1Z6YA

Structure of human adp-ribosylation factor-like 5
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
173
structure length
169
Chain Sequence
ILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQESLRSYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 5
publication title Structure Of Human ADP-Ribosylation Factor-Like 5
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 55
structure length 169
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1z6yA00
1U90A 3PEVA 4H1UA 1NF3A 5EE9A 4JLNA 3VKWA 1KK3A 5GJWC 5K8UA 5HR5A 4XSGA 3AVVA 3W8NA 1A82A 3AKCA 5SZIA 1KNQA 4PAQA 2NO1A 1EFHA 4XOIA 3K53A 4DSUA 2FJUA 3KUDA 5KDOA 4BPBA 1J8YF 5FPKA 1Q3TA 2ZAMA 1NIPA 3EXAA 1M7HA 3O8DA 5IRCD 5FBQB 4ZKEA 2QORA 1YZQA 1GDDA 3TUIC 1FZQA 2GK6A 5LB4A 1S1CA 4Q4AB 2QE7A 2D4HA 2ZUDA 3X1WA 1DAIA 4DCNA 4FINA 3TW8B 1E9SA 1A2KC 4A1FA 1XPUA 1KSHA 2PLFA 1GITA 2BEKA 4JL6A 2P2LA 5FL7D 2OXCA 2ZYTX 3GJ5A 2XOKA 3PXGA 5FL7A 2GJSA 1TF5A 1VCOA 5GVSA 5HE9A 4OJKA 1GOTA 5FOSA 3I4LA 1OXTA 3VHXA 2AHOA 2IK8A 2EFEB 4LJ4A 4K8OA 1IOZA 4YDHB 3I92A 4LZZA 2QGZA 4B3DA 2X2FA 4P3YA 1M2OB 3U7HB 3WMGA 2PMDA 3ZVNA 2VHCA 4C0BA 4YMTA 3SNHA 2F43B 2PLRA 4ACBA 3HPRA 3KB1A 2WWXA 4AY2A 2GCOB 3QXCA 3A6PC 4O25A 3AKDA 3SBDA 4L16A 4P33A 3SYLA 4JZKA 2V1UA 5EXSA 2REXB 3P1JA 2H57A 4M21A 1GTVA 2Z6VA 4D0NA 5DI3B 2R2AA 2VSOA 2VLIA 5L8VA 4B6FA 2ONKA 2QQEA 4Q4HA 4TYWA 2WIBA 1YR7A 2BJWA 1D2EA 1NP6A 2RKOA 1DAMA 1JXOA 4C30A 1XEFA 2RHDA 3U3KA 1ZIPA 5J47A 1E94E 3GMTA 3RAPR 4GOKA 4CEIA 1GRQA 2OLJA 1G17A 3CPJB 4N1AA 5KDDA 4HZUB 2IYZA 3FWYA 3QKRB 4J0QA 3GLFE 5FOXA 3GJXC 2DPXA 821PA 3QKSB 4QJ3A 4B43A 3BE4A 4EDHA 4G0NA 2O8FA 1TQDA 1KSGA 1BKDR 3LXRA 1G3UA 4ARZB 1P2SA 4JS0A 5KSYA 2ZJBA 4BZQA 4HDOB 3T1QA 4EAQA 3TNFA 1FMJA 2O0JA 3CX7A 4FWIB 3Q5DA 1XXHA 2PZEA 1OH8A 3SJZA 4A6XA 4Q66C 2GZAA 1G6OA 3TAHA 3ND9A 2ZJZA 2YOGA 1OH6A 2WAXA 1Z6AA 3MLEA 1UBFA 3C5HA 5EZ5A 2LCFA 3BB3A 1AJEA 2ZEJA 1E2DA 2CCKA 2IW3A 3GLFB 1XMIA 1G291 2EFHB 3BRWD 4OQMA 2CHGA 2VH5R 3LXXA 2WWHA 3NTUA 4OHYA 4BFVA 3OIVA 3WMFA 3U3RA 2AKAB 3VR2A 4DBLC 2VHJA 5J4KA 2AK2A 1GNQA 1CBUA 4LK2A 3VU9A 5EXPA 2HYDA 4DLWA 2J5XA 1CR2A 3MJRA 5D3MB 3FMIA 4Q4JB 2HCBA 4TMWA 2WICA 4D2IA 1U9IC 1N6RA 5KU1A 4NH0A 3KXKA 2QBYA 3SE0A 2BV3A 1RJ9B 2AD5A 2IEYA 1JBKA 4BEJA 4M2LA 3PEYA 1HT2E 2AXPA 2HEIA 4KBGA 3Q5EA 1Q22A 3EIEA 3ZZTA 3NVAA 1GVNB 4GSYA 1ZM4A 2JAQA 5TARA 1YR8A 4EIWA 2O8DA 2RGBA 4B48A 3KL4A 1QHSA 3AGQA 1BMFD 1NY5A 3AVXA 2YWGA 3BC1A 1BMFA 3OHMA 3T5DA 4CEJB 1AKEA 3X1XA 3CF0A 2Q0HA 4DDUA 3U60B 3NWJA 5L3QB 4XIGS 3AQ4A 3EPHA 1YZNA 1ZCBA 3LW7A 4ABYA 2P6NA 3CIOA 4EPWA 3KXIA 5JECA 2JIZA 3CRMA 2VIIA 2OBMA 1G9XA 1I2DA 1MO3A 4HAXA 2WOJA 2MSEB 3PUVA 4IJMA 5KNDA 4HDQB 3MFYA 3SOPA 1GM5A 4S2EA 5DISB 2GXUA 3WRXC 4NCNA 2ZRNA 4ACAA 1U98A 4HAVA 3CBQA 3LH5A 5CM9C 4OHXA 5FI0B 4RZ3A 5G3ZA 1YRBA 4QJ4A 4D80A 3EPJA 2QMEA 2DCUA 4QL3A 2Z83A 1D6JA 3DHWC 4YQFA 3IBGA 3U3OA 4GI7A 1B23P 2W2VA 2GEVA 3DO6A 3P20A 1S4QA 2EYUA 1U99A 2HLDA 1RPZA 4HAUA 3VKHA 1N5LA 3AUXA 5CYOA 3LWNA 3M0EA 5FOTA 2EFDB 2Z5FA 1E2EA 1P2UA 3K9GA 4LRWA 3GLGE 2FDCA 5CK5A 3SBEA 5KHOC 1DG3A 1NVUQ 1LVGA 4CZ2A 2AK3A 2GK7A 1YHNA 4HZIA 2KBFA 4PC1A 1H8ED 2X77A 4LPKA 4XSHA 4DDWA 3NDBB 4GFDA 1H8EA 3AH8A 3SYNA 1NL3A 2ZS9A 2FOLA 2J59A 3MG9A 3LBHA 4LJYA 4M9QA 2ZUCA 5DH9A 2F1HA 3IUYA 1V43A 4NE2A 2X19A 4KO8A 4DT1B 2F43A 3B1XA 1IXRC 2TMKA 2GCOA 3GJ3A 4PHTA 3EZ6A 1EESA 4DLUA 5EXTA 2C98A 4OQXA 1Z63A 1N2CE 1Z6XA 2FSHA 2IT1A 4KFTA 5G53C 4O3MA 3O8RA 4PZYA 1E9BA 1QG4A 3RC3A 5DI3A 2OXRA 4HLUA 3HU2A 3BS4A 1MH1A 1Q3HA 1XDBA 1E9EA 3CONA 2QP3A 3EPLA 3FHTA 4ILEA 2HV8A 2UZIR 2J9RA 4R9UC 3GLGB 1YR6A 1YQTA 2ZI9A 5H1YA 4US0R 2JJ1D 1E1RD 2OSBA 2NG1A 2ERXA 4MKHA 2JJ1A 1E1RA 1E9AA 1M34E 3F8TA 3K9NA 2BMJA 5JJIA 2X1VA 1GUAA 2DBYA 1CRQA 5FTMA 4HZUA 5CLQA 3QKRA 5KTYA 4LC0A 1GKYA 3EZ7A 1F60A 3BH0A 3QKSA 4DDTA 2QG6A 3HYRA 1D5CA 4Q1BA 4XVUA 5CB6A 4DLTA 2GVZC 4RJLA 1E79D 4FW9A 4Z8YA 2CVHA 2ZSBA 1KI4A 1JQLB 4ARZA 4PQFA 4IDPA 1JEEA 1KAOA 2P65A 4XVQA 1MRNA 5SZJA 3ADDA 2J1LA 1Z29A 2REOA 3BERA 5KYKA 2PH1A 4JLKA 3C5CA 1D9XA 1TX4B 2RGDA 4OQLA 5FPTA 1W36B 3KFXA 2GCPA 2WIAA 4ZCIA 5AUQA 4D0GA 3UMFA 4M9SA 2ZROA 2FWRA 1KNXA 3P27A 4ESHA 3GLFA 1DTSA 3THOA 2BVNA 1A2BA 4ZPXA 1Q21A 2FPKA 4JLAA 2H8KA 3WYFA 1DE0A 2A5JA 1GL9B 3NBYC 5TV2A 4NPHA 2RGCA 3TQCA 2PCLA 4AI6A 1G7RA 5P21A 4D81A 1ESNA 1E2QA 4PC3A 3NBXX 4MYTA 5D3MA 1NNEA 2JLVA 2WJYA 4Q4JA 3HPQA 1LS6A 4AG6A 2UVQA 3CUEF 1KKLA 1RJ9A 1BIFA 3WP0A 1W46A 3AKEA 3QEOA 3VAAA 4LSGA 3A1TA 3U3MA 2DB3A 4MKGA 1NIJA 1EG7A 4PZZA 1X3SA 2PZGA 1CIPA 3QXXA 2GETA 2Q21A 3OEHD 3OFND 5GADl 4JT2A 1SGWA 2VRWA 1IHUA 3QI2A 2HF8A 3OEHA 1VMAA 3OFNA 3SJCA 4DSTA 1Z5ZA 4NP6A 3P4YA 2OCYC 4X8LA 5KPDA 3ZDQA 1XD9A 4JJZA 4CEJA 2IYWA 2FPLA 2J0VA 5CJPA 1BYIA 2YYZA 5L3QA 1OHHA 3W34A 1TTTA 3I5XA 2QAGC 2O0HA 5TMPA 1KI9A 1L7VC 1QVRA 3B1WA 3MGCA 4QC2A 4TMKA 3CX8A 2IYSA 3DPUA 5AJVB 2JLZA 5JFGA 1IJFA 1MRSA 4KCGA 1NRJB 1UFQA 4LV6A 5SZKB 1GIAA 1ZNWA 4TMZA 3L43A 3I8SA 2BBOA 5BN5A 1XBTA 2YWEA 3QG1A 3QEJA 4LPSA 4G5QA 3PENA 4PHGA 5G41A 2ORWA 4HUTA 1BS1A 2PZFA 2CCGA 2FGKA 3X1DA 3EIQA 4QNRA 1P6XA 1P72A 2QPOA 5F9FA 1E2KA 3BFVA 1ZM3A 1AM4D 2ZRPA 3JZMA 1L2TA 1M8PA 1XZQA 4IVQA 2F3RA 2ZR0A 3L0OA 4RZUA 4LBWA 3V4FA 1TQ6A 2GCNA 4EUNA 3AM1A 1XP8A 3GLHE 1Z0IA 2JEOA 3OIWA 5JRJA 2ZSEA 1OYWA 1SVOA 3BOSA 3QPUA 2JLQA 1JXMA 1FNMA 2BIFA 2H7VA 2OILA 1NN0A 2OE2A 4TLCA 2PEZA 2R6FA 3LLMA 2C99A 3QKTA 5LDDC 1MO6A 3I72A 2FFQA 2ATVA 5AUOB 3GQBA 3B13B 1OV4A 1SVLA 2RMKA 2FF7A 4OI4A 4EJSA 3NDPA 4KI0A 4DT1A 3PV0A 2CL7X 4EJSC 4OQFA 1XJ0A 2IYVA 1XWIA 2NOAA 3WBJA 3B2EA 4N0EA 1A5TA 2WWGA 1E32A 1XFAA 2D2EA 3B9PA 2IL1A 1JAHA 1FTSA 4RZ2A 4KODA 3Q3JB 1E0AA 1XEXB 1YZKA 3C8UA 3GLHB 2IX3A 4NYMR 2CEAA 3K0AB 3KFVA 4HATA 3GLGA 1XJCA 1R4AA 4QBHA 1SHKA 2CLSA 2QEQA 1E2MA 3KKMA 4HAWA 1FPMA 1YE8A 4P31A 4Z54A 1JR3E 4L5BA 2CNWD 2QMHA 2X8AA 3CNNA 2W2TA 2CNWA 3ASZA 2ZE6A 2WKPA 4RD6A 1VHLA 4PO8A 5J40A 4BLRA 3KB2A 4D82A 1KAGA 4M1TA 2FG5A 3FE2A 3PFIA 2OAQ1 4BQSA 3THYB 4MYHA 1Z2AA 4NCIA 1TPZA 4NYIQ 3NHAA 3NH9A 1ZYUA 4DEYA 2R6DA 2WJHA 1CRPA 4JL8A 3BFKA 2CL6X 3RSLA 1F5NA 1VG1A 3GEHA 3AF4A 1XXHE 4Q02A 3FPAA 5FOUA 2ORIA 5C1BA 3QF4B 2VSFA 1P2TA 3H84A 3BWDD 3QBTA 3D7MA 4IXMA 5G40A 1GAJA 1W36D 2NO7A 1GKUB 1N6OA 2IHBA 2Z4RA 3IHWA 1Q57A 1EXMA 2A5YB 3ZS8A 3DKPA 2GKSA 3KUCA 4LI0A 1WDTA 3P4XA 3R8CA 1TADA 2WJGA 2PT7A 1E69A 2IA5A 3N5CA 1ZUHA 2WWFA 1F2TB 2VA8A 4B3CA 3U2QA 2EQBA 3KZ1E 3OIUA 5J5CA 3IBYA 2F7SA 2WBLC 3NKVA 4W5HA 4MUAA 1IBRA 3UIEA 2PJRA 2AKYA 4UNRA 5KSOA 2EWVA 1XTRA 1NJGA 3I3SR 4JLPA 4I81A 1WF3A 1IXSB 4D0LB 3IIJA 4DZZA 1QG2A 2PCJA 2NO0A 4JLVA 1LY1A 2BC9A 1XNJA 4LC1A 3BD9A 5E7MA 4P4SB 5JI3E 4QFMA 2JJ2D 1J2JA 2H18A 3AGPA 5CIQA 3X2SA 1RRPA 3Q7QA 2IBMA 2XXAB 1NJFA 2F9LA 2L0XA 1N5JA 3FKQA 3RS2A 2NZ8A 1P9NA 2D3WA 2R65A 1KJWA 1H8HD 1S1MA 1KYIA 1S96A 1X1SA 2BMFA 2CHQA 3A1VA 4MKIA 1ZUNB 3KJEA 1H8HA 2LKDA 1UAAA 4NONA 3KKOA 1KJZA 4MRNA 4BRUA 3SN6A 3U3JA 4NHOA 4IFEA 5C4MA 2I1QA 1S0UA 1Y63A 2KJQA 4U7DA 4MRPA 3RANA 3MWLA 5EXXA 3TSZA 1R5BA 2QTFA 1P62B 1IAQA 2DY1A 3O8CA 2H92A 3IEVA 2XTZA 4TSFD 1N0UA 4C9BA 4DSOA 4TSFA 4AIIA 4DLVA 1KZGB 3Q85A 3UG7A 4E5UA 1HY3A 1IM2A 1KY3A 1Y3AA 1GFIA 2ZE7A 3B9QA 4KV9A 4MKFA 5D3QA 3TR0A 3TSWA 1A7JA 1BYUA 4B47A 4B75A 3CPHA 1AIPA 2LWIA 2REBA 4OYHA 3H86A 2WOOA 2OHFA 2QSZA 3SHFA 4DDVA 2PJZA 1E1QA 5HTKA 2CMKA 3MD0A 2OESA 1CP2A 3T35A 1YRAA 2ASEA 3IILA 1Z0AA 2RH5A 1ZNZA 4PC7A 2A7QA 3I8XA 3LDAA 4BUJA 3PEWA 1ZNXA 2ZRBA 1YR9A 3LW8A 4Q9KA 1ANKA 4ZI3A 1DVRA 1ZMXA 3DVLA 4LJ9A 1WE2A 1GL7A 4YC7A 1NVVR 2NO9A 1Z28A 1I4DD 1ZW6A 2ZI4A 3VNVA 2ZE5A 5DE3A 1US8B 4POAA 1RRFA 3CX6A 2AWNA 2DFLA 1K6MA 1AQUA 2AX4A 4B3XA 3DOEA 3I5YA 2ZSFA 4Q19A 4L9WA 2GJKA 3AB3A 5EE0A 5C4GB 3IQXA 3NEYA 5CYPA 1ZCAA 2OFXA 1X1RA 4IRUB 1L4UA 4LJ8A 2J3EA 1E9FA 4E22A 4EPTA 2NQ2C 2HDNB 3MWJA 3AF2A 3CKLA 5C18A 5BQ5A 1AGRA 1KI6B 5CJ2A 2BMDA 2R62A 4RCYA 4A36A 1Z0FA 3E2IA 4QBFA 1E3MA 1KI7A 1Z06A 5KSZA 1KIMA 3U6KA 4Q5IA 4V0LA 1UJ2A 2G1JA 2Q9AA 2RGXA 2WHXA 3R9XA 4QG7A 4IOMA 2VP6A 3PG5A 4Y0AA 1CF4A 1MV5A 1WA5A 4CF7A 5L3SB 3X1ZA 1PZNA 3CRRA 1I4TD 2GF0A 3IIKA 4EPVA 1WBBA 4UNPA 3HU3A 1XEXA 3MJHA 5CM8B 3LQRA 5HE8A 3GLHA 1P61B 4F7WA 2V9PA 1CEEA 1UADA 3K0AA 1F2UB 3JVVA 4CEHB 3FYHA 2EVWX 5EP3A 5C46F 1UPTA 4B3GA 4JVMA 1E2PA 2BHRA 4LHYA 2P67A 3VMFA 1FQJA 1M6NA 1P3JA 4XVRA 5F3WB 4QRHA 3THYA 3QG5A 2QENA 4YMSA 3RS3A 2ZRCA 1ESMA 2IXFA 4OHWA 1E96A 1DAFA 1ZC3A 1HA3A 3JZAA 5FR2A 4FN5A 2VPPA 5EE3A 3BB4A 2LKCA 4NCKA 4XWOA 3BAFA 4FMDF 1D8TA 3DZDA 2P5TB 1YZUA 4UXIA 1T0HB 4R71A 2O8CB 3QF4A 1F6BA 3SZRA 4WXPA 2XZPA 2QM7A 3UWKA 4G5SA 5LB2A 4PANA 3CRQA 5HZKA 5K8TA 4IW3B 2QU8A 4EPYA 1JR3D 3A4NA 3K0CA 3K0EA 1JR3A 1XD2B 1TQ4A 2E1RA 4IDNA 4B3FX 1RRGA 1PUJA 4RKFA 4AG5A 4MA4A 1H65A 4XWAA 3EA5A 2ZJOA 4QHTA 1FMLA 2GAOA 1OIWA 1AZSC 2BCGY 4I4LA 1F2TA 4BFTA 2ZRKA 4PO9A 4WOPA 1NMXA 4A92A 1G41A 5JLJA 1ZU5A 4Q7JB 5J4LA 2YV5A 1NLFA 2DWPA 4M53A 3EIHA 3FMPB 2VSXA 4DCVA 1U0LA 1QVAA 4QXAA 5FR1A 3LD9A 3A1SA 3EWAA 1RVDA 1NVVQ 3ZLJA 3IKJA 2OAP1 2WVJA 3WYAA 1Z8FA 1PLLA 4P4SA 2VP4A 2VF7A 4PSVA 4TMVA 5AJXA 4MITA 3LY5A 3R20A 1KI8A 4XTRA 3UATA 3WMEA 3ZD6A 1DAGA 3PITA 4IVPA 2XXAA 2WJIA 2ZR7A 2MSCB 3W90A 1NBME 5H8WA 2ZRHA 2ZIAA 1YZGA 4OKSA 4UNNA 4DB2A 1U2RA 1W5SA 2GAAA 2R6GA 3PVSA 1OXUA 1E6CA 4A8JB 2F3TA 1P4SA 4OK3A 2BM1A 1WP9A 4Q9IA 4LHVA 1G8FA 1N6PA 4Q03A 1QHNA 1CJVC 5EJEA 1HURA 1KO7A 2OZEA 3CNLA 4TMTA 1IQPA 3PUXA 4JVSB 3AVUA 5J4HA 1ZD1A 1SXJB 1TL7C 3RRNA 1CJUC 3FFBA 1Q20A 4W5WA 1ZM9A 5KDLA 3K70B 1RZ3A 1T91A 4G1UC 1FUUA 1XTJA 3DOFA 2ZRJA 2IWHA 4JLMA 3BBPA 1DAKA 4MYCA 4GOJA 5EE1A 1M7BA 1KO1A 2V54A 4TL8A 1VECA 4P0TA 1G64A 1DBSA 3LX8A 1SKQA 5IT5A 2IF0A 2XITA 2NPIA 2IWRA 1R5NA 4PX9A 3SR0A 1OFTA 3B1ZA 2FZ4A 1NVXQ 1YU9A 1OFUX 4TTPA 2DFTA 4PHFA 4AKEA 5JEDA 3D8BA 2A2ZA 4M4SA 1TAGA 5M04A 3UPUA 3LQQA 1TQ2A 2IUTA 3LX5A 3L0PA 2F9MA 4W7SA 4C2TA 1OXSC 4DC9A 2VEDA 4LBYA 4LHXA 3R8FA 5KO2A 2PMKA 1US8A 5HCNA 4YDSA 2G9NA 4NTZA 4D4KA 1KMHB 3SQXA 4UJ3A 3FHCB 3M4YA 1HUQA 4M9ZA 4RFSB 4D4LA 2D62A 1G5RA 3BH6A 5DHAA 5DIFA 4UXJA 2B21A 2BOVA 4FCVA 1KDTA 4MUBA 5A4JA 5IF9A 1T0JB 3VR4A 3AVTA 4Q4AA 1IONA 5FPYA 4Q9JA 3DZ8A 1Z0KA 3CF2A 1KI6A 2WWYA 4D26A 4B74A 221PA 2QQ0A 4OQNA 4M1MA 1N5KA 2QNRA 1J7KA 2CVFA 1AZTA 3SFZA 1JQJC 2Q6TA 2D74A 4Q7KA 2HF9A 2V55B 3GP8A 4PPNA 1QHGA 5L3SA 1OSNA 4L8GA 2F1JA 2BJVA 2NO6A 3ADBA 3TVTA 2ZJ5A 1WCV1 4OI0A 4XH9B 4TYYA 2Q9CA 1Z83A 3PUZA 2OV2A 1F2UA 1KI1A 2W83A 3THWB 4CEHA 1T5IA 2HXYA 4JBXA 4EPXA 1R8SA 4TTRA 1I4LD 3VKGA 2ZVPX 2W6JD 1ZNYA 4W5JA 1EK0A 2W6JA 2DWOA 3TAUA 1NSFA 3W5IA 1SVSA 3GD7A 3PUWA 2CLDX 5E7IA 3W6OA 5LBIA 1KHTA 4M22A 2CDNA 2VHQA 2DYKA 2ZVQX 5JZVA 1OXXK 1JPNA 3GCGA 4DLRA 4A2QA 5K8LA 2G0TA 5AJZA 5DSZA 1QHIA 1IN6A 3RRYA 4HLUC 3A4LA 4LGMA 3X1YA 3ICEA 4C0KA 1II8B 3C4JA 1OB5A 1OB2A 3EPKA 2O8CA 4PC6A 5KNCA 2VP2A 2MMGA 3CB4A 3P32A 3W3AA 4LOAA 3LBIA 2NTYC 5JWOA 1EFUA 3NEJA 2I4IA 4BFWA 1DS6A 1LF5A 3CZPA 4RD1A 5IHPA 2ORVA 2AWOA 4X8HA 3KQLA 2VYFA 4HB0A 4GZLA 1OH5A 2ZI7A 1XD2A 5GJBA 4EJSB 1CJTC 4A0HA 1UEIA 4URXR 1VDZA 4RD2A 1RYHA 3BB1A 1S9HA 1VYUA 2QP9X 4Q4LA 2QMUA 1AGPA 3AEZA 4Q01A 1E79A 3FGNA 3G0HA 2A78A 3BFXA 3GJ7A 4ASUD 5DYIA 1ZU4A 4PSAA 3D31A 4BLOA 4BE7B 1RC8A 1MO5A 4FMDB 3SFVA 2Y8EA 4JT4A 3QIAA 4ASUA 4B2PA 4CT5A 5J4YA 1Q1EA 3EC2A 3TR5A 1PLJA 4LYFA 1MOZA 1W1WA 4NBSA 3UKDA 1Z0DA 3FMFA 2QT0A 2ZJ8A 3MRSA 3V00A 2QAJA 2VHUA 3C15C 5KPJA 4JKIA 5CB8A 4FWTA 2GWHA 1KOFA 3GJ0A 2VHTA 5FTKA 1HT1E 2KB0A 2ZRGA 5EQTA 3WXMA 3ZS9A 4C0QC 3OZXA 2C77A 3DMNA 2N42A 1E9RA 2OCAA 1SVIA 1UBEA 4IFBA 4CRWB 4AKHA 2RGNA 4UNQA 4IOLA 4JJKA 2B7BA 4KLNA 2NZJA 4A8JA 4ERNA 2QRNA 3S1AB 2RGNC 4ZIRB 3QUSA 2V6IA 3SS8A 1VCMA 5SZHB 4DRZA 1R0WA 1AA9A 3P26A 3LRPA 5DO9A 5JBQA 4KU4A 1IN7A 5BXQC 4QGFA 3AF3A 4ZI2A 1SXJD 4IDHA 1SXJA 3IPYA 1AS0A 2AL7A 721PA 2O0KA 2W6ID 5BW8A 1WMSA 3K70D 5BWMA 3T1VA 1EFTA 2W6IA 4HSEA 4TL6A 2GXAA 2F55A 1N3BA 3O8BA 3EAQA 4QHSA 1F3OA 421PA 3IQWA 4NYIR 1GG2A 1FL9A 1NBMD 5CLLA 4PTLA 5HZHA 2ZYWX 1NBMA 3KKPA 2XSZD 1N6KA 4P4TA 3TUJC 3MUFA 2OEPA 3MAAC 1E9DA 2XSZA 2YWHA 4DCUA 1ZC4A 3TK1A 4ZDKA 1G16A 2H16A 4EFMA 2QMOA 4W9MC 1Z08A 2OG2A 3ADKA 1SKYE 2P3SA 3CWZA 3GLIE 1N0WA 1TMKA 1G18A 3BGWA 3TJZA 1DEKA 1GL6A 1UBGA 4B6EA 4AURA 3FOZA 3KQHA 3ZVMA 4DWJA 2ZU6A 4I1SA 1SULA 2QT1A 4OK6A 1LS1A 1QHHB 1Z07A 1OT3A 2FFHA 4XD7D 3WP1B 1N6IA 3U44B 4DIDA 4XD7A 3EA0A 3SYKA 3K0SA 5LD2B 1KMHA 3A36A 2IS4A 3EZFA 2CLCX 4BWYA 2IS1A 2AXNA 4RFSA 1NN5A 2G0NA 3HP1A 3B8HA 2OBNA 1Z0JA 2FN4A 4AYWA 4MQBA 3EZ2A 4MRRA 2QZ4A 5EP1A 1CS4C 1GNPA 4TLBA 1G3IA 1ZM7A 4FXPA 3TQFA 1DADA 4DEXA 2XX3A 2A30A 1S9DA 4PAOA 3RNLA 4PC2A 2ZANA 2GJAA 5FPSA 4H9GA 3ZVRA 4LHZA 4B2LA 2JATA 2HYIC 1A4RA 4JL5A 1JNYA 4GP7A 1FTNA 1EFRD 1SKYB 4IEEA 4ITRC 2D7DA 3I62A 3EASA 3LV8A 4JBWA 3GLIB 4ESVA 1EFRA 1DPFA 3VR1A 3OAAD 2ZYVX 1XF9A 4V0NA 1E2GA 2JA1A 3SU8A 2IHYA 3OAAA 1X8LA 1WBDA 3ZD7A 3BORA 2Z0MA 1UKZA 3WY9A 1CJMA 1JALA 4RD4A 1N5IA 1QHXA 1FP6A 1G21E 2H1LA 4Q1FA 2EWWA 3ZZ0A 3THWA 1RRCA 1NKTA 4MRVA 2Q3MA 5JI2E 3CWQA 4ZDJA 1S3SA 3CRVA 1B0UA 1G5TA 1YJ5A 3HJNA 2W0MA 3DEFA 5JEEA 2QGNA 2IEZA 4B3BA 3KKQA 3QPVA 4NYJQ 1QRAA 1M7GA 3HYTA 2F1IA 4EQ6B 4EFLA 3B82A 2ZS8A 3ND8A 1T5LA 4V03A 1AKYA 3UWOA 1Z6GA 3SJBA 2GZDA 2BBWA 2J7KA 3TRFA 4NL4H 2W2XA 1UBCA 4FD2A 2MSDB 3I61A 3H0KA 2WMOB 4QBGB 2HXSA 2ODBA 5AUNB 1II8A 2O52A 1T6NA 2Z43A 4X8OA 4BFYA 2P6RA 1XU4A 4HAYA 5AJYA 4IKEA 2R44A 1N6LA 1VKJA 1COWD 3RLFA 4CDGA 1U8AA 2ZI5A 1S3GA 5FBWB 1IN8A 2FSFA 2PBRA 4JVNA 2JLWA 2FX3A 1FFHA 4IDOA 1X6VA 2QL6A 3T61A 2AD1A 1E98A 4F4IA 3PIRA 2W58A 5DGXA 4URYR 1HEIA 1JJVA 4JSTA 2ZREA 2XTNA 4Q9HA 5K8IA 3U7GA 3TMKA 4OHZA 3LVQE 2B8WA 5JHHB 2X2EA 1OPXA 2W00A 4RCZA 2XEXA 1M1YE 4R2HA 3IEUA 2ZR9A 4G5GA 2C9OA 2BMEA 1KO4A 5F2EA 2H5EA 1KDOA 3LNCA 3AF0A 3V4RA 4MGZR 1P2VA 3CNOA 6Q21A 2NIPA 1XJQA 4K46A 3UANA 5FOWA 3ZZUA 4LV5B 4QGGA 4F93B 1XTKA 4A0RA 1TUEA 4ON9A 1OJLA 2ZE8A 5JCZA 3EARA 1W36C 2YC4C 1RKBA 4PPGA 3Q7PA 4LY6A 2WKQA 5FBVB 3LVRE 3OEED 2QTHA 1CTQA 3LBNA 1KZ7B 4KVGA 3OEEA 3TIFA 3ZGXA 4MDFA 1QHYA 2JDID 1XB2A 4IDQA 2JDIA 2ZPTX 2WTUA 2ATXA 2XJ9A 2KE5A 1S2MA 2DR3A 2ZYUX 3CPEA 2IYXA 4FI3C 4KAXA 5FBRB 3PJRA 1E99A 2C8VA 1JI0A 3B60A 4OJQA 3S1AA 4V0ME 2HT6A 5AWFC 2GBLA 5JSZB 4NZYA 1E4YA 3B1VA 2B6HA 3ASYA 3ZJYA 3RS4A 4BFXA 3W8RA 1L4YA 4NCJA 1U0JA 4Q7LA 1T8TA 1VG8A 2GZHA 4PQYA 2A5FA 2FPMA 2XAUA 3T15A 3TE6A 3IGFA 3DDCA 1NLYA 2ZXUA 2JJ2A 4MGYR 2G3YA 1UKYA 2OFWA 1TF2A 4E09A 4NKRA 2C78A 2CHVA 3SC3A 2ODWA 3EG5A 5FH9A 4PHHA 3RRZA 3QF7A 5TDHA 3C7KA 3F0TA 5A0FA 1TEVA 3L0SA 2O5VA 2GXSA 4KXFB 4MRSA 3EZ9A 2RGGA 1W2GA 2VO1A 2RB4A 4CVNA 3U7FB 4RZXA 4TLEA 1K5GA 2KI5A 2QRZA 3MMPA 1KJYA 2IC5A 2ANCA 4KVAA 4DLSA 2FNAA 1EX7A 4QGAA 3BJIC 4L4UA 2ZTSA 3C41J 1VCIA 2UKDA 3NC0C 1G3QA 3GJ4A 4M9XA 1QHHA 2JLRA 4BZPA 1R10A 3U44A 1IN5A 4TZ6A 3KDSE 3RRMA 4IHQA 2ZRFA 5JJLA 2WJVA 3AUYA 4LJ6A 1W0KD 1E0JA 3LFUA 4EFNA 4Q18A 1W0KA 3ZIAD 1G4UR 3ZIAA 1GWNA 3T5GA 4GDFA 1G5PA 1N0VC 2FEOA 3L2OB 2V1XA 4F38A 3HWSA 1ZD9A 2D06A 1KKMA 2F6RA 4I1UA 4NCHA 3RS5A 2ZJAA 3CR7A 3ETLA 2R8RA 1PLKA 1X8JA 5EE5B 1R0XA 3VNUA 3ZQJA 2FFBA 1QF9A 1DELA 2Q9BA 5FTNA 2ZITA 1KY2A 5FUXA 2WSMA 3GLIA 4WXRA 3AV0B 4CIDA 1EWRA 5JWRA 2A5GA 3AKYA 4PZLA 3IO5A 2ZU0C 1E2IA 4URUR 2QPTA 1ZRHA 1JPJA 1KO8A 2C96A 5TVKA 2ZRAA 2GRJA 4OBEA 5FTLA 1JJ7A 3RHFA 5CK4A 1IY1A 5BYJA 4OI1A 4TQ9A 1YVDA 4HUQB 2NPFA 2GTPA 4LYAA 5HPYB 5ELXA 3THXB 2BCJQ 4LYHA 2H17A 4HYYA 1AN0A 4G3XA 1E2NA 3GEIA 3KTAB 1UEJA 2RCNA 4KHZA 2GEDA 4EQ6A 2A5DA 4D25A 3G5UA 2AR7A 1QDEA 3TSOA 1ZJ6A 5CDFE 2GJ9A 1KDRA 3LLUA 2HJGA 1AS3A 2O8EB 1JR6A 2QE7D 1PV4A 2NMVA 2IYRA 2BWJA 1E4VA 1ZBDA 3IHLA 1O87A 2RGAA 4WW0A 3FHOA 4G01B 2VQSA 4BECA 1UKEA 1G19A 4B32A 4JIMA 4DIEA 2G77B 1XTQA 3UK6A 1W2HA 2WPDD 2XOKD 1OIXA 2Q3FA 2WPDA 4Q7MB 5L3VA 1KGDA 3VTKA 2OBLA 2J0UB 4Q48A 5EUMA 2ZRLA 2NGRA 4GZMA 3GEEA 4BEBA 4AKGA 1X8KA 2WJJA 1RIFA 1Q44A 2JASA 4WBSA 2Q3HA 4C0AC 2HT1A 1XTSA 4QOSA 2HCJB 3TLXA 4E07A 2O8BB 2ECKA 1NMZA 4GRAA 4PAMA 1MT0A 2ZI3A 3WNCA 1SVKA 3CRW1 1F48A 2J87A 4KFUA 4WA7A 5HKKD 1C9KA 4BASA 2PX3A 1TUIA 2FEMA 5HKKA 3PCRB 2OUKA 1CU1A 1LW7A 2ZUBA 1FX0B 4JLBA 4I99A 4URVR 4F4CA 1W7AA 4LHWA 1HE8B 4JVLA 5B58C 1KTVA 3K0CC 1VYVA 4MYUA 3G82C 4TN1A 2YJTD 1KO5A 4P4UA 1T9HA 5FL3A 3E5HA 2XB2A 4GBMA 3HR7A 2YOFA 3UMRA 4F4JA 1U81A 1HV8A 1NN3A 1JAIA 4FCWA 4Z1MD 2OCPA 4DCTA 5EZ6B 4Z1MA 1PJRA 2RHMA 1OW3B 1NKSA 5KUTA 3C16C 5JSZA 2IS6A 1W44A 1HH4A 2CE2X 3GFOA 3Q72A 1SXJE 1KK1A 1V5WA 3EX7C 1Q1BA 3IIMA 1Q1QA 2CBZA 2VL7A 3QXHA 3RWMB 4S35A 2A9KA 2XNSA 4O2LA 5GVRA 3HU1A 3T12A 3REFA 3A37A 3A4MA 2XZOA 4TL7A 1WXQA 1G8YA 1W49A 3FVQA 3AVPA 3QKUA 2JLUA 1OF1A 1ETUA 1ZAKA 2VP5A 4JLJA 2FA9A 1DO0A 4Z51A 5FUYA 3QVVA 2RGEA 1RW4A 4DJTA 3AVYA 1DARA 5E3HA 2R6CA 2HUPA 1HE1C 2GVDC 2QPAA 8OHMA 2IUUA 2FMXA 5JJKA 4DCSA 4HDCA 2WZQA 3ICQB 3F3YA 1W4AA 2VF8A 3GJ8A 2PT5A 4U02A 1UF9A 4H1VA 1LB1B 1G1MA 2OLKA 2EYQA 1W48A 2ODNA 1GSIA 1C4OA 2VBCA 3U6BA 4PSKA 4V0MA 4CT4B 4IOJA 1E2LA 1MKYA 1DO2A 1KK0A 3GJ6A 4UJ5A 5EP4A 1DAHA 2BBSA 4I1VA 4V0KA 4YONB 1VYTA 4QHYA 1OFIA 4MGIR 4BGDA 1MABB 4BFZA 1XMJA 1GKIA 2BKUA 2FSGA 4QKQA 5JS7A 4GL2A 1BH2A 4C4PA 4JBYA 1OLOA 1OFHA 2Z4SA 1TF7A 3N2EA 3NC1C 4UXHA 1P60A 1U9IA 4V02A 5B30A 3FTQA 2I1VB 4GNKA 4C3ZA 4UNSA 5BN3A 1QBKC 3NH6A 4M1YA 2PX0A 3DM5A 3B5JA 4KJZA 1KK2A 1W47A 1G8HA 4M8NE 4TMXA 2QA5A 4KSCA 521PA 3GPLA 3MSXA 2V8OA 1MO4A 4QJ5A 4Q1CA 2XB4A 1CULC 3J81k 1SQ5A 3QXJA 3ZH9B 4KFSA 1J99A 3QVUA 4YXWD 4LCBA 4B71A 4Y0VA 1K5DA 1E0SA 1Z3IX 4YXWA 1ODFA 4B73A 2C95A 1X86B 4LYJA 1FOEB 1N25A 3ADCA 1D2MA 5FUWA 3NXSA 1UDWA 3A58B 3O47A 3T34A 3KJIA 3RSOA 2QAGB 4JLDA 4JSYA 4RVCA 2JIZD 1P7CA 4NU0A 4B34A 1UM8A 1AQYA 2JLXA 3TUZC 1I2MA 4RY2A 4HUQA 3JVUA 2PEYA 3K1JA 2GESA 3WNBA 4ZV4A 5JWHA 1OH7A 3QJYA 5IK2D 3THXA 2J0QA 2SHKA 2I3BA 1WB9A 5IK2A 1D2NA 3CW2A 3KJHA 3KTAA 3N2IA 4TLAA 2GXQA 2OFOA 1E2HA 4HLCA 4F92B 2GHIA 3B6EA 2FE4A 2WKRA 3I73A 3W6NA 1AK2A 1N6NA 3I32A 1YZTA 3K9HA 3RABA 4TYNA 1J8MF 1TU4A 4ZKDA 2O8EA 3PR1A 4AYTA 4Q1DA 1M74A 1OYYA 4D4JA 2HLDD 3ZVLA 1P73A 1U8YA 4RD3A 1P5ZB 1VG0B 4A0FA 4X8MA 1EFCA 1EGAA 2QY9A 4R2IA 1K8RA 2J45A 4V0OA 3K8YA 4TLDA 2KSQA 1IY2A 4KITB 1R2QA 3TGPA 2HJVA 4TL9A 2J0UA 3K0FB 1U94A 2VP0A 1P9WA 4URZR 2GA8A 3SI7A 2IYTA 1FQKA 4ZCMA 1CXZA 1VG9B 4QGHA 4JYBA 1OXVA 1ZINA 2O8BA 4LJ5A 2V7QD 4C7OB 2CCJA 1II9A 1WQ1R 1J90A 2QI9C 2V7QA 4IVRA 5CDFA 4FMCF 2JJ8A 1G8GA 3EWSA 4PPFA 2C9YA 4F91B 1G7TA 4C2UA 2FH5B 4BLQA 5KOYA 1XPRA 3OIYA 4ZCLA 1T3LA 4DVGA 1SVWA 1FX0A 1II0A 4LV8B 5E7JA 2XZLA 2W0SA 1W0JD 3QY0A 1SVMA 3FDIA 1W0JA 4A9AA 2E9SA 4L15A 4AK9A 5KNBA 1XEWY 4TQUS 4WZAE 1LTQA 1NLZA 3OE7D 3MWYW 2ZI6A 4RSGA 3R7WB 1PVOA 3OE7A 4C0HA 3MCAA 3RS7A 4CGZA 4UQOA 2BKEA 1VTKA 3T1OA 1KSFX 2CL0X 4A0GA 3SEAA 2WWIA 1LFDB 1R8QA 4A2PA 4Q21A 5GJCA 2JLYA 3AVQA 1W4BA 1G3MA 5ANRB 2JGNA 4WZ6A 4DLXA 4IXNA 5AK0A 2YKGA 1WRBA 1VIYA 3VR5A 4DKXA 3GFPA 3RC8A 3H1TA 4AWXA 2YOHA 1OIVA 3KQUA 1GP2A 2IF2A 2ZETA 4HLQB 1TU3A 1XCMA 4NYJR 1UKVY 4R98A 4XTCS 2C9CA 1E2FA 4N3NA 1HTWA 1U8ZA 2QN6A 1Q12A 1T3HA 2P6UA 1XEWX 1OE0A 3WYGA 4D4MA 1TNDA 4DUGD 1R7RA 3U4QB 5TY0A 1BOFA 2YHSA 4DUGA 2QP4A 4A8JC 4N0DA 2N1BA 4HB4A 4TZ0A 4QM6A 4E03A 4HB2A 2IUSA 4JMPA 1ZD8A 4KLZA 4GP6A 4KYIB 5DI9A 5A5GA 2YZ2A 1HQCA 2ONJA 3QE0A 2ANBA 4LUCA 1NVWQ 1A1VA 2GILA 2CJWB 2ODEA 3IO3A 3NHBA 1G3RA 1SXJC 2UZ3A 4OI2A 3D3QA 4MH0R 1LF0A 1E0KA 1MABA 3OF5A 4GMDA 3W6PA 4B44A 2PL3A 5JS8A 3DKVA 3K70C 3BIFA 3TVDA 3QNUA 2B8TA 4AD8A 5EP2A 5H68A 2WV9A 2IYQA 4Q9LA 1QZXA 4QM7A 3RDPA 2ZM5A 4URWR 1NG9A 2WWWA 3AP1A 4AC9A 1NSTA 1XMSA 1DAEA 1G7SA 5UKDA 2C2HA 5FPHA 2IS2A 1NG1A 3H2YA 3QBVA 4HI0E 5H70A 3W3ZB 3BH7A 3ECCA 3CR8A 4Q1AA 1N6HA 4ZDIA 2FU5C 2IYLD 3Q9LA 4HLDA 5JHGB 1ZIOA 1G20E 2A3RA 2C03A 3B1YA 4XWKA 2ZJ2A 2DWQA 4TT3D 3AP2A 3UMSA 1Q0UA 2R6AA 1VPLA 4LBZA 4TT3A 4RKEA 5F9HA 4WAUA 3QXSA 4WZBE 2MMCA 1OHHD 2QTVB 2RAPA 3D6TB 3FMOB 3L8ZA 3CH5A 4YMWA 5DHFA 2QAGA 3TBKA 1XCGB 3CZQA 3T1TA 4OHVA 3E70C 3F5FA 2K5UA 2OM2A 4HB3A 2DFNA 1CLUA 2JLSA 4M1OA 2GNOA 2ZRIA 3QOFA 2OCBA 3FKSD 4GOXA 3WHLA 1IJEA 4M1KA 621PA 1XCPA 3HR8A 3FKSA 4WIAA 3VX4A 4TYPA 4KSBA 2ZRMA 5DNYB 2IXEA 5HCIA 3L82B 1IN4A 4LX0A 3A1WA 4QNMA 3B85A 2YNMA 1AS2A 3AF1A 1NN1A 4KYUA 1EX6A 1RE0A 4BFSA 3RYTC 2E87A 2OO7A 2CK3D 2IXGA 3RVBA 1LNZA 1R5OA 3WBKA 1PUIA 2CK3A 4YMVA 1R0ZA 1KMQA 3QPWA 1W4RA 5E95A 2QROA 1ZVQA 3IPXA 4CW7A 3OESA 4UKDA 4I1OA 2V4ZA 3VFDA 5FBLB 1KI3A 2GDJA 4FIDA 3I1FA 2P0EA 3PEUA 1KI2A 4LJ7A 3HDTA 2V3CC 1R0YA 3TH5A 5EUQB 4A82A 4US1R 5B64A 4B33A 2YINC 2GF9A 5CITA 3WNDA 4DHEA 2N46A 1G7CA 1Z47A 3K0FA 1CJKC 1ONBA 3SJAA 2ZJYA 1Q1ZA 3SQWA 3E1SA 5IDVA 3KKNA 2FGJA 2XNDD 4Z8XA 2IYYA 3FB4A 2XNDA 1KSJA 1GRRA 1JB1A 2B7CA 4BLTA 4DLZA 1T8UA 2OT3B 5B57C 3UG6A 4U00A 2ZSAA 2VTKA 3SDZA 4C7OA 2XGJA 1VHTA 3A1UA 4PQRA 1SZPA 5BN4A 2D2FA 1XD8A 4LJAA 1XPOA 3KQNA 3EC1A 3DL0A 1ZP6A 5LPNA 1COWA 3ZQ6A 3RWOA 3L8YA 1L8QA 5AR1A 5J4VA 1XRJA 3A8TA 3T06B 4IOKA 1HYQA 1JEDA 4PPQA 3DM9B 4TWZA 1O3YA 3UXMA 4YMUA 3M1IA 3CF6R 2J41A 1CR0A 1OKKD 1P9RA 1W4CA 2EFGA 2ZS7A 3BXZA 1GILA 1OKKA 3CO5A 3ZYCA 2BBTA 4K81B 4JLOA 2KWIA 3MWKA 5JCPA 3R7WA 2G88A 5BYKA 1XTIA 3CM0A 3Q8XB 2F1RA 4PR0A 3KXLA 2AFIE 4C0JA 1YZLA 4FMCB 2D7CA 1E9CA 3NG1A 3SHWA 3VX3A 4RD0A 5FUVA 5TB5A 1VIAA 1G8PA 2V6JA 3B78A 3IDQA 4LBVA 4II7A 4P32A 1NI3A 2G1KA 5GJVC 4B76A 4DXAA 1XX6A 1JECA 2FV8A 4PFSA 2P5SA 4HEJA 4Q4HB 1GRNA 4LDJA 5FFMA 3CLVA 1MR3F 2AFHE 1BO6A 1LV7A 4L9SA 4GPTA 5TXGA 3R9IA 3VR3A 4D6PA 3H4MA 4Q1EA 5DYGA 5FTJA 2WM9B 3R9WA 1T3SA 121PA 4A2WA 1FNNA 4XJXA 5FOVA 3U5ZB 4CEIB 4NMMA 3RS0A 3B7GA 2QUZA 4ZIRA 3U4QA 2DFKB 1Z22A 3AVOA 4LWZA 1GZSA 1G6HA 1Z6TA 3VHLB 3NBFA 4EKDA 4U5XA 4C0LA 2GBLC 1RFLA 5CIWA 3REGA 1DOAA 2QSYA 2KBEA 3KJGA 4B35A 2J46A 1Z2CA 2XJ4A 4MDEA 4FMBB 3NIBA 2O8FB 4G5RA 3EW9A 4JYCA 4HAZA 1SHZA 3L0IB 2AN9A 3N70A 3PUYA 4JKYA 5E4FA 2FSIA 2GJ8A 2CJWA 1XZPA 2WSSD 4OK5A 4OL0A 5C2JB 4US2R 2WSSA 4A6PA 3VQTA 2ZAOA 2JCSA 1U0HC 3KX2A 3QENA 5FI1B 1P75A 2IYUA 1XXHB 4TTQA 3LAWA 3C14C 1YKSA 1TEXA 2YWFA 2C5LA 4BLPA 3PQCA 2FFAA 4KBFA 4BZXA 1GNRA 1CKEA 3DMDA 1IY0A 4FCTA 1FP7A 2ZSDA 2XTMA 3AVWA 4QBIA 2QM8A 3NBZC 5DN6D 2FZLA 3TW4A 2BEJA 4PO1A 5DN6A 1G4AE 1RYFA 1CR4A 2R9VA 4B2IA 4A15A 1UDXA 5L3RA 1D9ZA 1VCNA 4M1WA 2BDTA 3TKLA 4CYMA 4DB4A 1CR1A 2YC2C 4M1SA 1FUKA 1W5TA 3LA6A 3VU9B 1R6BX 5DLQC 4AYXA 4BFUA 1Z6YA 4Q00A 3U7EB 1IXZA 4NDZA 5LD2C 3W5JA 3CH4B 2CXXA 4G5OA 3FFAA 4PXAA 2ZRDA 4M0LA 1T4GA 4WVFA 2QBYB 1ZUIA 4Q47A 5AJWA 4A4DA 1NMYA 1FW6A 2J0SA 3GFTA 3K09A 3V9PA 1NY6A 3BK7A 2CE7A 2J7PD 4GMXA 4EPRA 1KDPA 3K09C 4TYQA 4R7ZA 4MGKR 2J7PA 3W9YA 5AUPB 2G6BA 3WRYC 3M6AA 1ELOA 4NYMQ 2O8DB 2ERYA 4AKIA 1ZM2A 5B2ZA 3QSYA 3KQKA 1DG1G 1EWQA 1C1YA 1J70A 3AP3A 3LO5A 2DHRA 4ZDWA 2VP9A 5G3YA 4DLYA 2EW1A 4DSNA 4ZO4A 2EU8A 2YVUA 3ONWA 1E1QD 3QQ5A 2C04A 4O0MA 5F98A 2EFCB 5JMTA 4BLSA 3U61B 1E2JA 2BM0A 4TQAA 2WAYA 4C0SA 4GT1A 2B92A 2ZQ5A 4YLGA 5JRZA 5KSPA 1S8FA 4KFRA 4RFVA 2GEUA 2WMNB 4BRWA 3WHKA 2G83A 4O2RA 3VR6A 1XMVA 3K9LA 1HQYE 4IEIA
chains in the Genus database with same CATH superfamily
2H48A 1JZQA 4C43A 3VPXA 1KK3A 3AHEA 5HR5A 5CHEA 3RFTA 2P79A 3W8NA 1VYHA 3HV2A 3AKCA 4E30A 1KNQA 4PZAA 2NO1A 1KFKB 2VTEA 1HEYA 2NO5A 5DWDA 4P5EA 4IH9A 2H6EA 1EU1A 1GV1A 2B8NA 2O20A 3D3WB 3K53A 3ORRA 3KUDA 3MWFA 1PZXA 4HNSA 1BKSB 3O3MB 2IBSA 2NUTA 1ZBQA 2G04A 1LJUA 4MCIA 4UMDA 5EMJA 3FUVA 4YHBA 4ZKEA 1YZQA 5B55A 5JANA 4DMLA 1S1CA 4B3HA 4R5MA 4Q4AB 3AL3A 1TGYA 4HZGA 2ZIEA 4MX8A 1H5NA 4ZVMA 5LP6B 1DAIA 4ZANA 2HIHA 4MWEA 1HFJA 1A2KC 4UCWA 1N78A 1KSHA 2PLFA 2D0OB 3ZK7A 4Z6KA 1VJ1A 5D3KA 2ZYTX 3NEPX 4O2AB 2HGZA 1JR6A 5FL7A 3MD9A 3GBPA 4C78A 2NXCA 4L8YA 1FVXA 3A10A 1C3OA 3UVEA 5LYJB 3DMPA 3ED5A 3UJDA 3NM6B 4LGCA 4D9MA 4YUZA 2Z2JA 2EFEB 4RULA 3PRYA 3Q3IA 4RMGA 1J2UA 1GGHA 1JA0A 2HXGA 4ODIA 4PZCA 5CAEB 4DIOA 5BUZA 4UTRA 1PVDA 4P3YA 3GA5A 5TEVA 4D8UA 3B9RA 3ZVNA 1V4BA 5CW1A 2F43B 3A9UA 1XTZA 4G8CA 2HA2A 4X1IA 2FP3A 4ESEA 2B61A 1FA9A 2JFWA 2ISCA 3M6IA 3F98A 3GCZA 1T4DA 4UM7A 1M8KA 3RTDA 3AKDA 1LI4A 2CD7A 2XLCA 3SYLA 4JZKA 4YH1A 2V1UA 1O77A 1UIMA 4YCDA 1U2GC 4HDMB 5REQA 4QIHA 1L0BA 1O08A 4CFSA 5DI3B 2FXVA 2G9QA 3GZ4A 5F21A 4KIUA 4B6FA 3KLBA 3A1EA 4ZI7F 1F8FA 3I12A 2HLNA 2BJWA 1D2EA 1EZZA 4RDHA 3IVRA 1JXOA 1YRYE 4EI9A 3C6ZA 3PDIA 5AK4A 1ZIPA 3OKAA 1XNGA 2FPGA 4GOKA 4IJWA 3R3VA 4Y1RA 4MRMB 5HX7A 2B4YA 4CM6A 2PLWA 3CPJB 4H4DA 2IYZA 1ZI8A 6CHYA 4J0QA 5EHXA 3F4KA 1MGPA 2DPXA 3ZI7A 1CHNA 3E58A 1CUZA 3C3CA 3C5WP 4F97A 4HC4A 3Q8KA 4EDHA 4NE7A 4NXNB 2O8FA 1B74A 3H6HA 4Z4GA 1ZGBA 1BKDR 3JAWA 4ARZB 5EKTA 3NYWA 1WUJS 4BZQA 2SCUA 2ZIVB 1EE1A 5KQLA 3TNFA 1DU4A 4HN9A 1U0RA 2BELA 2VSYA 1KZ6A 2XE4A 1SM4A 3VMMA 4AUMA 4Z4FA 1UK8A 4MCJA 1YVPA 2DEUA 1S2DA 3SJZA 4A6XA 2NACA 1G6OA 2X9VA 4HDKB 2JHFA 3IVAA 2ZJZA 2E6UX 3ND9A 4IEFB 4RH0A 1JH8A 4P80A 1CVLA 4XB2A 1WD5A 2JGIA 3FYCA 1SKAA 3PHBE 4ZT5A 3OLWA 4NATA 3DCNA 4N8SA 1E2DA 2CCKA 3PPXA 4B79A 3MHTA 1CIVA 5K6AC 2OD7A 1B00A 3X43A 3QX7A 1QGDA 2IJGX 2CYAA 2B78A 2X4GA 2X4IA 3IKMB 3DLIA 4QQRA 3WMFA 2AKAB 3VR2A 1I94B 2VHJA 2VZ0A 3O4IA 5A9SB 2AK2A 4RJJA 5J4KA 2F59A 1CBUA 4G1VA 3AT1A 3VU8A 3VYUB 3L4JA 2J5XA 1HORA 3MTEA 4ID9A 4OMCA 1CR2A 3HCCA 1NXOA 2RK4A 3CZ4A 4BAZA 4PYQA 1DKMA 1B43A 2WICA 1U9IC 1N6RA 1HNNA 1BQEA 1PV1A 1IHPA 3KXKA 1X80A 2Y76A 4RMNA 3VPAA 1D2RA 1ZG3A 2C8LA 4OXRA 4B09A 4X1KA 1ZCJA 3OZRA 5C1DA 2IEYA 2D2XA 2L2QA 4M2LA 5CP8A 1U3TA 4KBGA 2EEZA 2CF6A 1Q22A 4E15A 3NVAA 2XYRA 3TXYA 3ELWA 5AW2A 1YR8A 1D7AA 2I3GA 4RS3A 3UZUA 4WMLA 1FFCA 3V5NA 1I5OA 4B48A 2Q5QA 3FZEA 1PJSA 3GU3A 2IDMA 1QHSA 4S2UA 1JSXA 1PR6A 1PNOA 3GFVA 4RPIA 4LYGA 2YVAA 2YWGA 4LQ4A 3OHMA 1Q0SA 2XKJE 1AKEA 1Q16A 3RTCA 3FTEA 1JVBA 3GEDA 2RHWA 4KQ9A 4DDUA 1ODIA 1HDRA 3MOIA 3NWJA 2QLTA 2QMYA 3SFTA 5DW0A 3RQSA 1YZNA 1CVIA 1ZCBA 5DRTA 4FFMA 5H81A 4ABYA 3UJCA 1ZIDA 2J5QA 1JJIA 1XQXA 2C4HA 2VDRB 4IQGA 4BL5A 2R1UA 1BE0A 4OATA 2SKCA 1EXVA 2MSEB 4BQOA 3PUVA 3NC4A 4Z0NA 1K7SN 4HDQB 5CNKA 4BTVA 4S2EA 4OU5A 2GXUA 4U7GA 5DISB 3WRXC 1FDTA 1SJ9A 3ZBPA 3ZE7A 3ZD9A 4HAVA 4R0VA 1QORA 5BVGB 1EBFA 4EUSA 2PKQO 3T0FA 4BB9A 3TLBA 5C1OA 4GE3A 4FTWA 5LDHA 1SD5A 4PIMA 2FXIA 1OASA 1YZFA 1EMDA 3WJ7A 1D6JA 4YQFA 4D3SA 3U3OA 3V8EA 5TJHA 3G8YA 1VKZA 4EGCB 1JLKA 1RXEA 4QARA 2EATA 3CEPB 4FSHA 3SQOA 4FYHA 1LQTA 1NTRA 5B2EA 1VE6A 3TW8A 3JQGB 4J1QA 3U1VA 1HYHA 1SB8A 2DHCA 3AUXA 2VF5X 1MQSA 4G4SP 2GJ4A 3ESRA 4INPA 1B0AA 5CYOA 5LKRA 1CUUA 5LZ2A 1Q0ZA 2BHLA 2P68A 2Z5FA 1P2UA 5JYEA 2IELA 4KL8S 4RVUA 2HM7A 2VJMA 4AQYB 2JI8A 1GAQA 4JLSA 4RVOA 2QR2A 1R6VA 5F1KA 1DEAA 1NVUQ 2IYNA 3HKEB 5CDGA 1CUDA 3OQOA 4MEAA 4OQYA 5DBOA 1F8UA 3EBPA 1Z15A 4JQYA 4ZO6A 2GN2A 1PDWA 1ICIA 2C2BA 2RG1A 4HZIA 1SIBE 3VKUA 4MV6A 4YJDA 1UBTS 1ZICA 4LPKA 1KQPA 4XSHA 2J6CA 2O05A 3AH8A 3P0HA 1M2OA 2J59A 4LJYA 3X2SA 4CWAA 2ZUCA 3RAEC 1V43A 2H9IA 2X19A 4KO8A 3HJHA 2C9MA 4DT1B 3B1XA 1BU5A 4OGFA 4PVDA 5CRIA 3ANYB 3FBWA 5IM4A 4NARA 1LK0A 2JAUA 2OZLA 3E81A 2GCOA 1EX1A 3GJ3A 4OMUA 3LT5A 4P35A 2FW0A 4O3MA 4LRSB 3ISJA 1Z6XA 4KFTA 5G53C 2RHJA 3ZCSA 2X7JA 3O8RA 4ZT2A 3SXJA 2TMGA 1QG4A 1W34A 1ZCFA 2VWQA 3QVJA 4LX8A 3WB1A 9ATCA 1E62A 4HLUA 3BS4A 5HM6A 2P9GA 5IJWA 4H6VA 2AMFA 4IIXA 4EG7A 2PBFA 1OWNA 3A6HA 3HYNA 2XHEA 4ILEA 5FIUA 3FHTA 4R9UC 2J9RA 2VK8A 4OJYA 4BBJA 3GLGB 4QUHA 3PD7A 4US0R 4IHAA 4E2WA 4BN4A 2HSJA 4MKHA 2OHXA 5H3HA 3F8TA 1BX1A 3NMUF 4OGKA 3V4VB 1O7JA 1OX4A 1E1DA 5FJJA 2W5UA 3KOXA 5F3DA 2A0XA 4N3GA 1P7YA 5KNCH 1KEEA 3M9XA 3C5EA 3DCYA 4ZTBA 1XHFA 4TGLA 2QG6A 1ZD3A 3V48A 5LQUA 1H3NA 4UE6A 4NICA 1ISRA 3ZE1B 5GIPE 3D7SA 5CB6A 2GVZC 1LXCA 2FOIA 4Z8YA 2CVHA 1MQAA 4P9NA 1PL7A 4U8HA 4BO1A 5K09A 1JQLB 4HD8A 2X23A 2XRFA 3GP5A 4CNBA 3C87A 4XVQA 4WN9A 1MRNA 5SZJA 2WF6A 5KOJA 4DR7B 1F12A 1GYRA 3JYHA 3R5TA 3ADDA 1Z26A 2WFLB 2J85A 3HCFA 1NVEA 1ML3A 5KYKA 4QGAA 1HFWA 1KRXA 1Z7GA 1QK3A 1V95A 2MSKA 3ROQA 3IUPA 4HJRA 2FZWA 2OTCA 4ZK6A 1M34B 3KFXA 2UYQA 2CLIB 4RIFA 4YIKA 2OPBA 3HGTA 4GF5A 4H4CA 5AUQA 5CXUA 2ZROA 1A88A 3I2HA 3ZWNA 1VMEA 1F4PA 2QMZA 1XZFA 3WAJA 1I5EA 1YULA 3OLYA 4ESHA 5CB0A 1AQLA 1DTSA 3THOA 5ITWA 1R6XA 2FPKA 3CKMA 4LXUA 1T6YA 5G0TA 1GNTA 3KRTA 3OCJA 5CX1A 3PF8A 4Y1FA 1DE0A 2OGWA 4L3WA 2HOQA 3NBYC 5TV2A 1A8IA 4MLPA 4LVCA 4C7MA 3X3HA 5SYAA 1SPBS 3I53A 3RQIA 1V1RA 4QYIA 1WBDA 4TLLB 1G7RA 4D81A 1CT9A 1LSJA 4YI3A 1KZHA 3S5JA 5CPFA 4BKPA 1E2QA 5D3MA 3P19A 1NNEA 3EXEB 2BGUA 5JVDA 1MU0A 4DA9A 4Q4JA 4RK6A 4EGQA 1MJNA 1L7NA 3HPQA 1UK6A 2D6FA 1LS6A 3OQ1A 2WJPA 5ICFA 1JHYA 1KKLA 4LNUB 4OQDA 4DC9A 1KP9A 3ZGNA 5EWMB 1W46A 3DBIA 3VAAA 1O0SA 1F1JA 1JMVA 3O8OB 4RACA 3UMCA 4G25A 2W71A 2VS1A 4U2GA 4TKVA 4H3VA 4B4WA 2H51A 4FFVA 4UQLA 4JASB 3GZJA 2PZGA 3L9WA 1F0YA 2GAIA 2OUIA 2GPTA 2ZPUA 2GETA 4HMPA 4R2JA 3I64A 4CTNA 1IHUA 3OEHA 3OFNA 3SJCA 4B8YA 3NWEA 5B6PA 1KXZA 2Q3CA 2IYWA 1DX9A 1V11A 2FPLA 2ZWPA 1PFKA 3RAGA 1FLDA 4BNVA 5CJPA 1ZMOA 4IQ0A 4C4RA 1BYIA 1RQGA 3W1EA 2WAMA 5L3QA 3N0VA 1C1HA 2QTZA 2MYNA 2CSUA 2A84A 4GVPA 4UBNA 2C4TA 2YX1A 5TMPA 1FFDA 1R9MA 3IVXA 4GE0A 2I0FA 1CZRA 2PX5A 3EGXB 2XD4A 1SOUA 5AJVB 5KKAA 2E18A 2JLZA 5HJEA 3QEBZ 5I7WA 4H4EA 3I28A 5HUHA 1NRJB 1UFQA 2PAFA 1JQAA 2WFAA 4LV6A 4M36A 4UBOA 4AJJA 4RTKA 1LDNA 4FPXA 4QTTB 5CYGA 1GUFA 3ZD8A 4MV1A 1HC7A 3FR7A 4FEGA 4JLUA 4LF9B 2X8JB 4PHGA 3YASA 1BS1A 4HNUA 4D9JA 1NUSA 2RKBA 1MX3A 3C1OA 3FFXA 3A3YA 4QNRA 4CM7A 4RLSA 3S44A 1P8AA 4FE7A 1YHYA 3I4FA 3IEPA 4YRIA 2ZRPA 4AZSA 2FG7C 2GKGA 1G8JA 2F3RA 3SYMA 2AUTA 2YXNA 3M6XA 1MORA 2AZMA 3DGFC 1FW8A 3G2KA 3TI9A 6REQB 4OX9Y 5IKMA 1TQ6A 3RPEA 1RWQA 1Z0IA 2JEOA 4EJ6A 5CFZA 1ISHA 2VNHA 3D3JA 2LE0A 2XQFA 5BRNA 1SVOA 2JLQA 4XQGA 2VRCD 4FR0A 5FLEX 1C7JA 1MTOA 3IERA 4M86A 2CYCA 4CQMD 1JHAA 1U6KA 4R7TA 4WK4B 4D44A 2OE2A 3RFXA 1T0IA 2PEZA 4OUDB 2VSNA 2C99A 4G0WA 1MO6A 2WTBA 1R4MB 3DNFA 5G2OA 4RTMA 1HRDA 1T24A 4RTPA 3GQBA 1JR2A 3IPRA 2VOJA 4IV8A 4YAGA 3QHPA 5K0NA 3ZLBA 5L7TA 1SVLA 2RMKA 3BGOS 4ZQFA 2FF7A 4YDRA 3FOBA 4GD3Q 4OI4A 7ADHA 3FX2A 5AW9A 3VO8A 2GBFA 2PVCA 3AG5A 1Z2OX 1HKUA 4EVQA 1PV2A 1CUEA 1Y3FE 4OQFA 4AX8A 2ENWA 3V55A 2O19A 4RKQA 4WCVA 4BJHB 2I3DA 1XWIA 5C51B 1EK5A 4DMKA 3J7TA 1R9GA 1A5TA 2VCYA 2WWGA 4N0EA 4RIHA 5KTKA 3L8MA 2G5TA 2YQZA 1O95D 3ZY3A 2QL9A 1NYQA 1N7GA 2JFPA 2QI9F 2YXBA 3PGLA 1FTSA 4MKZA 4RZ2A 1NMEA 4YREA 1IH8A 2OYSA 4UHDA 1DI0A 4FHZA 4KODA 3TRJA 1AH2A 4BB5A 2X3FA 3FCAA 1HDOA 3GAAA 4PFKA 2WT9A 1K27A 4GYYA 3WRVA 5LSAA 3WLFA 1JG3A 5M5BA 2BH9A 2HPVA 2W6NA 1IEQA 3RU3A 3V8VA 1SHKA 2BEWB 3GRUA 3RGGA 4Z54A 1YE8A 2QRQA 3HNRA 2IV3A 4BLUA 1JR3E 2R5FA 2JKVA 2Z1DA 4PZ9A 4ZV9A 3UAYA 1FUEA 1ZJWA 2X8AA 4BX0A 2DPLA 3CNNA 1GPBA 4WVLA 4BGVA 4HPJB 1OAOC 2EIHA 4EJMA 1VHLA 3KB2A 3H7IA 3OTGA 5U9CA 1DHRA 1XG5A 1KY4A 4FFDA 5A4MS 3THYB 1MCZA 3CTMA 3MYRA 2YR0A 2F62A 3NH9A 5EPOA 2YDXA 3BYZA 1G42A 1DCFA 1DKPA 1Q77A 2FFRA 2Q62A 2WJHA 1BRTA 4RZQA 5H16A 4DG9A 3F5MA 1IUPA 1Z7BA 3BWMA 1XZ8A 1XP5A 2FK8A 2Z2KA 1FS6A 3AF4A 3D0KA 3HADA 3FSJX 1G98A 3LLCA 2DHEA 4GX1A 4Q02A 3FPAA 2MDTA 5IS2A 4I14A 3PXCX 4ZQGA 1JH9A 3CR3C 1IXKA 3FHJA 4HADA 4KPGA 3EGEA 5DCYA 3IOCA 5LQAA 3RBAA 5IM5A 4DYHA 2VUTA 2VJKA 4O4HF 5FWAA 2V7UA 5G40A 5B7NA 4X3OA 3F8WA 1ZK0A 2A35A 5IEBA 4KR2A 5K3BA 4IJQA 4D7AA 5IJ9A 5AI9A 2AQ8A 2KX7A 2HUNA 4TTVA 2FCAA 3V4OA 4BMVA 1ODKA 3DV0A 2C2KA 2I2DA 1XCJA 9MHTA 1ULHA 1E69A 2QM0A 5TX7A 4CUKA 1ZR4A 2F2TA 5TGTA 3IMFA 4H18A 4TT8A 3S7TA 4LY3A 4B4OA 2VA8A 3VNAA 1U8XX 2G70A 1KWGA 3JD0A 1AQIA 1UJCA 5J5CA 1QDLB 3NKVA 3R3UA 4DVJA 3IAM1 1RQNA 3QH4A 3UHAA 2DUWA 4X93A 3F5QA 2NV6A 4UNRA 1AF4A 4X6XA 2ES4A 1XTRA 4WKGA 2HDHA 4I81A 4NU8X 1G0OA 1C3VA 1WF3A 1NXPA 3GT7A 4AMVA 1QG2A 5CJJA 3R44A 3LCRA 2YIVX 4E4RA 1LY1A 2C7QA 2XDYA 4LC1A 4J8PA 5E7MA 4P4SB 3WYNA 5JI3E 5BWOA 1O89A 3URKA 3L01A 4D8WA 1ZHHA 3PC4A 2JJ2D 1J2JA 1GUZA 2H18A 4G8BA 2WU1A 1RRPA 2ZSIA 2IBMA 1TD1A 4RK7A 5A2GA 1G2PA 2F9LA 1N5JA 5EESA 1U1EA 4B7AA 3N8NA 1JPUA 1FUYB 4XYLA 1DX4A 1V1MB 1HNZB 2R65A 1RYZA 1KJWA 4IIBA 1S96A 2Q6VA 2BMFA 5HDBB 3A1VA 1BVYF 1G8KA 5KQPA 3LY8A 4LSWA 3EMVA 1UAAA 1GZ7A 1L4KA 4MRNA 1NASA 2WABA 2HMAA 1LRJA 1L5MA 3U3JA 1QQ5A 3HP4A 1YBMA 3BJZA 2XH8A 2JK1A 1N3LA 1OZAA 1RPTA 3EIFA 3HWX1 5DX8A 1TMOA 4Y6GB 5NLLA 2WY2D 2VYQA 4IHJF 5JMOA 4HMQA 2XTZA 3TZQA 2CLEB 1HE5A 1T1RA 4MQ6A 1OBOA 1C9YA 3WRWA 3WQQA 4JELA 1FFYA 3NTXA 1KZGB 3QW2A 4GQAA 1HY3A 2X9LA 1IM2A 1K4YA 5F5NA 3RTAA 4H27A 3TTUA 4H7JA 1GFIA 2ZE7A 4KV9A 3TR0A 3TSWA 4B75A 1A7JA 1BYUA 1E5QA 1NUQA 1O9HA 1V9SA 2V6BA 3CPHA 1JIQA 1DUSA 4GC9A 1ULBA 4Z9YA 3GA0A 3USZA 2DC1A 2C7GA 3SBOA 1CUJA 1AVTA 5H9VA 4QEKA 1D2AA 3BK2A 5CA1F 3LKBA 2QSZA 1OQAA 1Z4MA 1JQBA 2PJZA 4V39A 4M8SA 3SHFA 4DDVA 2CMKA 5JJ5A 1CP2A 1S3IA 3L6EA 4RTLA 3HJAA 4N82A 2ASEA 4KE8A 1Z0AA 1O5IA 5BT9A 4ENTA 3KYCB 4FU0A 4IDCA 5JZOA 5IDWA 2A7QA 3MUOA 3V8NA 1AMUA 3K71B 4NK4A 1P91A 3LW8A 2CUZA 4KDRA 4Q9KA 1YONA 4ZI3A 1DVRA 1GL7A 2P9BA 3VO9A 1NVVR 3OJOA 1E3EA 3N2LA 1ZK2A 3WGZA 5B5SA 1YIAA 2PGAA 2PLAA 4HHEA 5DE3A 3S2YA 4XUGB 4DUZB 4PYIA 1IOLA 2O50A 3IUSA 4U6SA 4HFRA 5LYYA 2DFLA 1K6MA 1K0UA 2WIFA 3AIMA 4YAUA 1YB2A 3DOEA 4Q19A 1AURA 3SLGA 1SR8A 5DNWA 1GCOA 2VBIA 3CZMA 2FF5A 3AR3A 4ZOLA 1X1RA 4J7UA 1L4UA 3VH3A 2G40A 1AU9A 2J3EA 1JSRA 3DV9A 3WGJA 3A7EA 4GU5A 4D4GA 1QIKA 1NBWB 1SCNE 5ALTA 3BSFA 2NQ2C 2HDNB 4FOLA 3RUFA 3UF0A 1SXQA 5C9ZA 2EKPA 1K88A 4C88A 2ODTX 4E33A 2Y92A 3GP3A 2CNDA 3PNLA 1KI6B 9GPBA 5J2TA 5DGHA 1A9TA 1IM5A 2FPPB 2KS6A 1GADO 4EHHA 2F00A 3E2IA 4Q3NA 3JV7A 1ZGAA 2AOUA 3VJMA 4D02A 1Z06A 2NNLD 3QE4A 3U6KA 2X4DA 3KPYA 4Q5IA 2V7XA 1UJ2A 1X1QA 4FEEA 4F5WA 3IKTA 3BRCA 1GEEA 3DL4A 2GZSA 3BHNA 3OQHA 4FZJA 5L3SB 2XBLA 3X1ZA 2BYTA 1KAEA 1HTTA 3U3ZA 2GPYA 3IIKA 4PLCA 2FZKA 1CQJA 1UMBB 5IU6A 3DT6A 2V9PA 1T5BA 1W9HA 4MUYA 3CVYA 2EJBA 3EFBA 1TO1E 2PL5A 3FYHA 1VZ3A 1KETA 4LSMA 5FNZA 2EVWX 1F14A 4W5NA 1Y1LA 1XRMA 5I7VA 5JY1A 1UPTA 2E89A 1CUXA 3H97A 3M81A 4HGRA 4B3GA 3DT9A 4G5XA 2KW5A 3PQ7A 1M1NA 1FQJA 1AUVA 1KC3A 2I6GA 1E2BA 3DPSA 3OFSA 1NUPA 2FLVA 3KQSA 1P33A 3QG5A 1SIWA 4EF5A 3G5LA 4FFPA 1IUNA 2ZRCA 1L1RA 2IXFA 3KSRA 4ND4A 3CJRA 4OHWA 1DAFA 1ZC3A 1HA3A 2I03A 3IP5A 3MINB 3PUKA 4FN5A 4PICA 4E6PA 1FJGB 2LKCA 1Y48E 4RTQA 5JDCA 3TFOA 3KBBA 2WA1A 4IZIA 4W99A 1YZUA 2JCYA 4ZHQF 3QOYA 3HLKA 3D0OA 2O8CB 3CJQA 4KXXA 2TECE 4BNXA 3QF4A 1PK9A 5JH7B 1U2SA 5C7OO 4UHCA 3U0BA 1WV0A 1JE0A 4XPZA 2ZW9A 4BNUA 1JKXA 2PGNA 3W5AA 4QDJA 4PANA 2BSQA 3V33A 3M1AA 3NORA 5ABPA 4EPYA 1WZCA 2QU8A 3GOHA 5CURA 2GZMA 1HYBA 5I7SA 3K0EA 1F4VA 1JR3A 1U8FO 3KYJB 4P22A 3AHDA 4JYMA 1RRGA 1PUJA 1L8XA 2E4XA 3Q87B 4O2BB 5E4TA 3OTOB 3L4EA 5INTA 1JFRA 1DIGA 1H4VB 1NZJA 1VSVA 4FI3F 2GAOA 3WYBA 1OIWA 3LLVA 4I4LA 2V97A 3CXUA 4WACA 5FORA 3CCCA 4G2TA 4WOPA 3UV7A 1NMXA 4A92A 5AHXA 5IH3A 3A7DA 4H0NA 5A2QA 5JCOC 4OAQA 2AOWA 4Q7JB 4A36A 2BM8A 2DWPA 4M53A 3EIHA 3FMPB 4TV8A 2VSXA 3V9AA 1PKXA 2ZIZA 3EGWA 2JAXA 2DCMA 3AWIA 3N5KA 4QXAA 2WT4A 3A1SA 1R8JA 4DW8A 1YIDA 4RM2A 4U63A 4QOGA 2O1SA 1PS8A 2R86A 3IKJA 2CB9A 2J9GA 2OAP1 2YZNA 2SBTA 3IDFA 4QUEA 4ZVSA 1Z8FA 5DM60 1PLLA 3VV3A 2V3VA 4GPBA 2VF7A 3AEXA 1RRVA 3DW1X 4TMVA 3KSAC 3KZXA 1QCDA 3WMEA 3WLNA 3ZD6A 2BF7A 3PX7A 2HQ1A 2OK8A 3MGBA 3W90A 2MSCB 2Q27A 4QUIA 2O48X 5DWQA 4OKSA 4I19A 3PPVA 5DXFA 4TVBA 1U2RA 1X7ZA 3PJDA 2W2PA 1ID1A 4FGLA 2WU8A 5B1YA 4OA8A 1YMQA 4A8JB 1OY1A 2BM1A 3R77A 2G8NA 4EW3A 2YFQA 4LNAA 4Q9IA 2UZ1B 3VDRA 4L28A 4Q03A 1QHNA 5EJEA 3HDHA 1C41A 3OX1A 2LDBA 3R1IA 1YASA 3N0WA 1TCAA 5AICA 3PUXA 4JVSB 3M6VA 2CVQA 4TXNA 3FWKA 3D6HA 3LHIA 4C7KA 2JG3A 2O3RA 2HBQA 2RBEA 3Q3EA 2QJWA 2EJCA 4BC0A 1M6EX 2EGGA 1ZM9A 1IG3A 3NRBA 5BY2A 5KDLA 4H7IA 2CXQA 3O92A 3WWPA 1T5DX 4BUZA 1GQYA 3V8MA 2DR0A 3HH8A 1XU7A 3WL5A 4F6RA 1OYOA 3EDOA 2IWHA 3PGMA 1DAKA 4GOJA 3HXOA 4I55F 4JJ4A 4RTNA 1CIJA 1KO1A 4YQEA 1ACJA 3L7OA 1MB2A 5ICSA 5TQJA 4INZA 2Q6LA 3FJYA 4P0TA 1G64A 2QZ9A 5F1PA 3SS7X 2YBDA 3SX2A 4BQEA 3KZCA 4U39A 5TQVA 4MHOA 1RM5A 1SOAA 4L73A 1OFTA 2AFVA 2XNHA 3MT7A 1DFHA 3IFSA 4M0MA 4JN6B 4I9GA 4B4VA 1YU9A 4V1CI 5CDHA 1C0EA 1RAGA 3UK0A 1TAGA 1UP7A 3H1PA 3IAHA 3PTZA 2CB0A 4BMZA 3DVRX 3L0PA 4C2TA 5MHTA 1UMCB 1OXSC 2P0AA 2YMPA 1NVGA 2VEDA 3MCUA 4LBYA 5A6SB 3SIWA 1P1BA 1TKRA 1RPNA 3ZEAA 3UTDA 2VUIB 3DNMA 3GLTA 3HYSA 2V9CA 3KWFA 4N6GA 3D6FA 4G4IA 4NTZA 3SQXA 1X1AA 2NU8A 2A5LA 5ESWA 4J7CA 4YRGA 4QUGA 2WM2A 1HUQA 4M9ZA 3TLZA 1Y89A 3CUUA 3BH6A 1OX5A 5CFRA 2IU3A 2C2OA 1E3LA 5JV5A 2B82A 1BCSA 3T3MB 4BS9A 3Q8MA 3RC9A 1T0JB 3PFWO 4G0QA 1FU7A 4WT7A 1V0JA 2X0NA 1U02A 2JKYA 2QQGA 3DZ8A 3CF2A 3MTJA 4PLHA 4K9LA 5LL6P 2WWYA 2GHRA 4EF4A 4Z3KA 5TMDA 221PA 5CTAA 4L95C 2FUEA 3OFVA 4J16A 4TV9B 1N5KA 3RSZA 2NX2A 1K68A 3OY7A 5CH8A 3LJKA 3NRJA 2ZT5A 2CVFA 1N2IA 1AZTA 4ZCTA 1BMQA 4TROA 3SFZA 1OZHA 3H11A 4DLPA 1VA5A 5K0LA 1H93A 1P0FA 3KYBA 4TS4A 4PLTA 5KTSA 2EARA 3LA8A 1WCV1 4URFA 2QW1A 4S1TA 3S8EA 2Q50A 2EFYA 3E82A 3EULA 5AK6A 2O5RA 2OV2A 3LC2O 3PUZA 4GI1A 3RREA 4CEHA 1GDHA 3BXOA 4R81A 5BMVF 2HXYA 4FJ2A 2OV6A 4MINA 3WTCA 4JODA 1ZGGA 5ALDA 2WSLA 3HBAA 4KQ1A 1EK0A 5K3OA 5KB3A 1L4LA 3W5IA 2B99A 2ZTVA 3TAUA 4TWBA 1Y42X 4JB2A 1U9CA 3COVA 4NOMA 4R1NA 3W6OA 5HMMA 3JQ8A 3EJWA 4IF6A 2B35A 3TTSA 3DZKA 1HLPA 3VH1A 5ICMA 1QQAA 3VZCA 3UBTA 1WSBA 2MTBA 3I5MA 2VHYA 4A2QA 3BTOA 3GUYA 2G0TA 4L50A 5DSZA 1QHIA 3RRYA 4HLUC 1CQWA 2PWAA 5ALOA 5CHYA 3C4JA 1XTTA 3DLTA 4WINA 4AZVA 2OECA 5KNCA 2VP2A 2RC5A 3P32A 2IDJA 2VRNA 1QQ7A 2B30A 2NTYC 5B6IA 1RYDA 3NEJA 5IC6A 4BFWA 3OUZA 3GLVA 4BV8A 2VA9A 1DRJA 1NP3A 2B9EA 4MP3A 4RD1A 5IBRA 5IJ0B 2AWOA 4G1BA 1GQ2A 4XIYA 3KQLA 2VYFA 2P9YA 2R7MA 2OL4A 1DFIA 5CNMA 5D7BA 1QRRA 2XTJA 1B8NA 3UFBA 3KLPX 1CRWG 1CJTC 4FZRA 4QVGA 1UEIA 4BO7A 3R74A 8AT1A 4RD2A 3UT5B 5F2NA 1VYUA 1KOLA 4C01A 2QMUA 3H83A 2E7ZA 1NVFA 4N12A 4TYYA 1Y3DE 4XYBA 3T1NA 5BSFA 1E79A 3QJGA 3FGNA 3OE4A 1Q84A 2A78A 3GJ7A 3QVWA 3UGQA 4JGBA 1L7XA 4F71A 3G0HA 4BE7B 5ALQA 3H3JA 1RC8A 2AOXA 4G8JA 4RS4A 1L7EA 2RHLA 2UUBB 3HZOA 2QRGA 3HUEA 1PJZA 2YV4A 2XYQA 1PLJA 4ZCQA 1MOZA 4BEVA 2QK4A 3UKDA 2ET6A 3RJ9A 2VDQB 4XE5A 5DU2A 3SZUA 5BR4A 5EIBD 4NZOA 5LJLA 3B6MA 1AA6A 3C15C 1KMCA 1VE3A 1IQ0A 3O8NA 1FP4B 1J49A 4F3TA 1W5FA 1XDUA 5CB8A 2PSDA 5M2QA 1KOFA 5LA6B 5C5DA 4ZO9A 4IX9A 3MPOA 4S0ZA 5FTKA 1HT1E 2KB0A 3KLOA 1ZNQO 4V24A 4WXEA 4CU2A 3ZKWA 3S2ZA 4C0QC 1Y5NA 4KWEA 4C5AA 2AJLI 1QH0A 4KXLA 3DMNA 2OCAA 3UAOA 3N7TA 1F9EA 5A3VA 1K8YB 1YGYA 2AE2A 4Y7CA 4AMYA 3O84A 4ND6A 1PQWA 3ZTYA 3ZXSA 5C8YB 1GY8A 2RGNC 3QUSA 3BMNB 3ROMA 4DS3A 1JFFA 1KAMA 1W87A 3AUUA 3E1KA 1HZJA 4MPPA 5KCMA 4DRZA 2QNIA 2VWGA 1JEOA 2OHHA 1ESDA 2P2NA 4B9EA 3P26A 1PFWA 4HAOA 5ALZA 5BW5A 4EKNB 3IMKA 4GGMX 4EYEA 3GV0A 2I5PO 4IDHA 3ORFA 1JIUA 2DTEA 1RJEA 4DAOA 3LUKA 4ZI2A 1GG9A 2BL4A 5JBIA 1SXJA 1ZJZA 5EIOA 3ZY5A 2MWMA 4BYGA 4Y9SA 1CZNA 1P77A 3DONA 3W9SA 1PGJA 4AS3A 3GJSA 4MS4A 5BW8A 4LSZA 2W6IA 5IHXA 1FPQA 4KQHA 4Y8VA 3DHNA 1OA1A 3DR5A 2GLUA 2CLMB 2PR2A 4J29A 421PA 1C0PA 3IQWA 3OMXA 1Y5MA 3S2SA 5AHRA 2I99A 1FL9A 3OCUA 2AHRA 5AI0A 5ITZA 4QTUB 3DBLB 4PTLA 2ZB2A 4W5RA 5DHPA 3B5EA 4EMBA 1N6KA 3TUJC 3AESB 1K97A 4KKVA 3MAAC 4YI5A 2XSZA 5EVJA 4AMBA 1DDGA 2ECPA 5HF8A 4BMDA 4DCUA 1N77A 1G16A 1BKYA 1JJAA 1WMBA 3IXMA 2Q45A 1GQQA 2M6RA 3OZSA 3ROPA 3TTTA 3LWBA 1P39A 2VHVA 3PFBA 1CZHA 3PBKA 4TVSA 1GFZA 1C3XA 3BGWA 1CHDA 2PMFA 1WZNA 1UBGA 3D81A 4AURA 3JSXA 1GT6A 4I46A 4RVHA 4J6EA 3FOZA 2HRDA 5ELMA 3ZVMA 4ZGBA 2Q5OA 4NFSA 2Q99A 3A1FA 3CTPA 3TFQA 3GG9A 5COQA 1VRWA 4A3SA 1YOVB 5GIOE 1H5UA 3TB4A 4QXQA 3WJ1A 3WP1B 1SUIA 3MRTA 2JARA 3K0SA 1SWWA 4KNYA 3O1HB 5K4GA 3EZFA 4IIFA 1JHVA 3O4RA 3GCWA 5G1NA 4HXGA 4BWYA 2IS4A 1KZ1A 1UT6A 1CUIA 1UBKS 2G0NA 5SY6A 3SXUB 4E11A 5C5CA 3V6MA 4AF7A 4LRXA 1Z0JA 2FN4A 5JTTA 3EZ2A 2WZCA 3QA9A 1G3IA 1EFDN 2A67A 4DEXA 3KP1A 4M7OA 2XX3A 2A30A 3RNLA 2OBXA 1J5XA 3HXTA 5ES4B 3WDMA 2V7GA 2A1IA 5IKEA 2GJAA 1O1YA 3E7PA 4ZP1A 4RESA 1GL3A 1NXWA 1OREA 4JEUA 2M9MA 3F71A 1A4RA 5AJUA 1JNYA 2DWCA 4GP7A 1EFRD 2YVQA 3OZWA 2AJ8A 3QVLA 3KQVA 4ITRC 3LV8A 3C0KA 4OV6B 4ECEA 3OAAD 2ZBQA 1GCUA 1Z8NA 1XF9A 4R5HA 4MR8A 4J3JA 4V0NA 3C7CB 5KHAA 1L4HA 1X8LA 4YRPA 3SU8A 6PFKA 2G4LA 3MMSA 3NTLA 4BQPA 3QSGA 1NI4A 2RH9B 3VV2A 4RD4A 2A4MA 3FUTA 3K32A 3LT0A 2VTVA 2JKZA 2O14A 4ZEVA 1FP6A 5BYBA 2NLOA 4K9MA 1R6UA 1X2BA 3LGAA 4MRVA 4AS1A 3G79A 1VLHA 4ZDJA 5KKNB 4GR5A 4LG1A 1PWXA 1YDHA 2J6HA 1JIIA 3ZQ4A 1UPAA 4R31A 2YHAA 5HGJA 5I7AA 1TXGA 5J2UB 2IEZA 1QKIA 4MWOA 5H5JA 3KKQA 4RY9A 3NALA 4QRDA 3HYTA 4WJLA 2CV1A 3ESQA 3OE1A 4M8KA 2PK3A 1IL0A 4CKCA 3B82A 1SELA 1XRSB 3SICE 2XHZA 1V8ZA 3UXYA 4K1XA 2NUTB 3UWOA 5CXXA 4ZJZA 5P8WA 3M5CA 4Z4IA 1K7CA 2E55A 2GN0A 3OU7A 4PSDA 3PPIA 1I1HA 2MSDB 1Y1SA 3I61A 3R9KA 2WMOB 1SA0B 3QPAA 2Z6UA 1II8A 1NVBA 2XRZA 2O52A 1T6NA 3UOWA 3PGA1 3EFEA 3FDZB 1N8TA 2X5OA 3LOQA 3LQYA 4HRYA 4IKEA 4ALLA 3SSAA 5E2IA 2VPQA 1ZSNA 3NO4A 3BCRA 4CDGA 3VKFA 1ECCA 3ZWBA 2PV0A 1S3GA 1JHQA 3WHKA 2FSFA 1RWPA 3GVCA 1OFUA 4WKCA 3WIUA 1U2PA 4PYKA 3ZN2A 4BJ3A 2JFFA 3M9WA 1OXKB 5I7FA 2JLWA 1HPLA 4QYWA 3N6XA 1YA4A 2AD1A 4IDDA 4PBSA 1Y5LA 2FUKA 3RC7A 5B4VA 3VHQA 3RV4A 3C3MA 4IG4A 7ABPA 2OVBA 1PS9A 2EQ5A 1JUDA 4WGGA 3KD3A 4JSTA 3AF5A 5K8IA 1TZJA 5HG0A 5L51A 4OHZA 3LVQE 3W7BA 1U3UA 5AOBA 4BNKA 4RCZA 2XEXA