5ALZA 4X71A 5F3WB 4ZZ1A 1KIMA 1J2TA 5LLTA 2CV0A 4D9JA 4MW7A 4YAWA 1UANA 1NA5A 1O4VA 2CUKA 2LBPA 2N1MA 2PRZA 1R64A 2HIHA 3GEBA 4OJTA 1MG5A 3WS7A 2XVZA 1JPVA 3HHEA 3IBTA 1LDEA 1JDVA 3C3DA 3BYZA 3SD7A 2ZDGA 3KKZA 4L57A 5GADl 2X22A 4A03A 3BBLA 1U5CA 1ML3A 1E9BA 4RVCA 5KB3A 2BYTA 3SG0A 1MOZA 4FYIA 1HXHA 4XUGB 2QPAA 5THXA 3UB3A 5LDDC 1V95A 3MUFA 5IM4A 5GIOE 3N2ZB 4R2MA 2QJRA 4UHEA 4ND6A 2VATA 1A9OA 1OAOA 1UXKA 3WGOA 4C2AA 1EFVB 1TYEB 3WYDA 3ICVA 5BR7A 1HQDA 1COWD 3FG9A 1BO6A 2Z08A 4DCJA 2REOA 3PUYA 5H9VA 1OBVA 3VPXA 3RAPR 2I55A 3PJEA 2JLQA 4PR0A 2UZAA 2Q29A 3D4PA 5KYVA 1Z82A 3QJYA 1N34B 1KMMA 1TK9A 1ZISA 1WXQA 2FZWA 2VXBA 4CDMA 3B1XA 1F1JA 1PFUA 4DLUA 1W75A 4TYMA 3ER6A 3HLYA 3O0TA 2QG9A 1F2DA 1JL3A 4FFPA 5TT1A 1ND5A 1DNPA 2OGUA 5TQ2B 4XWWA 3GDWA 1ZN7A 4AO8A 4KV7A 4NSNA 2YWCA 3DOUA 3IURA 3HXLA 1P31A 1JMKC 2D0OB 5BUZA 3EB9A 2NYUA 1TD1A 4MHOA 5KKNB 1BSVA 3U37A 1U1GA 3GA5A 4PW0A 1G8YA 4W4TA 1V3TA 1KFBB 4DSUA 1P2VA 1TDJA 1XZGA 1B14A 4LJAA 2YBDA 5KOIA 1OH6A 2DUJA 5ALYA 2ZXEA 3CXUA 3WLQA 1P0QA 1SBCA 2YQ4A 4BTLA 1PJTA 2W00A 3FMFA 3LF2A 5DGCA 2OMKA 2ATIA 1IM8A 1R4AA 1E2HA 3AYZB 1B15A 1LLCA 4G2TA 1HDEA 2PL3A 1NBOA 3NKLA 4LV8B 3WA7A 2ZUUA 3LLUA 1WXDA 1XNJA 4OHOA 5EHNA 4ZCPA 4RS4A 3DEZA 4COOA 1GTMA 2OV1A 2R8EA 4LSZA 3QELA 3AEZA 4OSPA 1X7XA 1CRWG 1DCFA 1YUBA 2Q62A 1RBYA 5DBIA 3K8OE 4G9GA 2UUPA 3WJ2A 5JXIA 4RTJA 2G9VA 1R88A 5EC8A 5KTRA 1GAXA 4OJMX 5T8KA 1G2QA 1ZMTA 3DVAA 3WKCA 2OG1A 1ZGJA 5ALWA 1VYUA 2IPMA 2VAMA 4O4IB 4TL9A 1YWGO 1U0GA 4HLUA 3DMHA 3VO1A 2J6CA 4BQEA 4RL4A 3SBDA 3A11A 4QO8A 1YONA 4HRXA 1YKGA 2ZUCA 1O57A 4RS3A 4R6XA 1MT0A 3E0XA 4C4ZA 2I2BA 5BRAA 4J6FA 1V5FA 5IX8A 4QJBA 4U1RA 5JMTA 1H94A 2X0RA 1ILWA 3NIWA 4K28A 4WKPA 4JU9A 1YNSA 1AKWA 4K05A 5AW3A 2GK3A 1E9SA 4RAOA 4B2PA 5I9NA 4G26A 1I30A 5C4GB 1XJWA 2HRZA 2WFMA 4FFMA 2UYGA 4NU8X 5JU6A 4NAVA 2FSPA 2MIIA 2IC5A 3ZW8A 5F12A 3DPIA 4AC9A 5L6MB 1EHYA 1SVIA 3D3QA 1Z17A 2YZKA 4I99A 2XUJA 5CW2A 5D00A 1YBMA 3G7SA 3RYIB 4BYGA 2HF7A 4QGHA 5AM4A 4G5FA 1M73E 1N2GA 4IO0A 3Q8KA 1XGKA 5DTJA 2EWWA 2HCBA 4YJ3A 3ZWNA 1BJRE 3I92A 5CIYA 1E5DA 3H0CA 4OMDA 3R5KA 4MUXA 4KOEC 4DV3B 3D1JA 5EMKA 5COBA 4F2PA 1WULS 2YRXA 4X44A 1NMXA 1G41A 2OWDA 4HZUB 4LOIA 3N7UA 3LC1O 3WISA 3RYCB 4XDGA 5J2UA 5IKPA 1NUUA 4NG4A 4IQGA 4MMZB 2WB2A 4XUDA 3WQQA 4NG5A 2D7CA 3FZNA 1P7YA 4C7VA 2I2AA 1SIWA 3W5JA 5JRZA 2JFWA 2A0XA 2Z1DA 2ID7A 4G1BA 3HRKA 3QG1A 3QMPA 4L8WB 4MQ6A 4Z9FA 3L40A 3RVDA 3MFYA 4RPCA 4BMNA 5JSZA 2NVBA 2GN9A 1G9XA 1SA0B 3RWOA 1WB6A 1K6MA 2MSDB 4DJFC 4YDHB 5AKIA 4UBNA 5EAIA 4EF5A 3TW8B 2D5AA 3G6KA 5C52B 3L7BA 1U7ZA 4DW8A 1RWWA 3FB1A 4ZAGA 4V02A 3R9IA 1QKKA 5ERXA 4RF2A 2XE8A 3Q6NA 4R9VA 1N3LA 1Y1QA 5K0BA 5JAHA 1CW2B 4DBLE 5LFAA 1QR2A 1SPBS 4J0HA 5DBFA 2JD1A 4JYAB 4WOPA 2P4UA 4FFSA 4YPVA 3OF5A 1M7BA 4AURA 2R6CA 1OV4A 2PBZA 3CCFA 2R7KA 3KHTA 3N0TA 4LV5B 5IMSA 3KVRA 4XJTA 4CV3A 1KMQA 1NSTA 4YCMA 4LZAA 1L0BA 5ITWA 3NBQA 4OG2A 3CZMA 4ZDWA 3PKJA 2CEKA 4BU1A 1WLYA 2GARA 2OCYC 3M6IA 1AUPA 1NJFA 1WSWA 2QDKA 2V5UA 2WJ4A 2DLDA 5ALGA 1RE1A 3UWOA 2EIXA 4G07A 4NE2A 1PJ4A 2CDRA 4NBRA 1NW3A 1Z15A 3TW6A 4PC7A 2IBTA 3PEYA 2R5WA 2AG1A 1Z7EA 4RDHA 3ETJA 4JJ7A 2DTXA 3NDPA 1NHWA 5EE9A 1HRDA 3ROFA 4C20A 4W63A 1KAEA 3OU6A 3WMFA 2PA3A 3Q0IA 5DIFA 2EKPA 4B34A 2YV2A 2FMHA 2C2ZA 2IXTA 3R76A 3E7XA 3IESA 3ZY4A 2PZBA 2JIRA 3SIPA 4M76B 4QICA 1Z0AA 3BRWD 4NECA 1ZA1A 1Z5GA 3L06A 3QUQA 2QB5A 1BOFA 2HA5A 2HJHA 1UJCA 3KJXA 4JI5B 2C2OA 2WOJA 3HLTA 1U8ZA 4MYUA 3PGMA 3LU1A 1PGQA 4MCJA 1CQIA 1NY5A 1V41E 3Q8LA 3COVA 2JIPA 3QEMB 3R5SA 2BGGA 2V96A 3IMEA 1ODKA 2BMDA 2QN3A 2IKSA 3ETDA 2RGCA 4PS0A 1EGQA 3KR0A 4MDFA 3WR5A 4TZ6A 5H3HA 2BZ1A 2PSDA 4JBIA 2O2JA 2VJOA 3NVDA 4YYZA 3A3YA 1KMCA 1D5CA 3E70C 5TT0A 4YMHA 3W2EA 2DYKA 3RCBA 4TXNA 1IYZA 3OHMA 4QPPA 2V4ZA 2IYUA 1J8DA 2XADA 1UKVY 4K9KA 4IIHA 5CNIA 1LPNA 3WDLA 4CODB 3KV3O 4C5CA 1HYEA 5K0SA 3UXMA 1J8YF 2XX3A 3UC9A 3TX6A 5IVHA 3B85A 2EGUA 3RROA 2JGFA 2WVHA 3BJIC 2DT8A 1KKMA 2KLHA 3M9XA 1Y7TA 5F1OA 5GGXA 5B12A 1RJ9B 1XZBA 2X13A 1K1EA 4J0IA 1VXRA 4D4IA 2XVMA 3DWEX 2ZJOA 1LVGA 3T7CA 1FSZA 4HGNA 3MJDA 3R5TA 4MW0A 3WYAA 1IG0A 2VPWA 2WHQA 4MV8A 3AZPA 4MV1A 4G8JA 4CMBA 5DNAA 3K4QA 2BJVA 1NQUA 1V5EA 3CMMA 1H93A 3P0HA 4RY8A 2QX6A 3VR4D 4J49A 2BSAA 3O8BA 1ZIPA 3KZKA 2VUHB 3CLKA 1N6PA 2IA5A 4MXDA 1WBJB 4Y1RA 3RV3A 2G36A 3RLFA 1MABA 4C7KA 5IT9A 1O0BA 3L6UA 4D4LA 5D3KA 3C8ZA 3I73A 4ZU6X 4QG3A 2O2DA 1G8SA 1I5OA 5KMGB 4UVDA 3HCNA 2WSBA 3R3VA 4KQKA 2VT3A 4LSMA 1Q1GA 5E1BA 1HORA 5DCYA 4MQLA 4DQ0A 1OMOA 5AOAA 1Y5MA 4K9SA 4HNAA 1DTEA 3DEAA 1XE3A 3NYWA 4MV3A 4CTMA 4IG4A 1GNPA 1NBMA 2AFIE 3PWSA 4ROTA 1HPLA 3AEKB 4C2TA 1DDIA 1N2HA 5SY6A 4HT3B 1Q0QA 1JFTA 3TOZA 1IDN1 1QWSA 3PX7A 2OPBA 2M6SA 3T0FA 4HNQA 5FORA 2C8VA 5CK5A 4BTVA 4H3VA 4DCUA 3D6AA 1I3KA 4ZJPA 3O8NA 1JKIA 3E23A 4MULA 1GQQA 3W06A 1S2GA 5FLKA 1V3UA 1LX7A 3T61A 3FBTA 1EWKA 2HH9A 4S3MA 5CDFA 1TUIA 2ATCA 2RKBA 3PSAA 1RRKA 2X1MA 3GMIA 3RYFA 4PC3A 3TPCA 3U09A 5HA5A 2F1RA 1W76A 4TV9A 3BWVA 5C51B 2EP8A 1RTKA 1LBTA 4XD7D 1FNNA 4DJJA 3PEVA 3REQB 1AB5A 4QUHA 1GZSA 1BAPA 1IC6A 2PO5A 4IJWA 4NAUA 5FOXA 3REFA 1N6RA 3KPVA 3RT9A 3WK9A 3SOZA 1JH9A 3UUGA 4KNYA 1KMHA 3PXBA 1KI8A 2QTNA 3ENKA 1L7PA 4NOKA 2ZR7A 1LNSA 3RHSA 1E2KA 1FNCA 3N58A 2ZAGA 3KTOA 1J7KA 4HDMB 3O1LA 3PPIA 5DGDA 1CUIA 2Z5LA 4Q7KA 5CH5A 5EIFA 4E51A 4JJFA 4DR2B 2OZLB 4FCVA 4JOCA 2COEA 4H0CA 4W5HA 4ZMRA 2UZ4A 3EUWA 4IG9A 1DKRA 3F3KA 2A57A 3FCCA 3O9ZA 1RI2A 4PYMA 1Q5PA 4KO2S 4WBSA 1WHSA 1XDSA 2G7MC 3P2JA 2ILVA 1EU1A 5E4JA 4QPNA 3V3KA 5SYNA 2OBYA 2ECOA 4RLSA 5EWJB 3VGPA 4CV2A 2X1LA 1BRMA 1C1XB 1ONBA 2PVPA 2SCUB 4JFAA 2H52A 1SUEA 2DE0X 2Z2IA 3CW9A 2R6FA 4KX5A 4LE0A 1E2GA 4AB1A 4QFCA 1XZFA 4B80A 1NSYA 1N7HA 1QIFA 4BBZA 3HSYA 4G2NA 5LZ8A 2F9MA 3R8FA 2OAEA 4FHCA 4PE5B 3LPDA 4JUAA 1UQRA 5AI0A 2V98A 2R1TB 2Q1WA 1XQXA 2B98A 3TKYA 2WMDA 4YI3A 3ZW9A 2GM5A 3DTVA 4X91A 3C1TA 1T6ZA 3U7EB 2C2WA 1MV8A 2HWKA 3OCXA 1UT6A 1FE8A 2LRHA 2ZI7A 2ZBEA 2LE0A 3PD7A 5KU7A 4JSYA 2PL9A 3ESYA 3VR3D 5KU1A 1CZHA 4IX1A 2VZEA 4BNNA 1W4BA 2YHBA 4P34A 1XZJA 2G72A 1J23A 2JJ8A 3DHYA 3QWBA 4GH5A 5TQJA 1KA9H 4PX2A 4MW6A 4XVCA 4HBZA 3C87A 1M8GA 2CXQA 1EKXA 1ST2A 2N9UA 3CUKA 3WK8A 1YB2A 2EW1A 3VU8A 4RZHA 1YA6A 5D8DA 3ONFA 3FJOA 4HTFB 1KZ9A 1NF2A 2B82A 2CMDA 2A6PA 2XNDD 2ORVA 3UMBA 4DLYA 4IO1A 4DMFA 2FPPA 3UGTA 1GNLA 3S7TA 3NI2A 2AOUB 2VWHA 5KX5A 1XRMA 4I4TB 3KQNA 3JXEA 1N2CA 4UTZA 3LM8A 4MUIA 5DFAA 1TZMA 1E2JA 4A8HA 5IULC 4EHBA 1F9EA 2HR1A 1TX4B 5EJAA 5C4IA 1NBEA 1RJDA 3RVQA 3LZDA 1L4EA 3VX3A 2LW7A 3CF4A 1IU9A 1NRXA 3G8BA 4D42A 2OVFA 2ACWA 1JSXA 2FU5C 3LW8A 2CJWB 1GZHB 3FLEA 3JWHA 4L5YA 3MGGA 3IPRA 3KXPA 1JJBA 2JHCA 4KV9A 4AO6A 2GXQA 2PX2A 3V7NA 1M2NA 1DBIA 5LBTA 3GJ0A 4DCPA 4J2TA 1RWKA 5CJ2A 1Z7WA 5FUXA 5AXAA 2PPVA 3IAHA 1E96A 5DRYA 3QVJA 5E38A 4MICA 4RD6A 2VSXA 2WIBA 1L8OA 3Q8MA 3RBXA 2JBHA 3S6JA 2H2GA 4KIWA 3RAJA 1AF7A 3PFKA 1LCIA 4O3FA 1XLWA 2VHJA 4N47A 2HQSA 1L4MA 4RKEA 1VGQA 2F1OA 3FPFA 3U40A 1YBVA 5EZYF 1GNQA 4UHKA 2OLKA 3WL3A 1ZRMA 3GRZA 4NPHA 3E27A 4PLFA 3U1BA 3WXBA 3FPHA 5JO0A 4D45A 3GPDG 4JX9A 3DEYX 1XZCA 2HU2A 2VSQA 3B5EA 4RJKA 2D4AA 5KOJA 4K86A 4I55F 3M2TA 4ZGGA 1P9OA 2VDPB 4JJAA 5JY1A 1CC1S 1EQAA 3GU3A 2FWPA 4I9FA 4JLVA 4LCJA 5FAKA 3FNIA 5DTQA 4FEAA 3GT4A 4JI0B 1MC8A 4QATA 1YIAA 3U7IA 2PUCA 2VXOA 2NSDA 3FCSB 4BV2A 1Q1ZA 2LIPA 4B3HA 3M82A 3A6EA 5EZYB 1ZA2A 1XVLA 5A0FA 3UJ9A 3WIUA 3DCIA 1FJGB 5AKGA 1JA0A 1YNOA 1G21A 4NV0A 4PHTA 3U4AA 1L3IA 4CF4A 2PMEA 4ZGBA 3R3WA 1MQ9A 2FUNB 3QHQA 1U99A 1D2RA 2AW3A 4TZTA 3SF8A 2O7QA 5ERGB 2F8LA 1LF0A 2IX3A 4MGIR 4PV7A 4AJLA 3FTCA 2QRHA 4HQ6A 2ZU6A 4MYDA 3NJ4A 3VR5D 3EZXA 1FUKA 1P19A 2W90A 3HDQA 4O29A 5EPOA 1AN9A 1TA9A 4EFMA 4EYQA 4KIGA 1T1RA 1C1DA 1I3LA 4FE4A 4CNQA 2Z2KA 2UVPB 4M2LA 1UWCA 4NIMA 2W2QA 4FDMA 4TS1A 3GLGE 4HZIA 3AJEA 1T25A 3BKWA 1TJNA 5KQSA 1CUAA 2CVHA 4L51A 4MLDA 4KL8S 3QFSA 4NMLA 3ZNNA 3WRWA 1H4SA 1VE7A 5HFNA 3WNZA 3TSZA 1KYZA 3ZY2A 1RRCA 1XD2A 4L3VA 3OECA 1ZPDA 3BBPA 1NFQA 1ZD2P 3MAGA 4XWKA 4J0FA 2CXSA 4CI0B 1JKJB 1W0JA 1R1DA 2FPXA 4RELA 2Y9PB 5A3QA 4L50A 2V4MA 4P5EA 2UZ3A 5EUBA 2JK0A 2G82A 4B3BA 3SXUB 1M67A 4DMKA 4EW2A 3T7AA 2LR0A 1AK9A 3PNMA 1YACA 4HJXA 4YQYA 5MFZA 5FL3A 1RSZA 2R8BA 2HJ9A 5K03A 2AKAB 1CPYA 1XRLA 5J9FA 3FKSA 4EY6A 4G0WA 4KXXA 2I67A 2WOOA 4E32A 1W48A 3MMXA 2WG1A 4LF6B 1V7CA 3WL5A 1S6YA 1RWVA 2P0YA 4GI5A 3VYSB 1A5TA 1GITA 4X95A 1LTKA 1NIJA 5F78A 2NXWA 4AZSA 1FU7A 3LAWA 2YW2A 2X1HA 2X5JO 1P2DA 3F73A 1FXSA 2ACVA 3VPHA 2O23A 3PIIA 4Q47A 5EKXA 7REQA 1N8NA 4X5OA 3A7DA 1MRZA 4L8GA 5E6RA 1SUAA 4D02A 3RTBA 4F96A 4MV9A 1K5DA 3MWEA 1YMQA 3VR6D 4R1TA 2AOXA 3LE8A 1T4BA 1V6SA 2FKAA 1ECBA 4L28A 5FR1A 3W2TA 2QD5A 3D2LA 1B93A 3HKEB 2I4NA 1ZCZA 3KZMA 3P5SA 2JC3A 4X8MA 4QAJA 1M1YB 3RNLA 4RK4A 4M54A 3RS7A 4MS3A 4YJHB 4EG7A 3WQSB 1HO3A 1W2GA 4G0XA 3RPEA 1AV7A 3NO4A 1O7JA 1OW3B 3SU8A 5BMVF 1N4DA 4OEHA 3AVTA 4KQJA 3LCJA 3BEOA 2POQX 4Y2RA 2EKDA 3KJGA 5CB0A 3QF4B 4AQDA 2HDWA 1W4ZA 4F91B 2PGNA 4WERA 1T8RA 2JJ2A 5ITZA 3AERA 3PJFA 1YRYE 3H4TA 5B4TA 4RY2A 4O1HA 2QVXX 5EA2A 1CS4C 2GVZC 3HYNA 1CUHA 4G6ZA 1E1CA 2PHZA 3G2IA 1G5FA 4NTZA 4CR8A 3B3GA 1F3OA 1P4GA 3KZ1E 5JPIA 4O2AF 1B0ZA 4NF2A 1O0SA 1XHLA 3P2KA 3G2PA 4P3OA 4CMCA 1ULSA 1O96A 5BMVB 1HOTA 1KZ1A 3JRNA 2VTBA 6CHYA 3FTEA 4DV4B 1R5BA 3W90A 1WMAA 2VNHA 1Y4AE 3L77A 2FOLA 3R3HA 1GFWA 4LNUA 4R0VA 3MMPA 4XKJA 3JR7A 4YRKA 1O08A 4QZVA 4I1VA 2J45A 1BNCA 1SD2A 4ZQFA 1K8YB 3FDXA 1MORA 3OP4A 4NEQA 3SHFA 4C88A 1ZM4A 1NXOA 1K7EB 1WJGA 3DOOA 3MJSA 3OPYI 4OUKX 2X0IA 4KACA 4JVSB 1YC5A 4QLOA 4OHVA 3S2SA 3LKBA 2ZI4A 1VSVA 2XGGA 4YRSA 3VZQA 2KWIA 3U4CA 4OBWA 3T0GA 1B7GO 3C4QA 1M1UA 4B4WA 4OVKA 4B2IA 4W7IA 3FYUA 1FXUA 4C0WA 4BFVA 3T5DA 1JBQA 1LPOA 3ZKWB 2EQAA 1KRXA 1CUXA 1IRXA 1KFJB 1U0NA 2QORA 4AJ2A 5SYMA 1E1NA 2VEOA 3VPCA 2IYZA 1ESDA 3R0ZA 2YMPA 4HFRA 4DMUB 4U2KA 2V1UA 4LJYA 4LFAB 1XVUA 2JI6A 4DV0B 3HPQA 3S5UA 2FEWB 1WSBA 2JIZD 3O73A 1EG7A 1H8ED 5L7YA 3HXQA 1LNZA 3RC7A 1JJ7A 1DLJA 2X41A 3GLKA 3JZFA 1JTEA 4ER5A 4GICA 2O1SA 5EEHA 1IK4A 3PK0A 2I6FA 2CXUA 4XB1A 1UBRS 1QOZA 2XZLA 2PT5A 1B41A 2IHVA 4YRZA 1F4VA 2H08A 3BB4A 4NATA 4OHRA 5TEWA 3P32A 1CNFA 1MEOA 4AMUA 2R79A 3O8DA 1C81A 2F9LA 1FMJA 4QELA 1E2FA 2QVYX 4Y6SA 4YH1A 4A2QA 1SGWA 3ND7A 1UPTA 3H2JA 2OKCA 4C43A 1R0RE 1TTHA 1A9XA 4RHEA 2AJDA 3GUCA 2ZRCA 3CNHA 4WJKB 2PKXA 3IEPA 1ESNA 1L1QA 1JEJA 4LXIA 4EATA 1R4NA 2DXIA 1D4AA 4J07A 4K6FA 1XAJA 2VHUA 4FEYA 2QGFA 2IYEA 1EBFA 1MW8X 2Y6UA 4PS1A 3SS8A 4K26A 2C31A 4NENA 2JFQA 4Y2SA 3ANNA 1M72A 5K0NA 4XGRA 1YFLA 2M32A 1DFHA 1YOVB 1JR3D 3GR6A 4RK0A 4UUAA 5FV7A 5BV0A 8ABPA 1CJSA 4YLEA 3DQZA 3K6JA 3SQLA 1G55A 1B43A 3NR2A 2ZBRA 3DQQA 3RH0A 3D7SA 3JTMA 5TMEA 3PHCA 1MQAA 4UHBA 3AVWA 4C6HA 3OAAA 1V37A 2ZR9A 5FT9A 3UAZA 5B6PA 1N36B 3LXMA 5H5JA 1Z73A 1PSWA 4ZVQA 4F1KA 3V8VA 3FMVA 3WIEA 1Z0DA 4QDUA 5BQ5A 5J4YA 1W88A 4OX9Y 5BT8A 5F5LA 3SSMA 2ZSDA 3PXCX 4N65A 3I39X 3WGJA 1G2PA 1KK3A 2XRYA 3A6DA 4TRMA 5YASA 4O25A 1UAYA 4LI3X 1SXJC 3MQFA 4POOA 1A95A 1ZNYA 2NUPB 5K8UA 4QRIA 3HLKA 4LXUA 1ZVKA 4U7WA 1N5DA 4M8LA 1I8TA 3VVBA 4BKMA 5HKKD 5MDHA 5C8YF 2M6LA 1F2UA 5EMLA 4D9IA 2NIPA 3EF3A 4K9MA 4Z1OA 2W4IA 3GRAA 3NHFA 1SC4A 3I32A 2NZWA 2CFTA 4OH1A 4GZ3A 4ECAA 3KJNA 3SHOA 4N39A 4JCCA 2H3HA 2QN2A 3TNJA 4LJ8A 1I94B 5I8PA 5EE1A 3FNQA 2QQ5A 1W35A 1DZ3A 2IYRA 2RHTA 3K96A 1ZEJA 3L6EA 2V7BA 2H57A 2OB1A 3ZHRA 5I47A 1CQZA 3DDSA 3N0WA 3V4RA 1IZZA 5C8YB 4H3SA 1C9JA 5BSRA 5A2GA 2PMBA 4NRDA 5HPYB 1JHOA 3DCJA 1T8PA 4MQBA 2ZE7A 5EVCA 4AECA 1VL6A 2I8LA 6REQB 1JT9A 4LBYA 2B8NA 3EGOA 2Z8ZA 3FFBA 3U4DA 2VJYA 3CVJA 3QTLA 1YKFA 4LZWA 4F3NA 1Q74A 3AESA 3K2IA 3DXXA 1ECGA 4NEHB 4X1IA 1H42A 1ISJA 1KEEA 2WYOA 2J4CA 2QN6A 4J9UE 4P7FA 3TTUA 4YT4A 2IV7A 4OHWA 2ZT6A 3CA8A 1N3IA 4YRPA 4EWLA 5IC4A 1UKCA 3WWYA 4QECA 3BXPA 2PZEA 3Q7IA 4DDMA 1M5TA 3IAUA 2OO5C 1EHCA 3AH8A 2QUJA 5K3BA 4G0YA 5AP9A 1ECLA 5KC8A 2ZATA 1KMNA 4XPIB 5A5FA 2FSFA 4LQ4A 3AFIA 5FEUA 5IZCA 5CD1A 3OC0A 3VV3A 3NASA 3KKEA 3ZGYA 4C0HA 1T3TA 4JP8A 2HGZA 4PYOA 3UHJA 3DWFA 3LPCA 1XTZA 4MWBA 4PLGA 2WU1A 4MWSA 3W4KA 3ZTWA 2N3ZA 4CU2A 2B35A 2XGMA 1FDWA 4LXXA 4M1KA 5JAQA 3TLZA 1PN3A 1DPFA 1SUWA 2A14A 2EC5A 2IBMA 3MB5A 5CFLA 3EEOA 1MBZA 2WTNA 1TFUA 4QC2A 5KDLA 2ILTA 3RTCA 2B8WA 5DT2A 5CCXA 3EXG2 1G5IA 4B17A 3MUNA 4CRWB 3WGNA 4Z4GA 1FX0A 1GIAA 1VL0A 1YVEI 1ZX1A 3NIFB 3AL2A 5FNZA 3X2SA 1NLFA 1M7HA 2B1QA 3VKUA 2FUG6 2DPYA 2GJSA 3B3FA 4GW3A 1XJQA 4J90A 4JSRA 4YDSA 1TEZA 3DC7A 4D4GA 1PEAA 2CLKB 5DIZA 3MYRA 3KWFA 4D99A 5HCUA 1U81A 4Z3KA 4ZHQA 1I7PA 4DA0A 5MN4A 2ODEA 2ZSKA 3OPNA 1G291 4MZXA 2X58A 4GM1A 4QFDA 3OOJA 2NU6A 4ES6A 4TTRA 3D64A 5HKLA 4I50A 1UBJS 2LCQA 1YD7A 1RAGA 5LB4A 1T1JA 1SQ5A 3TXXA 4ENPA 5IT4A 1KWGA 5JFOA 5AT1A 2FPWA 1YGYA 2QI9C 3P9SA 4HEA6 5JECA 2DSTA 3EWSA 2P11A 2AC4A 3IULA 1PJLA 3HCPA 5IANA 2CDCA 3F6SA 1KTVA 3ZJ4A 3G3EA 4RH3A 3ICQB 4L6IA 5KTNA 3KLBA 2ISCA 3ZK8A 1XL1A 2CNNA 2IHTA 2HCJB 1KEZA 1JSLA 4R2HA 4WK6A 1NZJA 1T0UA 4NBWA 4RMNA 3DCNA 3UAWA 2FOIA 1JSRA 1LS6A 3W5SA 4I2NA 5C2JB 2IX9A 4N03A 4Q37A 3C7KA 4PYIA 2GQ0A 1S9HA 5FFMA 3C24A 3E9ZA 1IUPA 2QUKA 2XV1A 3G0OA 2XEDA 3GBPA 3HQ4O 4F06A 5BR4A 5KOYA 3DKIA 3GYGA 1P6UA 3AV3A 3HFSA 3DE4X 3T52A 1MFZA 1M1NA 2QTTA 1GGNA 2VF5X 3E6AA 4WKNA 3WZLA 4AWBA 4DA8A 4Z53A 4NMMA 1Z13A 4QFMA 1V6AA 3FUWA 3BTOA 2CLIB 1UM9A 3OLWA 2DBQA 3FWHA 2P9HA 3UQYS 1WNTA 4F04A 2BHNA 4MCIA 3AIKA 1KHTA 4KZPA 1I5RA 1KBZA 1A4UA 5JSQA 2AFIB 4RJIA 1JWBB 3ZV6A 3JQ6A 3M6UA 1EUDB 1GO2A 2ZYAA 4P2GA 4Q4AB 2NZJA 4ABYA 3N2GB 3QKSB 3FFAA 4OA5A 3MBOA 4BNZA 3O8QA 4M0LA 5EKSA 2IKQA 3I9V1 1VSBA 2WHYA 3OLVA 1P1IA 4R05A 1HTWA 5E9JA 1NVBA 2NPFA 4Z4EA 1KZ7B 4JYMA 1ZM9A 3ETGA 3EZ2A 1MCZA 1RYNA 4CV1A 1R3DA 3CX7A 2XVYA 4L15A 2NUAB 2EFGA 2BGRA 2IRWA 2NZUG 2VRCD 1P6QA 2RAFA 2ZJ1A 5F21A 1JU4A 1HSOA 5FAXA 2F3PA 4FEGA 3Q0TA 3IAXA 4LRTB 5BR8B 3GAZA 1P17A 1PGNA 4ZZ2A 2QN1A 2ZR0A 4XCXA 1Y8ZA 1QH9A 2YCBA 3JARA 1J1IA 4BNXA 3EIEA 3HACA 4OLBA 4GLLA 1W1IA 4KJXA 1Y6FA 3LDHA 1AE1A 1IXKA 13PKA 1FQWA 1OUMA 2Y1XA 5EXTA 5IAKA 4NVRA 1MNAA 3HV2A 4X24A 3SYNA 1VHLA 3TI9A 3DVQX 2RGYA 3TZKA 7MDHA 2ZM5A 4G24A 5JPCA 4Y1GA 1C7ZA 4Q1EA 2RHLA 2YXDA 3B9RA 5KCMA 3MUOA 1VJTA 4N0EA 4UDYX 4XM1A 4QLBA 3O82A 3G0GA 1JIVA 5JD5A 1CUGA 2Z57A 4B1FA 4EGCB 3CKLA 2A30A 1NMYA 4E22A 1Y9AA 3KSUA 2L42A 4RH1A 2WHRA 3O03A 1GCOA 1OLSA 1LI4A 4GX0A 4BNFA 4EJSC 1PDWA 3WDMA 1VLJA 2YRFA 1Z45A 1A7AA 2JCGA 3DBVO 1IRIA 4Y6OA 4AZ0A 5AQ1A 1U8CB 2BFEA 1VDZA 1CERA 4POAA 2ZB8A 4ALLA 1MW9X 2R8RA 2MSNA 3PQ5A 3AJRA 1C4XA 2WKPA 4GZMA 2QYTA 5FB3A 4BB0A 4EY7A 2ZYWX 2B5WA 4P3NA 2XQJA 5B58C 4RPGA 4V1CB 4KMOA 1NUTA 3TZ6A 1AS0A 1WABA 4MGYR 4L4XA 1U94A 1YCDA 1Z0UA 2FXVA 4AROA 4XA8A 1Z34A 1K4KA 4D0GA 1COWA 3ASUA 1VQ1A 4CF7A 5HG0A 1I33A 3Q10A 3F1LA 1U7OA 4OYYA 1XV5A 3PQ4A 3RM3A 2RCNA 1BYIA 1QGUB 1QIIA 3OUZA 1WOMA 1IM5A 3R5XA 4JUDX 2AC7A 4LC9A 1ZC4A 4N3BA 3WOVA 3ZU5A 1Z8NA 3P8ZA 1OIWA 1NTRA 3KTAB 4J8PA 2BMWA 1MAUA 1QAQA 2C92A 3K0CC 3EBOA 4L78A 2M6KA 4QDKA 1VLMA 1HLFA 3O3NB 5G3YA 1A98A 1RHQA 2I66A 3E3MA 1X80B 2O2CA 1ZOIA 1ZGGA 2PUGA 1BKSB 4DB4A 1WU7A 3EGEA 2X2PA 2VHCA 4ZMSA 3D81A 1CUWA 4EBBA 2XCUA 2GB4A 2Z1NA 2YXNA 3S68A 2FPIB 5JCXA 3QPWA 2NVUB 3DFUA 2L19A 3HC7A 2OFPA 2OZKA 4F5WA 4Q48A 1F0KA 5HXAA 4XSHA 4RVDA 1GZ7A 1PTJC 3QXHA 3TQIA 4ACAA 3UMYA 4O3MA 1EK1A 4QYMA 4ARUA 1E3EA 5I4IA 2IYVA 5LNK6 1VJ1A 4QTTB 3L7IA 3RRBA 1W96A 4CM4A 2GILA 3U9TA 2QM3A 3JZIA 5AXDA 4EHKA 3C0KA 4D8UA 4LWOA 1C50A 4RVSA 3AX6A 4X6XA 3AF6A 1U1CA 3D4OA 4DNXA 2JVIA 1NXTA 3EMVA 3OIVA 3R0IA 4LZZA 5DOVA 1S4MA 2NSJA 2REXB 3UTDA 4CKCA 1UK6A 3TLAA 2WBLC 4XQCA 1U0OC 1XTUA 3F4LA 3BAFA 3GZJA 2CZGA 5CURA 3ZU2A 1Y1RA 1ZIYA 2PUTA 2Q5OA 3B1ZA 4IDBA 5DMHA 5FA5A 2NYAA 4BMSA 1U2EA 3ENVA 3UOAB 1VMIA 5EJ6A 2C97A 2HBRA 4JJ6A 1TTTA 4I8IA 2WMOB 4IY1A 1ZMRA 3B6KA 3LCMA 5ALLA 5B30A 3NX4A 621PA 2R00C 1VM6A 4YASA 1N32B 4YJGA 3HWX1 4PX5A 4A8JB 1C9DB 5EERA 3I5AA 4YFVA 2GLUA 1ZH4A 5ALMA 4B6QA 2BEUB 5CLJA 4BVLA 4UULA 1VFPA 1ONSA 1W6UA 2WYHA 1PDVA 4AYTA 3PHGA 2PN1A 2L18A 4BNVA 5B55A 1GNSA 2P9TA 2X86A 2B20A 4FK8A 3B60A 4URYR 2JAQA 1Q0ZA 5HGXA 3WHKA 3IPYA 3TGWA 1KAGA 3U3MA 5IRCD 3LLSA 3G85A 5AJTA 3V4FA 4CEHB 3RUCA 1R9JA 4PYKA 3O8RA 2PSHA 2E6UX 2GWHA 3F7MA 4PONA 5E3JA 5F1YA 1RXYA 1NJSA 2P9ZA 1FBNA 4XARA 1KE2A 3PC8A 2Q8QA 2QEQA 5J4LA 1XNRB 2XBLA 1AHNA 3C3CA 1MIOA 2C3OA 3F67A 1HEYA 4IQFA 1GXSA 4E11A 2O8CA 3PUKA 3HA2A 2MT9A 2ODPA 3GP8A 2GA9A 2WW8A 4N3GA 4A73A 1NVAA 4ZI7A 3DBLB 5TJHA 3GJTA 1IWBB 1HC7A 2QRVA 1U2DC 3F6EX 4BXOB 3ZLVA 5M29A 1D5WA 1AQIA 3TVTA 3OIFA 3CFYA 3PQ7A 3LUPA 4ZVVA 3WHIA 3C5VA 4RA6B 4DCMA 2OD7A 2XGJA 4M1YA 1LSOA 3E58A 2ZGVA 1YKSA 1K92A 2G76A 2E48A 5LA6F 5JH7F 1F0NA 4HNGA 1OA0A 4UMDA 1RDFA 1XRRA 1YCFA 2ZS8A 4WVFA 5E8RA 1L5ZA 5CAEA 4R9NA 4W5OA 3ZXUB 4R41A 3LJKA 1NMQA 5CDHA 1UPBA 2YH2A 1FLVA 3ORHA 4YP1A 1PRYA 3PEWA 4RTKA 1MU0A 2D1FA 1NVUQ 4MVJG 1LDYA 1A97A 2GI4A 1T0BA 2AMJA 2IXDA 1R2QA 5T5QA 4UNSA 1ADBA 4V39A 3EHDA 3RUHA 4BLSA 3PV0A 1AH2A 2ZTHA 1JQDA 3JYQA 4NPAA 3IBCA 4HGPA 3DEKA 1BC5A 4LISA 4YRLA 2JATA 3LC7O 1BHJA 3LTEA 2VBIA 4MVJE 3K5WA 1VCMA 2OHHA 3GF4A 3RU3A 3IKMB 2R47A 3G2LA 1Z4IA 4ID3A 4FGKA 4BPBA 5LWHA 2O19A 2VDMB 4KUHA 2CLLB 3ZR4B 3ZU3A 4CQLB 1T5OA 2QG4A 1UFVA 1EFVA 3H0KA 4QL3A 4Z5XA 3AL0C 3BGSA 1ATIA 5SZJA 3I5YA 2OCGA 1N9GB 3DD5A 2HUNA 5LYJF 1TKAA 4JYBA 3I2YX 2JCBA 1C3LA 5CVJA 3WMEA 4IBOA 4NLLA 4OMCA 2BEWB 4Q1AA 4AX8A 5BQXA 5IZ4A 2P6MA 1SKQA 1TQ6A 4RQTA 4WLVA 4MINA 2I6XA 2FPRA 3VC3A 2GASA 3LQ1A 2RI6A 2MWMA 1BOOA 2J0EA 3KCNA 5C1IA 5AHKA 1EA7A 4IV5A 2E37A 5AK3A 3D1VA 3WADA 1YVUA 2FGJA 2LCIA 3FSEA 1NDQA 3CV3A 3GDGA 2SKCA 1DXYA 1V47A 3ZQUA 3H1PA 3FYDA 2XB9A 3QWAA 1KI9A 5TQ2A 1BFDA 3PUXA 1C9EA 2C2BA 3KKOA 3M6LA 4ATNA 4J0JA 4UTVA 2YY6A 4TQ9A 5KJEA 5LYJB 3P52A 1PJBA 5HBGA 1DRJA 1OZHA 4OAPA 2HEGA 1Q92A 2ZQYA 1FUIA 2UUCB 1R6TA 4PO3X 3EAFA 3JVEA 1JPNA 3EVFA 3QK7A 4HMPA 4R8MA 1V35A 1E2MA 3IP8A 2GN8A 5J59A 1D8AA 2OGSA 1COZA 1R4MB 3M9WA 4HUTA 1E7YA 1TO6A 1ZINA 2E1RA 3QZUA 5IMBA 2ZS9A 2AYZA 2BRUC 3BK1A 3IUYA 3T54A 4ZHSA 2P2YA 4JOQA 2XXAB 2ZSUA 1ORDA 4Q9DA 4RQAA 4C0BA 2BJHA 1O58A 1CCWA 1U3WA 1N8SA 2OMEA 3GLFB 3TCNA 2BEVB 5T7BA 3EZ7A 5HCNA 3IAS1 5H9WA 1DAPA 2HQBA 3IEXA 4R3WA 4M8IA 5JARA 1ORWA 4GZLA 5EI5A 3EUEA 1NBIA 1SXJD 3AY0A 1LXCA 2TSYB 2NUBA 2P2LA 4O4IA 4PQGA 5LC1A 4LCEA 2ATVA 4FYKA 1BMTA 5LJIA 5FLXA 4DCCA 2A4MA 1EZ1A 1YFKA 2CCKA 3S99A 1H2ZA 4XPZA 4ZEVA 4JBGA 4OLAA 1ZD3A 1AKUA 1QO7A 3EEBA 2ZCVA 1A8HA 2GFIA 2HDNB 4GOJA 1K2VN 4PZZA 3EZLA 4U5XA 4AJEA 5JTTA 1EEHA 2RK3A 1Y6QA 1I0ZA 3O8OB 2QLBA 1Z6YA 1AT1A 4XWGA 3TS1A 5ICCA 4TL6A 4LDPA 1I4WA 5DTEA 1WRBA 4IM7A 4WINA 4XJSA 4FFOA 4QTYA 1HWYA 1ESEA 4FD3A 4TMYA 2HCFA 2DVMA 4GBJA 2GBCA 3GJ5A 4LHWA 5TDHA 1U65A 3GRCA 1IHXA 1TEXA 2Z58A 3DL2A 3KIPA 1E5TA 3LQ4A 3IILA 3O7WA 1RLOA 1XA4A 2P65A 1A8PA 4JR2A 4WEQA 2FRDA 2R4UA 1RM5A 3NGLA 3LK7A 1L8LA 3W34A 3QFRA 3EY9A 1Q0UA 4B79A 3LRTA 1LKZA 3QOFA 2H17A 5CEFA 1TM4E 2IH2A 2CVPA 1NI4B 2REBA 2V7WA 3CRNA 2BGIA 3ZE2B 3BKXA 4ETMA 5C9ZA 1A0OA 3K3PA 4O2BB 5ISMA 2IS2A 1I0LA 5HE9A 1WQ3A 4M60A 1RRMA 4HZUA 3L8ZA 1PWYE 4HLQB 3TVDA 2B4TO 1H4VB 3HI4A 5JXHA 4UNIA 3TW4A 1W46A 3RYCA 2GKGA 3DLTA 3LCVB 4B7ZA 2IYTA 3R9XB 1E2EA 4IS3A 1ULBA 2JFHA 3OMLA 3ZNQA 4AJJA 1GM5A 2B2XA 3TTWA 4BAUA 5CT8A 4EG5A 1A88A 1M2EA 2W5UA 1E61A 2D5IA 5K8TA 3M5CA 5JS2A 2XUZA 1NVTA 5CYGA 5DSXA 5AD1A 2ODWA 2FVYA 3V1UA 3QE9Y 5AVKA 3JYOA 2Z2YA 3BCRA 4BB5A 4H4CA 2J6IA 3O84A 3V42A 1SA0A 1PX2A 1C3VA 2QJOA 1DWUA 2OV8A 1GKUB 1JR3E 2Z4SA 3CLTC 4PWYA 1OBCA 3W5CA 3TW8A 1NVVR 1IE3A 1HETA 2ZB7A 3DDCA 3GYBA 3IPLA 4MVJM 4E33A 3VA7A 3STHA 1WVMA 1GLGA 1YJ5A 2VYNA 3MBKA 3WXMA 5KIAA 1DU4A 2OK7A 2O3TA 1KI1A 3AM4A 4QOFA 4JB2A 3VHLB 5FTNA 5KTKA 2XE6A 1KQOA 4QLAA 5CDSA 3FYTA 3A1WA 1M33A 1RRFA 1RPAA 1YQQA 3VPAA 4C4OA 4Y9SA 1EXMA 1XAGA 1Z4JA 3FDJA 4RY9A 5EIXA 1JHXA 4LVUA 1WF3A 4QJIA 1NVVQ 5A06A 2JHPA 4E4RA 5IABA 2F1IA 4CKZA 1VPWA 1JG6A 2R66A 3BZWA 3F8WA 2PUWA 5FTMA 4BMYA 4AUNA 4L72A 1O95A 1AO3A 1EEXB 2Q7DA 2CHEA 2HJWA 3K32A 1TKRA 2D2XA 2DBRA 2YTZA 3D7LA 3H8WA 2PS9A 4J0KA 2H00A 3L8YA 2OM2A 4IUCS 3BIXA 3SSAA 3TPZA 3NM4A 2WJWA 1XTPA 3DGFC 2HXGA 3K9GA 2PD4A 2PANA 5BNWA 3VC2A 1SZCA 3OZBA 3IUJA 5LZ9A 3UGJA 1ULUA 5AKXA 2BBOA 3P4XA 3WWOA 4RTLA 2P7IA 4IJKA 1ZI6A 3PL1A 1A71A 2NGRA 1MXHA 2QLMA 4XB6B 1O9BA 2ZI5A 2ZK7A 2EHJA 1XG5A 4INAA 4WRRA 4RANA 2WR8A 3FSGD 4C04A 2P5UA 4JHXA 4N0QA 2ZIZA 3CSSA 1QR6A 1X2BA 1AS2A 2XSZA 4TVKA 4ZDKA 5KNDH 3UVEA 3OMWA 4K3VA 1X1BA 2IHZA 3SQOA 3OZSA 1I2MA 3QEBZ 5BN3B 2G1PA 4FS8A 1E2QA 4DR4B 1XZMA 3H6KA 3E61A 1CULC 3H9BA 4IDFA 2Q6KA 4AULA 2A84A 1QQ7A 4ENTA 1ZD5A 4S35A 3E18A 1AKTA 3CEPB 3RSHA 2EZUA 4AAYA 1QO9A 1VTKA 3MEQA 3QEMA 3JQ9C 2RJ3A 4HD8A 2G06A 5T6MA 5GZ1A 1F3LA 4XGNA 3K0HA 2Y1WA 1NBAA 2MYUA 1TM2A 2PBFA 2HXYA 4H6WA 4Q1DA 1AXEA 2YIJA 5A3RA 1V9CA 3AKZA 1PR3A 1Z6AA 3DAFA 4U6NA 3SBOA 4FGLA 3HGMA 4MS4B 4KDRA 1Z38A 1QAOA 2UYHA 4B4OA 2VL7A 1CE8B 3MN1A 3AVUA 2DUUA 3QLEA 5LZ7A 3QENA 2Q21A 2LGJA 3WB2A 1A9ZA 4X94A 4CMIB 4DLXA 2IZ0A 2QK4A 5HDQA 4JC8A 5HNKA 4C2BA 3DDUA 4BKPA 3QWHA 3ADDA 4J2OA 5DGXA 4C21A 1RJ9A 3OM0A 4JUIA 5J4HA 2C29D 3TLEA 2IYPA 3RRJA 3UJBA 1DAIA 2QS9A 1OFUA 3Q5GA 2BZ0A 3GGDA 4DG8A 4RZIA 2V6FA 1KWKA 2WAYA 4OK5A 1R00A 3G2HA 5DGIA 3KG2A 2I78A 4RQUA 1QDLB 4HPJB 2FSHA 3FN4A 2JH3A 4K8OA 4YRNA 1WW8A 2H5LA 2ZPTX 1HEIA 3RARA 5EFOA 1IN6A 2X7XA 5JZSA 2HNAA 5H83A 3PA6A 5CCDA 4UM9B 3DT8A 4YK7A 5KMGA 3ACDA 3TNFA 4RWEA 4ZTZB 4DNOA 1F51E 2H1WA 1U1FA 4DMLA 4YRBA 4RL6A 4Q7EA 3GRPA 4FGWA 1LH0A 1NG9A 1Y8CA 1LBQA 1U2GC 1ZK1A 5KAMA 1N92A 1PS9A 2OD9A 3CIOA 2AR7A 3AEKA 3BRQA 3IV6A 3F90A 2DWQA 4Q1CA 5TQ0B 2B7BA 4IUYA 4MRVA 5IAAA 3H04A 1GNVA 4OGGA 1SU6A 4JR0A 3ETLA 2XMGA 3U7FB 1LK0A 4TSFA 3ZBTA 3NUGA 4QYTA 1QLJA 2Q6IA 1OAKA 4JI4B 1LBIA 3C41J 3WGVA 2GVDC 4Q3EA 2YFYA 3TQOA 2WA1A 3ZWXA 1MTOA 1WPXA 3C4JA 2YIVX 3OX4A 4IWXA 2QQGA 3TOVA 3ZEIA 3PFFA 2GR9A 4FKBA 2FPGB 4JP1A 2ZULA 3AVPA 4IS2A 4P4UA 2ZG6A 4PEVA 5AMXA 3WP0A 2ODQA 3H87A 4OXXA 3CM0A 1XU4A 4FR0A 1E4OA 2RJOA 4YAOA 2N0SA 4XOUA 2G9NA 1HSZA 3BXFA 3CR8A 2Y76A 1SBQA 5JYDA 5IT0A 1GD1O 2AN3A 3R77A 1LFAA 4FI3C 4WKCA 1VKRA 4LPKA 1QHFA 4EL5A 2NO9A 3FMPB 3KTDA 3REQA 4FNMA 4NBUA 1JHPA 4YUVA 5C5CA 1CEQA 2GX6A 4MYSA 1WA5A 2DG2A 1KBOA 3A58B 3AEYA 3A9TA 1YZ3A 3SJAA 2WA2A 1L5YA 2J4FA 1M2GA 4L07A 4V24A 3TSOA 3KKLA 4FYYA 4HDMA 1Q14A 2GYVA 5JNSA 4LF7B 1EZ4A 2O05A 3I2KA 5JJBA 3GVCA 2AG5A 3NEAA 5FWDA 1ESCA 2OZLA 3KJQA 5DNEA 1NXPA 2EGHA 1GRNA 3A05A 3VR5A 1IXZA 4RE6A 1OT5A 2WE8A 1YS4A 3I5UA 3TXYA 3OQMA 3G59A 1TVCA 2VTKA 5L3SB 2J09A 1FDIA 2GHTA 4TTTS 4DSTA 1PT9A 4ZYYA 5EWJA 2HWYA 2IQ5A 3R9KA 4EH1A 6AT1A 1C0EA 1C1XA 1TMOA 2SCUA 1W4AA 2DHRA 3OD1A 3VVLA 1H9BA 2H1VA 5LOVF 1YZGA 2FYTA 4UHDA 1K27A 5HQTA 2QRJA 2Y6VA 3L49A 3A10A 1RWBA 2GCOB 1QHNA 1QCZA 3FOBA 1T0PA 1W1UA 4HX5A 2IZ7A 2R1TA 3JZMA 4H7IA 5DYYA 5F64A 3ANYB 4GBGA 2V6JA 2B4KA 1CWUA 3I9LA 1W29A 4I5EA 4F9GA 4WZAB 3K0KA 1LLQA 4FZ5A 1L5KA 1R50A 1U3GA 3NVMB 3VOAA 3VBEA 3R4VA 2GAOA 3SR3A 1O5IA 1D0VA 2BLLA 4OQMA 5EJ8A 5LOVB 4W1RA 2JD0A 4DAOA 4NXMB 2BKXA 1R8QA 1ECCA 1U7UA 3IHLA 1G4AE 3IOBA 2EKQA 3JQBC 3SS7X 3VC1A 4D1YA 2BGKA 4GPZA 3RD5A 3GLGA 1NKSA 2C7VA 5DM4A 3M3DA 3JQQA 4HTFA 2FZLA 3GIDA 5HUQA 4PSAA 1D6MA 1F1BA 1Y4DE 1EK5A 1WXEA 4Q7MB 1IXSB 2JIDA 3FJYA 1SD1A 4HATA 1BX1A 3UH0A 1QTQA 1MOQA 2AOUA 4X63A 4I4TA 1XU9A 4XGQA 5FH9A 1YCHA 4UBLA 3UMJA 2O2IA 1EWRA 1YZQA 1CF4A 4U2GA 1V7QA 4ZVOA 4WX2B 3ID6C 1TC2A 2YFHA 4J29A 2OCXA 3NFYA 5J4VA 2PLWA 3EWAA 1ENYA 4NEGA 5F3RA 4CF5A 4AN0A 1DQSA 5ADWA 2FFAA 3CKMA 2CVZA 1YJAA 1RC1A 3IP5A 4KNWA 2H7CA 1I1NA 4XSVA 1QHSA 3ZLBA 1A50B 1P1HA 4P31A 4EI9A 5B58T 3JQCA 2IK8A