1JLKA

Crystal structure of the mn(2+)-bound form of response regulator rcp1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
141
structure length
141
Chain Sequence
NPPKVILLVEDSKADSRLVQEVLKTSTIDHELIILRDGLAAMAFLQQQGEYENSPRPNLILLDLNLPKKDGREVLAEIKQNPDLKRIPVVVLTTSHNEDDVIASYELHVNCYLTKSRNLKDLFKMVQGIESFWLETVTLPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Response regulator RCP1
publication title Crystal structure of a cyanobacterial phytochrome response regulator.
pubmed doi rcsb
source organism Synechocystis sp.
total genus 47
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jlkA00
1FQWA 4E7OA 4GNRA 4HNSA 1L5ZA 1GUBA 2IPAB 1DG9A 2MSKA 4Z4IA 3LUGA 6ABPA 4WXMA 5TQ2A 1JDPA 3ROTA 4DN6A 4IF4A 3GWGA 3DGFC 1QPZA 1QP4A 1SXHA 4XARA 4YRZA 2LP4Y 2DRIA 4H60A 1LJLA 4LE0A 1NATA 1QKKA 3LTEA 2FQYA 1YS6A 2N9UA 1P8AA 2PL9A 2VYCA 3MA0A 3MM4A 4YLEA 3I45A 1J56A 3R0JA 2I6FA 1URPA 1L5YA 2B1JA 2E4YA 5B3JA 3OMWA 1SRRA 3CKMA 3L49A 2GX6A 1TVMA 3UKJA 3N53A 1PEAA 3D02A 5IEJA 4Q7EA 4P1ZA 2IKSA 4CBVA 1LJUA 4RXMA 4W5RA 4W5OA 1Z16A 4MS3A 4O1HA 4WT7A 1ZESA 3BILA 4MQFB 5EWMB 5IULC 3LOPA 5JNRA 3W9SA 2NT3A 4N03A 5GOTA 5TQ2B 5KI6A 2OQRA 3H75A 4TMYA 1FFGA 3OM1A 3HUTA 3KYIB 2HPHA 1YMVA 5BRAA 2O20A 4YR7A 1D5WA 1M2FA 2E4ZA 3DGEC 1BDHA 4MQEA 2PUCA 3TX6A 1QMPA 1TJYA 3EULA 1HEYA 4MR9A 3RVPA 3TO5A 4RK7A 3ILYA 2QVCA 1YVUA 1DCFA 2FTKE 3A0RB 4QYWA 4RK6A 3L6UA 2FKAA 3CS3A 5DCLA 2PLNA 3E3MA 3N75A 2VUHB 4DADA 1GLGA 3TB6A 1KRWA 1OXKB 1YIOA 2HQOA 1USKA 2X7XA 4G0MA 1ZAYA 2R25B 1RPJA 4MGEA 4KVFA 5GQSA 1PNTA 4N0PA 4MR8A 3RVRA 2ID9A 3QLVA 2A9PA 4O1IA 1AB5A 3HUUA 3H5IA 2A9OA 1CHNA 4G0PA 3M9WA 4RWEA 3KCNA 2FXIA 1NXPA 4JB0A 4QYMA 1EAYA 1EFAA 2RGYA 3C97A 3MF4A 3NNNA 3TMYA 4ZMSA 1QQBA 3B2NA 1BDJA 1QP7A 1ZHHA 1ABEA 1M5UA 3O74A 4LE2A 2IOYA 4OTZA 5B3JC 4N76A 2QXYA 3JTEA 3Q15C 4QPJC 5KC8A 2PE5A 2FLWA 2PL1A 1DJMA 1CYEA 1JX6A 1TMYA 1KGSA 4RK4A 1XHEA 3KTOA 1DRJA 3GV0A 3LUFA 2H0AA 4B09A 4UHJA 3BBLA 3DBIA 1DBPA 1FFSA 4N0QA 1BVHA 3N0WA 1W9HA 3EGCA 5EWJA 4Y9TA 1VKRA 3GT7A 2P9HA 3KKEA 2JB9A 4RZSA 2FMKA 3HO1A 3MYYA 5FWYB 2JVIA 3QELB 4MAAA 1S8NA 4ML3A 4WUTA 1QQAA 5IEBA 1Z25A 3NNDA 5TQ0A 2KYRA 5EWLB 2A9QA 5T3YA 1LK0A 3RVMA 3HZHA 1USGA 4S05A 1E6KA 3HVRA 4G97A 3DZDA 1ZY2A 2QV0A 4MS1B 2JVKA 3P9YA 4Z0NA 3GA5A 1GCAA 4F12A 3EODA 5KQLA 2GKGA 2B4AA 1F4VA 4OG2A 1E6LA 3JY6A 5JS2A 3OLYA 1GUDA 2PMCA 3O2JA 1KRXA 2JRLA 5C5EA 3SAJA 2PAFA 1DBWA 3CHYA 1EHCA 3HCWA 1ZH2A 4P98A 4MLDA 2QSJA 5DKFA 4ZMRA 4XASA 2FMHA 1BAPA 3F6CA 3NHMA 3RQIA 4FE4A 5HSGA 3LUAA 4PZ0A 3JVIA 4RXUA 9ABPA 5I4CA 3QLVC 1YMUA 1W25A 1H9CA 1SD5A 2Q5CA 3D8UA 2FN8A 4G0XA 1B00A 4LRQA 1JFSA 1FSPA 4QICA 5IUNC 3Q7TA 3RVOA 4HNQA 2WWVD 4MS4A 4F8JA 2JBAB 3O2SB 4RDCA 3Q9SA 3OLVA 1SXGA 5FWXA 4L85A 5CNMA 4PYRA 3CNBA 4HYEA 4XFKA 5FBHA 3HV2A 3OMXA 2W42A 4KV7A 4IRXA 4W5QA 2L2QA 3G85A 4EGSA 3H1GA 4NQRA 4RSMA 2CHEA 4MR7B 1NXTA 1PUXA 2L17A 3QEMA 3GYBA 3JVDA 4TLMB 4LE1A 3EJWA 3CZ5A 8ABPA 1NY5A 2PKXA 3KG2A 1XHFA 1QP0A 1NXWA 4IMIB 5TQJA 1M2EA 2L18A 4JASB 1D1QA 3EQ2A 4YP9A 1DCKA 1KMIY 2R48A 2FMIA 3HS3A 4Z9AA 4RKRA 5IUKC 4KZKA 5KQMA 5TE9A 3KS9A 2E4UA 5FBKA 5BRJA 5JNUA 1BDIA 4MLCA 4KQ9A 2MYTA 4N41A 3BREA 1OXBB 1RZRA 2E4XA 4NCBA 1ZH4A 4L4UA 4WWHA 2FQWA 4RY0A 2HQRA 1DCMA 2IPNA 2V0NA 4JA2A 3IP9A 1P6UA 5ED4A 3MMNA 3Q41A 5TPWA 4XAQA 4MS3B 2JK1A 4PICA 3KYJB 4ZJPA 3HXMA 2PUDA 4N47A 3CG4A 3OLWA 3HK2A 3MQ4A 1RZRD 1MVOA 4GPAA 4Z4FA 1U2QA 1VPWA 3NBMA 1JF8A 3FDFA 3LUCA 2E4WA 1IIBA 5TPZD 3RVSA 1YS7A 1JYEA 4MQEB 2WB4A 3ROFA 4KQCA 4OLBA 2PUFA 2WMYA 1U04A 4Z9BA 4MR9B 5BR1A 4EUKA 1C4WA 1JWLA 2FEKA 3I42A 1JDNA 2YHBA 3O1JC 1JLKA 3RVKA 2R47A 4KRFA 4Z4EA 4EYKA 3NNSA 3F6PA 3I09A 2FEPA 1DP4A 2IPMA 4E7PA 1C0EA 3KJXA 3LUJA 1ABFA 1T34A 4MRMA 4OLAA 2GWRA 2OENG 3QEKA 4M88A 3BRQA 1K66A 3OQNA 1M5TA 2AYXA 3FMVA 1EWKA 6CHYA 3K9CA 3H1EA 3GL9A 5JNSA 4KPYA 3CZCA 1JBEA 4MR8B 4TLLB 5HKOA 1JFTA 1YTUA 1Z2DA 4KNYA 1NXOA 1VRVA 5CNKA 3H5OA 3NHZA 3M6MD 3QLTA 1NXXA 1NXVA 3KLNA 3OLXA 4Z99A 2PUEA 4JP1A 1R8JA 2FLKA 4H3HB 4RKQA 4EVQA 3KHTA 3HDVA 1USIA 3QK7A 4EVSA 4Z4GA 3Q7RA 2CD7A 3N6VA 4IILA 2LUOA 1MB3A 1EWVA 1JHZA 5JS1A 2J48A 4W5NA 3CFYA 1ISRA 1MAVA 1JL3A 3KSMA 3LUDA 1P6QA 2QVGA 5EWJB 1U2PA 3H6HA 3URMA 2FSPA 5DLEA 4NCAA 4G0ZA 4EY3A 3H1FA 2P4UA 1E6MA 3N0XA 3O75A 3FFXA 4TN5A 4EYOA 2NUBA 5TQ0B 3F73A 2IYNA 3OO0A 4Z4HA 2PUBA 4ZPJA 4YGXB 3EQZA 3DLBA 2WJAA 4YO7A 2HQBA 1QO0A 2QW1A 4W5TA 1JH9A 3F7NA 4F11A 1ZN2A 4NV3A 2FQXA 3A10A 2A9RA 4F06A 4RV5A 5EWMA 2M1ZA 3G1WA 4H3KB 4MQFA 3JS5A 3CLKA 5KQPA 2LPMA 3LKBA 3M9XA 4HNRA 3A3KA 1Z18A 5HM6A 1LBIA 1EWTA 1PEYA 3SG0A 2VUIB 3H6GA 3DLHA 5CNIA 3C3KA 3IPAA 4YS6A 1QO0D 1XWWA 2YHAA 5IBQA 1CEYA 2CWDA 1ISSA 2R4QA 4NICA 2PUGA 3C3WA 2WJWA 4RK5A 4RY9A 1Z12A 2QU7A 3LUKA 3Q7SA 3O1HB 5DGCA 4ETIA 4EYQA 3CU5A 2IDMA 3QLUA 5IX8A 3HEBA 1UDRA 2MYPA 3O2QB 4FB4A 2FW0A 5JNVA 1ZITA 2LBPA 1RNLA 3GRCA 4IGAA 2RJOA 3CRNA 4MS4B 2JCGA 4XXHA 5F64A 4DQDA 2VK2A 1BA2A 2JVJA 2ID7A 4YV7A 5FWXB 4LX8A 1K68A 2ZWMA 3IPCA 4G0YA 4FE7A 1DZ3A 3LUHA 4IMJB 3UUGA 5KQGA 2HJ9A 2HSGA 2IPLA 3JPWA 4JB2A 5BQ3A 3SM9A 3RVLA 5TPZA 4RXTA 1TLFA 1Z15A 5T7BA 3H5TA 5IUJC 3QX9A 1FFWA 1I3CA 4RY8A 5DTEA 4MPTA 3SQNA 2FMFA 4UHKA 5PNTA 1TM2A 3HSYA 3S99A 1DRKA 3QEMB 2MYUA 4MYRA 4RK0A 4WXEA 5CHYA 2NZUG 4D74A 2M98A 1LBHA 2XDYA 3OO1A 2QZJA 4LDAA 4D6XA 4D6YA 1WETA 3H5WA 4RU1A 1U0SY 1P2FA 1Z26A 2AYZA 4Z4CA 5ABPA 2WY2D 1NXSA 3BRSA 1ZVVA 3T95A 2PUAA 1DC7A 2CHFA 2H3HA 2GI4A 3RVJA 5CNJA 2RDMA 1E2BA 3T38A 4KMRA 4ETMA 1A04A 3H5VA 1RXIA 2PJUA 3LMKA 2RJNA 1Y1LA 2NZVG 5E3JA 3RH0A 5JNTA 3T8YA 2WRZA 4WZZA 5FWYA 3HM9A 2L19A 3QELA 3TD9A 4F3TA 2E4VA 2NT4A 2F8SA 4YCSA 3CTPA 3MIZA 1D1PA 5EWLA 5TPWB 4KFCA 1DC8A 3EDCA 5KWSA 3OM0A 1ZGZA 4OBBA 4YWHA 1GCGA 4S04A 4G0OA 5C5CA 3VNAA 3RVNA 4PE5B 4KREA 3FFWA 4MS1A 1AB6A 7ABPA 3N8IA 4LZLA 3CG0A 3EAFA 3H5LA 4JAVC 1JFVA 1Z13A 1PHRA 3GBVA 4ZYLA 3QLUC 2FVYA 3JPYA 1YK0A 4O5AA 1APBA 3T6KA 1SXIA 3LFTA 4EYGA 5JNWA 3HJFA 1U8TA 3I5AA 3OQMA 3K4HA 3UK0A 3O21A 1VLZA 3OLZA 2MSLA 2MYNA 4ETNA 1A0OA 1DBQA 1F51E 4LDZA 3IP6A 3N0RA 2QR3A 3IP5A 4KK4A 3LKVA 3O1IC 4Q6BA 5D2CA 3A0UA 4G0QA 2LIVA 1Z17A 4RK1A 2MSWA 3C6QA 3VNBA 3OQOA 2FN9A 1PNRA 3IDOA 4G86A 1A2OA 4MRMB 1QNLA 3IP7A 3GBPA 3HDGA 3KLOA 4KK3A 3SY8A 1MB0A 1MIHA 2FEWB 2JBAA 4JOQA 1ZGGA 1ZDMA 3C3MA 2ZAYA 1D2AA 5IC5A 3E61A 4EVRA 1NTRA 3QX8A 3RVQA 1RXEA 4PEVA 5HQJA 5KC9A 4RS3A 2TMYA 3FGZA 1YK1A 3SNKA 4OATA 2BGGA 1D4ZA 4Q6WA 4MR7A 1Z2EA 2GBPA 3FFTA 1JYFA 3ILHA 4XLTA 2F8TA
chains in the Genus database with same CATH superfamily
3IAM1 3FDXA 3F97A 5IVDA 4IJ6A 4ZFNA 3CXUA 4PGAA 1R0LA 2PXCA 4Y6RA 4WXMA 2IYYA 1EVEA 1P1JA 3H5AA 4M7WA 5IH7A 2PH1A 4LHSA 3LVQE 1FRVA 3U19A 1U0HC 3V00A 2QUAA 2VNIA 2ZSIA 1EZZA 4GM4A 5DN9A 3R74A 3I52A 1Y1TA 2F1JA 3C8MA 2NVUB 3SWWA 1CJSA 2X4LA 3NBYC 4R9SA 1OFIA 5EZSA 1M7HA 5B1DA 4BMOB 2WJPA 4CODB 1JTFA 3WBKA 4UTNA 3TF5A 2AFHB 1EIWA 4HGNA 1UZNA 4URUR 4CKWB 1VKHA 1D8AA 1RYFA 2HDOA 1LA2A 3KJZA 4QBKA 1MB9A 1T9GR 5F73A 1KXJA 4QDZA 1NBWB 2ZBRA 3NB0A 4WD3A 5C1PA 4K1LA 3GNSA 1ODJA 2PX6A 3PFWO 2PRIA 4KLNA 1M54A 5KYUA 5IBCA 3EXHC 4Q1FA 3SHWA 2VLIA 2FW7A 4NOJA 1Y8AA 2G80A 2HJWA 3DC7A 4TMFA 4F8EA 3LQFA 4C0BA 1GGFA 4NPCA 4RAQA 1TPYA 1FJHA 2PGAA 5M2QA 2FN7A 4IL5A 1NVXQ 3OPYA 4J3FA 3ZD9A 5JI3E 2G9VA 1CDDA 4L4ZA 3BSFA 4RM3A 2G71A 2H2DA 5J9FA 3I0MA 1WKCA 3DGEC 3PEFA 2O19A 3OD1A 5G1OA 4EGFA 1ZIXA 2WSIA 5AKKA 3ZGOA 1O4VA 3DYBA 3DZFA 1PSWA 2I55A 1MV5A 3M6XA 3E7PA 2Q8NA 4INAA 4GWKA 4K9MA 4DYVA 4RIIA 3H0EA 3OECA 4QDTA 2M6RA 1H4SA 1Q2UA 2K2QB 4G5XA 5DCLA 3WVNA 1N5RA 2PH7A 3Q8MA 2X23A 3JAWB 1IUOA 1ETUA 1ZGAA 3UJCA 4YT2A 2D0PB 1J1UA 5FTNA 5LDHA 2PFGA 4FWTA 4Z3DA 2PA3A 3TRDA 1J0CA 2O0MA 1GGJA 2I3DA 4TS9A 1DBIA 3PFIA 3R5XA 1AXGA 1O8CA 2V7TA 2AZDA 2NZJA 1TD9A 4ZIRB 2IZ1A 3RI3A 3V7YA 1R5NA 1EFAA 1EAYA 4GOOD 4KOAA 3MF4A 4ZVKA 4UFPA 1C8KA 9GPBA 2BBWA 2I4TA 3B1WA 1ABEA 4YIHA 1S01A 3JQ8B 4QUBA 2RHDA 4J2OA 4N6OA 1VI5A 2OAGA 4HB2A 5AJWA 4D9GA 2PQ2A 3A7EA 2Y1DA 2WHPA 5DTRA 3COSA 1BROA 2UVDA 1PVOA 2I9PA 1JVNA 4OB6A 3JQRA 1Z06A 2ZBUA 4D9NA 1F9AA 4FUQA 2DOKA 2GN9A 3WLPA 2I99A 4WVFA 3VNQA 4D4IA 1EXWA 4QPNA 2FZKA 1J21A 4WECA 1YOBA 3N2NA 5KUTA 3D2LA 2BTOA 5FNVA 3KXLA 2XUFA 5CLFA 2QMUA 3PD7A 1CDZA 5FWYB 3HO1A 1TU3A 1QC5B 2VPTA 3CJRA 4GOLD 4JBGA 4ML3A 4I2NA 3QKRA 3WAKA 1YJCA 4C04A 3RQSA 1LDNA 2OL4A 2JBWA 3BUSA 3ERCA 3AKZA 1ZJ6A 1BEZA 4NAHA 4DR1B 4RZ3A 4QU5A 3TRFA 3QSYA 1CB7A 4TXLA 9LDBA 1HLPA 2G3YA 4KFTA 2QRQA 1EVKA 4WZAE 4WZAA 4ZAFA 5T3UA 2W71A 3K92A 2C77A 3HKCB 2UU9B 4D25A 2X58A 4AKIA 2WWYA 2MJLA 5BSWA 3FWZA 4O2AB 5FUVA 2QPAA 2PX3A 4CN8A 3FFAA 4PG8A 2VO1A 2WMDA 3BE5A 1OLUA 3NXKA 5K8UA 4IRMA 1OKKD 4ZEWA 2P2CA 1BGXT 1LDMA 3ASZA 3WSWA 2JCBA 1EVJA 3MD9A 5H1YA 3Q3EA 3BXXA 1BMDA 4L2IB 4P98A 1W4RA 1Y1RA 1T5DX 1ZK2A 2FJPA 4REQB 4ZMRA 3GEPA 3LX6A 1SH7A 2H7XA 3NATA 3BM5A 4OJQA 1OFVA 5CB4A 5HSGA 4FE4A 1SQSA 4N7BA 1T9AA 3EXHB 1D9ZA 2YV1A 2ZT5A 4N8DA 4O4HB 3AUUA 5EKUA 1ESZA 1GDHA 2OY0A 2V7PA 1JPUA 2XCLA 3I61A 5IT9A 5HIIA 5IH3A 3WRYC 2Q5CA 3HP4A 2NPFA 4B5LA 5JMTA 4OKNA 2Q3LA 1RZVA 4I55B 3DFFA 5KYYA 3NDRA 2BR3A 4KGZA 5FL3A 3BT7A 4LF5B 2QI9F 4L02A 1OJ7A 1PD1A 2JBAB 1NR1A 2QYOA 3EN0A 3HR8A 4OGGA 2C3MA 1TUBA 4R31A 4C22A 3DAHA 4RDHA 2XT9A 1ZG3A 3UW1A 3SR3A 4CMEC 3WLAA 1WSWA 3GRZA 2R66A 5ARCA 2EF1A 2W42A 4WEQA 1OXUA 3A3PA 3INGA 2ZUSA 3FOBA 4FPXA 3H1GA 1LDYA 1BDMA 4M1MA 2CNLA 3G5MA 3N86A 4GRAA 4Q7MB 1NYTA 1I7PA 4MR7B 1NOKA 3AV0B 3EEYA 5A06A 1VPWA 4RS4A 2B69A 1ODFA 5G02A 1ZU4A 4TROA 4XWWA 3DOEA 4JNKA 3AL2A 1EX6A 1JHDA 4PC3A 3WHLA 1K6JA 2IWHA 2ZB3A 2CT8A 1XLVA 1I1OA 1NNLA 4L8VA 3LRXA 1DKMA 1NJ1A 4GXRA 4AO7A 1TQ6A 3V4OA 4JASB 1W5SA 2ZSDA 5DX0A 4KQFA 2KSQA 3DD1A 4HO1X 1Y9JA 5JCOC 2C98A 3N05A 5G40A 4HDRA 2AFIB 4QFDA 2WU1A 4AWAA 1XD9A 5AJUA 4RNDB 4B4UA 4UBIA 3WXMA 2A5YB 4DUGA 3AJEA 3SQMA 1V6CA 3LX4A 2P1DA 2VOEA 4UUNA 2WHEA 3ZCQA 4N41A 1WDMA 1JW9B 2VK4A 1OXBB 1HE3A 2P2NA 4PAWA 5JSUA 2PQ0A 2WQ7A 1XCBA 2J3MA 1XP8A 4L4SA 5LR6A 1EDEA 2XDWA 2HD4A 3HCRA 4OHCA 4D4HA 1HV8A 2C96A 4LTNA 3DOCA 4J1NA 2XZOA 3L1UA 1V3TA 1MUUA 1G60A 1W5BA 2P0YA 3ZNNA 3PX7A 1Y9AA 2PHZA 4GICA 4A10A 3RABA 3HXMA 2NUTB 4YUVA 3HA2A 5DI9A 4OCZA 3T7AA 4CMAA 5EHXA 5H3LA 1P77A 4QFMA 1QHFA 3A1FA 3EGEA 3KETA 5IAGA 4KFSA 4RF3A 2DCUA 2XMGA 3JASB 3JQDA 1FB5A 5CVVA 1N75A 4U5QA 3CVJA 4LOAA 4G5OA 4W9MC 3BWCA 1KDTA 4FFRA 1IUNA 3SC4A 3LI2A 4IICA 3G9UA 3ABSB 4PZEA 3GNLA 2XYRA 2BGWA 4FMCF 4PAMA 1F3LA 3OOSA 1U5AA 4IXWA 4QTZA 3EDMA 1CP3A 4S1TA 2ZSKA 5IKOA 1WP4A 1YZYA 4BMYA 4KRFA 3K94A 2R47A 4UBJA 1QMGA 2CYBA 4JJ8A 5IP5A 2WJZB 2GNAA 2RBGA 3E2IA 5L95A 2H2AA 4J1QA 3PE6A 4Y2JA 1C0EA 1ZH6A 2O6HA 1GZHB 3GGPA 2IYVA 2JI9A 4QXQA 1F7UA 5KYYB 1R1DA 1UWLA 4AJ2A 2HJVA 5LZ8A 1HYQA 2ADOA 4ALJA 5L3VA 4LPSA 2XUGA 3S8EA 4LNHA 4LTMA 4PCAA 1MU0A 5DGXA 3TL2A 3W5HA 1JFTA 1SA0A 4YUYA 1K7XB 1GCOA 1L5FA 2JFVA 1YHNA 2AOVA 1PGOA 3F6RA 5A6VA 2VNAA 3A1VA 3TL3A 3TN7A 5DNYB 3GJXC 1R74A 4CR8A 2PBLA 3C3BA 2ZSUA 1HYGA 3QWHA 2EQAA 4J1TA 2EARA 3IKTA 4GL4A 1JNXX 1K3TA 3WIVA 2G40A 3R3YA 4C3VA 2BTQA 4MV0A 3HZRA 3OHSX 5CPBA 4YCLA 3AVYA 2Z5FA 1HLDA 3P27A 4V0ME 1DJLA 3G0IA 4WXHA 3WP1B 4EW2A 4YUAA 2AQ8A 3ESZA 4PXSA 2C54A 4AMVA 4LGYA 2HSEA 4OKSA 2I1WA 4JL6A 5DXFA 1Y37A 4UFNA 2PFKA 4DCVA 1A8UA 4MGYR 1U2PA 1YL6A 2D7CA 5MGBA 3W78A 1BN7A 1OFHA 2WHQA 2AEJA 1RQXA 1DIBA 5CA1B 4G81A 1AKNA 4NIMA 2IUTA 4H17A 2I71A 3BD6A 3M49A 2IYRA 2PTHA 4GBMA 1JDTA 2JFWA 1JEYB 2O1XA 1PYDA 3QXHA 3VR2D 3B6KA 4MUFA 1E4EA 1MABB 3M4ZA 2IYUA 3IDZA 3IPLA 2NLOA 4OA5A 4F06A 3A25A 1KZ6A 3L79A 1MTZA 3P7MA 2REQB 1Z4OA 2RB5A 1NW6A 3MBIA 4FD2A 3QZUA 4JJZA 2XZDA 3H6GA 3GGOA 3LWDA 5GINE 3FUWA 1IIRA 3WNQA 2QRKA 2VHYA 2P4HX 4QNRA 3UWOA 3W6NA 4EGQA 3GH3A 1QO0D 1KJ9A 2J4DA 1KETA 3SEAA 3L0OA 1G5QA 1IBKB 2CWDA 4DJJA 3S5UA 1GV1A 5KDDA 4HWKA 1BCSA 2A0YA 2C31A 2PMDA 2PUGA 3QU4A 2WJWA 2BEVB 2QNIA 2ZSBA 1HE1C 3AOEA 2DHEA 1FS5A 4LHYA 2D8MA 2DPMA 4IIJB 1TTQB 4JX9A 1KC3A 1DHRA 3CW2A 3NWEA 3Q4GA 4MA5A 4LRUA 1C7RA 2GA8A 1B0PA 1KNXA 1S7GA 1ZIDA 2NSDA 2W6CX 3K73O 3H84A 1HUQA 2PMBA 2Q2VA 1ZITA 1CRQA 3E5HA 3KV1A 1H8HA 4YJHA 2AZTA 4YROA 2ZIAA 1C41A 2ID7A 4GXTA 1T5TA 4LX8A 4ZYZA 4KV9A 4FDVA 4N5IX 4B43A 3A1SA 3LQQA 1L9XA 1T5BA 2Y05A 3AO0B 3AR3A 3QXCA 4H6XA 3UUGA 1BQEA 1EHIA 1NBAA 1QH8A 2FZGA 3K0HA 3KJHA 4BZZA 2MMCA 3CWQA 5BV1A 5JWOA 3IVRA 4J90A 5HMMA 3A05A 4CFSA 5JV5A 2ZM6B 2XIJA 1G5FA 3L1VA 3RU7A 4EJFA 1I3CA 1T25A 1UT8A 1H6CA 2PD4A 1SZJG 3EG5A 3MJRA 3QA9A 1DAOA 4HQNA 4ISBA 1JA9A 1ZBDA 2I6SA 4UHKA 4BO1A 4CCYB 4KSBA 4EYQA 1M67A 1XTZA 5JQGB 1YQWA 3TLXA 4BN0A 4IDBA 4TMKA 2QZJA 3ISTA 4LSWA 1SVSA 2ZRDA 5EJIA 1FSFA 5IYZB 3LHKA 3GJ5A 3L93A 3GY0A 1CP2A 1JR2A 1U4SA 1XCPA 1O0SA 5FBRB 3H4TA 3VR3D 1K63A 4Y2UA 3KQUA 4JBWA 1ZVKA 3RVJA 2AT1A 4TZTA 3VYTB 2RDMA 4K9OA 2CUZA 4FJ2A 4NATA 4A2WA 3CNNA 3LAWA 2VT2A 1HKHA 4FSHA 4MEBA 5E3IA 1KVSA 1KZGB 1WJGA 2PJUA 4XD7A 2MT9A 1PFVA 1ANKA 1M1XB 1Z62A 2QE6A 3OOWA 1P9WA 2E82A 1D2GA 3HGMA 3FUCA 4FSXA 3ZOZA 4BNIA 4NQZA 2PS3A 3AFIA 4F3TA 3HDQA 2H1SA 3AHFA 3GLGA 5EESA 1Y6RA 2BFCA 4ZVQA 3C3AA 2YWJA 3CISA 3DM5A 3FTDA 5LQJA 2VSFA 4EPWA 4YJ2B 4OL0A 5FWDA 1S4MA 3ZC3A 5BV0A 3R44A 4IWNA 3R7BA 4GKVA 1P2TA 2PT6A 2VBFA 3H7AA 3P9RA 4EHHA 3MHPA 3TGPA 2WG2A 3ICEA 4LWOA 2UYHA 1N5JA 5CT4A 4XUDA 1WF6A 1YE5A 4JB8A 2OGWA 3KALA 4GYKA 4RFSA 4U6QA 1XZNA 3C39A 3W2GA 1ZRNA 4YMSA 4CG2A 4Z4QA 4PZDA 2VP4A 1O94D 2HWYA 4QDOA 5FRDA 1GL9B 2BN4A 3R3SA 1DAHA 3EGOA 2IZ7A 4X61A 3IUJA 1ZLXA 4LC0A 1QZXA 3C74A 1FNCA 4AICA 2XWJI 4M0CA 5EFZA 3I1YA 1XKXA 5H4GA 4BAZA 5ALDA 2LW7A 4LYYA 3AIIA 5D2CA 4DBZA 1IM8A 2ZI3A 2ZQZA 1C9YA 3DS8A 1CEQA 4ZK6A 4KLZA 3FVQA 4L75A 1ATIA 2VJLA 2V8OA 2PLRA 3P0RA 5LYYA 3G89A 4INJA 4LY3A 1P6XA 3DT9A 3OIUA 2OFFA 4BTEA 3QHQA 4HAOA 2B7LA 2W6QA 1M83A 3KUDA 4KK3A 1XXHE 3OCWA 1XXHA 4L9AA 3K9GA 2COUA 2VJBA 3HJAA 4OJTA 4MUXA 3RS8A 2OHVA 3OIGA 4MLPA 1M6VA 2ILVA 3QF4A 2VUSA 2CZQA 1YL5A 1DIRA 2BSAA 2Q9BA 2YY7A 3HCCA 2ZTLA 4JD5A 1XZEA 4JQOA 2VIIA 4O33A 5CMLA 4Q82A 5JECA 1CDOA 1CR0A 1NTRA 3DDHA 3K0SA 5FLKA 2YBDA 1TU4A 2YVQA 1GL6A 3QG1A 4YMTA 2GR9A 4HDNB 4MRSA 1IK4A 4EKIA 2BGGA 4Q6WA 1N5OX 3QVXA 1Q0SA 1U31A 1UBMS 4PHGA 2HA2A 2WLSA 1CZRA 3W0LB 1L7XA 3ZV7A 5KJEA 2B7CA 1JDJA 4RIHA 4BN5A 2XUQA 2R4TA 3PC7A 2WZBA 1WXEA 1O94C 5ITVA 4J0HA 1JQ5A 5IK2D 3A2KA 1E94E 1D4OA 3ZWKA 1SZPA 4HBGA 2V45A 3OZCA 2PV0A 4H0FA 4WI1A 4LE0A 1ZXXA 4MQBA 1RZUA 2EFDB 3I5UA 2NO0A 4F56A 1YS6A 1JI3A 1ZD1A 2N9UA 3P52A 4KBGA 4KR9A 3EVFA 1DQSA 1UBFA 3HR4A 3PITA 3F2VA 3PHIA 4IS3A 4PYRA 3U3MA 3W4JA 4FT4A 3V8EA 3AVWA 4TN1A 3SE0A 4MJ3A 4XSGA 3AQIA 3CKMA 1C0LA 1CV2A 4JT4A 2C7VA 2OCLA 1HYEA 2O2IA 4R8VA 5IEJA 4MICA 2GF0A 5HW0A 4MIYA 5FULA 1NI5A 1PNOA 2CLFB 1T2CA 2AFVA 3GCXA 1FTNA 3HEAA 4D8XA 1VI6A 1P1HA 3PA6A 4ZA2A 1IEQA 1YSCA 3IQFA 3TOSA 1R00A 3IAHA 3BILA 5DDIP 4AS2A 4LDNA 3ZX5A 2HQ1A 4Y9DA 1A77A 1KYTA 4UBNA 2R9VA 2HJGA 2E9SA 4NH0A 4Q48A 3T1QA 4GSKA 1K2VN 1P2GA 2C7GA 4GZ6A 4UM9D 3V4LA 5GOTA 5GVSA 7MHTA 5K0TA 4LBVA 1CHDA 1YQQA 2CCGA 1ZNXA 2E37A 3HWSA 5GM2A 3VDNB 3ELDA 1XZCA 2BMEA 1E1LA 3AY0A 4TQUS 4XVCA 4I5DA 4EMTA 4LTDA 1K5GA 4CIAA 1UMCB 4R3WA 2JLCA 1Y4AE 4XJXA 2ZUWA 1EESA 4PINA 2YC2C 2GF2A 4BPBA 4PLWA 2GJKA 1NNUA 3GX1A 3MYRA 4IDCA 3AEKB 1AUOA 1DCFA 1WU7A 4EAQA 3LLSA 5CDUA 3WB0A 2IH2A 2QR2A 3L6UA 4X60A 3H65A 1AUVA 4D9MA 4PV7A 4RSGA 1EK1A 4XTCS 1VE7A 2OXIA 1RXCA 4I9UA 1RQLA 2FWIA 1USKA 3FWYA 2H0RA 4BMCA 2ZRHA 3GIDA 3F0TA 4G0VA 4M0KA 1XQ1A 1GWNA 2R65A 4O59O 4BFUA 2ZZNA 1DGQA 2NVOA 4MR8A 4GZLA 4HWGA 3B1ZA 4N49A 5DHTA 3KL2A 3NDBB 4XWAA 4LV5B 1UBLS 1XMPA 3KKOA 4U3JB 1KXZA 1D0VA 2XB8A 4LJ7A 2YINC 1ESNA 4KW7A 3RUIA 4F85A 1WB9A 4FIZA 3WK4A 1G7CA 2W6JA 5JXHA 3QVMA 3U62A 5A2GA 2HLDA 4G8JA 2GM4A 3ZHXA 1AHPA 4HH1A 4DRZA 3P2JA 4I6GA 3BCRA 1BDJA 1UIRA 3K8OE 3GFQA 4AF8A 3DZBA 1C29B 1YJAA 3F74A 3HYLA 1HT0A 4GRDA 1ZVMA 4R16A 5ABPA 4FONA 2PE5A 3BDAA 4GT1A 2XRFA 5IAKA 1KZYC 4UHCA 5BQXA 4UTVA 1N7GA 2QN3A 4KX5A 2GF9A 4JYMA 5TQVA 3T9DA 4XKJA 3BMXA 1HWYA 3GV0A 3K9NA 2ZROA 3IIJA 4XIGS 4B09A 1MEJA 2JGAA 3BBLA 3TLEA 5FT9A 4KQEA 4N0QA 2IYXA 3ER8A 3WLHA 1V0JA 4HSEA 3WLQA 1B26A 3KKEA 3L40A 5CDSA 3QBEA 2CBGA 1L1EA 3FR7A 1GM5A 1H0RA 1S8NA 3T5AA 2HA0A 5CCBA 4X63A 2QPLA 3K0CC 2ZTSA 4C20A 2I6UA 4IRUB 3O8QB 5IEBA 5T4EA 2HFJA 2D3TA 4EY4A 5DMHA 5DNEA 5B58C 4I1IA 3ICWA 1NBMD 1T43A 1WVMA 2L69A 3KAKA 4Y8VA 2OK8A 4J49A 4KDEA 2YJTD 3ZXUB 3UTDA 2UUCB 3D4LA 4MLZA 4MS1B 2HBQA 3A1EA 2BDUA 5CLJA 3FOZA 1P3DA 4RJTA 2CLSA 5TXGA 3KOMA 1I2BA 1RVDA 2JK0A 3U7QA 5IT4A 4Q3BA 4M22A 1RLJA 2RH5A 4UM7A 1QFMA 3AKCA 4JVNA 5EP4A 2W2PA 2ZWIA 4IIGA 4DXDA 4F4DA 3X1KA 2G70A 5KNCD 2EL7A 3IYLW 1NMEA 4D79A 2YOGA 4YPVA 2PUVA 2WDZA 1RQ2A 3CVOA 1SHTX 3L7KA 4MUBA 4O4JB 3ZTYA 3LHFA 4U2BA 3GHYA 3QPDA 3JTMA 4NOLA 1FS6A 4ZV9A 5TRTA 2G17A 3NOQA 1RIIA 4MPDA 2VAPA 4N9QA 1Z68A 3QPAA 4MV3A 4ALLA 1YMUA 4G63A 4PPNA 4WX2B 3CNHA 5FPQA 2FUCA 1QPBA 1T8PA 3TLKA 3N3BC 1U3UA 4OSEA 5JZBA 2YMQA 1XTVA 4KCGA 3ETHA 3RVOA 3V7UA 2WWVD 4PBSA 3SZLA 2HJRA 3DEJA 4Q4AB 5EZYF 3GLHB 5B12A 5HIAA 3OLVA 1SXGA 4L51A 4LQCA 4MWSA 2BH9A 3W77A 4L95C 1FNDA 3BMOB 3A4IA 5LJIA 3HKDB 3U1BA 5EJEA 2R68A 3REQB 4B3TB 5SYNA 4IDPA 4I1SA 5EERA 3VR6A 1LZKA 2L2QA 4JBIA 1V37A 4FCWA 1CIPA 1MPXA 1RLTA 4WN9B 1P0IA 1TAGA 1K98A 3TW6A 3QEBZ 3E5MA 4Z7JA 3C7AA 4PQGA 2ORWA 1NUPA 2ZE6A 4K26A 2B4YA 5DHAA 3GCWA 4F97A 2GKSA 1N6KA 1FP4B 2VJNA 4FGLA 1JV2B 1BVYF 1RRVA 3L8EA 4KL8S 2F00A 3U7HB 1YGYA 4FP9A 1O9GA 4YRKA 5A4FS 4OUKX 5F4ZA 4CLHA 3BBPA 2I6GA 5GJCA 1II8B 1PBNA 5B4VA 3PUZA 5BXQC 3RSGA 1BFDA 4CKCB 3TUZC 5CVUA 1WCIB 1B2RA 3KKLA 5JANA 3F47A 4F6RB 3I01M 4U8GA 4WFQA 4UM9B 2XUDA 3MOGA 4X8HA 4G4SO 3ZVNA 3M82A 4FEAA 3GEDA 3SHQA 1UJBA 1E79D 2IIVA 2YYAA 4QBTA 4IXMA 3DBVO 5DGHA 4ZJUA 5LP1A 1EVQA 5IAEA 3STHA 4G1UC 3IQHX 2OQ2A 4Q4JA 4G1MB 4XAQA 1M6EX 1AK1A 4YV1A 2ZIGA 4QVKA 1IH8A 4B2YA 3TFOA 1D9XA 1UJ6A 4JEUA 2H59A 4TS1A 3RTCA 3BMNA 1EFPA 3BWDD 5IJXA 2GPYA 1TUGA 2FFQA 5AXDA 3OLWA 1RYEA 2JZCA 3CRMA 4CETA 3QENA 4YMGA 1DB3A 3S44A 2D4HA 2ZVQX 3P9KA 3T3GA 5DRYA 2FVXA 2QD1A 4D9BA 5TPZD 3KYCB 3TQSA 4RJLA 2Q0XA 2WAYA 4DSTA 2W8ZA 4YP7A 3PIIA 1YZ3A 1T6YA 1H9AA 1VQ1A 2I7VA 3ZE7A 4OU5A 3FOAA 1W0JD 1HFEL 1JIQA 4UPVA 2ZBFA 1T0IA 1KFJB 2EDAA 2FJ0A 2VJMB 4ZVUA 2BC9A 4H1WA 1X9HA 2AK2A 4KQGA 3OBIA 3NWPA 3AB3A 5UKDA 4XCQA 4GHWA 3F6PA 5LWQA 5CB6A 1KS2A 1I6MA 2XB6A 3DHWC 3SX2A 4XPIB 3HH8A 1BQ3A 1AQYA 2GWRA 2GZAA 4GZMA 4E6EA 4DCOA 5DIFA 3MUFA 1A9XA 3NASA 3G8AA 3KAJA 3IL2A 2JJMA 3CZCA 1R15A 3CRQA 2Q9UA 2EV9A 4GF5A 2H9IA 5JDIA 4NZPA 3CVXA 2J3KA 2C00A 1BCRB 1RPTA 4JP2A 5U9CA 2XKBA 3RC8A 3NP7A 1T9KA 1X1AA 3ICVA 5DX8A 4EY5A 1WB4A 3GDHA 3GCDA 1Q21A 3K0AA 2JEZA 4NZ9A 5E0OA 1S3GA 1A5BB 2WJGA 5EMMA 1Q1QA 3M1IA 2XNDD 4B80A 1X77A 4ZU6X 1IZ0A 5DK4A 3AIKA 4GSYA 4KI7A 3ZV6A 3FHOA 4KWHA 3ZYZA 4DF3A 1SCBA 5EHZA 2YYYA 2V3CC 5LSAA 1FSZA 2VP3A 3Q7RA 4G85A 2CJPA 3IHWA 4O0MA 5CYPA 1AMNA 4IILA 4MYCA 1WV0A 3BZUA 3TNLA 4LY9A 3SJCA 2HF7A 1H6AA 2VPYA 4Q3CA 3CFYA 3FGNA 3PC4A 1JL3A 5T6MA 5ADHA 1E9RA 5EKXA 2ZKLA 2VHTA 4WNCA 4HP8A 1WZUA 1F8GA 5D7NA 5DLEA 5AR1A 2OHFA 1A4UA 5C34B 1LW6E 1NN3A 4PSUA 2YRWA 3NGXA 2XQGA 1NF2A 4Y9SA 1R5BA 5CM8B 2AFHE 4TN5A 2AFHA 4EYOA 3FHCB 2YL2A 4CKWA 3GHHA 4LGMA 2F62A 1W19A 1XDGA 2G4LA 2IDKA 1C1YA 4WCFC 1T1JA 2WJAA 5CITA 3B1YA 4O8ZA 3E7FA 1UC4B 3MRXA 4F60A 2CNBA 1G17A 2D7JA 3ISJA 4ZAXA 1R5JA 1SWVA 3IUPA 4CU5A 1NONA 3OE7A 3G1WA 4TWRA 3KDAA 4CMIB 4UREA 2GZHA 4R2JA 4EI7A 3BCUA 4FN4A 5DBEX 5B2FA 1IBRA 2E49A 3OHMA 4H6WA 4Q37A 2Y4NA 5A62A 4PS1A 4QUHA 4AJNA 5KSPA 1LRJA 1YQUA 1U99A 1G63A 3I4LA 1AHIA 2A92A 3NEPX 4OHOA 4PW0A 4NDAA 2EL9A 3ZWVA 5A7FA 5BR7A 4GOND 3TGWA 1UINA 5ES3A 4TZKA 1MAAA 5ICCA 2O2HA 2CNKA 2ZRFA 2H5LA 3O1HB 3TPZA 2P1RA 3AT1A 3G9QA 3SJZA 1H0HA 4FINA 3PUJA 4D92A 5IKMA 2C2GA 1YF3A 1KTVA 3A8TA 2M1XA 2C4TA 2IY9A 2ZSFA 4MITA 2LBPA 1RNLA 5FXMA 1K86A 4LWZA 2JCGA 2QY6A 4S12A 1ORTA 1FOEB 3JAWA 3L05A 1XX6A 2FPLA 2ZWMA 3D8NA 3PDUA 1PGJA 1P39A 3PEUA 4K9PA 5BQ5A 1S02A 1MVNA 3R8CA 3U3XA 1XEXB 5K6AC 1Y3BE 5AKZA 5KQGA 2XCTB 2HRRA 4HRVA 2B21A 4KUHA 1Z36A 2RH8A 2ODEA 5EHNA 1QQ6A 2BR5A 1HG0A 1PT6A 4CT0A 1LTQA 1NV9A 1X38A 1YVDA 2HGZA 2HMWA 3QTLA 4QHTA 4QUEA 5CX4A 3ZY6A 5M3BA 3QX9A 4ZIRA 1AUPA 3DAGA 5KTPA 4XB6B 1C3EA 1ZGCA 3JU3A 4ZOCA 4ZYYA 1ZN8A 3A9SA 4D74A 4FYKA 4WAUA 4AVYA 1EIZA 3RHSA 3WYCA 4MO2A 1QHEA 1CBUA 4D6XA 3UMYA 3HWX1 3I83A 2X13A 3UMSA 1Q84A 2BUCA 2WFLB 4I4TB 4G5QA 2VHZA 3P71T 3JQ8A 2QRUA 2AF4C 3Q5DA 4BNZA 3T95A 4IUBS 1CS4C 4TV9F 3K3PA 5KJ6A 5IG2A 3HRIA 1K8ZB 1QCCA 4MIOA 1H4QA 4AQYB 1MX3A 3SR4A 4JI0B 1YJ5A 2ODQA 3F4LA 3N1UA 4UTXA 2NTVA 3SEFA 1WPQA 1VL1A 2FOXA 3TTUA 1VG8A 3EW9A 4Z54A 5FWYA 1RQGA 3HM9A 3UFXB 4DUZB 4BUZA 1QC5A 3AVUA 2FZWA 2FJUA 4ZO9A 3UA4A 1CJBA 3S2GA 4C0SA 1U3CA 3JRNA 1HNXB 2WPDD 3DMRA 4UULA 2YRXA 4UE6A 3TZHA 3AUAA 5ANRB 1L1FA 3U4AA 2J4FA 4DCTA 3SQDA 3RS5A 2PUWA 3NXSA 1TF2A 1M2KA 2R1VB 4UW9A 5JWRA 3HKCA 5FB3A 2FN4A 1ENZA 3N8IA 4NZZA 5IABA 5KYGA 4O2AA 3RV3A 1OXMA 1Z13A 3MG9A 4PNHA 4ZYLA 1Q7RA 3NIWA 3IELA 1HY3A 3OE5A 3AINA 4B4VA 2P9TA 2ASVA 3PP8A 3ZDQA 3QXGA 3T6KA 3AFNA 4WCFB 1RKXA 2Q5FA 4Y2GA 3RRYA 1N3IA 4O2RA 1QRSA 5CH8A 3FNRA 3OJWA 3DT8A 2W2LD 1KFKB 4L2IA 2XYPA 4REQA 3LVBA 5ISMA 2PTGA 2UXCB 2YJNA 2M9MA 4RH3A 4UDXX 3EXHA 1EG2A 3HJUA 4O4HA 1XZMA 3LKVA 4Q6BA 1O6FA 3NBZC 3HABA 1FYWA 2BHLA 1WCYA 3H9GA 2HMAA 3IMFA 4P7KA 3USZA 3QVGB 3PRKE 3VNBA 1XTTA 4OLFA 4FFLA 3TEJA 4I55A 3T9FA 3U7EB 2IWRA 5F5LA 2QMEA 2OAQ1 3WKDA 4CM8B 5BNZA 1P1FA 1U7ZA 2R5FA 3SEQA 4R2KA 3WDLA 5IJZA 4NBKA 1DWPA 2OSVA 1MIHA 1XEWY 2JBAA 3AM4A 3F9CA 3I6ZA 5HM8A 4CDMA 3GC6A 5EJ6A 5DHPA 5JIBA 4BVKA 3GIWA 3OQ1A 3OY7A 4UM8B 5IC5A 2FHPA 5AUNB 5C31A 4G23A 4H2DA 3FOEC 5ITWA 4R8LA 5ERXA 3T1NA 5JJBA 2P9GA 2Q6IA 1RXEA 2TMYA 4B3HA 2ZUTA 3C1OA 4EJMA 1Z9BA 2IHJA 2C5SA 4FK8A 4MR7A 3WDMA 3UWKA 1UPTA 4AIRA 4Z7QB 3OWXA 3JWPA 2XWBF 4YJGB 5CVEA 1TM5E 3DEZA 3LUBA 3O38A 2ECKA 4ZQIA 1GUBA 3AP2A 4TMVA 3W1EA 2ZGVA 4TL7A 2P35A 1GA6A 2J85A 2E85A 1NAIA 2CVOA 3D6VA 4BGEA 4GX2A 1IN6A 3DZGA 5DYTA 4MRPA 1QPZA 3HVKA 3ULKA 1CNEA 5LP6C 3BJIC 2QRGA 1FFAA 4KMSA 4BGUA 1SUCA 4DQXA 1N0IA 2FQYA 2AFIE 3IT1A 2AFIA 1ISJA 2YDYA 5H82A 4M1SA 2C8VA 1S9DA 3QU5A 1G55A 3EPPA 2BLLA 3LC1O 2K87A 4FNMA 4UVDA 3ZDEA 5J2UA 1Y1SA 3MB8A 3QKUA 5FA6A 2NP6A 2ZEJA 3Q3HA 4N7JA 4P1ZA 3KUKA 4S1PA 1L0BA 2C5AA 5G0WA 4U2CA 2GPNA 1ZK3A 5HEKA 1U3TA 3QI7A 2P30A 3GH1A 3WIBA 3N2IA 2FZLA 3L3BA 4EHNA 2P9CA 3UENA 3U26A 2O06A 4RGYA 4UC0A 4JLMA 2NUTA 3L06A 1RAGA 4MRAA 4G4IA 4ZQGA 1IHYA 2R1ZA 5FWAA 1KNQA 1MRNA 2FK8A 5EIHA 1QRRA 1GADO 3JASA 3DULA 2GKOA 1U8CB 4KRXA 1TA4A 3PGA1 1RWPA 5BRAA 1THMA 4D57A 5ALIA 5M7EA 3TZ6A 4IG9A 4OI1A 3E2PA 3IOBA 1AVTA 1M2HA 3DH0A 1HLFA 7GPBA 1L5QA 3ZV3A 1X8LA 5C8XA 2OV2A 3GOQA 3FTNA 5ELLA 1T3SA 2IHNA 2OG1A 2QVCA 2J08A 4M8SA 4MQUA 4BRSA 1JR3D 2FTKE 3A0RB 1I30A 2CMGA 4LFBB 1JEOA 1WM1A 3KQSA 1IZYA 3QEJA 1AKYA 1NUUA 4MVXA 1P7CA 1TM4E 3TB6A 5I7FA 1PF7E 2JI4A 4G1EB 1L3CA 3E9QA 4RYDA 1PGPA 2FRDC 4YP1A 5FO0A 1WE2A 2XAUA 3P8ZA 2BFNA 2GCEA 1K08A 4J7CA 1AQUA 4FX5A 3QV2A 4J0QA 1FTGA 2Z0MA 4JLPA 3SJAA 3WRYA 1AY0A 1CHNA 3M9WA 2QGNA 3MMXA 4MVJI 1WZCA 3T7CA 3WWPA 3LVFO 1RHKA 4BJ1A 4CKZA 2OMKA 5TT1A 1CUFA 1T9HA 2F8LA 4GI3A 4WY8A 3O74A 2VJOA 1GPLA 5C8YB 1SY7A 3UG7A 5LCXA 4OYYA 3RT1A 4MVWA 4CMEA 1P9NA 1C9EA 3H87A 3FTPA 1DX6A 1VE3A 3CR8A 4NG5A 5IWCA 3BX1A 4GO1A 1EGMB 3LYAA 4IDAA 3LQYA 1E5LA 4LISA 1Y3CE 2EGHA 5AMXA 2Z8XA 2NUPB 4ER0A 3FXAA 4RVDA 3CH4B 1V9CA 3HWRA 4TTIA 1BIFA 5KSOA 1OE0A 2QNBA 2JVIA 3OQVA 3PNMA 5CA1A 1U6KA 1OC4A 3E7XA 4O63O 1OKKA 4OYLA 1BYUA 3W2FA 3E4DA 1C4OA 3JD0A 4ZTBA 3W4KA 1ZWLA 4S05A 2C97A 2IP4A 4FI3F 4PC2A 5LP6B 1JEYA 4J9UE 1JS1X 4EH1A 5JCOA 2OBBA 3I01A 3BH6A 1MABA 5KTSA 3DOIA 4D4JA 4MARA 1KRHA 3IR5A 3N76A 5EIBD 3TOZA 4XRRA 1NDQA 4HEHA 5CD1A 2REQA 1FCJA 1LF5A 1NYRA 4E51A 3OJCA 2VP5A 1ZISA 3SAJA 2R86A 4JKIA 2YHIB 1ZGHA 1MDFA 1ZH2A 2I2CA 3K2QA 3O91A 2PSEA 3OTQA 4M4SA 3T7IA 1RM0A 1V7CA 2CMHA 2JFHA 4G37A 5J4LA 3H3JA 1UDWA 5JZVA 2GWHA 4QXPA 1DARA 2WTBA 2BEVA 1M2JA 3KJQA 1NL3A 1Y5IA 4IIJA 1FFXB 5JZMA 2G1JA 4N65A 5AT1A 3UPDA 4OREX 3HTXA 3RGGA 2HMSA 4PX5A 4KLRA 1SUFA 3Q0EA 5GZ3A 4PCUA 2C92A 3GJTA 1V1RB 4YBZA 1S1MA 5DBIA 5F33A 4YAJA 4ID9A 5SYMA 1T5LA 1L7OA 4MRRA 1WOYA 3E2MA 1X14A 5AUPB 4C07A 1I3MA 3O73A 2Q27A 3HHEA 3RUPA 5HFAA 3C0KA 5IKXA 3AJ9A 1SK9A 1AJEA 1LRLA 4YXWD 4Q93A 3PF9A 1W76A 3CLUD 3LX8A 3CCCA 1JA0A 3FLAA 4HAUA 2VH2A 1J9ZA 1XALA 5H8WA 5TDHA 4YLYA 2QD5A 3DTNA 3CUYA 1T2VA 4RSMA 3GLFE 4M0MA 5E4FA 2L17A 4IDFA 5JQGA 1E3TA 5DNWA 2ZUUA 5EIBC 4E4RA 2WT9A 3OSZA 3IJPA 4LJ4A 3IQIX 2VF5X 5IYZA 1QWOA 3GJ8A 4J07A 2BGMA 2ZS7A 3WLLA 2ONYA 2BR4A 3KG2A 5KU7A 2HJHA 1L6IA 2LKCA 2PDAA 1A4IA 3LO5A 1R3UA 2XR1A 4YLGA 3PD0A 5JSYA 1E7YA 1OYWA 2WHYA 1RRKA 1YT5A 3RE1A 4OX9Y 2QG4A 3MWJA 1Y8RB 1NJ2A 3HS3A 2ERXA 1R27A 2XWSA 1SOMA 1EWRA 5A02A 2PLWA 1BDIA 4WQMA 1FRFS 1J0AA 3MS4A 5ALVA 5AHRA 1SG0A 2VATA 1PJ3A 3AUTA 4JFRA 4Q18A 3FDJA 1P4SA 3DONA 3WTCA 4CTNA 2ZR9A 1ZH4A 5JLJA 1VL8A 4FYPA 1TM7E 4ZCLA 4LHXA 2WC1A 4YY3B 4CR6A 5J3JA 4HK4A 4JA2A 4YJ2A 4B40A 3HCPA 2YWXA 1H05A 1EUDB 3FI0A 3IP9A 3O5AA 1IWOA 3QNMA 4F4CA 1CY0A 4UASA 4C2UA 1WP9A 3KFLA 2JK1A 2YJ4A 2ICAA 3NC1C 1OX6A 3TIXB 5A3QA 3HCDA 1ULUA 1KP2A 2RCYA 2I6TA 1IXZA 4AZTA 2DFDA 2IOFA 4JJEA 2DERA 3DVSX 3CLUC 4JR0A 1ZOSA 1RBMA 3G0HA 5J1SB 1MVOA 1S9HA 2PKQP 4XGIA 3K1ZA 4FOSA 4HEA1 2DQ4A 4Q1CA 2PZBA 3LUCA 2HBZA 3KZNA 1XRMA 4NU5A 4EJ2A 1QYIA 2HEGA 4A15A 4EHIA 3KZMA 1K7EB 3LYHA 3QJGA 1R0CA 3W4IA 1RJ9B 4NS1A 3DC2A 4AJPA 1K4KA 1HSOA 2V6GA 2ZKIA 4ZYTA 4DGQA 1N2EA 5LIRA 2PUFA 3PWZA 4OLBA 4BNKA 4MR9B 3WYBA 3Q3IA 3U3ZA 3P97A 5ADVA 3RUEA 1IEXA 4BQEA 2DFLA 2H48A 3DWIA 2EBWA 1ZYUA 4GR5A 5EXDA 1H5QA 4L9SA 2QJFA 4HX2A 1FUUA 3FYDA 3RC2A 4ARZB 4UAGA 4DARA 1DV2A 4DDTA 5K9ZA 1JKIA 1FUKA 2VDKB 2Z8YM 4XM2A 1RPZA 5DJ5A 1NRXA 4K9SA 3UV3A 3OEWA 2WWGA 3TK1A 4CCYA 3THYA 2A4KA 1EWKA 3PIDA 5CLQA 1RBYA 2VJPA 1HK7A 3ASYA 1K0UA 5IZCC 3FD8A 2XUKA 3HGQA 3PHLA 4XDHA 3TLJA 1F12A 2BI8A 2QT1A 3AJDA 3KAQA 4FDTA 4W7IA 4N54A 2P2LA 1RYMA 1ZM7A 5ICMA 2XSZD 3FJOA 1F2UB 2ZK7A 4L8FA 2SCUB 3CLSD 3VU8A 1YR6A 4OQPA 4GMGA 1A98A 4FZRA 1XMOB 2DTEA 2ORVA 4HDNA 1MHPA 2NNWB 2R6FA 1OGIA 3OOHA 2HOQA 4H3HB 4KXLA 5IBPA 2HDWA 4JQCA 4PWZA 4Y2XA 4Q05A 1DDIA 2QX7A 4DMFA 1UOQA 5EQTA 2GEFA 2UZIR 4EHJA 4XWOA 2IE8A 1EWVA 1UXHA 2D1RA 1SULA 3AY7A 3D5EA 4Y6OA 1EG7A 5EIAA 3RTAA 4OIFA 4IPTA 4WA8A 5D5QA 3T99A 3UQYS 3VR2A 4ZMBA 3Q1LA 4HS4A 5CXSA 3R3HA 2HRCA 1GKIA 1ZZGA 2B0CA 1WXQA 5L3QB 1DNPA 3AEXA 4PC1A 2Y1EA 1MFZA 1MO2A 2P62A 1Z28A 1R0SA 2PSSA 4PLVA 4QIHA 2NUBA 3SKVA 3UYKA 2HBYA 3FR8A 4LMRA 3F3YA 5I4KA 1BNCA 3AP3A 2GARA 3H2HA 3IAAA 2BMJA 3P2EA 1QO0A 4HY3A 4NK5A 1XEAA 1G66A 4D99A 1O03A 3FSJX 1JE1A 4RMHA 3WZMA 2XKAA 3NYWA 1J42A 1RHJA 3VR4A 2CHQA 3M8KA 3I9V6 1U9CA 3LXXA 3U4MA 2FSFA 3CLKA 3LKBA 2ZDHA 3K1TA 1H3EA 2AK3A 2BUAA 1SQ5A 3DMFA 5CA0B 3UATA 3UOGA 4NFHA 3CLSC 4A0FA 1N77A 2RGWA 3GRPA 2EFJA 5CNIA 3OBBA 3IMKA 5SV2A 1OIXA 1XZIA 1XPJA 1C5KA 1E66A 1UMCA 2C9CA 2R2GA 3EXAA 3R20A 2HTFA 3ETDA 3R6TA 4JP3A 4OQMA 3JQQA 1G18A 2IUEA 1M6YA 4IH9A 1O6ZA 2HAEA 1WHTB 1ECLA 4NFLA 3AEKA 1PJQA 4EG8A 3RSSA 3G2IA 1IN8A 4HPXB 4PGHA 3ZIAD 2ZPTX 4GDFA 4LS3A 4WTOA 5LNK1 3HN6A 1GGEA 3HL4A 2JVJA 3CH5A 1PQ4A 1AQJA 3NDJA 3WV4A 4XQGA 4GPTA 4KC0A 1EK0A 1NF8A 1AZLA 1T15A 1WXDA 2F59A 5J5CA 1GTRA 3MJ4A 1JHOA 1K89A 2DG2A 4GPEA 4R8MA 2VQFB 3OTIA 1XSEA 3RVLA 2Q5OA 4B46A 2ZUEA 3VR3A 2ZFUA 4IEIA 4U3JA 4Y2RA 4UCFA 2FPGB 3GRRA 4PZCA 3ZGXA 2I0FA 1QHXA 2CXXA 3G0OA 4WK4B 1J97A 4YX9A 3AR9A 3GLIE 2F8TA 3ECSA 3DHEA 3B1VA 4ENPA 2RSLA 1JXMA 4MP8A 2X2FA 1Z5OA 4P81A 3M34A 5B3LA 2PU5A 4J94A 1FMCA 1Z26A 3LC7O 2AYZA 5ARDA 4URWR 1N2BA 1NVVQ 2YJ3A 3KKMA 4RTLA 5C35A 1NLUA 1VMDA 3EQ7A 1DKPA 3L84A 4HB0A 4PLHA 4KQ6A 3UAWA 4C7OB 2G83A 4GZ3A 1NP3A 1NBOA 5DLQC 2C4VA 3L8YA 1JIVA 4PLFA 4B8YA 3ABQB 1MXFA 5AKIA 3SS7X 3FPBA 4CWAA 1O54A 3S2SA 4KPGA 3NAMA 1GRVA 2RBEA 3EIWA 2IOHA 3GGDA 3AVOA 1NVUQ 4GMDA 1XEWX 2HA4A 4BB5A 1E2HA 4U5XA 2L19A 2ZTVA 2GBIA 1V6AA 1WDKA 1GFZA 3LPAA 1IZ8A 4BNFA 4EWLA 4DCGA 1O94A 3O8QA 4WK0B 4KN8A 1M6NA 3QPWA 5AM1A 1KQPA 2IYWA 2VDRB 1FIUA 1EK2A 3EFBA 5TPWB 4BUCA 3S81A 1DC8A 5KWSA 2Q3JA 2CGEA 4OBBA 2RK3A 3HU3A 5DTJA 1XWFA 4OXYA 4F0JA 4XB1A 5F52A 3I23A 2A0KA 1VSTA 4MS1A 2C2MA 4DWOA 4AYWA 1MIOB 3EAFA 4Q3LA 4CLOB 3GMDA 5AM4A 3Q5GA 4NE2A 4RTKA 2IVFA 1IOLA 2X9QA 2Q29A 1L7RA 2G4CA 1VBFA 2AGVA 1APBA 3LQ2A 4X3PA 3VNVA 3ZGYA 1SXIA 1ZCZA 3NTUA 3KUUA 3I5AA 1O9BA 2VXYA 5KAMA 1NMSA 4WBSA 2QAGC 4OP1A 4ZXPA 5F1OA 1OUMA 1UAGA 1ZM2A 4O4JA 2HM7A 4YEDA 2R6R1 5KTNA 2QUJA 3EIEA 3B6JA 4Q7LA 2QTNA 3IP6A 2RHMA 2YXNA 4YNBA 1ZJZA 1UAAA 1SHZA 3SSAA 1E4OA 4FTWA 3BAZA 1Q0RA 2QTLA 3QUCA 2RIRA 4XX0B 5DWVA 2Z6UA 1J8FA 3HB5X 1M66A 3I76A 1KO4A 2MSWA 4LY0A 3SYKA 2X0JA 1AQNA 3IDOA 3ONNA 4LI0A 3KTDA 4QTXA 3H5RA 5U4XA 3TXYA 4CMJA 3O8BA 1JJ7A 1SCDA 4ZCPA 1TJ5A 4KLCA 4D9JA 3LL7A 4QE3A 4Q4AA 3GLHA 3HU5A 3RC3A 4Q3KA 2I9KA 4AMGA 1TFUA 3C5HA 4YMVA 3TCKA 3DEFA 3BMOA 4URHA 1HMYA 3O83A 3HKDA 5K0GA 4AJEA 1WKBA 3ANTA 1RJEA 1YS1X 1JJBA 3IMCA 5IK2A 3EEOA 4QUAA 3OX4A 5KC9A 3FOWA 2OZEA 2R5WA 4UE3S 3ZUPA 3R3VA 1JLRA 2DECA 3P26A 3UHFA 1HG1A 3H13A 3I92A 4WN9A 1BRMA 1DC3A 3PQ3A 4D8TA 1XF1A 4RJIA 4PGGA 2CDAA 1NW4A 1RYYA 4MK4A 4XLTA 3K5PA 3ZBTA 4G4JA 4BNJA 2Z2ZA 2OILA 3TRIA 4EPXA 4GNRA 4ITVA 1DG9A 2I4MA 1FP4A 1CQIB 2GH1A 2ZYTX 3SFTA 2ZRPA 2PCJA 3GWGA 2J1LA 2JAWA 4H3VA 3V2GA 4GECA 4EHBA 5K0ZA 3U61B 2ZYAA 3I04A 3PVCA 1HT2E 3Q3CA 5J63A 3C6MA 3LTEA 3U7RA 2VCHA 1II8A 4OXNA 2H92A 5BRNA 4CKCA 4N5MA 5MF6A 4HMOA 3C6KA 4JLKA 5A9RA 1WCIA 3RYCB 3DVQX 1ZN9A 1YDMA 1G21E 4F6RA 3VOTA 4EA7A 2VRNA 3LDHA 5B37A 2GFQA 3X1XA 4FWIB 1LCIA 1KEWA 2QD3A 3PXAA 4ON9A 1EA7A 1Q0HA 1J0XO 3GG2A 1W88B 4TXMA 1XZGA 4M1KA 4EY6A 2ZBEA 1ICEA 1GPDG 3RC1A 1XU9A 1YBFA 1U0TA 2P2ZA 1W5EA 4HWSA 4MAMA 5H9VA 1ZESA 4P38A 2DPYA 2G7MC 4PAGA 4F8YA 1IY0A 1SO8A 4AG3A 1EJBA 5LDGA 1ECGA 2FWNA 3F6SA 3FYUC 3GD5A 3K0CA 4AJHA 2M32A 1MOZA 3IEPA 4UZSA 2AJ8A 4KNWA 1EE2A 2B9VA 3KYCA 4XA8A 1RQNA 1WVIA 2OOSA 4P35A 5HDBB 5JH7F 1QRAA 1SVKA 3AI2A 3Q7PA 2IIQA 1FYDA 1LDGA 1RJDA 5I7AA 3W8EA 2V74B 4N0MA 1WXGA 2QTWB 3X44A 1KERA 3CPSA 4BKPA 5F76A 1HEYA 2BAGA 2VJMA 4QDUA 1GSHA 2J7PD 2PLAA 4MB2A 4QYTA 3K70D 3QE4A 5FJJA 3SDBA 4CM5A 5DO9A 2FUKA 4HPJB 1WU8A 4R1MA 2OXFA 1ZU5A 2FKAA 2QIPA 2YASA 5DSXA 3HP1A 1TUEA 1XYVA 3IUQA 2DKFA 2COEA 3MOSA 4XYGA 1GR1A 2QAGB 4XPIA 2Q3DA 1BXZA 1GUFA 5C3MA 1P61B 1RXVA 3R9XB 4RZXA 3V8MA 2DFPA 2QE7D 2R25B 2JCSA 4MGEA 5COAA 1SBQA 3EC7A 1P1IA 1JECA 3FH0A 1SVOA 2RAPA 2PT9A 1M1ZA 2DB3A 1EFKA 3VYVA 2QN6A 3M5PA 1WD7A 4JOBA 1BCRA 3LGXA 5GY7A 3VZPA 5BUZA 1YKSA 4DSAA 1UJ5A 3MXOA 4JB0A 1UBUS 2AG6A 4QBGB 4QYMA 1AV7A 4H6VA 3TMYA 1QQBA 5KTOA 3N6XA 1KI4A 4BVFA 5D8DA 4BVHA 4LE2A 4TWAA 4L3VA 3DEIA 3UA3A 3IKVA 2QXYA 5K3EA 2YV3A 2BY4A 2WVJA 2V1UA 5B7NA 1CYEA 3RWMB 1LNQA 2HL6A 1IHDA 3OOJA 4OF4A 1WXXA 5C7LO 5EJ8A 1E3EA 3KTOA 1M8PA 1NBME 2ZT8A 1NBMA 3D3KA 4PYOA 5COBA 2QTZA 1Q0UA 4MX8A 3TMAA 1J4AA 4H27A 1DBPA 1FFSA 4LF8B 5KO2A 1AKRA 2V5AA 1NIJA 4L0DA 3NHYA 2P9HA 3DLCA 4DCMA 4BV8A 2OORC 2QT0A 4YRGA 2KS6A 3K70C 2YMMA 3CB2A 3EC2A 1U2DC 4GGMX 1I94B 5KJ1A 4B7XA 2X8AA 3EC1A 1K27A 3ZIUA 4HFJA 2QGFA 1KAQA 5EWLB 3VFDA 4L5JA 5KNCA 1GUAA 3RFFA 3W5DA 1YI1A 3A70A 1NKSA 4EDFA 1XCLA 1RAFA 4LFCB 2W2OA 2JLXA 5SYAA 2FX5A 2V97A 3IOCA 4WW0A 5K2MA 4D6PA 3IKMB 3SIXA 1VBMA 4Z0NA 2W90A 2XY4A 4ND2A 4YRNA 3A6LA 2IZ0A 4OG2A 2CE7A 3CYFA 4G2NA 4PYNA 4HWRA 4CMIA 2GPAA 4AJIA 3VX4A 2HO5A 4RJ2A 3CKLA 5FTJA 1G16A 5C5EA 2KM1A 3SICE 3N0TA 2XGGA 4GBED 1N6HA 3KT3A 4E22A 5A4MS 2WJ4A 2B3TA 2PUTA 3CZRA 3QKWA 4BMVA 2IH4A 4AY6A 1JLMA 1KYWA 3FUUA 1OJLA 1FRNA 1TYCA 2ZIVB 3LA6A 1SEPA 4ILKA 4L8YA 1U7PA 2RHRA 3EQ8A 4P2BA 3VKUA 5BSFA 2Y0EA 4PZ0A 2V0GA 2OCXA 2GCIA 4LMAA 3TTXA 3TTWA 1O97D 1E2JA 1DFHA 4P92A 3VMMA 5BORA 8MHTA 3G2OA 1SD5A 2R11A 4KGXA 5E7JA 3FYUB 3M6UA 4OGLA 4TSFA 5FL7A 3B5JA 3KM0A 5EL0A 1B00A 3HBAA 4ZTZB 3OQJA 1F0YA 1YD7A 4EEZA 4IIBA 4XYBA 5CD9A 4DOMA 1N0VC 4OPMA 4ZDJA 3BB1A 4C01A 1QH1B 1KIAA 2BD0A 4LYJA 5IAOA 5HP4A 1GPNA 2IJGX 1N8SA 4PYLA 5BSHA 5TMPA 4DG5A 1QO9A 4Q3DA 5FUXA 1K75A 1DLIA 2AG1A 2ZB2A 1XEXA 3ZLVA 4YUZA 5KWJA 3HFGA 1CEEA 4HYEA 3ETEA 2UKDA 4QGGA 2VJYA 4ZCRA 4KITB 4IG4A 2Z8YA 1OWLA 2EJVA 3ZGLA 4DANA 5FPSA 4EGSA 2H1FA 3GJYA 16PKA 2XUZA 4KR3A 4KMOA 1JWBB 3ZE9A 4MW6A 2XVXA 2YY5A 2WYOA 2QRVB 2W7TA 3B38A 5AK3A 3TZEA 4MULA 2X1MA 3D31A 4OHKA 4YECA 4QBFA 4KFRA 2WFLA 4I4TA 3U3RA 2LV8A 3VH3A 3TVYA 3VSEA 3F98A 3OZRA 2H08A 1ZGJA 2BM8A 4R9RA 3RSLA 4DV3B 1YRAA 1Z6AA 5CGQB 5DNUA 1QR2A 1XTIA 1AGNA 1E79A 2VYVD 4JODA 4JXJA 2WYVA 5AW4A 2E48A 2CZGA 4BP8A 2PZAA 4N3BA 4LC9A 3B3JA 4CNQA 1XMJA 1I3KA 4ZAVA 5KKAA 2R6CA 3LPNA 1DWOA 4OI0A 3KS9A 2X0NA 1O97C 2IXBA 3ANXA 4UU1A 2JHPA 5IC6A 4WBNF 3KYBA 2PVSA 4BLPA 4EBBA 3SDZA 5C46F 3INTA 2PYIA 1CYDA 2RGEA 4GQBA 1TRKA 3RROA 1OX4B 1ES9A 2NYVA 3MZ0A 5FP0A 2JIRA 2UVPB 5JLAA 4Q4JB 3NHBA 1KK1A 2ANCA 5LNK6 2P6PA 3BQMB 3Q41A 2ZBGA 4TUYF 3SP1A 1VXRA 3PU6A 1W0JA 4CCSA 1YR2A 2PSDA 4JK3A 4WN3A 2QLMA 3RIGA 4RTRA 1KMCA 3IBCA 1HZJA 2R1VA 3OKAA 3K70B 4I4NA 3ELWA 4BQFA 2HK7A 1Y82A 5E1BA 5IF3A 3SC2B 2XH8A 4BJ3A 2C9DA 3W90A 1ZCJA 4C0HA 4ZI7F 1FEZA 2JZNA 3HB1A 4LZOA 4QM6A 1NM5C 4FR5A 3RVSA 1G5TA 3CVUA 1J25A 4WCFA 1QTNA 1YS7A 4NJEB 4TM8A 1RWBA 1ZUHA 1YA8A 1XVVA 2EQ5A 4DLKA 4TVSA 1JQDA 1KSFX 2RJ3A 1WQ3A 3EA5A 5HS4A 1U04A 1QAQA 1XMSA 2EHJA 2IYTA 2P3LA 1NQTA 4DV7B 3KVVA 4YI3A 2OYSA 2IA5A 3BJMA 2I87A 3ZWCA 3TWOA 1JDSA 4BTVA 4E5KA 2ZM5A 2I91A 3VPAA 4BGDA 2RHLA 3QVGA 2OUIA 1QIIA 4JYCA 1GL7A 1JYSA 5E8JA 4OLAA 1T34A 2A78A 1MPTA 2PPVA 3PNOA 2ANBA 3QM1A 4JCCA 2OSBA 3BXOA 4NULA 1HOTA 4C03A 4CM8A 3OQNA 1Q5PA 1J2EA 1VIDA 2XNDA 2C4UA 3LE8A 1M5TA 3QA3E 2RAUA 4FX2A 5EA2A 5EKDA 1ZUWA 1BOOA 4MW9A 1JTEA 4DR7B 1B6RA 3QIVA 4WOBA 5A0VA 4MVJF 4EJSC 1T24A 2JD0A 2NV0A 4YP5A 1QK4A 5IT5A 3N07A 4RVHA 1E2FA 4N5DA 1NXOA 4ENUA 1CG6A 4US1R 1DLJA 1EBBA 1AKUA 1ZL2A 3ND7A 4DJFC 4KFUA 1NXVA 4GOXA 1G19A 5JS6A 3K09C 2FZEA 1A9PA 1RRMA 1YQXA 3IVMA 4LEIA 4XQEA 4YJGA 1USIA 3DDOA 5K6AA 5H83A 1K88A 1JDVA 2CD7A 1C7FA 1UK9A 1DC5A 2AEFA 2NTNA 4JJ6A 5DMXA 4CQJA 2Y99A 4N9WA 4B6SA 2JEOA 4DZRA 4F9EA 1FMTA 3WB2A 2I1QA 3ZW8A 1MAVA 4EG0A 2AJDA 2VSQA 3KZ1E 4JI6B 1A5AB 1P6QA 1WB6A 4MWDA 1KWGA 1SUSA 4MWGA 3RF6A 4B7CA 4BO9A 5LKAA 1BHSA 3D8HA 2FETA 1JTVA 4RE6A 3NTOA 3IIIA 3RTDA 3SBXA 3B3GA 2CSUA 3O75A 2UUBB 2LWIA 3E7DA 3JQ7B 3P19A 2XIQA 5E7MA 4Q4HA 1D09A 3I4CA 2FFBA 1Y6ZA 3BPSA 3C1AA 2Q3FA 1GA4A 3D8TA 4PAQA 3ZJYA 3EXG1 1P3JA 2PUJA 4G84A 4I0WB 3SVZA 4EPRA 5BT8A 3O90A 3OCYA 3F8WA 3H0CA 3EE6A 2NU6B 3E48A 1NZFA 2GN8A 2F17A 2INGX 4MWCA 4XGQA 1ECBA 2JD1A 4WXRA 5T4FA 3TR6A 2OA0A 5F35A 3LU1A 1DPGA 2EERA 5JJLA 1KY2A 1MLDA 5J40A 3L9XA 5HM6A 1NLYA 2PT5A 4LDJA 2WUWE 1GZ4A 3PUWA 5F3DA 2H17A 2PY6A 4LBYA 4QUGA 4WKPA 2GZRA 3VGPA 2ZATA 1SELA 3E4CA 3FG9A 5KNDH 1H8ED 1D2CA 2GZ2A 1QORA 2IYSA 4X71A 4RK5A 2DM6A 4EA8A 1ULBA 4ENWA 1L7NA 2PRZA 3AHHA 1LSSA 1TX4B 3EWAA 1LY1A 4XR9A 4ETIA 3ITNA 4A16A 2XITA 1WMEA 4WMLA 2OP1A 4WNYA 3SN6A 4YUXA 4P4LA 1AF4A 1Z4JA 2QVYX 3C5EA 1ZBQA 4OXQA 4ZJZA 2X8BA 3G68A 1C50A 3LOUA 4IGAA 1Z5GA 4X00A 5FKJA 3NTVA 1NLMA 3T3NA 3QKIA 1UXIA 1XYYA 1FP6A 1ZICA 2XCIA 4QOSA 1M74A 3VC2A 2PIDA 1GLNA 3ES9A 4B44A 1Q1ZA 4A6EA 4CPDA 2PJRA 3MAGA 1CUBA 3UUWA 1E98A 1L3BA 1Q20A 2GD6A 3DOHA 1CC1S 4HOYA 4ASUD 4P53A 2PG3A 3HFSA 3O03A 3SM9A 5BQFA 4UD6A 4D4MA 3K2EA 1R50A 5IUJC 1YO6A 4FS3A 2CXTA 2YBEA 3DBLB 1SC4A 3KB1A 3TPCA 4FJ1A 1FBTA 2BZ1A 2JFZA 2M98A 2YYSA 3ZWOA 3U6KA 2FXVA 4I5GA 4BQRA 4DLWA 2XB2A 2F4NA 3GLQA 4Z0HO 1ZK4A 2VWPA 1M1NB 3OZFA 1CD5A 1KKMA 1PFYA 3F78A 4II2A 5C8YA 4Q3OA 1QGYA 2WUFA 1UKYA 2VHXA 3OFND 2FEOA 2HDNB 4EJSB 4ZDKA 1HE4A 2CMKA 3PIRA 2ENUA 1A50B 2VHQA 1T5HX 2HMTA 3ETNA 3FMFA 2XEXA 1PG5A 1BFUA 4Y2PA 3RKUA 2O4CA 4JLBA 1P2UA 1E2BA 2C1XA 1SN7A 4FNOA 1E3SA 3ZYCA 1BD4A 1I9CA 1RXIA 4MGKR 1O89A 5K3AA 2NUPA 2QN2A 2A33A 4HDMB 4HMPA 5FA5A 3KSDO 1Q11A 1J8VA 2L82A 4D8UA 2W6ZA 2W2MA 3O9MA 4M38A 1Y9ZA 2QW0X 4RTNA 4RM2A 2Q6VA 3VKGA 4NU8X 4E1AA 3D6HA 1IB0A 2VF7A 4X54A 4JI2B 2BI4A 2C03A 1JAZA 5LMNB 5LP6A 2W2LA 4YWHA 1KZHA 4G07A 3D6JA 3VNAA 2JKVA 3FKQA 2OK7A 4JDPA 1AB6A 4QVIA 4LZLA 1Q3HA 2CUTA 3NM5A 3D0QA 2FFJA 2P67A 1PHRA 2XV1A 5AI8A 3CUTA 3EMBA 2WD8A 3JPYA 1ZI6A 3EZFA 3K9BA 3SYTA 3UWDA 2XTNA 5HZKA 4EYGA 2H1CA 5DW3A 2BOVA 3OJEA 2YHIA 2CFSA 3SYRA 4DHWA 3LNCA 3SM3A 1H1LB 4FZJA 4DIFA 4JMPA 4OQNA 1EQ2A 2MSLA 4KVGA 4ETNA 2HIGA 3AHDA 3K05A 3CA8A 3QVKA 5DEOA 5K6TA 4LDZA 2HC9A 1TKCA 1G6KA 1YKGA 5AHKA 4BKMA 4W82A 2Z4TA 2IPXA 3DXYA 5AQEA 5FUYA 2XLCA 3W6UA 4X7MA 1FFXA 5HJEA 4XDGA 2VYFA 1JQEA 3ZR4B 4I9NA 4BVLA 2FA9A 2H65A 2R6JA 1BKSB 1M0EA 5FBZA 1DADA 2C1ZA 2OFPA 3MRSA 4WSOA 2VNHA 1R8QA 4MRMB 3IP7A 1OGYA 2C4MA 2DU8A 2EATA 2HIMA 2OCYC 4P32A 5GPBA 3ZXYA 4CV2A 4F4JA 1ZOOA 5I3CA 3DMGA 1LPBB 5JE8A 3EZ9A 4Z1OA 2ADMA 3NH6A 1R37A 2K6GA 1U1FA 4RKWA 5HR5A 3DDWA 3BOSA 3AF1A 2WMNB 1W5AA 1SUIA 2GS9A 2YOHA 3I9FA 4IR7A 3SIWA 3UXHA 2VAMA 3WIDA 4X7BA 2G7ZA 3M1LA 1WG8A 3MTGA 1W34A 1B8UA 1IN7A 4QPCA 1ZXBA 5TEWA 4EFMA 1I2MA 5FBWB 1AG9A 1ISFA 2GQ0A 3HJBA 4G1CA 4QPDA 3SZMA 2XMSA 5JEEA 4EMUA 3DQQA 4JUBA 3TQFA 1IG3A 3AIOA 4QSMA 1XUOA 3UKOA 1R6AA 4RGBA 1N3LA 3AZOA 3D7LA 4G89A 4DTCA 1DXOA 2ATXA 2PZFA 4K81B 4OM8A 2X9LA 4EGJA 4E7OA 2VK8A 1JG7A 4Z4IA 4QUJA 3U3KA 4Y2HA 3PCRB 4EKNB 1HPLA 4RY2A 5FOTA 5KJFA 2QZPA 1PEDA 2G67A 4TV8F 1CQPA 2XE6A 3VU1A 4KQKA 4E5SA 3SQWA 1GQQA 2C94A 5L4NA 4GBJA 1LJLA 1CZLA 1N5MA 1TKRA 4K3VA 5JT1A 2WABA 1PLJA 3UFBA 4MJXA 1Y8RA 5LUAA 1T9BA 4QG3A 4R6XA 1U90A 3FGOA 2E4YA 1SVIA 3H2JA 1P2VA 3P9XA 1YONA 4IJVA 3PFCA 3L49A 1Z34A 1PTKA 4GZ5A 4ONEA 1JJAA 3WLJA 2C9BA 2ZXEA 3LZ6A 5A5DA 3CVWA 4F45A 4DB4A 2IKSA 4PTYA 3NUZA 4QXRA 1EMDA 4LCJA 4WE3A 4C6TB 3D1LA 3KJFA 5B7GA 4DVJA 2O14A 2OCKA 1EUDA 1LJUA 3H1AA 4G01B 4L1KA 1DO8A 4BU0A 1EZ4A 1A9XB 1OXSC 3VO2A 2OBNA 3ZNQA 5C18A 5G0SA 1TAUA 3RRXA 4RSRA 5IJWA 4N40A 3B6EA 3TQIA 3VTZA 2J46A 3ZTWA 1L5MA 1WBDA 4IHAA 4XPZA 4PX2A 2QLJA 4UD2A 1QXSA 2VDNB 1D07A 1DWQA 3K7EA 4RD3A 1JR3E 2PM8A 1JR3A 3SI7A 3AZPA 3R40A 1G42A 3B51X 1ZH8A 4ENSA 4QYIB 5F9FA 1L4EA 2Y67A 2Y9MB 1RE1A 3TKYA 4DJDC 3COWA 4XYMA 1CW2B 1MKYA 4O3MA 1JSZA 1O1YA 2NZXA 4EPVA 4RTSA 1RJ9A 2VHUA 5AW2A 2D54A 5F7XA 3RAEC 4E33A 3WL8A 1JH8A 3IDAA 1P5HA 3ADOA 4MR9A 3UK6A 1U0GA 1L4YA 4LJ5A 4LQ4A 1JEEA 4H7KA 5I7SA 1SD2A 1WXFA 3T54A 1U81A 1YI8A 3EH2A 3WQRA 4B8WA 1BX0A 3P5SA 4YDHB 4YMIA 5EE5B 1FUIA 1JT9A 2HT1A 3F4KA 3EVTA 2ZI9A 1SC3A 3EEIA 1P5FA 4TYQA 1ZMBA 3AF0A 5JSKA 3B9BA 3ZLTA 3K4PA 4ARZA 5IXSA 1KO8A 1X8XA 3L7DA 4IDDA 4NMWA 1XNGA 1WMSA 1ZM4A 3ZGZA 4WKOA 2ORYA 3K0KA 1PG2A 5BN4B 1HETA 4F2DA 2YZ2A 3BIWA 3K6RA 4NLLA 3EEFA 3IJRA 4TWZA 1NUSA 1UFOA 2A9OA 4AU1A 2ZITA 2OLEA 1IVSA 1F2UA 2VUTA 3UIEA 2SCUA 5LZ2A 3UMBA 3RK0A 1FZQA 5M34A 2H5IA 3OUUA 1WMBA 3LZCA 3PNKA 4R2XA 3SX4A 5DLPA 4UEJA 1PVDA 2PFSA 4F3KA 2QQEA 5EP1A 2JCVA 4YK7A 3DCJA 5GV7A 4BPRA 1JHAA 2HTEA 4J0DA 3GN1A 4O2BB 4AY4A 4LWPA 3R5SA 2J07A 2H2GA 2ZS9A 1HFJA 3P94A 4IDGA 5KVCA 3JAMA 4MDFA 1F4PA 3GF4A 2D8AA 2OECA 3GN2A 3JR7A 2CL0X 3ANMA 3MWFA 4LW8A 4UHJA 3V8BA 5LLDA 3Q8LA 1SCUA 2GCNA 2JIQA 3WX0A 4Y9TA 3X0DA 4GUDA 3VTFA 5AJZA 3W5CA 1I4LD 3DOJA 1KA9H 1VCMA 3QOWA 4X85A 9ATCA 2BJVA 4HKTA 1GAJA 1TECE 4OEHA 5H5JA 5L3QA 4HHEA 5ECYA 1AS2A 3JYLA 4O2BF 3CMMA 2X8LA 3OTGA 1XQYA 4B7AA 4XIFA 5G4KB 621PA 1Z3IX 3VOAA 1Y6GA 3FPGA 4DT1B 4N8EA 3HCOA 1DAEA 3KEQA 4GUAA 1FPQA 5FFFA 1NUQA 1Q16A 2WM9B 2PZJA 4TTJA 3TH5A 5K99A 1USWA 2Q0QA 3SGLA 1RSZA 2OPBA 2AG8A 2CLKB 3CLTD 1FK8A 1KFCB 1OFUX 3GA5A 3LLCA 3EODA 1TK2A 4QLBA 3CM0A 1JHQA 1P62B 3C70A 3IE2A 4X24A 3ZQKA 5I45A 5JS2A 1WCWA 4G5GA 4YC7A 3ND6A 3O2JA 3FTEA 3LCRA 5CA0A 1SC9A 2PAFA 5FF9A 1N9ZA 1BN6A 1Q15A 1XQ6A 4NJMB 3D2CA 1BE0A 1SKMA 4BC0A 1XMIA 3RUAA 1TYDE 4WJZA 1TQHA 3B70A 5DFAA 4NE7A 4KXUA 3TR5A 3UGQA 4CUJA 2G1AA 2IT1A 2J9YB 3NOXA 3VHXB 2MTBA 2XYVA 4NNPA 3T1YB 3VMFA 4YXWA 3CF2A 4QC2A 2EZTA 4PYQA 1G4UR 2ZDGA 3DZIA 4KX3A 4PCVA 2QTBA 2FN8A 2G9NA 4L4RA 5AM5A 1XK7A 1J22A 1NZDA 3GW8A 3FB4A 2O7QA 1EHYA 3QIAA 5CH3A 4F4FA 2ZS8A 4GH5A 1YQDA 2ES4A 3L7IA 3NT4A 2YFYA 1PWXA 2K7ZA 4WLNA 1XA3A 5HK8A 4BMPB 3ZVMA 1EP3B 1ZMOA 3KVOA 4E2FA 4BFCA 3NBQA 5LZ9A 1UK7A 5EMHA 3FNBA 3IV9A 2ZJ1A 4GI2A 1P74A 3PLAE 2O3SA 2OHJA 3OEED 2ZJ8A 1X7XB 4RQAA 3WGQA 3A26A 1NX6A 3OT4A 1PDVA 2E89A 1IMOA 1JP7A 2FPGA 2PN1A 1JBQA 2CHEA 2CEKA 2XCUA 3AMVA 3GGCA 3H1TA 3OZAA 3SVTA 3CLTC 3KPVA 5AHOA 5DTIA 4ZHQB 1NASA 2IXAA 2JGMA 5COQA 4AUMA 3V4RA 4PZZA 2AFRA 5IASA 4B47A 2EGGA 3DYVA 4ZV4A 5CCDA 1Y6JA 2YKGA 3G2HA 1ZN7A 4XUGB 1TVKB 3OZXA 2GMWA 4C7OA 3AH8A 1QDEA 2CKMA 2IS2A 2W2XA 3LQKA 1U7XA 4BIMA 1R0YA 1ZEMA 1QM5A 5K0NA 1TEVA 3LJKA 2BHRA 2EKBA 1H93A 4HD8A 1CIJA 4BCDA 1GGHA 4C4RA 3JD1A 4ZT2A 1GQRA 1XGKA 1ZI8A 4IHJF 3NBXX 4BFYA 4L3OA 5ULLA 4EF5A 1RLUA 3PD1A 3ST7A 1AZSC 3PWKA 1CWUA 3I5YA 2VYQA 5EE0A 2PT7A 1JIKA 1A8QA 1SVLA 4II7A 3GO4A 5DN6D 3T1HB 5A9SB 2R1TB 5TX7A 1I51A 5TPWA 4M49A 2X9VA 3C6XA 3RYTC 5IDWA 2B4QA 2EF0A 5K1ZA 2ZSEA 4AAYA 5DW0A 1XFDA 4L5YA 4S35A 4ZC1A 3MJCA 1YHZA 1MIOA 4CE6A 5BYJA 1SCAA 1TI7A 2RI0A 4CLOA 4M98A 5J4VA 2FI1A 4LJKA 2DAPA 1NWHA 3DE0X 2P9JA 3JWGA 3RSFA 3GVXA 5GGXA 3ETLA 3PXDA 4ALKA