2YJ4A

Conformational changes in the catalytic domain of the cpx-atpase copb- b upon nucleotide binding
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
250
structure length
248
Chain Sequence
LSLYEKMLHKGMIIKNSNVYEKIKEIDTIIFNKTGTLTYGTPIVTQFIGDSLSLAYAASVEALSSHPIAKAIVKYAKEQGVKILEVKDFKEISGIGVRGKISDKIIEVKKAENDIAVYINGEPIASFNISDVPRPNLKDYLEKLKNEGLKIIILSGDKEDKVKELSKELNIQEYYSNLSPEDKVRIIEKLKQNGNKVLMIGDGVNDAAALALADVSVAMGNGVDISKNVADIILVSNDIGTLLGLIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational Changes in the Catalytic Domain of the Cpx-ATPase Copb-B Upon Nucleotide Binding
rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
molecule keywords COPPER-TRANSPORTING ATPASE
total genus 74
structure length 248
sequence length 250
chains with identical sequence B
ec nomenclature ec 3.6.1.36: Transferred entry: 7.2.2.19.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2yj4A01
3.40.1110.10 Alpha Beta 3-Layer(aba) Sandwich Calcium-transporting ATPase, cytoplasmic domain N Calcium-transporting ATPase, cytoplasmic domain N 2yj4A02
1WZCA 3L1UA 3AR6A 3UMBA 3OCZA 4UU1A 5AIAA 2WM8A 2HHLA 4Y2PA 3N1UA 1ZD2P 2IA5A 4OHFA 5AI9A 4YCMA 1XP5A 1Y8AA 3NAMA 3AR8A 2HO4A 4YCLA 4G63A 2YMPA 5ALWA 3ZUPA 2B0CA 5AVWA 4NWIA 3QGMA 3SHQA 2X4DA 2YJ4A 3L0YA 3NASA 4L6AA 2I54A 2ZBFA 4UU0A 1U7QA 5ALVA 1SVJA 3EF1A 5AM4A 3UMGA 4ZEWA 3L1VA 4BNDA 1Z4MA 4L57A 2I55A 5AW3A 5E0OA 3ZI4A 1U2SA 2HSZA 3WGUA 3ZVLA 5AICA 5ALFA 3AR5A 2PR7A 5AW5A 4UMVA 3WK8A 4NV0A 5ALUA 3ZU6A 4AS2A 4BNDB 3ZWKA 3M9LA 3GWIA 1L7PA 2YBDA 1TJ4A 5AVYA 2EATA 4HGQA 1ZOLA 3B9BA 5AI0A 4C4TA 3ET5A 3PDWA 5AKEA 3WGVA 3DDHA 5AKGA 4KX5A 2OA0A 2ZBEA 3QUBA 1ZD4A 1NRWA 1YJ5A 4O8CA 5AW8A 4HAIA 2RBKA 3U26A 2C88A 3NRJA 3A1EA 2KMVA 4J03A 5AM2A 5AVXA 4L6CA 2YJ5A 2NYVA 3OCVA 3WK9A 1U2TA 3ESQA 5ALTA 2C9MA 3NIWA 2YMMA 5AK4A 2IOHA 2FUEA 2WF5A 3QUCA 3E58A 3QUTA 3QU5A 4EX6A 2HF7A 3R09A 1S8OA 5AVZA 5AW9A 2HF2A 4Y2RA 5ALSA 1IWOA 4DWOA 1RKVA 4CF5A 1YS9A 5ALEA 1RQNA 4UM5A 3SD7A 2GHQA 2ZBDA 1L7NA 1RPZA 2JARA 4QJBA 1NF2A 1EK1A 1QQ5A 2RAVA 1N8NA 3A1DA 3QXGA 3ESRA 2GHTA 3AR3A 4XQ0A 2Q5EA 5AM5A 1QH9A 3FGOA 4BX2A 1YNSA 4UMDA 3FPSA 4MWOA 3QU4A 4IFTA 1Z4OA 2B8JA 2P9JA 4Y2YA 5ALMA 1AQ6A 4UASA 5ALKA 4I9GA 4AS3A 3U19A 5FP0A 2DQSA 4Y2JA 1MH9A 5AVUA 2ZG6A 4OD0A 2YMQA 4J2TA 5AVSA 1WPGA 3W5CA 4XE5A 2MU1A 2YY6A 2I6XA 3NALA 2WF8A 4UAVA 2I34A 4G9BA 2OM6A 1CQZA 4I9FA 4KYTA 5AK6A 1RDFA 4KX3A 2ZXEA 3PCTA 3KD3A 3I76A 3J7TA 4QQFA 3F9RA 5AK3A 2G07A 4EZEA 4Y2TA 2R8ZA 2WF6A 3L8GA 3CNHA 4BYGA 3WKAA 4Y2UA 3WKBA 2A29A 2QYHA 3P96A 3OPXA 5JJBA 2A00A 2FEAA 4C4RA 4JB3A 1RMQA 4DFDA 4AP9A 5AI6A 1KYTA 4EX7A 4Y2XA 5AW2A 4KNVA 3VAYA 2PQ0A 3ZX5A 1Q3IA 2G0AA 3KDPA 3SMVA 3BA6A 4BKMA 1L7OA 3SF0A 4Y2QA 2HEGA 3GYGA 4F72A 1RKUA 4UAUA 3MMZA 2B1QA 2W11A 4KN8A 3R4CA 4MUMA 1RLMA 4HGNA 3IRUA 1QYIA 3AR2A 2CFTA 2FPSA 3ONNA 3QU9A 3NANA 2IOFA 2QLTA 3N07A 4GXTA 3DAOA 1WR8A 2EAUA 2AMYA 3FPBA 3L0BA 3AR9A 1Z5GA 3FM9A 1O08A 4HGPA 4IG4A 3WKCA 3DNPA 1J8DA 1XVIA 2YJ3A 5AW6A 3OCUA 2NO4A 3FZQA 1Z4IA 5ALDA 3L8HA 5ALHA 4EEKA 2FI1A 1RMTA 4HGRA 2GO7A 5AI4A 3OTQA 4XPZA 1PW5A 3I1YA 1RC8A 3RF6A 1JUDA 4UM7A 1QQ6A 1RMYA 1ZRNA 2IOFK 2MSNA 4NAVA 1L6RA 2FDRA 3S6JA 2RB5A 5AESA 4BBJA 2AUTA 1Z4JA 1MO7A 2P27A 3W5DA 1F5SA 5ALLA 3AR7A 2YMLA 3K1ZA 2WHEA 4UMFA 1TE2A 5AI8A 3RFUA 1MO8A 3HLTA 3ZX4A 3ZTYA 5ALJA 2GMWA 4YIHA 1RQLA 3HYCA 4BX3A 5AW7A 2W43A 3QNMA 1U7PA 2VKQA 3NUQA 3L8EA 4NABA 4F71A 3QYPA 5AKLA 5AKHA 4FFDA 4E88A 2FPWA 2G09A 5A3SA 1YMQA 3DV9A 2JGAA 3WKEA 2C8KA 4BEVA 4HGOA 2I33A 1LTQA 3OCXA 4DW8A 2KMXA 2HCFA 1ZJJA 5ALRA 3QX7A 3ZTWA 2WF9A 4EELA 4HYTA 5ALPA 3KZXA 1T9ZA 1L7MA 3B8EA 2P11A 2B82A 3N8GA 2BDUA 1Z4QA 2Q4RA 2C8LA 1U7OA 3L8FA 3I28A 3KC2A 5T41A 3ZVMA 2G08A 4BX0A 3EWIA 5ALXA 3IJ5A 3N28A 2PKEA 2ODAA 2HDOA 3OCYA 5IT0A 5AHXA 2ZOSA 3R9KA 3M1YA 1X42A 2OYCA 3L5KA 3U7HB 1L8OA 4FYPA 3B9RA 2R8XA 5AM1A 2C4NA 2Q4TA 2RARA 3ZW7A 5AW1A 2EARA 1RLTA 3IB6A 1YV9A 1T5TA 2GFHA 1VJRA 3U7EB 2WFAA 2NO5A 2YN4A 2JAUA 3L7YA 5A3RA 1SWVA 5AKXA 3KBBA 4Y2VA 1O03A 3MN1A 4JDPA 4GIBA 2AGVA 1ZS9A 3MC1A 1RRCA 2CFRA 2B30A 5AM0A 5ALNA 4NFLA 4H1WA 2G1AA 4RETA 4RESA 5AW0A 3FVVA 5AKZA 1ZRMA 2O9JA 5ALZA 1FEZA 2ARFA 1WVIA 5ALGA 1XPJA 3ZVNA 1TJ5A 3WKDA 4YCNA 2AH5A 2HOQA 1S2OA 1NNLA 2HI0A 5ALQA 2FPXA 1Q91A 2JAOA 1VJ5A 3UM9A 3A1CA 3QU7A 3PGVA 4Y2SA 5AI5A 3N5KA 3CZ4A 1Z5UA 1VFPA 1Q92A 1Z4LA 1Z4KA 4YGYA 1EK2A 4UMEA 2CFSA 2P69A 2BDEA 3E8MA 3SLRA 3W5BA 5IT4A 3WK4A 2G06A 5ALOA 5AVQA 4BEWA 3ED5A 4KNWA 3ET4A 4PNHA 5AKKA 5AVRA 1SWWA 3E84A 4OCZA 3U13A 5AM3A 1U02A 2I7DA 2R8YA 2G80A 1J97A 1TA0A 2BY4A 3OCWA 3EPRA 4EENA 4FE3A 1L8LA 2B8EA 2WF7A 4UARA 2JAWA 4Y3UA 1T5SA 5AKJA 3L0CA 3E81A 2IYEA 4ZEXA 3WK7A 1K1EA 5AIBA 5A3QA 3EF0A 2ZBGA 3KOOA 4OFZA 3PGLA 2FUCA 3MPOA 2FPRA 2D2VA 3WK5A 5AVVA 1ZD5A 5IS2A 2B1RA 5AVTA 3U7GA 3I6BA 4CE6A 1Z4PX 3SKXA 4C4SA 5ALYA 1SU4A 2YJ6A 3QLEA 4UW9A 1RLOA 5AKIA 2YFYA 1YDFA 3ZWDA 1Z4NA 3UMCA 5ALIA 4DCCA 4ZEVA 2OBBA 3U7FB 1Z88A 1CR6A 1ZD3A 3A3YA 2CN1A 2FPUA 4YIKA 5AKYA 1QQ7A 3QU2A 3BWVA 2HX1A 4XOUA 3SKYA 1LVHA 1N9KA 2O2XA 4YH1A 4B6JA 3D6JA 3QUQA 3W5AA 2W4MA 1TJ3A 2R8EA 4UATA 3AR4A 5AW4A 4CF3A 3TLMA 1RKQA 4CF4A 5AK5A 4CNQA 3WK6A
chains in the Genus database with same CATH superfamily
1WZCA 3H13A 4GLFA 2A9JA 3TXAA 4P4GA 3MHTA 3AR6A 1ID8A 2QM0A 2DBZA 5DCYA 2IEGA 2ZYWX 3IILA 1G8GA 4KMRA 4LHEA 5JISA 4H7KA 1NYTA 2P41A 3R0IA 4ZAXA 5DT9A 4ZOLB 1SBNE 1HMYA 1IHXA 4DHWA 2CSXA 1WTAA 1UFQA 1QH1A 4WADA 4KH0A 4X8HA 3LOPA 4BQNA 2HBYA 1F6DA 2PRJA 4CKCA 1DAFA 5C5EA 1U3GA 2B4QA 3CLTD 4D9JA 4LV6A 3G6WA 4OHZA 1X7DA 3RJZA 1CX9B 4OX9B 4IR7A 4MA4A 3Q7SA 3LIIA 2ZUFA 3HKCA 2J7KA 1E66A 3M3PA 4V0NA 4KXFB 5A06A 5K3EA 4C14A 2FWNA 1S2NA 4IHQA 2CXNA 3AXSA 3KALA 4X60A 3ZWOA 1OZGA 3OZWA 4C7JA 3E5NA 1FB5A 3VPAA 2Y05A 4C7MA 4FU0A 1CP3A 4B7UA 1UKAA 3D8TA 3IQEA 2K4MA 1KZ9A 1MX9A 1NDUA 3MELA 4S1WA 1PBNA 4ZCQA 4G8JA 3U37A 4TL6A 3B82A 4BBPA 5JV5A 2NT3A 2I55A 4KRYA 3ZY2A 1VYHA 2NXNA 3DPIA 3GJXC 4XR9A 3JARB 4IEFB 1EJ0A 4J2OA 2NQTA 2YV2A 4M8KA 1DC6A 4R9NA 4RX1A 4UUBA 4J4HA 3AR5A 2JBWA 3GCXA 1P2TA 3REQA 3RS4A 2WA1A 1EUDB 4OFWA 5LP6F 2WT4A 1G21A 4NV0A 4BNDB 2VDMB 2E55A 4G1UC 2AXQA 5GQSA 3TL3A 3TSCA 2NXWA 2ZIXA 3OIFA 1QDLB 1W0KD 1YAJA 3JZDA 1NW4A 4IFIA 1IONA 3VSDA 1JN0A 3H17A 2C4VA 4CTJA 3IKLA 3Q3VA 3ZVRA 4YREA 2WTXA 2PX8A 3IPAA 1CJTC 1TM5E 3PWKA 4A0RA 2ZB3A 4D0RA 1U3DA 1QFYA 1CR4A 4OOEA 1F1BA 3HCEA 4LGVA 3PJFA 4MIYA 5C8YA 5TARA 5B6PA 4QX6A 4ZPXA 2OGWA 3CVUA 4XUGB 2Y1LA 3DOFA 4LZPA 4XCXA 3A3OA 3JVIA 1GT6A 1XAJA 4OHUA 1FK8A 3VKVA 3L0DA 1F6WA 2PXAA 4KV9A 1G63A 1JXMA 2OZLA 3SCZA 1VJDA 2I2XB 1Z82A 2NNWB 4YP9A 4F5DA 5G4KB 1M7HA 2F48A 2ORED 1YKGA 3BFKA 3F6SA 2OY0A 5D1NA 5E8JA 2F43B 5EKUA 5B53A 4HWPA 2PX3A 3ZJ4A 4EIWA 5C4GB 3PFKA 5LC1A 3VU0A 4F9FA 3P2EA 4RS3A 3QK7A 5K0JA 4F6RA 5LQMA 4OIMA 4XB1A 5ALTA 1DKPA 2VK2A 2YHAA 2HIAA 4D43A 3NIWA 2QXYA 3JAWA 3EZYA 4EQ6A 1BSVA 3WO0A 2UZ4A 3G8DA 2ZJ5A 4ZT6A 2QQFA 4D96A 2I7XA 2QUJA 2PH1A 2ZTHA 2EJWA 3WX0A 4CCYB 4CM1A 1PNRA 2HF7A 1UXOA 2PLWA 3C15C 1PG2A 1UZNA 2DPHA 5D6NA 1T2CA 2HF2A 2J07A 5AOBA 3RSSA 3KYBA 1ZJYA 4GOND 3TD2A 1LVUA 3UV3A 1H1TA 1RKVA 1ESEA 1F8UA 1ZHFA 4RZUA 4A03A 1CC1S 4EK9A 2BEKA 1CB0A 4BNMA 1RWKA 3A6JA 2ZYSA 3OESA 1Z2PX 4QUIA 5BR7A 1JQ5A 1NF2A 3E9EA 1VP9A 5HOEA 1ESMA 2PX4A 3VZQA 3P4YA 2VWGA 3BS4A 3WZMA 5HKKA 3KOMA 3PC6A 4ACBA 3R5SA 4G09A 5ISMA 3G9XA 4OMCA 1V8OA 1LDGA 4L72A 4X6UA 2ZVJA 3M3DA 3WB0A 5THXA 3E7DA 2CL0X 3O2SB 1E2EA 3HCDA 4IFTA 3VSEA 1A97A 4Y2YA 4D0LB 4LKOA 2XTJA 1C14A 1R5BA 1YI0A 5C52B 3NVDA 1KGSA 2OZKA 4G8BA 4EPYA 3PPYA 3WBJA 1EEHA 1XN1A 2FNAA 2J32A 2O8BA 5GIPE 4ETMA 3OIGA 4LRUA 3OQBA 2CV2A 2EL7A 3OPMA 3KVNA 4UUOA 1XRRA 3H4MA 4IOMA 3GW8A 2ZG6A 1E7YA 2BP7A 2WJJA 1MQ8B 5I8ZA 4AMUA 2YYAA 1VSQA 4O5OA 3SJZA 3SSOA 2MU1A 3C39A 1JPNA 5E2AA 5C34B 1MNQA 2DQZA 5K7SA 3TGLA 4PZUA 4XX0A 3CRW1 1QOZA 3EIHA 3ZDZB 2CE2X 2OM6A 1X9GA 4RDHA 4B71A 2XCOA 4G65A 1DEXA 3F2IA 3DAHA 1TIKA 1GPUA 3ORRA 1QE3A 3PCTA 2EFGA 3F4BA 1GNSA 2W8BA 4HUJA 2XCLA 4ENSA 3T5PA 5KQLA 4RFVA 1E99A 1N2GA 4M1ZA 4QQFA 1L7XA 1VMIA 5AK3A 5F77A 1T5BA 1TC2A 1X7XA 3O1IC 4TVSA 4YO7A 2DKFA 2XI4A 3BHJA 1GU7A 4HDKA 2EEPA 4EB6B 2CNWD 2GNOA 3KOYA 1PT8A 1L7DA 1XRJA 2P5YA 3BJMA 5E1MA 3FAKA 2DM6A 3NIGB 1NSYA 1U2EA 4XGQA 3NC1C 3RRYA 1KSJA 4MIEA 5AUNB 5FFFA 5ABPA 4OAOA 3FCSB 1CVRA 1PR1A 4RJKA 4QVIA 1Y1TA 3ETJA 4DR3B 2BMEA 3Q87B 4EX7A 1FJGB 1KU0A 1BA3A 3VAYA 2VNSA 2G0AA 2Z2IA 4IW3B 4DM4A 3Q11A 2BKVA 4X94A 3QVOA 1FMTA 2Q5HA 4JXXA 1GL9B 1RJGA 2ZBQA 1AGYA 3I2YX 1O1YA 2NVOA 4MR7A 2A58A 3EGXA 4Q3CA 2PGJA 1I0LA 4WA7A 1AF7A 1I4TD 2KMLA 3Q3HA 4FNAA 4KQGA 4RVUA 2NPOA 3R20A 4Z7QB 5TS2A 1IIRA 3B7WA 2VHVA 5BSFA 2XRZA 1IL0A 2JIMA 3CH5A 4YMLA 1S2DA 1U5AA 1O77A 4D41A 4LHSA 1W36D 2ZUTA 4JI4B 3GDOA 2CF6A 1ZNYA 2G8LA 4M1QA 4EHLA 5LXTF 4FR2A 3KYCB 1QS0A 1MPTA 1Z5GA 3VR3A 3Q3CA 2BW0A 1I14A 2LKCA 4FP9A 5AJUA 3O74A 5GVSA 2O54A 4KSCA 1J8QA 5G0VA 2DTDA 3ND8A 2LKDA 3AF3A 2NVWA 2E5WA 2REOA 2WVGA 2B92A 1PQPA 5HBGA 1TO6A 4D80A 3K6SA 3PUYA 4AULA 1RLJA 1EVLA 4IX9A 1PAUA 1Q50A 5K0FA 4RCYA 1Z7EA 3QUSA 2XSZD 1TADA 1KTVA 1U2PA 3HEAA 3DCNA 4RHEA 2MMGA 2FWPA 3K20A 4FT2A 3HM9A 1H8EA 1H2WA 1ESZA 4FOLA 2NG1A 4LXYA 4RCZA 1LV7A 3H4IA 4M9UA 4YT5A 5EA2A 7REQB 2CD9A 6ADHA 3X1WA 4V3BA 5LPNA 2Q8PA 3KPVA 1E6WA 1W8DA 1AURA 1K75A 2INGX 1XCJA 1X0XA 3DL7A 4UHJA 5CGZA 5LP6B 1E9FA 1N5JA 3R3HA 3E0XA 3D0RA 3GP3A 3C8HA 4ZYVA 4BNLA 4N3BA 2DERA 1VIAA 4ZCMA 5AJXA 4B4KA 3RTGA 2GD0A 2XYHA 3QQPA 4BL5A 4X1IA 2SBTA 4DLAA 4FE4A 4MUGA 5BNIA 1WA5A 1WSWA 4IQ0A 1V7QA 2R6GA 2X5KO 1PWZA 5BRJA 4IDBA 1ZNXA 2AHOA 3IP9A 1DXHA 2FRVA 2H4WA 1PTKA 3W3AH 1NW8A 5JYCA 3SHTA 1MN6A 3KWLA 4PFSA 1U3VA 3CX7A 2C4KA 5DLDA 2UYCA 3L4EA 3TTWA 4TV8B 4R40A 4PC1A 4YMIA 4PZZA 3U3DA 4YAKA 2NX2A 1U80A 1TEZA 3KRTA 1WPXA 1D6MA 4MLDA 2ZITA 3ROPA 4HDMB 3A0UA 5GONF 1BMQA 3N2KB 4JQSA 4W6QA 5I4KA 2V97A 1GRQA 2JIOA 4DLRA 1Z6PA 3AG5A 2G40A 1IHUA 3WKEA 2GEDA 3I6MA 1W29A 3GDWA 3HCAA 4OK3A 1HY3A 3SX0A 5IC4A 2XZLA 4MOWA 4IIHA 3VO1A 3NVAA 4E7PA 3U44B 3ON5A 4JP8A 4AZVA 3OCJA 1CHNA 3H8JA 5H81A 3ZD8A 4E30A 2X5OA 4RVNA 4URYR 3ZK7A 1ZVVA 4X97A 5JSQA 1Q84A 1Y4ZA 3LA6A 3B6IA 1L5SA 3KELA 3W9UA 5K0TA 4ALJA 1LSSA 1J0EA 2YY5A 3D1LA 3IQFA 4HTFB 4XM1A 2A5GA 1ZR2A 2BGTA 3LF2A 3NS7A 4Q48A 2NXCA 4U00A 3ZN2A 3QVXA 4YVFA 3WY9A 4YMVA 3UPUA 4C0HA 4FOTA 2EGHA 4U02A 4GR9A 5EHGA 2XE6A 1NF9A 4XIIA 5IG2A 1U7WA 4AN0A 1NUPA 1LNQA 1ZUHA 3V3TA 4N5HX 5EIWA 4M1WA 1P8JA 4N01A 1QIDA 2ZPAA 1K06A 2II6A 3TF5A 2LV8A 2F90A 3LP8A 2LZ0A 2R6JA 4B3CA 4RTRA 3KSRA 5D51S 2EGGA 3TKLA 1L9KA 2JIDA 3AP1A 1GQYA 3OSUA 3WP0A 3UWPA 4WJLA 2VAXA 1UJCA 1RZVA 3CONA 3EEIA 2XJ9A 3OOYA 1X1TA 3PJEA 5FTKA 4POOA 3TQQA 4LFAB 5AM1A 4MQ5A 1PS0A 4BGEA 1TYDE 1UXIA 2VRBA 4HXFB 3D7NA 1ST3A 4C7XA 3NWPA 1K2VN 5EERA 1E2FA 1QMPA 1DBVO 3EXIB 5IJ0A 1CUAA 2ZM6B 5IXJA 3OFJA 2QJFA 1ZM7A 3P8ZA 3M6XA 2EIHA 4TROA 2JAQA 2JGRA 4C08A 1II8A 1NZDA 1RBYA 1HLGA 1YHZA 2HV9A 4YRCA 1L5LA 1KXJA 1NBAA 3COVA 4CM7A 4IGIA 4QA9A 4IX1A 3IVGA 4HAVA 4JR1A 2VHTA 4F45A 1UKCA 1F17A 3E3OA 5DNUA 4PAQA 1MGPA 2R8PA 2R6DA 1UIRA 1QCCA 2V9ZA 2UVDA 1V37A 3M4ZA 3KT8A 5AM0A 5F7ZA 1KQNA 4UXHA 1ONNA 1UBNA 5EUQB 3VU8A 4YUXA 1TK2A 1LGYA 1K7FB 1BHSA 1LNSA 1T8WA 1TL7C 3D4PA 4OQYA 1ZRSA 4X84A 3L82B 3PPVA 1JG1A 4HUTA 3S8EA 2Q5JA 4GOLD 2ZE5A 2ETXA 2C9YA 1R9MA 2IV3A 1RE0A 4JT2A 3E5MA 3PGKA 5J2UB 1H4VB 2HRCA 2CCKA 3QPBA 5HZMA 4YCNA 1D04A 4I4CA 1GG5A 2HOQA 3D31A 1S2OA 1R7RA 1W96A 3FWPA 4Q5IA 4OY3A 4DLKA 4KN5A 4YB8A 1GCGA 3GLTA 3VHRA 1EZ1A 1VHQA 1XU9A 4L9AA 1E9SA 1KQOA 4PNPA 1U0HC 1RHKA 1NE7A 2OKCA 2W0SA 1MOZA 4H08A 1X9IA 3IUQA 4PG7A 1N25A 2G04A 3FCYA 3OOSA 1WRBA 3BKWA 1VDZA 4JB0A 1XC7A 2AR0A 3GJQA 3G59A 3CZ4A 3HE3A 5IJZA 5BQ3A 1JVBA 1N2BA 3PFCA 4KR7A 1WDTA 4D6XA 3ANTA 4CM3A 2WQ6A 3ZIAD 5HIKA 3AVVA 2OWDA 2KHZA 1LF0A 1VSUA 1KK3A 4HYQA 1LLFA 2OYSA 2W2OA 4QUDA 4A10A 4C4AA 2QJTA 5IT4A 3AL0C 3T41A 2RHBA 4B3IA 3IQDB 1W88B 2DFPA 4D92A 3F3SA 4OA8A 2NZYA 4L4UA 5JHHB 1SXJA 2ZR9A 4RY8A 5D1HA 3SG0A 1S01A 1NVTA 5GP1A 4B32A 5FOUA 4EVQA 4KO3S 4F2PA 1J99A 1DKNA 1LI5A 1MAHA 1ULZA 3PWSA 1VMAA 5H4HA 2CW5A 4UFPA 4FQ8A 4QVKA 3WYAA 3G2OA 1JFTA 3N05A 1J7KA 1IAVA 1BCSA 2P4UA 4UEQA 2A7QA 4AWAA 1LBEA 2Z2KA 3G5LA 1MFZA 1NT2A 4JL5A 4BIMA 2H4XA 5DBOA 3GMDA 4RTPA 3E6AA 3COJA 2BFMA 1IPEA 4L4ZA 2OLJA 3DNMA 2BGIA 4CLRB 4PGGA 3MOGA 1JU4A 4X1IB 3AW9A 1FU7A 5HQ3B 1HZZA 2D0DA 2LDXA 3LX6A 5JLAA 4C0QC 1XOIA 1DO8A 4JZYA 1YVRA 2C2OA 2GK4A 4IJUA 4HX2A 4K3VA 5A3VA 3EIFA 1H3FA 1B1AA 1IPFA 1SNYA 2IOYA 4F1WA 4YPOA 1ZD5A 3NHPA 5AVTA 2RMKA 3DMYA 5CAEA 2AW3A 3LX8A 1Z4PX 5DOZA 2H29A 2JFOA 3TNYA 4BNZA 1Z7YA 1V95A 1XVUA 3MCTA 3ZV3A 3A0RB 3FPHA 2D1TA 4Q15A 4ZVTA 1JXOA 1ZL2A 4OQMA 2UZ0A 5HF8A 2IKQA 3KDAA 3Q5GA 4MKXA 1A1SA 1N7HA 1MJFA 1DL5A 3IH5A 3NHLA 1X94A 3ENQA 4O4LA 4CLEA 2QORA 5L7TA 4N6GA 1G8FA 2X7XA 1DAHA 4KYIB 5C37A 2A4KA 4OQPA 2AG0A 2DBYA 1CR6A 3QEMB 5AKYA 2IEAA 4RTKA 2FPGA 1LBTA 5J5CA 4IVQA 1MVLA 1LVHA 1RYFA 4LC9A 3LOUA 2R60A 3RIEA 4WDRA 1IN7A 3OC0A 1VE5A 4FDLA 16PKA 4GC9A 3LF1A 1SHTX 3AVWA 1GIAA 1Y7PA 3PQ3A 3WIDA 5KNBD 3OHSX 3PTAA 4CNQA 1QRUA 2QLLA 1K4MA 5JDCA 1WABA 4Z9XA 3EOZA 3V5NA 1OAAA 1NXSA 3NBXX 3OCZA 4W1QA 4UU1A 5AIAA 3UC5A 4MVJA 1R0SA 3HDQA 2R47A 1GHTA 1AO3A 4ODIA 2ALJA 4TSFD 4OHFA 3OUUA 4PQYA 3JAKA 2AV6A 2PWBA 4QUKA 1R5JA 5JZSA 1FY2A 4PRLA 1ISGA 2J9FB 4P5EA 3QFCA 3JYOA 4KDFA 3J7AC 3PZRA 2OCDA 3BMCB 1T3HA 1ZJ6A 3EJ6A 4QELA 4YC7A 1FVOA 4FN4A 1ZPDA 4EO4A 1OH5A 4Z1MA 4WBNA 4KACA 1FW8A 1PHPA 3KAKA 1TZ2A 4IICA 3OZXA 3S5UA 4AROA 4XIYA 3DFUA 2G9ZA 2Y66A 1O95A 1SBIA 1U7UA 1IAQA 4JJKA 2HMVA 1JQAA 4BJHB 5B4VA 2HSGA 4K2AA 1F9AA 1EAMA 2I2CA 5CYOA 1USIA 2YXPX 1K8ZB 3K8ZA 3PHHA 4D0GA 5GONA 1M1YB 3HXPA 4D9GA 1BU8A 3JQGB 4D74A 2IYZA 4V1CI 4EY6A 2RFLA 1A9SA 2RCYA 3K15A 4FHFA 4F9TA 4P32A 2R6AA 1UH5A 2QM7A 3ZGYA 4D7AA 1VMDA 5BVHB 4WZBE 1GPYA 1LI4A 1L5RA 1G5RA 2MINA 3H9CA 4Q03A 3FI0A 3AEYA 4TWZA 4POAA 2GETA 3AKZA 4A1OA 4ZYLA 4FFRA 2XDWA 5HVNA 3NR2A 1PR2A 2OCAA 1QB7A 1U99A 2QEQA 4UTXA 2PA0A 2DGDA 3RC9A 3SQMA 1Q16A 3FNFA 1NR5A 3TVYA 5EHXA 3OZFA 2R3SA 3IMKA 4IVPA 4XX0B 4CMEA 3QF4A 2MR5A 3ORSA 2F2TA 3N7AA 3DAYA 4KXWA 1LS6A 1L4FA 1ESCA 1KK2A 1FBTA 1RAGA 4LWOA 5ESDA 1JBEA 1JMKC 1FUIA 3EGDB 4GKAA 4UCWA 5AKEA 2CNDA 1L4KA 3BD6A 3C3BA 2GAJA 4IFBA 3RVMA 2AZMA 4GUAA 3SZMA 1YJ8A 3H2IA 1VC2A 2SCUA 1YRHA 2AYZA 4YK7A 2R6CA 1UBTS 2B1IA 3EUEA 1OAOC 1C1HA 4WBSA 4ZZ2A 2ZJBA 4O6VA 5B3KA 1FFGA 4BVEA 1VGQA 3R7SA 3GF4A 4NJMA 2XUZA 5EHNA 3ZE1B 3PQ6A 2AMJA 1QANA 4G0NA 1FFSA 4KZPA 2IT1A 1VMEA 2BHNA 2JJ1A 5CCDA 4F11A 5KVQA 5LIRA 1N9GA 3V8NA 4PC2A 3TKYA 3L02A 2YRWA 1M2KA 3QVLA 4ZAZA 1DLJA 1DX6A 2CMDA 1M34B 4NPAA 3ZZ1A 1ML4A 1WHSB 4IQ8A 2E21A 4JIMA 2FR8A 1LXCA 1ZC4A 5FLKA 3TQSA 3FFBA 3PLNA 4JLOA 4JD5A 4UPVA 2VYNA 3KQKA 1O5IA 5A4JA 1KQGA 1CJMA 5F2OA 1SVWA 2JGDA 3S8MA 1DKOA 4EUSA 2LR0A 3AU9A 1LX7A 2ZQ5A 2OC4A 1R8XA 2PSHA 2A2ZA 4UM5A 1L4NA 2AFIB 3NHAA 3UB4A 2RJOA 3AM4A 3TQRA 4CUJA 1MW9X 3UUGA 4AMZA 1RM4A 3F6BX 2NUAB 4CZ2A 3W2TA 1ZAKA 3AR3A 1JIIA 3P9RA 4UTOA 1Q5PA 3R6WA 4KJXA 5JNLA 1XDSA 1NMSA 4OA5A 3LX5A 4KSBA 4AY3A 4CV3A 3JZFA 1M2HA 2AC4A 2ZAGA 3U7RA 5JC8A 3OEHA 3AHIA 3O5AA 5DI9A 3RKUA 1AQ6A 3IVCA 1CE8B 2QTRA 3VPFA 4AKTA 5KYTA 3TFWA 4LFBB 1NY5A 4CR6A 4ECAA 4YRJA 3HH8A 4F4IA 3TGWA 5IYZB 2IITA 5CXXA 3T3MB 2H57A 1DC3A 1YVDA 3AESA 5CLFA 1FUEA 3BXXA 5E2IA 1L5OA 4CEJA 1W6RA 4H6WA 4IIJA 4OL0A 5J59A 3T7IA 2YV4A 4GGMX 3L8DA 4KFSA 4MCAA 3U16A 1E5XA 1U3UA 3ICVA 4EHKA 3KQUA 4PPYA 2CE7A 4GOMD 4EHDA 2GVZC 4UDNA 3HJRA 1CKEA 5DCUA 3ELUA 4BNTA 1PGOA 2Q3EA 3PE6A 2QXUA 4TXHA 2ZULA 3JWEA 5CTAA 3OI7A 1YTUA 1ECCA 1ULTA 4KIGA 4Q12A 2Y2UA 3I32A 2X2OA 4ME6A 3HM2A 4A1FA 1RDFA 4MGKR 2PUGA 2XB6A 1I2BA 1MG0A 2XMDA 3N86A 3THOA 2I5PO 1N5OX 5L6LB 5C80A 3LKBA 4E5MA 4JI6B 2VTBA 2C9BA 2V74B 3PCXA 4HY3A 1YWGO 5BSUA 5L3ZA 1ZEMA 1QBGA 2Q9CA 3EPJA 4KREA 3AVTA 1GTL1 5TDHA 3SXUB 1L7EA 1EBBA 3GMSA 5IH3A 4HEQA 1SCJA 2O2ZA 3FYDA 3PHJA 4H1UA 3GLGE 1XROA 4TKUB 4J0DA 3H16A 4EG5A 3QWHA 1QV7A 1T9GR 1D7AA 1FVXA 2BVNA 3PPIA 4KQKA 4UEWA 3NRCA 4OP1A 1YZFA 2PO7A 4E6PA 4DYDA 2X1MA 1DBSA 2FWIA 2JA1A 4K86A 3U31A 4OBEA 1KK1A 1FZTA 1UWCA 1I2CA 2IUEA 2P4SA 2RKWA 2RHTA 4WACA 4Y2QA 1Q2UA 1J5EB 3HBAA 3OT1B 2P1ZA 5CDTA 5J43A 2ZKIA 4F72A 2HCTA 3UJ7A 3PKZA 4UAUA 1FDVA 1DB3A 2HV8A 2XUJA 1W0KA 2OXTA 1EINA 2MSCB 5KNLA 3KJQA 3C2QA 1UP6A 3IV9A 1JH9A 2O8FB 2G5TA 5CDSA 1EE9A 4YCSA 1I6MA 2VVTA 5A5VA 1DCMA 1ZMTA 1UXJA 1UPXA 2QTWB 2EAUA 2X9LA 2CXUA 3DAOA 2LGJA 4R9RA 2GHRA 3HBJA 4IJQA 4E94A 1OXMA 4NK5A 5GJCA 4EO7A 1SU8A 1NR7A 1XVIA 5EMJA 4R1UA 2B1JA 1FA9A 2I2BA 1XEWY 2GPWA 2WRZA 3L43A 3H6GA 2N1MA 2ZS8A 3L0IB 4Q9DA 4R7GA 5ALHA 2CYBA 3MIZA 1DOZA 4MQMA 4MQ4A 4NBKA 1BDIA 1ACJA 1AK1A 1GSHA 4KN9S 5LYYA 1HQDA 3G23A 3PXUA 4LWZA 2OILA 4NZPA 3HCCA 3I1YA 1NAIA 1QYDA 1ZUD1 4PXAA 1XE3A 2PT5A 3RF6A 1NXPA 3I72A 4C2TA 1ZRNA 4MKHA 5A6SB 4X85A 4EW1A 3OMLA 4CKBB 1M8PA 3DUFB 4LVUA 4N48A 1I3CA 1I1OA 3TIGA 1VL1A 3WMRA 4RZSA 5DTQA 2ZAOA 4V02A 4WXYB 4CLXA 5BMVA 2BV3A 4CKWA 1CQIA 1G7TA 2IW1A 2BKXA 1MO7A 4WNYA 1KDVA 2Z3WA 5JPCA 1D4FA 3EF3A 4Z4GA 3ESCA 5FIUA 2VF5X 4M4SA 1NXXA 2Y4NA 3NWOA 3TS1A 1C0PA 4FEGA 3DDOA 1EXVA 4C78A 2BI8A 4WE3A 4JJ8A 4AMVA 1GKYA 1T5LA 2I7VA 3EA4A 3F9CA 3NTQA 1AGRA 3OLZA 5FUYA 4NIMA 1KZHA 4MQUA 4EZIA 4A0FA 4U5QA 1ENPA 3E35A 3HBLA 3PDHA 3RU9A 3VO2A 1XA3A 4BASA 8ABPA 5LCXA 4GM1A 3ETGA 2PMKA 3DMNA 4UOEA 4EHAA 3LOQA 5BN1A 2R11A 2G9UA 4HFJA 4MW6A 2OVBA 4KAAA 421PA 5GZ1A 2LWIA 2VK8A 1Z28A 5TIIA 2DWUA 1UODA 1QV6A 2PGAA 4FFDA 3JQCA 2QM3A 2EKPA 2FPWA 5JXWA 1I3NA 2O0LA 3T8YA 2WW8A 4OB8A 1RM3A 4JLSA 5LN1A 3T7AA 2E5LB 1A4IA 5DYYA 1ABBA 2P9QA 4KGZA 5TGZA 2ZS7A 2ZUWA 3B9PA 4LXUA 4N5NA 1QVAA 3QLVA 3U5ZB 3IR5A 1GUBA 4JEMA 4LHYA 1T5DX 2HY7A 4TTRA 3CO5A 4JJIA 2EW1A 1JDBB 2H1IA 1J00A 4J3NA 3TLBA 1XKTA 2VDPB 2DPLA 1GPDG 1CUJA 1JZQA 1RBMA 2PUVA 4NG5A 4MQFA 5EL0A 4OHYA 4L7QA 9ATCA 1II0A 2A92A 5FPKA 3CY6A 4WZAE 4LVCA 1L7MA 2YIJA 5C5DA 3F78A 1C4XA 1N7JA 3EEYA 3HGQA 4HL6A 2IPOA 4J0EA 1U9JA 3GNSA 1DX9A 1JHOA 3W7BA 3O0DA 5JFTA 4O02B 1Z37A 3OPNA 4DRZA 4FFWA 5IYZA 1Y9AA 4KKXB 4FFPA 1MZVA 4F84A 2HT6A 1D2AA 3AOEA 3EWSA 3KQHA 4JQCA 3HLKA 4MV6A 1B8UA 1E3WB 3QTLA 1GL6A 4HZIA 5HCIA 3IIMA 3R9KA 5JCXA 1N3IA 3KPWA 3QE3A 1RRPA 3WYNA 4ASUA 5IABA 1LH0A 1NOJA 5E3JA 4JI0B 2HW8A 3CF2A 1T1JA 2R8XA 4KHZA 5WRFA 2DWCA 1NW6A 1XJWA 4ER6A 4XIFA 3RRBA 5IYZF 3C43A 4L02A 1OFIA 3ZGLA 1QYXA 3GHHA 5AOCA 4CTOA 5FOQA 4W99A 3SYRA 1SVSA 1G8KA 4PGMA 5JT1A 1I5RA 1UKBA 3O73A 1XCPA 1QKIA 4GT1A 2DSNA 1RI2A 5CM9C 1QQBA 3DV0B 4ND4A 1DEAA 4PG5A 1GZHB 2G8NA 2P9BA 2BM1A 3KK0A 1HDOA 1JU9A 2R44A 2XR1A 2Q9UA 4NCKA 4B4OA 5I3CA 4DIKA 1T36A 1TQDA 2KQUA 1F4LA 3K96A 4I8DA 4ZCLA 1V48A 4CIVA 4DCGA 2YBEA 4HS9A 1PL8A 2O57A 1S5PA 2YN0A 1JYSA 3IUBA 1GUAA 1C9JA 4CKEA 4IS3A 4HWSA 3R8XA 1WCYA 3DOIA 4FS8A 1YZYA 1HL3A 3WFJA 1A8IA 2C5BA 3P0EA 3DLBA 3HXTA 5D5PA 2OV2A 4HVAA 5AW0A 5AKZA 1EZ4A 2O9JA 4F8EA 5MN6A 1QHYA 4DRXB 5DK6A 3CX3A 4JSTA 2FN8A 1VE3A 1I2MA 3ZQJA 3C8UA 4ZK6A 4Q34A 2P3OA 1CBUA 5FPPA 5A1TA 1JSZA 5IT9A 3ZVNA 1E2BA 3OLCX 4CLOB 2V6JA 4NH4A 3UJAA 1JHAA 1TIPA 1YULA 1VJ1A 2ZUSA 4X90A 3RARA 5JZ9A 1KORA 1SULA 1J33A 1RQXA 2YWRA 4FZVA 5ALQA 5GGXA 3QPVA 5GJWC 2NUTA 2BFBB 6Q21A 3HNPA 2Z2YA 3SIPA 4X1YB 4UHFA 4E7OA 5HGJA 1L5HB 2XYQA 4E3WA 1E64A 1FNMA 3NBAA 3QWBA 5LZ5A 2WSYB 4WLOA 3TDMA 4U6QA 1TF5A 4EUFA 4YHBA 2F6RA 3UPTA 1KDOA 1A5SB 3LYLA 3N5KA 3KVYA 4URUR 4WOPA 3P5BA 5FF9A 3ZI7A 4CMIA 1E0KA 4B4WA 1USUA 1EHIA 1FP6A 3PA8A 3T7TA 1UPAA 3SM3A 2BGGA 5DHAA 4ENPA 2ISQA 3I9JA 2YJTD 1ZK1A 3NIFB 3QW2A 5ALOA 2XE7A 3FNHA 2VJMB 5ICMA 3GBSA 4H3SA 3AKCA 4I9HA 2JEZA 4J16A 4DLNA 5D01A 3K6SB 1NZFA 2V4MA 2FWBA 5CH8A 3SC4A 5IM4A 3RAGA 2VIIA 3T7JA 3WL7A 1BVYF 1TJYA 2E18A 3OOJA 1R6TA 3S1AB 4UDXX 1IN8A 3IDAA 3HCBA 2D2FA 3Q41A 2YXEA 1L7VC 1XALA 3T1VA 4ZCPA 2X4GA 4GWKA 5LBIA 2WUGA 3A14A 3ANSA 4JHXA 1FOEB 4TL8A 3V55A 4J7XA 1SVNA 1RAEA 2CK3A 5C1IA 6YASA 5HP4A 3WDSA 1EQUA 4PBSA 1BS2A 1M76A 1RXCA 2WIJA 1IOWA 1X1QA 3JVUA 4MDYA 3T5AA 1TO1E 1T0UA 5GINE 1ANKA 3BMCA 3OZEA 1FSZA 4BU0A 4MR7B 3GJ7A 2LBPA 4HDSB 3BICA 1FFBA 3NONA 4XYGA 1JDZA 2BFCA 4H3VA 3T34A 4MR8A 9ABPA 3VU1A 4X24A 2O0HA 2V3VA 3A9UA 3MGAA 2FUNB 1RT9A 4D99A 1EEXB 4RZ2A 5J4HA 2QB5A 5KYUA 4D9MA 4GKKB 5LQKA 5DCLA 4GKBA 2V7GA 4C0SA 4RPKA 1BE6A 3H3XA 5ICSA 2AZDA 5AKIA 1A9PA 3MTGA 5DMXA 1FX0A 1X2BA 3T52A 1L4EA 4DCCA 4LW8A 2DRIA 1W52X 2OBBA 4U7FA 2YHSA 1V0JA 2H16A 2H1HA 3FA2A 3EIWA 2CN1A 1WZEA 1QG0A 4HWRA 4N41A 2JD2A 1C1DA 3JQ6A 3QU2A 4JXKA 4IGFA 2PMWB 4ZP1A 4YMGA 1TU0A 4WK0B 1QKJA 3P2YA 3G85A 2FW7A 4IXMA 3GLHA 2Z4RA 1MJGM 4IUCS 7ADHA 3EVDA 4ND2A 1OHHD 3UWOA 2JAXA 4RHFA 5HMMA 3DXFA 2UUOA 3LY9A 4ZVPA 5DLPA 2AC2A 1KBZA 3PHLA 4E5YA 4JXJA 3I3OA 1JJ7A 4I4TB 4S1VA 1YFLA 4UBJA 1A5ZA 2H31A 3W78A 2ZIVB 4R8MA 2VPIA 3VAAA 2XNSA 3FLAA 3NIDB 3ONEA 4LY6A 4YCMA 2GCEA 2VBFA 3NAMA 3AR8A 4L0QA 3OETA 1EB9A 4OH7A 1KH2A 4RGVA 1H9AA 4LOAA 4N18A 1ZCZA 1VKRA 4EWLA 2HA4A 1JKJB 2HF8A 3ESBA 3PCRB 1Z3IX 5TVKA 3RYHA 1GRRA 1EK0A 2C2HA 4LKRA 3E8SA 3HTXA 1PVDA 5H3LA 3MWKA 2R85A 3H5NA 2RGGA 1YZUA 4UJ3A 4TRMA 2HA3A 2VJPA 4EG6A 3L0YA 3NASA 3ZBPA 5I4CA 3I39X 1GQSA 1CR1A 2TMDA 2VJCA 3GAFA 4NONA 4PN7A 2DUUA 1SIOA 1FS6A 3H1BA 1C30B 1LRLA 1M1YA 1VSBA 1SZPA 2ZBFA 1B42A 1V4NA 3VVCA 2Q41A 1H0KA 2RK4A 3RYCA 3LHDA 1YQ9A 1TFUA 1UWKA 4Q9IA 2PX6A 3IAFA 3NG1A 3T0GA 1WKBA 3KOZA 2BGRA 2HJWA 2WTMA 1YOVB 3QKRA 3QP9A 3TW6A 4F1JA 1JR2A 3P0HA 1T5IA 4KDRA 1ZDMA 2APJA 2VK1A 1P7WA 2IE0A 3ORFA 4FFSA 3CEPB 2ZK7A 3V80A 2EFDB 4JODA 3UV6A 4CMJA 1CTQA 4DCUA 5CB4B 1NHWA 2K6GA 3G9UA 3NUZA 1FNNA 1JH8A 4FE7A 4O4HF 4U9HS 1AMUA 2BUCA 4XQGA 3LT0A 2XQFA 3JS5A 1R5NA 1EFKA 1FDSA 3BIOA 3CRVA 1XG5A 2IIQA 5HS6A 1L7PA 4KMOA 5HUHA 2C7QA 1RYEA 4KFTA 4QU5A 2R7NA 3QVGB 1F0KA 2FZLA 2PIAA 1XZEA 3IR6A 4NCIA 5HKLA 4B3DA 1JGTA 3QY0A 2ID8A 4CL0A 2BBTA 2IS2A 3N8DA 3QXHA 1VHJA 4EKEA 1NL3A 5BO5A 1VB3A 4Q1VA 4DIFA 2JKYA 4GVPA 1KU6A 5HX7A 4UULA 5LOVB 4G0VA 3AETA 1TCCA 3GU3A 4PZDA 1JTFA 3A06A 1FP2A 3DSRA 1XZAA 4NYJQ 2EKBA 3RC7A 4WCFB 1K68A 2B2NA 1E2PA 3OZBA 2BJWA 4JK3A 3U1BA 4F3CA 2OO7A 1WB6A 2WAYA 3DE4X 3KZCA 4YRDA 4EFDA 2PZFA 1WW2A 4O2BF 5BN4B 1W76A 1Y1LA 3SE7A 3PUZA 2ZRHA 1YZQA 4CUKA 4EYOA 2VR1A 2JFXA 3T7CA 1FYFA 4V2UA 2ACEA 4TTIA 1U2TA 2FKNA 1THZA 3RAFC 1M75A 1X14A 3IAEA 4IXNA 1OB2A 4H0FA 4NFYA 1SURA 2VYND 2VYVA 3L4SO 1A4RA 1CP2A 5JIBA 1MAUA 4AWXA 4XSGA 3FTDA 1NOIA 4JNCA 3AT1A 5JSZA 1KBOA 2G67A 2BE9A 4DG8A 1FFEA 3D8NA 5C1BA 2H48A 2X2FA 3P2IA 3REQB 2JS7A 3M83A 3OMWA 4PFJA 5EC8A 1RYBA 1II8B 1N8SA 2Z1NA 1IHOA 1RQNA 1Z5VA 2IC5A 2WHYA 2O3RA 5E9AA 4DIEA 3EXIA 3JWJA 1GKIA 5IULC 3Q6NA 5TGDA 3W5JA 3MT7A 4H18A 3PA6A 5ARDA 2LCFA 5AM5A 3CBQA 4BFCA 4C4OA 1AUOA 1V9CA 4UHKA 1N5LA 1FU8A 3WQQA 5F21A 2JZNA 3PL1A 4G07A 2F64A 2NYAA 5FHQA 2D7CA 4WMLA 1GTVA 3HCNA 3QMWA 4I9GA 1WSDA 2WU0A 1CS0A 4UPDA 4HXYA 4ZAGA 1J1UA 4PSCA 3HKEB 1YVPA 1OT5A 1RRVA 2AJTA 1Z5WA 1BEEA 5I7OA 1XWWA 3STYA 4AP6A 3FOZA 1MEOA 4P4TA 4D5EA 1F3LA 2H7XA 1JHPA 1MH1A 3LPMA 4PGFA 1EWQA 1GCIA 4FW9A 2VDWA 5B2FA 1WF6A 3RWBA 1IEXA 3C6YA 5F7OA 4HEJA 1KSGA 2BM9A 3LQKA 3PJGA 4HAYA 1R3DA 2CLSA 3FPGA 1T3LA 1M2VA 1DC4A 1T91A 2QMOA 3JQ8B 4YLGA 1VI5A 1KO7A 3CA8A 1XNRB 5EIBD 3I6ZA 3QJYA 1AN0A 1U5BA 3ZHCA 3BMQA 1Q1GA 3DYBA 2AX3A 3QG1A 4UTZA 2R5NA 3LO5A 5DM1A 1EUYA 3AI7A 4DV2B 3UAZA 4O29A 1UDBA 4I9UA 3M5PA 3GRUA 1SCBA 4JP3A 1P62B 3B8HA 721PA 2R8ZA 1HPLA 3E1GA 1USWA 4DBLC 1U9ZA 1KARA 3MAGA 1SGWA 1RRCA 1FUKA 1KZ6A 3OPYA 3MD9A 1CF4A 2FZKA 2GNPA 4E4YA 2NAPA 3PC2A 2IYWA 3PNYA 4OH1A 2VT7A 3GK3A 3G9TA 1ZH0A 4F1KA 2B2XA 3BF8A 2BI7A 4BUJA 1OXSC 4UEKA 2B83A 4FXPA 1I2AA 2Z1MA 3G2KA 1QE0A 5K99A 2WZBA 5HWSA 2YUTA 4L27A 3TRDA 3E3MA 2W2VA 1PF7E 3I9FA 4OKNA 1UT5A 3FPLA 1Z6AA 1UINA 3AEQB 3GELA 5BNWA 4JJ7A 4QARA 4CIWA 5EKDA 1ODIA 3N0VA 1Y1SA 4F2GA 4YV7A 1E2MA 1XQ9A 4X9XA 1SUEA 4NQZA 4XLLA 1PFGA 1SKUA 4NYMR 3ZE6A 5K03A 1S1CA 2ZSUA 5A03A 4BLPA 2XB4A 4EI2A 1EWVA 3R7AA 3ZLTA 2OZVA 4EUKA 3NBFA 4PYRA 3Q3JB 5JARA 1T3ZA 2FSVC 4JHLA 4WECA 3WIUA 3D4LA 1TYCA 3AK4A 3PE4A 1GGJA 4AJLA 1AIPA 1WR8A 4AO6A 5JCPA 4BE9A 2A5DA 3RB8A 4IOKA 2WNHA 1BCRB 3IERA 2FMTA 4UUPA 2OLEA 5BSWA 2YJ3A 3L6RA 3L8CA 4WFQA 3PFWO 4YA6A 1XQXA 2NO4A 3ENWA 4QL3A 3BMNA 2ZXFA 3NDJA 3UO8B 1HUQA 1V47A 4YP5A 4LY9A 2C4WA 4IF4A 3GJ5A 4L0DA 3IHLA 3OFSA 1P3JA 2OV4A 3FB1A 1VI2A 1SXQA 5EPEA 1N6LA 2I99A 3Q1KA 3W5IA 3IKTA 4K40A 2AOUB 2YJZA 4WN9B 1S2GA 2WY2D 1Q3TA 4CFZA 2WG0A 1GSIA 2DFKB 2QGNA 1INLA 4NAVA 2PDAA 4FC7A 2PSDA 3A9RA 4NBRA 2Y9PB 4M6WB 4Y9UA 1B0ZA 1VGRA 1J2JA 2AXPA 2DTEA 4R1TA 5DRYA 5H0IA 4CM8A 3RNLA 4TOIA 3ADCA 3EGXB 1ZKMA 1A8SA 2L19A 3DR5A 3RUHA 1X7WA 1HI9A 1CIJA 2C3OA 3NORA 2RBEA 1AV6A 1B26A 2C94A 2HREA 1TVKB 1F5SA 1UJNA 4IYJA 3K1ZA 5CDUA 4DLZA 2R7LA 2BELA 3KR0A 2SKDA 1H8HA 3HCPA 3OFKA 3I09A 3RS8A 1BDHA 4PLWA 1PT9A 1KI8A 3TMKA 5K45A 1C7JA 4BWVA 1JA1A 2XA9A 1B1CA 1SUPA 4PONA 4RIGA 1Q22A 1S7CA 4MPPA 4CKWB 3HLTA 5E38A 1BYIA 2BCGY 3AVOA 4M9ZA 4UXJA 4MVJP 1OFTA 2FX2A 4UTPA 5H3CA 4BX3A 2IS6A 5AW7A 5EIEA 2B3TA 1IUPA 4DQVA 4WKNA 1DBRA 1VCHA 2BCEA 4LCBA 4RIFA 4CM5A 2GRAA 3FDIA 3H2KA 4QGFA 1N1EA 3EZ2A 5TX7A 4RYDA 1QP7A 5HE9A 4DB4A 2NVUA 1EX9A 4OHWA 4JJFA 2WWFA 1Y1KE 5CT6A 6PFKA 1EFTA 3Q9LA 1GN9A 5AHKA 2C84A 1YJCA 1DIRA 4CRWB 1RJ9B 3PQFA 4TX1A 1NULA 2E89A 1XO1A 2ONJA 2JGAA 3AINA 3I58A 3SS7X 5BN3A 1EWTA 3GGOA 3L0SA 2ZB2A 3ZWKA 2XE8A 2FMFA 1HKHA 1GZ5A 3QX7A 3GT0A 3QE9Y 1WTCA 3ZHQA 5HRCA 4MEAA 2BMVA 2XHEA 4RVHA 1FTYA 1N5KA 3G5UA 2WSSA 5FI3A 3TLGA 3USES 5L8VA 1VKHA 1U65A 1SXJD 1KJWA 2IYVA 2UVPB 4G5QA 1KAOA 4X0EA 1DEHA 3VKWA 3A2KA 4KL8S 2QT9A 2PMBA 3PYMA 5F64A 4DV5B 3EFHA 4EBBA 1Z4QA 2AOTA 3AEKA 3KPYA 3NAQA 3E2IA 4INAA 4Q6WA 2G9NA 5FLXA 4OHXA 2QR5A 2O8BB 3JSAA 2NXEA 2WHQA 4N82A 4HQ6A 4EJSA 3PLAE 1JIJA 3H65A 2ZIWB 4LQDA 5GADl 2QPAA 2JBHA 2FEOA 3OIYA 3OMXA 4X71A 3DG9A 3UHPA 1QP8A 4KPYA 3PNQA 5KYXA 1XZGA 2PKQP 4M0DA 4PVCA 5CH5A 3KT6A 3HRKA 1QGDA 3KU4A 2G6TA 3AI2A 5LBTA 3RSCA 3H5LA 3FKQA 3USZA 4ML3A 1YJAA 2H0AA 5G1NA 2H5JA 4FMPA 1XLTC 2RBGA 4NZZA 3AI3A 3T15A 3S2IA 4CM9A 3E70C 1KMMA 3GOHA 4ZZIA 1BVUA 1RXUA 4RVCA 1CRZA 3HUEA 2W2MA 4HH1A 2IEYA 3SQLA 3VDQA 3ZW7A 4NY1A 5JAIA 4KWHA 4H1TA 1RRMA 1DC8A 2IH4A 3KSDO 3SEFA 4KXMA 3LWZA 4ZHSA 3TB4A 3LU1A 4CCWA 1NN5A 1LDMA 1X3LA 2GFHA 2ZTSA 1H8ED 1TVKA 1DQRA 2HNBA 2MOKA 3DKVA 4LJ7A 3L0ZA 4LYFA 5AOAA 4EARA 4DCPA 5K09A 1M5UA 3KSUA 2C57A 4FDTA 5J2TA 3OO0A 4D5GA 5ED0A 3WJ1A 2K2WA 4D3SA 3WXBA 3FN4A 3I2JA 2AGVA 1GA1A 2BH9A 2P91A 4NAHA 4QGBA 2W7TA 3R3ZA 4UTRA 4IWXA 1F7UA 4RXUA 2GBPA 5MFPA 1R0LA 4EKNB 2P67A 1CVIA 3CH4B 5EJ4A 1P5RA 1MQAA 1SOWA 1ADGA 5LA6F 1UXGA 1OB5A 4W8OA 3MFQA 3MWLA 2BMAA 1PJAA 1V45E 1Y8CA 3N2YA 3WRYC 3KBOA 4JY7A 5DH9A 4P36A 2E87A 2OD7A 1VQ1A 2HTEA 3Q9SA 1FPMA 1O87A 2CBZA 3KHKA 4K8RB 3WHPA 4DDWA 2RC6A 1TDJA 1D2GA 4WERA 4NP6A 4BXOA 1EJ2A 1KI3A 3O31A 1VRCA 1Z7BA 1X92A 1NNLA 2O23A 3DQQA 3HFSA 3HEMA 3RVNA 4AUEA 3BMOB 3DEYX 3MCVA 5DNVA 5C8YB 1G3UA 3FUTA 2CKMA 3OE5A 3UKOA 2GN2A 1I4OA 4WGGA 1CT9A 2C92A 4D98A 2OHOA 1GQRA 5HUJA 3TLGB 5JMTA 1IM2A 1V9SA 1YQWA 3QBVA 2QT0A 1S2MA 3TR6A 5K8JB 2ONCA 3T3NA 3GLKA 1R12A 1WBBA 5CG1A 2P2GA 1VFPA 2OHVA 5DRTA 1C3OB 5C3UA 1V6AA 3JYHA 5CYFA 3ZPXA 1ZYUA 3A36A 2WVJA 1BJKA 3SBXA 3QKUA 2ODEA 1BMFA 4OLBA 1Z68A 2ZAIA 1U8AA 1EUDA 3I5YA 5C4IA 3W5BA 2GRJA 2OGUA 3K7EA 4X6YA 4ZXFA 4EB0A 1ZU5A 4YS6A 3SYLA 4OFXA 4QECA 1WS6A 4C0WA 4HN2A 3HWSA 2QYOA 4D4LA 3WRXC 4TKVB 3H2BA 3U13A 4GWLA 1QSGA 3QHAA 4YXWA 3VHQA 5JY1A 1Z38A 3O1JC 4RD6A 2B25A 4AJ9A 1DWPA 2P2NA 2CJWB 1W2HA 4ZD6A 3OCWA 2JGJA 1L8LA 4U2CA 5IXSA 3LP6A 1TUBA 5I9MA 5A5DA 4M89A 2A5JA 2WF7A 2JGLA 4JWKA 1YZTA 4RQBA 3E4DA 1JI0A 3E81A 2QNRA 1N6IA 1FDIA 1JXAA 1NUHA 3NFYA 2X8JA 5L40A 1IN6A 5FRDA 2NPFA 2DH6A 3C16C 1GY8A 4MARA 1Z6XA 1ZGJA 5IHPA 4P4NA 4WTOA 1HDIA 2DETA 2ERYA 4ZAWA 4YWHA 1QKKA 3DO5A 4CKCB 5JPIA 3WK5A 3IEVA 3IT3A 2D74A 3A1VA 2NU8B 5KEIA 1QRSA 1M9NA 1YBAA 1YQUA 4M38A 5DN9A 1OBVA 3U7GA 1YUNA 2G82A 2ZKLA 4OOFA 4Q3NA 2VOJA 4W8GA 1MG5A 2VSNA 1VFNA 3HDTA 4CW7A 5JQGA 3K5PA 3ABIA 4Q93A 2C2KA 4MXDA 1MC1A 3GJZA 1JQ3A 4IV0A 3RADC 1TNDA 3ER8A 2UVPA 3IMEA 4A2CA 1BH2A 1ODFA 3ANNA 4KDEA 5T67A 4DZRA 3L8ZA 2JLCA 1XL1A 2XQIA 2SKCA 5TPWA 2VT2A 3WWYA 3W9SA 2P9GA 1QIMA 1IULA 1KSFX 2J3JA 2ZATA 1PO7A 2ATEA 3P94A 1RYZA 3RTEA 2C3UA 4HP8A 4HVTA 1PQ4A 3VZRA 4W5TA 2EQ5A 3LUHA 3NHUA 1WCWA 1ZM4A 3WYBA 2GJ8A 1HX7A 2CJYA 3OTOB 5B6IA 3HB9A 2XIQA 2R8EA 4OBXA 5CEFA 4UJ5A 4XWAA 3ZXSA 4C3ZA 5AW4A 2ES4A 5FAKA 3VYUB 3LNTA 3HJFA 2QG6A 3BCRA 3ZD9A 3U60B 2ADFA 3BULA 3AUAA 5COBA 4B4UA 1NKVA 3F7TA 4A92A 2JFBA 3Q8LA 3L6OO 1M1ZA 4X8OA 4I55B 1MRZA 5LM3A 4DG9A 1JIXA 1LVGA 4XIGS 5BWLA 2DCMA 2R4TA 4E0BA 5AI9A 4D82A 2VYCA 1SFRA 1Y8AA 4IVRA 3ZHRA 1C7IA 1Q1ZA 5FL7A 1DXQA 3TSZA 4Q19A 1ZINA 3ZUPA 2P2LA 3KE9A 1M10A 3I9LA 4NWIA 1HGXA 3K5WA 2ZWVA 3PRKE 1U3CA 4FHCA 1IY2A 3U80A 3PFHA 1GPMA 4TS1A 1XK6A 1R15A 1KQPA 2BBWA 2FSPA 4KUHA 1QHNA 1ONBA 1V2GA 1PR4A 3B53X 2JGFA 3A4LA 3B6MA 1IZZA 2BM8A 3BCHA 3WHIA 2AT1A 5LLTA 3EC1A 2CLFB 2Z5GA 3BQ9A 1FVHA 3GEIA 3LPNA 2ZIGA 1H23A 1UZMA 3DZ8A 1U7QA 3C1OA 1SOVA 4WJKB 1EHYA 3HV0A 1K3FA 4KQWA 2YYZA 3QXXA 3EF1A 1RBQA 1J0XO 3G2HA 3E0QA 5FTNA 3AVXA 1N6KA 4G0QA 1FRFS 3ZHVA 4U7DA 3EQ2A 1DQPA 1UBHS 2N42A 1EJ6A 1YGPA 4UQPA 4WCFA 1RP7A 4RD4A 3EPHA 3S81A 1RTTA 1EBFA 2ZWAA 2FH5B 4Q9JA 2CL7X 1PFQA 1L2TA 2OHGA 5AICA 3SIXA 1GQQA 4KWEA 3A11A 4E12A 4G85A 4PXSA 1SQ6A 5B7QA 3R24A 5BMVB 2OBNA 4MPRA 2VTEA 3ENVA 5LQSA 3ZWQA 1ZH4A 5TJ9A 3GWIA 1P1HA 1Q19A 1N2OA 1QFJA 4P54A 5CVEA 2F1KA 2I66A 3AIOA 3QOXA 4LZZA 3IEKA 5FBZA 4Q3AA 2K7ZA 2EBWA 3G0IA 1NNSA 1VE7A 2B4RO 1E2IA 3AIKA 4KU4A 3VVBA 3X1KA 5IMBA 4E33A 2JCXA 3SQDA 3FROA 1I24A 4HEA6 1P3Y1 1P29A 1E1LA 4DVJA 1QPGA 2BFFB 2OO5C 1VB5A 1I10A 4JBHA 4HAUA 1TB4A 1E5QA 5JNTA 3CC8A 3WGVA 4LISA 5CP8A 3IP3A 2O4CA 1P18A 2B5VA 1XPRA 2BMDA 2ZBEA 3W3AD 2CEKA 1NQTA 3PVCA 4ENRA 3CNLA 1ONSA 3O4JA 4O8CA 4BFTA 5C46F 4FYHA 2IF0A 4QYMA 4A8PA 2CBGA 3JQAA 4ARZB 4AMYA 4UVDA 4TTPA 3LZDA 5DW0A 4D8TA 3ZEAA 1ZU4A 3C6XA 5AM2A 1FCJA 2Z4TA 3FKSD 3JD3A 3CW8X 4I14A 1C8VB 3V2HA 1E63A 3OEWA 1KFCB 2HA5A 1KVUA 2IXGA 2LIVA 1PL0A 5CA0A 3ASUA 1L5VA 1ZESA 4UHEA 1E1MA 2Q1XA 4U2KA 5CW1A 3UAVA 1IQ0A 4YJHB 2WF5A 4KQJA 3AU8A 1THGA 4EX6A 1MQ9A 2OFWA 4N3NA 2QRUA 4HNQA 4OKSA 5FA8A 1GV1A 4NMHA 3HDVA 2JRCA 4R54A 3RUAA 4DL9A 4QGSA 3RVBA 2ZDQA 3KJIA 4ZRDA 4D02A 2UZ1A 4XWOA 2VJOA 4E31A 2NTNA 3RV3A 2UUCB 4YR9A 1OIWA 1JHXA 1BN6A 5A2QA 1L7RA 1WV1A 3FBTA 5C3MA 3FRJA 1M2WA 3GLSA 5IBRA 4PQFA 1T10A 1MNAA 4JMPA 4QO8A 2QMHA 3NEYA 3O47A 4RDCA 3FGZA 4W1PA 4B6EA 2H07A 4D4HA 5IHXA 4KR3A 5FJJA 3SEAA 2GM3A 4REQA 5CB4F 1JTEA 4LZLA 1UBSB 5KTOA 4PC6A 1TF7A 1NX6A 3GDFA 4HNUA 4MIKA 4QTUB 3BSSA 5ALMA 2EFHB 4NOMA 1A8PA 1JX6A 2J3HA 2VAWA 2O48X 2ZTUA 2ORVA 3DVSX 4R16A 3N2ZB 5AH0A 5TQ0B 5I01A 4M1EA 1SCAA 1RYMA 4IGEA 3KAPA 3MCAA 1WXDA 3BMXA 1Q1BA 2HHAA 3KKZA 1VA4A 3NHFA 4MHTA 5IC6A 2A7XA 5CR9A 1C3LA 2HGSA 2N46A 4JYCA 5GVRA 4OD0A 5KU1A 4DM3A 5JJCA 1V3QE 3Q0IA 3HN6A 1FXSA 2VPXA 4HLUA 4BEBA 2CC2A 5LP6C 3DT8A 3WNBA 1EFPA 4LOHA 5BWOA 3GUZA 3ONVA 4I4NA 2ZIFA 4X64B 4ENUA 1D2EA 1YHNA 2GFQA 1RWXA 3RTAA 4LJYA 4XX1A 3PR1A 3K0HA 1T9DA 4G5XA 1CJCA 1Y3DE 2QRVA 3GH3A 4GOKA 3E22A 2G63A 1HA3A 2ZR0A 4ZOQI 4BBZA 3L7MA 2JFGA 2FDXA 3GGJA 5CNJA 1GCUA 4A5SA 2CFCA 2O7RA 5JCZA 2PANA 4HNVA 4OLFA 3GPBA 3P71T 1KYXA 4X95A 1NUSA 5BW6B 3BWYA 3BOSA 3BSYA 3T4PA 1R3UA 3R3JA 5EXSA 1NUUA 2EWVA 2D3WA 3ZCRA 1AS3A 2QJWA 1JA0A 4O4JF 3UWSA 5KPJA 1KRXA 4K6KA 2FPIA 3BAZA 2G0NA 2EZ8A 1KYYA 1ZUNB 1UBCA 3UATA 3OIUA 3RRMA 4G4GA 1OPRA 1SUAA 3IV6A 2XGSA 5HG0A 3TFQA 4PZPA 4ND6A 3OCCA 5DXFA 3CZQA 4AZ0B 1V9LA 4L8GA 1ZCJA 1VLHA 2WJAA 4WZBB 4MRSA 4QULA 1ZSYA 1T1GA 2J59A 3OJ0A 4K46A 1IHDA 1S8FA 3SMVA 4RJJA 4ZAYA 1BD3A 1UMKA 1ZSVA 3LVFO 2RHLA 3VR4A 1GAJA 2JH3A 2YJGA 3KQYA 1ZM2A 3H8VA 5BSGA 1U3TA 2XEDA 4K6GA 2E6KA 1QHGA 4UZSA 4QREA 3VV3A 2GAIA 2WNIA 2ZZKA 4LFCB 3UAOA 2IEIA 4KXNA 3ONDA 5HF9A 2ZRFA 5J5AA 5IVPA 1YQXA 3T54A 2AKAB 3I2GA 4OP2A 2GM9A 2X15A 3H5OA 1SD2A 3INNA 4LJ5A 2QNBA 1XDZA 1ZBQA 5FNZA 3FDZA 1OWOA 2Y8EA 1ZJ4A 1ZY2A 2L18A 3QLUA 4MHOA 1J2TA 3P9XA 5DGXA 5JO9A 1LRJA 4EA8A 1C4OA 1DAKA 3LHFA 3OE1A 3U44A 2XD9A 1Y0BA 3OUZA 2JIQA 2ZBVA 3RH0A 4YRGA 4IDOA 2OBMA 2AF3C 3UHAA 4Q24A 4WZ6A 3UMFA 3M6LA 1HH4A 3WLJA 2O2GA 3AONB 4K9QA 1XNHA 1B6RA 1CY1A 4RYLA 4UVGA 5DLEA 4ZVSA 2F67A 2AZ4A 3C3EA 1MJHA 3OHMA 1O2DA 2BFDA 3A6DA 2GEVA 5EZ5A 1LSJA 1LNZA 2OESA 1D3AA 1RHUA 2FZWA 1DAEA 4QQRA 3DKKA 5FPHA 1VM6A 5C5IA 1RI5A 5GM2A 3VR4H 4INOA 4ID3A 1E98A 3HY6A 4TKLA 3IA7A 3SZRA 4X41A 2R6ZA 1G8MA 4DDVA 4RTLA 5KINB 2JLZA 3K4QA 3ZWVA 1T6BY 5DKFA 5KCMA 4LSWA 1N2XA 1MX5A 1FMJA 4M53A 5ITZA 5DBGA 4G0OA 1E1RD 1Z2EA 3B38A 5EIOA 4B46A 4HYEA 4C3UA 4YUAA 1AMOA 2IGBA 5CT8A 4UBIA 5GJVC 4QEZA 2PRZA 4MTLA 2DUNA 2QZPA 1YTLA 1QTRA 2NZXA 2QZ4A 2J9YB 3AIMA 4GP6A 2EKDA 1A2OA 4RPJA 1E8MA 1WLYA 4J7CA 2PSEA 2QL7A 4QBHA 1NURA 1XRSB 4B87A 1NHGA 2A9FA 2BKUA 2EP8A 3EVGA 4GW3A 3HSYA 4ROSA 3ESZA 4BFUA 2IOQA 1WUYA 3V1KA 1ULUA 5TQVA 4H6VA 2YZ2A 4WKGA 1QVZA 4IIXA 4KG7A 1BDBA 2OWEA 2W6CX 3D54D 3NBUA 2V59A 4JGIA 1R8YA 2I76A 3NUQA 2CHUA 3MILA 4YCDA 1JWBB 1ZD1A 2H2IA 2PTHA 2CEAA 4LHZA 1UPBA 4C6TB 2HNKA 3VOBA 1HOTA 1P9LA 3OQJA 5CXQA 4ZVUA 3HWWA 1AHHA 4YO8A 5ICFA 4HH3C 3K3PA 4JI5B 4A7PA 2ZEJA 3UHJA 1RFLA 4GPTA 1WXQA 5F5NA 1M0WA 1UEIA 2YWEA 2H9AA 4L5AA 2WINI 1EIWA 1JW9B 4IIBA 2W2TA 1SO8A 2PE5A 2HFKA 1L3CA 1V7PC 1CQPA 1G2IA 2FQXA 3EXHC 2XOKD 4GYKA 4JBLA 4CCAA 5BYJA 1Z34A 5DHRA 2ZIAA 4GE3A 3F7NA 5HEKA 1KMHA 4JITA 1UF9A 3FNIA 5EY5B 4TM7A 5T4EA 4AZTA 2FFHA 3OIWA 1SKAA 4NCXA 1MHTA 5AUQA 2OCYC 4LRWA 3OQ6A 5B2EA 3FOFC 3EXAA 1CY7A 2P6OA 1V1RB 4RGQA 1U7OA 5LZ7A 1KEZA 4J49A 4COOA 5T41A 1G60A 3ELWA 3SMQA 3C3PA 1ILWA 3PDUA 1RU3A 2HJGA 4AF8A 4QDOA 1TM2A 1NBHA 1Z0JA 3IJ5A 3AILA 3CWCA 2XH8A 4I1SA 4AICA 1RSZA 2HDOA 2CLIB 1ZN9A 3LSYA 3QEMA 2W2PA 2ECPA 3T1YB 4WJZA 4ARUA 3C3CA 3MTIA 1W4BA 2FJ0A 2J0UA 3CURA 4IUYA 1Z5PA 4FIZA 4LMBA 3HY4A 2Q2VA 4MVJM 2DP4E 4PLTA 2AQKA 4REQB 5COAA 4ZVNA 3ZCUA 5K20A 2NP6A 5EIXA 2QUHA 3NHSA 3SC2A 5I7VA 5KU7A 1AGNA 5JW6A 2BJVA 2PWAA 3H0KA 5EQDA 5TS3A 4CXMA 2EARA 2OV8A 3GWZA 3V2GA 1T13A 4LX0A 2AJBA 3DYIA 3EYWA 3N6RA 3WRWA 621PA 3I8XA 4BNVA 5LU8A 1BO6A 1KKMA 1YV9A 2HWWA 3WGMA 1L3BA 2A0KA 2J9RA 2O8DB 4P2BA 1OY1A 1ZZGA 2G7MC 1CF9A 2YCBA 2F8TA 1TVCA 1CQIB 4MLZA 3ZU3A 4EY4A 3FX2A 1NVWQ 5A3RA 2OCPA 1SWVA 2QLBA 3EG5A 3K70D 3N0RA 4ZI7A 2MSLA 1SA0A 2DPGA 3CNOA 2OG1A 1QGYA 4D79A 5I45A 3DUFA 4OGKA 3BKXA 4NV1A 1Y89A 1XXHB 3LBFA 1UM9A 1PSDA 1Q17A 4NFLA 3UG6A 1BMTA 3GLFE 1BNCA 3VC1A 2R62A 4G4SP 1AZSC 3VTAA 4DIBA 3VPGA 4EGCB 4DBVO 2O3JA 1O9BA 1IEQA 1T3GA 3B1VA 3E9ZA 2FK7A 3LV8A 3OBIA 2ZCJA 4R4JA 2FRDA 3L7OA 4M9XA 5DVZA 5FOVA 1L3IA 4EH1A 1DJMA 4EB3A 3V1UA 2ZBPA 4BMOB 4LMAA 2RD2A 1ES9A 3FOCA 2GXQA 4QOFA 3CRRA 3U1TA 4OUDA 2HDHA 2V55B 3K2EA 4GXNA 5CW2A 1GKUB 2BFAA 1JB1A 2G4LA 2BKAA 3HPRA 4G1FA 5AJWA 3GT3A 2P6MA 4G5YA 3UJ3X 4K8OA 3FSGA 5IWAB 4WT7A 2A59A 1MB4A 2ZUBA 4GQIA 1ATZA 3WLTA 3TLYA 1P1BA 1XIVA 3CR7A 1AE1A 2EG5A 1P1CA 4IY1A 1EBUA 3AYXB 4PINA 4YV1A 4B83A 3CRNA 4C88A 3O92A 4FDUA 3GMTA 4BGUA 1FDTA 2WM3A 3L8YA 3NJ8A 1D6NA 5AKKA 1XJ0A 4ENVA 1CK4A 1SH7A 3I5AA 1BKYA 2VAPA 1K08A 3E84A 3LPLA 5A6VA 2EFCB 4GI3A 2Q7XA 1MJ5A 2FUG6 3DV0A 3ZWXA 4M83A 1KS9A 3NHJA 3MT0A 4J3FA 4NJEB 4PF1A 2ZRDA 3BXFA 4HUQB 4N0DA 1EB8A 5JI2E 2PVPA 4A36A 3I4FA 1QLJA 3LY5A 1XCLA 2BLNA 3OY7A 4OQQA 1YOBA 3DCJA 1E9VA 1ZI9A 1P9WA 1SVOA 2QS9A 4RMGA 1T2AA 3QIAA 3A1UA 1P5ZB 1UC8A 1Y3IA 3K0KA 4UUAA 4EOGA 4IP0A 5ENDA 5IXYA 1ADYA 3FFXA 3HGMA 4PZEA 4TL7A 1G7SA 1K1EA 821PA 4LVOA 5I7HA 4B7AA 3D81A 4UXIA 1AKTA 2AFHA 3KQQA 4P80A 3TL6A 4RFSA 2GBLC 3GFGA 3H8WA 3I4LA 2HMAA 1EWRA 1DO2A 1FQJA 4MUJA 4MJ7A 3TOSA 2B1RA 3BMNB 1S8NA 2YC4C 3CLSD 4PS0A 1QAMA 1HDGO 3L40A 4OXNA 1V5GA 3TINA 2Z3ZA 4ZRMA 4NDAA 1S3GA 5E3HA 1E3DA 4A2QA 1FTWA 4P4SA 2WSIA 1J2RA 2ZI4A 5F1PA 1IHPA 1NDHA 1PR9A 1U0LA 4BBAA 4EJ2A 4IZIA 3QLEA 2FYTA 2CHVA 3AF0A 1KKUA 3LCMA 1J49A 2GZAA 1NW5A 1CZLA 4WNAB 3ZZ0A 4B5LA 1K3TA 1P7YA 1XRQA 3FYHA 5EUBA 4E5KA 1PVOA 3ZBQA 2GZMA 3AESB 2OCXA 3D6AA 4QNRA 1VCOA 4BGIA 4CQLB 2I9KA 1GKKA 4YROA 4KR6A 1GUDA 1R8JA 4DVGA 2HX1A 2B7BA 1S8AA 3R5KA 1VG1A 5MFZA 3Q3EA 1T3TA 4M1SA 1RJWA 4C0XA 1VL2A 4V2IA 3RTDA 4IIEA 3INTA 4JMLA 4L8VA 4QBIA 2VZ8A 1PN3A 4YAWA 2HDNB 1FP7A 1XZFA 4EF5A 3LFHA 2V58A 4XWGA 1PT7A 1AJEA 2LXNA 2FR1A 4B6PA 3SX4A 4IRMA 1NFRA 1NWCA 2OVFA 3OOHA 1G6KA 5ERYA 5K01A 2P9ZA 4IILA 5DGIA 2HYIC 1JDUA 1PHRA 3GLUA 1QXSA 1HO3A 2PKCA 3TTTA 1C7EA 3JU3A 1ODCA 1PK8A 2AQ8A 3OLXA 4IL5A 2ZLBA 4I3FA 1FTNA 2PNFA 4QDUA 3QMPA 1BJTA 2KI5A 1ADCA 2XGGA 4F2HA 4TZKA 4RZIA 1EVZA 1QUFA 4Y1RA 3WJAA 5GZ3A 1I7PA 4GBED 4GF5A 2FZ5A 4J0GA 4UDOA 2H5EA 2W9XA 5D5QA 4AXXA 3WB1A 2RH8A 1AO0A 4CIYA 2I8AA 2KE5A 4DA9A 2QHXA 3GLIB 1QMGA 1PEDA 4TL9A 3C5VA 2FN9A 5KMGA 2XUDA 2AUMA 3RPEA 5G0UA 1JHRA 1Z33A 3FFTA 3IAM6 2Y27A 5H8WA 4JCCA 4HATA 5C7OO 2EW2A 2R1TA 3MJSA 4FYJA 1P9OA 2C20A 4OATA 1X77A 2C4UA 2WJYA 3HP7A 4FLMA 3RWOA 2ZIEA 3VGPA 5JECA 3R4VA 5DNCA 3P97A 4QHSA 4A0HA 1U1DA 4YACA 3QVKA 4ZIRA 3M4JA 3IV7A 1HTBA 3PQ2A 2IEZA 4PSKA 3WWDA 2O4UX 5CX1B 5CJPA 5JRJA 2VTBB 5FJIA 1RHJA 1FIUA 1NM5C 3Q7TA 4QQ8A 3R9IA 5HK8A 2IHUA 3FE2A 3UTCA 2X8BA 1H3NA 4Q1DA 4REMA 3W2IA 4MUBA 2OLKA 2H08A 3BEDA 2H59A 3P52A 4LJ6A 4OI0A 7MHTA 2C9CA 1DQSA 4FYVA 1KO1A 1TJ4A 5ED4A 3MVEA 4BB0A 2ZT6A 1Q0PA 3D6FA 3R0VA 1L1EA 3B9BA 5IVDA 3GGPA 2WU4A 1JAHA 4MCHA 2ZRAA 3F1LA 4DDKA 4DANA 4JR0A 3A6GA 2X9GA 2HAEA 1JLLA 5D6OA 3ZXUB 3GFTA 2ZYTX 3A4VA 1Z15A 2BFOA 1UAYA 5LFAA 3NC0C 1CF2O 1SD1A 1G6OA 2Q6TA 3BX1A 5DM60 4FNMA 4LC1A 3QNUA 2J3LA 1U98A 3LUPA 2BSQA 2O7VA 4RAOA 2VDKB 4RTJA 3UCEA 1YJ5A 1XHFA 2JFQA 4OYRA 2I3BA 4HAIA 3ZZNA 1ZG3A 3X2FA 2AW5A 4OHRA 4HAXA 1E77A 4NCHA 4J03A 3OG9A 4TS3A 4TXJA 4CTNA 1REQB 1P7PA 4GRAA 2AFHB 5FKJA 6REQA 2D1YA 4WLEA 1SZJG 2D5BA 1CQXA 3OCVA 3OFND 2RH9B 3KYDB 4NENB 2VEDA 2CD7A 2XIJA 3KAJA 1CERA 1V1MA 5A4KA 2YMMA 2D4AA 3S2EA 3GT4A 3H19A 1MVOA 3LSTA 3QUCA 2JLSA 2FU5C 3GRPA 3E58A 3KZOA 4MVYA 4Y18A 3TO5A 3OA2A 3LVBA 4Y30A 4KPUB 1PU2A 4CIAA 4N0EA 4US2R 4AJNA 5CBKA 5FADA 1KVTA 4D26A 1GITA 1ZCAA 5ALSA 1N2CB 3CE9A 3AOGA 4N40A 3SIWA 3BHMA 2JGIA 4YJ3B 4HZGA 3TTXA 4YXFA 5FR1A 5LQJA 4GO1A 4ZU6X 3K8YA 2J5BA 3P0IA 3W8EA 1AQNA 3FTEA 3MTBA 2PS1A 1S7GA 3CSSA 1N8NA 1ZGAA 3FLBA 4K0RA 1E2HA 3DDSA 4E2ZA 1MAAA 2QBYA 1YC2A 3LRPA 4QYSA 2XPCA 4A8JC 3FGOA 4J0HA 4BX2A 4PNZA 3D5EA 2G9RA 4FHGA 2FFAA 3PLRA 4D2IA 4F06A 3ACBA 3OH8A 1NQWA 2EJBA 5A9TA 5LJLA 1YCDA 2CDCA 2PZEA 2Z43A 4NDZA 3PU6A 5DNYB 1ZNWA 1JLSA 3EW9A 3V1TC 1SHZA 1LU9A 1YMVA 2X5JO 1SRQA 3F5SA 1V5IA 2KWIA 4HDKB 4RHCA 4UE3S 3ROEA 3WL6A 1HQCA 4F4UA 3BILA 4RACA 1N3LA 2O8VA 1JG6A 1ESNA 2C2YA 5B55A 1ZL0A 5AVUA 2AOTB 1TA9A 2F8LA 2DR0A 5A71A 3CVVA 2V3CC 3TXXA 2MIIA 3MINA 1T6NA 4W4TA 2JLRA 2I78A 4Z9AA 1Z5OA 1SKBA 4H7FA 2GCOA 5K6RA 3DVQX 4ER3A 2WJWA 1GZ4A 1KJ8A 1UBGA 1QDEA 1KBQA 1QFZA 3TLZA 1OWNA 1I3LA 1BD4A 3I53A 3OKAA 1XTTA 1ZMOA 3HU3A 3HI6A 3PDJA 3PKIA 5CAEB 3OJWA 2WILA 4X66B 4KYTA 4WRRA 1JECA 3CF6R 1ARZA 2QUZA 3GCWA 3QOWA 4RZ3A 1Y9EA 2QE6A 4OGLA 3LX4A 3EGWA 4MVWA 4XZ3A 2R1ZA 3A9VA 5CA1B 1U2QA 2G07A 5LIPA 2F1HA 2QAIA 1WCXA 4WZBA 1IG3A 5FLEX 3Q9UA 5FI0B 1WM1A 2BM0A 5I9TA 3ZNQA 4DEVA 1XZBA 4OI4A 3K6KA 4EMBA 1D4AA 4JVLA 2CNBA 2B7LA 3VJKA 3BTOA 3JQGA 5LOVF 1MT0A 4G41A 4JYAB 1ECBA 5BRAA 2XKKA 5K3OA 3N0WA 3LECA 4M76B 4B6FA 1RFGE 2XMQA 1KH3A 5K1ZA 1I1HA 1M34A 3PITA 5ER9A 1HOXA 4BCDA 4JB3A 2PS0A 1RZ3A 3CZCA 3UIEA 1B6SA 1V35A 4G23A 4JWTA 2JIZD 4V0SA 3D7MA 3BWDD 1U6KA 3R0XA 3KDPA 5EIBC 1L4YA 1R6DA 2W83A 1EHCA 3BA6A 5IAEA 5K6AA 1YFKA 2IELA 2VP0A 4JGGA 1DSSG 4YR7A 3QX3A 4DLTA 2BF4A 4OTZA 2PLFA 4TLBA 1PD1A 3FNGA 5CXSA 2O2JA 1KEEB 2PYDA 3TLKA 1LLQA 3JAKB 4CEIB 3MS7A 1VIDA 1RKUA 2FWAA 4JUDX 4GOOD 1OD6A 5JUWA 3A9TA 2PA3A 1WY5A 3IULA 2XT9A 4E2WA 1AA6A 2XLCA 3CVJA 3TOVA 2IOFA 1CU1A 4A16A 2QLTA 2WD9A 3RBAA 3T61A 5I7RA 1M0EA 5JANA 1KMHB 2AMYA 1OU4A 3FPBA 3ICPA 3QFHA 3QPUA 4M7RA 3A2NA 3L18A 2UZ3A 3IEXA 4HGPA 3R5JA 4IG4A 1D1PA 2VNJA 3ZU4A 1T9BA 3UC9A 1F2VA 4O63O 1FQKA 3FZQA 5ALDA 5EMMA 3RHSA 4N0QA 3VH4A 3DWGA 4YAIA 3FTQA 1RRFA 1OILA 4TLMB 3EWAA 4M1KA 5FOSA 1G42A 2DYKA 2I6GA 1T2VA 3GB9A 4G5OA 1U7ZA 3GP5A 4QM6A 2C8JA 4DA4A 2C4HA 2DBVO 4NTZA 2ZWPA 2RI0A 4UM7A 5ITWA 1QQ6A 2FW8A 3PNPA 4KO8A 3KQSA 4XD7D 2HF9A 4M0CA 3PUXA 4LEIA 3K70C 3AB8A 2FDRA 1PJ4A 4DXDA 4R0MA 1OXUA 1SCDA 1YUMA 3R0JA 4LZOA 2X1HA 4NHEA 4DNXA 5CM8B 1ZUIA 1KO5A 1FUYB 2P6UA 3GQBB 1Z25A 2VUIB 2I6UA 3M33A 1FSPA 2ZSDA 1OXKB 4CGYA 2J31A 4CYMA 3HBMA 3C45A 3OQNA 3EPPA 1U3WA 3GRAA 5BR1A 2P8JA 3VHXB 1WG8A 2EZTA 5KJEA 5JBNA 3NEAA 1TTPB 1TW3A 3C0KA 3L4KA 4K6CA 1HEUA 2BMJA 3VPHA 4G0PA 1JDSA 3GI1A 4HDRB 1N78A 3RVPA 3CV3A 3OF3A 4IXWA 1NPTO 5AI8A 1DDOA 1MO8A 3EAFA 4FGKA 4PAMA 3SZGA 1V7ZA 4C0BA 3TIVA 1A76A 3DA8A 3OLQA 2ZJZA 1ZI8A 3CUEF 4UD2A 2V7XA 3EGEA 1XJCA 2ODPA 1ZMRA 1MAWA 1K97A 3KTFA 1H85A 3CUTA 2BT4A 2RHHA 3C5CA 3INGA 3Q2OA 5AKLA 4X1YA 5FTWA 1ZR4A 3A05A 3D4NA 3HZHA 4OQDA 1HQYE 3STWA 3QVMA 3T3HA 4RTOA 1EYZA 2GQ0A 3EXHB 3BFPA 3OX3A 2H9IA 4OQZA 4GDMA 4QFBA 4F3NA 1JEYA 2DHQA 4G9EA 3RT9A 4BEVA 5ELXA 2GPNA 5F9MA 3PWZA 1XK7A 3GFRA 3O03A 4TTJA 4RLHA 4DW8A 2A8YA 5CFMA 1MGOA 2NYRA 3IOBA 3KQMA 2GZDA 2ZRKA 3B6JA 3D0KA 3QKIA 1HE5A 4LDPA 4V0KA 4FFNA 3ZE7A 3DFZA 3ZW8A 4C05A 2C98A 2FLKA 5IFKA 3WA6A 3GJ3A 1WXIA 1MOQA 3M82A 3G2MA 1PJSA 5KYVA 4JC8A 3FTFA 3WMWA 3C3DA 3OTGA 1QTNA 1XQVA 5FBWB 3UYLA 5INTA 3U61B 3GLHE 3Q8MA 1NJ2A 4I1UA 3SYNA 2D62A 2AOVA 4R0VA 1ZFNA 2PU5A 4NCBA 2AHRA 3O8DA 1KEPA 4KPEC 5EI5A 1JAIA 4D3DA 4MNTA 2A3NA 3WGLA 1SG9A 4HH4A 2BKEA 1R0KA 4JLWA 2GAOA 4DUGA 3D2LA 4BVLA 2XWSA 3LKZA