1JLKA

Crystal structure of the mn(2+)-bound form of response regulator rcp1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
141
structure length
141
Chain Sequence
b'NPPKVILLVEDSKADSRLVQEVLKTSTIDHELIILRDGLAAMAFLQQQGEYENSPRPNLILLDLNLPKKDGREVLAEIKQNPDLKRIPVVVLTTSHNEDDVIASYELHVNCYLTKSRNLKDLFKMVQGIESFWLETVTLPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator RCP1
publication title Crystal structure of a cyanobacterial phytochrome response regulator.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Signaling protein
total genus 47
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jlkA00
3IP6A 1ISSA 8ABPA 4MQFA 3HUUA 2QV0A 3QLUA 2QR3A 2WWVD 1PEAA 1LBHA 3N53A 4IILA 4MQEA 4UHJA 1QO0A 4EYGA 7ABPA 2W42A 1E6KA 1DBPA 2M1ZA 6CHYA 3NHMA 1YTUA 1TLFA 3MF4A 1SD5A 4W5QA 2FMHA 3CZCA 2CD7A 1JL3A 3CNBA 5TQ2B 3TMYA 4TN5A 1M2FA 3FFWA 1Z2EA 4YS6A 1JYEA 3EGCA 4PZ0A 1TJYA 3M9WA 3LKBA 4IF4A 3KLOA 4KFCA 3HZHA 4RS3A 5I4CA 3RVKA 5IX8A 3NHZA 3O75A 2IPMA 2L18A 4Z4IA 1NXOA 3LUDA 4G0YA 3T95A 1QP0A 3NNSA 3O2QB 1SXGA 2JRLA 5PNTA 4HNQA 1E2BA 1K66A 2JB9A 3E3MA 3LMKA 5BR1A 3OO0A 3QX9A 3LFTA 4MLDA 3F73A 3EJWA 5EWJA 2PUGA 5D2CA 3QLTA 3H5IA 4LDZA 2OQRA 1DC8A 5B3JC 1ZGZA 1Z16A 2R25B 3C97A 2BGGA 4LRQA 4PEVA 4RU1A 4Z9BA 4L85A 3N0XA 3N75A 3OMWA 4P98A 3DLBA 3BRSA 3HK2A 3SAJA 4O1IA 3HEBA 4W5TA 2FQWA 5TPWA 3DGFC 4PICA 1P6UA 5KC8A 2JCGA 3QEMB 1BVHA 1C0EA 1MAVA 5TPZA 3VNAA 3H5TA 1AB6A 3O21A 4JA2A 4KK4A 2JK1A 3I45A 2JVIA 4NCAA 1D4ZA 2LPMA 2IOYA 3IDOA 1M2EA 3FMVA 4YGXB 5EWLB 4YCSA 3C3WA 3OQNA 2IYNA 3RVQA 1DG9A 2OENG 3I5AA 1MB3A 4MS3A 3MA0A 4LDAA 1Z15A 4QYWA 5FBKA 3H5WA 1JLKA 4RZSA 3C6QA 5JNTA 2QW1A 1TM2A 4MS4A 4HNRA 1J56A 4F3TA 2CHFA 5T7BA 3H6HA 3HV2A 1LBIA 4RSMA 1BAPA 4MGEA 1U2PA 5CNJA 3K4HA 1NXTA 3DBIA 3OM1A 1YS7A 2FXIA 4MQEB 4W5OA 3QLUC 5BRAA 2HQRA 3DZDA 3H5OA 5KQLA 4MR9A 3IPAA 1QP7A 4OLBA 5B3JA 2R48A 2QXYA 4WWHA 2A9PA 4EVRA 4RK1A 3KYIB 2LP4Y 4YR7A 1AB5A 3D8UA 4EUKA 2HQBA 4IMIB 1L5YA 2E4UA 5JNWA 4EGSA 1BA2A 5IUJC 3ROTA 4Z4HA 1S8NA 2QVCA 3TD9A 2WY2D 3JS5A 4D6YA 1JBEA 4MR7A 2GBPA 1QPZA 3EQ2A 3URMA 1PEYA 3QK7A 4ETNA 5CHYA 1A2OA 3OQOA 4JB2A 3UKJA 4XASA 2FN8A 1KGSA 2Q5CA 5EWJB 4W5NA 3KS9A 4MAAA 4RK4A 4ZPJA 1PHRA 3OLVA 2XDYA 3JVDA 4Z0NA 3I09A 4KQ9A 2WB4A 4QYMA 4DADA 1JYFA 1YMUA 2MSWA 4MS1A 4RY8A 2WMYA 5E3JA 1RNLA 4RXUA 3GV0A 5DTEA 1NATA 3L6UA 4EYQA 2LUOA 1DRKA 2P4UA 3RVRA 5JS2A 3GT7A 5DKFA 5TPWB 4TMYA 3TO5A 9ABPA 6ABPA 3T38A 1TVMA 4NV3A 3D02A 3GBPA 1K68A 1QQAA 1NTRA 2FEWB 3MMNA 4MPTA 2JVJA 4XAQA 4S04A 3O1JC 1D5WA 1EAYA 3CG0A 4GPAA 4WUTA 5IC5A 1QMPA 3HM9A 3F6CA 1USKA 4ZMSA 3A0UA 3JTEA 4JB0A 3JY6A 2V0NA 3GYBA 1TMYA 3QLVC 4MS3B 4XLTA 1M5TA 2B4AA 1ZH2A 5C5CA 3EAFA 2A9RA 3N0WA 4MS4B 3UUGA 2PE5A 1D2AA 2HQOA 1Z17A 4NQRA 4IMJB 2H3HA 3GL9A 1ZH4A 5KWSA 3H6GA 2FMFA 2FSPA 3FDFA 2E4YA 4N0PA 3H5LA 3SNKA 1YIOA 2MSLA 2MYUA 3H1FA 3CKMA 5C5EA 3H75A 2WJWA 2NT4A 3OO1A 1FSPA 1JX6A 4QICA 4MR9B 5CNKA 2RJNA 1DCFA 1APBA 4RKRA 1R8JA 4EYKA 4D6XA 4E7PA 5DLEA 3HS3A 1JHZA 3SQNA 4RK6A 4RK5A 3CTPA 3KTOA 1YVUA 5DGCA 3H1GA 4XFKA 1LJLA 1FFSA 3K9CA 5FWXB 1FFWA 2FTKE 3RVSA 4ZYLA 1DJMA 1EHCA 2IPAB 4MR7B 4WXMA 1YS6A 3CU5A 3EQZA 1CYEA 1FQWA 4EVQA 4OG2A 5FWYA 3IP7A 1LJUA 2NZUG 3OQMA 5EWMB 4RK0A 1GLGA 1D1PA 3RVMA 1F4VA 1SXHA 2QVGA 4NCBA 3RQIA 1XWWA 4FE7A 4G0ZA 2M98A 3QLVA 3IP5A 3JVIA 3LTEA 4MS1B 1Z2DA 3B2NA 3HXMA 3HO1A 2AYZA 4OATA 2PUAA 2CHEA 3W9SA 4GNRA 1RZRD 2L17A 3Q9SA 3DGEC 3F7NA 2E4VA 4MRMA 5T3YA 4HYEA 2ZWMA 5BRJA 2MYPA 4G0QA 4QPJC 3ILHA 3MM4A 2PUCA 2PUFA 4RXTA 1ZESA 3KJXA 3KYJB 4KREA 1ZN2A 2B1JA 1JDNA 3IPCA 5HQJA 4MQFB 1BDJA 2FVYA 5CNMA 2J48A 3HSYA 4CBVA 2YHBA 3O1HB 4LE2A 1JWLA 2HPHA 3BBLA 1P6QA 3O74A 3SG0A 1GCAA 2HJ9A 3VNBA 1VPWA 3HUTA 1W9HA 1ABEA 4Z9AA 4YLEA 4H3HB 1DBWA 2N9UA 4ETMA 4Z4GA 4JP1A 2E4ZA 1Z25A 2PLNA 5TQ2A 5KC9A 1GUDA 1QP4A 1Z18A 3OM0A 3RVOA 4F8JA 1I3CA 1FFGA 3CFYA 1ABFA 2VUHB 1EWVA 2H0AA 4EVSA 4EY3A 3C3KA 2RDMA 5F64A 4Q6BA 1VRVA 4YP9A 4F11A 3HVRA 4UHKA 1Z13A 3S99A 4MR8A 4Z4FA 3QX8A 4YRZA 5JNVA 3CRNA 3OLXA 3RVLA 4LX8A 4KQCA 3QELA 4RWEA 4Z4EA 5IUKC 1M5UA 1U0SY 3GBVA 4G0MA 1L5ZA 1MIHA 5KQGA 4KMRA 4Z99A 2IDMA 1D1QA 4H60A 4KZKA 2MYTA 2A9OA 3TX6A 4RV5A 4RY0A 3ROFA 5FWYB 5IBQA 2FMKA 2FN9A 4JOQA 2NUBA 2JBAA 3CG4A 3Q15C 4LE1A 2KYRA 4N03A 1LK0A 1U2QA 3A10A 4ZMRA 4KV7A 2TMYA 1SRRA 3SY8A 4Q7EA 2ZAYA 4N76A 1P8AA 2P9HA 3C3MA 3MIZA 3JPYA 1URPA 3EODA 2IPNA 4O5AA 4TLMB 5EWLA 1F51E 4EYOA 5HSGA 4S05A 4KPYA 3OLWA 4MYRA 3Q7SA 3HCWA 4MRMB 4LE0A 4G97A 4WT7A 5ABPA 3LKVA 4YO7A 4WZZA 3OLZA 2JVKA 4IGAA 3CS3A 3G1WA 1H9CA 3BREA 1JFSA 3MQ4A 1PNRA 2F8TA 2GWRA 3LUCA 3O2JA 1WETA 5GQSA 4D74A 2L19A 4Y9TA 3M9XA 1EFAA 4Z4CA 5IEJA 1NXWA 1Z26A 2FW0A 2PMCA 5DCLA 3ILYA 2ID9A 2E4XA 2IKSA 2GX6A 2E4WA 1Z12A 1U8TA 3P9YA 2FLKA 2RJOA 3O2SB 4TLLB 3R0JA 3KKEA 4N47A 1RZRA 3Q7RA 1UDRA 5CNIA 1E6MA 1JF8A 3O1IC 1SXIA 4ZJPA 4RK7A 3EULA 1DC7A 5ED4A 3A0RB 2VK2A 4WXEA 1DBQA 3FFTA 1C4WA 1USIA 1T34A 3OLYA 3GA5A 3NBMA 3A3KA 4XARA 3HDVA 1PNTA 1Y1LA 2WJAA 4MR8B 3HDGA 1ZHHA 1QO0D 2AYXA 2YHAA 3L49A 3N0RA 4IRXA 3Q7TA 5TE9A 3I42A 3QELB 2FMIA 1ZITA 4F06A 1RXIA 2VUIB 4XXHA 3N8IA 4NICA 3NNDA 3GRCA 5IULC 5KQPA 3T6KA 1DZ3A 4G0OA 1NXVA 4DQDA 4B09A 4ETIA 2NZVG 1PUXA 2CWDA 5TQ0A 1QNLA 4RY9A 1VLZA 5IEBA 2JBAB 1U04A 1YK1A 1HEYA 2PL9A 4L4UA 4YWHA 2LIVA 4RXMA 1EWTA 2NT3A 4KVFA 2GI4A 3RVPA 1DP4A 2L2QA 1XHEA 2X7XA 3TB6A 3H1EA 1JH9A 2QU7A 1DRJA 2R47A 3MYYA 3DLHA 1USGA 1NXSA 1A0OA 4Q6WA 1XHFA 1ZAYA 3F6PA 1JDPA 5JS1A 5JNUA 2PUDA 1KMIY 2A9QA 5BQ3A 5HKOA 3LUFA 2QSJA 3Q41A 1KRXA 3H5VA 2MSKA 3IP9A 4OLAA 1MB0A 4RKQA 2FQYA 4P1ZA 4N41A 4O1HA 2F8SA 2FKAA 2FQXA 4OBBA 3GWGA 3RVJA 1ZGGA 1CHNA 5TQJA 3LUGA 2PAFA 2QZJA 2RGYA 5HM6A 1DCKA 1RXEA 4HNSA 1CEYA 5TPZD 2PKXA 3KCNA 3LUHA 3M6MD 3UK0A 1W25A 1YMVA 4LZLA 4RDCA 4OTZA 3LUJA 3OMXA 5KQMA 2FLWA 1ISRA 1ZY2A 4JAVC 1JFVA 3LUAA 1NXPA 1YK0A 4G0PA 3LUKA 2PL1A 5JNSA 1P2FA 3KG2A 4F12A 1NY5A 5IUNC 1JFTA 4G86A 1ZDMA 1B00A 2IPLA 4KK3A 4N0QA 1ZVVA 1BDHA 3FFXA 5GOTA 3BILA 2HSGA 2PJUA 4JASB 2LBPA 4H3KB 2FEKA 1OXKB 2FEPA 4G0XA 4DN6A 2MYNA 5FWXA 1DCMA 2GKGA 1IIBA 3CZ5A 1A04A 1GUBA 1E6LA 4PE5B 4ML3A 1VKRA 4W5RA 1KRWA 4MLCA 1GCGA 2R4QA 3CHYA 2PUEA 3EDCA 3QEMA 5EWMA 4FE4A 5FBHA 3KSMA 3RVNA 3HJFA 4KRFA 3T8YA 3N6VA 2WRZA 2PUBA 1QQBA 3G85A 1MVOA 3SM9A 2VYCA 3KHTA 3NNNA 4E7OA 4M88A 2I6FA 4PYRA 1EWKA 3FGZA 3E61A 1OXBB 3LOPA 1NXXA 3RH0A 4KNYA 2O20A 2ID7A 1BDIA 3CLKA 1QKKA 5KI6A 5JNRA 3BRQA 3QEKA 5TQ0B 4FB4A 2DRIA 3JPWA 1RPJA 4YV7A 3KLNA
chains in the Genus database with same CATH superfamily
1WMAA 1TUBB 1X1SA 5CYOA 3NEJA 1U02A 2ZUWA 3NC0C 4CKWA 2JIDA 2V8OA 3DBHA 3HUUA 4HWTA 3H1AA 4K2HA 4RCVA 5TVKA 5EUMA 2WWVD 1LBHA 3EF0A 3I01A 3N53A 4LSWA 1H9AA 1ZC4A 1QO0A 2O52A 1D2HA 2P1ZA 3CLSC 1QH1A 5KTSA 4Y67A 5JFTA 2AQIA 2VYND 3OF2A 3WB2A 1KZ6A 3MF4A 1PT5A 2Y0EA 2OHHA 4B2YA 5MFPA 1Q7EA 4HH0A 1NNEA 2R8YA 4EPXA 1T2VA 4K87A 1AQUA 4BFUA 1J00A 2H11A 4PPQA 5B7PA 2JHAA 4S1NA 2BGNA 3ANNA 4CM1A 5C3MA 4ZU6X 1NUHA 4YRIA 3COPA 5KWSA 5C3UA 1EFTA 2QL9A 1IU9A 1JXMA 1NQVA 3NHZA 1TJ5A 1XCLA 3V1NA 2L18A 1QP0A 2FCAA 2EU8A 3O2QB 4OMCA 5TR9A 2IHNA 1KI9A 2PRZA 2JRLA 1H1LA 2IEYA 1PX0A 3DZ8A 4CKBB 1GSIA 5DHRA 1U81A 1SVOA 3TR6A 4N01A 4NJEA 4IMRA 2JGNA 3EB9A 3VU0A 4CUZA 1WV1A 1IPFA 4MITA 3IQXA 2FA9A 1H5NA 4RHCA 1P74A 3BCHA 3D3KA 1G2OA 4AS1A 1RKUA 3FN4A 1X7HA 1EFUA 3A31A 4YRSA 1NQWA 3BF7A 2CLEB 1LRLA 3VR4A 2WDZA 3JQFC 3BDAA 2PGIA 3CCBA 4R8RA 3VSBA 3K1AA 1NG1A 1WDTA 2VPPA 3D4NA 2FX3A 1YR1A 4CTMA 2JCGA 1JI3A 4MGZR 2B82A 1BOOA 4PR0A 5F5LA 4DJAA 2NU8B 3BICA 2HN9A 3T9DA 3QIAA 5JCJA 1QU3A 4D9HA 5BVGA 1CQZA 2OV1A 4NBRA 3MJCA 3BXHA 3FOAA 1R3DA 2GR9A 3PDUA 1KNQA 2GK3A 3FMVA 3KB8A 2VHZA 4X1IB 4EB0A 3ZZTA 4CKEB 4BGEA 4MS3A 1QHXA 1QS0A 3FZQA 1NX6A 4KU4A 1G8FA 3GGPA 4JHLA 5FDFA 2BBTA 1D1SA 1XEWY 2OP0A 2W2MA 3CVOA 3HUFA 2ZT7A 2UKDA 3VNRA 3EVEA 3ZVKA 1K6EA 1EB9A 3HVIA 4E09A 1BAPA 4ZK2A 4MB2A 2D1SA 3LGXA 4FOOA 1MNQA 1WUHS 2GB4A 2NUPB 3FOWA 2CJYA 4WOJA 3R75A 5AVSA 3L4KA 1PV4A 2FXIA 4TWRA 5C1BA 4NU8X 3D7KA 5EY5B 2E1RA 2GYUA 2BKUA 3RU9A 3VVMA 1R0XA 3J7AC 1RHQA 4DV1B 4KDCA 4J1NA 1MG5A 1KYYA 4PQEA 1VSTA 1MEEA 4EHBA 2GCNA 1RW4A 2WWRA 3IV9A 1Z4LA 2GAIA 3P0FA 4EVRA 1VJTA 1Z35A 4RK1A 1G6Q1 3I9V1 6AT1A 4RTKA 4IH1A 3LX6A 3RSGA 4OOEA 3VDXA 3QU9A 1L5YA 1CJSA 4L6CA 3QXXA 2E4UA 4PGMA 5KJEA 3SEFA 1L8QA 1ARZA 5BYAA 5JNWA 1RWPA 1XF1A 4DB4A 4S3MA 4GOND 3U4DA 2Q1SA 4N6GA 3IUJA 4OA8A 4MJXA 3E2PA 4GMKA 4RMNA 2PKCA 3UH0A 1RT9A 1WZUA 3F46A 4WBXC 4XM2A 1FYDA 4DG5A 4EJSA 4QHTA 3G2NA 3EZGA 3T41A 3C48A 3CNEA 5DP2A 2LCFA 5AM2A 5EC8A 1N2CE 4JB2A 5HKAA 5DB4A 2O50A 5E1DA 4CDNA 2QIOA 4W5NA 4Z1MA 2AI3A 4F5WA 1PHRA 4HN9A 3GJXC 1G8MA 1OU0A 3CLTD 4ITUA 3A6HA 4UXHA 4X5OA 2B92A 3PFKA 3EHDA 2J5XA 3K2EA 4S2EA 1QIFA 1XDSA 4M53A 3KOZA 5MGNA 4W5WA 5LJLA 3C3JA 2JLYA 1RYMA 4TTRA 1NATA 3O0TA 1L7EA 4BFTA 1A5BB 1S2GA 5CVEA 3U5TA 3DAPA 3EGXA 3OZIA 1N2CA 1A8QA 4QJIA 2Y1WA 4R3NA 5J5VA 3D3JA 3TAXA 5L4LA 3KT0A 3GLFE 1U8YA 1LDYA 3MXTA 3AYZB 4IQ8A 4Z0PA 1WMDA 4ZCSA 4MEBA 1JG4A 4C7MA 3H16A 3W5JA 1OR8A 2DH5A 3QV1A 1EAYA 1Z5OA 2NTNA 4IQ0A 4TMWA 1WOYA 5J5CA 5AYVA 4C22A 1YHZA 2A5LA 2ZS7A 2ZYIA 3OBBA 4KO8A 3TUZC 4ZMSA 1T1SA 1C30A 1YDWA 3HBMA 3HBFA 3JWGA 2NQ2C 2WVAA 4LWPA 2IRWA 3K0CA 3P4UA 4FYHA 4A0RA 1KAGA 2I3BA 2C4VA 3ZWWA 4ZCIA 2HNAA 1I3NA 2BOVA 3B5EA 3ORFA 4BNMA 1FMCA 5CCBA 2QRGA 1QIHA 1R27A 2WAOA 4R1SA 2BZ1A 1SVLA 3EW7A 3SYKA 3ZQ6A 1S96A 3ZW9A 5JFOA 1HMYA 5FUWA 3KQWA 1FDOA 1HM5A 2HB6A 1XN1A 2WHQA 3HCOA 4PR3A 5EKSA 3T7EA 3KB6A 4NCNA 4QXRA 3N3BC 4XEUA 2XWSA 1OREA 4I19A 1RKQA 5AI8A 2XB6A 4Y0NA 1UJ5A 1MC8A 4B9EA 4BDSA 1HT3A 2FEOA 5CNKA 3NBUA 2PS3A 1FNMA 1DCFA 2RJNA 1GRQA 3ESZA 2C5LA 3HVKA 3Q72A 3Q9LA 3P9KA 4D6XA 5H83A 3B1FA 1LDMA 1VC2A 4CKCA 1FDVA 4UPVA 3V6LA 2UZ1B 4ARAA 5KOIA 4DBLE 1S8AA 4FBLA 2ZRBA 4RH0A 5DLDA 3BB1A 3DL2A 1N7GA 2YWEA 4KR7A 2FPIB 1PL6A 4LG1A 2FWJA 1QH8A 3ND7A 1PLJA 1V96A 1M6NA 1DJMA 3GLIA 3BIFA 3EA4A 3LLVA 4W6QA 2UZIR 3EDQA 2PPVA 4E12A 5GZ3A 4GXTA 4EA9A 1IN4A 4B7UA 1IJEA 1N2ZA 3AGPA 5DWVA 2G7MC 5U4QA 2O2IA 4QOSA 4FEEA 1VJDA 3A7EA 3PHJA 5FWNA 3AZPA 2JLCA 1TOAA 2WM3A 1KEUA 5L4SA 3STWA 5J2TB 3TZBA 1T4GA 3IALA 4LVCA 4MJLA 1CVIA 3FSEA 4PLGA 3G82C 2Q5IA 3W9SA 1OBCA 1F2VA 2WHRA 2EYQA 3NHRA 5BRJA 5CFZA 1JEAA 3F8WA 2JIMA 3G9UA 2JFGA 4L8YA 2CNDA 2Q0XA 5K0SA 5LKRA 3NATA 3DBLB 3SIRA 4TQGA 1IJKA 2O3QA 3WAKA 4E5YA 1Z7YA 1GGKA 5CX4A 1BJTA 3T0GA 2RAPA 2FHPA 1UAGA 1VL8A 1IM8A 1Y3AA 4UD6A 5EKDA 1Y82A 4FZVA 3U3KA 1THZA 3FYDA 2DVMA 2IU6A 2BKXA 3RSLA 2GJ8A 1P6QA 3G2LA 5DZSA 3QVXA 1A2QA 3Q2IA 1U3UA 3O73A 2D00A 3TS1A 2IYVA 4LF7B 3C7DB 4K9DA 4EKIA 1KIMA 3T4XA 4CLXA 4CM4B 2JEYA 4EWLA 3EZ2A 3IVMA 4WAUA 4JP1A 4ETMA 3BC1A 4EKNB 4Z4GA 3HXPA 1JG3A 1IXRC 2NXEA 4H6VA 4JJGA 4MINA 2Z09A 1O03A 3IE2A 5A0FA 2NO6A 3VKVA 1IM5A 2IDJA 1WCYA 4KE6A 4M9UA 1M7BA 1VPVA 5CB6A 2GFQA 2V7UA 1GV0A 2QAGA 5BNIA 3OPQA 2HSJA 1CBUA 1WB5A 1C7ZA 5AQEA 1T9BA 2Z30A 2RAFA 4HQ6A 3OF5A 4ZICA 2DJIA 3H9UA 3I8OA 2DFLA 2J8ZA 3WL5A 4CV2A 1EX1A 5J43A 2ACWA 4CCYA 4YP9A 4BVBA 3LPMA 3M3HA 1YA6A 1NW4A 5F5NA 5FO1A 2OHOA 1H0RA 2ZOSA 1IRIA 1EBBA 4P3YA 4MVJM 4ROSA 3REFA 2ZSHA 5CDFA 3RVLA 3H8JA 2ZUCA 4H1HA 4LX8A 1HE4A 2B5WA 1K4YA 2IU3A 3AFOA 5JXIA 4OYRA 4YN3A 3PX7A 5KSPA 2DSNA 4Z99A 3W9UA 2IOHA 4BNDB 5EJ4A 3LTNC 1U0GA 4BQPA 1H2YA 2VP0A 3DEHA 4H60A 4E31A 3UUEA 5BUCA 4HJXA 2P6NA 4ZYZA 3ZGZA 4NBSA 1G5PA 1PK7A 5HFAA 2WAYA 3M2TA 4CLOB 4YCLA 1H8HA 3BUSA 1NUSA 2JBAA 4OGWA 4MH0R 1W0JD 2QLNA 2H8KA 1U2QA 2XUJA 4UHEA 5DTRA 2GPTA 4ZI2A 1E3TA 1CC1S 1P0PA 2FUG1 3A1CA 3HNPA 3ZZMA 1XHLA 1K6MA 2F9MA 1UUFA 2J7PA 4U0KA 2ZYGA 4OXXA 3RUHA 8OHMA 2PSHA 1JI0A 3D8SA 1N2JA 2WF8A 4LRYA 3ZI0A 4C05A 2BP7B 2XUDA 3EY4A 1P2DA 3L43A 3R5SA 1TT5A 2ZB4A 3AF3A 2JGKA 3Q12A 4PLHA 5H7XA 4WT7A 4D4GA 2J3LA 4MRVA 3E2IA 5CX1A 1YQGA 5FWAA 4A8JA 3PGA1 1W5EA 1ZSNA 3MD0A 4I9NA 1Z5PA 2HJWA 2AMFA 3WL7A 2O2XA 3I9OA 1YZTA 3K9GA 5KTNA 5B58T 2E85A 1ML3A 2VF8A 2WG1A 2PZEA 2C07A 3DF7A 1M83A 1XZQA 1GDHA 3JYLA 2FG6C 1QX3A 4PQRA 3PRYA 3SDBA 2W6PA 1FP1D 4BO3A 2AMLA 1ESCA 4TTIA 1YT5A 3IVAA 3PEFA 4DG9A 3MWKA 3EC2A 1E4VA 3O3MB 2GJKA 4Z3OA 1LS1A 3I5UA 4EFMA 1N7JA 4FK8A 4L1KA 5FADA 3OIVA 3KQPA 3R7LA 4KWCA 4GKBA 3OEHD 1TEHA 3D6AA 3GR6A 4CMBA 2ZUEA 3RAFC 2MMGA 1T8SA 1E1QD 1RWBA 5LLSA 3T3HA 3P9SA 3QF7A 3K05A 4ND2A 1SKYB 4TS1A 5AVWA 2BL4A 2HJHA 2D59A 4X1KB 5CNIA 4ZYUA 1DC5A 4BHTA 1DJQA 5AI5A 1AQIA 3UJ6A 5BV0A 4P7BA 1WHTB 2O1EA 3FFTA 5TJ9A 3W3AA 5K4AA 4EI7A 3EQ7A 1D07A 3KAQA 1MIOB 2DQ4A 3OOHA 4HXGA 4R1PA 3WHKA 4BNFA 1YR6A 4KUGA 5KOJA 5THXA 5JTUA 4ZANA 3SWWA 4GVPA 4R54A 3ESYA 4FYXA 3IQGX 1Z2PX 2H1WA 4GGMX 2DFTA 2JGFA 4C01A 3VQTA 2QN2A 3DO5A 4YJHB 1E61A 1QO0D 1EFCA 1R37A 2YHAA 2YWDA 4UVEA 3GCGA 5DCUA 5IP5A 3TAHA 1U90A 1WXQA 2CGEA 3QELB 2LZ0A 1ORVA 2Z3ZA 3RS0A 1RXIA 2X8JA 1PFVA 3OT4A 3VSEA 4D92A 2C7QA 1PP4A 2BFBB 1TCBA 1C8BA 4B0OA 3TDNA 3LT4A 1L5SA 1Q7GA 1QGYA 5KIAA 2P9YA 1RJ9A 1Z0DA 1GQFA 4R1LA 3DVAB 4G37A 1RFLA 3KPVA 4UUPA 2FAXA 3W79A 4AO8A 5DGIA 5KKAA 4ETIA 4HWPA 3MCAA 3S2EA 4RFLA 2HA5A 1RBYA 1VLZA 1WXWA 5DXFA 4HDNB 4QUGA 4OBEA 4UAVA 1NBME 3ZUPA 4INZA 3IJPA 1IOZA 3MLEA 1O77A 1BGXT 3EZLA 3ONFA 5ALNA 1XYYA 2FXVA 3STTA 2L2QA 4JT8A 3CO0S 1R64A 4YQEA 3A6GA 1DRJA 3ZHRA 1QK3A 2VNSA 1JKXA 1UPAA 2P9BA 3GZNB 4PLWA 5A04A 2HREA 3FA2A 1UBUS 2FEXA 4AC9A 5LM3A 1T5LA 2DUUA 2V8BA 4OGLA 4YJ3A 4AM8A 3HE3A 2VOJA 2AL7A 3CPJB 4O6VA 3WLKX 3EE6A 3SIWA 4UHCA 5BQ3A 3TF5A 3Q41A 2YVAA 4YPFA 2D1QA 3IHKA 4PAWA 1J9EA 5CVTA 4J03A 2FQYA 2WJYA 4OEHA 5DTMA 1NBMA 4KUHA 4AXBA 2IL1A 5FXMA 1CUXA 5FLEX 4QQ8A 5LZ8A 3PR3A 3ROKA 4RZHA 1ZGGA 2XY4A 3DL4A 3W5SA 2PAFA 2RGYA 3ANSA 3JQ6A 2DPMA 4Y6RA 1CY2A 1DCKA 4I8IA 5J4VA 3Q7IA 2A35A 2ONCA 4X20A 1FCJA 5H82A 5NULA 1J2YA 3ZGLA 5CT6A 4LZLA 1MJ5A 1SQGA 4YJGA 3L7KA 4JCCA 1VRWA 1R6BX 1SUCA 1X3SA 2FLWA 4OTZA 3RS9A 4TVKA 3RFFA 5AM0A 5FPYA 1BWRA 1GFWA 1P2FA 2O2JA 1U3DA 1FTWA 4WEOA 2Q2OA 2AD1A 1OYYA 4OP3A 4AO6A 4GOMD 4RTQA 2J09A 1IBKB 4H3KB 2QVLA 2VH1A 1XTZA 5ISMA 4OJTA 4PTZA 4H7EA 1OMOA 4IGEA 3HVUA 2HLDA 4K81B 1K0FA 3W2FA 1DXYA 1VLQA 3EXFA 3OHMA 4PE5B 1I0IA 2PVCA 4I1VA 2H2GA 1KRWA 2XKBA 3AZQA 3BD7A 3Q3JB 2P78A 2QQ0A 3KSMA 5ULLA 1XNHA 5C8XA 1C3XA 4C06A 3N6VA 3PXEA 4EMUA 1DIHA 3U4GA 2P6UA 4RWZA 3ZGOA 4B35A 4EUNA 3G85A 3K15A 1M2JA 2PKWA 4NF2A 3NNNA 4E7OA 3ER6A 1DRVA 5LLTA 2GA8A 1EWKA 4FMDB 3DFFA 1G2IA 1NVAA 1SN7A 3JQRA 4M99A 3TQFA 3VNSA 5GAJA 3T3NA 4GF5A 4OSEA 2EV9A 4LJ6A 2HF7A 2ZVJA 3NAMA 4HTFA 5DWQA 3T61A 3THYA 1KIAA 5FB3A 1RZ3A 3HKEB 4PBTA 1RPJA 2GWHA 2H2HA 2PRJA 4FC7A 4YECA 1E9EA 4EZEA 4DPLA 1GVHA 2KS6A 3NP7A 3BQMB 3RU7A 4GRDA 2QPTA 4GRAA 1JTFA 4ROTA 3QW4B 3THWB 1MD9A 4JU9A 3QFCA 3ILVA 1KI4A 2OFOA 3B1YA 4P7JA 5K03A 1CZLA 2C9OA 4IJQA 4PC2A 5E6RA 4Z1MD 2AZTA 3KSDO 4KYUA 3T94A 2IVZA 3ER8A 3SBOA 5BMVA 2RARA 4IKEA 1Q57A 1TCCA 3DMTA 5DN6A 4IEFB 3FRHA 4C03A 2E7ZA 3QUTA 3D2LA 1O0BA 4BEBA 4PLTA 3K1ZA 4QO8A 3GFOA 1CUEA 2V55B 5B30A 1CR2A 4LY0A 1DHTA 3GLKA 4HB0A 4X3PA 5JS7A 2HPAA 3T1QA 1H2FA 4A27A 1A7AA 2AOUA 3I4FA 1PR2A 1QCCA 2JJMA 1GZ5A 3ZUGA 1SCUB 4XUCA 3LBNA 3R3ZA 2A0YA 3M1AA 4HTAA 4E1AA 2ZK7A 3NVMB 3PFGA 2LIPA 1PE0A 1XZPA 4KO1S 4B33A 4MJ3A 5H3CA 3PJDA 4AQ7A 4FSDA 2ZS8A 2FX2A 3ZKWB 3AX6A 2F4NA 3D1JA 4UE3S 2C7PA 2OO5A 1DQZA 4Z4QA 1F14A 1P9RA 4HAWA 1XVIA 4LIPD 3U6BA 4I7EA 3IEMA 3KKLA 1Z56C 1OBOA 5K20A 2HA0A 2ZTLA 3U4HA 2DECA 4L28A 1F7UA 4AZ0A 1P0FA 3L6DA 4REQA 4LDQA 2ZVPX 4LY6A 3SAJA 4G1BA 3TR0A 2AMVA 3U0BA 1JZQA 5CM2Z 5IK2A 2CL0X 3D6NB 1O6ZA 3UOAB 2FUKA 2QRUA 3FI9A 2I7DA 4IG9A 1H69A 1W49A 1E59A 5DHFA 3EQ6A 4YJ3F 2B4YA 2NGRA 5C4GB 2GVNA 3TTXA 2RKBA 5CA1F 1FYEA 5A71A 1TLTA 2GEJA 1U80A 1H5UA 1UEXC 3AFNA 3V1MA 1QGED 2CMFA 4F7DA 4FWTA 1TA0A 2VBFA 3FCSB 4KXNA 3ZDYB 4C4ZA 4MUHA 4K40A 1MV5A 2OENG 1D2GA 4QYWA 4HYTA 3PP8A 4KZPA 4GDFA 1CQJA 2Q1TA 3G5TA 3PNSA 4XJSA 3S8EA 4FBMA 1F2TA 2XKAA 3HA3A 4DV7B 4DRYA 2ST1A 5ARCA 2A78A 4FFBA 4U6QA 4RHEA 5F4ZA 5TNXA 1JHAA 5JFGA 3GLGB 1YFJA 4HAOA 5TEVA 2FPGA 3GA0A 2QL5A 3RADC 3ZV4A 2AXQA 4ZQBA 1E94E 3L8GA 4IOKA 4WEQA 3TIFA 3R09A 4FVTA 5C8DA 1ESZA 5K51A 4YIHA 2AOWA 2R8ZA 5A4AA 2FZEA 2I34A 2AV6A 2CXQA 1SVSA 2C97A 5B3AA 1DKQA 1TKRA 4CF5A 4WBNB 4IV0A 2ZE5A 2AE1A 2QM3A 4OLFA 3OIWA 4PFQA 3UWDA 4W9MC 5C35A 1YE3A 3IS3A 5TEWA 3SXUB 4BNWA 2W6ZA 1RE0A 3N0TA 5LMZA 2REQA 1X9IA 3RM3A 4IMIB 3HJAA 1DRWA 3UTDA 2XTMA 4YMHA 4IVRA 2QLFA 2VAVA 1I2ZA 1RPAA 3B2QA 2EGGA 2P9CA 3WK5A 2JGDB 4C6TB 3UJAA 3T5MA 1Q77A 3KFLA 2G77B 1KAMA 5A2GA 1CUSA 4LHXA 4RVNA 2Q5OA 3EIXA 1RHMA 3WGNA 5I5EA 2V58A 1PEYA 4L5CA 1KK3A 3GGDA 2O8CB 5CYGA 1F0KA 2OFPA 2ZRIA 3BXGA 4KDRA 4J94A 4PNHA 3CA8A 2P5UA 1EHYA 3UKJA 2GBCA 3KKQA 3OX1A 1JSRA 3W8DA 5EZSA 3DXFA 4A5OA 3JVDA 4IGKA 1OHHA 2WB4A 3W9BA 2C5AA 3K9WA 2AZMA 1R4MB 3IPYA 3RGWS 4H59A 5KNDH 2UYYA 3GFQA 1T4CA 4H0CA 1VL2A 5JBIA 2CMDA 2Q0SA 5CM8B 1W47A 4YCDA 1MTZA 3WZMA 5JYEA 4MRRA 3WJ7A 3PYXA 3HWSA 4DMLA 5E6SB 2EDCA 2WJGA 3CVJA 3IAM6 5G0VA 3CN7A 1GG9A 3W4KA 4JT9A 1X2BA 4BL5A 2SKEA 2ZANA 4WK0B 4NTZA 1FU8A 5FOUA 5JV5A 3BM5A 4N40A 4DDUA 4PSVA 4CTOA 4O3MA 4Y2JA 5LQRA 4XD7D 3ZIDA 2XBMA 5AVUA 2H08A 2UUAB 2AI1A 1C9KA 4RE6A 5JC8A 2B35A 1TRKA 2A7XA 1M6YA 4IDDA 4F6CA 5A4KA 4QYTA 2IZ5A 2YIJA 3A8TA 4YRDA 5IKMA 5JC1A 1YRQA 2CLDX 3D6TB 2BKEA 1VP3A 1Z06A 2JH3A 4NV0A 3P2MA 3ZWAA 2NO4A 5LU9A 3QTTA 4EEKA 3THRA 4EF6A 1FB5A 3S5JA 3GL9A 1XL0A 3CX8A 4F2DA 1YB4A 2RCNA 1AV7A 3H5LA 4MMYB 5LCXA 1E92A 1HFJA 1ZD1A 1D4OA 4CLEA 2DHEA 4M46A 2ZI7A 3CKMA 3UWPA 4RTLA 1WF3A 1YHNA 2OHVA 2X4GA 3CEHA 1QGAA 4GMGA 2XHZA 3DKVA 4GPTA 4IXWA 4KKXB 5BOSB 5KNBA 1ZJWA 4H7IA 3OZGA 2H7VA 2R4TA 1OX4B 3MWDB 2WSBA 1UPCA 5DRYA 2W22A 1R8JA 5AOVA 1RP1A 1JR4A 5AKJA 5DLEA 4YBRA 1ECCA 1E6CA 1NVFA 3FYUA 1BS1A 4IVNA 2I2XB 3FWPA 3QITA 2J5BA 4Q1FA 5C8YB 2GRJA 3HDJA 4PO1A 4JLUA 1VJ5A 1XLVA 5JBQA 4XGIA 1LJLA 4QT4A 4BNXA 3GY0A 1UC8A 3DUFB 1AGRA 1XSEA 1WZNA 2VRBA 1KWKA 1XA0A 3OKCA 3HJHA 4K6MA 4EPVA 4B4VA 1ESDA 1K6XA 1PLLA 1VGVA 3G5UA 5IAJA 1I4WA 2FKNA 1RYHA 3MSXA 2BEVA 4L07A 2V7QA 1UMCB 4CZ2A 3OQBA 4DEYA 1XKTA 3RVMA 3TQQA 4ZI7A 2HT1A 4DTIA 1POWA 2FZGA 1FQOA 3FR8A 4KTVE 1POXA 1TECE 2LV8A 1NVVR 2H57A 2VQFB 3GP5A 3R6GA 3EF1A 4MS1B 3UMGA 1GG8A 1PR0A 3GVHA 3I37X 3FXAA 2R60A 1MRZA 5HK8A 3RGGA 3U19A 3MERA 1OASA 2FV8A 3ASUA 2HWWA 4LA4A 4P4UA 4IXMA 2H06A 4JB8A 1HQCA 2A86A 5EJMA 1LK7A 1RCUA 5GADl 3K6SA 3KTFA 2Y2VA 3TLJA 4MDFA 1ZESA 1GKIA 2UVQA 4FOLA 2XNCA 5ALZA 3W3AD 2PRYA 2GYVA 3LVQE 5CLIA 1N9GB 5LP6F 3T7JA 3TQRA 4KOAA 3SZMA 4BFCA 4RIIA 1QAQA 4FDTA 1Y3CE 3AHJA 5DYGA 3ZQKA 3PTAA 4AYTA 1II8B 3L7YA 1JSXA 4Y2VA 3O74A 2F3RA 3N8NA 1EK0A 2YVQA 2FE1A 3IUSA 5DMXA 1X0XA 2ZJ0A 4BV8A 2IUEA 7YASA 4MB0A 3ONWA 3RHSA 5AW6A 4V0LA 1LPNA 1TYDE 2Q45A 3L0OA 4DQVA 3C14C 3DMRA 3OTWA 3PR1A 1RADA 3R3HA 4EI9A 1DBRA 1Z7WA 2JGRA 1DTEA 4BLTA 5JR3A 5IAGA 2C29D 2WIFA 1I33A 2CZCA 4A2CA 3PPXA 4RFVA 4EGAA 4P53A 2H0AA 3HL0A 2QM8A 5F33A 1G6HA 1XZMA 2NWQA 3G5LA 5F64A 3TIGA 4HNVA 3WLAA 3BFXA 5JT1A 3I8XA 2C5SA 2J6BA 4TS9A 1XZBA 2QI9F 3S99A 1H2RS 1KZYC 5L7TA 4B3GA 3G9QA 3QX8A 3QNUA 2I6TA 3PCTA 5LQSA 5LQKA 3ZV5A 1AZTA 4B3JA 4RWEA 1TM4E 3RCBA 1ZD3A 2ZUVA 4C29A 1R0SA 1ZU5A 4DR4B 1DS6A 4FOSA 2X8LA 2Y3IA 1I30A 3A32A 1HRKA 3KYDA 1K5DA 3PPIA 4J43A 3T99A 4LVNA 1M67A 3ESAA 1NBMD 2B3TA 4A5SA 4RVCA 1CZOA 3PZRA 2HA6A 4HR7A 2A9OA 5DGXA 4CCSA 3GPBA 5H9WA 5I8WA 5CLHA 1JFFA 1X1RA 1T29A 3ROFA 3VPXA 3G23A 4L9RA 3V3TA 1D7OA 4ND8A 2QD2A 2Z0MA 4X7RA 4N03A 4D9CA 2GCPA 4C7VA 4J4TA 1YQWA 1JXQA 4RA9A 4N1AA 5EHNA 2OECA 1SRRA 1QHIA 2ZAYA 5HNKA 3E7FA 2I7TA 2WU1A 4JN6B 5CPBA 1GZ4A 1Z4QA 3QFTA 3QJGA 5LDDC 2ES4A 1US8B 4CF6A 5ITZB 1L8OA 3PC4A 3DDCA 3TEMA 1JG1A 3EEQA 3EVCA 4ESHA 4S05A 2BEUB 2Y1GA 1NBHA 3A6DA 3H2YA 3T1TA 4AZTA 5BUQA 4MRMB 2ZCJA 5FNVA 3TI9A 4H4DA 3PE4A 4KLNA 4XGRA 1YZHA 2WP8J 1NJSA 3WGQA 4C7OA 1PYOA 2J30A 3HQ4O 3NHJA 4MCAA 5LUAA 3BREA 2HLDD 4XM1A 1NDUA 4MWGA 4ZEXA 2V7XA 1L7BA 4X6XA 3NBQA 3A1WA 1Q1QA 3KDPA 3K0FB 4YCAA 1ZMXA 1LNZA 5GQSA 3EXIA 3V4FA 5IASA 2A5JA 1PGPA 1JVNA 2NZ8A 3KLPX 4O33A 821PA 1FLDA 1RRGA 1XAHA 2XPCA 2HTEA 4K86A 3ZE1B 4D8VA 1QU2A 2FWIA 3B60A 2H4JA 3EG5A 3P5BA 1BJKA 1YGYA 2RJOA 3ND8A 3WIVA 1EUYA 3GAAA 4MI1A 4L8VA 2IHJA 1NPTO 4HFNA 2ZSFA 1JF8A 1IQUA 4EW1A 3NJ8A 4NS1A 3D1LA 1JHMA 1M2WA 3X1YA 4AG3A 3QE2A 3RYHA 2DBYA 1QZUA 4IDAA 2DBVO 4XZ3A 3O8NA 1W34A 5EJ9A 1C4WA 4G84A 3B6KA 4YP6A 4MWDA 4ITVA 3M1LA 3V4SA 4ENPA 3GA5A 2OFFA 1YBMA 4BQOA 3ICVA 3BWCA 1N5KA 2WTAA 4IAOA 1JQDA 5FUMA 3IDFA 3Q3EA 3VZPA 2BC9A 1V1MB 4K3VA 1EGAA 1Q0PA 3AR8A 5KSYA 2VZ9A 2Y76A 3QBDA 2AHRA 3SDZA 4RD3A 2VJMA 1NJ2A 1NW6A 3RK4A 5DN6D 2PGDA 3WZLA 1D6JA 2ZYHA 4B3DA 5KQPA 2K2QB 5ECWA 2I6GA 1I6LA 4G5RA 5IJWA 3T5GA 4GUDA 3W2IA 4OV6B 4DQUA 1AUXA 1EX7A 2A9JA 4FE3A 1Y4DE 4IXNA 2NP7A 1EP2B 1OXMA 1KFJB 3RSFA 3KJIA 2FG7C 1GCOA 1LTQA 4MPRA 4A1OA 2QMZA 4XCVA 1HEYA 4KCGA 1JXAA 3T7RA 1X1QA 4TWBA 1SCJA 5DTQA 3TDMA 4AS2A 2BR5A 4FFRA 4PNEA 1C7RA 2C9ZA 4YT4A 2QZ4A 5A3RA 1HTBA 3KXKA 2J41A 4YJ2A 2O2YA 3OEEA 1KH1A 2P65A 3I4CA 4P34A 4KQMA 4AKEA 1MG0A 1IHXA 4TN1A 5CDTA 1CQIB 1E9FA 2E48A 3IP3A 4XR4A 4JI5B 1ID8A 1SUAA 1AN9A 2QSJA 1YZQA 1LV8A 1F4LA 3FCYA 2F1JA 2I29A 2R00C 4WUVA 4B7CA 2OD7A 3VSCA 3OFVA 4OLAA 2ZP1A 3NO4A 2O1XA 4QNRA 2F3TA 1QR6A 2J85A 3HLYA 4F56A 3MWGA 3OQIB 3FOEC 4TKLA 1H0HA 5GV7A 3ZLBA 1DZIA 1UMDA 2WD7A 5A06A 3S81A 1UBLS 3HZRA 5L40A 2C59A 3NOQA 1JU3A 3QUCA 4PCLA 4UM5A 2Y1KA 5AH0A 4AROA 1T5TA 3S1AA 5F78A 3H04A 3CH7A 4CHGA 4J2TA 1JFVA 1Y8CA 4QG3A 2XMCA 4QAJA 5A2QA 4DR3B 2A1UA 4UU1A 2D3TA 1NURA 3DMDA 1X7WB 3OPYI 3U3JA 1WB4A 1L1QA 2V7GA 3NGXA 3HYLA 2F1RA 3CX4A 5GOTA 2QDKA 3EDRA 1CJVC 2GN2A 4B3HA 1QRTA 2BONA 4IVPA 4QTZA 3RAJA 5LQNA 1THMA 2AH5A 3AUKA 4WKOA 3IQFA 3TLGA 4UNQA 1FDRA 1GUBA 5D1HA 1I14A 2XUHA 3GAMA 2IPOA 5G40A 5AR1A 2ZCUA 1GPLA 4TWJA 4ZAFA 2HSZA 4HH1A 4MLCA 4RMIA 3RRXA 3D8HA 5JQGF 4Q9HA 3S4YA 4CPDA 1JQLB 4FE4A 4YV2A 4ZT7A 1L7OA 1AHHA 1U0RA 2MINA 1V9SA 1K5HA 3PIIA 3G8AA 4W1PA 4CTKA 3UMVA 2J59A 4M7PA 3RNOA 1XDZA 3LPAA 3GDGA 5CA0A 4ZRNA 4S0ZA 2E89A 3T12A 4PM4A 5GY7A 1NWCA 3QRWA 1G6OA 1SBNE 3DOJA 4G01B 4TMXA 2HRZA 3ZCVA 3ZVMA 3E61A 2A4KA 3UMFA 2J45A 4J0FA 4JXJA 3PX3A 2RHOA 2XT0A 4BQQA 1I32A 3D6JA 5C46F 1VIAA 4C4AA 3LT5A 1IXKA 1S7GA 2YV2A 3LYHA 1JLMA 3KKPA 4J6EA 4LOJA 2M6LA 4CIYA 4DZTA 1W9MA 1SU4A 3KAPA 1P91A 1CUCA 4BV2A 3TL6A 4JSTA 1V5IA 1OLSA 4KPFC 4CNBA 1CJMA 4OU5A 4OXQA 1XVVA 1CE8A 2WQZA 3A3OA 3SICE 3KL4A 4F04A 1W2GA 2DPXA 1IUOA 4GSKA 5P21A 4EO7A 2ZYTX 2PWZA 4GKAA 3D7RA 3L1JA 1OHHD 5H1YA 1X1CA 4FLMA 1SB8A 2CD7A 4LCJA 3CNBA 4RPJA 4MWOA 4M0LA 5I9BA 1AGYA 1QUEA 4MYHA 4IV8A 5FQOA 2ZRFA 3FYSA 3AVUA 4YCMA 3WGJA 1JQ5A 2ZIAA 2ZRQA 2NTJA 4FTWA 5AICA 5IX8A 5KTRA 1M0WA 1Q1BA 3K2BA 3BH6A 3O75A 4MJ7A 1E7RA 3TEFA 4CMIB 1MO3A 4YP5A 1L7AA 3RSCA 4ESEA 3G8DA 1DJLA 2Z08A 3JQBA 3L06A 3V7NA 1CR6A 4TXLA 4EGFA 5CRIA 4P31A 1JP7A 3I05A 5DDIP 3OO0A 2JZNA 1UJ6A 4P3OA 4RH1A 1BMFA 4XGKA 1J1IA 3EJWA 2FZLA 3TSZA 4EW6A 4ID3A 5D2CA 3F73A 2HCBA 1YCHA 5CLQA 3WRXA 1GL9B 1XDBA 2NU9A 3N76A 4IKPA 3VR5A 4Q9IA 4OQXA 4OKNA 1PVDA 2CL6X 4B6QA 3SYRA 2DBRA 4MUEA 5A3JA 5LOVB 4HEA6 3IQIX 1A9ZA 3ED1A 2EFGA 5G4KA 4EY4A 1CEEA 5K8JB 3WXBA 4YRBA 5BN5B 1R10A 3ZDCA 3PYLA 2H2AA 3MSCA 3LVFO 2MIIA 4KRGA 3QGMA 2NXCA 5EIHA 5C80A 2XJ4A 2QZSA 2ZRKA 4GPEA 1BVHA 1WB6A 2OL4A 4ZMBA 2HA7A 3OPYA 3GJTA 2WOOA 4B3FX 2GXSA 3KKOA 5BMOA 1FRZA 3WTBA 1Y6ZA 1DINA 3LQYA 1KYZA 2DTEA 4Y2TA 3I1FA 3KSAC 4DY4A 2J0UB 1P17A 1ZXLA 2Q2NA 3DWFA 5EWLB 3NTOA 3OHSX 1T2UA 3OCYA 4H15A 1Q20A 4BKOA 4CKYA 1GGHA 1H65A 3NOXA 5FBKA 3HABA 3UAOA 1AA9A 4GMFA 4NMMA 3D4IA 2I2DA 4Z0TA 4XA8A 5IH7A 1LH0A 5JW6A 3ZHQA 1SURA 1X80A 2IIBA 2I8LA 1W1IA 2C04A 4M4SA 4CKWB 4DIDA 1PS0A 1J22A 3DBHB 4PLFA 3ECCA 3K4HA 1NXTA 3HXOA 1DXOA 1WJGA 3A1NA 3OM1A 4U7HA 1O4VA 1UKYA 1G20E 3Q5EA 3PE6A 1SRQA 3BBPA 4YAFA 1QH1B 1E18A 2ZIGA 5E0OA 3EEYA 5F2OA 3RUCA 3WO0A 4LHWA 1M72A 1QP7A 4Q3CA 4G81A 3FKJA 5B3JA 2R48A 4YP7A 1ODFA 4KQIA 5BW6B 2QXYA 3C2QA 3PQ7A 4WWHA 4ZVVA 1NQOA 4E2XA 3N2EA 3LQRA 4XIFA 2IBTA 1W44A 1GZHB 3W5AA 1VCMA 3K0CC 4PHTA 1TE2A 1P9LA 2V54A 1U5BB 2AN4A 2P67A 3IQHX 3JZAA 4IGIA 2WY2D 2OV4A 3HCCA 2FN7A 2Y2UA 2DQYA 2PQ2A 4TZ0A 2VPYA 4P08A 3TJMA 1H1LB 3D1VA 3I28A 1Y37A 3IAXA 2NQTA 3LL7A 2CL5A 1PWZA 5HKKA 3BYZA 1M6EX 3MRSA 4OHFA 1XMSA 5CLJA 1JJVA 4ZO7A 3WNCA 5H4HA 3DE0X 4RJKA 4QDTA 1H05A 5KCMA 1FBNA 1L0BA 3O4JA 2PLAA 2WV7A 4PLPA 5CVJA 2RMKA 3N5KA 1WQ1R 5HQ3A 1U7TA 5JPCA 3OTIA 2XMZA 3OC0A 1P2GA 1JU4A 3ICQB 5KNCH 3ZNNA 5BV1A 4YREA 4OF4A 4OK3A 5E9QA 4EM6A 2VA8A 2G3YA 3RKRA 5HJ7A 2AI2A 3K1AB 4I4CA 1NNSA 1XRRA 4LAFA 1ISJA 3AM4A 3DEJA 4HRAA 4BVEA 1MO5A 1GNTA 2IZ6A 5GP1A 2NNWB 5ICMA 1L5LA 2ZZNA 4J3FA 1J33A 5KHOC 2HWUA 2PBRA 1ISFA 3IKVA 1P39A 3ANYB 4BPRA 2D2EA 2QKYA 1T6ZA 3GLFA 1EVYA 1ZC3A 4KR0A 3GD5A 1J24A 1EXNA 1R6AA 1RWMA 4C87A 3D6FA 5BQPA 3R0QA 2WIBA 4TPKA 1E2UA 2JHCA 1IZ8A 4MS3B 5LQMA 5LYJA 4MGHA 2X3FA 4GOOD 1YJCA 3PFNA 4R0VA 4LOHA 4ZDJA 2VR1A 5JO0A 2P8SA 4A91A 1Q0LA 2CD9A 3OUUA 1UPXA 3NWPA 4D0RA 2FSPA 5C1PA 2BRUC 4TV9F 3ICEA 1VJCA 4ENVA 5C7IO 1QIDA 3L6OO 4AZ3A 1GO2A 2EHDA 3IMGA 3PNPA 3SNKA 1YFLA 5KYNA 2JCVA 2J32A 2MYUA 4GI1A 4ZU3A 3SHFA 4ZKDA 7MDHA 3TNLA 2HTFA 2UXDB 1TTTA 4GEKA 1VBKA 2WJWA 1NGSA 3FJYA 3TLXA 4EZIA 4BLVA 4I9HA 2H9AA 4QDUA 3RUAA 4KJZA 1CDEA 4ZOLA 3A37A 3IOBA 2R96A 1XK6A 2ZR9A 2E18A 2HHAA 1P9NA 4EJ2A 4A16A 5LZ4A 2OXIA 1SCDA 1PZHA 1QOZA 1JKMA 2ODNA 1RZUA 3C85A 4QGFA 5JSQA 2ZI3A 2QRPA 2N46A 1UP6A 3IT0A 4MVJP 4HNUA 4J16C 4PNZA 3WLQA 4HN4B 4XFKA 4C5AA 1FFSA 3K9CA 3PJEA 4OHZA 5KYWA 3RKUA 3GPIA 4A8HA 5EJFA 3BJRA 3U7QA 3GCDA 2PPLA 2VCYA 2X86A 1YTLA 1CKEA 2XAUA 3NM6B 1C3OB 1P2TA 4JZKA 3SP1A 2VCHA 4ABYA 2CLMB 4EJSB 1ZK0A 2R1VA 1HE2A 3TZKA 3DC7A 4HYQA 2Y0DA 5JADA 1KEVA 1R5JA 2D2VA 3LCCA 2A84A 4YACA 5FV4A 1JEYA 2IEIA 3HU1A 2NSLA 4NNJA 2XWJI 2FRXA 1BCRA 1DAKA 3GIDA 3ACDA 3STUA 4MNTA 1UOQA 4BX3A 3JALB 4PAQA 1AZLA 3CGWA 5HW0A 3QPCA 3VV2A 1GQ2A 2CHUA 1MO6A 2M6SA 2OCKA 4JS0A 2X9QA 3Q7QA 1IQPA 1SOWA 3QUAA 4OVKA 4GE0A 2H6EA 2O54A 1BEZA 2L17A 4JJKA 5EXDA 5CDSA 5HUJA 1IRXA 3BJEA 3U7JA 1X74A 4GVXA 4P3KA 4C6HA 5JXWA 3EGXB 5FPHA 1DKRA 1N2CB 4D9IA 1FDSA 3IO3A 3N5CA 2R87A 4R2WA 2QE7A 3KYJB 5EI5A 5JAHA 4IZOA 4ND4A 5CNMA 4CBVA 1RLOA 3AZOA 1M6HA 1OWLA 5D7NA 3RT1A 2IH2A 3DOCA 1KBOA 3MMZA 3VU8A 2I1LA 1C30B 5C4IA 1VPWA 1UZLA 4D80A 5L8VA 5K2OA 5A3VA 1PG0A 4HGQA 4HQ0A 4AFNA 3L0PA 5C0OE 1U65A 1LWOA 3SF8B 2P3OA 3I04M 1CJCA 1FK8A 1CLUA 3L7IA 4UDXX 5KC9A 3GLFB 4LYFA 2GN8A 1PV1A 4F8JA 1JECA 3PQ3A 3CVUA 2ET6A 5DYNA 1G19A 1MO4A 3P96A 4E4TA 4BNGA 2ZSKA 1LPAB 1BGVA 3MK31 4L50A 1EWVA 2BGWA 5DTJA 3O8DA 2HJVA 1QHHA 3PE3A 1JT9A 3S1LA 4OXNA 3SC3A 4EY3A 1EGHA 5DNAA 1GR0A 3OLQA 2CCJA 4OLJA 4OB7A 1JR6A 3OEED 4H7HA 4JR1A 1E2FA 4QU8A 4MR8A 4CKCB 2CXNA 3QKTA 3MB8A 2I0FA 4YROA 5GJCA 1VHDA 4P4TA 2Z5VA 3A11A 1L8AA 1ORDA 5EJ6A 2VTDA 4ENTA 1UJMA 2F8LA 2ODPA 4NYMQ 1JKJA 1V41E 1QNFA 4M8IA 4UU7A 2OCIA 2OOKA 5DCWA 5L9AA 4DIEA 3UTCA 2NACA 2JEZA 1RRCA 3GLIB 4HP8A 1I7SB 3EIEA 1DDOA 3T06B 4KOEC 3P9QA 4B34A 3R0VA 5ALJA 3SMVA 1XPOA 4FIZA 2GYWA 1LWNA 3NPMA 4G1VA 3BORA 2NUBA 4H9GA 3C8UA 3AJAA 4DLVA 1HT2E 2V0CA 3L7NA 3ACCA 3I9V6 5HFJA 3LKZA 3BD8A 1E9SA 4X8MA 3LCVB 3RTAA 2JFXA 2X9NA 3Q8WA 5LYJF 3A06A 4OQZA 4N76A 3T1YB 3N86A 2UVDA 4PHGA 5KWIA 4NBUA 4UJ5A 4XRGA 1MFZA 4JC8A 2NLOA 3SXPA 2HQ1A 5FPSA 4G25A 3FSRA 4JP8A 3R5KA 4F3RA 2FPUA 2Q5QA 1QRSA 3G1WA 5KJ6A 3O91A 3W4IA 1EE1A 2NVWA 1NZJA 3F78A 1KPHA 1GUYA 5IW8A 1ZI6A 5L7YA 2WWGA 3NTRA 5TMPA 3T1NA 2PZBA 1QWSA 2H16A 3B3AA 3UGQA 3WL8A 2QLMA 2O3RA 1G5RA 3LFUA 3VC3A 5BSHA 4KIJA 1NW9B 4LYYA 2XZOA 1M76A 1Z26A 2ZWIA 3FHCB 5KX5A 5FIUA 4ZV9A 4QPZA 1CY4A 3M34A 4K03A 5C52B 1B0AA 1PW5A 2H29A 2D6FA 5SZKB 4M0UA 1JS1X 3HYTA 1GAQA 4G24A 2FLKA 4FC6A 1KO8A 2O7NA 2VHYA 1Y5LA 4BQEA 5FTWA 4YFYA 4BNVA 1IHPA 1NE2A 3U3ZA 1RZRA 1HA3A 2QAGB 2FPRA 4JYMA 1WE2A 5L95A 3PKZA 3BWEA 4CHTA 3LXUX 4V1CI 2VK2A 4I55A 2XITA 4IQ4A 5ANRB 2A6PA 2OXFA 3USZA 1OLUA 1EP9A 2OESA 3K9LA 3WOHA 1V6AA 2B4KA 4I1YA 2SBTA 4L4SA 4CCYB 3M83A 5AXBA 1OTYA 5KWEA 1MV8A 4E5NA 5AQ1A 2PKRA 4QZVA 4XB2A 3U7GA 3SOPA 1QSGA 1HDYA 3AUYA 4JXXA 4JYBA 5JE8A 1TEVA 2QX4A 1U3WA 2ZDHA 4X90A 3VHXA 1I10A 3FHOA 3JZMA 1E0AA 3HB7A 4DR1B 2AKYA 9ATCA 1R0KA 4KWTA 5AVVA 4GL2A 2D8AA 3AVOA 1ZCAA 2P2SA 3A6EA 4ITRC 4JEIA 4NZPA 5DYWA 3RBXA 5CFMA 2WJJA 1FRFS 1OILA 1TA9A 3HR8A 5EN4A 1QNLA 3B52X 3SC2A 2JBAB 1U04A 2PL9A 2VQ6A 3C8MA 4MGYR 4QVKA 4B17A 3VRHA 4O08A 1EDOA 4RXMA 5ENZA 1IYZA 4QX6A 2NT3A 2FSVC 4A4DA 4UHFA 4ASUA 4G4SP 4G36A 3OKPA 4H0NA 3E6AA 5J2UA 2B8EA 4BVJA 3KEQA 1HFWA 1BMFD 3F74A 2QUHA 4HWSA 4CU5A 1FU7A 1KKMA 5HMMA 3T9BA 1N6OA 1NUQA 2FHSA 2QTFA 3EUWA 3LCUA 4FFVA 4WTOA 2YZMA 2ZWVA 2QJTA 3CGGA 4OGKA 2A67A 1TT5B 1KMIY 3VR5D 1F5SA 4A8JB 4E2ZA 1BTOA 3ODPA 4NI5A 4W8HA 2WFLA 2R9VA 2OVFA 3ZXSA 2ZBVA 3HWWA 1EXDA 5JD4A 3OTGA 4OBBA 3SX4A 4DCOA 4I1UA 5CD9A 4Q18A 2X0NA 3JATB 1YQEA 1QYRA 1JU9A 3NC4A 1QDLB 2ZDQA 4CIAA 3G9XA 4QJ3A 5LP1A 5CLGA 5IDQA 1SCAA 2WD9A 1BE0A 1V39A 3GJ4A 3LYAA 2OXEA 4IO0A 4RHYA 4PN7A 4JU8A 2LD4A 2O6HA 1MX3A 2GXQA 3BCUA 2O4UX 1FS4A 3KAJA 3TN7A 2H85A 5PGMA 3LUJA 1WD5A 1ZY2A 2OSVA 4M1WA 2JHFA 2Q3DA 2PK3A 3AP3A 5I7EA 3TJZA 2P2DA 2XMRA 1JJAA 4MWZA 5LQCA 2X19A 1KIFA 3E22A 4YDHB 5JSYA 5IUNC 3DMTC 1SOAA 4MW4A 3H9QA 4Y30A 1QQ6A 1B0UA 1D0IA 4I36A 1JXOA 2PJUA 3EZXA 3UMMA 1CULC 4TTQA 2RI6A 3OFNA 4AK9A 3B7PA 3S7ZA 3W1EA 4D3FA 1E7QA 2Y99A 3LJKA 3OQ1A 3GCWA 1A04A 1M10A 1Q7CA 3BHJA 3MTGA 1LX6A 4WFJA 2HSEA 5JWRA 1MZPA 4DEXA 1KY5A 5KOJB 1X87A 1KP9A 2YFKA 4JCOA 1GITA 2WUGA 4FXPA 2O7SA 4WJKB 1DWUA 4OHYA 1SVNA 1UM9A 3D0KA 2WIDA 3CSDA 2AR0A 3GW8A 3ZLUA 3TGLA 4ECAA 4NOMA 2WRZA 1SA0A 1G55A 3EPRA 1TXGA 2XRMA 3FBWA 1XAJA 2X8JB 3AEQB 5AI4A 5E7JA 2GERA 1JQAA 4V1CA 1FP2A 5J4HA 5IXYA 1MDFA 2ISQA 4EH1A 2Y0CA 4DBZA 3GFRA 4EA6A 3F5FA 4JJ7A 4J3JA 4BO4A 3WDMA 1OH5A 2OORA 1NI5A 1IULA 1Y3BE 3PFCA 4L16A 4CIBA 4HNGA 4DSNA 1C9EA 5KI6A 4NJMB 1NLZA 3BRQA 1OPXA 1BXRA 3FOBA 4C0WA 3NONA 4UM7A 1E1NA 1PDVA 4MDEA 1DL5A 1OYOA 1PZXA 3BXZA 2BEKA 4U0JA 5IMBA 2W2XA 4IYRA 4Q9NA 3VPCA 4EENA 3TTSA 3JV7A 3A2KA 4QXQA 1DFHA 3BJMA 1I36A 1L3CA 1E3SA 3N2YA 2EW2A 2HEIA 4RPCA 5HKKD 1M1YE 1YULA 3HJGA 3IP1A 3PNBA 1R1DA 1U5AA 1ZLXA 3R6LA 3ADOA 4LJ5A 4YJ3B 4NIMA 4Q7JB 1RI5A 1PZFA 1I0ZA 4D8XA 5AK3A 1DE0A 2FMHA 5DK6A 2I3AA 2Y66A 3LP8A 3H18A 4I55F 4EZBA 3PC6A 4YS6A 1N2XA 1KP2A 4GM4A 1RRMA 4OXKA 5HKBA 4PY2A 1BN7A 3LM8A 1KYXA 2FUG6 4U3JB 2ZE7A 3E03A 4RSHA 3RROA 1AH2A 1M1YA 1HOXA 1NSYA 3DNPA 1UJBA 1TIBA 3FUVA 3AR2A 4HFMA 4X20B 3SMQA 3T95A 2X6TA 1NUPA 1EYZA 4YJGB 3SHVA 2ZUUA 5PNTA 3AESA 2WILA 4ZEOA 4DGQA 3DM9B 3QX7A 4ZHQA 2JZOA 2O48X 5HTOA 1LVGA 4U2DA 5LP6C 1MJGA 4H1WA 4FZJA 4DRXA 4YPVA 4MA0A 3R3YA 3R3WA 1KNXA 3BTSA 1N1DA 4MPDA 3W1WA 2F59A 1Z6XA 3IEIA 3CE6A 4M8SA 4Q4AA 5IBRA 4OHVA 3IQDB 1YBHA 3CTMA 3VJKA 1Z8FA 4X6UA 5CH8A 1U7WA 2XX3A 4Q7LA 1U2RA 4HV4A 1L4UA 3DFMA 1KAEA 3AVPA 2BFDA 3EXFB 4W5TA 1T9ZA 3L79A 1SJ9A 5M3BA 1IL0A 2JCSA 1RFGE 3ETCA 3LY8A 4NBVA 2H1SA 3O0DA 3V1YA 5K8IA 3FI0A 1MVLA 3NI2A 2BV3A 4XQ0A 1JIJA 2P79A 3T3PB 1C2TA 2C5HA 1E3IA 5JD5A 4ND5A 2JK1A 3ZBPA 1SBIA 1JKFA 2YZGA 4YBZA 5DK4A 1K8RA 1TF5A 4UEOA 1XNRB 4ZYWA 4CLRA 2IOYA 8MHTA 3T1OA 3AM5A 3GLHA 3NYQA 3WLPA 1KO4A 1K27A 4HY3A 3OPXA 3H5RA 1LQUA 1UDBA 3CEMA 1Z15A 3DDOA 3T3DA 1WW3A 2WE7A 4S1VA 3OE7A 4I5EA 3TSWA 2QI9C 2XYGA 4HTFB 4ZEWA 1HYBA 3KV1A 4GE3A 3THYB 2EFDB 2EAUA 2IYYA 5I4IA 3LQQA 3K8ZA 1DB3A 1M1ZA 3V6MA 1PTKA 1B4DA 2X8WA 4M89A 4AT1A 5CNJA 2BLNA 4HLNA 4J6FA 1B3RA 4B32A 4MPJA 2DP4E 2WP0A 5EUBA 4AJEA 5H9VA 2VJAA 1G3RA 5E6RB 1KZHA 3MT8A 4D9MA 3WAGA 3LU1A 4BO7A 5FNZA 4DHEA 4MWCA 2O0HA 3ENQA 5KQLA 1KI1A 2FGJA 5GVRA 3KM0A 4S1OA 1K9VF 4ZCLA 2E37A 3PFHA 2VLIA 3LX5A 3CBQA 4Y9RA 3KYIB 1D4FA 1E5TA 2CNWA 1G9XA 1WY5A 1CUFA 2BR3A 2WF7A 3EWAA 3WWPA 3ZY5A 4EUKA 3EOAI 5JSKA 2Q9BA 3UMSA 3WGKA 5D6OA 2YYSA 2AOUB 1BA2A 1EIWA 1BFUA 1VCHA 3NFYA 4Q3OA 8ATCA 3L3BA 1O1YA 3JYPA 3B20A 2V6MA 1FYXA 3MG9A 2I7VA 1WXEA 5MGBA 2CYCA 4X8LA 1R0WA 3TR5A 3AY0A 2P9TA 3QK7A 3OZVA 2DU8A 2I4IA 3VISA 4ETNA 1VMEA 3DFZA 2GASA 1ECPA 1NJ5A 3HB5X 1EH5A 1Q3HA 2OILA 3WK9A 4MVJF 2YMPA 2NADA 3MWEA 2TMKA 1YASA 5FWXB 5L6LB 1SUIA 3A1TA 1P60A 2ZWOA 4YRQA 3R76A 3ZLJA 4IDHA 4A2QA 4REQB 3HRIA 4MHTA 2B5VA 1VLMA 4I4LA 4TL7A 4JI4B 2IX3A 1FUKA 1R0CA 4I9UA 4RULA 1XGKA 1WBBA 5H81A 5BN4A 5CH5A 4TMYA 1GPMA 9LDTA 1TQ8A 2MJLA 1N9ZA 2JJ1D 1RP7A 4GBJA 2IKQA 5K4HA 4G67A 1O0SA 5KHAA 2G17A 3STYA 2C92A 3D3NA 5J1SB 5IYZF 2O1SA 1SC4A 3OU7A 3H13A 3E9MA 1QC5B 4GPAA 1YZVA 2QMEA 4QULA 1QMPA 3W0LB 3E7WA 1HNZB 3TE7A 3N3AC 1AHIA 3B1XA 4H4EA 2V0NA 4ISCA 3VKWA 4DPKA 4XYBA 1PQYA 2W43A 3DVRX 1MW8X 1CNMA 3EAFA 4QPNA 5GOZA 2OY0A 1D2AA 4KI7A 1XD9A 2WFAA 1F2TB 4MRNA 1ZNYA 3HACA 2LRHA 2VP5A 4O2LA 4FFBB 3VZSA 5L51A 2XCRB 1WZCA 3TIXB 3FYHA 2AF3C 3UICA 4RESA 2FPGB 3G2KA 1NKVA 4C7BA 4BVGA 1U8AA 4KGVA 3H1FA 3GLVA 1KVSA 1T3TA 4ZHQF 1RHUA 3D8BA 1QPBA 1QCZA 1V11A 2Z56A 1PYGA 4YDRA 2PKYX 2ZRPA 3CZPA 1NR1A 1WVMA 5LP6B 1CF9A 3EC1A 3B12A 1MH9A 4R1QA 1UCFA 4H7KA 4BVFA 2D54A 1DTWA 3HS3A 4TMTA 3VXKA 2REQB 4V1CB 1IVNA 1GNRA 2HBRA 4QL3A 3PNKA 4Z4EA 2E1PA 3TKLA 2KQUA 1NQXA 4KR3A 4HKTA 2HPZA 1R50A 3L07A 5TGZA 3BDVA 3C15C 4JY7A 4ZYLA 4OQYA 4DSTA 4Z51A 1J7JA 2B2XA 3P8ZA 4DWJA 1VCOA 3JX9A 5DHSA 5DU2A 3WGGA 4CG0A 4DDKA 3SJ7A 4BKMA 2C3MA 1Y4ZA 2WG2A 3LUPA 1GLGA 2I78A 3AGQA 1A9SA 2EQAA 1Q1ZA 2EATA 3U3MA 3D0QA 3T7TA 2OWEA 4MWBA 1LDBA 4HN2A 1F6WA 1PJCA 2GO1A 2WNHA 3OFKA 4NOJA 5EL0A 1HSZA 2A8YA 2QTHA 5EHGA 1X9GA 2IYOA 4PRLA 1XMOB 1ZVMA 2YV4A 4FJ2A 2ZR0A 3U7FB 1OFHA 4B74A 1T4CB 4LV5B 1HQYE 2G40A 4BWFB 3ZE6A 3CO5A 1RZRD 1Q1NA 3ZY2A 4QM6A 2GLTA 3FTFA 4WJZA 1ACJA 2X0RA 2FFQA 3JAWA 1QJCA 4YVFA 2AFIE 3V48A 2HH9A 1N34B 3IRUA 1Y9AA 4I4NA 5JXGA 4Q02A 4YXFA 1ZK1A 2FR8C 1ZN2A 3WGHA 2XXBA 3DEZA 1JFRA 3OJEA 1ADGA 1ELOA 4Y6PA 1OC2A 1Q0ZA 2G6TA 3DE3X 2GTPA 2B99A 2YHBA 3O5AA 3KOYA 5EIWA 3FE2A 2OYSA 3K70D 3TLYA 2K87A 2VUSA 3GI1A 1P7CA 3L8YA 3U31A 1NJ6A 1VBNA 2HCJB 2VSOA 3HWX1 2I1WA 1Z4PX 1A8PA 5A3SA 4IMPA 1MORA 2AFIA 3CT4A 2ADOA 4ZP1A 2AXNA 3QVLA 2VL7A 2QLTA 4JC5A 1AMUA 4TZ6A 1FNNA 1WSDA 4JBIA 1HE8B 3L9WA 2IW1A 4LPSA 3RVOA 5KVVA 2P3QA 4KH0A 1VHQA 4PHFA 3RDPA 4NCJA 1OJLA 5AVZA 4ZTZB 3AHGA 4OP2A 2CCGA 4J0QA 3FWNA 2IYRA 4XLZA 2PANA 2OZVA 1F5NA 3CBGA 4J0DA 2XW6A 4LKRA 4ASUD 1GQRA 3L0YA 1QKJA 2X8BA 2JJ2D 4PCAA 1RXVA 3G6KA 3LGSA 2Z9CA 3KK0A 2ZAMA 1W5BA 1E99A 2YXEA 3ZH2A 5EYPA 5HZGA 3FYUB 1NIJA 5AJYA 3HP4A 3CWCA 3K09A 5LN1A 1VG9B 4LYAA 4TKZA 2PNFA 4LXXA 1KGDA 3WNVA 4D0LB 2EJWA 4B8ZA 3AHCA 2E5LB 2RH4A 3ZOZA 1ZK2A 3LO8A 5E1OA 4ETWA 1HR0B 3VU1A 2PYDA 3PNQA 1P7YA 4UTXA 4FUTA 2IYFA 1WBJB 4RELA 4C21A 4DAEA 4JBLA 4RV5A 4HX2A 4WKNA 4XYEA 3U1TA 4E33A 4E08A 2WIKA 4FEGA 4KC0A 4KUEA 3RTBA 3SJBA 4KXUA 4ZI7B 4EY5A 4YFVA 4JQZA 1Z6YA 2TMYA 3H1BA 1GGVA 1RABA 4JOBA 5IVIA 4MB6A 3U9TA 5BSFA 1KJIA 3R3JA 2XQFA 3LC7O 4F3KA 2D13A 4Q3BA 4Z9FA 4LVOA 1HPLA 1UOOA 2JIQA 4XCXA 5CFPA 5H59A 1XFDA 2QRNA 2YVKA 2ZG6A 1WSBA 2WU3A 1NBEA 4TKMA 1MN6A 4NYIQ 3TI7A 4WQMA 4HPXB 3TOZA 3EFOA 5AVJA 5TY0A 4YO7A 3OFND 4G6ZA 5F76A 1AUPA 1X19A 2OO3A 4ILKA 1PZGA 5JI2E 3VHQA 2OE2A 2F8TA 2EHJA 4XI9A 3TRKA 5CMLA 1VA5A 1PNRA 5F12A 3HN7A 3B1VA 3NANA 1RC1A 4W6ZA 3SU8A 1CETA 3C8HA 3BE5A 1PIWA 3DONA 2C4MA 4EB3A 4OU4A 4Z4CA 4LF5B 2PU7A 2FW6A 2GK6A 2C1EA 1EZ4A 2C5EA 5AW8A 3CW2A 4BMNA 1IUKA 4BLSA 4W8OA 5A02A 4XSVA 2RGNC 5LQAA 2H48A 2DF8A 3KTAA 3ILYA 1P18A 4P38A 4RIFA 4W9NA 3F3SA 5IF9A 4J75A 2IKSA 3FCOA 5CVUA 5FI1B 2FFRA 1DJOA 2GX6A 2HMYB 5DYIA 3GT3A 1AKTA 1CQPA 4J2HA 1K8XB 5HS6A 3EOBI 3Q3IA 2XRFA 4MV0A 4NHOA 3CKKA 4MKGA 4J7UA 3TLEA 4UKDA 4I8DA 4JB3A 1Z7GA 1MJHA 3QXCA 2IW3A 4W1RA 2CJXA 1E2LA 4ONEA 3PU6A 1WAMA 3PITA 2YBEA 1J8MF 5K3AA 2BKVA 2WM8A 1DQSA 3E9CA 3LO5A 1DEKA 3VKFA 1N2OA 2JL1A 5ENDA 4MW5A 2IXFA 4L7VA 1ZMBA 4BWVA 1HORA 2VXBA 1OC4A 4Z7NB 2PFGA 4GS5A 4LRXA 1N2BA 4W1SA 5ELLA 3DMPA 4DA4A 3VYRB 5DNCA 2O2SA 2RGCA 5CJPA 1DAFA 1YZUA 4OX9B 2BGTA 3KYDB 3MBKA 2BMDA 4I6GA 4MMZB 2WVJA 3HB9A 4G8JA 4QFBA 3MHTA 1RYEA 1M34E 5KNDA 1W5TA 3GFBA 3K0KA 3ME5A 2Q7OE 3ZDXB 1G66A 1GG2A 1KPGA 1PZMA 3M9LA 4JVSB 4M8NE 5JECA 4KITB 4EG8A 4PGHA 5LMNB 4YAKA 4QUEA 1JFFB 1UF9A 1I5OA 2NZVG 4A2WA 3JZIA 4N0MA 4ND8B 5TQ0A 1QIKA 3EX7C 4WY8A 1PQPA 4M1OA 2Y4OA 3D5TA 5JO9A 1J06A 4IIJA 4C3UA 4PYJA 1VB5A 3NEYA 1NJ8A 1UXGA 3IAEA 4B4DA 1LY1A 1OFTA 1J9GA 1CB7A 3E9RA 3M6VA 5L45A 4OI0A 3H1EA 1TLLA 4JL6A 4M1TA 4L57A 2I91A 2V9ZA 3EQ9A 5JQGB 1M34A 3JQ8A 5I9NA 1ZVQA 3PVZA 1BEUB 2FSFA 4ZZ2A 5FAKA 2YY7A 4RM3A 4OFXA 5JNUA 1RRKA 1H1TA 2JIPA 5FNVB 1JLLA 1AURA 2C61A 1H93A 2O1WA 3H5VA 2IHBA 5ICSA 4C7OB 2ZRCA 4MQUA 5AUPB 4J0HA 2F8SA 1QR2A 2GZ1A 2W0MA 5T8KC 1YH3A 2BGLA 5AXAA 1I4TD 3QX3A 2B1IA 3FCCA 3EXIB 1P29A 3AOEA 2YQZA 3P2OA 5C18A 2KLBA 3CCFA 1P9OA 3HBLA 1A7UA 1KZ1A 4D4LA 4YV0A 3IO5A 4QFDA 2V5AA 1YQTA 3AI3A 3OC6A 1YWGO 2QU8A 3X1DA 2FX5A 2SKCA 3DXXA 3K5IA 3KL2A 2P2YA 5HZMA 3VKUA 2BUCA 3P94A 5FFMA 3OU2A 3KG2A 2QTGA 1Y6FA 3EBLA 2V97A 1SUFA 1U3TA 2OHJA 3EPKA 2G28A 1A9PA 1RC8A 1YA8A 2YYZA 3BILA 1L3BA 3OE7D 4OB8A 1VLJA 2A5FA 2G06A 3W05A 2PSDA 1EQ2A 3RYHB 2AKEA 1VJ1A 1N6IA 2F62A 2P1DA 4U1RA 1JIKA 1V3TA 4WNAA 5AM4A 1QUFA 5BOVA 4M1ZA 5MN4A 2IH4A 3RWBA 5A1JA 4HAXA 5KB3A 1ICIA 1OKKA 1J5PA 1KE1A 1K5PA 1FNBA 2QXTA 4L0MA 2Q7DA 4LGCA 2Q5LA 5FBRB 3UV3A 4AKSA 3KQHA 2G9QA 3AHEA 1PT8A 2JFZA 1K3UB 1WD7A 3KEGA 3UXYA 3IR7A 4BMDA 3VAYA 4KRFA 2XUQA 3PL5A 2FRDC 4CUKA 2VJMB 3SVZA 1O5TA 1JMVA 1LDEA 1Y3FE 4IFIA 2JEOA 1MAAA 5ERGB 1BMTA 2VP4A 1R8YA 4UC0A 4CFZA 2CNWD 2CFOA 1OZFA 3VJMA 4RGBA 4CG1A 1VECA 3QF4A 4EPYA 2I4TA 2VO1A 4DC9A 2IXGA 2YUTA 1EVIA 1XJQA 2BTOA 3EASA 5D3QA 4E2WA 1YSCA 1DIAA 2HU5A 2OO7A 1ISSA 3GXOA 3BN3A 3MUNA 3O7MA 1FFXA 2UAGA 2K5UA 4YJ2B 5EMKA 2D8MA 2QV0A 3QLUA 1IVYA 4ZFNA 1NIPA 1PEAA 1PG2A 1BWSA 1PKEA 2X2OA 3GH3A 3I1YA 4HDQB 3UOWA 1JDZA 2YN0A 3PLNA 4QJ5A 2CC2A 1Y4SA 2D4HA 4WK2B 4IV5A 4PV7A 4HGOA 3IEPA 3JRWA 4OYYA 3AUFA 4BBZA 3Q88A 5HYVA 2FJUA 3FFWA 1KDTA 2UYOA 3AB8A 4WDRA 1QH9A 3ACBA 4WV3A 4DIUA 3M9WA 4ESOA 1PTJA 1IWOA 2CVZA 5FTMA 1IPEA 3B13B 2WD7B 1AOXA 1UMDB 5G3YA 1G5FA 4PXAA 1J99A 4FGWA 3A2MA 5M5BA 4G0YA 4N3BA 5D87A 2WB2A 4Z53A 3AMVA 3SSAA 3FVVA 2LW7A 1WCIA 4MP8A 1U11A 1PK8A 3QLEA 4UOZA 3SHQA 2AXPA 3DZGA 1K66A 2JB9A 1DU4A 2C31A 2RHJA 5ITVA 1VMKA 4TT8A 5JS8A 3DEAA 4OREX 4Q4DA 2A1UB 3U13A 1YUBA 3I52A 3SZRA 2JH9A 5EWJA 3ZCUA 4DMHA 3O47A 4G4SO 1CDDA 4FEAA 1RQLA 4G8BA 1T8UA 4O8ZA 3F97A 5B3JC 4UXIA 1LBSA 3VYVA 1QAOA 2WZBA 5KSZA 1FDUA 3HBJA 2OV2A 3C41J 5LB4A 5DF1A 1PAUA 2F1IA 4IIJF 4AAYA 1KOFA 5SZIA 1M5RA 2OAP1 1OFVA 1TKAA 2BBOA 4O1IA 2RE8A 3PZBA 1JR2A 1P6UA 5E1BA 3JWPA 4IHJA 1C0EA 4ZK6A 4IJVA 3C98A 2MINB 2R5FA 4E6EA 1BW9A 3FTEA 1HYQA 2XF2A 1W4AA 1TYCA 5IH3A 5DVZA 5CLFA 2O06A 3WNZA 4GLFA 3ZHTA 1BNCA 4CMJA 1S01A 2LPMA 4G1MB 2XECA 4PZAA 4FD2A 3WXMA 2Q4DA 1XWIA 4AQYB 3RUIA 3PNYA 4C5CA 2DT5A 1HY3A 3E2MA 4L7QA 1NC3A 2IU0A 5JCPA 3LC1O 1KZ7B 3WGZA 2HO5A 4I4IA 1RJFA 3ESRA 1GPUA 4OI2A 3IFSA 4QXMA 4ZT6A 2O14A 4EABA 2PG3A 2UZ4A 2ZZMA 4XQCA 4K05A 8ADHA 2PCLA 1LBIA 3VZBA 1NHGA 4DDVA 2OGUA 3ORHA 1P7WA 1SULA 3RC7A 2P9FA 1BU8A 1T8YA 3PUWA 4LEIA 4DLAA 5C1DA 3U56A 1CE8B 5I7VA 4CIWA 2VQEB 2ZJBA 4HLUC 2DPGA 1VFNA 1MDBA 2WAMA 2BH2A 1KY3A 2YMQA 3PI6A 2G36A 2PX0A 4RZ2A 2VT7A 2SNIE 1E5LA 1ZUHA 2B8TA 4MARA 3EMKA 4YI5A 5F3DA 2QTCA 5JG7A 3BCSA 3ZNOA 2CY0A 4O4LA 4PRZA 4Y6LA 4ZVNA 1S9DA 2WSLA 2CBXA 2HQBA 1O89A 3PLAE 3RASA 3LYUA 2WLTA 2AK3A 2R8EA 3PTLA 4LGYA 5KOHB 4O5OA 1ODLA 1ZCJA 4MLPA 1A8HA 2QLJA 2QW0X 2VWQA 1D04A 5B7NA 5F7ZA 2OUKA 1OWOA 1B1CA 1JBEA 4ZEVA 1E98A 1QPZA 3K0BA 2C2GA 5EA2A 1OWMA 2LCQA 4D4KA 3NDBB 1C1XA 2MT9A 3AHFA 1HKHA 3G49A 4Y6QA 3ZU5A 4CKXA 4XWGA 4HEQA 5FOVA 3EGEA 2H59A 3H2JA 3L1HA 3ZV7A 1V71A 1SB9A 2J3KA 2C2KA 2IEGA 2WWFA 3NUGA 4G5YA 1ZD8A 1JQJC 4JVMA 2NU9B 3NTQA 3UHPA 1PFUA 2LKCA 3MC1A 4BRSA 4DA0A 1AN0A 4N3CA 2Y93A 1HE5A 4BPBA 4MRAA 5HF9A 2QYSA 3UFBA 1E7YA 1KI7A 5E3JA 4MVCA 5G4KB 5CH3A 1GA6A 1P4AA 5LQDA 1CUGA 5JZOA 2XT6A 4FXOA 2C8KA 1T1RA 4KHZA 3KXPA 4PSDA 1ILEA 5DKFA 2XQGA 2QSUA 3QTBA 4GI5A 5KWVA 1NV8A 1G9SA 3EK2A 4BASA 3MGBA 3AVTA 1TVMA 2C4WA 2CXPA 1V2GA 3OPYB 5CVVA 5KJ1A 1CF2O 2APJA 1Q1GA 1EX9A 2QHXA 3QXHA 4MPTA 3VKHA 4XAQA 5CT8A 4KR2A 3CSSA 2F1OA 1NI4A 1PSDA 1WRBA 3F6CA 4Q01A 1EZZA 1FTGA 3QVVA 4ZTBA 4YPOA 3HA7A 3CUVA 3DOOA 1KC3A 2QUAA 3LC2O 5ADVA 2XUPA 2HIGA 4BO0A 1INLA 4DR6B 3WGVA 4UUNA 5IWCA 3BQNB 4R2LA 5SY4A 2ENUA 3L46A 2F64A 2Z4RA 5I7HA 1JZSA 2QBYA 1X80B 2JAXA 2PXAA 4YGYA 5EFOA 3GN2A 2Y6VA 1VI6A 2R6DA 4E5PA 2LXNA 4BO9A 1S2DA 1L7MA 1EFKA 1YONA 1BO6A 2IP1A 2QTLA 1OAKA 3P45A 5FCDA 4CIVA 1KVUA 2RGUA 4MZXA 4EA8A 2ATVA 3DHNA 5JS6A 1PR4A 4LX0A 2P0AA 1IE3A 3CRMA 3AUSA 4KXMA 4PX5A 1EESA 3P5SA 2PT5A 2HXYA 2QVBA 4KN8A 3AUTA 2Q1UA 3C5CA 1FJ2A 1CR4A 4LGVA 3KR1A 2BDUA 4E7PA 2J9GA 2RC5A 2XMBA 3M7IA 4N7MA 3IEUA 4IBOA 4XDHA 1L1EA 3CX3A 4EKYA 3TMAA 1GUFA 2FI1A 1TZCA 3AWDA 4JLJA 4JXKA 3NQ41 1D9ZA 4C89A 5C37A 3PB3A 5JCOA 1PCXA 4ENRA 2VTEA 4LJRA 3GEMA 4IHJF 1BRMA 3KVNA 3THOA 1W36D 1EHCA 3IEVA 1G20B 2VJQA 3N8HA 3PD1A 2A94A 3BWXA 1YS6A 2YICA 3CU5A 3IBGA 3AL0C 1PVOA 1QO9A 1XYGA 1NQTA 4EA7A 4XWAA 1LJUA 1IIRA 2G70A 3K20A 1RR6A 2PUWA 4IFBA 2X0JA 5DPMA 4B7AA 4ALLA 3GEIA 2ZAIA 4G4JA 3TRFA 1H22A 2JFWA 4ZXFA 1V4BA