3R1IA

Crystal structure of a short-chain type dehydrogenase/reductase from mycobacterium marinum
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
254
structure length
254
Chain Sequence
SVLDLFDLSGKRALITGASTGIGKKVALAYAEAGAQVAVAARHSDALQVVADEIAGVGGKALPIRCDVTQPDQVRGMLDQMTGELGGIDIAVCNAGIVSVQAMLDMPLEEFQRIQDTNVTGVFLTAQAAARAMVDQGLGGTIITTASMSGHIINIPQQVSHYCTSKAAVVHLTKAMAVELAPHQIRVNSVSPGYIRTELVEPLADYHALWEPKIPLGRMGRPEELTGLYLYLASAASSYMTGSDIVIDGGYTCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium marinum
molecule tags Oxidoreductase
molecule keywords Short-chain type dehydrogenase/reductase
total genus 97
structure length 254
sequence length 254
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3r1iA00
4MVJA 3SC4A 3DOCA 4RZHA 3VZRA 4J0EA 2LDXA 1HZZA 5L51A 5L95A 1ULSA 1WWKA 4CM4A 4UVDA 3WQRA 1ZUD1 3GMSA 1VJ0A 4Z9XA 2NVUB 5JPIA 5U1PA 4BNUA 2P5YA 1IULA 3C1AA 3DFUA 3GEGA 3I52A 2GO1A 4PRLA 1SMKA 3NKLA 4Y98A 1BG6A 4YWJA 3RUAA 4R9RA 1Q0LA 3JQCA 2X4GA 3LC1O 1EMDA 1LBEA 2OZPA 1G0NA 3JQ7A 4FPXA 1XG5A 3ZU3A 3IP1A 4NH4A 2ZTMA 5CHEA 4YPOA 2OFPA 2OP1A 1FK8A 3PVZA 4CLRB 3DHEA 1W0CA 3JQ9C 1PSDA 3Q6IA 3H2ZA 2J5QA 3JD1A 4CMJA 3L4SO 2UV8A 3MEQA 3OJFA 5TF4A 4YT8A 3X2FA 2NADA 3OQBA 4XQCA 3DTYA 3L4BC 3O8QA 3JQEA 2P2SA 3ZW8A 1VM6A 4BMNA 4U7WA 3ADOA 1XCBA 2GN9A 1BW9A 1EUCA 1E7SA 1LC0A 3QLJA 2BHLA 2A92A 2NV6A 2Q99A 1F0YA 1LLCA 2ZTVA 5JFOA 1N1GA 1C0PA 4U6SA 3IKVA 5G4KA 4GPD1 1DJNA 1MFZA 1QORA 3C1OA 4I1IA 1E7YA 2C07A 1E3WA 2D8AA 2OUIA 5GMOA 3VDQA 3WYBA 1UUFA 2XF8A 5GZ6A 5JO9A 1UZNA 3RSHA 4N5LA 1RKXA 5A9TA 1EE2A 1UR5A 1Z45A 2Y68A 3G79A 4YJGB 4D79A 3FR7A 3S1LA 2GZ2A 1GEEA 3A06A 3F4BA 1QYDA 3HSKA 3LT1A 4L9RA 1SOVA 4TRRA 5TT1A 3OP4A 1R6DA 2EF1A 3ZU2A 2X0RA 4HUJA 1GY8A 1T2AA 1D8AA 3DBRB 1ADBA 1JQBA 2OMEA 1NXQA 4PVDA 5GZ3A 3AW9A 3TL2A 4GVXA 1V6AA 2C20A 3ZNNA 2E4AA 3R1IA 3ZWVA 5DZSA 4AJ2A 4Z3KA 3D7LA 3FWNA 3WR5A 3D4NA 1AE1A 1FMCA 1VPDA 3NUGA 4J0FA 4JK3A 3KSDO 4GX1A 3KYCA 1HDCA 3R0IA 3UOGA 3ZU4A 2VHVA 4W99A 3OM9A 2B5WA 2BF7A 3H5NA 3I3OA 4GI2A 4J4TA 1GEGA 3HADA 1F8GA 3H7AA 4R16A 1I24A 3TNLA 2NU8A 2EKPA 1NNUA 4MP8A 4XX0A 4BGIA 2OXIA 5AXCA 3E9QA 3W8EA 4TZKA 4U0JA 1I32A 2D1YA 1Q7BA 2X9GA 4RPLA 4YT5A 5C7LO 5THKA 3PZBA 1C1DA 5DCYA 3TJRA 3DQPA 3MZ0A 2JHFA 5L7YA 1TT5B 3KYDB 3NTOA 1CWUA 4CV2A 3AI1A 3VZSA 3H4VA 2CUKA 1AHHA 4XGIA 3U4CA 3G1UA 4CM8B 3L6DA 4CODB 2AHRA 4J4HA 5B37A 3TRIA 4LMPA 3ICCA 2NVUA 4TKLA 4PFJA 1HT0A 1SNYA 2CDCA 2GERA 3KUXA 5IN4A 1NWCA 2O2YA 2AW5A 2X1HA 2UYYA 4LCEA 5H81A 4BNLA 1P74A 3H5AA 4IQ8A 1EQUA 3E6AA 4Q9NA 3NDIA 4DXHA 1YQXA 1A27A 2Q1WA 2EP5A 2PD3A 3BHMA 3IP3A 4FFLA 3SBOA 4CLHA 1RM3A 3GGPA 3PQEA 4CUZA 4HFMA 5CEJA 1EVIA 5JAIA 2W2KB 3U5TA 3BMNA 4B7XA 1QV6A 1U5AA 2FR1A 1AGNA 4E32A 2EKLA 4PG4A 3RC2A 2IXAA 1DLIA 1QXSA 3OJLA 4K9DA 2VHYA 4FFMA 2VWPA 4IDEA 4ZJUA 1P31A 4ZD6A 1M76A 4NI5A 4XYGA 3GGGA 2J6IA 2P9GA 1R0SA 2W8ZA 3GN2A 4YJDA 4CMEA 3W8DA 4IUYA 3UXYA 5ITWA 2FRDA 3PWSA 3CTMA 3PIIA 1E6EA 1IE3A 3AY6A 3KYCB 2HJRA 4BB6A 5JY1A 3JQGB 1E3JA 4YEDA 4U6QA 3QWHA 4LMRA 4DMLA 4YRDA 5IXSA 4F45A 2G82A 2X9VA 3GMDA 2YFHA 5COBA 5IXYA 4FC7A 1WLYA 1B2LA 4A73A 4RVHA 1DC4A 2PFGA 4IQ0A 4CMGA 4EDFA 3PIDA 4A03A 5DBGA 5KNLA 5TNXA 2Y05A 3VPSA 3A14A 1HSZA 1HTBA 3HB4X 2Y1DA 3GDGA 3FPLA 2QYSA 1KC3A 4NU6A 4AJHA 4E6PA 3ZWPA 5I7VA 5TS3A 2EP7A 2I3GA 4IDFA 2B4TO 3QP9A 4OOEA 1D7OA 1LSSA 3G0OA 4CMCA 4K6FA 1GUFA 1H6AA 1ZFNA 2YW9A 4K6CA 5IN5A 2D2IA 3TZCA 4EJMA 4FB5A 5IG2A 3IKTA 3NAQA 1BHSA 2RHCA 3F47A 2VTEA 3DBLA 4UVIA 2TMGA 1F06A 2YDXA 3UCEA 2VCYA 5TIIA 3M2TA 4IM7A 3GK3A 4GL4A 3ORFA 1Z7BA 3HN2A 3ROKA 1R37A 3PHLA 1HL3A 1G6KA 4GGPA 1BXGA 2OBNA 3GVXA 5MDHA 3A28A 3EUWA 5DCWA 4II2A 1ML3A 4NJMB 4BO3A 3MJEA 3PJGA 5HRUA 1K3TA 1LI4A 3DZGA 4GKVA 4AJ1A 1G0OA 1TI7A 1KERA 1E3SA 1Y9AA 4EEXA 5A9RA 4BKUA 5BQFA 1BVRA 2BH9A 3K73O 3JCZA 3LK7A 4RCVA 4L4SA 4DBVO 2VYND 4UEJA 3P19A 3RUHA 4DRYA 3R6DA 3A4VA 4RZIA 5JXWA 3CMCO 1M6HA 1BDMA 4DC0A 4ZVVA 4IDAA 5T5QA 4CR7A 1U9JA 2BLLA 4AG3A 5CPBA 3IJRA 4OMUA 4XCVA 1JU9A 2DVMA 2BD0A 4B4UA 3GGOA 2FPGA 2NVBA 4DPMA 1DFGA 1X15A 3KTDA 4W4TA 1UAGA 4R4JA 1NVTA 4QTZA 3EY4A 5ILOA 1EUDA 2WE7A 3JQBC 2H5LA 3GH3A 3IUSA 3ANMA 1Y1PA 3KETA 1PZEA 1WZEA 4P4GA 4CUKA 3QE3A 1A7KA 3S2IA 3QWAA 4MIEA 4AJ4A 5U4QA 2FZEA 2FR8A 3OECA 3FCOA 3H9QA 1O9BA 3G1TA 2O3SA 4OKIA 1M6WA 3DBVO 3NJ4A 3STHA 3U49A 4PRKA 4IY1A 2NUAA 3BTVA 2X0NA 1PR9A 1V35A 4B8WA 4RF5A 1KS9A 1NASA 2VRCD 3JV7A 3QVOA 5ILGA 5EINA 3JYQA 3DAGA 1ZK1A 3ENKA 4XYEA 4LRTB 1O95A 3QY9A 3JYPA 4R54A 4PLTA 2QZZA 4IMRA 3H65A 2AEJA 1H9BA 1LSJA 4R1SA 1SB8A 4CMHA 5ICSA 1LUAA 2JFHA 2D59A 4BO5A 2XXJA 4ZGWA 4YJFA 4KQWA 1O94A 3N7UA 3NV9A 5I7SA 3MCVA 2B4RO 4MO2A 1PIWA 7ADHA 4JJIA 2JHGA 3K6JA 4R5HA 4PLGA 4CM9D 1XYGA 2O50A 2LDBA 1PJTA 4N18A 1HSOA 1YQGA 3QWIA 2R6JA 3O8QB 1JW9B 1PX0A 3WBFA 3WDSA 1RYEA 4XGNA 2DBVO 1TT7A 2R00A 1FDWA 4QEDA 5ITVA 1BW9B 4OM8A 1EVJA 2CVQA 3WGZA 3JQ6A 4RF4A 3I9LA 4DQVA 5HA5A 4OGWA 3QVXA 1HRDA 1JKJA 1GQYA 3UF0A 2O3TA 1XQ1A 2A4KA 4UREA 3WB9A 1V3VA 1YDWA 4G65A 3GEDA 3DXFA 4RPKA 2B35A 3VZPA 4F6CA 4WASA 2DPGA 1KVQA 2W98A 2D4AA 3OQ6A 1VI2A 1X1TA 1QV7A 4Y8VA 5HS6A 5TJHA 4ZICA 3DDNA 4L74A 4Q3DA 3CEAA 4FQ8A 4GWKA 1EK5A 3A1NA 5G0UA 2NU7A 1LRKA 2EJWA 3AI2A 4M55A 4QUKA 3DOOA 3VPFA 3HUDA 3FPCA 4HBGA 4CL8A 5B4VA 4M87A 4YAEA 3LLSA 1JWBB 4ITUA 4RJTA 4DPKA 3JQDA 4BQPA 2HK9A 3KVOA 4I8XA 3SEFA 4A0SA 4BNYA 4E2WA 2JAHA 3WGOA 1U3TA 1NFFA 5F3RA 4BNHA 3BYZA 5DF1A 5FWNA 3I9KA 5JAQA 4RVSA 4DYDA 5KKAA 3ROPA 3MTJA 1UDBA 4KTTE 3BHJA 2D0IA 3UH1A 1MA0A 1NYTA 4D3DA 1Y8RA 1C3VA 1EVYA 3P5SA 4XEHA 1HKUA 3QJ5A 4H3VA 3MOIA 4YXFA 5B12A 3OF2A 5FI5A 2ZJ0A 5DT9A 1M2WA 3W6ZA 4JGBA 3C7CB 5A1TA 4UVHA 1XDWA 4GGOA 1E77A 1N9GB 3CMMA 4M1QA 3KOUA 2CF6A 3KRTA 3LT2A 4HNGA 4DLLA 3DBLB 4ZQEA 4ZQFA 4BO8A 2YV3A 3AU8A 1DIBA 1X7DA 5KOIA 3K96A 3OJEA 3E18A 4EUHA 1UP4A 4WUVA 1P44A 1HDGO 2BI8A 2Q4EA 4J16A 4L4XA 4PLHA 1EE9A 1F17A 3D1LA 2FZWA 3FBGA 1GQQA 1N7GA 4NNJA 4RV9A 1HE3A 1KY4A 2NLOA 4HKTA 2IRWA 3ETGA 4HNHA 3UHAA 4FR5A 2CVZA 3ZDFA 4YRAA 5BSGA 4LGVA 1I36A 1SB9A 3PZRA 3FWZA 4D3FA 1I3MA 2J8ZA 3HDJA 2DTXA 2Z1MA 3V1YA 4XKJA 1H0KA 4BKQA 4YAGA 1GADO 3CXRA 3BMQA 2SCUA 5L7WA 4BO6A 4AJPA 1Y81A 3GA0A 3C24A 1IL0A 1YJ8A 4URFA 1YO6A 4A27A 2G76A 2O2SA 1I2CA 2FN7A 3S8MA 3LSYA 4ZHSA 4TZTA 1Z6ZA 2CY0A 4E2ZA 2IZ1A 2GSDA 4CQMD 1A71A 3ANNA 3ZV4A 1LQUA 2GR9A 1C1XB 2YHUA 1SPXA 3WXBA 4A7PA 4E5MA 3W8FA 2Q1UA 1OAAA 1YONA 1DC3A 4FGSA 3VVBA 5KVCA 5COAA 3GG9A 1GAEO 1EQ2A 3K8ZA 4G5HA 4PLPA 3QQPA 1WMBA 3IS3A 4PCVA 1RM0A 5K0ZA 3KM0A 3U4IA 1SAYA 2I66A 2HK7A 4K1LA 2NQTA 1YKFA 1ZSVA 1Y6JA 2ZCUA 3WFJA 1M66A 2WJPA 1T2DA 5TT0A 1VRWA 4KWIA 2WM3A 4DGSA 2VUSA 2HDHA 3E8XA 4CQLB 2WTBA 3I9MA 1N9GA 5G2OA 2Q50A 4NBRA 3RUIA 3QW2A 1QLHA 1X7GA 2IDZA 1FDUA 1I30A 2OO5A 4E5PA 4RO0A 2TMDA 4LRSB 2HMSA 3F5QA 4XQ9A 5JAZA 2IYPA 3GLQA 4M8SA 4JNKA 4Z9YA 5C37A 4CM5A 3Q1LA 2Q1SA 3ZNQA 1NX6A 4PG7A 1R16A 1LX6A 5I9NA 5DNAA 2CDAA 3ASVA 5FFFA 2YQ5A 2RCYA 3JQAA 3OIDA 3ADPA 4MVJE 3WJAA 2B0JA 2EWMA 4BNKA 1P1JA 4G81A 4PLVA 5I9LA 4GBJA 5JW6A 4C7KA 2I99A 2V6MA 4WPGA 3ZWNA 2EW2A 2Y0EA 1N7HA 5EERA 3F5SA 2ZB3A 5L53A 3AWDA 4RF2A 3VPGA 1A7AA 3U09A 2PA3A 4J1QA 3P2YA 1T24A 1Y8RB 1N1EA 2VNAA 4UUPA 2ZYGA 3GZNA 5DP2A 2PK3A 5T8KA 5I8WA 2VUUA 3GY0A 5FYDA 1FXSA 3NJ8A 3W4IA 5KJCA 4PG5A 1NQTA 1ONOA 5T57A 2GNAA 1AXGA 5L4SA 3SXPA 2E48A 3OSUA 5AQ1A 3Q3CA 4LSMA 4FJ2A 1TB4A 4OSOA 5KWEA 1SO8A 4I5EA 1T1RA 1LTHR 1VC2A 5TC4A 1E5QA 3EYWA 4BO9A 1R66A 3LC2O 4XYMA 3ZWWA 2GN6A 4XDZA 2QW8A 3DZJA 3NTQA 4YDRA 3TZQA 4L76A 4PIVA 2Y0DA 1DEHA 2GPTA 1MFPA 3HJAA 5KJ6A 4WNCA 3SVTA 3AFMA 4MOWA 1R4NB 3OMLA 3FTNA 4IXTA 1P77A 4CLOA 3IAHA 4MP3A 1UP6A 2WYWA 3FNHA 3GNSA 4IDGA 3ZWOA 5EQFA 1OZAA 1B8VA 4JCOA 4BNWA 2B69A 4E12A 1MGOA 3ITDA 4B79A 4BNVA 1BWSA 2JCXA 1ULUA 2Y1CA 3DZFA 3F6YA 4MIYA 1H6CA 4FSHA 1GL3A 1UXHA 1E7WA 3WGTA 4BO0A 5ER9A 3HFSA 1NP3A 3L0DA 4BVAA 1PS9A 3A9WA 5JY6A 3DBRA 3DZKA 4CM8A 3WQQA 4NU5A 2YUTA 3DONA 3RBXA 3RROA 3RUCA 3C1TA 4IGFA 1FDVA 2I76A 8LDHA 4I5GA 2P4QA 4AJNA 2J3JA 4OXNA 4AVYA 3ON5A 5U9CA 2C2XA 5I7EA 2JAPA 2EG9A 5C3MA 4GAEA 4P4LA 4CQMB 1DHRA 2Q2WA 8ADHA 9LDBA 4RVFA 4X54A 3UCFA 1KETA 4K26A 1NR1A 3OJ0A 5KJFA 2EIHA 1GUZA 3VH4A 4OJNA 5JC8A 4ONEA 4D7AA 1J5PA 2C7GA 1AUPA 3LC7O 3PGXA 2R00C 5G4KB 4OYRA 1A9ZA 2EKQA 4RORA 1VJ1A 3B20A 4FJ0A 3T7EA 3PI7A 4BGVA 1FF9A 1KIFA 1CQIA 3T4XA 2NQ8A 1PL6A 3OJOA 5JYDA 1GPJA 4II3A 3L9XA 3UN1A 2Y93A 2WE8A 3AFNA 4LVCA 4D42A 1YS4A 2XAAA 2ZCVA 3HZZA 3I4FA 2GCGA 3M6IA 3KB6A 3PHJA 3PTZA 4IGEA 1ZMTA 1UXIA 2CNBA 3OQ1A 4HV4A 1UAYA 1PR3A 1U8FO 4EYEA 3DZHA 4NDNE 1BGVA 1HEUA 2DFVA 4NJMA 3B1FA 3EZYA 1I8TA 4GVLA 5AVOA 2H6EA 5KVVA 1ISFA 4J7XA 1U3WA 4B4WA 1YL6A 1BXZA 3BZUA 3OEWA 1MLDA 3TF5A 4IMPA 3AY3A 4TQGA 1R4MB 3FHLA 2RBEA 5L4NA 1YXMA 2J3KA 2I65A 5ES3A 4YJFB 1NQOA 4KP7A 1PL8A 1VKNA 3IJPA 4FFOA 5IDXA 3ROQA 1LDBA 3ICPA 4IDCA 3DFZA 3JQFA 3BMOA 2YV1A 5H82A 4BKRA 2PGLA 3BXXA 4CMIA 1YRLA 3GVCA 2JD2A 4G2NA 3UICA 2I67A 3BTSA 3OBBA 4I9NA 4BGEA 4KDEA 4N5MA 1PZGA 4DC1A 3HB5X 3ZNOA 5BNIA 3FR8A 4CLXA 1XU9A 4KDFA 3V2HA 1ISJA 2O3UA 2YYYA 4Z6KA 5TX7A 1F8FA 4DBZA 1PEDA 2NNLD 4ILKA 5L45A 3PP8A 3ONFA 3LDHA 3NYWA 4JP3A 2V65A 4R01A 5CDGA 3FI9A 3JD3A 5L4LA 1P1IA 1GV1A 4BNIA 1YE3A 4J9UE 3H3JA 1NQ5A 3WIDA 4J1SA 3QA9A 1OMOA 3FTPA 2BGMA 5EL0A 1S6YA 7MDHA 4QX6A 4WEQA 1AN9A 1CYDA 1IHYA 4I5FA 1X7HA 1KY5A 4IJVA 1E1KA 2AG8A 3PDJA 3RC7A 2CMDA 1E1LA 2DQ4A 2X5KO 3RD5A 3JYOA 2BI7A 4H15A 4F3YA 3WFIA 3TOZA 2O4UX 1E7RA 1WP4A 3WLEA 1YWGO 1LRLA 1GR0A 1VLLA 2VHWA 3BMNB 4HFNA 3PLNA 4RDIA 1EFKA 4B8ZA 4E2XA 4GLLA 4O6VA 1IYZA 1ISMA 4NK5A 4J3FA 4F6LA 4R5MA 2CDBA 1U2GA 1KEVA 3LQFA 5A9SA 3B1KA 5TLSA 5G4LA 3MWEB 5JE8A 2Y1OA 3AUTA 2YJZA 3G17A 5L40A 4W9NC 1XSEA 3SLKA 2DTEA 1BXKA 4EJ0A 3RKRA 2DTDA 2HLPA 3BTUA 3LVFO 3JTMA 3WLFA 3D3WA 3VH2A 1DHTA 2VOEA 1LC3A 1VE9A 3OIFA 1GFSA 3RU7A 1GCOA 1LDNA 4ND3A 5A3VA 5A3JA 3WBBA 1F14A 3OICA 4JIGA 2E82A 3L07A 2Y67A 4LISA 2XPCA 5JCJA 3GQVA 4MDHA 2FMUA 3H9JA 3JYLA 3PJDA 5JCXA 5TJ9A 3WOHA 1Q1NA 2VWQA 4WLNA 2HSDA 2F00A 2PD6A 3PWKA 3RUDA 4TRJA 3H2SA 1YL5A 1IUKA 1TVEA 1ZK0A 3PLRA 3ZV3A 1XQ6A 3IIEA 3BHIA 5IAAA 2JFGA 5JBIA 2AA3A 3Q0EA 3TZKA 3D3WB 5JMWA 4ZRNA 1IPEA 1RWBA 4GLOA 4FDAA 4YCAA 3B6ZA 1GUYA 3WQSB 2P91A 4BNZA 1O89A 3VVCA 5T8KC 4PLFA 3ZU5A 1PJ2A 2EEZA 4QECA 1A4IA 3GDFA 2FSSA 5EMHA 4ZA2A 3GG2A 2WYVA 4EI2A 1PJBA 1LDGA 1KOLA 3KZVA 3PHIA 3RI3A 1E3WB 2HU2A 1B0AA 4FW8A 4YAIA 1CRWG 2ZB8A 3H9UA 1ONPA 5BNTA 4NIMA 4UUNA 4U0KA 3QVSA 1C0IA 1YOVA 2DKNA 1H2BA 4TRNA 5IZCA 1CETA 5IDQA 1AHIA 1B15A 1UXGA 3ANLA 1WMAA 2ET6A 4LCJA 2O7SA 2WSBA 4J9VA 1TT5A 2Q45A 3KYDA 4QQRA 3OHSX 4QXMA 4Z0PA 3E9MA 4CMKA 4WECA 5F1OA 3LYLA 3RBVA 3PEFA 1D3AA 4AICA 2OP0A 3JD0A 4PZCA 4A5OA 2PH3A 1YVEI 2PWZA 2W2LD 1SCUA 2B37A 2XOXA 3EMKA 4WKGA 2VHXA 1R12A 2BKAA 2I5PO 1WW8A 5KJEA 1J0XO 2UDPA 4Y9DA 1GPDG 1KEWA 2Q2QA 3GZ4A 4D0RA 2I6TA 1WVGA 1ZH8A 2DM6A 5JMPA 3BAZA 3EK2A 4NK4A 4R1NA 4BNNA 2BFAA 1PTJA 3HFGA 4Z9FA 3KV3O 3AM4A 2NTNA 5DDIP 1R0LA 2B36A 4OL9A 1NAIA 1PJLA 3CIFA 3I9OA 4ND1A 1BDBA 4J2HA 5LDGA 1NHWA 2FSVA 2W2KA 5F5NA 3RCBA 4E5NA 2O4CA 3WICA 1BMDA 4IIVA 1U3UA 4CM1A 3JD4A 1P33A 4XDYA 4BNMA 3BA1A 3GUYA 1H2HA 1FDTA 2G5CA 3DWFA 1NVGA 2IXBA 3PXXA 2AQIA 4L4RA 4Q39A 4LN1A 1NAHA 4XRGA 3GFBA 1B16A 2X8LA 3ZWYA 1X1EA 2B4QA 4UULA 1E1NA 3VTFA 2BMAA 4OSPA 3EVNA 4UUOA 3U3XA 1ONNA 1E6UA 1WDKA 3Q9UA 3BMQB 4ALIA 1QYCA 1UXKA 2NWQA 3JQAD 5I9MA 2X22A 1EVZA 1HYHA 5A5EA 1OBFO 4EITA 4P8RA 5JO0A 1EZ4A 1HXHA 2RIRA 1PZHA 4J6FA 3JQAB 3TPCA 3V2UA 1XIVA 2FP4A 3GAZA 1ID1A 2IEDA 2Z1NA 3LF1A 4YVFA 1U3VA 3RVDA 4MVJP 3EGOA 3DMYA 1KC1A 4PG8A 1E7MA 1GYPA 1K5HA 4ZRMA 5I7FA 5B4UA 1EDOA 3HHPA 3GEMA 2OGUA 2Y0CA 4FGWA 3CE6A 5JS6A 3FNGA 3Q11A 1Y8QA 3EAGA 3PRJA 4R3NA 1LSOA 4CLEA 4ZU3A 4OIMA 2CFCA 1P0CA 3RJ5A 3CZMA 4DQUA 3TN7A 4MVJG 1DAOA 2I9PA 3NT2A 1DLJA 2YZ7A 2UUOA 2X23A 3AM5A 3DZBA 3KHUA 3F46A 3D64A 3PPIA 4UAGA 4BMSA 4DPLA 3ZWCA 2FHSA 1XELA 1GU7A 1Y5RA 1MC5A 3ITKA 4MVJD 1U2DA 1DFHA 6ADHA 5L9AA 4IDDA 3PFWO 4GSLA 5KKCA 4MPDA 4KUHA 1QLJA 1YBVA 1Z82A 1HDRA 4WLVA 1QRRA 4XB2A 2CSUA 2FPPA 2WDZA 3GR6A 1ENPA 3H9EO 3SX2A 2Q3EA 3WGYA 2XXBA 1MG0A 3ZH2A 5A06A 2POQX 4DIFA 3E03A 3DB2A 3OIGA 2QYTA 4BMVA 1QR6A 1EFLA 1GZ6A 1CF2O 4NZ9A 1Q0HA 3DTTA 3IL2A 4WCFB 1EDZA 4PLYA 2AEMA 3QRWA 3UVEA 4NBVA 1HDXA 3AOGA 2R2GA 3MJ4A 3JQ9A 2DT5A 2P5UA 4OOFA 4BL5A 3I23A 4BOYA 4J7UA 4KTVE 4XYLA 3LF2A 3GVHA 4O1MA 3H9GA 5ENDA 2AQ8A 3CINA 1LDYA 2JL1A 5L3ZA 4Z3DA 1SC6A 3RAJA 3TZ6A 3WMXA 5HTOA 1I5RA 4BNXA 2QIOA 2ZQYA 1DIHA 5IZCC 4FN4A 2NVWA 5AXDA 1XA0A 4XIYA 3ZWAA 1HE4A 4JP2A 4ESOA 1VSUA 2NU6A 4YQZA 5CDYA 2VWGA 1QMGA 4OO3A 5COQA 2O3QA 4YJHB 1DSSG 2Q46A 1HDYA 3IDSA 2VZ0A 4GSKA 4WE3A 1C0KA 2G0TA 3HDYA 4BB5A 3OFSA 4P4NA 3K2BA 3JQGA 2GN8A 4GMFA 4MVJH 4D3SA 1JKFA 4UUMA 3QV1A 4J4BA 3FN4A 3CZRA 1PWXA 2HAEA 5KVQA 1NVMB 5CEFA 2CZCA 3M1AA 4FFRA 3L77A 2PZKA 1LSUA 2GF2A 3FD8A 2ZYDA 1TLTA 1C1XA 4L8VA 1E6WA 1NWHA 2E37A 4WGGA 1YOVB 1XWFA 1U4SA 1A5ZA 1ENOA 3N74A 5C5IA 4CM6A 3VTZA 2DU8A 4RLSA 3LU1A 3GHYA 3DC2A 3W1VA 2G17A 1JVSA 1K2WA 2D5CA 2H9IA 2BFPA 4BHTA 4WJZA 1KBZA 4EEZA 4XR9A 3WNQA 4YRBA 3C7AA 3W6UA 2OORA 1W4ZA 4WEOA 5AYVA 1ZEMA 3PK0A 1KYQA 4FD3A 1WZIA 3JYNA 4RPHA 1E1MA 2AEFA 1SBYA 3RIHA 2B5VA 1K0UA 2P4HX 4W9NA 4GKBA 4W82A 2J5KA 4IXWA 2GDZA 1UZLA 2EXXA 1LDEA 2PKQO 4B3IA 1U28A 5CDTA 1R15A 3ZHXA 4ID9A 4UVEA 1P45A 1GYRA 3PYMA 1QYVA 3MJTA 3E5RA 2AE1A 9LDTA 1UXJA 4GH5A 3GF4A 4Z0TA 1B7GO 4K28A 4R1UA 3KLPX 1JKIA 3VOSA 4CR8A 3D5TA 1GCUA 4TWRA 4XZ3A 4BNFA 4EBFA 2C54A 5L7TA 1D1SA 3VAZA 2C2YA 4IZHA 3VH1A 3WYCA 3MTGA 1I01A 4XJSA 2IEBA 4CLOB 3JQBA 1ZVMA 1IHXA 4RF3A 3DAPA 5JDIC 4NJOA 4JBIA 4HP8A 4IPTA 2HQ1A 4JXKA 2EV9A 2C7VA 4NFHA 2Y1GA 4B4VA 2AG5A 5JNLA 3E82A 1UDAA 2GLXA 1YB5A 2X86A 2O3RA 2O48X 1MUUA 1K6IA 1PQWA 1N2SA 5BSHA 5EIOA 2I3AA 4OXKA 5CAEA 3PFFA 1E7QA 1LLUA 3GNTA 4FOOA 3ST7A 2VRCA 2DBRA 5GZ1A 4IQGA 5EQDA 1MC4A 3AU9A 4NPCA 4DUPA 4DYVA 1B3BA 1HLDA 1H94A 4JQCA 4XQEA 1LLDA 4XB1A 4NR0A 2QX7A 3WGGA 1PS8A 1DRWA 2PZJA 2VUTA 1C1DB 1W8DA 2CD9A 4J7CA 3JQFC 1DRUA 4JBHA 2PD4A 2V7PA 1T4DA 3AOEA 4AJEA 1WPQA 2J3HA 4E5KA 1XLTA 2WD8A 2JFFA 3RWBA 3AUUA 5IJZA 5MGBA 5EPOA 3DZIA 1ADGA 4IJUA 3I1JA 5CPFA 3GC6A 5GY7A 3NT5A 2OBYA 5H83A 1A4UA 3NDRA 2AE2A 3C7DB 4J1TA 1X14A 4OQZA 3U4HA 6LDHA 1I3NA 4AJKA 2VNSA 3BIOA 1WXDA 1CDOA 3F3SA 3QHAA 2GASA 2VHZA 1Y7TA 3H6KA 1P3DA 5KIAA 1GTMA 2WD7A 2VOJA 2PTGA 2EHDA 3QWFA 4LSWA 2FPIA 2JCYA 4Y6SA 2UUPA 3AI3A 1T4BA 1E3EA 4YBZA 4GMGA 4YTEA 4J1NA 1LLQA 1HWYA 2X6TA 2X5JO 1LJ8A 2NTJA 4GX5A 1V3UA 5G0SA 4UEOA 5CDSA 2YY7A 2ZK7A 5BNFA 1DIAA 3O9ZA 1NBOA 1VJTA 3LLVA 4RPJA 4CQMA 2QHXA 3F1LA 4MVJM 1T26A 4D41A 1K6XA 4EJ6A 3S2FA 1UP7A 4IINA 1BXGB 3U9LA 2BGLA 4GQAA 4F46A 1T2CA 3G49A 4ALLA 2EERA 3KEQA 4FIZA 4CMEC 1Z74A 4N54A 5FF9A 3SJUA 3I4CA 4PVCA 4DTIA 1RM5A 1EUZA 1Z75A 5F1KA 4LW8A 1ZJZA 3BMCB 3TFOA 4D45A 4NBTA 5CG2A 4IBOA 4JJFA 4GWGA 4R9SA 3NTRA 4NFSA 2PNFA 1LEHA 3NT4A 2Q49A 3AJRA 4NG5A 3ZNPA 1Q7CA 2O7QA 3D4OA 4WOKA 2Q4BA 2PH5A 2DBQA 3IUPA 3SJ7A 3WSWA 4XWYA 1W6UA 4JBGA 1JTVA 2BGKA 1P1RA 3SLGA 5T6BA 1SEPA 3VH3A 1HETA 4WCDA 4XR4A 2PV7A 4ZQBA 3GN1A 2QZ9A 1ZCJA 3ZGYA 5EJ2A 1IOLA 5G0VA 4BNJA 4KWHA 3WMWA 4BS9A 5A05A 1XKQA 4B4OA 4W7HA 2Y1FA 4N5NA 4O0LA 1TA4A 2DC1A 4R41A 3RFTA 1BVUA 1N92A 2WEKA 1R4MA 4AJLA 5DBFA 3W4KA 3QVTA 3TDKA 4BIIA 5JC1A 2HCTA 3T4EA 4FS3A 3WWZA 2OOSA 2YDYA 3ASUA 5T64A 3Q2IA 5DOVA 5DBIA 2GZ3A 3C85A 3VKVA 3UCXA 3I6IA 4NMHA 2QRJA 2ZB4A 5BT9A 4C7JA 2EW8A 5IFLA 5A03A 1QG6A 1SZJG 4CM7A 3PQFA 4TKMA 1MG5A 1U1IA 2FOIA 1NHGA 2O3JA 1DIRA 2HMWA 3MWDB 4YJHA 1LNQA 1I2ZA 3GVIA 2P68A 1KVUA 4CL3A 1XEAA 2V6BA 4HY3A 2HMVA 2VZ8A 5IZ4A 1D1TA 2C0CA 2GGSA 2UVDA 4M49A 2D3TA 5EESA 3P2OA 1C14A 4E3ZA 4QFDA 4AJJA 2E6UX 4DQXA 1NFRA 1SOWA 3O03A 5JDIA 5C7OO 5A5FA 5THQA 4XD2A 3E5MA 4N7RA 3QIVA 2ZQZA 1CJCA 4CV1A 4FCCA 4ZN6A 1HYGA 2RH4A 2QRKA 3FBTA 1RJWA 2YV2A 4MVJF 4BGUA 5J23A 4C4OA 4M86A 4IDBA 3CPSA 4BO2A 3TZHA 4CM9A 2RH8A 3D5QA 1Q0QA 3PDUA 1DC6A 1VL0A 1T1SA 1ZSYA 1T2EA 3ONEA 5KJ1A 4B7CA 3VZQA 4MJLA 3VHRA 3JQ8B 4FJ1A 5HWSA 3I9NA 5LCXA 3MOGA 4KMSA 2IZ0A 4O63O 3TWOA 1C0LA 1VL6A 3ZI0A 4O5OA 2PKRA 3T7CA 3ZZNA 2Z95A 5BR7A 2VT3A 3RASA 1V9LA 3VKUA 1YB1A 1UDCA 3ZV5A 2VYVA 3WGHA 1LXCA 4BO7A 4BO4A 1P1FA 4LVUA 2DBZA 4JLWA 2HO5A 3PHHA 5A4DA 3L4BA 3MJSA 4KUGA 4E5YA 4MKXA 1GYQA 1ENZA 4XIJA 1ZK3A 3BTOA 1KEUA 5A04A 4BV9A 3AK4A 4D43A 3K92A 4DREA 3ZHZA 1IY8A 1FJHA 4HWKA 1BTOA 1VSVA 2YQ4A 5K9ZA 1DJQA 1I3KA 3UKOA 5DOZA 4Q3NA 2OL4A 1HF3A 3JQ7B 3GPDG 2AQHA 1PQUA 5IF3A 5JYEA 1JLLA 1Y8QB 2W2LA 3TL3A 4YAKA 4S1VA 4HX5A 4CLRA 1VL8A 2DAPA 1MX3A 3FNEA 2VTDA 1XU7A 3ABIA 3H5RA 2PGDA 5CEEA 1W73A 1YBMA 2PY6A 4DWVA 1X0XA 4FFNA 3UAGA 1OOEA 5HBRA 1JN0A 1Q2XA 1R0KA 4B3JA 1PWZA 4EW6A 5LDHA 3RUFA 1ZXBA 4W7IA 4B3HA 4H16A 3E1KA 2AQKA 3WGQA 5A02A 3MJVA 4I5DA 4AFNA 3GZNB 4DLBA 3GHHA 4WNIA 3ZW9A 2HMTA 4I08A 4CPDA 1WDLA 4PLWA 1J49A 3K5PA 3V2GA 4NQZA 1T2FA 3CKYA 3HN7A 1Y9EA 4Q3AA 1ISHA 4TSKA 3DAFA 3HDQA 4J2OA 2YFQA 1DOHA 1WNTA 4TMFA 1A9YA 3ZWBA 1PGQA 1XGKA 1DDOA 3H8VA 1JDJA 1XR3A 1I33A 4AL4A 1JWAB 1LU9A 2EGGA 2FR0A 2P9EA 1JA9A 2Z5LA 3ETDA 1ZK4A 3ULKA 3L6OO 4AJOA 4CMAA 2HK8A 3ETEA 3QSGA 4I9UA 2PGJA 4TRMA 3OA2A 4CMBA 3FSRA 1LQTA 1PGJA 4MINA 1YJQA 3WYEA 2EGHA 1P1HA 1GDHA 4J91A 3RC9A 2J5RA 1JAXA 3V8BA 3R3JA 2WMDA 4ROSA 4OHUA 2JKVA 3TFQA 4ND5A 2ZIZA 2X0IA 5AOVA 4DLAA 4XA8A 1GD1O 1ZXLA 4M54A 5CP8A 4CUJA 4RVDA 5IDWA 1IZ9A 2X5OA 4BV8A 1ZW1A 1ZEJA 2W4QA 1HZJA 4CM4B 5DN9A 1PZFA 2F1KA 2AXQA 4FOSA 4D44A 3DMTA 1P0FA 3DL2A 1BRMA 4JX8A 4CR6A 3MJCA 5JAMA 1HLPA 4OH1A 1PJ4A 1NPDA 3JQ8A 4A2CA 1O8CA 4YJGA 1PGNA 3VPXA 3RU9A 1DO8A 1DFIA 2GN4A 1OC2A 1A72A 5C7IO 2P9CA 3ONDA 4XQGA 3VDRA 3HWRA 3K31A 3G3EA 1ORRA 4NBUA 5JCJD 1F12A 3SC6A 5ENVA 5DULA 1ZK2A 2WD7B 2X7HA 1CIVA 2JD1A 4RGBA 2ZYAA 4YR9A 4Q3EA 5G0WA 3IQDB 4IJKA 2DUWA 3NEPX 4KOAA 4XYBA 3GDOA 5JDCC 2C59A 4JROA 3I9JA 3WS7A 1MV8A 1U8XX 3B1JA 1GV0A 3K2EA 1ADCA 1SEVA 3E48A 4XGKA 1L7DA 4RVUA 3I5MA 2VRBA 3ENNA 4R3WA 1D4FA 1KVTA 1ZBQA 2RHRA 3RC1A 4J90A 1ISIA 3E9NA 3I6QA 3V5NA 1LDMA 3IC5A 1E92A 3PYXA 4YAJA 4MKRA 2OHXA 4RQUA 1GZ4A 3KXDA 2PZMA 4S3MA 1ARZA 2J3IA 4PG6A 3WTCA 1EBUA 1YL7A 1LRJA 2CVOA 2VT2A 3TSCA 1KVRA 2ZTLA 2ZTUA 3NRCA 3TOXA 3UGKA 1HYEA 1YQDA 3ZWXA 2A35A 4OKNA 4OQYA 5B4TA 2GYYA 5EN4A 4BKOA 4L75A 2HJSA 3PHGA 5TRTA 2VYVD 3FNFA 4PZEA 2GUGA 3UW3A 3WNVA 2C5AA 4YACA 1H6DA 3HDHA 1Q7GA 5K6AA 1OC4A 3DHNA 2FY8A 4Q3CA 3O26A 2C29D 3WJ7A 2GZ1A 5F5LA 3BMOB 3RFVA 5CG1A 4FFPA 4Y6RA 1ZZEA 3X2EA 4QT0A 4XRRA 3ZWMA 4D0SA 3Q2KA 3KEOA 4MVJI 4E31A 2VQ3A 3K30A 3P7MA 3WWYA 3N58A 3JSAA 3FF4A 2Q1TA 4TROA 4INAA 4BUCA 3HE3A 1ADFA 1YH3A 3WTBA 1V0JA 1KEPA 3C3XA 4JN6B 1NM5A 1RPNA 2IODA 3OH8A 4LK3A 4I9HA 1ZNQO 2YHIB 1NPYA 3PQDA 5TSDA 3INRA 4DIOA 2W90A 5JSFA 4RDHA 5KCZA 5KTKA 5FEUA 1M67A 1HE5A 5JLAA 4EGFA 1PJ3A 3GOHA 4GX0A 1YGYA 1E3LA 1EEHA 4R68A 3INGA 5G0TA 4RQTA 4CQLA 5ADHA 2VN8A 5T67A 1CQJA 4WCFC 4KZPA 4QO7A 3R3SA 3QWBA 4U8GA 4ALJA 3PGJA 4BQRA 2CF5A 3AUSA 4IZIA 4BKPA 5ICMA 3EHEA 1V8BA 1B14A 3V1TC 3D4PA 1NQAO 2E49A 3K9QO 4HFRA 4XJTA 2DUUA 1E0DA 3F1KA 2NM0A 1YDEA 4ND2A 5CDUA 3U0BA 1GQ2A 3DEYX 4DL9A 3ZHBA 1B8PA 1YB4A 2H63A 2WWRA 2Y1EA 4M89A 3U4DA 3ZV6A 3HNPA 1FDSA 1EK6A 3DR3A 3LT0A 5BSEA 1Z73A 2X58A 5ER6A 5KVSA 2NACA 4NBWA 4J43A 4P38A 5AXAA 3EZLA 1K6JA 4UVGA 4O59O 4EUFA 1L7EA 1X13A 5LC1A 3B70A 2HKIA 4L0QA 4YYZA 4PN3A 3Q9NA 2D5AA 1DXYA 1DB3A 1MP0A 4E13A 4EUEA 3NDJA 1O5IA 3GPIA 2RAFA 3RFXA 2ZATA 1H9AA 3OETA 2HRBA 2QG4A 3L9WA 2VZ9A 3BMCA 3CSDA 1WAMA 4ND4A 4WCFA 3VPHA 4IJWA 3IMFA 4A10A 4ALMA 4BNGA 5HM8A 3DHYA 3EW7A 4WLFA 3WG9A 1H93A 2JD0A 3D3EA 1DPGA 3EDMA 4E21A 1Z7EA 1E5LA 4A26A 4E2YA 3INTA 4Z0HO 3OA0A 1NTOA 2QQ5A 4Y67A 3RKUA 3NGXA 1GZ3A 1PGPA 1PJSA 3RUEA 4PGFA 4QO8A 3S2EA 4WLUA 1UH5A 2Q2VA 3V1UA 1ISGA 1NR7A 3S55A 2VYNA 4TVBA 2ZJ1A 1PS0A 2DFDA 2V6FA 4L73A 1WDMA 3JD2A 2EJVA 4DVJA 3RBZA 2A94A 5IDYA 4ALNA 3ROMA 3ZN2A 1I0ZA 1QYWA 2ZB7A 3PJFA 4ALKA 1NFQA 1IB6A 3LZ6A 4DMMA 1KVSA 1I3LA 3PYLA 3D0OA 2IE0A 1AXEA 4EZBA 3H3FA 2H1SA 1DRVA 5K6AC 5TGDA 4UEKA 1U7HA 3NX4A 3ZCXA 3VC7A 1OI7A 1ZKMA 1RM4A 4KQXA 4BNTA 1PGOA 3QVWA 3GRKA 2NU9A 1YBAA 2HRZA 3L6EA 1UJMA 3AM3A 1JAYA 2VWHA 3GT0A 1PU2A 1JVBA 2IZZA 3GAFA 3GUCA 3IOYA 5AXBA 1U7TA 2IYOA 1TEHA 2DPHA 3DBHA 1H6BA 3COSA 1CERA 3M1LA 2PLAA 4CV3A 2YHIA 4RLHA 2BFMA 4FC6A 3O4RA 1NPTO 3AOEC 1T25A 2O23A 4IIUA 1HDOA 4YA6A 2UAGA 3M2PA 2HUNA 3LT4A 3TQHA 1U5CA 4E4YA 2B83A 2JJYA 1PL7A 1G1AA 3WX0A 1R4NA 2WYUA 2X9NA 4BO1A 3KSZO 4JJGA 1MXHA 1ZO8A 1M75A 3OEYA 2NTVA 1BSVA 5JDCA 2BFOA 4CV0A 1DBVO 4AJIA 1PJCA 4NHEA 4J49A 4KUEA 4U5QA 3HG7A 1P1KA 4PZDA 3WIEA 4GX2A 3WSVA 3DBHB 4E33A 1IPFA 4E0BA 1ENYA 1TXGA 2V6GA 1PQPA 4CLDA 4PLCA 3PJEA 4R51A 5BSFA 1HE2A 4W6ZA 3KSUA 4HXYA 4WOJA 4E30A 2A9FA 3U62A 1ZSNA 4ZQGA 1MB4A 4IS3A 1L1FA 4YT4A 1QYXA 3C8MA 4HFJA 1DAPA 4DA9A 3KBOA 3PWZA 5I8ZA 4R69A 1N5DA 3GNQA 3GVPA 1DIGA 4R1TA 2PR2A 1VKOA 1X0VA 3DMTC 3CH6A 3EVTA 3F9IA 3KYBA 5HS4A 3AY7A 3NGLA 4DIBA 1DC5A 3GRPA 1B8UA 1Y5MA 3I83A 3UFXA 1ZIDA 2BRUA 3FRJA 4Q3BA 2PZLA 1O6ZA 3HQ4O 3S2GA 4CJXA 2ZKLA 1IZ0A 1MXFA 2C5EA 2JCVA 3GFGA 4FBGA 1P9LA 3EC7A 4CMIB 1B26A 3F4LA 2C82A 3RQSA 2AMFA 2PKQP 1N8KA 3RJ9A 5A9SB 1HDZA 4YB8A 5F1PA 4OAQA 1S7CA 3UUWA 5F21A 1XHLA 1U4OA 1O0SA 1QP8A 2GD1O 4WLEA 4YQYA 4D46A 4OXYA 2NSDA 4QFCA 3AUAA 3DOJA 3WGIA 1I2BA 1OFGA 4RL6A 4B7UA 4CM3A 2DLDA 1QKIA 4QSMA 1E3IA 1QSGA 2ILTA 4ZQHA 1B3RA 3DO5A 2X0JA 3O38A 4TVOA 5TQVA 4H7PA 1K89A 1LA2A 2BELA 4NFYA 2HMUA 3W4JA 4YT2A 1J6UA 1UZMA 4RVGA 2GRAA 4IS2A 4MKZA 3KO8A 4PLZA 4WLOA 4MP6A 4Y6PA 1CEQA 5FI3A 2G1UA 1H5QA 4MIOA 2QRLA 1ZJYA 1J4AA 1ZMOA 2Y99A 4WK6A 5DP1A 1I10A 3ZHYA 3CUKA 1V3TA 1EBFA 5B1YA 5CFZA 4P22A 5DCUA 3KLMX 1PJQA 4HADA 1RYDA 2Y66A 4RPGA 2FWMX
chains in the Genus database with same CATH superfamily
4QHYA 2YN0A 3BRCA 4HDMA 4F3KA 3VZRA 4LYAA 4TV9A 1Z0AA 2A0UA 1P7VA 2QMOA 3GD7A 3FTFA 1UWVA 4I2VA 1V4BA 2WNHA 5FOTA 1NU8A 1O94D 1J42A 1JLHA 3JQQA 1P4JA 1VJ0A 2LCQA 4XM2A 2O2GA 3D6UA 4C2UA 5U1PA 4IIGA 1MV5A 1IULA 1C9YA 2HPHA 3HCPA 5ALEA 2BBTA 3C1AA 1KBOA 3DFUA 3GJRA 2GO1A 5CJJA 1T5TA 3STWA 1SMKA 3S40A 1N2CB 4H7EA 1Z7GA 1BG6A 4LYFA 4Y98A 2H1IA 4YWJA 4DWWA 1EM8B 3B7PA 3HP4A 4OATA 1PVDA 4REQA 5AOCA 1JR4A 3CKKA 3FZGA 3LC1O 4QATA 1EMDA 4LJAA 5IJ9A 1LBEA 2OZPA 3OPQA 3RS5A 4FPXA 1XG5A 1ZH6A 3NBYC 2CXHA 3ZU3A 2J4FA 3AJDA 4Y3UA 4YPOA 1FK8A 4PWYA 4EI9A 4AZVA 1PFUA 1W0CA 2QMQA 3W2IA 2EQBA 2L42A 4FHDA 4E5MA 2IXTA 2V0NA 5FOQA 4I6GA 3EXFB 2WYOA 3BERA 3KXIA 4MR8A 2HD4A 1N0IA 1OROA 3JWJA 5IMBA 5TF4A 3X2FA 4MW2A 2NADA 3LDFA 4XQCA 1AKTA 1W9MA 2JGMA 3IUEA 4UAVA 3R6WA 3ZW8A 4B44A 2XRMA 3ADOA 5ILQA 3ICOA 1T9AA 3V8PA 5AVTA 5D5HA 1EFUA 1EUCA 2H7CA 4YO8A 2Z3ZA 1N78A 2VUHB 4W5QA 3MD0A 2J31A 2PLFA 1Z5PA 2C2ZA 2C4HA 1M0SA 2XB8A 1SD1A 4ARCA 1K98A 3PUJA 1N1GA 2II6A 3EZXA 2WPDD 1DJNA 4LJKA 2XB2A 4GT1A 4X7RA 4I1IA 2B8JA 3QG5A 1E3WA 1EXWA 3GRFA 4U1RA 5CURA 2XBMA 3DMGA 1E2MA 2CHEA 1UUFA 5EP3A 1ULHA 5JO9A 3R7BA 5JD4A 5JXHA 5D51S 1U2RA 5HRAA 4AS1A 3WLSA 2GT1A 2Y68A 4YJGB 1WXHA 2VK1A 2REQB 3F74A 2C95A 3AYZB 4XFJA 2GZ2A 4O29A 1M1YE 3TQFA 1H23A 1ZHFA 5KWJA 4TMTA 1SKBA 1U11A 3UK6A 4DJAA 2IY8A 4TM8A 5INTA 1GVHA 1EGQA 1H85A 3ZU2A 4OB8A 1OI3A 4WK2B 5EFZA 1G8JA 3HYSA 1XWIA 4HUJA 3G5AA 4QVGA 3NQ41 5FNVF 2GNPA 1YS1X 1RKUA 4QYXA 3QBVA 3ZEIA 4QE3A 2AD1A 4KGVA 1FP4A 3IA2A 3PFCA 5GZ3A 3QNMA 4BLWA 1JQ5A 3QJYA 3CWQA 1D9XA 2DFLA 1VZ2A 2O5VA 5CMLA 2QY9A 1M9NA 4G5OA 2E4AA 4S1PA 3L2OB 5DZSA 4AJ2A 4C4SA 2CXXA 2A7XA 2ABWA 4EUSA 5C81A 1VBMA 1G6OA 1R0CA 3AVQA 3MCWA 3UHJA 1IZYA 2O2HA 2P9QA 3C39A 4G4SP 1U6KA 5HEKA 8GPBA 4JK3A 1DKPA 2ATCA 2GMWA 1P4RA 2PSEA 3ND8A 4GX1A 4DNFA 3UOGA 4DLXA 1YE8A 4F9EA 4W99A 3DF7A 5IBPA 1AGPA 3HA3A 4Q15A 2EKDA 3OM9A 4MQ5A 2B5WA 1KE1A 2MIIA 3W06A 3H5NA 5I4CA 1YUBA 2BFFB 1US8B 2IV7A 3EOAI 4J4TA 4K8OA 4Q82A 2ZS7A 3E3LA 3OF5A 4K6OA 1M34A 4RH1A 3S2UA 2QW0X 4NG4A 3H7AA 3CXUA 2YC2C 5I3CA 5CBPA 3TNLA 3UV6A 2AD5A 1NJ6A 1NNUA 4XX0A 1O96A 2X2PA 4UFNA 3GROA 4F91B 1KHTA 4EMBA 2W2TA 2XTJA 3LVBA 3PUZA 4U0JA 1GRRA 1PI3A 1Z2EA 2BMWA 1G7CA 1Q7BA 2R11A 2GH1A 1N2BA 1H0SA 2HIGA 4YT5A 1QJ4A 4ZOLB 5MN4A 1C1DA 1SH7A 5DCYA 2P67A 4WH0A 4DR3B 2JHFA 4M0DA 2H1OA 3KYDB 3O3OB 5HZKA 4DA0A 5D84A 5EUCA 3M5WA 4BGDA 2YN4A 2RGGA 4XGIA 3OU6A 3WAKA 2YJTD 1Y34E 1YDFA 3PEWA 2FPOA 4YJ3B 4ZCPA 3W9UA 1OIWA 3L04A 2F59A 2TS1A 4UQPA 3TRIA 4PS0A 1W30A 4F60A 2FZ4A 3MPOA 1JTEA 1VLMA 5E2BA 4ZHQB 3DXXA 2EOAA 4IEIA 1HNZB 5IN4A 4M99A 4ZAVA 1NWCA 3WMEA 2AW5A 3TW6A 2GTIA 4OQDA 4BNLA 3L8EA 2HLNA 3H5AA 1F2UA 3QE4A 4TWBA 3EBOA 3NDIA 4Q9NA 4X7BA 4DCOA 5FBWB 1A27A 1FPMA 2EP5A 4FFLA 4YLGA 2OPBA 4YP6A 4CLHA 4TMYA 2HJHA 5JSZB 3ZD7A 3GGPA 2H8KA 3PQEA 4O4LA 3ZJYA 2FAXA 3KOYA 1VIAA 2AZDA 4M37A 2ZI6A 4O4JA 5T3UA 3BMNA 1ZMBA 4BVKA 1U5AA 5TQ0A 4E32A 3KOZA 5BWNA 4I66A 4JZYA 3TLGA 2V7BA 3QVGA 4EHIA 3VA7A 3KAQA 2DQSA 2I3BA 5JCZA 3GB9A 2EX0A 4FFMA 5E0OA 2PBRA 4IDEA 2PVSA 2PFSA 1IWBB 1M76A 3G1WA 2QUZA 3CNOA 2PSJA 1GILA 1KA9H 4L8WB 5HQJA 5C4IA 3OPMA 5HKBA 4E5UA 5ITWA 1QCYA 5F5XA 2FRDA 1Q6YA 4X1IB 1QFSA 1KAQA 3CTMA 3AY6A 3PIIA 2HF9A 4NMMA 3FOBA 4MRPA 5CDFE 4GZ5A 1CRZA 3TQRA 3VZBA 3MW8A 4TMKA 1FRQA 2LUOA 1NVUQ 1BYIA 3B1YA 3PSAA 5BN5A 2FZVA 3T94A 3U0VA 1JAZA 5B7NA 1CLEA 4U6QA 5JZ9A 3QWHA 3ZDAA 3AFGA 4PFKA 4LMRA 3OO1A 5A7HA 1G18A 2ODTX 2G82A 1A9OA 5JCOA 3ZE7A 4WV3A 3ZTTA 4UU8A 1THGA 4A73A 4EGAA 3D5EA 3THSA 2PFGA 3FZQA 1FVXA 4EWLA 1OZHA 2Q5IA 1EU1A 3EF3A 4HATA 4TL6A 1P0MA 3ENZA 2Y05A 3CW8X 1QH0A 4KAFA 4GFDA 3O73A 1N32B 5EG5A 4G23A 3VGJA 2O8EA 1P72A 3KXKA 1M54A 1MB2A 2QYSA 1QHYA 2XKBA 1O94C 1GUBA 3FPLA 4OHMA 4E6PA 5LD2B 4KIGA 4C6HA 3DZDA 2DY0A 4BXOB 2VZLA 3O84A 1MQ8B 2IUSA 3LJKA 1G17A 4MWTA 3TRJA 1GSHA 2I3GA 4LMBA 1NZJA 1DKQA 1Y63A 3E53A 3G0OA 4CMCA 3ICWA 5CYGA 1M8GA 2YW9A 4HZUB 4RA9B 4EJMA 3F6RA 5IG2A 1V7CA 3IKTA 4XLLA 4YRKA 2ZE5A 3X1MA 1N7IA 1H2WA 2E5LB 5LUBA 4UVIA 1OV6A 4NS4A 4MWZA 3VNAA 3E0XA 4FUTA 2LZ0A 2FXVA 4MS3B 1ELOA 2I4NA 3BQ9A 3ROKA 2JI7A 3IJ5A 3PHLA 5GAJA 4UW9A 3S29A 5L3SB 4GGPA 2ZPAA 5K3BA 1F2VA 2PZ8A 4ARZB 5LJIA 5MDHA 3A28A 3C5EA 4TTTS 2Q2NA 4V0KA 3I58A 3MWJA 1JHOA 4G0ZA 3PJGA 1W52X 1K3TA 1NJ2A 3DZGA 1KR2A 2SKCA 1IIBA 2G9ZA 1KERA 1RTTA 2B3DA 1Y3IA 3B1XA 3BULA 5FOXA 5JZBA 2BH9A 1GTRA 2C96A 1SC9A 4D8WA 3LK7A 5CA1F 4LZLA 3E9CA 4RS4A 5JJCA 5IKEA 3DJYA 4HXFB 2G5TA 4IXDA 1QGOA 5FLKA 2P62A 4Y1GA 2OLEA 3RUHA 3U7RA 3SWWA 2FWPA 1I1NA 4JMLA 5CBKA 2OZEA 1M6HA 4KMRA 1M1XB 4AURA 4KNYA 3BXOA 4BMPB 4ZVVA 1RZUA 4N9QA 4MROA 2WWXA 1JI3A 3DL0A 1GPMA 4KNVA 4WKNA 2GBCA 4DCGA 4ZGGA 3JWIA 3IEVA 4AG3A 3BWDD 4O4JF 4XCVA 2WWYA 2MDTA 1WG8A 5K0SA 2O8CB 1UK9A 3G5UA 1FTQA 2ONYA 3GGOA 3KD3A 4B4UA 3S8YA 1PV4A 3W2FA 3MBIA 3KT3A 4GP7A 2MMGA 2ZE8A 1G42A 1UAGA 4QTZA 3QUQA 3ET5A 4YV7A 1SVSA 2YXPX 3GH3A 1E1QA 3KP1A 3EA5A 3IX7A 4B3CA 3GCXA 2X4LA 4C05A 3CLKA 4DCNA 2R7MA 1WZEA 3BH7A 3IAAA 5H3LA 1XHFA 4BMDA 4CUKA 2GS9A 3S2IA 1RCUA 2C8JA 3UTCA 4FD2A 4NECA 4YQFA 4ZK2A 5U4QA 4K9MA 2CLIB 4OB7A 5C4GB 5LOVB 2FR8A 1R6XA 5AVKA 4C2BA 2FJ0A 3LCJA 1SHLA 3RADC 3K09C 4UZSA 1FMFA 3WL8A 2B30A 4H7IA 4DSNA 4L5IA 1RXUA 4O2RA 4PRKA 4TOIA 3JW8A 4NHOA 5DLPA 2BHNA 1LNSA 2WW8A 1PR9A 1E64A 1SKYE 4MUNA 4Y0VA 2C2MA 2A30A 1EB8A 2IHYA 3BWCA 4HEHA 2JZOA 4B8WA 3R5FA 3EDYA 2XVZA 4NX2A 4R9NA 4EYQA 3L84A 2ACEA 1RT9A 2AX3A 2OSVA 3ENKA 3WLRA 1FSGA 4CEHA 1WHSA 2XRFA 2BR5A 4H1TA 4FU0A 4P0TA 2AEJA 4R1SA 5ICSA 3OUUA 1DV2A 2D59A 3EUAA 5T41A 2XXJA 5C2JB 2Y0PA 3O2QB 2QD3A 2HRQA 1YDGA 1M7GA 1C4XA 3N7UA 3FVQA 1QIKA 3EC1A 3MCVA 2B4RO 2FLVA 1BCSA 2YYAA 5IT4A 4ASUA 2HF7A 1PIWA 3K8OE 1OBVA 1RHKA 3Q41A 2JHGA 3QMVA 2G08A 5DRYA 3WB2A 4DCUA 4IUCS 3W1EA 3HUTA 1ULBA 4PLGA 3FH0A 3H8SA 1OT5A 5BV0A 1WZCA 1XYGA 2O50A 2C0QA 5E6SA 1GPAA 1OA1A 1XJQA 2LDBA 1PJTA 3UMFA 1TE2A 1HSOA 2F8TA 2IKSA 4RZ3A 1Y8ZA 5LBUA 5K0JA 1DBPA 1Y6RA 2E4WA 1JW9B 1PX0A 3WDSA 1RYEA 3EF0A 4RESA 4XGNA 3ZDBA 5LVAA 3MD9A 2R00A 2IF0A 3KVYA 1QIIA 2GSWA 2R84A 2ZJ2A 4Q3KA 4I3FA 3KHKA 3SFTA 2CVQA 3T3EA 1RCFA 1HL7A 1E8NA 1UKZA 4PXAA 5FJJA 1BHJA 1AO0A 4NCJA 4L5CA 4YWHA 5F2OA 1CQPA 1Z5UA 2H06A 3IT0A 4DQVA 5G1NA 3FGPA 3N2YA 4UE2A 1MO4A 4L9SA 3V4RA 4NBSA 1XQ1A 1IK4A 2A4KA 4S2UA 4UREA 4PCLA 3WB9A 4PANA 4YALA 5BSWA 2C2HA 3LA6A 2PT7A 4RPKA 1BFKA 4MRSA 1KDTA 4YUVA 3H5OA 2IUFA 221PA 3VZPA 1Z35A 1BFUA 3HNOA 4IOKA 2R96A 2C5FA 4ZQCB 2TSYB 5AOAA 2IH5A 5BQPA 1T4CA 2REBA 2WIAA 4R84A 2NYRA 2GN1A 3DDUA 4M1KA 5FWYA 1DQNA 1BE8A 3W7BA 3A1NA 2ADFA 4UNRA 2BFCA 1GT6A 2Q6IA 2QD1A 2NU7A 2QPLA 2X4DA 5HKAA 1SQFA 4QUKA 3SJBA 2E21A 4KOEC 2YWHA 3MSXA 3RYHB 4CQNA 3HUDA 4IYRA 4CL8A 3PPYA 5FBHA 1T91A 4L78A 1X1DA 2ZWIA 3K2QA 3A3PA 3HCOA 4ITUA 4NAHA 4RJTA 4DPKA 3LHKA 3EG5A 3JQDA 4P98A 1VYTA 1YRYE 2A59A 2HK9A 3PDWA 4I8XA 3GJQA 2EZ8A 3OY7A 4V03A 4WAUA 3WGOA 1YVUA 4B4KA 2GCOA 2EX1A 4ZTBA 1U1EA 2QNIA 3IDQA 5EJEA 3MFYA 2PUCA 4KIJA 1TEZA 1KAOA 2IHUA 4FUQA 4LX0A 1MIOB 5KKAA 1UDBA 5EJGA 3Q40A 3CWCA 4KTTE 1WZNA 1XTBA 1MA0A 4MK4A 1NYTA 1VHWA 3BT7A 1RRGA 3N53A 1EVYA 1WA5A 5F4ZA 4G5GA 4PSVA 1HKUA 3EHDA 3GLUA 4JNCA 3CVYA 3N70A 4TQ9A 1QANA 5B12A 5C51B 1VXRA 2XUJA 5K8LA 1P0PA 2ZJ0A 5JRJA 2GJ9A 1ZZGA 4MLZA 4CU2A 4EGSA 1JPVA 4QDTA 3T3NA 1YZUA 1NMXA 5BW6B 1X92A 2XNKA 2IZ6A 2YMMA 5JMTA 1TM4E 2B4YA 3LBHA 3KOUA 2CF6A 2EKZA 2KQUA 1NATA 2FFBA 3AXSA 3LT2A 4LJRA 3HB0A 2D3WA 1TEVA 1QK4A 2BDTA 1BXRB 3G13A 3HI6A 1V4NA 1Y1RA 1KY2A 3L7NA 3LOPA 2R44A 2YR0A 4P5DA 4YMWA 1WXWA 5CW1A 1OU4A 2WTUA 2Y4NA 1TM3E 3LIIA 4OI1A 3AF5A 4YH1A 2N42A 4HWOA 2GK6A 4GU5A 4RKEA 4QUBA 5LMUB 2WB2A 4ARSA 2QQGA 4KIUA 4NCBA 2IRWA 3KALA 3L8FA 2JLZA 2XCIA 2OCYC 4WACA 2PWAA 4IIYA 1NUSA 1F6BA 1EVLA 1SD5A 1SZPA 1MR3F 2J3DA 3L05A 3M0EA 5GJWC 5J1TB 3SF8A 4CIDA 1I36A 1MA3A 4LGCA 3SSOA 5JJLA 2G9UA 4WXEA 1DC8A 3HB9A 3GEHA 2ZCJA 1SVLA 4TN1A 3HDJA 4D3FA 5GADl 4GWLA 3V1YA 1H0KA 1QGUB 4WHMA 4JJ8A 4YAGA 1O95D 5K3OA 3V6LA 4BJ3A 4RHXA 1W4RA 3NJRA 5JANA 3JAKB 5ADVA 2SCUA 5L7WA 1Y81A 3VNSA 2DR2A 1S2GA 4D82A 1L0BA 1SWVA 1JFLA 1W85B 1YO6A 3CT6A 4Q03A 5K2OA 1I2CA 1HKHA 2AN3A 1DO2A 4M9UA 2OB1A 4WVFA 3EYAA 3HCEA 3S8MA 1OYWA 4PU0A 3A6LA 3HJUA 2Z5GA 4E2ZA 1FBNA 1Z9BA 3NLLA 4C20A 5AR1A 1WU8A 1Z4MA 2VJNA 3ANNA 3ZV4A 2HBRA 4NXMB 2CUNA 3KS9A 2AC4A 3THWA 2OCPA 1S96A 1Z4PX 2Q1UA 1DC3A 2HN9A 5KVCA 2AN5A 3LI2A 5COAA 3ZY6A 4B43A 2DX7A 4L8FA 1POXA 3PC7A 4UE6A 5D6OA 3KXLA 5AP9A 3HKDA 5FWDA 2HBQA 2ZJ3A 3CH4B 4PCVA 1RM0A 2ES4A 4X94A 5K0ZA 3KM0A 1QTNA 1CUIA 1IN5A 1SAYA 1LTKA 1RHQA 1R8JA 1VLVA 3L0SA 4H2DA 4XW2A 2O2DA 4IKPA 1YKFA 1ZSVA 3MAAC 4GEGA 4AMGA 3JPWA 3M4JA 5BN5B 5FR2A 5KO2A 4KX5A 4FB4A 1NVBA 4CF6A 1EXMA 2I7DA 3CKLA 4H7HA 4MEAA 3KZ1E 5AM5A 5HUQA 3WBJA 1MD9A 3QX3A 5IAKA 3WMFA 3V8EA 5HZMA 3DT6A 4O2LA 4M8NE 1TYBE 2JH3A 1JBQA 1W25A 3NTUA 4NBRA 3WZ2A 3QW2A 1X7GA 3ZZTA 5KTYA 4DQLA 1QLWA 4E5PA 4ZT3A 4TMVA 2TMDA 4DLRA 4YLYA 1XYYA 3F5QA 3GH1A 4FYKA 5DYYA 5JAZA 2P30A 4ASUD 3GLQA 2AF4C 4N7BA 1L7BA 1FZTA 4BVHA 4Z9YA 5C37A 3CRVA 4CM5A 4LV8B 4X91A 1RYMA 2WIKA 1V25A 3R23A 4OHFA 4EHHA 1SY7A 3N2GB 2EU8A 5FEMA 3SYNA 2X2EA 2YQ5A 1FTGA 2RCYA 1YAHA 4D57A 2AS0A 3A3YA 3OKCA 1MHTA 2Z5FA 4F4CA 1MJGA 4BNKA 3AF0A 4TSRA 3RVBA 1RVV1 4KWEA 5I9LA 1AO3A 4TL9A 4C7KA 1XEWY 1WD5A 8MHTA 3VYVA 1CE8A 2ZB3A 1YF3A 4XWKA 4B5LA 5KYXA 4DV2B 3LQRA 4LRQA 3BJIC 3U09A 1YRAA 1A8SA 1DQRA 3HBAA 5IT0A 4WX2B 4BCBA 3DF9A 2VNAA 3IR6A 1HZZC 1Z0JA 2Q9AA 1Z63A 2PK3A 4NFLA 2VUUA 1SQ5A 1ZQ9A 3KZXA 5AKYA 3A3NA 3GWZA 4RHFA 2QAJA 3NG1A 3FPEA 3P71T 4FDMA 2VQDA 1NQTA 1ONOA 1V6SA 2XNHA 2GNAA 4QD3A 4ZO9A 1AN0A 1E9FA 1CQIB 5T57A 5T4EA 2D2XA 3FDZA 2E48A 3GMIA 1JMYA 1Z8FA 3SXPA 4NKRA 1BWQA 3NM5A 4MPPA 5AQ1A 4M0KA 4H9GA 4ZZ0A 1FJXA 2P6OA 4OSOA 5KWEA 2NZJA 1GQOA 2F64A 3BZWA 3WWOA 1SO8A 3CEHA 4MI9A 5B58C 1Z4NA 3Q8LA 4G01B 4ED9A 1JQKA 1LW7A 3V8NA 5AUOB 1R66A 3V8RA 2OGWA 2QMUA 2HIAA 1G3IA 3BDAA 4RFLA 4J3NA 3TM4A 3KR2A 2AI2A 4MS1A 2C4VA 4LOAA 1XZPA 1K5DA 4AQYB 2BFFA 1ZA2A 2EBHX 3JQPA 4NU0A 5KJ6A 3AFMA 3BD9A 3FTNA 5CXSA 4HDQB 5F78A 3AF6A 4UE3S 4CLOA 3IAHA 3RRMA 5AW7A 3SK0A 3HZRA 4EG4A 1SCKA 2QE7D 2Z0MA 5D7BA 5EQFA 4A9AA 1ODIA 5LL6P 4G85A 2B2NA 3DQQA 4B79A 1BWSA 4NOKA 1F6WA 2JCXA 3L0PA 1RRKA 3IV7A 2Y1CA 3DZFA 3H83A 3Q0IA 4MIYA 4QOSA 1JR3A 4DKJA 3L5OA 5L3SA 1I4OA 2JLUA 3HFSA 1Y5IA 1PS9A 4K6KA 1PVOA 5JY6A 4BFZA 1OXVA 1X1AA 5CK5A 1L7AA 2WZDA 3AR2A 1D9ZA 4MDYA 5ALYA 4NU5A 3C0KA 3DONA 3E5NA 3NHYA 3UXMA 3NYRA 4A0FA 4DIEA 1N8TA 2V58A 3IXLA 4Z99A 3SXUA 3QU9A 3TUZC 2QRZA 2ODPA 1KNXA 4AVYA 4F9GA 4DSUA 3EA4A 5I7EA 1BH2A 2JAPA 5C3MA 4P7JA 2Q2WA 1DXQA 4LHXA 8ADHA 2DLNA 1CF4A 1TKAA 3O1JC 4PHFA 2VDPB 4WI1A 5KX5F 3I2KA 2NX2A 3ZX5A 3PF8A 3ADDA 2JCSA 3U3ZA 3UCFA 1XTSA 3OJ0A 4DIDA 1Z4QA 1CNFA 2EIHA 5F3DA 1GUZA 4C4XA 4F4JA 2NYUA 3NC4A 5C5EA 2GQ0A 1J5PA 2AT1A 3CQ9A 1XMIA 2BAGA 3OOSA 4A1OA 1MHPA 2QORA 2A0FA 3NUQA 2FX5A 1TU3A 3SOPA 3T7EA 4BFYA 5CW2A 4HK4A 4HOYA 1IG0A 4KXXA 3STYA 4Z1OA 1UOQA 2B98A 1JI0A 2IVFA 1JHZA 1CQIA 1HH4A 1U0HC 4UMFA 1EG7A 2AG1A 2FG7C 1W1WA 5REQB 2AZMA 3QELA 4GKKB 5EE1A 3KT0A 3L9XA 3UN1A 3ZX4A 4X61A 1FNMA 1RJDA 4LVCA 3K0SA 1CHDA 2JARA 3L1JA 5DTRA 2XAAA 1R6UA 1HY3A 2ZCVA 2XRZA 2TECE 2GCGA 3M6IA 3KB6A 4KIFA 1YFLA 3FYUC 2G1PA 4K9QA 5A71A 1NGSA 4HV4A 3JR7A 6CHYA 3P9RA 5I7OA 1UAYA 2FUG6 2PLWA 3CW9A 1ZRMA 4Y7CA 1RKQA 4D8YA 2ON6A 3Q87B 2OAQ1 2BZGA 2OTCA 4ZT6A 5H16A 1UBTS 2DFVA 4M21A 4KPFC 2PKYX 1V4VA 3PKJA 3ZBUA 1XL1A 1CY7A 3JZMA 4ETWA 1I8TA 1KAMA 2IA5A 3I6ZA 1M2KA 4GVLA 4X1KB 1DV1A 5AVOA 3PFIA 1GHTA 3IALA 4YP9A 3ZBPA 4J7XA 2X0KA 3L46A 4B4WA 4DG9A 3PNQA 1ZWKA 5F7XA 5K51A 4X60A 2F17A 4KXMA 4NENB 4IMPA 2R66A 1VSTA 3GCGA 3DMFA 3H42B 1G7RA 3VYTB 4DDTA 3KR1A 1R4MB 3FHLA 5L4NA 1YXMA 1GIAA 3ZPXA 1QGYA 1BS2A 2OO7A 1OGJA 4KP7A 1O6FA 1PL8A 4DE5A 3R3XA 4WZAA 1UWCA 3MRTA 3T9DA 4LY3A 3BMOA 2YNMA 3O1IC 3GCWA 4C06A 2PGLA 3CGGA 4QUIA 1C30B 4ZPJA 3GVCA 4IF6A 1OLXA 4QIHA 1KI3A 2YUIA 3OBBA 3K71B 2GF0A 4I9NA 3GPLA 3G2KA 4BGEA 5E6SB 1RJGA 1DDGA 1WR8A 3WLLA 4DNXA 4DC1A 4EHKA 1MW9X 2WKSA 3KZMA 3BXEA 4TT3A 3FKJA 1S4MA 5CNKA 3I2FA 4CLXA 3V2HA 2O3UA 1RMTA 2YYYA 4Z6KA 5CTJA 1FP6A 2O9JA 3GFVA 4UNSA 2NNLD 3NBUA 4IQFA 4NPHA 3FHTA 2NOAA 3PQ5A 5HKLA 4JLUA 3JZDA 4DQ0A 1M2FA 1MX1A 3GBSA 3LDHA 3NYWA 3ZY3A 1FLAA 4Y2QA 5B30A 1VYVA 3FI9A 1W35A 4JOQA 4ENTA 5L4LA 4JBLA 2WUFA 3SYKA 1CR6A 4J9UE 4BZXA 3THYA 1RZRD 3KQPA 3JVDA 3SEQA 3H2HA 1XMJA 1XTRA 2JGNA 3FTPA 2PU5A 4YRMA 4WEQA 2EL9A 1AN9A 1CYDA 2QSYA 2WJHA 2WTMA 3QVKA 4I5FA 3EFEA 3PU6A 1KY5A 4J75A 1KRWA 1KO1A 3NNSA 5JHGB 2BTOA 1K9SA 3OLQA 2AG8A 3OF3A 1O57A 4KQEA 1SC1A 1RP1A 3RIYA 4G0WA 2QTMA 3V7YA 4M0LA 5ALSA 2PE5A 3ZHCA 1SQGA 3TOZA 2GEUA 5GM2A 2K6GA 1R8XA 1RLOA 4GPAA 4MWSA 1LRLA 1GR0A 1VLLA 4RDIA 3BMNB 4RK0A 4U63A 3RYHA 2YN2A 3WJ1A 4B8ZA 4GLLA 3EZ9A 4GR5A 2C7OA 4RPIA 3T4UA 1XMOB 2C92A 3EDCA 3MUOA 1U2GA 4RGVA 4LF9B 1EFRD 1ZCZA 3RDPA 4AMZA 2YJZA 1B0ZA 4DABA 2H48A 1BXKA 1OLUA 3OZBA 4EH1A 2HLPA 3BTUA 2VNIA 3IUYA 1VIYA 1WXEA 1Z2NX 1EJBA 3TTXA 3ZY4A 4R0NA 3T7KA 1YACA 1LDNA 1HDIA 2V03A 2XT0A 4OBXA 1P5RA 3BM5A 3FMOB 3OICA 5A3JA 4N6NA 5KYVA 1C3XA 3CF4A 3L6CA 3WV5A 5JCPA 3D8SA 3TSAA 1G2IA 4MDHA 1QGAA 4PZUA 3JYLA 3FYTA 1Q1NA 2VWQA 1SRQA 3DLIA 3ONVA 4WLNA 2VCEA 3PDIB 4TM7A 3V7WA 3RUDA 4OEHA 3I39X 3CUVA 4TRJA 4ENSA 3H2SA 1IOZA 4HR7A 1YL5A 3E27A 1HFWA 3QPBA 4TS3A 3OUTA 5IAAA 3BHIA 3PGKA 4KQGA 4D45A 3DVAA 1P2UA 4FDAA 4RXUA 4YCAA 1GUYA 3CG4A 5AM4A 3VUEA 3GFQA 1UT6A 1XP8A 4HH3C 2K7ZA 4PLFA 2PZEA 3IIJA 1PJ2A 4K2HA 4Q5IA 4QECA 3WK7A 1N77A 1A4IA 3GDFA 2A5DA 1CVIA 2W43A 3N2NA 5FRDA 4Z1MA 2WHXA 3B53X 1ND6A 1X8LA 3CU5A 3AF4A 3PHIA 1NM5C 1XTUA 5GGYA 2FETA 1KOLA 3RI3A 2AFRA 3O8LA 4BEWA 4CIYA 3MHTA 2V8OA 3SQNA 5FD8A 3AHIA 1EWRA 3GBPA 3B5IA 1CCWA 5KTPA 5MGNA 1XCJA 2GEFA 3EEBA 5CX1B 1W88A 2HT1A 2HEIA 1I6LA 3NWPA 4U0KA 2B8NA 1YOVA 1EM6A 1ZRHA 4HB3A 2RGXA 4G0PA 5LXTF 4PIMA 5IZCA 5IDQA 3VC1A 1WCIA 4GM4A 4U7HA 1V45E 4ZANA 1B15A 2VF4X 2PKCA 3O7MA 3CS3A 2ET6A 4KDRA 1IZ7A 4HN4B 4IIFA 4OHCA 3OHSX 1UBKS 3B7WA 4C3ZA 1KMQA 2SCUB 3IEKA 1AKVA 2C97A 3KLNA 1N3LA 3QFCA 3RJZA 2A1UA 1D3AA 2G0NA 2OP0A 5E3HA 1T5HX 4A5OA 1GNTA 1L6RA 1YVEI 2O1EA 2PH3A 1NDUA 2WJIA 4EG5A 2W2LD 4V0LA 1SCUA 2H2AA 4DDUA 5HQ3B 3CVXA 1SXPA 4WKGA 3M4NA 2VHXA 2BKAA 2I1VB 1L4KA 4QRIA 2QY6A 3NR2A 5HW0A 2QRUA 1NLYA 2FZLA 3EFOA 3IIKA 4I55B 1J0XO 2PJZA 2UDPA 3O2JA 4GZMA 3LCUA 2Q2QA 3P8ZA 4Z0NA 3BOSA 2I8AA 3D8BA 2VK2A 3L8MA 3EK2A 4R1NA 5AI8A 2PXHA 4BNNA 4Z9FA 4EB8A 4PHHA 3NKVA 4Q1AA 3SYMA 3GP8A 4G8DA 2B36A 2ZUWA 1G59A 1NAIA 3I9OA 2P6RA 3KBBA 4UARA 3R0JA 4Q4CA 1QTIA 1SC4A 2YCLA 4J2HA 3DNFA 1NHWA 1RC1A 2W2KA 3FYCA 4IV8A 1RBQA 3HLTA 2O4CA 3RSSA 4W5NA 1T10A 5JJIA 4IIVA 1IMJA 4CM1A 3COPA 5LWQA 1U1CA 1FDTA 3Q88A 5KAPA 3SZ3A 4NCIA 1NVGA 4Q39A 3VOTA 1DCTA 3ZY5A 1NAHA 4UHJA 3PE4A 3HCRA 3SHVA 3TW4A 5BN4B 3GFBA 5F2NA 1SHUX 2IVZA 1SZDA 4A82A 4ENRA 2R0QC 4NYJQ 2X8LA 1VFNA 4UULA 4KR0A 5AW6A 4B71A 4WZZA 4DNOA 3V6MA 1KMMA 5DW3A 4YFVA 4XTCS 3U3XA 1G98A 3CBGA 4OI4A 3RSFA 1XXHA 1E4OA 5J4YA 2NWQA 4F12A 3KPWA 4B83A 1FOEB 5C35A 1HYHA 5EMJA 5DLDA 2A88A 5CRIA 1OBFO 2G7MC 3C7KA 4F5ZA 2DH5A 5JO0A 3GU3A 2XGGA 2XOEA 4ND7A 4I4LA 5KQMA 4J6FA 2EF0A 3SLRA 3TPCA 4ZVKA 5IC4A 2JGLA 4FW9A 2ZAGA 2PSDA 3MWEA 1EX6A 1CW2B 2ZSEA 2IK8A 3RT9A 2D7DA 1W94A 3U80A 2GHRA 3JVVA 1D5WA 1PR1A 4NAUA 4PG8A 2YFYA 1QOQB 2BONA 3T0IA 3F71A 2XCQA 4ZRMA 2B78A 2XA1A 3R7FA 4PXYA 3E5HA 4MV4A 3GEMA 2Y0CA 3BWMA 3B89A 5AMXA 2ZW9A 4MWOA 4POOA 5JS6A 2Z9DA 2F4VB 3LIPA 2ODNA 1JLLB 3HUFA 3Q11A 1EP1B 5DK6A 4AX8A 5IXJA 3CVVA 3DWEX 1FQKA 4QM7A 3QNWA 4KVZA 5FTWA 2A67A 3D4IA 2REXB 1R8YA 4MUHA 4RC9A 4LRYA 4G86A 3WIOA 5AVZA 4QULA 2APJA 4GMDA 1U3GA 2BEKA 2GBLA 2UUOA 2HWKA 3F46A 3L0YA 3KLBA 4MW1A 4AZ0A 3IIMA 4MW6A 1MZVA 1GU7A 1MC5A 2ZUVA 4C7MA 4OQPA 1KEZA 1QIFA 1L4NA 1U0TA 3H2BA 5L9AA 4IH1A 2H07A 3A36A 4GSLA 5KKCA 1YE5A 3VNUA 2QL5A 1PV2A 4TGLA 4Z4QA 1TMGE 4PN7A 4XB2A 2CSUA 2WDZA 4E15A 3MGAA 2ZOSA 3LTEA 2ZIGA 3BRSA 1ENPA 4PY2A 2IEIA 3TRDA 2XXBA 3WGYA 4LC0A 2QE7A 3OHPA 5GOZA 5DV9A 1K6EA 2Q6OA 3AW8A 3P4YA 3OIGA 4IRXA 5B6IA 3OD5A 1QR6A 4TN5A 1C9EA 1CF2O 2FOXA 3W5HA 1B0UA 2I80A 3DTTA 4U6NA 4UFPA 3NUZA 1ZI9A 3EE6A 1PFGA 1FNCA 4EFLA 2DWPA 2F1JA 4O8CA 4Q3LA 4NBVA 1AG9A 3L93A 1MKYA 2H0QA 2IEYA 4BRUA 5KSWB 3VSAA 2DT5A 1JH9A 2NT3A 1CJSA 4WGFA 1BA3A 2EQ5A 2KPOA 1BOFA 1F1BA 2JASA 3EGDB 4O1MA 1UKBA 2AQ8A 3GI1A 2JL1A 2X3UA 2R6ZA 4FGKA 3NPAA 4Z3DA 1SC6A 5HTOA 4J3JA 3NEAA 4JUAA 4MVWA 3T9AA 5BRNA 1L5GB 2ZQYA 4MV3A 4RD1A 4FN4A 3K4HA 5KSZA 3RJTA 3HNRA 4A2CA 1PNQA 3SYTA 1HE4A 3BA6A 2JLAA 2NU6A 4JELA 4YQZA 1E79D 4PQEA 2CNWA 1AQYA 1LPOA 4JXJA 4JYMA 4B46A 3MWDA 2GO7A 1DSSG 1MRSA 2Q46A 4YJHB 4ND8B 3VI4B 1OH6A 1DG9A 3R7DA 3NWOA 5SY6A 3MAGA 4MS3A 4P34A 1UFKA 2NSJA 4KQ9A 2M1ZA 2QG6A 3OFSA 4D26A 5TEVA 1JSRA 4P4NA 2GBFA 4ZIRA 3HFRA 1L4UA 3QV1A 3EVEA 1DKMA 2FCRA 2PRYA 2NN3C 3X1XA 1NVMB 3UHFA 3M1AA 4JR2A 1PRYA 4PC6A 3WOVA 3L77A 3BF7A 3KVRA 5BSVA 4FWBA 2VRWA 3LHDA 2GLTA 2JA2A 3FD8A 2JLYA 2WU3A 3NCTA 4JC0A 5DX0A 1XRRA 4Y2JA 5K0EA 4PE5B 3Q7EA 5JXIA 4ZK6A 3VVLA 1BDHA 1SBZA 4MAAA 1J39A 4GRDA 4DY4A 1YRHA 1UBMS 2OC9A 1Y42X 4YXWD 9ATCA 5E1OA 2E2WA 2G17A 2AOUB 2G67A 1D07A 3BSFA 5EGNA 3U60B 4FYPA 1T6NA 2Q8QA 2RJOA 3Q4GA 1MABA 1J90A 1ZINA 2QR5A 3BEOA 3VX4A 3RTDA 2RK3A 2OORA 1W4ZA 4WEOA 1WY7A 1ZEMA 3AL3A 3LPAA 1Y5LA 1AMOA 1KYQA 1L5HB 2I2AA 4FD3A 1AA9A 1WCWA 3TQTA 3RIHA 1E4VA 1GKYA 1CQXA 1UZLA 2EXXA 3A6KA 4YAFA 1U2PA 2PKQO 3DVRX 4YUYA 3UAWA 3UFBA 1U28A 3R7LA 2LNDA 4UVEA 3U6BA 4FZVA 4XWTA 4XVCA 5GJBA 3P45A 3LRTA 3ONNA 3OX3A 2AE1A 5TQJA 5DSZA 3U4GA 1DU4A 3JYHA 4N9WA 4HWRA 3KT8A 4R1UA 4PFSA 1U0LA 3Q0TA 1F1JA 4BJHB 3AVTA 5JJBA 4J7AA 4F4HA 1UZAA 3E8MA 2XXAA 1H1TA 1QRUA 3CRQA 1F4PA 2I4IA 2NO6A 3D5TA 1GCUA 4BNFA 1NV9A 3KKPA 5DTMA 3VAZA 3EN0A 2C2YA 1RC0A 4IZHA 1WB6A 1JLSA 5JS2A 1P3JA 4YK7A 4MRRA 3BGSA 2FWIA 1I01A 4XJSA 3A4LA 1BMTA 1QS0A 1WLSA 2Z2XA 2XUFA 3EZFA 1ZVMA 2XB6A 3GEPA 3GD5A 3QHPA 4R8VA 4RBNA 4X95A 5G02A 3RSZA 1ZR4A 4JBIA 3C3YA 1NN5A 3GL9A 3QPVA 1SKAA 2BM8A 2VJCA 4JXKA 5I9SA 1KI6A 1IATA 5FLEX 4YRCA 5D3MA 3WY9A 3E82A 3BKWA 4MUAA 3VU0A 4YCSA 5JSKA 3FROA 5A4MS 2X86A 4FBLA 1NW8A 1FZQA 1K6IA 2YWRA 4TXHA 1GNQA 5G41A 5J4VA 3EPLA 5FBRB 2I3DA 1KH2A 5EIOA 3VOAA 5C8YF 5CAEA 1JEJA 3PFFA 1Y8CA 2J0QA 3TGWA 3ST7A 1M1YB 2YVKA 1Z36A 4WCVA 2CJXA 3HKBB 5FULA 5EOVA 5EQDA 1G8PA 1H69A 1FUEA 2ZUUA 3EVZA 5KC8A 4HEQA 1EFAA 4DUPA 4KDCA 3V55A 1HLDA 1A0OA 3OZSA 4JLBA 1IQRA 5FTNA 1OFIA 4J0CA 1G4HA 4F6RA 3FYHA 3AJ9A 1QWOA 3NEJA 5EXPA 3OFNA 2CC2A 4KVGA 4ZP1A 3WGGA 5IT5A 4ARVA 2Z58A 2M6RA 3MB8A 3O90A 3ZEAA 5C1OA 1EXDA 2PZJA 2CNNA 4I1RA 4JBHA 1E2PA 1UPAA 4KK3A 4DA4A 2PD4A 4A4DA 1DZIA 3AOEA 1DG1G 3HBMA 3WYAA 1S2MA 5JAUA 4E5KA 1QK5A 1WDTA 2NGRA 2WD8A 4Q12A 5FBZA 1NVFA 3SN6A 5I51A 4AX4A 1R3UA 1L7QA 2CFOA 3DKKA 1J25A 3MINA 4KR9A 4EA9A 3B82A 3I0NA 4MRMA 2IHTA 2J5XA 1P4SA 1TIKA 6GPBA 4QJ4A 3KUDA 2GEBA 3DKRA 4MVCA 1N0UA 5BUSA 4W9MC 2OBYA 5H83A 5BW5A 3C7DB 1Z39A 5AJUA 1X14A 1TC1A 4JBWA 1IXZA 3D4BA 4P3OA 4UNNA 4AJKA 1JHYA 1JIUA 3BIOA 3NHJA 1CDOA 3LBFA 1H1DA 1IXSB 1EQAA 4MTCA 1PG5A 1X3SA 4QARA 4F9FA 1VG1A 2F2TA 5JFTA 3FG9A 1Y7TA 5J2UA 2QJRA 4QJ5A 5DWVA 4QBTA 3TBFA 4AIRA 5KIAA 4GZ3A 2PTGA 4HMQA 4WFIA 4LSWA 2FPIA 3VHXB 4UDOA 4UUAA 2BMEA 2A58A 2UUPA 3ET4A 4Y6SA 3THXB 1E3EA 1NY5A 4PYKA 1FYWA 4ER3A 2FW7A 1G6HA 1V3UA 2HHLA 2XUOA 5CCEA 1VKJA 1MRNA 1E1RA 1NUPA 4MWGA 1DIAA 5AHOA