2YJ4A

Conformational changes in the catalytic domain of the cpx-atpase copb- b upon nucleotide binding
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
250
structure length
248
Chain Sequence
b'LSLYEKMLHKGMIIKNSNVYEKIKEIDTIIFNKTGTLTYGTPIVTQFIGDSLSLAYAASVEALSSHPIAKAIVKYAKEQGVKILEVKDFKEISGIGVRGKISDKIIEVKKAENDIAVYINGEPIASFNISDVPRPNLKDYLEKLKNEGLKIIILSGDKEDKVKELSKELNIQEYYSNLSPEDKVRIIEKLKQNGNKVLMIGDGVNDAAALALADVSVAMGNGVDISKNVADIILVSNDIGTLLGLIKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COPPER-TRANSPORTING ATPASE
publication title Conformational Changes in the Catalytic Domain of the Cpx-ATPase Copb-B Upon Nucleotide Binding
rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 74
structure length 248
sequence length 250
chains with identical sequence B
ec nomenclature ec 3.6.1.36: Transferred entry: 7.2.2.19.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2yj4A01
3.40.1110.10 Alpha Beta 3-Layer(aba) Sandwich Calcium-transporting ATPase, cytoplasmic domain N Calcium-transporting ATPase, cytoplasmic domain N 2yj4A02
5FP0A 2A29A 2FPRA 4L6CA 2PKEA 1Y8AA 3B9RA 3EWIA 5AM1A 2YJ5A 4KX5A 5AM0A 1WR8A 5ALYA 3QU5A 1NRWA 2B1RA 1TA0A 3B8EA 4XOUA 2HSZA 4MUMA 1MH9A 3S6JA 3KZXA 2FDRA 3BWVA 2I33A 2IOHA 3N07A 4KYTA 4BNDB 2OM6A 3SMVA 3I1YA 4J2TA 2OYCA 2B82A 3B9BA 5AW1A 3WK4A 4EENA 3N28A 2WFAA 4UU1A 3WKAA 1T9ZA 1VJRA 2PR7A 2GHTA 3KD3A 1U7QA 3DDHA 3WKEA 2EAUA 3L0BA 1XPJA 3U19A 1ZJJA 2B8JA 5ALTA 1Z4PX 3I76A 5AVXA 2JARA 4L6AA 1N9KA 4HGPA 3U7HB 4UARA 4YH1A 5T41A 4XQ0A 3SHQA 4UMFA 4AP9A 3ZVLA 2P11A 5E0OA 1U7PA 3OCXA 2YFYA 3HYCA 4DW8A 4BEWA 1L7NA 2G07A 4OCZA 5AKJA 3QYPA 5AKZA 5AVRA 1NF2A 3ESRA 1WZCA 4KN8A 4AS2A 3FGOA 2ZBDA 4C4SA 5AVSA 4XE5A 4CNQA 4EX6A 4UASA 4YIHA 5ALNA 1T5SA 5AIBA 2W4MA 3OCVA 1SWWA 3R9KA 4NFLA 4YGYA 5AVUA 5ALXA 3ZVNA 2MU1A 4L57A 4FFDA 3NAMA 1XVIA 4KNWA 3AR3A 2BDUA 4UATA 5AKHA 4I9GA 1MO7A 2Q4TA 3QU2A 4Y2VA 5AKLA 4G63A 3ZX5A 5AM4A 1KYTA 4G9BA 4HAIA 4C4TA 5IT0A 1Z4JA 1Q3IA 2OA0A 3UMCA 5ALUA 3R4CA 3L1VA 2HI0A 3U13A 4YIKA 3WK9A 1QYIA 3ZTWA 3SD7A 3N8GA 5ALOA 5AK5A 4I9FA 2AH5A 3RF6A 4QQFA 3NASA 4EEKA 1TJ3A 2YMMA 4KNVA 4Y3UA 1TJ4A 3QU7A 3WK6A 2C8KA 2YY6A 5AW7A 5AVWA 4NWIA 2JGAA 3UMGA 2FPSA 1CQZA 1NNLA 2HOQA 4UM5A 3ESQA 5ALJA 1L7MA 2RARA 3WGVA 3ZW7A 2W43A 5AVVA 1CR6A 1S8OA 2CFSA 2PQ0A 2ZBFA 3MC1A 5AESA 4UAUA 3PGLA 4IFTA 2MSNA 4NABA 5ALKA 1L6RA 3IJ5A 5AI4A 3E58A 3OPXA 4MWOA 1RDFA 3I6BA 3P96A 4UAVA 3UM9A 4B6JA 2P9JA 3SF0A 5ALEA 5AW4A 5ALZA 3WK8A 3L8GA 2P27A 2HX1A 2FPXA 2G80A 2YMPA 1RQLA 1ZRMA 1RMYA 1X42A 3NRJA 3W5AA 1VFPA 2I6XA 1Z4NA 2Q4RA 3AR6A 1J8DA 2C9MA 5AKEA 3PDWA 3SLRA 1JUDA 3W5CA 2QYHA 1RPZA 3OTQA 5A3RA 3NIWA 4DCCA 3GYGA 2EARA 3KC2A 3ZUPA 2RAVA 4HGRA 3E81A 1YS9A 4BX2A 1RRCA 3M9LA 1QQ6A 2WF8A 4BEVA 1L7PA 1QQ5A 3W5BA 2P69A 4DWOA 3HLTA 4ZEXA 5AI9A 2ODAA 4UMVA 2AMYA 2FI1A 2G0AA 4CE6A 1S2OA 3WKDA 3KDPA 3QU4A 4Y2RA 3NALA 1U2TA 3CNHA 2ZBEA 3E84A 1ZD2P 1ZD3A 2C8LA 2FPUA 4QJBA 1RMQA 4IG4A 4GXTA 4NAVA 3R09A 4XPZA 5AI6A 5ALMA 5IT4A 1Z4LA 3ZWDA 2WF9A 3WKBA 3A1EA 5ALGA 3AR8A 3L8FA 3AR4A 3WK7A 3FVVA 3AR7A 3RFUA 1IWOA 3CZ4A 3QUQA 2VKQA 2KMVA 5IS2A 3E8MA 2I7DA 3DV9A 3A3YA 4BKMA 2WF5A 4EZEA 1WVIA 1TE2A 1RQNA 3L8HA 3ONNA 4RETA 1SVJA 1U02A 1RKVA 2D2VA 2C88A 3KBBA 2B0CA 3FZQA 3FPSA 3MPOA 1LTQA 4CF5A 4UMDA 2O9JA 3WKCA 2HF7A 2B30A 1L8OA 1WPGA 1RC8A 2BY4A 4Y2YA 4HGNA 2IOFK 4BX3A 1SWVA 2KMXA 2AUTA 2G09A 5AI0A 2G06A 1YMQA 3WK5A 2HHLA 2CFRA 4EELA 3MN1A 4C4RA 1ZRNA 5AVQA 2Q5EA 2HDOA 4YCNA 2YBDA 4H1WA 4NV0A 3ZX4A 4PNHA 3IRUA 3QXGA 2R8YA 1VJ5A 4UM7A 4YCLA 3DNPA 2BDEA 5A3SA 1XP5A 2NO5A 2HCFA 2CFTA 1U7OA 1K1EA 1RLMA 1Z5UA 3BA6A 3ZTYA 2ZOSA 5ALIA 2FUEA 2YMLA 1YJ5A 5JJBA 3N5KA 1Z4IA 5AICA 3NUQA 3QX7A 3AR2A 4BBJA 2ZBGA 3UMBA 2GFHA 4F71A 2QLTA 4BNDA 2X4DA 1LVHA 4O8CA 2HO4A 2ZXEA 4HGQA 1O03A 5AKGA 1Z4KA 3PGVA 2AGVA 3L0YA 3MMZA 2YJ3A 5ALFA 3KOOA 5AK4A 2C4NA 4Y2PA 5AM3A 2ZG6A 3ZVMA 3EF1A 3PCTA 5AIAA 4E88A 4CF4A 4BX0A 4OD0A 2O2XA 3DAOA 3IB6A 3EF0A 1YDFA 5AW8A 2FUCA 3ED5A 2JAWA 2NO4A 4UMEA 1RLOA 2YMQA 3ET4A 2RBKA 2B8EA 2G08A 4EX7A 1Z4MA 2R8EA 3QLEA 3ZWKA 2FPWA 3OCUA 1Z4OA 1QQ7A 4FE3A 5ALLA 4Y2XA 3K1ZA 3EPRA 3VAYA 5ALDA 1F5SA 3F9RA 3QUCA 5AW0A 5AM2A 2IOFA 3OCWA 5AW6A 5AW3A 3TLMA 2WF6A 1SU4A 4Y2UA 4YCMA 5AK6A 3GWIA 3L1UA 5AK3A 2CN1A 4HYTA 5AHXA 1Q91A 3L7YA 4Y2TA 4FYPA 3U7EB 2I55A 3NANA 4OFZA 5AKIA 5ALSA 3U26A 4ZEWA 1Z4QA 5AVTA 3QNMA 1Z5GA 4KX3A 5AVYA 3N1UA 3FPBA 3I28A 4OHFA 2NYVA 2EATA 2OBBA 1QH9A 1RLTA 2YJ6A 2WM8A 3A1DA 3W5DA 5AW9A 2GHQA 5ALWA 5ALPA 3A1CA 2YJ4A 1Q92A 1L7OA 2ARFA 1EK2A 3QU9A 4BYGA 4UW9A 5ALHA 1RMTA 5ALQA 1EK1A 4AS3A 1ZOLA 4Y2SA 3WGUA 4ZEVA 1ZD4A 2FEAA 3ZI4A 5AW5A 3U7GA 4RESA 5AI5A 5ALRA 2GO7A 2DQSA 4JB3A 2A00A 1FEZA 5AKXA 2YN4A 3L8EA 5ALVA 2R8ZA 5AKKA 5AKYA 5AVZA 2I34A 2RB5A 3QUTA 1TJ5A 4GIBA 3OCYA 4Y2JA 2WF7A 3L0CA 2B1QA 1RKUA 3FM9A 3ZU6A 2R8XA 3OCZA 1O08A 4JDPA 5AW2A 2G1AA 1AQ6A 5AI8A 2W11A 1Z88A 2JAOA 2JAUA 1ZS9A 3ET5A 3U7FB 3QGMA 1L8LA 1RKQA 3SKYA 3AR5A 4HGOA 1PW5A 1T5TA 3J7TA 2I54A 3D6JA 4UU0A 4F72A 2HEGA 2IA5A 1J97A 3L5KA 4Y2QA 2IYEA 4DFDA 1ZD5A 1N8NA 1YV9A 2GMWA 4J03A 5A3QA 2HF2A 1MO8A 5AM5A 1U2SA 1YNSA 3M1YA 3QUBA 2WHEA 4CF3A 3SKXA 3AR9A
chains in the Genus database with same CATH superfamily
2PTHA 1RYHA 5F7JA 1JEDA 5H59A 1Q11A 2TSYB 3PGKA 1R1DA 4BMNA 4HXFB 2D5AA 2W93A 2COKA 2CXHA 2ODPA 3EARA 3O7WA 5CIYA 1FVFA 1VKOA 3NBUA 2CCGA 4ATNA 2FW1A 3PDIB 2G9ZA 1Y8QB 5HFNA 3SF8A 2VSXA 2ZI5A 5KUTA 5H4HA 4E11A 2EX4A 1H2FA 2HO5A 4CLXA 1SN7A 2DHCA 2QX7A 5K5EA 1NNSA 2FOXA 4MRVA 1JU9A 3OMWA 4AK9A 3B36A 3F3YA 1CRPA 4J2TA 5IAGA 2Z9BA 3LKDA 4GOLD 4X54A 5FBWB 1O0CA 1D09A 3V48A 3ADDA 1W6RA 4QX6A 4DR6B 1N2JA 1YQDA 3DA8A 3O95A 5CXUA 1I3KA 4RADA 3TUIC 5DNEA 1G7SA 3K2EA 2OSVA 1XLVA 4TZTA 3EGDB 3EC2A 2IXFA 3H7IA 3EG9A 4BN5A 3KQLA 1IZ8A 3SLKA 1C50A 4G8CA 4FEGA 4ND6A 4WESB 1D7AA 5BV8A 4RLSA 1M2EA 4RPHA 5D1NA 1JR4A 1LDBA 5JHGB 3WQBA 1Z4PX 4A82A 2ZI4A 2C2MA 5CDHA 4FYJA 2ZIZA 3DZIA 4IIBA 4WTOA 2RH4A 3OF2A 1T9GS 2YZ2A 2ZWPA 3AP1A 3V55A 4E30A 3PBKA 1U1GA 2WU4A 3MJTA 4JITA 4PLCA 1KJ9A 5L9AA 1S96A 3O8DA 3PSAA 1T29A 2VQSA 4DW8A 5EIEA 3OKCA 3KB1A 5BN3B 1I5OA 3NKVA 2WHPB 4ZO6A 4BEWA 3N2EA 2BRUC 3AU8A 4WD3A 3R8CA 3K94A 5AKJA 5FUYA 4G5QA 4QU0A 1OT5A 1P6QA 1S89A 1E1KA 3B9QA 4F3TA 4AMVA 1U28A 1XTBA 3KO8A 4EFKA 4KITB 1JE0A 4UD6A 4UHCA 4Z2AA 3T3DA 2C04A 1W4RA 5A5FA 3FUCA 3F5SA 4G07A 4K9DA 5CP8A 1QPZA 1E1LA 1E6WA 1MPTA 3A2MA 4FCWA 5E2BA 4V2UA 5DLQC 2Q6VA 3KPYA 1N6IA 3CH4B 1IHYA 1MB9A 4OM7A 4H9GA 5B6PA 3NCTA 4G8DA 5L45A 3KETA 1GAWA 3AERA 3E03A 3FYCA 1QOZA 3EVNA 1R6AA 1UXKA 4I9GA 4JELA 5DU2A 4LYAA 2LWIA 4KBGA 5HWSA 2Y1XA 1XEXB 5D7NA 5LP6B 1FTGA 3MYRA 2UYOA 3LDAA 5F52A 5LNK6 1B6TA 3KSZO 4NARA 3AEXA 3RSHA 4I8XA 4DBZA 1QAQA 5AUQA 4POOA 2FWMX 5BWLA 2AVNA 2GKGA 2HI0A 2VZ9A 3DOOA 1A8SA 4TM7A 5E1DA 3WK9A 4XQ9A 2PRJA 2XRYA 2RHLA 3EULA 5HF8A 2QNIA 4D42A 2DZDA 3KUKA 4AJKA 2I76A 3WG9A 1HDZA 1NHGA 4LJ5A 4B4VA 2WIFA 3KM0A 1YZVA 1WNFA 2P9TA 1T2CA 4BB6A 4E22A 1M1NB 2QQFA 3SDZA 2WWVD 5C18A 2WJ6A 2YY6A 1VZ2A 1RIFA 4EYSA 2QRPA 1HGXA 4C6TB 3FPKA 2PUFA 1V9SA 1MAVA 4FBGA 1MT0A 5IVDA 2XVZA 2OXRA 3OJEA 3ESDA 2EZ9A 1BDIA 5FPYA 5KKAA 2EF1A 1XLTC 2QVCA 1BROA 1I5EA 2VT6A 2RI0A 2FV8A 3AB7A 4L5AA 1UMDB 2ODQA 3UIEA 3JQ9C 1GNQA 1MVNA 4HSEA 1SA0B 3GFPA 4PINA 4OBBA 4ER3A 5FUWA 1V4VA 1FY2A 2RH8A 1JXMA 2X8LA 2W2PA 1DIBA 2UZ1B 2WLSA 1RTKA 2MSNA 5JPDA 4BQOA 5GQSA 4Z1MD 5B58C 3VVCA 2IYXA 4OP2A 1C9JA 2W90A 3LRXA 4HNRA 1M6WA 4N8DA 1JG2A 1VYUA 1DDGA 2A0YA 1TTTA 2FRVA 3GEPA 3TAHA 2IHUA 1GRNA 2HT6A 1BN6A 4BKOA 5ALEA 4GR9A 4ZAXA 4UE6A 3UV7A 5A7GA 4NNPA 4BLTA 5K0ZA 4W5NA 3E3NA 2ZZNA 4BLOA 1Z8HA 4IHJB 4RVCA 3RK0A 3TS1A 2VPWA 3ITNA 1FJ2A 2GKOA 2WJHA 4DBLC 2FFAA 2PR2A 2Q0XA 2PQ2A 2V98A 4DA7A 1QGOA 2I6XA 3LX5A 5BR7A 4BU0A 2E4XA 2POQX 4OI1A 5EY5B 5JS1A 3GUHA 3EGXB 2CLFB 1IG3A 4PG7A 5FL7D 2BKVA 3B52X 4IQ4A 4DIBA 1OAOA 1Y8ZA 2IZ0A 3FOAA 2IW1A 4XB6B 4BECA 1ECGA 2DCUA 4CL0A 5J47A 2CF5A 3QNUA 3BRWD 4UQLA 1TZJA 4LEIA 3P32A 1C4KA 1OTYA 4PLHA 1PL6A 4EG0A 4ZODA 1GJRA 2IIVA 2RHTA 1KAMA 2IPLA 2GJ4A 2ZS9A 1UC4B 3GG9A 3L0SA 2DUNA 1H4QA 1M8GA 1QHEA 4HTFA 4EB6A 1L4EA 2H59A 1JG3A 5HCNA 1KSFX 2VYND 4I1SA 1OFTA 1Z06A 2GCNA 2OBXA 4CMJA 3QE0A 4UULA 3LUGA 5F51A 1QONA 1TO6A 2GCPA 1BXKA 1J8FA 4G4JA 4WK0B 4EW2A 4D79A 1EXVA 1Y3DE 4EKNB 2GCEA 1H9BA 4BZZA 2AG5A 4LC9A 5I7HA 2YINC 4LYGA 1YFKA 2AMYA 3MWGA 3OIYA 1S2OA 4IIEA 2E4AA 2P30A 4UDYX 1SH7A 4X3CA 1O58A 2XUQA 3R75A 3VO9A 3P4UA 3QU4A 4ZIRB 3HYRA 1S4MA 3EBPA 3HVJA 4M9RA 3KKLA 1IATA 2HZ7A 3E82A 2W22A 3NIFB 3EFOB 1VMIA 1ZMXA 2P6OA 3N76A 4WT7A 1LJ8A 1DJOA 1KYYA 1MCZA 1OTXA 3PPXA 2PKCA 3PNOA 4FDTA 4MB2A 5FFFA 1T6XA 2GM9A 1PUXA 3VSCA 6REQB 4C06A 1M2GA 3H65A 5CVCA 3B70A 4L50A 3P9IA 2ACVA 3CWQA 4QSHA 4TL6A 4F3NA 3QVVA 5BW6B 4TRJA 2JJ8A 3FJ1A 3FGZA 2HU2A 5LLDA 4NFSA 3NTRA 1NJFA 3L8FA 4QOIA 3V5NA 4E46A 5C31A 2I9PA 3H2BA 4P36A 4JLSA 3EBOA 3ZDAA 3A58B 1FNMA 1T91A 1KI2A 1XNGA 3DYVA 4K6HA 2NUBA 3N2KA 1J8MF 1YQEA 4IPTA 3IX7A 1HQDA 2JLCA 2G63A 3L8HA 5C8VA 4H59A 4Q4DA 3MWEB 2R6R1 3C3WA 4PIMA 1X1AA 1NXPA 2O8DA 4PX5A 4C21A 5LD2B 1DJMA 5TMDA 1DO0A 2XMSA 2VF2A 1OKKD 1RHKA 3HUEA 1Y4UA 4BNFA 4BV9A 1KR2A 4Q00A 4ESHA 4CKBA 1KYQA 3LUKA 5JZ9A 2WK1A 3R9IA 3V4SA 2H4FA 2PUEA 1PFVA 4TVBA 2OHXA 4FOTA 3H8SA 1NVKA 3E0XA 1A2QA 3SSNA 4B4WA 4BOYA 1RC8A 2ZLBA 3MQ2A 3N05A 5JJCA 3LXRA 4Q34A 1BCSA 5EEGA 3R5HA 3RU7A 3K0SA 2X9LA 1RP7A 3LQRA 2I2XB 3MS2A 4ENTA 3O82A 3S2EA 2TMKA 3GPCA 3VO2A 4AUMA 5K0BA 4ZVTA 4D9GA 2WW8A 4LG1A 4NH0A 2LKCA 1XA3A 3RLFA 4EHKA 2HPVA 3WYBA 5SY4A 2EZTA 3UXEA 2R7NA 1VPVA 2ZPUA 1TUIA 4MITA 1B4DA 2YXPX 5JG7A 2VQFB 4FSXA 5TVGA 3FTDA 3O8NA 1Q22A 3HP1A 2RCNA 3PR2B 4G6ZA 4KODA 1BE6A 4M88A 4RBNA 2ZROA 1IZ0A 3RVKA 3WQSB 3PVCA 4J7CA 5CMLA 2NGRA 1VECA 2XYPA 1U9CA 2RK3A 2Q49A 3EUEA 4ZQFA 4BZWA 3S68A 3G1TA 4WLNA 3W06A 4M54A 5FPSA 4F21A 5COQA 2GPJA 2R7AA 2QLNA 1GZ6A 3K2BA 2CLHB 1SAYA 4YCAA 4L1KA 1NRIA 5DNVA 2B7LA 5CDUA 3MA0A 3UK0A 5ADVA 4QXRA 3NHUA 1AH2A 4BMXA 3Q0EA 2PSHA 4A2PA 2GI4A 4Q3DA 4UVGA 4C2UA 1O5TA 4GVXA 1N4DA 4YAFA 3BFPA 5IKEA 4UNNA 1SBZA 1JEQA 3K0EA 3OOEA 4NYJQ 4PPNA 3WJAA 1Q7BA 5I8PA 1UKYA 5B2ZA 4CMCA 3ZBQA 4KMRA 3F7OA 4U2DA 3U81A 1DX6A 4EFDA 1DTSA 1KKUA 4TTSA 5HUQA 1PZHA 5IZ4A 1MF7A 2H4YA 2GWHA 5A9TA 4HSGA 1QO0A 1ZKMA 1PT6A 2J6HA 4TT3A 4M1YA 1KIMA 3VNBA 4EA8A 1E9RA 2GGSA 5CR9A 2BW0A 4CQLB 3DEAA 2B36A 2XZLA 3FVTA 3GZNB 2PFKA 3L01A 1L5YA 5BOSA 1QAMA 1TB4A 1NV9A 5FBHA 5FI1B 4FT2A 5E7QA 1UJ2A 2DWPA 2V9CA 3QFFA 4OA8A 5CFMA 2XITA 2YRXA 3ET4A 4L4ZA 5GVRA 1YA4A 3NVAA 2IK8A 1KPHA 2GBCA 5A03A 3DE3X 3EQ8A 1QTQA 4M8IA 3U1TA 2IV3A 2ZK7A 3HB7A 4PYNA 1R18A 3BVPA 4EKGA 3DOIA 2GLXA 2D3WA 3OCUA 4L8LA 1KH1A 4GYWA 1XQWA 1YBHA 2QJOA 3VPAA 4BNHA 6AT1A 3BMCA 3BC1A 1BS2A 1VMAA 3DONA 3VAYA 3ZV4A 4EY5A 4ZZ0A 1IMOA 3V33A 2PKXA 1EFUA 1JG6A 4HC4A 1LFDB 5AW6A 2IX9A 1I5RA 3MLAA 4H7IA 2XNHA 4PX9A 3W5SA 4YONB 2WTUA 1TW2A 1ESCA 1UWVA 1L4GA 2CNWD 2RGYA 2VG8A 4Y2UA 3PPIA 4P5DA 4EABA 2ZRKA 5M7EA 2O54A 5AFSA 1GO2A 2YJZA 5AVKA 4EA9A 3G59A 1JVNA 1Q3HA 2PA0A 2V6FA 3BXEA 1VKJA 1E5XA 4G5GA 2FG5A 4KJXA 1E2PA 2BHLA 4U9HS 5BY2A 4I4NA 2XUFA 3JQGA 1LB1B 3NANA 3PEFA 3OJOA 1DC7A 3EDQA 2OFWA 2H8KA 2VJMB 3PRKE 1CZRA 1E0DA 2QLFA 5EUMA 3RYIB 1WBDA 4XPIA 4K6GA 3ZU3A 3OZSA 4HJRA 3KZVA 3RKUA 2PGDA 1YDEA 3A1TA 2G6BA 2DOKA 3B38A 2HJ9A 1BQ3A 2OKGA 2OMEA 3IVMA 3JU3A 1QYCA 4NICA 3QSYA 3ENKA 2W5UA 2VRNA 4BN0A 1E9BA 3DBHB 3JYLA 3JYHA 4OHFA 5IAAA 3VOSA 4OH1A 2CJWA 2QVYX 1U0RA 4LTNA 1QH9A 5JUWA 1O0SA 2IBTA 3COVA 1JGTA 1XCMA 2GASA 2PUJA 1W93A 1J0XO 1ZN7A 2ZU6A 1C30A 3S5JA 5IJ0B 3WQRA 4H08A 3TZ6A 5DIZA 2E6UX 3UMFA 3W4JA 5IC4A 2RE8A 4XLLA 2OZPA 1BWRA 2H9AA 3QWIA 5LZ9A 4M9SA 2ODNA 3UAVA 5IAJA 1KEUA 1T4BA 5JRDS 3T1HB 3C5WP 4IWYA 1GEEA 2QJTA 3U16A 4B8YA 3I8OA 1NPYA 5E3IA 2HR1A 1TD1A 1UINA 4WJKB 1NU8A 3DDCA 3WNQA 3FCUB 4UM9B 1WD7A 1XL1A 2X1VA 2WZDA 3ISTA 1VA4A 3AKDA 3BGOS 3G5MA 4GT1A 4R8VA 4V3CA 3WWEA 3NDBB 1O96A 1E1RD 2J3MA 2AFIB 1XRJA 2FFJA 4KI0A 1J2TA 2VZ0A 1Q83A 1NOJA 4JHXA 3TB4A 4L3WA 4R5MA 3VPSA 1IJFA 3BSSA 1EDOA 5KYXB 4IQ0A 1E4YA 4FXPA 2OO5A 4RELA 5BT8A 3FM9A 5ENDA 1JDVA 1SZDA 1X7GA 2DQZA 3ZU6A 2H1RA 2R8XA 1XMVA 2O5RA 4ZT2A 5DNUA 2EGGA 1Y4DE 3EAFA 2AR7A 4ND1A 3SE0A 2I78A 3QFSA 2ZRMA 4G1MB 1ZFNA 2IYAA 1V47A 2JF0A 4PIPA 3ET5A 1V4BA 1EHIA 4HMQA 3OG9A 1VLZA 2E9SA 1K89A 1HV8A 1RKQA 2R2AA 5CUQA 3TPFA 2PIDA 2W6IA 3PVSA 4P82A 4WW0A 2R7LA 3C98A 3QKRA 3RTAA 4F93B 5J58A 3K70C 1K7YA 2CXTA 5HUJA 2D74A 5T4HA 3S2ZA 3RCBA 3V8PA 2CLMB 4JBXA 421PA 5K01A 3ND8A 3X3HA 1TXGA 4ZVKA 4O4JA 3F4BA 4JODA 4EG4A 4IFBA 1V8DA 5TQVA 1NXQA 3AKEA 2Y93A 4ZDKA 2OMKA 1FNNA 3KZMA 1XVLA 5IJZA 3HKCA 4J03A 4PQFA 2HF2A 1JWLA 2CHGA 3COZA 2YXNA 2OLKA 3ND7A 4Y30A 1DGQA 1MOZA 1WXQA 2ZB3A 2OT3B 1ZJ4A 4BMCA 4CVNA 3BXOA 3QELB 1GNLA 2EJUA 3NBAA 2FTKE 5CU7A 2OAEA 3C4JA 2QRUA 4OJKA 2RHGB 3D4BA 3GT3A 3GBVA 2QXTA 4GM1A 4L02A 5CAEB 1NW9B 1JSRA 1WSWA 3L1IA 4XDGA 4NE2A 4US2R 5HK9A 4IQ8A 1SXJE 2CFCA 3DQPA 4PZDA 1JMYA 5EG5A 2R6JA 3VKFA 1RZUA 3SEFA 3LCCA 2YKGA 2PU5A 1IULA 1P80A 1WULS 3EPLA 1Z7WA 1MB0A 2A5DA 1H8ED 2IXTA 2JFVA 3OZBA 4V0RA 1ZNWA 1PS8A 4MW0A 3BK2A 1FMLA 4D7AA 2OM6A 3QTBA 1KZ1A 4DAEA 2ZRCA 4AJ4A 2BLNA 1OWLA 1USGA 3J80A 3C1UA 3QHPA 1HDGO 3MTQA 1V48A 5FWYB 4YJDA 3D81A 4IS3A 2EG9A 1EI9A 5E6UB 4YRLA 3UH0A 2PMBA 2XCRB 4OI0A 2DPXA 3E2MA 1Y3FE 2M32A 3L0BA 1WXEA 5DLDA 5FI5A 1DU4A 4A2CA 3KCQA 1KJNA 3L1HA 3IUBA 4RA9A 1CD5A 5F1OA 2Z95A 3GMDA 3GBSA 4YPVA 2R6ZA 5DGTA 2ISSD 5F21A 1RPNA 4PNZA 3IPRA 3RHFA 1XZAA 2ARKA 1SUAA 4QJ4A 1N75A 2G4LA 5BQPA 3VDRA 4LDNA 3K0AB 1ENYA 3U4HA 2H2DA 5D3ZA 4AO6A 4IDQA 1XMQB 1YZKA 2BRUA 3TCXB 1SUSA 2Q6IA 4KGXA 2LTAA 1FP7A 4YO7A 2QTWB 4BO9A 1KSJA 3QYPA 2ZQ5A 2HZBA 3S8YA 1DG1G 1WZEA 4XTRA 1LS6A 2BSXA 5K0JA 1XKLA 3T3IA 1LD3A 3PP8A 2FMIA 4MLZA 1JFFA 3HJGA 3FH0A 4WZZA 4F5WA 1NASA 4AO8A 1M1XB 4D8TA 3O4JA 1X86B 1YRLA 3CKYA 5TVKA 4AB1A 4J4HA 4W6ZA 5BMVF 3OCVA 2ACWA 1BEEA 1QUEA 4NK5A 1CRZA 3KQNA 2J6BA 1SVNA 5K8IA 3E9EA 5ALXA 4J1SA 4EVSA 3P0IA 4LVOA 2SKCA 2Y9MB 4GKJB 1DEAA 4EBBA 1OD6A 3ABIA 2Y99A 3EW7A 2YIMA 1PT7A 3R2JA 5AKHA 1J0BA 1F20A 4D4JA 3E9MA 1LBTA 2D1FA 2FPOA 2R65A 3GEIA 3MUNA 4F5YA 3A4TA 1MC5A 5JSZB 2HRBA 4LOHA 2PMCA 4H3VA 3EVFA 2OZLB 3R3ZA 4P4NA 4LF7B 2VC2B 3PEEA 3K5HA 1W73A 4FI3C 2OA0A 1IY9A 4BVGA 5GPBA 3I1IA 721PA 2YWCA 2XCSB 4TMFA 4E4TA 4GI7A 5LB2A 4DLAA 2JD0A 5ALOA 2ISQA 1JDZA 3TLCA 3WGQA 1U8UA 3BXFA 4I1RA 5CJJA 3RRYA 1AN9A 1WMAA 3GA5A 2ROQA 2EBHX 1KMIY 1EJ6A 1PDOA 3GRRA 1ZD1A 3ZWXA 5JXIA 1GNSA 5ABPA 221PA 4MV0A 2GM4A 3WK6A 4GE3A 2C8KA 4RHUA 3AG5A 4KIFA 4OATA 4BGUA 4BE9A 2P4EA 5AVWA 3VNVA 3U4IA 3P2KA 2XTJA 4H31A 4IUYA 4LCBA 2GZ1A 1GXSA 1XLTA 4PBTA 3VR4H 4F4CA 1SQ5A 3AKZA 3AI3A 4FGSA 4QASA 4CI0B 3A3NA 4BNLA 1B1CA 1NDUA 2W43A 4KXQA 2IHTA 3IMEA 4DXDA 3UWKA 1XELA 5FO0A 3CSDA 4P34A 1CP3A 2V0NA 4YHBA 4GMDA 2PBLA 4K9MA 4MCAA 4QEDA 4V1CI 5FTLA 4OP3A 1KOJA 5DLYA 1XMJA 2IU4A 2ET6A 2X77A 4FDUA 4LXQA 5ECDA 5KTTA 1A95A 4G0VA 3DWFA 1PR3A 1BRMA 3L8GA 2E3JA 3ZJVA 3G7NA 3IE1A 2F7SA 1WVMA 3P4XA 1C8LA 1L7QA 3RK1A 1M7GA 1TZBA 3ULKA 3NJRA 1F51E 1DWOA 1M1YA 1F6WA 4JWTA 4U3JB 4UBIA 5DMXA 5HIIA 5JAPA 3I1JA 4DV2B 3W5AA 3V1YA 3O5AA 2J4FA 2O3SA 4OBEA 2P4HX 4UZFA 1J8DA 2ZRLA 3F2VA 4QE3A 1U0TA 3LF1A 2Y0CA 1ZKDA 2Q0SA 4WKOA 1XG5A 3EC1A 3R3WA 3THWB 4YP0A 5EXSA 1E3WA 4OHOA 2BZSA 4P3PA 3R1IA 1OTHA 1TJYA 3ZH9B 1E6KA 1YA8A 3KALA 2CXUA 3CZCA 3DVQX 5I48A 1WU8A 3F6CA 2F1KA 5JRZA 2Z6UA 5EE9A 1EDZA 5C1DA 2X40A 1I7LA 4IIJB 1BYUA 4FFBA 4K9PA 1G6OA 4AX8A 4I3FA 3GRVA 4GOMD 4OSOA 2DUWA 3D6NB 4KDRA 1F3OA 3S28A 3TNLA 4Z3OA 5AO9A 4DDWA 1R9GA 2BELA 4PAWA 3FA2A 1XK7A 2PMDA 4ZYXA 1IOVA 3RYCB 2G67A 2OFXA 1ZNXA 2D0OB 5TS2A 5C46F 1EEXB 5G1PA 2ZPTX 1QORA 3E22A 4XGKA 5LQAA 3DOUA 3GFVA 1JHOA 2X1LA 4RCZA 3REGA 1YB5A 3CB2A 2O0HA 1Z5WA 1L5OA 1TVEA 4NQRA 4B3JA 1GQOA 4W5HA 2IHZA 4MRRA 1GPMA 4M37A 2PZKA 5FBZA 1LPPA 3OT1A 5TS3A 4ISBA 2OXTA 3RFXA 4G1EB 2QTLA 5DWVA 2QBYA 4JSYA 1GQSA 3C7AA 4MWCA 3BGWA 3RQSA 5GZ3A 3S1SA 5DFAA 1JLRA 3LY5A 1IN8A 4HWKA 3AJEA 1Z2NX 2JIDA 4OHPA 2NTNA 4UTRA 2X19A 3V8MA 3ROPA 1VPDA 1ZC4A 4GMGA 3LTEA 4OQYA 3MYYA 5ED0A 1M8JA 2CB9A 4QJBA 1DC8A 5DWDA 5FUMA 5LU9A 3A2NA 4KPEC 1WW2A 1MEEA 3TKYA 4JBWA 5KTNA 2NZ8A 1QC5A 4QUDA 1HDXA 4D9CA 4W5QA 3WKBA 1OU0A 3WA7A 2RC6A 3OCJA 3COSA 2BFMA 5JJLA 3LOQA 3UJ9A 3VBEA 5K0FA 3AR4A 3EHEA 3NC4A 3S27A 4IUCS 1Y1KE 2C2WA 1RQRA 4LJYA 2KW5A 1DRWA 2FVXA 3P9PA 1UDBA 3RFUA 3U9TA 1QG4A 4EIWA 3JAWB 1M7BA 2PBZA 4KPUA 2PBRA 1CUIA 4DHEA 1TF7A 1SEVA 4KE8A 3O3OB 2YUTA 5B1DA 2OP1A 4TSFA 2ISCA 3M3PA 4PZZA 3DKKA 3LRPA 5DMHA 3BWBA 3KBBA 3KUXA 4YMIA 3GP8A 3E3MA 3KE8A 1JQJC 5T6BA 2NN3C 3DVSX 4CF5A 4WXHA 4L5IA 2V6MA 4LC1A 1OFHA 3QWHA 4RD2A 2IODA 1GM5A 4AW9A 1YIDA 4FMDF 5A06A 4MWEA 1R9NA 2WB4A 1Y0BA 1FSFA 1OLSB 4FHEA 4Y2YA 1MRSA 4Q4HB 2IPOA 4YUZA 1AKYA 1KSHA 5AI0A 2OESA 4MO2A 4DPKA 1I4TD 4BATA 2O2IA 4ARVA 3H13A 1EK6A 1PF7E 1QGED 3BXGA 4O4JF 1XTIA 4LZPA 1N1DA 1IEXA 4EELA 5B4UA 3JASB 4HX5A 1E3SA 4IDDA 1RXEA 2IL1A 2VP3A 4RQTA 4FS8A 5IRCD 1QH0A 3H16A 2Q46A 3H0CA 5F73A 1VLQA 1SOWA 3WGMA 4E6EA 4PNHA 3LCMA 4X61A 4BWGA 2ZI9A 4I46A 3NNNA 1MEJA 4PO9A 2YWEA 4WN3A 1GL7A 1T0BA 3K6KA 4LMRA 1IZ7A 2FPLA 4Z1MA 3R7NA 4NSNA 2GAAA 4UTNA 5JI2E 1TF2A 2C2YA 1FP2A 1GQYA 2LKDA 3EAQA 4W1QA 4M86A 3FUUA 2WHRA 2JFHA 3BIWA 5KYWB 4XFKA 5AJHA 3UAOA 4X9XA 4F5ZA 4GM0A 4QUGA 4RLQA 4MQFA 3GV0A 3NBYC 1ADBA 1WPXA 1XDSA 3T9AA 3I3OA 1NQOA 3EMVA 3GZJA 4BASA 1YUBA 1YB7A 3S70A 3V4LA 4U39A 1C1XA 2IEBA 2JI7A 2R97A 3QX7A 3KSAC 2ZBGA 5KEIA 3F46A 1EUDB 4YBRA 3ZDCA 4YMGA 4FGUA 1II0A 5IEBA 5A9SA 1T9CA 5KNDA 2XYQA 3DE4X 1EWRA 3KJNA 3MIZA 3HE3A 3JALA 1A5AB 1FX1A 1Z25A 5G02A 3N7UA 13PKA 3AHHA 2WMNB 1O6FA 2AC7A 4MUJA 4GZ3A 4YCSA 3R8XA 3HJFA 3THOA 1GPLA 2HLPA 2HPAA 3BRWA 2A9JA 2WG0A 2J3QA 4RF4A 4YJKA 2ZIXA 5FXMA 5CA1A 4K9QA 4Z4GA 2O8EA 5AM3A 3AL2A 3GOHA 3PJRA 1R4ZA 2B7CA 3IDAA 3CH6A 2B25A 2QTAA 3CO5A 2A0FA 2CSUA 4IJMA 3SXPA 3EB9A 1ACJA 2W4IA 2PSSA 4MKHA 4OQFA 1NV8A 4XIGS 3A4VA 4MCHA 2JCVA 1E7QA 3GD7A 3IIKA 3VSAA 1PAUA 1U94A 2VYNA 3TW8B 1E64A 1KRHA 1SBNE 1SHZA 1TECE 2H1WA 5TRTA 2LPMA 4JXKA 3EZXA 5JIBA 2B3TA 1OBHA 5KNCH 2BEWB 3T95A 1UL1X 4PYIA 1BEUB 4AX4A 3C1AA 1TA4A 4UBOA 3R7WA 2FEPA 2O20A 3EEBA 2WVGA 4DIKA 4KGDA 1U9JA 4C0HA 1E2MA 1ZVVA 2ZR9A 4G84A 3HJAA 1KJWA 3TQQA 4B80A 2W2OA 3IFSA 1F4PA 1P8JA 3MWLA 1US8B 2ZWVA 3OWXA 4MTCA 4XDHA 4B7XA 3NHYA 2FN9A 3TLMA 1Y8RB 1CB7A 3ORRA 3ECCA 4WNYA 1E5VA 2YIDA 4BQEA 3G49A 1V25A 4WCVA 1WF3A 2RGNC 2FF7A 5C53B 3TYXA 4WOBA 3V8VA 2XE8A 2WPDD 2CHFA 2YW2A 4K26A 4BDSA 5JCOC 3G2JA 3JYPA 1BMDA 4L95C 3CRQA 5JO9A 3SHVA 5DW0A 5TQJA 1H4TA 4RZIA 1V7CA 1SG9A 2YCLA 1NDHA 3QX9A 1EJ0A 4BN4A 1XNRB 2OZEA 3EVAA 1UBKS 3OFND 1CE8A 4D25A 2XMZA 4LCEA 2RAUA 2P90A 2PKQP 2YY5A 3UCEA 4HAZA 3VOBA 5JTUA 1RWMA 4FTWA 1VXOA 3EXHB 1N7JA 4RS3A 4AZ0A 1V1RA 3EEIA 1NBIA 5JWOA 1CQIA 4IXDA 4PBSA 1AA6A 2VUHB 4LGVA 3MHTA 2WJ3A 1OIXA 1Y3HA 2QZ4A 1A04A 3BIXA 2A4MA 3IBFA 4F1KA 3AF3A 4X6XA 5K0TA 2CUZA 2VJPA 1J5PA 1OKKA 3HCWA 4V0MA 3T35A 1E59A 4NRDA 3N8IA 3NC0C 4ER7A 2XQIA 1B15A 3EVCA 5C3UA 2WM8A 2OFOA 3K09C 1BIFA 1RJ9A 2P41A 2QN7A 2Y0DA 2NO7A 3Q12A 4Y18A 1DIRA 1G8JA 1L7OA 3L46A 3R0ZA 2C7GA 4YAIA 3F9IA 3LM8A 5ALHA 2DCMA 5LXTA 5KAPA 2R8PA 3ANSA 4N8SA 2O8VA 3HJRA 4A5SA 2Q4DA 3UCFA 3SBDA 3FSJX 2HREA 1DBQA 1Y7PA 2HQSA 3CXUA 1MBZA 2GJ8A 1IHUA 2NPIA 1CQXA 1WIWA 2EP7A 5JBNA 2XT6A 4CDMA 4GFDA 2G9NA 2JGIA 1YQGA 2ONZA 3W0LB 2A00A 5E6RA 5AKXA 1I01A 2W00A 3PDCA 3G5AA 4QQNA 4WERA 5DKFA 4CTMA 5BUQA 1UZUA 1ZVJA 1V8PA 4CFSA 5L4NA 5HCIA 1ONPA 4PZEA 5C35A 4MQ5A 3X2SA 4EO7A 1QR2A 3G1WA 3N0XA 1C7ZA 4IIHA 3FYTA 4LV6A 4RFSA 3SM9A 4C2TA 4ID3A 3BORA 4IZOA 4ARAA 3ESYA 3IQEA 2A9VA 1WG8A 1KEEB 4MNTA 1GVHA 1HTWA 5A9RA 3HCBA 3PF8A 2ODTX 4BNIA 4G8JA 1KMQA 2YWDA 1J9ZA 1MJGA 1U9YA 3LBFA 3LVRE 5BOVA 5THQA 2CHUA 3RU2A 3L1JA 3RD5A 1S7GA 4J0DA 2FCRA 3KKZA 4W99A 3WLMA 4D57A 2Z6AA 3CNEA 3IUMA 3PRJA 1B42A 4G2NA 4XWKA 2PUDA 4OX9B 3A6PC 1LW6E 4BO5A 1PW5A 1FYFA 2PKRA 2EWMA 4FFRA 4GPTA 1LVUA 2XJ4A 3ND5A 3ZCTA 4RHXA 4KXYA 4YP7A 1LS1A 3HVRA 1U1DA 2Z3WA 1S1CA 5DW3A 2AZDA 4Y2QA 1DZ3A 4PZ9A 4BVHA 1ZD5A 5CBPB 2EKBA 4J0GA 5B5SA 1O5IA 1Y7IA 3TE6A 2OBMA 4GZMA 1ZCZA 4FJ2A 4XJXA 1G66A 3SFVA 5ED4A 2J3JA 2BHNA 1XZCA 3K72B 2JFWA 1KK0A 4NOKA 4CUZA 1FFYA 5D3MB 1U7HA 2VUSA 3JWPA 4G41A 3HJTA 5JY6A 2O14A 5EQJB 2IXGA 4JUDX 5D3QA 1KOGA 4Q4AB 3ELWA 2Y1FA 4MUKA 3OE7D 4UEOA 5GJVC 4LHXA 1G0NA 4RIEA 1G18A 1V43A 2Z8XA 3KG2A 2DQ4A 5D3KA 2XOXA 1WR8A 1K6MA 1XTSA 3DHVA 3HO6A 2NUAA 2C99A 3P9SA 1VL0A 4RANA 1AXEA 2XVAA 3RV3A 2C7RA 4FYXA 2OP0A 1W581 4OREX 1NXWA 1SXJB 3GRPA 5JADA 3ORQA 1QHFA 3D6HA 1E2JA 2QXYA 3IPAA 3KVRA 1VCHA 4KDFA 3NDPA 4LUCA 3RS3A 4M7RA 4TV8B 3LPNA 4IVQA 1ZN2A 3LO5A 3DF9A 4IGIA 3WVNA 4BB0A 3EPHA 1XFDA 3PQ3A 4EENA 3LKBA 4BNJA 5CVVA 5LQCA 1TK2A 4DLVA 4UU1A 3AB8A 4XYGA 4AL4A 3MCTA 3SC3A 3UOWA 3AVQA 2AG1A 4HAXA 4M98A 2GPWA 4MQEA 4CMEA 5L40A 1ZIOA 1TF5A 3MAAC 1GGNA 3FW1A 2IBMA 2MR5A 1XPJA 1YR1A 2EIHA 2NSJA 1QHHA 2QZZA 4MXDA 4F4DA 4ZWNA 2EJCA 2Q1TA 4HWOA 2ZIGA 3N5CA 4LX0A 4MROA 5J9FA 3RABA 1ENOA 2F4VB 3KHSA 3NHFA 3ILSA 4CEIB 3JWJA 3O9MA 4NBKA 1OIWA 1PT8A 4LF6B 4XQ0A 2FMFA 5AD1A 1PSDA 4CG0A 1VBFA 3IKVA 3M6VA 1M0TA 1F9AA 2VZ8A 1N2CA 3MRSA 5IAEA 3OD1A 4RVOA 2OB2A 3IKMB 4N0EA 3WBBA 2PL5A 3H7AA 1L7NA 5I4CA 5B12A 3IEMA 1QH1A 4X7RA 1NF2A 3DE6X 4R40A 3DKPA 1V8OA 2BJHA 2XUPA 4NFHA 5I7AA 4MVJM 3WO0A 2JFUA 4NF2A 4ND5A 4NH4A 2F3QA 3IE0A 4IRMA 4QNNA 4C4SA 3UN1A 1KFKB 3G8CA 2R84A 2JRCA 1J7KA 2ZRPA 1AMNA 3FN4A 4MIEA 4D5GA 3RWOA 1PR9A 2W4MA 3R77A 4I4CA 4DUGD 2H4ZA 1W36C 3QEMA 4PC7A 2WSSD 5FQNA 2F9LA 3K8YA 4E51A 3HM9A 2UYQA 3HACA 5AQEA 3VSDA 4Q9LA 1A9RA 3LL4A 1ZM9A 4QTXA 2PZEA 5H70A 1VSBA 3IQIX 3VTKA 3EVDA 5FNVF 1XVUA 5SZJA 1XXLA 3OJFA 1U7XA 4Y2VA 1C3XA 3U3DA 1F38A 2GESA 3JQ8A 3H5OA 3GLKA 1VYHA 2HBRA 5IT0A 5CH5A 5DB4A 2BBSA 3P9CA 5B64A 4JD5A 2BOVA 4Q9JA 5HIJA 1NUUA 4NOLA 4X1IA 4O4IB 4B6PA 4IIGA 5LL6P 2ZYIA 2AF4C 2P6MA 1QQBA 3IH5A 1XDWA 4B76A 3G6KA 2O7QA 4MEBA 1G4AE 3BM5A 1DV2A 1USWA 5DISB 2QI9C 4AUNA 2FJUA 2JH9A 3KK0A 1P7WA 4RQAA 2H2GA 3NASA 4WHMA 3GNTA 2Z5LA 4WZAA 2VDPB 5J4YA 2HN9A 3D02A 4DMKA 1T3TA 4KNVA 3ZE6A 5JO0A 1C8VB 3A26A 1D1SA 5IKXA 2O3QA 4R2MA 1GPWB 3ZHTA 4OJTA 3BBPA 1IIBA 3OFVA 3IUPA 3RYHA 2RKWA 2ZI6A 1SCQA 2ZWOA 3MF4A 2IS1A 3BRCA 1NNLA 1SCUA 2VATA 2ZS8A 2HOQA 1L4MA 2YICA 2JIBA 3Q40A 1JQAA 2WYWA 1U2GA 4HEHA 1SKYE 4UM5A 4CT5A 4JT9A 1G59A 2V7GA 1WCWA 2RARA 4IJQA 3QW2A 3HRHA 1T0HB 4JR0A 4MW1A 5AVVA 1KDRA 3HG7A 1UMBA 4NNJA 2B92A 5FOUA 5CA1F 1IVYA 4PLTA 1OXBB 4UAUA 3SN6A 2DFKB 1CJCA 1P6XA 2GF0A 3NWPA 1DTWB 1WMFA 3FR7A 3GXBA 1UDRA 3JQAD 2VXOA 4M0CA 4XASA 4DG8A 1C0KA 1QH8B 2IU3A 3AEZA 3DO8A 3PYXA 3ZGYA 4MRMB 2H0QA 4ARIA 3FNGA 1VBMA 5EAIA 3DBOB 1JVBA 4G0XA 1JA1A 1T9KA 1UXGA 3EXFB 1LPNA 3HI4A 4G0OA 4QGFA 1ZW1A 5EJFA 1Q12A 1XYVA 3B13B 3S1AA 2XMGA 4WNCA 3O0TA 4C0LA 2ZT5A 3C5HA 3ITDA 4RDCA 5GTDA 1H2XA 4FX5A 2Q1YA 4NECA 3SS9X 5CIWA 1OU4A 3ROGA 4PWZA 3IAS6 1VFPA 3VR5H 4LYFA 4S2UA 4AYWA 4L0QA 4D9NA 4E13A 1RVDA 2X2OA 5EE1A 4AP6A 1PJRA 5JC8A 3AM3A 4BFTA 4KWIA 4YC7A 3D0OA 2PZFA 5CURA 5H16A 2JGLA 5FWDA 1X7XA 1RWVA 2HM7A 4BWYA 4IEFB 3HSYA 1NU6A 1N5KA 4NBSA 4URYR 4YUWA 2J3IA 1H8EA 3D0QA 5CTJA 4A26A 4YRNA 4X66B 1UJCA 2EJTA 3QK7A 4TXNA 1DOZA 1ZMOA 5CFOA 3TUZC 4LNUB 1U63A 3QA3E 1BG6A 3U44A 2ZB8A 5DM2A 3CLSC 5E2IA 4HQKA 1H05A 4GSYA 4WNIA 3C7DB 5T4FA 4HVAA 3X1MA 1EWTA 1TU3A 2Y2VA 4KQKA 4N5MA 4BX2A 3ZIAD 4DLRA 2OGZA 4G89A 4ZALA 1VKZA 2O8BB 3BL6A 2I2WA 2WF8A 4LMBA 4BEVA 4IJ5A 2NVOA 1EXDA 2C9CA 1QQ5A 3ZYZA 4CIBA 4M55A 5B6JA 2O8NA 3FXAA 3RS5A 3HP7A 4RDIA 1AF4A 2P35A 4RMHA 1NW4A 3VNSA 1IBSA 2HFJA 3SF8B 2IT1A 3BL8A 1QP8A 3HGMA 3MFYA 2PO5A 3D8TA 1CP2A 3E9ZA 2RBEA 4RY2A 2QN8A 4Z86A 1SBTA 1RZ3A 4JC4A 3WAGA 1NAHA 1P74A 3LP8A 3CNHA 1CJMA 3LPLA 2OBLA 1ND6A 2NV0A 4KRYA 4Q7MB 1Y9JA 4YAOA 4NDZA 4H0FA 4ZAFA 1IQUA 1N3BA 1KMNA 3SQNA 3UJAA 2O3UA 2PE5A 3A31A 1NTRA 3VKWA 3EG9B 5LQRA 5C1IA 4IG4A 4V1CA 1FXWA 2B69A 1Y9DA 1G7TA 1JQ5A 1J06A 2HEIA 1QRAA 3OX3A 3UMVA 4AQDA 4DV6B 2VDLB 1YR8A 2P1RA 3FFTA 4WVLA 1YJ8A 3GLTA 2F00A 3QYAA 4CN8A 1CJKC 1USUA 1G8SA 5P21A 4E7PA 5EIXA 1EZ4A 1KORA 2WFMA 3PVZA 3F5QA 4ZC8A 3PNKA 3UHJA 5MN5A 4RULA 2OXEA 3P9KA 1WXFA 2ZRHA 1PW7A 1JHYA 3L1KA 4E3ZA 1ZXLA 1YJXA 4ZVPA 3QHQA 3Q72A 2XTAA 1QNLA 2WJIA 1B6RA 3ROQA 3QRWA 1IWOA 3PC4A 4Z9YA 4WKNA 1QF7A 1Y1QA 1PGQA 4DLNA 1TL7C 3ADKA 4MV4A 2GCOA 1L4NA 4C78A 5JNLA 3J81k 2DM6A 3HCOA 3WP1B 3GRAA 3IP5A 3VA7A 2PT6A 4EI2A 3QVTA 5F9FA 2GLTA 2OORA 1Q2UA 5FHQA 2C88A 5C34B 4YP5A 4J0QA 1X3LA 2ZANA 3KT0A 3EMDA 1B93A 4Y2GA 3RRXA 3WL6A 1BVYF 3Q10A 2CXNA 1BWPA 4KO1S 3IVAA 1WDKA 1B6SA 3R20A 3VPHA 2B1JA 3FNBA 3BX1A 3VYWA 2HL6A 4JUBA 2ECPA 6ABPA 3VO1A 4EHBA 3EDMA 3NEAA 1PFQA 2H18A 5DBIA 4BEBA 5GJCA 3EF3A 4IINA 2EYQA 4PYKA 4OUKX 2G09A 2HY7A 2B6NA 3P0EA 3V42A 2HH9A 2YWBA 3ML1A 2LRHA 4WN9A 3SSMA 4DCOA 1MX1A 1FF9A 1CY6A 1UAYA 2C5BA 1PQ4A 2C98A 2YDXA 3AERB 3A4YA 3F74A 1LCIA 1N7HA 1M2KA 1AXGA 4URXR 1UBGA 4C4RA 1XXHA 3GVIA 3JVEA 4G1CA 1BC5A 1LDMA 3DFFA 2MTBA 3EDRA 4KQ9A 4XEHA 4YAUA 4FZ5A 3I83A 3PE3A 3HCAA 3B1WA 2QW1A 2YBDA 521PA 1U9IC 3A6FA 2M1ZA 4BNTA 2O5EA 3LA6A 4ODIA 2W83A 4Z99A 2EW2A 3I8XA 1QHYA 3TIGA 1GZ4A 3BG5A 1TQ6A 1S6YA 3ENNA 3OC0A 2VLIA 5CCBA 3LD9A 1CVIA 5I7VA 4TS9A 3S2SA 3U17A 1HQKA 1N7IA 1OOEA 1Z5UA 2OZKA 3BFVA 2UZIR 3LLVA 2C9ZA 5LCXA 1JJVA 1RI1A 1WU7A 2OD7A 3NPMA 5UKDA 1QMPA 3REQA 3SC4A 2IQ5A 4RDHA 3IERA 2AFHA 3QI7A 2NZUG 5L3VA 2WWFA 4DQUA 2B2NA 1XRSB 1MH1A 1W49A 5L3QB 5KHLB 4D4HA 3IUNA 4CIWA 1JPVA 2O3RA 3BIJA 1K3TA 1GEGA 3CO0S 3DEYX 1PNQA 4V0QA 4XR4A 5H02A 1XVAA 4Y6SA 5EEHA 4O25A 4KWEA 2OKCA 3QW4B 3KFVA 1BE0A 2X4DA 3P71T 2YRWA 4TKLA 5BSEA 4IYJA 1I6WA 4RHYA 2CEKA 3RRMA 1WLSA 3KXIA 5E9WA 3CEAA 3P1JA 2ZSUA 2QRVA 1KPIA 4GEGA 5HIMA 5BQ3A 1Z4KA 4LTDA 3L9WA 1UBOS 3MMZA 4XYEA 5FEUA 3I9JA 1A98A 4NBUA 5ECYA 3IP6A 3DULA 3WZMA 4D3ZA 1OZ0A 4FYHA 5EC8A 4DMCA 1EU1A 3VU9A 1W76A 3GP3A 1B6GA 3RHSA 2WJYA 1YOVA 4KSCA 1WA5A 1IYZA 3CLKA 4BMVA 2O1WA 5EXXA 4PLYA 3LV8A 1M1YE 3HHEA 1E4OA 3DBLA 4BUZA 3BXZA 1QP7A 1T5BA 1MB2A 2V7QA 3E5HA 3FOZA 1V2GA 2HA6A 5F98A 3NXSA 1EE1A 1Q20A 4JDUA 5DGCA 2VDNB 2XDYA 2PZMA 3T4EA 3WLQA 4PCAA 1X9HA 3S55A 3ZXSA 3HSSA 1LK5A 3NKLA 4KQCA 3RBXA 4QBFA 4BQIA 5KTSA 1T35A 4L7VA 5DBEX 2FPGA 3RS0A 1H8HD 1W88A 5JAZA 5LBUA 3HL4A 5KKCA 3T6KA 3KDSE 1J90A 2QW8A 4FGKA 1TJPB 3ESXA 2F8LA 5DSTA 5J5AA 3JZAA 5KQRA 1K97A 3R9WA 1T36A 4HFNA 4PO3X 4ZANA 3W2GA 5HRUA 3ZOZA 2LGJA 3UMYA 3KOWA 4OGWA 3PA6A 3UT6A 3OZXA 2WUVA 2FZEA 2BHSA 3E15A 4PGHA 2CMFA 3RAGA 1TD9A 3L6EA 1Q0HA 4HTFB 4JP2A 4MS3A 1TIPA 4EB6B 5C51B 3GLIE 3DPUA 3FBWA 3JYNA 2P79A 1RRFA 3NBXX 1E7WA 4HRYA 1U2ZA 2VNIA 1PU2A 3H8WA 3L1UA 2OVFA 3SKVA 3GI1A 5JJKA 2AXQA 3L4EA 3CLTD 1WUYA 1KU0A 4YDHB 2BT4A 5TY0A 4BAZA 2RHOA 3AGQA 1CIVA 1W46A 3PUYA 1FIUA 2REBA 3JAKA 2HUNA 2HYDA 3SBXA 2QHXA 4LVCA 2WEKA 4Q1AA 3U40A 1FC0A 1VBNA 4NULA 2ST1A 4JBGA 4BHTA 3EH1A 4EEXA 1T1EA 1UXOA 5EFOA 3RFTA 2AC4A 3SVTA 2E5LB 1CR1A 2F1RA 4HDSA 3JQCA 3MJVA 1P0FA 3G82C 3UUWA 1T0JB 3FOCA 5AVTA 4DV7B 4TWRA 1A88A 2AV6A 3QA9A 1IUPA 2QR3A 3Q6IA 4XB1A 5EMJA 4URVR 2QX6A 2VYQA 1TQ8A 2JFZA 4OQEA 4R0MA 1DE0A 6LDHA 4QL3A 5E95A 3K09A 5C8YA 2ECFA 1A2OA 1P61B 3LHKA 1JHZA 2YJ6A 4I9UA 2BM0A 2ZUDA 2JFBA 4YREA 4D9JA 2P2NA 1WKBA 3X2EA 4Q05A 5IUJC 2W6CX 2RGGA 2C31A 3UQYS 1FX0B 1U8AA 3F3MA 5BR8B 3KQPA 5K9ZA 4LVNA 3N0VA 1AKEA 1CYDA 1J00A 2WTBA 4AY4A 3TL2A 1F60A 3A4NA 1MJNA 2I1LA 2IYVA 3N2KB 4N18A 1JKJA 2HBZA 4EFLA 3URMA 3SSAA 5AW5A 4DJEC 4DR1B 4G1UC 1PYDA 4M9QA 4A8HA 1KPGA 2O8DB 4UBKA 3KR1A 3G9QA 2OO7A 4TZKA 2WSYB 3DEFA 3INGA 5GM2A 4WX2B 3ZCXA 5L7TA 2R85A 3M4NA 4GIBA 4CKBB 4LWZA 1JHRA 5EPUA 3ADOA 1YA6A 4DCGA 1N78A 4YHHB 4QQRA 4WY5A 3IS3A 3LW8A 2I9KA 2C3UA 1W85B 1ZY2A 4PC3A 3VBCA 4M8LA 3RGWS 1BCSB 2WRZA 1P4GA 4INAA 4L4UA 4LISA 2JEOA 5FOTA 4ECAA 5LMCA 4TL7A 3U7FB 4G37A 1M8KA 1DEHA 2EP5A 4FQ7A 3TD6A 4DMUB 1IQ0A 5AUOB 3M6WA 3EQZA 1YC5A 1GTZA 2OM2A 3BK1A 4Q47A 3ROEA 2GR9A 1N2XA 1MGPA 1V96A 1JW9B 3EEFA 2I62A 2IYUA 3ZWYA 1ZP6A 3BB3A 3PT9A 1LX7A 4U2BA 5DLPA 3ZCUA 1T9BA 1X7ZB 5C7OO 4PPQA 3S8MA 4UFPA 2UYCA 8LDHA 1Z0ZA 3LG2A 4X1OA 3AF1A 3NU1A 2FNAA 1LW7A 3LYAA 2Z9CA 3TOZA 2A3NA 3OHPA 4G4GA 5JV5A 4DMMA 3T99A 4P81A 3RG8A 7MHTA 4EGSA 2Q3EA 1VSVA 2GPBA 5DASA 2Q5JA 3Q7PA 4N4AA 4MINA 1A9XA 2VSOA 4HQLA 4NATA 4TKUB 2HSZA 4L5YA 4UBMA 3NGLA 4S3MA 2ZTLA 3FDZB 3OOYA 4WXMA 1V1JA 1E3JA 2D7DA 3B3QA 4AAYA 3BWVA 4PZCA 1UFOA 2OE2A 3ZHCA 4LCJA 5IUNC 2XDWA 4KLNA 4JBNA 4F5EA 2AI1A 4N48A 1XF1A 2P2CA 3B9BA 4M4SA 1ELOA 1Y5IA 4WMLA 5CTAA 4HMPA 4X92A 4TTRA 3T5PA 1RE1A 3W1EA 5AVQA 3UPDA 1T9ZA 4RTPA 3HEAA 1T4CA 3AWIA 1P7ZA 1Z6ZA 2GN2A 4Y0AA 5CJ2A 4DXHA 1LLFA 1TM5E 1FUKA 1ZJJA 1BHQ1 2VF7A 4GHWA 2XBLA 1NC1A 3O7MA 4UD2A 1I7DA 2ZP1A 1DADA 4WPGA 4RSGA 3RS7A 3CRW1 5LYYA 4ZCMA 4IMJB 4HH3C 4ZQBA 1N34B 2VHEA 2ZWAA 4P2GA 5J2TA 3OFSA 3JATA 3MFQA 3EDYA 2JVIA 3IMFA 3PWSA 7REQA 3EPPA 3QVGA 3A4LA 3DE7X 1R37A 3BMQB 3IXLA 3SM3A 5H82A 3SYMA 1O94D 5C5CA 1M2HA 4BFLA 4RLHA 4KG7A 2BFCA 2QN1A 3Q3CA 4TN5A 3WYNA 1NVEA 3AEKA 1XRRA 3DZHA 5BN4A 4UFNA 1SPBS 4JH0A 3OFNA 2RI1A 3OE4A 4Q9DA 3RASA 4MTLA 5DLEA 2Z8YM 3RO7A 1RVV1 1YR7A 3BMCB 4YJGA 1D6NA 1OYVA 5I6DA 4WSOA 2W2NA 2JH3A 4AJIA 1GG8A 1XT6A 2ZJYA 3U3RA 3IODA 2FLKA 3QLJA 1FFXA 2QW0X 5C4IA 2J5XA 2PLAA 3T9FA 3STTA 4FHGA 2VL7A 4CIAA 1NR7A 1FDIA 1ZN8A 2VCYA 4LAFA 4F3YA 4L6IA 3MTEA 2EWVA 3TRIA 3PWKA 1H2AS 2PFSA 3AR3A 2BDUA 8ATCA 4KE9A 2XKKA 1BQ4A 4UBNA 4Q3KA 4ZI5A 3KYCA 3NHRA 4HXGA 4D9HA 4P4TA 3ZX5A 4M0LA 3SQLA 4DNPA 1SCJA 4C4TA 2ATXA 2Q3LA 1VL8A 3ZV3A 1RHJA 5EHGA 4ZCTA 5BSGA 4U7DA 4WUTA 2C77A 2BFOA 4KQWA 5REQB 4EJ2A 2GJAA 1A2KC 2B0JA 3R4CA 1YS4A 2PVSA 1VIMA 1R0LA 3KLNA 2JI8A 4QREA 3UGTA 5JAMA 2OPBA 5AK5A 1IK4A 2YHUA 3SVLA 3GROA 5ICEA 2CUKA 3I9LA 5H3LA 3UBMA 3M6UA 4QAQA 3IJRA 4V0ME 1F7UA 2NZYA 4P08A 1CR4A 5C8XA 4W8OA 2VWPA 4IO0A 2CL7X 3PHIA 4GWGA 3CKLA 1UP4A 4M83A 3OJLA 1GZVA 2CJWB 1KC3A 4AICA 1CU1A 4LMPA 1COWA 4K28A 2H1LA 3A27A 1TFUA 1IVSA 4PQRA 2GN9A 5IEJA 1SVKA 4PQYA 1P0PA 3TTTA 5L6LB 4KZKA 3QXJA 1ABFA 1HC7A 4RCVA 5J3JA 2JLXA 3ESQA 1EIZA 1Q95A 2NXJA 2GZAA 3A1NA 2C5SA 1LPSA 3VH4A 5I47A 4TYYA 3HCPA 3F6SA 1GUZA 3K5IA 3DPIA 1SKYB 3LFUA 121PA 3AIIA 4BKPA 4KHPB 1LDNA 2ZWIA 4TTVA 4DIEA 1PJAA 3M6MD 1E79D 4XWTA 4JZKA 1KJ8A 2VF5X 4X90A 3RYFB 4AF7A 3T3NA 1UDXA 2ATCA 4ZI7A 5HUHA 3U3KA 3AW9A 4OKNA 3CNOA 2WWGA 3BWMA 4X6LA 3FMGA 2BFWA 2E4UA 1L1RA 4YT2A 1C9DB 1CFZA 3P96A 1VLJA 2CF6A 3X44A 4NE7A 1UBEA 2P2ZA 3TOCA 4NLLA 3T41A 3WK8A 3W5JA 4MGEA 4UDXX 2FZ5A 4HGZA 2PM8A 4PAQA 3H0KA 3IDSA 4X8OA 2ERXA 3PNMA 3I0MA 3LUAA 1ZRMA 4FQ8A 1MC4A 3TIXB 1GITA 1K08A 1RYEA 3OE7A 4G9GA 4WOKA 1YRQA 5FO1A 4EHDA 5BMVA 1VIAA 3ROTA 1F0NA 1HEYA 4J75A 4XRGA 3WV5A 3GJYA 1QNFA 4D4MA 3QKRB 1KTIA 1EFRA 4CTOA 4Y2HA 1SHUX 4HH0A 4B2IA 3K70B 2CLOB 4ME6A 5GZ1A 5ES3A 3ILXA 1D2MA 1UBLS 5K09A 4D9MA 4DCCA 4EYGA 2DY0A 1JZTA 1OJLA 4O4JB 3TLBA 4ENUA 4FILA 4MI1A 4MDYA 3LWZA 3QLTA 4MIYA 2KM1A 3EG5A 1I6KA 4R3NA 3DTYA 2EEZA 3FMVA 4WNAA 4C07A 1N33B 2BEJA 3LKVA 3HYNA 1KXJA 4RVHA 3IBGA 5JASA 2JCSA 4B31A 4BMZA 3KHKA 5BXQC 3K0HA 4AUKA 1GZHB 2D2XA 2WYHA 2CJYA 5L7WA 4JJ4A 3EIQA 1W5BA 3HLTA 3M8KA 3K4QA 1CSEE 4MQ6A 2DHRA 4B48A 1ZH0A 4CLOA 4KIJA 5FBKA 3FWKA 2EU8A 6PFKA 2I4LA 2ZT6A 1FRVA 4XVUA 1JRLA 1HFEL 3FCSB 4A6PA 1T6BY 5AWFC 1VB3A 4K03A 4XA8A 5C8YF 5LOVA 2FK7A 4PGFA 2CNKA 3OQBA 4I08A 3D5QA 1RM5A 1U3WA 3OY2A 3LYUA 3E3OA 3KS9A 1MGOA 1T8TA 1ZD2P 2HLDA 2YRFA 3WYGA 4HG2A 3O9VA 4MUXA 1G9XA 1OA1A 1RMQA 1E2LA 4YAWA 1A4IA 3P2EA 3G2NA 4JP5A 2PUWA 5B2FA 4ED9A 4HZIA 3QOYA 1EHYA 5DHPA 4DIUA 3F7MA 5IMBA 4RA9B 5BV0A 3SZMA 2Y1GA 1KYVA 1NVVR 2AKYA 2Q3DA 5H9WA 1SELA 2O8CA 2AR0A 5B58T 4C0WA 3IPCA 2E18A 3SAJA 2HCJB 1EEHA 4V0OA 1N9ZA 1N2CE 4WDRA 3NWJA 5LP6C 1L3BA 1TMYA 3AIMA 2JAXA 5EIHA 3BREA 2D3TA 3QUQA 3VPGA 2MR6A 1I2CA 2FETA 5EIBC 3DYBA 1DIAA 3HUTA 1WVIA 4TMYA 1RQNA 4MIKA 4RETA 3EA5A 1EDDA 5JD4A 2O2JA 5CLLA 3CUYA 3ICPA 3U37A 4NJOA 4S1OA 2KB0A 5ELXA 2IEZA 4YI3A 1O3YA 2R25B 4OO3A 1ID8A 4JJEA 4MDHA 1IXSB 4JVOA 2BWJA 1LTQA 1S2MA 1RRVA 3LGAA 4HATA 4L2IB 4KBYA 5ARDA 3P52A 1H5NA 1OX5A 2ODWA 2J33A 2W6ZA 2XSZD 2OGWA 4CM1A 5A0FA 3ETGA 3BHNA 4MLDA 4FVTA 1L8OA 1VA5A 3P19A 2VAVA 4ARSA 4WBNA 3PKIA 3KYDA 4RKYA 4JCOA 4L78A 4GS5A 2UKDA 3M5CA 4JXJA 3TIIA 5IMSA 2WU1A 2FG7C 1TFRA 2FP4A 1UPUA 4LTMA 5FPTA 3KLOA 5LBTA 4ZZIA 3T7RA 4ZT4A 2XWJI 3PR3A 3TXXA 3H0EA 3CVYA 1CR2A 4R81A 4I1YA 3QP9A 3T4XA 4M2LA 1Y33E 4C7JA 4NCIA 4ZK6A 2VDVE 4AZVA 1JJIA 3GIDA 1U9IA 1XQ9A 4UEWA 5AOCA 4AJLA 1MFPA 1OPXA 2BFBA 3FDJA 1N32B 2OCGA 5CRIA 4H1WA 4QOSA 1H2RS 1N6NA 4MYHA 4PYOA 4UXHA 2HWYA 1P1HA 3VNRA 2EF0A 3WRVA 4C4XA 2J5QA 3V7FA 2IF0A 4HLUC 1GTL1 2QUHA 2WP8J 4QGSA 1PNOA 3WICA 5JW6A 2VPZA 2HK6A 3KAQA 4F2HA 4ER6A 1VI5A 2WT9A 1XTQA 3C45A 5EMNA 4A0SA 1W4BA 4PXAA 2AG0A 2HCFA 3DDWA 5ARBA 4UVIA 1WCXA 1K1EA 1DS6A 5F3WB 1IB0A 1HE2A 2WLTA 4F60A 1FA9A 5SYAA 1GSHA 1MO5A 1UKZA 2ZETA 3KKOA 2R00C 3KQKA 4DSNA 3GLRA 2JFNA 2IWHA 3RC3A 1I33A 3FB4A 2MWMA 4N41A 2GZ2A 3RSCA 3N74A 4BB5A 4GYYA 4BE4A 4FEAA 1AIPA 3KYBA 4L0CA 4NU8X 1Z75A 4ZHQB 1E4EA 1NYTA 1SKQA 1U04A 5DYTA 4BBJA 2XYHA 3GPIA 5D87A 5DWQA 4F71A 2C5EA 4ALIA 1NP3A 3DMNA 5IKMA 1V3VA 4RHEA 4WKPA 2GD2A 5CEEA 3KB8A 1QCYA 1SU8A 4JSTA 1KO7A 1YMVA 5EP1A 4EHNA 2E4WA 2CNOA 4F1WA 2HA2A 3ZE1B 4ZRMA 1HYQA 5GAJA 1OFVA 5SY6A 1Q44A 2QX8A 1JH9A 1L5HA 4WE3A 3OQNA 2OG1A 3AJAA 1JDBB 2YJ3A 4Q7EA 1TMGE 3KOOA 5AK4A 5EXEA 2QV7A 3S7ZA 2X8JA 4HAOA 4MQUA 1FYXA 3DAGA 3O2JA 3DM5A 3PCTA 1A72A 3UHOA 4AZ3B 4XGNA 3RVBA 4XX0B 2O2XA 3GLGB 1BDJA 5B3JA 3ONEA 1XRPA 3LRTA 2H2IA 3GELA 3PZBA 5E2AA 2JAWA 5THKA 3ZIAA 4DIMA 5BVHA 5LSAA 1KNXA 1NVUQ 2XADA 4GPIB 5EVCA 4LY9A 3FG9A 2BMWA 2NUPB 2GNPA 2VTVA 5IM5A 5F1YA 1Q15A 1JSCA 2OLJA 5JS6A 2EL7A 4P4UA 4YAEA 3ND6A 4ZAWA 1QE0A 1TNDA 1TQDA 4RV9A 2ODEA 2QE7D 4PLFA 4X45A 5I7OA 4LYJA 1PX0A 1SIOA 1QYXA 5ALLA 4PE5B 5HP4A 1Z37A 2A9PA 2QM0A 4RVNA 1JXOA 2AN9A 4CR7A 4O2BA 4QYMA 4E70A 5EKSA 3DE0X 2F17A 2IOFA 4FFBB 4B2LA 4INJA 3ANMA 1J5XA 2ORVA 2F1IA 1RWWA 1WOMA 3I0NA 4DR4B 3X2FA 1ORVA 2ZSBA 2BFDA 8MHTA 1UBJS 1HBJA 1C8BA 2G9RA 2FX2A 2IW3A 1H5UA 1D2GA 3AP3A 1IE3A 3TAXA 4RIFA 4B3MB 3VQTA 3L8MA 1JKMA 1UF9A 3T34A 2FPPA 4GX2A 2G36A 5KX5F 3OT4A 1HNXB 2PUCA 3VYUB 3G23A 4FR0A 3OESA 3AFNA 1VE5A 4JENA 1EUYA 3V9PA 4N65A 1JMKC 2JGFA 1I2ZA 2QBYB 2G28A 2IELA 4U6SA 3WGKA 3IAFA 3DHNA 4D0NA 5LD2C 3ZWBA 2B21A 2IWRA 5HDQA 1R8XA 2Y76A 1Y6GA 3UY4A 4G23A 1TZ2A 3CTMA 4M0UA 5DYWA 5F3RA 3RIXA 5BORA 4NC9A 4YBZA 5JMTA 2NZVG 5KOHA 3PQ7A 1X77A 2NVWA 2XGGA 3ECSA 3K1YA 1E3DA 5BWBA 3ISJA 4QGHA 3H9UA 3OZAA 2QMHA 4S0ZA 2OBBA 3DMGA 5KSPA 2VA9A 1HA3A 1N6PA 3NZEA 2PJDA 1XPUA 1QC5B 3QFTA 3EZ9A 4YY3B 1IUNA 5K0LA 5JJ5A 1QLWA 5BSHA 4LK2A 1BSVA 1XJQA 4YRKA 4I4TA 4CCYA 4K2AA 1T8UA 2FMTA 1MC1A 3MT8A 5EXPA 4ZI7F 3PJFA 1ISFA 1EGQA 3OPYA 4RF3A 3M6AA 4U2CA 4ES6A 2II6A 3OT5A 4BU1A 3HBMA 3KPUA 3CX8A 4PZ0A 4FE7A 5EP3A 5B6IA 3U6BA 5K51A 1IL0A 2P3OA 4WAUA 2X8WA 5HR5A 1BXZA 4Q3OA 5HBGA 5HQ3B 2D0PB 2ZKIA 4Q7KA 5D7BA 3TPCA 4X5OA 2DB3A 4EAAA 4EUNA 3AG6A 4MPTA 3DMHA 3I61A 5KBYA 4OHRA 3D3QA 1RFLA 1LY1A 5FLEX 1N2BA 2XZDA 3UHAA 2ZUEA 1XZ8A 1K8ZB 1U1IA 2YQ5A 2J09A 5TJHA 1GV0A 3INYA 4GI2A 4ENVA 5MHTA 3TLGB 1XNHA 4K81B 2FRDA 1WMEA 4KXNA 1URPA 1UBFA 3AHDA 5DPMA 5AI8A 1G2IA 2NO0A 3EXG1 1XXHE 1ZS9A 1IC6A 2POCA 4DYVA 8AT1A 1II8A 4XUDA 1HDOA 4B2PA 3KTAA 3LQ1A 4PM4A 3SQXA 4TWJA 1MEOA 3MJEA 4NBWA 4S1PA 1IB6A 5JCPA 1KJYA 2V0CA 3WYDA 3TKLA 1U1EA 2AEFA 4QGAA 3WLLA 2I54A 4OB7A 4DMLA 4EGQA 4N1AA 4CL8A 1WXXA 3N8HA 1IMJA 3SGLA 1U0SY 1R5JA 3DMYA 4AYTA 4MMZB 1OGJA 1P17A 5H4GA 3AP2A 4YK7A 4EHLA 1QMGA 1E18A 4MR8A 2BGRA 5JQGF 1V11B 2COEA 2RIPA 3PCXA 3T5AA 2H52A 2HNBA 4KV9A 1OWNA 2AFHE 4J6FA 3K0FA 3N87A 1MAUA 3T5MA 1HZZA 1XX6A 4XSVA 5JNVA 2A29A 1AKQA 4OKIA 1IONA 2PKEA 1Y8AA 3G2LA 2HTEA 2RGXA 4MQFB 3AETB 3H1FA 3ODPA 2EERA 1L7DA 1V3TA 4FGLA 1T3HA 1T5DX 1C1XB 2HA0A 1KTVA 4LDJA 2XMCA 2WNIA 3PL1A 2FDRA 4B2YA 2I33A 5ES4B 3WY9A 5A9SB 3ZHZA 2DU8A 3OZ7A 4PYLA 4B44A 3R40A 2C9DA 2JGKA 3SMVA 4BX9A 1QHSA 3WGNA 5C8ZA 4B3FX 3KVNA 3KD2A 2WYIA 4DWVA 3FTFA 2RCYA 4C4YA 3WIOA 2X3YA 2CLIB 4A2WA 1Q1AA 1DIHA 5FYDA 4YP9A 3ZGOA 2AC2A 1GDDA 1P3Y1 2ZIXB 5CA1B 1NF8A 1P1RA 2VJDA 1VGQA 4TL9A 4NJEA 1KHHA 3D3KA 4OBXA 1I0LA 3O8LA 3PITA 4UDOA 1F17A 3U7HB 4ZC1A 3LP6A 1B2RA 4G0ZA 5JD3A 4E2WA 5BVGB 3GLHE 3SHQA 1E2GA 1R4AA 2BFEA 4C0AC 2Y1DA 2XGSA 2JD2A 4HUJA 1DARA 3IOCA 1DC4A 3BEOA 3MWDB 3WI7A 3OCXA 1PP4A 2ZYGA 4MV6A 3LH5A 4N5DA 4Q15A 1GUYA 2V7PA 1KP9A 2I65A 4TRRA 2AZMA 5LQSA 4UPEA 1DRJA 1Z2PX 2O59A 3T9DA 4OHCA 3HWX1 5B36A 1CQJB 1EE9A 2RI6A 4GMKA 4WBNF 4ABTA 2KLBA 2ZUCA 1IPFA 2IFTA 2WA1A 4JBLA 2HTFA 3OHSX 4KN8A 2X5OA 3NEYA 3TIVA 2JIQA 2R6CA 2JGNA 3H5VA 4EOGA 3O2NA 4XE5A 5BO5A 3I1FA 1NF3A 2P4SA 4DSAA 1CY4A 5LN1A 1F6DA 3A7DA 2WAAA 4MYDA 4R05A 1I3LA 4MKGA 5AIBA 3GUVA 1GL6A 1X1QA 4EDFA 5G0TA 5IK2A 4Q9KA 2DJ5A 4PYRA 1RS0A 2NM0A 5EKUA 4TV9B 1QIJA 5CDGA 5JARA 4G5SA 2I4TA 3CXRA 3SJBA 1PNTA 1NSTA 3EIXA 4XJVA 1JPJA 2J9YB 2CZCA 3QF4B 3SHOA 5M34A 4UATA 2YOFA 2VRBA 1F2TB 1SFRA 2AKAB 4WH0A 4AUEA 5A6SA 3U1BA 5T6MA 1QAOA 2IYFA 4HDOB 1JIVA 2VR1A 1XRLA 2OCIA 2IUEA 3ZWMA 2PH3A 1VXRA 3PHLA 3C3AA 4V02A 4L5CA 3HGQA 2XHEA 1CE8B 1NQWA 1QYVA 1R4NA 1YZNA 4MYRA 1LDYA 3L1VA 1YAHA 1S3GA 3C43A 4Q3AA 4YIKA 1QYIA 2Q9UA 2ZI7A 4E5MA 4YB8A 4H1VA 5IBRA 5BYJA 5JQWA 4AZ0B 2Y2UA 3B85A 4YRTA 1E20A 1GR1A 4KR3A 1L4FA 4LDAA 3IXQA 3SG0A 3MWJA 3JARB 2P75A 2WWHA 4UTVA 4I5IA 1TJ3A 1Z33A 3V8RA 1FMCA 1ORRA 2CC2A 4IJKA 3TTUA 2O5CA 1FDUA 3G7UA 4PVCA 4ZRNA 1Y81A 3QU7A 2D7JA 4G5HA 4CWAA 3O8RA 5AW7A 1SQGA 1VJDA 4NWIA 1DBVO 1TYCA 2LDBA 5HHTA 2O57A 1KZ6A 2E0IA 2L17A 5HS4A 1JZSA 1CZLA 1O95D 1K5HA 1BX1A 4QJ5A 5LXTB 1KARA 2PX3A 1GLNA 1XB2A 4P7GA 5L3SB 5K3BA 5GADl 1GPUA 3FUVA 3WGVA 5JNRA 3GXOA 3UANA 1S8OA 3COJA 2D1YA 4KQHA 5PGMA 5I01A 4JLUA 3G2KA 4IHQA 1AKMA 4LE0A 3ZDXB 3OTIA 3E4DA 5E8JA 1AKNA 5E6RB 1JTEA 2X0IA 3I62A 1THGA 3L0OA 4MI6A 3T94A 1W19A 4EK9A 2ZSAA 3SZGA 3VMFA 4JMPA 4MWOA 1CF4A 1TM1E 4O59O 1G6Q1 5F7XA 3KWMA 1IN5A 3TH5A 1OFUA 3DEZA 2B4QA 1H6BA 3HB0A 4KR0A 1YRAA 5A3VA 1KI3A 4G8BA 1V6AA 3MOSA 2M98A 4BKRA 1SKMA 1Z63A 1NQVA 4R3WA 2JIPA 2DPHA 2DPGA 2QUAA 2V5VA 1NFFA 2HIHA 1VLMA 3P2MA 5CBKA 4DCUA 1EWKA 1XVTA 2P67A 3RC2A 2QY9A 1GA1A 4PPYA 1Y8QA 3WIEA 2PSEA 4D9EA 1LNZA 3E70C 5E4JA 3ELUA 1SGWA 4JFAA 1EDEA 2OGUA 4K0RA 4G26A 1SOUA 1MRZA 4MVJD 4O2BF 2VK8A 4KO8A 3CX6A 3OMXA 3VV3A 3WB1A 4PN7A 4K05A 1B26A 2VRCD 2FZCA 3C6YA 4HLDA 5HF9A 4EG5A 1D9XA 1GAQA 5J59A 3UENA 5CFQA 5JSQA 1HM5A 2GBIA 3A6HA 2OHJA 4FX2A 4MI3A 1M2WA 1XK6A 1FFDA 2EXXA 4WUVA 3ZUPA 4HGRA 5LA6F 2GPSA 3T54A 5KNBA 1XZQA 1YVDA 3JPYA 4K86A 3VTFA 1NGSA 3PA8A 2WJVA 4R2JA 5E4TA 1GFSA 2ZIVB 4K2HA 2KBFA 2O2YA 3CV3A 3DSRA 3IEPA 1KQFA 1V0JA 2GEUA 2Q8NA 2XXBA 4UUOA 2WTMA 1S9DA 1P7CA 5JSUA 3QVXA 2EFDB 3C3JA 1G4HA 3EZ7A 5JDIA 1KAEA 4RD0A 2OQIA 1NE2A 4J0FA 4JGBA 4I9NA 2FSIA 3Q41A 4J49A 2WHPA 4UMVA 2QM7A 2DTXA 3OECA 3FHOA 5J1TB 1J0DA 2M9MA 4YDRA 3QKIA 2GDZA 4Y2RA 1SC3A 1JSLA 2AW5A 3CVOA 2WHXA 3QE3A 1O94A 1ZUD1 2CB0A 4RPLA 3VUFA 3RWBA 3I6QA 2YYYA 3QUAA 3WX0A 1USKA 5KJFA 1PKXA 3MGBA 3LYHA 4RZQA 3EUAA 2Z08A 2PT7A 5EUQB 4JY7A 2DWOA 3DUFA 3ORSA 4I55F 1OXMA 1HPLA 4L22A 2V3VA 1OI3A 1IAVA 4HH4A 3OIFA 4MQEB 2DJIA 5K3FB 4BFXA 3TZKA 3DLTA 3PLNA 5BQFA 1JHMA 4NS4A 4AQ7A 4JLAA 5AI6A 1A77A 1Z4LA 4PFQA 5GJBA 1RAIA 4PYQA 3A4IA 3ZDRA 5J2UB 4M0KA 4CDNA 2XXAB 1DKOA 3HN2A 1K3UB 5LP6A 2R1ZA 4CIDA 1NYRA 3BTUA 3BYZA 4ZOAA 2UXBB 2OR3A 4HQOA 4UNPA 4YP6A 3LUBA 5SY9A 4GRIA 1IXYA 1JJ7A 4BGEA 3VKVA 1G2QA 2WVJA 1N2CB 2I7DA 4DV4B 2IP4A 2B4RO 3Q11A 4DMHA 4NX2A 2YYAA 3EOZA 1JTVA 10MHA 3QPCA 1U02A 3GFSA 5I9BA 1L7AA 2D2VA 1QH1B 4YWJA 2ZJ2A 3FZQA 3FPSA 4LYEA 1P31A 3BEDA 4ZCIA 3OJCA 2VJCA 2W6MA 4ND4A 4ZQGA 4ERNA 4FCVA 4NNOA 4RFLA 2NPOA 2CD9A 2I1VB 1SQFA 2JW5A 4FEYA 2XRFA 4HK4A 3PF9A 1GIAA 2G17A 3FROA 4XJTA 1F2UB 1A71A 1NOIA 3EVZA 5T3UA 4C6TA 4MGKR 4QXOA 1FFAA 1XAIA 4I9HA 4NZOA 3LX6A 4DM3A 3LQFA 4JOCA 3L0IB 4OXIA 4I14A 5DP1A 4CFYA 2QVXX 2MSDB 5EJ7A 1P62B 1TIKA 4PY2A 1WKVA 2QF7A 1I80A 1SA0A 1XWFA 4X8LA 4EL0A 5U9CA 3TLKA 1BWQA 3NVMB 3G2MA 1I4OA 2P4UA 3JQ8B 4PO1A 1YGYA 1S8NA 1SG0A 1TYEB 2KJQA 2J87A 2RGAA 3Q3JB 3KB2A 4JUAA 5CB4A 1P33A 1YQXA 5C0OE 1B43A 1FNBA 2BZ1A 2JPDA 3CUVA 3DT8A 3FPJA 4HLUA 4MS1B 1UC9A 4NV0A 2HGZA 3NM4A 2G9QA 3CRMA 2C2XA 2ES4A 4HLNA 1OREA 4CE6A 1CBUA 1VJ5A 1XLWA 1E79A 4O1MA 4AJ1A 4BLWA 2BDEA 4DT1A 2X0JA 4PG6A 3ZLTA 4WK2B 4AKGA 2PXXA 3R76A 4IHJA 2FF5A 2C7OA 2NT4A 1PRYA 3HS3A 4WZAB 2P2YA 5E1BA 3NT5A 4E1AA 5ALIA 2F9FA 4OYLA 1K7FB 4R3UC 2DERA 4RHFA 2VYCA 2HWUA 3TOVA 4FFLA 2C29D 1ZHHA 4KUGA 3RYHB 1M3SA 3BWDD 3DL0A 5EUBA 2GVDC 1P2BA 2XODA 1SCUB 3PXGA 3VSBA 3AVUA 1O2DA 3LS2A 3LQ2A 4Q3LA 1J5EB 1NT2A 1R4MB 3P9XA 3TLXA 2O4UX 4ISCA 1LVHA 2PHZA 1VJ1A 4FDAA 3OLYA 4QIHA 2HSWA 3AZOA 4W82A 3H5LA 1SXQA 4ZYZA 2LBPA 3ZR4B 5YASA 3DW1X 1MNAA 5DN9A 3RS4A 3UV6A 1GTJ1 4HXYA 1AXRA 2PUTA 4F3KA 3TRJA 3VAAA 4M60A 3ZVMA 4FHCA 4DLYA 1RBQA 3EF1A 4IL5A 1E3TA 3CSUA 3GK3A 5JZOA 1DC3A 1SPXA 4H7EA 3QEAZ 3S1AB 4LJ6A 3MJFA 4BV3A 3AY7A 4BTLA 5EJ9A 2VAWA 1U0JA 3NETA 3DLIA 5D01A 1XQYA 1IOWA 2M6LA 1R9MA 4O4LA 1CHDA 3KEMA 3WMGA 4PHFA 3MB5A 3KUCA 2Q5LA 4ZIRA 3HUUA 1CJSA 2O2GA 4FHFA 3OO0A 4WXRA 4ZOBA 3BRQA 4GQAA 4YCJA 1X7XB 4TYWA 2XAUA 2A0XA 4QLBA 2A94A 1YIOA 4CBVA 3BKWA 4L8YA 1VPTA 4XTCS 3LO8A 4HF7A 4P92A 5ICCA 5M5BA 2MSKA 1ZWKA 3AJ9A 2DULA 4P5PA 1AO0A 1AK2A 4IFIA 3G9XA 1F5SA 3OEHA 4AI6A 2R60A 3H83A 4D4KA 3ZHOA 4LV5B 3EIOA 3G9ZA 4K0KB 4PLVA 5A5DA 3PNSA 4CDRA 1E3IA 3H5AA 1RCUA 3R8FA 2ORIA 2DFNA 2AQIA 4DL9A 1EINA 1AUPA 3AY6A 1RQ7A 1HLDA 1LH0A 5AT1A 4GUDA 1T9DA