3R1IA

Crystal structure of a short-chain type dehydrogenase/reductase from mycobacterium marinum
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
254
structure length
254
Chain Sequence
b'SVLDLFDLSGKRALITGASTGIGKKVALAYAEAGAQVAVAARHSDALQVVADEIAGVGGKALPIRCDVTQPDQVRGMLDQMTGELGGIDIAVCNAGIVSVQAMLDMPLEEFQRIQDTNVTGVFLTAQAAARAMVDQGLGGTIITTASMSGHIINIPQQVSHYCTSKAAVVHLTKAMAVELAPHQIRVNSVSPGYIRTELVEPLADYHALWEPKIPLGRMGRPEELTGLYLYLASAASSYMTGSDIVIDGGYTCP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Short-chain type dehydrogenase/reductase
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium marinum
molecule tags Oxidoreductase
total genus 97
structure length 254
sequence length 254
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3r1iA00
2NVBA 2HJRA 4LISA 4JP3A 4FS3A 1EVJA 5T57A 1BDMA 1C1XA 3GRKA 2DM6A 3GN2A 4DQXA 2FHSA 3MJEA 4RGBA 3VH4A 3ZH2A 2CDAA 1EDZA 3H9JA 1HYHA 1YDWA 4IS2A 1T4DA 5HRUA 1B0AA 3C7AA 4CR8A 5JCXA 1X14A 4EEZA 4DRYA 5JY6A 1ZK3A 4AJKA 4CQLA 4J7XA 2AE1A 3PEFA 2W98A 4E33A 5A9SA 3VVBA 4UUOA 4ALLA 1C14A 1R0SA 3D3WB 5AYVA 1N9GA 1Q0HA 1ZK2A 5DOZA 1H0KA 1TI7A 4E3ZA 5HS4A 1OOEA 4NMHA 4BO4A 5IJZA 4FC7A 2HMTA 2VRCD 4MJLA 3LU1A 1IZ0A 2X1HA 3WS7A 1WVGA 1DLJA 3RUFA 4CL3A 5ES3A 3KYDA 4XYEA 4E30A 3PQFA 2V6GA 4O63O 1DC5A 3AW9A 4TKLA 1H2HA 1UZLA 2B5WA 3DFZA 1C1DB 4XYMA 3HADA 3JQ6A 3OBBA 5KJ1A 4FCCA 2PKQO 4PLWA 4BMSA 4CMIB 4FPXA 3KRTA 2Y1CA 3NTOA 3DQPA 4BNVA 4IPTA 3FSRA 4I5GA 2O4CA 1GV1A 1ZMTA 2CF6A 5L4SA 1H6DA 5AVOA 2J8ZA 2GZ1A 4I1IA 1TA4A 1B3BA 1K6IA 1TT5B 2AQHA 4EW6A 1M6HA 4BQRA 2Y1FA 3EZLA 1I01A 1EBFA 4KDFA 4BGIA 3PWKA 1I3LA 4KTTE 1UP6A 1GEGA 1Y8QB 1MA0A 3BTOA 4Z0PA 1VJ0A 4IZHA 5EPOA 5G4LA 2H5LA 4XGNA 3W4IA 2V6FA 2AEMA 3TZ6A 3TZQA 5GZ1A 3NDJA 2GZ3A 3RWBA 4CLRB 1GDHA 1C3VA 2CVZA 1IY8A 1HEUA 1XGKA 3MTGA 3QIVA 4J91A 2NSDA 5FF9A 1NM5A 3AUTA 4DA9A 3U5TA 2HK9A 1LJ8A 1GYQA 4IQ8A 2ET6A 3WR5A 2BD0A 4GL4A 1KC1A 1KIFA 2NU8A 5B12A 3T7EA 3WSVA 4AJHA 2LDBA 1GUYA 2WJPA 3DFUA 1IYZA 4I9NA 3ZZNA 5L40A 3DBHA 2HU2A 2WYVA 2Y66A 3DEYX 5KWEA 1YJ8A 5FI3A 4NK4A 1LA2A 4IDDA 5JPIA 4FBGA 1QYDA 3ZCXA 2V7PA 2DC1A 3QV1A 3RKRA 1JA9A 1JKIA 5T8KC 2YZ7A 1U3UA 3RQSA 4JXKA 4BNNA 4YVFA 1TXGA 3SC6A 3AK4A 3GNSA 4BS9A 4JP2A 4YAEA 3K73O 1GYPA 2X5JO 4GX0A 2VQ3A 2QRKA 3PGJA 4BO6A 2Y0EA 3K2BA 1LQTA 2G76A 3UVEA 4TRJA 2R6JA 4GQAA 3L6EA 2B83A 3ZNNA 1JWBB 2E4AA 1SZJG 2C07A 2DKNA 3C85A 2H1SA 4OSPA 5CPBA 3VPXA 1D3AA 1DSSG 4RF3A 1HDGO 1PGNA 1ZBQA 3MWDB 3ABIA 4DBZA 1Z7BA 1WZIA 3IP1A 3MOIA 3PFFA 5G4KA 1Z6ZA 1NAHA 4IDFA 1E3LA 4MDHA 3WFJA 4CM4B 4XGKA 5DF1A 4I08A 2X4GA 3EK2A 4NBUA 1WW8A 1LQUA 1ULSA 4J7CA 4FB5A 2IZ0A 4F45A 1E3JA 3D4PA 3ZU4A 3HUDA 1B14A 1GU7A 1PWZA 3GT0A 5FEUA 2W4QA 2YV1A 4R68A 4WLUA 2PNFA 3AFNA 1LDGA 3NJ4A 4PZDA 3ZI0A 1SO8A 1EUZA 1QYCA 3S55A 3JQ7A 3AI3A 1E3WB 1KY5A 5JO9A 3WOHA 4OYRA 3WIEA 1Z45A 4E21A 3ZDFA 4UUMA 4CM7A 4Q3NA 4DPKA 4KDEA 5G0TA 1ZVMA 2NADA 2UDPA 2E37A 2WWRA 3QVTA 4AJPA 1CYDA 4WCFB 1K3TA 3BXXA 2PD3A 1NQOA 3OJOA 5KTKA 1ULUA 1NBOA 4W7HA 4WLNA 3MJ4A 4MIYA 3PWZA 5COAA 4YCAA 4BNFA 3UXYA 1R0KA 3DTYA 3DONA 5EN4A 3DBRA 3GVIA 4CM1A 2YV2A 4GH5A 3QA9A 7MDHA 1IPEA 4CM9A 1ISMA 5C5IA 2HK7A 2D5AA 1XLTA 3RC9A 1QXSA 2JCVA 5H81A 3RVDA 4B8WA 2C20A 1HWYA 1DHRA 1VL8A 2O23A 4INAA 4KQWA 1GY8A 1FDWA 1UZNA 1D4FA 2RH4A 2VWHA 3U49A 4BVAA 2HKIA 3K30A 2C7VA 4XGIA 5FYDA 5A9RA 3OEWA 1ISHA 3RJ9A 2WD7B 5KIAA 2RAFA 4O1MA 1PZFA 4RVSA 1YBMA 1YWGO 1EVYA 1ZSYA 3BTVA 3INRA 1QMGA 3R1IA 3DOCA 2GERA 3QY9A 4FOOA 3C24A 4JLWA 4R69A 1DIRA 2X86A 3OHSX 5HWSA 3RSHA 2WM3A 3JD2A 4Y6RA 4BUCA 2QRJA 3FTPA 4E4YA 1B2LA 1EK5A 1UXIA 4BNWA 3TRIA 5CEEA 1Y9AA 1YVEI 5EL0A 1XYGA 2Z95A 2EJWA 3VPFA 4PCVA 5TS3A 3AUUA 2NVUA 1E3SA 1PGOA 1LC3A 5B4TA 3TOZA 4TSKA 3AM4A 4HY3A 2X0IA 5A9TA 4WCDA 1T26A 2DTDA 4IGFA 1ZMOA 2DTXA 2VNSA 4XRRA 3I4FA 4LMRA 3ORFA 1LDBA 3ZU2A 4WLVA 1XR3A 1N7HA 4NJMB 1KERA 4HXYA 4U5QA 3RIHA 5CAEA 2C2YA 1E5QA 1U3WA 4MPDA 5L45A 3KO8A 3OIGA 3GAFA 2RBEA 1SC6A 1RM3A 2X7HA 1P45A 3SX2A 2I9PA 1MG0A 4YXFA 4NU5A 4I5FA 4URFA 1NR7A 4Z9XA 4CM8A 5CDSA 5CDUA 1ID1A 3OP4A 4L74A 3G49A 4N18A 3IKVA 1HTBA 3WXBA 4CR7A 1KYQA 3GDGA 4PG6A 3U4DA 1VRWA 4CQMB 4WUVA 3H5AA 4IJKA 1DRVA 2VYVA 3FN4A 1BW9B 3I1JA 1DOHA 2Y1EA 3NV9A 4NG5A 3ONEA 3LT0A 4TQGA 3GRPA 2O7SA 3I6IA 1YBAA 4CLHA 3PQEA 3ZV6A 3HSKA 1GV0A 2GDZA 1LDYA 4DQVA 4AJEA 4CMEA 1BXGB 9LDTA 3VZQA 4BB5A 1UP7A 1ZW1A 2ZQYA 4ZVVA 4B4VA 2AQ8A 3WG9A 4KUGA 2P9CA 4O0LA 3VKVA 3JYOA 3CXRA 3L9XA 3H3FA 1U8XX 4ESOA 2J5QA 2QX7A 3QWHA 3GVCA 5JAMA 4K26A 5DBIA 5KOIA 5I7VA 4HFJA 3WQQA 1LLCA 3RJ5A 1CQJA 3GVXA 2NACA 1UP4A 1OZAA 3VVCA 1P77A 1K5HA 2NTVA 4IMRA 3KTDA 3GZNA 4XRGA 2FR8A 2VZ9A 2P4HX 5MGBA 3H9QA 1I32A 3BMOB 3WWYA 5DP1A 1DJNA 2Q1UA 3R3JA 4CMEC 1GZ3A 3QE3A 4M1QA 4YJHB 4ZHSA 3U09A 4YYZA 4OM8A 2YW9A 5IDYA 2EIHA 1NPDA 2ZB3A 1ZEJA 2B4QA 4R1UA 1AHIA 3ZWOA 3JQAA 2D4AA 1WPQA 1BSVA 3H6KA 1B15A 1GAEO 1ADBA 2QZZA 1PR9A 3KB6A 1SB9A 4D0SA 2OBNA 3ETGA 4DYVA 4E5KA 3PVZA 3H65A 4II2A 1QLJA 3A4VA 4JIGA 3NGLA 2PV7A 2IRWA 1HZJA 1HF3A 1VL0A 1MG5A 2Q2QA 4QQRA 4CV1A 1GZ4A 4GLOA 4KP7A 3GDOA 5AOVA 2FPGA 1GCUA 4F6CA 1GQ2A 4BNGA 2VT2A 5LDHA 1T2AA 2VWPA 3PHIA 4D44A 2WYUA 3I4CA 5L9AA 5DZSA 2NLOA 3KZVA 4TKMA 4EI2A 3OA0A 3RUEA 1KBZA 3DTTA 1TVEA 3QWIA 1RM4A 2I76A 1SBYA 2YDYA 2CSUA 3E9QA 3JQBA 4J4TA 2NTJA 5DP2A 4BNMA 1KEWA 5B1YA 4PLGA 4BKPA 4IM7A 3WNVA 4CLOB 1LC0A 1S6YA 2BHLA 3PFWO 1D1TA 4NNJA 3GPDG 1R37A 3ZV4A 4D3DA 1YE3A 1I3MA 2NVWA 4PIVA 2W2LA 1X7HA 2RIRA 1HDXA 4NK5A 5DOVA 2YV3A 2GN6A 4G65A 3CE6A 1AHHA 2EP5A 1BTOA 5ENVA 3HQ4O 2B37A 1KVQA 1SOVA 4E12A 3TF5A 1C0LA 5CG1A 1E5LA 2FRDA 1I2CA 4J49A 3BMNA 2EGHA 2G17A 1PJSA 4G5HA 1GEEA 5CEJA 5EINA 2X0RA 3A9WA 3BMQB 3UAGA 5H83A 4LW8A 5HA5A 5A5FA 1IHXA 3GNQA 4B7CA 3U62A 1DPGA 4QO8A 3ETDA 4RPGA 5I7FA 2BH9A 3ZN2A 3IIEA 2DQ4A 1IB6A 1MXFA 3ADOA 3V1TC 1Q0QA 1XKQA 4UVDA 2I65A 1GR0A 2FPIA 1GD1O 3ICCA 4PLPA 2LDXA 4I5EA 4ND3A 4YQYA 5ENDA 3TDKA 3EAGA 3OA2A 5ILGA 1PIWA 1K89A 2HRZA 2YDXA 4Y98A 3T7CA 2W2LD 4J4HA 1E1MA 3OMLA 1Y5RA 2DBQA 3OSUA 4DC1A 1K0UA 3JD4A 2HCTA 3ASVA 2BGKA 3ZWCA 4GPD1 4H15A 4GMGA 1I8TA 1N5DA 1HT0A 5KJCA 1XDWA 3QWAA 4TZKA 4B3HA 2IODA 4QFCA 3WX0A 1MLDA 3S1LA 3MOGA 2BELA 4A03A 4FQ8A 1D7OA 4ZA2A 4DLAA 4FDAA 1U4OA 4DVJA 2Q46A 3GOHA 3HDYA 3TZHA 2YYYA 4BOYA 3A14A 3VC7A 3O8QB 2AEJA 4WLOA 2YHIA 2O2YA 4E32A 1Y8RB 2CNBA 3FCOA 3KSZO 3KEQA 3GY0A 3IS3A 3KSDO 1N1GA 4B3JA 1XU7A 2HMWA 1H6AA 3WDSA 5IDWA 1GCOA 2NUAA 1B26A 3C1AA 1T24A 1FMCA 1CF2O 1JAXA 4IIUA 1BVRA 3KSUA 1HYEA 1T2CA 3HJAA 1EDOA 2BI8A 1I24A 3JQ9C 4GSKA 4HFRA 2B69A 3L4BC 3KM0A 3D1LA 2VOEA 3SVTA 3QLJA 1A9ZA 3RC2A 3E9MA 4OOEA 3L77A 1TEHA 2UV8A 1QR6A 4LCJA 2GZ2A 4J2OA 4W99A 4KWIA 5IDXA 1ADGA 2AE2A 4BGUA 3QQPA 1IOLA 5TNXA 4E5PA 1H6BA 3AWDA 3JQGA 5I9MA 1P9LA 2EW8A 1ENPA 1E1KA 3F47A 4PLTA 3WTCA 4D3FA 2OZPA 1PX0A 5TC4A 2J5RA 2X9VA 4DIOA 3GVHA 2JFHA 2VNAA 3LT2A 3G17A 4Q3BA 5A02A 2G5CA 2ZIZA 1IPFA 4ALJA 1GQYA 2DBVO 5BNIA 2Q1SA 3RC7A 2VHYA 1W4ZA 4OIMA 3NJ8A 4CV2A 1E6UA 3RUHA 2GO1A 3QP9A 1JVBA 1F8GA 1X0VA 4R01A 1HE3A 2HMUA 2E82A 1WXDA 2GN8A 2X6TA 3DHEA 3AJRA 4OQZA 3DO5A 1G0OA 3DBLA 2VHWA 1YL5A 2YUTA 1B3RA 1U28A 3OJLA 3UW3A 2NV6A 4BNTA 4CLXA 4DL9A 4IDEA 5KVQA 2QYTA 5AXBA 1UH5A 3WGIA 4GVXA 4BQPA 5KJFA 1IUKA 3E5MA 4PLVA 4D0RA 4AJ4A 1YDEA 4E2ZA 1ZSVA 2DAPA 3HG7A 1ZUD1 4AJNA 5I8WA 5EIOA 1LXCA 4PVCA 4QUKA 1WMAA 4Y6PA 1EK6A 3FTNA 5CHEA 2AG8A 3ZV3A 1ENOA 3VOSA 1X13A 1DXYA 3M1LA 3P7MA 1HE5A 3KETA 3JYLA 3ZW8A 3HE3A 4OOFA 2XPCA 2VUUA 2Y1DA 4DTIA 2PZJA 4P8RA 3RCBA 4NH4A 1RM5A 2AA3A 3SJ7A 3GLQA 1BXZA 3DWFA 5GZ3A 2RHCA 4YRDA 4WASA 4RPJA 2X9NA 4MVJH 4HWKA 4XKJA 2QRLA 2Y1OA 3MCVA 2DLDA 3IL2A 3ZWBA 2EJVA 1IULA 1FDVA 4ALNA 4J9VA 2PFGA 4R9RA 4FIZA 4S3MA 1R4MA 2FSVA 4L8VA 4WECA 2WDZA 1ENZA 3PJEA 1RJWA 3VZSA 4R3WA 1YL6A 2O2SA 1I2ZA 2DUUA 4MVJE 2FY8A 1EVIA 5FFFA 4FR5A 2RHRA 3F4BA 1ZH8A 1RYDA 1PZHA 4DWVA 1TT7A 1O6ZA 4RORA 1KVSA 1DC6A 2WMDA 4R1NA 5CDYA 5JCJA 2AQIA 1PS9A 3RC1A 4FD3A 4ZRMA 3GFBA 2QW8A 2BRUA 4HV4A 4HADA 2P2SA 1J4AA 4FFMA 4L4SA 5U9CA 3Q2KA 3GG9A 2OORA 2X58A 3ROPA 4BKUA 4F3YA 4W7IA 2H9IA 2O7QA 3LQFA 3ZNQA 4GX1A 4RLHA 2IXAA 4WJZA 2JCXA 1MB4A 3RROA 2JHFA 3TJRA 1EZ4A 4ZJUA 3MJVA 4TWRA 4KZPA 3PPIA 1F14A 4W82A 4XR9A 1C0KA 1DRUA 1XG5A 2BGMA 2CY0A 1V0JA 3OM9A 4PLFA 4YJGB 3WGOA 1ZK0A 2J5KA 2O4UX 2XF8A 3EZYA 5L4LA 2BFOA 5JCJD 2ZTVA 1AGNA 2X5OA 4O59O 1JLLA 5TJ9A 3GAZA 1UXKA 2C5EA 1X0XA 2PZKA 4YB8A 5G0WA 4RVFA 3B1JA 1E6WA 4O5OA 1U5AA 4QEDA 3TN7A 5MDHA 2JL1A 1QYXA 3ZHYA 5JY1A 3DZJA 3COSA 4CR6A 2Y99A 3CH6A 1W0CA 2HLPA 4J0EA 2JHGA 4Q3EA 1HETA 3G0OA 3QWBA 3IMFA 5AQ1A 5BQFA 1QP8A 2BI7A 3VH3A 3S2EA 5C7IO 3AY6A 2IZ1A 1QG6A 5DCYA 1MC5A 3JTMA 3FNFA 2ZB7A 3PHJA 3TZKA 1U4SA 4H16A 3U4CA 3G1TA 1DFGA 5T8KA 4YAKA 2JD2A 5TT0A 3UCEA 1ORRA 5IZCC 3WLEA 4Q3CA 4LN1A 3WBFA 2W8ZA 2Y0CA 2BFAA 2BMAA 4Q3DA 1CJCA 1VI2A 5JBIA 3FHLA 1VC2A 1Q0LA 5HBRA 4NJOA 4PG5A 1FF9A 4UVGA 1J5PA 2ZTUA 4CLDA 1EMDA 4E5MA 5KCZA 4U8GA 1ADFA 1UAGA 3TOXA 1XA0A 1V6AA 2ZYGA 5T64A 3RU7A 3V5NA 1DIBA 4MVJI 3BMCB 4YAGA 2D5CA 1U5CA 5JE8A 3CMCO 4NR0A 1YBVA 1VLLA 3KOUA 3D3WA 3U4IA 2B4RO 3O38A 4BNKA 5K9ZA 3S8MA 2NM0A 2Y68A 2WEKA 1YONA 3I9MA 5L7WA 2WTBA 4L0QA 3CEAA 1PZGA 1J0XO 5EMHA 1EQUA 4OSOA 2UAGA 5B37A 4N7RA 4BO3A 4AJOA 1WAMA 1IZ9A 4BO2A 4FSHA 5JLAA 1HDRA 3CZMA 3PLNA 5L95A 4R51A 4EYEA 2JD1A 4CMIA 4CMAA 4ZGWA 1FDTA 1NP3A 3F46A 1ZJZA 3UCFA 3AFMA 4PRKA 4J16A 4R5MA 4BMNA 1ISFA 4AJIA 1AN9A 5EERA 1NVGA 3VZPA 4E2WA 4I9UA 4YJFB 2W2KB 4IMPA 4BHTA 1P74A 4FFNA 1TT5A 5BT9A 1AUPA 3CUKA 3AI1A 1Y8QA 2Q45A 3F1KA 1D8AA 4EEXA 1E6EA 4J1QA 1K6XA 1QLHA 1YQGA 1WP4A 1V9LA 5TGDA 5C7LO 3DMYA 4LK3A 3ZWNA 4CLRA 1UXJA 3ANNA 5TIIA 3CZRA 2PH5A 3F1LA 3GG2A 4GAEA 5TJHA 1YO6A 3LT1A 4MP8A 3KUXA 5J23A 3RBXA 3GDFA 2PD6A 4HFNA 3GH3A 4C4OA 2IZZA 1ENYA 3IKTA 1DC3A 1P33A 2JFGA 4JROA 1LDNA 4X54A 3FNEA 4IIVA 5IN4A 2NU9A 3H4VA 4IXTA 1PJ3A 3WMWA 2OP1A 4DC0A 1UXGA 1MXHA 1OI7A 3C7DB 3NT5A 3PXXA 1DFHA 1ZXLA 3ADPA 4ZD6A 3NGXA 2X8LA 4CL8A 1A72A 2C59A 3E48A 4HNGA 4ALKA 1LRJA 4WNIA 5JDCA 3WNQA 2PTGA 5LCXA 3LK7A 2PZMA 4Y67A 5BSEA 3EYWA 4ZRNA 3PYLA 3W8DA 2CZCA 4BKRA 4JJGA 1P1FA 2IDZA 2TMDA 2I3AA 5F3RA 1P0CA 1PJ2A 2DU8A 3UCXA 4RPKA 3DR3A 3L6OO 5F1OA 2ZQZA 4L73A 4GGPA 3JQDA 3KV3O 5F5LA 5L53A 2VOJA 3AOEC 4ROSA 4PG8A 3GNTA 2C5AA 3JQFC 4CM8B 2WE8A 3ZWVA 5TQVA 1VPDA 4B4OA 5JDCC 4GLLA 1H5QA 1A9YA 3ZV5A 3JYNA 1Z82A 3WMXA 4CMHA 5DCUA 4IXWA 2PA3A 4EGFA 1NR1A 4CM4A 4DLBA 3K8ZA 3MWEB 3IC5A 4ILKA 1SEPA 3WGQA 2FZEA 4IDGA 4CM9D 2DPGA 3ITKA 2GGSA 3EUWA 4E13A 2FN7A 5CFZA 4MVJP 3FRJA 3H9UA 3I52A 5L51A 3HFSA 5JMPA 1KVUA 2Q4BA 2TMGA 4UEKA 3K5PA 3GGPA 1E3WA 4RVDA 2YJZA 4Z9FA 1NPYA 3V2HA 4ND1A 1Z74A 4A2CA 1O95A 1ONPA 4E0BA 3DAFA 1JAYA 1PGQA 4W9NA 4I5DA 3WWZA 3RKUA 1LLDA 2X0JA 4P4LA 1N8KA 4WCFA 3OQ6A 4DLLA 1CERA 2Q2WA 1AXEA 2IE0A 1VJTA 3GGGA 2NQ8A 3TL3A 4BL5A 4DQUA 5T6BA 3P19A 1I36A 4KMSA 4ND2A 2EERA 2AW5A 4KUEA 2Z1MA 2P9GA 3UF0A 1P44A 1HE4A 4CLEA 2ZB8A 4R16A 3M6IA 1P1JA 1TB4A 3GVPA 4HFMA 4M54A 3U0BA 1U2GA 1FK8A 4PLCA 1E92A 1I5RA 3W6UA 2J3HA 4MVJG 1NFQA 3DC2A 1E3EA 1WNTA 1WDKA 1YL7A 4WE3A 1XQ1A 1Y9EA 3INTA 4FN4A 4YAIA 1EBUA 5THKA 3E6AA 2GRAA 3P2YA 4W9NC 3OH8A 3BHIA 1BWSA 5T5QA 1JKFA 2PR2A 3NTRA 4WCFC 2EKPA 3KXDA 4CMCA 5BSGA 2WD8A 3X2EA 4B7UA 2WD7A 1XQ6A 2X0NA 2O3SA 3PWSA 3PYMA 1OBFO 5TRTA 4WOJA 3TZCA 2P5UA 3QVOA 3GN1A 2VHXA 3L4SO 4MO2A 2VHZA 2V6BA 4MVJM 4UVIA 4D41A 1R12A 4IJVA 2VT3A 2YFHA 5H82A 1LU9A 3VPHA 3ZHXA 2F00A 3KYCB 3I9KA 3OEYA 4NFSA 5JDIA 3LF2A 4CM3A 2G82A 3E18A 3OJFA 3QVXA 1XU9A 2VYVD 1KVRA 2PGJA 4UVEA 3AUAA 4A27A 3B1KA 3GEMA 1HDOA 2HMSA 4AVYA 1GPJA 4BNZA 3JV7A 1E7WA 5EQFA 1UUFA 4XB1A 1H94A 2JJYA 5KJEA 2GD1O 1ZK4A 1HDYA 4NJMA 5C3MA 4E2XA 3NAQA 1O89A 3OFSA 4OXNA 2BLLA 3DOOA 1H6CA 4AJ2A 3WQSB 2V65A 5COQA 4NPCA 3IQDB 4N5NA 4EJ6A 1NTOA 4L76A 1YS4A 1VJ1A 1BMDA 5T67A 5JDIC 3VHRA 3BMNB 3GUYA 2ZB4A 2BFPA 5KVSA 1XELA 2RH8A 2BFMA 4J90A 4XQGA 3IJRA 3NT2A 1U3TA 1U2DA 4XYLA 3H5NA 3FR7A 3ICPA 4WKGA 1YGYA 5ITWA 4OH1A 1OAAA 2QZ9A 4CQMA 1XSEA 3Q2IA 5JAZA 3LZ6A 4BMVA 3HZZA 3T4EA 1RKXA 4RVHA 1DEHA 1YOVB 4MVJA 2ILTA 3IDSA 2I67A 4BO1A 4N54A 1B16A 2D2IA 4A26A 7ADHA 1BXGA 3JQAD 3Q1LA 1MX3A 3S2GA 3V8BA 1YB1A 4UVHA 4JBIA 3OQ1A 1ZCJA 3WQRA 1EQ2A 3V1YA 2B4TO 1JW9B 2DPHA 4RVGA 2F1KA 1PQWA 2FZWA 3LC1O 4I9HA 1PQUA 3NKLA 3VH1A 4ALIA 4BO9A 1G6KA 3IP3A 3STHA 1O9BA 3ZWWA 3PHLA 3CMMA 3RUDA 3IUSA 4MKXA 1Z73A 2GR9A 1Y7TA 2UUPA 5GMOA 3EY4A 3VZRA 5FWNA 2D8AA 2IEDA 3ROQA 1E7MA 1G0NA 1LLQA 4XEHA 4HX5A 4ND4A 1U1IA 4OXYA 2CFCA 3BMOA 3PQDA 3OF2A 2PGLA 1A4UA 1BGVA 4EUFA 4PZCA 4YJHA 3UOGA 4J4BA 4D79A 3GMDA 2B35A 4IJUA 5DT9A 3DL2A 5KJ6A 1X1EA 4OKIA 5KNLA 3RUCA 2ZYDA 5A4DA 4BKOA 2UUOA 2HMVA 3OIDA 1V3VA 3N7UA 1BXKA 3FBGA 3RUAA 4HKTA 1MV8A 4ZICA 1PQPA 2CUKA 5A05A 2V6MA 4MKZA 4RDIA 1EEHA 5C7OO 3Q9UA 3D7LA 4FJ0A 2HDHA 3DAGA 3FI9A 1R4NA 5JYDA 3JQ8B 4TVOA 4PRLA 4D43A 4AJJA 3ZGYA 1WZEA 4DPMA 2CVOA 3MJTA 1R66A 4H7PA 1ZKMA 1FDUA 1OFGA 5JW6A 1EFLA 3I9OA 2Q4EA 1N2SA 1I2BA 2W90A 1V8BA 5L3ZA 4M87A 3Q9NA 5DCWA 3JQ9A 4XIYA 2PY6A 3L4BA 2B0JA 2J3IA 4E6PA 2A94A 3L07A 3LF1A 4B4WA 3KYBA 3GC6A 1P1RA 2VHVA 1UR5A 2ZTMA 1Q2XA 2VCYA 4J1SA 2IEBA 3IAHA 3PDJA 5LC1A 2GF2A 4CLOA 4LVUA 3DZGA 4WEOA 4AICA 4YQZA 3ZWAA 3LLSA 1ZIDA 1KEUA 1P3DA 3EMKA 1LSUA 2Q1WA 1NWHA 3LC7O 2EW2A 1KVTA 5B4VA 4CJXA 1ONOA 1DRWA 3EVTA 4DPLA 3T4XA 3GPIA 2VN8A 3BYZA 3DZFA 1W8DA 1E7RA 4A7PA 1CWUA 1DJQA 1M66A 4M8SA 4BV8A 3D5QA 3H9GA 2YQ5A 4OXKA 3VDRA 1ZEMA 4YACA 3LT4A 3BMQA 4QTZA 4RPLA 3O26A 4GX5A 1GZ6A 4IQ0A 4Z0HO 5B4UA 3ITDA 5JSFA 3DAPA 3WJAA 4UAGA 1W73A 1XHLA 2GYYA 2NU7A 4J7UA 4H3VA 3TFQA 5DBGA 1I3KA 4HNHA 1U9JA 3H3JA 3WIDA 3F9IA 3ZNOA 5BNTA 1DBVO 5F1PA 2OBYA 4OMUA 5IXSA 5JXWA 1O0SA 4TRNA 3DMTC 1E3IA 3B1FA 5HTOA 3JYQA 4XDYA 1PR3A 3U4HA 4DBVO 4QXMA 4W6ZA 4U7WA 4NU6A 2FR0A 4JCOA 1H93A 3GGOA 2NWQA 4YAJA 1WDLA 2J6IA 3QRWA 4FFPA 1Q1NA 4BNUA 4FW8A 3D5TA 5A04A 5KKAA 3A06A 4GGOA 2Y05A 3TWOA 5IZ4A 1QV7A 1ZO8A 4AG3A 3WTBA 1C0IA 2FOIA 3U9LA 1GUFA 5ITVA 2A4KA 1NXQA 1YQXA 1P31A 1U7TA 4LRTB 5DNAA 1C1XB 2AXQA 1NVMB 1EUCA 3PJGA 1JN0A 5JFOA 1DAOA 4R4JA 1DAPA 1F17A 3WYCA 3K6JA 4TRRA 1ADCA 2ZTLA 4R54A 1DDOA 1JKJA 4OAQA 3K96A 3PIIA 1WWKA 3FWNA 4R5HA 3ROKA 1DIAA 1M76A 1MGOA 4QFDA 5TT1A 1DLIA 4MIEA 2JKVA 4FGSA 3TFOA 3OJEA 4QX6A 4RQUA 2AG5A 5THQA 5JYEA 3WGZA 4CUZA 3NEPX 4NDNE 2EGGA 3I83A 4Q9NA 5JMWA 4CQLB 3WJ7A 3CIFA 5A9SB 1LDEA 4IINA 4YT2A 1N9GB 3HDJA 4I8XA 2J3JA 2BKAA 3HB4X 4BGVA 1YJQA 1EE2A 3NDRA 5A06A 2JFFA 3EVNA 4EDFA 3KEOA 3RFTA 5ER9A 2D3TA 3VPGA 3KYDB 5COBA 2XOXA 3AOGA 5BNFA 2O3TA 1GADO 4JN6B 2H6EA 1CQIA 1K6JA 2GUGA 3Q11A 1LSJA 2ZYAA 3QSGA 4EITA 2CDBA 3NYWA 4RF5A 4RL6A 1X15A 3BZUA 2DBRA 3JD1A 4NFYA 3ZNPA 1PJLA 4GI2A 4ID9A 2YFQA 1Q7BA 4BB6A 5EQDA 4IS3A 4Q39A 4J0FA 4M89A 4WK6A 3UUWA 4E2YA 1QKIA 2Y1GA 3F4LA 1C0PA 1Y1PA 1E1LA 4Z9YA 1NWCA 4KTVE 1T1RA 2D1YA 3G79A 1XIVA 1T4BA 5C37A 4ZQHA 4PN3A 1IHYA 3TPCA 3FPLA 1SEVA 1A7KA 4OQYA 4L4XA 2PKQP 1ZXBA 4B79A 4K1LA 3SJUA 4AJLA 1MUUA 5CG2A 3JYPA 2RCYA 1IL0A 4Z3KA 5A3VA 1AE1A 5JNLA 5FI5A 3W6ZA 2VRCA 3ZWPA 3E5RA 2QQ5A 3JSAA 1M75A 4HBGA 4J1TA 4UEJA 1PU2A 2VTDA 2BF7A 2VZ0A 4YRAA 1GL3A 2ZKLA 3OICA 1MC4A 4LRSB 2P9EA 3SC4A 3SLKA 1CEQA 1ONNA 1DFIA 2WE7A 3K2EA 3NT4A 5KKCA 4RCVA 4A73A 4TMFA 4YT5A 5F5NA 1PJ4A 4E5NA 1E77A 2O3RA 4CMKA 1BHSA 1R6DA 1YH3A 5JC8A 3DBHB 4UREA 2E6UX 1HKUA 3DBVO 3ZWMA 3PI7A 1KS9A 4JJIA 5ILOA 4XYBA 1XEAA 1I10A 3UKOA 2Q49A 3MJCA 3F3SA 3WICA 3EW7A 1NAIA 4CM5A 4NI5A 5IZCA 4IZIA 3IUPA 3RFVA 3HWRA 2EG9A 5HM8A 5TX7A 3ZW9A 3HHPA 2R00A 2Z5LA 5IN5A 1ARZA 4MVJF 3SEFA 6ADHA 4XQEA 2Y93A 4JQCA 5AXDA 1PJBA 1T2DA 2CVQA 1LEHA 5K6AA 5IAAA 5KVCA 1EUDA 5LDGA 1JQBA 4JX8A 1LTHR 3D3EA 4ZQBA 4BGEA 3I9NA 2HO5A 4K9DA 1HYGA 2QG4A 3QJ5A 4BNYA 1Q7GA 4GKBA 1E1NA 1LLUA 1O8CA 3TSCA 2G0TA 4FJ1A 4GWGA 4DUPA 4YWJA 3GEDA 4AFNA 4B7XA 1LSSA 1RM0A 3C7CB 3QW2A 4GMFA 1E7QA 4G81A 4PLYA 4PLZA 2PGDA 1R0LA 2PKRA 2OL4A 3WGTA 3VDQA 3K9QO 4UULA 1NQTA 1GYRA 3B20A 3FPCA 5EJ2A 2R00C 4ZU3A 5G4KB 3WYEA 3M1AA 1VL6A 1ZSNA 1B7GO 1T2FA 3ENKA 4U6QA 5KVVA 5G0UA 1Z75A 1QRRA 1A7AA 3KHUA 1QYWA 2AQKA 3GF4A 5AXCA 1PS0A 3UGKA 5K6AC 1GPDG 4F6LA 3ON5A 8ADHA 1NQ5A 1UDCA 1H2BA 2B36A 3SLGA 4UUPA 1D1SA 3DHNA 5JAQA 3G1UA 1SNYA 1NASA 2O50A 3D64A 5EESA 2C82A 3H2ZA 3VTZA 4NBVA 3JQ7B 3NX4A 2OOSA 2OMEA 3JQEA 1KY4A 3AU8A 1UDAA 3JD3A 4U6SA 2C2XA 3NTQA 1DHTA 5G0SA 3TNLA 1YXMA 1QORA 4FOSA 1O5IA 2DUWA 4MP6A 1PWXA 4Z6KA 3QVSA 1C1DA 4QECA 4YJGA 4MKRA 4TVBA 4YDRA 2ZATA 3HB5X 2DT5A 3BTUA 3C3XA 3EHEA 4Q3AA 3UFXA 5JS6A 4XDZA 1LX6A 3F5QA 3ASUA 3N58A 3UH1A 1BDBA 4M55A 1LUAA 3V1UA 3DBRB 4HUJA 1PGJA 2EXXA 3I9JA 4QO7A 4LSMA 3DOJA 5TLSA 5ER6A 3ZWYA 1HSOA 3DDNA 3NRCA 2A35A 4UUNA 3AUSA 4DMMA 2EV9A 4GX2A 1PJQA 4GSLA 2OGUA 3GA0A 4L9RA 1I30A 2BGLA 1H9BA 4PVDA 5L7YA 4RJTA 1AXGA 2P68A 5G2OA 4FJ2A 2IYPA 1O94A 3TQHA 4J1NA 4BO7A 3O9ZA 3S2FA 3H8VA 3DZBA 5I7SA 3WGGA 4AJ1A 1VKNA 4M49A 2EF1A 3ONFA 1OMOA 4R41A 1NNUA 2OHXA 3GK3A 2OP0A 2HUNA 3ETEA 5F21A 2Q99A 4RZIA 2WSBA 3AOEA 4IDBA 2NVUB 4RQTA 1YKFA 3BMCA 3ZHZA 1PTJA 5BSHA 2NU6A 4LGVA 1B8UA 5IF3A 3JQFA 1WDMA 2GN4A 4IBOA 1IE3A 4XX0A 4EZBA 1NYTA 1PL6A 1ZNQO 3DHYA 4RF4A 5TF4A 2E48A 2JCYA 4FGWA 2O3JA 1KOLA 4DGSA 3DXFA 5A03A 5ADHA 4LSWA 1RPNA 3JD0A 1HE2A 4Z0TA 1YB5A 3GEGA 4WEQA 3DZHA 2XAAA 1JU9A 3O4RA 1JVSA 2PZLA 4GKVA 4GWKA 3HN2A 2Q1TA 1NVTA 1VKOA 4RLSA 3W8FA 5A5EA 2OFPA 4XB2A 2R2GA 1F8FA 2GLXA 4IY1A 4OKNA 4WOKA 3D4OA 4Y6SA 5IDQA 2Y67A 3PZBA 2UVDA 3H5RA 1V3TA 3E8XA 3CSDA 4YJFA 2W2KA 4LCEA 3MEQA 3ANMA 4WLEA 1U7HA 3GMSA 4YRBA 1CETA 4FFLA 2JD0A 1SCUA 1WMBA 3VTFA 4A5OA 4C7KA 3C8MA 3PDUA 1KEVA 3RUIA 4A10A 6LDHA 3RU9A 3I9LA 4HP8A 4KWHA 2I5PO 2POQX 3GR6A 2VWQA 1VSUA 4RZHA 4WGGA 4L75A 1UXHA 3FWZA 3EC7A 3PGXA 3AY7A 3PP8A 3P5SA 4XR4A 5CP8A 3WYBA 1GUZA 4FC6A 1BVUA 4B3IA 1M2WA 2ZCUA 1HZZA 3AM3A 2AMFA 4ZQEA 4RF2A 5L4NA 3BTSA 2AEFA 3ZU3A 4NQZA 1X1TA 2ZJ0A 3BHJA 3PTZA 3I6QA 2EKQA 4TZTA 2VZ8A 2C54A 4U0KA 1Q7CA 1DIGA 2I6TA 2PH3A 5AXAA 4PZEA 3A28A 1GQQA 1E7SA 1NHGA 4PFJA 3GZNB 4YT8A 3W8EA 2UYYA 5I9NA 1U8FO 1ISJA 1N92A 1X7DA 4P4NA 4DIBA 3H2SA 1E0DA 2VYNA 2CDCA 2YQ4A 4IUYA 1CIVA 4XWYA 2EHDA 3OECA 4DXHA 4EBFA 1J6UA 1B8PA 1A4IA 2J3KA 2ZK7A 3W4JA 4XQCA 3JQAB 2QHXA 2PWZA 1KEPA 3L0DA 3HN7A 3PYXA 3A1NA 2FMUA 3HDQA 3PK0A 3R0IA 4DIFA 3BA1A 3W4KA 5GZ6A 1HL3A 4XD2A 1DIHA 4N5LA 3Q3CA 1H9AA 1JTVA 3D0OA 2NQTA 1PS8A 3IOYA 4NZ9A 1NFRA 3ENNA 1K2WA 4P38A 1JDJA 3E03A 1BG6A 4JK3A 2DFVA 5G0VA 4YA6A 3RBZA 5GY7A 3AU9A 3M2TA 1PGPA 3PZRA 1LI4A 1PEDA 2VYND 3ONDA 1JWAB 1S7CA 1LNQA 4JBGA 4BNLA 4XA8A 5CDGA 3AY3A 1P1KA 4J3FA 4D7AA 1UAYA 1XCBA 5DDIP 2CD9A 4OJNA 4KQXA 5CEFA 1NX6A 1P1IA 2FR1A 4OGWA 5DBFA 4Y8VA 4JGBA 3ANLA 3BIOA 3OJ0A 1L7EA 4XJTA 3EDMA 5A1TA 2B5VA 2Q2VA 5U4QA 4IDAA 1UJMA 1HRDA 2PD4A 4IDCA 3I5MA 2Z1NA 1E7YA 1R15A 3FD8A 3KLPX 1QYVA 4FFRA 1FDSA 4J2HA 1T25A 4NFHA 2HK8A 3QVWA 5ICMA 3GZ4A 1ML3A 3BAZA 4ND5A 3E82A 4CUKA 1NFFA 1T1SA 2IYOA 3HDHA 5JC1A 1WLYA 5JAIA 2I99A 1ZFNA 3ZWXA 4EUHA 4XIJA 4E31A 4CV3A 3LYLA 4PLHA 4P22A 3KVOA 4M86A 3GUCA 4CPDA 2FWMX 1EVZA 3U3XA 2DVMA 4NBWA 3INGA 3R3SA 1BW9A 1KC3A 3K92A 1A5ZA 1ZK1A 2HJSA 5DULA 4JJFA 3RFXA 4YPOA 4NBTA 4ZQFA 3MZ0A 5BSFA 4DMLA 3FNGA 3F5SA 3C1TA 4EUEA 1R4NB 2EP7A 3DZKA 4MP3A 4GVLA 3UHAA 4LVCA 4R3NA 4DYDA 3PHGA 3LDHA 4KOAA 3JCZA 4RV9A 2X23A 3MTJA 4BNHA 2VTEA 1DB3A 3PIDA 3KYCA 3WSWA 1M67A 1OC4A 2GASA 1SB8A 3GHHA 4CV0A 4CQMD 2FP4A 1L1FA 5ICSA 2VWGA 3RASA 2YHIB 3V2GA 4AL4A 4BIIA 1LDMA 3D4NA 1A27A 3L6DA 2P91A 1P0FA 4MVJD 4E5YA 1EE9A 4NHEA 4MINA 2FSSA 3WGHA 4DREA 4IQGA 4ZQGA 4OL9A 2ZJ1A 2PK3A 2EKLA 1GFSA 5IG2A 5A3JA 3DZIA 4II3A 4YJDA 3Q0EA 5I8ZA 2JAHA 4BO0A 4J43A 1CRWG 1CDOA 2Q3EA 2YY7A 1V3UA 2NTNA 3G3EA 3JQCA 2GPTA 4PG4A 4P4GA 3VAZA 4ITUA 4IGEA 3WGYA 2Q50A 4IJWA 3W1VA 3JQBC 4YTEA 1MFZA 4OO3A 4BNXA 1L7DA 2GCGA 4BNIA 4A0SA 4JBHA 2HAEA 1PL7A 4LMPA 1ISGA 5IFLA 2A9FA 2CF5A 4MOWA 4RVUA 1LSOA 2FPPA 4XQ9A 3WBBA 3P2OA 3M2PA 4CUJA 2X22A 1Y5MA 4R1TA 4BO5A 2I3GA 2O3UA 3JQGB 4OHUA 4CODB 4YBZA 4KUHA 3TL2A 4F46A 3GQVA 3WB9A 1YOVA 1YB4A 2P4QA 2WYWA 3L9WA 3LVFO 4J9UE 5HS6A 4UEOA 4D46A 1VSVA 2DBZA 3KLMX 4EJ0A 3SBOA 1M6WA 3GHYA 3ZU5A 2C0CA 3B70A 5I7EA 5L7TA 1RYEA 2GSDA 1HDCA 5CPFA 3HNPA 3CPSA 3LSYA 3B6ZA 2P5YA 4QSMA 1RWBA 1VE9A 4R9SA 4Y9DA 3RI3A 3E1KA 1N1EA 2HQ1A 2I66A 3CKYA 4W4TA 4O6VA 1YRLA 4Z3DA 3DBLB 3EGOA 1G1AA 2GNAA 3OETA 3PJFA 3ULKA 3DMTA 1Z7EA 4N5MA 3ST7A 1UDBA 1PSDA 1GTMA 2PLAA 2VUTA 3F6YA 3KBOA 2XXJA 1VM6A 2IXBA 1QSGA 1LBEA 3RD5A 4WLFA 3SXPA 1HSZA 2GN9A 4YEDA 2JAPA 3BHMA 4R1SA 3VPSA 3LLVA 1FXSA 1SMKA 3FNHA 3OQBA 4K28A 3E9NA 1J49A 3H7AA 3DB2A 1Y6JA 5F1KA 4QT0A 2YHUA 1XWFA 3FBTA 1OC2A 2QIOA 1TLTA 2Y0DA 3RAJA 3H9EO 4U0JA 5K0ZA 4JNKA 5U1PA 5IXYA 4B8ZA 2XXBA 1MP0A 3I23A 5I9LA 4ZN6A 4BNJA 1F12A 3AM5A 3PHHA 1A71A 2E49A 3C1OA 4K6FA 3JQ8A 1F06A 3RBVA 4D3SA 4D42A 8LDHA 4ALMA 4D45A 4CMJA 2D0IA 1QV6A 3IJPA 3PLRA 3Q6IA 2SCUA 4K6CA 4XCVA 4S1VA 4L4RA 1SOWA 4XJSA 1DO8A 3UICA 1PJTA 1R4MB 2OXIA 4WNCA 3FR8A 1NPTO 1NQAO 3PJDA 4MIOA 1P1HA 1HXHA 2VUSA 3V2UA 4B4UA 3O8QA 4CMBA 3VKUA 1ZJYA 1LRKA 3ROMA 1Y8RA 2A92A 3FF4A 1ZZEA 2C29D 3R6DA 4TROA 1I33A 5JO0A 2EWMA 3MJSA 1Y81A 3LC2O 3VH2A 2DFDA 1F0YA 1SAYA 3K31A 4NBRA 1N7GA 1UZMA 3I3OA 1HLDA 3QWFA 1B8VA 3ZHBA 2HRBA 1ISIA 1T2EA 2G1UA 3OIFA 4NIMA 1PL8A 2OUIA 1X7GA 1V35A 1DC4A 3QHAA 1SPXA 1U3VA 5CDTA 3NUGA 5DN9A 3O03A 1LRLA 2NNLD 1BRMA 4XYGA 1NHWA 9LDBA 4J6FA 1HDZA 3CTMA 3HFGA 5BR7A 4CMGA 4GBJA 3WFIA 2AHRA 4EJMA 4YR9A 3CINA 3UN1A 3S2IA 1YQDA 4CM6A 2C7GA 3X2FA 2O48X 2CMDA 3GFGA 1EFKA 4RDHA 4WPGA 3PRJA 2OO5A 4PGFA 4BV9A 1R16A 4G2NA 2ZCVA 4C7JA 1KETA 3AI2A 4YT4A 4XZ3A 4RPHA 2X9GA 4PG7A 3NDIA 1PZEA 1FJHA 2X5KO 4FFOA 1HLPA 1I3NA 2H63A 2O3QA 4TRMA 2DTEA 1I0ZA 1MFPA 2HSDA 1W6UA 2D59A 3WLFA 4BKQA 4ONEA 1PJCA 5TSDA 2QYSA 3N74A 2VRBA 4BO8A 4RO0A 2EEZA
chains in the Genus database with same CATH superfamily
2NVBA 3WKCA 1H2FA 1CRQA 2Q29A 5DXFA 3MGBA 2EDAA 2ZE7A 4B80A 2BYTA 2YHSA 3AEZA 4JP3A 3EEBA 3JQRA 5LU8A 1BDMA 1UBOS 1OW3B 3NWJA 1C1XA 4A92A 3J80A 4C0AC 3H9BA 2C42A 4X45A 4GRAA 1CSEE 3VH4A 5ICGA 2V3CC 3ZH2A 3CEJA 2O8DB 2ZIFA 1X7YA 4CTNA 1T0IA 2QVZX 3FOCA 1T4DA 1JX6A 5HRUA 1V2HE 3RYIA 4CR8A 3T3IA 4KQFA 1JQ5A 4QBKA 4C0JA 5C5DA 1EWQA 1ZD3A 3IR5A 5JY6A 3KQKA 1CDZA 5IUKC 2ODAA 4DIEA 1RW4A 4P9NA 1A69A 4EAAA 1IB0A 2E1RA 4NF2A 3PEFA 4HEJA 1XTBA 1L5VA 1GILA 2A1UB 4M88A 3L0PA 3JZIA 3DJYA 3LUBA 3P0JA 4TV8A 4IDNA 5IUNC 4C05A 1S2GA 2G3YA 3T3OA 1RI3A 3K3PA 5EIAA 1OOEA 2V6JA 2QMEA 3PC2A 4BO4A 1XYYA 2HEGA 1W94A 3A10A 4RGYA 4B34A 2VRCD 5P8WA 1YFLA 4MJLA 4KPUA 1DLJA 3RUFA 4X1YA 4XTRA 4ZAWA 4E30A 4EB3A 3NQ41 2JGNA 1R00A 4HC4A 4UAJA 4JI7B 1GOTA 3IHTA 2ECFA 4IYRA 3RTGA 1HI9A 1T2VA 4FR2A 5BV7A 5F9HA 2FAXA 4F5YA 2C57A 2HV9A 3MTIA 4PLWA 2M9MA 4DSNA 4CMIB 4DCNA 3KRTA 2CLCX 3ND9A 3NTOA 5JQWA 4KXMA 1UOPA 3OKFA 2QQEA 1VL2A 2I4OA 4I5GA 2QBYB 2O4CA 3I73A 3NYRA 2JS7A 2D3WA 5CIQA 4H3SA 3UENA 1B0ZA 2X77A 4JITA 4B46A 1HE8B 2BDUA 4I1IA 5DBEX 1TA4A 1IU9A 4ZO7A 1EFUA 5F1YA 2OD2A 1ORVA 4BXOB 1UPUA 1TT5B 2AQHA 4EW6A 3RSGA 1K0FA 4M36A 5TQ0B 1J8QA 4BQRA 1XU4A 4BGIA 3VKFA 1I2DA 4IIBA 1Z2EA 3CLSD 4KTTE 4F3RA 1GEGA 1Y8QB 4IKOA 4IDOA 2VDRB 4NQRA 5C0OE 1PHRA 5GJVC 4GU5A 4WTOA 3QENA 1P4SA 4FINA 1RWWA 3BB1A 4IZHA 4LOKA 4M53A 1SHKA 2H5LA 3DEIA 2I8LA 4XGNA 2DBYA 4UU0A 4RFSB 3TGWA 3UOWA 2KW5A 2AEMA 1VL1A 3TZ6A 5GZ1A 3OZCA 2GZ3A 2OB2A 3MWLA 3RWBA 4CLRB 3THXA 3HP1A 2WUFA 1C3VA 2TSYB 5LQJA 3L93A 1IY8A 1ADJA 1SUCA 2QK4A 2QZ4A 1VBNA 2Y2VA 3VTAA 4JGIA 2XHEA 3IUBA 4IQ4A 5FF9A 1T3SA 2V7XA 4R8LA 3AUTA 4OAPA 1BA2A 4Y2QA 1F51E 3ZLJA 4XIFA 4LJAA 5H7XA 2GM4A 3WYDA 2ZU0C 4QHYA 3ECAA 4C21A 4CKCA 4W8HA 3WR5A 1CG6A 3TTTA 4L2IB 1KIFA 5B12A 4MLCA 1Y1QA 3I64A 2LDBA 1GUYA 3DFUA 4YRTA 1S9DA 1QGUB 1B1AA 2JAWA 3QUBA 1IYZA 4HHEA 5D85A 3MJDA 4O2LA 4RIHA 2NTYC 3UAWA 3DBHA 1WW3A 2HU2A 1I6MA 1T9KA 2W2MA 1NBHA 3MIZA 2JGIA 5FI3A 1UMKA 2V8OA 3M3DA 3E58A 4IDDA 4OHOA 5JPIA 4FBGA 1QYDA 3TDMA 4MQEA 4OXQA 3AIMA 3QV1A 3RKRA 1NR5A 1FFGA 1FVHA 3HB9A 4UNIA 3B38A 4MV9A 3HL0A 4YP5A 3E22A 4XFDA 1YA4A 3CF0A 1CR6A 2N1MA 1U65A 5I9SA 4JXKA 2NIPA 4XSVA 2A9PA 2OV4A 3KHSA 3KJEA 1TXGA 3Q4GA 3U16A 3GFOA 4MR8B 5JZOA 3EBLA 2XNKA 1E1YA 2JAUA 2Y0EA 1JZSA 3EZ2A 3V00A 3RVRA 2V4MA 4E6EA 3QI2A 5JOQA 1RXWA 5DX8A 4FBLA 1KIAA 1VFPA 2QR2A 3UVEA 1D1QA 4IO1A 1L3BA 1C9NA 1JF8A 1T0PA 3C70A 3D54D 3ZNNA 5BW8A 1DKQA 2E4AA 4B83A 1SZJG 4JLAA 3C85A 4YIHA 4OSPA 1U2RA 1D3AA 4RF3A 1F2UA 3HS3A 4LJ6A 1DUVG 1NMQA 3IP7A 2ZIXA 4DEYA 2H4JA 1O8BA 3GWGA 3DP9A 1IHPA 1H2AS 4L9WA 4Z9BA 4UXIA 2YRWA 1TDJA 4BB0A 1BCRB 1MX9A 4Z8YA 2H1VA 3NHPA 2ZULA 1VI6A 1WW8A 5LIPA 2CMHA 5KAMA 4BFLA 4GC9A 1IWBB 4UZSA 3IBSA 1OZ0A 4WLUA 1LBSA 4OHRA 4J16C 2P6RA 4PZDA 2VF7A 1UT8A 4Q12A 3HEMA 3PNYA 4MRAA 3A0UA 4JOSA 4NH0A 4JCCA 2XOEA 2AK2A 3HRKA 3JQ7A 1E3WB 1KY5A 5IK2A 3FTFA 3JU3A 3P0FA 3DE2X 1HH4A 4DPKA 4ZP1A 5FWYB 2C31A 1C9EA 1XTVA 4TS1A 2C4VA 3S40A 1YQTA 1SHJA 3W06A 5K3EA 5KYYA 3REFA 3DE7X 3L8FA 1KI3A 1EP3B 2Q9CA 5AIAA 1U2EA 4BCBA 4YMWA 4TMZA 2WHPB 3HBJA 5AKGA 2ONKA 3LUKA 1CYDA 1MABA 4AJPA 3BXXA 1QC5B 2PD3A 4NX2A 5BYJA 5KTKA 4W7HA 2B21A 4WLNA 4PX5A 3MJ4A 5COAA 3BA6A 4YCAA 1ZM2A 3V8VA 1R0KA 2BKUA 4WK0B 3BWVA 3CUTA 1PK7A 6ABPA 3MPUA 1DTEA 3QA9A 7MDHA 3GJ8A 1OU4A 2E4WA 1OLXB 1TKAA 3ZIDA 5LBIA 1RWKA 1LPPA 2VTKA 5LUBA 4HRYA 4UEQA 5C5IA 1GPMA 2HLDD 3RC9A 2G7ZA 2WQ6A 3ZKWB 2PJDA 3WO1A 3V8EA 2FW9A 5GM2A 1T5OA 1W6RA 2YJTD 4BLRA 2C20A 1HWYA 4K6OA 1VL8A 4FOTA 4YRGA 1JQJC 1GY8A 1P1BA 3TLGA 2RH4A 2VWHA 4P3OA 4A16A 3OFND 2WWVD 4N0QA 1EWRA 3K30A 4TKUA 1OF1A 3H1GA 5FYDA 2VA9A 3ZI4A 3AR3A 4R0NA 3D2AA 3OZUA 5FOTA 1UKAA 4H60A 1IM2A 3RJ9A 4B73A 3EVZA 3FCEA 5LQRA 1PZFA 3C43A 3KL4A 3MTAA 1K75A 3F67A 3PEUA 4NEHB 4RVSA 1XZDA 2J3EA 1FP6A 4PZPA 3STVA 2XA1A 3BTVA 3INRA 4D0LB 4FOOA 3DOCA 3QY9A 3FX2A 4ZTZB 2CNNA 2IBMA 2OXFA 4FOPA 4EFMA 3OHSX 4OHBA 4RUKA 3D8HA 4B33A 2WM3A 1B23P 1ZM7A 4BUCA 1N8NA 4E4YA 5B2FA 4ZZ2A 3ELUA 2HZ7A 4PC3A 5EL0A 1XYGA 2C5BA 5K8LA 3QMVA 3WGLA 5ELMA 4ZGGA 4PEVA 4UE3S 1PGOA 2NZVG 3PUYA 4KFTA 3QY0A 3TOZA 4PBTA 3AM4A 2PSSA 5D00A 2F1IA 3OP1A 1XZJA 4BBJA 4U2GA 2C92A 5FLYA 2I6SA 4ZI5A 5A9TA 3DLAA 4WCDA 3BD9A 2DTDA 3P97A 5DX0A 1WXXA 3CLTC 3EWNA 1BDIA 3OT1A 1EJ2A 2F8LA 2R7MA 1QO0D 3TUIC 4NJMB 2B5OA 2WUEA 3INNA 4MV1A 2XTNA 4YFVA 5CX1A 1E5QA 4MPDA 4TWBA 2ZT6A 2RGAA 3AVUA 3KO8A 4TM8A 1NTRA 2Z3WA 3GAFA 1SC6A 4YCDA 2ZIVB 3WFZA 5BYAA 3EUEA 5DIFA 1C3XA 2QB5A 1OYWA 5BXQC 2C3OA 1A8QA 3VYRB 2RGGA 4URFA 3T06B 1U98A 3NIBA 5C2JB 4WNAA 1O6CA 1U1EA 3C8DA 4TUYF 4Z9XA 5CDUA 5AVWA 2EYQA 2JCBA 3OP4A 1NKSA 3T0FA 5ICCA 4I2VA 4JLJA 3G49A 3DOIA 3KOOA 2FPRA 2ZRQA 4BP1A 1VLQA 2XOKD 4BBZA 1C9DB 2BHSA 1RRCA 5BQPA 4DQLA 1CQWA 3RVQA 1DRVA 2ENUA 1TJPB 4YJ3A 4RK0A 2OHFA 1E2GA 3FN4A 5T4FA 2WBLC 4HR7A 2DOKA 3HTXA 4NG5A 1DOHA 2XYVA 1T15A 2W8BA 1UOOA 3ONEA 1NDUA 3NC1C 2WAXA 3AEXA 3TRHA 3PGKA 2V0GA 2I7CA 1X2EA 2JJ1D 1GTZA 1CUBA 1VTKA 1EFRD 4DQVA 3VV2A 1ZDMA 2H2AA 2PT5A 1OKKA 1VLHA 1UP7A 1ZW1A 1Y5IA 3GFPA 2JFYA 3MGGA 3QUSA 2I54A 4I7EA 4KE9A 5BMVF 4LF7B 5FA8A 5IJ0B 1X9HA 4KUGA 1DTWA 3PG5A 4O2AA 3VZBA 3WE7A 2G8NA 2KX7A 3JYOA 5AKIA 3C7TA 3ZJUA 1WTAA 1WKBA 1V7PC 2QX7A 2B7BA 3IQWA 1JZTA 3GVCA 5KYXB 1SD1A 5DBIA 5KOIA 3EASA 2GESA 1C7QA 2XCQA 2C61A 2A5DA 2DSNA 2VDWA 3PC8C 1LLCA 3RJ5A 6Q21A 1DWOA 3I6MA 1CQJA 1G291 3A37A 1NP7A 1UP4A 2PS0A 4JKIA 1OZAA 4YUAA 3BCUA 2ZS9A 3VVCA 2VUHB 4Z4CA 3RJTA 2I4NA 2NTVA 4NTZA 1VJCA 5EYPB 4XRGA 3LY5A 2I34A 1KK0A 1NC1A 5F12A 1Q0SA 1EGVB 5BW5A 2FFJA 1WB5A 1C3EA 3BRSA 4ZU6X 4CCSA 5AW4A 5F64A 5EOVA 2JIPA 4BVFA 2DF8A 4BGDA 2FQ1A 1Z6YA 2ZYUX 2ZDQA 2WJHA 5FBQB 2HWYA 3C4QA 1O97D 1ZITA 3R3XA 2AD5A 3B2EA 2EIHA 1L9KA 1ZEJA 2F48A 5HF6A 2COKA 4H3HB 2IF2A 2O06A 1HQKA 3SEZA 3AX6A 2QRZA 2ZITA 2D4AA 3NM6B 4EHNA 4CIYA 1GL6A 1H1TA 1YBHA 3JALA 3WWDA 2WINI 2QVYX 5KSPA 1GAEO 1ADBA 1UANA 3UIEA 3KB6A 4OLFA 1SB9A 2A0YA 4B1FA 4E5KA 4UM9B 1J2YA 2WNIA 1IJEA 2ZRKA 2CJWA 1PJZA 3EBPA 2NZWA 4FYMA 1FP4B 2PV7A 3VSDA 1HZJA 4C87A 3KHTA 3LKBA 2G36A 3NYIA 1HF3A 1BVYF 4TYWA 4HEQA 3RWMB 5JWOA 1Q5PA 3DG9A 1P4AA 5ICEA 2FPGA 1RQNA 2PX3A 1SG0A 2GTIA 4BNGA 4GEGA 5FYQA 5HQ3B 1WS6A 3EG9A 4BAUA 4BFXA 2EDCA 5TGZA 2QE7D 3IDAA 4L28A 3A8TA 5B3LA 4GZMA 3U7FB 3NHRA 5BQXA 5L9AA 2CLMB 4C14A 3GLFA 1RMQA 3OA0A 5B53A 4DBLC 1KBZA 2H4HA 3DTTA 4YASA 4PO1A 3A6FA 1SBYA 2VRNA 3E9QA 3ZLVA 4EECA 2QJRA 1L8LA 5AO9A 5C8XA 1JXMA 3WA7A 5DX1A 3R5SA 4M6WA 2XVZA 1KSFX 3TBHA 3U4MA 2QY6A 2QXYA 2W6QA 5DYYA 4KR9A 2D4HA 1LC0A 4C1NA 1S6YA 3PFWO 4IKPA 4DA7A 3NHKA 3N87A 2QAGA 4D8TA 2FN9A 3ZCSA 1EVKA 1OREA 4PIVA 4AIRA 1I80A 1VYUA 3W5DA 4U7DA 4ZYVA 1IBMB 3RG8A 3LBHA 1JPUA 4G65A 4TSRA 4DMCA 1AHHA 2JJ2D 3TLAA 3NORA 2YCBA 2OQRA 2B37A 1SOVA 2IITA 3QX9A 1TCCA 3TF5A 2GN1A 3GP3A 1WG8A 2FGKA 4Q9HA 4QOEA 4D5GA 4MW7A 4YO8A 1I2CA 2PBZA 1PJSA 4QDKA 3D3NA 4RXTA 5EINA 1R88A 2BUAA 4LW8A 2EL7A 4JC8A 2JIZA 1IHXA 5EXTA 2P3QA 3MIIA 1TE2A 2B8WA 5I9IA 3I2HA 3I42A 5CIWA 3USCS 2CW5A 3IIEA 1ZGJA 1V1MA 3MAJA 3ZN2A 5I8PA 2F3SA 1Q0QA 1PZNA 3WICA 2QROA 4JU9A 1V8FA 2I65A 2I8AA 4I14A 1AF4A 2F6RA 4BP9A 4YXWA 2LDXA 3A31A 1OGJA 3TQFA 2Z3ZA 4QELA 5ENDA 2ZSBA 4GYYA 4UCQA 4ZVNA 4B48A 1TC2A 4EPVA 4E08A 4DCMA 2EL9A 2HRZA 2EKBA 4NABA 4GPZA 4Y98A 4AYWA 1C41A 2DBQA 1K0UA 3VPCA 3D6FA 4MS1A 4MO9A 2HCTA 2GFHA 2R8OA 2ZOSA 3N8IA 5FA5A 1YZNA 4QODA 5AUPB 4WKCA 2BGIA 4H15A 3WWPA 1KORA 3HVKA 3LPNA 4IZ6A 4RNCA 4D82A 1NW5A 1HT0A 4ITVA 3X43A 5ALTA 3O8OB 4IL5A 1MLDA 4C2TA 2JGLA 3KJNA 1OXBB 4A03A 3PQ7A 2VA8A 1TF5A 1D7OA 1N2GA 5GTDA 1OYYA 4DLAA 3HA2A 1WB9A 4FP9A 1JR3A 1H8HA 2G88A 3GX1A 1E2UA 3AHJA 3IBGA 1U4OA 1W5TA 2E87A 3NBXX 4MRNA 5AVVA 3AG5A 3GOHA 4R1QA 3TZHA 1W4RA 2YYYA 5IKOA 1EUCB 3A14A 4BOYA 9ATCA 3ADDA 1PJAA 2YHIA 3CRMA 1T36B 4NEQA 3RS9A 1BX1A 1Y8RB 2R11A 3HJBA 3D6JA 3DMGA 3KSZO 4JYPA 5LYYA 3KSDO 4OA8A 3ZTTA 1JT2A 4RYDA 1AKMA 3VC1A 4DA0A 4IIEA 5JNVA 2DRIA 1PFUA 4DNQA 4ME6A 1DS6A 1XU7A 3CLUD 1Z22A 2O6LA 5IDWA 1BE8A 1KMHA 1S02A 2X14A 1GCOA 3PD1A 3D0QA 4EIWA 1BEUB 1NW8A 1FUYB 1T24A 4DQDA 1JDPA 1RBQA 4C2BA 3R7DA 1JAXA 2FEOA 3KSUA 1VKZA 5CJJA 5DE3A 3ZIAD 2XMDA 3VJKA 1EDOA 1PFKA 4WW0A 4L7QA 2NV0A 3O8RA 4ARCA 1FVFA 3F98A 2B69A 3JPYA 3L4BC 4J8PA 2JEZA 5KQRA 4RULA 1FQKA 3RC2A 3OIVA 4OHMA 3E9MA 3L77A 3W1WA 2QLJA 3ADBA 1R0ZA 1OXTA 2C04A 1ZQ9A 4B71A 3T52A 2Z0MA 4KQKA 4IX9A 5KBYA 4LZZA 3DTNA 4EW2A 2YC2C 3NVDA 4RL4A 2BGJA 2HHHB 4LNAA 5BRAA 1IEWA 2YC4C 3OQPA 4MYTA 4JD5A 5I9MA 1YC2A 5L3SB 3EPLA 3AERA 1E1KA 2GNPA 2Z5GA 2QXTA 3ABOB 4JAVC 3EZ9A 3F3KA 4IP0A 4MZDA 2J5RA 2FW6A 3L5KA 2X9VA 3FGOA 4JUIA 3TGPA 1ODFA 4J0KA 3SI7A 1GNLA 3LT2A 3G17A 5HTKA 1Q7TA 2G5CA 5A02A 5DWDA 3ENWA 1GQYA 1R9NA 3R7LA 2Q1SA 2WTAA 1X1RA 4MYSA 2VHYA 5IVIA 3RC7A 3VGJA 1CYEA 1ZHFA 4TUYB 5HR5A 2YOGA 1FW6A 2F17A 1JVBA 4QSHA 1SUFA 3T3GA 1HE3A 2E82A 2GN8A 4OQZA 3TS1A 3IE1A 3AJRA 3ED5A 2ZR8A 4WXYB 4TXLA 4EQ6A 5DWVA 2YHBA 1FU8A 2YUTA 4X93A 1VXOA 2VP9A 2XTZA 4C6SA 1T6ZA 2IVFA 3N0WA 1NXWA 2J0EA 1TQ4A 1XHFA 4IDEA 1A7JA 5DTEA 2VBFA 5TR9A 4BQPA 2J09A 2C9BA 3E5MA 3GZJA 4PLVA 3PUVA 3R5TA 2DUNA 4DHEA 4OHWA 2ZUBA 4E2ZA 2QIPA 4HX2A 4MWOA 5GADl 3ZXSA 1E79A 2AG1A 1VHLA 5EE3A 3IDQA 1JG4A 3MW8A 4A8TA 2GA8A 4CLRA 3R9XA 1XTZA 4YH1A 3TMAA 2NG1A 5I8WA 2C0PA 3DO6A 1WMAA 4JOCA 4QUKA 4Y6PA 5AOCA 1EK6A 1YR9A 4LYEA 1MB9A 5EIFA 1ENOA 3H2HA 3VOSA 3EN0A 4UZEA 4II7A 1QKKA 1I5EA 1NE7A 1ZC3A 3AR8A 1QFXA 3M1LA 3P7MA 3TE7A 3MD0A 1OWOA 3FYUA 3T34A 3RCBA 4NH4A 1RM5A 2AOUB 5ALXA 3AF4A 3DWFA 3OIYA 1KAGA 5GZ3A 1R6TA 4QM7A 3FCAA 1EJ0A 3MK31 4RV5A 1MIHA 1NN5A 2C4NA 1A50B 4UFOA 5CVDA 2ZBDA 4Q1AA 4BTLA 2ZZNA 4HWKA 4XKJA 2P90A 4PS0A 1FB5A 2XYGA 1QRUA 2DLDA 4LKRA 3ZWBA 3HJHA 4CDRA 3KB2A 4ALNA 3WY9A 4J9VA 5JEEA 1CRPA 2OGSA 2PFGA 1L5NA 4HNAA 1UBMS 4F2HA 2Q41A 3QKRA 1QZTA 2FSVA 1JJAA 3PXEA 1TFUA 2WDZA 3VZSA 4K81B 2J41A 1WPXA 2Z3VA 5AJTA 2JLZA 2O2SA 1JHXA 1JJVA 2XBUA 4MVJE 3VR3D 5HZKA 4ARZB 2XZTA 3I58A 4PAGA 5I7HA 5EKUA 4LJSA 3T1YB 2OEPA 3F3MA 1CE8A 3FCYA 1JDTA 1G8PA 3PWTA 2AZXA 1DQSA 5FOXA 2QGNA 1KVSA 3AYXB 3HCOA 4R1NA 2BFEA 2F3PA 5JCJA 1AHPA 3M4JA 2ATVA 1N1DA 2H0QA 4MKHA 1WBJB 3BQNB 3MT9A 1DINA 1MAAA 4JENA 4ZRMA 5LM3A 3GDHA 4UNSA 3WKBA 1XPRA 3CF4G 1CXZA 3TNJA 2J7PD 5JNTA 4Z1MA 1J4AA 4FFMA 4L4SA 5GQSA 3W77A 4BATA 1PZXA 2JLRA 3FMGA 4L8GA 3KTAA 1VLZA 4Y2JA 3AY0A 3RIGA 1AGRA 4BKUA 4W7IA 1FFCA 2H9IA 5JUWA 4Q05A 1UMDA 3KR1A 2G6BA 3WP1B 4GX1A 2QW1A 3MELA 4GOMD 4OQLA 2JCXA 2PFKA 3AC0A 4OQMA 1XCJA 5FQOA 3VDNB 3TJRA 3MJVA 3LFTA 1DAGA 2AG0A 4FMCB 4H6XA 1U9ZA 3PPIA 1E8MA 4NE9A 4OHCA 2EZ9A 4PPGA 4RCYA 1C0KA 2BGMA 2CY0A 3KD3A 4W82A 4ZU1X 4YJGB 1X38A 3WGOA 4DDTA 4V1CA 4DV0B 4EHFA 3FGPA 3UJ9A 1XWWA 5EMJA 5K45A 4M8NE 1HQCA 5BN4B 2ZTVA 4BFYA 5FI1B 2X5OA 1JLLA 3ZXYA 3TI9A 3WL5A 4XWTA 3MAGA 2C5EA 2QUBA 2G4LA 3TG8A 2GDJA 1E6WA 3ESQA 2BP7A 3KEMA 4ZEVA 2PUAA 5MDHA 1FRFS 4RM3A 4KG7A 4DDKA 1Y5NA 2OORC 1WUJS 2CVFA 3ZHYA 5JY1A 3EQ7A 4WBSA 3KKMA 1NULA 3L46A 1P0QA 2YR0A 1RSZA 1ZLXA 5DV9A 1F5NA 2RMKA 2Y99A 4IKEA 4DM4A 1FFXB 2F8MA 3OIUA 2JHGA 4GLFA 4Q3EA 5AQ1A 3IMFA 5CH3A 4OVKA 5I7RA 3KZ1E 1QP8A 2BI7A 3ER6A 3IIMA 5C7IO 3UKJA 4B2YA 4PHHA 1MO2A 1RRFA 2NXNA 3PVCA 3IEUA 4CGZA 3DEFA 3U7JA 4KXVA 3H2IA 3CNQS 5J2UB 1U4SA 5TPZA 2Q4TA 1YZVA 4ZO9A 3PDIB 3KKEA 1DFGA 3DMPA 2XSZD 4HX9A 4L8LA 4YAKA 1T4GA 4PX3A 3C98A 1L5GB 4FKBA 2QM3A 4LN1A 3WBFA 4KLCA 4MQFA 2BMAA 3ZWAA 4PPYA 3T9BA 4ZKDA 1VC2A 1YT5A 3GJZA 3NIDB 5IW8A 4ZI2A 1VPEA 2IP1A 5HBRA 4PG5A 2EVWX 1QS0B 1FF9A 4UVGA 4FYYA 2ZTUA 3FTQA 2H2GA 4UHKA 4ARSA 1T3TA 1SQ0A 1DIBA 3BMCB 4AECA 1Z33A 2D5CA 4C89A 4E1BA 5C1DA 1U5CA 5JE8A 3QSYA 1VLLA 1E61A 1UFRA 2FEKA 3U4IA 1II0A 1YNSA 4NNOA 4XX0B 3T1TA 4ZT7A 2X0DA 5K9ZA 4N7MA 4KNVA 4W7SA 1M9NA 1GAQA 1FBNA 2IJGX 2WHQA 3FWKA 1EIZA 1ZX1A 2HIAA 2V8BA 4HAYA 3W5SA 3D02A 1UAAA 1Q16A 3HI4A 5EMHA 1EQUA 4CIAA 1HO3A 4QGFA 2UAGA 5CHYA 1GL7A 3U37A 1Y89A 2D74A 3HI6A 1ZIYA 3HZHA 2ETXA 3PNBA 4HAUA 4MUEA 1IZ9A 3FPAA 2WTUA 2OCIA 4WFKA 1UEJA 5EXEA 1E1RA 3PC6A 4Q7JB 2O0LA 1FMJA 3CZMA 4V39A 3N28A 4PSCA 4LVOA 1NL3A 4CMAA 2ZQ5A 3QKTA 2EQAA 3D81A 4JR2A 4ZOQI 2NSYA 1XLWA 3JZMA 3DHWC 4Q5IA 2LCQA 3UCFA 4PRKA 2VK1A 4H08A 2VJDA 2JFVA 2OSVA 2X6RA 3CUWA 4ZAVA 1ZGCA 3NHUA 5BN5B 2OC4A 3AG6A 1AN9A 3EGXB 3HBFA 1N5RA 5EERA 4AXXA 1PE0A 3IAS1 3S2YA 4A1OA 1EFHA 4IMPA 4OQ4A 1P74A 4FFNA 2E89A 2ZUTA 5BT9A 2C7OA 3OT4A 2F9MA 3R0XA 2J0SA 4LHEA 5DI3A 3WGKA 1SBZA 2ZR7A 4UU8A 1R8XA 3RYFA 4D25A 4X8LA 2H51A 4KIWA 4QIHA 2ZIGA 1Y34E 2M6RA 3V32A 4J1QA 5GIPE 4ZALA 1PF7E 3P9PA 1F7UA 3UXEA 4AJ9A 1W29A 1WP9A 4V0ME 1VE7A 1TYCA 4LK3A 2IEAA 1WV0A 3W5JA 2IYEA 3EDOA 3PF9A 3ZWNA 1QU3A 1G5PA 3IDOA 1KMMA 1OFTA 4E11A 4ON9A 1H3EA 1YO6A 1AMUA 1G2IA 1XTIA 2FJPA 3LT1A 1VHJA 5BR8B 2H8KA 2PKYX 4MP8A 1MTZA 1TK2A 4AULA 5J23A 3UMYA 4V02A 4HFNA 5JRJA 4LRUA 4O4LA 4XUDA 2IZZA 4U7TB 2D13A 4GC5A 4C4OA 1DWUA 4C4TA 4TGLA 4DCOA 3AZOA 1DC3A 3MCTA 3O8BA 4MR7B 5AJVB 1BYIA 1XRJA 4JROA 1LDNA 3WB1A 2IH2A 5DYNA 1X7XB 5DH9A 5CNJA 3H4VA 1LK5A 1S4MA 1S1MA 3ZUGA 5GJBA 1N25A 2OP1A 2XYHA 1UXGA 1T6NA 3EFOA 3NT5A 1C9MA 4NY1A 1DFHA 3THWA 4AI6A 3GP5A 3LIPA 1TM7E 2VDMB 2C59A 3HU1A 3E48A 3NGXA 4J76A 2QV7A 3ZQKA 4MUHA 1LRJA 4U2CA 4WNIA 3UGTA 3VR2A 5FUMA 4U3JA 1U90A 5KX5F 3B5IA 3AP1A 4KIFA 4QBTA 4Y67A 4ZQIA 4BNDA 5BSEA 3EYWA 4KBFA 5JARA 4EB0A 2FF5A 2WNSA 1KI9A 3TD6A 1MDBA 4OHXA 5KMGB 1JILA 3TLMA 1PR0A 3TUZC 3KFLA 4HATA 4BFWA 3DMFA 1PJ2A 2DU8A 2A8YA 4LYDA 3WBJA 1A7UA 1CR0A 4Q1FA 3DR3A 4RPKA 4RMGA 4WGFA 5BWCA 2XGGA 2Z8YM 3IT3A 2WJ3A 3B82A 2OCGA 4G4JA 1N6KA 4MKIA 2AC4A 1IOVA 4NJEA 1IUOA 4HQLA 5L53A 3C0KA 5DN6D 1S3SA 2AF4C 3NEAA 5JAUA 4MDEA 4HGOA 3QU9A 4L02A 3MCWA 5EJFA 1N8TA 1K27A 1SU7A 4CM8B 2VPPA 4I1YA 1YS1X 4XASA 5ALJA 3AL3A 5E3IA 3TKYA 2Q7DA 3LPMA 4B4OA 5B5SA 1QMPA 2HU7A 4GLLA 5JDCC 2OM2A 1H5QA 2PT9A 4ER3A 1QAOA 3HA7A 3TW8A 3ZR4B 3WMXA 2XQIA 3AO0B 1N2EA 4IIGA 4GR9A 3VNUA 5DM60 2R7KA 2ZRMA 4PGGA 1Z4OA 2BTOA 5H0IA 4FEGA 4ZO4A 2HQSA 4LQLA 2CZQA 3MWEB 1WZCA 2O1XA 3INYA 3DOUA 4JI5B 4HDKA 2Q7XA 2WU4A 4J0CA 3VC3A 3I72A 4DLZA 2YY5A 4GZ5A 5JD6A 4A8HA 1DUSA 4ZCQA 1SBCA 2VDNB 2WKRA 2FZEA 3KV1A 2RDMA 3KPWA 4IDGA 4LYGA 4R05A 2OXTA 2DPGA 3A9TA 4UHFA 4HQKA 4NZYA 1J7JA 4MNTA 1F2TB 4F5EA 3RF6A 2WYIA 1QIKA 1XWIA 2WF6A 3DPIA 3O73A 4HWSA 4ZOEA 5DBHX 2I78A 1QQ5A 1GN9A 2P6UA 3H9UA 4MVJP 4Q48A 4X9XA 2FRVA 1QH1B 3U1VA 5L51A 1HQYE 4E5VA 3HCNA 1SUBA 2R66A 2OFFA 3JAWB 2YJZA 1IXSB 4P53A 3CLTD 5AK0A 3V2HA 3FNRA 4LY0A 4Q01A 3NFRA 3UV7A 1ONPA 1XJQA 3WQBA 1L4KA 3SVLA 3RKUA 1LLDA 3EXG2 4BFZA 3PLAE 4EA6A 4WCFA 2QKYA 5KNCD 4OG2A 1JU3A 4FKMA 4RETA 5LMZA 3GGGA 1AXEA 1ZL0A 4AY5A 1MIOB 3JVEA 1B73A 5A7HA 4D3XA 1NRXA 3UB2A 4RK1A 2Q0QA 4KO4S 4KGZA 1N2OA 2FXIA 3LCVB 4V0LA 1YE8A 3DDZX 1P44A 1ZY2A 2XCOA 2YXDA 4CLEA 5JXIA 2ZB8A 4R16A 3MTBA 3V42A 3M6IA 1P1JA 3GVPA 1R6VA 2J7KA 1RRMA 4PLCA 1FK8A 1M6VA 1E92A 2GZDA 1W2HA 2OO7A 4MVJG 4AQDA 4PQYA 3DC2A 2YXBA 3FY4A 1XQ1A 1DVRA 3NBYC 2P1DA 2W2OA 1O95C 4KRYA 1F3LA 3E6AA 5FO0A 5DNVA 4W9NC 1ZUNA 3OH8A 3HBAA 5T5QA 4OBBA 1CB0A 3NWEA 5LP1A 2EKPA 3A4NA 3IAXA 3MS4A 3PYMA 5EE0A 5JHHB 5CB0A 1OBFO 2DERA 3LMKA 3SBEA 5TRTA 2RG7A 1ORIA 3HDGA 4JWTA 4LZNA 3IQZA 4O4HA 4JL6A 5IUJC 1E4EA 2F1HA 2VHZA 4UVIA 4D41A 4ZCMA 5B7QA 3MHPA 1A0OA 2JLQA 1C2TA 1R12A 1MU0A 2W83A 3E8SA 2Y71A 2VT3A 2PMKA 4J7AA 4M76B 3KVVA 4N48A 5B1EA 3VPHA 2F00A 2HWXA 4G56A 3I9KA 1NJ6A 4NFSA 4D8VA 4B4DA 5JDIA 4RTRA 4DLYA 4JV5B 4X91A 4AKEA 1UK6A 1G3IA 3AYZB 1T10A 3IHLA 1WKVA 4NDZA 5CB8A 2YJGA 4P36A 4X6UA 5AKJA 2NYVA 1R9GA 3AUAA 1JMKC 5BSTA 2XE4A 3CT6A 3GBPA 4RD6A 1HDOA 1ELOA 1MEJA 1SUEA 3L0CA 4AVYA 1TEZA 1YUNA 1G9XA 1E7WA 1TD9A 2OKCA 3NHAA 1CUVA 2PR7A 3GRFA 3N0XA 4PR0A 4PYKA 3WNDA 4CTMA 3M82A 3UMRA 2GD1O 5IVPA 4IHJB 3TRFA 2G07A 2JFZA 4AZVA 5C3MA 4RIEA 1E1CB 1O89A 1IN6A 3OFSA 4OXNA 2BLLA 3DOOA 4XPZA 3VU9A 3ZHRA 4CFYA 4ECEA 1H6CA 2KS6A 3D7NA 3WQSB 3U1BA 4NKRA 1U2ZA 4NPCA 2I4TA 4FGJA 1QWSA 1R3DA 1E2KA 1OZHA 2KPOA 2WJGA 1T8PA 2XWJI 1DAKA 2H08A 3CRW1 5J9FA 5T67A 4LWPA 3GUYA 4MRVA 3VHRA 4EY5A 4A5SA 2AZTA 3M6FA 1PBTA 5F52A 4C5CA 4QUEA 4BFUA 4XW2A 4EA7A 1U3TA 1U3FA 4LDPA 3TRKA 3FR7A 4QPCA 1X8JA 4EVQA 3HCPA 4BX2A 1RMYA 1VCOA 4F12A 3DFMA 2FQQA 3H6HA 2O2HA 5AK3A 2QZ9A 3RGWS 1UWCA 4H4EA 2Z9DA 2CD7A 1Z2AA 3HSSA 2HJWA 1OFUA 4P86A 3F90A 3FH0A 3LGSA 1K3FA 2M6SA 1YR3A 1WY5A 3DH0A 2JJQA 5IARA 4EYQA 4BO1A 1XF9A 3AVYA 5AK6A 3D6AA 2WPNA 1FNNA 3CX3A 1BXGA 2QN8A 1KOGA 1W44A 4NARA 3V8BA 1ZZGA 2GJSA 3H1AA 1ULAA 4PNZA 1ZCJA 1M8JA 4M99A 4DZRA 5EGSA 3SMVA 2VK2A 2Q3FA 1M2VB 2VJLA 3K0AB 3IQXA 2A59A 3LUCA 3MC1A 5THXA 3CCBA 3R8XA 2D1FA 3B1XA 2BBOA 4Z4FA 1PQWA 4UBMA 4W1RA 3P0RA 4I9HA 1Z8DA 1F9AA 4XAQA 4BYMA 5IM4F 1O9BA 2GCOB 3ZH9B 5EC8A 2CFRA 4L72A 3PHLA 2E0IA 4D4HA 3RUDA 4CDNA 3IUSA 1M34A 1Y7TA 3OAAA 1G21E 5FWNA 5KNDH 2H1OA 4JZYA 4M0UA 2O7VA 4XEHA 1V5IA 5A0FA 1DXHA 4OXYA 2VVTA 3CS3A 3BMOA 3DVAA 4Z99A 1Z12A 4REQA 1WPRA 3C8UA 4XJVA 2PGLA 1A4UA 1BGVA 4NCAA 1IBSA 4EPWA 1YZUA 3UOGA 2QOEA 1Z0IA 1TYZA 2N46A 4B32A 4ENUA 1MVNA 1Y1TA 3DXXA 1K1EA 3RNOA 4EHKA 4QJBA 2GLUA 5CB6A 1H2WA 2X8WA 1AQYA 5KJ6A 3G02A 5KNLA 4O4JA 3R24A 2W6NA 4EGCB 2NT4A 2UUOA 3OIDA 2R8BA 2G09A 1CPYA 1XQYA 4US1R 4KR2A 1BXKA 4W9MC 3QFHA 4CKEB 3QVGB 4KJXA 2IYRA 1EWVA 2OBMA 3RS5A 2BMJA 4CF5A 1G41A 3NM5A 5A05A 4EYKA 4RDIA 3KR2A 5EJ7A 2WP0A 3Q9UA 3D7LA 4LEIA 2GILA 3VU8A 1TC1A 3DCNA 3NKVA 4V2UA 4EOGA 1G2PA 1UFVA 3AGPA 2WJ6A 1L5HB 2EWVA 2RAPA 4E07A 2ID4A 4KKVA 5E38A 4DYHA 4E15A 3BWMA 2CVOA 1BOOA 3MB5A 3MJTA 1J21A 1HLFA 2SICE 4LYFA 4MKGA 2IS4A 1OFGA 3LWZA 3GRVA 3I9OA 3N8NA 4D5EA 1GRVA 3N2YA 4I36A 5EY5B 3A04A 1X1DA 1W85B 2W90A 1V8BA 5L3ZA 5J40A 3I0NA 3HXOA 1WF6A 1XJ0A 2P6MA 4OJQA 4XIYA 1Z47A 2JI4A 3L07A 4QXQA 4B4WA 2AFVA 3LQ2A 2HMAA 4I1SA 1V8PA 2WG1A 3DS8A 3K8YA 2AT1A 1Q2XA 4MEAA 3O7MA 3SGLA 3ORSA 3IJ5A 1QM5A 2QPAA 3KNZA 4CLOA 2X1VA 3L3BA 5J1TB 3ZTYA 4YQZA 1MH1A 4AICA 2QQ0A 5HF9A 3TTVA 2F2TA 1WDTA 3FVWA 3I39X 3PRHA 4MI3A 1P3DA 1YS6A 4JVLA 4WL0A 2QWXA 4B3DA 3AIKA 5HX7A 5M04A 3TM5A 3LC7O 4B3XA 5KNBD 1KVTA 3OLCX 5B4VA 1AU9A 2D5IA 3EH1A 3H4TA 1GNQA 3OKAA 3EVTA 1NW7A 3CRVA 4P5DA 1YI0A 1BFKA 1CWUA 4WY2A 1XALA 3GJXC 4M8SA 1UINA 3D5QA 2YQ5A 2CNWD 1OBVA 4YACA 3BMQA 3N2NA 2I1LA 3O26A 2WFMA 1GZ6A 2NX2A 5EWLB 5JSFA 2VQEB 3ZQ4A 5KHOC 3RLIA 3TW4A 5I7EA 1E6LA 4UAGA 4JVSB 3KPJA 3EGVA 1S0UA 1XHLA 2GYYA 3E53A 5EVJA 4G1MB 1P6UA 3P5BA 2R1ZA 4EFKA 3CPJB 1I3KA 4XD7A 4H9GA 4PPFA 3S2UA 1Z6GA 4IJMA 1U9JA 2IYFA 1T35A 2Q0SA 4G8CA 2DQSA 4X1IA 4ZT5A 1DEXA 5J4LA 2OBYA 4KX3A 4OMUA 5EKTA 4KQJA 1QRAA 2Q5OA 4TRNA 1GTSA 3DYVA 3OX2A 1H69A 3AB7A 1ZAYA 4ZIRB 3JYQA 4XSHA 2V7GA 4TLDA 2PO5A 4WK4B 2XUZA 1TAQA 3U4HA 4DBVO 1PG0A 3JYHA 3VNRA 2J08A 4ARUA 5CA0B 1WQ4A 1JJFA 2I62A 1UBJS 5J59A 3TR0A 3HYCA 3QNMA 4GXQA 2XD4A 2C5FA 4NATA 1G9SA 3UHJA 4FW8A 5BV1A 2AZMA 3M1IA 3V7WA 5JZBA 3Q3HA 2R87A 3QYFA 2Y05A 3TWOA 3PPYA 4K6GA 3WTBA 4HTAA 1C0IA 3U9LA 2PQMA 2WMNB 2ODEA 1GUFA 3NOQA 5IT5A 5ITVA 4PIMA 4LRTB 1YQXA 1U7TA 3FOZA 3JRWA 4U4AA 2MSKA 2OE2A 4NULA 2XWPA 1G3UA 3Q5GA 5B3JA 3RS2A 4ZDJA 3B5EA 1Z5UA 5E7MA 4MHTA 1L9XA 2GN0A 1DAOA 4I4TF 4WN9A 3GBSA 3K6JA 3H16A 1ADCA 1UM9A 4TRRA 3M6MD 3U7QA 3CPEA 3IV9A 2W42A 1DDOA 1SHLA 1K63A 3NI2A 3RG2A 2P9FA 1DP4A 4R5HA 4ZZ3A 3W8NA 1DIAA 4N49A 3K4PA 5KHLB 1YQEA 4MIEA 1DE0A 1FSZA 1IM8A 4FGSA 4FUTA 4QX6A 3CO5A 4RQUA 4L16A 3A3OA 3AIIA 2BHNA 4NDNE 1JG6A 2IU6A 3ILSA 2BV3A 1T6YA 4Q9NA 5JMWA 4R8VA 1F6WA 1Z36A 4RAQA 3OTQA 4CQLB 2MT9