1Z6YA

Structure of human adp-ribosylation factor-like 5
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
173
structure length
169
Chain Sequence
ILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQESLRSYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure Of Human ADP-Ribosylation Factor-Like 5
rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords ADP-ribosylation factor-like protein 5
total genus 55
structure length 169
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1z6yA00
2ODEA 1U9IA 2YZ2A 1GNQA 4OHWA 1GAJA 2YC4C 2ZSDA 2HJGA 1OKKD 3GLHB 2H5EA 5AJWA 2GKSA 4RVCA 5JLJA 3B8HA 2D2FA 5JWHA 5F9HA 3CB4A 5FBWB 4DEXA 1T91A 1NBMD 1G9XA 4GI7A 3SHWA 3SYLA 4OHVA 1E2FA 1LS6A 2H1LA 5J4VA 5HE9A 5FOUA 4OHYA 1II8A 4DLXA 1SKYB 5EE3A 3GLGE 2WPDA 4EUNA 2J59A 4KFUA 4XWOA 4JVLA 2E9SA 1KSFX 2OE2A 4C7OA 2Q0HA 2J7KA 5CB8A 2VA8A 1II9A 4AYTA 4HATA 1GSIA 4V0ME 1Z0JA 2L0XA 3R7WA 2AKYA 2JCSA 5E7IA 5KNBA 4D26A 2ZAMA 3AF0A 2JEOA 4PR0A 2QSYA 4PPGA 3C4JA 5ANRB 4M9QA 3THXA 4YMSA 1XZQA 1CXZA 1OFTA 2CNWD 2PJRA 1KI2A 2BKUA 3C14C 1RPZA 2RGDA 2RMKA 3W8NA 3LV8A 2JLRA 2QY9A 1EX6A 1UBCA 3TIFA 2KE5A 4JLOA 2QL6A 1RFLA 1H65A 2SHKA 1GKYA 4JYCA 1SVMA 3LD9A 1G291 2BCGY 2C96A 3KB2A 3OAAD 4A4DA 5TY0A 3THYB 1GL9B 1MO5A 2XX3A 1AZSC 4QJ5A 2ONJA 3U6BA 4N0DA 5J4HA 1YJ5A 4IDQA 1B0UA 1XEXB 4HLUA 2Y8EA 5JCZA 1G3UA 4Q9IA 4MYCA 4JBYA 5L3QA 2VO1A 2VSFA 3SYNA 1OH8A 3PEVA 3D31A 2ZS7A 1P9RA 3H86A 1XNJA 4YDSA 1GIAA 4LBYA 2ZYWX 1Z6YA 2VPPA 1QHGA 2Q3MA 1LFDB 4JLJA 4O2RA 2R62A 1XD8A 4TL8A 1QHYA 3LX8A 4TN1A 4OI2A 4QGGA 5FOXA 3U7EB 3K53A 4KV9A 1VG8A 2ZRDA 4MRSA 3IBYA 4PAQA 4LSGA 3DZ8A 5TV2A 3SS8A 4DHEA 4BLPA 1GL7A 1KI6A 2RGBA 4WXRA 2QTVB 4DIEA 4MDEA 2B6HA 1YRBA 5SZHB 3LXRA 3LXXA 1Y63A 2GXAA 1U8ZA 3N2EA 3CLVA 2GEVA 3HR8A 3SN6A 3I32A 3N2IA 4HDCA 1S96A 3QSYA 3VR1A 3U44B 2PMDA 4EJSB 4NYJQ 4KBGA 1JAHA 1DAIA 4V0MA 4QHSA 1DO0A 1E1RA 1OB2A 2OAP1 1ZNWA 4OI4A 2ANBA 4GMDA 1CLUA 4R9UC 4TMZA 4G5OA 1QHHA 1S1MA 2WPDD 3Q5EA 3UK6A 4C2TA 2WKRA 1F2TB 4EJSC 4TYNA 1G8HA 3B2EA 2LKDA 4Q4LA 2ZI9A 1DAMA 1KDRA 1W5SA 4HB2A 1N0UA 1RZ3A 2BMFA 4IEIA 4DLVA 5KUTA 4JVSB 4URVR 221PA 2JATA 2P67A 1JEDA 3PCRB 4NYMQ 1U94A 5SZKB 2I4IA 1SXJA 3BH6A 4Q18A 4ARZB 4LJ6A 3EC1A 1IAQA 4Z8XA 2PT7A 2V7QD 1AZTA 4DDVA 1CP2A 2WZQA 3WXMA 4A8JB 3F3YA 5K8TA 5L3VA 3BGWA 3C8UA 1TUEA 2A30A 2J87A 4G1UC 1IM2A 1Z3IX 2IEYA 1IXSB 1S0UA 2WJJA 1KO4A 3AKEA 5LPNA 1P5ZB 4FMCF 1WQ1R 2A9KA 4NU0A 4TT3A 2O8CA 2G1KA 3NWJA 5GJWC 5EUQB 3KFXA 5H70A 1C1YA 1NVXQ 2J0QA 1NJGA 2R44A 3T15A 5FR2A 3ZH9B 1TF7A 1KDOA 3SDZA 2DYKA 5CK5A 1IBRA 2BMDA 1P9WA 2LWIA 4D4LA 1W1WA 3ZVNA 2WOOA 1VPLA 1NNEA 4XOIA 4HUTA 2IYLD 1N2CE 5JBQA 1QBKC 4LJ4A 1JJ7A 2IW3A 2RGCA 3TMKA 3ADKA 4YQFA 2ZE7A 4DSNA 4H1UA 2AL7A 1XTJA 2HYIC 4GBMA 1JXMA 3O8BA 4X8LA 3U7HB 1DAEA 1FFHA 2NOAA 3IUYA 2IUUA 1DS6A 1Z06A 2OCBA 2WJGA 1XD9A 3KKQA 3AUXA 4MYUA 1G4UR 2NGRA 2WJHA 5DSZA 4B3CA 4C0HA 4Z1MD 1KK3A 5C4GB 5KOYA 4A0RA 1IONA 2AWNA 4MKIA 3VTKA 4Z51A 3THXB 1COWD 2IT1A 4OJQA 1FQJA 3K09A 4C9BA 4XD7D 2H7VA 2IC5A 1SXJC 3TH5A 1AA9A 3BFKA 2QMOA 3K9LA 3MLEA 5DISB 4AIIA 1FX0A 5JRJA 1UBEA 2GJAA 3L2OB 1XU4A 4JLBA 3QXXA 2OM2A 3NVAA 4C30A 2J0SA 4LYJA 4BLQA 2R8RA 3U3MA 4EPXA 1UPTA 4Y0VA 2WMNB 4JYBA 3GLGA 1KAGA 4WA7A 5HKKD 5E95A 2OLJA 5BWMA 1A1VA 2VSXA 3FMOB 1NVVR 1NSFA 2AWOA 1M8PA 1DTSA 1EG7A 1ZJ6A 1Q21A 2VEDA 4CT5A 2FPKA 1BKDR 3EIEA 4Q4HA 5B57C 4JLDA 5K8LA 5TXGA 3GLGB 1LV7A 3TUIC 1ZRHA 3E5HA 5KYKA 1L4YA 5BN3A 3P20A 2AK2A 4R71A 5A4JA 1DOAA 3VR2A 3SQWA 3UXMA 3L43A 4LY6A 4M1TA 5KSPA 3QVVA 4IKEA 4NCKA 4V0OA 2A78A 4RCYA 4LJYA 4QBIA 4W7SA 5JSZB 5AK0A 3GJ8A 5H8WA 2GDJA 1QRAA 2YWGA 2QQ0A 5LB2A 3QNUA 4YXWD 1Z83A 3BJIC 3U5ZB 4YMVA 3MJHA 2CLDX 2O5VA 4PSKA 4TMXA 1WXQA 2ZAOA 5E7JA 3P32A 4PQRA 4XIGS 4EPTA 2FPLA 1I2MA 1P60A 2V9PA 4ZKEA 4Q4JA 1MABB 5J47A 2FF7A 3QF4B 1ZYUA 1DELA 1JXOA 5JEDA 1VDZA 5JRZA 1IXRC 3TR0A 4BQSA 1HEIA 4H9GA 1OIXA 1Z0KA 4KYIB 4TLDA 2W6JD 5CM9C 3K0FB 5TVKA 4OK5A 5CIQA 4G5SA 1SGWA 3BB4A 1KHTA 4B76A 2HT1A 2FDCA 3X1WA 4G5GA 5D3QA 1KI1A 4RFSA 5EXSA 3MGCA 1A2KC 1GUAA 1W2GA 2CDNA 4LCBA 3ICQB 1VKJA 4IVRA 3QXSA 2Z5FA 1Z2CA 4LJAA 1BYIA 4Q47A 5JECA 4JL8A 1E94E 2FMXA 4K46A 5G41A 3SYKA 2YV5A 3CPHA 3WNBA 3GLHE 1CR2A 4BLTA 3MAAC 1SXJD 3BFVA 2FOLA 1N0WA 2BWJA 3CR8A 2O8BA 2AHOA 2ZYTX 1UADA 2XZLA 4DRZA 1UKZA 1TTTA 2ZR9A 5EP2A 4TZ0A 3MFYA 2DPXA 2HV8A 4ARZA 1KO1A 2ERXA 3NBYC 3SFZA 3WNDA 4EFLA 1T4GA 2GBLA 2OCYC 3V4FA 3CNOA 2JIZD 1Q1QA 3AKDA 4TLBA 1XWIA 4TQAA 4ERNA 2CL7X 1PV4A 3B5JA 1C9KA 2PZGA 3W9YA 1SZPA 1QG4A 2F3RA 3FYHA 1ZVQA 2XAUA 1UBFA 3KXIA 3QVUA 4AG6A 3CX7A 2JLXA 2OSBA 4II7A 4URWR 4LRWA 2OO7A 1WBBA 1HA3A 2CL0X 2YINC 4ZCLA 1NKSA 4KBFA 4HUQB 2B7CA 2EWVA 3DOFA 2ZS8A 3KB1A 4KVGA 4ZI2A 3U4QB 4EDHA 1T6NA 4HUQA 3T1QA 4TLCA 4QNRA 2DFKB 3W90A 4EAQA 1DEKA 1OFHA 2C78A 2JASA 5JS7A 1JI0A 1XXHE 3T5DA 3BWDD 4CIDA 3WNCA 3AEZA 3KJHA 5GJCA 4WAUA 3K1JA 1OYYA 1SVIA 3L0OA 1XTQA 2P0EA 3KQNA 1Y3AA 1VYTA 3GQBA 1UKEA 4Q21A 4D82A 4C4PA 3D7MA 4DKXA 4ZIRB 4JLMA 2MMCA 1G17A 2ZUCA 4PQYA 1IN5A 2PCLA 2XTZA 3U61B 3R9XA 1AJEA 3OESA 2PX0A 5EZ5A 1RVDA 1TL7C 2GCOB 2A7QA 3RRNA 4JLPA 3W5IA 2X1VA 2IYWA 4TQ9A 1EFCA 1IN6A 2VRWA 1XD2A 4A2QA 2F55A 2IS6A 2ZANA 4Q1CA 3A1VA 5FUYA 3ZYCA 1OXXK 4MKFA 1U2RA 1JAIA 2NO0A 4L8GA 3FFBA 2Z6VA 3A1SA 3RYTC 1XMJA 4TTRA 3O8CA 1WB9A 4GP6A 3ZLJA 4JLNA 4D81A 4Q1FA 1WE2A 4DDTA 3QKUA 4HYYA 3RNLA 1E32A 1ELOA 3FOZA 5FPHA 2G1JA 4KLZA 1VMAA 3SBDA 2UZIR 3K0FA 1T9HA 1T8TA 2QPAA 1ZBDA 2NMVA 2BMEA 4EQ6A 4V0LA 4IHQA 3VMFA 1TQ2A 4PO8A 3RAPR 4G5RA 1DG3A 1G21E 4JBXA 3IEVA 3X1ZA 3ADBA 1G41A 1Z6GA 1E0AA 1E9CA 3FFAA 3AKYA 4HB3A 3GLFE 4RZXA 1E1QA 3B7GA 3DKPA 3HU1A 2J41A 5EJEA 2G9NA 4IFEA 3RDPA 1AIPA 3V00A 2QP3A 2ZETA 3TW4A 1KNXA 3C15C 1MOZA 4C0AC 3R7WB 4RFSB 4O25A 5AR1A 1KNQA 2ZRLA 1Z29A 4Q4HB 1UDWA 2QORA 2CLSA 4LI0A 3A8TA 4LHVA 3MSXA 1M7BA 2EFEB 1K5GA 5FUXA 1D2NA 3A4NA 2GK6A 4B75A 1MO4A 1ESMA 4HLUC 3SEAA 4EKDA 4BFYA 2RGEA 3RC3A 4M2LA 1W4RA 2J9RA 2OBLA 3LLUA 1XMIA 1M7HA 1OHHD 1Q57A 2CCGA 2WWFA 3LAWA 4FWIB 5EE0A 3LW8A 3B85A 3IBGA 1XJCA 3TK1A 2GILA 1W4CA 4KFSA 4JKIA 2J0UA 3VR6A 3NKVA 4LYFA 5UKDA 1GNPA 4DCTA 2CK3A 2GAOA 4OQXA 3ZZ0A 1ODFA 1OSNA 4DUGA 2WVJA 4KSBA 4B3FX 2VTKA 1M74A 2OV2A 4LUCA 5J4YA 1P7CA 1ZNYA 1M1YE 1GL6A 5CLLA 2F43A 2Q3FA 2V55B 4B44A 5JMTA 5IRCD 4BGDA 5D3MA 3WRXC 4Q7JB 3KJIA 4CVNA 4DC9A 3M1IA 2ZE6A 2ZXUA 4MRPA 4AYWA 4HLCA 1S1CA 1X8KA 1W0JD 2REXB 2O8DA 1TEXA 2C03A 4C0LA 1VCOA 4ZDJA 3UG6A 3AUYA 5C2JB 3CX6A 1X86B 1LY1A 1PLKA 1W4AA 4YMTA 1GKIA 2R6CA 3AVUA 2EYUA 2FX3A 1CR4A 3W8RA 1S3GA 4ABYA 2D7DA 3QPVA 4YMWA 3DL0A 4QJ3A 1FMLA 2CVFA 2ECKA 2REOA 3P26A 3VKHA 3T5GA 1R5BA 3Q72A 3K9HA 3KJGA 3EPLA 4PHGA 1BOFA 4HEJA 4LV8B 2CLCX 4J0QA 2DBYA 1T8UA 1GVNB 4BEJA 4MGZR 5FPSA 1QVRA 2DWOA 1WMSA 4E22A 4LJ7A 3RS2A 4W5WA 3BFXA 4M9SA 3AVQA 4ESVA 3ZQ6A 3Q5DA 1GKUB 2VIIA 4DXAA 3B78A 3GEHA 4F93B 3LBIA 5SZIA 3GFPA 3M0EA 2JA1A 4NCNA 3A36A 5BN4A 4ITRC 4IOJA 3NBXX 2FFAA 3CPEA 1EWQA 1G8YA 1G3IA 1ZUNB 3QENA 5ELXA 2O52A 3DZDA 2OCPA 1IY2A 5C46F 1AQYA 4QFMA 4K81B 3OEHA 3GCGA 1QHNA 1DADA 1U99A 1WBDA 1T3HA 4D2IA 2GCOA 2HT6A 3LLMA 4DEYA 3GPLA 4BE7B 2OUKA 2R6AA 4DBLC 2VLIA 4HAZA 4EFNA 2PEZA 4A8JA 1W49A 121PA 3SNHA 4ZIRA 4I1VA 1CKEA 2ZI6A 2BCJQ 5DI3B 3U3KA 3EWSA 4AURA 4DVGA 1E9FA 4OHXA 4NPHA 2XNSA 4TTPA 5CB6A 3S1AB 2ATXA 1JR3E 1MRSA 1Q1BA 4UNSA 3I8SA 3CF0A 3R8FA 2WJVA 4DLUA 3FDIA 2ZROA 5F98A 3SC3A 1GZSA 4PPNA 2QE7A 4HDOB 2DB3A 4RZ3A 3H2YA 4D4JA 3ZVLA 4DSOA 4AY2A 2CCKA 2QMUA 1FNMA 3GJ4A 1OH7A 2QM7A 2FEMA 3A4MA 2XZPA 2GNOA 1H8EA 1W4BA 4CDGA 1G6HA 4ASUA 3PUXA 4PAMA 2IYRA 4BFXA 3BIFA 3U7GA 1SULA 2F1IA 5HCNA 3WY9A 4CEJB 1VCIA 4ZDIA 1VYUA 1R5OA 2UKDA 2IK8A 1N3BA 4WOPA 5DI3A 4LHYA 5FUVA 3SBEA 3TGPA 4AG5A 2G0NA 3U6KA 3FMFA 5JHGB 1LTQA 521PA 4YXWA 2WHXA 4DUGD 3RLFA 5FBRB 1P6XA 4DT1B 1E2GA 2RB4A 3REGA 1FNNA 5BN5A 4URXR 1JEEA 5TDHA 4Z54A 2WM9B 3LH5A 2A3RA 2YOGA 2YWEA 1BYUA 1D5CA 2ATVA 2IWRA 2BBOA 4MKHA 2EWWA 3VHLB 2IF0A 2F6RA 2OLKA 1WA5A 2FFBA 4MUAA 5JJKA 4PO9A 1QHHB 4D4KA 4AC9A 3CM0A 4HZUB 3M4YA 1QVAA 2XSZA 4I99A 1G64A 2QGNA 3BXZA 3A6PC 4UKDA 2DHRA 4GSYA 4OJKA 4C0KA 3T1TA 3WMEA 4QL3A 4B43A 1FUUA 5HR5A 1G7TA 3NXSA 4IVPA 4DLSA 1KK1A 4LWZA 3L82B 4BFTA 3RS5A 2IEZA 1CJMA 4LBVA 1A2BA 3P27A 2CJWB 3ZS8A 3CF2A 2VP9A 1I4DD 1M34E 2BEJA 2JJ2D 2O8FB 2RGNC 4P4SB 4NH0A 5LD2C 3HYRA 4A9AA 3AF1A 1T0JB 1NMYA 1Q1EA 1Z08A 2VHJA 1G3RA 1O87A 5GVSA 1RRPA 2EQBA 2W2XA 4JVNA 4MKGA 3X1DA 3T06B 4GZMA 2GZHA 4TSFA 5JHHB 5CITA 1MABA 2E87A 2VBCA 1E2PA 1N6LA 1QDEA 4YC7A 2O8DB 3NEYA 3T61A 1R0XA 3UMFA 1Z0AA 1N6RA 2AN9A 3FVQA 3U7FB 1Q3TA 4NCIA 2ZM5A 2FFHA 4RKFA 4C0BA 2CMKA 3CZPA 3VHXA 2V7QA 2BOVA 4URZR 4BLRA 4LBWA 2BBSA 2ZR7A 5JSZA 1DVRA 4GNKA 2GHIA 2V3CC 3WBJA 1J2JA 2ZI3A 2BKEA 2ZS9A 1HTWA 1KI7A 4FMDF 4C0SA 2QP4A 1G1MA 1D9ZA 2DR3A 3GLIA 3C5CA 3ETLA 2ZRJA 3B9QA 4DSUA 2FJUA 3GLHA 2JLQA 1G7SA 1F3OA 2Z4SA 1JQJC 1S8FA 4M1WA 1IY1A 3RS7A 1EK0A 2O0KA 4HZUA 2GVZC 3JVVA 4LHWA 2VHUA 2JLYA 1UM8A 2RGXA 2XOKD 4PTLA 5TMPA 2FWRA 2PEYA 1HURA 2GWHA 1IN4A 2P2LA 3BB3A 2LKCA 4OHZA 2MSCB 4LYHA 4TLEA 3RSOA 3FHCB 1Z0DA 2BDTA 1E9AA 4M1OA 2F1HA 3WMFA 3GEIA 3OZXA 4KVAA 1Z6AA 2ZVQX 1NVUQ 1XXHA 1Q20A 2PX3A 4BLOA 1UKVY 3I1FA 4PQFA 5EXXA 4RJLA 3AV0B 5L3SA 4FCTA 4IOMA 5CK4A 4QM6A 2NPFA 1T3SA 3IEUA 2ZRHA 4V0KA 5FBQB 3LA6A 1NN5A 1ZCAA 2A5JA 1NIPA 4UJ5A 2BJVA 2QMEA 5IF9A 3E2IA 3AF2A 1ANKA 3NG1A 2YOHA 3HWSA 1KDPA 3RS4A 1E6CA 3FWYA 2FNAA 5CDFE 2ZYUX 4NYIR 3KX2A 4QXAA 5CDFA 2J7PA 2Z0MA 5JZVA 4NP6A 1NLYA 2QMHA 5LD2B 2Q9AA 1YHNA 3CKLA 1IHUA 2ZJ2A 1RC8A 2PH1A 1V43A 1NKTA 3FMIA 1KY2A 4DCVA 5HKKA 2FSIA 1P4SA 3NHBA 4IVQA 3AGQA 1PZNA 1F48A 1OW3B 1YE8A 4UNQA 3KUCA 2GEUA 2OXRA 2OXCA 5FUWA 3MWKA 2V1XA 1E2KA 1KI9A 4EPRA 3RRZA 3S1AA 2BBWA 4R2IA 5JFGA 1P61B 3VU9A 4I4LA 5FOVA 4RFVA 1US8A 4DCSA 2VP5A 1U90A 2NPIA 4Q9KA 2HDNB 3MWJA 1I4TD 1TQDA 3LY5A 3QEOA 4XD7A 1FZQA 3NBZC 2P6RA 4X8OA 1W47A 1ESNA 4KODA 2RKOA 3H1TA 1G16A 4WBSA 3QKTA 3UATA 4EPWA 2JLZA 2C5LA 3QY0A 3FHOA 2J5XA 2XB2A 3C41J 5KNCA 2V6JA 3ADDA 2GCPA 2WMOB 1SVKA 2WAXA 1K6MA 3MD0A 3X1XA 1XTKA 2ONKA 1MR3F 1TF2A 5GADl 3AKCA 3IKJA 4P33A 1ZU4A 2O0HA 4F4CA 1SHZA 4B6FA 3EZFA 3A1UA 1E2LA 3IIKA 3K9GA 4ZDKA 1YZTA 3BS4A 1E4YA 5EP1A 3DPUA 3PITA 3BORA 4XH9B 2ZI7A 5B58C 2Z83A 1HH4A 4P4UA 3CF6R 2GJ8A 3U3JA 2HUPA 3BH7A 5HZHA 4DSTA 4QHTA 1YZUA 1M2OB 1GM5A 3A58B 2NIPA 2AFIE 3IO5A 4XWAA 3HPQA 2D7CA 2XOKA 1NL3A 4FWTA 2A5YB 3WBKA 5AUQA 1Z28A 3SJBA 3PJRA 1N25A 2NZJA 4KI0A 3ZD6A 4TZ6A 2OT3B 4GOJA 3LDAA 2X8AA 3RS3A 1NN1A 2E1RA 4TLAA 1K5DA 6Q21A 3SHFA 1DBSA 4TQUS 4BECA 4D0GA 4IJMA 1EGAA 4X8MA 4UXJA 2ZJOA 4JVMA 4B2LA 1W36D 2CE7A 4UNNA 4ZKDA 3QQ5A 3O8RA 3WHLA 5JJLA 2CCJA 5GJVC 4Q03A 2X19A 5FTLA 3FKSA 4PC2A 1WRBA 4GRAA 4AKEA 1KMQA 4IW3B 4IXNA 1R0ZA 1SVOA 1HQCA 3QXCA 4P4TA 2ZEJA 2Z4RA 4JLKA 4G5QA 4HB0A 3OHMA 1YRAA 1MT0A 1FMJA 1R6BX 1RJ9A 3LBNA 3DO6A 2AXPA 1XB2A 4LOAA 2WWHA 4PPFA 1LF0A 1WP9A 4N1AA 4F7WA 1XMSA 3TBKA 3Q85A 3OE7D 3ONWA 1AS3A 4KITB 1HQYE 4AKHA 3RABA 1PVOA 3ZDQA 2HLDD 3VQTA 3H84A 5FPTA 5JCPA 2CHVA 1OH6A 2NO7A 3PUYA 3FE2A 5J40A 1OF1A 4RSGA 3GLFA 1SXJE 1HV8A 1X3SA 3CIOA 2PZEA 2F9MA 5JWRA 4XVUA 3N5CA 4MRNA 3X1YA 1ZD8A 3HU3A 2ZRKA 1NLFA 4Q19A 2JJ8A 1FL9A 1XEWX 3MG9A 3QI2A 1F5NA 2QN6A 3EPKA 2OFXA 4NONA 4Q48A 3E70C 5L3QB 1OH5A 3OAAA 4QRHA 4JT4A 3EG5A 3NDBB 3QG5A 4B71A 1HUQA 3THYA 3ZZTA 2BHRA 1E2IA 4JS0A 1AGRA 2IS1A 1WDTA 3K09C 3OEEA 4TSFD 5AJZA 3GP8A 4P4SA 4LJ9A 4D4MA 1P2VA 1JR6A 4HLQB 3W6NA 3R9IA 2VYFA 3HDTA 3VFDA 3BOSA 1GDDA 1PJRA 2O8EB 5FFMA 2XEXA 4MH0R 4BLSA 1G8PA 3Q7QA 3K70B 3Q9LA 3K0CC 4D25A 3ND9A 1A7JA 2ZVPX 3KDSE 3A4LA 2ZU0C 4RY2A 5EE9A 1S3SA 4A82A 4DDUA 1CEEA 4QHYA 1NBME 3TQFA 1PLJA 1J7KA 3NHAA 1XEWY 3WMGA 4B33A 2XXAB 2ODBA 4US2R 1OT3A 1KKMA 4QBFA 1YZKA 2ODNA 2FSGA 4KJZA 5KU1A 5FOWA 2XJ9A 1L2TA 4JKYA 1P2SA 4TTQA 2W0SA 4GT1A 5AJYA 4E07A 1RJ9B 1D9XA 1ETUA 1TEVA 1KZGB 1T3LA 3MMPA 2BC9A 2IHBA 2ZI4A 4Q4JB 1GTVA 1ZUHA 4HAVA 4PHHA 2HXSA 4FD2A 4URYR 1BO6A 1E2MA 3OIVA 4QBGB 3VNUA 1EFHA 2ZR0A 4ZCMA 5HCIA 1ZU5A 1UJ2A 2FE4A 4GMXA 3W5JA 1E4VA 2ZRAA 2ZSBA 1NP6A 4S35A 4CEJA 3BERA 3PUVA 4HB4A 4L5BA 4MYHA 4G01B 3VX4A 2C9CA 1RRFA 4FCWA 1U8AA 4B3DA 4MUBA 2GETA 3MWYW 2IXFA 5G3ZA 4M22A 1YVDA 3FMPB 1RKBA 1U0HC 1D6JA 1JPNA 1X1RA 3G0HA 4OQFA 1NN3A 2H57A 4NE2A 2BM1A 2JJ2A 1LF5A 3TVTA 3FTQA 4MRRA 3KQLA 3NEJA 3DM5A 4M4SA 1Z47A 1OFIA 3EZ7A 2VF8A 5KDOA 4B73A 1RW4A 2FSHA 3KKNA 4PANA 2BV3A 3CH5A 4B35A 1XF9A 2V54A 4Q4AB 1ZUIA 5BXQC 3TSZA 2ZJYA 4NMMA 1FTSA 1H8HD 4KAXA 3KXLA 4X8HA 5CJPA 4KLNA 1LW7A 5BQ5A 1Z63A 3MCAA 2QBYB 1FW6A 4MRVA 1TU4A 1ZCBA 3OIYA 4IDHA 1YKSA 4LC1A 1E3MA 2O8CB 3RHFA 2WICA 4OQMA 2ZJAA 4L15A 1DE0A 2VP0A 3NH6A 1P62B 821PA 1L8QA 2FZ4A 1XTIA 4IFBA 1UF9A 3LQQA 4QNMA 5DHFA 3B13B 3RS0A 3GJ5A 4XTRA 1VIYA 4LC0A 3RSLA 2Q3HA 5C18A 4TMKA 3AVYA 3DKVA 3BC1A 3BB1A 2KBFA 4FINA 4B34A 3EX7C 2QM8A 1DPFA 5L3SB 5H1YA 2NO1A 3EPHA 1MO3A 4A0FA 2FFQA 2GTPA 3HYTA 3DDCA 3KZ1E 4JIMA 3ZQJA 1ZW6A 3AVVA 3QPWA 1PUIA 4KXFB 3GJ7A 2CK3D 2IBMA 4ZPXA 1NBMA 1ZM9A 3TUJC 2QTHA 1R0YA 4ZDWA 4R2HA 2YWFA 1S2MA 1OPXA 2QE7D 2FV8A 2VL7A 2YWHA 1QG2A 3K0AB 5DH9A 2VH5R 4IOKA 4BRUA 4UNRA 5A0FA 4EIWA 1Z5ZA 2WKQA 2YNMA 2QAGA 1OYWA 2ZRIA 4GL2A 5FTMA 2VSOA 1E2QA 1W2HA 3ECCA 3CZQA 3P4YA 4IRUB 4PFSA 3A1WA 1SKQA 4Q1EA 4QGHA 4GOXA 4Y0AA 1XPOA 1XPUA 5JWOA 5DE3A 1F60A 3W3AA 1DAHA 2CL6X 3GFOA 1NSTA 5P21A 3QOFA 3T35A 3DMDA 1TNDA 3DM9B 5IT5A 3ZJYA 2BJWA 1J8MF 1G20E 3RRMA 3QJYA 5BYJA 3CNNA 3ASZA 1SHKA 3SJZA 1G6OA 1NI3A 3TR5A 3KQUA 1G18A 2IL1A 5TARA 3GFTA 2CBZA 4QM7A 1ZM4A 5H68A 4HLDA 4M53A 2FN4A 3CONA 4D0LB 1CJVC 2ZRBA 3NTUA 4DZZA 4B2PA 2ORWA 1W5TA 1R10A 4ESHA 1UFQA 5JJIA 3Q7PA 1E9RA 1E98A 1JJVA 2CHGA 5EXPA 1P2TA 3QE0A 2PBRA 1U81A 3THWA 3C7KA 2ZTSA 3IPXA 1EFRA 1IN7A 1E99A 2OILA 3ZS9A 3JVUA 4U7DA 3BE4A 2WJYA 4C3ZA 1RYFA 1ZAKA 4PSAA 2CVHA 1NMZA 3D6TB 4F91B 3B9PA 2JAQA 5KSYA 2WWWA 4B3XA 4BFVA 4PO1A 421PA 3KUDA 4FI3C 5CM8B 1VYVA 2G83A 2GRJA 1N5IA 4C0JA 1CR0A 4LBZA 3DHWC 1JALA 1FX0B 1XP8A 2FGKA 2ZSFA 3C16C 5HTKA 1E69A 1JECA 2PMKA 4HAUA 1TAGA 2NO9A 1GILA 1J90A 5EP3A 3U2QA 4U5XA 4O3MA 3AVPA 1VG0B 2JDIA 3B1XA 4W9MC 4RD4A 1HE1C 2ORIA 2JDID 3AVTA 4KFTA 1NY5A 3J81k 4OL0A 5DN6D 4TYQA 4AK9A 2AX4A 3KTAA 3CRVA 4I1SA 1D2MA 4NBSA 2GBLC 1OJLA 1SVSA 3EZ2A 4R98A 4GP7A 2QP9X 4FMDB 5B2ZA 5KHOC 5DHAA 4RD6A 2W6ID 4PC7A 2LCFA 1TMKA 3WP0A 2G0TA 1NG1A 1E79A 5K8IA 4CZ2A 4POAA 1CJKC 1OIVA 3VKWA 1VECA 2A5GA 2RHMA 2ZITA 2O8FA 3PEYA 3AQ4A 3PQCA 3GLFB 1YZNA 4MGKR 1DG1G 1S9DA 4A6PA 4XWKA 1Z22A 2GZAA 4XSHA 3LO5A 1ZD9A 3PIRA 1GITA 5FL3A 1LB1B 3G82C 4JT2A 721PA 2ZRCA 3CRQA 4IOLA 5KSOA 4PPQA 2QNRA 1KSJA 2QENA 1IOZA 5BYKA 4Q1AA 1AS0A 4FMBB 2FG5A 3THWB 3SR0A 4C2UA 3I62A 3L8YA 2IYUA 4NYIQ 4A2PA 4DIDA 2JLVA 1S9HA 2AR7A 1ZIOA 3WYFA 3A1TA 1FP6A 4KYUA 4JJZA 5LBIA 3TSWA 2WIBA 2VHCA 2YYZA 4HAYA 2RHDA 2JIZA 2IHYA 2HF9A 2IYVA 3EAQA 5F9FA 2I3BA 2O0JA 1SXJB 2BVNA 2YJTD 2FEOA 621PA 3BK7A 2HCJB 2H17A 2QQEA 3KXKA 2CE2X 2RAPA 3EXAA 3BH0A 4DT1A 1Z2AA 3G5UA 4WZAE 4LGMA 5A5GA 3CR7A 3TAUA 1U9IC 2ZUBA 3RWMB 3TQCA 1AGPA 1ZM3A 4G0NA 4FCVA 8OHMA 2XGJA 4Q7KA 2B92A 3CH4B 3IDQA 2W2VA 3I4LA 4URUR 5EXTA 3NBFA 3VR4A 4AWXA 4LJ5A 2D74A 2V6IA 3SJAA 1XJ0A 2ZSEA 1IY0A 4U02A 2YOFA 3ZVMA 4QBHA 4CT4B 2HF8A 2QSZA 4TMTA 3T1VA 2G77B 2O8EA 2DY1A 4ZO4A 2WWYA 3QUSA 4F4JA 2DFLA 4PSVA 1Z0IA 3GJ6A 5E4FA 1Z07A 4M1SA 1SVWA 2ZJZA 1UDXA 3PFIA 4BZXA 1AS2A 1E1QD 1N5JA 3MJRA 1MKYA 2REBA 4DDWA 2BM0A 3E1SA 3KKPA 1CF4A 4WW0A 5KTYA 5AJVB 4CYMA 2VHQA 4MGIR 3B1YA 4OI0A 4JSTA 3I8XA 3IHLA 1PUJA 4B47A 1U0JA 3T34A 5C1BA 3MWLA 4TYWA 4UXIA 1KI8A 4D0NA 1CBUA 1AM4D 2GXUA 2YC2C 2ZSAA 2GCNA 1BIFA 3AGPA 4L4UA 1DAKA 4TMWA 3EC2A 4M1YA 1UKYA 1XCMA 4PC6A 3Q8XB 3EASA 3FKSD 3B60A 1TX4B 1ZP6A 2H16A 5G3YA 2HYDA 1EFRD 1E0JA 1XEFA 1XFAA 4DB4A 2VP2A 3W3ZB 4TL9A 1L7VC 4QOSA 1AKEA 2PLFA 3TSOA 1UAAA 4QGFA 4A0GA 4PZYA 2OBMA 1KGDA 1ZINA 4BFWA 2NZ8A 5DO9A 5BW8A 1KDTA 4QGAA 2CXXA 2JJ1D 3CNLA 2R2AA 3D3QA 3K9NA 1XPRA 2EFDB 3WP1B 4P32A 4US1R 4W5HA 2QZ4A 3EWAA 3OFNA 1KJYA 3LFUA 3AM1A 1P75A 1DAFA 3PEWA 3ZD7A 1GRQA 1CIPA 1S4QA 4CGZA 2XJ4A 2QPOA 4E5UA 4UQOA 3IIMA 1EESA 4WZ6A 1VTKA 1ZC3A 2KSQA 2F1RA 4Q7LA 2Q9BA 4C0QC 4NYMR 3UWOA 2CEAA 5E3HA 4AKIA 5DYGA 3OIWA 4B48A 1JR3D 2QT1A 4V0NA 3EA5A 2J46A 1QHSA 2R6DA 3AF3A 3NDPA 3FHTA 3UIEA 3QXJA 1R4AA 3UPUA 3CRRA 1UEJA 5EE5B 2EFCB 3B1ZA 4XVRA 4Q9HA 2VF7A 4XTCS 4C7OB 3I73A 2X2EA 2FU5C 2GAAA 2VQSA 3QKRB 4TL7A 4Z1MA 1YZGA 5L8VA 4RKEA 5G40A 4B3GA 2AKAB 4IDOA 3AVWA 4W5JA 3UG7A 3EW9A 2IYYA 2ZRFA 3GJ0A 3QEJA 1XTSA 3FKQA 4P0TA 1QZXA 3O47A 2WWXA 2ZRMA 4PXAA 3VR5A 3JZAA 4DCNA 4ZV4A 4AKGA 5FTKA 1E9EA 4Q00A 2C95A 2QRZA 4Q01A 3LVQE 4ASUD 3ZZUA 1GRRA 3PV0A 5E7MA 2PT5A 2A5FA 4DB2A 4NDZA 4A36A 4YMUA 3K70C 2WV9A 1R0WA 2PL3A 2ERYA 1E96A 1N6KA 4ILEA 2OESA 2XTNA 1OKKA 2FPMA 3TAHA 4GFDA 5FPKA 4XJXA 1PLLA 2QI9C 1TF5A 2A5DA 4NL4H 2WOJA 5FH9A 5KNDA 3M6AA 3CPJB 4CEHA 3SQXA 2B8WA 1YZQA 4HSEA 3CBQA 1HYQA 2R6GA 2IXEA 3RVBA 3ASYA 3I92A 5EE1A 2WTUA 1R2QA 2GJ9A 1F6BA 1NF3A 4Q1DA 2WWIA 5FL7D 2ZRGA 1ZNZA 2XNDD 3GJXC 3CUEF 1FTNA 4BEBA 1R8QA 1XJQA 2N46A 5EQTA 1O3YA 4KO8A 2JLUA 4EQ6B 1I4LD 2W6JA 2QROA 3SE0A 1W44A 2MMGA 1XBTA 2N42A 1NMXA 2D2EA 5AJXA 1Z8FA 1IQPA 5DNYB 2D3WA 2V8OA 1J8YF 2K5UA 1OB5A 2ZPTX 5CJ2A 2IYQA 3FB4A 1A4RA 3HU2A 1XD2B 1X1SA 1CR1A 4LDJA 1QF9A 1JB1A 1T5IA 3AF4A 4JBWA 1W46A 3QBVA 2YKGA 2ZI5A 4JL5A 2XNDA 3OEED 5DYIA 1AN0A 2IWHA 3R20A 3CW2A 3PENA 4TT3D 2ZJ8A 1GOTA 2DFTA 2GEDA 4KSCA 4RD0A 1R5NA 4GZLA 5CIWA 1WF3A 1KKLA 1KZ7B 3KFVA 3CO5A 4M8NE 4O0MA 4UNPA 1G3MA 1XDBA 3B1WA 4US0R 4QJ4A 3HP1A 1OLOA 4QC2A 1VG1A 1N6HA 3TVDA 2P6NA 1Z6TA 4F92B 1NRJB 4NTZA 1P3JA 2AK3A 1YR9A 4DLYA 5SZJA 1B23P 5FTNA 2G88A 1DAGA 3U4QA 1R8SA 4OK3A 4PHFA 3FPAA 3KJEA 4XVQA 2CHQA 4DLWA 4TWZA 1P9NA 3OEHD 4TYYA 4PC3A 2FSFA 3W34A 3B1VA 4L16A 4DWJA 4OBEA 3LRPA 4ACBA 1GNRA 2ZJ5A 3GLIB 1E2NA 2XXAA 5EUMA 3AH8A 3EZ6A 3GLIE 2RGAA 1QHXA 3CWQA 4OQLA 4MQBA 1AKYA 4PX9A 5IK2D 1FPMA 2KI5A 1DO2A 2R6FA 1W7AA 2P5TB 3DVLA 4WVFA 3TKLA 3VAAA 1G7CA 3KTAB 3HJNA 3PVSA 1BH2A 1T5LA 3CRW1 4RCZA 3O8DA 1VHLA 1L4UA 4V02A 5DLQC 2OBNA 3GJ3A 1Q3HA 2OFOA 2DFNA 3LBHA 2O8BB 1BS1A 3F5FA 3TJZA 2H18A 4QKQA 4B74A 1N6PA 2QU8A 3EIHA 5GVRA 4KFRA 1CRPA 2QT0A 1G7RA 1C4OA 1G5TA 2P3SA 3H0KA 3ND8A 2JLSA 2QA5A 3H4MA 4FXPA 1U8YA 4G3XA 5IHPA 2XZOA 3ZIAA 3U3OA 1KK2A 4CEHB 2WSSA 4F38A 5KSZA 2ODWA 5AUOB 1D8TA 4A1FA 2HCBA 3IHWA 5DN6A 1N6NA 3NIBA 3PUZA 1E9SA 1E2EA 3LVRE 5J4LA 3PUWA 1XEXA 2OFWA 2EVWX 4Q7MB 2VHTA 1N5LA 1XRJA 1I2DA 4H1VA 1IJFA 2GA8A 2UZ3A 3QKSA 3Q3JB 3P1JA 4NYJR 2ORVA 1E1RD 2DCUA 3PXGA 2XSZD 4Q9JA 4OQNA 1YQTA 2OAQ1 5KPJA 3EA0A 1TPZA 4CEIB 1CU1A 1WCV1 2MSEB 2BIFA 3QIAA 5DIFA 2Q6TA 3MUFA 2BEKA 4M1MA 3VNVA 2GF9A 2PCJA 4FIDA 2C99A 3QF4A 4A6XA 3QKRA 4TL6A 3I61A 2QAGC 1XCGB 1CULC 2AD1A 1KMHB 3WYAA 4OI1A 3ZVRA 4E03A 2QUZA 1KMHA 2ZREA 3PEUA 4LPKA 4TMVA 5D3MB 2HXYA 5JI3E 4LHZA 1Z0FA 1EFTA 3B82A 4A92A 1XXHB 2QGZA 3WYGA 2EW1A 3KL4A 4EPYA 1BMFD 2ZJBA 3LWNA 1GRNA 1Q22A 2EYQA 1BMFA 4CF7A 1VCMA 2OCAA 5CLQA 3AVOA 1FQKA 1G5PA 3V4RA 3SU8A 5HZKA 1XTRA 2WBLC 3L0SA 4M9XA 4YLGA 5J4KA 2RGGA 5M04A 4HAXA 4BWYA 4PC1A 5LB4A 3EPJA 2EU8A 4NKRA 4A2WA 1NN0A 3QKSB 5KO2A 3K0AA 4WZBE 2C9YA 2XTMA 2P5SA 2IS4A 1NIJA 5DGXA 4LJ8A 3UANA 1OXSC 5KDLA 2Q21A 1KJWA 1ZNXA 2B21A 3KKMA 3DOEA 3U60B 4HI0E 2P6UA 2YHSA 3KQHA 2KBEA 2ZUDA 1Q1ZA 1W36B 2ASEA 5L3RA 2ZIAA 2IUSA 1Q12A 3ZGXA 3FGNA 4NCHA 3UKDA 3WHKA 1FUKA 1NVWQ 3SI7A 1A5TA 1E9DA 4GOKA 3C5HA 4MYTA 1XCPA 1EX7A 4HDQB 2IYXA 4Q1BA 3R9WA 5HPYB 2GJSA 2QAGB 1JQLB 3BAFA 4BZQA 2C98A 4JSYA 2NTYC 2FZLA 2WAYA 3RWOA 5CYOA 1NG9A 1G4AE 2P65A 4AI6A 2B8TA 1W36C 1IJEA 4B2IA 2QAJA 2JLWA 2IF2A 5C4MA 4B3BA 1HY3A 2WKPA 3IQXA 1IXZA 3VU9B 2ANCA 1G3QA 1N6OA 1ZC4A 1ZMXA 3IGFA 2OEPA 3L0IB 3QBTA 4JLAA 2X2FA 4PZLA 5AUPB 3I5YA 3AVXA 3X2SA 4KHZA 1MRNA 2C77A 2GZDA 3TUZC 3DEFA 4XSGA 2J7PD 4HAWA 2C8VA 3IQWA 4ACAA 3TW8B 1X8LA 4MITA 3NC0C 4M9ZA 4MDFA 3SZRA 2Z43A 1XX6A 2EFGA 1K8RA 2IUTA 2J1LA 2ZYVX 2I1QA 1KY3A 3DMNA 4Q9LA 2FGJA 5JEEA 2Q9CA 4I81A 4KCGA 2KB0A 2NQ2C 2G6BA 4ZI3A 4YONB 1MH1A 5FBVB 2HJVA 2RGNA 2GF0A 2X77A 3EIQA 4I1OA 2H8KA 5IK2A 4WXPA 3TLXA 4S2EA 1MV5A 4L9WA 4CRWB 3TRFA 3L8ZA 1U0LA 3GD7A 1W0JA 1W0KD 2F43B 2I1VB 4P3YA 1SKYE 3LQRA 3GEEA 4HZIA 3K0SA 3I3SR 3OE7A 4CEIA 4NCJA 3OFND 4JJKA 2IA5A 3AP1A 1KI4A 4A15A 3GMTA 5B64A 3PG5A 2EFHB 2J0UB 4GPTA 2GK7A 4IDPA 3BD9A 1GWNA 2FH5B 2VP4A 4BFSA 1HE8B 2KJQA 2UVQA 2ZU6A 4Q4AA 3LNCA 4UXHA 2OZEA 2J45A 1T0HB 3L0PA 5F3WB 1OE0A 1MO6A 2C9OA 4FMCB 2IS2A 1SQ5A 2GXSA 1P2UA 4RZ2A 1OIWA 1Z6XA 1RRCA 2YVUA 1ZIPA 2F3TA 1OHHA 3T12A 1HT2E 2IYZA 3P4XA 2HEIA 1RRGA 1F2TA 2AD5A 1COWA 3I72A 2GXQA 4LX0A 4ON9A 3LX5A 1GG2A 4N0EA 1X8JA 3V9PA 1JR3A 5TB5A 5DI9A 4BFUA 4M0LA 2ZE5A 4TYPA 1G8GA 2NO6A 3AP3A 1CJUC 2W6IA 2ZE8A 4LPSA 2PJZA 3IO3A 3QF7A 4JMPA 2VP6A 1OXUA 3W6OA 1KO5A 1KI6B 3SOPA 1KSHA 4EJSA 2QRNA 2F1JA 2R65A 2WWGA 3UWKA 4IEEA 5K8UA 1D2EA 4Z8YA 3U44A 4GDFA 3UMRA 4YDHB 1KAOA 2D62A 2IXGA 4MA4A 4RD3A 4AYXA 3RC8A 2JJ1A 2V1UA 4IDNA 1YR6A 1CJTC 3ICEA 5J5CA 4JZKA 2BBTA 3VKGA 1XMVA 1CTQA 4BUJA 4EFMA 2WSSD 3LW7A 4LHXA 3JZMA 1E0SA 4LV5B 2CJWA 1KSGA 1F2UB 1CRQA 4RD1A 5G53C 2G3YA 1TQ6A 1EWRA 1YR8A 5FPYA 1RYHA 1F2UA 2B7BA 4IXMA 5FI0B 3QPUA 4CW7A 2QEQA 3F8TA 3T1OA 3N70A 3IPYA 5B30A 5HE8A 4B6EA 1M6NA 1CS4C 5FI1B 1FP7A 1H8HA 2V4ZA 2GJKA 4DLTA 2D4HA 2TMKA 1E2DA 1KIMA 4WIAA 3CX8A 1UEIA 3F0TA 2R9VA 1NJFA 4RD2A 1SVLA 1X6VA 1LVGA 4ZCIA 4PZZA 1KI3A 2RCNA 1W48A 2QG6A 1A82A 3NH9A 4N3NA 1TQ4A 3I5XA 2HLDA 2MSDB 1Q0UA 1NY6A 4O2LA 1VG9B 1JNYA 1FOEB 2F7SA 4DCUA 2IYTA 1KYIA 3QXHA 2IYSA 4JLVA 2WIAA 3AB3A 1AQUA 2ZQ5A 1H8ED 3NC1C 2WJIA 3HPRA 5EZ6B 2DWPA 4Q66C 4M1KA 5FOTA 4B32A 2GESA 2D06A 4U00A 1II8B 2GVDC 1G8FA 2C2HA 1EFUA 4JL6A 3OIUA 2PZFA 3WRYC 1YR7A 2H92A 2DWQA 4R7ZA 4M21A 1XZPA 2ZRPA 1J99A 4P31A 2ZRNA 3TE6A 2XITA 2CNWA 4I1UA 3VX3A 4FW9A 4LYAA 4Q5IA 2RH5A 4BRWA 4DLZA 5F2EA 3MRSA 3SJCA 3RRYA 3IILA 4D80A 5KPDA 3K8YA 3R8CA 2OG2A 4A0HA 1E2HA 2W2TA 4OKSA 1HT1E 4NHOA 3REFA 4RZUA 1JBKA 3W6PA 4BFZA 1R7RA 1VCNA 2FA9A 4F4IA 1RE0A 1E0KA 4A8JC 3RANA 4DLRA 5JS8A 3CWZA 2IX3A 2AXNA 1OXTA 1W0KA 1TU3A 3QG1A 1E2JA 4EPVA 2BMJA 3ADCA 2W00A 4LZZA 2PLRA 3AP2A 3SFVA 4V03A 5FTJA 4FN5A 4K8OA 2NG1A 1VIAA 3BBPA 3ZIAD 1GFIA 3K0CA 1YZLA 1GP2A 1DARA 3A37A 1G5RA 3KKOA 5FR1A 3KQKA 4QG7A 4KU4A 1OXVA 3BRWD 4MGYR 4PHTA 3CRMA 3U3RA 2C04A 1QHIA 1V5WA 3TNFA 1E79D 1TADA 3B6EA 4BPBA 1E9BA 4E09A 4DJTA 2QBYA 4OYHA 1US8B 1OV4A 3D8BA 2W83A 1IN8A 5IDVA 2AFHE 2J3EA 1LS1A 2OHFA 5GJBA 1J70A 1YU9A 1KO7A 3PR1A 4BASA 2KWIA 3K70D 4UJ3A 1OFUX 4D6PA 4NZYA 2JGNA 1UBGA 1JPJA 1ZD1A 3EARA 1N5KA 3OF5A 2QPTA 5FBLB 1Q44A 1KTVA 2W0MA 3UMSA 1NVVQ 2N1BA 1P73A 1RIFA 1LNZA 1VHTA 5EP4A 1NLZA 2QTFA 2XB4A 1ZM2A 5LDDC 2W58A 1ZM7A 1AK2A 3EZ9A 3K0EA 5FOSA 5JI2E 1M7GA 1ONBA 1KK0A 1KJZA 1N6IA 5FL7A 1KO8A 2F9LA 4AD8A 1G19A 1U98A 5KDDA 2J0VA 5AWFC 3IIJA 2WSMA 3VR3A 4LV6A 1N0VC 5AUNB 4L9SA 4LK2A 1EXMA 4Q02A 4BZPA 1KOFA 5CYPA 3THOA 3HR7A 1TUIA 2A2ZA 4PAOA 1II0A 4OK6A 1P72A
chains in the Genus database with same CATH superfamily
2QLTA 3B6MA 1D4OA 3VGPA 4IDAA 1NR5A 2VNAA 4X90A 2YDXA 3K31A 2VHXA 2H5EA 2GKSA 4RVCA 3KVVA 4TXLA 4EATA 2XIJA 4I5EA 5JLJA 2QM0A 1XE3A 4QU0A 1BFUA 3F6EX 3MYYA 2OGUA 4L0CA 4DEXA 3SHWA 4UUOA 2H8GA 3WL4A 1R4ZA 2V59A 4OHVA 3OEYA 4H27A 2GBFA 5CCDA 2H1LA 5CB0A 1TYAE 5HE9A 5FOUA 2GGSA 2PGJA 4OHYA 1II8A 1BA2A 4R31A 5EMKA 1YZ3A 1LKZA 3OZDA 2VF5X 3NWOA 4I9FA 3QUTA 1DNPA 5EE3A 4EG3A 1Q7CA 1XZLA 4TVSA 4EUNA 4KFUA 5HIKA 1WOYA 5JJCA 5CNKA 2RH9B 3OCWA 2OE2A 4BNFA 2J7KA 3IPCA 2R751 4EY8A 1GSIA 4MUNA 3KT6A 2AHRA 2OSVA 2QJWA 4GAEA 1MQSA 1SU4A 2JCSA 1NDUA 4F71A 5KNBA 4D26A 1GYQA 2W70A 4M0PA 3IAXA 1RXYA 3VHXB 2IPOA 2JEOA 3GL9A 2QSYA 4PPGA 3WOHA 5ANRB 2P4EA 4P84A 3NX4A 1R8JA 1Z5GA 1Z7BA 3NANA 2RGDA 2Q62A 2RMKA 3G8YA 1PF7E 3KSUA 4LYEA 4PS1A 3NRBA 4AJ2A 2L69A 4M99A 1HT3A 2HCTA 4JLOA 2R7LA 3WGMA 1G9TA 4BNGA 2P2SA 1EJ2A 2DPLA 2Y0PA 5ALJA 2SHKA 1H65A 2BFFA 3W2TA 2PUCA 4MVWA 1SVMA 1RPTA 1G291 2C96A 1F5SA 4A4DA 5HP4A 4G37A 3O8NA 3HV2A 4U3JB 3THYB 1CUWA 4RXTA 4WSOA 1AZSC 5BMOA 4N0DA 4N9WA 3JAWA 1B0UA 2GAFA 2P9JA 3FDZB 2Y8EA 3W7AA 1H2FA 3T6KA 5L3QA 4JBYA 5CCEA 9GPBA 1VI2A 2H2IA 4KMSA 4QRIA 1Z6ZA 3SYNA 1YVUA 4N7MA 3KXDA 1P9RA 3LWDA 1XNJA 1TKBA 3JATA 2I3AA 1I1QB 3OC6A 4NAVA 5MN5A 2BSQA 1MXHA 1N9ZA 3OZGA 3W1VA 5CH5A 3I05A 2ZDGA 4NABA 3DL4A 2Y0EA 5AT1A 2Q3MA 4RGBA 5D01A 2R62A 3HG7A 4UM5A 1JHZA 2W2KA 3TZLA 4XYLA 1VA4A 1X7WA 4F8JA 1MBZA 3H11A 3ILVA 4E51A 3ELYA 5KCZA 4FONA 5A7FA 3QNMA 2HJ9A 3MOGA 1P4GA 5TV2A 1EIZA 4PAQA 2WIGA 2M6KA 5EE9A 1M66A 1QWSA 3SS8A 4DHEA 4BLPA 3QH4A 3QJ5A 1TZ2A 4DIEA 5B7PA 1A96A 1YRBA 3AR6A 5SZHB 4JEHA 3RRXA 3LXXA 4KDCA 1JEYA 4YACA 1LDEA 1P1JA 5TF0A 4U9IS 5JIBA 3N2EA 3CLVA 3HR8A 2XCLA 1FJHA 4UQPA 2XDQA 3I28A 3ZKWA 2OZPA 3KCQA 2ZJ6A 1M2FA 4M8KA 3WGLA 3IULA 1N0IA 2RI1A 4ZTBA 3B1KA 4H7FA 4TWIA 4NYJQ 5BYBA 2GCGA 1FS6A 3B5IA 3ZUGA 3PPWA 1JAHA 4N0MA 1GQYA 3IP9A 1E7SA 1E1RA 4AKTA 4ZOBA 1GUFA 4KO1S 1QK4A 3NOQA 4RTRA 5LKRA 1E3WA 2G08A 4ZJPA 4G5OA 4GZ6A 2W2PA 3W0LB 1D1SA 4DQLA 2DBRA 2WPDD 3UK6A 5K3EA 4X61A 5CT9A 3E7DA 3CGWA 3QJGA 1LLDA 4YGXB 3B2EA 2FEXA 4KPYA 4P3OA 1WU7A 1HORA 2ZI9A 2BFEB 1DAMA 2AGVA 1IBCA 1KDRA 3CEMA 1V3TA 3LQFA 3OM8A 3HJAA 1VM6A 4QTUB 3S2YA 1N0UA 3WZ2A 3IHTA 3A26A 4URVR 1CUFA 2X0RA 3PFWO 2BGIA 2WJPA 3PCRB 4L4ZA 4X84A 3PJGA 5SZKB 3BH6A 4Q18A 4D46A 4UU7A 1IAQA 1EH5A 4Z8XA 4KAJA 1AZTA 4DDVA 2WZQA 3RYFB 2F3PA 3SIXA 1F9EA 3G8BA 4ZVOA 5FWXA 4YUVA 3C8UA 3PFHA 3ZCXA 2ADMA 4KX5A 5IZCC 1RLTA 1ZRSA 1LTKA 3IUQA 5FUMA 1IN1A 3SX0A 2OGTA 1P5HA 1KO4A 3AKEA 3ZDYB 4BBAA 5B36A 1FFAA 1XGKA 5D3ZA 5LPNA 4EYSA 4W9NC 3AW9A 2XIQA 1JDUA 4NU0A 2O8CA 1ECCA 1FU7A 3WK5A 4BNDA 3KFXA 3UCFA 1NVXQ 4OHCA 3FNFA 4WTOA 2R44A 3T15A 3DEZA 5KYXB 4L95C 1WCIA 2AW3A 2PKWA 2EWMA 2CBGA 4RVDA 4YJGA 1E3JA 2DYKA 4LI3X 4CL0A 1IBRA 1QQ6A 1JIIA 2PWAA 2WDPA 3DOCA 1W1WA 3A0UA 3DVSX 3N2GA 3ESDA 5DVZA 3WLKX 1IIRA 3A05A 3U49A 4AQYB 1TJYA 2OORC 1L3BA 3DDHA 4WESB 3CNHA 5DTEA 4C05A 4DCPA 2ZUSA 4PNHA 5IANA 5JBQA 1L7EA 2P1ZA 3A3OA 3QMVA 1NV9A 1N2IA 3TMKA 4IJQA 4MS3A 5HNKA 4WE3A 1NF9A 1PYGA 2NUAA 5KCMA 2DQZA 3HKDB 3V5NA 1UM9A 2Q6IA 1FFHA 1OVMA 2NSJA 1RXIA 4MO2A 1WXWA 3IUYA 2IUUA 4JI4B 2WJGA 2O7RA 1SUFA 4LRSB 1LPPA 3EC7A 4MYUA 3LPLA 2QZJA 2FZWA 2WJHA 2TS1A 2BZ1A 3A4IA 4Z1MD 1K86A 1P81A 3PXDA 5C4GB 3D3NA 3ZE8A 4WFIA 1GUZA 1QLWA 2Z9CA 3H5AA 3GFQA 2Y93A 3THXB 1EWTA 2MSNA 4N39A 1JB9A 2YRWA 3PFFA 4C9BA 3NEPX 3B7PA 5KU7A 1CHNA 1ZD4A 4DE5A 1L4GA 1VXOA 2IC5A 2V7UA 1PV2A 5CDHA 3AFGA 3TH5A 4H4DA 1U9YA 4BO6A 5JO0A 1XQVA 2VRNA 4KGZA 2INGX 3K9LA 3MLEA 4YJHA 1F17A 1UXKA 3L1JA 1WUYA 5JRJA 4MK4A 2J0SA 4OVKA 5AKJA 1WO8A 4BLQA 2AOUA 4D0SA 1UPTA 4Y0VA 5B3JA 3A10A 5JNSA 2A0UA 1TJ3A 1DXOA 3RSHA 1KAGA 5FYQA 2GLUA 1GZ7A 1A1VA 2VSXA 3FMOB 1NVVR 1Y8RB 3UV3A 1M8PA 1DTSA 4HPWA 1EG7A 1PU2A 3GN1A 3HJBA 3M82A 4M7OA 3C3XA 4EYGA 3MRTA 2F1OA 3O75A 3DCNA 4CT5A 5DXFA 4FILA 4ZZIA 1BKDR 3LF2A 3JQBA 4JLDA 2H6EA 2BEUB 1B76A 4K9LA 2XUGA 3TUIC 3WBFA 5GIPE 2WJZB 2PXAA 3E5HA 1M8FA 1L4YA 3L6OO 2AK2A 1CZLA 1V5IA 1UAGA 2B5OA 3NHUA 5H9VA 3UXMA 3L43A 4M1TA 1XVLA 3I09A 2YIMA 3V8EA 4RSRA 3PNLA 3B3QA 1U1GA 1G20B 3WSTA 4CV3A 1VBMA 2IJGX 5CNMA 1BCSB 2BKXA 4W7SA 5AK0A 2PGIA 3JTMA 4NATA 5TT1A 3KKKA 4FX2A 3R3WA 5DHQA 5I4BA 4AY3A 5C7LO 1KOJA 2XDAA 3H9CA 4N03A 4CWAA 5I8WA 4NBNA 2IYNA 2AZ4A 2J67A 2BISA 5AKZA 4YMVA 4KN8A 4YPOA 2F90A 2O5VA 3OTGA 1WW8A 3N8KA 3HK2A 1H2RS 1M6YA 4BO2A 1JH8A 1L5WA 4EPTA 4IZ6A 1I2MA 3AY7A 3I39X 3QMWA 4Q4JA 1NFQA 1R5JA 1QMGA 2X2OA 3QF4B 3RHSA 4ZQCB 4EW6A 2XA1A 4ZVVA 5DCUA 5JAZA 1VDZA 1JIUA 2QV0A 1V47A 1MORA 3CLKA 3THSA 4PZUA 3TR0A 4BQSA 5H4GA 4H9GA 5TEWA 1Z0KA 2QUIA 2FZKA 5CM9C 1AGNA 4PU0A 1ND6A 5TVKA 3NHSA 5KEIA 4OK5A 3K1AA 4M0DA 1C7ZA 3FNHA 1SGWA 3BB4A 4QPNA 3ZVKA 2HT1A 4JD5A 4NMWA 1W1UA 1RMQA 4L8YA 3X1WA 3OKPA 1Y3DE 4M89A 3EXG1 3DAHA 3Q10A 3LCCA 4KOAA 4JROA 3WO1A 1ESEA 1NJ2A 4YJGB 5EXSA 4M6WA 4U39A 4GC5A 1NXSA 3W5UA 3C3YA 2OOSA 1MP0A 4HFNA 4Q47A 2H1IA 3AONB 4JL8A 1KQNA 1RZRD 4XIFA 3PC6A 4TZKA 1R6XA 4KN6A 3SYKA 1NW7A 1Z5UA 3TIXB 2YV5A 4KXXA 3CPHA 2UZ1A 3GLHE 1CR2A 5F12A 3WNBA 4A91A 4AJ4A 1KH2A 5EUBA 5KWIA 3QOXA 2OMEA 2O8BA 2BWJA 3GCDA 5ELLA 1PSDA 2AHOA 1NU6A 3QELA 1UADA 2XZLA 4CLXA 3RREA 1YA8A 2BMWA 4DRZA 4CI0B 2E5FA 4MLPA 1D2RA 4A8HA 1K3TA 2VDLB 3ROXA 1GUBA 1EDOA 2PL1A 1NULA 3MFYA 2DPXA 5HZGA 5T5QA 1DQYA 2HV8A 3HDJA 3QW4B 1KO1A 2WYVA 2ERXA 3NIDB 4WNAB 3SC6A 2BJHA 1CUSA 4EFLA 2UUOA 4NHEA 2OCYC 3E8XA 1QRRA 4C3VA 3INNA 1Q1QA 5CDGA 1JE0A 4KN9S 1MHTA 4LQDA 4A8TA 4TLMB 1OBVA 1BTOA 5DMXA 3W9YA 1QG4A 4GKVA 1ZVQA 3RBZA 1IJBA 2LZ0A 4KOEC 1R8XA 4I5DA 1YV9A 3CX7A 3NPMA 4FZRA 4LRWA 2AN5A 2FVYA 4LCJA 1D6NA 1O9BA 1WBBA 2CL0X 5A4AA 1XVAA 4DW8A 1NKSA 2DC1A 4KBFA 1W4ZA 3SLRA 2O3TA 1Z12A 3UOWA 1EBUA 2R2GA 3KWMA 2VJKA 4OH7A 4C1NA 3Q3EA 5I7AA 4DUZB 3U4QB 4WUVA 2VVTA 4Y6LA 3TLMA 4HUQA 1NI4A 5A6SA 1U8TA 5TT0A 2DFKB 2FI1A 4ARSA 1KBOA 4AMVA 3PDIA 2C78A 1RACA 3NV9A 4QAJA 4BKUA 3HN7A 1MX1A 4CQLB 4QARA 4Z7QB 5K0TA 3BWDD 1T6YA 1YCDA 2PUFA 3AEZA 3KJHA 3KO8A 2ZTMA 3GUHA 4OMUA 3JYLA 3FG9A 3L0OA 1OYYA 5A03A 4J7XA 4H6XA 3UHAA 2PLWA 1X1CA 1CUBA 4LXXA 5K7SA 3SVLA 3HA5A 4C4PA 2MU1A 5KX5A 2DKFA 4K88A 5LQUA 1J5PA 2BP7B 3BIJA 2D1QA 1C8KA 3M6VA 5GPBA 2PNJA 2Y2UA 5EZ5A 2VLBA 3I6MA 2CBXA 1NKVA 1V5FA 2BYTA 4PRKA 2X6RA 4FOPA 4R54A 5JZOA 2AR0A 5JO9A 4EB6A 1JGTA 2IYWA 1CT9A 1WXFA 3NHWA 4B4WA 3NONA 2VRWA 1IN6A 3WAGA 2GZRA 3QP9A 4NC9A 2F55A 4A2QA 2ZANA 3NYQA 4MPRA 4P7JA 2HCRA 1OXXK 4CR6A 2QUHA 1X7XB 2Y71A 1U2RA 3VH2A 5EMHA 4TVOA 1P6UA 4L8GA 4I5GA 3WL8A 1TLLA 3RYTC 3O8CA 3TLAA 1JILA 1RTKA 1UMKA 4MUFA 3AERB 4WLVA 1MF7A 1E32A 5EMJA 5FB3A 2C4UA 4X5OA 3FFXA 1SBIA 2G1JA 2QJTA 3VKVA 4KLZA 1EA7A 1SXIA 2JEZA 4EKGA 3KR0A 2EGGA 2H9IA 2HM7A 3RFVA 1I6WA 4MTCA 4PBSA 2XUQA 4KDEA 3EUWA 3I2FA 4M8LA 1OYOA 2XQGA 1I4EB 4WL0A 1E63A 2VXCA 1K0FA 1LPBB 2BM8A 2O2JA 4V0LA 1B26A 5KUTA 4RM3A 4Y9RA 4EJMA 2DSTA 4L8WB 4O8CA 1YONA 1G21E 1USKA 4JBXA 3T0GA 4HQKA 4J7CA 3X1ZA 2ILVA 5J5VA 5FWYB 3NMUF 3HACA 1Z6GA 4DJJA 2I2WA 3MOSA 1E1QA 5EJEA 2N47A 2J41A 5DYYA 4N8SA 9LDTA 1AIPA 1P31A 2P78A 3O8OB 5AQEA 3WFIA 2B69A 1DUVG 1KNXA 1S6YA 1UCFA 2EEPA 1JYEA 3BYZA 3FPBA 3OOEA 1UIMA 4ME6A 4O25A 4P38A 1KNQA 4J0HA 4X6XA 3KETA 3U1VA 1Z29A 4NJMB 4DREA 3O31A 1U0GA 3PQEA 3TEJA 1SKMA 5JY1A 2I3ZA 2PKEA 1QS0A 3A8TA 1WKCA 4OL9A 3WLAA 3Q8MA 3BGDA 3F49S 4GPAA 4RV5A 2EFEB 4YASA 4UVIA 1NUHA 3A4NA 5G1OA 1HDXA 1MW9X 3GLTA 1ABFA 3A04A 1UAYA 1W4RA 3FTNA 1KAEA 2BKLA 1OZHA 3G2IA 4FFNA 4IINA 1DWOA 2WU8A 1TPYA 1WHTB 2OBLA 2FYTA 1WCWA 2WWFA 3GDOA 3IUPA 3FWNA 5C5DA 3U7IA 3B85A 1DKQA 5GGYA 3ZE6A 4KFSA 3DLPX 3KHSA 2OVFA 3CNQS 3THWA 2J0UA 1TD9A 5L7YA 3NKVA 4LYFA 3VR6A 4C88A 4EKYA 1JXAA 1CFJA 2CK3A 2GAOA 3DTYA 3L6RA 3V7WA 4GYYA 3ZZ0A 4EHDA 5BMVA 1H2ZA 1TTPB 2WVJA 4B3FX 4F3RA 2CN1A 2RI6A 1M74A 4DWOA 1FFYA 2EIXA 3CVXA 4HYEA 2WYUA 1WWKA 1ZNYA 2GN1A 3VBEA 2V55B 2P91A 3PGA1 3R7LA 4D4GA 2E0IA 5D3MA 2B2CA 2MCFA 3KJIA 3W2IA 3SYRA 3WRXC 1W581 4ZGWA 3JY6A 5EHXA 3BZBA 5C8YA 2H4XA 1ZNQO 1AVTA 4M37A 3UJ3X 4AYWA 2Z3WA 9ABPA 1TFRA 4RF2A 1AO0A 3INGA 4C0LA 4P54A 3E5RA 5LP6C 3F6SA 3G7UA 4GI3A 4I8DA 2OV4A 1Z0ZA 2VPZA 2WAAA 1W4AA 2BR5A 2E7ZA 3JARB 4J9VA 4TSRA 3G2NA 4W7IA 3SBOA 3ZU4A 5KOHB 2WMYA 5MN6A 3AVUA 4KTTE 1ZQ1A 1ORDA 1CR4A 3U62A 1S3GA 3DCJA 4RLHA 2BM9A 1TKRA 1KOLA 5K0BA 3WYBA 3AHGA 3ZPXA 4XB6B 1VL0A 2L82A 3DL0A 1QH8B 2CLLB 2VAPA 3PNYA 1BEEA 4I9HA 3TZKA 1HC7A 1V1JA 1SBNE 3F9CA 3DE5X 2HWXA 2FMIA 3GR6A 4UU8A 3R23A 3ISJA 3D7KA 2HQOA 5LUAA 4YJ2F 3INRA 4TV9A 4U5QA 3N8DA 4JI7B 4LEIA 4LV8B 4OXIA 2G5CA 4TXMA 3LY8A 1JKMA 1DU4A 1P7ZA 2PKQO 3TIGA 4LF7B 1L5OA 2AEMA 3AU8A 1Q16A 4E22A 4M9SA 5A9SB 3V4VB 4ZVQA 3OE4A 4JXXA 5JASA 5SZIA 1OBCA 3WR5A 2P5UA 3R6WA 4G1FA 3SEFA 1VKZA 5BO5A 4ZGBA 1VE9A 1PZFA 4YJ2A 1FF9A 3IR6A 4QUKA 3X0DA 3LT1A 3CPEA 2XRMA 1S2GA 1WDLA 2RHWA 3JWIA 4UEKA 3C5WP 1NXTA 5JAIA 1CK4A 2X41A 4D3ZA 5JSHA 3QENA 3DZDA 2OHHA 3EZXA 5LBTA 5C46F 1I3LA 1AQYA 2X2PA 5HZMA 5I9IA 4K81B 3B5EA 3KFLA 1FDTA 3R76A 1ULSA 2BFWA 1TLTA 4D2IA 2GCOA 2HT6A 5EESA 4DEYA 4B80A 4G4SO 3QLUC 4LIPD 3LHFA 5EJ2A 4AP9A 2Z2YA 4R83A 3MGGA 4RXUA 3W1WA 4MIOA 3V4SA 5TGTA 4NV3A 3SNHA 4CR7A 4ZIRA 4DA4A 1MV8A 3BPSA 3C7TA 3L7BA 4WH0A 5DI3B 4PONA 4AMUA 1TC1A 4UZFA 5EEHA 4AURA 5BY2A 1RKXA 3IAM6 3W5CA 2O1XA 4UNSA 1CE8B 3EGOA 3IKLA 2PO7A 1S8OA 1EFVA 2G7MC 4DLUA 5MFPA 3OMLA 5F98A 4PPNA 2WQ6A 2QE7A 2C5HA 2QQGA 4HOYA 5KVQA 2DB3A 2P9QA 2C88A 1O7JA 3DLCA 5KJFA 2CDRA 2CCKA 5KTYA 1U7XA 3GJ4A 2FEMA 2FETA 2VFAA 2XZPA 2ZWMA 4E21A 2BFOA 4RQUA 3AJDA 3HXTA 3K94A 4ASUA 2X4IA 1Y6GA 1MX3A 2FPGA 4H16A 4CNBA 3PRJA 3OOHA 4KAAA 1JLMA 5AKYA 2CDCA 5B58T 5BUZA 1V4NA 4CLOA 3MLAA 4HWTA 5EZQA 3DQPA 2UKDA 4TS9A 4WKOA 1RBQA 1RWQA 2H5LA 3UWPA 5DI3A 5FUVA 3P2JA 1N33B 2G0NA 2VC2B 3E4DA 1PFWA 1F4LA 1O6BA 3F1LA 2A33A 3FMFA 1X2BA 3EVAA 1LTQA 4O4LB 2WHXA 4Q93A 1Z4NA 4YJ3A 5EIOA 1EIWA 2RB4A 2B36A 4M86A 3G9ZA 5BN5A 1HYHA 1JEEA 5TDHA 3K4HA 1UWLA 2WM9B 1VL2A 2YWEA 1ZMTA 1BYUA 2ATVA 2IWRA 4HAIA 1GGJA 4MKHA 3UVEA 4DOMA 4L1KA 2F6RA 1T5SA 4FC7A 4LXIA 2IYAA 1A9OA 2R3SA 3G1TA 3HDGA 4O4HF 3WDKA 3U13A 4PO9A 3WO0A 3CLHA 3FRJA 2NADA 4I99A 1PX0A 2XUZA 1W85B 3LL7A 4I4CA 4OP3A 1YR1A 1VJ5A 3PX3A 3A6PC 5BOVA 2DHRA 1SC3A 1EX9A 2IV7A 3N0VA 4UFPA 1MOQA 3FOFC 2AOXA 3NXSA 3O84A 5C80A 1N2EA 2Q27A 3FJOA 3O3NB 4R01A 4RIFA 3FUWA 1RQXA 3NT4A 4R0NA 3P27A 2H2WA 2QD4A 5EIWA 2C31A 2HSDA 1TFUA 4QWWA 5CA0B 1R6VA 4GMHA 3FNQA 1WVIA 5KVVA 2VTDA 4A10A 2D1FA 1IY9A 2NSDA 3UPTA 5J2TF 1O87A 3BDVA 2O9JA 2E6UX 2O8VA 2EV9A 2EKLA 2EQBA 4MKGA 4KR6A 3NTRA 2IIBA 3R3VA 4P3PA 4TSFA 2V6GA 5JHHB 5LYJB 1MABA 4ZVLA 4JWTA 2Y1WA 3P19A 1K7SN 2ATIA 3TR6A 4YC7A 3JASB 3WIEA 5AW8A 3FVWA 5BSWA 2IYEA 5EJAA 2DF8A 3CV3A 5LQMA 1N6RA 1L5GB 3U7RA 2A35A 3UXHA 3EFBA 3IQFA 2ZM5A 2FFHA 1QH1B 4D3XA 1FCJA 2ZSUA 3HMKA 3HB9A 2C3UA 4C0BA 3CZPA 4R3NA 2H2GA 2BOVA 4URZR 1XQXA 3FUCA 4O59O 1VL1A 4KE7A 2H1OA 4M55A 3WBJA 1HTWA 1P7PA 4KNYA 1KI7A 3QWHA 1J42A 3ETLA 5GTDA 1O9GA 2FRDC 3GLHA 2YJ5A 1PD0A 1HETA 3JD4A 1XEAA 2YXEA 4U3JA 1F3OA 2Z4SA 1JQJC 3EEOA 4D8YA 2YFYA 1ZWLA 2NUPA 1IY1A 1RI2A 2B5VA 2O0KA 2GVZC 1EWVA 4R1PA 2COEA 3RVSA 1UM8A 2RJ3A 2XOKD 3KAJA 4RMGA 4V3BA 4S0ZA 1EQUA 1HURA 1SVNA 3E7PA 4LG1A 1R4NA 4RK0A 4EKIA 3RSOA 1RAGA 4CQNA 1Y6FA 1Z0DA 1E9AA 1L5FA 2X23A 1XU9A 1Z74A 2F1HA 1FB5A 5JALA 4CV2A 2A9OA 1Z6AA 1EB8A 2ZVQX 1XXHA 1UKVY 3IELA 3AV0B 1BE0A 5FNVB 2VUTA 3EVCA 5A3SA 4FCTA 2HLHA 3BXGA 2FZCA 3CZAA 2OCDA 4IOMA 1E5LA 2NPFA 5FEUA 1YJ8A 2EJCA 1YI1A 4B3IA 1V8FA 4DV0B 1A0OA 1SIBE 1AY0A 3ESXA 5F2NA 2CXRA 3VR2D 4KWEA 3HV0A 3NNDA 3FCYA 5AVZA 1LU9A 1CY8A 5EMLA 5DM1A 1GV0A 1UMCB 4BXOA 4UD6A 1W59A 4FEYA 2A14A 5K6RA 3NG1A 1KDPA 2ID8A 4CKWB 5IASA 3HTXA 2FNAA 5CD9A 1NV8A 4NYIR 3LSYA 4W9RA 2R1VA 1K4YA 3KR9A 2R60A 3MYRA 4XYBA 1Z17A 3LSTA 1NLYA 4NP6A 5CMLA 2BGUA 2Q9AA 3P0FA 1NJSA 1IHUA 2Q50A 2ZJ2A 3PWZA 3UH1A 1NVKA 1ORTA 1NKTA 1KY2A 3DEKA 5FO1A 2NXEA 1P4SA 4I4TF 1OW3B 3C3PA 3ZQUA 4KBYA 2PA3A 2GEUA 3KE8A 2ODAA 5FIUA 3SX2A 4ZMBA 3MWKA 1Z2NX 1E2KA 4FEAA 4EPRA 1OGYA 3EVFA 4R2IA 1LBTA 2NZUG 1BROA 2Q5HA 3UNXA 5JFGA 5ALXA 5DMHA 4I4LA 1Y8AA 1H6CA 4L8FA 4MO9A 2FJPA 2NTEA 1U90A 1X7ZA 3E22A 3FBTA 1TQDA 3NBMA 4FUTA 1LPSA 1V35A 1WULS 2HQRA 4DY4A 1REQB 1XN4A 2AG1A 3QKTA 2JLZA 2EKPA 1U8UA 4UEWA 3WGQA 5KVAA 3BL8A 4PGGA 1H5NA 2J5XA 2XB2A 3ZW8A 1BS2A 4UTOA 2V3VA 3F90A 5KNCA 3RC9A 3WB0A 2B9EA 2Q1WA 3ADDA 4X1KB 2Q45A 1R74A 1KBZA 4MCAA 5FLEX 1K6MA 1HDRA 1XFDA 3MD0A 3U16A 3WLLA 1MR3F 3AQIA 3RIYA 5KX5B 4WPGA 3WGNA 4BVBA 2EZ9A 2J3QA 2RSLA 3IKJA 2JANA 2EJWA 3SVZA 3GP3A 3UZUA 4B6FA 5IJ9B 1E2LA 4P82A 4DYVA 3WLHA 4D45A 3PIDA 2P2ZA 2G9UA 4ZDKA 2Z2IA 3DMPA 4CFYA 5LLDA 4W1RA 3OPMA 3VDRA 2ZI7A 3MLBA 4FYXA 1QP4A 3WVNA 3GRPA 3K6SB 1XG5A 2NZ2A 1HH4A 4MPPA 4WN9A 2JFOA 3CF6R 1A9YA 1WW2A 3NWPA 1L7QA 1AV6A 2HUPA 1PBNA 1GADO 2IRWA 3BXEA 5A6SB 3ROMA 1YZUA 3H1BA 1RHUA 5I7VA 2AOTB 5BYAA 3ZY6A 1G8JA 1VI6A 3S40A 4NEQA 1DUSA 2E48A 2Y05A 3OU7A 4P3NA 5KBYA 3QKIA 2A5YB 4ZCTA 4FWTA 5AUQA 1B93A 3HYNA 5AI0A 5BR8B 3CW8X 1NU8A 2FN9A 3PKIA 2VCHA 3TS1A 4KI0A 1P17A 2JGMA 2N0SA 4PLHA 2X8AA 3WGOA 1V3QE 1NMEA 3U31A 4RMNA 3ZDFA 1K5DA 4LN1A 4JBIA 3U09A 5K1ZA 4BECA 3IOBA 1EGAA 5EHNA 2VJAA 1RI1A 2ZJOA 3I9V6 5MFZA 3NBUA 4YRZA 3O8RA 4YRIA 4WJKB 4IIUA 3MWFA 4R8KA 4Q03A 4X71A 5BWCA 4PC2A 1OXKB 3TDKA 5JPIA 2X0NA 2GYVA 3VV2A 4BZWA 3QFSA 1HQCA 4P4TA 4PX5A 4JB0A 4ER5A 3ER9A 4XGQA 2IHKA 4R2LA 1FXSA 2J85A 4G5QA 3KTOA 3AY6A 4HB0A 1YRAA 3FYUC 3VPAA 1R6BX 1WL8A 4ZCQA 1ZZGA 3RVOA 4V1CI 1VJGA 2V7TA 3NTQA 2RB5A 3PP8A 5KNBH 1V96A 2RHGB 2O2SA 4FGKA 4NMHA 4YUZA 4W6QA 2ZCJA 3KSBC 1HE5A 1WP9A 3BGOS 4F7WA 4IAOA 3ONWA 1RAAA 1TECE 1U8EA 5F1KA 1VJCA 1J39A 1SEVA 2PIDA 3RABA 3ZDQA 1X80A 3EHEA 1YQEA 3I9V1 4K6HA 4MWZA 1UT8A 4A0SA 5JCPA 2CHVA 3S8MA 2NO7A 4U4AA 4JA2A 4YT5A 1Y6ZA 2QUAA 1OF1A 2HOQA 4ND4A 1IEVA 3X2EA 1D1QA 3BWCA 3OJWA 3U7QA 2I2AA 4XVUA 1GGNA 1KY4A 2A57A 2EF0A 3RIMA 4HRXA 5FA6A 2WILA 4D79A 1UDRA 1IG0A 4XRRA 4Q19A 3IOCA 4PICA 4KRYA 2GN9A 2Q2VA 1XEWX 1E7MA 2QTRA 3QI2A 4AZ3B 1HGXA 2QN6A 4W8HA 2I6TA 3K32A 3O1HB 1LUAA 4BX2A 3OAAA 1A5BB 3RBXA 4EHLA 3K05A 3KPVA 3EG5A 1EBBA 2GI4A 3QMPA 4PYMA 5IBQA 5K3BA 3G88A 1GTZA 2YHBA 2UVPB 3QG5A 2YRFA 2W43A 4B40A 4BMPB 2FW1A 1JAZA 1E2IA 4JS0A 1Y1SA 2J3MA 4N5DA 3IFSA 4RQTA 1AA6A 1I7NA 1QOZA 1HOXA 3GP8A 1BU5A 3LPAA 3FLAA 3PSAA 4RU1A 1UOOA 2BY4A 3K0KA 4C4ZA 4D4MA 2OR3A 3RUDA 1A27A 1L5ZA 4HLQB 2AZXA 3W6NA 1JR6A 1B6TA 4JP5A 5MF6A 3BOSA 3UC9A 3KLMX 1QTNA 1MAAA 5IAKA 3WWOA 3NAGA 1PJRA 2D7JA 3TTUA 1I2AA 2YCBA 4MDHA 2C42A 3LUAA 5ILQA 1H22A 1G8PA 4WRRA 3F9RA 1SAYA 2JD0A 4K6CA 5EEGA 5G0UA 3TO5A 3WJ7A 3BE8A 1EXDA 4QHYA 5H81A 4GPEA 3EXIB 1G8KA 4P58A 3NHAA 5IP5A 3WMGA 5HJEA 1SBYA 4U7DA 5DXJA 3PHLA 4US2R 2NYUA 1NP3A 3D7RA 2CV2A 1KKMA 3PGXA 4J75A 4QBFA 5KU1A 3F5DA 4EB8A 3UTDA 2XJ9A 4D4HA 4RQBA 4OXQA 3ZDAA 1P2SA 1IY8A 4CKEB 1E3TA 3AR7A 2VRBA 1V11A 2W0SA 3NAZA 4TTQA 3STWA 4B17A 5LQAA 1QFXA 1B6SA 4E07A 4QYIB 4XCVA 1QF6A 1RRKA 1QTRA 3SQLA 1D9XA 1ZH6A 1XZBA 2FWMX 1W75A 1M75A 1YB7A 2CL5A 2RAVA 3GAAA 3P0RA 4FFMA 5KQMA 3D0KA 2IPAB 3KEQA 1C7IA 4HNVA 5DCYA 1GTVA 1KXZA 2HXSA 2R97A 3BRSA 4S24A 4JFAA 8AT1A 3KKZA 1Q2UA 3AJ8A 4NI5A 3DTNA 1TUGA 4JYMA 5HJ2A 3VZQA 4BDTA 4EI7A 3MWDB 3SX4A 2VTBB 3DAOA 2C8KA 1P9LA 3RFXA 3RVMA 1E4VA 2GT1A 3EY4A 4RV9A 1Z0UA 5BV0A 1B6GA 1UJ4A 3PUVA 4L2IA 4L5BA 1MQ8B 3NHLA 3R0ZA 5GZ1A 3VX4A 2C9CA 3FWHA 1U8AA 4LOLA 3TQQA 3WI7A 3KQPA 4YAJA 5G3ZA 1EXVA 3UAGA 4NE7A 3FMPB 2XUIA 4CMHA 5KINB 3OX1A 1JPNA 1X1RA 4OQQA 2W42A 1HZJA 1EYZA 4OQFA 5IVKA 1NN3A 1K6EA 3PFGA 1DRKA 2QAIA 2G72A 3SOZA 5HM6A 3KQLA 4Y7DA 3FNBA 3NEJA 4M4SA 1UPBA 3BWVA 1WP4A 2VF8A 3EZ7A 3HKDA 2FSHA 2Q2WA 5KWVA 1V2GA 3ZIUA 2V54A 1M5UA 3G9TA 1A7AA 4Q4AB 1ZUIA 4QPCA 4BO3A 4XZ3A 3N59A 4YPVA 1FDOA 4O5AA 1H8HD 1JDBB 2GF2A 3WBBA 5AK6A 3UY4A 3ZK9A 2IBTA 4MSUA 1KRXA 1FLDA 3LC7O 2FW7A 1J49A 3HCWA 1KQ3A 4JP3A 2R96A 3OQ1A 4KLNA 3K6RA 1BRTA 1H2AS 1SKAA 1TVCA 3N2GB 3CVYA 3M5WA 4IXWA 2C2KA 5JS2A 4BNLA 4DQUA 2B98A 5B4UA 3H5IA 4EHHA 2V0CA 4ZAXA 2O8CB 2ZJAA 1EQ2A 3WHPA 3KQYA 2VP0A 3M6WA 3BCSA 2WUDA 4CLRB 4M7WA 1XTIA 2X9QA 4IFBA 1ECLA 5IDYA 2VHVA 5DHFA 5ADWA 4JXZA 5I9LA 5FWXB 3MB5A 4LC0A 1KMIY 3RSLA 2NM0A 2Q3HA 2FR8A 1NYQA 2HK9A 2OHJA 2BUBA 4TKVB 1QRUA 1VFPA 5DHRA 2Q6VA 4EKEA 3UT5B 4UTPA 1DPFA 5AD1A 2HV9A 3LPMA 5L3SB 2XTAA 5C5IA 1HFEL 2FFQA 3ZV6A 1Z7WA 4JIMA 2AJLI 1AQLA 1P18A 1ZOSA 3IR5A 5KOJB 3AVVA 3UFXB 1APBA 4CGYA 1HQKA 4QDJA 5EQJB 2W2QA 3KOUA 4GS5A 1NBMA 3OE1A 1YIAA 1Q6ZA 5AYVA 2C92A 4ZDWA 3PA6A 4TS1A 3UGKA 3DUFB 3O92A 1DIGA 1QLJA 2QE7D 3AR8A 1T8RA 3IB6A 4LOHA 4QYTA 4S12A 2PMBA 2VL7A 1E60A 2EZUA 3LYHA 1QG2A 3K0AB 3JXEA 1I7DA 3I1JA 4XQGA 3KZKA 3CCCA 1J22A 1EXWA 2YNMA 3THRA 1AZLA 1B8VA 4JR2A 3U9SA 2P6PA 3X43A 1XZJA 2PU7A 1OILA 4I08A 4GMFA 1UC4B 5JJIA 3NDJA 4FYHA 1I51A 1SKQA 1XPUA 3DZFA 3TKAA 2ZCVA 1EDEA 4YCNA 4RTJA 4RELA 2LRHA 3DMDA 3IXMA 2H1VA 3MEQA 1QVZA 5IVPA 2G70A 2BJWA 2YXBA 3S2UA 1G20E 2OGWA 3QJYA 4DA8A 1GCOA 1YB4A 2RARA 3ASZA 1J0EA 1WPXA 4MW5A 5KVSA 1NI3A 4MJ3A 1T9GR 2YVAA 4PYKA 1QYXA 2V7GA 2NXCA 1YFJA 4PLFA 1ZM4A 5H68A 5KZMB 4HLDA 3V4OA 4M53A 1BMTA 2FUEA 5K0NA 4H7PA 3NTUA 1IMJA 3PGJA 1W5TA 2BHLA 4ESHA 3TSAA 1GPWB 4FFDA 1E9RA 2PFGA 2FY8A 2HREA 2JF0A 5U1PA 4DMFA 2FLVA 5B1HA 1U81A 2YV3A 2VKQA 3OZTA 3C3WA 4FFBB 4HBGA 2O1SA 4ND8A 2IV3A 3UKJA 1EFRA 2J5BA 2OILA 2WD7B 2B4RO 3AG6A 4K6MA 5ITSA 5HF6A 4KNWA 3BE4A 2WJYA 3ICPA 1FC0A 3C39A 2PGLA 2IXAA 4I7EA 4Y6QA 5TQ0B 3HA7A 4C3ZA 4QFBA 1NMZA 2ZZMA 3B48A 1ITZA 4BYMA 4HN9A 2JH3A 5I51A 2ZWVA 2WWWA 5E6UA 421PA 3PF8A 4JQOA 3ORSA 3S2GA 2JIRA 2GRJA 2EJBA 5I5EA 3RIEA 3ECSA 3DOJA 3QE9Y 1Z2DA 3H99A 1ZWKA 4FCCA 3WGHA 4FGLA 4AMGA 5IKOA 2ZSFA 1CNFA 1Q0LA 5ELMA 1JBEA 1OLSB 4KN5A 3A4TA 3PUHA 1U0BB 3ENNA 4MICA 4BB6A 4B2YA 1JECA 1Z37A 3N6XA 4O4JB 2PL9A 4BVJA 2XE7A 5EP3A 4M3NA 3U56A 2OPHA 3W5VA 4CMEC 3OJFA 1IBLB 1V25A 3AVPA 1GPNA 3B1XA 4CL8A 4WJZA 2IZOA 4UHFA 4HH1A 3AVTA 5CYFA 3E18A 1XLVA 4AO7A 4OL0A 1QE3A 2JHPA 5F7ZA 1MW8X 5BSUA 4AK9A 8ATCA