2YJ4A

Conformational changes in the catalytic domain of the cpx-atpase copb- b upon nucleotide binding
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
250
structure length
248
Chain Sequence
LSLYEKMLHKGMIIKNSNVYEKIKEIDTIIFNKTGTLTYGTPIVTQFIGDSLSLAYAASVEALSSHPIAKAIVKYAKEQGVKILEVKDFKEISGIGVRGKISDKIIEVKKAENDIAVYINGEPIASFNISDVPRPNLKDYLEKLKNEGLKIIILSGDKEDKVKELSKELNIQEYYSNLSPEDKVRIIEKLKQNGNKVLMIGDGVNDAAALALADVSVAMGNGVDISKNVADIILVSNDIGTLLGLIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords COPPER-TRANSPORTING ATPASE
publication title Conformational Changes in the Catalytic Domain of the Cpx-ATPase Copb-B Upon Nucleotide Binding
rcsb
source organism Sulfolobus solfataricus
total genus 74
structure length 248
sequence length 250
chains with identical sequence B
ec nomenclature ec 3.6.1.36: Transferred entry: 7.2.2.19.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2yj4A01
3.40.1110.10 Alpha Beta 3-Layer(aba) Sandwich Calcium-transporting ATPase, cytoplasmic domain N Calcium-transporting ATPase, cytoplasmic domain N 2yj4A02
4F72A 3I76A 4BKMA 4UW9A 5AI4A 3TLMA 1ZS9A 3FPSA 1N9KA 1ZD4A 4NFLA 1Z4JA 4IG4A 2JAOA 3U13A 1RKVA 2YMMA 2ZOSA 3A1DA 4NAVA 5AICA 5AK6A 2P69A 2EATA 5AIAA 3RF6A 3FPBA 3L0CA 2OBBA 3E84A 4C4RA 3WK9A 4Y2VA 3MMZA 1ZRMA 2G08A 3HLTA 5IS2A 1WVIA 1QH9A 2G06A 2B1RA 5ALHA 2WF9A 3AR3A 2FUEA 1Y8AA 5AVZA 2C4NA 4Y2PA 2O9JA 1EK1A 4DWOA 3U7EB 3EF0A 2BDEA 5A3QA 3ET5A 5AKZA 3ZX4A 1TJ4A 1T5SA 1ZD3A 3UMCA 2YJ5A 1RLTA 1S8OA 1XP5A 4HYTA 4XE5A 1Q92A 2FPWA 4EZEA 3L8HA 2O2XA 4G9BA 5AK5A 2B1QA 3DNPA 2G80A 4FFDA 3BA6A 3KBBA 1J97A 5AW5A 4C4TA 5AI5A 2DQSA 1U2SA 5FP0A 4QQFA 1S2OA 1SVJA 3W5AA 1YV9A 5ALKA 1Z4LA 2YJ6A 5ALPA 1PW5A 3SD7A 3L8GA 5ALZA 2YJ4A 1Z4MA 3WKAA 2JGAA 4I9FA 4UAVA 4KN8A 1VFPA 4Y3UA 3PDWA 3ONNA 5AVQA 5ALOA 3KZXA 1T5TA 2KMVA 3QU4A 4DFDA 5AI9A 2CFTA 4J2TA 4UU1A 4KNWA 1RMTA 5ALMA 2YBDA 4YH1A 4BX3A 1QYIA 3QUTA 4UMVA 3KC2A 2QLTA 4HGPA 5AI8A 3GWIA 2B8EA 2HX1A 1XVIA 2JAWA 1CR6A 2JAUA 1MO8A 1RMYA 2G0AA 4BEWA 1L8OA 5ALFA 3ZTYA 5AW3A 5ALEA 4BBJA 1Z4NA 4YCMA 2VKQA 2FI1A 2Q4RA 3ZI4A 1RC8A 2W43A 1WZCA 3WGVA 2NYVA 1WPGA 2FPRA 4FE3A 1U7OA 3M1YA 4XQ0A 4EX7A 2B30A 5AVXA 3U7HB 2A29A 5AM4A 3WK6A 4XPZA 3UMGA 5AW2A 2G1AA 4NWIA 2FPSA 2W11A 4KX3A 5AW9A 3FVVA 4Y2XA 1NF2A 4UAUA 3U7GA 4OHFA 3E81A 3N07A 5A3RA 2X4DA 1U2TA 1ZJJA 4JB3A 3W5BA 5AKYA 5AW4A 3KDPA 2ZBGA 5ALGA 2R8ZA 2FEAA 4Y2YA 5ALJA 3ZVNA 3W5DA 4ZEWA 1XPJA 3NRJA 2ZXEA 3QLEA 2B0CA 4HAIA 1L7MA 2GMWA 3ZTWA 2BY4A 3L0BA 1T9ZA 1Z4PX 4PNHA 5AHXA 3U26A 2FPUA 1U02A 1TA0A 2QYHA 3UMBA 3FZQA 4UATA 2HI0A 3OCWA 2ZBEA 2HHLA 4KX5A 1VJ5A 5AM1A 3HYCA 3M9LA 3ZVMA 5AI0A 4HGRA 2WFAA 3PGLA 4Y2TA 3UM9A 4CF4A 1Q91A 3EPRA 5AESA 5AKHA 1F5SA 2HDOA 1Z4IA 4YIHA 5IT0A 5ALRA 2W4MA 2WF8A 3SKXA 1L6RA 4JDPA 4L6CA 4NABA 5AVWA 2P27A 4UMFA 1IWOA 3WKCA 3QU9A 1TE2A 2R8EA 3ED5A 3N8GA 5AKKA 3EWIA 3B8EA 3L8EA 3B9BA 5ALDA 2KMXA 2YN4A 1JUDA 3DDHA 5AK4A 4CNQA 1Q3IA 3A1EA 5IT4A 5JJBA 1K1EA 5ALNA 2ZBFA 3L0YA 2HF2A 5AW6A 3VAYA 2OA0A 1RDFA 4CF3A 2D2VA 1U7QA 3ESRA 3SLRA 3L8FA 2P11A 3SF0A 3I28A 3AR6A 4EEKA 2IOHA 3MPOA 3N1UA 1CQZA 1QQ7A 2GO7A 2HOQA 4H1WA 1RPZA 2YMQA 3D6JA 3AR4A 3R4CA 1N8NA 4BX0A 3R09A 4DW8A 2CFSA 2I7DA 3L1VA 4UMEA 4EX6A 3QYPA 5AM5A 1RKQA 3ZU6A 1TJ3A 4AP9A 3IB6A 1RMQA 2YJ3A 3NALA 4BNDB 4UM7A 5ALTA 3RFUA 3ZX5A 4GXTA 2CFRA 4MWOA 2MSNA 2MU1A 3F9RA 3KD3A 4CE6A 1L7OA 2WHEA 2FPXA 3L5KA 3QU7A 3A1CA 2I33A 2YMPA 5AM0A 2GHQA 3AR9A 5E0OA 1Z88A 1YNSA 3I6BA 4RESA 2RB5A 5AIBA 3I1YA 2CN1A 1MH9A 2OYCA 5AVUA 2HCFA 2Q5EA 5AKXA 2I54A 1LTQA 3W5CA 1MO7A 5AW0A 3WK5A 1NNLA 3WK7A 3PCTA 4E88A 2PQ0A 2RAVA 3N28A 2AH5A 3N5KA 1QQ5A 3OCYA 3WKBA 2I55A 2FUCA 2P9JA 2WF6A 5ALLA 2Q4TA 2AUTA 4HGQA 4NV0A 4C4SA 3CNHA 3QUCA 3ZWKA 1J8DA 5AKGA 3L1UA 4UMDA 4YCNA 4QJBA 2NO4A 3ZWDA 2HF7A 5ALIA 4UARA 4AS3A 2ARFA 2WF5A 3SMVA 3L7YA 3OTQA 3J7TA 2EAUA 4ZEXA 3CZ4A 1RQLA 1KYTA 3QGMA 3BWVA 3OCXA 2I34A 3OPXA 2FDRA 3B9RA 5AKIA 5AW8A 1RKUA 3IRUA 5AM2A 1NRWA 4CF5A 4KNVA 3PGVA 1Z5GA 3E58A 3QU5A 3GYGA 1RLMA 1SWVA 4O8CA 2IOFA 5AVYA 4BX2A 1L7PA 3QX7A 4L57A 3S6JA 1WR8A 2HSZA 1Z5UA 2I6XA 1ZD2P 3FGOA 2C8LA 3U7FB 2JARA 4AS2A 3MC1A 3NASA 3QUQA 2YFYA 4DCCA 5AM3A 4L6AA 5AI6A 3FM9A 2ODAA 3P96A 5ALQA 3WKEA 5AW1A 4XOUA 4UM5A 5AKJA 1Z4OA 1YJ5A 2B8JA 3SKYA 4EENA 2G09A 3ZW7A 4GIBA 2IA5A 2WM8A 1YDFA 4IFTA 2A00A 1SWWA 5AVTA 2IOFK 4Y2QA 4Y2UA 3R9KA 3ZUPA 2G07A 3ET4A 3QU2A 5AVRA 3WGUA 3AR8A 1ZOLA 3AR7A 4YCLA 2IYEA 2YMLA 2YY6A 5AW7A 3AR2A 3OCVA 2RARA 2C9MA 4G63A 2C88A 1Z4KA 3AR5A 2PR7A 4KYTA 5ALVA 3SHQA 1ZD5A 2B82A 2R8XA 2C8KA 5AVVA 3QNMA 3WK4A 2OM6A 5AKLA 4OD0A 1FEZA 4HGNA 4UU0A 3MN1A 1RRCA 3IJ5A 1O08A 3A3YA 1AQ6A 4Y2RA 1ZRNA 1YMQA 4B6JA 3K1ZA 4BNDA 2GHTA 1VJRA 2BDUA 3QUBA 3WKDA 3NANA 3DAOA 3ZVLA 4BEVA 5A3SA 3E8MA 5AKEA 4Y2JA 1EK2A 4Y2SA 4YIKA 1LVHA 1U7PA 4MUMA 1X42A 2AGVA 3QXGA 4UASA 4RETA 1L8LA 4FYPA 4HGOA 1RLOA 3ESQA 2HO4A 5ALUA 1TJ5A 3OCUA 5T41A 5AVSA 3KOOA 2AMYA 3NIWA 1L7NA 4I9GA 4F71A 5ALXA 1O03A 3DV9A 4OFZA 2WF7A 3NUQA 3NAMA 1YS9A 2ZBDA 5ALSA 2R8YA 3WK8A 1RQNA 4J03A 3EF1A 1Z4QA 4OCZA 3OCZA 2EARA 1SU4A 2HEGA 5ALYA 5AK3A 2GFHA 4BYGA 1QQ6A 4EELA 4ZEVA 3U19A 2ZG6A 5ALWA 2NO5A 2RBKA 2PKEA 4YGYA
chains in the Genus database with same CATH superfamily
3KTAA 1YULA 2WUFA 4MKIA 3T94A 3LCCA 4C3ZA 2JDID 4NFLA 3U6KA 1IL0A 1KO1A 2C59A 4EO4A 3KPUA 1S1MA 1K5DA 5J1TB 1XAGA 1W85B 2O8VA 4JR0A 5LBIA 5C8ZA 4EGCB 4YALA 1T24A 3UWMA 5EJEA 2O2HA 1I6LA 2A9PA 3S44A 3T7JA 1E18A 1KAOA 5COAA 4A26A 4C06A 5K8IA 4LBZA 4A7PA 5MF6A 2AI2A 3DYIA 4P53A 1ZXLA 3GBSA 3LF1A 2LIPA 2Y6VA 1ZK0A 3O8RA 1HE4A 3CKMA 4ERNA 2ZWIA 3ABRB 4MV7A 4U4AA 2CZQA 3O9MA 1ZRMA 3Q4GA 4Q9LA 4C1BA 4EAQA 1K3FA 3V4VB 5KDOA 4H9GA 1ZONA 3KYJB 4KQIA 3PXGA 4S3MA 2ZVPX 1YIAA 2IYPA 3JSXA 3L4BC 3AIIA 2Y1LA 3HABA 4NSNA 5EE0A 1VJGA 4ZU3A 3HA7A 3DUFA 5KQGA 1YC5A 1K88A 2IYWA 7REQA 3PFCA 4M1TA 3Q7IA 2J32A 1OY1A 4Q19A 4ZOBA 3KAPA 4G4IA 1GNSA 2D4HA 3FPJA 4Z99A 4A2CA 4DWJA 2FPWA 2ABWA 4D3FA 1X2EA 1A5TA 3KTOA 3IP6A 1O9GA 1P1JA 1YZHA 3N2EA 5HOEA 5J1SB 2QE7D 1P60A 3Q1LA 1ZESA 4A16A 1GVNB 4G3XA 2F62A 4I4NA 3C3XA 3KBBA 4DRXA 2QSJA 4EY7A 1D03A 4PO8A 1DARA 3L6DA 5AI5A 3K9NA 4C4TA 3D2BA 1O95D 1JHUA 1HE2A 4ONEA 1N6LA 4NYIQ 4ZQHA 3UGTA 2D59A 4IF4A 3EGCA 4ZARA 3RLFA 3ND6A 2YZMA 2GBFA 2Z3ZA 2H0RA 3RIMA 3FHCB 3JV7A 2JLZA 2YJ4A 2QN3A 2B4AA 2EBFX 3O1IC 3T06B 3BMQA 4F5EA 1O6BA 2CSUA 2WE8A 2C61A 2WM3A 1U0EA 3AH8A 5GONF 2GVZC 1YE5A 2VT3A 3QVLA 1CWUA 3BJMA 3UJAA 2IU6A 2P0AA 1ZQ1A 1SZDA 5CH3A 4E07A 1E96A 3TSOA 3K0KA 4G1MB 2X14A 3KV3O 3ONFA 4RZ3A 4D82A 1X2BA 2KBFA 2X7HA 2PBFA 3QU4A 4QPPA 5AYVA 1NXPA 5CB4A 4RS4A 4DLPA 3N75A 3A6EA 4ZDKA 1BYUA 2ZBUA 3AFMA 4S05A 1GGHA 2HAEA 1SGWA 1Y1TA 4J2TA 5BR7A 5SZJA 5K8LA 4MVJI 4UD2A 1X8JA 3KZ1E 3T8YA 3KKZA 4KK3A 4KBYA 4RFSA 4GI5A 1J09A 2P4UA 5IJ9A 4F84A 2BELA 2FZCA 1E3QA 5A4IS 4KAJA 1XVAA 4EW1A 5AHOA 2G0AA 4ALKA 4E15A 1NP6A 4X3CA 5ALFA 2PD6A 2DSNA 1FMTA 2VXBA 3JQQA 3C8MA 2ZZKA 1LPAB 1SUPA 1P61B 1Y8QB 3PSAA 3RANA 1N34B 3VNVA 1J8YF 1ZVJA 2H9IA 4LK3A 3PC2A 5AUPB 1Y6JA 4QOEA 3V6MA 1Z6XA 1T6XA 2CDCA 2CE7A 3S68A 1KL7A 3H2SA 1WW8A 2CEAA 3K2BA 2IP1A 4RK0A 2BKAA 2HYIC 3FMIA 3I2HA 1V2HE 1E6KA 4F9EA 1Q21A 3T7CA 4FVTA 3FNBA 4YP6A 4DE5A 4D9FA 3KXPA 3WWCA 4KXXA 2B30A 1LZLA 4X24A 2FZLA 2CLIB 3MSCA 3TLEA 4AXXA 2VK8A 3OQOA 2WMDA 4CU5A 4OQZA 1V25A 5K0SA 2XWJI 3M4NA 5K3EA 1RXYA 2PLAA 5BPHA 4C88A 5CU7A 3UMGA 2IHNA 3KLBA 4AMZA 1Y8ZA 3C6XA 4WK4B 1O0BA 1XD2B 3GXOA 5ETJA 1LFAA 2WQ7A 3BEOA 1VM6A 4G8BA 5DTMA 3PNVA 3ZDQA 1E2BA 3UJDA 3TLAA 1DKOA 2PEZA 1NQXA 1L5GB 1ABEA 3RYFB 3WL8A 5JXJA 4U2BA 3HCBA 4WZBA 2F9LA 2DFPA 2EGHA 1R9GA 2BSXA 2OGSA 4OQNA 5DE3A 4IH9A 2ILVA 3IAS1 3ZV5A 3F3KA 3A2KA 1WNTA 2VXCA 2X2PA 1U04A 2WWWA 4LSGA 3M3HA 4PPYA 4F6LA 1JFRA 1VPTA 3FRIA 1ZCAA 1SZJG 3KKNA 3NGMA 4LY9A 5ALGA 1PL7A 4PZCA 2C7VA 1UZAA 2QSUA 1DBQA 2VPIA 2W6QA 4HI0E 3W5DA 1EQUA 1SULA 3C7AA 3L7CA 5ER9A 3W3AH 4D3XA 1FP4A 2FDCA 1C4XA 2A88A 3GU3A 4HDRA 5CCXA 3TUIC 4BKUA 3BTSA 3ZXSA 2X2OA 2ZPUA 4WW0A 2BM1A 1AZLA 3SYTA 1EESA 1L7MA 2JIPA 2VRBA 4R2LA 3ZE9A 5DHFA 1I1OA 4GR4A 1MB0A 2BY4A 3I52A 3S27A 4DSNA 2FPGB 4FN5A 5A3VA 4OQMA 4QDKA 4DB4A 4JLDA 3NOOA 4JVSB 2A2ZA 1GUDA 4K87A 4MA4A 1NW9B 1H2HA 4RXUA 5D5QA 1Y98A 3EULA 5JSYA 1E2JA 2QWXA 4CNBA 2F3QA 3BWXA 4B3BA 3TLYA 5DNUA 1SBNE 1VCHA 2CNBA 1ECBA 1VJ5A 3T5GA 4BRSA 4HLQB 3SBDA 4DV7B 2BPOA 3JQCA 5F78A 1OLOA 1J4AA 3PXBA 4NH0A 4A0HA 3PFWO 3D5QA 2Q07A 4QHSA 3O0DA 3FCOA 3ML1A 5FXMA 1WDWB 4LXYA 4URYR 3F97A 1FW6A 4PSUA 1XDUA 1CB0A 1X8LA 4BQSA 2QUIA 1DRJA 2WF8A 3BYZA 1BDHA 5F98A 3VHLB 2ZJ4A 4PX5A 3BHJA 4ZI5A 3IP3A 1U6IA 3RS7A 3DOHA 2JLRA 3AVYA 5F1PA 4MJ3A 4NG4A 4R31A 1CIPA 3QXJA 1X86B 3M3PA 2PBLA 2QTGA 1JJVA 1GZ5A 4KYVA 3T1NA 5CFZA 3B1VA 3DBRB 5I9IA 2JLVA 3PJGA 2GX6A 2PCJA 2J9FB 3Q0IA 5B7GA 2G77B 5JH7A 4RFLA 5TGTA 4NCHA 5C32A 5CLHA 2Q7OE 4WASA 4DTCA 2BTQB 3LDHA 3FWPA 3VTZA 2WWTA 4N1AA 4B80A 4XB2A 1U0BB 4OUDA 3A1WA 4K81B 3TRHA 1VBKA 1GAXA 2QK4A 2M32A 1I2CA 2GRAA 4GR9A 1VJCA 3HFJA 1KDZA 2NU8A 4UOEA 1PT5A 3IRVA 1Z63A 3KHSA 2GBGA 2TMGA 1E5TA 1H3NA 1XDDA 2G88A 5ALNA 5SICE 3PWKA 4P80A 1YDGA 5GP1A 2ZSJA 2W8ZA 2O8BB 3T9CA 4FCCA 4X92A 1UBHS 4TMVA 1N8SA 2ZTUA 3SLRA 3W5SA 1SAYA 2GAOA 2VJYA 1QP4A 4BV8A 5KYXB 1H66A 2NSHA 4XCVA 3SR3A 4ODIA 5K0TA 4S1OA 4EKYA 2REBA 3ROXA 3SEAA 3QKUA 1UOEA 1YONA 4UFOA 3PDJA 4ASUA 4NE9A 4BO0A 3DWEX 1RPAA 1YOVA 2ADOA 3E9YA 4MQFA 5IM4F 3FFBA 4KW7A 5K01A 3AERA 2W2QA 2I7DA 4FEGA 3B6MA 1N2ZA 1ODTC 2VA8A 3EVFA 1V11B 4C7VA 3OPNA 1ZG3A 1WXWA 4CKEB 4DSTA 3IB6A 2ONZA 4O63O 1UK9A 2YJ3A 3HN2A 5JE8A 4MDHA 3VM6A 1DJNA 4PIPA 1Q0PA 4AT1A 4Y9UA 4EI9A 1XYGA 2O6HA 3KD3A 1C0KA 2R1TA 2HU8A 4HT3B 1UMCA 2GZ2A 3B6EA 4RCZA 2VUIB 1QOPB 2YDXA 5J59A 2IBSA 5JXGA 2QD2A 5DP1A 4CF6A 1VHLA 1OAKA 2BFCB 1O89A 3DEZA 4YJ3B 5C37A 3G2KA 2RB5A 4RPHA 1K3UB 3SQNA 5LD2B 3EZFA 4HEQA 4UUPA 4C0WA 1T8UA 3CONA 4DCGA 2DR2A 4YRJA 1OJ7A 2XCLA 3IELA 1L5YA 4MV0A 5AKXA 3H97A 1Q77A 1QIDA 4JK3A 5L4LA 3DZCA 4UFNA 3CVUA 1TM1E 2ZJYA 2PZBA 5HF9A 4CV3A 5L51A 5IN4A 3O3NB 2O3RA 3VPSA 3N28A 4E88A 1P4HA 3N5KA 2YIDA 4YAWA 2VJMB 5DGIA 4YAJA 3V55A 3UWOA 4P6VF 1RIFA 3PX3A 2VYFA 2PU5A 1UFVA 2H57A 1FNNA 1G18A 2ZFUA 4DMKA 5JNWA 1WMFA 4OHKA 5EOVA 1NVXQ 3NTXA 3RUIA 3ZWKA 5M2QA 1IBLB 4WV3A 1JLRA 1WDMA 3EE6A 4HY3A 4H1UA 4ZD6A 4HWGA 3REOA 1S5PA 5KTOA 3SSMA 5SY6A 5DW3A 3NX4A 4WOPA 2QUZA 4BQRA 3KSMA 3TEMA 4JL6A 4QJ3A 4DNPA 1J1UA 4GG1A 5CD9A 5PNTA 3IOEA 3EIUA 4JUIA 1CYEA 4YRRA 1FTQA 1E1KA 1QCZA 5H3CA 3W2TA 2RJNA 1N5RA 1SCUB 4G23A 4PNPA 4AU1A 3OH8A 4DR7B 3OPXA 2RGXA 4QBGB 2Y4OA 1DOZA 2GEJA 4Z86A 5FI5A 3PFIA 4YQZA 2ZYTX 6ADHA 2BRUC 2NYUA 5EXPA 4BGDA 1F51E 2VOJA 4NZYA 5HYVA 5K0FA 2Q0SA 4A1OA 2RHMA 3K9LA 4U6QA 3L7AA 1X1RA 1HYEA 4GOXA 3GYGA 4BFZA 2HJSA 4PAQA 2BISA 5DIFA 5F3WB 3HL0A 4FEEA 3BK2A 4L4XA 4LEIA 5J58A 2RHWA 3STHA 1E9DA 4Z3OA 4C3OB 3VC3A 3SIWA 4YV2A 3BD9A 3LA8A 1WD5A 1E2GA 3UV6A 3WSTA 3G49A 2BP7A 2QL6A 2YVQA 2XXAB 3LD9A 3I4FA 1TCUA 2VP3A 1R27A 4I99A 3MC1A 3D6MA 4BZPA 4O2BB 1N33B 1G0NA 1V5EA 2IELA 2YYYA 4N7BA 4UBJA 5K3FA 2WWVD 1ZD9A 3M5PA 1E1MA 5BPFA 1U9YA 5CP8A 2NPFA 2WSLA 1TTHA 2YFKA 3I34X 5FOXA 5E7IA 1U5BA 1FZTA 5AW1A 4XSHA 1R9MA 1VLMA 4Y2GA 5C8YB 1QK4A 3BJRA 3QA9A 4RIGA 3RFCA 5A04A 5GZ3A 2FP3A 2OMKA 3PKIA 5GONA 3RRBA 3TLGA 3T52A 3WISA 2E21A 5IWCA 3PD0A 5IH3A 3ZE6A 3QMVA 5A7FA 1WZNA 3A05A 1N36B 4L95C 2DT5A 5GM2A 2V3VA 4XFJA 3CBGA 1J99A 2FSVA 2P3OA 3X1WA 5IXJA 1FTWA 1UT8A 3C8ZA 3WL4A 2TMDA 1P73A 3TOXA 1M76A 1DEOA 1K2WA 3IO3A 5FWYB 3U3XA 2X1LA 4HXGA 2XNDA 2ZI4A 3E6AA 4MS1B 4P3KA 3SHQA 4BCCA 3RAEC 4K3UA 3N2NA 4L3OA 3ESZA 3V32A 3RSZA 1VZ3A 5JHHB 3I04A 1BX3A 2D7JA 2OM6A 2XA9A 2JFPA 1RRCA 1V2GA 2J4FA 121PA 3TL2A 2H1IA 3T1YB 4DIMA 1FXUA 1A27A 1AS0A 1GR0A 2J6CA 1XLUA 4NOLA 4Q7MB 3ZHQA 4XWOA 1G9SA 1ZGZA 2DCMA 4B3RB 3BE6A 5L3VA 3RFVA 1T8PA 4EYOA 4QFBA 1V45E 4IIYA 1F60A 1EX1A 3PFKA 1R18A 3HRHA 2I4MA 1BS1A 3IP9A 3H83A 5HIJA 3E4DA 5JIBA 1CZUA 5EIBD 5KI6A 2EGGA 1Y6RA 1N25A 2OCDA 3LT2A 2DRIA 2LNDA 4FKBA 3W6PA 4DVGA 3I6MA 5JUWA 4Y2JA 2H59A 4N0EA 5AQEA 3J7AC 1VL0A 3ZGZA 1RD4A 3L0PA 4FFPA 1WY7A 4J16A 1L3CA 2AC2A 4MUIA 1EQAA 3TBKA 1DIGA 4LC9A 2IV3A 1OFVA 3A1NA 4B09A 1SIUA 3ZU5A 2YNMC 3GFRA 1UF9A 5FHRA 2XA1A 1C3OB 2QZ4A 4GWKA 5L95A 1S4QA 2HPZA 4IINA 4P82A 3EDCA 4DAOA 2MCFA 1P3DA 5JCOC 4X1IB 1J7KA 2X40A 1JQAA 2WTXA 1ZO8A 3E1GA 2HMTA 4X7RA 5A5DA 3K09A 2R4UA 4IRUB 3SX4A 1BCRB 1SU7A 3AF3A 3QFSA 1AQUA 4YMLA 4ETIA 4Y18A 1OIVA 4IEIA 1U3CA 5HS6A 4C5BA 2C4HA 1P17A 1NI4B 2QMYA 1A9QA 3PUZA 4N3AA 5LM3A 2GDJA 4DDKA 5JAZA 3ZK9A 2Q3HA 1QIJA 3MW8A 2IPAB 2ZBDA 4RORA 5UKDA 3NAGA 1WHTB 3WBJA 4ARZB 3SHVA 1E2HA 3OF3A 5CNKA 3DDSA 5JAQA 3VGPA 4CM1A 1A2KC 4HXYA 3S99A 3GRKA 1UJMA 5IBRA 1QO9A 2UUOA 3HSYA 2EARA 1S9DA 4BQIA 4OREX 3TL6A 3AM1A 3AM4A 4O2AA 1C7RA 1U2GC 4MW9A 5BN5B 4M8SA 4R9VA 2A1TR 4P31A 2IYAA 3FF4A 2CWDA 5JAOA 1RXUA 2HYDA 4RYDA 4W5WA 4PZDA 4OHXA 3W9YA 2WP0A 1XL1A 4EO9A 3AKDA 1J0EA 1TF5A 2IEZA 5DN6A 2ZUWA 2EZ9A 2ZSKA 4YVFA 1D2AA 4FOLA 1E6MA 2AFHB 1NMXA 4NXMB 1OLSA 2WU3A 1B42A 1J39A 2CF5A 3BXZA 2EJUA 3JWHA 1L7VC 4IXWA 4UTXA 3LIPA 4AJ2A 4DS3A 1I10A 1FYXA 1QYDA 2YHIB 2ZRKA 1EK6A 4PC6A 5IUKC 3SVZA 1AUOA 2H0AA 3C3EA 2NUAB 4F3YA 1MAUA 4ZOEA 1XCPA 4WFKA 2UUAB 2HWXA 5IYZA 2IUTA 1BE1A 2F43B 5H82A 4ZI7A 5ICMA 3MTBA 3STXA 2ZSHA 4B79A 3FGZA 1OW3B 4CM5A 4D8YA 1UQUA 1Z06A 3U2QA 1KZ1A 2Z43A 3H7AA 3RSFA 1M2NA 2JZOA 4C7OB 1T2NA 5BNFA 1T8RA 4Q4DA 1U4OA 2O4CA 4CM4A 2ERYA 3WB2A 5K9ZA 2OCPA 2PN1A 5F1OA 2WF9A 3DLHA 2C4NA 3KCQA 3UH0A 3D4LA 3LUHA 3NETA 1XTQA 1X80B 4Q1EA 4CMEA 5EJ5A 3LL7A 4LRQA 4Z3KA 2YXBA 3IVAA 3D6NB 4BAZA 1QZXA 1R15A 2YDYA 3AI2A 1VC2A 1D4AA 1YDWA 3M2PA 4UXIA 4F3RA 5K0GA 5KX5A 2JGMA 3BZBA 4IHJF 5AK5A 2DUMA 2FKAA 5BVHB 1LLFA 3OOYA 3QMPA 3U4QA 2ZSEA 2ZSDA 4DCMA 3NDBB 2O3JA 1Q7BA 3ENZA 5CVUA 2FV8A 5EZ6B 5D87A 2X8AA 3EPHA 1G6HA 4IWYA 1Z28A 3FZNA 4Q1CA 5JVDF 1E0SA 2E49A 2JW5A 5BRJA 3VAAA 1WABA 2YRWA 5EJGA 1R5BA 3BULA 3OFKA 2X9QA 5LYJB 1YI1A 5BQXA 1EJ6A 1MLDA 2HU2A 1JZTA 3KKEA 4R5MA 4DCNA 4F2DA 1CQJB 3AJRA 2Y1XA 3ECAA 4OHUA 5ESXA 4Q39A 3R75A 2CY0A 2LBPA 3V1LA 5IM4A 3LMKA 4Y3UA 2IW3A 1Y4AE 3RRFA 7ADHA 5MGNA 4FINA 1FW8A 4OMCA 5EZYF 3E9CA 1K8RA 3IXQA 3DBVO 2G4CA 3N2KA 1SOVA 2V4MA 3PYMA 4X9XA 1AGNA 3B1ZA 3BN3A 1GPBA 3DL4A 3FWYA 3PQ7A 4GRDA 4UQPA 2LGJA 5FADA 5FI0B 1WD7A 2H17A 3AEUA 1Q0RA 1VPDA 3KUXA 4F12A 2FWPA 3TRDA 3ZPXA 2AE1A 4U7WA 5BSFA 1R6VA 1Z6TA 3R0ZA 4P83A 4DJTA 6AT1A 1K4YA 3MOSA 3RVPA 1BEEA 1KEZA 2ACKA 2B4QA 4LOHA 1XELA 3L7MA 1UBMS 4LXXA 1COWD 1FU8A 5TVGA 5ITZB 3HUDA 1O0CA 2AWNA 4EMUA 4AJPA 4YWHA 4HN2A 4QL3A 3RTBA 1IVSA 3DB1A 3DDOA 1SKUA 2PMBA 2W71A 4KP7A 3QX9A 3T3OA 1MO8A 3EEYA 2IEYA 3L1JA 3R5XA 1GPAA 3T3EA 3ZY5A 2BMJA 1ECGA 4YPOA 1QV9A 1WNFA 2PSSA 4QDXA 1HYHA 2QXUA 3NOQA 1O6ZA 2HIGA 3EVCA 2ZJ5A 3L02A 5K51A 4I5FA 3FUXA 4LN1A 3TM4A 1YQTA 2YVAA 1PZMA 4GC5A 2ZULA 1GUBA 5EJAA 2XVZA 5FHQA 4E22A 1X8XA 4MARA 2W43A 3NWOA 4LTMA 1RKBA 1WZCA 3N2YA 4H60A 3WGVA 5E1DA 4GOND 1Y42X 1Z3CA 4R2KA 1JTEA 4YBZA 1ZR2A 1MZVA 3GHYA 4PHCA 1DIBA 5J5VA 3S2IA 3PU6A 2YICA 4P3YA 3BJZA 4FM9A 2ZGVA 1GGMA 4WLUA 1VIDA 2E4YA 5L7YA 2OXTA 2W2PA 2HJWA 3DZDA 4XYGA 5I7SA 4G07A 3ZHYA 4XEUA 5F73A 5CA0F 2R7AA 3PX7A 3OM9A 1C3LA 3HWX1 2FPSA 3FZYA 2O7RA 3K2QA 4BMVA 4S2EA 1YFZA 4UUBA 1Z0KA 1HDZA 1X38A 2RHOA 2DPGA 3Q8XB 2FR8C 5FL7A 3FYUA 1ZEMA 4JEIA 5GIPE 3WZMA 3DZ8A 2RCYA 4C9BA 3BOSA 1NVVQ 4GZ6A 2WIKA 1J70A 1SUSA 3FYTA 3W7VA 2CF6A 1XVVA 3LVBA 1SVIA 4G4SO 2EG9A 3ZZUA 1GXSB 1XTKA 4I55F 2XLBA 4DV1B 1DIOB 2QRHA 2FEAA 3IMFA 4IJKA 1K8QA 4KE8A 1KQOA 1P2BA 2WLTA 2ZKLA 3A3NA 3HZHA 4LY3A 2VQ6A 3WBKA 1C8KA 4NMMA 4PLYA 4IM7A 1C7QA 3NP9A 3GH3A 2V6MA 3ON5A 1ULBA 2ZB3A 1B0ZA 3P9YA 1IN7A 4NMXB 5EIFA 5EWLA 2K5UA 1V16B 5JWHA 2X0FA 3UB2A 421PA 4KWIA 5K3OA 3QOYA 1T9ZA 1EVKA 2YH2A 3DFUA 2WUDA 1MQAA 3NHSA 4V0QA 4ZJUA 7MHTA 3GPIA 1W1IA 2BL4A 1II8A 3TE7A 1EGHA 4UTOA 5DBFA 3IVCA 4U7TB 4UUAA 3VH2A 3R0IA 1SKQA 2BF7A 1LQ2A 3AY0A 4CIWA 2HCJB 3AM5A 4MVJH 4N12A 3FPEA 4NCXA 3WLOA 4KAXA 5FPKA 1YD7A 5AI0A 4CG0A 1S6YA 3HCPA 5FFFA 1WKCA 3S5UA 1LBQA 4IFBA 1Y34E 4Y2TA 3TNDA 3R0VA 1DADA 4P38A 4W6ZA 1YA8A 3HJRA 1Q91A 1DXOA 3FIJA 4LGCA 2IH4A 3L1HA 1QS0A 2PYZA 5G4KA 3QFCA 4QQ8A 1TD9A 2VYQA 4GRIA 1DQYA 1FRFS 3V4FA 4C01A 5C2JB 3GFFA 3MYYA 4DMCA 3B3FA 4LAFA 5TF4A 3V4OA 3P0EA 4DJJA 4Z6KA 4JT9A 2V6GA 3K94A 3QWAA 4I08A 4RDIA 1H22A 2JI6A 4RIFA 4TXNA 4YCAA 3FHTA 2SCUA 4H15A 1GCAA 5B58T 5E7QA 4BFUA 3ZE2B 4DLVA 1F6WA 5DCLA 3WQSB 1TMYA 3JW8A 3OFND 1JLLB 3BRWA 1IEWA 3PDCA 1T3LA 5ECDA 3T4EA 1HI9A 5T64A 4PG8A 4HGYA 5AKKA 4JGIA 1OV6A 5I6DA 1AKWA 1JMYA 3UV3A 3FYHA 5LU8A 1XZQA 4YMWA 4X6XA 4C5AA 3WL7A 3ZI0A 4IICA 4O4HF 4XWKA 2BTEA 4O4LB 4J0KA 3JQAB 2P2GA 2I2AA 2ZYRA 1AU9A 1XROA 4XEHA 5IT4A 3TRFA 3HBFA 5F9HA 3NORA 3GN1A 4GS5A 5EP1A 1JXMA 3RYIA 5HFNA 1IVYA 3AX6A 1Z2DA 3GEMA 4GKVA 2QUBA 2NU6B 2VRWA 1CD5A 4HOYA 5JCJA 3U7QA 3VAYA 1LZKA 2QIPA 3L6OO 3S1LA 1EWTA 2CVQA 3PV0A 2D2VA 1ZJYA 2FTKE 2A59A 3IBYA 3H1EA 4NCJA 3BRQA 1LF0A 2DQKA 3HVRA 4IQFA 1YE8A 2I76A 1XDGA 3EIFA 4X64B 3GLUA 2PGXA 2GO7A 1RQPA 3LSYA 2E9SA 4DCVA 1JE0A 2RAUA 3LI2A 4TKZA 4MGEA 1PGPA 3AFGA 4ZC8A 1TYDE 3TW0A 1KO5A 1L4FA 1BFUA 1EJ2A 4RO0A 3TZ6A 1C9EA 1SBTA 4OK6A 5LBUA 2EW1A 2V97A 2WA2A 4HVAA 4ZOLA 1HG1A 4U2EA 3V3TA 1B1AA 3HUEA 5T5QA 3D54D 1RCFA 1QONA 1B15A 4ZT6A 3S2EA 5A1TA 3RK4A 4D4JA 1TJ3A 1RAHA 2I71A 4RTSA 1ADBA 5EYPB 2O0HA 5EMMA 3ZXIA 5LOVB 3QIAA 4GKKB 3F1KA 3SJZA 1DMSA 4NE7A 5H9VA 3LFHA 4QU0A 3D7LA 2P9HA 4Q93A 4FYXA 3G7SA 2PZAA 1BEUB 5CIQA 3HG7A 4U5QA 3GRAA 2WMNB 3FTCA 5EUMA 4G0VA 4PW0A 1Z88A 1Z6AA 2OCIA 4P5PA 4M9CA 3CZQA 4F5WA 5KWSA 2A3RA 2P2LA 2OLKA 3ABQB 1ECLA 2PU7A 4YRDA 1XK7A 2HLDD 1QAQA 3BIFA 3PHJA 2OYCA 2Q5EA 1RM0A 1Z38A 4OP1A 5CHYA 5CTAA 4DIFA 1ZPDA 4V03A 5AW0A 2BD0A 3TPFA 2ISQA 1Q44A 3N2LA 2ON6A 4E5NA 1IZZA 1FYDA 3OWOA 2PQ0A 3OQNA 4C4ZA 2PT6A 3BSFA 4EG3A 1P4GA 4PYMA 5TNXA 4EMSA 3B6IA 2WAOA 1KAGA 4UEWA 4E12A 4FLMA 4B3GA 1SXIA 1CEYA 1DAIA 2PS0A 5FO1A 3E22B 5BMVB 1PFUA 2IWRA 1TQ2A 3MLEA 1V43A 1GTL1 1R5NA 2N1MA 3PSHA 4DPMA 1V7PC 3NH6A 1U8TA 4HTFA 1KERA 1CY6A 1RYZA 2ZJ6A 3GPCA 5DCYA 2W2OA 4BLVA 1V3VA 3HJGA 4EB6B 4B4VA 1A5BB 2ZYGA 4ZCMA 1JYEA 1DC5A 1E3JA 1M2FA 3BS4A 1YDHA 5IAEA 1NYLA 3CZ4A 4UVGA 2HEIA 3R7FA 3GBPA 5THQA 5JNUA 2Q46A 1J00A 2JGLA 2V6BA 1CUGA 4BQQA 5EJ7A 5AKIA 2B4KA 4CCAA 3GUHA 4EPTA 1RWMA 2XCIA 3OTOB 1NU8A 4BN4A 3JQFC 4EF6A 4HH4A 5FOQA 4LGMA 5L3ZA 2IEGA 1P9RA 2X19A 1M1NB 1AB6A 3CEAA 3HM2A 3OLWA 1M1UA 3LXXA 1CUAA 2VP4A 3EOBI 4GZ5A 4LSZA 1KOFA 1T15A 1UEJA 1E0JA 3PVCA 4DV3B 3L8MA 3QQPA 4R8VA 4BB0A 3S1SA 2IOFA 4E08A 3EJWA 2UZ1B 3I9JA 2AN5A 2XVAA 2VP5A 4YDRA 2ETXA 3EC2A 1IOLA 5C5DA 3PUVA 5G02A 3P94A 2MSKA 4IHJA 1LPMA 3F2IA 1MIOA 4XAQA 4RNCA 5KVQA 4NXNB 1P7PA 2WAMA 4B3XA 2JARA 4TXMA 4J1TC 1YZYA 1SM4A 2J07A 2YFYA 5GVRA 2G1JA 1YL5A 4C43A 2Z6QA 1ZIDA 3GD5A 1J2YA 3BDAA 1QO7A 1V39A 3QF7A 4MINA 4WGGA 3FM9A 5LCXA 3VDQA 5J4LA 3KAKA 3VR2D 3KM0A 3LY5A 3WRWA 5KQRA 2J3HA 4E5YA 2YV5A 4FOPA 3DG9A 2C54A 1XCJA 3WFIA 1JLHA 2Q5FA 3SE0A 2CXUA 2X6RA 5KKCA 1KEEA 4MYUA 4RTPA 1P1CA 2IA5A 5I7FA 2O0JA 2CNLA 2ZIZA 3MUOA 2PGOA 5KNDH 1JTFA 5BNIA 5AVTA 1JI3A 1P77A 4Y2UA 4X66B 1L5FA 4HV4A 2XKJE 2BM8A 4JR1A 3DKKA 2DQZA 2Q5OA 4V1CA 4I2VA 2BMWA 5BYAA 4A0SA 4RD6A 3NHZA 1L5RA 3FUCA 5EZYA 3TINA 4HAXA 3RS3A 1FU7A 1THTA 1X15A 1QFZA 4O4JF 4ZVPA 3VMMA 1OFTA 4Z7OB 4CR7A 3RF7A 3TB6A 4KYTA 5ALVA 2BI8A 5HJ7A 1TM2A 5IABA 2D5IA 3O9VA 4KYUA 2Z3WA 1FSGA 3D0OA 1KHTA 2BFFB 3GV0A 1GD1O 1NQOA 4OHZA 3LDUA 4R3WA 1FEZA 1BW9B 5TPZA 1V71A 3CIFA 3IAHA 4HPJB 5EQJB 5DGTA 4EEKA 4F9FA 1OWLA 3EN0A 2EFJA 4KUEA 5EHZA 3KXIA 3EZLA 1ETUA 2GEVA 4QO7A 2DX7A 5LZ2A 1V1JA 1E1CB 1M1YE 1UDCA 3A6ZA 2F4VB 4RKWA 4Z2YA 2BDUA 3O2QB 4QRHA 1YU9A 4IIJF 5F35A 1QP7A 4TQAA 1ZHHA 4XDGA 3ZGOA 2XOKA 5FEMA 5IU6A 1UINA 3ZVLA 1DINA 5AKEA 4WNAB 2RI1A 1JXOA 2XJ4A 4JUBA 2QRVB 9ABPA 2IHZA 4C08A 1QRDA 1ADJA 2ORYA 3FZGA 5B36A 2DFDA 3D31A 4TRRA 2WYVA 3L0ZA 3R3XA 1UPFA 5DM0A 5A05A 1I4LD 3SBEA 2G0NA 2H18A 4PHHA 2PUHA 4QICA 3GZJA 1OH6A 1RRMA 2POQX 1XDSA 3AFOA 4IMIB 1YRAA 3CJTA 4RDCA 5K8JB 1GO2A 2EDCA 3QG5A 4U3JB 1WXDA 4WLNA 4B44A 3KPJA 4XH9B 2C78A 1TJ5A 2WJPA 1L5MA 2WYHA 2ZYDA 5ALUA 2DVMA 1BFKA 4JP1A 3TBHA 2OFFA 1WBBA 3SBXA 1H3FA 3C16C 3DWIA 3KVRA 4L51A 2PA0A 3VKFA 4EHDA 4XVRA 4KITB 5IG2A 1REQA 1PK8A 2WVGA 4FR5A 1UM9B 2X7JA 2XXJA 4BU1A 2PRSA 3ULKA 4NZ9A 2H29A 4PXSA 1T2EA 1P5HA 3IUQA 4QATA 2CXSA 1PAUA 3UOWA 2LIVA 2JFYA 1GPDG 2PJUA 3A1SA 3ANNA 2VO1A 3CN9A 3DLIA 4P5EA 3B9QA 4DLSA 3EGVA 4FQ7A 4ZOQI 2OHJA 4YRBA 5LVAA 3EC7A 4MTCA 1ZOPA 4RABA 3VU9B 1YQXA 3W90A 5B3LA 3WGKA 1GGEA 1YVRA 4QEDA 5LN1A 3LBYA 2NLOA 3V48A 4QU9A 3PQ3A 4NYJR 1DXHA 1A77A 4X6LA 1UAGA 2W2NA 1L7DA 2AYYA 2ZR8A 3IL2A 1J7JA 5FOSA 3UQYS 1UEXC 4BYGA 1B1CA 3V42A 1LRJA 2NU9A 3EXAA 1TIBA 1L5SA 3WYCA 3U19A 3L7IA 5A9SA 5KEIA 3BGSA 2BMVA 1NQWA 3CCBA 3CHYA 4LQ4A 5CW1A 1XRJA 2NUPB 2ZRBA 3I76A 3UC9A 3VR3D 4GYYA 4ER5A 3CA8A 3TGLA 1QK3A 2Q1TA 4BB6A 1PI3A 2Q2VA 1P0QA 3N39C 5LYJF 2DEUA 2YKGA 4ESEA 3T5MA 1HLGA 3GUUA 4KQJA 4KV9A 1CF9A 1HH4A 4B3IA 5EIEA 4PZLA 1V95A 2G36A 3FLMA 1TJNA 2ZK7A 3DO5A 5LLSA 4R2WA 1EVZA 4FB4A 1C0EA 3WV5A 4LFBB 1RWPA 2IYZA 2ZRNA 2BMDA 2Q4OA 2SKEA 3OIVA 3CVOA 3O8LA 1TXGA 1WSBA 4OOEA 8AT1A 1POXA 3LBFA 1P2UA 1PK7A 3U4HA 1JB1A 4DM3A 2PL9A 1U9ZA 4PIMA 4DMUB 5CDYA 5IJWA 3T38A 4DHEA 3N2GB 5FDFA 2DWQA 3DH0A 3PENA 5ALHA 1QGED 1U0GA 2NT4A 4BZZA 1LDMA 3HKDB 4KQHA 1DMRA 2FJ0A 2O9JA 4WESB 3WQHA 3ABIA 1L5KA 5KHLB 4A8PA 3SQDA 3MGBA 1S8OA 3R3WA 5GINE 1SVLA 1RQRA 3CLSC 3TIIA 3F47A 2AFIE 2QL7A 1S2MA 1PSWA 4JB0A 2HMAA 1TAUA 3WGMA 4DA6A 5KNBH 2OV1A 3Q0TA 1ODSA 3WZ2A 1BE8A 4OAQA 4M60A 4XUGB 2XTJA 1YL7A 2G80A 4ND7A 1WMDA 3NTUA 3V4PB 1SJ9A 4QT4A 2H2HA 1EFVA 2G9RA 3CT6A 3KAJA 3O4RA 4G1FA 3S2UA 4BAGA 4B83A 5JWOA 1VSVA 2C29D 4TVSA 4DARA 1NUHA 2AR0A 4QQFA 5BOSA 3SLKA 2PS9A 3DA8A 2QGFA 1M6YA 3W5AA 2VRNA 1SURA 4GZ3A 2B83A 2YJ6A 3KPWA 3IEXA 3CB4A 5TJHA 3VYUB 2PA3A 2W2XA 1NG9A 1ID8A 1N0WA 4NG5A 1BNCA 1ZH6A 2XEDA 1ODIA 5E9QA 3EDOA 3PZRA 3JZMA 4F21A 1V11A 2G4LA 3GLKA 4EG1A 3OZVA 4JP3A 2CW5A 1GSHA 3JWJA 3DP9A 1GPNA 2QN1A 5DHQA 4LYHA 4BVKA 4ZQBA 4HB4A 1KI6B 4I8XA 4OP3A 2VUUA 5H7XA 4WXPA 4BZXA 3MS7A 1Q0LA 3LU1A 4FMPA 4BJ1A 2ORIA 3ESYA 3QSYA 5IRCD 3M4YA 1NSYA 1ML4A 1NA5A 2ZRLA 2IS6A 2BFCA 3F1LA 3GDWA 5I7UA 1OBHA 3HU2A 1NJ2A 3ZLVA 1CZOA 1UC4B 2GD1O 2ZDQA 4LI0A 1XTBA 1V7CA 2PX6A 3BRSA 6NULA 4G56A 4KIWA 2VIIA 2NTEA 3EMDA 4HGPA 4UMVA 3T34A 3JR7A 3GNLA 3IIJA 1TLFA 4EY4A 1DKPA 3C1UA 3G2PA 3BE5A 1HNWB 1BMFD 1L8OA 1LRKA 3EUAA 3OOSA 2BM0A 1ZUHA 3HI6A 2Z8YA 1KR5A 2Q41A 1EP1B 1ENYA 1XBTA 3IUEA 3L7NA 1DRKA 1IDN1 3HEBA 4C04A 3EBOA 4MW4A 3JSAA 4PQEA 4BBZA 2IKSA 1RC8A 1QRTA 3DW1X 4TWJA 1N7HA 1ZSYA 3LW7A 4MRRA 4QDTA 3KFXA 2RHLA 3BJEA 1ZK4A 5LDGA 2I8LA 2Y1GA 3EBPA 4AYXA 1Z8HA 3QP9A 2WTAA 4UZEA 4GL2A 3ENKA 3D7RA 3OQMA 5NULA 4HWSA 4B81A 2GFQA 1E1RD 2E0IA 3GK3A 5AM4A 4E4TA 3UCFA 5EESA 4B74A 1M2EA 4OL0A 3AL0C 2B7CA 2VF8A 3GI1A 3I61A 5FF9A 1SCUA 1EBUA 2DR3A 2G70A 1MN6A 3PC8A 1BVUA 1EA7A 4MVXA 5LP6C 1VHJA 3ZH9B 2OGUA 1S9HA 1JAZA 3R3JA 3HBJA 1UC5B 4HYYA 3HBLA 2B4YA 1Z0JA 4Y2XA 1QYXA 2VHYA 1U31A 3PE6A 1U1GA 5TARA 4OHFA 3SG0A 3GFVA 4PS0A 5EE1A 2JHCA 4RSRA 2VSFA 2F8TA 1UAYA 4IWXA 1R0XA 4YJHA 2YXDA 2XSZA 3A70A 3NHAA 4NOKA 2AI1A 3NVDA 2W4QA 4LOJA 5BQOA 5CX1B 3WMGA 4DQLA 1WW2A 5G0WA 1Y63A 3EODA 4EQZA 4TSFA 1F9AA 4M8NE 5MFZA 1YZFA 5LQKA 4PTZA 4FX2A 2VQFB 2R8ZA 1NF3A 3VZPA 2FZ4A 3P5SA 3RYCB 1ZCZA 1I3NA 1IHPA 1THGA 4MRAA 2IV7A 2VJDA 3BT7A 1QX4A 1SG0A 2FWIA 4WKBA 4RJTA 1T43A 2BFWA 2I3GA 5K3DA 2GEDA 3V7FA 2DPHA 5ERXA 3ZYCA 1KEWA 1DOHA 5DNAA 3HJTA 4CLRB 2BGNA 2BTOA 4YAUA 2HIAA 3RQSA 1C80A 3L3BA 3ZY4A 3ESBA 1LTHR 1W59A 4CKXA 3NKVA 2VSYA 2ZSUA 4L74A 2DU8A 3HPRA 2EX1A 3OA2A 1OZAA 1UKEA 1TO2E 3PL5A 3TOCA 5A2GA 5LQCA 2O54A 2X5KO 1I9CA 3Q0EA 1E64A 4C22A 1QHXA 1RLJA 2YV1A 2Z4TA 2I99A 2BKXA 2D0OB 3WADA 5JNLA 4ZU1X 1YKGA 3MIZA 1AGRA 3NW9A 4NU8X 4YMUA 3QJGA 1NI3A 1CIJA 2PRJA 3QEKA 5B37A 2A0YA 1J2JA 3KCNA 5JSQA 1M6WA 1OASA 3EA4A 3R7DA 1GU0A 2AUMA 3COSA 4B3JA 3GLIA 1MO5A 1DT5A 3MMNA 2XUKA 5TX7A 1SBCA 5A9TA 2BGUA 3MLAA 1L6RA 2NGRA 4BFTA 4JDPA 1W52X 1K6JA 1A9XA 4IQ0A 4D98A 4FPXA 2P27A 1QC5A 3BMNB 3K20A 3FTNA 4WTOA 3PRKE 5SZIA 5MDHA 4KO2S 3DE7X 1GV1A 1VLHA 4YONB 4QYIA 4Z8XA 4LMPA 3HCOA 2OV2A 3FOZA 4YCJA 3RS2A 4TYQA 2VRCD 3ZWPA 3B2QA 3RK0A 2P7HA 3N87A 3K9WA 4TWAA 2HIMA 4FZJA 3HUTA 5CX4A 4RMGA 2CWWA 3V8BA 1IQPA 1F20A 1GN9A 3D8BA 1D6MA 4UE3S 3MGCA 5F2EA 3RSLA 4L5YA 5D00A 3MJHA 3H18A 2P6MA 3CNQS 3ZDFA 5DVZA 3ZWYA 2R97A 2D7DA 4OLJA 2YXEA 2FB9A 3RCBA 1YMUA 4PYQA 3M6UA 4L02A 4RVSA 3RJMA 1VMIA 3C4QA 3O92A 3PR3A 4JLKA 1KXJA 2NW6A 1OB2A 3OBIA 4CF3A 3RPEA 1EX9A 3C2QA 4G41A 3G0CA 5KMGB 1TZBA 3DEKA 2P11A 4WMLA 2JFQA 3WS7A 3LPCA 1C3OA 1SKYB 2BZ0A 1F4LA 5F3RA 3VUEA 4AJ1A 1XD8A 4ZODA 2CXQA 4YB8A 4WWHA 2WJ6A 4LKOA 4X1IA 2YS7A 5CJJA 4LHVA 4LYEA 1G5HA 2ACEA 4ALLA 1G3QA 3ORQA 3A2LA 1BCRA 5K20A 5E1BA 3SGLA 1DG3A 3QXHA 1DBIA 1O9HA 1S8NA 3CTMA 3HQ4O 4LRWA 4DW8A 1G8JA 4EB0A 1LBIA 1B76A 2X6TA 4CM9A 3KOXA 4EYEA 4CQNA 4K6HA 3TEFA 2CB9A 1CUUA 1RKQA 1Y7PA 4R2XA 4U6SA 1KMHA 4P0TA 3IA2A 4ZJYA 1KI4A 5DT9A 1FFDA 4BNDB 5B1HA 2YS6A 1B8NA 1N6IA 1R00A 1LQUA 1LSSA 4BECA 1ZW6A 2P0YA 2QTTA 2Y9PB 4JX8A 1MGOA 4MWTA 3AVXA 1YQUA 4LJ7A 1RYHA 4D9KA 4BJ3A 4BRZA 4Q18A 1EI9A 3GRFA 2Q3LA 3QSGA 5DTRA 3W9UA 3LLSA 3GW8A 4OSEA 4NK5A 3F6YA 2NO9A 2A9RA 2XV1A 3EQ9A 1H05A 1KJZA 3EH2A 1P9NA 5CA0A 1P0MA 2WNHA 3O26A 4IP0A 1NPDA 1P2FA 3DMTA 5EGSA 1JDPA 1K97A 4RF5A 5YASA 2RONA 2RH4A 4HDMA 4BO2A 1GQOA 1Q16A 1DWPA 3CE9A 4QDJA 3VBCA 1JEQB 3U56A 2FYTA 1C1HA 2ROQA 3KDSE 1H0HA 4U7JA 4IWNA 2J3DA 1U1IA 2YHIA 1QQ5A 2VQEB 1OFUA 3PIRA 9GPBA 5DT2A 1RCUA 4H6WA 2ZVQX 1GIAA 2NUAA 4KWCA 5AXAA 3OTIA 2BV3A 5ILGA 4MB0A 1KOLA 2CDNA 1EDZA 3OPYB 4BNLA 3GEGA 3IUPA 4MRNA 2Q4DA 3PC7A 1GQFA 1HT3A 2W2KA 4JMPA 2Z08A 3VO2A 2DM6A 2GNOA 2ZRPA 1S0UA 2IZ1A 2QY9A 3GCDA 3PUHA 4MVJG 4N3GA 2AKAB 3NBUA 4JOQA 2G83A 2QXYA 3DFFA 2C5SA 3DMHA 2G04A 4GBGA 4J1QA 3TXYA 4D9MA 5K0BA 1C7IA 1UPBA 1V8DA 2WDZA 4ZVRA 4LK2A 3QPWA 3H1AA 4J94A 1C7FA 3SWWA 1RPTA 1UCFA 2V6JA 1W19A 2AR7A 4YJFA 3B9RA 1G8YA 1V26A 3EPPA 1EGQA 1MABA 1WDKA 2VI5A 3A6JA 2FWNA 1X80A 1JIUA 1TFRA 1U0OC 3GVCA 3PFFA 1U28C 4J0JA 3RC2A 4QUAA 3VZCA 5HGJA 4NJMB 2V5AA 2OMEA 3U4GA 4ALJA 3QBEA 5A5VA 4JHXA 4YMSA 5DGHA 3UC5A 2WHYA 2EX4A 4HYQA 1XVLA 5FIUA 1Z16A 3NRCA 5EWMB 3R9XB 4Q4HA 3B53X 1LFDB 1UMDB 5BVHA 2VAWA 3IQHX 1M8KA 2PLRA 2P2CA 1L7PA 2FLKA 2MHCA 5JYEA 1DC6A 2NZYA 3ISJA 3L6EA 1V3QE 2HSZA 4RH1A 3FIUA 3HO1A 2OBYA 2VJOA 2WWRA 1OE0A 1TX4B 3LCMA 3LQ4A 1E7YA 3QX8A 5CBKA 3RVQA 1RM5A 4CG2A 5LJIA 4IGKA 2OZLA 2QV7A 3K4QA 3PYLA 3ZW8A 3GJ5A 4KI0A 4B4UA 3S55A 5IDXA 4OJTA 1KFKB 2C03A 1J07A 1ST2A 1TO6A 2ODAA 1JA9A 2BEUB 3GQBB 1CZHA 4CLHA 2CLSA 4OL9A 4IDGA 2CUTA 1Z22A 1Z4OA 2ZIGA 1L4LA 1Q14A 3PHGA 4AO8A 1LI4A 2G3YA 4GU5A 1BAPA 2AEFA 2W6CX 1PEDA 3G9XA 1SWWA 5JVDB 1I2ZA 2I2XB 2X4IA 3THRA 1FXWF 1Q7RA 1J1ZA 4IEFB 3ET4A 3ZY6A 3K4PA 1JHZA 1T3TA 2H63A 1N5DA 2YASA 2ZJFA 3LOPA 2ZBRA 3I2JA 4J2HA 5FYQA 3NGXA 2JLWA 2R2GA 3O0TA 2JL1A 3G2QA 1X14A 4MXDA 1O9BA 2IEBA 1XZFA 4G5HA 3PKJA 2KS6A 3Q3IA 5CDFA 5BR8B 1J24A 5ITZA 3OT4A 2JCGA 2P0EA 3RRXA 3MVEA 4NPCA 3UHOA 1RRVA 1WTCA 2P67A 4ZDIA 1QCCA 2I4LA 4J1SA 1JEDA 4KQ6A 3LPLA 1Y8RB 3X2SA 2Z2IA 1E3WA 1WCYA 1EJBA 4TKMA 4TTVA 4D5GA 1EHCA 1OPXA 1J06A 1SUEA 3MT0A 3W6OA 4Z9YA 3WP0A 3CEHA 3EVEA 4YJGB 2WOOA 4XB6B 3QEAZ 1VL6A 3MBOA 2C97A 1W0JD 3DOFA 4ABTA 1GNTA 4XTCS 2P79A 4Z7NB 3PFNA 3GFSA 1GGJA 1Z5NA 4DYDA 4NRDA 2HY7A 4I9NA 4L73A 1P3Y1 3RBVA 3F67A 2POCA 1XX6A 2HTEA 1ZUIA 3BL6A 2AQ8A 2KBEA 2VS1A 3KJIA 2OSVA 4G8CA 4TKVB 4YUWA 2QUHA 2VHCA 3GDOA 1GNRA 3K35A 4NBVA 1WUKS 3EK2A 4NYMQ 4DF3A 3LCRA 4XQGA 4D3ZA 1C2YA 2C2GA 4IMJB 2HA0A 1ZOIA 3ESQA 3LLCA 3NEJA 1Z37A 4GEKA 2QY6A 4KDFA 4LZWA 2XQIA 1RAFA 5JZMA 3DZHA 1C0PA 3H5OA 3LNCA 5KYNA 4DVJA 1E3DA 1EM8B 1DC4A 1GEGA 1MRZA 4HB2A 1DI0A 2IYRA 3EG5A 1WF6A 2BMFA 5L8VA 2OHOA 1E5XA 4F4UA 1SA0A 1CJMA 2P6RA 4LPKA 1HL7A 2RBGA 4UNPA 2CJYA 1E7MA 1LWOA 3DV9A 2GM5A 2BWJA 4YLEA 2E4XA 3UMVA 4BVJA 1GXSA 2QZ9A 1JZSA 2OZKA 3LQ1A 2R68A 4TVKA 2H5LA 3ZDBA 1OC2A 3PUXA 4QQKA 3H5RA 2XUZA 2ODPA 1IJKA 3NC1C 3DE3X 2FZEA 3KSDO 5KNLA 1JPJA 2J30A 1AF4A 4W63A 4RWZA 4G89A 3H7IA 1HZZA 4JJZA 5FEUA 2VQ3A 1UPXA 5SY9A 3UJCA 5LP6B 2OZEA 2GASA 1T3ZA 3GWIA 1D7OA 2JGNA 3CSSA 4H1VA 1Z74A 2HLHA 2EBHX 2YV4A 3GEPA 1Y89A 4JL5A 1A8HA 3LUGA 4NTZA 5C5IA 4TMYA 3SVLA 5LDDC 2I65A 1KHHA 4Q1AA 4I55B 3L43A 4NMLA 3JQGB 3MQ4A 4WKOA 5K0LA 2QN9A 4LJAA 4PLPA 4NPHA 1XV5A 2R79A 4X20A 1DDIA 1V8OA 1N5MA 1Z2EA 1E2IA 1A1VA 5CLJA 4I9HA 1ORIA 2O2CA 4RHYA 4BKMA 5LIRA 3ND8A 4ZOCA 5JZ9A 3KR0A 2B37A 4OP2A 1N9KA 5DX0A 2CVPA 2JIBA 1W4LA 3K0BA 5DM4A 4AUNA 2O8DA 3U9LA 1J25A 1AN9A 2JAOA 1DLJA 2MMGA 2ZANA 1U0SY 3OKAA 4CEJA 2L19A 1Z33A 5FJIA 3I9LA 3B51X 1C3JA 4URXR 1NN1A 1KDOA 3DHVA 1X7YB 3G5LA 4EB8A 1CUHA 2UXDB 4CV0A 2JI9A 5EIBC 1FZQA 3WRXC 3LJKA 4NU0A 4DNFA 4TXLA 5FQOA 5HKBA 2WPNA 3FR7A 2W6ZA 2P6UA 3KQKA 1G38A 4JXKA 5DBEX 2X5XA 2HT1A 4YK7A 2VF5X 1FSZA 3P26A 4OXQA 1AJEA 4FMDF 4LC1A 2GN2A 4PONA 3LC7O 1ZD8A 4GAEA 4B0PA 5TR9A 2OPBA 3BXGA 3MMSA 3QHAA 4Q3DA 4NIMA 1YFLA 1X1EA 2Q1WA 1RBMA 2XBUA 3IHWA 4U63A 5DW0A 4ZVVA 3Q8LA 3EW9A 3KEMA 2G76A 3OQIB 3WWDA 5IDVA 1QLHA 1X3SA 3BORA 3MGGA 3NI2A 2SKDA 1J2EA 2BGLA 2Q7DA 3RDPA 4B82A 2PUFA 4PLHA 3MD0A 5CLIA 10MHA 1YCFA 2H52A 3DM5A 2XUDA 3I12A 5C34B 4UBLA 1FMLA 1JG1A 2ODEA 4LHZA 4FFDA 4LC0A 3L0OA 4LBYA 4O4HB 4QJ5A 1BD4A 1CS4C 1MV5A 2JFHA 1LW7A 2R6FA 3N58A 3TRIA 1EUZA 2VNAA 3QMMA 3K15A 3VGJA 1Z56C 3RQIA 4DWWA 3E0QA 2JRLA 3G3EA 1SVJA 3V7UA 3I1IA 4WZAE 1A04A 1JDTA 4WXEA 4Q3EA 5ALPA 4GZMA 3SX2A 5ALZA 3OI7A 2ZR7A 3CPSA 4FFNA 4PRKA 5THXA 4D9CA 4W8OA 4BWYA 1FS5A 2HQ1A 4PG7A 2DFTA 1YF3A 1CE8B 5CT6A 3I53A 5EYPA 3TR5A 5MN6A 4PZZA 1WZIA 3X2EA 3SDSA 4CFSA 1AMOA 3WXMA 3WA7A 3UFXB 1IUPA 1MOQA 3FPLA 2DGDA 3DLPX 3HN7A 3KSRA 4UNSA 5CNMA 4HL6A 3PFHA 7YASA 1JFFA 1MUUA 1XWWA 3K4HA 5FI3A 3EYAA 3ROZA 1WUIS 1TM3E 1GZSA 1M2HA 1E2DA 2QOEA 4GI1A 1TIPA 1I36A 1U1EA 4M87A 4RKEA 1C3XA 1CQIA 4JEMA 1D4FA 4P7JA 4DEXA 3SP1A 2NNLD 1WEHA 1DGQA 2CFTA 4JC5A 3PUWA 4JYAB 5IHPA 3DNMA 4OBWA 3ZHZA 3HYNA 3F4LA 5IAOA 1HPLA 1AK9A 4FGJA 2V58A 5BWNA 3DCYA 4ZHSA 3K0CA 3Q12A 1P5ZB 4FI3F 1RRKA 1PYDA 4YC7A 4F04A 3O8OB 2BH2A 1XEXB 1IRXA 5AW3A 2GLXA 3NBFA 1ZH2A 1XB2A 1U0LA 4PSCA 2PNJA 1H23A 5A62A 3H2YA 1XTJA 3LFTA 3FNFA 4KPUA 2A9JA 1JEYA 5CXSA 3A3OA 4F4IA 1UOPA 1UBGA 4JLBA 1XDWA 2J9YB 3EXHB 3EB9A 3O94A 5EWJB 3F8SA 1B0UA 3SX0A 5E38A 1VMKA 2B7LA 1QTNA 2WRZA 2JHPA 3FZEA 3I39X 1LDGA 2AZ4A 4IIEA 4ZU6X 3T9AA 1U7OA 3M6MD 1OTHA 4L4ZA 4WJKB 2AHRA 2NN3C 3JRNA 2OQ2A 1G21E 2BKEA 2CMFA 2X0DA 4AX4A 1U8CB 3TCNA 4ZI3A 4DR4B 3U7HB 1MIHA 1T2CA 1W88A 3VVCA 3QE9Y 3ZZ1A 3R6GA 1U90A 2JLBA 4GP7A 2OGTA 1AIPA 2QNRA 2JLAA 4I3HA 1VKRA 3OC0A 4K6KA 4HLUA 5DX1A 1IB0A 1AO0A 2QUAA 2D5CA 3CNBA 2CLOB 4XJXA 3CRW1 3A1VA 5FLYA 1A9ZA 1L9KA 3WQRA 2GHRA 4ZT2A 4CIVA 3U60B 3A2MA 1A2BA 3DVQX 1T2FA 4QA9A 2YWDA 2GA8A 1AGYA 1EWKA 3F71A 1Z6QA 3B13B 3UUEA 1U8YA 1W75A 3OE7D 3GGDA 4OY3A 4WCVA 4MYTA 1O97D 4FGUA 3UW3A 1G5QA 1ZK2A 1ZVMA 4HNQA 4DDMA 1ENZA 4PQYA 1F2UB 4PWZA 4AY3A 4NC9A 1P0PA 1DXQA 1QHEA 2AFRA 2MSEB 2QN6A 4FR0A 4O0LA 5FV7A 3I92A 5JSZB 4RY0A 2NUTA 3X3HA 4QNNA 4D57A 3HFGA 5LC1A 2EQBA 3T95A 2YOFA 1SHKA 2KWIA 2B69A 2QX9A 1FLVA 1KR2A 3E70C 3L0BA 3O38A 4KGZA 4N3BA 1L5LA 3X1ZA 4DG5A 5AQ1A 1RFGE 1WU7A 4XD7A 4CFZA 1Y3AA 3NC4A 1UJNA 2N47A 2OM2A 2FZWA 3RSSA 4KX5A 2BZ1A 2VHTA 3N74A 3VOTA 2F8SA 2WIJA 1CUXA 1KJJA 1JV2B 1FB5A 1Z36A 1XTRA 2J6IA 4Q15A 1JIKA 1DJLA 2NO1A 3DC2A 4GKBA 2C1XA 4MO9A 4UULA 3UM9A 2BFNA 4JI4B 5DYTA 2GARA 3R24A 2DHEA 1Z7GA 2CD7A 2JBAA 4DTIA 3PQ5A 5ESWA 4QZVA 2A92A 1JHXA 1CUVA 2QS9A 4R05A 2HQBA 1ZUNA 4D3SA 2I2WA 5FKJA 4HAVA 2AMJA 4NBTA 3T7IA 3ZIUA 4HQ6A 4DQKA 3P2OA 3B3GA 4ND8A 3FUVA 5AVWA 1LJ8A 3C5VA 4OUKX 3VYRB 3ZD7A 1BJRE 2PMCA 1F3OA 1OXVA 2F8LA 5BYBA 2JGDA 5B3AA 1TE2A 4OQQA 1O6CA 3DTYA 4TXHA 2WB2A 4X95A 5FR1A 3F5DA 5IT9A 2CL0X 3AHEA 2PX8A 4AQYB 1LI7A 3CEPB 3IAEA 3LF2A 1JLKA 5DPMA 4L5BA 4O4JB 5JDCA 3K9BA 5HFAA 2K7ZA 3G82C 2IXFA 3BXOA 5DKFA 1Y3DE 1PL6A 2FSSA 1XVUA 2PJDA 2AEEA 1CETA 3FCCA 1L8XA 3SY8A 1I94B 2WWXA 2Y92A 5EXDA 4W6QA 3ZNOA 5BVGB 5CDTA 2WMYA 3TLCA 6ABPA 1VPWA 3A1EA 4W7SA 4FW9A 2GJ9A 4EI2A 2HMWA 4DR2B 4PCAA 1M8PA 1NJGA 3WLFA 4TTAA 1X9IA 3KOWA 2OA0A 3FDZA 4OAPA 5ABPA 4XDZA 1ZOOA 4IIJB 1WL8A 3TL3A 3WOHA 4AYTA 1DL5A 3I28A 1HDRA 1T5DX 3M1LA 1OKKD 3B6JA 3E8XA 5FBVB 3B5EA 3SNKA 4QLBA 3LYHA 4OSPA 4RPJA 5E6RA 1KBZA 3CZ9A 3GIWA 5DCWA 3D3WB 4PWYA 2QLBA 4ZYUA 1B3BA 2OZVA 1N8NA 3QE2A 4DJ5X 2QRGA 3HDYA 4FIZA 1PTJA 1SR8A 2K6GA 1P81A 1ZSNA 4KH1A 2NZ2A 4X7PA 5A0VA 5E2BA 1AO3A 2CFSA 2ESRA 3ZV4A 4D4IA 1DTSA 1OU4A 3ADDA 1VLQA 2A9QA 5AM5A 1I2BA 4KDCA 4E51A 5BSHA 1B6GA 2ZSBA 2AVNA 1RMQA 1YFJA 1C9JA 1DG9A 1I3LA 3HHPA 3CR8A 3RFUA 8OHMA 2GK4A 4RZUA 4YV7A 1H85A 2ZRJA 3KSUA 1ZM4A 2CB0A 3R41A 1S2GA 3GZNA 4XYMA 4F5DA 3D6TB 4R1TA 1L7OA 2WHEA 4NENB 5LJLA 2XZLA 2P4QA 2R00C 3AEKB 3QU7A 5AXDA 1LF5A 5HTKA 2IIQA 4CQLB 1G5IA 4DSAA 2GKSA 5AIBA 2WABA 4PRLA 2QRJA 4R9UC 1RQXA 2Y1WA 4IH4A 4PLVA 3EEFA 3EUWA 2C4TA 3E9DA 2XOXA 3Q5DA 3QVSA 1NFRA 2FGKA 1T4DA 5HRUA 4DDVA 3GUVA 1H9BA 3BSYA 2UVDA 2H4WA 3HKCB 3MBKA 3PGMA 4CMHA 2JD2A 4M1SA 1PR3A 2QR2A 1Q7EA 3JRWA 5FBHA 1P19A 4CM4B 4D96A 4D4GA 4MKZA 1GAEO 4MYHA 4ID3A 2BAGA 4R2HA 5B4TA 3HVHA 4MCJA 4QOHA 2VYVA 1JQKA 1YB4A 3UENA 4E21A 2Q4TA 4EW6A 4QJ4A 2ADFA 2HPHA 4XUDA 1BU8A 4R1LA 4MVJD 3CW9A 3EXEA 3MG9A 4ISBA 1V0JA 1RRGA 4A23A 4ZICA 2WJHA 5C1OA 2C82A 2W0MA 2A5DA 4C0XA 2C77A 3E9RA 2QN8A 2AXPA 3EMKA 3H5TA 3HB9A 1D5WA 3OLCX 4FNOA 5ULLA 3RHSA 2OD7A 2WF5A 4QAQA 4IXNA 3TTYA 4G5YA 2EBUA 1LPOA 2LDXA 4QC2A 3AL3A 4Z4QA 3TLZA 3CO0S 4QE3A 3KALA 1FQJA 4WEOA 3NH9A 1PJ4A 3DFZA 3GLRA 3LO5A 3H1FA 2ZYAA 4H1TA 2H8GA 4RD4A 5I45A 2GYYA 1ZRHA 2BUBA 2FN4A 2ZXUA 1CP2A 2BZSA 4ZANA 2Q28A 4LSWA 4Q4CA 4HFMA 5K6TA 2PFSA 4D99A 1RVV1 1TT5B 4JR2A 2QW8A 4HAZA 3HWWA 2K2QB 4IL5A 5KVSA 2F3PA 1UBFA 2NVOA 1T9HA 4FDAA 2X9VA 5LMCA 3QHQA 2ZYWX 4QLOA 4JVNA 3LGSA 1SD1A 4EY6A 1TW2A 2Q5JA 2I6QA 4ND4A 4N9WA 1IY1A 4X93A 3WYEA 1HURA 4EUEA 1EIWA 1FSPA 2WU0A 3S6JA 1S2NA 1B23P 5I7EA 2B7BA 2DPLA 3FGOA 1AUPA 4G4JA 4XLTA 5FTMA 2C8LA 5AJZA 4D0SA 3D8TA 5DSTA 4TTSA 3FNQA 1YXMA 1N3LA 2H2GA 4LV8B 5K8UA 5AM3A 1JDUA 4QASA 3R2JA 4IIXA 5DJ5A 4E4YA 2ZQ5A 1MX9A 2E4WA 3WJAA 3VA7A 5KOJB 3THXA 2I67A 3JYPA 5GJCA 4FHEA 4UVEA 3EIWA 3VC2A 3WGQA 1XIVA 2VLIA 5CA1F 1ZHFA 5JAMA 5EVJA 1XAIA 2Q8QA 1ISSA 1P5FA 5K0NA 1TD1A 1FFHA 4RKYA 3SF8B 2AOUB 2IX9A 2JGEA 1TAHA 3VRHA 1Q1ZA 2ZS9A 5FWYA 1U2RA 5CB8A 1PN3A 1M67A 2IOFK 3DUWA 4IGFA 1K9SA 3TQRA 2J5XA 2W2LD 3D4PA 1GKYA 2OLEA 3D3QA 3PHBE 1CUSA 4XASA 1EUDB 4E0BA 1Z9BA 3HGQA 4YCLA 2H5EA 4L5JA 2OGWA 3SSAA 2XECA 1CRPA 3ZE7A 4JSTA 1H2AS 1UPTA 1E6EA 4KWHA 4GSLA 1KE1A 3G9QA 4U2FA 2EW8A 3S28A 1SXJA 3QF4A 3G5TA 4RGBA 4TYMA 5C4MA 3IDFA 1RXCA 3DTVD 3GYBA 4KXNA 1JR3E 3E7PA 5I3CA 1GZVA 3QNMA 5L53A 4LOKA 4EGAA 4XVUA 4EG6A 5L3RA 1JIJA 4BX9A 2C92A 2JI7A 3QEMA 1TIKA 1H1DA 1O08A 5HFJA 1J0XO 1AKQA 3QVOA 3MOGA 1N1MA 1VG9B 3I3SR 4YYZA 3ETLA 4DLLA 2Q6VA 2AR9A 1YMQA 1ADCA 2EIXA 4XCQA 5DI9A 3WIDA 4EJSA 3SC2B 3I83A 1I7NA 3OJWA 2CV1A 3WY9A 5J3JA 3U6BA 1Z6GA 2VPTA 4WQMA 1CDEA 1VJ0A 3ETCA 4U9UA 5IFKA 4L8GA 3DD5A 2WU8A 2ZJ1A 4EFKA 2PKXA 2ZPAA 1H93A 1OHHD 1KJIA 4DA9A 1JDVA 1DTWA 3F7MA 3UAOA 2ARKA 4FLFA 2V0NA 3K1AB 1LVHA 1TUBB 4B6EA 2BIFA 1ZNQO 2KMLA 2YZNA 3QXGA 3VX3A 1OPRA 2ZUCA 4QVKA 4G97A 1Z0ZA 3UO8B 3MJVA 4WADA 4CEIA 3ILHA 1X7ZA 1AQLA 3FOBA 4TTPA 1C30B 5K3AA 4AJEA 4D9BA 1B6SA 4Z4IA 2WTBA 4C05A 6YASA 2KB0A 2Q5IA 1G7RA 3QUAA 3WIEA 1JLSA 1U94A 1NSTA 2OQVA 3CBQA 1TZ2A 3IEKA 1X1CA 1GY8A 1O03A 3ODGA 4YTEA 2ANBA 2ZUEA 4CIAA 5BWOA 3EQ6A 1DO2A 5L45A 1UOOA 1NSFA 4LZPA 3SQOA 5TF0A 4LE2A 1RQ2A 1CLUA 2FX5A 1HX7A 1X7WB 1AM4D 4XQCA 4UKDA 1GRRA 4EO7A 1X7DA 5SV2A 2OWDA 4OCZA 3ZLBA 2OK7A 2JKZA 2HRDA 3H8VA 2P65A 1ZD1A 5HJ2A 4ZO7A 4WCDA 1SU4A 3NFYA 2HEGA 1MJGM 3LHIA 3KFVA 5CR9A 2G5CA 2QRNA 4JLVA 5AK3A 4GOOD 3SIRA 3UXHA 2W6JD 3GT3A 4N0QA 3GRYA 1TMGE 2XUIA 5BNWA 1L7QA 2BKUA 4NCNA 4WINA 3JWIA 3LWNA 3C4VA 3IIEA 4LDAA 4ESVA 4QEZA 4FZ3A 4RVNA 2SKCA 2W5UA 3NEPX 3OSUA 2GFIA 2PPLA 4M4SA 4L9RA 3HY6A 1C50A 5AUOB 2RBKA 3X1KA 2O8CA 4F72A 2PTGA 2WW8A 4RCYA 5LXTF 1RRPA 4PC2A 2D6FA 2XE7A 3CPEA 5FO0A 3ZCQA 3AL2A 4NS1A 4CW7A 4F8JA 5JMPA 1CUCA 1Z0SA 3BL5A 4NCKA 3WHIA 5J2TB 1ZINA 5KTKA 1QGYA 4XGRA 3UT5B 3SEFA 3DOUA 1NR5A 4WVLA 1GKLA 2ZIFA 3GLGA 1JDSA 4H4CA 5KNDD 4ER7A 4EAAA 3AXTA 3CX8A 3KQSA 4L78A 3IKJA 5LZ4A 4GMXA 4D9EA 2ZXFA 3QK7A 4HO1X 4QRDA 5AJYA 2C9CA 2AN1A 4KPGA 3VO8A 1AN0A 4EYKA 1AHPA 3ZCVA 4ZYZA 2G5PA 3NRBA 3TAXA 4C30A 5LP1A 5JPCA 5CEJA 4M7PA 1NWHA 1NBMA 4HWKA 1NX9A 2FUEA 1Y8AA 3CEMA 5H4GA 4RQTA 4DQXA 2JBHA 4X5OA 3SEQA 2PMFA 1FNCA 1G8MA 2YC2C 3AY7A 3OUUA 2J3IA 1TJ4A 2HWUA 4IX9A 4R9RA 3S8MA 2H6EA 1YCHA 5C1BA 4ME6A 1TF2A 4B34A 1P2GA 4F5YA 2QMHA 3WLPA 3PLAE 4G9BA 4A8JB 4FC7A 3DZIA 3WDKA 5AVKA 2ECQA 1BA2A 5KMGA 4Y2HA 1X74A 1X3LA 2J3LA 3MK31 2PWAA 4LQDA 2XB8A 3DAPA 1HYGA 2BC9A 1HE1C 3IQDB 4M3NA 2WD8A 2J9ZB 1DG1G 3EMBA 1T9GR 3IR6A 3QKWA 3GEDA 4IKOA 3SDZA 4OAOA 5I9SA 2KYRA 2O8EB 1H9AA 1ISMA 1QVZA 2B61A 2GD2A 3LUJA 3AONB 1XKLA 4R81A 4UHDA 5G1OA 4PANA 5DB4A 4B8YA 3AVTA 5IK2A 4ZVMA 1SC9A 3LBNA 4I9FA 3DVAB 4AK9A 3CMCO 2CFOA 3CX3A 1QIEA 5ITVA 2RE8A 3PD7A 1E79A 2NXEA 3KZOA 3TLJA 3ZC3A 2Q27A 1INLA 1QHHA 3DMPA 3V8RA 4P22A 3KQHA 2JJYA 2GEKA 3NT2A 3H3XA 4M1YA 3IIKA 4II2A 1KYZA 1QZUA 2I1LA 3GX1A 5ALOA 2VDQB 4O3FA 5HIMA 1XSEA 3ZLUA 5K8VA 3OF2A 1T0BA 2GVNA 1NW7A 1N0IA 1WG8A 4RMJA 1VE3A 2WSIA 3RI3A 2PZLA 1QDUA 4EJSC 4FI3C 4Q9KA 3GRVA 3C3DA 1NBIA 4UJ5A 4EI8A 3RU7A 5TLSA 1W6UA 4AN4A 2I3ZA 3IB3A 3RTGA 2VHJA 4FCTA 5J23A 4ZCTA 3WHLA 1ODKA 5AJVB 1I0IA 2JGIA 2HX1A 2RGUA 3NR2A 3ZXUB 2VH5R 1PJSA 2GDZA 1SU8A 2PJZA 3E3NA 4M88A 5TB5A 5HUJA 2OESA 3K6SA 5T4HA 4B2LA 1DCFA 2O2JA 2W6NA 3DV0B 4BEBA 5T6BA 4MITA 2C42A 1UMKA 1ZIXA 2FPLA 2O2GA 3AB8A 3K0FA 4QOJA 1SG9A 2XX3A 4ZZ1A 4LZNA 4M0FA 4E32A 1BZYA 3F7OA 2CKDA 3OPYA 4LDZA 2FF7A 2D8AA 4NVRA 5CH8A 3FA2A 1W36D 1G5TA 1QO0A 2AMLA 2VDNB 3LRPA 3TFOA 3FTFA 1W9MA 1AXRA 1PWHA 4NZPA 2IIVA 1ZU4A 3FNHA 4KO1S 3HK2A 2JHGA 4GNRA 5EEGA 3AVUA 5J2UF 3CURA 3E9NA 3BWEA 1D09A 3ANYB 3QVKA 4DREA 3STWA 1R10A 2Y66A 4RHUA 2WZDA 5KWJA 4H4EA 1H4QA 1V1MA 3JXEA 4LV5B 3UHAA 4Z54A 2YL2A 2HR1A 4K0KB 1I2AA 2I7VA 1MVOA 4HP8A 1CVIA 1IHOA 1DDOA 2WNIA 3BXEA 5F2KA 1FDOA 1E9BA 1ZX1A 2VSQA 1XWIA 4MRVA 4MRSA 1UDAA 4Z1MD 1Z6ZA 1D6SA 1KK1A 3IMCA 1DHTA 4NJMA 4PFJA 1RI1A 1N3IA 4DY6A 8MHTA 2X8LA 1FJ2A 2X22A 2ZWPA 3M82A 5HX7A 5KKNB 2WTUA 5F9FA 2YFQA 3DEHA 5F9MA 2VOEA 5FTWA 5HKAA 2IYTA 3K8YA 1NVFA 2R60A 4HNSA 4I1UA 5BV1A 4U9IS 3ND5A 1GYRA 2VLBA 4OTZA 2F1RA 2VHUA 1ORWA 2JVJA 4JB3A 3ADCA 3EY9A 1XVTA 3OIFA 1XCMA 1RACA 1X0VA 3AV0B 2OORC 3ANXA 1WO8A 5FAKA 1M75A 2OTCA 4X97A 2FUNB 2HL6A 4BN0A 4S2UA 3KEFA 1FX0B 2HNBA 3A11A 4MEAA 4R7ZA 4Y1RA 1RHQA 3OMWA 5EINA 5KNBD 1O57A 1MO4A 1KJ9A 1WKVA 2VUSA 3MTGA 2ZE8A 4Y6RA 3FPAA 3IEPA 1Z5WA 4CM6A 5E6SB 1GRCA 1QE0A 2MSCB 1KEVA 2HGSA 3UWSA 4N47A 4MULA 1R2QA 3O6VA 5BUQA 4A36A 3GUZA 3OCWA 3TCKA 1NW5A 2UUBB 5C3UA 1MEOA 3F73A 3NHRA 1G7TA 4J4TA 3EFOB 4PFKA 4POOA 4CKBB 2QVYX 3P0FA 5K5EA 5BSGA 4R16A 1PR0A 2OP0A 1GUAA 3FWZA 4P84A 2WFAA 2WPDD 5HJEA 5AHKA 3ZDXB 2QORA 4YCBA 1U1FA 1D2HA 4G0XA 4Y67A 5DYYA 2PX4A 3AESB 1GLGA 2C3YA 4HEA6 3EAGA 1EHIA 2W8BA 1CG6A 4H3HB 1E77A 2WK1A 4WKGA 4CVNA 3TVYA 4BGUA 3HC7A 4M98A 5DWQA 1C5KA 2D1YA 1U8AA 5DU2A 2NM0A 3L07A 1EFCA 4XR9A 1EFRA 1FFAA 1U3DA 2ZYHA 1RYNA 2ZI9A 4OSOA 1ZITA 1ZISA 2D2FA 3PNQA 3QELB 4RZSA 3AEQB 2RGRA 3LTEA 3WJ2A 3RVMA 4AJ9A 4IVNA 3S7TA 3LC1O 1OAOA 2XWQA 3HV0A 3NHUA 5D3MB 3V7YA 4EVQA 5KVVA 2YJNA 4UBIA 1Z8FA 4BS9A 4OGWA 1N1DA 2ZUBA 1ZDMA 3NBKA 4WPGA 1XGKA 1TPZA 4MQEA 4FWBA 2JFVA 3ZTTA 2O7QA 3HLKA 1Z08A 4JZYA 3GEEA 3TG8A 1P9OA 1K92A 2QJFA 2H9YA 3WHKA 1TUGA 2Y2UA 4MRMA 1ZM9A 5ENVA 5JJBA 3MCAA 4B4OA 5IUNC 4R9NA 3SZLA 4LMAA 3PFGA 3ZQUA 3L0YA 3OIWA 2HK6A 3P1JA 1EU1A 4LJ6A 1QIHA 4N8SA 5DBHX 3IOMA 5TQ2A 4M1ZA 2I7TA 3TSWA 3N6VA 1U7QA 4EL5A 1NJ8A 3AR6A 4IY1A 2IOHA 1SCAA 2QBYA 3OKCA 2J5BA 1TC1A 2X0KA 3IPRA 1NNSA 1KZ6A 2CEKA 2JAQA 2CVOA 2QTVA 2F90A 4LY6A 5BR4A 2X4LA 4QG7A 4TL6A 2CXOA 4YHHB 1TKAA 4F0JA 2XMCA 3CG0A 3H87A 3ROKA 3P2KA 5ICSA 5JAIA 4YJ2B 4LNUB 2YWHA 2PGLA 2Z83A 1J1IA 4HQRA 4RLQA 1FUEA 1MFPA 1D2NA 1TVCA 4P08A 4DG9A 3X1JA 2NAFA 2YZKA 3SYMA 1YSCA 4H59A 2WYIA 3EPKA 1AZSC 4PSVA 4I46A 4QECA 5KTTA 1LS6A 8ATCA 4Q01A 5BN4B 2MU1A 2ADMA 3BXXA 2QM0A 4BN5A 5KHOC 3H4IA 2ZYVX 4C0JA 1FNBA 2G7ZA 2VYND 2QX6A 5F3DA 4CDNA 3DPUA 1JN0A 4RQUA 1LJUA 5AM0A 3KFLA 3UNXA 3TH5A 4CUJA 1O95A 3WNCA 3K96A 3UJPA 3Q7TA 3RUAA 4RESA 1EUCB 1FRQA 3I1YA 3OC6A 3VHQA 2HSWA 4DUYB 2CMGA 2CN1A 1VKJA 3MYRA 4HDNB 4WUVA 1I32A 3HO8A 4DPKA 5CITA 1NG1A 5CG2A 3MLBA 1YHYA 1QVRA 3PC4A 5E4FA 2VHXA 2WWIA 3PUIA 1UT6A 3O93A 1C14A 1NIPA 4RAOA 5HP4A 3AIOA 1OYYA 4N54A 1NLFA 2FEKA 2DFLA 3WK7A 5FUXA 5ARBA 2I6UA 4BLQA 1EVJA 1I9GA 1TEXA 3H9QA 4PN3A 4K9RA 1NF8A 1W29A 1CJSA 2FUCA 2P9JA 2PK3A 3BD8A 3N8DA 1UIMA 1U9CA 1C1DB 4B7AA 4DQDA 4L4UA 1LNQA 4YA6A 1X7YA 4DL9A 4X3PA 5AKGA 1OLXA 2OCKA 2PXAA 4HXFB 5BSRA 1M2OB 5LMUB 2GJ4A 1J2TA 2ZJ8A 1M7HA 3H16A 2B20A 2CVHA 4BWVA 2APJA 1KU0A 1ODLA 4JL8A 1E5QA 1FF9A 3FYDA 3P0RA 3BE4A 5EKUA 5FPQA 3IOBA 3JQ8B 3OTQA 5LMZA 3EEOA 4G0QA 5EUBA 1ISRA 3T99A 3V1UA 2X2EA 1EWYA 3ZGXA 3AJDA 1WLYA 3BWVA 3JALA 3Q10A 3RR2A 3LY7A 2IP4A 2ASEA 1GKIA 2JHFA 4LTNA 1WF3A 1YS6A 5K05A 2XB2A 1ULAA 5HZMA 4L85A 3OQIA 5CT8A 4N5IX 2VAXA 1Q0ZA 1TTQB 3OMXA 4Q7JB 3SS7X 3TNLA 4AVYA 4F6RB 4M8LA 4Y7DA 3IVRA 1JAIA