1Z6YA

Structure of human adp-ribosylation factor-like 5
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
173
structure length
169
Chain Sequence
ILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQESLRSYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ADP-ribosylation factor-like protein 5
publication title Structure Of Human ADP-Ribosylation Factor-Like 5
rcsb
source organism Homo sapiens
total genus 55
structure length 169
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1z6yA00
4B75A 1M7GA 3B13B 2DPXA 2QA5A 3CR7A 1FX0B 4B2PA 4M8NE 4Q01A 3REFA 4MKFA 1Z07A 3TRFA 3VQTA 1J2JA 3ASYA 4GP7A 4CDGA 4JL8A 4DLXA 1VDZA 1GKUB 3UXMA 3V4RA 1G3MA 4ZPXA 3TQCA 4NPHA 3CIOA 1RC8A 2JCSA 3GP8A 2HJVA 3U44B 5LD2C 3K70D 4IKEA 3QG1A 4TMVA 4JVMA 1LY1A 2JLRA 2YVUA 3WMGA 4RD0A 3B9QA 3L0SA 1UKVY 3QXCA 1OH5A 1CRQA 4A2WA 5JBQA 2Z5FA 1KSJA 1CTQA 2J5XA 2JJ1A 1KDTA 1AS2A 4P4SA 5KPDA 3KQNA 3GJ6A 4Q7JB 3ZD6A 5JWOA 2EVWX 2NMVA 1II0A 4Z54A 4F91B 4TTRA 2QPOA 1U9IC 5EXTA 2WPDA 4V0NA 1RVDA 2Z4SA 2OCBA 2WKPA 1W5TA 3KXKA 3P1JA 3MSXA 3VU9B 1GTVA 3OHMA 4TL7A 2AWNA 3IQXA 5FI0B 5HE8A 2R44A 2GESA 2GTPA 5D3MB 1SVIA 3OIVA 1IJFA 2BHRA 1GOTA 2YYZA 3EC2A 5DYGA 1XD2B 4H1UA 2AKAB 3GLFA 3O8DA 1N25A 1SKYE 4FMDB 1NSFA 221PA 2BMEA 2EFHB 4QGGA 5DYIA 5FPYA 3K9LA 4DCTA 3GLGA 3CNLA 1DG3A 1TUIA 4URYR 2J7PA 1X8KA 1YU9A 2FGJA 4LBVA 4PANA 2QORA 2PEZA 2PH1A 1XD8A 4HATA 4B47A 4D0LB 1JR6A 1NSTA 1JBKA 2GCOB 2IF2A 1XEWX 4CEIA 1ZP6A 4RJLA 2AFIE 4KLZA 4TZ6A 2FX3A 1H65A 5KU1A 1N0VC 5DSZA 3SZRA 4IDNA 2PX3A 2FEMA 4Q7KA 2VO1A 3A36A 3QF4B 4R71A 3AB3A 2QE7A 1E96A 3D3QA 1E9EA 4KFUA 4Q1DA 3W9YA 3UMFA 2OHFA 1JALA 1G6HA 4PHTA 1XCMA 1US8A 1U8ZA 2XXAA 4FXPA 4B3FX 5DN6D 1U94A 2CEAA 4NKRA 1IN8A 1CIPA 1U90A 4N0DA 2YJTD 1W46A 3T1OA 5IRCD 1YQTA 2QN6A 4P32A 1UDXA 3CZQA 2VF8A 1W36B 4OK6A 1YZKA 1KK2A 2CJWA 2ZJOA 2ZRIA 1B23P 3Q5DA 2MSDB 1KSHA 4DCUA 1ZM4A 1CRPA 4Q4HA 4G5SA 3DOFA 3PUYA 3AVVA 3CWQA 3LLUA 5BXQC 1FP6A 4M1SA 3UWOA 4K46A 1E1QD 1FFHA 1YZUA 2QAGB 2QSYA 5CJPA 5LD2B 2C98A 2DB3A 1MO5A 2VYFA 2WAXA 3FGNA 4LC1A 5EE5B 1EFUA 2UVQA 2PCJA 2XOKA 1S8FA 1ETUA 1P2SA 2F6RA 2FJUA 3Q8XB 5L3VA 2ZE7A 3EWSA 1BOFA 2WSSD 1PVOA 4LYJA 2J7KA 4ZKEA 3KXLA 4K8OA 1GAJA 2FDCA 4QBIA 5TDHA 1W4RA 4DT1A 4NCKA 1ESMA 3QVVA 4PXAA 3VAAA 5FH9A 4D26A 3B2EA 3NIBA 2CLCX 2ZJAA 3AVPA 2DFLA 2KBEA 3H4MA 5F9HA 1NLYA 2OESA 3TJZA 4NTZA 4HAWA 2FZLA 5JFGA 5FBQB 4JIMA 4D4MA 2EFDB 4PPGA 3RSLA 1GNRA 4M21A 2DWOA 3NDBB 2O8CB 2G0NA 4IVQA 4QGAA 2W83A 4KFTA 2RGXA 3DL0A 2ZRMA 3UPUA 1TU3A 3EC1A 3N70A 1R0YA 3BB3A 2XJ9A 1IOZA 2ZVPX 1XTIA 4XD7A 1E2MA 1IJEA 1R7RA 4OHXA 4RZ3A 3T5DA 1LF0A 2D4HA 2R6AA 3LDAA 3PG5A 3WMEA 1ZC3A 4HAUA 4HSEA 2WBLC 5DI3B 2QP9X 2ZSEA 5FPKA 2GJAA 2G88A 3W3AA 1A5TA 2FSIA 4DKXA 1DO2A 1PV4A 1SVKA 4A36A 3R9IA 2NIPA 1VYVA 4IDQA 3F3YA 4IDOA 1KYIA 2ZYWX 5A4JA 1EK0A 1MR3F 3I5XA 2AL7A 4JYCA 4RD3A 2GXQA 1Q1QA 3W8NA 5DHAA 3NG1A 1QVAA 1Z3IX 3EPHA 4IRUB 3QEOA 3KJHA 4NYIQ 4EPXA 4V0MA 2XX3A 2REBA 2Q0HA 3FKQA 1XBTA 3RRMA 2H5EA 5K8LA 1ZNZA 1LW7A 3NHAA 4MUAA 2QTHA 4LV6A 5EUMA 4CZ2A 3WHLA 5P21A 4M9XA 3KTAB 4Q9JA 4GNKA 2ASEA 1J8MF 1QDEA 1XB2A 3SNHA 2GDJA 3WNBA 1GVNB 3AP3A 3BFKA 1E0SA 2ZR7A 5J47A 3TH5A 1AM4D 1RRFA 1BIFA 2WWFA 5GJWC 3WYAA 4U5XA 4WW0A 5HZKA 1RKBA 5BWMA 1U99A 1ZD8A 2CXXA 5DLQC 1JEEA 1LB1B 1NVVR 4ERNA 4DB2A 1Q1BA 3WYGA 4TN1A 1T0JB 3JVUA 1TAGA 2OZEA 1M7HA 3BC1A 4M9ZA 1BYUA 4B3GA 1IY0A 1UJ2A 4MUBA 3TVTA 3T1VA 2QM7A 2GA8A 5L3QB 3DKVA 2V1UA 1HYQA 1UKZA 2FF7A 2ZI5A 3KQKA 2VHQA 1SVOA 1P75A 1RJ9A 2GEVA 4LPKA 1YZQA 4KLNA 4JLAA 3IEVA 5H68A 4E07A 4WVFA 4HLCA 1RZ3A 1T3SA 1TF5A 3EZ2A 2F55A 4HLUA 4DLWA 2RHDA 4AKGA 4V0LA 5J40A 2GZDA 3LWNA 4Q1BA 2V8OA 4RCZA 3NBYC 4CEJA 1B0UA 2VSOA 4OQMA 1GKYA 3RDPA 1DAEA 3VR3A 2E1RA 2V7QD 2N42A 3SYNA 5FTLA 1Q44A 4YMSA 4L15A 5A0FA 1Z0AA 2HXYA 2OBMA 3BH0A 1G64A 2AXPA 4LHZA 3OIYA 2XTMA 3HDTA 2KSQA 4AWXA 1G41A 3A1TA 3UMSA 1Q1EA 3B7GA 3LW7A 2OCAA 1RRGA 1Z0DA 2A3RA 2J0UB 4O25A 1JPNA 4NCNA 2ZS9A 2A78A 4PFSA 1KI7A 2JDIA 3KFXA 5C4GB 1GRQA 3GJ4A 2J0QA 1QHYA 3ZVLA 4E22A 5G3YA 5B58C 1KI9A 2ZRNA 1JXMA 2ZYVX 3K0FB 2ZJ2A 3L0IB 4CEHA 1JEDA 3Q5EA 2ZUCA 1TEXA 4KITB 3SOPA 1GZSA 1NRJB 4RY2A 1KNQA 3CRVA 4WZ6A 3A4NA 3BFVA 1Y63A 1T9HA 3KZ1E 4X8OA 3EZ6A 1LFDB 2D06A 2JATA 3M4YA 2XSZD 1OKKD 2ZRFA 5EZ6B 3AVTA 4C0BA 1RIFA 2AX4A 3QEJA 5K8IA 2F1IA 3B1VA 4GSYA 4KYUA 1SZPA 4NMMA 2F9MA 2O0KA 1G20E 1DAGA 3GLHE 1D8TA 4MQBA 4UJ3A 3VNUA 3LVQE 1FNNA 2IUTA 1Z0KA 1NG9A 3GLFB 4MKHA 3TKLA 3U60B 1ZRHA 4DLYA 4TLEA 1FX0A 2YWHA 3X1ZA 4TYYA 3DDCA 1MO3A 5GVRA 4ZCLA 1L7VC 2JLQA 2JGNA 2V55B 4DWJA 3GLGB 1FUKA 2HCJB 2J0SA 2X77A 3G0HA 4TMXA 2IS4A 3ZIAD 4QBFA 3CM0A 2C96A 5E7IA 121PA 3QI2A 1T5IA 2GJ8A 1JB1A 4GI7A 1DAKA 4XOIA 1ZD1A 521PA 3A37A 2PCLA 3SHWA 2DFTA 4PHGA 3T1QA 1XMIA 3D31A 3U44A 3BB4A 1E2KA 1NMZA 2B8TA 2QTVB 3AKEA 4LUCA 3H84A 1LV7A 3HU1A 3SEAA 2BEKA 1OSNA 2BJVA 2IYRA 3PEVA 3X1YA 5FUVA 1R6BX 3AP1A 3ZGXA 4IFBA 4TMWA 2QQEA 5KTYA 2I4IA 421PA 2V1XA 3K8YA 1US8B 3SJCA 2JJ8A 5UKDA 3SYKA 5IT5A 2XXAB 4BLTA 1MABA 5HKKA 2YKGA 1ZU5A 1HH4A 2P6RA 2QQ0A 2ZIAA 3MLEA 4DCVA 1N0WA 4URWR 4BFUA 2GJSA 5FTMA 3N2EA 3OE7D 4AG5A 2A9KA 3K9HA 4Q5IA 1T0HB 4AYTA 4A15A 1VCMA 1AGRA 1E9AA 1ZC4A 4ON9A 2RGNA 4OHVA 2CNWD 4UKDA 3EZ7A 5FI1B 2YZ2A 3AF4A 1IXZA 4PC7A 2FGKA 3MJHA 5IDVA 4BQSA 1OH7A 3U3MA 5JI3E 1N5KA 1XEWY 1TQ2A 1GWNA 4UXHA 2A5FA 4Q4AA 5CDFE 2ZPTX 4M1MA 1IM2A 4MGYR 3UWKA 3ASZA 1MOZA 4FCVA 3ZVNA 1CU1A 4YC7A 3BOSA 1RRCA 2C78A 3CB4A 3BAFA 5FUXA 2G83A 1DADA 1SXJA 2GAOA 3B1YA 1AN0A 2IYWA 1E79A 5HR5A 4LGMA 1NJFA 4W5WA 1NLFA 3FOZA 3AVOA 4TL8A 2QBYA 4TMTA 2V6IA 2FSHA 1R5BA 3H0KA 5CLLA 2N46A 3DEFA 1XXHA 1T8TA 3RRYA 1G5TA 4QRHA 2RGAA 1GILA 2AKYA 2GKSA 2OV2A 5KSZA 2P2LA 1E32A 1GIAA 2BCJQ 2X1VA 4URXR 3A4LA 2QGZA 2WJYA 3QNUA 2F3RA 1CKEA 4I1VA 3DM9B 4TQAA 1M2OB 4HLQB 5M04A 2WM9B 1IONA 4Q9LA 3RSOA 5EXXA 5BN4A 4TL9A 3VFDA 2VP4A 4FIDA 1QG2A 4HLUC 3BIFA 1E9FA 2F7SA 4ZIRA 5JRJA 2PJZA 4JLJA 2JIZD 3WYFA 4JLBA 4B44A 4MA4A 5JSZA 4F4JA 2QAGA 2ZU6A 4EFNA 3PQCA 1Z0JA 3RWMB 3C5CA 3OIWA 4OQNA 2ZRAA 4QM6A 2PMDA 4EPTA 3EA0A 4DSNA 3P4XA 2R6DA 3RABA 1G4AE 4KBGA 1M7BA 4PX9A 2VP5A 5ELXA 3PCRB 1A4RA 4RZ2A 4RCYA 5TY0A 5EP4A 3IIMA 1VYTA 4C2TA 3WRYC 1PZNA 5KO2A 4DSOA 1I4DD 4LWZA 1GUAA 1T8UA 4PAMA 1FMJA 2BEJA 1E2LA 3HPRA 2GEDA 4B71A 2ZI4A 4IOJA 3RS4A 3SFVA 4CF7A 1G8YA 4TT3D 3RYTC 5EUQB 3LXRA 4D6PA 1XPUA 3FHOA 2Z43A 4QHYA 3F0TA 4GRAA 1KIMA 5FOXA 2JLYA 3FHTA 1NBMD 1EFHA 1NY5A 3LBNA 4HLDA 1CR4A 4URZR 1E94E 2ZJZA 2RKOA 821PA 1G17A 3D7MA 4JS0A 3GFPA 3VR2A 3NC0C 2ZJ8A 4MRSA 2CDNA 2WIAA 4EJSA 2IW3A 3C14C 4G0NA 3ZH9B 2QT1A 4ZDJA 3D6TB 2RGEA 4XTRA 1ZMXA 3SQXA 3QXJA 4K81B 2A5YB 3C7KA 3DMNA 1MKYA 2EQBA 3QJYA 4QJ5A 4DBLC 2WWXA 3CH4B 5EP2A 4O3MA 3HWSA 5J4HA 4OI0A 1XF9A 2EWVA 2XTNA 3Q72A 1VCIA 3ETLA 3TW4A 4L9SA 1SVSA 5FR1A 2DFNA 3VTKA 2IXGA 2HT1A 1CJTC 4Z1MD 3L0OA 1XDBA 1NN3A 1RJ9B 3B6EA 2W6JD 3O8CA 2HLDA 2NO9A 2YOFA 4F92B 1X3SA 1KI1A 4KCGA 3H2YA 1P9RA 4C7OB 2RGBA 1ZCAA 2QZ4A 4YONB 4WAUA 3WY9A 4EQ6A 2IBMA 3ONWA 2NO1A 5EZ5A 2D2EA 2AD5A 2V3CC 1ZJ6A 4XIGS 4Q4LA 3WBJA 4B3XA 3GJ0A 2GETA 5SZHB 3E1SA 1ODFA 4DJTA 1YR7A 1NKTA 3FMFA 3LO5A 1KAOA 1NVXQ 4Q9HA 2FH5B 3V4FA 4XVRA 4Q47A 3I92A 3PUWA 1XP8A 4HAXA 4FMCB 3NHBA 4DLRA 4PPFA 5JLJA 5KNDA 5FBLB 1N2CE 4EDHA 2E87A 2RGNC 1Z0IA 1XU4A 4ZDIA 2FPLA 1HE8B 2GXAA 2QEQA 1T6NA 3IO5A 4EFMA 1IY1A 3CNOA 4WBSA 5JJKA 2ZRHA 4FMCF 2XGJA 1ZNWA 1Q1ZA 4HB0A 1N6NA 3AGPA 3WP1B 2DBYA 5FR2A 3BBPA 5L3RA 4A0HA 1R5NA 4OHYA 1E2PA 4XJXA 2VP9A 2HDNB 3GJXC 3B78A 4BFVA 5LB2A 1ZCBA 5DH9A 1ESNA 1ZD9A 1JNYA 3EASA 1RPZA 1ZNXA 1VHLA 5JWHA 1FOEB 2IK8A 4X8LA 2VPPA 1P7CA 4LPSA 1FNMA 5FOVA 4OQFA 3WBKA 4IDPA 4NL4H 4OI4A 1BS1A 2WAYA 3U6BA 3PXGA 2HF8A 2OSBA 2AK3A 1Z29A 3KX2A 2ZYUX 1S1CA 1NBME 3SS8A 3P32A 1HY3A 3QF7A 4D0NA 1QRAA 6Q21A 1CXZA 3LW8A 2JLVA 1SKQA 3SN6A 1P2UA 3RNLA 1YR9A 2AN9A 2GNOA 4ARZA 4IW3B 4C0HA 4C3ZA 5JI2E 1NN1A 2CE7A 2W0SA 4AK9A 4D2IA 3U7EB 1II8B 3OFNA 1GRRA 1W36C 2X19A 3FDIA 4AG6A 3GLIE 2ECKA 4AYXA 3VR4A 1HURA 5HPYB 2WWHA 5JJLA 4HUTA 1KZ7B 3KDSE 2QAGC 4URUR 4A92A 4QGFA 2J0UA 3CRRA 1I2MA 5CK5A 4ABYA 1N6KA 3Q3JB 3ZQJA 1F2UA 4G5QA 4DEYA 4JBXA 4AI6A 2GCPA 3W34A 2IX3A 3WP0A 3Q85A 4HZIA 3K0FA 5CM9C 5DN6A 4BLPA 4O2LA 4QM7A 2KB0A 2F1HA 3U61B 1E2FA 2XB4A 4LC0A 3AF3A 1G6OA 1MABB 3I73A 5TMPA 1P3JA 4NCIA 2NPIA 4M53A 2Y8EA 1VECA 3AVXA 1W0KD 2FWRA 2OO7A 3MUFA 3OEHD 1E1QA 1QG4A 3SYLA 1UAAA 4WXRA 3VKWA 4HZUA 1NI3A 2C95A 4S2EA 3FVQA 3QE0A 1JQLB 3PITA 1T4GA 2GCNA 3J81k 2VH5R 1SGWA 1R0ZA 2I3BA 3IPXA 2VA8A 4LHVA 3M6AA 3RS3A 2QU8A 2VL7A 4YXWD 3SR0A 2ONKA 2WSSA 1HEIA 1KMHA 4JKIA 4Q4AB 1PUJA 3UIEA 4D25A 3AVQA 4PHHA 4C2UA 1IXRC 2PBRA 2ZSDA 1OIWA 1SXJB 1W49A 1T3LA 1XEFA 1Z8FA 1OB5A 2WJGA 1FW6A 4TYWA 4B43A 5AWFC 2EFCB 4EPYA 4FMDF 3D8BA 2A5DA 2QBYB 1KMQA 4Q48A 1D2EA 1GRNA 2XB2A 2BKUA 3UATA 3CPEA 4Q66C 4EAQA 1H8ED 4MRPA 1UBFA 1DVRA 1XXHB 4UXIA 1GFIA 2WKRA 3ICQB 1S3GA 2VP0A 4Q1CA 2H17A 1MO6A 2J0VA 4XTCS 2GVZC 4LZZA 1Z6YA 4E03A 2WWIA 5BQ5A 4W9MC 3OIUA 1A82A 4G3XA 5JHGB 2Q9BA 1NVWQ 5TXGA 5F3WB 1BMFD 2OUKA 4UJ5A 4B74A 1PLKA 1YR8A 3RRZA 1AS0A 2NZJA 4FMBB 3GLIB 2ERXA 3MD0A 4JKYA 4ZIRB 5KDDA 2J41A 3CZPA 4OYHA 3WHKA 3W8RA 2XAUA 3LX8A 5JSZB 4JLOA 4JLMA 4DDUA 3VNVA 2GRJA 5EP1A 1XTJA 4GMXA 5H1YA 2A7QA 1QF9A 3IIKA 2ZXUA 3QXHA 1S3SA 4JMPA 1KSFX 4ZO4A 1QHGA 4V02A 3NTUA 4NYMR 5KSYA 2WWGA 5IK2A 3QG5A 4G1UC 1QHIA 3WRXC 4MYUA 1E2GA 3C4JA 2MMCA 1ELOA 4LHYA 1KK3A 2C5LA 4LBZA 1J70A 3MJRA 5E7MA 3FHCB 1BH2A 4ILEA 5L3SB 3SDZA 4IOMA 4B6FA 3GLHA 2FFAA 1XJQA 1UEIA 3C5HA 3QBVA 4OK5A 1NVVQ 2VHCA 2JLWA 4PSAA 3O47A 3BS4A 1XMJA 2QNRA 3K0EA 3QENA 1I2DA 4PR0A 3A58B 5KSOA 2XITA 4TQ9A 2FZ4A 3IQWA 2OXCA 2P67A 1SKYB 4LJ4A 4HAVA 3TUJC 1X8LA 2B7BA 4R9UC 1EFCA 1XCPA 2OBLA 2ONJA 3OF5A 2IXEA 3ND8A 2CLSA 2VEDA 1KK1A 2LWIA 1LNZA 1FTSA 1E4YA 1QZXA 3CRQA 4EJSB 2C9OA 4Q1EA 1VMAA 3B60A 3PV0A 4DUGD 2FG5A 1VYUA 3EPJA 2W0MA 3KKMA 3TNFA 3U7GA 3AVYA 1DE0A 1PJRA 2OBNA 1E2IA 4IXNA 3C15C 1ZM2A 3RC3A 2KI5A 4TLBA 1AZTA 4IJMA 4BWYA 4JVLA 2FE4A 4ESVA 3U5ZB 2QRZA 3RLFA 1S2MA 1FP7A 3BRWD 1C1YA 3ADKA 5TV2A 1HQYE 2D3WA 2IF0A 2F1RA 2PT5A 1J7KA 5AUNB 4BASA 4ITRC 2V6JA 3IIJA 4TYQA 2Q9AA 1K5GA 1A7JA 1ZUHA 2ZRPA 4PQRA 4Q18A 3EPKA 3NDPA 2GVDC 2W2TA 1TUEA 1N6LA 3H1TA 3P20A 2NZ8A 2IT1A 2W6IA 5FL3A 4M22A 5HCIA 2IC5A 2WKQA 4JL5A 1Q57A 4EQ6B 3NBZC 1KZGB 1GDDA 1II9A 1RE0A 1UPTA 2ATVA 2ZI3A 3T35A 3U3KA 3ZS8A 4AKHA 1KOFA 2NG1A 3B5JA 4U7DA 4ASUD 1S4QA 4LCBA 4AURA 4F38A 2QTFA 5FOWA 1NY6A 4PC3A 3CW2A 1UEJA 3PIRA 1P72A 5E95A 1E9BA 1GL6A 2JJ2D 5CDFA 2NO0A 1NN0A 1D5CA 4EKDA 2G1JA 1OXVA 2Z6VA 1Q12A 2BJWA 4Q03A 2ATXA 5FBVB 2IYXA 3QXSA 2KWIA 4NCJA 3EX7C 3K70B 2V9PA 2YWGA 3NWJA 4RFSA 2PZEA 3L82B 1EFRD 1NG1A 1GKIA 1YJ5A 3U3OA 2IEYA 1N6PA 2PL3A 2ZRJA 3EWAA 4B2IA 4B73A 4DZZA 4PSVA 4B3BA 2OAP1 2D7CA 2VHJA 4TL6A 3F8TA 4XVUA 4N0EA 4POAA 2BWJA 5E4FA 2YOGA 3GJ7A 2C2HA 3U7HB 4M2LA 5LB4A 1J8YF 3TQFA 3CR8A 3BWDD 4G5OA 4JT4A 1OKKA 1UM8A 1ZYUA 2H1LA 1IN6A 2BM1A 1Z5ZA 1WP9A 2P6UA 3L0PA 1XD9A 1E6CA 3B1XA 1RFLA 1XPOA 2IWRA 4P31A 1KK0A 3P27A 2CE2X 3UG6A 3I62A 1Q0UA 1UKYA 2FPKA 4NBSA 4NYJR 1JJ7A 2IHYA 2ZR9A 1E4VA 3TBKA 5H70A 1E2NA 4WXPA 4DXAA 4C7OA 1D6JA 4DLZA 1W2GA 2PMKA 2TMKA 3BGWA 3NXSA 5J4KA 1VHTA 1H8HA 5JJIA 3LD9A 1FZQA 2QI9C 1O3YA 2RAPA 4PPNA 3A8TA 4XVQA 1ZBDA 2RCNA 3TSWA 1OPXA 3ZIAA 4ARZB 4JBYA 2WWYA 3RRNA 2JEOA 3MWYW 2B21A 4QJ4A 2QP4A 4PO9A 4GZMA 5BYJA 3TSZA 1OH6A 2ODBA 1NIPA 3EPLA 4W5JA 2BBOA 1KO8A 3PEYA 4QFMA 4HB2A 3SBEA 2H18A 3ZDQA 4ACBA 1OHHD 2ZJBA 1OE0A 1OF1A 5C4MA 1F2UB 4Q21A 3BJIC 2EU8A 3EW9A 4PTLA 4QBGB 3A1WA 3B85A 2X2EA 5E3HA 1FPMA 1G16A 3FMOB 3GEEA 3PUXA 3AUXA 3WNDA 5C2JB 4PQYA 5B64A 1R8QA 1X86B 5GJVC 3EARA 3ADBA 2FNAA 1XNJA 2OLJA 3OE7A 1WMSA 1E9SA 4C0AC 4MRVA 2IS2A 3SE0A 2O5VA 3DO6A 1JR3D 2BMJA 2BKEA 3AF0A 2F1JA 1C9KA 1GSIA 3BXZA 4OKSA 1ONBA 4ZI2A 4TYNA 2CNWA 4ACAA 1WXQA 1EESA 3QPUA 1LS6A 4C0KA 4XSHA 5JCPA 4HZUB 1NL3A 1CJMA 2O8FB 3P4YA 3TE6A 4HDQB 1PLJA 3A1SA 4QXAA 3TW8B 4V0OA 5IF9A 1HT1E 4FINA 2C03A 4S35A 3GD7A 2O0JA 3L8ZA 2WWWA 1KMHB 1RYFA 2J59A 3GFTA 1CJVC 3GJ3A 1NNEA 3TVDA 3RS5A 2C9YA 2RB4A 3DZDA 1UKEA 4A0GA 3NH9A 1E9DA 2C8VA 5KUTA 4C30A 3KJGA 5GADl 5J4LA 1II8A 2ZETA 1E98A 5FOUA 5JMTA 1E9RA 3GQBA 4B35A 3E2IA 3SQWA 3T61A 1ZIOA 4BECA 4CYMA 4BFXA 4DLVA 2Z4RA 3HYTA 1DOAA 5EP3A 2IYVA 2BIFA 2BBSA 5BN5A 2OAQ1 3ZLJA 2ORWA 5FBWB 1CP2A 2ZAMA 4LJ5A 3RVBA 3LX5A 3BE4A 5ANRB 3OEED 4UXJA 4NONA 5BW8A 1XPRA 1OLOA 5K8TA 4DDVA 4BLSA 1L4YA 5C18A 1W4BA 3M0EA 2WJIA 3KJIA 3PUZA 2HT6A 5HZHA 2XJ4A 3OZXA 4IFEA 4PC1A 1KO7A 2CVFA 3K9GA 3G82C 3K1JA 1OXTA 1CF4A 2ZE8A 4BFYA 1EFTA 2JIZA 3AQ4A 1QHNA 4C4PA 3EIQA 4BUJA 4ZDKA 2FEOA 4BE7B 3PFIA 5SZKB 4D0GA 4RD2A 2GWHA 3CPHA 4LBWA 3VMFA 2NPFA 1IAQA 3KB2A 1KI8A 4DLUA 3IHWA 2QRNA 1WA5A 1AIPA 1Q3TA 2O8BB 1EGAA 1W0JD 2BDTA 3HYRA 3ZJYA 3BORA 1AA9A 4AIIA 4CRWB 2DFKB 2VSFA 2CL6X 3T34A 2O0HA 2DR3A 1XTSA 1TQ4A 4BRUA 5LPNA 1GG2A 1YZTA 2G77B 2P3SA 1QBKC 1Z08A 4I4LA 2D7DA 2D2FA 5CM8B 4PZYA 2ZI7A 3MG9A 1P9NA 2J9RA 4PZLA 4XSGA 2WSMA 1E2JA 3GLHB 1KDOA 4TT3A 2BBTA 5JZVA 5KDLA 1YRBA 5FPHA 4GOKA 1NBMA 5HE9A 1BKDR 2CCJA 1UF9A 3HJNA 4P3YA 5C46F 2Q9CA 3MFYA 5D3QA 1HA3A 4NU0A 2YWEA 4OQLA 4KXFB 3M1IA 2ERYA 4V0KA 1JR3E 4I81A 1P73A 4II7A 1M74A 3CWZA 4LYHA 4TTQA 3DMDA 1KNXA 2OCPA 2VP6A 2A2ZA 1D9ZA 2PLFA 4B3DA 2HEIA 1DEKA 2VIIA 4IOKA 3ZS9A 1OXXK 4B2LA 3CLVA 5AJZA 1F2TA 1N6IA 1RYHA 1Z06A 3LVRE 4XWKA 3GLIA 1KO4A 4BLQA 3AH8A 3RWOA 4GMDA 1SVLA 3AKCA 2PZGA 2JLUA 1Q3HA 5KNBA 4V03A 1XTQA 3U4QA 4A4DA 4BZPA 2VHTA 3FYHA 4Z1MA 5CB8A 3LQQA 4DB4A 1OIVA 3N5CA 4HUQA 3W5JA 2WOOA 2JAQA 3JZMA 2VQSA 2QGNA 2ORVA 1R4AA 2ZROA 3RS2A 1P60A 2B7CA 1G5RA 4C0SA 5FFMA 1KTVA 4L4UA 1E0JA 1A2BA 4LV5B 1HQCA 1U81A 5L3SA 5G53C 2ZUBA 1SHZA 1VCNA 1TADA 2QMOA 4OI1A 2GHIA 1ZM9A 3SI7A 3GJ5A 1G19A 4P33A 1ZAKA 1OFTA 1COWD 2NO6A 2QT0A 2ZE5A 3C8UA 4LSGA 2W2XA 2QUZA 4X8HA 5J4VA 1G7CA 1VPLA 4JLNA 3KUDA 2HXSA 2XNDD 3X1WA 1U8YA 2XNSA 4M9QA 1HUQA 4JLKA 2H7VA 3TK1A 2ZAOA 1OXSC 2G0TA 2P6NA 5FL7D 4KVAA 5J5CA 1IXSB 4M4SA 4UNRA 2REXB 1LF5A 4RFSB 1D2MA 4C9BA 1G4UR 1NF3A 1DG1G 4Q7LA 5DGXA 5JWRA 3NEYA 1TNDA 1XX6A 2VHUA 4LDJA 4KODA 4QG7A 2ZRGA 1CR2A 1OH8A 1G3RA 3K0SA 3TR5A 4FWTA 2E9SA 2WICA 2WJVA 1D9XA 3AVWA 3THYB 3BERA 4XH9B 5SZIA 5HCNA 3GCGA 1HV8A 1EG7A 5CIWA 4Q1AA 1SULA 2R65A 3EZ9A 2NO7A 1Z22A 2DYKA 2H16A 3W5IA 1IY2A 3CNNA 4B6EA 1W36D 3C41J 3KXIA 3T5GA 1XZPA 3NKVA 4AD8A 3DKPA 5AUQA 3UMRA 1OFIA 4RD1A 1EX6A 1GNQA 4F4IA 1MT0A 4OQXA 2ZS7A 2OG2A 2ZYTX 4LI0A 1V5WA 1X1SA 2MSCB 2F43B 2ZM5A 2QSZA 5KNCA 3C16C 1VKJA 1XFAA 4RFVA 4NH0A 4MDEA 4Z51A 2ORIA 1YVDA 4TSFD 3K53A 4OK3A 1JAHA 2GZHA 3HR8A 4CIDA 3U6KA 2XZLA 4FN5A 4LHWA 2ZSFA 1T5LA 1WBBA 4R98A 1J99A 1N0UA 2XZPA 1LVGA 4YMVA 4DSUA 3Q9LA 4JZKA 4B48A 5AJWA 2ZEJA 1BYIA 1WCV1 4QHSA 1E1RD 1DAFA 3IBYA 4DVGA 5FUYA 1G7SA 3ZZTA 1I4LD 2ZJ5A 4Q19A 4H1VA 2AR7A 2GAAA 4QBHA 3IDQA 5KSPA 3G5UA 4BFSA 3THWA 3MGCA 2QROA 3IPYA 2VSXA 4YMWA 3KL4A 1W7AA 1Y3AA 4M1WA 2FSGA 2CK3D 1N3BA 1P61B 1NKSA 1SXJC 3HU2A 2A5JA 3QKUA 4PAOA 1W0KA 3OEHA 3PEUA 3SU8A 4M1KA 4TLCA 3AVUA 1KI4A 2QENA 5DNYB 4OHZA 4ZV4A 1S9DA 1AS3A 3KKQA 4A2PA 3E70C 1X6VA 1NN5A 2OFWA 4CT4B 3DZ8A 1KGDA 4IDHA 2JA1A 4YXWA 4Q00A 2WVJA 1G291 5DI9A 5EE0A 4KI0A 4NP6A 2O8EB 3L8YA 3QUSA 8OHMA 4FWIB 1T91A 1N6OA 2PLRA 3VHLB 3NBXX 2BV3A 3SJAA 2GJ9A 2OXRA 5CJ2A 3LFUA 4E5UA 2JASA 3RAPR 3EIEA 2IA5A 1NP6A 1FMLA 4DHEA 4ZCIA 2HF9A 3B82A 3IHLA 4BZXA 2C77A 2FFQA 3X1XA 3FKSD 1LTQA 2PJRA 1DO0A 4UNSA 1H8EA 2ZRKA 4LK2A 2ZTSA 2ZSBA 3BK7A 4X8MA 1LS1A 1Z6TA 4BEBA 4R2HA 4WA7A 1W5SA 1AKYA 1G8PA 3BH7A 5J4YA 3CUEF 2IYLD 3R8CA 4A6PA 4PHFA 4E09A 3HPQA 3I8SA 4JLVA 2PT7A 3A6PC 1NLZA 1GP2A 4Y0AA 2I1QA 3FMPB 2XTZA 1BMFA 1ZM7A 2GXUA 2B6HA 1OXUA 3A1VA 3X2SA 1TMKA 4NYMQ 5KOYA 2RGDA 4MDFA 2VP2A 1NJGA 2JLSA 4NDZA 5EXSA 1KDPA 3ZZ0A 2AWOA 4MKGA 4TMZA 4UQOA 1EWRA 2CBZA 4DDTA 1EX7A 3REGA 5E7JA 1DTSA 5FPSA 4KFSA 2VBCA 4DEXA 1ZW6A 3ICEA 4KBFA 4EPRA 2QMEA 1S9HA 4ZDWA 2J45A 1JJVA 3UKDA 5FUWA 2IYZA 2EYQA 3I1FA 2BM0A 2O8FA 4PC2A 4US0R 3AEZA 4URVR 4P0TA 4BGDA 5IHPA 4PO8A 3PVSA 3W6OA 5CK4A 1Z2AA 2R6GA 1G8GA 3LRPA 5AJYA 3GFOA 4CT5A 4ZKDA 4YMUA 2QY9A 3ZZUA 4ZCMA 4JSYA 5AJXA 1PLLA 3MWLA 1CULC 1W1WA 2QAJA 2IUSA 4L16A 2WV9A 2ZI9A 4QKQA 1W48A 4TLDA 3WXMA 721PA 3GEIA 4EJSC 2Q6TA 1KI6A 1DAIA 3FWYA 4TLAA 1KJWA 5DISB 3OAAD 5JEEA 2ANCA 2CHQA 1ZIPA 2BOVA 2GBLA 2OT3B 2WIBA 3IEUA 3RS7A 3A1UA 2PX0A 3I3SR 4GZLA 4HAYA 2LCFA 1JQJC 4D82A 1OYWA 1CS4C 2IYTA 2BMFA 5FOTA 4FCWA 1Z83A 3KKPA 4YDHB 4F7WA 1FQKA 4IEEA 3R9WA 2YV5A 3FB4A 4EIWA 4JL6A 1A1VA 4M1TA 1Z2CA 4GBMA 4W7SA 4C0LA 4CW7A 1OT3A 5BN3A 1GM5A 2JLZA 4Q7MB 4DUGA 2RH5A 1DAHA 3OFND 4L5BA 1F2TB 3VX3A 3ZQ6A 4DCSA 3KB1A 3GPLA 1XEXA 1K8RA 2OILA 4KSCA 3VR6A 2J87A 1GL7A 3DHWC 4RZXA 1TQ6A 1VG1A 4A82A 3EAQA 3U4QB 1F6BA 3F5FA 1F5NA 1MV5A 2ODNA 2VTKA 4UNNA 5JECA 2EWWA 2ZE6A 1KY3A 3R8FA 4MYCA 4QL3A 1MH1A 4MITA 4O2RA 2O8BA 2DWPA 2W2VA 2UKDA 4HUQB 4PZZA 4TTPA 2CHVA 3SC3A 1AZSC 1TU4A 1UBCA 1W2HA 4Q4JB 4P4TA 4W5HA 5JCZA 1VCOA 1JPJA 2FMXA 2JJ1D 2CCKA 3K09A 4Q1FA 4I1OA 1QHXA 4LJ6A 2GEUA 1GITA 2WOJA 3BD9A 3K70C 5CB6A 2GF0A 1NVUQ 3JVVA 4A0FA 3ADDA 2ODEA 1TQDA 4ZI3A 1OW3B 5AUOB 5AJVB 2QG6A 2Q21A 1GL9B 2WPDD 4Y0VA 1CBUA 5K8UA 1ZINA 5JHHB 4ASUA 1W47A 2OCYC 3T06B 2GF9A 5EE9A 1NMYA 2JJ2A 3VR5A 1E9CA 2J1LA 2NGRA 1G21E 5EXPA 1IN4A 3SJZA 4R2IA 1YZNA 4UNPA 3U7FB 1L2TA 1QVRA 2ODWA 3THXA 1OB2A 4RKFA 1TTTA 1QHSA 2CLDX 2F3TA 2Q3HA 2GXSA 1R5OA 1WDTA 2L0XA 2OFOA 4IEIA 1EFRA 2IYSA 4QGHA 4OI2A 3AF2A 1F3OA 2J7PD 3UG7A 4NYJQ 1UADA 2BC9A 5F2EA 2IXFA 3AM1A 4H9GA 1X1RA 3KQHA 2IS1A 3RS0A 3GEHA 2XZOA 3CBQA 4A1FA 4IHQA 3IBGA 2O8DB 2Z83A 1E0KA 1OYYA 1TF7A 4LBYA 2QPAA 1CLUA 4EFLA 2LKDA 4RZUA 2QE7D 2O52A 3QKSA 1M1YE 4DSTA 3S1AB 4RD6A 2FU5C 2G1KA 4JBWA 1P6XA 1V43A 1HT2E 4EUNA 2AD1A 2Z0MA 3HR7A 1XCGB 3HU3A 4BFTA 3QY0A 4KYIB 1R0XA 4B76A 4LJYA 5FBRB 4PO1A 1K6MA 4DCNA 2WJJA 3R9XA 3RHFA 2LKCA 2DWQA 3VHXA 2A5GA 4GOJA 3BH6A 5CLQA 2ZSAA 4I1SA 4WZBE 1IBRA 3CONA 2CL7X 3EG5A 1P2VA 4J0QA 3TUIC 4A8JA 4FD2A 4IVRA 5GJCA 4BLOA 3T1TA 1QHHA 4JT2A 2V7QA 5JEDA 2XOKD 3W6NA 3PR1A 3LBIA 5F9FA 3ECCA 2GK6A 1JI0A 3U3RA 2R6CA 2FA9A 2R6FA 3KQUA 3FPAA 5IK2D 1FQJA 4MYTA 4RSGA 1IQPA 5DE3A 5L8VA 3QIAA 1E2EA 4O0MA 1YZLA 1OHHA 4I99A 3KQLA 4MGIR 2N1BA 4DLTA 4AYWA 3P26A 4B3CA 3A4MA 2D62A 1CR0A 2REOA 1S1MA 1G9XA 2ZRDA 3T15A 5A5GA 3NH6A 1NIJA 1E2DA 4HAZA 2A30A 3AF1A 3THWB 5G41A 4EPVA 4FI3C 3H86A 1VIAA 2FFHA 3PJRA 1JR3A 1TF2A 1WQ1R 3QKRA 2ANBA 2XSZA 3MMPA 3K0CA 4GL2A 3MWJA 4IXMA 1CJKC 3CX6A 3AKDA 1K5DA 2GBLC 4MYHA 4YLGA 2IL1A 1Z0FA 1DAMA 5JS8A 3I5YA 3NEJA 3Q7PA 2NQ2C 3R7WB 4BLRA 2IS6A 4D4LA 2EW1A 2RMKA 5FTNA 1MRSA 3O8RA 3KKNA 4HYYA 2G9NA 3Q7QA 4KV9A 1ZVQA 3GLFE 2OE2A 4HB3A 4LJ9A 2CMKA 1CR1A 2F43A 3LXXA 3LY5A 5B30A 3SHFA 2J46A 5HTKA 4LJAA 4JVNA 4AC9A 2XEXA 3CF2A 4XD7D 1FL9A 4WIAA 2IYYA 1OIXA 3WMFA 4Z8XA 3GLGE 4G5GA 3TGPA 1AKEA 1N5JA 2RHMA 4B33A 2ZRLA 1P4SA 2RGGA 2EFGA 3U3JA 1ZUNB 3RANA 1U98A 4DDWA 1MRNA 4NZYA 5TARA 1E2HA 3IILA 4US1R 2CHGA 1XTKA 4IVPA 3OEEA 4M1YA 2W6ID 3CRMA 3DVLA 1VG0B 4QNMA 3T12A 4KHZA 5FOSA 1IN5A 4LY6A 4NCHA 1WBDA 3DPUA 2AK2A 3KFVA 2VF7A 3QPWA 3CH5A 2X8AA 4MGZR 5KDOA 5KYKA 3DM5A 5GVSA 1DELA 1VIYA 3K09C 2ZUDA 1ZNYA 1E99A 2R8RA 4HDOB 3THYA 1GNPA 1CEEA 4DC9A 4RD4A 2P5TB 4TQUS 1HTWA 3KKOA 3KUCA 4TMKA 1JXOA 1DARA 2IYUA 1ANKA 5FTJA 4MGKR 1N5LA 2RGCA 3QOFA 3LA6A 4JLDA 4LJ8A 4P4UA 3VX4A 3L2OB 1U2RA 4DRZA 1W0JA 4A2QA 3ZYCA 4YMTA 4Z8YA 1VG8A 1BO6A 2O8EA 4LV8B 1KSGA 4LJ7A 4KAXA 4NYIR 4GPTA 4P4SB 1YHNA 1G3QA 1U0LA 3K9NA 2HUPA 2G3YA 3MAAC 2ZREA 3IO3A 1SVWA 4L8GA 4JYBA 4Q9KA 4AKIA 1KI6B 1KO1A 3QKTA 1P62B 4QHTA 3IKJA 4D81A 3HP1A 2ZJYA 4HDCA 4B34A 4LHXA 4R7ZA 4FW9A 4D80A 3K0AA 1T3HA 1H8HD 2IHBA 2YWFA 1ZUIA 1M6NA 4HB4A 1F60A 4MH0R 5B2ZA 2AFHE 1KY2A 4I1UA 4PSKA 1YR6A 3TLXA 4PPQA 2J3EA 2AHOA 5GJBA 2ZQ5A 5FTKA 1XJ0A 4CEIB 2HJGA 4FCTA 1L8QA 1XJCA 1HE1C 4HI0E 1XEXB 2BCGY 2IUUA 2W00A 4LYAA 3CX7A 4A8JC 2W58A 1YKSA 1R8SA 2GK7A 2UZIR 3LNCA 5EE1A 5CYOA 1XWIA 5DIFA 2CL0X 2JDID 1R10A 2CCGA 5DO9A 2YNMA 1RRPA 4MKIA 3QQ5A 3B1WA 2OEPA 2WHXA 3BFXA 4OJKA 3QBTA 4LX0A 2GJKA 3MWKA 2X2FA 5EQTA 2CJWB 1A2KC 5EE3A 3GJ8A 4Q4HB 3VU9A 5FPTA 3CPJB 2NOAA 1OFHA 3CX8A 2BBWA 2FFBA 2ZI6A 1KKMA 1COWA 2HCBA 5D3MA 1P5ZB 3FTQA 4BFZA 1KI2A 1XD2A 4OJQA 1AJEA 2C99A 4V0ME 2IEZA 2I1VB 1YE8A 3E5HA 3N2IA 1KKLA 5CYPA 2XNDA 2V4ZA 4D4KA 1DBSA 1X8JA 1CJUC 3EXAA 3EZFA 3K0CC 1AGPA 3THXB 5FL7A 2QMHA 4A6XA 3LH5A 3FFAA 1AQUA 3V00A 4IOLA 4DT1B 2OFXA 4GFDA 2GCOA 2Q3MA 2BMDA 2QMUA 3WNCA 1WB9A 4MRRA 2JLXA 2P5SA 4JVSB 1KI3A 1Z6GA 3QSYA 3LAWA 2ZANA 1TPZA 1XTRA 4U02A 3QF4A 4Q9IA 3QPVA 1KAGA 4HEJA 5TVKA 2MMGA 2WZQA 1OJLA 1VTKA 4XWOA 4N3NA 1XRJA 1EWQA 3QKSB 1SVMA 3FFBA 1OFUX 2BVNA 1W4AA 4Q4JA 2ZITA 1G3IA 2W6JA 1TX4B 1TEVA 3AGQA 5G3ZA 5SZJA 2ZS8A 4U00A 1KDRA 3I8XA 5HKKD 3LV8A 1EXMA 2ZRCA 1SHKA 3B1ZA 4JLPA 2KJQA 1WE2A 1XMSA 2FOLA 2FV8A 4NE2A 5LBIA 3W3ZB 4JJZA 4CGZA 3I4LA 3I61A 2G6BA 4DIDA 1OV4A 2H57A 1P2TA 4UNQA 2B8WA 3EA5A 3SBDA 4ESHA 3THOA 4A8JB 3CF6R 4TSFA 4BFWA 4OHWA 1YZGA 1QHHB 1RW4A 1G8HA 1F48A 3ZVMA 1UBEA 3ADCA 2YOHA 1G8FA 3LBHA 3FMIA 2FPMA 5JS7A 1C4OA 1YRAA 3TR0A 1WF3A 1XZQA 3X1DA 1G3UA 5B57C 1N6HA 2HYDA 1TL7C 3NC1C 2B92A 1SXJD 3TUZC 2EYUA 1E1RA 1SQ5A 2K5UA 4PAQA 1E79D 5G40A 1U9IA 2VRWA 3B8HA 1U0HC 2V54A 2QL6A 2YHSA 4XWAA 3JZAA 1G5PA 3NVAA 2VLIA 5C1BA 1UFQA 2P65A 2DCUA 4KVGA 4US2R 4AKEA 2WJHA 1Q20A 1G7RA 4LOAA 1I4TD 2HV8A 2QM8A 4JJKA 2GILA 3RC8A 2O8DA 3UK6A 2CK3A 5LDDC 3QXXA 2PZFA 4WOPA 1P9WA 3MCAA 4KFRA 2KE5A 4LRWA 4BEJA 1ZU4A 5KPJA 1E69A 1M8PA 2OM2A 4TWZA 3CKLA 5BYKA 1Q21A 1DPFA 3SJBA 4CVNA 4F93B 3QKRB 4MRNA 3S1AA 4DLSA 4TZ0A 4M1OA 2O8CA 1L4UA 2EFEB 3AV0B 2Q3FA 3EIHA 4QOSA 3MRSA 3AUYA 4TYPA 3W90A 2HYIC 1NMXA 2R9VA 3U2QA 3IGFA 4G5RA 4M0LA 3I32A 4M9SA 3TAUA 3TSOA 3CO5A 3W6PA 3OESA 4KSBA 3ND9A 1N6RA 3CRW1 2YINC 2QP3A 2CVHA 4F4CA 4EPWA 2C04A 2H92A 1KJZA 5TB5A 3PENA 3DOEA 4PQFA 2D74A 1Z6AA 4YDSA 1DS6A 2UZ3A 2FN4A 4BZQA 5JRZA 4GT1A 3FKSA 4N1AA 5DI3A 5H8WA 2ZU0C 2H8KA 1R0WA 1E2QA 1FTNA 3FE2A 4AY2A 5F98A 1N5IA 1JECA 1R2QA 1E3MA 1WRBA 1MO4A 3R20A 1Z63A 5AK0A 3NBFA 2YC2C 4QNRA 3B9PA 2WMOB 2PEYA 2R62A 4A0RA 4C0JA 2DHRA 1IHUA 3V9PA 2ZRBA 4YQFA 1J90A 3PUVA 2C9CA 3IUYA 621PA 1O87A 1Q22A 3ZVRA 4CEJB 4DIEA 1IN7A 3GMTA 3UANA 3TIFA 1UBGA 4RKEA 1KO5A 1D2NA 5KHOC 3SFZA 3KJEA 2AXNA 2QPTA 1KJYA 3CF0A 4QC2A 4C0QC 2R2AA 4GOXA 3KTAA 4A9AA 2SHKA 4Q02A 5DHFA 2IWHA 1E0AA 1FUUA 1W44A 2DY1A 3AKYA 1M34E 4OL0A 4D4JA 4LYFA 3PEWA 2KBFA 4RVCA 3R7WA 4KJZA 2GZAA 4PC6A 4NHOA 1G7TA 1S96A 1W4CA 3LLMA 4B32A 1ZM3A 1AQYA 4CEHB 3O8BA 3I72A 2IYQA 2OLKA 4L9WA 4JSTA 3QVUA 5AR1A 4BPBA 4QJ3A 1S0UA 1Z6XA 5L3QA 3ZD7A 2ZR0A 4KO8A 2MSEB 1KHTA 1SXJE 3AP2A 5AUPB 1XMVA 3OAAA 1G18A 2F9LA 1JAIA 3VR1A 2WMNB 1U8AA 1G1MA 1AK2A 2P0EA 4OBEA 3VKGA 3TMKA 1UDWA 3L43A 1Z28A 4WZAE 1PUIA 2HLDD 2YC4C 3TAHA 5CIQA 4BRWA 3VKHA 1XXHE 1U0JA 3BB1A 5EJEA 5CITA 1Z47A 2NTYC 3LQRA 4GP6A 4KU4A 2WTUA 4GDFA 1VG9B 2FSFA 2ZVQX 4G01B 3K0AB
chains in the Genus database with same CATH superfamily
2REQB 3VPHA 5P8WA 4DOMA 1UJNA 3B13B 4KYVA 3TJMA 5KNCD 5A0TA 2AVDA 4B2PA 4I9FA 4KQCA 3OZ7A 1HDZA 3FLMA 1MP0A 1ZSNA 4IUCS 4D4IA 2X0EA 4RZIA 4LMRA 1EAMA 3R3UA 4QTTB 2OO5A 2HQRA 2X9GA 4WT7A 4QICA 3S40A 3HVJA 1B6RA 4GP7A 2HMSA 4I55B 3F4BA 3DL2A 4GEKA 1VDZA 2D5BA 3IUPA 1G3MA 2B82A 2D8MA 2I2XB 3BTOA 3EGCA 1B3RA 1RC8A 2G25A 3SM3A 3OVMA 1VKHA 3E5RA 4AZ3A 3D5QA 3FNEA 3RRJA 1DIOB 2EFYA 3HXTA 3IE2A 4DIBA 1GGNA 2Q28A 3BGDA 5GM2A 4DV7B 1PS9A 3GEMA 3WLLA 4G9GA 3MOSA 1OWPA 2ZAGA 3KEQA 3JQPA 4MNTA 1P7YA 1UKVY 2Q6KA 3QXCA 7GPBA 1CRQA 3SS9X 4L16A 2C7OA 2J5XA 1CTQA 3DDZX 2JJ1A 5DK4A 4F0JA 5FLYA 1KDTA 3DUFB 3ZDDA 5KPDA 1GEGA 3L7BA 3IPLA 2XCSB 4NJEB 2GMWA 4H77A 2WU4A 3UUEA 2EC5A 5BNTA 4Z54A 4F91B 4TTRA 5I9TA 3KE9A 4IJVA 1PJ8A 1QK3A 2WPDA 5HG0A 1HETA 4I9HA 3R4VA 3MSXA 2O2EA 4RVNA 4U3JA 3RYIA 2G4VA 1GTVA 2I1WA 2VCYA 5H7XA 3LO8A 1RPAA 4JN6B 3IQXA 1Z7BA 2R44A 4IIJB 4I19A 3WIBA 5EZSA 3O0TA 1NUAA 1WCYA 2Q29A 1SVIA 5D3MB 1KXZA 3JWJA 4AF7A 2Q5HA 1GOTA 2YYZA 3EC2A 2FSUA 1Z5VA 1TAQA 3TRIA 3KXDA 1NE7A 1SK8A 3MS2A 1L4BA 1SKYE 3LGSA 4B3TB 1NSFA 2OXIA 1RXCA 3ZLUA 2QVGA 4G0MA 1DX6A 2EFHB 2ECPA 2QVLA 4N39A 1VMIA 5BNWA 1V9CA 4JI8B 1S2IA 2OHXA 3FDJA 4G24A 1DXQA 1OJ7A 1Z36A 3PYLA 4URYR 1UWVA 2J7PA 2UZ1B 2V03A 2FGJA 3MMZA 2FMIA 4ZYLA 1WETA 1MQ9A 2JFOA 1TZCA 4DR6B 2FOIA 6CHYA 1JR6A 1NSTA 4X6YA 2Z58A 4WNYA 1NUSA 1QOPB 4PLZA 2B0CA 3K94A 4WRRA 2H9YA 4HV4A 1HEUA 1EUCB 1ZP6A 2IV3A 3BXOA 4H59A 1FVFA 2EL9A 1QOZA 1VJDA 4QULA 4M0MA 1EWVA 2PX3A 4EB8A 2FEMA 3L0YA 4Q7KA 1K8QA 2Q3LA 2V7WA 2D0IA 3IAM1 5CR9A 3ZCRA 5JW6A 1SH7A 1ULHA 2QE7A 2YZ7A 3AB3A 3D3QA 3PE3A 4Q1DA 5EKXA 4B80A 2Z2YA 5AKJA 3W9YA 3UMFA 4ZPJA 5AKXA 2BTOA 2V5VA 5A2GA 4PSCA 4TZTA 3S28A 1C9NA 3F2IA 4YV1A 3VBEA 4LVCA 1M2JA 5EJ2A 1U94A 1RMQA 3O3MB 1IN8A 3S29A 4E5NA 2ZTLA 4M89A 4X7MA 3KNZA 3T1OA 1JHOA 1P8AA 4FX2A 1FC0A 4UTZA 4P32A 4CMEA 2ABWA 4OK6A 3A4TA 1V35A 1C29B 1G6KA 3Q5DA 4MQFA 2I2CA 4Y1GA 2PL1A 4KXNA 1XCBA 3PUYA 5EAIA 3AVVA 3HL0A 2E1PA 4RK6A 4M1SA 1TYAE 3ILVA 4K46A 3WAKA 5CJPA 1YZUA 4YH1A 4F11A 2JHGA 3AEUB 3FGNA 2J3QA 4FC7A 4YCJA 2XOKA 3WWYA 1NPDA 1S8FA 2G4LA 3F4KA 3JRXA 3IR5A 4IHKA 4JJGA 4WEOA 1S2NA 4X85A 2FP3A 4EK9A 4OV6B 5AJUA 3SDBA 4ZEMA 4MDYA 3PP8A 1BOFA 1N2GA 5DK6A 5BSVA 3S8YA 2R1TA 4E2FA 2IGBA 1PVOA 1EK6A 3FPFA 3KXLA 3DKKA 4PQEA 3SLGA 4K8OA 1GAJA 2K7FA 5LR6A 3HUFA 2FDCA 1S2DA 1W4RA 1OXMA 3EVFA 5LP6F 3H5LA 4NCKA 4MHSA 1VBNA 4MV7A 4PXAA 4GSKA 4YBZA 4X1OA 3B2EA 1V5GA 2ICAA 4D79A 2QUAA 1QKKA 2TSYB 3ZBUA 4A7PA 2O2DA 3NIBA 2E85A 5KS2A 5IS2A 4NX2A 4Q9AA 2DFLA 2KBEA 4C7JA 4XE5A 4BO5A 4ZVUA 4HYTA 2WFLA 4RV9A 3HUUA 3TM5A 1A95A 3B3QA 3HCCA 3UCEA 1L3CA 1WCIA 2WV7A 2I71A 4QLOA 5JXGA 5BVGB 1VHWA 2FZLA 5JFGA 3RVDA 1U7ZA 3O31A 4OP3A 5AQEA 4JIMA 5FBQB 1M2VB 5IAEA 4Y2PA 3RKRA 1GNRA 2H4YA 3N8IA 4M21A 4W63A 4L2IA 3LCJA 4X91A 1BCSA 2YZNA 1CY7A 1IDOA 4WPGA 1NASA 2XI4A 3OA0A 4FFBB 4BX9A 5BVHB 3DL0A 4LSWA 2FW7A 3EC1A 3N70A 3BB3A 4ND4A 2C88A 3ZLTA 1RACA 2ZVPX 1RVV1 1ACMA 1FLAA 2VLBA 4H7FA 1O08A 1HDYA 2NUAA 1K88A 1IJEA 1R7RA 1QCDA 2C59A 4XD7A 2BEVA 2CUTA 1REQB 5ITWA 3LFTA 2ACWA 4I14A 2QXUA 3D6HA 4MQ5A 3TW0A 4BAZA 5CA0B 1W88B 4HWOA 1MRZA 1K08A 1ODKA 1CQWA 2R7LA 5JASA 4BVLA 5HJ2A 3UC5A 4QASA 3V5NA 2W6ZA 5EIWA 4MUYA 3SGLA 1TW2A 2Y2UA 4YFVA 1P3DA 2QP9X 2ZSEA 4KSYA 2G88A 2X58A 3C7TA 4J29A 4E21A 2FSIA 2GTHA 4PE5B 3AK4A 5TQ0B 3PCXA 4NABA 3NCHA 3TEMA 1SVKA 3DR5A 4A36A 5CYFA 4K0KB 1Y5MA 2BMVA 4IDQA 4P81A 1HZJA 1B26A 3JTMA 1WUYA 3VH2A 3MTJA 3OF3A 3W7BA 4BMVA 2AL7A 1HE4A 4JYCA 4ND2A 4RD3A 3RAGA 1DCKA 1JHAA 2GYVA 3L0CA 5FPPA 2VNKA 8ADHA 2VHYA 3NG1A 1M8GA 1QQAA 4W1SA 3WK4A 2F8SA 1UOOA 1GUDA 3W8FA 2C5GA 4NSNA 1OU0A 1PJ2A 3D7NA 3T9FA 1H0HA 2FRXA 4K6OA 2H5EA 1BJRE 3WGUA 1P7WA 1G5HA 2QTHA 5EUMA 1MU0A 4CZ2A 1CUWA 1D2HA 1ACLA 2NNLD 3JATA 5P21A 1NM5A 4W6ZA 4N6GA 2H4JA 4Q9JA 3T5BA 2ASEA 1XB2A 1QDEA 2FRVA 2XR1A 2GDJA 3OA2A 3WNBA 1QIHA 4FHDA 4AF8A 1KIAA 3FTDA 1A9XB 2AOVA 3AP3A 3FYCA 4Q3DA 1SBIA 1AKQA 2ZR7A 3KDPA 4JD5A 4E5SA 2EEPA 1C30B 1GFZA 4R2XA 4ZQGA 4ZJUA 2WWFA 3T5TA 1MW8X 5JPCA 4JUBA 2I1LA 2X22A 3JVIA 4DR2B 5KYWA 3LX6A 3VUFA 1NVVR 5IHXA 3HXKA 3I5UA 4X97A 1NRIA 1Q1BA 2WJ3A 4Z4HA 1K7YA 4TN1A 3JVUA 3JYLA 1TAGA 3NHPA 4ETWA 2PUAA 1P4JA 1M7HA 4M9ZA 2GLTA 3V1MA 1EE2A 1K6XA 4OM7A 4MGHA 3V1TC 5IT9A 3IQDB 4Y6PA 5LZ2A 1XZHA 1C3OB 5L3QB 1M1YB 2AG6A 1TA9A 2B1QA 4RTKA 1A9ZA 1P75A 1U2TA 4DMFA 2RE8A 2GEVA 2D1YA 4HAIA 4FYJA 4IH4A 4PF1A 4X84A 4YI5A 4QRIA 1XG5A 4WVFA 3VSBA 4EI9A 2V7EA 2OL4A 4OMUA 5TGDA 1TF5A 1KJIA 2HD4A 2LDXA 1HLGA 3DBRA 5L45A 4EQZA 2WKWA 4K40A 4PVDA 5IULC 3QEAZ 4MZDA 2D1RA 5TE9A 5BV8A 1VA5A 4F46A 2NWQA 2PYDA 4Q1BA 2V8OA 4RCZA 4LRUA 1NE2A 4KDEA 1XVIA 2B34A 2VSOA 4JUIA 4OQMA 3RUDA 1GT6A 1GKYA 2FXIA 2VDNB 3OOWA 3T9EA 5FCDA 1QFXA 1Q44A 5EQJB 5A0FA 2OBMA 2Y1XA 4LHZA 1G64A 2AXPA 4FYVA 3OIYA 3G0DA 3IUQA 4IG9A 4D9IA 1W6RA 1BTOA 2NT4A 3HDTA 4MLPA 3ED1A 4UVGA 5B1IA 5IKEA 4ER5A 2I22A 2KSQA 5JQGA 3DV0B 3B7GA 3SKYA 3RB8A 4RELA 2PKQP 3OJWA 1Y7IA 4ZOLB 3ILXA 1DQRA 4J16A 2B2NA 1Z0DA 2YDYA 4AZ3B 2J0UB 3ZY4A 1URPA 1JPNA 3A10A 4NCNA 3C6XA 4XCXA 4M49A 4DJAA 1KI7A 2NUTB 3VMMA 5H59A 1DAPA 3KUUA 1F20A 5FNZA 2DM6A 1KI9A 1PX2A 1JXMA 1WM1A 2JIBA 2ZJ2A 3QSGA 4H3VA 5D00A 1Z0UA 5C34B 4DDMA 5A5VA 3L7NA 1H9CA 3O8QA 2GZRA 4D57A 3K71B 2VYVD 1ORVA 3A4NA 2VJMA 5JJCA 1YTUA 2O7SA 1OX4A 1O97D 5DHUA 3E6AA 3CLRC 1OKKD 1NSYA 2VH1A 2QG4A 3FDFA 2ETXA 5EZ6B 3WL3A 3L6CA 4NE7A 5F78A 2ACEA 1KYZA 1CY0A 1OTYA 2WIFA 2X0IA 2XECA 4GQBA 3C87A 4J7AA 4QRDA 1SZPA 3DTVD 1G20E 2F9MA 1M75A 3G2LA 4RWZA 1D8TA 1V47A 4U3JB 5C8ZA 2GM4A 3T3OA 1X39A 4PIVA 3VNUA 1MBZA 3GWZA 3IXMA 1VPWA 4UZEA 1U3WA 3T7SA 4CUJA 4JLSA 5K6RA 1ISJA 3FMVA 2X0NA 3T5MA 2HCTA 1GTRA 4KIFA 1LVHA 3KZVA 3QKWA 5K9ZA 3BDIA 1V2HE 1ZRHA 3EXHC 3QV2A 3F8SA 4ZT7A 5JDCC 3JQGA 4LDRA 4J0GA 4DLYA 3Q8KA 2YWHA 3X1ZA 3U4MA 3VSAA 3MJTA 3PXAA 4ZCLA 1L7VC 4EUFA 2OLEA 2G1UA 1XHLA 2IS4A 2J0SA 2AF3C 4BNMA 1HNNA 3A9TA 4L76A 1NJ8A 2O2HA 2P79A 2VZEA 5E7IA 5BSMA 4D4HA 4LF4B 4AIRA 2GJ8A 2VUSA 3LWDA 3UICA 5IG2A 4ATNA 1RS0A 2X5OA 1N2XA 1CNFA 3EC7A 4H1HA 4RUKA 2DTXA 1M0SA 2PCLA 2Q7XA 4D3ZA 3T1QA 3WK9A 4OGFA 1PBTA 3ZWXA 4YEDA 3BB4A 1NMZA 3AKEA 1P1HA 3OT4A 4BE9A 5I48A 1POXA 4ARCA 1WHTA 1BCRB 1ODLA 2YW9A 2BJVA 3LC1O 3PEVA 3GDWA 4Y6RA 1UBJS 1R6BX 3AP1A 5FUVA 1OX6A 4JBHA 2CD7A 3ZGXA 2QQ5A 1TZBA 3LUKA 3T3HA 421PA 1SC9A 2CXSA 1NUTA 4GC5A 3E9NA 2V1XA 3K8YA 4MEAA 5COQA 2JJ8A 3SJCA 1PEAA 1QYDA 1AKVA 3C3MA 2FB9A 1D2CA 4BNYA 5HKKA 3LTNC 2YKGA 3D81A 1ZU5A 3H3XA 1B8UA 2XUIA 4G5YA 3MLEA 4W5NA 4BFUA 5FTMA 2C1ZA 3OE7D 4AG5A 1Y5NA 3T4EA 1KVTA 2QS9A 2HXGA 3HRIA 4MQFB 1VCMA 4QYWA 3IT2A 4YWHA 2H2WA 5AK4A 5SICE 3J81A 4BMYA 5G0UA 2BFBB 3IDSA 1FNDA 4HXFB 1BVYF 2QR5A 4ZRNA 1V16A 4C4RA 2WTXA 4R8VA 1NW6A 3UH0A 4N47A 2DTEA 4PC7A 3OZWA 2W90A 3MJHA 9LDTA 5IDVA 5DX8A 3OBBA 1ZOSA 4E6EA 5JI3E 4KJXA 4FCCA 1RP1A 3R7DA 1C2YA 1XEWY 3BSWA 1GWNA 1NJSA 3KOUA 4UXHA 2NX2A 4KB5A 4Q4AA 3PNQA 1ZBQA 4M1MA 1DX4A 4MGYR 4QXMA 3ZVNA 5C1IA 2R1TB 1CU1A 4R1MA 3OOSA 4YC7A 1RRCA 1B1AA 1JJIA 3NJ8A 3S5UA 1FBNA 1XVVA 1BKSB 1NMSA 2GAOA 4MV6A 2IYWA 4LGMA 3FDZB 2R97A 1NJFA 3GUZA 2K2QB 3ABIA 4LY9A 1WB6A 2FQ1A 4ZICA 2QBYA 3TG8A 3DAOA 5BN1A 5GWXA 2V6IA 2M6KA 3UJBA 2ZSIA 2ZJ0A 3VO2A 1ZHOA 3HK2A 4CTMA 1R4NA 2EP8A 3H0KA 6ADHA 1RZRD 5CLLA 1EP3B 4Y2TA 5A7FA 1CS0B 1XP5A 4JCCA 2RAFA 5DT2A 1DGQA 3KVNA 4TTIA 1GILA 2PH7A 4KG7A 5JAPA 1GIAA 4MYRA 4O4IA 5DX1A 3QNUA 1WDMA 3DM9B 5IZCA 1M2OB 3A9UA 4BL5A 1Q7EA 4YIKA 2WHEA 1GPAA 1U65A 4Q9LA 3RSOA 1NWCA 5EXXA 3ZWYA 5BN4A 4ZTZB 5EC8A 3VFDA 2RC5A 4X00A 1SM4A 3S2FA 1M72A 3IUMA 4L2IB 5GM1A 1BCSB 5CVJA 2Q4RA 1QG2A 2A0FA 3O83A 4BTEA 1IIBA 2PKCA 4E7PA 5IXJA 3T1YB 2VDKB 2Y2VA 4RF2A 1RJGA 2CLEB 4LXXA 4MEJA 3ON5A 1M2WA 3VVLA 3ZE6A 4AJPA 1VSQA 3GMIA 2JIZD 3HKCA 1JEAA 4FMPA 1XMOB 5D7NA 3FSGA 4YT8A 1GPNA 2IOFK 2IOHA 1N5MA 4LNHA 4RK1A 4X20A 3RNOA 3ZBPA 1Z0JA 3JWHA 2G76A 2NUAB 1EWYA 2BEVB 3TLMA 3IXLA 4J1NA 1B2RA 1PK9A 3ID6C 5J63A 3DLTA 2YFYA 1DDOA 4LDZA 1FRNA 2VXBA 3EA0A 1T2DA 1VL5A 2AOUA 3P4XA 4QEKA 4DSNA 5HUQA 3IAM6 1TIKA 4PX9A 3M89A 3GUUA 1W85B 2BZ1A 3PCRB 4GIBA 1FFSA 4QUEA 5EP4A 5TY0A 1EJ6A 1KVQA 1KRHA 1FZTA 3WRYC 5HSGA 1NTOA 1GGVA 1B8PA 4LWZA 4BO4A 2BEJA 3FNHA 1JQEA 3U13A 4ZHQF 3F6BX 3L7IA 1SD5A 2O2YA 4JT8A 3MSCA 3GZNB 2PR2A 1G8YA 2I2WA 1EVJA 3O82A 4ND5A 3RYTC 4BE4A 4CF7A 1KRXA 3QZUA 2OCLA 4KVZA 1VLHA 3H04A 4TN5A 1TPYA 4QUGA 4GRAA 5DHQA 2JLYA 3FHTA 2QW8A 4FE4A 2BLLA 3L04A 4B9AA 5DTIA 1EFHA 3LBNA 3O9MA 1ORHA 1EA7A 1KU6A 6YASA 4YCNA 2Q7DA 1H6AA 1D1TA 3GFPA 3K73O 4J1QA 3H65A 4P82A 4QATA 2CDNA 3UB3A 4AECA 1DHTA 2WHPA 4JBLA 4KR0A 3D6TB 2FRDC 4N9QA 3ANMA 3D1LA 4XTRA 5IVIA 4EX6A 3JVDA 3SQXA 5A4IS 2CLMB 2EX1A 4ZEVA 4QJ5A 3MERA 3AIOA 1Z4OA 4EVIA 5DXJA 4BCDA 3NOVA 3SSOA 2WWXA 5KYWB 1FTWA 1TB4A 1QIDA 2X0KA 3AR4A 3ZUPA 4Z2YA 1U8XX 3EGVA 2A5LA 4HQLA 3AWDA 4HGNA 5JXJA 1ZA1A 3L0OA 4AJIA 2GD6A 3HVHA 4H6VA 1WUJS 3TM4A 2ZJFA 3DMTA 3RU3A 3B6EA 1QDLB 2GN0A 3OZFA 1DPGA 1V71A 4RPKA 3HACA 1W34A 3MT8A 5DYYA 2J6IA 4L4XA 4NAVA 4YRNA 2XV1A 2VSNA 4LGVA 1MB3A 2J3JA 4KCGA 4F92B 5F5LA 3F90A 1BAPA 4QU8A 3WG9A 3IKLA 3DBRB 4FT4A 4WAUA 3WY9A 4MWOA 4DA4A 5E3JA 5FQNA 1GSOA 4O4JA 1OLXA 4RAOA 4QGSA 3W2GA 2V3CC 4OLBA 2NQ8A 4ZCSA 1AK1A 4M55A 4MVJG 4XIGS 2HEGA 4U2CA 4IKPA 4D46A 4EA8A 4O2AB 1GDTA 4XWYA 2ZOSA 4B40A 2FI1A 4DJTA 1W76A 2CFIA 3U16A 5LZ7A 3FMFA 3LO5A 1KAOA 1ZWKA 3V4FA 3ZU3A 3ONVA 4FYKA 4J9VA 3N3BC 3I92A 2AJBA 1KP2A 2QQFA 3WLTA 4PPFA 3FGOA 3PLAE 3UAYA 3FOBA 4D6XA 1GUYA 2DRIA 1LLFA 1C0PA 2XKBA 4FHEA 5JQGB 1D7OA 3PEFA 1Q6ZA 2VJNA 3NGMA 1HBJA 2I6FA 2Q0XA 3E9CA 3WV5A 4EFMA 3CNOA 2JFQA 5JJKA 2ZRHA 4FMCF 2XGJA 1ZNWA 3MEQA 5H81A 4CM7A 1N6NA 4I6EA 4A0HA 5FR2A 1VKRA 5I8PA 3OZEA 3Q6NA 2G09A 4OHYA 4ZALA 2D0DA 3GJXC 4D74A 1JG6A 2IY7A 2EDAA 5ALYA 3S44A 5DH9A 3EVEA 2XLCA 3O8QB 2CVPA 3SOZA 3RUFA 3UMVA 3NANA 1I7SB 1KJNA 2VJMB 1ZD9A 1QH8A 3KYDA 1KDVA 1XZEA 1TGYA 3IP6A 4AUEA 4RHCA 1OX4B 5JWHA 1J0DA 1FOEB 2HA5A 1JAZA 5BR1A 3LY9A 1FXWF 1P7CA 4EG7A 4LPSA 2PGAA 4RJKA 3SDSA 4OQFA 3ZHQA 3K0HA 3WBKA 1WY5A 1BU5A 1DMSA 4DARA 4BNZA 1DQSA 1J97A 4B7UA 4LZOA 3ZLBA 3PXGA 4D9KA 1D2GA 4GU5A 3FKJA 1CP3A 4D0NA 1QRAA 4R0NA 3CUWA 2NM0A 1NU6A 1XDGA 4NBWA 1IQ0A 4PRZA 1A72A 3L8EA 4J0JA 4AO8A 4EENA 1P2UA 2EGGA 1YR9A 2AN9A 3E7DA 2W0SA 3C8DA 5LQSA 2IYFA 1F14A 1L4LA 4JJFA 1L4MA 4D2IA 1II8B 3EWIA 3L77A 4MTCA 1T4CA 3LOQA 4CM8A 4E5YA 3HY3A 3GQBB 5IBCA 1OGYA 3DC2A 4C87A 2XNHA 4DRXA 4EARA 2WJZB 4C7KA 2PBZA 3GLIE 2Q1YA 3VR4A 1GUZA 1E59A 2JCGA 3IOBA 3FNFA 3EEFA 5T8KC 4HUTA 4UUAA 4O59O 5L4SA 4HH1A 1I3KA 2VN8A 3ZDRA 4ABYA 1N6KA 3Q3JB 5F9MA 5KX5B 3JAMA 5T7BA 4RGYA 4AI6A 2Q9UA 1FNSA 2GCPA 2JS7A 3I58A 4B6JA 3DAYA 2ZBGA 4NAHA 3DP7A 1CWUA 4LJLA 4Z0TA 3WP0A 1ZRSA 2GM3A 5DN6A 3Q9SA 2R8BA 3UW1A 1VSTA 2ZIGA 1LPPA 1PJAA 1E2FA 1SCIA 2ZATA 4OQQA 1IPEA 1G8AA 1H6DA 2VI5A 5B1HA 4LC0A 3I73A 4FSXA 1G8SA 1CUAA 1P3JA 1WLSA 2QSJA 3PVZA 2ID4A 4ZVRA 4RVHA 2QRLA 3PE4A 1TJNA 4DG8A 1K68A 2JBHA 3WFIA 2QLJA 2PMBA 4XUCA 1Z5NA 4PWYA 2FWRA 2OO7A 5EMHA 3B6MA 3GRVA 4ZT4A 3X43A 4B09A 1TRHA 4JBIA 4QTUB 3WL8A 1KAEA 4S2EA 1VHDA 1CZLA 1HT3A 1JQLB 4M54A 3OWXA 4K9NA 4DQDA 1WD7A 4HSGA 4E1VA 1A97A 1SGWA 4BWGA 3L0BA 1OWLA 3IPXA 2QU8A 4NDAA 1DC6A 2VL7A 1LLDA 1ZRMA 1SCAA 1CD5A 2HI0A 1MVNA 2ONKA 3AIMA 1EBUA 3LK7A 4RMJA 4TS1A 3U4GA 4AZ0B 5BNFA 4Q4AB 5DLDA 2XD4A 2VT6A 3O3OB 4D8WA 2X5JO 1YIOA 2PBRA 3E05A 4PBRA 1RKUA 4DNOA 5IASA 5ILOA 3WX0A 2XYRA 1PL6A 5AW1A 4WZZA 3G1WA 2HSWA 4FMDF 3JZFA 4H1TA 2XCOA 5DLEA 2QBYB 1KMQA 1C81A 2Z6UA 1Q84A 1GRNA 3TNJA 1JDPA 2CHUA 3KM0A 3GGJA 4BMOB 3CPEA 5ITZA 1R4NB 4DCPA 4TUYF 1TYEB 4M0PA 2VAVA 2WG2A 1DVRA 2GD2A 3EODA 3KYIB 1GFIA 2WKRA 4LDAA 5AOAA 3C4VA 1RXVA 2HR1A 1MO6A 4M3NA 4Q9DA 3ZOZA 1NXXA 4LZZA 1Z6YA 5CTJA 1SIBE 4PONA 1P1KA 1YI8A 2GBPA 2WWIA 2XT0A 3FETA 2ZT8A 1BEUB 4G3XA 1MUUA 2IE0A 5KWJA 1U7TA 2EJVA 2O2IA 3EVAA 1Y9EA 1FLNA 4RF3A 4KYTA 2OUKA 3TIVA 3TINA 4E5VA 5BN4B 4LZLA 4K87A 4B74A 1GPKA 1PLKA 1JLHA 1YR8A 4P7KA 5HBGA 1DLJA 1Z5OA 1TM5E 2EGHA 3NETA 4FMBB 5IMBA 4BJHB 4E30A 4RPLA 1ISFA 1U6JA 3Q11A 4FBMA 5KDDA 4UMEA 3CZPA 2ID8A 2QX4A 2W48A 3HKCB 4P5DA 4PZAA 4QQFA 5H16A 4EMUA 1SKMA 2XAUA 3ILSA 2RJ3A 4PLFA 3WBFA 3VNVA 5CXSA 2BGGA 1BN7A 1I4EB 5CB4F 5K6AC 4XYMA 2ZXUA 3TEFA 1ULUA 3DKIA 3QFRA 3L8HA 5TSDA 1X1AA 4E5PA 5CXQA 1XYYA 3R77A 2AOUB 4ZO4A 5KSYA 2BJHA 3C7AA 3EDMA 2SNIE 4G1UC 1Y7HA 2ZSHA 5T3UA 3AU9A 2HX1A 1KWGA 1E3LA 4G1FA 1E2GA 4WH0A 1GYQA 1ELOA 1RHQA 4M6WA 2O3UA 4NEGA 2BRUC 3DBHA 1MQAA 4NBRA 1JIUA 1BH2A 5E9JA 2I4MA 1Y1PA 1O89A 1G20A 2YASA 2DQ4A 5C7OO 2X5NA 3C5HA 1UH5A 4J1TC 4MMZB 1GLGA 4OL9A 1NVVQ 1P44A 1FMFA 1WSBA 4PSAA 1FB5A 1XMJA 2YCBA 2QNRA 4LJRA 2H7CA 3GRZA 3ZWNA 3K0EA 1AMUA 4PR0A 4YPOA 1PWYE 4MVJE 7YASA 4TQ9A 3D6UA 3IQWA 1CUEA 4EW6A 1GNVA 3RYCA 2BFWA 1SKYB 4LJ4A 2GCEA 4JI4B 3ZNNA 2H0AA 2IKSA 3D2AA 1EVEA 3IMEA 4KPUA 3E15A 4KGDA 2OBLA 4J90A 2J3MA 1OA1A 5DNVA 2R84A 2XE8A 1D4AA 1ECBA 3E9YA 4DAEA 2XVYA 1I0LA 3PC4A 1KK1A 3EQ7A 2J48A 4E22A 3L84A 3KUXA 1LNZA 1FTSA 1MCZA 3PKJA 1N0HA 4HTAA 4LNAA 4BUCA 2I6QA 1YDEA 2DC1A 2C9OA 2YVLA 4Q1EA 5BORA 4EJ0A 3K6SA 5J5VA 4DUGD 2FG5A 2GWRA 1QIGA 3EPJA 3Q8MA 3KO8A 4TS3A 4P5PA 3AVYA 1ZMRA 1HRDA 1DEAA 1PJRA 1E2IA 1H5UA 3NGLA 4HGOA 3ZOKA 2OYCA 1LGYA 1SFRA 2Z4TA 4IJKA 3RU9A 5IM4A 1SQ6A 5A02A 1INLA 1AOXA 2NAPA 3O2JA 2IIPA 3RLFA 1FJHA 4TWBA 1YJAA 1C1YA 5K0EA 1NRXA 2O2XA 4RJJA 2EJUA 4ZQFA 1EHIA 1XQ6A 1J7KA 1PT6A 2C61A 2Y9MB 3NTVA 1I1HA 4GSLA 4J4BA 4HKTA 4ITRC 3GPDG 1UQUA 4MINA 4TYQA 5HF6A 4E15A 1SXQA 3ROFA 5JYEA 3NALA 3AETA 4IHAA 5JMPA 3CB2A 1R6TA 4PIMA 4IEFB 5F1YA 3P20A 4KREA 4BNKA 1X19A 3OP1A 5FL3A 2VKTA 3DXYA 3EZXA 2NVUA 4ZMSA 4I6GA 5B6IA 1DUVG 2XNKA 3AQIA 1LC3A 1D4OA 1GDDA 2ATVA 5J2UB 3GCDA 1SCBA 1OLXB 4KE7A 4GF5A 1JDVA 4WTOA 4FGKA 3OKCA 1R66A 4ASUD 4UBJA 2QTFA 5DLPA 4GWKA 4DCGA 1NY6A 4ZAGA 1SMKA 2ZK7A 7MDHA 1RPJA 5E95A 2JJ2D 3DLIA 4EYQA 1H5NA 3HYCA 3TAXA 2YWDA 1JMKC 1OXVA 1XTPA 2BJWA 1XK7A 1BXGB 3CKKA 3GOQA 3KSAC 3QXSA 1ZQ9A 4NCJA 5DNEA 3K70B 4BFLA 3V4LA 2PZEA 3PDUA 3TEJA 3LUAA 4ML3A 1Y5LA 5KKNB 1NG1A 3CLRD 3VPSA 3WWZA 5C81A 2XE4A 5SY9A 1U6KA 1NC1A 1NR1A 2ZRJA 4U9UA 3T4PA 4B2IA 3RUCA 4DZZA 1N3IA 1JG4A 3H1BA 4IGFA 4Q1VA 2X0FA 4D9NA 1QFZA 2D7CA 2VHJA 3HJAA 4L27A 4TL6A 3RE1A 1VLJA 3TPZA 4XVUA 4KR2A 3BK2A 3FCCA 3NRCA 2BKVA 2JPDA 2RD2A 3HB7A 3DAHA 5JMWA 3DWIA 1GU1A 4DMHA 2IQ5A 3AIIA 4R1QA 1TJ4A 4ARSA 4G5OA 1Y3IA 4F2DA 1QH8B 3KYDB 1WP9A 2BGIA 4RVDA 1ISSA 2XF2A 3RUIA 1DBVO 1ZOLA 4LS3A 2PHZA 4RX1A 4P31A 2IWRA 1RLIA 1Q0UA 3RG8A 1UKYA 4NBSA 3LL7A 2NV6A 1B6GA 3KSUA 4MI6A 4C0XA 2IHYA 2ZR9A 1SOAA 4D0SA 4LF8B 4RTRA 3TBKA 3W6ZA 2P0AA 2W8BA 1E2NA 4WXPA 3ZY5A 5T4BA 4DYDA 6REQA 1JAXA 1D6JA 3JSAA 3PXEA 1I80A 2FEKA 3BGWA 3INNA 3NXSA 4NESA 5J4KA 1ADJA 4FD3A 2M98A 1P8JA 3VJLA 3L1VA 4QNNA 3K16A 4PPNA 1QE5A 1XWFA 4ARBA 4YRAA 5KNDH 4KMSA 1L4NA 5KQSA 2WWYA 3AHHA 3TMYA 1QQ6A 4WCFA 4WK0B 4F85A 4CMEC 5BYJA 5CAEA 4CM8B 3P5SA 2ZULA 4MV4A 1JDBB 2XA2A 1I0ZA 3EXIA 5U4QA 1XRSB 4G4SP 4O4LF 4DRXB 2FWPA 4DIUA 4H6WA 1A77A 1NX6A 3W3AD 1MN6A 4CQMD 4EKYA 5JNRA 4HB2A 2ZB7A 5EEGA 4GNRA 1CRWG 1L1QA 1XHFA 3ZDQA 4TYMA 2ZJBA 2P2ZA 1OF1A 4G63A 3FFWA 2XMCA 4QBGB 1CVRA 1Q74A 2WJWA 1XA0A 3A1WA 2EARA 3FMOB 1PNQA 3GEEA 3PUXA 5E8RA 3WNDA 2IYOA 5GONA 5B64A 3TB6A 4GI2A 4AWBA 3DFIA 3LUJA 5JARA 3PR2B 1MB9A 1RQXA 2OLJA 4X95A 2ATCA 1E9SA 4N12A 5E4YA 3ER9A 1JQ5A 1DDIA 2ZBFA 1S8AA 1Z4JA 3M82A 5CFOA 3NBKA 1C9KA 2F1JA 1GSIA 3BXZA 4KLAA 1T6ZA 1VA4A 3CCFA 3GNLA 2PTHA 2H11A 2CNWA 2XXJA 1C3VA 1VBFA 2E4XA 3H18A 1V95A 1UJBA 2W2OA 4JENA 4PQGA 1LS6A 2GSWA 2WP8J 4L7VA 3IRUA 3ZHZA 2A1IA 1Z56C 3TE6A 2FZCA 3NONA 3LCMA 4JI0B 3IT3A 4M9RA 3C8ZA 1QK5A 4NVRA 1GTZA 1SVUA 3DZBA 5AK3A 3TW8B 5HZGA 1PNOA 1HT1E 3ENQA 4E12A 4E70A 3I28A 4NU8X 2O0JA 3L8ZA 1BH6A 3IMFA 4KK3A 1C7JA 4W5RA 1BDIA 1YDFA 4DV3B 1M1NA 3GJZA 1L8OA 1ZX1A 2PS9A 1LPAB 2C9YA 2O4CA 4WECA 3RS5A 2WSLA 3OUZA 1U3VA 4EA6A 4W5TA 1OILA 1T6YA 2CJYA 2NV2B 5KUTA 3HTXA 5JSFA 1O9HA 5ALFA 4PFQA 3VKVA 5IANA 1SKAA 4PZEA 5IMSA 4HWTA 1E9RA 1H4TA 1T0UA 4RYLA 4C89A 4IHJF 3AFOA 3E9RA 1ZIOA 1R1DA 3GGCA 1KP9A 2ZBUA 4R2WA 1RWBA 5ITZB 3OTQA 1L7NA 4OH7A 1CP2A 4ERXA 5A3SA 5ANRB 1KEZA 4UXJA 2QDKA 2EHDA 1N2HA 1CRZA 5JFOA 1VRCA 3FPKA 5CW1A 3T7IA 3DEZA 2HADA 1L4YA 1HFWA 1E7MA 2WJIA 1ZD5A 4JHLA 1UBHS 2HT6A 2EGUA 2UZ0A 4XLZA 4HAOA 3KSRA 3D54D 2YXNA 3JWEA 1OAOA 4CLOA 4GPEA 4OF4A 4WFKA 2ZE8A 1HDOA 4XQ9A 4AJEA 1ZL2A 4BFYA 4EY7A 4F04A 2HRCA 3D9QX 3OPYB 3E8XA 4YPFA 3N0TA 3N6XA 3AB7A 2XXBA 3M5PA 4BUJA 3HRHA 1BHQ1 2B37A 2PD3A 1DQNA 3PFIA 1LLUA 3DJYA 2X14A 5GAJA 3A9VA 5AVQA 4TS4A 3HEBA 3CVVA 4JCOA 3BVPA 3S2YA 1JBEA 2QJOA 5I9LA 1Z68A 2ILVA 4PCUA 3VISA 4CIXA 1Q3TA 1U8EA 4H3KB 1W0JD 3GX1A 1BKYA 2JGLA 2ZT7A 3UMYA 3TN7A 2DUNA 2GPJA 3HBLA 5F3RA 3V1UA 1Y1TA 2AT1A 3PD7A 3T41A 3Q0IA 4FFLA 1TQ4A 3EGEA 4BRUA 1GG2A 1CUZA 2G77B 5ER6A 1LBHA 5LPNA 1Z08A 3Q9NA 4GXQA 4X71A 4M6WB 1QE3A 3DLCA 3E84A 3UCFA 2AJCA 5BMVF 3DBHB 2J3DA 2PWZA 4EA7A 1P9NA 4L0CA 2JRLA 3M5WA 1RD4A 1G20B 1E2JA 1BVRA 4TT3A 3LBAA 2PBLA 3JQ9C 2HIHA 4E51A 4KIUA 4J75A 2CVZA 2PXAA 1N7GA 5ALLA 3R5TA 5FPHA 5DGTA 4OGGA 2CCJA 3MFQA 2IUEA 3ZXSA 1CPYA 4PTZA 1UF9A 4G56A 4LXUA 3T5CA 2Q9CA 5D3QA 2YMMA 3ORRA 5A5DA 3RYCB 1MEOA 3MA0A 1UBKS 4I4TA 3Q9UA 3R0QA 4KXFB 4BNWA 3HB4X 3BHNA 1JR3E 1T24A 3YASA 1P73A 5ICSA 3ZCXA 3CWZA 3TIXB 3DMDA 2A0KA 2ENWA 3QH4A 1RLTA 1UQTA 2BD0A 4RHTA 4Y2QA 5DMXA 3ODPA 3N8KA 1YV9A 1WU8A 1DEKA 2CMFA 3EHDA 2ZJ6A 1XGKA 4DCJA 1CC1S 3E3MA 1UMDA 2DUMA 4LMBA 1R0KA 1Z06A 2WFAA 3W5UA 3X1KA 3GLIA 4BLQA 3MWDA 2FVYA 2PZGA 3EMVA 4HO1X 3TJRA 3RKSA 4DV1B 1X87A 5EWMA 1TLFA 3BCUA 1CUJA 5KNBA 4CKWA 4A4DA 3V4ZA 1HSZA 1PYDA 1V26A 3AY3A 1Q7GA 3W05A 2GM5A 3ENWA 3ORFA 4XGIA 3NHZA 2UAGA 3GVPA 5REQA 1B00A 3LQQA 4R1NA 1HF3A 1YFKA 3N5CA 4KX5A 3E0QA 4L0MA 3V1NA 1RQLA 1H2HA 1YGYA 4AUNA 1HK7A 2CJXA 1PGPA 4HRVA 3BE5A 4HX9A 4TRJA 1PEDA 1EKXA 2VQSA 3I8OA 1F0YA 2YNMD 3IYLW 4I5GA 2ORVA 2R79A 1R4AA 2MR5A 2ZROA 4S12A 3H13A 1P60A 2WTEA