3R1IA

Crystal structure of a short-chain type dehydrogenase/reductase from mycobacterium marinum
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
254
structure length
254
Chain Sequence
SVLDLFDLSGKRALITGASTGIGKKVALAYAEAGAQVAVAARHSDALQVVADEIAGVGGKALPIRCDVTQPDQVRGMLDQMTGELGGIDIAVCNAGIVSVQAMLDMPLEEFQRIQDTNVTGVFLTAQAAARAMVDQGLGGTIITTASMSGHIINIPQQVSHYCTSKAAVVHLTKAMAVELAPHQIRVNSVSPGYIRTELVEPLADYHALWEPKIPLGRMGRPEELTGLYLYLASAASSYMTGSDIVIDGGYTCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Short-chain type dehydrogenase/reductase
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium marinum
molecule tags Oxidoreductase
total genus 97
structure length 254
sequence length 254
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3r1iA00
1FXSA 1LA2A 1QSGA 1RPNA 3AUUA 3V2HA 1YWGO 2P4HX 1O94A 2QRJA 5FI3A 1MC4A 4WLUA 4EEXA 1Y5RA 1PWZA 2ET6A 3HNPA 1GAEO 2D1YA 4QO8A 5EERA 1I30A 1QLJA 4K26A 2DC1A 2PKQP 3QVTA 2WD7B 1M66A 3AU8A 1LLQA 3VH3A 1SCUA 3VPSA 3KB6A 3RUIA 1LRLA 2X23A 3BMQA 3NUGA 4EBFA 2DUUA 2G82A 5A05A 2Y93A 5HS4A 3BMNA 3EUWA 3LT2A 4YJHA 3ROPA 3IAHA 4RF2A 1FDUA 4BMNA 2FR1A 3KYCA 1UR5A 8ADHA 4YXFA 2YYYA 5JYDA 3HDJA 1JKIA 2X58A 4CLEA 2B4QA 3AM5A 1NP3A 4A73A 4OSPA 3RD5A 4R9SA 5HM8A 2P9CA 4ND1A 4GSKA 1OC4A 4R69A 5EQDA 4OSOA 1DPGA 4FN4A 1DRWA 1LRKA 4MJLA 3EVNA 1ISJA 3DWFA 1E3SA 4RPLA 4F3YA 4XRGA 3EMKA 4I5EA 4J9UE 1ZMOA 2X86A 3HDHA 1SMKA 2EWMA 3MJ4A 1Y1PA 4CL3A 3PWKA 1E1NA 1O95A 1E7WA 1Q7BA 4JP2A 2X9GA 2JFFA 3JQGA 1GU7A 4O59O 3UFXA 2X8LA 3G1UA 2C07A 4CM6A 2GUGA 5A5FA 4YCAA 3WGZA 3ZN2A 3VC7A 2V6FA 1RM5A 5C7OO 1ADGA 4IMPA 5KNLA 2QYTA 4M1QA 4BMSA 4GX2A 2GYYA 4R3NA 3WMXA 1K89A 1C1XB 3T4XA 3U0BA 4YRAA 3GZNA 3WG9A 3NEPX 3ANMA 2UV8A 2C7VA 2YUTA 3UXYA 2Z1NA 4TSKA 1KS9A 4MP8A 2ZTUA 5LDHA 1PZGA 3DHEA 4IDFA 5F1KA 3KSUA 3C1AA 5JMWA 3INRA 5IXSA 2C7GA 1BSVA 4OXKA 3E82A 2JFHA 4MVJD 1EK6A 2A9FA 4FB5A 2OO5A 4FFLA 1EBUA 4Y9DA 2VYNA 4J4BA 4ZHSA 3AY6A 4LSWA 4OMUA 4AJ2A 4UUOA 2B5WA 5C5IA 4B7XA 3OQ1A 4DMMA 2EIHA 3D4OA 3EZYA 1Y7TA 1KYQA 2NQ8A 5L53A 3E5MA 3I52A 3DOJA 4CQMA 2DBVO 4NU6A 1BXZA 1GUZA 4BB5A 1B8UA 4RDIA 3OETA 1H93A 3MTJA 2B5VA 5L7WA 1A9ZA 2CDCA 4CQLB 2Y67A 2LDBA 4MOWA 1WWKA 4E3ZA 3EK2A 3N74A 5ICMA 3RJ9A 3QWAA 3JQ7A 3PTZA 4IY1A 4UEJA 5JO9A 3ON5A 5LCXA 2HDHA 4BOYA 4CMBA 1KERA 1ZCJA 4XIJA 3FHLA 4B7CA 1WP4A 2OFPA 5THQA 4R1UA 4YR9A 4OGWA 4AJEA 2X22A 1M75A 3DMYA 4A03A 2CF6A 5JYEA 4DVJA 5B12A 2G5CA 4I9UA 3Q6IA 4WLNA 1HXHA 1U8FO 1K3TA 3JQBA 3U4IA 1Z7EA 1GY8A 4XWYA 2ZB7A 5ADHA 4ITUA 2WEKA 2ZYAA 5TT0A 1EE9A 1YDWA 2PA3A 5IDQA 4OKIA 4N5NA 1DJNA 3L77A 1D8AA 2RHRA 5C37A 5JY1A 3MJEA 2AEMA 1IHXA 3VH2A 4EITA 2PTGA 3ETGA 3FBTA 2QQ5A 2X0JA 5IDXA 2WE7A 3DBRB 2VZ0A 1UP6A 1QV6A 2DFDA 4KWHA 4Y8VA 3WTCA 1W4ZA 4S3MA 4F6CA 2VNSA 1PGJA 1Y8RA 4IQ8A 4YT5A 3H65A 2HUNA 2JAHA 3WNVA 2GDZA 3G17A 4J7XA 5A03A 4ND2A 1JKJA 5IG2A 3ROKA 1JN0A 3TZCA 2PV7A 5G0VA 4ND4A 2JJYA 3NGXA 2QZZA 2YHIA 1U2DA 4J1TA 4E2WA 1NVTA 4AJOA 4BKOA 3SLKA 3H4VA 1PGOA 5U4QA 4PRKA 3U4HA 3WGIA 3I83A 1FDTA 2WD8A 2Y99A 2YV3A 4YJHB 2AA3A 1R66A 2X7HA 3DXFA 1V8BA 4B3JA 3KYCB 4TKLA 3MJTA 2DFVA 4NI5A 4XJSA 3KTDA 3B70A 1PIWA 1HKUA 1FDSA 1XIVA 1ZXLA 4E4YA 3FWNA 2CDAA 2PKQO 2FN7A 2VTDA 3DO5A 1YOVA 4HBGA 1OMOA 1QYWA 1PJCA 4BGVA 4LRSB 1NPDA 4FFMA 3WLEA 2XOXA 2QHXA 1CWUA 2VT2A 4WE3A 3L6OO 4PZDA 2CVOA 4XZ3A 3R3JA 3PYMA 2C2YA 2PH5A 3DZFA 3TSCA 3ZGYA 3FBGA 3QHAA 1T2FA 5JDCC 2B36A 3AOGA 1VC2A 3GEDA 1Q7GA 4ND3A 4K6CA 1DXYA 5DZSA 1Y9AA 5A1TA 4NK5A 4XEHA 1MFPA 1WZIA 3K31A 4CR7A 3CINA 2GZ2A 3OHSX 1UZLA 3PHIA 1LDEA 1WMAA 5ENVA 2HLPA 2EJVA 4D44A 2Q4BA 4RL6A 3P5SA 5TGDA 5KJ6A 3GZNB 5CDSA 1EK5A 3NDJA 4KMSA 4X54A 2J5KA 5EINA 3RCBA 4IBOA 2WDZA 4W9NC 4RPKA 1U1IA 4I1IA 2Q4EA 5A5EA 4BNLA 2BKAA 4NFHA 1NVMB 3K92A 5B37A 3VH4A 4BO5A 4UUPA 3WQRA 1EFKA 5BNTA 3GNTA 5COAA 4YJFB 4TRMA 5EL0A 5T5QA 4EUEA 2VN8A 1T25A 4O0LA 4FC6A 2VYVD 4W6ZA 5K6AC 4OM8A 4CMIA 4Z6KA 3AUAA 3S2GA 4OQYA 4B79A 1F06A 1YKFA 4KOAA 2YW9A 4OJNA 4BNXA 4E30A 1DRUA 4OH1A 1X1TA 2XXBA 2X9VA 4G5HA 1BWSA 1NAHA 1YL6A 3ZWCA 2B0JA 3MZ0A 4JIGA 4FR5A 3V1YA 4B7UA 2FR0A 3RKUA 3I9NA 3W4IA 1DIGA 3FR7A 3UCFA 3ZH2A 1PQUA 5I9MA 3K8ZA 2W90A 3H2ZA 4Q3CA 3ROQA 4W99A 5CEJA 3BAZA 4WCDA 3KYBA 1YVEI 3MOIA 5HA5A 4PLWA 1RKXA 3GLQA 2VYND 2YDYA 1M76A 3WWYA 2EW8A 3JQ7B 4Z9YA 3WQQA 2P91A 3AI1A 3WGYA 1P1FA 2PGLA 3V1TC 4JN6B 2CF5A 4WLOA 4JX8A 2C0CA 3U49A 3D1LA 5TSDA 1GD1O 5BSHA 1BGVA 3ZWOA 3PJDA 4D45A 1WPQA 1R0KA 1XQ1A 2TMGA 3GMDA 3BHMA 1GEEA 3E9QA 4K1LA 3ZWYA 3Q9NA 2WMDA 5JNLA 4FBGA 1S7CA 1N9GA 2OP0A 2DTDA 4Z9FA 6LDHA 4CM1A 1P31A 3C8MA 3GPDG 1K2WA 3LDHA 1PJ2A 2O23A 1I24A 2YZ7A 1ADBA 3A06A 1KY4A 3JD3A 3U4DA 2EP5A 4NFYA 5BNFA 4CV3A 1HYGA 3NT4A 4DL9A 5JDIC 3F46A 3PZRA 4GWGA 4M87A 3C7DB 4CMGA 5F5NA 2NTNA 5FF9A 3D0OA 3JYOA 3D3WA 2Q2WA 5G0UA 3LSYA 1ML3A 4NDNE 2HO5A 1JU9A 4LSMA 1KVTA 2Q1TA 3MWEB 3ITDA 1A72A 1XYGA 1LNQA 4J2OA 4DMLA 4R54A 3PVZA 1ZXBA 3MWDB 3PWSA 4YDRA 4UUNA 3ZW8A 1GTMA 5DF1A 5JBIA 1MUUA 2O50A 1E7RA 4DC0A 1P74A 4Q3AA 3U9LA 3DAFA 2H9IA 1PGPA 2HRZA 4IUYA 1JA9A 1YQDA 1HZZA 1XELA 2D8AA 3L07A 2YHIB 1H94A 3ETEA 3IS3A 1I3NA 2UAGA 3EY4A 4IXWA 1F8GA 4L75A 2NWQA 5TT1A 4IS2A 2D4AA 4CLHA 5AXAA 2P9EA 1NWHA 4MPDA 2PD6A 2ZYDA 5JAIA 1E7QA 1SEPA 1LDBA 3I9MA 3WIEA 3F4BA 1HTBA 1P1JA 1GQ2A 3I3OA 1YOVB 5JY6A 1G6KA 1GFSA 3JTMA 3RC1A 3BTSA 5GZ6A 1YE3A 4Z0PA 4HFRA 4WEQA 5BR7A 1VSUA 3NT5A 2C2XA 3TNLA 4TVBA 4XJTA 3L6DA 1V6AA 1Q7CA 1U3WA 3I9KA 3VPGA 4CMEC 3E5RA 5BQFA 5ER6A 4PG5A 1MFZA 2YQ4A 3GFGA 3TQHA 4BO1A 1YL7A 4RVUA 5DN9A 1H5QA 2B4RO 1EVJA 4BKRA 1VE9A 4HP8A 3PJGA 5DDIP 5EN4A 4ALNA 5DBGA 4JLWA 5IAAA 1DLIA 1CETA 5DOVA 1NHGA 3T4EA 1ORRA 4I8XA 2BFPA 1ONNA 1SAYA 1BVRA 2VTEA 3OA0A 2BF7A 2VHYA 3ENKA 4GGPA 4XR4A 2C54A 1SOWA 2CMDA 4HFJA 4J91A 5DBFA 3CTMA 2C82A 3UCXA 4F6LA 2A94A 3FNEA 3OJOA 1KVQA 4UULA 5KVQA 2V65A 2ZTVA 5DP2A 3W6UA 4R1SA 1V9LA 2I99A 4R3WA 4EUFA 4URFA 1Y5MA 5CPBA 4BO3A 1PWXA 1HETA 2V6BA 2AMFA 1UUFA 3IL2A 4GWKA 4J1SA 4WCFA 4N54A 2PH3A 5T57A 4YAGA 4AJIA 3WYEA 2VHWA 5CFZA 1IB6A 2C20A 3A1NA 2YV2A 5I9LA 4DQVA 4WGGA 3BTOA 4M86A 2GF2A 1UAYA 4WNCA 1VJ1A 3ABIA 3QSGA 1ISFA 1HDXA 4R16A 4ZN6A 1GYQA 3HFGA 1W6UA 4R68A 1W73A 5J23A 2VUTA 3BXXA 1TT7A 2G76A 4NIMA 5U9CA 1X1EA 1U7TA 4Z9XA 3Q3CA 2O48X 3CZMA 3TJRA 3ZV3A 1C0IA 2WE8A 5L7YA 2HMTA 3V2GA 3LF1A 2VOJA 3D3EA 1V3TA 4E5PA 3S1LA 1X13A 1IL0A 2J8ZA 1T24A 4I9HA 1XU9A 3LF2A 1NXQA 4M49A 1L1FA 1PZFA 4QO7A 4ALJA 2YDXA 4BO2A 3GNSA 2IXBA 4C7JA 2NVWA 3RASA 3HSKA 1DIHA 2BHLA 5KKCA 3ST7A 4E2ZA 1Z73A 5MDHA 1YH3A 4ZQFA 3IQDB 1QYDA 3PK0A 1NNUA 4CM8A 2DBZA 2HMVA 4BB6A 1KC1A 4N5LA 2ZQYA 4OAQA 1Z45A 1GQYA 1DFHA 1ISHA 3VKUA 1YB1A 3GDFA 3QWHA 1XDWA 1GUFA 1ZEJA 3MEQA 4D42A 2HJRA 5ER9A 1F14A 5DCWA 4HUJA 4TZKA 3OIGA 4XB1A 1IZ9A 5T64A 1IY8A 4K28A 3S55A 2ZCVA 4FPXA 5FWNA 5JMPA 3JSAA 3KHUA 1ONPA 3CKYA 3JQDA 3OSUA 4XA8A 1BW9A 3VOSA 2FOIA 1WDMA 4OKNA 2PWZA 4PZEA 4XYEA 2EJWA 3TDKA 1ZSNA 3FPLA 3TOZA 4XGNA 4CMJA 5F1OA 3IKTA 1TT5A 4BL5A 4RVSA 5JAMA 4JGBA 2RCYA 4XQEA 1VJTA 4EUHA 4GI2A 3IKVA 3W1VA 4RPJA 4RJTA 3FR8A 3QVXA 3G79A 2Q50A 3UGKA 4FW8A 1HDCA 2IRWA 2OOSA 3ADPA 3F1KA 4PG7A 3IIEA 3VAZA 2YFQA 1IHYA 2R00A 3HB4X 3HN7A 4XYLA 1DAPA 1GDHA 1DFGA 1Q1NA 3H5NA 1PR9A 5TC4A 4P4GA 3ZNPA 3GC6A 4TZTA 5B4UA 5JC8A 1KVSA 3JQBC 2QX7A 5F3RA 1WDKA 4KWIA 5IN5A 1ZK4A 1JWBB 4YAIA 3DB2A 3F3SA 3R0IA 4TRJA 4EI2A 1NAIA 4I5GA 2HAEA 4ZQHA 2OGUA 4KUEA 4XQCA 4CM7A 4IJVA 4PLCA 3DFZA 2OUIA 4NBTA 3H6KA 3G0OA 3DOOA 3F4LA 2X0RA 1QLHA 3LK7A 4Y67A 5TS3A 4YEDA 3VPXA 2NU7A 1NQAO 4INAA 3WTBA 4GVXA 4R1TA 3H5AA 3HE3A 1CERA 2FPPA 3L9XA 3OJLA 2AQKA 3Q9UA 4DQUA 3RUAA 1PU2A 1JW9B 1QV7A 1QYCA 2NVUB 3RUDA 1F0YA 1CEQA 1N7HA 3ONFA 4YAJA 4KZPA 2Q2QA 4BHTA 5HWSA 3G49A 1UH5A 3NTOA 1DO8A 1HDRA 4J7CA 3C24A 1HF3A 2HSDA 4MVJI 4QSMA 3KOUA 5G2OA 3F5SA 4DIBA 5KVCA 4OHUA 4E12A 4BS9A 2E4AA 3OEWA 2Y0DA 1HZJA 1PS8A 2IODA 3LT4A 1HYHA 2WSBA 3B1FA 1PJTA 3PHLA 1GZ6A 2DQ4A 4FJ2A 4M54A 4E21A 3OQBA 1Z75A 5H83A 3DBHB 4GL4A 1KIFA 3VVCA 3HFSA 3ZWVA 4J16A 5A06A 1U5CA 1V0JA 4XRRA 2E6UX 4HXYA 2POQX 2EV9A 2OBNA 3GDOA 2IXAA 1X7DA 1J4AA 3GT0A 3AU9A 3MJSA 4PG6A 1OZAA 3CSDA 3HN2A 3WDSA 2GN8A 3M2PA 4RZHA 3ZHXA 1JKFA 2GGSA 4QFCA 4RORA 1LRJA 2D59A 2DT5A 2XAAA 4XD2A 3PQFA 2BFMA 1H6CA 1MB4A 4A26A 5IZCC 3KM0A 5IFLA 3D4NA 2HK7A 3RUFA 1E3EA 2V6MA 4BNZA 2Y1CA 4IDGA 2D2IA 4GKBA 4D7AA 2Y1FA 1OBFO 3WWZA 3PQDA 1GV0A 2A92A 2WYWA 3DR3A 3EDMA 4JJFA 3DONA 2GN9A 3FF4A 2R6JA 1LQTA 5DCUA 1O6ZA 2RIRA 6ADHA 1LU9A 4FOSA 3ICCA 4DA9A 1B15A 1LDMA 4KQWA 2O7QA 3ULKA 2E37A 3L4BA 3P7MA 1F12A 4MVJE 2ZJ0A 1T26A 3PFFA 3M2TA 3S2IA 5IN4A 3W4JA 3FSRA 4P22A 2W2KB 3FTPA 4CV1A 1R0LA 2Y68A 1YONA 4BQRA 1AHHA 5CG2A 3NX4A 1QYXA 4FJ0A 4BO9A 2FY8A 1MC5A 3QP9A 1DB3A 1IYZA 4IQGA 3RVDA 1R37A 1WVGA 3HDYA 4NBRA 2P68A 2B4TO 1YJ8A 2BLLA 5AXDA 1Z82A 4D0RA 5A9SB 1Y8QB 1BW9B 1E7MA 1TA4A 3B1JA 4UEKA 4PLZA 2I66A 1ZJZA 3EW7A 3NV9A 2Q49A 1BXGA 4HY3A 5EESA 4F46A 1PS0A 4BKPA 4E13A 1Y6JA 5ILOA 3ZWBA 5KKAA 4BO4A 2EGHA 4E5YA 2HK8A 3FNFA 1DJQA 4MO2A 4KP7A 3TOXA 3ZWPA 5IDWA 1EE2A 1B14A 2G17A 2VUSA 1DBVO 2GNAA 3GG9A 2I3AA 2Q1UA 1DLJA 4RF4A 1LQUA 1T2DA 1YRLA 4N7RA 4EYEA 2P4QA 5JFOA 4IJWA 3HJAA 4FGSA 3INTA 4WEOA 1LSSA 1VKOA 3GHYA 3RC2A 2EHDA 1W8DA 3CPSA 5I7SA 3JYPA 3I4FA 3HHPA 1SO8A 1PR3A 3EAGA 1XCBA 3M1AA 5DT9A 5IJZA 3B20A 2HU2A 1R4NA 3TZQA 1UP7A 3GRPA 3PZBA 4RGBA 4B3IA 1GV1A 2RAFA 1ZVMA 1WXDA 4P4LA 1L7EA 1VLLA 1WMBA 2NM0A 3H8VA 3LU1A 2OXIA 1MX3A 3OF2A 4PVDA 5BT9A 4LVCA 3O4RA 1DSSG 4YBZA 4FDAA 3WYCA 4TROA 3KLMX 3Q0EA 1E1LA 1UZNA 3ZWMA 3H9UA 5G0SA 3WOHA 3ADOA 2OZPA 4B4WA 4IINA 5CEFA 3NDRA 3ZV6A 2Q1WA 5KVSA 2D3TA 2GRAA 3BMQB 1Z6ZA 2AEJA 4KTTE 3BMNB 1QR6A 2P5YA 3DL2A 3ICPA 4CMKA 3CE6A 1RM4A 1CF2O 1NQTA 5CAEA 2E48A 1OAAA 3WNQA 4YQYA 4HNHA 4FC7A 3QLJA 2I6TA 3K2EA 4RZIA 3U3XA 1KY5A 5GMOA 2PLAA 1GYRA 4WNIA 4WOJA 4KUHA 1G1AA 4D41A 5C3MA 1ZUD1 3U5TA 4JNKA 4LRTB 5H82A 2DUWA 3RBVA 1QP8A 2B83A 1C3VA 3C7AA 4NHEA 2FZEA 4UVGA 2FMUA 4ZQBA 3ZNQA 4RVGA 1HDOA 5KOIA 4EW6A 1ZK0A 3W8FA 4YJGA 3W4KA 3IUPA 4OO3A 1HSOA 1YXMA 1PS9A 4O63O 3DMTA 5T8KC 1A9YA 4LMPA 3ZNNA 3JQGB 1ZK1A 5L95A 3GQVA 3H9JA 1C0LA 3TL3A 3AOEA 3INGA 1O0SA 1M67A 3NAQA 5H81A 3W8DA 4BNFA 3OA2A 5L4LA 3IJPA 4DYDA 3PWZA 2IYPA 1Y9EA 5A3JA 4OXYA 4FD3A 4UUMA 1P3DA 1GCOA 1ZKMA 3F9IA 1MXFA 3GUYA 1DDOA 4PZCA 2Y1GA 3V8BA 1ZSYA 2Q3EA 1V3UA 4QEDA 1HWYA 2PZMA 4IIVA 3DEYX 3TWOA 4EJ0A 4YTEA 1T2AA 2O3JA 3C3XA 3HADA 5JCJA 3LVFO 3WJAA 4Z3KA 4L8VA 3DAPA 1DC4A 3HQ4O 4GX0A 3IJRA 3U09A 4J2HA 4Z3DA 2AE1A 2CZCA 2AXQA 4PLYA 2ZQZA 2X5OA 5EMHA 1AN9A 4OYRA 4F45A 1B2LA 1PSDA 2ZB3A 3E03A 1I10A 2D5AA 2BRUA 1R16A 3X2FA 1UXGA 3Q2KA 4ALIA 3QW2A 3W6ZA 4WCFC 2FZWA 4ZQEA 4CQMB 4D3SA 3ZU3A 5ICSA 1M2WA 1ZK2A 4IDDA 3R6DA 5CEEA 1E3WA 4NU5A 2J6IA 3QVSA 3NRCA 2PZJA 4A0SA 3RC7A 3BMOA 1MGOA 4CR8A 4DLLA 5KCZA 5DBIA 2Y0CA 1RM3A 2JAPA 4ZICA 1DAOA 3PGJA 4H3VA 1HE4A 4CUJA 4YJDA 2YHUA 4JBHA 3OFSA 4CODB 2EG9A 5AXBA 1VSVA 3E18A 1NHWA 2X9NA 2JD0A 2JCYA 2FPGA 3JYLA 4LW8A 4N18A 4QQRA 3K5PA 4WUVA 5ES3A 4C4OA 3QV1A 4KQXA 4XGIA 4CQMD 2FSVA 3A28A 4GX5A 1F17A 2AQ8A 3WFIA 3I6IA 2V6GA 2W98A 1X7HA 1LLDA 1B16A 3ZU2A 3IUSA 3WR5A 3UUWA 5I8WA 5B4TA 1ARZA 4JK3A 1FK8A 2QRLA 1PX0A 4CUKA 2X5KO 4EZBA 1KVUA 5HBRA 5KTKA 2HMSA 5F21A 1N7GA 1LJ8A 4J4HA 4MP3A 4ILKA 4NR0A 4CMAA 1WW8A 3DZJA 1LEHA 2F1KA 3ZWAA 1R4NB 4RDHA 1E6WA 3PEFA 1YB5A 3GAFA 4IDBA 5DCYA 2BFAA 2YFHA 2BI8A 3ONEA 4FCCA 1T2CA 3DZBA 1D3AA 4M55A 4QUKA 3K73O 4CMCA 3K30A 5EIOA 3S2EA 1Y8RB 2G0TA 2HK9A 3P2YA 2VWPA 1CRWG 4N5MA 1VPDA 2C59A 1MXHA 2J5QA 5COQA 1KEVA 1VL0A 4AJ1A 3DBLA 3GFBA 3OM9A 3TL2A 1ULUA 3I6QA 3SJ7A 2BMAA 3WIDA 1GR0A 1EUCA 3TZHA 2JD2A 1TB4A 2O3UA 2RHCA 2EKPA 3GVIA 4J9VA 4B4VA 4JJIA 5F5LA 3H7AA 3VDRA 3WSVA 3WSWA 3E1KA 1PL6A 3QWIA 1B3RA 2VCYA 1ZZEA 1WDLA 4AICA 4RQTA 1X15A 3AY7A 3DC2A 3WB9A 1UXIA 4XR9A 4BO6A 1QKIA 2ZJ1A 1SB8A 1YBAA 2EEZA 4CLOA 1GYPA 3RWBA 5IZ4A 4AJLA 5K0ZA 3UW3A 4BQPA 5A9TA 3E9NA 4AVYA 5COBA 3RBXA 3JQ6A 4XIYA 3I9OA 3OQ6A 1TI7A 2ZKLA 1HE5A 3GOHA 1NR1A 3PPIA 1XG5A 1N5DA 3KZVA 3AI2A 1F8FA 4YJGB 2R00C 1G0NA 4GQAA 1P1IA 2FHSA 5TRTA 1A71A 4O5OA 1SZJG 1KEUA 1J49A 1P77A 1YJQA 4BNHA 3HG7A 2DBRA 4J4TA 1N1GA 1EVYA 1JVBA 3DFUA 2AW5A 2NADA 1DC6A 4J0EA 2QIOA 1K6JA 4U0KA 3BMCA 4E2YA 1I2ZA 4L4SA 2RBEA 4OIMA 4E33A 2NACA 2ZK7A 1E7YA 4JROA 5GZ1A 4H15A 4NMHA 1K6IA 1JAXA 4W4TA 1I8TA 3UHAA 1PEDA 3U4CA 2UUOA 3EZLA 1VL8A 3TF5A 2DPHA 3JQAA 4PG8A 1RYDA 3FRJA 2GASA 3PLNA 1M6HA 1GL3A 3JYNA 1PJ4A 1E5QA 3KLPX 4NG5A 2Q1SA 4YB8A 2X6TA 1R0SA 2X4GA 2PK3A 2Y66A 1U5AA 5TIIA 1XU7A 3NJ4A 3OECA 1HDGO 4OXNA 3H3JA 1PJLA 4YAEA 1WZEA 1PZHA 4RVFA 4BKUA 3KO8A 4L76A 3GRKA 1NFQA 3JCZA 1RM0A 4CMIB 5CDTA 2FSSA 4CM4A 4LISA 2J5RA 5L40A 1B26A 2Y05A 5DNAA 4FJ1A 1LLUA 3C85A 3G3EA 2X0NA 2CY0A 4E5KA 2WD7A 1BMDA 4L0QA 5BNIA 4S1VA 5L4SA 5L45A 2HJSA 5GY7A 3D4PA 5DOZA 2OL4A 1X14A 5JCJD 2GZ1A 3JQ9A 5CDUA 4GPD1 4BNJA 3V1UA 1EMDA 3UH1A 4W7IA 2EP7A 4BGUA 4U7WA 5L51A 2YQ5A 1H6DA 2W4QA 4GLLA 4BNNA 3CUKA 3L6EA 2HMWA 3VH1A 1BDMA 1U3TA 4CPDA 2Z95A 1O89A 4R9RA 2CDBA 1J0XO 1JLLA 3BA1A 1ENPA 1PQPA 2XXJA 4CLDA 4CR6A 5AOVA 2AEFA 4GH5A 5IXYA 1U4OA 2NU9A 1XHLA 1M6WA 1J5PA 1TXGA 5A4DA 4GGOA 3G1TA 3PDUA 3RBZA 3FD8A 3H9EO 4YT4A 4XDYA 4IIUA 3RU9A 4HFNA 3BTUA 5KIAA 1I3LA 5L9AA 3WMWA 3PHGA 3STHA 3FTNA 3BYZA 2GZ3A 4H7PA 4DPMA 1N9GB 4Z0HO 1YDEA 3FN4A 3DOCA 3RU7A 1FDVA 5BSEA 3GR6A 1QXSA 1BDBA 2HMUA 2PZLA 4ROSA 4DIFA 5A3VA 1I01A 4MVJA 2EKQA 3H3FA 2X5JO 4NQZA 1PTJA 1HLPA 3PJFA 4DWVA 4XQGA 1ZNQO 3JQFA 2D5CA 3VTZA 4ZU3A 4YRDA 1BRMA 2AG5A 4J90A 1C1XA 4PIVA 4RCVA 4RQUA 2PFGA 3D3WB 1HDZA 3B1KA 3LLVA 3O26A 4WKGA 2WYUA 1SEVA 4DBZA 4DBVO 5CDYA 4J3FA 3L4BC 3OP4A 5JDIA 1T4DA 1J6UA 3T7EA 1WLYA 2NVBA 2DVMA 2Z1MA 2RH8A 9LDTA 1KOLA 1A4IA 1HE3A 2B69A 1I0ZA 1U28A 3O38A 4CLXA 2VUUA 4LCEA 4BUCA 2JD1A 2JHGA 4CV2A 4KTVE 1ZEMA 3PHHA 3DBLB 4RF3A 3SJUA 4D3DA 2VT3A 3GH3A 5LDGA 4K9DA 3ZHYA 1CQJA 1Q0HA 3PP8A 2DM6A 3UF0A 3H5RA 3FCOA 5EJ2A 4YPOA 2YV1A 2JHFA 1E7SA 1SNYA 4TVOA 1IZ0A 2AHRA 2PNFA 2RH4A 2GCGA 4LCJA 5LC1A 1IPEA 3HZZA 3NYWA 3WGGA 4D79A 4CQLA 1DIBA 1H2HA 2VHXA 4BNTA 4YWJA 3S8MA 1YQGA 4JBIA 1VRWA 2VRBA 4XCVA 2NSDA 2ILTA 3VTFA 3GVCA 3F47A 1XEAA 1BHSA 3I9JA 4G2NA 4XQ9A 5DULA 5TNXA 4IDEA 1Q2XA 3GUCA 5ITVA 3A4VA 1LTHR 4P38A 2BGLA 1FJHA 2X0IA 3I4CA 3TRIA 4AJPA 1YGYA 1P9LA 3O8QA 5GZ3A 1DFIA 1E6UA 1FDWA 2O3RA 2Q99A 5HTOA 4QXMA 1EVIA 4DLBA 1NPTO 2DPGA 4GLOA 4FQ8A 4FSHA 4UEOA 3WYBA 3BMCB 3ANNA 5TF4A 2V7PA 1ULSA 3DTYA 3AUTA 4XYBA 3NJ8A 2PGJA 4AJNA 4CM9A 1A5ZA 4GBJA 2C5EA 2WM3A 2A4KA 4NZ9A 3K96A 5EQFA 3JQAB 3RFXA 4B3HA 3AFNA 1D7OA 1C0PA 3AM3A 3JD4A 4PLGA 4EJMA 4G81A 4UVIA 3ANLA 3BHJA 3MOGA 2X1HA 3SX2A 4MVJM 5G0WA 1U3UA 4WCFB 3F5QA 4J6FA 1IUKA 5HS6A 2OP1A 4CLRA 5G4KA 3EHEA 4A7PA 1VJ0A 5FFFA 4ALKA 4CM4B 4MVJF 3ZDFA 3DBVO 3JQCA 4XB2A 3AY3A 2EKLA 2JCXA 3JQAD 4PG4A 2XPCA 4L4RA 5L7TA 3DQPA 3M1LA 3COSA 4JP3A 3KBOA 2VOEA 3ETDA 3ZV5A 4CM3A 4FFOA 1NQ5A 1E3JA 1MP0A 1D4FA 3ROMA 3ORFA 3OJ0A 4YRBA 4R1NA 3CH6A 3QY9A 3UN1A 5JS6A 1GEGA 2GLXA 4PCVA 3ZHZA 2B35A 2GO1A 4RPHA 3VVBA 2DTEA 2NTVA 3GY0A 3FPCA 1N8KA 2JFGA 1IULA 3JQ8A 3PI7A 3OIDA 1U3VA 1IPFA 3GGPA 3EYWA 4HV4A 1PJSA 2WWRA 2OMEA 3DMTC 1EQUA 1I33A 4ZQGA 1ONOA 1UJMA 3K9QO 4HWKA 1PJQA 1ADCA 3AW9A 4TRNA 3DZGA 3H9QA 7MDHA 3AOEC 4IQ0A 4DTIA 3C1TA 3RJ5A 4Q3EA 1MG5A 5FEUA 4A10A 3QRWA 1K6XA 4TRRA 4TQGA 3GN2A 1NTOA 3MCVA 1EBFA 1XR3A 3ZHBA 1DEHA 4L4XA 4Y98A 4FFPA 1ZMTA 4IDCA 3LT1A 3U62A 4CM8B 2VYVA 3IP1A 3UOGA 3PHJA 1NX6A 1XQ6A 4E32A 4R5HA 4QFDA 2AG8A 2GN4A 3PLRA 4WASA 3M6IA 1B7GO 4RVDA 4MVJH 3ITKA 2DKNA 3OICA 4AFNA 4GKVA 3I5MA 4LN1A 1LDNA 4J49A 4YT8A 3DZIA 4BO8A 2O3QA 1R4MA 4RO0A 2ZB8A 3RUHA 5TJHA 4MKZA 4RV9A 1YBVA 1LI4A 3N7UA 1T1RA 1GADO 4W7HA 5CHEA 4YJFA 4YVFA 4ZVVA 4OQZA 1X0VA 2O3TA 4FGWA 3QVWA 1I3MA 3ZW9A 4BO7A 1CDOA 3V2UA 2ZIZA 3I1JA 4B8WA 5BSFA 4WK6A 4NNJA 2EERA 2YJZA 3UICA 1UZMA 1TT5B 4FS3A 3ZNOA 3FI9A 3SEFA 1B0AA 2O4CA 4PLPA 2E82A 5KVVA 4NBUA 1QRRA 4XYMA 3ENNA 5B1YA 3RROA 1BG6A 1LX6A 1G0OA 1AUPA 2IZ0A 3LT0A 2QZ9A 1PL8A 3C1OA 2UUPA 4J0FA 3VZQA 2WTBA 5C7IO 2NU6A 4I5DA 1LDYA 1EFLA 2PY6A 3WS7A 2ZB4A 2W8ZA 2NNLD 2JCVA 3E9MA 2QW8A 2D0IA 4IMRA 5JSFA 4TKMA 5JLAA 1LUAA 4E0BA 1JAYA 1P1HA 1E1MA 5K9ZA 3DAGA 1LC0A 4II3A 4AJKA 4D3FA 1E0DA 1EZ4A 1DHTA 4IGFA 3WQSB 3O8QB 5KJ1A 1X0XA 5I9NA 2I5PO 2GERA 2WJPA 4RVHA 1YB4A 3CEAA 1D1TA 1P44A 3JD1A 4II2A 1N1EA 3CZRA 3UVEA 4UVEA 3WJ7A 3K6JA 1SB9A 4DQXA 1O8CA 4EJ6A 2QG4A 1N2SA 5JPIA 3OJEA 4ID9A 1QYVA 5I7EA 2F00A 1DC5A 5L3ZA 4CUZA 3UCEA 4ZA2A 2VHVA 1OOEA 4QTZA 1DRVA 3O03A 3O9ZA 4BNMA 4QX6A 2B37A 2A35A 1ZO8A 3GVXA 3P2OA 4RF5A 1MLDA 3IMFA 4DPKA 2W2LA 4MIYA 4AJJA 1ENYA 1YS4A 1HL3A 2HCTA 4CLRB 4AL4A 5G4KB 1H6AA 3NGLA 2IZ1A 1QG6A 1GZ3A 3RC9A 1NM5A 4U6QA 4CM9D 4HNGA 2AQIA 3IC5A 2O2YA 1XKQA 5MGBA 2I65A 4L74A 3AJRA 4BGEA 4ZRNA 2IZZA 2BGKA 4NJMA 1ID1A 2P9GA 4E6PA 2VWQA 2BD0A 4LVUA 1MV8A 2Y1EA 3DHNA 1C1DA 3QWBA 1ENOA 4JXKA 2IE0A 3GVHA 4K6FA 3GPIA 4IJKA 3AFMA 1P33A 4D43A 4Q3BA 2ZATA 3QA9A 1TLTA 2UDPA 4YYZA 4GMFA 1NWCA 1ZIDA 4UVHA 1XGKA 3ZU4A 1X7GA 4ND5A 4B4UA 1DIRA 3RSHA 3JQ8B 3KEOA 2I67A 1SOVA 3DZHA 3GEGA 1GCUA 4I08A 3KRTA 1UXKA 1P45A 1A4UA 1V35A 2VWHA 5IZCA 1VL6A 5BSGA 3BTVA 1AXEA 1NFRA 1U4SA 4FFRA 4YT2A 4DLAA 1D1SA 1UXJA 3LLSA 3Q2IA 1ISIA 3GN1A 1WNTA 1C0KA 4G65A 2R2GA 2C5AA 4C7KA 3GZ4A 3SBOA 2VRCA 1RYEA 2FR8A 4NPCA 1RJWA 3WFJA 3KUXA 4BNIA 4BNUA 3JD2A 5KWEA 1NQOA 1YL5A 3PIDA 5EPOA 4BMVA 4D46A 3SVTA 3PIIA 4PGFA 5A02A 3LC2O 4XX0A 4WOKA 4Y6RA 2H5LA 5JC1A 1EQ2A 3CXRA 3KETA 1BTOA 4WLEA 1CQIA 3GGGA 4IDAA 3WGTA 2G1UA 3WBFA 3PJEA 1UDAA 2DU8A 2UYYA 4IGEA 4R4JA 3DTTA 1LXCA 3VHRA 1FF9A 4PN3A 1SPXA 3SC6A 1R4MB 1B8VA 3ASVA 1RWBA 4NBVA 5TX7A 4U5QA 4B4OA 1I2BA 3PGXA 7ADHA 3HB5X 2GR9A 1E5LA 3H2SA 2Q2VA 1A27A 2QRKA 1HDYA 5DP1A 1YBMA 1ADFA 1OFGA 1E77A 4A27A 2O2SA 1BXGB 1DHRA 4E31A 2NQTA 4L9RA 4CJXA 1C14A 1CYDA 2SCUA 2Y1DA 3JQ9C 4ZD6A 3PQEA 5TLSA 4RPGA 3TZKA 4LK3A 4UAGA 4UREA 4YACA 4MKRA 3L9WA 1S6YA 4XGKA 1KBZA 4IZHA 4ESOA 1EDOA 4MINA 4ALLA 4B8ZA 2BH9A 1PQWA 3KV3O 4A2CA 4DYVA 3C7CB 3D64A 3KYDA 3NTQA 4JJGA 2FRDA 1ZK3A 2I9PA 3Q11A 4BV8A 4IPTA 5FYDA 1VM6A 3EGOA 4FFNA 3E6AA 4Q3NA 3KVOA 2EF1A 2JKVA 4WECA 4Z0TA 4R41A 2BELA 1EUDA 2BGMA 3GA0A 4BNYA 2LDXA 3OH8A 2H6EA 1KC3A 1HYEA 3R3SA 4GMGA 3WLFA 5CP8A 3ZWNA 1ZH8A 1UXHA 4NK4A 4QT0A 2Q46A 4J1QA 1CIVA 5JE8A 4BVAA 1NBOA 2WYVA 3GAZA 3RFVA 4J43A 1AXGA 2CD9A 3RUEA 3D5QA 3LC1O 1CJCA 2CVZA 2BI7A 3JQFC 4GSLA 2FWMX 1ZJYA 1E3IA 1O5IA 1PGNA 3PYLA 4U6SA 3GDGA 3UAGA 4P4NA 1O9BA 4IJUA 1XA0A 4JCOA 1LC3A 1H9BA 1N92A 2H1SA 4BGIA 1NR7A 1OC2A 1U9JA 3GF4A 3GVPA 3LYLA 4MIOA 1UDBA 4OL9A 3RUCA 4ALMA 4YAKA 1GQQA 1FMCA 3LC7O 5JCXA 2O4UX 4DRYA 3RQSA 1MG0A 3AM4A 1NPYA 3VDQA 1PJBA 3E8XA 3VPHA 4J1NA 5L4NA 1ZSVA 3GG2A 4I9NA 5A04A 5CG1A 3A14A 3VZSA 3GK3A 2CVQA 1PZEA 2NU8A 1NFFA 2FP4A 5A9RA 3ZCXA 3GNQA 2I3GA 2PD3A 1AGNA 2JL1A 1OI7A 4NJOA 3PDJA 3MTGA 4MVJG 3MJVA 2CNBA 2C29D 2DAPA 3JV7A 1R12A 2TMDA 2VNAA 3QE3A 5KJFA 1P1KA 2IEBA 1I32A 3PFWO 5KJEA 3PYXA 2HKIA 4NJMB 4YQZA 4IS3A 3RIHA 2E49A 1LSOA 2CUKA 2Z5LA 3FNHA 5KJCA 3AUSA 1C1DB 2NUAA 3F1LA 1K0UA 3WXBA 4BV9A 1P0CA 1LSJA 4BO0A 2ZTLA 3OMLA 3TFQA 2W2LD 3AK4A 1LDGA 4MIEA 4IM7A 3I23A 1PL7A 3ZWWA 3P19A 4HFMA 4Y6SA 2FPIA 1T2EA 3KSZO 4XKJA 3ZZNA 4CM5A 2NV6A 3AI3A 4O1MA 5JDCA 5B4VA 1H2BA 1I36A 4MKXA 2OORA 4PLHA 2Q45A 1H6BA 4ZJUA 1E6EA 5JW6A 5T8KA 2QYSA 4CMHA 1JTVA 4DC1A 4GX1A 3IDSA 2DLDA 1GPDG 1P1RA 3W8EA 9LDBA 3NKLA 4Q3DA 3HDQA 3OIFA 1LBEA 2NTJA 3FWZA 5T67A 5JXWA 3BHIA 2Y0EA 3WBBA 4P8RA 1LSUA 5TJ9A 3SLGA 1JWAB 3QIVA 1DIAA 3AWDA 3RI3A 2PGDA 3EVTA 3VKVA 3GHHA 4MP6A 3HWRA 1YQXA 5ILGA 1LLCA 4H16A 4W9NA 2HRBA 3Q1LA 4DIOA 2VWGA 1MA0A 3ASUA 2AE2A 2OHXA 3E48A 5AVOA 3CMMA 2NLOA 2OBYA 3KEQA 4YA6A 1AE1A 4ZRMA 2GSDA 2VQ3A 2NVUA 4U0JA 1WAMA 1L7DA 1AHIA 5G0TA 4WLVA 5K6AA 1EDZA 3WICA 3H9GA 2VRCD 4RLHA 1ISMA 3KXDA 3PRJA 5U1PA 1ZBQA 2VZ8A 4Q9NA 1E3WB 4PLTA 3BMOB 5AXCA 1KETA 3D7LA 4WPGA 3K2BA 1UDCA 2PD4A 4L73A 3ZV4A 3S2FA 3ZI0A 3UKOA 3WGOA 4HKTA 3VZPA 1GUYA 4AG3A 4JBGA 2P5UA 2H63A 3DBHA 4NFSA 4ONEA 4EGFA 2DTXA 3R1IA 3LZ6A 4AJ4A 1R6DA 1UP4A 2IEDA 3DZKA 4HX5A 4R5MA 4DUPA 5I7VA 4BIIA 4LGVA 2Y1OA 3BIOA 1JVSA 5JAQA 4XYGA 4FOOA 3NDIA 3LQFA 3PXXA 4AJHA 5JAZA 1NASA 1ISGA 3KYDB 1VKNA 5ENDA 5AYVA 4ZGWA 4XDZA 3WGHA 5C7LO 4NH4A 4KDFA 1XWFA 1QORA 3CMCO 3QWFA 4M89A 4PFJA 2J3KA 3N58A 4LMRA 1ZW1A 1IE3A 1YO6A 3TPCA 3NTRA 3A9WA 1IOLA 1E1KA 1XSEA 3MJCA 2ZTMA 4E2XA 4DXHA 4E5MA 1I5RA 4DPLA 1Q0QA 5JO0A 4PLFA 5I8ZA 1B3BA 4PLVA 3JYQA 3D5TA 4NBWA 4R01A 4BNGA 3SC4A 2BFOA 3SXPA 1Z74A 4IZIA 3I9LA 3CIFA 3WX0A 3VPFA 1SBYA 3B6ZA 2UVDA 3F6YA 3ONDA 1A7KA 4IXTA 4BKQA 4QECA 2O3SA 3QVOA 4WLFA 3TN7A 5IDYA 4CL8A 2O7SA 5T6BA 2VHZA 2J3HA 1TVEA 1UAGA 5FI5A 1EUZA 1KEWA 1I2CA 4DREA 4HADA 4MDHA 4TMFA 3RFTA 4TWRA 3V5NA 4EEZA 3GMSA 3DHYA 2W2KA 1R15A 2AQHA 3TFOA 1HLDA 1U8XX 3JQEA 1ENZA 1T4BA 3OBBA 4I5FA 3DDNA 1JQBA 8LDHA 5G4LA 3GGOA 4PVCA 4FIZA 1HSZA 1P0FA 2P2SA 3QQPA 4UVDA 4OOFA 3HUDA 1W0CA 1HT0A 1Y81A 1HRDA 5A9SA 1QMGA 1H0KA 3X2EA 1Y8QA 5CPFA 2IDZA 1PGQA 2J3JA 5F1PA 3VZRA 4CLOB 4E5NA 2CFCA 4W82A 1BVUA 5AQ1A 1T1SA 2XF8A 1V3VA 3BZUA 2ZCUA 1VI2A 3RKRA 4M8SA 5ITWA 3FNGA 1KVRA 4OOEA 4EDFA 3QJ5A 2IYOA 3OJFA 1EEHA 1KEPA 4D0SA 2PZKA 3ZU5A 1EVZA 3TZ6A 3RAJA 4JQCA 1Z7BA 1Q0LA 1TEHA 4MVJP 3KSDO 4R51A 2VZ9A 1I3KA 2HQ1A 1XLTA 2GD1O 3L4SO 4DGSA 3IOYA 4GAEA 4U8GA 1E3LA 2J3IA 2I76A 1U2GA 4CMEA 1DOHA 2PKRA 1K5HA 4J7UA 4Q39A 1GZ4A 4O6VA 4GVLA 1GPJA 4BNVA 3L0DA 4Y6PA 5TQVA 3IP3A 5HRUA 1BXKA 5THKA 1H9AA 2GN6A 2EW2A 1U7HA 4WJZA 4BNKA 1B8PA 4KUGA 5I7FA 4A5OA 1HE2A 3GEMA 2CSUA 2GPTA 4PRLA 1PJ3A 2EGGA 3NT2A 1JDJA 4CV0A 3JD0A 1SC6A 1A7AA 4KDEA 5IF3A 1DC3A 1NVGA 1ZFNA 1E92A 3DBRA 2DBQA 3OEYA 1HEUA 3EC7A 1NYTA 2ZYGA 3T7CA 3WGQA 2YY7A 3ZWXA 4RLSA 2PR2A 2EXXA 5CDGA 4BNWA
chains in the Genus database with same CATH superfamily
2Q8NA 3PFCA 4O2BF 3FDXA 3F6BX 1L5HA 1YWGO 2P4HX 1QTQA 1R6XA 5TR9A 1MC4A 2ADOA 3IDZA 1DQNA 1Y1TA 3EC2A 1Y5RA 2OAQ1 3FUCA 4INZA 1PWZA 2XSZA 3SJBA 3VR3A 4K2AA 2IQIA 1GNRA 3FPBA 2ZRNA 3N75A 2WI8A 4R7ZA 2CCKA 2V59A 4MR9B 5TPWB 1M0SA 1RBMA 2VAWA 3QVTA 4OSEA 1N77A 2BKEA 2WD7B 1TM3E 2G9UA 1A5SB 1M0TA 5HIMA 3VPSA 4MITA 4RELA 4IUBS 2X23A 2BUCA 2QJFA 5KWJA 3LIPA 4D9FA 1U99A 5HS4A 3DO6A 4RTMA 4NV3A 2DH5A 4BTLA 2FR1A 2A14A 2C9DA 1RAEA 2P1RA 3OE1A 2JRLA 2OAEA 4UD2A 1HFEL 3HDJA 1D2MA 3L41A 1J09A 2Z58A 5DE3A 4IH9A 5DM1A 4DZRA 1UOPA 2ZSAA 4RZXA 1XRRA 4IOLA 5BV0A 5HYVA 3PR2B 1KYXA 4R9SA 5HM8A 1T5SA 5KNCD 5JPCA 4ND1A 2O5EA 4R69A 4E94A 3A9TA 4FGKA 2FKNA 2ZTHA 4OSOA 4CTKA 2GEBA 1ZMBA 1DPGA 5DBHX 5F2NA 4FYIA 2IEAA 3EVNA 1FBNA 1ZD5A 3CVOA 3FDIA 4RPLA 4F3YA 3R3WA 1PKEA 1NT2A 3LV8A 4RH3A 4I4TF 4KPFC 4LOIA 2YXBA 4BX0A 2CXSA 3CX7A 2IW3A 2PGXA 1W1WA 1ZMOA 2P9ZA 3Q3HA 4U7TB 3NXKA 2AC2A 3DBOB 3ZHOA 1FFDA 3P9KA 1E7WA 4JP2A 3WDLA 1VLVA 3DV9A 3JQGA 4OI4A 5GGYA 1HBJA 3UPTA 4ER7A 3UFXA 3UA4A 2C07A 3QX9A 1U2QA 4JI1B 2EDCA 4ANFA 3DLBA 1ADGA 5JHGB 1ZCFA 3DAOA 3LMKA 4IMPA 5JMOA 2QYTA 2BFBB 2Q3LA 4BMSA 2R2AA 2YY5A 4PEVA 1H1LA 1WB9A 2AKYA 3CH7A 2J4FA 4YRAA 3B5EA 1X8LA 3VFDA 2UV8A 1W4BA 2C7VA 3IEUA 4X63A 1I7DA 2ZDQA 1FOEB 3NWJA 3NBQA 4S1PA 2A0YA 5ARCA 5AM0A 2ZUWA 5F1KA 2IH5A 3H1EA 1R1DA 3KSUA 1M5UA 1NBIA 1T3HA 2C7GA 3PNKA 5BWCA 5PNTA 3E82A 2XNDD 3EWIA 3WGJA 4CEHA 4PFQA 3ADDA 1EK6A 3L05A 4DBLC 4FFLA 1EBUA 5BXQC 5D2CA 5ALYA 5AJYA 5E1DA 2ZUTA 2IH2A 5DU2A 1X3SA 1W29A 3LCVB 4ARZB 5C5IA 4BLSA 2JLAA 3BS4A 1T5IA 4EENA 1WEKA 3OQ1A 2H2WA 3TKLA 2MDTA 5ESXA 4FYXA 2A9PA 3D4OA 1O2DA 2VYCA 1T6BY 1WY7A 3AZOA 5FA8A 3TLXA 2X7XA 2EX1A 3NFRA 4Q01A 3FPKA 1BXZA 2H57A 4UDXX 3ZKWA 3H4MA 1GTJ1 1VJDA 2R4QA 4G1VA 3RHSA 5L3QB 3NTUA 1FYVA 4MHTA 1JR6A 4ISBA 3T95A 3FTQA 5JXHA 1U04A 1TEXA 4FNMA 2VNHA 3QOXA 3RODA 5D5PA 5IS2A 5A3RA 1G8SA 1R2QA 5IWAB 2LDBA 1ZAYA 4Z54A 5AM2A 5J4YA 1YFJA 1RAGA 4MQ5A 4UEJA 4GDMA 2YIMA 3PTLA 3ON5A 4P7FA 3L1HA 4RJIA 3I73A 3OY2A 2FSVC 1F20A 2C2WA 3KE8A 4NABA 4UU7A 1U94A 1VI5A 3WADA 4CGZA 1F6BA 4AWBA 4YRMA 4YR9A 2B5OA 1JEOA 3DMYA 4QOGA 4EL5A 2PQMA 2RGNA 3I1IA 1CK4A 3FGPA 1YTUA 5CNJA 1JLHA 1UWCA 1ELOA 4CKWA 2G5CA 4TLDA 1TZCA 3KJGA 1Y4DE 1HT1E 3NKVA 4C78A 1XZNA 1GG9A 2OECA 1L4FA 1C9DB 1GQSA 2SECE 1GY8A 3CVJA 2ZB7A 2G7ZA 1PYDA 3IEVA 5SICE 1VLQA 4LZPA 2QLBA 1D2NA 2C5HA 1SHKA 3VGPA 2AOXA 1L7VC 1YDWA 1Y3HA 2JFUA 4ZODA 5CFQA 5BSMA 5IDQA 4PC6A 4N82A 1DJNA 2IS4A 1D8AA 1I0LA 2RHRA 4PPGA 2C5SA 4Z4HA 3MJEA 4FKZA 1Z62A 2P7IA 1IHXA 2VBFA 2CHGA 1NVUQ 1TMYA 1KGDA 1LFDB 1QGDA 3Q5GA 5E0KB 3TLAA 4B73A 2PTGA 2ADFA 1YDFA 3GJYA 5JFGA 2A5FA 4ZCQA 4C7OA 3FJOA 1CY2A 4PHHA 5A7GA 1DCFA 3G2KA 1V9CA 2WE7A 2EG5A 3BFXA 3LBAA 4JL6A 1UP6A 1MO3A 4KWHA 4Y8VA 1L1EA 1Z22A 1W4ZA 4BFYA 4BUZA 2GJAA 3UUEA 5AW6A 4C7XA 4YT5A 4GM1A 4RJJA 5CJPA 3WNVA 1USKA 3A6JA 2PHZA 4J7XA 2R6AA 3LUAA 4ND2A 2CNLA 4Y2QA 1JKJA 4Z49A 3A3YA 4UE6A 3T5TA 4BBJA 4XWKA 1QE5A 2NG1A 1A4RA 2Z9BA 3M0EA 3D6JA 3ROKA 5IG2A 2KM1A 5J2UB 5KYKA 4BC1A 3QVKA 2YTZA 2FRXA 3O8BA 1DS6A 5FL7D 4R1OA 2Q62A 2C9BA 2JJYA 3CW9A 5C4GB 3KDAA 4J1TA 1IY2A 4E2WA 1NMQA 4AJOA 1TRHA 3E2IA 5FRDA 1PGOA 2WC1A 5U4QA 4WBNF 1LVHA 6NULA 3I83A 4L3WA 2YV3A 3HYLA 1VJGA 2CZQA 2Y99A 1JJVA 4YJHB 2VPQA 5F7JA 5K01A 3DXFA 1V8BA 2ILVA 3VYTB 4YRKA 2AKEA 4TKLA 2XTZA 3G7UA 2PX6A 4QD3A 5FPYA 3THXA 1JEAA 5HKBA 1F2UB 3IHWA 2A3NA 3HXTA 1SUSA 1XIVA 3EUFA 4XWGA 1NU8A 4E4YA 4EKNB 2Z2YA 4WVFA 2CDAA 2CNOA 1Z5NA 4TT8A 5LNK1 3ICEA 4YHHB 3O7MA 5E1OA 3T38A 2XF2A 2P9JA 3WGLA 4LRSB 4UZSA 3EVEA 2ZRIA 2QHXA 1YUNA 2A9VA 1CZLA 4WE3A 3SSOA 2IH4A 1TC2A 3TEJA 3R3JA 4MUAA 4C07A 1TTHA 2PH5A 3TSCA 3V8VA 5FBVB 3NC4A 4AKIA 2YXDA 1HLFA 1T2FA 2RAUA 3DMRA 2WKPA 4KMOA 5JDCC 3STXA 5CM9C 3UQYS 5B58C 1TEZA 3AOGA 5K7SA 1OTXA 2M1ZA 3HBLA 4KGXA 3TLBA 5G53C 4ND3A 1TDJA 3GJ7A 3OOHA 5DZSA 5C8YA 1CEXA 1Y9AA 2DWPA 2Z2XA 4NK5A 4KPEC 4JLVA 4QUDA 3K31A 5HJ7A 3BOSA 1CE8A 4PNPA 3FYHA 4R9NA 5L3SA 1UZLA 2BT4A 3PHIA 3A10A 3LRXA 1KK2A 1WMAA 5EPEA 3OTOB 5L3VA 2IBSA 2J3LA 1FRNA 3EQ8A 1E2DA 3WAJA 1YRAA 4Q24A 1XD8A 5LQSA 3AVWA 3SG0A 2RD2A 4KACA 2GK4A 4JEMA 4LSGA 3GZNB 3T9CA 1J2JA 2AG1A 4H1VA 4YNBA 3JVEA 4EHIA 1Y7IA 2VNKA 1JR4A 4H2DA 1P2FA 4QTUB 5HGJA 4YJ3B 4AN1A 4W9NC 3C2QA 2PA0A 4OQXA 2QTTA 1U1IA 2PFKA 5TB5A 4I1IA 2Q4EA 4E46A 5A5EA 1M1YE 3T1YB 2ZUVA 5FBKA 2AWOA 2XR1A 4FWTA 3JVIA 2FWNA 3ROGA 4BO5A 1L3BA 3AUFA 3ZHSA 2UUAB 3N8GA 3R7AA 1XAGA 2ZSJA 1ECPA 5B1DA 4YJFB 4JENA 4Q9KA 4Q18A 2Q07A 4EUEA 2VN8A 4CN9A 1CVIA 2A7XA 4O0LA 5AH0A 1KYIA 2Y0PA 5CIQA 1RYYA 4OM8A 5ELLA 4BMDA 4CMIA 4KFCA 4I1VA 2GTIA 2XW6A 5E38A 2Z6AA 4OJNA 4E30A 4HDRB 1X1TA 2P2YA 2XXBA 5E7MA 3NYRA 1UPTA 4Z1MA 1Y6GA 3GWZA 5K8LA 5TXGA 2B0JA 1KY2A 3WGVA 3B2NA 2FEOA 4MQLA 4ZIRB 1X38A 4ZXPA 3RKUA 1JX6A 1DIGA 2KWIA 4F3CA 1WUYA 4NMWA 3ZH2A 1PQUA 4C05A 4B35A 2QY9A 4CEIB 3K8ZA 2W90A 3RK1A 3ENZA 3ROQA 4CKCA 2C1ZA 5KX5F 1OXUA 2ZRMA 3BAZA 3LUPA 4FYKA 1SIOA 4KBYA 4MVXA 4QJBA 2B1GA 1HYBA 4PLWA 5HA5A 4EPTA 3RAFC 2O8BA 1P1BA 5BUCA 4MVYA 2EW8A 4WL0A 2OHVA 1TJNA 3AKEA 3GOQA 4DDUA 4RTNA 4RC9A 2CXUA 5DLEA 4WLOA 1JAIA 3LDFA 2PSHA 1AK9A 2Q5CA 4Y2YA 3PFBA 4BP9A 2JPDA 2WMYA 2PAFA 3T0FA 1CS0B 3ZE8A 2QLJA 1DI0A 4HXFB 4HRYA 5D87A 4PYKA 5TSDA 2OGSA 4L8YA 4X1IB 4C4XA 4YIHA 1XVVA 4DCVA 1Z28A 3B1YA 3ESBA 4YMTA 5LQUA 5KS2A 1TU3A 3BK1A 1Q12A 4KXNA 3UJNA 5BQ3A 1XD2A 4K1LA 5JZ9A 2ZRCA 1KY3A 1N5MA 3G2PA 3Q9NA 2WIKA 4LDAA 4LJAA 2BFFA 4FBGA 3L7LA 1XEWX 4V1CB 1H0RA 4XASA 2ZRBA 3ZXUB 1XPRA 1UANA 2IGTA 3CLTD 2OP0A 5FLXA 2IITA 3IEKA 3T41A 4Z9FA 4CGYA 3CUWA 6LDHA 1KQNA 5KZMB 3B9QA 3LDHA 1G8KA 1PNTA 1PJ2A 3FZGA 4HEA6 4FMDF 4XLLA 1I24A 2YZ7A 3A06A 4P0TA 3UMBA 3QEMB 4HB2A 1PUJA 3HBFA 2H48A 4E07A 2HA0A 1FYDA 3B78A 2IYAA 2WF6A 3ZVNA 2PQ2A 4Q0MA 3HJCA 2R6FA 4OUDA 4RHTA 3UK6A 2HHHB 4GXTA 3U31A 4QDOA 4B3DA 2VP9A 1ZGZA 2VNJA 4GZLA 4HDKB 4KIWA 5F5NA 1DIOB 2Q2WA 2HPAA 5G0UA 1UDWA 3LSYA 3PNQA 4S24A 4HSGA 1HOTA 3DGEC 4XGQA 2Q1TA 4XWWA 4RD4A 3ONNA 2BTQB 3KVVA 1VDZA 3IQHX 3VU0A 4ZPJA 1NZFA 3B7WA 5BOSB 5B1SA 4HPXB 2O0HA 4D9KA 2DFLA 3PVZA 1ZXBA 3O0DA 4UUNA 3P45A 1UFKA 3GEBA 1GTMA 4RLQA 5FOWA 3T5CA 3THWA 4J3JA 3FNBA 4JNCA 5F3WB 1O1YA 1GSAA 3MVEA 4OX9Y 1L1QA 3DAFA 1X80A 2HRZA 1W34A 2RK6A 4TVKA 4XM2A 3L07A 2M1XA 1H94A 3WA7A 1ZVKA 3ETEA 1CHNA 2PJZA 3IS3A 1XK7A 2F2TA 2UAGA 1F1JA 2AFRA 3BXEA 3DEFA 3PC4A 3QOWA 1XDZA 2Q9CA 3AKYA 4BMPB 5LQCA 1MBZA 2G6BA 2YFYA 3QU4A 1WXQA 2JASA 2P9EA 1P75A 2AXEA 1NLYA 2ZYDA 1UC4B 3DF7A 4JVMA 1Y34E 1RZRD 1E7QA 4JL5A 4X44A 1SEPA 3I9MA 4GOXA 2I4OA 2C5GA 5B3KA 1KAQA 2JFYA 4HAXA 3KTAB 4M2LA 3RTEA 3OFKA 2CXQA 1THGA 3ONVA 2A88A 2Y71A 2W58A 5IAJA 4LF6B 4HZGA 1W9MA 2Y8EA 3BE6A 3H7IA 1FSGA 1GFSA 5K0CA 5JY6A 3HM9A 2ODPA 3ZDDA 2B7LA 2RHWA 1YE3A 3FBWA 1MQAA 1KAHA 1JGTA 2ZANA 3UW1A 3KR1A 1EP1B 2R5FA 3MWGA 5LQKA 1T8RA 4HB4A 5ED4A 3LX5A 5I3CA 2XNHA 4G56A 3SKXA 3LUDA 2BBTA 1RXSA 3VPGA 1LK0A 3Q3EA 4EDHA 5B64A 2FMHA 3OEHA 3H2JA 1M8KA 4AY6A 3RVPA 2YHSA 1K68A 1VE9A 4ALNA 5LXTA 3W7AA 1USVA 4JLWA 3WIOA 3A3PA 3L0BA 3LW8A 3SEZA 4DDHA 5DOVA 1N5JA 3BIFA 4TGLA 3T4EA 1PW5A 4G4SO 1HT2E 5EZYB 1SKYB 5HR5A 1LVGA 1GKYA 4IHJB 4D8UA 2H85A 4KE8A 4K81B 2Z5VA 5HUQA 4QVIA 3OA0A 4GGPA 3PA8A 3W77A 3SE0A 4ZU1X 3G7SA 2I71A 4HFJA 5EJ7A 2REOA 1NE7A 1YULA 2A33A 4NJEA 3ZDRA 5BV7A 2HOQA 1PRYA 3OJWA 3PB3A 4QOSA 1OCEA 3FNEA 3O4JA 4FDTA 4JV5B 2D2FA 2BKVA 5GJBA 3BSFA 5DP2A 1K0FA 3CLRD 1V9LA 5KNDD 2M98A 2ORYA 3D1VA 2QD5A 3O4IA 4R2MA 4X3OA 2C4NA 3PPVA 1N33B 2JFPA 2ZBDA 4NNPA 3Q98A 3U7RA 3ZZMA 2HBYA 1U0OC 4WCFA 4NCIA 1I1HA 2JJQA 3ZV7A 1QLWA 2FOLA 2HCBA 3L06A 4LNUA 1KBQA 5DLYA 1T6XA 3DDOA 3WYEA 1J8MF 3WGKA 1IB6A 2CVHA 1ZDMA 1FQOA 1OW3B 1Z56C 4OAOA 3RIXA 2A2ZA 4P80A 5BURA 1B0PA 3WDKA 4WGGA 4B6GA 4FN5A 5E3JA 1HEIA 2XQVA 5LBIA 5JR3A 3O3CA 4Z4QA 5F2KA 3UMRA 1VJ1A 3ABIA 2WU3A 5KTPA 4U6NA 2PMWB 3SF8A 3NHJA 1WIWA 2WT9A 3EXHC 4R16A 5FORA 1GYQA 5JS8A 2RKWA 1YAJA 3LQQA 3BXXA 4JI6B 1QQBA 3DF9A 2OQIA 1U0JA 4P5PA 3W04A 4IH1A 4R8RA 5DK4A 3ED1A 3GFFA 3RK4A 3IR6A 1Z2NX 2R86A 2P41A 3LBHA 5AI8A 5BVHB 2XGMA 1R9JA 4MYRA 3TRFA 2ZRFA 1NMYA 2ZRJA 1UMDB 4HTAA 1YB6A 1XDDA 1OLSB 1NLMA 2NUTB 2WE8A 3EIOA 5AUOB 4I1PA 1U80A 1K08A 3HCBA 3THYB 2Y1XA 2YS7A 2ZJ2A 2AX4A 4P6VF 1X13A 4WSOA 4NCHA 2X19A 5J5VA 3S1LA 3SKVA 2BSXA 2C92A 1G7TA 3V1NA 4AECA 3SQMA 4K6MA 3ND7A 3TMYA 1G3UA 3WL7A 4ND8B 4M49A 1IJEA 3WKBA 1PZFA 2C8JA 3KUUA 1L7XA 1Q17A 2OEPA 2QM8A 2ZE8A 3D6FA 1WG8A 3UWPA 2E2WA 2YDXA 2DULA 4Q3KA 1OFVA 4OMFG 5H1YA 5EQTA 3T3MB 3HSKA 1DBWA 1XNRB 4B3TB 2BHLA 3ZK9A 3L7OA 4E2ZA 3DQQA 4TTRA 1YH3A 2FJUA 3IODA 4R6WA 1QYDA 1WMFA 2VH2A 2GZDA 3PK0A 1NNUA 4F1KA 4BLUA 4D4HA 1A7UA 2HMVA 3NC0C 4BB6A 3A31A 2F67A 5EZQA 1J20A 2ZIXB 2PE5A 2ZQYA 1GQYA 1YB1A 4D2IA 1A96A 4TKVA 3FKSA 1ZEJA 2BEWA 3ETNA 4D42A 2OO5C 3GCWA 4UZFA 3V8NA 2WICA 3P9IA 4QQKA 3R9KA 1N2CB 4K28A 4QA9A 4Y2UA 3M83A 2ZSBA 3OX3A 5JMPA 3WLKX 5FWNA 3JSAA 3S81A 5K20A 2DB3A 2OOKA 3SJCA 2IHBA 5KQGA 3H2BA 4KR3A 1D2GA 1OFHA 1QCYA 1Y33E 2Z3VA 2FOIA 2IYNA 4ARSA 2FSIA 2JGAA 2VG8A 2GPWA 4G01B 4PZEA 4E1BA 2B30A 1ZSNA 1C2TA 1FNSA 2IPAB 1NI4A 1T10A 1YA4A 2R65A 2WK1A 3BJRA 4M0EA 3TDNA 3TOZA 4ASUD 5IM4F 1OLUA 4AF6A 4DJEC 1QIKA 1IQRA 2XD9A 1VSBA 1ZMXA 1EM8A 4BL5A 2WNSA 1PK9A 5KQSA 5ALEA 5F4ZA 3N8DA 4RY8A 3QSYA 3FHCB 1JJIA 1DINA 1ZVJA 4EUHA 4EYOA 3ZS9A 3BD8A 3S6JA 4B32A 2N0SA 1FZQA 4RYLA 4RJTA 4KKXB 5A62A 3ZJTA 2WSSA 1JQDA 5CTJA 3DUFB 2PNJA 1DUIA 1KJYA 3MELA 1YQWA 4KRXA 4MZDA 1W52X 3EUEA 4JVSB 1LV7A 1GDHA 2FX5A 1I3CA 4RA9B 2D13A 3H5NA 1PR9A 5KQPA 4Z5XA 2J59A 4MKIA 4V0QA 2E9SA 2GPSA 5KYXB 1Y6RA 5B4UA 2VBGA 1JSZA 1E4OA 3AR2A 3KR9A 4LPSA 3JQBC 1SCNE 2EBWA 4RTPA 3WIUA 4KWIA 5KWIA 4Q9HA 1JWBB 4YAIA 5REQB 5EEHA 1GN9A 2HNKA 3OF3A 2C31A 3IOMA 4DM3A 1BWRA 4EVRA 3VUFA 1Y3AA 2D3WA 2R96A 1SKAA 3EGIA 4I5GA 4RZ3A 2OGUA 4TRJA 4XTRA 1FLVA 2HO4A 3K2QA 1BGWA 5DI3A 4CM7A 1GG2A 3V8QA 1RKBA 4JJEA 4BYMA 3REOA 1OD6A 3R5XA 4ZOQI 3T15A 1U2PA 4WDRA 1RRMA 1EFAA 1JJAA 2COKA 1QP4A 1BQEA 3OCCA 2XWPA 3KYJB 1QLHA 2HLNA 5EAIA 1RE0A 1VLJA 4MW4A 3TOSA 5JADA 4GR4A 3AB3A 1BJRE 2PO5A 4GVXA 4R1TA 2B1QA 3HE3A 1CERA 4ZCLA 2FPPA 4UHDA 1KMCA 5BN3B 2FSGA 1E9AA 2AQKA 3FFAA 3RUAA 3P4YA 5C81A 5FX2A 2OYCA 1FSFA 3QHQA 1F0YA 3UC9A 5IKXA 4MPPA 4WADA 3I92A 4MV8A 4GRIA 3PXGA 2VK4A 3IJEB 1U2ZA 2RKBA 3LG2A 5F1YA 1Y82A 3RV3A 4CIBA 1HDRA 3ORRA 3QE2A 1P5RA 3HJRA 4AXXA 3AG5A 521PA 5KVCA 1RC0A 4OHUA 2FF7A 5CLIA 4R2KA 3D6AA 4X6XA 1ZIPA 3S70A 2C2GA 3LE8A 1U2DC 1PS8A 1CQZA 2IODA 2IHUA 2IGBA 3B1FA 3VMFA 1WHTA 1UM9B 1GZ6A 3RC8A 1BMTA 4OFBA 3RIHA 1FIUA 1FFAA 3DBHB 4NCXA 1POWA 4E22A 1IY9A 2QAGB 4MJ7A 4B84A 4XJXA 4J16A 4JBYA 2VJQA 3CLKA 1SZPA 2POQX 3OQPA 3GDOA 3DZCA 1NXXA 1X7DA 3GT0A 2IUUA 3MJSA 4JT4A 5CVUA 3WDSA 2BDTA 1QZXA 3KXLA 3OD1A 4FNAA 4G24A 4MUIA 1D6MA 4TV8F 3RSGA 5ANRB 1SU6A 1ZD8A 2JJ8A 1BE1A 3CEJA 4O2BB 4ZVTA 1VPTA 2GGSA 1WXFA 5HOQA 4X5OA 2XLBA 2C2KA 3NVDA 3KM0A 2YJTD 3TGWA 2HK7A 1JG3A 3RUFA 4BNZA 3HLKA 1EG7A 1GZ7A 2GM3A 2VT7A 4LF8B 3JZDA 4TMXA 1HA3A 4DN6A 1DAKA 1QVWA 2P90A 3DR3A 2R8RA 1VA5A 1CBUA 5B3JC 4Z4IA 2X4IA 4QG3A 1RCUA 4QL3A 3FF4A 5DCUA 4A91A 2ATCA 2FR8C 1KOFA 2RIRA 2D06A 2PSFA 2Q0HA 3HDGA 3N0XA 4NVRA 1QVAA 1U63A 6ADHA 4PAQA 3FGOA 3NBKA 4ED9A 2O19A 2ZP1A 3F49S 1MABB 1UMCA 2QR5A 3EA0A 4XFDA 2BGTA 5IABA 1LDMA 1QJ4A 1KSFX 3ZXXA 4EKYA 3K0SA 2ECPA 4Q05A 1X1AA 3BDAA 2ONCA 2O7QA 1P62B 2MYTA 2VPWA 2E37A 2ZETA 4FDVA 4P84A 5JQGA 1T91A 3PQ6A 4HDQB 4MVJE 1DBPA 1JHXA 2BFCB 2V5UA 3FTFA 5IVPA 3PX3A 3R20A 1BX1A 4B71A 3TZEA 2D0DA 1SK9A 4PSAA 5IAGA 2R1ZA 5H7XA 1JEYA 3EXEB 3H2IA 1JQEA 5DYGA 4MWBA 3FZEA 1SUIA 2HT6A 4I4TB 1UPAA 1UZUA 1DKMA 2ZYIA 1M5TA 4MVWA 4QTXA 1QYXA 4JBNA 2G9NA 4LMAA 3FTEA 4AY5A 1T9GS 3PBKA 3QJYA 4N8SA 4X84A 3NBZC 5ICFA 4BO9A 4XAQA 3ZDYB 3HDTA 4IQGA 1MIHA 2H08A 2VTVA 3RVDA 4UJ3A 1Y5NA 3HDYA 4NBRA 3NOXA 3ABSB 1YJ8A 4LJ4A 5FP0A 4D9CA 5JNRA 4XVQA 3G23A 1I4EB 1OBHA 3C14C 2VJKA 3FI0A 3HACA 5FBRB 4XDHA 3FOZA 1QG0A 3B1JA 1CUDA 3KL4A 1C9YA 3MFQA 2SKCA 1WVIA 1ZJZA 4MYHA 3NV9A 2Q49A 1BXGA 5EESA 2J45A 4IDQA 1TM5E 4OJYA 5CGZA 2OG2A 5HW0A 4QPJC 3VYWA 2O1SA 2DHDA 3ZWBA 5KKAA 1Y4UA 1RQXA 1QFXA 1XPUA 1NV8A 4MUKA 3ZWPA 2BEUA 2QRUA 3QE0A 2WUWE 1J22A 4KXLA 1KI6B 2ZDGA 4TT3A 2G17A 4NBKA 3EEBA 1FS5A 3CE9A 4UTXA 4G84A 4PICA 3RSSA 3KLNA 1P5HA 3UGTA 2XNCA 1IN1A 4HRXA 3O2SB 4KXWA 3S2YA 1JG2A 1L5MA 1T2DA 1B6SA 4OP3A 1YRLA 2NTYC 3R8FA 2P4QA 4DRXA 2AG0A 3A9CA 2PUBA 2QW1A 1Z35A 3ADKA 2BGJA 2BDUA 2PRSA 3EFHA 2UYOA 4FUTA 4PAWA 2BDEA 3R41A 1MRNA 1HO3A 1G5IA 4QBIA 3QLVA 4FNGA 4LS3A 4E4RA 4P0QB 3K70B 2RFLA 1QFJA 3B5JA 3IAEA 4OQNA 2WHEA 4QBFA 2WIDA 3WL6A 3I4FA 1ZJ5A 4Z86A 3A2LA 3B6MA 3HHPA 3QH4A 1ULHA 3SEAA 3CRRA 1OXSC 1TTPB 2HPVA 2OBLA 3JZAA 2BYTA 2HU2A 2DR2A 1RBZA 1Z6GA 4S1NA 2I6GA 1RXUA 4ID3A 2C7OA 4HHEA 4RGBA 1MF7A 1GV1A 2JGKA 3F6PA 3T0GA 3TNFA 4BATA 3WJ2A 3KOOA 3I1YA 3RAGA 3RH0A 1JF8A 1OXMA 1WMBA 2F1JA 3BXOA 4KREA 4LA4A 3Q41A 4PVDA 4GD3Q 4BU0A 3P8ZA 2GQ0A 5HXAA 4LVCA 5BYJA 1DSSG 3KZOA 3FLMA 4YBZA 2A5JA 3ABOB 1N0HA 2G06A 3KLMX 1N9KA 3Q0EA 3H97A 2VS1A 3L40A 4LJ7A 3WK7A 1OVGA 3WOHA 3ZWMA 1BCRB 3INNA 3VX4A 2JBWA 3L02A 3I53A 4HLNA 4B4WA 1F2TA 1L0BA 3K0AA 2GKSA 3N2IA 3NDRA 4TN5A 3ZK8A 2Q1WA 4ETNA 4CKYA 2XE8A 3GELA 4MCAA 4MEBA 3ED5A 4ZYXA 3CUEF 3VOAA 1X1DA 2I1VB 1KI9A 3A6LA 4S0ZA 4DQLA 1Q1QA 2P5YA 4BAGA 3IALA 5KTMA 4CMKA 1NJFA 3CE6A 1G20B 2IIVA 1CF2O 1NQTA 2G1KA 3U56A 1AB5A 5D7NA 1XTQA 4ICIA 5A0TA 4DE5A 1FS6A 2AF3C 2QTGA 4OQLA 1ZC3A 1SBZA 2YX1A 4FC7A 4LE2A 1GRRA 3QLJA 3Q7QA 1KY5A 1YASA 1C30A 3MK31 5GMOA 3R7BA 1DE0A 1GYRA 1KFCB 1MJGA 5H9WA 1ZH0A 2AJCA 4C5BA 3K1ZA 5IKEA 4P7GA 5IUJC 1AURA 2PYIA 4WNIA 4WOJA 4DQKA 1QIJA 1KRXA 2R8BA 1G1AA 1FJ2A 1XMSA 5EXTA 2H31A 3KSRA 1EAMA 2HYDA 2JGFA 4JNKA 4L8WB 4LRTB 4ZOBA 5H82A 3C7AA 1C3VA 4OU5A 4V0SA 4AKSA 2FZCA 1V8PA 3DMNA 2FVXA 2I3ZA 5WRFA 1S2LA 2ZOSA 1JPVA 2QM0A 4EW6A 2H4FA 4JYPA 1NN3A 3OZIA 2QVYX 3N8IA 2PGNA 2R62A 3IUPA 1HSOA 2OORC 4O63O 4OHCA 4AK9A 5AVVA 3KTOA 4DLPA 2OAP1 1OXXK 1KXZA 2ZJAA 4FWIB 4KXFB 5BSRA 4LMPA 4MDEA 3ICVA 4HYYA 1EG2A 3DEIA 3TW8A 1N7IA 1O57A 1Q44A 1RMTA 3BWXA 3NHRA 4G67A 5BN5A 1C0LA 2ETVA 2DQZA 5FAKA 1GSIA 5L95A 2L17A 1NYRA 3NAQA 2ID9A 1USUA 3OA2A 2QMEA 4O3MA 1I80A 4JUDX 1V47A 2IYPA 5A3JA 4OXYA 1QJCA 1DMSA 1I2AA 2JNWA 4FD3A 1S2DA 4LWQA 1EB9A 2QUKA 1ZJ6A 3MMPA 4IIJF 2QMQA 3B51X 4DYHA 1V16A 1MXFA 1R3DA 1DDOA 3GUYA 5D1HA 1ZSYA 5IJAA 4PGAA 4MS4B 3IBTA 3OPMA 2BPOA 1M1YB 4K1XA 1BE0A 4EJ0A 1WF6A 3C3XA 4MS3A 5F7OA 1L9XA 2E4VA 2FN3A 3AIIA 3LVFO 4NE7A 3O84A 4HMPA 2GNPA 4ZAGA 3DAPA 4CFSA 4DCSA 3O3OB 3QHPA 2B25A 4K5QA 4ZKDA 2GCEA 4QZVA 1VKRA 2VQ6A 1QKKA 3I9FA 4UOZA 4UCWA 2CZCA 2H1RA 2OFXA 5E2IA 2AXQA 2VO1A 3F2IA 5EMHA 2ZQZA 2X5OA 4KQGA 1AN9A 4TS9A 1QZ3A 4F45A 5K03A 1GNTA 1PF7E 3BRSA 3A6KA 4HAYA 5BMVA 1TZMA 4F04A 3HJNA 1J99A 3OOEA 1T5LA 1E6KA 2W22A 1R16A 3T34A 4U2GA 3EAFA 1E9VA 1NY6A 2OV6A 1M8FA 1J9ZA 3N76A 3GFVA 4D3SA 1AIPA 4F56A 3KEGA 1M2WA 1ZCBA 1C4XA 1O4VA 3QMWA 1D6NA 3R6DA 2ZBFA 3SN6A 3H2GA 4UBOA 3K0BA 3LLCA 2IFTA 3QVSA 1KIMA 3NRCA 4A0SA 4CR8A 2RAVA 2C9OA 1FXWF 2ONKA 4KWCA 1ZHHA 4O2RA 5DBIA 1RM3A 4JEHA 5ALZA 2WIGA 3EQZA 4H3VA 3LKVA 1CEYA 2YHUA 1TQ8A 2R4TA 5CBPA 4HNQA 3OFSA 5H4GA 2A6PA 5AXBA 1VSVA 5BSKA 2JAUA 2E4WA 2JD0A 2FPGA 5ES3A 4BCDA 5D3QA 2F4VB 3A28A 1UJ4A 2I6UA 4PZZA 2X5XA 2QD2A 3MA0A 3WFIA 1NXWA 4I5IA 1KMQA 4DZTA 1B16A 3MTIA 4CG3A 3IUSA 4ZI7F 3TUZC 3L0SA 1FUEA 2WWTA 5DX8A 1FDRA 4M7OA 5DWDA 1FK8A 3GDHA 1MJGM 1NSFA 1PX0A 2O2JA 4BV3A 3TS1A 4CUKA 2WILA 2X5KO 2IXTA 4EZBA 2ZVQX 5JEEA 3I8SA 3TTWA 1ZH4A 4FGLA 4J4HA 1CQPA 2DY0A 2V45A 2N1MA 4ILKA 1MAWA 4EYQA 1WW8A 2AJ8A 1LEHA 2F1KA 3ZWAA 2ZU0C 4YRFA 3C7TA 3T3GA 3PEFA 5CFOA 5IX8A 3FFBA 2CXNA 1G4HA 1U6KA 2E4XA 4KDCA 5D3KA 3RS2A 5KX5B 2P8JA 2XWSA 2YFHA 4M0DA 3T3DA 4FCCA 3GIWA 4QUKA 1TIPA 2AN4A 2BM8A 4B87A 5IANA 2IE8A 2ZKIA 5FB3A 1Y8RB 1EPUA 3H11A 5EY5B 3QQ5A 1Q7EA 2VWPA 5DIFA 5C0OE 3QE9Y 4CU2A 4N5MA 3G0HA 3H5IA 1KKUA 5HMMA 2C59A 4HOYA 1W2GA 1WZ2A 2Y1WA 1KEVA 1VL0A 3DBLA 2JI7A 3B2EA 3GFBA 4A6XA 5JT1A 2GEDA 1YS7A 2ATIA 3TL2A 4Z7OB 1J24A 2BMAA 4M22A 1I13A 3ZKAA 2YWJA 5ALJA 3TZHA 2DE0X 2JD2A 3K4PA 2VP3A 4Q4LA 8AT1A 1TB4A 2AR9A 1U9YA 3JAWA 4K9LA 5CIWA 3E22A 3RHFA 3ZIAD 4EB8A 2EKPA 3GEEA 3GVIA 4I55F 4H1WA 3H7AA 2H2HA 3E1KA 3F71A 1B3RA 3IX7A 1QE3A 4FMDB 1N5LA 1WDLA 2PXAA 5FTLA 5IYZA 1J90A 1VJ5A 3HRHA 3VXKA 5B3AA 3ZCUA 3WB9A 4CG0A 1JBKA 4OMCA 4IF4A 4YK7A 4BO6A 4CLOA 2V7WA 1RRPA 1N0UA 1R4AA 3MCTA 2BTOA 4WZBE 3SY8A 5MGNA 1J9EA 4GPIB 1QHHA 1DJOA 2JJMA 4MJ3A 1IG0A 4W1RA 4O3FA 5IZ4A 5LWQA 5K0ZA 3NHUA 4G5FA 1XTRA 4H9GA 4D8TA 1JG6A 1XAHA 5AM5A 3DCIA 3DHVA 2FG6C 3JQ6A 3ZZTA 1V11A 1Q21A 4XIYA 4OBWA 2CWWA 3FNQA 2WJYA 4G5RA 3ZPXA 3QZUA 2GHQA 2QLTA 2GOYA 3K20A 3KZVA 3PPIA 1ZZGA 2BF4A 1CRZA 4R9UC 5JE8A 4JC8A 4YJGB 1P29A 1E20A 2JGIA 3LCRA 4XUCA 3VAAA 1M1XB 4M1WA 1A8IA 3QF4A 4O5OA 1JNYA 3UWDA 3T5DA 2JLWA 3ZIDA 1NQWA 3ERCA 5H3HA 1B2RA 1KEUA 4UCQA 1Z0KA 3RVKA 2OQRA 4YP0A 4M36A 1XLVA 1N1GA 2B8EA 3WRYC 1DC6A 3Q9LA 1RTTA 5BSUA 1PUIA 4Y6LA 3BMCA 5D6NA 4ZK6A 2V4MA 3KQSA 2HXSA 1Y6ZA 1I2ZA 3MS7A 4MLCA 3VMMA 3I5XA 1L8XA 4H3KB 4E33A 5EOVA 5ALNA 1ZOLA 2B8NA 3HMKA 3NVMB 2DSNA 1JAXA 2DP4E 3A1UA 4D9NA 4Q12A 4W4TA 2N47A 4ZALA 1V7QA 2LGJA 2UUOA 1STOA 1X94A 1XTVA 2EARA 2Q8QA 1VL8A 3EZLA 2Y77A 2O2CA 2DPHA 3BQMB 1YC5A 1RYDA 3FRJA 1ODCA 3JQAA 3N3BC 3QMPA 2QN8A 4MNTA 2GASA 3VHLB 4EYSA 1M6HA 3NHLA 2XVYA 1E94E 1VL2A 1YR3A 3KLPX 4NYMQ 3G2MA 4YB8A 4FHFA 4XCQA 3R7LA 4LQ4A 2HQSA 4V0KA 2PZEA 3DBIA 1NJ2A 4BMYA 3I09A 4RPCA 3ZX5A 2IHVA 1XU7A 3UMCA 4JLDA 2V3VA 3NUQA 1QDLB 1PZHA 2Q41A 4RVFA 4I2NA 4U39A 3T4UA 4BKUA 1A7JA 1NFQA 2QEQA 2PU5A 1RM0A 2XADA 2CLSA 4GBMA 4NH0A 5K0GA 1YV9A 3B1VA 3O4GA 3TTXA 4D8YA 4R83A 4LZNA 1B26A 1OX5A 4JLJA 3Q7EA 4FJ1A 2B78A 1LLUA 4LMBA 3G3EA 3T5PA 1WHSA 2F1IA 4PNEA 2J0VA 1CJVC 1XC7A 4B45A 3FIUA 2HJSA 5GY7A 4UM9B 2IPMA 2I54A 4M83A 3PD0A 3JQ9A 1XKTA 4F21A 1SG6A 4M8KA 5AHWA 2AZXA 1IOZA 4G3XA 3BT7A 3GRZA 1R5NA 1TU4A 3KSBC 1H6DA 4MQBA 4MWGA 1XWIA 3CKMA 3CUKA 4WZAB 4LXIA 1KI3A 4ETWA 3T3PB 2YVLA 4F9EA 2H16A 2G0AA 2GBCA 4R9RA 3E70C 3GLGE 3QKRA 3NBAA 4QVGA 2VXCA 3DZDA 4O4HF 1IM8A 4LKOA 2AEFA 1T9CA 1X7WA 2BUBA 2H7XA 2ZE7A 3WIBA 2NU9A 1M6WA 2IQ5A 1U81A 1JHDA 2C8LA 3OIVA 3OZUA 4GGOA 3PDUA 4HQKA 1BH2A 2IVFA 1A5TA 5C2JB 5K3EA 1XOIA 1ORVA 4HDCA 1GAXA 1RYNA 4XDYA 4YT4A 4UM9D 1GQFA 2OGTA 4J6EA 3R44A 2LPMA 4HFNA 3RU9A 2G71A 1IB0A 1I3LA 2C5FA 3O75A 1KI7A 1V5WA 3PHGA 3FTNA 3DMGA 3DVAB 3HVJA 3K9NA 3QBJA 4HWRA 2BGRA 5AJUA 4DPMA 1N9GB 1UWKA 2BFEA 1Z38A 1YDEA 4PCAA 1U8EA 3GR6A 2HMUA 3VPCA 3QTBA 2IIPA 4I46A 4KWTA 4DIFA 2VI5A 5T4EA 3VISA 3HM2A 2QT9A 4W1PA 3QXCA 4TYPA 3QYFA 2GRJA 5I3ZA 1XZPA 3F3KA 4Q00A 1NC1A 4H1HA 3B6KA 4DWVA 1EFRA 1URPA 1ZNQO 3E84A 3FIJA 3B82A 3N39C 4ZU3A 4MARA 4Q4DA 3VTZA 4BLOA 9MHTA 1VTKA 1ZICA 3BZBA 4RQUA 1C1XA 2QT0A 4RCVA 1AG9A 1XDSA 2PFGA 4PX5A 4WKGA 5JS7A 4MB6A 2WYUA 1OUMA 2DY1A 3RYHA 3OP4A 1J6UA 1N6KA 3FROA 1JJFA 1K5PA 1D9ZA 1T0IA 2XEXA 2GKOA 1Q83A 4LJ6A 4UHKA 5BWNA 9LDTA 5KSZA 3DXYA 5JI2E 1V96A 2Z43A 3LPAA 2VSXA 1DU4A 1TTTA 3O38A 1JHPA 4BUCA 4CV2A 1TMOA 2VJDA 4QNMA 1M1NA 1GL7A 2XZDA 6PFKA 4QUHA 2W6JD 1ZEMA 3HZHA 1VLZA 1WR8A 1BU8A 1JEEA 3TG2A 2VT3A 3ZD7A 1Q0HA 2EP8A 2PZBA 4H7JA 1DJLA 4F71A 4XM1A 4YUVA 5I45A 2XHEA 1RTKA 1KHHA 3LGXA 4A6EA 4CF5A 1ZGGA 4PQRA 4YPOA 2JHFA 2Y2UA 2R6ZA 1KZ1A 2PNFA 4NZNA 4KDRA 1JHOA 1AD2A 1BXRB 2HRRA 4A0HA 3QM1A 1YC2A 5KWSA 1JQ5A 3I37X 1YCHA 2HN9A 3U39A