3R1IA

Crystal structure of a short-chain type dehydrogenase/reductase from mycobacterium marinum
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
254
structure length
254
Chain Sequence
SVLDLFDLSGKRALITGASTGIGKKVALAYAEAGAQVAVAARHSDALQVVADEIAGVGGKALPIRCDVTQPDQVRGMLDQMTGELGGIDIAVCNAGIVSVQAMLDMPLEEFQRIQDTNVTGVFLTAQAAARAMVDQGLGGTIITTASMSGHIINIPQQVSHYCTSKAAVVHLTKAMAVELAPHQIRVNSVSPGYIRTELVEPLADYHALWEPKIPLGRMGRPEELTGLYLYLASAASSYMTGSDIVIDGGYTCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium marinum
molecule tags Oxidoreductase
molecule keywords Short-chain type dehydrogenase/reductase
total genus 97
structure length 254
sequence length 254
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3r1iA00
1VLLA 2GRAA 4R1NA 1TVEA 4ZHSA 4I08A 1DFIA 1JWBB 1U3VA 2NTNA 2OP1A 3SLKA 1WWKA 4L4SA 3Q2IA 3DBVO 4NG5A 4IZIA 1ZXBA 1B7GO 2I3GA 1DRUA 2GGSA 4CMBA 3WTBA 1ID1A 3ZW9A 5KVCA 5JW6A 1RYEA 3JQGB 1B14A 2Q2WA 1E1MA 2C2XA 3UVEA 5A3VA 2H1SA 1C3VA 3W6ZA 3R0IA 4J1SA 4XKJA 3DZBA 4A7PA 2AE2A 2PY6A 1ADBA 3DAFA 5TS3A 3MJ4A 2Q50A 2VCYA 4PLVA 3WTCA 5B4TA 3RC1A 1LI4A 1PL7A 3HB5X 5DZSA 2GASA 4PCVA 1MP0A 3JD3A 4L9RA 5LC1A 1GTMA 1EUZA 1G6KA 1Y8QB 2NADA 3JD4A 3KYDB 1Y8QA 2NM0A 4U0JA 2EGHA 3TOXA 4ZVVA 3HDQA 4UULA 1IPEA 5AXCA 3DHYA 1BXZA 2X22A 3RCBA 4J9VA 4AJ4A 2VYVA 3AFNA 4IDGA 3F47A 3WSVA 4CMEC 1ZEJA 3B1KA 4FGWA 1PX0A 4R3NA 3U4HA 1ISHA 2PTGA 1FF9A 1GYPA 4EUHA 5T8KA 3U0BA 5A06A 2AEFA 3BXXA 1I30A 4F46A 2ZATA 1GUFA 4JP2A 1I0ZA 3C1TA 1GAEO 4DGSA 2DUWA 4R01A 1C1XA 3DBRB 4P4NA 4BNWA 2BFAA 4M55A 4EJ6A 4AFNA 3O8QB 3ZNOA 5JFOA 4BNMA 4JBGA 3HE3A 3AUTA 5JCJD 1NPTO 1OOEA 3WGHA 2ZB7A 2ZQZA 3FBGA 4J4HA 4BGVA 3TZCA 1NWCA 4IQ8A 3C8MA 1ML3A 1P9LA 3OECA 4LSWA 3PIIA 4RO0A 2CD9A 3ONFA 2IODA 2ILTA 3GNSA 4XDZA 3IUSA 3M1AA 3GUCA 3E5MA 4WECA 1R16A 2ZCVA 4II2A 3QVOA 4IDFA 3JQ8B 3V1YA 5B37A 3ZHZA 2QRKA 3F46A 1HYEA 2VZ0A 1O89A 3OMLA 3VPXA 4FOOA 4DPMA 4YAIA 4I5GA 4QEDA 1EDOA 2YJZA 2X9GA 3GNTA 1LSOA 4PRLA 4PG7A 4YT8A 2DBZA 2PD4A 4H15A 1JTVA 3AFMA 4WASA 1KVSA 1ZSVA 5IXYA 3K8ZA 3I9OA 4OJNA 3GRKA 1T2AA 1YQDA 2JD0A 3O4RA 4MVJD 3ZV4A 3ASUA 4MVJM 1GY8A 4ND1A 2EJWA 4Q3CA 4B3JA 1NQAO 2YHIA 1H94A 4JLWA 1YDEA 4JJIA 3FN4A 4M8SA 5CFZA 1K0UA 1TA4A 1UDBA 4M54A 3AM3A 1XG5A 3E9QA 3GDGA 3JQ7B 1YQGA 2DLDA 3VC7A 3JQ7A 3OIDA 4Z0TA 5AVOA 1GZ3A 1LQUA 3G49A 4UUMA 1MA0A 5EN4A 5KJ1A 2R00C 1DO8A 3KYCB 3KSUA 1ZMTA 1DSSG 1GQYA 2QW8A 2RHRA 2YQ5A 4CQMA 3KV3O 3VVBA 1JLLA 2AQ8A 3OJ0A 5TX7A 1AHIA 5MGBA 2UUOA 4UREA 2BELA 5ADHA 2O3QA 3BYZA 3WQSB 5U9CA 4P8RA 3FCOA 3DZFA 3ADOA 1M6HA 1H6AA 2VTDA 5G2OA 3VKUA 3PWSA 1KETA 3OQ6A 5FYDA 1W8DA 1DEHA 3S2FA 5IF3A 5KVVA 5GY7A 1QR6A 1YXMA 1QYDA 3GFGA 1NTOA 2A4KA 1A71A 2ZYDA 4IINA 2NVBA 3C7DB 4I5DA 4MVJG 2NWQA 3GF4A 3FRJA 3MJEA 4R68A 1BWSA 1SZJG 2HLPA 3H9QA 2ZQYA 3GN2A 1MV8A 1H2BA 4CV2A 5BSGA 1BDMA 2PH3A 3IKTA 1KEWA 3ZI0A 2E6UX 2EP5A 2DPGA 2ZCUA 4PLTA 2XF8A 4XJTA 4LRSB 4XQCA 3V5NA 4CM8B 5A9SB 1SBYA 3E6AA 4BNLA 3H8VA 5HTOA 2HK9A 4I9HA 3FR7A 4I9UA 5F5NA 3H5AA 3R1IA 1ZJZA 3U49A 2H9IA 2YV3A 4G65A 3U3XA 1F8FA 3DOJA 4XYBA 1B15A 1ISGA 3GK3A 4J91A 1QKIA 2JAHA 4K6FA 3LT0A 3FNGA 5JC8A 1FXSA 2W98A 3KLMX 4UEJA 3VDQA 3GEDA 3OA0A 1EVYA 3MJCA 4RVUA 2Z95A 2NVUA 3ADPA 3KBOA 1ARZA 1PR3A 1Z7EA 5JAQA 1GR0A 1O94A 1T4DA 2X9NA 5KWEA 3L4BC 1MFPA 1N1EA 3HADA 1XWFA 4K9DA 4XEHA 2VOEA 2OORA 5HA5A 5C5IA 4XQGA 1XQ6A 1HL3A 1CYDA 4AJHA 3AOEA 3OEYA 3TOZA 4J2OA 1BXGB 3W4IA 4NMHA 4QQRA 4JGBA 3ZZNA 4E13A 4CQMB 1Y8RB 3IDSA 3WOHA 2DC1A 4R1TA 3HDJA 1X1TA 4NHEA 5TQVA 5C7IO 1NQTA 1ZK3A 2ZYAA 1B0AA 2J3JA 3HDHA 4B3HA 4BUCA 1XR3A 5JDCC 1ZKMA 4YBZA 3ONEA 4BNTA 3NYWA 3DZIA 4NBVA 1TEHA 2IXAA 3Q1LA 3RUHA 4D3SA 2YQ4A 4GMFA 4W7HA 3SVTA 3CTMA 4UEOA 3QVTA 3JQGA 1T2EA 1V6AA 1GPDG 5JO0A 4JROA 5L40A 5G4LA 2DFVA 1RM5A 1UP7A 5L7TA 4ALIA 3D64A 2CFCA 4CJXA 3I9NA 3E18A 1CQJA 3GDOA 1IOLA 4UVHA 1KEUA 3B1JA 2WD7A 3H7AA 4J1NA 3WNVA 5A5FA 5B4UA 3IL2A 4QTZA 4IJKA 4KWHA 2GUGA 2AEJA 1LSUA 2WYVA 5A9SA 1GEEA 3FNHA 4Y6RA 3E1KA 3PEFA 2AQKA 3NEPX 2LDXA 4M89A 3LC7O 1PZHA 3I4FA 2P9CA 3GVPA 1WPQA 3WNQA 3P7MA 2EP7A 1HDOA 1E7QA 1U8XX 3F5SA 4IM7A 1EQ2A 4JK3A 4ZD6A 5JMPA 4XIJA 3JD2A 1SB9A 4LVUA 8LDHA 7MDHA 2ZIZA 4XCVA 1V35A 2O50A 4CV1A 1ENZA 4XRRA 4MVJH 1WLYA 4CQLA 3LT4A 5JDCA 1YL6A 4ND2A 3ABIA 4YJDA 1PL8A 1BRMA 4DIBA 2FHSA 3V8BA 5A3JA 1H6BA 1N9GB 1U7HA 2V6BA 2NU6A 5GZ1A 3DOCA 3QY9A 1GPJA 3AW9A 4LVCA 1P3DA 2IZ1A 3H2SA 4XYGA 4CUZA 3UICA 1NFRA 1VC2A 3SJ7A 2Y1EA 2PV7A 1DHTA 2V6FA 3QRWA 3U4IA 4M86A 1PJ4A 4Q3NA 1WW8A 3GGGA 1RYDA 3TWOA 5JY1A 4ILKA 2H63A 2Y0EA 2VHVA 1Q1NA 1ADFA 1R15A 3GPDG 4HP8A 4WLUA 1NR7A 2PH5A 5CDYA 2J5RA 2QHXA 1VM6A 5I9MA 4DMMA 1B8PA 4BNZA 4W6ZA 5BQFA 2EGGA 2GO1A 3BAZA 3PK0A 3I5MA 1KEVA 5CG1A 2DT5A 4GAEA 2QX7A 2I66A 2X6TA 3DZGA 4HX5A 4WCFB 2VRBA 3GQVA 4HXYA 2ZB4A 1Y9AA 3PWZA 4D3DA 2X58A 4XWYA 1A7KA 1F14A 3DHNA 3MWDB 4GMGA 1QORA 2BRUA 3CZMA 4BNKA 1UZLA 1P74A 4XR4A 2NVUB 3UH1A 1QLJA 2G5CA 2NVWA 4Z6KA 2FSSA 2YHIB 3AWDA 5DCWA 1P1FA 4MKRA 2OMEA 3F1KA 3MCVA 3JYQA 4BHTA 3QP9A 3IP1A 3ITDA 1TLTA 4UUPA 2ZJ0A 4E31A 1VPDA 2BKAA 3H4VA 2YUTA 3HWRA 3PJFA 4U6QA 1NPDA 4WNIA 3NGLA 2PGDA 2Q4BA 1H93A 2P5UA 3PQEA 2ZTUA 3C24A 3HHPA 4OHUA 4NJOA 2OXIA 1K3TA 2EG9A 1JVSA 1NHGA 1XELA 4CLDA 4EZBA 3JYNA 4TWRA 3F9IA 4LGVA 4GKVA 2A35A 5L53A 1PGNA 2EERA 2C7GA 4E21A 3KLPX 4XQEA 4C4OA 4FSHA 4OMUA 4J4TA 4NI5A 5KJFA 1NM5A 4GGOA 1DLJA 3R3JA 1FDWA 3WWYA 2HK8A 4EGFA 4ZGWA 1FK8A 3JQFC 5DBIA 4FFOA 4NIMA 3WMWA 2WEKA 4TRJA 5IDQA 1IHXA 1KC3A 3GVIA 5F1PA 3VH3A 4P4GA 3OSUA 3EC7A 4CM8A 4K26A 3L9XA 3WS7A 1T1SA 3LLSA 3PDJA 1HDYA 5I9NA 3PJEA 3VHRA 4NU5A 3QVWA 5TGDA 5JS6A 5K9ZA 4WCFA 4CM7A 4NH4A 3ZU3A 3OA2A 1HSOA 1NXQA 1X0VA 2DBRA 4IBOA 3ZV3A 4CLXA 1WAMA 3BTUA 2JFFA 2CF6A 3OIGA 2VRCD 4IIUA 4XJSA 3RASA 3RUDA 1UDAA 1I2BA 3PTZA 4YEDA 4ONEA 1B8VA 1L7EA 5DOVA 4WLVA 3GMSA 4D43A 1YOVB 3F1LA 3UF0A 3I9JA 1Q7BA 4J1QA 1JU9A 2XPCA 5FI5A 3RI3A 4GQAA 2PZMA 1R0KA 1PJQA 3MJVA 3H9JA 1E3EA 2RIRA 3TPCA 3Q6IA 4XRGA 2WTBA 4AJPA 4WK6A 2GDZA 3QWIA 3K73O 4NK5A 4YQYA 1UXIA 1PJSA 1I3MA 3MOIA 4GX2A 3T4XA 3ZWXA 1OAAA 3NDRA 4IGEA 4FFRA 5EINA 3WGTA 1E7YA 2EKPA 3K92A 3M2PA 1IB6A 1PS0A 3EAGA 1PZGA 5JAMA 1J5PA 1IULA 2HMWA 1HKUA 1HZJA 3I1JA 3WB9A 1Y81A 2D2IA 1I2CA 4E12A 3WGOA 2X86A 4KDFA 3CE6A 2Q1UA 2Y93A 2X0RA 1IPFA 4RPHA 1P0CA 1V0JA 1XGKA 1NP3A 2RH8A 4IDAA 4YJHB 3VKVA 1I33A 3GAFA 5ILGA 2FPGA 2J5KA 1R4NA 2BI7A 4IDEA 4QO8A 3TFOA 1BTOA 1P1KA 4N7RA 1WDLA 1X7GA 2WMDA 4WE3A 4ZQBA 1JDJA 4B7XA 3ZWBA 4WNCA 4EYEA 4HV4A 1M2WA 3FTNA 5A02A 4KZPA 1AXGA 2VWQA 4GI2A 3TL2A 2PNFA 3WYCA 2BI8A 1PZEA 2IEDA 4F45A 4L74A 1Z82A 1LTHR 3ZWOA 4OAQA 4ZU3A 2VT2A 3QHAA 3IIEA 2CUKA 4Q9NA 1E77A 4R51A 1VI2A 4MVJI 1XKQA 4ZRMA 2Y99A 1E92A 5L4LA 4BIIA 4D0SA 1MC4A 4XYEA 4KDEA 4CV0A 4AJ1A 1PGQA 4WPGA 3BHMA 3JV7A 5U4QA 4RVGA 1U3WA 5JAIA 3EK2A 1IHYA 1ZNQO 4E4YA 4D3FA 3BMOA 4FD3A 1PJBA 1R4MB 1ZH8A 3QLJA 3TZ6A 4BKOA 4QT0A 2YFHA 4DPLA 4CMEA 3AUAA 3WGZA 5F21A 1ZK2A 4CMIB 1XQ1A 3L07A 3WGYA 1VJTA 2ET6A 1A5ZA 2I9PA 4H3VA 5JYEA 3O9ZA 3OFSA 2JL1A 4AJEA 2GN8A 4CLEA 1EEHA 2PR2A 4Z9XA 3VTFA 4RPLA 4DC1A 4GLLA 2VWPA 2C5EA 4Q3DA 3WG9A 3DAPA 5GZ6A 3DL2A 1DRWA 1D3AA 1NR1A 1ZJYA 3ZU4A 2JJYA 4D41A 3EGOA 2JD2A 2AEMA 1SCUA 1BW9B 4GX0A 4D44A 1JKJA 1ENOA 1KC1A 2V65A 4PG8A 4RJTA 1E1LA 4AJOA 3BMCB 4EI2A 3FBTA 4DQVA 1U28A 1DFHA 1PWZA 1UJMA 3HNPA 1I32A 1G0NA 3GEGA 4BO1A 4DWVA 3FPCA 3N7UA 4H16A 5ICMA 2X0JA 3FF4A 3ICPA 4CMCA 2PKQP 4J2HA 4Y9DA 3LC2O 1EMDA 3H6KA 4XR9A 2ZTMA 3TDKA 2CZCA 3NT4A 2C5AA 1ENPA 4GSKA 4RL6A 1KBZA 5CDSA 1T24A 1HLPA 4FFPA 2X5KO 1I3LA 3DHEA 4JJFA 4PLYA 3WYBA 2E37A 4JXKA 1DFGA 4YJFA 3E82A 5TT0A 4F6CA 1M67A 6LDHA 4I8XA 1VL6A 1LEHA 3H3FA 1I10A 1Y7TA 1PQPA 3M6IA 1SOWA 4E5YA 2G82A 1JKFA 1PGPA 1X0XA 4CM9D 2Q2QA 2HDHA 2RBEA 3RU7A 3DTTA 2AE1A 3CPSA 5JCJA 4E6PA 2FY8A 3NDIA 5HBRA 3WIEA 1JQBA 3D1LA 1KOLA 4CL3A 2HU2A 5TF4A 4U0KA 5I8WA 3EVNA 2HRZA 1XA0A 4KP7A 2ZJ1A 2F00A 1PZFA 3ZGYA 4I1IA 4A27A 4IPTA 1RM4A 4ALLA 1JKIA 2W2KB 2P4QA 1ZMOA 2B5VA 5G4KA 1X14A 2H6EA 5G4KB 5DP1A 4CMIA 2I76A 2Z1NA 4IY1A 3I23A 3HG7A 3L4BA 1ZCJA 3QIVA 1SPXA 4LISA 3X2FA 1TT7A 2G1UA 3NAQA 1Z74A 2FSVA 2AQIA 4J90A 2YFQA 3AOEC 1QMGA 3QV1A 1JAYA 4BO4A 1OZAA 1NPYA 4NFYA 2NSDA 4KUGA 4IUYA 3PHLA 5BNFA 4YVFA 1DJNA 2WYUA 4CM4A 2WE8A 3NX4A 3DBHA 3O26A 1EE2A 3N58A 1XU9A 1E7MA 4RZIA 1BVUA 1GCOA 3W8DA 3ORFA 1C1DB 1ULUA 2PD6A 3WJ7A 4CR6A 1LRKA 3JQEA 1GADO 5ENDA 3NJ4A 4D79A 5CAEA 3U4CA 3A4VA 1E0DA 3PP8A 4XYMA 3RFTA 3LLVA 3LQFA 4D7AA 3MWEB 2VHWA 4LN1A 4GBJA 3RIHA 1C0KA 2O3TA 3RSHA 4JBHA 4HFJA 3PHGA 4P22A 5AXBA 4UVEA 1PJ2A 1FDVA 2VN8A 3QQPA 4K28A 1F0YA 3FTPA 1GD1O 1MGOA 2IXBA 5KVQA 1GZ6A 3VPHA 3D7LA 1HDZA 1BHSA 4MIEA 5J23A 2HAEA 2PWZA 4LMPA 5T6BA 4D0RA 4Q39A 1A27A 1U2GA 4YTEA 2GN6A 3ZHYA 3H9GA 5IDYA 3JQBA 4OQYA 1O6ZA 4OYRA 3DQPA 3I52A 2YW9A 3TN7A 2C29D 4YYZA 7ADHA 2CDCA 1YBAA 2VTEA 3P2OA 4M1QA 3MTGA 1FMCA 4R9SA 4RF3A 2GZ1A 1KY4A 5COBA 1KERA 1Y1PA 2RH4A 2X1HA 1PU2A 3OHSX 4NJMB 4HUJA 4WCFC 4CV3A 4PZDA 4YAJA 5JO9A 3RBZA 3P2YA 1G1AA 4R4JA 5BNTA 1OI7A 1QRRA 4DLAA 4BKQA 2E48A 3RJ9A 3UN1A 3RFVA 4UUNA 3OBBA 4WUVA 4YJHA 3WLEA 2BFOA 3NJ8A 2VZ8A 2JFHA 4Z9FA 1AXEA 1B3BA 3EY4A 3RUCA 1ADGA 1NYTA 3KO8A 3ZWYA 5T64A 2H5LA 5AYVA 1T2FA 3GDFA 4TVOA 1LBEA 4NFHA 1MFZA 3QWHA 3ITKA 1N92A 4ALMA 1H9BA 3GY0A 3N74A 1R6DA 2VYND 1O0SA 4YJGA 4IDCA 5B4VA 2WSBA 4RVSA 3TSCA 4CMHA 1IZ9A 1C0LA 2UVDA 5L7YA 5I9LA 3FWZA 4JP3A 4CLHA 4WEQA 3EHEA 1R66A 1Z45A 3UXYA 1T2DA 1ZK1A 1HYHA 1S7CA 1U4OA 3BHIA 5EESA 3RUIA 4DBVO 5IZCA 3E5RA 4K1LA 1P1HA 3BA1A 4MIOA 4XGKA 1MC5A 3ICCA 3GHYA 3WGQA 4BV8A 2WDZA 3AUUA 3ONDA 3R6DA 2Q49A 3UW3A 3TFQA 1U8FO 2I5PO 1AGNA 1GUZA 2YV1A 3OICA 2W2KA 3S2IA 4IIVA 5TLSA 5JXWA 3STHA 1NASA 2Q99A 3C7AA 4FFMA 4KTVE 5TNXA 2NU7A 4CLRB 4Z3KA 4GSLA 4P38A 3ZWVA 2FN7A 1MG5A 3RUAA 3W6UA 3ZNNA 3DEYX 4RORA 4G5HA 3PJDA 5DNAA 3F5QA 2IZ0A 4UVDA 4MO2A 1H0KA 3AM5A 1KVTA 3ZWMA 2D3TA 5A5EA 4LSMA 1ONNA 1Q0QA 1YB4A 2O4CA 3NDJA 1A7AA 1BW9A 1YVEI 2VYNA 3IS3A 3WR5A 4AJIA 4BO9A 5C3MA 3K30A 2V7PA 1QP8A 2D5CA 4TKLA 5B12A 3NTQA 3V2GA 4A73A 4OM8A 4EUEA 4FC7A 4WOKA 5EPOA 4BMVA 5F1KA 5FF9A 4G2NA 4E5PA 2DKNA 3AU8A 4BO0A 5G0SA 4E2XA 3A1NA 4HFMA 2I3AA 4ITUA 4WKGA 1EBUA 4I5EA 5BSEA 1SOVA 4E5KA 3PRJA 5COQA 4E33A 4YT5A 4TRNA 4NR0A 2YDYA 3VTZA 1ORRA 5IAAA 3JYOA 4FOSA 2FZWA 2CDBA 1LDNA 4YAEA 2J3IA 1QYXA 3K9QO 5CDUA 2XXJA 1UP6A 3ROKA 3CEAA 5CEJA 1DIHA 2O3UA 2ZK7A 3OJEA 3RC2A 1YKFA 3W1VA 3UAGA 1BG6A 4QXMA 3DBLA 3IJPA 3SEFA 3WGIA 1KVRA 3I4CA 1N2SA 3ZV5A 4RVFA 1JAXA 2ZB3A 4CMJA 3GVHA 2HSDA 3GVXA 1AHHA 4B4WA 2UUPA 1XSEA 4L8VA 1OC4A 2G76A 3WXBA 1VKOA 2JD1A 4R5MA 3V1TC 1K5HA 1U5CA 3HQ4O 4EITA 5KJCA 2Y66A 1O8CA 2HMTA 3MZ0A 4BV9A 4C7JA 5KIAA 3BIOA 5DT9A 3LU1A 3JCZA 3ST7A 4PGFA 4RQUA 5DBFA 3DDNA 2QRLA 2E49A 4MKXA 4OQZA 1YL5A 4Y6SA 3FHLA 2FPIA 2P2SA 1C14A 3PLNA 3VZPA 3NV9A 4WLOA 2HKIA 4W9NA 5F3RA 5I7FA 3GLQA 4DC0A 2YYYA 4M87A 1UAGA 2EIHA 3K31A 4E30A 2DBVO 4FW8A 4NQZA 1HEUA 1IUKA 3DZKA 1JWAB 1F8GA 3JD1A 4YR9A 3AI3A 3KUXA 1YJQA 3OETA 4BKRA 2AQHA 3ENNA 5G0TA 1LC3A 2FPPA 3RC7A 4LW8A 3VZQA 3AJRA 1Z73A 5HS6A 2VHZA 5ITWA 3NTOA 2C59A 4LCEA 2OUIA 4YPOA 3A14A 4BO7A 5A04A 5A4DA 2BMAA 3S55A 2DTXA 3GG9A 4XA8A 3KVOA 1KYQA 4PLPA 1XIVA 3H9UA 3WDSA 1ENYA 3ETDA 3ZH2A 5FFFA 1EDZA 4FGSA 4PVCA 3H65A 1UUFA 3PZRA 5TRTA 1QXSA 3FI9A 1HRDA 2GLXA 2Y0CA 1ZFNA 4PLFA 4PRKA 1U3TA 1CETA 2UV8A 3NT2A 1DLIA 1DIAA 1IE3A 3DONA 5I8ZA 3ANMA 4YRAA 4PFJA 4XQ9A 4NBRA 4ZQEA 1PJ3A 3QWAA 1PQUA 4YXFA 4OIMA 4BO6A 2HUNA 4J1TA 1RPNA 4L0QA 1YWGO 1B3RA 4B3IA 4PVDA 2IDZA 4GH5A 3QJ5A 1ULSA 1NQOA 2EF1A 4FFLA 4XB2A 4INAA 2D4AA 1E1NA 4JCOA 2E82A 3UCXA 4AJKA 4GLOA 4GGPA 2JCVA 3BTSA 3GHHA 5GMOA 1PJCA 3AOGA 1LSJA 4RCVA 4UEKA 2AA3A 1EVIA 4FC6A 2X0NA 2CSUA 3V1UA 1U2DA 3QWBA 3WMXA 2VUTA 1UP4A 3VVCA 3INGA 1HE4A 2WM3A 2C82A 2FR0A 3GOHA 5A03A 3OEWA 3VH2A 1X7DA 1IL0A 3L6DA 2C07A 4R1UA 1DHRA 3B70A 1NFFA 5T5QA 1NQ5A 2IEBA 4HWKA 4ID9A 5FWNA 4BB6A 1LU9A 4O5OA 4YT2A 5LCXA 1DOHA 4DXHA 3UKOA 3QW2A 3I9LA 4U5QA 3U62A 4BNUA 1H2HA 2JCYA 3JQBC 3E48A 4B4UA 2Y1GA 5AXDA 1YL7A 3T4EA 4A03A 2CF5A 3CKYA 1E6WA 3F4LA 1PQWA 1CIVA 5JYDA 4XYLA 1CF2O 4YA6A 2CVOA 3TNLA 4ZQFA 2QZ9A 3CIFA 1E5LA 1GYRA 5ER9A 2YY7A 1WZEA 3JQAA 3WBFA 3C1OA 4CR7A 3GNQA 3JQAB 1A9ZA 1D1SA 4J7CA 3UHAA 1NNUA 3U4DA 5ICSA 4OOEA 2AMFA 4NDNE 3Q0EA 1TI7A 3TL3A 2WYWA 2Y67A 1EQUA 2OL4A 5EJ2A 5TJ9A 1C1XB 3DBRA 3GEMA 4MP8A 3KRTA 3G1TA 3BTVA 4BL5A 1K6XA 2QIOA 2SCUA 3O8QA 4BO3A 2NACA 2OHXA 4Y67A 4Y8VA 4G81A 4BNYA 3CZRA 2Y0DA 2Y1CA 2BFPA 2ZTLA 3PQFA 5CEFA 4RV9A 4DA9A 5I7VA 2EWMA 3BTOA 2QQ5A 3JQFA 3OIFA 1N5DA 1U3UA 2NU8A 3KSDO 1P0FA 1DC4A 5K0ZA 2GD1O 3JQ8A 1HYGA 1WP4A 3JD0A 3NT5A 3P5SA 3PPIA 4OXNA 1T4BA 4DLLA 2DM6A 3DZHA 3WICA 3Q9NA 2UDPA 1ZIDA 3CXRA 5AQ1A 4CM3A 1RKXA 5G0VA 2O7SA 4D42A 3DAGA 2ZTVA 2B0JA 1EK5A 4BKUA 1V8BA 3PYMA 2D59A 2TMDA 4ZA2A 3P19A 4PLHA 4B7UA 2P68A 1G0OA 2O4UX 4OXYA 2GZ3A 1YGYA 4PG4A 1HDCA 2GCGA 2CDAA 2CNBA 4TSKA 4BNXA 3CUKA 2W4QA 3EZLA 3C3XA 3AU9A 4AVYA 1YO6A 4BNFA 4A5OA 4QO7A 4OSPA 4W82A 3PJGA 2ZYGA 5I7EA 4ND4A 3PXXA 3IC5A 2GPTA 5KJ6A 1LJ8A 3LZ6A 4DQXA 2O2SA 4NBWA 2J3KA 1SAYA 3CH6A 3OQ1A 3DOOA 3M2TA 1E7WA 2FMUA 3FPLA 2DQ4A 3Q2KA 2GZ2A 3QWFA 3PDUA 3LVFO 4UVGA 4L73A 1VJ0A 2GYYA 3GH3A 3D3EA 2NTVA 2HMVA 4GPD1 4GWGA 4RZHA 3GUYA 4QFDA 2VYVD 3ZDFA 1JVBA 1Q0LA 2FWMX 2PD3A 2RAFA 5AOVA 5MDHA 2B4QA 2P4HX 4L75A 1YRLA 1PIWA 2YZ7A 3ZU2A 2I6TA 4TVBA 1DXYA 4F6LA 1UZMA 2DTDA 3RC9A 4DMLA 1BXKA 1Y5MA 4YWJA 4BMNA 1LC0A 2O2YA 1Y6JA 1UXJA 2FP4A 3QE3A 1YH3A 1CERA 4AJJA 1HWYA 3INRA 2J8ZA 2WJPA 3D3WA 2V6MA 3RUEA 2PA3A 3B6ZA 3TZHA 4GKBA 1O9BA 3PIDA 4E0BA 2B69A 2VWHA 2W2LA 5KVSA 3E9MA 2WD8A 5L4NA 2PZJA 4BVAA 5L51A 3I6QA 3I6IA 4AL4A 1GU7A 4O59O 5JSFA 1E7SA 4BQRA 2DFDA 4E5MA 5EMHA 4JX8A 1PTJA 1A9YA 3MJSA 3JQ9C 1P1IA 4BMSA 1AN9A 3LF2A 4FJ2A 1KS9A 1PWXA 3OQBA 3UFXA 2B4TO 2PK3A 3HFGA 4W7IA 4DIOA 1IZ0A 3JQ9A 4OL9A 1BGVA 4B79A 2HMUA 6ADHA 2O3SA 5CDTA 2O23A 4BNGA 2D1YA 2WE7A 1UH5A 4LRTB 1HE3A 1D7OA 1YJ8A 1J4AA 2PKRA 1H6CA 1DIBA 4KUEA 2V6GA 4PG5A 4Q3EA 1I8TA 4YAGA 1XLTA 5LDGA 4N54A 2VZ9A 3LC1O 3VH1A 3BZUA 5C37A 1PS9A 1YBMA 2Q46A 3AK4A 2EW8A 4D45A 3L9WA 5EERA 3PGXA 3H3JA 3ZWPA 1K89A 3FD8A 3PVZA 1EUCA 1QV6A 3GGOA 3RBXA 4I5FA 4RF5A 2WD7B 1BDBA 3EVTA 3HN2A 5THKA 4W99A 1MX3A 3C7CB 3GMDA 4N5NA 3QVXA 3VPGA 3L6OO 4E32A 1YB1A 2PLAA 4I9NA 2Y1FA 1NVGA 4YACA 3VAZA 1LLDA 4RLSA 4RPKA 1Y9EA 2G0TA 3PGJA 4IJWA 4B4VA 4R1SA 2VRCA 2CVQA 3D5QA 4IQ0A 4A26A 2PFGA 4MPDA 2Q1SA 4EW6A 2QRJA 2FR1A 1KIFA 1ZVMA 2W2LD 5IZCC 1ZBQA 4RPJA 4CUJA 3GT0A 4J7XA 1LX6A 1LUAA 2NNLD 2D5AA 1GZ4A 3E03A 2P5YA 5JE8A 4CQMD 1DIRA 3JYPA 5DULA 2EEZA 5IN5A 4BO8A 1OMOA 2IZZA 4CUKA 1ZUD1 5JMWA 4J43A 1PGJA 2JAPA 4DIFA 4LCJA 4J3FA 1LNQA 3B20A 2R00A 3KOUA 1LXCA 4J0FA 4Y6PA 1HLDA 3WFIA 2FRDA 3QVSA 4OGWA 3BHJA 1PEDA 4MIYA 2BFMA 1BXGA 5JAZA 3KYBA 5FI3A 1CQIA 5LDHA 4BB5A 4MVJA 5H82A 3W8EA 1PSDA 3CMMA 3GN1A 1T25A 3GZ4A 4TROA 1N7GA 4RDHA 3OH8A 3ULKA 1B16A 5K6AA 1E3JA 2NTJA 4QSMA 1X15A 5KKAA 1M76A 3WYEA 3HN7A 2C20A 4WCDA 5CEEA 2IRWA 3D5TA 2Q1TA 1QLHA 3ASVA 2GN4A 1NVMB 2XXBA 3FSRA 1DC3A 1K2WA 1I2ZA 2DVMA 3PFWO 1ISJA 2UAGA 2VHYA 3MTJA 4GVLA 2Q1WA 1DIGA 2G17A 1T26A 4RDIA 4II3A 4MDHA 4AICA 4JQCA 4W4TA 4KQXA 2EJVA 3A28A 2IYPA 2CMDA 4KUHA 3GAZA 3BMNB 4WEOA 5DCYA 3ROQA 4YCAA 1JW9B 1CRWG 1QG6A 2OBYA 3OJLA 4N5LA 2A92A 3G0OA 4YJFB 2DUUA 3RJ5A 5DP2A 4R16A 5U1PA 3VZRA 3WQRA 4NNJA 1ZK0A 3WWZA 4TZTA 4YQZA 1LDGA 4QX6A 1RJWA 2X23A 1P31A 4MINA 4XIYA 2GN9A 3PQDA 3L4SO 3AM4A 3GFBA 3VPFA 1UZNA 2VHXA 1NX6A 5G0UA 2OOSA 2ZKLA 2EKQA 3K2BA 1P33A 2QYTA 1SEVA 1Q7CA 4GVXA 1UXHA 4FQ8A 3ZNQA 1QYWA 1DC6A 4BNJA 1ISIA 2VUUA 1R4MA 5H83A 4CL8A 5IN4A 4FR5A 1IY8A 5HS4A 4TMFA 4FN4A 1SC6A 4WLNA 3SLGA 4CPDA 1N9GA 1I3KA 1FDUA 1WMBA 3T7CA 3IUPA 1OC2A 1J49A 4IMPA 4RF4A 2HK7A 4J16A 5CPFA 4BGUA 5L7WA 1R0SA 3ZW8A 1H6DA 3ENKA 3FNFA 3VPSA 4JNKA 1VSVA 3PLRA 1HT0A 3G79A 1B2LA 1WNTA 2VOJA 3EUWA 1HDRA 4IDDA 1UR5A 3OF2A 1NAHA 4GWKA 5I7SA 5L45A 2W90A 2BF7A 5IDWA 1NBOA 4FS3A 4EBFA 3PHIA 5BR7A 2OP0A 5T8KC 1YBVA 1ZK4A 3JQDA 4ALNA 4PIVA 8ADHA 4HFNA 1LDMA 4UVIA 1DPGA 4U7WA 4QUKA 3L6EA 3KXDA 4FIZA 2HJSA 1XYGA 1XEAA 4JJGA 3TZQA 3MEQA 1YE3A 3D3WB 2B37A 1ONPA 5JDIC 2R2GA 3EMKA 3S2EA 2X4GA 1UXGA 2JFGA 3U9LA 4QFCA 3C1AA 4S3MA 4CQLB 3VH4A 4DYDA 3VDRA 4EJMA 2WWRA 2Z1MA 3T7EA 1R0LA 1TXGA 4E5NA 3MOGA 4DPKA 1DRVA 1J6UA 2XOXA 4RPGA 2NV6A 3HB4X 2RHCA 4AJ2A 3D4OA 1PL6A 4U8GA 3JYLA 1SO8A 3DZJA 2AG8A 1E5QA 2HRBA 3DMTC 3KEOA 4R9RA 4UAGA 4RQTA 3JQ6A 5FEUA 3WBBA 1FJHA 1P1RA 1FDSA 4DUPA 4MP6A 4WGGA 5G0WA 1GV1A 1A72A 3O03A 5JPIA 5TC4A 3SC6A 5DCUA 2NLOA 4ALKA 3FWNA 4YB8A 3ROPA 3BMCA 3RUFA 3TZKA 1P1JA 1QSGA 1YB5A 3EYWA 1T2CA 5KJEA 2OGUA 2NU9A 3AI2A 4FBGA 3CSDA 1RM3A 3E8XA 1LLQA 2NQTA 1ISFA 1LSSA 3LSYA 4Q3BA 5ES3A 3RKUA 1Q7GA 3WLFA 1JA9A 3PYLA 2YHUA 3O38A 4Q3AA 3G3EA 4N18A 1I3NA 1PGOA 1WDMA 1VL8A 3BMNA 3DFZA 5ER6A 4BGIA 3Q11A 2B5WA 4FJ1A 1A4IA 4OO3A 4NK4A 1QYVA 5BSFA 2X5JO 3SJUA 1MG0A 3R3SA 1W4ZA 1AUPA 2C54A 2HO5A 9LDTA 2PZLA 4L76A 5IFLA 1L7DA 4F3YA 2X9VA 2B36A 1Z7BA 4DRYA 5CDGA 3HDYA 4IMRA 4IXTA 3K5PA 3S2GA 4B8ZA 4CM9A 3ZCXA 3ETGA 4MVJF 5CPBA 5K6AC 3INTA 4HY3A 4OKNA 2RCYA 3NKLA 4W9NC 2BLLA 1NFQA 1SEPA 3EZYA 4AG3A 1DB3A 1EFLA 4NPCA 2EV9A 3RWBA 2B35A 3ZWNA 2VUSA 5KCZA 3U5TA 1EK6A 2QG4A 4NZ9A 1UAYA 4FB5A 3HJAA 4R41A 4FPXA 4WOJA 2JCXA 2VWGA 1RM0A 3OJFA 2POQX 9LDBA 1CWUA 3FNEA 3VOSA 4IDBA 4BKPA 3KZVA 3QA9A 4XX0A 2Z5LA 1OFGA 4CLRA 1QYCA 5H81A 4IXWA 3AY3A 1N8KA 2YV2A 4OSOA 4OXKA 3RU9A 5IZ4A 4J9UE 2GSDA 1NAIA 2D0IA 2TMGA 1HZZA 1E3SA 3WQQA 3MJTA 1QV7A 1YDWA 4NBUA 1E3LA 1I36A 2Q4EA 2XAAA 3D4NA 5JCXA 5IXSA 4DL9A 1I24A 2Y68A 2QYSA 1MB4A 4HFRA 2PGJA 4JBIA 4J0EA 1ZW1A 3H5NA 3ZN2A 1MXHA 4J6FA 1U1IA 1K6IA 3ZWAA 3G1UA 1Q2XA 4R5HA 4GX5A 4TRRA 1EFKA 4X54A 3WJAA 3LT1A 4HNHA 4OKIA 1ADCA 4LK3A 3SX2A 4CMKA 4C7KA 1GEGA 4CMGA 3FR8A 3CINA 3DMTA 3PHJA 1E6EA 3GVCA 1E3IA 4MVJP 5ITVA 4KQWA 3DXFA 3EDMA 3DTYA 4YJGB 1UDCA 2NUAA 3G17A 3UCEA 4K6CA 1EBFA 2CY0A 5DOZA 4BO5A 4OOFA 3DR3A 3VZSA 4DYVA 3I83A 1GL3A 4O1MA 1Z6ZA 1SB8A 4YRDA 3TQHA 1LRLA 4GX1A 4HKTA 5IJZA 4HBGA 3ZV6A 3K6JA 1E1KA 1F12A 2Y1DA 3NTRA 1IYZA 4ZRNA 5EQDA 3C85A 4Z3DA 4ALJA 4PN3A 4N5MA 3RAJA 1O95A 4J4BA 3ZHBA 4E2ZA 5JLAA 1M66A 5KKCA 4ROSA 5GZ3A 1AE1A 1GDHA 4BNIA 2CVZA 1R37A 3W4KA 3H5RA 2PKQO 2PGLA 1M6WA 2OBNA 3OJOA 5T67A 4PLWA 4XGIA 3ZHXA 2EW2A 5TJHA 1LLCA 2DAPA 2J6IA 5F5LA 1ONOA 5C7LO 5JNLA 1K6JA 2O3RA 1R4NB 4BQPA 1HDXA 1VJ1A 3QSGA 3KETA 3PHHA 2BGLA 1H5QA 3TJRA 4IS2A 1D1TA 1ZO8A 4ZQGA 3HFSA 1LDBA 3AUSA 3Q9UA 2QZZA 1NHWA 3PZBA 4EDFA 1ZSNA 1KVUA 2BGMA 1Q0HA 2DPHA 3DBHB 4Y98A 1PJTA 1C0PA 5DN9A 3S8MA 1U4SA 1X1EA 5A9RA 1C1DA 1X13A 3JQAD 1YONA 5THQA 4XDYA 1VSUA 3S1LA 3ZWWA 2FZEA 3ON5A 4D46A 3ROMA 1V3TA 4OH1A 4TQGA 4IZHA 3PFFA 1FDTA 4J7UA 3KEQA 5JDIA 3ANNA 3UOGA 2Y1OA 4S1VA 4UUOA 3ZNPA 3WSWA 4P4LA 2I67A 5AXAA 1EE9A 4EEXA 3BMOB 1I5RA 3RVDA 3PI7A 3TRIA 1YOVA 3W4JA 5L9AA 4RVDA 4TZKA 4PG6A 3H2ZA 1O5IA 1W73A 4MJLA 3GZNA 5CP8A 2R6JA 1PS8A 2FR8A 1W6UA 3DFUA 3M1LA 1LDEA 3WGGA 4XB1A 5JY6A 2X0IA 4O0LA 5L4SA 1DAPA 4KOAA 1HF3A 2HJRA 4BGEA 3DB2A 4BNNA 2PZKA 3I9MA 3IMFA 1W0CA 2AG5A 2YDXA 2OO5A 4HNGA 5BT9A 1DDOA 1U7TA 3LF1A 1HXHA 4JN6B 1HDGO 5BSHA 4L4XA 1L1FA 2B4RO 4ZN6A 1D4FA 4RF2A 5COAA 1M75A 1XDWA 4CM6A 4IJVA 3DWFA 4A0SA 3L0DA 3DMYA 4PZCA 4DQUA 2B83A 1C0IA 1BMDA 2GF2A 4NBTA 1N7HA 4LMRA 1SMKA 5HRUA 3TF5A 5EQFA 3SC4A 1Y5RA 4R54A 5EIOA 4WJZA 1HE2A 4XD2A 4ZQHA 4ZJUA 1S6YA 3EW7A 2IE0A 3H9EO 3NUGA 2HCTA 4KMSA 3KTDA 3AY7A 3E9NA 2Q3EA 1CJCA 2AHRA 5JBIA 5TSDA 1EZ4A 3JTMA 3UCFA 1PR9A 4URFA 1TT5B 2O3JA 4FCCA 3AY6A 5EL0A 5ENVA 4PLZA 4H7PA 3GPIA 4KTTE 3GG2A 1XHLA 4NU6A 3GGPA 1XU7A 3X2EA 3IAHA 5CHEA 3ETEA 4AJNA 4E2YA 2Y05A 3F6YA 4O63O 1KVQA 1LLUA 3KHUA 4Z9YA 1BVRA 2P91A 3V2HA 3GRPA 1EUDA 3OM9A 1DJQA 2O48X 3DC2A 3DO5A 4BO2A 1P77A 3GZNB 4EJ0A 5IDXA 2I65A 2NQ8A 3RROA 2X5OA 4Z0HO 4YDRA 5DDIP 1LA2A 5KTKA 2EKLA 5KOIA 2FOIA 1GCUA 1HSZA 2Q45A 2EHDA 3LYLA 3KM0A 1E7RA 5F1OA 3U09A 2W8ZA 4R69A 4Z0PA 1YS4A 4GL4A 3ZWCA 2P9GA 4TKMA 5CG2A 4M49A 3RFXA 1OBFO 5DF1A 3K96A 2JHGA 1CDOA 2C2YA 3RKRA 1CEQA 4CM4B 1ZEMA 5L3ZA 5DBGA 1GUYA 1WXDA 2X8LA 4RLHA 1I01A 2AW5A 2X7HA 3PYXA 2BHLA 1F17A 3I3OA 3I9KA 2OFPA 1NWHA 4BS9A 3LK7A 3HZZA 3NGXA 3UGKA 4PLGA 1XCBA 3BMQB 1H9AA 1NVTA 4O6VA 3D0OA 4YT4A 2BGKA 3BMQA 4ND3A 2VT3A 1VKNA 1KY5A 3F3SA 3Q3CA 4CM1A 3WIDA 3GR6A 2DTEA 1TB4A 4XZ3A 4BOYA 4R3WA 1HE5A 2GNAA 2F1KA 4DTIA 3OP4A 1YQXA 4EEZA 1TT5A 4A2CA 4DREA 1B8UA 5C7OO 4CR8A 3D4PA 4JIGA 4IQGA 3UUWA 1U9JA 1HTBA 3DBLB 3IOYA 5BNIA 1MXFA 3KYDA 3K2EA 4HADA 3HUDA 4BNHA 4IJUA 4TRMA 1EVZA 1R12A 1ISMA 4ZICA 5TT1A 2IYOA 1VL0A 2J5QA 1D8AA 4FDAA 2HMSA 2C0CA 3GC6A 4RVHA 1V3VA 2BH9A 4BNVA 2O7QA 3F4BA 4PLCA 2J3HA 1LRJA 4FFNA 4KWIA 1WMAA 4AJLA 4YRBA 3AI1A 2I99A 4RGBA 4CMAA 3SBOA 4DBZA 1T1RA 4DLBA 2GERA 3A06A 3IJRA 4FJ0A 4IGFA 3V2UA 2VQ3A 1WDKA 4E2WA 2P9EA 2GR9A 3LDHA 3ZU5A 1X7HA 4ESOA 1PJLA 3WFJA 4WLFA 5TIIA 2ZB8A 2E4AA 2A94A 1VE9A 2HQ1A 1GFSA 2Q2VA 1MLDA 4CLOB 4CLOA 2UYYA 1SNYA 1MUUA 4MOWA 2JHFA 4B8WA 5IG2A 3NRCA 4NFSA 1A4UA 1UXKA 1DBVO 4MVJE 5A9TA 2D8AA 4DVJA 3RQSA 5A05A 4QECA 3WX0A 4E3ZA 5JC1A 4CM5A 4B7CA 2VNSA 3W8FA 4PZEA 2DBQA 5ILOA 2VNAA 2BD0A 1HETA 3KSZO 1N1GA 4ND5A 2OZPA 1DC5A 5T57A 1ZSYA 3CMCO 3PWKA 4J49A 4U6SA 4EUFA 4WLEA 1GV0A 1P45A 5HWSA 3GA0A 1VRWA 1LDYA 3JQCA 1WZIA 4IS3A 1RWBA 1ZZEA 2JKVA 1KEPA 3L77A 1E6UA 3RD5A 4B4OA 5B1YA 3IQDB 4A10A 1JN0A 3IP3A 5KNLA 3SXPA 1J0XO 1U5AA 1GQQA 3KB6A 1BSVA 4XGNA 4L4RA 3RBVA 3A9WA 1V9LA 1V3UA 2C7VA 1E3WB 2EXXA 3COSA 1E3WA 3B1FA 3LT2A 1P44A 4MP3A 1LQTA 3JSAA 5HM8A 3HSKA 4YAKA 1EVJA 1GQ2A 2LDBA 1B26A 1Z75A 1WVGA 1F06A 3ANLA 2A9FA 2AXQA 1GYQA 3IKVA 3KYCA 2DU8A 4MKZA 1DAOA 1ZXLA 4NJMA 4CODB 5A1TA 1Y8RA 5L95A
chains in the Genus database with same CATH superfamily
3JALA 1EM8B 1JKMA 1T3LA 2GRAA 1TVEA 3Q0TA 5EJEA 1XFDA 1L7MA 2OP1A 2V97A 3KU1A 2Q29A 4UM7A 1QG2A 4L4SA 4NG5A 5BYBA 1D9XA 1GRNA 1NBMD 5IC4A 3BOSA 1B7GO 3VHXB 4ZJYA 3LCRA 2GGSA 4CMBA 1EA5A 2B8JA 1XTJA 4IG4A 4OP3A 4FDVA 3V32A 4MS1B 2ZI9A 1Z5GA 5TPWB 4MR9B 3UVEA 4B2LA 4F4CA 2COEA 3IEMA 5KYNA 1CUZA 1E69A 1WXHA 2VDWB 3EASA 1BGWA 1RR6A 3O0DA 5ALSA 2OAEA 4XKJA 1WV1A 3LTNC 3DAFA 4EPVA 221PA 1RQRA 3MJ4A 4Q7EA 3WTCA 5P21A 3SE7A 2P9HA 3KE8A 1VJDA 2GASA 4DN6A 13PKA 3GEPA 1XOIA 1Z26A 3QI2A 3VM6A 3TLGA 4RHTA 3UMGA 1EZZA 1R64A 1GTMA 3QKUA 2EKBA 3VPCA 4FDTA 1XZLA 1ZESA 1NMQA 3M81A 1L4NA 1OLOA 2NADA 1XNRB 1Y8QA 2QMEA 2EGHA 3LI2A 4KK3A 1G8JA 3FLMA 4H7DA 4B73A 4M0KA 2C58A 3DV9A 3HACA 2WWYA 1BXZA 1CUEA 2G70A 3D0RA 3R3ZA 2B4AA 2CK3A 2CLLB 2QY6A 4LRXA 3MCTA 4WADA 5ALXA 1CRQA 4UM8B 3WADA 4E51A 3DGEC 1PX0A 4JKOA 1LS1A 2E55A 3E3AA 3E7XA 1G9TA 4HWSA 3L1HA 3KWJA 4ENQA 4Z4QA 2H3HA 2PTGA 3SYMA 5FP0A 4H0FA 3R7SA 1GYPA 1PR2A 3T0IA 3TQOA 4YV0A 3K0SA 3R0XA 5DTRA 1K68A 4XW2A 1TTHA 2AEFA 3BXXA 1I30A 4GP9A 2ZATA 5JD4A 3E27A 6AT1A 4JJ7A 3MCUA 3OTWA 3ZY2A 3C1TA 1MVOA 2G08A 1P1CA 4DGSA 4V0MA 1TADA 3TDMA 1NVFA 3OO0A 6Q21A 1RXVA 2SICE 4E46A 3PFGA 2PMEA 2BFAA 2PMFA 3DWIA 3U3RA 4EJ6A 1H5NA 4GT1A 1PJRA 4FCVA 4QT4A 5JFOA 1NRWA 2EL9A 3LPAA 1PQYA 1TAHA 5FTNA 3VU1A 3DKKA 4DT1A 1JR4A 1OOEA 1Z29A 4F4IA 4M36A 4UBOA 3K35A 3QH4A 1PDWA 2G1PA 3O8RA 3S8YA 3EGWA 3R8XA 3K4PA 4BGVA 4D8UA 4G0VA 2ZRNA 2EZ9A 4NRDA 2B1RA 1KI6A 1FFGA 1GTZA 1ZMRA 1FX1A 5LBTA 1YZLA 4RO0A 1TEZA 2CD9A 2IODA 1M2VA 4GM0A 4IJ6A 4XDZA 5FNVA 3WDKA 2QL6A 1H8EA 4A6PA 3PGVA 4DCNA 4IDFA 1PI3A 1ZGBA 3JQ8B 2PV0A 5B58T 1UMDA 1XT6A 1HFWA 1RYFA 2CLEB 3C45A 4EG3A 3LQ2A 5HRAA 3UMMA 2VZ0A 3KCQA 2FSGA 5E6SA 2WAXA 4FOOA 3Q7IA 4HDKB 4OYYA 3HGMA 4PW0A 2Q8PA 2X9GA 3ZDXB 4C4XA 4CF4A 1W5EA 4YT8A 4PG7A 5CDFE 4N48A 1JTVA 4WASA 4DJDC 1KAQA 1ZA1A 1CJSA 2PWPA 2WSSD 4JX9A 2ZSFA 4NE9A 4OJNA 1XD2A 3T5CA 2C4UA 3F7OA 4IKEA 3RPEA 4FCTA 3BWEA 4XVUA 2JD0A 3O4RA 1XEFA 3DA8A 2P6MA 3ASUA 3ZV4A 3UPTA 2PXHA 4HX2A 3ZWKA 2EJWA 1TUGA 5DGDA 2GBLC 2GN1A 1WZUA 3KVYA 1YDEA 3FN4A 2XB8A 2LTAA 1TA4A 1YR7A 2FOLA 2W00A 1RQ7A 4S1TA 3U3OA 2BW0A 3N76A 3N87A 2ZUUA 2BGNA 4Q9DA 3G0HA 4QBFA 5CB4A 1YQWA 4F86A 1C80A 2XUFA 2DLDA 3JQ7A 1X7YA 5AVOA 1VZ3A 1O87A 5C5CA 1ES9A 1MA0A 3GJ8A 2Q7DA 2VHQA 4HSGA 2R00C 1ETUA 2GCOB 4TKUA 1PX2A 2D13A 2QW8A 5EPEA 1C50A 3KV3O 1EG2A 1JLLA 2XUPA 3OJ0A 3K0BA 2UUOA 4NOKA 1Q3HA 3INNA 3BRWA 3F71A 3SIRA 5ADHA 2GEFA 5DSXA 2I4LA 2JVIA 3FCOA 3GLSA 1M6HA 5A62A 1H6AA 1E6LA 2FGJA 4UCWA 4ZHQF 4MUGA 1ULHA 2N9UA 1H3FA 5DEIA 4YUYA 4OX9B 4Q7JB 5FYDA 4XM1A 4BXOB 3V1KA 3IP6A 4LK2A 4X1IA 1QR6A 1V3QE 1JHYA 3NHSA 4MYSA 4RELA 2A4KA 4Q4DA 3SBDA 2JLZA 2PSDA 2MSNA 4I5DA 2YFYA 4WKBA 1U11A 1WM1A 4MVJG 3GF4A 1V9SA 3MJEA 3WKAA 4RXMA 3HV0A 4RZ2A 2ZQYA 3SM9A 2GPYA 1H2BA 2AT1A 4CV2A 5BSGA 2C7QA 3UT0A 3SXUA 2OFFA 1QFSA 2ZYWX 3DE0X 2MSKA 3OFJA 4ZQCB 3RAFC 3PX7A 2O8EB 2YJTD 5EP2A 2ZCUA 1QE5A 5FB3A 1DCTA 4WZBE 2OO3A 1PP4A 3I01A 4LRSB 4NCXA 4Q7MB 1L5NA 4B81A 4CBVA 4BNLA 5C8XA 5JHHB 4KR2A 4LWQA 4JR2A 5EHXA 4F5YA 1GARA 1VE7A 2J9RA 4I9UA 2FP4B 1JSCA 1XO1A 1MEEA 4K05A 5AOAA 3TSAA 3BGDA 4ES6A 2H9IA 4ZO6A 3GGDA 1ISGA 2JJ8A 1ZNWA 1QU3A 3AERB 3CF2A 3KUDA 2W83A 4RZQA 4YRLA 1U98A 4MW5A 3NHKA 3QY0A 1W35A 4KXUA 3GLVA 5FLEX 1PBTA 4Q93A 3EXFA 4Y6OA 1KMHB 2A33A 2NVUA 3B1YA 2C31A 2O8CB 2NSHA 5JG7A 1SK9A 2XUAA 4HZUA 2JEOA 1TF5A 3H11A 2FDXA 4BBPA 1Z7EA 5JAQA 3FCYA 4LF6B 1OGYA 1F1BA 1GR0A 1UBRS 1QCZA 3F6RA 4XWGA 4DYHA 5IT5A 2IX9A 3KB2A 4QHTA 1MEJA 1XTUA 1FS5A 1XWFA 2BONA 3OJXA 3RVJA 4ZYWA 1T0BA 2OORA 5HA5A 2ISSD 3ZVLA 5A5DA 3DLCA 3KVVA 1XQ6A 2YRFA 1RAHA 2NUTB 3IURA 3WQBA 1GZDA 4TZ6A 2OZVA 1KEKA 1ZS9A 2P65A 1SKMA 1E1DA 2FWBA 4H18A 3OLVA 4QQRA 2ZUDA 3C8HA 1VI6A 1QE3A 1COZA 2PX8A 2J46A 5AI0A 2WWIA 3ZE0B 2YWHA 2IU0A 4HXGA 3IDSA 4BMCA 3HYTA 3WOHA 5KQRA 4CEJA 4N0DA 2LE0A 4TYQA 4YGXB 5TQVA 4PX9A 3RNLA 1NQTA 2ZYAA 1B0AA 1TJ3A 2J3JA 3HDHA 2GAAA 3EPRA 3IBFA 1KMMA 1XR3A 4BNTA 4B5KA 1MTOA 2SECE 4BUCA 3UG7A 4DCUA 2YVKA 2JH8A 1QFJA 4D3SA 4DCTA 5B7PA 4W7HA 4DA8A 4D26A 4IF6A 1KZ9A 2G40A 1Z06A 3PUXA 4V0LA 2PUAA 3U3KA 3CG0A 4G0QA 3TE6A 5BV2P 1YZQA 4LAFA 5AKLA 5I8PA 5JAUA 5FAKA 5TPWA 5CFPA 4ESVA 3KZMA 3AEXA 4YRSA 2YX1A 5G4LA 2FMHA 2HWYA 3EZFA 1EWTA 1MBZA 1UP7A 4IFTA 4IFIA 3WZLA 4ALIA 3DT6A 3VR3A 2C5LA 3I9NA 2JLSA 4G23A 1X1RA 3GDOA 4HEQA 1IOLA 5JWHA 1KEUA 3B1JA 3H7AA 4J1NA 4M60A 2WJVA 1N77A 4ILEA 1GRQA 3O84A 2GUGA 4KWHA 7GPBA 3PNPA 3OUTA 2DRIA 4K81B 2PVPA 4NAUA 3K9FC 4PNEA 3TEMA 1RRCA 1UPUA 4JFAA 2ZJ5A 2H07A 2RDMA 2ZG6A 3PEFA 4PM4A 3EVGA 1L5HB 3QF4B 3I42A 2OQ2A 1ZGAA 3I6MA 3THYB 3EZNA 1BEZA 2C3UA 3Q7SA 4L5IA 4HYYA 3GVPA 1E5DA 4ZVTA 3VR1A 4DUYB 1LPNA 2RGWA 4R2WA 1UEXC 1W49A 2EP7A 3F5SA 4IM7A 3P0JA 1NJFA 4NENA 3JAMA 3A1DA 5JMPA 2IHNA 1I7PA 3SIWA 1Y9JA 5AKGA 1SB9A 2XE6A 1QHSA 3KTFA 1RHMA 1YJBA 4WWHA 2OYRA 3V8PA 4K9NA 2LIVA 1DC8A 2TRSB 1V35A 4QIHA 2AXEA 1ENZA 3ZBTA 4M76B 3SEAA 1FRVA 4RQAA 3ABIA 3NW9A 3VMFA 4N3CA 1PL8A 1YAHA 2R0QC 1E9CA 2LWIA 4KFTA 4QNRA 2VJQA 2YOGA 4BATA 1FTWA 1Z6AA 3ZDDA 2I4OA 1H6BA 4RJ2A 2V6BA 2BT4A 2MYPA 4OB6A 2Z8YA 3G2HA 4CKWA 4V38A 1GPJA 1ADYA 3DNFA 3H2SA 2IZ1A 4LVCA 2R6ZA 4EUKA 4CUZA 4L27A 5AKEA 3RAPR 4DANA 5JHGB 5K0EA 2PV7A 5YASA 3SFZA 3LT5A 2MHCA 1VE1A 1MH1A 3OU2A 4RBNA 1YE5A 2O8NA 2YASA 2ZRFA 4BMZA 2BEWB 3SXUB 3CX3A 3AUYA 3TWOA 1CIJA 5JY1A 4ZMRA 1VE3A 3DHWC 5KTPA 3WK4A 2X0EA 2NX2A 4TLMB 1SCUB 1SUEA 2P11A 3EQ8A 3X1JA 1WX1A 1ADFA 1A50B 3B3JA 4OATA 4UE2A 4FGJA 4WLUA 3STVA 5IKPA 1NR7A 3AY0A 3FUWA 4LXGA 3U40A 2J5RA 1RWQA 1VM6A 2DT8A 2WTEA 4U2FA 4GMHA 1KE1A 4C6SA 2EGGA 2GO1A 3I5MA 3CZQA 5CG1A 4O29A 4DV2B 1K7XB 1K06A 3N5KA 2PG3A 4F5EA 4QQ8A 2VRBA 3GQVA 5DLQC 2VXYA 4EAAA 1UPXA 2L2QA 4GR9A 3NXKA 5MHTA 3CF0A 2J9FA 3GCWA 3LQKA 3IAM1 4XWYA 3M5WA 4PQYA 2YMMA 1A7KA 1F14A 4DNQA 2LR0A 4YWHA 1SY7A 2C0PA 4GMGA 3V6LA 2B4KA 1JA0A 3W2TA 1KHHA 1UZLA 1WUIS 3MUEA 4GRIA 4XR4A 2NVUB 3SVZA 2YXLA 4DR6B 4CCAA 3EPKA 3QVKA 1JGTA 3VVLA 2Z3ZA 4MULA 1MO4A 4RIHA 1JFFB 4F92B 3HBLA 4ZKDA 1RLOA 1HC7A 2OMEA 4QDZA 1Y3DE 2UVQA 3CE9A 3LUCA 3S29A 1VRVA 4LI3X 4NMWA 4BHTA 4ZI7A 3QP9A 3ITDA 2FETA 3KPJA 1Q0RA 3EE6A 4OJMX 5C9ZA 1EFTA 1UIRA 3K6SB 3EQ6A 2E18A 3SQNA 5AVYA 2A0YA 3U81A 2WUDA 1XCLA 3RRJA 2VQ6A 2CBGA 2PGDA 4E70A 2UZ3A 1H93A 4B85A 2PXAA 3KOWA 3C24A 4ZI5A 3DDHA 2EG9A 3NASA 4L2IB 2GA8A 1RJ9B 5CVJA 1QO9A 3WAKA 4EZBA 2HC9A 2WPDD 1P7YA 2QJOA 4TWRA 2NAFA 4C2TA 5KZMB 3GH1A 2YY6A 3F5DA 3B7WA 2A35A 5CVDA 1PGNA 4KXYA 2H4JA 5KYYA 1CB0A 2O2DA 2RHMA 4XQEA 3RVKA 4MS4B 3B5JA 2ZSBA 5CXSA 1R7RA 3OO1A 1KYYA 1W30A 2E21A 1NM5A 4A1OA 4YJ2F 1Y63A 4F8JA 2BFBA 4GGOA 3UM9A 4R0MA 4GLFA 1OWNA 4ZGWA 5TMDA 3QPVA 4JVLA 5DBIA 1G18A 3NM4A 4LHVA 2OHVA 1K97A 3HO8A 4MAMA 2XIJA 4H6XA 5IDQA 2MYTA 4M9RA 1IHXA 1KXJA 3TNDA 4HAVA 5F1PA 3VH3A 4KPGA 4OXIA 4LDAA 1WOYA 4U8HA 4CM8A 3TG2A 5AICA 3ZGZA 1XMOB 2AWOA 4OGGA 1T1SA 3AB3A 2JB9A 1OXMA 1HDYA 3LLSA 4I9GA 3QNUA 4CDNA 3VHRA 1BKDR 3Q85A 2F48A 3QVWA 3K9CA 2QJTA 4NU5A 5TGDA 821PA 2CZGA 3CLSD 4IIXA 1TU3A 1WB6A 2HIMA 4K7JA 4XUDA 3T9EA 2HA0A 2J07A 2PMWB 1X7ZA 1J8YF 2Q27A 2PKXA 3GLFB 1NXQA 2DBRA 2IP4A 3BGVA 3KUCA 1XDUA 3KOXA 1WAMA 4IBOA 2IS4A 4TL6A 1ZAYA 2PMCA 1NW9B 2PN1A 3PUVA 2IUTA 1YS2X 1FNNA 1L8QA 3HDTA 1DQRA 4QASA 4KVFA 4ONEA 4ZDWA 5DOVA 5BQ5A 2PYIA 4WLVA 3GMSA 2W93A 3CLVA 2ZI5A 3RVNA 1YOVB 4D43A 2W8BB 5KQMA 3HL4A 3AR8A 1NI3A 5ADWA 1JU9A 5C53B 1YJAA 1FFXB 2XPCA 3MJHA 4JMPA 1T2VA 4UJ5A 4OQXA 3RI3A 2R1UA 3U3ZA 1Y6QA 3C6KA 2NXJA 3OQMA 1KDPA 1E3EA 2RIRA 2G80A 3DP7A 4TL8A 3T1YB 3GARA 2VAVA 4LQDA 2V59A 4QQKA 3G68A 2FW8A 4AJPA 4KQMA 4KPFC 2GDZA 1NC1A 1PJSA 2QS9A 2XITA 3D6VA 1PTKA 3SSNA 3WISA 4F04A 1EDDA 3LL7A 3QOFA 3DYBA 1XZGA 4FFRA 1CQIB 1O77A 3HVIA 4IGEA 4RFSA 3AQ4A 1E7YA 2EKPA 2HXYA 1DMRA 1IB6A 1QKJA 1J5PA 1IULA 3X1DA 1A7UA 2HPZA 1JQJC 2PX5A 1ZVKA 3WC4A 5HKKA 5KDDA 2QL7A 4RCYA 5JSQA 1K1EA 1AY0A 2Z8ZA 2HCFA 3H16A 5SZHB 3UMFA 2WJ3A 3SK0A 2D2IA 3Q7RA 4GPIB 1GGMA 1Z37A 2JAXA 2JLCA 4FILA 4NFLA 1ST2A 1TK2A 2X0RA 3G9XA 4Y2QA 3TZBA 1P0CA 2NU9B 4I66A 4MYHA 4IDAA 2QRQA 4ZYZA 1HYBA 3GAFA 5ILGA 4EBBA 2IYWA 2H4YA 3FTDA 1FYEA 5HF9A 3RADC 2JLRA 2AEEA 1BTOA 1P1KA 1T9CA 2ZSKA 2F1JA 1C9MA 1ECCA 1X7GA 1KF0A 2WMDA 3EVDA 3F2VA 4LDJA 4ZQBA 1JDJA 4LGMA 3VQTA 4EYEA 1DV2A 1ECGA 4IUBS 2M6LA 1U0HC 5A02A 5AP9A 1N36B 1IBSA 2GEDA 3OBIA 3AHFA 1AXGA 4KSYA 2XUKA 4BMOB 4DSOA 2ODQA 4LTNA 1L5YA 3WKBA 2IEDA 2YWXA 1CW2B 4JLUA 1CUBA 2EFDB 2DR3A 4HDSA 4P4SA 3H5OA 4R2KA 4V24A 4WZBB 2ZJ7A 1AVTA 3P9SA 3UA4A 4EVIA 3QPWA 3QHAA 2D5IA 1DIOB 2DPLA 4DLXA 5EWJB 3DTVD 1GTSA 4IAOA 1BS9A 4ITRC 1MA3A 5L4LA 1E92A 3GJYA 3LUHA 1Z5ZA 4D0SA 3G85A 1YE8A 3L1UA 4AJ1A 1E62A 4REMA 4LY9A 3MWFA 3TLCA 3P9PA 3GJ5A 3EB9A 4M22A 5M34A 3JV7A 1IU9A 4LYJA 1NU6A 4YQEA 2X8JB 3ORHA 2ODNA 3BH7A 4RV5A 4RVGA 1U3WA 5AHKA 5GONB 4ESEA 3JWPA 5CD9A 3NHLA 4H9GA 3TNYA 1U2PA 1ZPDA 4FD3A 2IW3A 1GXSA 1W29A 5LXTB 3QHPA 1L4LA 4QT0A 2ZWMA 3H83A 3ZZ0A 3WGZA 4MLCA 1EB8A 3AYXB 1KJYA 3B6MA 5F21A 4RHCA 4ZZ3A 1S1MA 2CDNA 4H3VA 1ZR4A 5JYEA 1RS0A 2FW0A 2JL1A 2C9YA 2NO9A 3OFSA 4B3BA 4BRZA 2GN8A 1AO0A 3BQMB 3RVRA 2I87A 3VTFA 3I6YA 5FWYB 2JK1A 3BXHA 2V6IA 2I9KA 4MHSA 3RVOA 4RULA 4PANA 3K1JA 1OXVA 4Q3DA 1W581 1HE8B 3DAPA 1MNAA 1D3AA 3N6RA 4JMLA 5CJ2A 1NR1A 3G7NA 4ZT3A 2NTYC 4BRUA 5C8YA 3OX4A 4D41A 4DJTA 2XE4A 4RJLA 3X2SA 2NP7A 3BRSA 1GSHA 1KC1A 2JIZA 3DEIA 2OD9A 4OQQA 3VU9B 4ASUA 4PG8A 1E1LA 1I4LD 1AV6A 2MU1A 4ZREA 2J9ZB 5H3HA 2ZR8A 3FBTA 2IOHA 4AK9A 4DQVA 4EI2A 4PC7A 4MV7A 1PWZA 4BFWA 3V9AA 9ATCA 5DBHX 2DKOA 3GEGA 4N65A 4BO1A 5HM6A 1F7VA 4PO9A 5ICMA 3KQWA 3FF4A 2O8FA 4G1EB 1ZIPA 2PKQP 4J2HA 3LRPA 4HWPA 1NUSA 4NNPA 4Y9DA 5DTEA 3OMWA 1AO3A 4DRZA 4ZDJA 3OQHA 1EMDA 4G5OA 4KV9A 4PY2A 5BWLA 8ABPA 1X7XA 1IUOA 5G53C 4BP8A 3WI7A 4IG9A 3E2IA 4IRMA 4X93A 1DCMA 2WKWA 5EP4A 3O83A 1W5TA 4ZT2A 4QTYA 3IV6A 4KR7A 5AI5A 4FFPA 4S1OA 5JRJA 1I3LA 1KAGA 3F97A 4KH1A 1LGYA 4RENA 1CIPA 1J2JA 1FQOA 2E37A 1DFGA 2V7QA 3E82A 3IFSA 5ICGA 2VLBA 3FDIA 1O1YA 1S8AA 2QYHA 1ZJ4A 3H3FA 4X3CA 1GUBA 3SHVA 1CU1A 1QM5A 4CG1A 1I10A 1Y7TA 1SOWA 3A2NA 1PQ4A 2XMQA 4ZI7B 1QRSA 5CBPB 1U1GA 2WTAA 4XCQA 2HMYB 5LZ2A 3AVYA 2Q2QA 3KKQA 2RBEA 2YZNA 2JIBA 5LN1A 4CL0A 3RU7A 1LI7A 2WU3A 3DTTA 1VOTA 1QUFA 3N2ZB 3CPSA 1KDZA 5JCJA 3T1OA 3ZV7A 4BVGA 5CFLA 2FY8A 1DCFA 3FDXA 3NDIA 3O21A 4O4HA 1XMIA 5GAJA 5JADA 1KOLA 4ERNA 3CEJA 5JZ9A 1O7JA 3GMTA 3QZUA 5D6OA 4CTOA 4RFVA 2HRZA 4KP7A 2ZJ1A 1MOZA 1PZFA 2CYBA 2M1XA 4JLNA 1BH2A 2H5JA 4RL4A 4TWIA 4L8FA 5DLEA 3UTDA 1VSTA 3KDPA 2W2KB 2OPHA 4JI0B 2QL9A 1WW3A 1ZMOA 4KRFA 2XAUA 1FU4A 3D59A 1MAUA 2WMOB 3HYNA 1ESZA 5G4KB 1JYFA 3RGWS 4IY1A 1JHZA 2GWRA 2H92A 1ZCJA 2WVAA 4KE8A 5EQTA 1NUUA 1XRPA 3X2FA 1TT7A 2I7TA 2Q3BA 3QG1A 5LU9A 4Q9HA 1XF1A 1KJIA 1Z39A 2QTRA 1UANA 2Y6UA 4LNHA 3L46A 4J90A 2NT4A 3WAGA 4YXWA 1QMGA 3QV1A 1JAYA 2CC2A 2HREA 4LBYA 1YIOA 1U7DA 3RS9A 4BO4A 3RJTA 2F9LA 4B80A 3ENWA 4OA8A 3SMVA 3ME5A 1NQUA 1MT0A 4MV8A 2GX6A 5BNFA 3B13B 4ZKEA 3QFSA 1QDUA 1DJNA 1Q84A 4K2AA 4CM4A 4OLAA 5DE3A 1EE2A 1YU6A 3GCGA 3KJFA 1OFVA 1PFYA 1BVUA 1GCOA 1YCGA 1V47A 2ID7A 1IM5A 3AZQA 4UXHA 5A7HA 3I58A 3HP1A 3AP2A 3RU2A 3CUSA 3FVTA 4CU5A 3VKWA 4ZEVA 5JQWA 4KBFA 5AW1A 3BL5A 3ISVA 3NJ4A 2V9CA 1UQTA 4HUQB 4HJXA 2BYTA 2VK1A 3A4VA 2NIPA 3CB4A 3BAFA 3OZBA 4PIMA 4ZZIA 1SULA 3D6FA 3RFTA 1I1QB 4OJQA 4REOA 1T8YA 3RIHA 4GBJA 4DNXA 5E2BA 4UQPA 2IU3A 4GMXA 4TV8A 5JNVA 3MILA 2VSYA 4P22A 4HEHA 5DXFA 5AXBA 2C9CA 4JKIA 3ORYA 5FUWA 3WKDA 4JOSA 1FDVA 2ZE8A 3QQPA 3VYTB 4P0QB 2B1GA 2G9UA 1DKRA 1MGOA 2I3DA 2IXBA 4WI1A 5AJTA 4UFPA 1HDZA 1YTLA 1GHTA 1KZGB 2NUAB 2DF8A 3BVPA 3L0PA 4LMPA 2JGDB 4KLNA 4LJAA 2KBEA 5H8WA 3ZHYA 4UU1A 3KE9A 2W37A 2XWQA 4OYRA 3DQPA 3I52A 1DOZA 2YW9A 4P9NA 3PE3A 2JIDA 5KYGA 3IEIA 2DZDA 1NDUA 2VTEA 3CRRA 2HM7A 4M1QA 3HBJA 1EHCA 3LPNA 2GN2A 4MWOA 3V9PA 1BGXT 1AK1A 1SHKA 5TMPA 1BIFA 1RWKA 1EFUA 4P0PB 3CKKA 3W7BA 1I5OA 3JQQA 3P9QA 1Y1PA 5KYXB 1X8XA 1CJUC 3IR5A 3THSA 4HUJA 4HDRA 1S96A 1SIWA 3URMA 4YAJA 1V7QA 3GZTB 4WK4B 1M8GA 5FEMA 1MJGM 1FY2A 3HI6A 5BNTA 1OI7A 1QRRA 5KYVA 4DLAA 1RD4A 5DLDA 3HUUA 2BCJQ 2E48A 4ZVMA 1N8SA 3UN1A 4D81A 2LXNA 1J00A 3KOZA 1CSEE 2GHTA 2VF4X 3RARA 3W5SA 4UQLA 3BXOA 1EWKA 3T7TA 1EX1A 5LUAA 1NYTA 2PAAA 2APJA 1ZUNA 3HA3A 2DXIA 1QZTA 5T64A 5AYVA 2F90A 4TVOA 1M2EA 3ZJ5A 2ZIVB 1H9BA 2RK4A 3GY0A 3N74A 5IUJC 2H4XA 4QDTA 1HRKA 3RRYA 4B7AA 1O0SA 4Y2VA 4IDCA 1T5LA 3A26A 1AF7A 4H77A 4Z1MA 4P31A 4F06A 2ZUWA 4MPJA 3IESA 1EX6A 2UVDA 3KLNA 5L7YA 4XSGA 4O2BF 1RQGA 3C41J 5LBUA 3FJYA 1ZRSA 1C9EA 4CLHA 1TRHA 4WEQA 2M32A 5E7IA 4EZIA 1P18A 1T2DA 2QRPA 1JFTA 2O5CA 1XZIA 2XOKD 4A5SA 3CLSC 1S7CA 1TQDA 5F9MA 4DBVO 1GPAA 3KYJB 3RUIA 3EULA 4YROA 2IPOA 3NO4A 5KYTA 2CW5A 2YNMA 3KUKA 1MC5A 3ICCA 5DISB 3VR5H 5IMBA 4Q24A 1EWYA 3GHYA 4R2JA 2WDZA 3AUUA 2CBZA 4RAOA 4S0XA 1U8FO 5HCIA 2C83A 2QU8A 3GRYA 2OXFA 2YV1A 5LQUA 1JU4A 4C0JA 4MGKR 2QVZX 2VP9A 4ITVA 4EQ6B 4Y7DA 1RMQA 2VT6A 1B4DA 3C7AA 5TNXA 4KTVE 4RD6A 4XX0B 4KXMA 4GBGA 2FUCA 2XWPA 4MR7B 5ICEA 1PYGA 1SQ0A 1XLVA 3GV0A 2GT1A 3OZVA 4B2IA 1ZJJA 4Z3KA 2C3MA 3C15C 4GZ5A 2XOEA 3ZWVA 2N1MA 1POWA 2FN7A 4IRUB 4QODA 5C1PA 3O2QB 2DQZA 1UFVA 4P53A 3VYWA 3R8CA 3OPYA 1UM8A 3HY3A 3FZEA 4RORA 5ETJA 1X7WA 2MSDB 3CNNA 2O1XA 8MHTA 1F2DA 5D6NA 3OVMA 3ZWMA 2BZ0A 5BRAA 4LSMA 5KNBH 3RIGA 1GZUA 1Q0QA 3A2LA 3E3OA 3NDJA 5HK9A 1A7AA 1D6MA 1XRJA 1YVEI 2Z9BA 3OEEA 3N8KA 1M0SA 2OV1A 1Q77A 1KK1A 3IS3A 4UOZA 3AVXA 2H4WA 2JARA 3M5PA 4UE3S 3N07A 5FR2A 4CI0B 3CFYA 5DHQA 4DMGA 5IW8A 3I5UA 1ISPA 3BCHA 3RC3A 3TIFA 4RMIA 1YZHA 1N3IA 1VIVA 1XZJA 2NSJA 3KXPA 4R8RA 4XARA 5EE5B 5EYPB 4FC7A 1R2QA 1MW9X 4E5PA 4X91A 5F1KA 4GI3A 3QX9A 4RY8A 4HGZA 4NJEA 4BO0A 3T6KA 1NLMA 2B30A 2J9YB 3NAGA 5KU7A 3D6NB 3AKZA 5BSEA 3SM3A 3PF9A 1SOVA 5DTIA 3LOUA 3ZD7A 4YT5A 4TRNA 3GLHB 4L16A 3AJDA 1ORRA 3VTZA 4HDNA 4LWPA 1QZUA 3OLXA 3ESRA 5FOSA 3GRFA 1HPLA 2Q3JA 1Y3BE 2B6NA 4D4GA 1LPPA 2FZWA 3H5VA 1XCOA 2AJLI 3Q1KA 4LFCB 2VYQA 3V8RA 3RC8A 1OWMA 2ZK7A 4JC4A 2BC9A 2FX2A 4WJKB 5AHRA 1HEIA 1UIMA 1IN4A 1RI4A 3BERA 2Q7OE 3L6UA 1WUTA 2XV1A 3GJ0A 1BG6A 3IO3A 3OWHA 4QXMA 3W1VA 3C6YA 4QXQA 4OGLA 4F1JA 3O0TA 6REQA 5CT6A 2YIDA 1U2DC 1X8LA 1Y48E 2CFTA 3KR2A 4MQBA 2DLCX 3KQHA 5DGTA 2UZ0A 1RJDA 3ZV5A 3CPHA 1QANA 2ZB3A 4EI9A 4O4HB 3GVHA 4KGDA 5DHSA 4HJRA 4B4WA 1J99A 3CYFA 5EWMB 1AT1A 2QLBA 3V42A 4TSRA 3L7KA 1G17A 4C7BA 5K3FA 5KHLB 4ACAA 4E5SA 2I3BA 3V1TC 3AF5A 1U5CA 2ZXEA 3GJ7A 3HQ4O 4X7BA 4ZOEA 4ZVKA 1NSFA 2Y66A 2ZVQX 1O8CA 3IVXA 3T1HB 1V48A 2F8TA 3DVLA 2PBZA 1CUSA 4LYGA 2IS2A 4BV9A 5KIAA 1IJFA 1G8SA 3LU1A 5BVHA 3N2EA 4TUYB 3NVMB 2VUHB 3L7OA 2GDJA 5LB2A 2FEWB 3FWKA 4GZ3A 1BQEA 4WV3A 3ORQA 1C29B 4W8HA 5LU8A 3DDNA 2XB2A 5K2MA 3QUTA 2E49A 3KUUA 4OQZA 5I7OA 3FHLA 4C4PA 4G8DA 1Z33A 2GJSA 3WLHA 2NN3C 2Y76A 4WLOA 2XA1A 3AR7A 1OLXA 4W9NA 2R2AA 2G67A 5F3RA 5I7FA 3GLQA 4DC0A 4CTMA 3O2NA 1RRMA 2FN9A 1VCOA 4QYMA 3PRHA 1ITZA 2EIHA 3BN3A 4L9WA 1I4OA 1O4WA 1TD1A 1XLUA 3Q41A 4E30A 2P4SA 3FPAA 4I1UA 1NNLA 2WAMA 1F9EA 2OYSA 1F8GA 4TWBA 4Q47A 3ZVNA 3JD1A 2A3RA 4EA6A 3CPEA 4ACBA 1YR1A 1GGHA 4YR9A 2G28A 3U3MA 4DGQA 3AI3A 4Q21A 1YJQA 3VXKA 2WAOA 4YREA 4BDSA 1AV7A 3FDFA 5FFNA 4WVLA 1G98A 2OV2A 5AJVB 1LC3A 5FYQA 5G0TA 1T2NA 5B2FA 4JI7B 3QOYA 4LW8A 3O4FA 1GPUA 3TLAA 3AJRA 5HS6A 2VHZA 1NDHA 3NTOA 4M0FA 2C59A 3TW6A 4GRDA 5L3SB 5JWOA 3AFHA 3IE1A 1H4QA 3VR2D 1A69A 4KL8S 4LIPD 4LRUA 5JSZB 3M9LA 3V1UA 1UT8A 1NJ6A 1S3SA 2BDTA 1QCDA 1TC2A 1U8TA 2DTXA 3C6XA 5ARDA 3TZEA 1XIVA 3PR1A 3H9UA 4P83A 2O2GA 4GIBA 4ZI7F 5LPNA 1FRZA 3OC6A 2CUTA 1E2LA 1JDSA 3A6KA 3RAGA 1EDZA 4FGSA 5JVDF 3HB9A 3I2KA 4OEHA 1G9XA 3PZRA 2JA2A 3GIDA 3OKPA 3P9ZA 1QVZA 4NQRA 1V7ZA 1VG8A 3C6ZA 4IJ5A 5K8LA 2DCMA 1ZFNA 2AF4C 4XPZA 3FH0A 1B0UA 1N0UA 4PRKA 3SYNA 4X20A 3CZ9A 4I99A 2HBZA 1PNVA 2UV8A 4UTXA 4AXXA 4DIUA 5KNCH 1DLIA 3AUKA 1IE3A 1VFNA 3OQVA 4P86A 3NFYA 5I8ZA 2E89A 5HUHA 3IP9A 4D97A 2IBSA 4NEGA 2ZIXB 1SVUA 1CUVA 3AV3A 1BHO1 1KJJA 4YUZA 2MDTA 4HEJA 4PHGA 5B58C 3PD7A 5IJ0B 2HUNA 2WG0A 4ADSG 4XIGS 3V34A 1XDGA 4YJ2A 4PVDA 3W0LB 2H59A 3QJ5A 4DVGA 1FSFA 4DLPA 4X8LA 1UMDB 3QIAA 1CP3A 3QX7A 3VYVA 5LP6A 4INAA 3SHQA 2P6PA 4AJKA 4GLOA 4O02B 3GLRA 6YASA 4HDKA 1G59A 3ELUA 5HWSA 1GGFA 1PZNA 3GHHA 3HJFA 5GMOA 1E8MA 4JLMA 4PZUA 4RCVA 4FC6A 2QXTA 3RS4A 3IIIA 4CKEB 1U2DA 2JH3A 2QB5A 3M49A 2VUTA 3H19A 4FFWA 4Q6WA 3WMXA 3B82A 3VVCA 4O2AF 2QI9C 4Q19A 1QGUA 4M8IA 4BLVA 5A03A 3PCXA 2YR0A 2MR6A 3M6UA 1X7DA 2J33A 4WKCA 1IJKA 3DO6A 4R1UA 4DCMA 4JQYA 3B70A 3NBZC 1SXPA 5T5QA 4K0RA 3AVQA 2IX3A 4BB6A 5AMXA 3ADDA 1LU9A 3LCJA 2WWXA 4F5ZA 5JV5A 1YJ5A 2H7CA 2Z6VA 3R0ZA 2X0KA 3GJRA 3QW2A 5ESWA 4BFVA 4Q3KA 3AIMA 3OZGA 2CXRA 2FPLA 3W04A 3HTXA 4EITA 4MRSA 5GM2A 2WB4A 1W0KD 4YP1A 3NWOA 4UNNA 3T4EA 4KPYA 1M34E 2A5JA 2CF5A 5AW9A 3O1HB 2V5VA 3CKYA 5HPYB 1WXIA 4XFDA 3F4LA 2RARA 1PQWA 2VQEB 2EW1A 5F73A 3ZS9A 4JWKA 4DSZA 4BLWA 1D2NA 3UJ6A 3CIFA 1R8QA 1GYRA 3DOFA 1A5SB 3C1OA 1IEVA 2ZOSA 3J80A 5EZYF 1NMSA 2WVJA 3TD9A 1RW4A 2AMFA 3RVLA 4TMZA 3JTEA 3KVNA 1OZHA 1FVXA 1CD5A 3MWLA 1B2RA 4JLPA 1M5TA 1Z6YA 3FDZB 1AXRA 4AZVA 5HYVA 2AFIE 2OUKA 3HKCA 4I46A 3RJZA 3FAKA 2UYQA 3FWHA 3UATA 1HY3A 4IH4A 3MMNA 4WXMA 3TKAA 4D4JA 5BSVA 3Q10A 4KPEC 1K6XA 3UFXB 4FKMA 3LSTA 2W11A 2OHXA 1W85A 1L6RA 1A9TA 1OLXB 3CCCA 3PE6A 1KZ7B 4G81A 2XR1A 4Y8VA 3N05A 1QRTA 1QIMA 4RA9A 1DJMA 3PQFA 4IFEA 4RV9A 1R1DA 4DA9A 1B74A 2LUOA 2L42A 3UPDA 1AMUA 4GI5A 5I7VA 1YZYA 2EWMA 2WKQA 2J87A 3CLRD 3FMFA 2A58A 3MWKA 3OIFA 1IBLB 5ADUS 5D3MA 1NUQA 1RKQA 2DHRA 2PLRA 1Q74A 1YQQA 4WKPA 3W34A 4MH0R 1Z5UA 1LK7A 3TTSA 4FYMA 2NU8A 4M9ZA 4C6TB 4LBWA 3AUJB 2OYCA 1T9DA 3X0DA 4D4KA 3VPSA 1VGQA 1WP4A 3ZX4A 4DLLA 5CLFA 3ICQB 1BYIA 2DM6A 1H22A 4Q9JA 1MQ8B 3CXRA 3N5CA 1E96A 5LKRA 3OE1A 2RFLA 2RHGB 1RKXA 3WYAA 4LC0A 1XAJA 1MO6A 2XUZA 3S1AA 2HBYA 1IQ0A 3M4JA 2WB2A 3FW1A 1JQAA 4XVQA 1DCKA 1V8BA 1YMVA 2H1WA 4P2GA 3R7WA 2TMDA 4BNDA 4ZA2A 2IPAB 4X1KA 5T41A 4A8HA 2WTXA 3U5ZB 1ONBA 4EMBA 4ZOLB 2GYVA 4OXYA 4YCJA 5K01A 2VBGA 2FEXA 4PG4A 3T7SA 5FUMA 3LDGA 2GCGA 3PR3A 1UZUA 4YK7A 2F2TA 1RJEA 4FINA 2Z2KA 5HDBB 3LHSA 5KTSA 1KORA 2WT9A 3LM8A 4RV4A 1R0WA 4FYKA 3EZLA 1GFZA 3C3XA 4G0PA 4JS0A 4AVYA 2DCUA 4X1OA 3VR6A 4DR7B 2I1VB 3OF3A 2FUNB 5DN6D 3R3UA 1UWCA 3QLUA 4ZVLA 3FNRA 3M4ZA 1LF0A 4W82A 3PJGA 1K8XB 3SYRA 1J8MF 3UJ8A 2C4TA 2FNAA 2AX3A 3IC5A 4B6JA 1YSCA 5TEVA 4DXDA 3ZY6A 2VO1A 3PX2A 5TE9A 2O2SA 5IUKC 2CYAA 1JT2A 1RXUA 3CH6A 4D3XA 1G2QA 3HHEA 4MTLA 2R62A 1DS6A 2GTIA 1T3HA 4RA6B 2Z3WA 1E7WA 3OLQA 3FPLA 2O14A 2HGSA 2FX3A 1V5GA 4FUTA 4C43A 1AZLA 1ECJA 2ISQA 1HOTA 3K5WA 3NM5A 3LVFO 2J48A 1IXKA 2QD5A 3DDSA 1M83A 3FVWA 5B4VA 1ORIA 1N2JA 3FCXA 2OC9A 3REQB 3D3EA 4HAXA 2NTVA 4GEKA 4K40A 3FBWA 1XCMA 1SKUA 5CURA 3U80A 2Q5CA 4DMFA 4GP6A 4QFDA 5G40A 4JP8A 1L6IA 3SKVA 1QHEA 3OCUA 2VYVD 3WLKX 2IXFA 1YQEA 5MDHA 1UPAA 4BPBA 1J25A 1YRLA 2SBTA 3TCNA 3ZDBA 4G89A 3WQHA 1JLKA 2YZ7A 2DWUA 1AKEA 4D9IA 5BPHA 2PZEA 4N5IX 2ZRPA 2DTDA 4D8VA 4DEYA 1Y5MA 1YU9A 1SKYE 3LNCA 4NDAA 4TOIA 3FKJA 3GJSA 1Y6JA 2WIDA 2ZRGA 1UXJA 4HL6A 1QHNA 1E2UA 4BN0A 3NBAA 2WJPA 1USVA 2V6MA 3EOBI 1IRXA 4IP0A 4Z9AA 4TMYA 5JJKA 1KYIA 3KEMA 4CETA 3VO2A 2OBLA 3AJ8A 1KMHA 3T5MA 1Q2UA 2C0QA 4CU2A 5JSFA 3EMBA 4O59O 2XDYA 4AF6A 4D9GA 1EVEA 1RCFA 2AYXA 1XNJA 2F3TA 2H4ZA 2Z4TA 1UBJS 3CUTA 4XTCS 1G7RA 2VLIA 2JLBA 1ZITA 4YJ3A 2EAUA 1PTJA 5IHXA 2VJOA 4Q6BA 1G4HA 2WAYA 1JIXA 3ZW7A 5DHTA 3MJSA 2I4TA 5IK2D 1GG9A 5CIWA 1A9XB 5ALYA 5JRDS 1E32A