3G9QA

Crystal structure of the fhud fold-family bsu3320, a periplasmic binding protein component of a fep/fec-like ferrichrome abc transporter from bacillus subtilis. northeast structural genomics consortium target sr577a
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
264
structure length
258
Chain Sequence
IPKHPKRVVVMADGYYGYFKTLGINVVGAPENVFKNPYYKGKTNGVENIGDGTSVEKVIDLNPDLIIVWTTADIKKLEKIAPTVAVKYDKLDNIEQLKEFAKMTGTEDKAEKWLAKWDKKVAAAKTKIKKAVGDKTISIMQTNGKDIYVFGKDFGRGGSIIYKDLGLQATKLTKEKAIDQGPGYTSISLEKLPDFAGDYIFAGPWQSGGVFESSIWKNLNAVKNGHVYKMDPIGFYFTDPISLEGQLEFITESLTKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Ferrichrome-binding protein
publication title Crystal structure of the FhuD fold-family BSU3320, a periplasmic binding protein component of a Fep/Fec-like ferrichrome ABC transporter from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR577A.
rcsb
source organism Bacillus subtilis subsp. subtilis
total genus 68
structure length 258
sequence length 264
ec nomenclature
pdb deposition date 2009-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3g9qA02
4ND8A 1K7SN 4PM4A 4TKUB 3MFQA 4B8YA 2XQVA 5KHLB 2PS3A 3K1AA 1QH8A 1PQ4A 2WI8A 3PDIB 3PSHA 3HJTA 1MIOB 1QH1A 1K2VN 3PSAA 5CX1B 4NNPA 3ZK8A 1L5HB 2AFHB 1KAHA 3R5TA 3AEUB 2AFIA 4WZAA 5M34A 4HMPA 3AEKB 1K0FA 3AESB 5BVHA 3AERA 4WESA 5CR9A 2PS9A 5JOQA 2PS0A 5JPDA 1PSZA 2R7AA 4GICA 2O1EA 5I4KA 5HDQA 3G9QA 4LJSA 4DBLE 3R5SA 1N4DA 3AEQB 5AFSA 4NNOA 4WN9A 4XPIB 4CL2A 1G20B 1M34A 2ETVA 2XH8A 1M1NA 5KOHA 4M7OA 3EIXA 2RG7A 3TEFA 1N2ZA 5BVGA 3HH8A 1QGUA 2YNMD 2OSVA 1K75A 1G21A 4UDOA 3UJPA 4MLZA 3EIWA 2MINB 5HX7A 3LHSA 1FP4B 5B58T 2OGWA 1QH8B 4OXRA 4MX8A 4OVKA 4HN9A 4TKVB 4WNAB 5KOJB 3MINB 2Q8QA 4PAGA 5FLYA 4INPA 4UTPA 2XY4A 4UTOA 2Q8PA 4OXQA 1N2CA 1H1LA 4UDNA 5BVHB 5JJ5A 1MIOA 1M1YB 4FNAA 4FKMA 4IRMA 3U7QB 3CX3A 4INOA 1L5HA 1KAEA 2WHYA 2X4LA 4WZBB 2AFHA 5JG7A 2M6KA 3AETA 4H59A 3AEUA 5GGXA 4WN9B 4FILA 3AESA 3NU1A 3ZTTA 1M1NB 4N01A 4ND8B 5KOHB 5GGYA 2XDQA 3MD9A 3K1AB 3MWGA 5M2QA 3TLKA 3TNYA 1QH1B 3GI1A 3AEQA 4XPIA 1G20A 2XV1A 4MO9A 2QI9F 1TOAA 4K3VA 1EFDN 4TKUA 4WZAB 1N4AA 2AFIB 3ZKAA 2OV3A 3ZK7A 4BBPA 1XVLA 2M6LA 3ZK9A 2PRSA 3PDIA 3AERB 4WESB 2MINA 5CX1A 5M29A 2PHZA 1FP4A 1N2CB 1H1LB 4TKVA 4WNAA 1KARA 5M3BA 5KOJA 4G09A 3MINA 3BE6A 3AEKA 4MDYA 1M34B 3AETB 2YNMC 4LS3A 2XUZA 3LI2A 5BVGB 4G07A 1QGUB 3HXPA 1G21B 4HMOA 3U7QA 1M1YA 1ESZA 2XDQB 4H0FA 4FI3F 4WZBA 3BE5A 3MWFA 4HMQA 2OV1A 2R79A
chains in the Genus database with same CATH superfamily
3EA0A 1V47A 1NF3A 2WSMA 4NRDA 3W9BA 4HUTA 4MDFA 2IU0A 5JDCC 5EJEA 4DLKA 5KUTA 1H66A 4WACA 3DFUA 1L5SA 1XNGA 2D1TA 2V03A 4M1WA 4M9UA 4OI2A 3FB4A 2NP7A 2NZ2A 4KXQA 3V97A 1Z08A 4IM7A 3HU5A 4C21A 2EHDA 1XDBA 3BJIC 2R8RA 3H2IA 3EHDA 3K8YA 1O96B 4TQ9A 3W2FA 1XZCA 2VPQA 1CYDA 4YCSA 1RM3A 1WCIB 3LVBA 3FFTA 1DUVG 2EF0A 3EK2A 1E5QA 1M6VB 2NLOA 3BIXA 4OKNA 4RQBA 5EJFA 1NJFA 1XJ5A 4LDAA 5GMOA 4D3ZA 4QU0A 4FIDA 2VP4A 4NULA 5JJLA 4R16A 2AYXA 1L2TA 4PLHA 5A9TA 3HYTA 1R8SA 3NETA 5CA1A 1GNRA 2FN4A 2MCFA 3SSMA 3MLAA 5ENZA 5LD2B 2A78A 1VCMA 3T99A 3SHQA 4O1IA 3M4YA 1KOJA 2BUBA 3AZOA 4WFKA 1WXIA 1FU7A 2ZRCA 4PHGA 4REQB 4Z1MA 2I2BA 4BNGA 3QEMB 3QIAA 2D4AA 3PGA1 5IBPA 1D9ZA 2QRJA 1HPLA 4GECA 1RI2A 4UVDA 5TMPA 1B7GO 1K4YA 1W4ZA 4HC4A 1IRIA 4UU8A 1C9YA 5KHOC 5C8XA 1W52X 1YULA 3GDWA 4NYMR 3B9RA 4NICA 1DEHA 5J3JA 3GUHA 1Y8QA 1NHWA 2GBCA 3BWVA 3JATA 4G6ZA 4Y0NA 2BJHA 2JJ2A 4BB9A 3KAJA 2OORA 4KBFA 1FDWA 5TVKA 5TXGA 3V8BA 5DMXA 4PG8A 3D4PA 4BO8A 3DW3X 3RUCA 3A4NA 3V2UA 2CFSA 4HY3A 1KE1A 3WYDA 3N3AC 1KO7A 3AJ8A 1XMQB 3A1UA 4TL6A 1IXYA 3FJ1A 3T12A 4HT3B 4H3HB 3NRCA 1UXOA 3D7NA 4O8CA 4F9TA 5EHXA 2AR9A 5CA1B 2OYRA 4AY6A 4KV7A 1R8XA 2CLEB 2VRBA 4JT9A 4B47A 2GVNA 4D82A 1B74A 1C1HA 2XZLA 4BLUA 3TW6A 3HDYA 5BR1A 1PL8A 4YT2A 3PJFA 3IXLA 10MHA 3EB9A 3MCUA 4YCMA 2PSFA 3IV9A 5J4VA 5LQAA 3T15A 3W3AH 4LOAA 2CC2A 2G5CA 1RAIA 1SXGA 4L8YA 4IINA 4DG5A 1W49A 1OAOA 1VSQA 4R0VA 5AHRA 2I9PA 2FG7C 4GC9A 3AY0A 1MEJA 1T3LA 2PGXA 1DBVO 1VG0B 2AFIB 3LY5A 2WM3A 3PK0A 4MRAA 4RABA 5TS2A 3GJ8A 1UPXA 1N5RA 4A0QA 5HR5A 3KD3A 1I51A 2XNJA 2HWYA 4BNDA 1GG9A 3SKYA 5C51B 1W94A 3ZOKA 5ITWA 1NVMB 1UINA 4QJIA 3UHOA 1Q7EA 3KTAA 3OMWA 4E5UA 1KARA 2DCUA 1SEPA 3O82A 5TB5A 3G17A 4UARA 2GR9A 4B0PA 1DEXA 1V8FA 1F51E 4B81A 4BX3A 5JD6A 2FZWA 3HL0A 1YS1X 4KO2S 5DLDA 1Y82A 1V16A 4DNFA 4X7PA 8ADHA 4DDMA 2ZWAA 1MGPA 2PGNA 3WIOA 1VKOA 2Q2NA 3P7MA 5FTJA 2F55A 4IQ4A 5E4JA 3FAZA 4XIYA 3RASA 4JXJA 4JR2A 3ZXXA 4EKIA 1OF1A 3STHA 2NIPA 4Z0PA 1DBPA 3OD1A 2Z4SA 4L5JA 4DUGA 5ILOA 4PYQA 4ZAFA 3GJZA 1JDUA 1VJDA 2BGLA 2FRDA 2CHGA 5KYUA 4HRAA 3VR6H 2ORWA 4ZQIA 1K2VN 4EHDA 1W6RA 1SWVA 4WK6A 1F8GA 1FFXB 2A5JA 2CFIA 1TXGA 2CEKA 2C8JA 2ZZKA 1Z4MA 3UNXA 1CC1S 5PNTA 1BQ4A 1YVPA 3B6KA 4KDRA 2L0XA 1E8MA 4XTCS 4C4TA 2HT6A 4ZJYA 4YRGA 5TGDA 1DEKA 3K6RA 4MV9A 4ZQHA 1QCDA 5CFLA 3TECE 3MHTA 2FPIB 3VPAA 3G9QA 4AJPA 3RFUA 4QHSA 1EDOA 3RTAA 3KLMX 4IL5A 1BW9B 1UZUA 3KZCA 4TTTS 3HA3A 1Y1TA 2HLDA 3CF4G 1LXCA 4YJ3F 3RHTA 3SYTA 1A8IA 1K8YB 2I4NA 2YJNA 3EEYA 4Y2XA 1WSBA 4JJGA 1D4AA 4EY6A 1ABFA 2W6NA 1Y7HA 3T1NA 4BE4A 4CIXA 4ER5A 2BGMA 1Y5NA 4R1OA 4TMVA 4ZXFA 1BA3A 4ZZ2A 3K0AA 3H2SA 5LQDA 4YI3A 4X63A 2JGAA 1GTMA 4UEOA 2JH9A 3BMOA 3F4LA 1NQVA 1LQ2A 4RTKA 1DFHA 2VHUA 3ZH2A 3CNNA 3Q0EA 1C3EA 2ZJ3A 2J9GA 4KMSA 3L6BA 4XM2A 4EMTA 3AIKA 1Q0QA 3UANA 1AKUA 4O4JA 1I1OA 3SJ7A 4MWBA 3UJDA 1AKQA 4W9MC 4C07A 5D3ZA 1YR8A 1NU6A 3M6LA 3KOYA 2X7HA 3U4DA 1HE8B 2Y2VA 4S24A 3AR4A 2ZIVB 1REQA 3EXAA 5DWDA 5JC1A 1MCZA 4FEEA 2WQ7A 1D2RA 5EIFA 3WY9A 1ECFA 4PZDA 4N0EA 1RAGA 3CHYA 3BGWA 3T94A 5C9ZA 1FX0B 3FHLA 3L1JA 4JEHA 4AF7A 3DEYX 3RFCA 1MRZA 3R5FA 4FD2A 4FIZA 2DFTA 4KPUB 1S2DA 4RVCA 1K7FB 2JCXA 3IMCA 1MQ9A 5AOBA 2R85A 3INRA 4HEHA 5DBGA 3SKVA 1E3DA 3BMOB 4HEQA 4MRRA 5LKRA 3O9VA 2PRYA 4UXIA 1NW4A 4DR4B 2C9CA 4I2NA 3BA6A 1M7HA 1NDUA 2E49A 2XTAA 4LYYA 5G0SA 4F2WA 2VAPA 3B13B 3CR8A 3E9YA 4I55F 4L95C 4N6NA 3OFKA 4PLVA 4CLDA 1GM5A 1QVAA 1UJ2A 1XP5A 1W4BA 2NX2A 4MS1B 4MV6A 4G5GA 5IKEA 5EJAA 4UQOA 2V7PA 1ISIA 1Y98A 5LQSA 3V46A 1SC3A 1J0XO 2HWUA 3VDQA 3ZHTA 3OJLA 4EJSA 1NUTA 3G5AA 3ZQKA 4RDCA 2FRDC 4IIUA 1REQB 1TW2A 4TL9A 4ZT3A 1XZMA 5CDHA 2E4XA 3T0FA 4TTAA 1XZHA 2B69A 3RSGA 4D4JA 4Z4HA 2JJ1A 1N9KA 2PGIA 2JAWA 5JXIA 4KIGA 3ADDA 3GJTA 5C1IA 3AHJA 1IM8A 3CN7A 4FYHA 2YZ2A 3CLKA 4JT2A 5K8IA 2B4AA 4KO4S 4HSEA 5GJWC 1DBWA 1OFTA 3HY4A 4O4HF 5A4DA 4JA0A 1OKKA 5D7BA 3SJCA 4G89A 1N1GA 2HL6A 3GH3A 1G38A 3LF2A 3FDXA 1NVBA 4X8OA 2C2BA 1OQAA 3B9QA 2QD1A 4BFLA 3ZZNA 3AI3A 4H08A 4Q7JB 2J9FA 1I01A 3PDWA 4EGJA 2ZB8A 3LKDA 1WZIA 3N0XA 4RETA 1JSLA 1U4OA 2HU2A 5FKJA 3R7WA 4AD8A 1VC2A 4UMFA 5CFQA 3EEQA 1AMUA 4R9NA 4F3YA 5ICCA 3R5TA 4WZAA 5ALYA 3ZWQA 3UA4A 1E6EA 1DEOA 1ZGBA 4FYMA 4Q7MB 1W581 2C77A 5DI3B 3RV4A 3IP8A 3R6GA 4I4NA 3NT4A 1EG2A 4IF6A 3RTBA 4KWEA 3VAAA 4B43A 4EB0A 1R6UA 2XJ9A 4I1IA 4ENTA 2PUVA 5G4LA 2F4VB 2O8DB 1LX7A 4WA7A 1O9BA 2VAXA 5FORA 3JWGA 1FYVA 4ARZB 5IK2D 3JXEA 3KLNA 4EYGA 2IXEA 5HNKA 4BKQA 2CFOA 1P39A 2I6QA 2XH8A 5JH7F 1Q2UA 3NALA 3P94A 3L7BA 1P1JA 3PTLA 5EQJB 2P6RA 2IYXA 2ZWPA 2F1IA 3UF0A 2EJCA 3JYPA 3RK0A 2HCRA 2NZUG 2WAXA 4G81A 3PXGA 3WWEA 4AMGA 3PYXA 5KYYB 4II3A 2Q6OA 3MQFA 3EXHA 4L5BA 4GBGA 3AF0A 1ONOA 2HPAA 4NCKA 4RNCA 4W82A 5FOVA 4D3YA 4DQVA 3BRCA 3O4VA 3ZQ4A 4AM8A 4E15A 3NM6B 5CFZA 3C98A 2QVBA 3FPKA 1C7QA 4JUBA 1V5FA 4TKVB 3OO1A 4XARA 3R7WB 2WBLC 5SYMA 3V1NA 2ZCVA 4IWNA 3U6BA 3U60B 4JN6B 5MGBA 3AKYA 2VHVA 4BECA 1HYHA 5CYPA 1E63A 4ZOLB 1FMJA 3R0IA 2C7VA 1N2CA 3IP1A 4LFAB 3K15A 4W8GA 2FG6C 3B6JA 4L8GA 4NENA 5L53A 1D1TA 2J48A 5G4KA 2X4LA 3LT4A 5IJWA 1GKLA 3ES9A 5ILQA 2OL4A 1S1CA 4FYYA 3TNFA 2JCGA 3RVOA 2P1RA 3AV0B 3WADA 4A2QA 5HS6A 3X2SA 1H9CA 3UHPA 1PR5A 1GGVA 3PENA 1SCAA 1HE3A 2BR5A 1LI4A 3BJMA 1C1DB 4R68A 4EJSC 5B55A 5AI6A 5JXGA 3HCNA 4WLVA 2R6AA 1KH3A 1M6EX 1U3CA 2SKEA 1E4EA 1NYLA 2XUFA 3NRJA 4FNMA 4O25A 4PPFA 4RYLA 4DWJA 4JIMA 5DK4A 3PJDA 2POQX 1LU9A 1R5NA 1XTIA 3I04M 2ORED 3QNUA 1E61A 1TTPB 1DKLA 5B1DA 1K3TA 3UC9A 3ZE0B 3PEEA 5WRFA 1ZVVA 3GZNB 2YXDA 3DXFA 1E1QA 3CFYA 1ETUA 3JWEA 1C1XA 1U2SA 3EWIA 3KVOA 1N2CB 4NF2A 3EFHA 2ATVA 1UC5B 4YP7A 4ID3A 2O3JA 4OUDB 1N1EA 2O0MA 2V4ZA 5A0FA 1KEWA 1XDZA 2P6OA 4Q4HA 1POXA 5G4KB 5KYGA 3EQ9A 4HBZA 4YO7A 4GE0A 3DP7A 4G5SA 1PWYE 1A71A 4HVAA 3S2GA 1Z6YA 1NR1A 1OGJA 5EXSA 4XOUA 4EKGA 4Z7JA 1PF7E 1Q11A 1TI7A 5AQ1A 2WWGA 4C0BA 1I94B 3PQ4A 3UUEA 1E4EB 4HXEB 2WJVA 2R79A 1T8YA 4Q1DA 2F1KA 3OX4A 1Q1BA 2WWFA 1I32A 3H5WA 4MGZR 4WY2A 4AZWA 1SVNA 3NIDB 4S1VA 3MFQA 5IXJA 3WK9A 4G56A 4WNCA 3SC4A 3DZGA 4E5VA 3H4IA 3HR8A 4YRTA 4V1CA 5IXYA 1SBHA 2VUHB 4I66A 3O94A 1MRSA 3QWBA 3TQFA 2EXXA 3GJ3A 5IMBA 2FZ4A 4TTRA 4F84A 4MIKA 1NMYA 3PCXA 4DUYB 4QIHA 4HQ0A 2W11A 3EXHC 2WJWA 3MERA 5TT0A 1SMKA 4D9NA 1SU4A 4HKTA 4BMNA 2VCYA 1G3QA 4RF4A 4OX9B 4AF6A 2IP4A 3OJXA 5EHIA 1FJGB 1KP3A 3R75A 4DANA 3IAS6 3FDIA 4D45A 1NLFA 3FYTA 2CL6X 1PJZA 1YI8A 1PE0A 2QL7A 2ZAGA 3JYHA 4V24A 4BNLA 3DWEX 3EGOA 3JZFA 5CNJA 3LIIA 1K6XA 3AF1A 3UK1A 2XNSA 3MILA 4E08A 4PHHA 1EJ6A 1P0FA 3NHJA 5HF9A 4UBMA 2OCGA 5BQ5A 3K9WA 1NRWA 5AOAA 5LM3A 4P3XA 3QE2A 1A2KC 2B7CA 3AEZA 2QTCA 4RGBA 2G6TA 3AW9A 4MKXA 1FUUA 2O59A 3ZUGA 2GRAA 2ZQ5A 3EFBA 3TSZA 4FKZA 4BNXA 3COZA 3LPNA 1MB0A 4NCNA 4C4SA 3R9KA 6GPBA 5JI2E 1KK2A 2C94A 5JSQA 4DR6B 2R7KA 2X8WA 4GYKA 4LTNA 2Y99A 2O8FA 3LY8A 3HA7A 1WCWA 3MW8A 2NPFA 1NT2A 1UT5A 2Z2JA 1E0JA 3WAKA 2XCRB 1U90A 1XT6A 4WBSA 1VBNA 3E2IA 1H1LA 3FMPB 5I8ZA 3DL0A 1FSSA 1ORVA 2XUQA 3LL7A 5E1DA 2Q4DA 3PL1A 4QJBA 1RXWA 2AN5A 3C6YA 1EJ0A 4PCLA 5BXQC 5K3OA 3FFXA 5FL7A 1QTNA 4BN4A 4C4OA 4E03A 3X0DA 4BXOB 3QY9A 2C00A 2OYSA 2WNIA 2ZYWX 3DEFA 4LQ4A 3WWYA 2CNBA 2R97A 4PYKA 2BZSA 4BJ6A 3A4TA 2Q4BA 5TNXA 1MNAA 4OQQA 5I48A 1IHOA 1TO1E 1G17A 1OX6A 4M1MA 4JX9A 4LYHA 1E7MA 1ZOLA 3B52X 2GBLA 4FZ5A 3K70D 2GT1A 4MA0A 3ZNOA 4CM1A 4KX3A 2XEXA 2ZUVA 3CN9A 3O8QA 2HA2A 1GARA 1YQUA 4JMLA 5DNWA 5EIBD 4HTFA 2BHSA 3KYBA 3A32A 4IEIA 4R1NA 1H1LB 5LZ4A 1L0BA 3HJRA 1ATZA 3JCZA 2QTVB 1NTOA 3FCAA 1ZU5A 2HJGA 2X8JA 4PX2A 3GAMA 3T95A 3W1VA 1PI3A 1BMDA 4H1UA 2QYHA 2IPNA 3B7GA 4B33A 4ZOEA 1GDDA 4JWKA 3W5HA 4ZWNA 1NJ1A 1WZCA 3WB2A 1JDNA 1GL3A 2IE8A 1GGMA 1FJXA 4WCDA 4GWKA 1PJRA 2GPWA 2IDZA 1EVQA 2Q6VA 3IIKA 4EFKA 4GSYA 4L6CA 1F3LA 3TINA 4JWTA 4JELA 4N47A 4HHEA 5LQJA 5JD4A 1HDCA 3EOZA 3TAHA 1CJMA 3AFMA 1QNLA 1SZDA 4I1OA 1NVUQ 4S1NA 4E30A 5IT5A 3HADA 1PS9A 1PHPA 1E4VA 1D2CA 5B58C 1P8AA 3DM9B 3OEED 2XCUA 4A0RA 1JEQA 3F46A 4BY9E 4GPBA 3MK31 1IUOA 1QAQA 3L43A 2X1MA 3VOSA 2VNHA 4DA6A 2CXHA 2R6FA 3QTTA 4M89A 1T3GA 5I7SA 1YQGA 3ZE7A 2CNWD 5KNLA 2QVXX 1E98A 1H05A 1I4TD 1IFXA 2GX6A 2CE7A 2R1TA 3TR6A 1XZDA 5IVPA 1PK9A 2O52A 2VWPA 5EJGA 4ZD6A 3WK7A 3CEHA 3N2KA 2GF9A 3KPJA 2W4MA 1CIVA 5EZYA 1NR7A 1JYFA 3E23A 2KE5A 3K72B 1QUFA 2YV2A 2X0RA 5ADUS 3BIJA 1UBLS 2XUPA 1JI3A 3BF8A 1Z6AA 2JA1A 2P11A 3VO8A 4WKOA 4MVJF 4Y0AA 2Q5OA 1V8DA 2BFDB 2GI4A 4NTZA 4REMA 3NRBA 2IE0A 4L73A 1YB7A 3KZMA 1YFLA 3BT7A 2X15A 5F3DA 2EBUA 1JEQB 2LXNA 4K6FA 3WOVA 5LP6A 2Y6VA 1KOFA 2FQWA 3SEFA 4EL5A 4KSCA 3PQ8A 2FJPA 1M2OA 3MIIA 3OC6A 2B2NA 4JT8A 1BJRE 1BFKA 1TM7E 3A1DA 4OXKA 3VKUA 2OHIA 4FFBA 3TLMA 4G63A 2X8AA 4MMXB 1SFRA 1LJLA 1DVRA 3QGMA 1ZONA 4H18A 1FZQA 5LUBA 3DT6A 4AZVA 2RK6A 1KEPA 2FW1A 2SECE 2GCGA 1PWHA 4G1BA 4PS0A 4Z3OA 2VAMA 3JYQA 4ND8B 2B4QA 3VYUB 5LNK1 1X6VA 3AF3A 1NVAA 3GDGA 4JBGA 3WGOA 3KWFA 2J7PA 2G28A 5H81A 1WXQA 3EPJA 4GD3Q 3BFXA 1D2MA 1C4KA 3W9YA 1RHQA 3AM4A 4RZXA 1A9XB 1E0DA 1Z7GA 3OKPA 2O1XA 1B41A 1UPUA 1T5TA 5TY0A 4E1AA 1VKHA 1X2BA 5BNTA 3IEMA 4EI9A 4EHNA 3A2NA 4GBMA 1VL6A 4JP2A 3E9MA 5MFPA 1CULC 1YNOA 3CZQA 2COEA 3OOJA 5JAUA 2ZAMA 1P3Y1 2MSDB 3LOPA 4XCVA 2CZGA 3LGSA 4ENWA 2H1HA 4BKPA 3JD4A 1N75A 2BISA 1FP4A 3DFKA 4L9RA 4LI3X 3DR5A 4Y2RA 3HCCA 1M2OB 2JGMA 4PQRA 4YS6A 1AB5A 1CERA 1V4BA 1AZLA 1ZIOA 2ZYHA 2FQXA 2I87A 4LYJA 1EFAA 1CUFA 4AXXA 1P61B 3PC3A 3UCEA 2V0CA 1ZA1A 2UXBB 1U3TA 5FADA 3SYNA 5FRDA 5M5BA 5G0UA 3HGMA 3VYRB 1JR4A 2PUEA 4JHLA 2OAP1 1GUAA 3A1EA 4DMLA 5JTTA 3WSWA 3I5UA 3MTDA 3UCXA 3X3HA 1KMCA 1COZA 3ZY6A 3IMKA 2MSEB 2B7LA 1I4DD 4FHCA 2BLNA 4U7FA 2ZZMA 3D3WA 3HI4A 4MRMA 5CB6A 4DG8A 1F7VA 2V0GA 4IH1A 2DQKA 2HQBA 3G5MA 1H8ED 1NQ5A 1RRFA 2IGBA 1G6OA 3QBDA 2O8CB 4BIIA 2RC5A 1RYEA 3MWDB 3BFJA 2O6HA 4A73A 4EB3A 5JZ9A 2Y1KA 2ARKA 4G4SP 2JDID 4LE2A 3NKVA 1Y1QA 3IQHX 4L0MA 5D6NA 4CPDA 4W5TA 1N34B 4RTSA 1CFZA 4JC5A 4R8RA 4WFJA 3SLRA 4QT0A 1R6DA 2OGUA 1XEAA 4P0PB 1E94E 1NP6A 3I1FA 3N8DA 5FCDA 3U9LA 3I42A 4E4TA 2BCGY 4GGMX 1TFRA 2IA5A 4OQZA 3ZBUA 1ULZA 3PXDA 4P08A 3UW1A 2VP9A 4H31A 4S1PA 4XOIA 3WGQA 5L3SA 1SU8A 4PRKA 3DVAA 1IHUA 2J7KA 1E9AA 4JB8A 4MDEA 2V45A 5D51S 1OZ0A 4ZI7F 3P2IA 4JLWA 4ZT4A 1N4DA 3VO1A 1OLOA 3O90A 4FONA 4RS4A 5FNVA 5LP6C 3DOCA 4L8FA 1OH8A 3UG6A 4OH1A 4P4SA 4N76A 1GTG1 2C8VA 5AW9A 3ZCRA 2OG1A 3LYAA 3OM1A 3TWOA 4YRMA 2JH3A 3G79A 1QWOA 1W8DA 3JQ8B 3L4BC 2CF6A 2HMVA 1II8B 4MOWA 3T8YA 1KQ3A 5IM4A 2GK7A 5KVSA 2D1FA 2WV9A 2XW6A 2JLYA 4PFQA 3E9DA 4CMIA 1MG0A 3K0BA 1YZUA 4IFEA 1C8BA 3ZWDA 1TUBA 2BKUA 2JIMA 1AV6A 3AP3A 1L4BA 3NTUA 2DY0A 1BNCA 1YVEI 4XVRA 1US8A 5AHOA 1YK0A 4ZVQA 5CT8A 4F0JA 3FYDA 2PGJA 5B53A 3LP6A 4OQNA 2C7QA 3WSTA 4KQXA 1WB4A 1O6FA 3GHYA 3HFSA 3TR5A 4F3KA 5FUMA 1KYIA 5EG5A 2YJTD 3M4JA 1MO6A 3UOAB 1J21A 2IBMA 3TTTA 4NDZA 3KTFA 4NOJA 4CKCA 4D9JA 3SDBA 3IFSA 1XMSA 5FNVB 1IY1A 3GLFE 4A26A 4OHYA 4NG4A 1P45A 3BWXA 4RQUA 2P7HA 4P4SB 1Q0PA 1R0XA 3MD9A 2FYTA 1TFUA 2EW2A 3U4MA 1YBFA 5ILGA 3H2KA 1RKVA 1KO1A 3C3JA 3QPWA 4OYHA 1MVNA 2YMQA 4UCFA 1LRJA 1G2QA 1SC4A 1XKTA 4RHCA 1T9BA 2F00A 3BS4A 1QMGA 3CLVA 3GEBA 1RQ7A 4XFDA 5IPFA 1IPFA 1B0PA 3PQDA 4GMDA 1XB2A 1V7CA 1PDWA 2RD2A 3FNFA 4LN1A 4TLEA 3PDIA 4U7WA 3RRYA 1A7AA 2W0MA 4FFDA 1OILA 1OOEA 5CFMA 4NBLA 4TTVA 1SRRA 4BUCA 1MO2A 1V5IA 5A0TA 1JALA 1J49A 1FPQA 3OWXA 4FPXA 1E77A 3QUSA 4GMXA 1CHNA 5E7MA 4BO6A 1PLKA 3OZFA 3KSUA 5JMTA 2Z6UA 2CHEA 1WDLA 2V55B 4CKCB 3RC7A 5A5VA 1NYTA 4JEUA 1C0IA 4CM4A 2XOXA 1EH5A 2B5VA 4QX6A 5JJBA 1ULAA 2I54A 5HHTA 3QU7A 1NQUA 1YE8A 2GTPA 3PLNA 5CCEA 5TLSA 1OXKB 5A3SA 3NS7A 5KI6A 1U3VA 3BE5A 2WB4A 3LZCA 1JIQA 2HBQA 3HCPA 4GZ3A 4P82A 2B61A 4Q9KA 2EARA 1NN5A 1U7TA 2GPAA 3VUEA 2EKLA 3C5CA 3I76A 4KRYA 1B93A 2BHLA 2P65A 3AK4A 1WG8A 4C29A 3IT3A 4NJMB 4BV9A 4URXR 4B3RB 4DLTA 1YQWA 4LWQA 1NSYA 1CG6A 4MRPA 3EVNA 4EYSA 2E2WA 3KPYA 3PDIB 1GLVA 1FU8A 1SVMA 2QTGA 2R3SA 4G5HA 4WOJA 4YRRA 4F1KA 1SQ0A 4REOA 5JSZA 4OAOA 5SYAA 5F9HA 1BE8A 2HCBA 5HZMA 1YCFA 3HDGA 3DZ8A 1LDMA 2DSNA 4GS5A 5FI3A 1GAJA 5A0VA 1G8AA 3I2FA 3KJEA 2QMUA 4H7HA 3JRWA 3MQ2A 3SMVA 5E8RA 1DXYA 1Q6YA 2Z95A 5EJIA 1AKTA 4QGFA 4CLEA 1SB8A 1UOPA 3TOXA 2WPNA 3MTIA 1T9HA 4GMHA 4LJSA 2YUTA 2WUEA 1V1MA 4AY2A 4MYCA 5HE8A 4Y2HA 4BVFA 1PFVA 1ZOSA 3A3NA 1ZGHA 5JISA 1XAJA 3BXHA 3QPUA 1X1DA 3E9QA 1X7WB 1QIFA 1G64A 2LNDA 3GW8A 3NTOA 1UWCA 3ZDYB 4CM5A 4DMUB 4RVGA 3O1IC 1R0LA 5KC8A 3IAFA 2W4QA 2ZSIA 3CG0A 4N5MA 4TXJA 3FNEA 3PGVA 4MV7A 4D8XA 4QXRA 4C0AC 5F23A 3BFKA 1A7JA 4YCBA 3WHPA 1WA5A 3I12A 4M0PA 4D0RA 1FDTA 4LXUA 1O4VA 4UM9D 4US1R 1P1FA 3CX6A 3R44A 3VR0A 4BKRA 4D6XA 4G3XA 3SIWA 4ZYVA 5FLYA 5KMGA 1Y3FE 5KPJA 2DM6A 1ZH2A 2DMRA 1RQXA 3HU3A 3QVLA 5AM1A 3VR4A 2C8KA 4RGQA 2UV8A 1ZIYA 2I6FA 4MMYB 2QAGB 2GGSA 5BNFA 1G5PA 3CX3A 4JNCA 3E5MA 4ENVA 3EYWA 4MR8A 1JDTA 2ATCA 3L79A 5BSTA 1CX9B 4EGSA 4ZJPA 3BHMA 1DL5A 3KOZA 2C59A 1EZ4A 1ZPDA 3BD8A 2Q50A 3MFYA 4MV5A 1V3VA 2XVXA 3AT1A 3H9CA 5IVDA 1ENYA 4FC6A 1UKVY 1CP3A 5F64A 5FPYA 3II6X 2DT5A 3MJSA 4FMDB 2YN0A 4Z86A 4KR9A 4F56A 4I4LA 4ZVUA 4OOFA 4AKGA 5EE1A 3VJKA 4JXZA 4R1LA 2WA1A 2Q4TA 3C7KA 3SM9A 2C92A 5K4GA 1OI4A 4FR2A 1VCNA 3KHUA 1GPYA 1RYNA 1Z2AA 3KT0A 3L05A 3NFYA 4GP6A 4JC8A 1Z7YA 2FK7A 4FJ1A 2QGNA 3GT4A 1GFWA 1U0FA 2HMAA 4DBZA 1TKCA 1R3DA 1SGWA 3INYA 3GH1A 3FBWA 3MWLA 1WXWA 4ZAXA 3WL7A 4MR8B 4RC9A 2HQRA 2YZ7A 1QFSA 3SFTA 2V6GA 4X5OA 4LVCA 1XL1A 1NBMD 2F3SA 3FYUA 2G4CA 5HS4A 1GN8A 5KNDA 1PV4A 3I45A 2PZGA 1DDOA 4Z9FA 3IX7A 2PZ8A 2IV7A 4UTRA 2VATA 2Z5GA 2XZTA 4L6AA 4OQLA 4EX6A 4F92B 3K9FC 3GNLA 3NEPX 2ZTVA 3P9RA 5L3RA 1AKYA 2EEZA 2F59A 3K30A 4RESA 4BP8A 1JT2A 3KO8A 5A3RA 2O5EA 4EG4A 2ZRNA 4P7KA 4QVKA 3A3PA 1U0HC 3T3NA 4M21A 4Z9AA 1I1HA 5CXXA 3EG9B 2O1SA 3MUEA 5BV0A 3MLEA 1ZY2A 3RK4A 3FIJA 1S3FA 2R65A 4IHKA 4AMUA 2F4NA 1NURA 2I3ZA 1H65A 3NHPA 3OY2A 4DPMA 3NKLA 5HKAA 4N3BA 5INTA 3HYRA 1EP2B 3QFSA 1CKEA 4QDKA 4I8DA 5FO0A 2PLNA 4FDLA 4IYRA 1GQFA 4RA6A 3TI7A 2G9VA 2I6SA 5EMNA 5HJEA 4I81A 1U8CB 4Q1CA 4KWTA 3ZI7A 4HATA 5H5JA 3B3FA 3EY9A 3MSXA 2QWXA 1R50A 4M38A 4P4TA 4YXFA 3K6JA 3AKZA 2QN8A 2PS0A 5DGTA 5J2UB 1FTQA 4YAOA 1E3MA 3WZ2A 2IP1A 3F71A 4MCJA 3PRJA 2AQHA 3EE6A 3DC7A 1WX1A 3GYBA 3PR3A 3SXUA 2XYPA 4A8JB 1T1RA 1C29B 3NT5A 2R62A 1I3CA 4CL2A 1EXNA 1F6BA 2GQ0A 3I1JA 4OO3A 1YRQA 4IWYA 4JOSA 3ENZA 2JS7A 1Y3HA 4S1OA 3VOTA 4Z7QB 1C1YA 3AVPA 4Q39A 2IY9A 1GDHA 1MA0A 1OLXA 2PTGA 1G21A 1VIAA 3G2JA 3LBIA 1D8AA 3MAAC 4PLFA 4L0CA 1LPSA 4MVCA 2OCIA 3M34A 1I1NA 1FDVA 3JW8A 4CIBA 3GCWA 2F9MA 2ZWVA 1Q6ZA 1RFGE 3D8TA 4L2IA 3ZS8A 4TYNA 3ICWA 1TD1A 1XBTA 5TMDA 1SOVA 4QFDA 1LC0A 2WIAA 3U4CA 1VGRA 3WRWA 1FXWA 2YTZA 1PBTA 4J8PA 1UCFA 2WP0A 3PBKA 2HC9A 7ADHA 3JVEA 1AKEA 1QGOA 4E88A 5JXJA 2VYQA 3GYGA 1YKFA 2FSIA 4DLNA 4AWXA 2HDOA 1DG9A 4GBJA 4LHYA 4DYVA 3QEKA 3N28A 1E2DA 1BXRA 1E5DA 1ZK2A 2WHYA 3A7DA 4YRCA 1SIWA 1SBYA 4ZO6A 4KQCA 4MP3A 1KMQA 3ONDA 1C80A 3SXUB 2O48X 1Q0UA 1MV8A 2WF5A 3U4QA 3VGPA 1QIHA 3H9JA 3PICA 4A0HA 5KWEA 1U7OA 2IHVA 3KB2A 1J97A 3B82A 2WNSA 2B35A 1RSZA 2GPNA 1GOTA 3DVQX 1P1BA 3O4HA 5IT9A 3B1JA 4FBMA 3RFFA 1FY2A 5ALNA 4YAIA 3FYUC 3KEGA 2WAAA 4WAUA 4CI9A 4NYJQ 1JQDA 4XUDA 4ZVMA 2JFNA 3SBOA 4EHBA 1RJGA 2RIPA 3BYZA 4PGHA 2BKLA 3ZWMA 1NI4A 5KVQA 2IXBA 1HQDA 1RXCA 1T2AA 4KUEA 2Z83A 1DIGA 1QIJA 1CR2A 2GCEA 3QEOA 4E12A 3K0EA 4CF3A 2ZJOA 3IR7A 2ISSD 4PHCA 3O0TA 4B4DA 1KAQA 1Y6JA 3QVSA 1YE5A 4RW0A 1PTJC 2AG1A 2NU9A 1AD2A 1CLEA 4CT4B 4Y2GA 3LQRA 2G0TA 1N6NA 2HK9A 2QRLA 3A36A 2V7UA 5AVQA 2EATA 1JG1A 2HJRA 3W4IA 1HOXA 1P62B 4DA0A 3SNHA 4TVBA 4LNHA 3KETA 4L4RA 1VG9B 4NZYA 2WQZA 2P4HX 3EQZA 3ORFA 3QHPA 4EABA 3JQBA 4YJ3B 1BCSA 1N3BA 3EX7C 2NSYA 3PF8A 4YUYA 1X1SA 2Y4OA 4GM1A 3VJLA 1GRVA 3SZLA 4BL5A 2TYSB 1NI4B 3FG9A 3M6AA 1VXOA 1LVGA 1XHLA 3GY0A 4U2KA 1ADCA 3ZDFA 3ZY4A 2CLIB 1IN7A 1Y9ZA 3D43A 5C8YF 1N92A 1NT4A 2VHWA 3KAPA 5KNCA 5LWQA 4F6LA 2IODA 2QTHA 1DNPA 1HT1E 2RKBA 5KWIA 4E1VA 4I55A 1Z15A 3H5AA 1C4WA 2Z0MA 1WUKS 3D6JA 3JSXA 4K81B 5JAZA 5E9JA 3DDCA 3AM5A 1EFTA 3I01M 5CMLA 3Q7QA 1XVTA 2Z08A 3KAKA 5EFOA 4FSXA 3NBZC 1P4AA 2HTFA 1QJCA 1V8PA 2JCVA 3W5UA 2X3UA 3LWZA 3C7DB 3IT2A 4V39A 4RV4A 3STWA 1N1MA 2X76A 2YXNA 1BCSB 2H16A 3MUFA 3T06B 5CB0A 721PA 4F91B 3HCDA 3SXJA 2RHLA 2O0HA 4FBLA 4F7WA 4YASA 4TRNA 5BSMA 1IJFA 1MAHA 2JI8A 2WNHA 3NHLA 3C4JA 4O4HA 3F8WA 4FGUA 1ZCAA 2FFQA 4HLDA 3GEDA 4DJJA 2H7XA 2F67A 4GICA 5AVRA 1RJWA 2DYKA 1YDHA 2FPXA 1JU3A 3GPDG 4RJTA 1N2EA 3LH5A 1P33A 3CSSA 2TSYB 4I55B 3T9AA 4L5IA 4PQEA 2GWRA 1VGQA 2HBRA 2IYEA 4B71A 1X7YB 3FMFA 3GFGA 2BFFB 3PNBA 2FSVC 2NZWA 4GMKA 5BW4A 2EW8A 2X1LA 3IP9A 2LW7A 2PUGA 1ULTA 4WIAA 5C7YA 3T7RA 2BHRA 4KCGA 3GN2A 2WWIA 2PFGA 3EBPA 5KQPA 4M0EA 1KFEB 4J0QA 5MF6A 2VEOA 3V4SA 1AXGA 3DMYA 2BV3A 2QLNA 3OTGA 5J23A 4MQ4A 5AVVA 2WSYB 1YR6A 5M2QA 1XK7A 1MXHA 4KUGA 3QKWA 5JH7A 5TPWA 3NNDA 3ZBTA 2I66A 3WE7A 4GGOA 1DWQA 4NV0A 3H6HA 3ZHBA 3ELBA 2BVNA 5HM8A 2ZAIA 3AVWA 1GGKA 3CT6A 4IH4A 2H5IA 1KR5A 1NWCA 3G68A 1CY6A 3OLYA 3OX2A 1PX2A 1IIBA 2HJWA 2I71A 1OLUB 2F1HA 3AVOA 4IHJA 1BWQA 2EJBA 3DKVA 4U1RA 2QX8A 3JQBC 5A9SB 1T3TA 3NR2A 3GA7A 1XRNA 2REQB 4TWBA 5JSYA 3NNNA 4A2PA 5ETJA 3QWFA 1W85B 1TTTA 4MW9A 3SY8A 1FMLA 5F9FA 1JRLA 1QAMA 2LBPA 2KHZA 4IQ0A 2MT9A 3OWOA 3E3LA 3GGGA 4KGVA 4NBVA 3C5VA 3K1JA 1K6IA 4ARUA 4NI5A 3FYHA 5L95A 1PP4A 4WXYB 2KB0A 3CUWA 2AYZA 3VVLA 3COJA 4Y3UA 5CW2A 3WKBA 2K7ZA 4MVJI 1PJLA 1J0DA 2EX0A 4UHHA 1CF2O 3G23A 1M0WA 1MRNA 3V1MA 4L5AA 1UIRA 2IU3A 2Z3ZA 4IOMA 4X84A 1E1CA 2JJ8A 3OEWA 3T4PA 4C43A 4MR7B 5FUQA 3LTNC 3RYTC 4GLJA 4M87A 5DGHA 4WGFA 1EVEA 4BO9A 1F0PA 2WMOB 3G1TA 3GRZA 4HAYA 2OD7A 4MV8A 3N8HA 4N0MA 1A8HA 4MW5A 3WGKA 4IV5A 2D8AA 1VHQA 1N33B 2X9NA 3AG5A 1HY3A 5LLSA 4YCJA 3V6LA 5LQMA 1XTPA 4KC0A 2W6PA 3OKAA 1SIUA 1ZRSA 2CXQA 2JRCA 1PYDA 4LE1A 3TKLA 3ZD9A 4CR8A 4ZOQI 4OJNA 2UYHA 1FYXA 1G9XA 2ODBA 2R11A 2V7VA 3P2OA 3WYFA 4LBYA 3MBKA 3IUBA 4H3SA 5FBZA 4M0KA 1L7BA 5LVAA 1XU4A 1N3YA 2NVWA 3CZCA 4KGDA 3DLTA 5H16A 3BQ9A 2GCPA 2XYGA 1VLQA 3TVYA 5I01A 4F12A 1G59A 4PLWA 1Y4DE 4N82A 4EHKA 2Y68A 4RZUA 1JVSA 1WVGA 1AF7A 2NTEA 4LRWA 1T2UA 2PSJA 3ZW9A 1NUUA 2ZRDA 3DKKA 4FT4A 2OGSA 4WXPA 1W4RA 2CD7A 3NYQA 2Q4OA 2JBWA 2PT5A 3ZDXB 1FOEB 3M49A 4IG9A 1NIJA 3HU2A 2JCYA 2BOVA 4O02B 2WSIA 4ZRDA 5K0NA 4DRZA 4NJEA 2RH4A 4F1WA 5BN1A 1RCUA 4FGSA 4E4RA 1HE2A 2RKWA 3N87A 4JP8A 4N6OA 4XJVA 4Y6OA 2HNAA 3OLQA 4I7EA 2PLWA 2V9ZA 5JZSA 1OIWA 4RNDB 3ZH9B 4TYMA 4YCLA 2CYBA 1RPJA 4WZZA 2RHHA 2QN6A 1QMPA 2J07A 1WXDA 1NBAA 3U7QB 5KTNA 1UEIA 1R7RA 5DK6A 1UJCA 4N5NA 2V9PA 3HLKA 4U7TB 5ER6A 1C14A 4O2RA 2P2ZA 1A9QA 4Z7NB 2VPPA 1UBSB 4QODA 3ZE8A 3I62A 4JLKA 4NZZA 4WLFA 3TL2A 1EVYA 3O93A 3TGWA 1Z2PX 3CBGA 4LNAA 5I7AA 3TEMA 3PZBA 1Q5PA 3VHLB 2VRWA 4HGRA 2IL1A 1ADGA 1DXOA 5DM60 1R8YA 1DIOB 1XTBA 1N6KA 4B6GA 1NW9B 1R6XA 1UOOA 5HTOA 1NN1A 3EGDB 3GG2A 4NJEB 1NE2A 2CB9A 1LI7A 2AMYA 4KIWA 2P69A 2XOKD 2R8XA 3O8CA 1RD4A 4DHWA 1JFFA 2Q7XA 3ZK7A 4D9MA 2A9RA 1CLUA 4MROA 4O1MA 4F04A 3WNBA 4G4IA 2AE1A 3BREA 1P29A 1T9GS 4CETA 2PX0A 1Z35A 3SQOA 2EGUA 4UD2A 4XX0B 1Z0UA 2JGFA 4N8SA 3O1HB 1BWPA 3PTZA 2Q3JA 5F1KA 1QR2A 1SA0B 1SCIA 4U2FA 3ANNA 5DP2A 1GAXA 3DZDA 2VJNA 1XZEA 1Q22A 4BGDA 4KR3A 3QI7A 3TMAA 2PMEA 4NBNA 4CCSA 2GEFA 3DDHA 2IOQA 3QMVA 3RVJA 3MJ4A 4GUDA 4JJ7A 1GGEA 3ILXA 3RSOA 2UXCB 4KXUA 5E38A 3BILA 1L5KA 3AFGA 2C99A 1SBTA 5B1SA 3RWMB 5CB8A 2V7QA 3HN6A 4K0RA 3PS9A 1L7RA 4C1BA 5HPYB 3VM6A 1YKGA 4D4KA 3UTCA 1GYRA 1U6KA 4KQ2A 1H9AA 2P30A 1JFFB 5MN6A 5J47A 5AVWA 3E84A 3FZQA 4OHCA 4YJ2B 2Q6LA 2XBMA 3L84A 5DIZA 3RVQA 4MPJA 3CZ5A 2PXHA 1L4HA 1NX9A 2P2SA 3D81A 2C54A 4ND1A 4PG7A 1QG6A 4WQMA 4RENA 4K9LA 2DR2A 4JJKA 5KTTA 2C7GA 4GI1A 1PZXA 2BEKA 5BVHA 4MP6A 4NNJA 3QVKA 3PHCA 2GJ4A 5DM0A 1GEEA 3WLKX 4X1KA 2ZATA 4L5CA 1NMQA 1B8PA 1E1DA 3ZHCA 4LNUA 4MA4A 3TZQA 3GRVA 1ORRA 1L8XA 5E3JA 2VBGA 1XEFA 3IPXA 4Z1MD 3HM2A 1DXQA 2J3MA 1JXQA 1N5MA 4N39A 4WHMA 621PA 7REQB 3EVGA 4JD5A 4DJTA 2P91A 2OCYC 1JI0A 3Q7RA 3TN7A 2OV8A 4EVIA 1RQ2A 4RSHA 3SOZA 4R31A 2ODNA 1G98A 1SNYA 4Y6GB 2YXLA 2JFYA 3MGGA 4UHEA 2WTEA 3GUYA 4R2WA 5H9VA 4Z3DA 2AX4A 4GG1A 3O91A 4NH4A 4PX5A 2JJ2D 1GRNA 2HDWA 3PITA 4FGWA 4YJKA 1KQNA 2DERA 5GJVC 3E8XA 1WMDA 4EY7A 4GNKA 3DOJA 4YECA 3MSCA 1ONBA 4DW8A 1A4RA 4P0QB 3AVTA 5AI8A 3EASA 4DGQA 5BVHB 2ZWIA 1GZUA 1UMBA 3DAHA 3IP3A 1TVCA 1ZU4A 1JW9B 5AJWA 4C05A 5I3CA 3LSYA 4E21A 2HIGA 4LNUB 1WHSB 4I9UA 5JV5A 2XT9A 2Y0EA 4DLWA 1CETA 1T13A 2DBYA 3MGKA 4N9WA 1T8UA 4NFLA 2GK6A 1NDHA 2AE2A 3A4YA 3ANSA 4B3DA 4Y1EA 5EMMA 5K0ZA 5CD1A 2UUAB 1WF3A 4FMBB 1RYDA 3O73A 1UDXA 1YKSA 1JBKA 2BSXA 4AKTA 5BR7A 3E8SA 3AEQA 3RADC 5B2ZA 1NF9A 3W8RA 2OHOA 4QNMA 1U5BA 1M7BA 1YVDA 3AL3A 1NBOA 2JW5A 2WJ6A 4G1FA 4HFJA 1QF9A 3OQHA 4R9UC 2OB1A 4EG0A 4UOZA 1OR8A 1XC7A 1XVLA 2I4TA 3R23A 1FZTA 2FLVA 3GLVA 1AGXA 3MCZA 1ZD2P 3LDAA 3PX3A 3PE6A 2H08A 3ABQB 4I08A 2P2YA 4WADA 1KEZA 2REXB 1CUCA 1KMNA 4DLYA 4E22A 3MPUA 2OXCA 4LDJA 3LWNA 4HQFA 3KXIA 3O21A 4MVJA 1I2CA 5THQA 1X19A 1P72A 3FOBA 4NHOA 3IEKA 1GEGA 3DOOA 2J3LA 2JJMA 3DE1X 1CS4C 3GD5A 3P1JA 4FDAA 4KAXA 4KLAA 5CBPA 4F97A 1NYQA 2C5SA 1QF7A 4DYHA 2HT1A 4MYRA 2JD2A 4KN8A 4Q4JA 4KQGA 4LBWA 4YMUA 3VYVA 1P1CA 4Y2VA 4DARA 1P80A 1CQJA 2FK8A 4PZUA 4HGOA 3LP5A 1EFHA 4PZ0A 3A0RB 5G40A 3C7CB 2UZAA 1UBUS 1J33A 1I6WA 3SU8A 2I4OA 4LJLA 1EQ2A 4ALMA 4DJFC 3MWFA 2WG2A 2W2OA 2XF8A 5CVDA 2NO4A 4FOSA 5B1IA 3USCS 2II6A 1L5MA 4PSAA 4JKOA 2FW8A 2AD5A 4OHUA 2HPHA 2XTMA 3C3DA 2QL6A 3T5TA 3TEFA 4MWCA 3KKMA 5HYVA 2IU4A 1L1EA 4MQUA 5E1MA 4BJ1A 3IUEA 3PC7A 2R1VA 1ZUNA 4FB5A 4B09A 5FTNA 3K8OE 4F2PA 1ZSVA 3CX7A 5TJ9A 4D9KA 4GU5A 3V4PB 1U7HA 1UKZA 3ESXA 2G5PA 3X1MA 4ZVNA 3T1YB 5C7OO 3MTAA 1C30A 1VE9A 1H42A 3COWA 1E79A 2R8ZA 3VO2A 4NZOA 4B4KA 2QUAA 4KFUA 3SPXA 1NNI1 3QXJA 1HSOA 4ZTBA 5CBPB 3IA7A 3LFTA 3FNHA 1XXHA 2O8NA 1S2OA 1CR1A 4Q4JB 2V7BA 3KKNA 2HZBA 1PR6A 3GJYA 3HFRA 1F2TB 3O8DA 1D6JA 3F5DA 3QKUA 1LS1A 1Q1AA 2HK8A 4HGQA 4J0IA 4LVOA 3SF8A 2B30A 2EQBA 2R1UA 3WNVA 4A10A 3U5TA 4N5DA 2HLDD 4UEWA 4EO7A 4URZR 3SYLA 3CS3A 4C0WA 2O19A 2X6RA 4BQIA 3OCVA 4H0CA 1ZVQA 4EZEA 4Y6SA 1O97C 1HDEA 2B3DA 2XWQA 3GO4A 3ZCVA 1HLDA 1ZBQA 3M1AA 2G04A 5JARA 2HHAA 3ZWKA 4FYIA 2K2WA 3I4FA 1A5BB 3K4QA 4OKIA 3DZFA 4R54A 4TLCA 2DRIA 5DNDA 1QFYA 5DRTA 2AG0A 1I5OA 1E96A 1NVKA 1ZUNB 2X19A 3D64A 3PFFA 2HI0A 2N42A 3EGXB 4RVOA 4TMZA 5ALMA 1HNNA 2DHRA 3UB2A 3ANYB 3L02A 4WRRA 4RZQA 1K86A 1XJWA 1T8TA 2ODEA 2Q49A 2QQFA 2QTFA 1G2OA 2ONZA 1XDUA 1JNYA 3C6ZA 2VXYA 4HB0A 2GXSA 3EZXA 2XUGA 1GZHB 4N7MA 1CEYA 2XOEA 4BFYA 2MMCA 4KPEC 1TYZA 2PE5A 2PD6A 3D5QA 4JLAA 4RCVA 2XR1A 5GIOE 2XODA 1UDRA 5A9RA 2JZCA 3RIHA 1D07A 1ZSYA 4Q4DA 2EERA 6PFKA 2L2QA 1L7QA 2H2FA 2VJBA 5TQ0A 1R10A 4C0XA 4AB1A 1JVBA 3T0GA 3ROKA 1KNXA 4NBUA 1CUHA 3N74A 3G5LA 4YC7A 4S04A 1ZICA 2H2GA 1OU0A 2W2MA 2HSWA 3JARA 2YZNA 1HZZA 5AI4A 3LKZA 1Q0TA 2Q0HA 1Z2OX 1LVUA 3H0KA 2ISQA 4ZI7A 3KYDB 1PT9A 5ARBA 3RYIA 1TLLA 1IRXA 1P0PA 5GWXA 1B3BA 1LPOA 2E5LB 1JKJA 3TOVA 1FVFA 2QUHA 2X4DA 2B78A 4GWGA 3PFBA 2H07A 4LDQA 2C83A 3R6TA 1KJZA 2F2TA 4LF4B 3A3OA 1UODA 2DTDA 1M8FA 2HUNA 2IYTA 2ODTX 3I61A 1O08A 4UUNA 5JU6A 1CQWA 2GBIA 2C3UA 3U7HB 3B9PA 3U49A 3WNCA 5LLTA 2WU0A 4LXGA 3T7JA 2FUNB 2FQYA 3KL4A 8LDHA 3FDZA 5H3CA 2OD2A 3RAJA 2C58A 2YS7A 5TQ0B 4BMSA 2JJ1D 2WIGA 2DTEA 3HXPA 4GLOA 3M89A 1K5PA 4BNWA 4OAPA 3GUVA 5K3DA 2VH1A 4B3MB 3WLAA 4GL4A 1O94A 3N2EA 4MWGA 5BPFA 5GONF 4DSZA 5LYJA 1VMEA 1N8NA 2G72A 2ZWMA 3N8NA 4GKVA 4GVLA 1SCKA 3OOWA 1OKKD 2P2NA 3RYIB 4EJ0A 2HHJA 4F2HA 1Z68A 4M37A 1IBCA 3X43A 1OASA 3ZLUA 3U61B 4HVCA 2FN9A 1KXJA 1M5UA 3IT0A 5KHLB 4YJGA 3ADCA 4O2LA 3F6YA 1PNTA 4EZIA 3H13A 4ZMBA 1QG0A 2VR1A 3ER8A 1OPRA 1LBQA 2FP4A 2JAPA 3F3SA 5ELMA 3QM1A 2DPMA 4E33A 2I6UA 2AOUA 4LGMA 4B6SA 1N8KA 3UW3A 1KAGA 4WKPA 4OGKA 4M53A 3WHLA 4CL3A 3UWDA 4JI0B 4MITA 4AO6A 1RIFA 1G0NA 3FVRA 2CHVA 4AUKA 1BHQ1 4FFSA 3ZWPA 2MJLA 2HDNB 4NARA 3P0FA 2P0AA 4BB6A 1E2PA 3T1QA 5JW6A 1KQPA 3D8NA 2H06A 1KY4A 5HDQA 1YR9A 2RC6A 2ZJ5A 2BHNA 1ZK3A 3B1KA 4Y0VA 2D00A 4X65B 2IUFA 2QR2A 5FUYA 1RLOA 1VMIA 2PEYA 3DLIA 4FJ2A 5KOHA 3G7SA 5IJXA 3S29A 3U1BA 1H4VB 2QTZA 1G63A 1XMPA 4D43A 4DM4A 1WPQA 2OVFA 2OHFA 2J09A 1LJUA 2NV2B 3K20A 3QFRA 4ND6A 3RBZA 3AWDA 1YUNA 2XZDA 2X2PA 1S2MA 1LBSA 1ZC4A 4ZO4A 1ADJA 3VNBA 2WJPA 3A10A 1CJTC 5C3UA 5L4SA 3CX8A 3TQIA 4HXYA 2EKPA 1A2BA 1HZZC 5F5LA 4F06A 3RJZA 1U8AA 2AOUB 2QN2A 3BK1A 3IBCA 3QELB 5IKOA 1AQYA 1OB5A 3MWKA 3Q0IA 4DV3B 3O95A 2CCJA 5DV9A 5E2IA 3W6ZA 3X1DA 3C8ZA 3IKTA 1GZ3A 1AKWA 2NTVA 2PPLA 4IIJA 3HBFA 3WGNA 4J07A 3UUFA 4CFSA 1SVLA 2JGLA 5C4MA 1EINA 1YIOA 2GKGA 3AR2A 1I7PA 4NE7A 3GLGA 2TMYA 3L1UA 3H1AA 4NC9A 1FDSA 1L5LA 3V32A 1C5KA 4HNHA 4AJEA 3ZHSA 3AP2A 3CVYA 2FWAA 4XFKA 5KOHB 4BEBA 1T15A 1T10A 2FGKA 3GX1A 4JS0A 4XLZA 3DE3X 2OHGA 5EZQA 1GZSA 2FNAA 4PC1A 3GLIA 5MHTA 3DDNA 3KVNA 4AY4A 4WZ6A 2G7MC 1VCOA 1XZJA 3HPQA 3REQB 1M5RA 4MS4A 1RJ9A 3DJFA 3ER6A 1UBKS 3HB7A 3L8CA 3LWBA 3PNOA 2VSYA 4J0JA 2EP8A 2IPMA 4UXJA 4BEJA 4YWHA 5E6SB 4URFA 1O94C 2B0JA 3WOHA 2DHCA 2XMGA 3F9CA 4Q15A 3FCXA 1SUBA 2PT6A 3FR8A 5CM2Z 1E1QD 1T8WA 3H7AA 4TTIA 4XVHA 5GAJA 1MT0A 3CR7A 3P4UA 2CNOA 2UYOA 4QDXA 1CQXA 4D0LB 2NV0A 1E59A 1QS0A 1DSSG 1E89A 2YINC 1OWMA 2IW3A 2OHXA 3N2ZB 4KGXA 4L15A 2ILTA 3KQYA 4OB7A 4F2GA 2R44A 3OPQA 3OF5A 2QBYB 3HGTA 1GIAA 3KCQA 3V6MA 1SPXA 1YS7A 5U1PA 1M1YE 3EUAA 4B6EA 2OQRA 3GLQA 2HHCA 4KYUA 1IM2A 2GNAA 4IFTA 3VYWA 5KCMA 4ECAA 1E2FA 1VCIA 4PNPA 2DJIA 1IONA 2C3OA 2I29A 2ORVA 3Q2KA 2WKPA 4YCCA 3OJWA 4LZOA 3RUIA 2VTBA 4Q12A 4MS4B 2RAUA 2WKRA 3Q4GA 2DUJA 1YH3A 2RHTA 3MCVA 1DINA 3PCRB 1NM5A 1YOVA 1QHNA 4YQEA 1R15A 1DZ3A 1A77A 4E5NA 2ATEA 4NCJA 2XA9A 2XWJI 3X2FA 1Y3DE 1MXFA 3HLTA 1ZEMA 2KBFA 2CDCA 4JFAA 2ACKA 5JJKA 4TLBA 3MF4A 3U3ZA 3A27A 5CLHA 3ESRA 3QTLA 5ADVA 3CZRA 3BWEA 1SC9A 1IE3A 1MT3A 3IAM1 4NDNE 2WA2A 2GS9A 4PO9A 4Y18A 4YMIA 1X1QA 2CCGA 4M1QA 2A59A 4DBLE 1AQNA 3TF5A 1QU2A 2GNOA 3OE5A 4Y30A 3BD9A 5CLJA 1QPZA 1U0LA 3I9NA 3N1UA 1T8PA 4LQDA 4BGUA 3D8UA 5ADHA 5IHXA 1CZNA 1WU8A 1ZH6A 2H9IA 2LCFA 3UM9A 1YTUA 1IQUA 3F9IA 1OXSC 1OXVA 1YOVB 4MRVA 3L6UA 1VI2A 1G60A 3IC5A 4K1XA 4MEAA 4EW6A 4KITB 3JWJA 5DBOA 2WOJA 3NHRA 1J06A 2QN3A 2GXAA 4MUHA 3UHJA 1XAIA 4HXGA 1XXHE 4QGHA 4RY2A 1E1KA 1GVHA 3S2IA 4BFXA 1OGYA 3VFDA 1RYBA 2ZB7A 3AVYA 1O57A 3L8GA 4YMTA 5CAEB 1PK8A 1Z5WA 4ZKDA 4J0CA 2ZIEA 1V7QA 4HP8A 4RXMA 2Q8PA 3CX4A 1JYSA 5JLAA 2QU8A 4NYMQ 3FPHA 3F7OA 4FDVA 1HE5A 1FP6A 2MDTA 2H4ZA 5DKFA 3ZDCA 4KPYA 3RW9A 3LUBA 3EH1A 1TUGA 5LBTA 3UZUA 4HWGA 2HPZA 3ROZA 4H3VA 5BWBA 2A67A 4TV8B 1JLKA 4WVFA 4A91A 1I9CA 1X0VA 2OLJA 3DFIA 1T9CA 2BZ1A 3PC2A 4K87A 2BDTA 3WLOA 2ODQA 1M8KA 2P0YA 1EVZA 2E21A 3U1TA 1PFWA 1OV6A 2YV3A 4FT2A 3MJEA 5L4LA 4HR7A 2AMVA 2G82A 2GA8A 4OF4A 5ITZA 5JE8A 3RQSA 4V0OA 5E3HA 3DHYA 1FC0A 3RS0A 1Y4ZA 8GPBA 4KFCA 1ZM4A 5EWLB 4A4DA 1LSOA 2JLAA 4O3MA 4M36A 1J70A 5DO9A 3RVSA 4H35A 1E6CA 4GWLA 5CLIA 1ZM9A 4ZVKA 1Z8DA 3E05A 2CJWA 1KF0A 1NM5C 4D41A 4K9RA 4PN3A 3D3JA 5KYTA 4NDAA 2AWOA 2AR7A 1YS6A 1ELOA 1HDRA 4BGEA 2YH2A 1FYEA 3AIOA 5AJYA 1YFZA 4RPLA 2JFWA 1GQ2A 3ZE1B 4CI0B 4LRSB 4OBEA 3HKDB 3WQQA 4LZLA 2BMVA 4GQBA 1D6SA 3VC2A 4TT3A 4XWAA 3GGJA 1JJVA 1PGPA 4ZVPA 2GK3A 3JR3A 4HVLA 5BP7A 2FI1A 4EHAA 2NYRA 2QT0A 3F49S 4YMWA 2GM9A 3C6QA 4UNRA 2DFPA 3AR8A 3ICVA 3K4PA 3L1VA 4HAIA 3P9XA 4XWYA 3R74A 1DQPA 221PA 5AUNB 1R4AA 4MVJP 1TYBE 1F9AA 2C1ZA 3ECSA 4RDXA 3IEUA 3OAAD 4H16A 4TMYA 3UJ9A 4CFZA 4ZYLA 1RVDA 1ZYUA 5DHAA 5TV2A 1DHRA 3W5CA 2VEDA 1TEHA 1Y5RA 3Q3HA 1FRNA 2V6JA 5TE9A 1YJBA 1EVLA 4U6QA 3B36A 1G55A 2OV6A 4EUNA 1WPRA 1XEWX 1Y33E 3CH4B 1JBQA 1YA4A 3IVAA 5CR9A 3OCXA 3U7EB 2H11A 2XX3A 2K4MA 3RJ5A 1KGSA 3OETA 5K8CA 3GLFB 4RZ3A 4XGKA 1IK6A 1BG6A 1JAYA 1G291 4OFBA 3CU5A 2GZMA 4C4PA 1KKUA 3SZRA 3I2IA 1L8QA 2YIJA 4URYR 3UGQA 1NKSA 2VF4X 4EHHA 3P5BA 3MBIA 3HJCA 2CDAA 4DOMA 3FM9A 1N8SA 4ZPJA 1U0TA 2BUAA 2EHJA 3D0OA 1ENZA 1Y37A 3TLGA 5DNEA 3A6DA 2OCLA 2OZLA 4ALIA 4EMSA 3NBFA 4HAZA 1EAMA 4L9WA 4HX5A 1V2HE 3DOIA 3LX8A 2XXAA 3VR4H 3FSEA 5EJ6A 3OE1A 4RAQA 1CDEA 2WD7A 2X0IA 3A6EA 3CEMA 4JUDX 5H82A 3FOFC 2I4LA 2W90A 5CHYA 5DISB 1H2WA 1AG9A 2JIZD 4PAGA 3BBLA 2ZSHA 4DMKA 1ISSA 2GO7A 2FLKA 4L6IA 4G4GA 3H5TA 5DHFA 4PFKA 2FY8A 4JBXA 1TMGE 4W1SA 4IFIA 2PVPA 1JHXA 5C8YA 4A2CA 2LWIA 1QX4A 5EMLA 2Q3DA 3JQ9A 4J0FA 4PQYA 2IC5A 3O7WA 4HTAA 1FTNA 4QGBA 2BMEA 2EAUA 4MWZA 2J7PD 4UASA 4X20B 1FFGA 1UBGA 1Q12A 1QFXA 5FPQA 3TLGB 3WNZA 3WKCA 3WQSB 4BO7A 4W1RA 2NWQA 4OI1A 2JHAA 4ZK6A 5SY6A 3B3GA 4XPIA 4UNQA 1IQ0A 1RM0A 3RJMA 4HPWA 5LNK6 1Z13A 4XJXA 4YUZA 1RKBA 3DFZA 4CKWA 1KRXA 1OAKA 3JAMA 2FPMA 3NUZA 5BNZA 5FEUA 1QO0A 2SCUA 2Q0XA 2Q3BA 3OQMA 1PJCA 1G8GA 1O54A 4QPDA 3LCCA 3HVKA 3V48A 3VDNB 2R6ZA 3TFOA 2P8SA 2NYUA 3VDXA 5GM1A 2X3FA 4Z51A 2PKQO 1Q84A 3GRKA 2ECQA 3GLIE 2GHIA 2G83A 1JDBC 2W4IA 3ZHZA 3ETHA 1TK2A 3RM3A 1K4MA 1VFNA 4C7MA 5B30A 4H1HA 5DLEA 2CNKA 4XCQA 1XRSB 4JBHA 4UHCA 4KH1A 3HYNA 5FBRB 4ZC8A 4N7BA 2DCMA 5G0VA 3V7NA 4B6OA 4CIVA 3NHKA 3VAZA 4CODB 3PNVA 5D3QA 1U3WA 4PC6A 3HVUA 3QI2A 3UMJA 1RXYA 1VIYA 1VBKA 1SC1A 1WOYA 2GAAA 3R0ZA 3TIGA 1JHQA 1JHDA 3BAZA 4DIUA 3FOZA 3BL6A 4UBKA 3I9JA 1LLQA 1SXJE 5F5XA 3MPOA 3OZXA 1Q1GA 3E61A 3KQLA 4G4JA 3VTZA 5K7SA 1KYXA 1EDBA 4LY3A 5BN3A 5EXPA 1T5IA 1J20A 5AM0A 4HNSA 1CRZA 1L3IA 4NAUA 5B64A 4CL8A 2AQ8A 4JP5A 3VVBA 3W34A 4LX0A 2KPOA 3FJOA 3S7TA 1AXRA 1B6GA 2GM3A 1XD9A 1Z75A 2QLFA 2CJFA 1EIZA 3K4HA 3KXLA 4G01B 1UBTS 4EPVA 1B76A 1H0SA 3GBSA 1V3TA 3HSYA 1R64A 4EX7A 3H6GA 1M8GA 2NO6A 1G5IA 4ZPXA 1YE3A 3RRZA 3ZHRA 4CM6A 5IUJC 1A8UA 2P7IA 4IOKA 2QG6A 1FFAA 1TGVA 3E3NA 2GN9A 4H7KA 1LLCA 4PSCA 5H4HA 5SY9A 3L8DA 2C03A 2ZRPA 3JQ9C 3LXUX 4KMRA 4LXIA 5ALRA 5IULC 5BYAA 4MINA 4Z99A 1RWOA 2DWUA 2L17A 2I1QA 4Z4CA 4CF4A 5BV1A 1T0PA 2FTKE 3TZLA 2VNKA 4V3CA 1VKNA 1JFRA 1INLA 1DAHA 5DSXA 3QF4B 2OFFA 1ZJYA 4V2UA 5K9ZA 3BCUA 4BZXA 2O8BA 1JKXA 2RGDA 1U80A 4KMMA 4MUGA 4RZHA 1GQOA 4HFRA 4V2IA 4FKBA 5ALTA 2NU6A 2OCKA 3FCYA 3Q12A 4HX9A 4AW9A 4CMEA 3I1YA 4DAEA 1R0WA 1EFLA 2WUDA 3D3QA 1LH0A 3QENA 4RE6A 5IW8A 2ECPA 5FTLA 5CDYA 1NMXA 1DARA 2B1JA 1GD1O 3AUFA 4FHZA 1SBNE 3D1VA 4C01A 1ADYA 5GGXA 4EF4A 1YC5A 1SZCA 3KRTA 2AFVA 4P4UA 2R86A 5E9AA 2C9ZA 3D2LA 1OLSA 2VQFB 3WMFA 3ZJYA 3KQSA 2E4VA 3LO8A 4TLLB 5EYPA 2YQZA 2A9KA 3H3JA 2PBRA 2ZBGA 1Z9BA 3H4VA 3OFND 4GOXA 5GPBA 4DIDA 2H29A 5IBQA 2P3QA 3GEHA 4C7JA 5I7FA 1N3IA 3S27A 3W05A 2FDRA 1C9JA 5A6SA 1TJ3A 1RC8A 4JLOA 1T3HA 1QZZA 4UQLA 2V4UA 3DTTA 3FMIA 5ALJA 5EKTA 1W29A 1Z8FA 4BJ5A 3HRHA 1ESEA 3PHJA 4KXXA 2PX2A 3PNPA 1NNEA 2PH7A 2IHBA 4P58A 4MAMA 3S2YA 5KKCA 3WDLA 1T25A 1ZGJA 1HRDA 5IAAA 2B8JA 1O89A 2FHSA 3G5UA 1OFIA 3U3MA 2YNMC 3WFJA 7ABPA 1NAIA 1RYMA 1TZJA 1Z56C 1CVIA 4B7XA 2Q5EA 2OCBA 5HRAA 1PR3A 2Q0SA 3CUTA 3S0JA 2Z5FA 4C2BA 1MIHA 4LOJA 3E9CA 3U40A 3OTOB 4HNUA 3QW2A 1VBMA 4ZI5A 3N05A 3D6FA 5A4FS 3L7AA 3CVWA 2VJOA 1OLSB 2B4KA 3SWWA 1NL3A 3FHOA 4K9SA 2PK3A 5EYPB 1T6BY 4FLEA 1RQPA 4E0BA 4ESEA 4KLCA 3R77A 5B4VA 1EPUA 1QYXA 1L8OA 3LC1O 2GBGA 3OZDA 2XUDA 3AF6A 1RWNA 3B89A 1DAGA 1I4LD 1P2DA 2Q2OA 4JVNA 4M4SA 4TTQA 2I7DA 2OBYA 2XA1A 3MMPA 3GPBA 2IHUA 1LBTA 5KNCH 5KX5F 4Z53A 1J9EA 2FSUA 4C7KA 3PVSA 2HD4A 3D9QX 3FPEA 1PFQA 3WRVA 1OX4A 4GR9A 1P7CA 1WD7A 3FY4A 1B2LA 2IYWA 2YIMA 1EEXB 2ZIXB 3KQMA 5J2TB 1ZI9A 4KQ1A 1Z2EA 2DBRA 5FF9A 4E2XA 5MN5A 4QOGA 2RHMA 2WDPA 3RS8A 3NKFA 1P77A 3UWPA 1TIKA 4LPKA 5B3JA 2C7RA 4KNVA 1KJ8A 1SH7A 4R8LA 4MRNA 4O0MA 1POWA 3AFNA 2EFHB 2Q9BA 4AJIA 1C3LA 1E6LA 1LJ8A 1OI7A 2VT6A 1PEDA 4BCBA 1KSFX 2BN4A 2F8MA 2GLUA 2PGAA 2YS6A 5EAIA 5JCPA 4Q4AA 1E2MA 1ISPA 3ST7A 1FP1D 5JECA 1HLGA 2Q9AA 1UXKA 3DNPA 4MZXA 3ESCA 4MHOA 4W5WA 5F4ZA 3VTAA 4BFZA 4CQLA 4W5NA 5ECYA 2AHRA 1RM5A 1E5VA 1SVIA 5DNUA 3EC7A 2RGRA 3FLEA 1WWKA 4RMHA 3CF2A 3P19A 4IZ6A 4QARA 1KA9H 4AZ3A 4COKA 4O2BF 2CY0A 4HI0E 2J6HA 5JNVA 1QH0A 5LCXA 2HN9A 2WIJA 2XD9A 3X2EA 1P7VA 2R84A 4KJXA 1W2HA 2W6MA 3VOAA 3OPYA 3F4BA 9LDBA 5BYKA 2BEUB 4LV5B 3DZIA 3I83A 1IVSA 1I0ZA 2PMKA 5DTJA 1AGRA 3DBVO 4R2JA 3RIGA 3GRAA 3PNQA 2FLWA 3AETA 3OOYA 3QTBA 4KG7A 5EMKA 4IZHA 4EW1A 3O3OB 3IQFA 4Z8YA 2B6HA 3B5JA 4M7WA 4R1UA 1FS4A 3C43A 2WICA 3M8KA 1YR1A 3NO4A 4MIEA 1YQTA 5ALSA 3IDFA 3FMVA 5CIWA 3TW8A 3NQ41 5HF5A 1JQ5A 2Q07A 3G0BA 1UP6A 2VZEA 2X5OA 2V0NA 3DEAA 4MPDA 4O8ZA 4Q4AB 2PNJA 3VPFA 1OT5A 1H5UA 1ESNA 1L5QA 1N57A 3L40A 4GI3A 1FQKA 3ROFA 3L0PA 5IX8A 1MC4A 3Q5DA 4PPYA 4F1JA 2R6JA 5D8DA 1F8XA 4AZ3B 3AF2A 1K88A 1TA4A 3JQ6A 3RTEA 1ZGAA 1JZQA 3WLMA 4F4UA 5ALGA 1EFRA 2X9QA 2FAXA 1BMFA 3OQBA 4C9BA 2RGWA 2XHZA 3AHHA 3C1UA 4W7HA 4ETIA 3CT4A 4BQFA 1PVDA 3NOXA 5IVKA 3FOAA 1UOQA 2PKWA 4G0PA 2J6CA 5AVUA 3AEKA 2VSOA 3LXMA 3R5JA 3AETB 4AT1A 5KNDD 2EOAA 5FTMA 4YV0A 4F3TA 5DEIA 3GB9A 1T0UA 4Q9IA 3TNDA 1KVQA 3C1OA 2DAPA 1RWWA 3SC2B 2J3JA 4FE4A 3WZMA 1RAEA 2WJYA 5TC4A 3FCSB 4RY0A 3W6NA 1EK2A 2QMEA 3H11A 1T2VA 3CLRC 3QOWA 1I6KA 3CF0A 4KBYA 2OLKA 4U8GA 4P32A 3EGIA 3VR5D 4BAUA 4EG6A 4ITRC 1RWMA 1Z5NA 3QBEA 4KEAA 3SKXA 1F14A 2VSFA 3JASA 1CYEA 2O2GA 3DAGA 3JZIA 4ZRMA 4RPCA 5I7EA 1JXMA 5LC1A 4KX5A 1L7EA 3AHCA 2Q4EA 4G86A 2JVJA 4X3PA 4FXOA 5DHPA 1Z73A 1ZD4A 4RMJA 3P5SA 2Q9UA 3T3MB 3OEHD 4CE6A 2AFRA 2CN1A 5A02A 3EFOB 5HSGA 2I33A 3QVJA 2WUFA 2VHZA 3HVRA 1FMTA 3GV0A 1AKVA 1NQTA 1M10A 1NBEA 3AEKB 2JFPA 4R9RA 4KKXB 5FFFA 1M2VA 1PSZA 4D56A 3B6MA 2Z09A 1NXWA 1NRIA 1R88A 1B1CA 1IXSB 3ESDA 3GCDA 3TW4A 3V8MA 3WG9A 4MUEA 2W2TA 3EMVA 4L27A 4QWMA 3IUPA 4F3NA 1RAFA 3OSUA 3O8OB 4W4TA 2IBSA 2XQFA 5HFJA 4X44A 3H11B 2FJUA 1WM1A 1Q83A 2X23A 3HNPA 2ZJBA 3KZOA 2Z98A 3KYCB 1J00A 1UPAA 4Q1AA 2GEDA 4X6YA 4DXAA 3WGIA 2JLXA 1U1EA 3QFFA 5FO1A 2VBFA 1CUIA 2FX5A 2YOFA 3BA1A 1RWBA 2DB3A 3ZDEA 5B7QA 6REQA 1C0EA 1FNDA 5JWRA 2KMLA 1CIPA 3M9WA 2C4NA 3IE2A 1HL7A 3SFZA 4XE5A 3RC8A 2I7XA 1HKHA 2JVIA 4IJQA 3R0XA 3SC3A 4BNZA 2I9KA 2E4UA 3D1LA 1VA4A 3DPIA 3KTDA 3VV3A 2J3QA 3FYSA 1VKZA 3MMZA 1ZD9A 2QT1A 2HMSA 1K5DA 3NDIA 1M2VB 3WIVA 3E0XA 3DH0A 4UW9A 1L4KA 3NFRA 3FHCB 3OZGA 3WB0A 1QRUA 1QB8A 3G13A 5JMOA 3I6QA 3AEUA 2WM8A 3D4OA 3DUFB 3VMFA 2I8LA 3WVNA 3ZGXA 2XKJE 3ZVLA 2HA0A 2W48A 5FP0A 4CCWA 1N7GA 1Z4QA 3TI9A 5DYYA 1FRZA 1RAAA 4INJA 3FKJA 1NVVR 2AI1A 1GP2A 1ECBA 4KDFA 4PAMA 3EJWA 2GPSA 4K46A 4EQ6A 4BP9A 2DOKA 1DIRA 3FRIA 4A3SA 1A4UA 1RKUA 3KVVA 3P9SA 6REQB 2D5CA 1G20A 4EGFA 1CZRA 1L7PA 2L18A 2QI9F 3F6EX 4PHTA 1SM4A 1Z17A 4RJKA 5G02A 4ZEMA 1JXAA 1QZXA 2PSHA 3SVZA 3TPZA 5IUNC 5JVDF 1QG2A 3UG7A 3LZDA 1EQAA 4EVSA 4U39A 3WK4A 4JB3A 1GU1A 2DH6A 3K0KA 1VJCA 4ND3A 4DIKA 1WY5A 2FSGA 3SVLA 3OWHA 3PNMA 2JGDA 3PIIA 4Y7CA 2C84A 1GGJA 2DTXA 3Q8MA 2D13A 2E48A 3U9SA 4E70A 4M9SA 5EE9A 5HGXA 1UQRA 2GCNA 3ZCUA 1RZRD 2R47A 4LOKA 1DWPA 3DWGA 3JZMA 5F73A 5SYNA 1V7PC 3DOEA 3W6UA 5AW0A 3WMRA 3U9TA 1B6TA 4W5HA 3G59A 4Y2TA 2NVBA 3VVCA 1SOMA 2AVNA 3WBKA 3JYOA 4N5LA 1FUKA 1E0SA 1JHVA 2W43A 2AOXA 4O1HA 5KTPA 1DCKA 2R4UA 3FETA 4AIIA 4CV0A 1S2GA 4EQ6B 4L9AA 3O38A 4AWAA 1L5ZA 2G8NA 1N0HA 2I3DA 1DKOA 4FGKA 4M46A 3E35A 4WY5A 5K1ZA 5TT1A 2WG1A 3S40A 3WMXA 2WTMA 4TS4A 4I19A 2NSLA 1YRWA 2ADOA 3UAVA 1B0ZA 1P4SA 3D8RA 5CTJA 1KJIA 1QH8A 4MZDA 4KVAA 4LGVA 3IPAA 2NTJA 4NS4A 3M70A 4P4NA 3OESA 4V0ME 6NULA 2GBFA 2VJMA 3KXPA 4OQFA 2BEWA 4OLJA 4QC2A 4D8YA 1VL2A 3FFWA 2NYVA 3V8VA 2NUTB 1SRQA 4EK9A 5JHGB 2Z8XA 1M72A 3GT7A 3H65A 1XYYA 4FHDA 3TVDA 1YVRA 2J9ZB 1DQYA 2NU7A 4UEKA 1NNLA 4J29A 4YONB 4S3MA 2PV7A 3KOMA 3DQPA 2YHUA 3DXYA 4UU1A 4JH0A 1HEIA 1IY9A 2XIQA 1QV7A 2CLMB 2WK1A 3G2HA 2G1PA 1U8FO 3OU2A 4GPD1 3VNAA 2QTAA 3LUCA 3BGDA 2IDJA 3OQIB 3D3EA 1ATIA 1CIJA 3LCVB 1N0WA 2XXJA 3TUJC 1NASA 3HBLA 2B5OA 2LCQA 2GYVA 3TZ6A 3KJGA 1X7ZA 2OZVA 3FF4A 1LA2A 4JENA 4WDRA 4OU5A 5GONA 2NUAA 1PV2A 4Q82A 1XZNA 3TZKA 4HB4A 3NBMA 2OEPA 3U7IA 3LHSA 5FWNA 1B00A 1QH8B 1TM3E 1IMJA 2GHQA 3I32A 1JLMA 3MB8A 4OK6A 2QG9A 4FFLA 1RTKA 1WKCA 1RZVA 2VJMB 4KACA 4W6ZA 3VX3A 4ZI3A 5JASA 3HU1A 4P1ZA 2BIFA 3ZI4A 1EFPA 1J09A 1Y3CE 1SCNE 3MTEA 4KFTA 2NU7B 1E9EA 3TB4A 5BORA 1MOSA 1ZH8A 2GD6A 1UADA 4NMWA 5EVJA 4WBNF 4XDHA 3I2YX 2QSYA 3QPCA 2M6KA 3H1FA 4IO0A 2JD0A 1N6PA 1W2GA 2EWVA 3O74A 5GQSA 3AI1A 2RHOA 2PSEA 1TECE 2C1XA 2FW6A 3FMGA 3NTXA 2BONA 3MELA 4LWOA 1C3OB 1QTRA 5C5IA 2OO3A 1Y7TA 3ZXSA 4F9GA 4J90A 4UHKA 5BQOA 5GONB 1UJNA 2NUAB 1OC2A 2ZTMA 3TZCA 2BBSA 2VQ6A 4RH1A 1XQVA 2GUGA 1NF8A 4ZVRA 3GA0A 1S01A 1KXZA 5BWCA 1W93A 2Y0BA 3OCUA 2BFNA 2HF2A 5HFAA 3QSYA 2I3BA 4ADSG 4OGLA 4K8OA 1K6JA 2J5QA 2X5KO 1EKXA 1WKBA 4RPGA 3VC7A 3U5ZB 1Z4OA 2AL7A 1EFPB 1YIAA 5K3AA 2G17A 1CJSA 1QHGA 2G6BA 3GOQA 4QSHA 2WYVA 3DMPA 2QVYX 1JHOA 1XU9A 2GTHA 3W06A 1I3LA 2WIFA 4AJLA 3LNTA 1AMNA 1XK6A 2IHKA 1JAZA 2B37A 1E18A 5DYNA 4YMVA 4MQFA 1T5OA 1EB8A 4OJQA 2IXAA 3ZDBA 4LCJA 3HRIA 3TH5A 4AZ0A 4EKNB 4XIGS 4LRTB 1CPYA 3MGBA 4QLAA 3R8XA 3W2GA 1HV8A 3U56A 3WHKA 2VPXA 1WBDA 1OX5A 2WD9A 4Q00A 4ZGWA 1WQ3A 4WASA 5IK2A 3HXMA 4OTZA 5JAHA 4AI6A 1BDHA 1IPEA 3CSUA 1D0VA 1N7JA 3QKSA 3F6SA 3H0CA 4G9GA 3K1AA 4G1CA 3MAJA 5DI9A 1XDWA 1J8DA 3KX2A 5BSRA 2FN7A 3DKIA 3HNRA 3W2HA 3Q98A 4X1IA 3JS5A 1G8SA 1JXOA 4PFJA 5ES4B 1PFYA 1T8RA 3EVZA 3SBEA 3VNRA 2X4IA 2NNLD 1QRRA 1NNUA 4G0MA 3KZ1E 4M99A 3ZDRA 1K5GA 2PRJA 3UAZA 4OLAA 2GMWA 1Q7CA 1RCFA 3ZG6A 2C7BA 4CUKA 1TT5A 3D7RA 4HEA6 3FTQA 4IVNA 2N9UA 4KLZA 3T5MA 3RAPR 3TLXA 4B34A 1TQ4A 4QUBA 5DBFA 4BCCA 2ID4A 3BN3A 1Y63A 3CLHA 2Q7DA 3SDSA 2HXGA 3GJRA 1P4HA 1GNPA 1EP9A 5FQOA 4CN8A 3H9EO 3NWJA 1S4QA 1ZHOA 2FHPA 1CZKA 5IBRA 3NT2A 1X0XA 2O3SA 1WZNA 5TIIA 1UDCA 2OM2A 4ISCA 2P5TB 3NASA 1OPXA 2QLJA 3E6AA 3ND9A 5A5EA 2H4FA 3U3DA 3E18A 1IWBB 2G9UA 1QOQB 4EYQA 4ZDJA 3A4MA 4R8KA 2D7CA 2YASA 3GEPA 4FNOA 4WNAB 1EXMA 2ECFA 2JFFA 3V00A 4EM6A 1ABBA 2Q2QA 3M82A 2QN7A 3K32A 2BMAA 3L7IA 3GLTA 2QZJA 3MRTA 3DLAA 1OI2A 3AFIA 3OA2A 1XPUA 2YVAA 4DF3A 5ALDA 2BH9A 1QCYA 3IHKA 2W37A 2PT7A 2Q3LA 1KR2A 3QFTA 3E0QA 1TT5B 3D6HA 4GYYA 2FGJA 2QLBA 3A70A 4JLBA 1YA8A 1DTEA 4N0QA 1Q15A 4OI0A 2P9HA 1WQ1R 2WR8A 3GNSA 2R2AA 4FZRA 4GZ6A 1J4AA 1RHRA 3PJRA 3IRVA 5JS7A 4PQFA 3TBHA 5AQEA 3QV2A 4CN9A 2QQEA 3PGKA 4G84A 4P4GA 1KP9A 3FOCA 3OPNA 3H5NA 2JI9A 3JALB 1PJAA 3AY7A 1TQ6A 1E2HA 1IUNA 3K73O 5FYQA 3V7FA 3KSRA 3E8MA 3RIXA 5DN9A 4ZCIA 3ICPA 5T4HA 2KM1A 5KNBA 1ZRNA 3T9EA 3PE4A 8AT1A 1DOAA 1QFZA 1S5PA 4MGEA 4HN4B 1AC5A 3W5BA 2B83A 5LN1A 1PN3A 1N25A 3TM5A 4GYJA 3JAKA 3PI6A 4RL6A 4XYEA 3BXOA 3K1ZA 2X0KA 5IZ4A 1W19A 1QOZA 1RLMA 4IGFA 1LCIA 1ZCBA 4YT5A 3LUPA 2VS1A 3QWIA 4BVEA 3C7AA 3UYKA 2EFCB 3SQDA 4F8YA 5FH9A 2IBTA 4POOA 4D0GA 4L8WB 1DG1G 3MCAA 1IEVA 3PYMA 2P62A 4GMFA 3DSRA 1G20E 2XKKA 3PA6A 3V8QA 1K7EB 2AG8A 3F7TA 2V1XA 4EZBA 3KU1A 4Q5IA 5SICE 4U2GA 4NYIQ 4MW1A 4YRLA 1LKZA 1QVZA 2V7QD 3TL3A 4QA9A 4CW7A 1Y6RA 4EDFA 4GOND 3A1WA 2AJCA 3CJRA 1XZGA 3ELYA 4PBRA 5I5GA 1MLDA 2VXCA 3L8YA 3WIDA 4WOKA 4BKMA 3LVRE 4W63A 4D3FA 1FUIA 1H8HA 2OBFA 2P77A 3COVA 1UK6A 1GRQA 3EZ9A 3K5IA 3NGMA 4ZAZA 3ZV3A 1G8FA 3HCRA 5CH3A 2Q29A 2Y6UA 2FZGA 2XWSA 4YRNA 3G2MA 5AVSA 1GNSA 2C3PA 4UAUA 4HPXB 1LQTA 3LUDA 2D0PB 3UGJA 4RD4A 3OIDA 2PFKA 1YRYE 3BMCA 2XVAA 4C5CA 1K63A 2G9ZA 5EQDA 3THYB 1IUPA 2JAXA 3V8EA 3CEPB 4DV4B 2I34A 2GH1A 4LYFA 2RSLA 4D3SA 3BICA 3ESAA 5DBIA 4ZEXA 2P5YA 3EPRA 2Q3HA 4I9GA 4WOCA 1WUTA 2R7LA 3HP7A 3M7IA 2HWKA 4QJ5A 5AKYA 3AUTA 4L85A 2EP5A 2J3HA 3DE0X 2ZCUA 3EW9A 2RI1A 2VQSA 1VPDA 2GZRA