2YJ4A

Conformational changes in the catalytic domain of the cpx-atpase copb- b upon nucleotide binding
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
250
structure length
248
Chain Sequence
LSLYEKMLHKGMIIKNSNVYEKIKEIDTIIFNKTGTLTYGTPIVTQFIGDSLSLAYAASVEALSSHPIAKAIVKYAKEQGVKILEVKDFKEISGIGVRGKISDKIIEVKKAENDIAVYINGEPIASFNISDVPRPNLKDYLEKLKNEGLKIIILSGDKEDKVKELSKELNIQEYYSNLSPEDKVRIIEKLKQNGNKVLMIGDGVNDAAALALADVSVAMGNGVDISKNVADIILVSNDIGTLLGLIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COPPER-TRANSPORTING ATPASE
publication title Conformational Changes in the Catalytic Domain of the Cpx-ATPase Copb-B Upon Nucleotide Binding
rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 74
structure length 248
sequence length 250
chains with identical sequence B
ec nomenclature ec 3.6.1.36: Transferred entry: 7.2.2.19.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2yj4A01
3.40.1110.10 Alpha Beta 3-Layer(aba) Sandwich Calcium-transporting ATPase, cytoplasmic domain N Calcium-transporting ATPase, cytoplasmic domain N 2yj4A02
1VJRA 3TLMA 1RLTA 4BBJA 5AESA 3I76A 2O2XA 1YDFA 3ZVMA 1T5TA 1S8OA 5ALUA 4EENA 2IOFA 2W43A 1AQ6A 4Y2QA 4YIKA 2GO7A 2PKEA 3E84A 3OCXA 4FE3A 2I7DA 3RF6A 5AICA 3B9RA 2YMLA 3HYCA 2JAOA 5AW6A 3WK5A 4GIBA 2HX1A 2VKQA 3NALA 2WF6A 1ZJJA 1YJ5A 4BKMA 2FEAA 1TJ4A 3SF0A 3RFUA 3ESQA 3W5DA 3B9BA 5ALFA 2C9MA 2ZBFA 5ALDA 2B30A 4CNQA 1RPZA 5AK6A 2D2VA 4HGPA 3AR2A 3WK7A 3WKCA 3NASA 2JARA 4QJBA 1ZOLA 2C88A 2A29A 2B82A 4UASA 4DWOA 4KX5A 1ZRMA 4YCMA 4KN8A 4O8CA 3FPBA 1K1EA 2JAUA 2WF5A 1TJ3A 3QX7A 5AVUA 4I9GA 4BNDB 4XQ0A 2AMYA 3AR5A 2HI0A 2G06A 4XOUA 5E0OA 4Y2JA 3AR8A 2RARA 4HGQA 4DW8A 4Y2VA 2WF7A 3ZTWA 2CFRA 3A1CA 2WF8A 5AI4A 5AKKA 4FYPA 4G9BA 1SU4A 3IJ5A 4NFLA 5AM2A 2OA0A 1PW5A 5AW7A 4ZEXA 1L7OA 4RETA 2I54A 3OCWA 3PDWA 3L8GA 5AI0A 1J97A 5AIBA 3M1YA 2YN4A 2ZG6A 3S6JA 4EZEA 4AP9A 3I1YA 4MUMA 3L1UA 1RDFA 3MC1A 3AR4A 2C4NA 2KMVA 3OCZA 1L8LA 5AKHA 4L6AA 4OFZA 3UM9A 3VAYA 3ZX4A 3SMVA 4BYGA 4DFDA 4UU1A 5AKJA 1SVJA 3ET5A 3A1EA 5ALMA 3WGUA 1L7NA 3PGLA 4DCCA 3MN1A 3R4CA 3ZW7A 2IOHA 3NRJA 4EX7A 2Q4RA 1RLMA 5IS2A 3WK4A 5AKIA 2R8XA 1Z4JA 2I34A 1Z4LA 1WPGA 2G09A 3KOOA 2IA5A 3WK6A 3WKBA 4UM7A 3QUTA 3KDPA 2NO5A 1RMQA 2MU1A 1J8DA 4YH1A 4UM5A 3SLRA 2FUCA 2HO4A 5ALIA 4UW9A 1L8OA 3E81A 2YMPA 5AVTA 3L0CA 1N8NA 3U26A 4J2TA 2BDEA 2OBBA 4NWIA 5IT4A 3QUBA 1MO8A 3R9KA 4CE6A 2ZOSA 5AVWA 4MWOA 3FPSA 4AS2A 2FPSA 4BNDA 2EAUA 2FPWA 3KC2A 5AM0A 3U13A 5AVQA 4KNWA 1X42A 5ALLA 1Z4OA 3F9RA 2I55A 3N1UA 3OCUA 2X4DA 3FGOA 4KYTA 4BEWA 2YJ5A 3ET4A 4CF5A 1KYTA 2WF9A 2P11A 5ALQA 2YMQA 5ALTA 4YCLA 3R09A 3SKXA 3UMBA 3WKAA 4Y2PA 3KD3A 1L7MA 3DAOA 2HSZA 2O9JA 1ZD5A 3U19A 3ZUPA 3NANA 2ZBDA 1Z4NA 1S2OA 3DNPA 1YS9A 3AR6A 3QNMA 3QXGA 1RQLA 1VFPA 2ZXEA 3I6BA 4KNVA 4Y2RA 2P27A 1RC8A 2AUTA 3B8EA 1U7PA 2JAWA 2R8ZA 3U7GA 5AW5A 2YFYA 1LVHA 4FFDA 3QUQA 4OCZA 4C4SA 2EARA 3FZQA 2RB5A 5ALJA 1SWWA 3A3YA 4JB3A 2Q4TA 4ZEWA 1ZRNA 4Y2YA 2G80A 3U7EB 4Y3UA 2CN1A 3L1VA 2WFAA 2OM6A 4HGOA 5A3QA 2G0AA 3QLEA 2C8LA 4F72A 2NO4A 1YMQA 4L6CA 5A3RA 2FPRA 2Q5EA 5AVSA 1SWVA 2B0CA 4UMFA 1Z5UA 3ZWKA 2B8EA 4QQFA 3OPXA 3I28A 5AI5A 5AK5A 1NRWA 2FDRA 3AR3A 1WZCA 3L8HA 3SKYA 3QU2A 1QQ5A 3QGMA 1Z5GA 1O08A 4E88A 3WKDA 4Y2XA 3MMZA 4CF3A 1Q92A 3ZX5A 1Z4IA 3ESRA 3DDHA 5AKXA 2ZBEA 2FPXA 4UAUA 5ALHA 4IG4A 5AKLA 4Y2SA 5AW2A 4CF4A 1XP5A 4YCNA 4UMEA 2RBKA 5AIAA 1JUDA 2HHLA 3BWVA 1U7OA 1CQZA 1EK1A 3D6JA 5AM5A 4AS3A 5AVZA 5AK4A 3FVVA 5AVYA 2G08A 3ED5A 3OCVA 2WM8A 3OTQA 3EWIA 1T9ZA 4UU0A 3QUCA 3NIWA 5FP0A 5ALKA 1RQNA 2R8YA 4XPZA 3UMGA 4NV0A 2ARFA 2DQSA 2B1RA 4YIHA 3L5KA 3UMCA 1RMTA 5AW3A 5AI8A 2A00A 5AW4A 2GHTA 5AVXA 2AH5A 4ZEVA 4C4RA 3L8EA 5ALYA 4EX6A 3W5CA 2HDOA 1QQ7A 4UMVA 3ZVNA 3DV9A 1Z4PX 1CR6A 3WK9A 2YJ3A 4RESA 5ALVA 1ZD4A 5AW0A 1MH9A 4Y2UA 2EATA 1RKUA 2HOQA 1WR8A 3L0BA 1QQ6A 5ALNA 3N28A 5AI6A 3ZTYA 1TE2A 3QU9A 3N07A 5AM4A 3FM9A 4B6JA 3N5KA 4C4TA 3ZU6A 2CFSA 4H1WA 2FI1A 3EF0A 2HF2A 4JDPA 5AVRA 1ZD2P 3U7FB 4HGRA 1U2SA 4I9FA 4UARA 5T41A 5AVVA 3E8MA 2YBDA 5AI9A 3W5AA 3ZVLA 2P69A 2FUEA 3U7HB 1N9KA 3IB6A 3SHQA 4XE5A 3GWIA 4EEKA 4UAVA 1RKVA 4OD0A 3AR9A 1U7QA 2GHQA 3KBBA 1RMYA 4UMDA 3SD7A 1TJ5A 3IRUA 2G1AA 2R8EA 1Z88A 1ZD3A 1ZS9A 3M9LA 4J03A 5ALWA 2I6XA 3GYGA 1F5SA 4HGNA 5ALPA 1Y8AA 5AW1A 3QU7A 1YV9A 3CZ4A 2W4MA 2BY4A 3P96A 3QU5A 1Q3IA 5A3SA 3BA6A 2PR7A 2PQ0A 4OHFA 4PNHA 1YNSA 3L0YA 4UATA 3PGVA 2ODAA 2YJ4A 2QYHA 3WK8A 5AKEA 2I33A 5AK3A 3HLTA 1RRCA 1NNLA 4NAVA 4BX3A 2YMMA 2OYCA 1QH9A 3PCTA 2HF7A 5IT0A 2IOFK 4NABA 3W5BA 2MSNA 1Q91A 1IWOA 2C8KA 1WVIA 1L6RA 3WGVA 3ZI4A 2AGVA 5ALEA 2WHEA 1FEZA 5ALSA 5ALGA 4Y2TA 2P9JA 2HEGA 2CFTA 3OCYA 4EELA 4L57A 1VJ5A 4KX3A 2W11A 1U02A 5AHXA 2NYVA 5JJBA 1EK2A 2IYEA 2FPUA 1MO7A 3KZXA 4IFTA 2G07A 4HYTA 4YGYA 3ZWDA 3E58A 4F71A 1XVIA 3EPRA 5AM3A 2GFHA 3NUQA 1Z4QA 5ALZA 2B1QA 2QLTA 1O03A 5AM1A 3AR7A 2YY6A 5AW9A 3L8FA 3QU4A 3WKEA 2B8JA 4GXTA 1LTQA 1T5SA 4BEVA 3N8GA 1L7PA 3QYPA 4BX0A 3K1ZA 4G63A 2JGAA 3NAMA 3MPOA 2ZBGA 4BX2A 5ALOA 5ALRA 5AKZA 1XPJA 5AW8A 2GMWA 3A1DA 3L7YA 3EF1A 1Z4MA 1Z4KA 5AKGA 5AKYA 2RAVA 1TA0A 1NF2A 1RKQA 2YJ6A 3ONNA 2HCFA 3CNHA 1QYIA 3J7TA 1U2TA 5ALXA 1RLOA 2KMXA 4HAIA 2BDUA
chains in the Genus database with same CATH superfamily
1QLJA 3QIAA 3TE7A 2EEZA 3PFHA 3QWAA 2JATA 1NLZA 3QMWA 3BMNB 3EXHC 4LYAA 2WIJA 4ZCLA 3TNJA 2W0MA 2DTXA 1IJBA 1OFVA 1Q1AA 2PDAA 5HFNA 3IHWA 5KNDA 1P4AA 3V33A 3FMVA 1AUPA 4D3FA 2IT1A 1RQRA 3UXYA 4BO8A 3G2HA 1OWNA 1BU8A 1Y4SA 2BGMA 2PKEA 4FE3A 4V0QA 2WKPA 1XKTA 3B9RA 3FA2A 1P2TA 2CNWD 4D98A 5CBKA 1T9CA 1QHHA 4HNSA 5ERYA 1HLDA 2CBGA 3PSAA 2BN4A 2OMKA 1Z2CA 5B1DA 3I01M 1WMBA 2QP3A 4L8VA 2V7TA 2ONKA 3IMFA 1WCV1 1JDPA 1XJWA 4KFUA 3IHKA 4W5QA 3JQAA 4CDGA 1CQIB 4DHWA 1PNOA 2J5QA 3RU7A 3COPA 3QZUA 4KGVA 3WB1A 4FMBB 4IJ6A 3DE1X 1N32B 4OIMA 4LYHA 4MWBA 4B6EA 3SN6A 2VNKA 1Y89A 3KJXA 3O1JC 2QOEA 4OKSA 4XLZA 5DI9A 1E5DA 1GPWB 2NUAA 2B6NA 4ENUA 3A1SA 4H2DA 5JSFA 4HNAB 4URVR 1XB2A 2QB5A 2HUPA 4IIFA 4G0ZA 1SK8A 1LH0A 1PWZA 3H7AA 3KVOA 1ZRMA 4R5HA 3ZPXA 4WGFA 1AK9A 2PBLA 3KSDO 3U80A 1K0UA 3R77A 4FEGA 2R11A 4DCVA 4RJIA 1J5EB 1UF9A 4AM8A 1MIHA 4UJ3A 5E7JA 3O82A 5KPJA 1ZK0A 3KQTA 4MP8A 4C06A 4JA0A 4C1NA 4P4TA 4B2PA 4BVBA 4MR8B 3TVTA 3WB2A 1NDUA 4A8JA 1CR0A 3PEWA 1K3UB 1GPBA 1T0JB 2P8SA 3BGOS 3CMMA 1ZMBA 3QE0A 1N5DA 1XZJA 3BDVA 1QK5A 2AUNA 3M5DA 1GP2A 1L8QA 2OKCA 3PDHA 2HV9A 4HGQA 2HXGA 3REQA 3V8NA 5LOVF 2OZLA 2YUTA 2FJUA 2F8LA 4XSVA 1UAYA 2PCLA 4P2BA 2WWYA 5C8DA 1W5TA 4DLNA 1N25A 3PQ2A 5FWNA 1Y1SA 1CUJA 1P1RA 2VT6A 4HD8A 2OA0A 1CJCA 2C61A 1BYUA 1NW3A 2P9CA 2V9CA 2WQZA 4K9RA 4RTOA 4YQZA 3WLEA 1WHTB 1TK3A 1FDIA 3GAZA 1FUUA 4BQIA 1H8HD 2JFBA 3A9RA 2GAIA 3QH4A 4MQMA 3RIXA 3R75A 2J3LA 1IY2A 4WBXC 4KR0A 1VL5A 2HMTA 3ICCA 3L0ZA 1LPNA 2DUNA 2I2BA 4WK4B 5E4YA 2AI1A 2ET6A 4TMYA 4D4KA 2FN7A 5DJ5A 1P1IA 2GN1A 1WSDA 3R6WA 2PLRA 5H4GA 2QTWB 1VLHA 4ZI7F 1ZNYA 4NENB 2WJZB 4EZEA 3P27A 1NG9A 1L7XA 4JYPA 5DBEX 2NUPB 5K1ZA 4DC1A 4QPPA 1NNEA 3QJGA 2YY7A 1Q6ZA 1QG0A 2XWJI 3JVVA 3ZC3A 1EP9A 2GASA 5BMVF 3R8FA 3DMRA 3X2EA 1E5QA 1GV1A 3VO8A 4XPIA 2JBAB 4D3XA 4RF5A 3LUGA 3O4VA 5H16A 4K0KB 1EWVA 1NVVR 3ZU3A 3WWOA 1EVLA 4OFZA 2CDBA 1AGXA 3SZUA 3LQYA 6Q21A 2RKWA 2CLSA 2GJ9A 3C43A 3EFBA 4UU1A 2NU9B 4BWYA 2M1ZA 4GR9A 1G8HA 5DTRA 1W52X 4X64B 2XGGA 3ACDA 4ZGGA 3HJCA 1WWKA 4PPYA 3AUJB 4DYHA 4YAJA 2ODWA 1Q77A 2B4KA 4QAJA 1OWLA 3HJNA 3IIIA 4GI1A 4DCCA 3AVWA 1PE0A 4BZQA 1SNYA 4EATA 2XVMA 3K5WA 2WFLB 1E1NA 5U1PA 2VZ9A 5JARA 4R8MA 5FUBA 3C74A 1Z4JA 3UENA 1E6MA 4GOMD 3IEIA 3QUSA 4XWAA 4S24A 3HKCA 3TLGA 1L7VC 1T8SA 1HE5A 1NY6A 2AOTA 4GKBA 1RMQA 4A03A 2UYQA 4M0MA 2FP3A 1K8YB 2YVKA 5BR7A 3HFSA 3W6OA 3D43A 5B4VA 1FDRA 1HDGO 4FGWA 3E81A 4TKVB 5EJ6A 3OZTA 3EPLA 1L5OA 1XZHA 3DTVA 3MOIA 3RSZA 1N8NA 2H0QA 3TRDA 1F51E 4IX1A 3WDMA 3ZNQA 4C22A 1P5JA 4MXDA 5EWJB 3TSWA 3UA4A 2DFDA 4I5FA 5B1IA 3FSGA 4PN7A 1V1RA 2EL7A 4ZYXA 2CNOA 2FMFA 1RCTE 4F46A 1QIGA 2C5GA 4N1AA 4FN5A 4YI5A 4KAAA 3FCAA 4AS2A 1YBAA 1OI4A 3LVRE 4FYYA 4MRRA 4BNDA 5JZBA 2L19A 1ZW1A 5A9RA 3RH0A 1NWCA 2FWRA 3VV2A 4WE3A 3V55A 2P65A 1SAYA 3EQ2A 3FB4A 1GTG1 1ML3A 1NYQA 2PMBA 3CX7A 3MLAA 4G85A 3T5CA 1WSWA 2ST1A 1DAFA 3VTKA 1B8UA 2C3UA 1PT5A 3OCUA 3C6QA 2KM1A 4KYTA 1ZUIA 2MINB 3P7MA 3NV7A 2I2XB 4K6MA 3THRA 5A9SB 2WOOA 1JG2A 2DQZA 3IPCA 4UD2A 3R5JA 1TGYA 1ZJ6A 3JARB 4YT5A 3T7DA 4YCLA 3EISA 3TINA 1EUCA 4XKJA 2WSSD 2YN0A 4P5DA 2IYUA 2I8AA 3U1VA 3RG8A 3I0NA 3FSRA 3M34A 1Z2DA 4U9HS 2J9FB 2GD2A 3BFVA 3U19A 3NDPA 1L4HA 1ZC4A 3C70A 5KWJA 1B7GO 1Z0SA 1OSNA 3DNPA 3QSGA 3EUFA 2V6GA 3LBFA 2DBVO 1H2WA 1II0A 1N92A 1TMOA 1AH2A 3DQPA 4D26A 3DAFA 1B73A 1F3OA 2ARKA 4YRNA 1DO8A 2F1IA 1KHHA 4L8WB 1C3OB 3EH2A 1WXWA 1YE3A 1ODIA 1MV8A 1R0XA 1C4OA 2NTNA 5IDQA 3EOZA 1DXYA 2WSMA 1MEJA 3DBLB 3PD7A 3RAFC 4BXOA 3VZRA 3WWCA 3QITA 2VBFA 2XB4A 4D4MA 3N39C 5CD1A 1Q74A 3LRPA 1WU7A 3RSFA 1ZGHA 4RM2A 1AZLA 5LQUA 3MLEA 4DLZA 2I9KA 3G5AA 5FBVB 2I2CA 2BTOA 5DYNA 5CX4A 5DX0A 5LYJF 1HZZA 3HB5X 5FFNA 3HXMA 4BMSA 2APJA 2ZSEA 4W8OA 3W6UA 4UUPA 2WTXA 1SXHA 3T1YB 3W79A 1UJMA 3GLQA 3B5EA 2HJVA 4Q93A 4RMJA 3SYKA 3ZHVA 4OMFG 5A3RA 1G7SA 3FJ1A 1QYRA 2JGFA 3NDBB 1WMDA 1H69A 2DG2A 3SEAA 1M6VA 2ZSUA 3R9XA 2BH2A 1TMGE 3SQDA 1IBLB 3AFOA 4MV8A 3H1FA 3HCAA 2IBMA 1M72A 2NNLD 1EFPB 2Z6UA 1OV4A 3WWZA 3L8HA 1RQ2A 1NUSA 1P2DA 1ZGJA 2BCEA 4TMVA 1MX3A 4PR3A 1AG9A 1RTTA 1T8TA 1E4YA 3P0RA 3R24A 5E9AA 1KMCA 4KWEA 4JGIA 1V16B 4O5OA 1GPNA 5ABPA 5BMVA 3GXOA 1N2CE 1YCDA 2A0XA 1XEXA 1AO0A 4DAEA 1Q7EA 3VC1A 1Q92A 3P1JA 3H9GA 1Y63A 3IURA 3U4AA 1Z5WA 5BR8B 2O6HA 1BMFA 1HORA 3RT1A 4IO0A 1BOFA 4L15A 4B6FA 3B1YA 4LSGA 3DV2A 4A2QA 4G1FA 1RI1A 1NXXA 4E12A 4REQB 4BKUA 3WYDA 4OHBA 2D0OB 1SXJD 3IPYA 5FADA 3QKSA 1LBEA 2PO7A 3QKWA 4GYWA 2P1DA 1K06A 4UBOA 5M3BA 4BU1A 1K6IA 4MP3A 1DPFA 2VDWA 3ZYZA 4FKBA 3QV1A 3DYBA 5F4ZA 5HJEA 4OFBA 5NULA 1JEYA 4IIXA 4DIFA 2JFYA 3KOZA 4IX9A 4FN4A 1CS0B 2B34A 2OCAA 4ZHQF 3L1JA 3KSUA 3DOFA 3OIDA 5BVGB 2W4IA 1DBSA 2O8DB 1ADBA 2EFCB 3GBVA 1NVFA 3GA7A 4NCIA 3JVDA 3ESYA 2EZ9A 3BIJA 4PBRA 3WX0A 2B8WA 2H1OA 1QRTA 4DMLA 1RHRA 4PLTA 2IY8A 4V2UA 2QQEA 4IQ4A 5K0JA 1PS0A 1P9RA 2A9VA 1I7NA 3DEJA 3A9TA 4NF2A 4V0ME 1AB5A 2PFGA 3BTOA 1OFTA 1KPGA 3QVTA 3EZGA 4ETWA 4QPNA 1BTOA 1RR6A 1ZAKA 4NONA 1O3YA 4CHGA 3Q3VA 1HDYA 2O8BB 3KQOA 3KWFA 2C5FA 2H7XA 2DHEA 4BTVA 3LOUA 2DHCA 4O4HF 4JUDX 2BP7A 2OV3A 1CS4C 3DMHA 3MINA 3G0GA 4LGYA 3DXZA 5IUNC 1T36A 4DWVA 5I7EA 2JH3A 1QQ7A 4UMVA 1DGQA 1JAHA 3FYTA 3OWHA 2J6CA 1Q7BA 1YR7A 1P2UA 3TN7A 2AJTA 1L7EA 5HF9A 1MH9A 3GRFA 1TU0A 2EATA 1CBUA 1KH2A 2DJIA 4RKRA 4FKMA 3R0JA 3WJ7A 5EJ9A 3I9MA 4DG8A 3IALA 3WP1B 1KAHA 3P2IA 5HK8A 1QG6A 1VA5A 2ZYSA 3N2ZB 5JCXA 1QIHA 1L1EA 5JQGB 4S12A 1QQAA 2P2YA 3GT3A 3IDSA 5I48A 1II8B 3D8BA 2R84A 2GO1A 3I1JA 1XC7A 3HTXA 2IEBA 4RORA 5EJIA 5DGCA 1XMSA 2YOGA 4F1KA 3WQRA 3WSWA 1W0KD 2C42A 3AVXA 2FI1A 9GPBA 1KEUA 1PRYA 5E6SB 1DIOB 3O3MB 3U49A 1KEEA 1HUQA 1VB3A 2FE4A 3PNYA 3S2FA 3V8PA 1PYGA 1P44A 3LWNA 4BMDA 1LDYA 4ECEA 3JSAA 4HGRA 3NTUA 4PFSA 5T41A 2EKQA 3KOYA 5AXCA 2K7FA 1YJ8A 4GOOD 1VL6A 1Y3HA 1ZLXA 4W9NA 4YT8A 1E6LA 1N6OA 4S35A 1QRAA 3WIEA 4V3CA 1Q50A 1WUKS 3A2MA 2BR4A 1M1NB 4E3WA 5KINB 1RI4A 1XMJA 4H16A 1QZXA 2O5RA 4DLLA 5KDLA 1Q21A 3CH4B 3I5UA 5B7QA 2Q5OA 1T8RA 4FOLA 1Z6ZA 3V7FA 1GYRA 1V7QA 1SC1A 2G0TA 1Z5OA 4JSRA 4MS3A 2OG2A 1L7AA 3PK0A 3TMAA 3SHOA 3FPEA 1G5QA 5SYMA 2FFQA 3C8MA 3ONEA 1T9BA 1ZU4A 3E22B 3OMXA 1VKHA 2C8JA 5LYJA 3T38A 4DR6B 1EGHA 1A9RA 1G20B 2AMFA 1Q1QA 5CEEA 3T5AA 2OENG 4RKYA 2IDKA 1F7UA 1PJRA 1RWXA 2PAFA 3O83A 2HF8A 4KCGA 5JCOA 5IVPA 5KYUA 2RGYA 2Z9CA 3UA3A 3DKVA 2E55A 1I2BA 1OF1A 1GYPA 3BQNB 1Q0ZA 3FZNA 5EE3A 3T3IA 1JEAA 4PNHA 1XDBA 1DIRA 4TV9F 4CPDA 3F8TA 1U2DC 4P38A 2DHQA 4OB7A 4EB6A 1J42A 1C5KA 4ZT3A 3QNWA 3RABA 1L1RA 4N65A 2AF4C 3S28A 1IBRA 3AQ4A 4YUZA 1CUGA 4S3MA 5G53C 1PNTA 4ZCPA 2ZIWB 1K4YA 4JVSB 2V6IA 4A36A 4YR9A 4DCOA 5JJ5A 2CK3D 3GPIA 2FEXA 3S27A 5HS4A 1TKCA 3HJHA 4QG7A 3GT7A 1YONA 1VQ1A 3KX2A 2NWQA 2Q5IA 3K2IA 1OCEA 1C7FA 1GOTA 4YFYA 4KE6A 3TL3A 4BLTA 4E30A 1W36D 1H9AA 1OLXA 5D8DA 2XODA 4CM6A 2OXFA 2ODQA 3T9BA 3GD5A 2FEKA 2G1UA 4DY6A 1XZIA 2ZJ1A 4Y2TA 3RIMA 2XITA 2WWXA 2PFSA 1PZMA 3ILHA 2PX8A 3GMIA 4BV3A 1GV0A 3OCYA 3AVPA 4G5HA 4LFAB 1QTQA 2WNIA 1K08A 3D6TB 3CXUA 4LVOA 2EP5A 1SCBA 2F3QA 1ZEMA 2BPOA 3OIUA 4HWRA 4N0PA 4RV5A 3UWMA 3ASUA 3TLEA 1FDTA 2Q4BA 4DARA 3UGTA 2FMXA 1LPMA 1GKUB 2YVQA 3GWZA 1PIWA 3VNBA 3R9IA 1AF4A 2J7PA 4IFTA 4E3ZA 5A4JA 5DZSA 5K0ZA 2OZVA 1ZGCA 4C0LA 2CMFA 1B15A 2DAPA 3FF1A 1BGXT 5AOCA 5EL0A 1O6ZA 2ZDHA 5D3MA 1CUEA 3ND5A 1E7YA 3NWEA 2QMUA 5CVEA 4PSKA 4N47A 3JZMA 2RGUA 1PYDA 5IPFA 1RZ3A 3WZMA 3EGVA 1QGAA 4GMKA 2R7AA 2Z8ZA 3A1VA 4OHKA 3TGLA 2HU7A 3HYNA 2LW7A 3WP0A 1K98A 4G86A 1QG4A 3V4LA 1A9XB 4L9RA 1NAHA 1Z26A 2OAQ1 5CLHA 3UAWA 1JQJC 3CRQA 1MB0A 4ZJUA 3M2TA 1CF2O 2P68A 1IIBA 1PO7A 1PT9A 1V4BA 3M4YA 3TZCA 2PZMA 4K6CA 3ZQKA 1SKUA 5I45A 5ITZB 1SD2A 1QNFA 2NYUA 3HLKA 4LCBA 4RX1A 5JFTA 2C2HA 5FL7A 3E3OA 1Z8FA 1FTQA 1Y9EA 3JQQA 3TRFA 4NCJA 4H3VA 4F5EA 3LE8A 4UFOA 4FD2A 3VMFA 2N3ZA 4D99A 3OP1A 1MJHA 2EJTA 1PFYA 4B09A 2FHSA 3PQEA 4B81A 1UZUA 4EHJA 3H9EO 3SC2A 3GHYA 4HTFA 1IVYA 4YT2A 1XQVA 1MF7A 2PKQO 1W2GA 1D6MA 2G6TA 2YWEA 3DKRA 5B2ZA 1Q7CA 2B4TO 2JLQA 3H5LA 4FNOA 1I80A 1CY7A 1V8FA 1WXXA 3I9V6 1T0HB 4Q15A 3NHKA 3MCTA 4ZTBA 5CB8A 5E38A 2QP9X 3WDSA 1QHXA 2ZAIA 4TWAA 4YRAA 1XYVA 5JUWA 5BOSA 2FW0A 1VECA 5AW6A 2O6LA 4QDKA 2Z08A 1DAOA 1REQA 1B6TA 3NQ41 2Y77A 2DPHA 2GPAA 5AHOA 4CTKA 4EKYA 5JAUA 4L4RA 3SF0A 5JH7F 4N7MA 3QVMA 2ZI4A 2VYNA 4EG6A 3K0SA 2BZ0A 2Z8YM 3LFUA 5TEVA 4C87A 5B30A 5KYWB 4EY7A 3SXJA 1QRRA 4F2GA 1VCOA 1WCWA 3HVKA 2P6MA 4HGPA 5EE1A 2CHGA 2RHWA 4TQAA 5BR1A 2E4UA 3AJAA 1RT9A 3OOHA 4DIDA 2WTUA 3WKCA 4RKEA 3ZI0A 3EA0A 5CNKA 1EWTA 1MO6A 2E37A 2JARA 4PO8A 4MJ7A 2OVBA 3SM3A 1E9AA 4AMZA 1ZW6A 4N41A 3IS3A 2J0UA 4R2IA 1K27A 4YCMA 5DTQA 4QXPA 4ARZA 4UNSA 3O4GA 4FHFA 4O8CA 1JBQA 3VR0A 4Y6OA 5EUCA 1C0IA 4MV5A 2P6UA 3PKJA 4LOIA 4OQEA 1ZN9A 5CT9A 2C31A 3TCXB 1N2HA 2B69A 1WCYA 1XXHB 2O2HA 3IOYA 3PL1A 3QX7A 4EHAA 5AVUA 4XQ0A 2XKAA 1YKGA 1BOOA 1ZMTA 2ATCA 2FY8A 5CXSA 3IKTA 1EI9A 2R8BA 1F5NA 4M6WB 4FEYA 2VHXA 3ASYA 5FWYB 3WLSA 2F8SA 1TZ2A 1LLQA 3H5WA 1RQXA 3CZCA 4FHGA 1Z0FA 3BXXA 4RZ2A 4XUDA 4Y2JA 3VKVA 4GX1A 4JMPA 2LCFA 1CLUA 3GCXA 4GT1A 3WC4A 2KSQA 2Y76A 5JXGA 3A1CA 2FUG6 3TLYA 3D0KA 4YMGA 2WF8A 3I0ZA 4KUGA 5AI4A 5LCXA 4G9BA 1AQNA 3WJ1A 5I4CA 5EHGA 3IOEA 4JBYA 1JPUA 4C6TA 3LY8A 1KAQA 1Z0UA 4KLCA 5HE9A 1VG8A 3VU0A 1J25A 1LNSA 2H5LA 1JMVA 1SXJB 2JKVA 2XBLA 4AO7A 1NRJB 1TZMA 3Q7SA 5BNIA 4AQYB 1O5IA 1WJGA 5FPKA 3HVUA 1NI4A 3D4OA 2CYBA 4F56A 4LF4B 1GPMA 2Q3MA 5I9TA 3PU6A 4ZTZB 1NLMA 1VRWA 5FBKA 3S68A 3VZPA 3ZQUA 4B3JA 3ED1A 4V0RA 1VHJA 1SBNE 2QGZA 1AIPA 1GUFA 1SKYE 3MD9A 2QN2A 3U2QA 5F64A 4OBEA 1OI3A 1ZVMA 4ERNA 4F2DA 1Z29A 2QBYA 4OHMA 1RDFA 2Y0EA 1OIVA 1SXQA 4GM0A 2FPKA 3F6BX 1ONSA 4YCBA 2Q1UA 2I66A 1ESDA 13PKA 3L02A 5LN1A 4AY4A 3QENA 4J8PA 5DULA 2CF6A 3ERCA 3AJRA 4L6AA 1QHEA 3SAJA 3LBNA 3RKRA 2PUVA 3BMNA 4QHYA 3UN1A 4WK6A 4XIGS 3VAYA 5KBYA 1SMKA 3H3JA 3CWCA 3KXIA 4JOCA 4KMMA 5CURA 3SC4A 4V1CB 2VDKB 1T6NA 5EGNA 1RPNA 1L5MA 3KQMA 1OVGA 3N05A 4N3GA 2IJGX 4FCCA 4J1SA 4FHEA 5LU9A 5CJ2A 2WICA 3DE3X 2GF2A 4D9BA 4BNTA 2PUGA 1FFGA 2JHAA 3DLIA 2M6KA 4BTLA 1PBTA 2IU0A 4UEQA 4URZR 5DASA 2I4LA 5FPSA 1GGNA 3WBBA 3TG8A 4I1UA 1NMQA 2QTTA 1MENA 4QPCA 3ZN2A 2JG3A 4NR0A 2X23A 5CYFA 2OLJA 2NT3A 2VUTA 3KOOA 3WK6A 2HK8A 3D54D 1CQIA 3NTQA 1BVRA 4P0TA 5EE0A 1VA4A 4BNWA 4EECA 4ZVLA 3KVYA 3SLRA 4B71A 2VHYA 1IIRA 3BK2A 3H4IA 4HXFB 3IBGA 2CEAA 4UW9A 5A1TA 4WTOA 2WWRA 4HNAA 1HO3A 4IDPA 4HQNA 3C3EA 3M5PA 3Q7EA 4OHWA 3AEYA 1L5NA 2LGJA 1OC2A 3A1NA 2FYTA 1A8SA 4LX0A 3RM3A 4HDRB 4YQEA 2DERA 5IT4A 4GC9A 5G3ZA 1TFRA 4NEQA 5JNSA 2ZOSA 1PF7E 4PXSA 1THZA 5HUHA 5J43A 1GPAA 4BS9A 4QEKA 5JEDA 1E62A 4POAA 4D46A 4JBGA 3GUZA 1JSZA 4J4HA 4U4AA 2O8VA 5C81A 2P77A 5JRJA 1JR6A 3U17A 4MR8A 2A88A 5AM0A 2XUPA 4GC5A 1FQOA 3R76A 5IF9A 5JPCA 3LHSA 4EY6A 1ITZA 2UYCA 3LO5A 2C2OA 3LNCA 2KE5A 4LRQA 2ZWOA 4K6OA 1NDQA 1XZDA 3TEMA 3VOSA 4BLUA 2IH4A 5TQ0B 2GYWA 1OC4A 2A3NA 1H2XA 3TQIA 4BCCA 2BEWA 1N2GA 5HA5A 2YMQA 2A0UA 2Z57A 3FJYA 2HTFA 3K5IA 3AYZB 5DXFA 3VMMA 3HB9A 2SKEA 1KEVA 2CF5A 3BCUA 4TM7A 5EWMB 4DABA 4EARA 5BSGA 3L01A 1O0BA 1Y3BE 1Y7LA 2IHJA 3O94A 3DE5X 1DWOA 2I3AA 2Q8NA 5LQDA 1VJCA 3WL6A 1GFSA 2NO6A 5ITWA 4KRGA 3NANA 1RAAA 3BK1A 1E60A 1RE0A 3IAS6 3ZV5A 4Y2RA 3LC1O 1FF9A 3UJCA 3SMQA 5AVKA 2PMWB 1G9TA 1PZEA 4GPD1 4ZT6A 1NYRA 1EDZA 3IUMA 4GVXA 1GQOA 2FZ4A 1QIMA 1JKXA 3OPNA 1YF3A 1NR1A 4NENA 1MIOB 1N7HA 1R0ZA 2NVBA 2NUPA 4J7AA 1SWWA 4NHEA 4PIPA 1ACJA 4C78A 5C46F 4E5UA 2J3KA 2GJAA 3X44A 3H18A 4ZP1A 3HWWA 5C9ZA 5SZHB 4MVXA 2JHGA 3HYSA 3KBOA 3LQ2A 4C6SA 2JBAA 2R2GA 3FI9A 4KODA 2HB6A 1UOOA 3K9BA 1NV9A 5K2MA 4BO7A 1WQ1R 2W6IA 2OM6A 3R7NA 2OHFA 2V6JA 3MRSA 4G36A 3RIYA 1WUIS 4CWAA 2NU9A 4R1TA 4FNGA 1HG1A 2XSZA 3QX8A 4TLBA 4M22A 1KBZA 1ODCA 4II7A 2EC5A 2R6ZA 2NYRA 2C8LA 4OQLA 1SKAA 4QYWA 3T5GA 5FOQA 2RDMA 3X1DA 4F9GA 3EIFA 1T4MA 1RWQA 3FDZB 4X8MA 5JSZB 3LD9A 4FI3C 4B3HA 3G8AA 3O9VA 3OJXA 2WFLA 3O2QB 1L3BA 3AF5A 4L3WA 4OU5A 4A6EA 3CO5A 3KTFA 3DLCA 4Y1EA 5B37A 1XFAA 2C00A 3PUKA 2MSKA 3AFHA 3FTFA 1CE8B 2EWMA 4C7MA 1E3EA 2VP3A 4JNCA 2WUEA 121PA 1VJGA 2FQ1A 3M4ZA 5SYAA 2AKEA 1HNNA 4LY9A 4B3BA 4TKVA 3D6MA 1MJFA 2CDRA 3V2UA 5JU6A 1D1PA 3N3BC 4D0RA 3RJ9A 4JWKA 4X24A 4ZVRA 2EKZA 4HAVA 2GRAA 5DKFA 4OQZA 1KGDA 3CN7A 2FN4A 1QU2A 2X5JO 1ZK1A 2YS7A 3RSHA 1BFKA 1TKBA 2M2IA 1RVDA 4I2NA 1IQUA 5JLAA 2FK8A 3T7CA 3KWMA 4YALA 1U7OA 1US8B 4C7OA 2Y05A 3RSGA 3RRNA 2GLXA 1KVUA 2ZRNA 4UDXX 2V7GA 3TNLA 3KZOA 4HC4A 1EMDA 2BFCB 2MSEB 4MUXA 3IERA 4YA6A 5E2IA 3LZCA 4IHJB 1P6XA 2MINA 4ZU1X 5FYQA 5IAKA 4DLTA 4E22A 2YWDA 5L9AA 5THXA 1A5BB 2GEBA 1BJRE 2CLEB 1CUFA 3JARA 4FXOA 5T4BA 3I2IA 2QLJA 1C50A 2OBLA 3GFGA 5HGJA 4TWRA 1XE3A 4Q66C 3FJOA 4KZPA 2G5GX 1EWKA 1PS8A 1H2BA 4WUTA 5G0WA 2JCGA 2J9FA 4DCJA 1FFSA 2I03A 4IMRA 5IHXA 1QONA 1EDOA 1XZGA 1Z7GA 3GVHA 4QA9A 4JUCA 1MLDA 4RBNA 1RRPA 4ZQEA 2Z43A 3I9FA 5JLJA 5HP4A 3ZWNA 1RWOA 5AI8A 4YWHA 2I6GA 4DIOA 4Z7QB 2R25B 2OY0A 1QR6A 1T1SA 3A26A 1ZQ1A 3BK7A 4YACA 3RTBA 1H5UA 3A9CA 3H99A 5D86A 2VBCA 1C3OA 1KK3A 1YVRA 3I1IA 4WZAB 2WG0A 2Z6VA 3W5CA 1OV6A 4CCSA 1M7HA 3PJFA 4BB9A 1QUEA 5KI6A 1ZOSA 4MQ4A 3HY6A 4ZEOA 2Z0MA 1IM5A 4Y9DA 3RHTA 5AUNB 1TTQB 1N5MA 3PC6A 1PG2A 2OCGA 4M99A 1PW7A 1X74A 1WQ3A 3A32A 3WZ2A 2O7SA 1EE1A 3R8CA 2RK6A 3FLAA 2O48X 1FVOA 3ZV4A 3PQDA 3U3RA 3GD7A 2Z5LA 4J1NA 1VPWA 1KS2A 2ZUSA 1VSUA 3LL7A 4BMOB 3CH6A 3KJEA 3GPLA 4KJZA 3KPJA 2J4FA 4I1OA 3MF4A 3C6KA 3E3LA 4H9GA 4QUHA 2IEYA 4RADA 3HM2A 4ZOLB 3FPKA 4YREA 1XEAA 4D4HA 2EIXA 3QPBA 2YKGA 1E18A 2C03A 1GQFA 3CONA 3MG9A 5IK2A 1F1JA 4GLJA 5FTWA 2SCUB 3ZCRA 1QGUB 1N2SA 3QLJA 4E1BA 3ZDDA 5IEBA 2FZ5A 2QZZA 4Q0MA 2EJCA 1ZLYA 2XUKA 3FN4A 4OLAA 1JVNA 1EFPA 4TS3A 5EKTA 1AHIA 2I4OA 1RTKA 1FUYB 4LTDA 3SHQA 1H9BA 1N5JA 1E9DA 5KSZA 1QH1A 2OK7A 3O31A 3ZE1B 1KI8A 3DO8A 4X6YA 1XVVA 2E6UX 2PSHA 4X1YB 1DKRA 1MX9A 4MINA 2OEPA 1GVNB 3DVAA 3E9MA 3RTEA 1V16A 2REXB 1A4XA 4J43A 3B3JA 2H9IA 4WY2A 3OTIA 4J0EA 2GXUA 3U7RA 3E2MA 1DBVO 1HYGA 3L43A 4K46A 3I8XA 4S04A 1UQTA 3TI7A 4IOJA 3E1SA 5DP1A 1T2AA 1HDRA 1A4UA 1OA1A 3MIZA 4LZOA 3M2PA 3ZU2A 4CKBB 3QPCA 3H1GA 3K9NA 4B85A 4FB5A 2VFAA 2JVIA 2Z95A 2NSHA 4G2NA 4WOBA 2IV3A 2VA9A 1F5SA 4REQA 4AJ2A 5LQNA 5IBCA 5A5VA 2XRZA 5DGDA 1XNGA 3G17A 3P8ZA 5FPPA 4FYKA 5ISMA 1DAPA 1G8KA 1Y8ZA 3COWA 2YJZA 2IXTA 3VKUA 3IAHA 1Q3IA 2AIRA 3DTYA 4D8TA 4MITA 4C7XA 1LK0A 1GU0A 2LV8A 4OJKA 1IJFA 1VMAA 3FKSA 1CHNA 5I9BA 1YZKA 5C1BA 3MB5A 5BVGA 2O8DA 3MELA 1K7SN 4RD4A 3UMYA 4N7JA 4A27A 2EJBA 1YVUA 4Q16A 4K03A 2EX1A 4LRSB 3Q12A 1IZ8A 3ICPA 2Z09A 3RAEC 1MA3A 3UV3A 4BJHB 2PJRA 2E1PA 1F8FA 1M2WA 2GF9A 3K1TA 5L3QB 3NP7A 1J2JA 4K6KA 3G5MA 1TEHA 2RAFA 2ZI7A 2CNWA 3AF1A 3EG9B 3HJRA 4D57A 2X1VA 1ZM7A 1TNDA 3IIEA 2K2QB 3H16A 2FJ0A 3VYTB 4MUJA 1KO5A 5D7BA 3B1KA 4ZYWA 1E9BA 1CRZA 2UZ0A 3ENWA 3G2LA 4JIGA 2HDNB 4KKXB 1FSGA 4NBWA 4D4JA 4ZFNA 2IX3A 2QMEA 2ZTVA 1OMOA 2CFOA 1NJSA 1RHUA 2QGFA 2ZQYA 3MRTA 4UVHA 2HEGA 3A70A 2AK2A 3DBIA 2E49A 4Q7LA 2ZZKA 4OYYA 5G4KA 5F7OA 1BA3A 2W11A 4OQDA 2AHRA 2HNAA 1I6KA 5SZJA 2X5XA 1ZIYA 4PG5A 4IXNA 5D85A 4RIEA 1XU9A 2G07A 1DRJA 2PCJA 5CBPA 1IM2A 1XRNA 1Z4QA 3OECA 4QUEA 3C6ZA 1LC0A 3W6PA 2N1BA 4MYTA 2PKYX 4AN0A 1VGQA 1KKUA 1UDRA 1YD7A 1BROA 1RJEA 3K0BA 5JQGA 3EBPA 1AJEA 1NIJA 1ZM2A 1S5PA 3CBQA 4FX5A 1II8A 4GXTA 5C34B 5KTOA 4NICA 3DDWA 1ZSNA 3PF9A 4OHRA 3D1LA 5EC8A 4AJJA 3FFAA 4KMSA 2OLEA 3ZIUA 2VP2A 3RUDA 4OMCA 4ALIA 2F17A 3JYPA 2ZAGA 5E6SA 2WRZA 4EJ2A 3KQPA 4CG0A 2JRCA 1P4SA 5ADWA 4LBVA 3K31A 3FYSA 1JW9B 3MUFA 4KUEA 5AKZA 3WGGA 4PLCA 3KHUA 5HXAA 4L5AA 2DLNA 2BI8A 2GMWA 2OXEA 2ZRDA 1NVWQ 5C4MA 3CLKA 1O6CA 5JXWA 1M1NA 1L8XA 3OQIB 2ZR9A 3FUWA 2Y9MB 4MVWA 3GDGA 4BNXA 4CRWB 4P0QB 1DADA 1OXUA 4PZ0A 4YXWD 2VHJA 4MWEA 4QU8A 4NMMA 1KR2A 1IN1A 1EAMA 3TMYA 2YOHA 4HX2A 2O50A 4PQGA 2ZUCA 1Q3TA 1TB4A 4AJLA 4GE3A 1MO3A 1ZN8A 3GARA 2I2WA 2UYYA 1H8HA 2G4LA 2QM0A 4P92A 4WN3A 5CW2A 1QH0A 2O2XA 4CLDA 2G83A 1VB5A 3IP8A 4WV3A 5J63A 4Q3OA 2DFNA 3TQRA 1EJ6A 5EPOA 3BWDD 3E22A 2ECOA 1QWSA 1P7WA 3T4XA 2GO7A 1G20A 3BICA 3CZ5A 3RC1A 5IJAA 1J06A 5F4BA 3ZK9A 1LI4A 1XRRA 2H0AA 2VDJA 4BN5A 3IPXA 4ZQIA 4F91B 4M87A 4EGFA 1CVRA 4MIKA 1QGYA 2HSEA 3NALA 3LVFO 3GF4A 2WF6A 4DQ0A 3GUHA 4BKMA 2DH5A 1IEQA 2ID4A 3E7FA 3AUXA 1MC4A 1GQRA 1TJ4A 2C4KA 3F2VA 3FYHA 1HE4A 3LYUA 4IGKA 4B9AA 4PIMA 4PAGA 4HLQB 2DH6A 2H4HA 1FFBA 3UB2A 2YDXA 2QI9C 2W2PA 2PTHA 3BRCA 3W5VA 2OQRA 1R88A 2AOXA 2PWAA 3A4LA 4QDXA 3TNDA 3ZHYA 5CFQA 3Q8LA 2IFTA 2M6LA 1FXSA 3HI4A 3VZDA 1XDSA 2HK9A 3LHKA 2C88A 2IKSA 2JFWA 1YDMA 3H0KA 2G77B 3QJYA 1A0OA 1OBFO 4HFJA 2BONA 4WCFC 2YWRA 4UQLA 4DSTA 1JEOA 1J70A 1X8KA 2BJWA 2VYCA 1GZ7A 2ZVQX 1SQ6A 3QQ5A 1HL7A 1WX1A 4YP7A 2O7RA 3M6XA 4BAGA 1B3RA 6AT1A 4DWJA 3ROKA 2UVDA 1CUCA 1TI7A 4TLMB 4L5CA 3UHFA 4UAJA 4C0QC 1UC8A 3NCTA 3O8CA 3B36A 5JYBA 1HG0A 3IILA 1QF9A 1YRYE 5HQTA 2WPDD 1KYIA 1C7RA 3QE9Y 1ZY2A 2RCNA 4XOUA 4BP9A 3H7IA 3WA6A 1ILWA 4ILEA 1GPKA 2PJDA 3UCFA 2VQEB 4TS1A 3NKFA 4UUMA 4PHCA 4KIGA 1CJMA 4CUJA 3QYAA 1CVLA 1UBSB 2G6BA 2HUNA 3IVRA 2CCKA 1PNRA 4MYRA 4R2LA 4HZIA 5JAHA 1ZOIA 2B0JA 3WLIA 3MBKA 1L8AA 1R4NB 1RD4A 3S1LA 5JADA 4GDFA 1L7OA 3UT0A 2ZUDA 4PPFA 1UANA 3JD1A 3NATA 1XD8A 1JFFB 4IMIB 5C4IA 3RO7A 1A9XA 2IV7A 3PDWA 5C5CA 5K2OA 4DV5B 4EEZA 2BHTA 3QW2A 2NV6A 1U1EA 4ITVA 2HT1A 1TK2A 3EVCA 1VHQA 4M9SA 4ETIA 4I14A 1NM5A 2YN4A 1WZUA 2ZG6A 5ITZA 1R74A 5A2GA 3FWYA 2D0DA 2DPYA 3IT1A 2OO7A 3ER9A 1CKEA 3EZYA 2HBQA 3K20A 2O2DA 3MC1A 4S1NA 4RZUA 2WSSA 3EY9A 2FSVC 2XF8A 2PUCA 2C4NA 3HXKA 3P4XA 4RMHA 4BNYA 5L4SA 5LU8A 4YJGB 3T7EA 3TIXB 1CTQA 3LGSA 4RL4A 4R51A 1BE0A 4YRTA 4F8EA 3ID6C 2B5WA 4RTKA 1DAHA 5BWBA 3W2TA 1PJTA 2QS9A 3S1SA 4BYGA 1A96A 1X0VA 1FSZA 3QVKA 4GHWA 1YJBA 3D7MA 3ZBUA 1PR2A 3DZDA 2AN1A 4GEGA 4UZFA 1OJLA 1TKAA 1U4OA 3O3NB 3QVLA 1EFUA 1YKFA 2UV8A 1M6WA 1PHRA 2CFIA 2IC5A 3RUEA 4C2UA 3CF4A 3EIWA 5C1OA 1OBCA 3KSBC 1Y98A 3MCZA 1H93A 3PYXA 1JXMA 1W85A 1AT1A 1RC1A 4F9EA 3W9BA 1PFWA 4MV3A 2BGUA 4KXFB 2WHQA 1U2ZA 5EJFA 2QTVA 4LA4A 1AGYA 1ZX1A 3DULA 1MTOA 2BGRA 2GI4A 2IYVA 2NO5A 1LTHR 4IM7A 2FW8A 3TD9A 3ZKAA 5KYWA 4EGQA 3ANNA 3RIHA 3VH3A 4KDFA 1PQYA 4NFSA 1LSUA 4QO7A 3D1VA 3E4CA 1B1CA 2BM0A 4F6RB 1YA4A 1ZR2A 5C3MA 2C4TA 2NX2A 2OMEA 1U8YA 1E66A 1RAEA 3PFKA 1ZAYA 1FTNA 4U7HA 4RK4A 4ICIA 5LB4A 3NZEA 1GCIA 3SQNA 1UBTS 2FOLA 1MJ5A 2CWDA 2FPOA 3QLUA 4IQGA 1B1AA 1PWXA 2VSQA 2BF7A 1EHCA 3CZ9A 3BKXA 2OXCA 3CLTC 1XXHA 3PX2A 4F85A 1IXRC 1U2PA 1QGOA 2QUJA 1M1UA 1YHYA 2FPWA 4QC2A 4HRYA 5F98A 4JCOA 4EM6A 2EWWA 1SIBE 2VK8A 3OVMA 2FCAA 4R40A 1DCMA 2X9QA 5I47A 1M2VB 5A6SB 2O5CA 5JFOA 3ETHA 2LRHA 1C3XA 4LJ9A 4CFYA 2ZPAA 4FIZA 4O4IB 1CUHA 4AIIA 4J3FA 1P81A 5T4FA 3PUVA 5JPDA 2VHTA 4KXXA 3EZXA 4P3NA 5G1OA 3Q9SA 5BQPA 1DMSA 2KBEA 4ZO4A 2FZLA 3PNLA 4QUIA 3Q6MA 2JGLA 3QFSA 2J0VA 1DAGA 3DBRB 1XN4A 4H3SA 2EBUA 4EHDA 3NPMA 4WKPA 3IEVA 3VYVA 3TZLA 2O9JA 4B46A 2DSTA 4AZTA 1SXJA 1NF3A 1TQHA 4NNPA 1CFZA 2EGGA 2VF2A 1Y9DA 3PWTA 4NDZA 1JSLA 1M8PA 1F0PA 3ANSA 3MWDA 2P0YA 3CVXA 3MTBA 3TRKA 2JIRA 2DMRA 4XOIA 5BQXA 3NTVA 1LUAA 1KPHA 1U7PA 1NBHA 1XMPA 1YMVA 3D81A 3DB1A 4OCZA 5CVCA 1BKDR 3P0HA 1C9JA 1B8NA 1N5KA 3D3WB 2ZIXB 1VSTA 3CIOA 1USUA 4PSVA 2JA1A 2D1RA 1XQXA 2C5HA 5TS2A 3AY3A 2FN3A 5CHEA 4CKYA 1RWWA 1B0AA 2XAUA 4RQBA 4FILA 3SPXA 1U65A 2Q9CA 2I87A 1OVMA 4E2FA 3JQ7A 1BH2A 2BR3A 4YUWA 3TQTA 1KH1A 5SZIA 3D6NB 4KI7A 4Q9KA 3OZWA 3L1VA 4QLAA 2NSDA 1O97C 4P86A 1LEHA 5U4XA 4BNKA 4V1CA 4HGOA 1P2VA 3H2BA 3QFRA 4GZLA 3OLCX 3CLSD 1UXJA 3EFOB 1PJ2A 2R1TB 2NTJA 2PZJA 2BEUB 1Q0TA 1EBUA 1G7RA 1I0ZA 1KR5A 1A9YA 3I9JA 4XWGA 2AK3A 1ETUA 4L6CA 4MUHA 1J00A 3HGQA 3D8TA 4XIFA 4EL0A 5FNVB 1RXSA 3T15A 4LJKA 2DSNA 2VA8A 4KWCA 4S1OA 3ISJA 1L6IA 3G5LA 3I2KA 3RLFA 3QX3A 2A59A 2A5FA 4V03A 1Q5PA 4EG7A 4HMOA 2JD0A 3WNBA 1VFNA 3GWGA 4DRZA 1B2LA 2EGHA 3AY7A 1WLSA 5ICMA 2I3ZA 4OH1A 4HNGA 4A15A 1SB9A 1DHRA 1FTYA 1Q3HA 1U8CB 1ZRHA 1XGKA 3GW8A 3KZCA 4MKZA 4E88A 4ER3A 1GRVA 3E35A 3JWPA 1Y1RA 1TM7E 1W0KA 3NHWA 3P0IA 1GUAA 4RUKA 1A82A 3JYOA 4DREA 4P4UA 3L6UA 3KLMX 3TRHA 4MWGA 4PO3X 2OHGA 4MW0A 2FPXA 4HZUB 3MAAC 4QM6A 4HDRA 5EIFA 4C0XA 5AKLA 2FMIA 3PQFA 3V4FA 1X19A 2XRMA 2CXXA 5IZ4A 3AUUA 1O95D 5K0BA 4QDUA 3ZQ6A 4CZ2A 1E5XA 3EDYA 3CUYA 9MHTA 2I7XA 1BGVA 1CT9A 4GP7A 3VPFA 1ILEA 3W3AD 2QNRA 2CXRA 2O8FB 3AG6A 1KEKA 3NHLA 3PUIA 4BNNA 2XDAA 4GPZA 2ACVA 3OI7A 1E2UA 3TG2A 3PNKA 1VL8A 2MYTA 5TQ0A 3SQLA 3NBFA 4ZAYA 1JSCA 3PGKA 5JDCA 2BFFB 4OGWA 4LEIA 1IK4A 2IPMA 3NUZA 1JILA 1GTSA 2DECA 1Z2AA 2P0EA 3PPIA 5EWMA 1PTKA 1F12A 3SBOA 2P3OA 1YZ3A 2ZRJA 2D7DA 4BMPB 3LCVB 2PUDA 4DLKA 4C89A 2REBA 3IB3A 2WYWA 4DL9A 2H63A 2Q1YA 2X2EA 4YJ2F 1HDIA 4OLFA 1TYEB 2YJTD 2OCBA 2B2CA 2Y71A 2I0FA 3PXUA 3QEJA 3PQ7A 4CHTA 1ZUD1 4QBGB 5JTUA 1O94C 1JR2A 1BHQ1 2C77A 4NE2A 4D80A 4AQ7A 1U5AA 2JI7A 4HQRA 2IXGA 2Q7XA 4MCIA 4TRRA 2JCSA 3JR7A 2VRNA 2CVQA 3FG9A 4ROSA 1MJGM 4LWOA 3OM0A 2W6JD 2ID9A 1MIOA 2YJGA 5DHAA 3WB0A 4ALNA 5CXQA 5EQTA 1JLLA 2XXBA 4GZ3A 4US1R 3CSDA 4EKEA 1B2RA 2IUFA 4R2WA 2CK3A 3ETDA 1YUMA 2X0EA 5KDDA 4RHCA 3TTTA 2GYYA 2P2SA 2V59A 1V8DA 1EXNA 3AMVA 2ZUUA 2JBHA 3ZTYA 4MA0A 2JIDA 3BQMB 3QU9A 1YZLA 3TVDA 5K3CA 5F9FA 3DMGA 4QPJC 2ADOA 5DFAA 2HRBA 2HA0A 3OFVA 1CYDA 1P7VA 2D1YA 1Z0AA 4FFBB 1VPTA 4GLFA 4Q4AB 2P3SA 1K8ZB 1M74A 5M5BA 4TYPA 4YMTA 1Z17A 3U7FB 1VMIA 1U2SA 4HAXA 4E5VA 2ODBA 5JSZA 1X9GA 4HS9A 4E5DA 3E8MA 3VR3D 1K7FB 3KKOA 3T3HA 2XA9A 3N0TA 4WFIA 2F62A 1YE5A 4EUSA 3KNZA 3CURA 4Q00A 2BVNA 2GOYA 2N0SA 2JFUA 1E2QA 1N2BA 1R18A 3EAFA 5EMHA 2O19A 1H0SA 1CE8A 2H2GA 4R0VA 2PO5A 2E5FA 2YCLA 4LF9B 2C9OA 5CCEA 2NW6A 4FYIA 3CHYA 1FMCA 2EX0A 3C6BA 5B6IA 4AJ4A 3ZWQA 4OB8A 1WPQA 4FYHA 3ROFA 2AEEA 1AF7A 4GW3A 4R8RA 2UDPA 3E61A 1P3DA 2YYAA 3LPNA 2ZYUX 2J7KA 1ZD9A 3ANLA 4X7PA 1S7CA 3SS8A 1P5FA 4A8JC 2GN2A 4WOJA 4CI9A 3O26A 3F8SA 3BJEA 3D5TA 1E9CA 3CKYA 2REQB 3GYGA 4MIYA 4QYTA 5KS2A 2C20A 3W5UA 1ZOOA 3ZHTA 2QDXA 1BO6A 2P7HA 3CZ4A 3IEPA 4AULA 4BYMA 1DZ3A 1DLJA 1WOMA 1US8A 2VPYA 1QBGA 3GVCA 4UNIA 2HA7A 4N76A 2CD7A 3NHZA 3LC7O 1H2HA 4UATA 1TJPB 5K3AA 2YJ4A 1N2ZA 3HCCA 2BFCA 1HF3A 3D59A 3MNFA 4IHJA 4QPDA 3SYNA 5K0TA 3S2GA 1ZHFA 3HLTA 4TRNA 2I99A 3HZOA 4FCWA 1VBKA 1E1DA 4AAYA 1E6WA 4KIWA 2DCUA 2Q28A 4ME6A 2HNKA 2I62A 3FPGA 3RS5A 3VO2A 2VHEA 2QR5A 3GEMA 4WBSA 5BSVA 2QL9A 4W9MC 2TS1A 1E1LA 3DAPA 3VNUA 4G4GA 1W87A 2VXYA 3BREA 3ND8A 3PI6A 1ARZA 2XE6A 1YI1A 1RBQA 4FYVA 1YUBA 1UBNA 1V8ZA 2R7NA 3X3HA 1FEZA 3CB4A 1GPLA 5EINA 2BMVA 4ER0A 4PHTA 1M2EA 5DK6A 3EMDA 3IXMA 3SICE 2D8AA 1G63A 4WZAA 4JI4B 3SHFA 1RZRA 1X94A 1O96B 2DBZA 4KLZA 5LYYA 3S2UA 2IXDA 3CNLA 5ETJA 4B3FX 1EVEA 1YR3A 3W9SA 5DK4A 1Y4UA 4M0FA 4J49A 4CDRA 2ZK7A 2VRCD 1W96A 3HCRA 1QRDA 4R3UC 4Y1GA 2P35A 1UIRA 5DWQA 4EBFA 3QVGB 1RBZA 1CUSA 4XJTA 1SVOA 5JYEA 2BM1A 1PLKA 3WL5A 1TLTA 3STHA 2W00A 3TX2A 1P0FA 2ENWA 3UATA 4LXIA 1T5SA 3CGGA 4PQEA 4ZOLA 2D4HA 3NC4A 2FX2A 5TGDA 3ROXA 2OHVA 4B80A 2O7QA 2VJDA 1L7PA 4UUOA 5I7VA 1Y34E 2G9RA 2PMFA 4CLRA 4GBED 5KB3A 1SGWA 2WQ6A 1XP8A 4IAOA 4PG4A 2UXDB 1QTNA 2NO1A 3QBDA 2SCUA 2WFZA 1QGUA 4MRMB 4KIJA 1LDEA 2GLTA 4BX2A 1OBOA 4ZC1A 3OOYA 1GZ3A 3KT8A 3SC3A 5DWVA 3UQYS 1WZEA 1ZYUA 3TCKA 3DZHA 2JJYA 1MB9A 5TR9A 2W90A 4JKIA 4ANFA 1OBHA 3VR6H 2ZSHA 4BJ6A 3F4KA 4ZK6A 3AIIA 4ARAA 3T1HB 3IPRA 1I7DA 1TECE 1PFUA 4PAMA 4QXQA 4PYOA 3DMTA 3LX6A 5CG2A 4X1YA 1MNAA 1U2TA 2BHNA 2FOXA 4ENRA 1XD9A 1R5BA 2VHQA 5P8WA 1AS2A 4MB2A 3VR4D 1WB9A 3BB3A 5JCPA 2FLKA 1YDFA 1LZKA 3HYLA 5BYKA 4OHOA 4UZEA 3DCNA 4MVJP 5H82A 4Y2QA 1CNEA 1Q20A 3T5DA 5J4LA 3EVGA 1UC5B 3JX9A 4EYKA 1KJYA 1P6UA 4GM4A 1QLWA 4JP5A 5F3WB 1PU2A 4LG1A 4QFBA 4R71A 2ZUFA 4E5PA 3HKBB 3CKMA 3FAKA 4V0KA 3LSTA 1VKZA 1D8AA 3DCYA 3U0BA 2IDZA 1GZUA 4E5KA 1TFUA 1WUJS 5FI0B 4TX1A 1WHSA 3E05A 2WMOB 1OX5A 3IGFA 1ZIXA 3O7MA 3Q88A 4HATA 1DAKA 4HAUA 4NBRA 4OH7A 5ESWA 3RFUA 5LR6A 4UBMA 3H86A 4TXNA 3M6IA 3I5AA 3E8SA 4PQYA 2BLNA 2ZBFA 4C7JA 1Z8NA 2B30A 4JP8A 1SVWA 2VHUA 1G41A 2WW8A 2ZJ4A 3IUQA 4PSDA 5B3AA 3RSQA 3TVYA 4CNQA 1TU3A 1PNVA 5DBOA 2Z5FA 1MBZA 3ZI7A 2IHYA 4IZHA 3SBEA 3AR2A 1UXOA 3OJ0A 4ADSG 1BEUB 5L3QA 2AN9A 4PNZA 2BKLA 4IUDS 4KE7A 3L84A 3EG9A 1QIIA 2DHRA 3E5NA 3VPXA 1G20E 4N3NA 4NMHA 1BDMA 1RYDA 4R9VA 3DLTA 5JO9A 1KSJA 3WBKA 1AQUA 3ZY2A 5KJEA 5F52A 1SCDA 3T3PB 5TY0A 3BT7A 2H4WA 2OYRA 2QQ5A 1K5PA 1NF8A 2OZPA 2Q46A 5BSEA 2D7CA 2IHUA 5AJTA 4XDZA 1P62B 3WLOA 5LWQA 3FDJA 5TLSA 1C1DB 4PYNA 1P1FA 1QP4A 1XZNA 4Q7JB 1ADCA 4B2LA 3P19A 5LXTF 4G5XA 4B87A 3OPYI 1MFPA 1YH3A 2HSDA 1F06A 3LPLA 3E7WA 4A6XA 1WKBA 1XRJA 1HZZC 2NQTA 4IV5A 4TMZA 5AVRA 5JJCA 1PJAA 1L4LA 2RAUA 3T99A 3T9FA 1NASA 5KNLA 3GRRA 1CETA 1JXQA 4Z9FA 1ZCAA 1FXWF 3HDHA 3PR2B 1EPUA 4NYJR 5HTKA 2XGOA 2I54A 4CCYB 1G8JA 1WXHA 5EXEA 5LDGA 3UGJA 3QBEA 3AVOA 4HB3A 4ESVA 5CA0F 4ARCA 3DW3X 2R1ZA 2I7TA 2PX3A 3L4SO 4Q4JB 5B3JA 3TW4A 4BLVA 4EVQA 1HFWA 2W2NA 3AOGA 4G1EB 1RHMA 2JVJA 4RK6A 2QZPA 4MIEA 3TTUA 1BDBA 3MFQA 2FQWA 5A7HA 1X77A 1KNXA 2BI7A 1CUIA 1PT8A 1V35A 3JQDA 4P0PB 3LH5A 3B70A 3VSDA 1J0EA 2JLWA 1N4AA 4KNYA 4MIOA 1N3IA 1GUDA 4LW8A 1LTKA 2QUIA 3WA7A 1CUVA 3E8XA 5LDDC 1S96A 2QX8A 3TPCA 5JQWA 3QOFA 3OCZA 4CF7A 3DZJA 2FW7A 1W9HA 3FSEA 4P7GA 1KK1A 1Q84A 2WAYA 1S4MA 5FR1A 5BNFA 3SIXA 3DT6A 3T1TA 5THKA 4UHCA 3FUVA 1CZHA 3SMVA 1T6XA 4REMA 3EGDB 1Z2EA 5KOIA 1WCIA 4XX1A 5HDBB 2CE7A 3ET5A 5EUMA 3G0BA 2EBHX 1HDCA 2FR8A 2PH3A 3AZPA 5ALMA 3SQMA 2B4YA 4D4IA 3WGUA 2UAGA 1Z6GA 4NE9A 4MDEA 3KJNA 1G6OA 1LBSA 1XTQA 4LY0A 4CL8A 4ZQCB 2R48A 1KAOA 5JSQA 2Q4RA 2YY5A 4PYRA 3RADC 1BYIA 3QFTA 2ZSFA 4YMWA 4Z8YA 1T2DA 1T8UA 4N5HX 4QODA 3O9MA 4BBPA 1HFEL 2JEYA 5TMPA 3CXRA 4RGQA 1WPGA 2G09A 4LMRA 1GAJA 3WKBA 2C78A 2MSWA 1ECPA 3DWIA 1OX4B 3L04A 4PZEA 3A04A 1O5OA 1J8DA 1XD2B 3F1LA 4FJ1A 1OI7A 4B4WA 1R3DA 4MV1A 1J2YA 1HFJA 1W88A 3OKPA 1NZFA 4H31A 2NP6A 4QKQA 1R37A 2H07A 3TB6A 3W3AH 1VHTA 4FGZA 3AKZA 3IUEA 3MIIA 4LQDA 5F5LA 4M37A 3DKPA 1M8KA 3FW1A 3LKVA 3WYEA 2OGSA 4AO8A 4CQLB 1EXDA 2WLTA 1I1HA 2F1RA 4PGFA 4RDHA 1JQKA 1KOFA 3JAWA 3JVEA 5J4VA 2CLDX 4URFA 4CDNA 2H7CA 1PP4A 1GKKA 1TD1A 1YRWA 2ASVA 2Y2VA 1NOKA 3OX2A 4FTWA 3FTEA 3TBFA 4DVJA 3CBGA 2AWNA 2ZM6B 3QOXA 1AKVA 1KK2A 1NJ5A 1RYMA 2IS2A 4K05A 1BEEA 5E1MA 5IAOA 4LOLA 1P7PA 2PYIA 3DBOB 3F96A 4O3FA 5HIJA 4CU2A 1SBYA 2JZCA 2IF2A 5MFZA 1G8MA 3ZLUA 1N7IA 2VG8A 5EI5A 3I2JA 4CKWB 3DWEX 2DQYA 3LJKA 2REOA 5K0FA 3P97A 2I3BA 2RHMA 3R09A 1VCNA 2ZRIA 4LMPA 4DDVA 2GZ3A 1SHLA 3EC7A 4R9RA 4ITRC 3QYJA 2F55A 2UU9B 1R4NA 4Y2PA 4EFNA 2GA8A 2C2YA 3ZDCA 1IONA 3DP9A 1S6YA 4KDEA 1JFFA 2O3SA 3GP5A 3VYSB 4W9NC 4B7CA 2Q99A 3AR6A 4C2BA 3ZJUA 4GLLA 3OOJA 4CM9D 1YASA 4BRWA 4U3JA 1CR1A 2C59A 3GVXA 3TD2A 4PRLA 3GCWA 3OZ7A 4IVNA 5G0UA 4CKEB 4LRWA 3FCUB 1JIUA 1KU6A 3ENQA 2N47A 4F60A 4BRUA 5EJGA 2WZDA 2HHAA 4U7WA 4TTAA 4L9AA 2J6BA 1JDZA 4GXRA 4J1QA 4NV1A 1SZPA 1ZDMA 2W2TA 4I8IA 1X2EA 2Q4TA 3HGMA 4JB3A 1FVFA 3L6RA 1P8AA 4YJGA 4ZEWA 1JFLA 5TJHA 3SZMA 5LXTA 4NXNB 3SJAA 3UT5A 1CUZA 3G59A 4XM1A 3TNFA 4DE5A 2V0NA 5EP2A 5KSPA 5J23A 1X7WB 2ORIA 1ZXLA 5H8WA 1S1MA 1ZXBA 4OFWA 5KWIA 3OQPA 3VNRA 3E70C 1OT3A 3HXLA 4I6GA 2VWHA 1RYHA 2H31A 4L5IA 3K70C 2YW9A 4DJAA 1HGXA 1U3WA 2F4NA 1NNSA 2EP7A 2B6HA 3P9CA 1MCZA 4HSEA 4JT4A 3MTIA 4B17A 2XWSA 3W7BA 3D6UA 3I9KA 3C6YA 5EYPB 1NSTA 3VGJA 4ZIRB 5HM8A 3RBXA 2C95A 4I4TB 1IU9A 4WLEA 5CVUA 4US2R 4QUDA 1L1FA 3R6DA 1CEYA 5HIIA 3N6RA 1E5VA 3COSA 3L06A 1E0JA 2E5LB 3ZDBA 3JYNA 2AR9A 2BT4A 1RJDA 4ZOCA 4TXMA 1I3NA 1Y0BA 2BIFA 3GLTA 1QV7A 2QSZA 2KQUA 4F6RA 2PGLA 1MAVA 2C94A 1CUBA 1HYHA 3QOYA 4WGGA 1UM9B 2D5AA 3TYXA 3QVUA 1A8UA 3HR7A 5LP6F 1WUYA 3E3AA 1SOUA 3O8DA 4B3IA 4CF3A 1OGIA 3BIOA 3ZWMA 1I5EA 4Y7DA 4K6GA 4DLSA 4ER5A 4HP8A 3LRTA 2N9UA 2V7PA 3OY2A 3F90A 5DSZA 3LXRA 3GIWA 1E4OA 1XJCA 1V71A 3QTTA 4WUVA 4WXMA 5IJ0B 3IP6A 4ZYZA 3VAAA 2I1QA 1WP9A 1W1UA 1QORA 2ERYA 2LCIA 2P1RA 3BORA 2PZLA 5DW3A 4M21A 3RLIA 4KPGA 4R1SA 4Q5IA 2WHRA 1QANA 3F3SA 3UPDA 3QG5A 3I6ZA 3HSYA 1I3OA 1K7YA 4AIRA 1M2VA 5JTTA 4U2CA 1EK1A 2D5CA 3D6JA 1AMOA 3WMFA 3BZUA 1YHZA 4JI1B 4B44A 4UE3S 3QI7A 3UHAA 2G08A 3RS9A 2AUMA 4EAAA 3A3OA 3DBRA 1E3MA 1FC0A 1R7RA 2DFKB 1P2SA 2Z3ZA 3D7NA 8ABPA 5HSGA 4LFBB 1SRQA 4FLFA 5F78A 4F5ZA 1YULA 1ES9A 4BNFA 5A3JA 3R0VA 4J2HA 1XRPA 5HYVA 2ZS7A 4FBLA 1J33A 2QXTA 3WGTA 2WTNA 4AMUA 4EWLA 3V3KA 1SHTX 1RMTA 4EMBA 2PWYA 5DNYB 3AP1A 4KTVE 4BLOA 5LA6F 1B74A 3R3HA 2Q50A 4KQ1A 4PX9A 1RWMA 4OQYA 5FI3A 3CH5A 5E9JA 2W48A 1T4CB 3N87A 1E61A 3OD1A 4LVNA 1XFDA 4M8IA 4YMIA 2VJYA 2W2QA 3D3WA 1FMFA 2ZIXA 1NU8A 1DCTA 1T1IA 5BORA 2JI8A 2OO5A 1KO8A 1M0EA 5F51A 4QGFA 3I4FA 3I8SA 3OU7A 2FVYA 4KB5A 2ZYTX 5HX7A 4XM0A 1KI9A 3HYTA 2FR0A 3UOWA 1OZ0A 1UPCA 3K6SB 1NIPA 4XJXA 3Q72A 4QT4A 1OQAA 2I6UA 2XLCA 2YHAA 1W4AA 1HSZA 3LFHA 4OXXA 5DYGA 2YCBA 1M1YB 1X7XA 2ZWPA 2IYSA 1E2MA 2G7MC 4FWBA 5H1YA 2HU5A 3KUKA 3EFOA 3QOWA 3O8RA 1JB9A 1IB6A 2R1TA 1I3KA 2WUWE 2X0FA 4KR3A 1EGMB 3K0FB 3QWFA 4JDPA 3HZRA 4HN2A 4LHEA 4Q9HA 3U3JA 4NV3A 4QJIA 4AP6A 2D5BA 1VG0B 1YDHA 3MWGA 1TAHA 3NVMB 4IUYA 4RW0A 4A10A 2B1JA 5B58T 4JJKA 4MAMA 2RGAA 5GMOA 4JXJA 2XI4A 1YE8A 4D8YA 4Z4FA 2RHOA 1T0UA 2VNIA 1NN5A 4KRYA 3CZRA 4QLBA 1B0UA 4X65B 4LUCA 1B76A 1KDZA 1JWAB 1OXKB 3I3SR 3S7ZA 4BMXA 3F6CA 2QM3A 3CR3C 4OI1A 3V9PA 3AR9A 4J0JA 1XEFA 1S2LA 1W73A 2Z56A 4NESA 1DXQA 1JYEA 4P8RA 1Z73A 3QLTA 4G84A 3PXBA 4U7TB 3C5HA 3MYYA 2ZIGA 2L17A 1T1JA 4P34A 1ZA1A 4RDCA 4YNBA 1A7AA 3IRUA 1USWA 4KTTE 3LU1A 3EUAA 3QHAA 4GOXA 4HZUA 3V8EA 3KTAB 4G9EA 3M3HA 2ZBRA 3THWB 2AYYA 5F77A 3TI9A 1UDBA 4OF4A 5K4AA 2P3LA 5IX8A 1Z56C 1GKLA 2VDLB 3VR2D 3V8MA 4JIMA 5LWHA 4R6XA 4L4YA 4LJAA 3OY7A 5CMLA 4A0SA 1OAKA 2FFAA 3KDAA 3DZCA 2B21A 2VYVD 1M7BA 3Q9NA 1SBCA 4YXWA 3DVRX 3AL2A 1GA6A 3MERA 2OL4A 1AKWA 1Y4DE 4CDMA 4XQGA 4IHAA 4NXMB 2VNAA 1XOIA 3ZIDA 4B6OA 3KHKA 3ZLJA 3FTDA 4NFHA 2BFFA 1L3IA 1VE3A 2WM9B 3X1MA 1KDVA 1S9HA 4FC6A 1MOPA 4HWSA 1RFLA 3KCQA 1E98A 2V5AA 1NAIA 1TO6A 1XA0A 3OQ6A 3PTLA 3TQHA 1TTTA 3IXQA 5COAA 5HJ7A 2DWPA 4Y0NA 1ICIA 1IPFA 4TLDA 4ABTA 4N6GA 2D2FA 1Q0RA 4AY5A 2AE1A 3BWXA 3ZI4A 1T8PA 5B3LA 3SVLA 2GLUA 4URWR 2B2NA 1KZYC 4P3YA 2O2SA 4U8HA 5ALEA 1ZCFA 5HBRA 2OXIA 3TL2A 3U9TA 4CN8A 4D9NA 4DBZA 3TXYA 2YIVX 3BULA 3V4VB 1Y37A 3LM8A 4GYKA 1MB2A 2O8CB 1YIDA 1TPYA 4BNUA 4TVSA 1JFVA 5TRTA 4AJOA 4L5YA 5FTLA 1JNYA 3B3GA 3THYB 1J07A 4IVRA 1MAHA 2JJ8A 3VHQA 5B12A 3DFIA 2HA5A 4DR7B 1XVIA 3O4HA 3K1AB 4A82A 4O29A 3FNRA 3NEJA 4FIDA 3V46A 2PLNA 3C3KA 1M34E 2QLTA 5AOBA 2E4XA 4Z0TA 4Y9RA 5DIZA 5BSKA 4RF2A 1Z75A 1M8FA 1KYQA 1RC0A 1U7UA 3IH5A 5AJUA 3N7UA 2CHUA 1YFLA 4AY6A 4B0PA 4Z9YA 5K3DA 3ZLTA 4CBVA 1P0IA 1NOIA 1IK6A 3IMEA 3RS4A 3I58A 1ORVA 2RHDA 2B4AA 2JCYA 3SNHA 4FFBA 2WPDA 1X7YB 4MS4B 4PWZA 3ZQJA 3REFA 2HC9A 1KZ6A 3WLPA 4RABA 1XG5A 3VU3A 3ZZUA 2C2BA 2IWRA 4WZAE 2ZR0A 3RVJA 2JLSA 3JZFA 3RYIB 3TLKA 4B7AA 5HQ3B 3FYUB 3HVRA 4M1WA 1MOZA 3F8WA 1IG3A 3PFBA 4OLBA 3II6X 2HJGA 2C7RA 2ZJ6A 2JK0A 1TA0A 1PEYA 1RCFA 3MTDA 4RLFA 2ES4A 5E8RA 5L53A 1Z2PX 2HCFA 2DQKA 2X5NA 2AVNA 2R87A 3IKMB 3Q5EA 2RK4A 4ARBA 1YIAA 1NYLA 2EHDA 2Q6IA 1KQNA 5IM4F 1HNZB 1UKCA 2VDNB 1T25A 2FZGA 4YASA 1FJXA 3ZVMA 1DX6A 4G1UC 3SXPA 2IOFA 5C3UA 5CFNA 3G0HA 1NQVA 3HPRA 2REQA 1U7TA 1QV6A 3FGPA 3IQXA 1RAIA 4U7GA 3O91A 4NCKA 1DINA 2X0RA 2ZBQA 2J59A 2JAOA 4Q39A 3WLKX 2OCXA 2ZYIA 1ECLA 2HX1A 3ADBA 1JSRA 3EIQA 4IDAA 5A7FA 1VHDA 3RRXA 2YVLA 1ATZA 3UFBA 2PSSA 2HA2A 1W36B 1QU3A 3NXKA 5LIPA 1Y5MA 4XA8A 2CLIB 2ZRCA 2HRDA 3A6ZA 3ZD6A 1EFKA 1VHWA 3FUUA 3N8HA 1UDCA 5BVHB 3EF3A 4DM7A 5KJFA 2WKWA 1J39A 4G4IA 5CH3A 3TJMA 1GY8A 3UBMA 1Z37A 2PWZA 3FWNA 3BRWD 5K03A 2PX0A 1EK0A 5TQVA 4IZOA 1KEZA 4UBJA 4N0MA 1P4GA 2AN4A 2GA9A 3A05A 4X85A 4OYRA 4Z1MD 2O23A 3EX7C 3PX3A 3MEQA 4DV2B 1J0AA 1MAAA 4DRXB 4S2EA 4YJ3F 2BRUA 2V7WA 3G79A 3GFOA 3OH8A 1GQ2A 4Y6PA 3DAHA 5IN4A 2OFXA 4FFWA 1MB3A 3BWYA 2O2CA 5HIKA 1E0SA 1STOA 3F7TA 5HKBA 2IZ7A 3DZ8A 4Y2VA 1MFZA 5JDIC 1AV7A 2IP2A 1NVDA 3SQXA 2O54A 1ABEA 3T4PA 3RJTA 5DOZA 4D2IA 2E6KA 3QVGA 1VCMA 3DKKA 4JC4A 3L41A 4XB6B 1JDSA 5EOVA 1Y8QB 3M49A 4LXXA 3ZS9A 4DDMA 5DHPA 3T0GA 2NSJA 3V7YA 1GTL1 1O6BA 4FDUA 4PLFA 3TIFA 4CIDA 3LSYA 3HBLA 3WRWA 2Z58A 3BRSA 3OBBA 2YZ2A 1R9MA 3B89A 4MR7B 3PLAE 1GIAA 2ATVA 3QNUA 4PLZA 5FULA 1HY3A 2GRUA 2X7XA 2XVXA 2QJWA 3WICA 4OUDA 5JD5A 1DFIA 2FG5A 5BQOA 4MRMA 4EPRA 4OLHA 3O8NA 4INAA 4YO8A 4E94A 3U1BA 4LJ6A 3ZJVA 4DKJA 2PT5A 4UBNA 4YPVA 1LSJA 1N5OX 2Q8QA 3WYNA 2ISCA 3NAGA 1PN3A 2XVYA 3DS8A 3K9QO 1DC6A 1NY5A 3Q41A 4FONA 4R2MA 4ZARA 4A91A 3DR5A 4P3KA 4AZ3B 1BXKA 3BBLA 4HUQB 2CCGA 2RJOA 2VPPA 3DE2X 2FE1A 3H1TA 2OGZA 3K94A 5CLJA 1I7SB 3ZK7A 5L3VA 2NZUG 1ZFNA 2GVDC 3HO8A 2FEMA 2AFVA 3UM9A 4IILA 3OHSX 4YP1A 1BW9B 4LJLA 1Z74A 3BD8A 2VXOA 3N5CA 5EFZA 3WYBA 1SPBS 2BEVB 1CEQA 5GM1A 1B8VA 4FT4A 3SWWA 3QPVA 3K2BA 1TJNA 2H1RA 2A0YA 5IYZF 1YQEA 4A0RA 3HKBA 5JZSA 2AE2A 1Z36A 2FH5B 3MN1A 3Q0EA 3BH7A 4GH5A 4XWYA 2ZSDA 2X0KA 2GCPA 4RS3A 2J41A 1NXQA 5DM60 3FYCA 1JIKA 3E3NA 2XMCA 1KSHA 3U61B 3THXB 3F0TA 3L8MA 1FZQA 4I8DA 1PWYE 4P81A 3ZE2B 2ZT8A 2IA5A 3OD5A 4B7XA 4DHEA 5BR4A 1CUYA 1KRHA 4U5XA 1T5BA 3BX1A 3NTRA 2VRWA 3LK7A 3F3KA 1F8YA 1RM5A 3C8DA 4IIYA 4ZVQA 1G8AA 1TEZA 4INOA 1L8OA 1G7TA 1HH4A 2FJPA 3GK3A 5FBQB 5AVOA 4BMNA 2WQ7A 1ZVVA 16PKA 2UVQA 3ADOA 3U81A 3QF7A 1ULBA 1H6AA 1HLGA 2RGNA 2ZR8A 1WO8A 2BHSA 3HEMA 3OFSA 4R2KA 2OBBA 1JFRA 1IQPA 2OSVA 3I04M 3ZYCA 4EG8A 3DXFA 4L76A 2YV1A 3OU2A 4JLOA 4KXQA 1WS6A 3KR9A 2WWVD 5AUPB 4OQQA 4CT0A 4HDKB 1FBTA 1JS1X 4HCJA 2J9YB 5DLYA 1NQUA 3ILSA 4RTPA 4DSNA 1Z28A 1C1DA 4KH0A 2VP6A 1W5BA 4MPPA 5KWSA 1QGDA 2E21A 1Z4OA 2LE0A 4R01A 4RF3A 4TS9A 3L7AA 5EIHA 4O2AB 3C5VA 5HF8A 1AN0A 4X63A 4B34A 4E21A 5BV7A 2O2IA 2FPIB 2X4DA 4JX9A 4LXGA 3WL4A 3WQSB 4DS3A 4EHFA 1PWEA 1Y5IA 4I81A 4RTQA 2JLVA 1KJWA 1OLSB 3B6JA 4QATA 2W2VA 1KYTA 2CZQA 3RGWS 3U3XA 3Q9UA 4HLNA 3C7CB 3VDXA 1OYOA 4RO0A 4KR2A 2GAFA 1ZBQA 2FPMA 2PL3A 1LSSA 1U8AA 3GZJA 3BXHA 5HS6A 3SGLA 4LBYA 5K0CA 1WZ2A 1CWUA 4CTNA 5JWHA 3OUZA 1OFUA 4JU8A 2XTZA 6GPBA 4RKQA 2IPNA 1FJHA 4YRLA 1KMQA 2D3WA 4CCYA 2BOVA 2D8MA 1O95A 3IBSA 2DYKA 3LF1A 2XYPA 4GOLD 4Q4JA 1FDWA 2GERA 3W3AA 4M3NA 5BWMA 1JHRA 2H17A 4FR2A 1JPNA 1V2GA 3DL2A 3SR0A 4HDSB 1V3TA 4FMDF 2DFLA 3BAZA 3U7GA 4FR5A 2VYQA 3NHYA 1O89A 3RFFA 2PD4A 3HWX1 3UW1A 4D9HA 2ZCJA 1EKXA 1YQ9A 5F9MA 3T54A 3BFJA 2Q4DA 4KR6A 1GNQA 5JYDA 2N46A 3K1JA 1Y6JA 3A3YA 2AL7A 1BJKA 3FNFA 3KYIB 4FD3A 4ZU6X 2WIKA 3UH1A 1BH6A 1WE2A 4J1TA 5F23A 3PGXA 1NMYA 2LWIA 4V39A 2R4QA 2OQIA 5CVVA 4AF6A 4CGZA 2FSSA 2OCDA 1BDIA 2WMNB 1PR1A 4M9XA 1U3CA 2OP0A 2EOAA 3HMQA 3GVPA 3UG7A 3N2NA 1YC2A 3DCIA 4G0YA 2RK3A 3EGDA 2VDVE 2CV1A 3S1AB 4JYMA 5I5EA 4OVKA 2PYDA 1V4VA 4P3XA 4Q1BA 3NW9A 4QXMA 5BWNA 2JFQA 4E1AA 3IE1A 2XQJA 3V1UA 4JQYA 4QSMA 3KQWA 4UM9D 2W6JA 2R79A 2Y1EA 3CPEA 3MJ4A 4JC8A 3RYFB 4EKNB 1PEKE 4PFKA 2IBSA 4OATA 4CMGA 1GPYA 4BX8A 5TMDA 4MEAA 3EEYA 2BGIA 5M29A 1IBSA 4G1BA 1UMCB 2AXEA 2O0KA 5AK5A 1NRWA 5JS6A 2LKCA 1WZCA 2CL0X 3EAGA 4HYEA 1TCUA 4RVFA 3SR4A 3DZKA 4X94A 1U0LA 4HNHA 4MUIA 1XD2A 4G5SA 4ZQFA 1E2GA 1O08A 2AG5A 3ZWOA 3ZCVA 4H7DA 2W98A 3MRXA 5CIQA 1DV1A 3BSYA 3FBTA 4QYIA 5TMBA 3C1TA 4PRYA 5IKMA 2JLXA 2NPFA 2XLBA 3I05A 1TM5E 4CQLA 4JVMA 4BB0A 2YRWA 3MPUA 3MT8A 3ZXIA 3UKOA 5J2TB 3VR3A 2DEUA 2PL9A 4FW8A 1IN4A 2NV0A 3Q7RA 2A30A 4YAFA 4NFYA 4L5JA 5E4JA 3E3MA 4CCAA 2Z5VA 2PUAA 2RBKA 3CA8A 1JX6A 4C5BA 3UHPA 4BEJA 1IN7A 1CY2A 4NRDA 1DCKA 3MWLA 2ZRFA 4LJ8A 1QHFA 1KSFX 4QZVA 4JZYA 2OP1A 1SOVA 1V25A 1CULC 2XTNA 3WMXA 4M98A 1E1QD 2Y27A 5FLKA 1G3QA 4MI6A 3D6HA 2IU6A 4HS4A 2WV9A 3ROTA 1NKSA 3WMRA 1SQ5A 5AK4A 3ANYB 2QMOA 4N54A 1UKAA 5CVJA 1WBDA 3QVVA 4CKWA 1BE1A 1B26A 3TTWA 3VJMA 4KO3S 1TYCA 4ARUA 1J7KA 5EXXA 3CG0A 2OC4A 3NIWA 4UBLA 3BFKA 4BEBA 3RBZA 3HCPA 3Q8WA 3VFDA 2PZ8A 4LWZA 2WE7A 4RXMA 4GI3A 4IW3B 4LAFA 3I4CA 3N9IA 3L6OO 4DIKA 1R00A 3M81A 3QTBA 4KXUA 2DLCX 1GSAA 4P7FA 5FFFA 1J1UA 3BIWA 3EGEA 3N0WA 4KRFA 1VXRA 3A9SA 1NMSA 1XZMA 3L5KA 5K0SA 3CEPB 2J5BA 2GEDA 4OHYA 2Y0BA 2VF5X 4NYMQ 3WO1A 4BIIA 2A00A 3QVSA 1UBCA 2D1FA 5F73A 1AHPA 4ZEVA 1G5TA 1R0SA 4CKEA 5ECWA 1JG1A 5ALYA 3PEEA 2EYQA 1K6XA 2WWHA 3PDIB 5AH0A 4EX6A 4D02A 1I1NA 2EJWA 3DV9A 4QJ5A 2V74B 2HWUA 1E7MA 4R68A 2FXVA 3GMTA 5HCIA 4YHHB 3FHOA 1PL0A 2G9VA 3BZBA 4II2A 3A4YA 1VJTA 3I09A 3U4IA 4N7RA 3E9RA 2R00A 3AF3A 3KKEA 4Q9AA 4DC9A 4RTLA 4KPYA 4QNMA 4HLCA 1H8ED 1ZD1A 3NVKI 3KJQA 3RSOA 5JJKA 2JFVA 1X7WA 3AFNA 3N07A 3R9WA 3EIUA 1CR4A 3BF7A 4KBYA 5D84A 4IWNA 4HEA1 5F1YA 2OHOA 2WOJA 3LUPA 4R54A 3B5JA 4MPJA 4B6JA 1IDN1 3DLBA 3HJAA 3SZ3A 2CFSA 4WESB 5KCMA 5CNMA 3TXXA 4F3TA 4ZGWA 2GXQA 1KY3A 2BMJA