3G9QA

Crystal structure of the fhud fold-family bsu3320, a periplasmic binding protein component of a fep/fec-like ferrichrome abc transporter from bacillus subtilis. northeast structural genomics consortium target sr577a
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
264
structure length
258
Chain Sequence
b'IPKHPKRVVVMADGYYGYFKTLGINVVGAPENVFKNPYYKGKTNGVENIGDGTSVEKVIDLNPDLIIVWTTADIKKLEKIAPTVAVKYDKLDNIEQLKEFAKMTGTEDKAEKWLAKWDKKVAAAKTKIKKAVGDKTISIMQTNGKDIYVFGKDFGRGGSIIYKDLGLQATKLTKEKAIDQGPGYTSISLEKLPDFAGDYIFAGPWQSGGVFESSIWKNLNAVKNGHVYKMDPIGFYFTDPISLEGQLEFITESLTKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrichrome-binding protein
publication title Crystal structure of the FhuD fold-family BSU3320, a periplasmic binding protein component of a Fep/Fec-like ferrichrome ABC transporter from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR577A.
rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Transport protein
total genus 68
structure length 258
sequence length 264
ec nomenclature
pdb deposition date 2009-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3g9qA02
2YNMD 3PSAA 1K0FA 2AFIB 4WZAB 5JG7A 1MIOA 4K3VA 2XH8A 4FKMA 4FI3F 5GGXA 4FILA 5JJ5A 5BVGA 4XPIB 3K1AA 4OVKA 3TNYA 1QH1A 1K2VN 2AFHA 1M1NA 1M34A 4GICA 1G20A 2QI9F 5HX7A 1H1LA 5HDQA 3AEUA 3TLKA 5KOJA 2PS3A 3PDIB 4N01A 1N2CA 1FP4B 4G09A 1N4AA 3U7QB 4MDYA 4UTPA 5JOQA 1FP4A 4TKUB 4UDNA 2R7AA 4ND8B 5CR9A 5I4KA 2PRSA 4ND8A 5AFSA 1G21B 3AEQB 3AERA 4DBLE 4WZBB 4B8YA 4WN9B 4TKVB 5M29A 2WI8A 3G9QA 5KOHA 4TKVA 1MIOB 2PS0A 2XUZA 2ETVA 4M7OA 4UDOA 5BVGB 4NNPA 3K1AB 4INPA 1QH1B 2AFHB 1M1NB 2OV1A 1M34B 1KARA 4G07A 4CL2A 1G20B 2OGWA 1H1LB 2Q8PA 3AEUB 2RG7A 5KOJB 5M2QA 3ZK8A 1N2CB 4PM4A 3EIXA 1PSZA 4HMOA 5BVHA 1XVLA 2R79A 4WESA 5CX1A 3MFQA 1KAEA 4HMPA 1M1YA 4LS3A 2YNMC 3AERB 3EIWA 3LI2A 3ZKAA 3BE5A 1KAHA 5KOHB 3MWFA 1L5HA 1K7SN 3R5SA 2OV3A 4H0FA 4OXQA 2M6LA 4INOA 1TOAA 2XDQA 3AETA 4LJSA 1EFDN 2M6KA 2PHZA 4NNOA 5JPDA 4FNAA 3AEKA 3ZTTA 3NU1A 5B58T 5KHLB 2X4LA 2XQVA 3HXPA 3HH8A 3BE6A 4BBPA 3MWGA 3R5TA 3HJTA 4MX8A 1ESZA 1QH8A 4HN9A 4PAGA 5BVHB 4WESB 3AESB 2MINA 4HMQA 2PS9A 4H59A 1M1YB 4MO9A 3AESA 5CX1B 3UJPA 1L5HB 2XY4A 2AFIA 3ZK9A 3CX3A 1PQ4A 4WZAA 3ZK7A 2OSVA 3LHSA 2XDQB 1N4DA 4XPIA 3AETB 3GI1A 4WNAA 2O1EA 3AEKB 5M3BA 5M34A 3MD9A 1QGUB 2WHYA 4IRMA 1QGUA 3TEFA 3PDIA 1K75A 3MINB 2XV1A 3U7QA 1QH8B 3MINA 4MLZA 4TKUA 3PSHA 2Q8QA 4OXRA 4UTOA 2MINB 4WNAB 5GGYA 5FLYA 1G21A 3AEQA 1N2ZA 4WZBA 4WN9A
chains in the Genus database with same CATH superfamily
4C4TA 1FS6A 4Q4JB 2VSNA 1O4VA 3M4YA 5EE3A 1JR2A 3UENA 4HAZA 5BQ5A 5E7QA 1OYOA 2QW1A 4CMJA 3CUSA 4MGZR 5JS2A 1EX7A 3KJEA 1S8AA 4C89A 3NBQA 4KQ6A 2IYZA 1ZI6A 3OC0A 3MEQA 4MDHA 1RAGA 4HFJA 3O8LA 4KVAA 5K0JA 4KOEC 4I50A 1IVYA 1EIWA 4YCJA 3LUBA 4WPGA 5LNK1 3M9XA 1XPUA 4Q0MA 1LDMA 4PHHA 5LDDC 4FMPA 4H3VA 2A7XA 1IQUA 3SC2B 2J08A 2R7AA 1CP3A 1H2YA 2X7JA 3EIHA 3PHHA 1MIHA 1FP7A 1JAXA 1UDBA 2J6CA 3GRUA 2YV5A 3IP5A 2QD4A 4PCVA 3WG9A 5K51A 4BO0A 1DS6A 4DYDA 1IBKB 1NN3A 4J49A 5C9ZA 4CV2A 4HXEB 2IOYA 4CKEA 2IY8A 3H13A 4ZFNA 1QCYA 3FETA 3L92A 2E5FA 2ISSD 4UDOA 2AXPA 1VLLA 4NYMQ 2PV0A 3BRSA 2YXDA 3EPKA 3NNNA 4YRAA 3G7SA 3H7IA 4ARZA 3LCJA 4E5DA 1T0PA 2IX3A 3B6KA 4O1MA 2JAQA 1M34B 4EGFA 3RF7A 2XYGA 3JVEA 5IT4A 4U6SA 1UKEA 2GBFA 4E5NA 4F9GA 1AN0A 3I9V1 3B70A 1H8EA 4FXPA 5JSFA 1N34B 3SSOA 1BQ4A 3EMDA 3G2JA 2XVXA 4HDAA 5ANRB 3EIXA 2DFDA 2WYVA 5EY5B 1U6JA 3CLSC 5LQNA 3U61B 4DPMA 2JA1A 2DTEA 1XDZA 2A30A 4RK6A 3RKRA 3G2PA 3FOAA 3LHKA 3LY7A 4DLAA 3DMTA 3IKLA 3IC5A 4WN3A 1TKRA 2YIDA 5TNXA 1UBTS 3ZNPA 4FOOA 3N2IA 2FGJA 2JIRA 5A4MS 3I6ZA 4ON9A 1NSYA 2PUVA 3D6NB 3UYKA 1N7GA 1TX4B 4PRLA 3U4HA 3WMFA 5EXTA 4YRSA 4XYBA 3A1SA 4BAGA 2X58A 2PKYX 3UB4A 3IPRA 5HIKA 4LQCA 5KNBH 1VDMA 4M8IA 2I8CA 4FNAA 5DHUA 5LZ8A 2VHTA 4IUDS 1QK3A 4NESA 1OILA 2IQIA 4RLFA 3MBKA 3SFZA 4B4VA 5LXTA 3RU9A 3P20A 2VRWA 4DRZA 1OZAA 3IEVA 2C99A 2JCBA 2WYWA 4E14A 1EE1A 1Z62A 3IIKA 2YHSA 3UJAA 4ZCTA 4M9CA 3T5DA 1ISGA 5HWSA 1QHHA 2DFTA 4JEHA 5KQRA 2J46A 4IKOA 3AUAA 3PPVA 1PFQA 3JVIA 3JWPA 3NP9A 3DMHA 4GG1A 1ES9A 4UNPA 1E9FA 5JS6A 3W5UA 1SXJE 1HT1E 1W4LA 2QXYA 3TRIA 2OQIA 4Z7JA 1PF7E 3EGEA 3K4QA 4DOMA 1QCZA 4R84A 5KNDH 1FX1A 4U8GA 2OM2A 1J09A 4ZQHA 5HXAA 2OYRA 4FHEA 2H4ZA 2HC9A 3Q6IA 3ROEA 4AG3A 4OHMA 4B75A 5IMSA 3JQEA 2EJCA 3C14C 3L0SA 1KYWA 3D7MA 3IQEA 3N2ZB 4LC9A 4LVOA 3D3KA 4QXRA 2C59A 3EWSA 3ZJTA 5DYGA 2XUHA 3VRHA 2FWMX 1NTOA 3ZZUA 4ZAWA 1EQAA 3WP0A 5JBQA 4B8WA 1FJ2A 3D4LA 4E32A 3O7MA 2EBUA 2WHPB 4W7HA 3KPWA 4CLOB 4DLWA 3AI1A 4RV4A 4EYKA 2QX8A 4YTEA 3WZLA 4XM0A 4ZALA 5JQGB 3OQ1A 4DSTA 2Z8YM 1XPRA 2HGZA 2WK1A 1SU7A 4QXMA 5TR9A 2OYCA 3VX4A 1ZS9A 5BY2A 4QUEA 4F11A 4WK6A 1FMCA 5AW0A 3ZWYA 3HADA 3LPCA 2YFKA 1G1AA 1EGHA 3O6VA 4IIGA 2IUSA 1VPDA 1TL7C 2FN3A 3FMOB 3W2HA 4O8CA 5F5NA 4MKHA 4ARVA 1EDDA 2XW6A 3NATA 1OBOA 2RIRA 1VMEA 3PD1A 3BBPA 3NOXA 3ILXA 1ZOSA 2X0IA 5ALXA 2X2FA 5AK3A 3UJCA 2WE7A 4ITUA 3YASA 5D87A 1I2CA 1R9NA 2ZSDA 3O95A 5DF1A 5C8YA 3MWEA 2Z56A 1E0DA 2PFGA 2VJKA 2A1UA 1PKEA 2V7TA 1RT9A 3Q3HA 3HCPA 3TLBA 4ILKA 1Q20A 4WZBB 5K8TA 1GGHA 5DWQA 2J41A 2R1UA 4N48A 1C1XB 4CM9A 2E0IA 1OH7A 3ABZA 3FUUA 3OBBA 1F12A 3SJ7A 3QI2A 3PS9A 4QOEA 2P68A 1M34E 4B6PA 2O52A 3C3DA 2YXPX 1B8VA 3G9UA 2QE6A 5K0TA 3F7OA 4I4CA 4O5OA 2Z9BA 3F0TA 2Z09A 1Z35A 1SKUA 2GEDA 2PH7A 3S70A 3WAJA 2UZ1B 2EJBA 1RWNA 3QWBA 3VH2A 4RTMA 4G41A 1ULTA 4Q9LA 3ICCA 3W9SA 1OHHD 1QR2A 4MRMA 5G0VA 2Y1DA 3WQSB 4CIYA 2O8DB 3UY4A 3VYTB 3PNBA 5AM2A 1UAYA 4R2XA 1NP7A 4F5DA 1G7RA 1NURA 2ZRFA 4JP3A 3NHAA 5BV8A 3FKSD 2QVYX 3LPMA 2Y0BA 3NIDB 4RXTA 2QGFA 1UZAA 1EQUA 1VRCA 1JE0A 2I33A 4H35A 5L6LB 3DV0A 3RJ9A 1QUEA 2FR1A 4N6OA 2EIXA 4K5QA 3U62A 2GPJA 4DA0A 3BKWA 3V00A 4BHTA 1GUDA 3ICOA 2DT8A 3MOGA 5EHNA 3K70D 4Y2GA 4O0LA 3UKOA 3AEKA 4M1QA 4KKXB 3TR0A 2C2ZA 2XDWA 3DKIA 3RKSA 1LNQA 1YR2A 3ZDQA 3UXEA 3KKNA 1XEAA 4PR0A 2C8JA 1A4RA 1JI0A 3N3AC 5KUTA 2OLKA 2IZ7A 1VGVA 1EH5A 1I80A 2E1PA 3I9LA 4BJHB 4NS1A 1U1CA 3HMKA 1K97A 4IJUA 1UEXC 4QGFA 3X1ZA 1L4LA 3LC2O 2FZKA 4KLCA 1T29A 2GCOB 4MIEA 1VCIA 2XNHA 2WB4A 1OPRA 3P9CA 4FZ5A 4RWZA 4GX5A 3WSTA 1QYXA 3ZWDA 3AR3A 4E31A 1AMNA 1K3FA 4CRWB 3AI7A 2ZJBA 1I1QB 3AFOA 5BWNA 1Q0RA 4LG1A 2FWBA 4UVIA 2LCQA 4NFSA 3TOSA 2XDQB 4HD8A 5E9AA 1DWOA 2Q62A 2VUIB 4OFWA 4DDVA 4CDRA 2VDPB 4L50A 1XVTA 2YOHA 3O3MB 5CP8A 4FK8A 3UT0A 3EYWA 5KWVA 4NE9A 1PUIA 4X1KB 2M6RA 1MX3A 4C0SA 1WZEA 1Z8FA 3IAS6 2IHYA 4NJMA 5ADHA 3UWOA 4YP7A 2VQ6A 2H8KA 2MYTA 2GFQA 3BJMA 2DG2A 4AJHA 4CIAA 5IM4A 3ACDA 4E6PA 4TXLA 3UAWA 4F6RB 1JYSA 5LYJA 5T4FA 3UFBA 2GCGA 2GWHA 3KZKA 3LK6A 2VRCD 5DVZA 5HRCA 1VIMA 2W2PA 4WN9A 3MRXA 4RCYA 3TD6A 4EATA 4ZYYA 1S4QA 2BFPA 2GHRA 1XMJA 4IEFB 4XE5A 4QVIA 5HGJA 5F9HA 5J5VA 1IPEA 2YV3A 4URFA 4NZMA 4X24A 3W0LB 4MVJF 3WRVA 2CXOA 4MHSA 5LA6B 4ENUA 1WCIB 2PR2A 2Q5LA 3W5AA 3KTAA 2CC2A 2E18A 4ZICA 1VE3A 4RJ2A 4QM6A 3K4PA 4IDNA 4COKA 4OSOA 1JNYA 3RYFB 4BQFA 3RK0A 1MOSA 4WZBE 3H8VA 3F4KA 5CFZA 2FEOA 3HK2A 5D5QA 2Q1UA 3U31A 3Q2IA 1B0ZA 1YZLA 2QTWB 2YHIA 3NYIA 4JJ7A 1FW8A 2IEGA 3OBIA 1MIOB 8OHMA 1KRWA 4BNXA 1QVRA 5ERXA 3ASVA 4QGSA 4R41A 3QSGA 2A4KA 3E8XA 3GT4A 3K72B 4LE2A 4O2AF 2UZ3A 3Q1KA 4UHCA 2PMEA 3T7JA 5LBIA 3OZAA 4QRDA 5I4IA 1SHKA 1JH8A 4DDMA 2HQ1A 1G20B 3ESDA 1YE3A 4CHGA 3PXEA 3D6AA 4B7XA 1IG3A 3I9FA 1LV8A 1GXSA 4Q9HA 1XI2A 4KEAA 1UKVY 4EUEA 5BOSA 2IUFA 3GLIA 2FW9A 1O0BA 3KD2A 1IBCA 1ZRSA 2A9QA 4JVMA 4R1MA 2F1RA 3GRCA 4YP0A 4ARUA 1T5TA 5JNRA 2QAJA 1RM5A 4KDRA 5CX1A 3TQRA 2Y92A 4BBAA 1DBQA 3BG5A 3UT5A 4NX2A 4EEKA 1Q92A 4FCCA 2W6NA 2VHCA 1YZHA 2E4ZA 2BISA 1ABBA 2M6LA 1EUCA 3MTBA 4IDQA 1NLFA 3S1AA 1AQNA 1BH2A 5DXFA 5L95A 3CRMA 1V43A 2V7UA 3F7NA 2V0GA 4MYTA 4LV5B 4QDUA 8ATCA 3PRYA 4FEGA 5LM3A 4OMCA 3TECE 1ZCJA 4HC4A 3B36A 1YTLA 4BN5A 2WABA 3TCXB 1T6YA 2R2GA 4QXAA 1ZX1A 4AIIA 1FSGA 1M2GA 2IQ5A 3K6SB 2V1UA 4UKDA 2A9PA 1TIBA 1ZM4A 1DUSA 3DCNA 2FPIB 5HZHA 2ATXA 4D79A 1Y8AA 1WW3A 2AN5A 1OWNA 4Z9FA 2IY9A 1TQHA 4NMLA 4R4JA 2WWGA 2I8AA 4XQCA 4PBTA 3RUEA 3T4EA 1OYWA 2QRMA 4MWGA 5AJVB 3D1LA 1Q7GA 2PAFA 2P6MA 4XFJA 1JXAA 1TZMA 2AEEA 1B23P 1OTHA 4LY3A 2GCIA 3O94A 5FBWB 5KYVA 5LUBA 2AOUB 3BHIA 4PC7A 3P9XA 4UTNA 1LTQA 3EIQA 4HCJA 5E0OA 4CIXA 4ZO4A 1U04A 1KQGA 2YMPA 2HYDA 4LXHA 1BXGA 4UHEA 3PRHA 4CQNA 1TMGE 4DIOA 1OI2A 4WKOA 4TKUA 3P4YA 3RVQA 2FUNB 2IYNA 2YV4A 1Z9BA 3PI6A 1C30A 1XOIA 1KMNA 4S35A 2L17A 1XZ8A 3MK31 3OEED 3PGKA 1H9BA 5DI3B 1Z5NA 2P4HX 3R3VA 3TLMA 5G4KA 1SUIA 1RM3A 4MUGA 2VHEA 1V71A 5JSQA 1CJTC 4Z0PA 3DFIA 3FGOA 1TTPB 3VO9A 3PRJA 1KMHB 4EF5A 2DPHA 1D09A 2K6GA 3EVGA 3HA5A 4QGBA 2A9VA 3V8BA 3UH0A 4B4OA 3UG7A 5KVCA 2HHJA 2QZ9A 3TKLA 2HWWA 2OL4A 4HDKA 1YO6A 3ETDA 3TLKA 2Y0DA 1B42A 2YMMA 5IN5A 4TMFA 2VHYA 5JOQA 1BHJA 1TC1A 5BQXA 2FWIA 4A0FA 1P2DA 1L1EA 4DADA 3V8VA 1LU9A 1XF9A 1XMPA 2FSHA 3ENZA 4Q4CA 4F9TA 1XN1A 1WPQA 3AJRA 4YRBA 2P6PA 2MDTA 1X2BA 1CQIB 3PHJA 4RSRA 2Q0SA 4C7MA 1EPUA 3GP3A 3OCXA 4MV3A 1HPLA 1IDOA 1LQ2A 3FYSA 3JYNA 4D4GA 1Y7IA 1BKDR 1ZIXA 3OLWA 1EDEA 5L3ZA 2OPHA 3WRXA 4AJLA 3A1VA 4ZVUA 4GM0A 1LBSA 1S7GA 2PMWB 1G20E 3MTGA 4OJMX 3W8FA 3WBBA 2JK0A 4R9VA 1Q1BA 1MABB 3CB2A 3DFKA 4RMNA 1RABA 4HOYA 3ZJ5A 1M2VA 2ZRKA 3HKCB 5PGMA 2WD7A 1E66A 2G1AA 1AUXA 2JD1A 4U7TB 3T7CA 5AUPB 1UFOA 1E2IA 4IOJA 4V0MA 1PK8A 2E4AA 1SVNA 2IU0A 5BNZA 4HMOA 1CB0A 2C9YA 5JO0A 3WL3A 2FW1A 4KPFC 2QPTA 3KL2A 2O8NA 3AJ8A 5CFMA 2CXPA 1GG2A 1ZM9A 4LYHA 4YXWD 4ARSA 4B9AA 1NBIA 4P38A 3A36A 4N9QA 2BEUA 3KHTA 3BORA 2QT0A 6ADHA 4UBNA 3NTLA 1T10A 1RM0A 1S9HA 3AOEA 2Q5QA 3B2QA 3AETA 3L7MA 4M22A 2R7KA 4RMIA 3IMEA 1RQXA 5ER6A 1XQ1A 3ZTTA 1EEHA 4E0BA 2EW2A 3GRZA 2Q0QA 1SBIA 1VOTA 3EGDB 4D1YA 2G72A 4Z9XA 1TUGA 4QU5A 1KI4A 4MHOA 4DMRA 2IYSA 2PNJA 5B12A 2DQKA 3JYPA 5AOVA 2FDCA 1W48A 5KINB 4RV9A 5BYKA 3NJRA 4N0MA 3FVRA 4KIJA 3RC9A 2DH5A 2CN1A 3L8GA 5G41A 3TIXB 4J8PA 2VR1A 1UBRS 3NZEA 3OLCX 4JJAA 2VC2B 1TK2A 4HYTA 2CE2X 4RVGA 2WJ3A 5GONB 5JCOA 1O08A 1RKBA 2RHDA 1XHFA 2XYVA 3NJ8A 3NNDA 1RXUA 2ZJ3A 4G5FA 4I4TA 2A8YA 2GJSA 1Y5IA 1OXTA 3S27A 3VNQA 4DBVO 3CPEA 4O1HA 3PPIA 5TQ2A 4OOFA 4B47A 1DMRA 3NH9A 4MROA 3FOBA 4IS2A 4MDEA 2DLCX 3FPGA 5SYNA 5M7EA 2CKMA 2X1MA 1KK1A 1FLDA 1IXYA 1E0JA 5HJ5A 5KVVA 3D5EA 4ZAZA 4WCFC 2GUGA 1TM2A 2Q1XA 1PVVA 1ZQ1A 1LRKA 3ED5A 4Q3DA 3TQFA 2FKNA 1WE2A 1SCKA 5M04A 1P7WA 4BTLA 3MJRA 4QXQA 4EI2A 1DP4A 2CL0X 1BJTA 3AR6A 4XGRA 5C34B 5E1OA 4MRNA 3P9NA 1NP3A 5EIBC 1TT7A 3PDCA 4M4SA 3EUEA 2FSFA 2PMDA 4IS3A 4MV8A 3RSSA 4HZUB 6REQB 1PJAA 3GH1A 3LU1A 4LRXA 1XD9A 4YR7A 3ANYB 4EPRA 4G63A 2VHJA 2BHTA 1GPDG 1M1NA 2FE4A 3WJ1A 5DNCA 3HJUA 2WNHA 1RKXA 1X1RA 2Z2XA 3QVGA 3EOAI 1BMTA 3QV1A 5BR1A 3RHSA 1NZFA 1U7ZA 4D4LA 2POQX 4F4FA 3OCUA 1MOPA 4IEIA 3ACCA 4MICA 5EA2A 3W3AH 2F9LA 1QONA 4LDNA 4M1KA 1MVNA 1DG1G 1VL2A 2PL5A 2PPVA 1Z6PA 2CK3A 3QK7A 2P9CA 4WOBA 1U8XX 3PJEA 2Z0MA 4NMHA 4EJFA 1E5XA 5HVNA 2PA3A 5K2OA 4XGKA 1WCXA 1U2DA 5HCIA 3NMUF 1U2GA 3AUTA 5J58A 3PDHA 3O74A 1GGMA 4FB4A 2OT3B 1Q16A 3NTQA 3R4CA 3COSA 4YQYA 5AI9A 1SWWA 2WTMA 4W99A 3EMBA 1T8PA 2GBPA 5KNLA 1UBCA 3RFXA 1U8YA 3SVZA 1YMUA 3N8NA 2IV7A 1CV2A 5K8LA 2H1CA 2FEKA 4M0MA 2PX0A 3T99A 2QN2A 4N3NA 4P22A 3AM4A 3ZY4A 2UU9B 4GS5A 5ALEA 5IP5A 3RC7A 3IOMA 3ETLA 3L8FA 3LCUA 5ALLA 2VXCA 4LCEA 4E1VA 4ZCRA 3KOUA 1SEPA 2BD0A 4C5BA 4JBHA 1QIFA 4UW9A 2Z2ZA 1SGWA 1LI4A 5EE9A 2G0TA 5E38A 2IIBA 1HDGO 3DWEX 3HV2A 4NDNE 2IUYA 3KIPA 2BCEA 3QOXA 3WS7A 2GO1A 2PD3A 3R5SA 4G8JA 4BVEA 3QWAA 1T5DX 5DTRA 3FCOA 1GSHA 4TSKA 4DVJA 4EMUA 4O29A 4R9NA 5JDIC 3NOOA 2QTCA 2M6KA 1Q11A 3K31A 4WLOA 4F1WA 5KTMA 5DHAA 5I7SA 2P9ZA 2Y1XA 4RA9A 2FN7A 3EIEA 2ACVA 3K8YA 3NBKA 1RQGA 1THTA 1ZOPA 2LXNA 4E3ZA 3BK7A 1NUAA 1CQPA 1QYVA 2ZB2A 3C2QA 3IOCA 3V1KA 3DGFC 2OEPA 2W6PA 5BVHB 2Q5EA 1PNVA 1DQPA 3A2MA 4UEQA 4V0KA 5TVKA 1TZCA 3NBFA 1AKRA 1CS0A 1EP2B 3NEAA 1JNXX 3OFJA 3PC8A 3ZLVA 3EAGA 1NF3A 1T8RA 3T6KA 4R1OA 4EBBA 2GZDA 3ZGXA 2AJ8A 3OOEA 1KDZA 1KORA 1BD4A 4HDSA 3ZZ1A 2HCJB 5BO5A 1H66A 4C4YA 1XAJA 2OO3A 1Z4QA 3QPUA 2JIZA 4A16A 7ABPA 1YSCA 1ZUWA 1AU9A 5AUNB 2VQDA 3GEEA 4ZCPA 1HE4A 2VDRB 1M8JA 1MW8X 3DE5X 3RF6A 1OWOA 3OZRA 1FSPA 1IVSA 1ZJYA 1IN5A 5EP3A 1F8YA 4X1YB 1BE6A 2RCNA 5EMHA 4AS1A 2GN8A 1PBTA 3CNNA 2GPAA 3EG9B 3SR4A 1HG1A 1SB8A 3LCRA 3ZU6A 2AIRA 3VU9A 4BMPB 3SIRA 1CQJA 3MJDA 5AM5A 4RDCA 2PT6A 1XZMA 2ZDQA 1AQUA 1EUDB 4W82A 3AILA 1IN1A 4KN8A 1EJBA 1YU9A 1FQOA 2XH8A 3E23A 4FKMA 4NS4A 1X1TA 1F8FA 4QWWA 3ZCPA 3EDMA 5LMCA 1P91A 1PVOA 3EZ9A 1V1RA 4LCJA 3I30X 2KMLA 4IJWA 1K7CA 1XU9A 1P4GA 2WKSA 1P2SA 2CB0A 4OUKX 2WWYA 3OJOA 1DGQA 4LNAA 4TT3D 4J0FA 1Q7CA 4NZPA 5A2GA 4G4JA 1VJCA 2G76A 4FPXA 2PS3A 4UE3S 2B4RO 3KE9A 4WMLA 2OYSA 3EQ2A 4A0HA 1FTGA 1MT0A 1NOJA 2EP8A 3LC0A 5JZ9A 5IJWA 4B84A 4RYDA 2RAPA 2D7JA 5DKFA 4W5WA 5B1DA 4AG5A 4MPTA 3QIAA 2CHUA 3KCNA 3HCAA 1IRIA 1F4VA 3DZJA 3ZXIA 2A1TR 4EELA 5KO2A 2PPLA 4HHEA 4Y2HA 1B2RA 1NRWA 2XUZA 4QOGA 3K0EA 5HK9A 4PVDA 5JMTA 2BF4A 1F4LA 2VZEA 4TV9B 1U28C 4JC4A 1COWA 4ND3A 3A3OA 2QROA 2IBTA 3MJ4A 1HNNA 2O3TA 4JU8A 4GRDA 3C43A 2RONA 3KOZA 3TQQA 4UNRA 4KR3A 4BNTA 1NATA 2IEIA 2TMDA 4I14A 4OP2A 3WL7A 2VCEA 1B0PA 5JYCA 5ALSA 4IXWA 4BO1A 2Q6IA 4XWKA 2AOWA 1M7GA 5KPJA 4M54A 5AM4A 1MOQA 3MD0A 5CAEB 2RHWA 4BJ3A 2QX6A 4NBVA 4FW9A 1JB1A 1CR4A 1KOFA 1ORWA 1Z6XA 3SZUA 5MF6A 3DBLA 2O0MA 5KCMA 5AK0A 5ALMA 4GLOA 3NEYA 4M1EA 2QQFA 1TD9A 3NXSA 2JGLA 1MFPA 5G4LA 3KTOA 5EXXA 4UQLA 1E2KA 4RVFA 1YU6A 1M2OA 4ZVLA 4AUKA 4F8EA 1LPSA 1JHUA 1JEAA 4YV0A 5BXYA 3SXJA 3VZRA 1NJ6A 2VK4A 3BQNB 1M5UA 2OXCA 1OUMA 3AUYA 1H9AA 1V0JA 1Z6AA 3WTCA 3JQAA 1H4SA 3RTEA 5B30A 1MB9A 3MFYA 2GILA 4AAYA 2NWQA 1GAJA 4JUIA 4KE7A 3CTPA 2J5BA 2G28A 1RZRA 4O2BF 4QBHA 2WINI 1AKUA 5DFAA 3BDIA 1OBHA 4G36A 1EAMA 4XIYA 3LG2A 4Y6SA 4ITVA 2QE7A 3C3BA 4MWSA 4V39A 5DISB 4F0JA 1JIVA 2SNIE 3OMXA 3Q88A 1HQCA 3N7AA 4KH1A 4LOKA 4MULA 4LDRA 3N8HA 4XEHA 1NXOA 2JZCA 3LLVA 1K8YB 2MWMA 5I7RA 2DTDA 3NUGA 4CU5A 1D9XA 4OHYA 4XJXA 1CPYA 1OAOC 2Q45A 2PQ2A 3DQZA 3PBKA 4TS1A 4MVJI 1R74A 3WGLA 1A98A 1V8OA 3THRA 4A8PA 4LW8A 3ZE1B 1E60A 4B2LA 3REGA 4R7GA 1Q44A 4QYIA 3F73A 4MVJA 1GTZA 1ZCBA 2OXFA 1DC3A 1OAKA 3GYGA 3M5PA 3FPKA 4EKEA 4YT4A 5BV1A 3F46A 5IVHA 2NSDA 1OLXB 1Q3KA 3OOSA 2ZJFA 4KK4A 4ZAGA 3LDHA 3CM0A 3GGDA 3SHQA 3IV6A 4HX9A 4QQFA 3L3BA 4ER3A 1GA4A 4PLFA 1XQVA 3QMVA 4KGDA 3W9UA 2H4JA 5E9JA 5K05A 5LIRA 1VYVA 3FTFA 2LRHA 2RI0A 3KDAA 4V0SA 2P2DA 3OIVA 3BREA 5TMEA 1E1NA 3S2GA 1GNLA 4U2KA 2O5CA 2IHUA 2NYVA 3M34A 1PJTA 4JSTA 3CR7A 1SCBA 1MO2A 1YVUA 1BCRB 1CF4A 5HUQA 1F17A 3TF5A 1C0PA 3OA2A 4LI3X 1KDRA 4O2AA 2EL7A 1U3DA 1SD2A 1NVAA 3NOQA 2VUSA 3ESZA 3B5EA 4HFMA 4R2WA 4RH1A 1RP7A 5CA1F 3FF4A 4AQ7A 1PR9A 2I3GA 4J91A 5KYXB 1OZFA 1TO6A 3OEHA 4LIPD 2VTKA 5M29A 2H1FA 2ACWA 3IKJA 5K0GA 2E82A 3OX1A 3WQBA 5IVIA 4UOEA 4D6YA 4LMPA 2W6JD 1C8BA 1Z68A 1YUNA 3M1YA 3MTIA 3HVIA 5ITWA 2IEZA 4LYAA 3NIBA 2P7HA 5G0WA 5LQDA 2DUJA 1T4BA 5DV9A 4Q7JB 1E58A 2XBMA 4RVOA 2G9ZA 2OGWA 1VJ0A 1CJKC 1JDUA 3LS2A 1ZUHA 2GPNA 1YQXA 3GUYA 4FCWA 2Q49A 4I50B 2EXXA 2P0YA 4PSKA 1CEXA 1L4UA 2CXSA 1E0KA 2BC9A 4XASA 1KOLA 1N8TA 1RXYA 3GIDA 3HI4A 3JVDA 1Z8DA 1A9RA 2DBRA 4AXXA 1XZAA 1D2GA 2VSYA 3COYA 3ZTYA 1TTTA 1ULZA 5IAJA 2E85A 1VCNA 2A9OA 2X2PA 4QD3A 4TYQA 3TG2A 4I8IA 2Q07A 3B2EA 2EHJA 4JKOA 2OHGA 3NG1A 2BRUC 1LJ8A 1CIVA 1D04A 5KPDA 4DR3B 3OP4A 3AFIA 3DLIA 3ES9A 4INOA 4F5EA 2R97A 3NDBB 4ARZB 3PC7A 2GRJA 1JR3E 5CVDA 1W1UA 3GNLA 1GPNA 4DYVA 3LA8A 2WIDA 1D6JA 4B46A 2EDCA 4M7PA 4G8CA 3EXG2 5IAAA 1J4AA 1GUBA 4MPJA 2BBSA 2GTHA 2PD4A 2WT4A 3IUYA 4OB6A 3JQFC 3TRKA 4C1BA 5JNUA 2QY6A 4KVZA 4OQQA 1KY5A 3IH5A 4EHKA 1QDEA 2QTAA 4N7JA 1GQYA 3H8JA 3IOYA 3LHSA 2HWYA 3RYIA 5LQUA 2PE5A 1JFTA 1ZSNA 2VH2A 1L7OA 1Q0UA 2HNAA 2JFZA 3PX3A 3SJAA 2H52A 3MC1A 2GVDC 5ITSA 3WA7A 4QARA 4I5DA 2A7QA 4I2NA 3T5CA 2PT7A 1GU0A 3HZOA 4MUKA 3HGTA 5TB5A 2GLXA 2RB5A 2Z4TA 4BB9A 3DGEC 2HYIC 1XPJA 4K05A 9LDBA 4FDTA 1QHHB 3A0UA 3Q7EA 2OBMA 1GKYA 4IFBA 4RQUA 3U4DA 1Z0FA 1UC5B 3D3EA 3TX2A 5GGYA 4OQMA 1IIRA 3UUWA 5HMLA 4H7EA 4A92A 1KO8A 4UHJA 1PLJA 1JFLA 3C5WP 4ZGWA 2WUDA 1CF9A 5CLLA 2GN9A 2CUKA 1FUKA 3NVMB 4ACBA 2LNDA 4Q6WA 3K70C 2XGOA 4TXJA 3B3QA 1L5WA 4NBRA 1UK6A 1RXIA 5KNCA 4C06A 4M9QA 1ECJA 1NR5A 1XQ9A 1ZGJA 3EEFA 4OJNA 3RD5A 5LZ9A 1KGDA 2QQEA 3M9LA 1N92A 4H1HA 2PJUA 2H2WA 1Y9DA 3G9ZA 1IY9A 2EFEB 3G8DA 3I5AA 3O2SB 4RS4A 2H6EA 5FUVA 1KS9A 2NYAA 4G09A 4EZBA 1F3LA 4MDYA 2HD4A 3UHPA 4DJAA 4JQZA 2ZBGA 2Q7OE 1HLGA 2VBFA 1VSQA 4NH0A 4QUKA 5ERGB 2AGVA 5TC4A 2BVNA 3OQBA 2KYRA 5DYTA 5LNK6 3ELDA 2BGKA 1CYDA 3NPMA 4AMBA 3DMRA 3ZJVA 2JHAA 1C9NA 1GZ5A 2ORVA 4KXVA 3DNPA 4X84A 9ATCA 1UEIA 3CU5A 1UINA 3PGVA 3C7DB 4QOSA 3VHRA 2ZUFA 1UAGA 1U6IA 2B5WA 4B9EA 3BWEA 3CXRA 1UZMA 1U7OA 4ZMSA 3GUZA 1EWKA 4XVHA 2PO5A 1APBA 5DTIA 3UICA 4AXBA 3MTJA 4CV1A 2CKDA 2BHLA 1TAHA 4NP6A 3G0HA 4KQKA 1JIJA 3AO0B 1R0CA 1TA0A 4U0KA 3RVOA 5DLQC 4C0LA 4MJLA 2GEUA 1CUEA 1QR6A 2IZZA 5DJ5A 5C8YB 3ZJUA 1FUUA 3MWEB 1Y9AA 2J3DA 3GRKA 4LAFA 3EZ6A 1HRDA 3I9V6 4YBZA 4DBLC 1NXXA 4Q1BA 4ODIA 2Q6TA 4G4SO 3IEKA 1CERA 4IJMA 4NQRA 5TGZA 3O26A 3RCBA 1EWQA 3VR6H 3LY9A 3CZRA 2EFDB 2C7VA 1T9CA 3C3CA 1H2ZA 2OCLA 4H7FA 1TYCA 1YKFA 1JAZA 2BZ0A 2R1ZA 4BO2A 4ZKDA 1SCIA 4AMUA 1YUMA 1X7WA 3G7NA 1QRRA 2XBUA 1W34A 2C54A 3MZ0A 3K05A 3VKFA 3DPUA 3HNRA 3W04A 4U0JA 2VRNA 1QHFA 1NYLA 4MRMB 3BERA 1N6KA 2H06A 4I3HA 4HF7A 3MGGA 3AXSA 2A9JA 5CJJA 4HVTA 4PNEA 1JJAA 3AF5A 2FFRA 3DDUA 4HMQA 4WOKA 3LO5A 2WAAA 2ZS7A 4FS8A 3PLNA 4NF2A 4QTZA 4PZUA 2BFBB 2E2WA 4UMVA 5EJAA 3UO8B 2A0UA 3ZWCA 5G1OA 2CL5A 2WWVD 1ZIPA 1XU7A 4KV9A 2EEPA 4PLYA 4H7DA 1Z5ZA 3TLGA 3BQMB 4FT4A 4MQEA 4W8OA 3MRSA 4BUJA 5A4DA 3AEKB 5H80A 5A3VA 2Q1SA 2WWWA 1IM8A 1R4MA 2FMKA 2R6CA 3UWKA 2GEBA 2WOJA 1R0XA 2SBTA 1G2QA 1YJ5A 2FZ5A 3DBHB 1ZHFA 3GC6A 5DK6A 4ETWA 1BS2A 1MNQA 1NBEA 2R68A 5EZSA 3AB7A 3RS3A 3SYTA 2WT9A 2RKOA 3L1IA 3VKUA 3ROZA 4D81A 5ITZA 1XZJA 4QPPA 3R3UA 5TMBA 4DM3A 2ZRIA 3TLXA 3T5TA 3IKMB 1RHJA 1JT9A 4YJFA 4TUYA 5JO9A 1WMDA 4UVHA 3T15A 5ED4A 1V5EA 1KH3A 3OM9A 1CUBA 2MSWA 3GFOA 1E3QA 3ZS8A 4FFRA 4EAQA 2HFKA 6CHYA 1X7DA 3K0FA 3BRWA 3SQDA 1EA5A 1L4BA 1A95A 5EL0A 1JDZA 1PEAA 2BV3A 4XH9B 3ABIA 1NXPA 4NJMB 1QGDA 1EFCA 2FN4A 1WP9A 2P5YA 3WK5A 1FRFS 4WBXC 3K15A 1N8SA 1VGQA 1RXCA 1NM5C 3AH8A 5LYJB 1R2QA 4TRRA 4GL2A 3RANA 3EGIA 3OUTA 2Q27A 3VHXA 4B4KA 1U2EA 3K2IA 1U0GA 4P35A 4TKVB 3IBGA 4JGIA 4WN9B 1DXOA 4IIHA 3DZCA 2RGAA 4I5IA 2Q5OA 1Z5WA 4PW0A 2YDXA 2ZDHA 3KEGA 4EENA 2B1GA 4W6ZA 3B78A 4BMXA 1J9EA 4FMCB 1LF0A 4KXFB 2IY7A 1I1HA 3CBQA 5I7WA 2OV1A 4AY6A 3AWDA 1LLDA 2VYVA 1TZJA 4K7JA 3KT8A 3K8OE 4N54A 1WCWA 1YB4A 2WFMA 3KTAB 2IJGX 1P31A 1S2OA 4A6DA 3G5LA 1YRBA 1LX6A 1QB8A 5DLEA 5E4YA 1OX6A 4JJ8A 4JBXA 3WZMA 2PGAA 3BIWA 1Z0IA 2GH1A 3U4CA 1EUQA 5KMGA 3MFQA 3CISA 1HXHA 3E9RA 3PQ3A 3QWFA 3VPGA 2YHIB 1KERA 4C43A 3DYVA 3T7AA 5C81A 3RH0A 3SMVA 5JFTA 3AIOA 4URUR 2ZI6A 4PX3A 4AUMA 4EH1A 4MV9A 1EWRA 2WU3A 1V5WA 4I46A 3FHLA 3LGAA 2HPVA 1KTVA 1O6ZA 2FUKA 3KB8A 5DT2A 2C7PA 5L51A 3OEYA 5JWHA 4F8JA 3AK4A 4EFDA 3L0IB 3WLLA 3Q7SA 2FXVA 4QDTA 2HBZA 2CNKA 1YMVA 1P80A 1UMCB 2J4CA 2XXBA 4Z9BA 5BOSB 1ESZA 3GLIB 2AJCA 1GPBA 1M6VA 1RQRA 2V98A 1RRMA 1Y80A 4HGPA 1M6NA 2R1TA 4YUYA 4TMTA 5J63A 4C22A 5TJHA 1K4YA 3R2JA 1FDSA 3ESCA 5CX1B 2NSLA 3UA4A 1BGXT 1Z47A 4P33A 4KAXA 3UT5B 5JXJA 2YOFA 4IZOA 3KPUA 2P0EA 1LQTA 1DX6A 3M83A 4YMUA 1ODTC 4NWIA 5D1NA 2IYAA 2YV2A 1J8MF 4U63A 1EUCB 1YVPA 3S1AB 4ZJPA 1T36A 3GJTA 3GJ0A 3FF1A 1G8SA 4KQGA 3MOSA 1KEEA 4JYMA 2JZNA 1U8ZA 3B13B 1DAHA 1AKWA 1JDBC 3ONFA 4WACA 1Y5LA 1XK6A 1EFUA 1SD5A 4FSDA 5FBKA 4JX8A 3CCFA 2DQSA 1BROA 4MI1A 4Y2XA 1ST2A 4AJJA 4CUJA 1X1QA 1RRGA 2GRAA 4LMBA 3L82B 4FFMA 3IP7A 4CUKA 3LWDA 3E5NA 1KETA 4C76A 1E9BA 3LCMA 2QLNA 3CF6R 3EODA 2W6MA 4V1CI 1QG0A 5KSOA 3B1ZA 3F8TA 4X8MA 3VR4A 3H9EO 5F3WB 5BNFA 2JFUA 4PY2A 1T9BA 1PQYA 3ZHYA 1P44A 1YBAA 4V1CA 2XOXA 1H4TA 4BGIA 2F8LA 5LL6P 1NF8A 5EJGA 2GKOA 1D1SA 3V42A 2YS7A 4JB8A 1J7JA 4XJVA 2OCYC 3FVVA 3L5OA 1DV1A 4O3MA 4WX2B 3I28A 4O2RA 1VBKA 1KYVA 2PIAA 2YJZA 5KTPA 2YWGA 2IW3A 3GGSA 4RQBA 1ISRA 5E3HA 3ETGA 1S2IA 3QELA 2FPPA 4GR4A 3ANTA 1PK9A 4Z7OB 4AZSA 1FP4A 2B2XA 3K5HA 3PFHA 1Q6YA 4TKUB 1M54A 1POWA 1LBIA 4E2XA 5FP0A 3RV4A 1N32B 3HR4A 3WNQA 4KRFA 4H3SA 1OPXA 4PHCA 1AJEA 1KVUA 2H7CA 5G4KB 1LUAA 2XB6A 2FSUA 2WG2A 4TRMA 1U0TA 3FCEA 4G0PA 5CIYA 4PNHA 4NULA 3K8ZA 4FFVA 5EP1A 1TO1E 2W00A 3GPBA 2BI7A 3TH5A 2V7BA 3CNHA 3JAKA 5K6RA 3C6KA 2C7GA 2EIHA 1FNSA 3T9BA 4MWDA 1OWMA 1MRSA 2HMSA 2X9VA 3JRXA 4M8NE 4HDKB 1MB2A 1K6IA 1I24A 5EZ6B 3ZK8A 2ES4A 3ZYZA 4HEJA 3HYNA 3COWA 3ORYA 3OCYA 3P97A 4EA9A 1WB6A 2Y1OA 6YASA 1FBTA 5DX0A 4CMEC 3ILYA 4LF6B 2LKCA 2WHRA 5JJKA 4IMJB 1D7OA 1NVUQ 1RHRA 2R2AA 3K6RA 3SKVA 1HEYA 2HJHA 2V54A 4JHLA 2XVYA 3VQTA 2DECA 1TTQB 1JXOA 1NVVR 3N2YA 2I87A 3AP2A 4O2BA 1PWYE 4OGLA 5THKA 1H2WA 1F14A 1U8EA 3K0CA 4XQ0A 1C3LA 4ZTZB 2HM7A 3CX8A 4QZVA 2C7QA 1PHPA 1Y5RA 2Q0XA 1WMSA 1W9MA 3A1CA 3RS4A 2IDJA 4L0MA 1EVIA 3ND9A 4JT2A 1P1RA 2YWJA 3I4FA 2XI4A 4AF8A 4K9QA 5JV5A 2QR2A 3OFVA 3L4SO 1D0SA 1ZO8A 1N5LA 4IDGA 4DQVA 1DXYA 1C1YA 1SC1A 3KZ1E 2GMWA 1UOQA 4ILEA 2WUVA 2BTEA 1H0RA 3PQ6A 1RBMA 4AO6A 2AG6A 4Q3AA 4XX1A 5AI4A 1GCAA 3AJAA 4QJIA 4DSAA 2P9QA 1MB0A 1BEUB 3A6ZA 6ABPA 2BM0A 3M3HA 4M6WA 2BEUB 2BKEA 1CVRA 4XYGA 5IRCD 1D3AA 2AEJA 3ME5A 1X1AA 4C20A 1YRYE 5COQA 5CDFE 2QBYA 5AM0A 2PX4A 3AETB 1O6BA 3DBRA 4KBYA 4V24A 2JD0A 1JECA 1SA0B 5B4VA 3PHCA 2JGDA 4RTRA 2X0RA 1K9VF 3SZGA 4CLRA 4OFZA 4XLTA 2PUEA 1H2FA 4KIGA 1Z25A 3SBOA 1PJLA 3C4JA 3LT4A 3N9IA 1JHDA 2FLKA 1LBTA 4OXXA 4DLVA 5FUQA 3SIPA 5HHTA 3OE7D 5CRIA 2G9QA 2PZJA 3W6NA 1DAEA 3HDTA 3F97A 1XKTA 4M0PA 3P0EA 1U9YA 3EZXA 3UCXA 4C4ZA 1QU3A 1A9SA 1XZGA 3RU3A 3C3JA 2GARA 3I23A 3JQ9A 4JI4B 1EVLA 4DWWA 4UM9B 2XMSA 4QBGB 4KO4S 1TU4A 1IZ8A 3F6YA 4WERA 5F7OA 1JP7A 2JAXA 1TJ4A 1MAAA 3NM6B 1XL1A 2BJHA 4I4TB 2FFJA 2JASA 5CA1A 1RRCA 3VU1A 2Q41A 2G67A 1KSHA 2L69A 3IYLW 4G25A 4YMSA 5TQ2B 1C4KA 2PANA 3QHPA 1W4BA 2H1VA 3W5HA 3H5IA 5EJ2A 3ELBA 1IK4A 4L8FA 1JG6A 3R8CA 1I0ZA 1SU4A 5D6OA 4OIMA 4XWTA 1A9TA 1E9EA 5ALIA 3WYBA 4IOKA 4EHDA 2BJWA 1I4EB 1KBZA 1QLJA 2E6UX 3BD6A 3KAJA 1L5OA 3M1AA 3OOYA 3GRVA 4E1BA 4F9EA 3ABQB 4RZXA 4R0MA 3G59A 3KSAC 5LZ7A 4BUZA 2WVAA 5D51S 4TYWA 1SVLA 1P1HA 2V0NA 2ZAYA 4OQZA 2Y93A 4DANA 4C7OB 3TINA 2N1BA 3S1LA 4ZOAA 4Y7DA 2BBTA 1BH6A 2HK6A 3PVSA 4OLBA 5DTEA 3N2KB 3V6MA 4HTFA 4IYRA 3R7WA 4RDXA 4K86A 1RWXA 5IBCA 3CF2A 3U5ZB 1M1NB 3VYWA 5F7XA 4LHYA 5AW5A 4JJGA 3ZGVA 3WMEA 1Z2AA 2G9RA 3BB3A 1TCAA 2BR3A 1P3JA 3HBLA 3QVGB 3D3NA 4KKVA 3RYHA 4E09A 4EA8A 2LD4A 1OQAA 3OOJA 4J16C 2HRZA 3BILA 4QUIA 2XAUA 4B4WA 1MQ8B 4PRKA 3DG9A 2VH5R 1W2HA 1ML3A 3HPRA 2B35A 4MYRA 1ORVA 3RVMA 4Z5XA 1A9ZA 2Q0HA 2VIIA 3HBAA 5KYTA 2P9JA 5IC5A 3N75A 3B82A 2Q6VA 3L7BA 4LVNA 3T9DA 3LYHA 2Q5JA 4C4OA 1SCNE 1VPWA 3AINA 4AJ1A 2EGGA 2Q3MA 1KI9A 4FEYA 3TBFA 1B00A 4D9MA 1ULAA 4PO1A 4CODB 4MVXA 4LF8B 5B3JC 3UV7A 2Y9MB 3DZFA 5C5CA 4CI9A 1O0CA 4DMMA 3UCEA 4KQ9A 1X0XA 1TXGA 1VMIA 2OD2A 3EHEA 1HE5A 2Y1CA 3MTEA 2FWAA 3ESBA 5TEVA 1OYYA 2A1IA 2A0XA 1I14A 3PCRB 2VJDA 5GJVC 2YVLA 3SBEA 1V6AA 3OSZA 1P0QA 2H85A 2YN2A 1ISPA 3N8GA 4WASA 3V2UA 4ARIA 1RYNA 2OMKA 1JR6A 3AESB 4Q4LA 2JFQA 2V6JA 3S2ZA 3PT9A 4A8JA 3KXLA 4BFYA 4HWPA 1K8RA 2VDWB 3ZJYA 1YZYA 1DIHA 2PXCA 5LVAA 2IYXA 2IRWA 2VWGA 1U7UA 1H05A 5GV7A 4E12A 2K7FA 1M0EA 2RH9B 1L5ZA 3TEMA 2EKLA 1ACMA 1N2GA 1XLWA 3NHPA 3UPDA 3WQQA 3CPSA 1P2UA 1V8ZA 1BVYF 2RGYA 1P5FA 4JROA 5DCYA 4JVOA 5E1BA 2OV8A 3SU8A 2CZGA 1L4MA 1MT3A 1TQ6A 3ZXXA 1T26A 4RA9B 4A23A 1QGUB 4BTEA 1M5TA 2HSZA 3R7LA 3HM2A 4L3VA 4B3CA 4JXZA 5ES3A 1W0KD 2PLNA 4E03A 2H1OA 1MA3A 4B71A 1V41E 3TKAA 1GRNA 4CUZA 3DXZA 1T2EA 4QULA 1FJHA 3FYUC 1ZHHA 1OLUA 3WNDA 1H5NA 3M1LA 2X5JO 1PTJC 1Y1TA 2F1JA 4GLLA 3ECCA 1JLRA 2A33A 3A1TA 3Q40A 4KSCA 3GJZA 4HDSB 2P3OA 4IVQA 5CH5A 5DM1A 4ZKEA 3V9AA 1G2OA 4ERNA 2CHVA 3HXMA 2GM4A 3P2KA 1X9GA 2Q29A 2C5BA 5GMOA 4D9FA 5JBIA 1I51A 1NR1A 1MG0A 2IE0A 4TTJA 4D4JA 1SVUA 2I99A 5AKGA 5JATA 5JLJA 3QJYA 3TW4A 1ZXLA 3HKDA 1X19A 1ZICA 3CZQA 4IGAA 2BGWA 2ZWPA 3Q9LA 2G3YA 3BOSA 5FNZA 1ZCFA 2Q2QA 3NYQA 5TMPA 1DUVG 1LQUA 1XVUA 2BGJA 2OVFA 3KKKA 4Q7MB 4JY7A 3VU9B 3VUEA 2BFNA 4RA6A 2G83A 5BMVF 3ZY2A 2PD6A 2BE9A 3QLEA 4HN4B 1NU8A 3IQDB 4EJSC 5A3RA 3FHCB 1TJPB 1JJIA 1WLSA 2PY6A 2RI6A 2WF7A 1C8VB 4INZA 1KJYA 4LVCA 1YQ9A 4DIDA 5IABA 2DWCA 2GK7A 3IRUA 1QTNA 2H3EA 2I22A 3H5AA 4Q5IA 1CQWA 4H08A 3BF8A 5TT0A 2AOXA 3OZWA 4M1SA 1G5RA 4Q34A 2Y8EA 1RYEA 1C7JA 4U2DA 5ECWA 4OL9A 1GNTA 3T95A 3H17A 4J1TA 1SHLA 4FNMA 1PGJA 4TTQA 2WJZB 4AN0A 4KIWA 2XTNA 2W93A 1IY0A 1NOIA 2LE0A 3ABOB 1E5QA 4KO8A 4QUGA 4E08A 4YAUA 3A8TA 2O7QA 1P75A 2EATA 2QRLA 5CJPA 4G0WA 3DFMA 3I32A 4PSUA 4XJSA 2WRZA 4CF7A 3F1LA 3B51X 3WL6A 1R15A 1YH3A 3RRNA 4DXAA 4I9HA 2FR8A 2VI5A 3DDNA 3WFIA 1DWPA 1P5JA 2XRZA 3DEAA 4ZPJA 3ZV6A 1QZUA 2FX3A 3LK7A 2XCTB 4C0JA 2G1UA 3IQZA 3V7WA 2F59A 3H1FA 1NI4A 2NYRA 3NBUA 3C1AA 3IIJA 4IIYA 2QU7A 4EJ6A 1NMEA 3G02A 4LHWA 1Z0AA 3BGDA 3BIOA 1TO2E 1U5AA 2VWHA 2QUKA 5TPWA 3S2EA 3F5MA 2EL9A 1IHYA 5BQOA 3ZIAA 5IFLA 2AMJA 4IUYA 3CE9A 3NIFB 4H7IA 1NKTA 2POCA 4JUCA 1Q0QA 3DBLB 3VSAA 3GJRA 4G26A 1SOUA 2CMDA 2I6GA 3HUUA 1QZZA 3MJEA 3MYYA 2Y6UA 1QVWA 4M1MA 3W6OA 4PLPA 1XRMA 4KDCA 4XQ9A 4F2PA 3RFVA 1P17A 5FYDA 3UTCA 2H48A 4D3ZA 1FZQA 1C50A 2GZMA 3HCEA 1JEOA 1XSEA 1M2OB 1WSAA 1GPKA 2R8OA 2ZSHA 3FHOA 1XHLA 2NAFA 3LBNA 3MMSA 1P4JA 1UXGA 5BSTA 5F3DA 3CCBA 4KR9A 2B92A 4WGGA 1LFDB 3BTOA 3GLRA 3U56A 4HQLA 4PGFA 2YYYA 4YLYA 3UK2A 1D6SA 3LJKA 1I9GA 3LZ6A 1PJBA 3JQAB 3A05A 4B3JA 1HRKA 2NO0A 5CK4A 1JXMA 4NVRA 2K87A 4MPDA 3OFKA 5IW8A 4XR9A 1UIMA 4BNVA 2EBFX 3ONDA 1XAIA 2CV0A 2OD7A 2V55B 2ODWA 4B7AA 1Q0TA 2JFOA 4CM4A 3ZI7A 3L40A 4Y2RA 3OCZA 3UATA 3B6MA 3HJCA 1FYFA 4GDFA 3EWIA 4JJFA 3IAUA 1JHXA 4BU0A 2QZPA 2CDRA 3JZMA 2Q3LA 3RYTC 5BSHA 2FW6A 4IH9A 3BBLA 4TROA 4TSRA 1UMDA 2VJPA 1JU4A 3FR8A 3VKGA 1DCTA 4YV2A 1DWUA 1NW9B 1UM8A 1XMQB 2VTDA 4TKMA 4G5HA 5DBOA 5HDQA 2H92A 3EMKA 4AN1A 1ZGBA 1W36D 4QYIB 1NAIA 1N2CA 2PUDA 3EEIA 1BRTA 2RARA 1HT3A 2DWPA 2W6ID 4OX9B 1WUTA 2CF5A 2XVAA 2EKPA 2BHSA 3BZBA 3IQXA 2AG1A 3TWOA 3O92A 3D4IA 2XE7A 1E5LA 4KQWA 3W06A 1ZUNA 2XECA 4PLGA 3DEHA 1IXRC 1N1DA 1WX1A 2BGUA 4WJKB 1RQPA 2O0KA 3ZNOA 2J9YB 5T3UA 1A71A 1PZHA 3FROA 3GB9A 5DBIA 4M7OA 3MAJA 1PK7A 2VNHA 1HSZA 2DY1A 4MO2A 3OJXA 1MQSA 4CIDA 2AUMA 1NYTA 2GK6A 3ZX4A 3ZBPA 4DJ5X 1C7QA 5AK4A 3SF8A 1JWAB 2V5AA 3KOMA 3LSYA 4H17A 4KTTE 2BM9A 5F78A 5IS2A 5AD1A 2EFHB 3EGVA 2R4UA 3WYGA 1Z2OX 2JGAA 4J3JA 4K9PA 5K0FA 2AX3A 2AG5A 4TM8A 4M89A 4I9FA 1QOQB 1XYGA 5SZKB 4OK6A 4WINA 5T6BA 3DTVA 1UJNA 4RD0A 1NN1A 4ZO9A 1C0IA 2HI0A 1YQDA 4LWZA 4QDZA 2Y05A 3VMFA 1C81A 2OHHA 1DCMA 1GQOA 3KKZA 2XKKA 3MB8A 5JS8A 2E89A 4BASA 1G8JA 1STOA 1SUBA 3C4VA 4MKZA 1FVOA 1C3XA 3HN2A 2BBOA 1QHNA 4LYJA 3VTAA 4EY5A 3L9WA 4PO3X 5ULLA 4KR7A 3BIXA 2AQIA 2R11A 1O54A 3AEXA 3PXDA 4HNAA 3HM9A 3NU1A 5EMKA 5G40A 3QVMA 4PZEA 2QMOA 1G3QA 1GL3A 1IIBA 1K2WA 5LP6B 2PRJA 3BDVA 5FKJA 1WO8A 3DL4A 1YS7A 3G0IA 3G3EA 3K5WA 3N53A 2JFPA 2OBLA 3MGCA 3MWGA 2XMRA 4RULA 4GEGA 2E4YA 3HYCA 1XE3A 3O0TA 1LWNA 4LJAA 1VYUA 1DJOA 1WUKS 3K9NA 4RORA 2GK4A 4JWKA 2WA2A 1TA4A 5D3KA 3LWZA 5DM0A 5CNIA 1ULSA 5G0SA 4EF6A 4Q3NA 2IHKA 4IH4A 2IYFA 3RT9A 4B3BA 4NH4A 2YW2A 4XYLA 1A5SB 3KQUA 3JQBC 5FUYA 4L28A 4OLJA 2G8LA 4K9MA 5LYYA 4WH0A 2RGXA 4MW2A 4RXUA 3IJRA 4IMRA 1CWUA 4D02A 3CR3C 3HY3A 1QIMA 3VU3A 1WZNA 1T0UA 3PNPA 1ETUA 2J07A 1T4CB 4FYXA 1UT8A 2E1RA 3L77A 5JAIA 5C51B 4IRMA 2FQXA 1EB8A 1S2MA 3K3PA 4UAVA 1S02A 4AJ4A 1NVXQ 4J1SA 3GJXC 2EZ4A 3UKDA 2RGEA 3GRPA 3GPLA 1OIWA 1QVVA 5AW6A 3AHCA 4GZLA 4LPSA 4RK7A 5AKLA 2FOXA 1US8A 5BOVA 3DQQA 1GL6A 1EP9A 4QO7A 3MGKA 4C6TA 2WKRA 2Q4TA 5TGDA 2JLAA 4N12A 2XRFA 5AVSA 1XTIA 2WR8A 2ZR9A 2QDKA 3MJFA 4FHCA 1GAEO 3TO5A 2UAGA 3O8OA 3ZW7A 1GOTA 3L6DA 3I09A 3CKYA 3LQKA 5H3HA 2YW9A 2J6IA 2GJAA 4MAAA 3E7WA 4I19A 1SBCA 4EFNA 4MVJE 4FP9A 1CRWG 2O20A 5DW3A 3R7DA 1O6FA 3UYLA 2ZSBA 5L4LA 1CD5A 1ZJ4A 2JI4A 4WZ6A 3CX7A 1PUJA 5FCDA 5KOJA 4RF5A 4HJXA 4S1NA 4QYTA 1A77A 1Y6RA 4HVAA 3W6PA 2AN9A 4DJDC 3ZQ6A 5C7OO 2DPLA 5EPOA 1LCIA 2JJMA 3QBJA 4J0GA 1KEWA 4MK4A 1E3WA 2P79A 1W2GA 5JNVA 1ZWLA 3F74A 2AE1A 4LNUA 2B1IA 2XNJA 2YYAA 4FUQA 4OATA 1L9KA 2QM8A 1YB1A 3EDOA 4RIGA 3T3OA 1IUOA 1QIIA 4FQ5A 5GQSA 3EXHA 4HB0A 3O8CA 5T4EA 3L4BC 4CQJA 4N41A 1NX9A 2EAUA 2V4MA 4KJXA 4EQ6B 3PA6A 4BCBA 3PIDA 2HSWA 1JHRA 4OB8A 4P4UA 1V3QE 1OMOA 2LZ0A 3A4YA 1DO8A 3I6BA 3P5BA 5CYOA 2Z08A 3DKRA 1CDDA 2O1XA 2W2KA 3I39X 2FVYA 3PFIA 1VIDA 3Q85A 1Y3IA 4HP8A 4BNDA 1MO5A 3OURA 4FDVA 1NQTA 3TSZA 4CQLB 3R74A 1G5PA 4K28A 2WV7A 3JQ7B 5NULA 4GRIA 4HEHA 2HIGA 3NKVA 2VTVA 3ZQKA 4JL8A 3AR5A 3FVWA 3TZKA 3G9XA 4R8VA 3F5SA 5AJXA 4XDYA 2UXCB 1WXGA 2Y4NA 3DPIA 3IP9A 1VPEA 4P83A 1NSTA 1GEEA 2XQFA 3ZXSA 1KKUA 1K88A 3FMVA 3JPYA 4C04A 4URXR 1TCVA 4JJEA 3PQ5A 1ABFA 3V8EA 1RSZA 2QSJA 4QBTA 4KJZA 2ZZKA 1LS6A 1NUHA 4H1WA 4II2A 1Y42X 2G6TA 3QBTA 4G8DA 2O2ZA 1JYEA 3KR0A 3MF4A 1IEVA 4QA9A 3RVSA 1SQSA 1TLTA 5CT6A 5LD2B 4NHOA 2BL4A 4EYEA 4PYRA 2ECQA 2A14A 3VR2D 5F64A 1YHNA 2HU8A 3LXXA 2B3DA 1O57A 2IEYA 2QM3A 2CSXA 1GKIA 2E55A 1W25A 2XQJA 1CUXA 4FJ2A 1I8TA 1JS1X 2ST1A 3QNMA 4R6XA 4YK7A 3W2TA 5JZBA 2JD2A 1E3JA 1WDMA 1Z82A 1CUIA 3UNXA 3H2ZA 1X7WB 2Z2YA 4G0MA 3AF3A 4IXMA 2OBYA 1YCDA 2G08A 2HCTA 2VP2A 1Z37A 3RREA 4B87A 1RACA 4Y6QA 5IT9A 3P2IA 2HJVA 2PUHA 4KQ2A 3MINB 3OIUA 4Y2VA 4C5AA 4I9UA 2IP1A 2QN7A 1Q1GA 5A6VA 3H99A 1Y8RB 2ZVPX 2ZKLA 3KC2A 4JYBA 1KYXA 1V16A 4QPCA 5MN5A 1ITZA 2PBLA 1CUZA 4IO1A 1NN5A 2XNKA 5IM5A 2O2XA 4H6VA 1SXJC 2ZVDA 3PSAA 1L3IA 5EESA 3CG4A 1F20A 3GL9A 3QEOA 3FSGA 4MQEB 1JBKA 3B1YA 1U1IA 2F1OA 2VLBA 3LDUA 4H0NA 4I8DA 4OU5A 3WA6A 3O8RA 4TV8F 1JAYA 1V11A 2P5TB 1E98A 1R4MB 4JC5A 1HFKA 1L7DA 2DSNA 4O25A 5CVEA 3S4YA 1QHGA 4AF7A 1GDTA 1Y4DE 4BIMA 1A96A 3PR1A 3ZJ4A 3LRPA 5A1TA 1JWLA 4AMGA 1UBUS 5FL7D 1YK0A 4BECA 4ENRA 5KTOA 3T7IA 1OW3B 4AIRA 1SOVA 3H4IA 4D44A 3PC6A 2JLVA 1E1CB 4KNYA 3E7FA 4NSNA 3OO0A 1SQFA 3PXAA 5BN3A 1YBHA 4EVQA 5IPFA 2G07A 3DE7X 3PQ7A 5ITZB 3IVCA 3K09A 3DWIA 4C7JA 3EEOA 3THYA 3H5OA 3ML1A 3UC9A 2HA5A 1JEDA 1A8PA 2EG9A 3G82C 5ER9A 1O77A 2GCNA 5FDFA 4TUYB 1JDTA 4J1QA 1G55A 2W2LD 4BUCA 3IPAA 3T61A 1G5IA 5AHOA 3X1MA 1ZD8A 3U9TA 1A2OA 1ZESA 2R6GA 3R44A 5CNKA 1NF2A 2HRBA 2IHJA 4AKHA 2ZB3A 3ESYA 2IHNA 1JEYA 1K89A 3DNFA 1CC1S 2R44A 3KD3A 2MMCA 3UGTA 4F9FA 4BX8A 4XFKA 1O03A 3BAZA 1IC6A 1L7EA 1JU3A 2C77A 2FSVA 2ZJ7A 3QNWA 2GPTA 4JBIA 5B53A 2R60A 5KNDA 1ZHOA 2RKBA 1RQ2A 3KYJB 2RIPA 1CTQA 3VHXB 1AMUA 4LFAB 2MIIA 3HLYA 4KMMA 2QSUA 3M6VA 4AZVA 1EE2A 1V7QA 2PYDA 3DOFA 1OWPA 3K2EA 1TUEA 1I2MA 3MCWA 1C3JA 5H4GA 4GM4A 2R6DA 4F6LA 3C7KA 1XNGA 1E6MA 5EE0A 1GZUA 2WV9A 2XJ9A 1EXMA 3D0QA 2C2MA 1IXKA 2O05A 3PJGA 1CJUC 4Q15A 1CJMA 2VJLA 2CFOA 2JNWA 3CSSA 1WZ2A 2V9CA 1QO7A 3ZCUA 1JLSA 1YJAA 4G0YA 2YOGA 3G88A 1G5TA 3BQ9A 3B2NA 2BR4A 4QDJA 3TD9A 3QA3E 3M6AA 3R3JA 1W5FA 3KUDA 4WK4B 4D25A 2JAHA 4LGYA 2ZSJA 4UD6A 4CIWA 4NU5A 3WIOA 1RI2A 3I5MA 2C2BA 4EP1A 5KU1A 3AVYA 3TE6A 2ZXFA 4GVPA 1OBCA 2CD7A 3ESAA 3O21A 2AEMA 1XNQB 3FSRA 5AI5A 3VU0A 3EF1A 4P34A 3GOHA 2CT8A 4WQMA 2FWJA 4JCOA 5A6SA 2HNKA 3A37A 2HWKA 4HQOA 2PBRA 1Y7LA 3C7TA 3UPUA 1DFHA 3ZDCA 1JDJA 1Z4JA 3MAGA 1SZDA 4IIFA 1E20A 2P0AA 4JBYA 1G66A 1XAGA 2AYYA 3IDSA 2ZBRA 1XZCA 3M33A 2WAXA 2R1TB 3L1VA 4KQIA 4JC8A 1E3MA 3FNGA 2H29A 2PRKA 2D06A 3AR2A 1YQQA 2VBGA 1QRDA 3VX3A 4OGGA 1QLWA 3U44A 4R16A 4DA8A 3PHGA 1X87A 2Z3VA 1KJIA 5A9TA 2X86A 1FOEB 1M9NA 1T36B 1Z34A 3RHZA 1PR1A 1XWIA 3PF9A 1DKOA 1KEEB 3K1AA 5BMVA 1W6RA 1Z88A 2YR0A 3NFRA 3Q7PA 2YHBA 1JG7A 3AHEA 4HWGA 2B34A 4YAGA 4GNRA 1H8HD 2LBPA 2P11A 3HCNA 3BC1A 1ULHA 5AKXA 3PLAE 3UWDA 1DRKA 1VE1A 5I3ZA 3Q98A 1IOVA 3U1VA 3D7LA 2RAFA 4MRAA 2P4SA 4DV6B 4TWJA 4WEOA 2BEWA 4FFDA 4DA4A 1EK1A 3B52X 4MV7A 1A5TA 2DULA 1VHJA 3NWOA 3UVEA 1ZJZA 1OY1A 3MS4A 3QHAA 3BMOA 2PH3A 2PMFA 1WAMA 1RRKA 3RS5A 3NPAA 1Y3FE 5COAA 2ODNA 4DABA 4P8RA 2ZPUA 4ND4A 3PYLA 4BCDA 4ZTBA 3V1UA 1V1MA 1X94A 5H3CA 4Z4IA 4B3HA 4Q4HB 2JVJA 1EFKA 1L5VA 3Q3IA 3L1KA 2QYHA 4G5OA 4HAOA 4ERXA 5B3LA 4W1SA 5AW8A 4KBFA 4ZU1X 4H4CA 3LY8A 1S5PA 3QVTA 3EFOA 3OT1A 1Y7HA 1QAOA 1LH0A 2A5LA 1IAQA 4KI7A 1D9ZA 4Y0AA 1J2YA 1AHNA 2FPPB 4ARAA 4P4GA 2PTHA 3WGMA 4RW0A 3BTSA 1K7YA 5LP1A 3TBKA 3WGYA 1KBOA 3K53A 2EGUA 3WK7A 2Q5IA 3ASYA 5E8JA 1U2ZA 1N2BA 4FZ3A 3ZKAA 5ECGC 4GPZA 4JI0B 4KBGA 2KLHA 3R41A 3ZVMA 5A0VA 3B1FA 4JI6B 1Z39A 4EGSA 1Z5GA 4Z7NB 4IM7A 5E6RB 3AXTA 2AWOA 5H59A 1VHLA 2WSIA 2OZKA 5IK2A 5HNKA 3JAKB 4ZVKA 1MAUA 1AHIA 2UZ0A 4HNRA 3SE7A 4BNKA 3PGXA 1T13A 1M75A 2XUOA 3AHFA 3HXPA 3HYSA 3DONA 1ZMTA 5BYJA 1R0BA 1O5IA 4FBGA 5A5GA 3ZHVA 1Y6GA 2FCRA 1AHHA 3I05A 4RZ3A 3QPVA 1LFAA 1I6MA 4FFPA 1XZEA 1ZRHA 1NQWA 5AHRA 4ZEVA 1GM5A 5FUMA 4HFNA 2QT9A 5SY4A 4BKRA 4LOLA 3EASA 2GVZC 3W2GA 2JS7A 3SZMA 4O2BB 1EAYA 3E9CA 2FWPA 1Q17A 1PGOA 3M81A 5ESWA 3EVCA 3OD1A 1JKFA 2WLSA 3F71A 3B7WA 4PX5A 3OJ0A 4OBWA 4BLWA 5T8KA 1G98A 4IYJA 4FFNA 5AKEA 1DCKA 3QI7A 2OGZA 4DUGD 4I5GA 5E1MA 1LD3A 4NG4A 2WTNA 3T3EA 1EP1B 1YZKA 1LK5A 2NVBA 2Y66A 3EJ6A 4RH3A 3SR0A 3R9XA 2R96A 2ZJ6A 4P92A 1XCJA 5IULC 2Z5FA 3KWLA 3QLVC 4JLKA 3S81A 1HYGA 1WPXA 3CBGA 3GLHA 4BL5A 2ZYIA 4XD7A 4PYJA 4LEIA 5KTYA 2FVXA 4Q1CA 4UUBA 2EX0A 3PNQA 5CK5A 1N75A 4JUFA 4EY3A 2CLSA 4WWHA 4B73A 4M6WB 2YNMD 3P2EA 3ZIDA 1WY5A 1Q0LA 1SBZA 2JDIA 1KO4A 3JALB 2I67A 4WCVA 2ORWA 1JI3A 1V5FA 2OORC 2QBYB 1FMFA 3ANNA 2HA7A 4PRZA 4FKBA 3DBRB 4Q93A 3LX4A 3T3PB 3EIFA 4WLUA 3V4ZA 2JKVA 3ZUPA 1IN4A 3E7XA 2YBEA 3VJMA 3GW8A 2QAGC 3R3WA 4GRAA 4LYEA 4CLRB 4GBED 2UYGA 1MFZA 4WLVA 3ZHZA 3AEUA 3PXGA 4CTJA 2NUBA 3AU9A 4JQSA 5J1SB 1NT2A 4DYHA 5CPFA 1NVEA 2JBAA 5AW9A 1R5OA 3EEQA 1KNXA 4E13A 1H2BA 3DR5A 2PZKA 4JLPA 1IHDA 2V6GA 3D0OA 5CA0F 9LDTA 2HPAA 1SG9A 3E9EA 1JQDA 2QTTA 5AM3A 5BW4A 2D2VA 3QU7A 3T7TA 5CA1B 1I3MA 2WKWA 3OPQA 1Z8HA 4NNPA 1ZM7A 4JEMA 3VJKA 4RZHA 4PAQA 2GF2A 5EJFA 4GHWA 4LV6A 5LZ5A 3CLTD 4X66B 2X9LA 3RIXA 2ZREA 2Q8PA 3RTCA 1YDFA 1UWVA 3DYIA 3H4MA 1KO7A 2ZYDA 4JXJA 4KMOA 1SU8A 4DQKA 3B38A 3CURA 1PWEA 4NATA 3TJMA 3KUXA 4ROTA 2HJWA 2O9JA 3WKBA 4ENPA 4YMVA 2BH9A 3LUGA 5KYYA 2VSOA 3OIDA 3AVOA 5CCBA 3JY6A 3MQ2A 1OKKA 2GETA 2ZB4A 4KQFA 3TPZA 4BVJA 5EKUA 3KOXA 1TZ2A 4FGJA 4XCQA 4R5MA 2ID8A 3WLHA 4KUEA 2YY7A 3KXIA 4FYJA 2FP3A 2X1HA 3OFSA 4HTFB 3R7WB 3JQCA 1VM6A 4QFMA 3Q12A 3LQ2A 4BE9A 3T1YB 1CVLA 4TYPA 2FOLA 3PGA1 2IEDA 1F60A 1W5SA 4DPKA 2ZJ2A 4QNMA 3FM9A 1ZJJA 1U2TA 2PZGA 2BZ1A 3K4HA 2PR7A 1YE8A 2DR0A 1R8XA 1JQLB 2AE2A 2WIFA 3VTFA 4BV2A 4BAZA 3IAFA 2AS0A 4V1CB 5F52A 3MCAA 4G0OA 4HDNA 1BQ3A 1R8YA 5HF8A 9GPBA 4GSLA 1RXWA 1BOOA 4Z4HA 5FTJA 1E1DA 2I9PA 2QJWA 4R1NA 3CJQA 2ERYA 3HU1A 3JR3A 1AK9A 2VCHA 2BCJQ 3GAFA 4J2TA 3BD9A 4DMGA 2ONKA 3LKDA 4LJ6A 3UCFA 4JI1B 1UJ2A 3OM1A 4Q4AA 2QZJA 3FH0A 2GPSA 2PZLA 4DV2B 1SKBA 1PE0A 4BIIA 1UC9A 5FLKA 1IRXA 4MUJA 1QBGA 5AVVA 1NXVA 3DHNA 2F8MA 1AO3A 1PP4A 4IO0A 3DOIA 3L8DA 3KRTA 5CT8A 2Q3JA 5F33A 1XZQA 4L4SA 4BLOA 4ZZ3A 1BS9A 1DINA 1DC4A 4R9SA 1ADBA 2YMQA 1MJ5A 4LA4A 1W87A 2IWHA 1ZVMA 4INAA 4A8JB 3OHPA 2EQAA 4COOA 4UARA 5AXDA 4DAEA 3SYLA 3PP8A 1XNJA 1WW2A 3MGAA 5AO9A 4CEHA 1NBAA 3V8NA 3DE6X 1CRQA 4Y7CA 5HG0A 1HTBA 2CNWD 3T9AA 4XD2A 1Z12A 2P91A 2LDBA 5E6UA 1YZNA 1R0YA 3SYNA 1B6GA 1SBHA 3ZWVA 4ND7A 4DIBA 4J7UA 2NTYC 3ND5A 4MPPA 2YWCA 2EWMA 2RHOA 2F62A 5JSYA 1SQ5A 4RHCA 5BSEA 3S40A 2GR9A 3OSUA 1I3CA 4QUHA 4JBNA 4I5FA 5DMHA 1JQ3A 1VCHA 4BQRA 4YUAA 4PAOA 5DN6D 3H8SA 2F7SA 5B37A 2P69A 1KI2A 4LOIA 3SG0A 3KYDB 5IH7A 1BMDA 2P78A 5AFSA 2H2IA 4KK3A 1XBTA 1E8DA 3AUXA 3QNUA 4I6GA 5TVGA 3UTDA 2WSSA 1FCJA 4GQBA 4DQLA 3IILA 4JLVA 5AHXA 1CK4A 3FAZA 4X8OA 1QU2A 2GZ3A 1X42A 3O9ZA 3WWPA 1CJBA 2BKAA 2FUCA 2J3LA 2TSYB 4HGOA 2WJGA 1XF1A 4OJYA 1QGYA 1ZFNA 3ROGA 3ZNQA 4A7PA 3PU6A 2ZAOA 3B5IA 3QU9A 4E11A 1TA9A 2ZM6B 2AF3C 4X6UA 1MPXA 3CUYA 3SY8A 2Y6VA 3IO5A 1FTSA 2BP7A 2RKWA 3AUJB 3HEBA 2Z5VA 2XNCA 4HJRA 4KHZA 3TI9A 4UMEA 1GIAA 3RBVA 3U17A 2XUFA 4HDRB 3ACBA 2NZYA 5BYBA 4QC2A 1PJCA 3TN7A 5E7IA 2XTAA 1C4XA 4RJKA 1DT5A 2IPMA 3IQIX 4DLUA 5AIBA 1R6VA 4RA6B 1KO1A 3EIWA 5EIOA 2G1PA 2ZETA 2PZFA 4PXAA 4D6XA 2HMUA 1RC8A 2FP4A 1B41A 3O2QB 4XIJA 3JS5A 3K0KA 3A1WA 4LHXA 5KX5F 3TOXA 1ADFA 1GN8A 4UUQA 3IBTA 1DIRA 4C6SA 1DBSA 1W5EA 2HKIA 5KHLB 4F97A 1LDEA 2CHEA 5K0ZA 1S3GA 1YR8A 2CHFA 3GQVA 3OH8A 5M5BA 1W36C 1FYVA 3I42A 2I4OA 3DP7A 3TLCA 2O07A 4YCCA 5HR5A 4R2LA 4HN9A 1TU0A 1LZLA 2G40A 4MJ7A 2BF7A 1K5PA 2OILA 3MUEA 2YRWA 3O1IC 3WMGA 4UTVA 3ICQB 1CCWA 1JL3A 2JPDA 3UK0A 1SK8A 2JBWA 4BFVA 5KWIA 1FLAA 2J87A 1EE9A 3PJFA 3UJHA 2QAIA 2HUNA 4U2GA 3RJTA 3C8HA 5ALZA 4ZI3A 1P8JA 2IPLA 1R88A 3M6XA 3NR2A 2BJVA 4IGEA 2I2DA 2QENA 4DBZA 4Z54A 1IY1A 3CEPB 4OLFA 4MQMA 4X7PA 1QK5A 1Z0UA 4EHHA 4EI7A 1LLFA 1SUCA 3ESQA 3GCWA 3K9BA 1NI4B 2XVMA 3W3AA 4N8DA 4DNFA 1BRMA 3UHFA 4EAAA 4EJ2A 5T7BA 1X8XA 3I2HA 4OAOA 3STWA 5LKRA 1CZUA 1N2EA 1K68A 5TPWB 1SOMA 1BQEA 4PANA 1SXQA 1FIUA 4MAMA 1V3UA 1DKRA 1N36B 4TV8A 1VKRA 4GIBA 2AG8A 5F2KA 4E5KA 3TDKA 2WJ6A 4X91A 5AM1A 1GU7A 4XWGA 4R9UC 4L07A 3U4MA 3IE0A 4HGRA 3MCZA 1RXSA 1KDPA 3LVFO 1PWZA 1O95D 4JB2A 2A0FA 3VOSA 2LDXA 3PIIA 1YONA 4L3OA 5ALUA 4EHLA 2BDTA 3Q10A 4NNJA 3QWIA 3RK4A 4BZPA 5CXQA 4QOFA 4ZZ2A 5TLSA 1U1DA 1ZOIA 4YFVA 4AJKA 3AF0A 4U6QA 4FD3A 5KHAA 1Y98A 4RF3A 1M6WA 2OBNA 5CB4F 1EK0A 3P0RA 2V6BA 2FMHA 4I4IA 4GP6A 2PT5A 3DVLA 3ASZA 3C98A 3KX2A 2B7CA 3W4JA 1E1RA 1WKBA 3PQCA 3SP1A 4ZYVA 5KJ6A 3GLFA 5CBPA 1FU7A 1KK0A 5B1SA 3W2IA 1E6KA 2YWDA 4YLGA 1FXWF 4BZXA 4CM4B 2O8CA 1M0SA 1P4SA 1OOEA 3GFQA 2C4KA 4NZNA 3ZZ0A 4JODA 1U80A 1T5OA 2WPDD 4AUEA 2BH2A 1WUIS 1BS1A 3CF0A 3HXTA 4JQYA 4QT4A 3AL0C 1DDOA 2P30A 4OK3A 1KIAA 4B43A 1O6CA 1Y37A 5T4HA 3H2YA 4DRXA 1UMDB 1MDFA 4MCIA 4QUDA 2FZGA 2ZYVX 4C3UA 3DEFA 5JH7F 2NOAA 3F5QA 2PUBA 1ISFA 2KBFA 1U0JA 1P2GA 3WL5A 4BP3A 4HEQA 1J8YF 3DLCA 4NYIR 3UV3A 1QFXA 1Q22A 3EQZA 5AVTA 3BFJA 1N2CB 2ZW9A 3CRRA 4H3KB 1BWPA 2GK3A 4OMUA 4BWVA 2WWTA 4JP5A 3C3WA 1CY8A 4OF4A 4Q01A 4AS2A 6GPBA 3HP4A 3BGIA 1ZUNB 1E2BA 3K35A 1OB5A 2D1SA 1G3MA 1ZOLA 2BGMA 2BUBA 3ONWA 4PZZA 5A04A 5IZCC 2F1IA 4LOHA 1ZXBA 1LK0A 1V3TA 4DCVA 3PICA 1ZZGA 4H1UA 2E5LB 3E18A 4ALIA 2ZDGA 2JLSA 2EDAA 2AKEA 5I9SA 1SB9A 5LBTA 2HNBA 4MKRA 1BX1A 3R7BA 3JD4A 1DNPA 2D7CA 4GL4A 4BGUA 2R7LA 5L3QA 2BM1A 2WSLA 3QITA 5CDGA 1JLMA 5DLYA 3SF8B 4NBWA 3CPHA 4QLAA 2XGSA 4FR5A 4BNYA 3AG5A 4G65A 3WLEA 4D9IA 1YAJA 4X6XA 4XD7D 4RQAA 4YLEA 1Z6TA 4MTLA 1OX4A 5EJ8A 3AKZA 2H7XA 3TB6A 1Z5PA 3KR9A 1UMKA 4MR7A 4CMKA 5KNBD 4IV0A 3H75A 5DNVA 3DTVB 4R51A 1S6YA 2V9ZA 5BQFA 3EK2A 4UM9D 1V9LA 4UJ3A 3AP1A 2IP2A 3TTXA 2FZVA 1SVOA 3H8WA 3J80A 5AVKA 3KSBC 3TXAA 4BFWA 4D5GA 4QWMA 4ZYWA 4CF4A 5K3FA 5DEOA 1TF2A 1GILA 2HF9A 2R1VA 3IUJA 1ZJ5A 4G84A 5EHQA 1VP9A 4D45A 2HU2A 3KU4A 1UBHS 1VB3A 1KHHA 1T3GA 2BKLA 4F92B 1KTIA 3O38A 3BH0A 4HNAB 3PNMA 4HUJA 1G4HA 2FPSA 1RP1A 3E84A 3TQOA 4UJ5A 3FTCA 4RJIA 4R69A 4YGYA 1XVAA 3CRW1 4K46A 2QRNA 4EHFA 2NO5A 1KVTA 2CJWA 1GY8A 4ZIRB 4H1VA 4URZR 4A15A 4Q18A 1Z5VA 3QG5A 1PV1A 3CIOA 3DD5A 2AFVA 1C9MA 3DSRA 2OKGA 4JYPA 3REQA 1TQDA 2WP8J 3GYBA 2R84A 3ZQJA 1N1MA 2VHWA 3B1KA 3VGPA 3R6WA 621PA 4EUNA 4D4HA 3OHMA 4MB6A 3GEDA 1ZISA 1RMQA 1BAPA 3I64A 2C31A 3PENA 3DKVA 2CWWA 1R37A 2FEXA 5BVGA 4FZJA 4PAWA 3INTA 2FPLA 1E7SA 2YVUA 3GHYA 3T4XA 4O4HB 3U37A 1T8UA 1VSBA 3VR3D 4B32A 3B6EA 4JT8A 1FYWA 4NCNA 2LCIA 3D6HA 3ECSA 3NHZA 4QU8A 1P9OA 2XT9A 1CRPA 1EGQA 3RI3A 4PC6A 1CQZA 1Z7BA 3VZBA 4YT8A 2QUZA 1FFEA 4UDNA 2XLBA 1XXHA 1US8B 2HXSA 3FB4A 2FK7A 4CM6A 3HFGA 1KKLA 2OHOA 5JJBA 4L5IA 4C6TB 3WO0A 4JCCA 1G42A 5LCXA 4W5HA 3COZA 1TYDE 3OIWA 4BOYA 5C1OA 1SVMA 1KPIA 1NVGA 3TQTA 2J9FA 3O8OB 3TNFA 3WB2A 1UC8A 1YS9A 2VZLA 3H19A 2P5SA 3KWJA 4EX7A 4WOPA 1U2PA 3RPEA 4UU7A 3WGZA 4BEJA 5L7WA 1PUXA 5EP4A 5AP9A 2COEA 5KYWA 4FKZA 5EJ9A 1N2CE 2HLDD 4XWWA 2B8JA 1T8TA 5D7BA 1WULS 1YR6A 3LDFA 4F5ZA 4W9RA 5KOJB 2OSBA 2XUDA 3ISVA 1K4MA 1BVRA 2I7VA 2IH4A 4MLCA 3I58A 4F60A 2VXOA 1WTCA 3OZFA 4C2TA 4ZU3A 3GFVA 3L7DA 4MLPA 2P4QA 1W49A 3PQ8A 1C7FA 3QF4A 3UHJA 1E3WB 3NCHA 1G9XA 4LNUB 4CLHA 3W5SA 5ECDA 1VJ5A 1EK2A 4V38A 4DEVA 3QEBZ 2AA3A 5FRDA 4HS9A 1JG4A 3WGNA 2ZBQA 3EXHB 3FBGA 4KYTA 3ZG6A 4DDTA 3ER9A 1AZWA 5JS7A 1AOXA 3DW1X 4QVGA 4E88A 5AKZA 3UC5A 4B4UA 5BR7A 3OTIA 4PGMA 3W6UA 4L72A 4YY3B 1U8AA 2Y76A 4I6JA 5EFZA 3UMSA 3FTQA 4YRNA 4BBPA 1LBEA 3PWSA 2W2KB 2XUGA 4BNDB 4YACA 1ZVJA 3A25A 1T43A 1S3IA 1FNDA 2CVQA 1FNMA 3DO6A 4QATA 4PZ9A 2J0SA 1SCDA 3INGA 4DARA 1XALA 1Z26A 1Q3TA 2R6JA 5FULA 4MO9A 4CM5A 2QJRA 3VSEA 1VE6A 3BD8A 3H5TA 1P1FA 2IZ6A 1UDAA 4DLLA 1E3EA 1EHIA 3K0HA 1FNBA 1FRNA 2OFFA 1ICIA 4Z7QB 4US2R 3AFMA 4BKUA 4A1FA 3IDFA 2JFHA 4CCYB 3BCRA 3EGXA 5FQNA 3T12A 4MUEA 2EGHA 2YFYA 4PQEA 2VHZA 1IK6A 3A3YA 3HDJA 3PHBE 3D7RA 2VPQA 3GT3A 4HLUC 5DBFA 4UCWA 2XZPA 3VTZA 4M0DA 4DLYA 1IY8A 3HQ4O 4MEJA 1ZVQA 1E2DA 2CUZA 1QG2A 1N9GA 3UHAA 3N7UA 1E99A 2A5JA 2FYTA 3DC7A 1Z74A 3BFKA 3OE4A 4P32A 4BP9A 4FMDB 3I83A 5K0SA 1NU6A 3WKEA 2AK3A 1GG5A 3ZI4A 5DX8A 4A6PA 1MJNA 3ZDFA 5IK2D 3I6IA 1EG2A 1KFEB 4DT1A 2C98A 4WY2A 1YJBA 1BX3A 2FHPA 4L6IA 5HFAA 3Q8KA 4LF7B 3HFSA 2ZPTX 1BA3A 1TZKA 3MUFA 5AK5A 3N59A 3PXCX 3PX7A 1LLQA 3FPHA 2OCDA 5CA0A 3DZBA 2ZRGA 1WQ1R 1E59A 2RE8A 1W30A 3IJPA 5ECYA 3H3XA 4M9ZA 4QNRA 1XVVA 1L7RA 3OY7A 2VK8A 4FD2A 5DRTA 1ZMRA 4HFRA 3F2VA 4LSGA 3G6WA 1NP6A 2P75A 3PNSA 3SJBA 2F8SA 1S4MA 3I9OA 4CTMA 4FNGA 1J5XA 1ODKA 2I71A 1XYVA 5DZSA 1XJ0A 3GFBA 4NEGA 2B8TA 1A1SA 1EDOA 3H6GA 2VDQB 2QTRA 5FOXA 4ZCMA 4QU9A 1G6HA 1V11B 4DV3B 4DKJA 1XCPA 3C48A 4ETIA 3CV3A 3PGMA 2ORIA 2I03A 5H1YA 3BULA 3TDNA 2H11A 4K3UA 3RIGA 1UMBA 4OJQA 1NYQA 3C97A 1L7PA 4K6HA 1L1FA 3T94A 3HR7A 2IXFA 2NVOA 2Q2OA 3FWKA 4AX4A 1BCSA 4GMFA 5BN3B 3PC2A 4HMPA 2GJ4A 3THYB 4QELA 1BZYA 4F96A 1E61A