1JLKA

Crystal structure of the mn(2+)-bound form of response regulator rcp1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
141
structure length
141
Chain Sequence
NPPKVILLVEDSKADSRLVQEVLKTSTIDHELIILRDGLAAMAFLQQQGEYENSPRPNLILLDLNLPKKDGREVLAEIKQNPDLKRIPVVVLTTSHNEDDVIASYELHVNCYLTKSRNLKDLFKMVQGIESFWLETVTLPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator RCP1
publication title Crystal structure of a cyanobacterial phytochrome response regulator.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Signaling protein
total genus 47
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jlkA00
1DC7A 1Y1LA 1VLZA 2YHBA 5JNWA 2LPMA 2RJNA 3KYJB 2JVJA 5GOTA 3GA5A 3O1JC 5D2CA 4N47A 3DBIA 1S8NA 2YHAA 3E3MA 1P8AA 3QELB 3EQZA 4YGXB 4NCAA 1NXTA 3GT7A 3OM1A 2IPAB 4Z0NA 4ZMSA 4JB0A 2FMFA 5HM6A 3CNBA 2FEPA 1FSPA 1U04A 4LE1A 1JDPA 4G0YA 3H5TA 4MLCA 1FFGA 3T95A 3KG2A 3Q7RA 5B3JC 2JRLA 4Z4HA 3CU5A 2FXIA 1Z18A 1W25A 2FQWA 5KQGA 4W5RA 3HJFA 1A0OA 3O2JA 2L2QA 4EYGA 5C5CA 3GBPA 1PUXA 1ABFA 4MQEA 4Q7EA 4D74A 4MPTA 1U2PA 3HK2A 1TLFA 1YS6A 3VNBA 1ZVVA 2QR3A 1JL3A 1DCFA 2MSLA 1USKA 3NNNA 4G0OA 2WJAA 4E7PA 1ZN2A 1ZY2A 3VNAA 1F51E 3IP5A 5FBHA 4P98A 5TPZA 3H6GA 3MA0A 3QLVC 4LX8A 3QEKA 1ISSA 4W5OA 2IPNA 3HVRA 4YO7A 5IBQA 4KFCA 1ZESA 1NTRA 4MR7A 1LJLA 3ROTA 3FFTA 2RDMA 5BR1A 1GLGA 4L4UA 1M5TA 1OXBB 3CS3A 1RXEA 4MAAA 4RK4A 3ROFA 2B4AA 1RXIA 4RV5A 4MS4B 3MMNA 5KI6A 3GRCA 2X7XA 4MR9B 5IEJA 4O1IA 4RKRA 2FLWA 4WXMA 3O1IC 2JVIA 5F64A 3OO1A 2PUAA 2IYNA 2FQXA 4QICA 1NXXA 3A3KA 1M5UA 4KPYA 5KWSA 1NY5A 1KGSA 4NICA 4RK6A 5FBKA 3UKJA 4FE7A 4MYRA 5T7BA 4RY8A 4F11A 5KC9A 1GUDA 4CBVA 4KK3A 5ABPA 3Q41A 5T3YA 4QYWA 4ETIA 2B1JA 2NUBA 4KRFA 1CEYA 4ZYLA 2N9UA 3A0RB 2JVKA 3JPWA 1QPZA 2R48A 4IF4A 1JX6A 4HNSA 4G0ZA 4EVRA 1Z2EA 2NZUG 4O1HA 3OMWA 4MS3A 2FEWB 1VRVA 3L49A 5TQ2A 5EWJB 2PAFA 2QW1A 1D1PA 4YLEA 4IILA 2WRZA 3IP7A 4N03A 3RVLA 5IUJC 2WY2D 1NATA 2IPMA 2PE5A 2A9PA 5HQJA 4WT7A 1JHZA 4GNRA 4RS3A 3LKVA 3HDVA 4ML3A 2PUDA 5JNTA 5KQMA 2J48A 5TPZD 3DLBA 4KQCA 1BVHA 1RZRD 3TD9A 5JNSA 3TX6A 1KMIY 2FSPA 2L19A 4RK7A 1E2BA 1KRWA 3GYBA 3CG4A 2HPHA 2GI4A 3OM0A 4JB2A 2NZVG 3N0WA 3IP6A 3NNDA 2NT4A 1BDJA 3O21A 4W5TA 4F06A 1XWWA 4F3TA 3SAJA 4QPJC 1EWTA 4G0MA 1CHNA 2JBAB 3H6HA 2L18A 5TPWA 3KTOA 4UHKA 5E3JA 1VPWA 3GV0A 4MR8A 2PUGA 1BDIA 3QLUA 3JY6A 4L85A 1URPA 1ZGGA 5EWMA 4YWHA 4LZLA 5DTEA 1AB5A 3OO0A 1DP4A 1FFSA 1ISRA 4OLBA 2MYNA 1ZHHA 1E6LA 1SXGA 3LUGA 4RY0A 2PMCA 4H60A 3ILYA 2R25B 2QXYA 3F6PA 4MQFA 3LUHA 2PUCA 1PNRA 3HUTA 1DRKA 2QVCA 1TM2A 2GWRA 3CFYA 1HEYA 2P9HA 2E4VA 1IIBA 1U2QA 3TMYA 3KSMA 3Q9SA 2FQYA 3N6VA 4EVQA 1FFWA 4KK4A 2WMYA 4EYQA 4YCSA 4KNYA 4JA2A 1YMVA 4H3KB 5DCLA 3JVIA 3M6MD 5IUKC 2WWVD 1UDRA 4F12A 4GPAA 1QP7A 1Z13A 5EWLA 1QQAA 1EHCA 3M9WA 4OBBA 3DLHA 5CHYA 4YS6A 4D6YA 4KREA 1MIHA 4TN5A 2PUEA 2CHEA 1GCGA 1A2OA 4G0QA 5GQSA 1EWVA 3MYYA 5KQPA 1LJUA 3JPYA 3EDCA 3E61A 4LDAA 3LMKA 4MQEB 3URMA 2IOYA 4PEVA 5FWYA 2E4WA 3C3MA 5BQ3A 1RPJA 1R8JA 4MGEA 1SXHA 1MB3A 1QMPA 4YP9A 3I45A 3RVSA 1MVOA 1DBWA 5FWXA 3ILHA 1LBHA 2VK2A 4G0XA 5FWXB 5KQLA 4TLMB 4IMJB 1YVUA 1E6KA 1QO0A 2O20A 4PZ0A 2HQBA 5DGCA 4Z99A 1EWKA 3RQIA 3EJWA 3IPAA 3EQ2A 4JOQA 3HO1A 3KCNA 4MR7B 1Z25A 3CRNA 4XLTA 3N0XA 4RK1A 4IRXA 3FDFA 3LUKA 3CG0A 4IGAA 4OTZA 2P4UA 1PHRA 3KJXA 5I4CA 2HSGA 1K68A 2CD7A 1JLKA 3EULA 3D8UA 2A9QA 3HV2A 3SQNA 3NHMA 2CHFA 3CLKA 4G86A 1LK0A 1QP4A 3KHTA 1USGA 2ID7A 9ABPA 4EY3A 3C97A 1DCKA 3LUAA 4RXTA 1D5WA 2W42A 4N76A 2FMIA 2QVGA 4Q6WA 2LP4Y 1SD5A 2ZAYA 3N8IA 3G1WA 3CHYA 3A0UA 2M1ZA 3DGFC 1SXIA 4LE0A 1YK1A 1JH9A 2FLKA 2FN8A 2DRIA 3BRQA 1W9HA 5JNRA 3N53A 1C0EA 1AB6A 3QEMA 4NCBA 2FMKA 4KZKA 3NBMA 4HNQA 2OENG 2R47A 4MS3B 2E4XA 5JS2A 1JYEA 5TQ2B 3SG0A 4RXUA 3SNKA 1Z12A 3CKMA 3LTEA 1QP0A 3Q7TA 4RZSA 4D6XA 2XDYA 4WWHA 2RGYA 3RVOA 3CZCA 3I42A 3RVJA 3C6QA 1B00A 1T34A 3JVDA 3OQMA 4ETNA 4Q6BA 5HKOA 3H75A 3OLYA 1MAVA 1L5ZA 2PLNA 1DBQA 1ZH4A 1J56A 2PL9A 2FVYA 3GL9A 1ZGZA 3IDOA 1PNTA 4DADA 2L17A 6ABPA 1QNLA 3QK7A 2PUFA 1BDHA 3T8YA 1GCAA 3O74A 4WZZA 1ZDMA 3LUCA 1DZ3A 4Z4EA 1FQWA 2IKSA 5TPWB 2LBPA 3RVQA 2HQRA 4YR7A 2MYTA 4G0PA 2ZWMA 4MR8B 4TMYA 1I3CA 2FN9A 3H5LA 4MLDA 3G85A 3TO5A 1APBA 3OQNA 1YMUA 5EWMB 2JCGA 4UHJA 4Y9TA 3RVKA 3FFXA 4XAQA 5DKFA 4DQDA 1EFAA 4TLLB 4Z9AA 2KYRA 3UK0A 4KMRA 3KS9A 2E4ZA 5CNIA 3OLWA 1M2EA 2GX6A 4MQFB 1ABEA 2F8TA 4MS1A 1E6MA 5BRAA 3H1EA 3DZDA 4DN6A 4ETMA 4H3HB 3HUUA 1P6QA 1YIOA 3LOPA 2IDMA 3LFTA 4RU1A 1GUBA 1LBIA 2A9RA 5TQ0A 3JTEA 3LKBA 2GKGA 5IEBA 3N75A 4RDCA 4Z4CA 2F8SA 4LE2A 2A9OA 3T38A 5ED4A 3KYIB 3R0JA 4MRMA 4OG2A 4EYKA 3M9XA 3H1FA 3QX9A 5EWLB 2MYPA 2VYCA 3TB6A 4QYMA 1TVMA 2MSWA 3RVPA 1D4ZA 4KVFA 1MB0A 2JK1A 3QLUC 4Z9BA 1DC8A 3D02A 1PEAA 3FMVA 2OQRA 4ZMRA 4IMIB 1F4VA 1JBEA 5FWYB 5IUNC 3CTPA 4XARA 4EUKA 1C4WA 4LRQA 4EYOA 1JFTA 3QELA 3QX8A 2V0NA 2H0AA 4RXMA 1Z2DA 6CHYA 1RNLA 7ABPA 3H5OA 4Z4IA 4XASA 4KV7A 4B09A 4N41A 3T6KA 2VUIB 1DG9A 1Z17A 4RY9A 3L6UA 4S05A 2FMHA 2TMYA 1JFSA 2Q5CA 3HCWA 3HEBA 5IC5A 1QQBA 2FKAA 3HS3A 4OLAA 1QKKA 3LUDA 4ZJPA 4Z4GA 1JYFA 4XFKA 4P1ZA 4RKQA 3MIZA 4NV3A 3H5VA 2CWDA 3O75A 4F8JA 5IX8A 2PUBA 1VKRA 1YS7A 5KC8A 4S04A 3NHZA 4JP1A 1A04A 4HNRA 1H9CA 1ZAYA 4KQ9A 1DRJA 1NXSA 3LUFA 3O2SB 3RH0A 1RZRA 3MM4A 4WXEA 2MYUA 2E4YA 2JB9A 1USIA 3DGEC 4RK5A 1EAYA 2HQOA 4NQRA 1ZH2A 3LUJA 4JASB 4RWEA 5TE9A 2BGGA 3K9CA 5TQJA 3OMXA 1U0SY 5PNTA 3W9SA 8ABPA 2WJWA 4MS4A 1XHFA 3HDGA 4Z4FA 4OATA 4MR9A 1NXOA 1CYEA 2PJUA 2M98A 2NT3A 4RSMA 3H1GA 3QEMB 4EGSA 2R4QA 3KLNA 2PKXA 2H3HA 1NXWA 1ZITA 3F6CA 1JFVA 1TMYA 4PYRA 2IPLA 1D1QA 2AYXA 1JDNA 3I5AA 5C5EA 4W5QA 2LUOA 1OXKB 4FB4A 1TJYA 2VUHB 3F73A 2QSJA 1Z26A 3BREA 1P6UA 3SM9A 3GBVA 3CZ5A 5CNJA 1BAPA 3HZHA 1WETA 3OLVA 4G97A 1M2FA 4XXHA 5CNKA 2AYZA 3MQ4A 4YRZA 3O2QB 1Z16A 3KKEA 1QO0D 1K66A 1YK0A 3FGZA 3I09A 4N0QA 3H5IA 4JAVC 3UUGA 4FE4A 2I6FA 5EWJA 3O1HB 4HYEA 3RVMA 2QV0A 3JS5A 5IULC 1DBPA 4N0PA 3H5WA 3Q15C 2RJOA 3BRSA 3F7NA 3NNSA 4PE5B 1BA2A 2HJ9A 4LDZA 1DCMA 2FTKE 2ID9A 5HSGA 1Z15A 3FFWA 5JNVA 3C3KA 2E4UA 3Q7SA 2FEKA 2LIVA 1SRRA 3QLTA 5CNMA 2MSKA 3IPCA 3BILA 2PL1A 1XHEA 3OQOA 2FW0A 3EODA 1L5YA 1NXPA 3KLOA 3A10A 3BBLA 2QZJA 1YTUA 3GWGA 5DLEA 3S99A 1KRXA 4MS1B 5JNUA 3HM9A 3P9YA 4M88A 1U8TA 5B3JA 2JBAA 4ZPJA 4PICA 4WUTA 4EVSA 5JS1A 3N0RA 3MF4A 1JF8A 3B2NA 5TQ0B 1JWLA 2QU7A 2GBPA 3HXMA 3SY8A 1P2FA 1D2AA 3EAFA 3RVRA 5BRJA 3IP9A 1DJMA 1NXVA 1PEYA 3OLZA 3K4HA 2WB4A 4E7OA 4YV7A 4MRMB 3RVNA 4W5NA 3EGCA 3OLXA 4O5AA 3C3WA 3HSYA 4RK0A 3QLVA
chains in the Genus database with same CATH superfamily
4PAWA 4YAJA 5EJIA 1RYFA 4NBVA 4RC9A 2BFWA 2PRJA 2DR0A 4RQAA 2EBFX 1NU8A 3KYJB 3B1ZA 4A0HA 4BOYA 4RM3A 3SIRA 2IEIA 4YRIA 1Z74A 3WAGA 4HQLA 3CH4B 3LP5A 2EWWA 2Y05A 1A95A 4DV2B 1MKYA 2YHAA 1I7QB 2YICA 4C5BA 4MROA 4Q19A 1R27A 2IC5A 1L4LA 1L8AA 5H02A 3WK6A 4KXUA 1RMYA 3RKUA 4B3FX 3AM3A 1OZ0A 3WGZA 4F7WA 4QZVA 4CEJA 2OY0A 4OY3A 4R1MA 1HYEA 2ZYUX 3JQFC 5HF9A 1X0VA 4NRDA 3UGTA 3UYLA 4PHCA 3U39A 4B8YA 2VHCA 3JQAB 1LLDA 1FMJA 4M8IA 3DAFA 4ZYVA 5KQGA 5LVAA 1YJXA 3FD8A 2ZYSA 4F3NA 1PJ3A 1UXJA 1NV8A 2BZ0A 3O2JA 5REQB 4BE7B 3AR5A 3GBPA 1PUXA 4L7QA 2O14A 1DAFA 4WH0A 3O84A 1L8LA 4C7JA 1ECBA 3UZUA 4LHWA 1QV7A 1K6IA 2OXCA 5L3QA 2J3EA 1G8YA 3RK4A 1WD7A 2ZJ7A 3L9XA 3VPDA 1SXPA 3ZLJA 1G8MA 3N76A 2YVAA 4CIXA 1XL0A 4US2R 4RTPA 4RMIA 4HH4A 4Z4QA 4YCLA 3DMGA 3M1IA 4LZJA 3T7TA 4A2CA 4AMYA 4CCYA 4GXQA 1OJ7A 4XW2A 1E2FA 2C0PA 2JJMA 4F5DA 4PBRA 1G6HA 1TVCA 2P9ZA 2CLDX 2WTAA 1UJ5A 4KO2S 3CV3A 4NAVA 1N9KA 4O3MA 3HGMA 1EFUA 4UHBA 4N1AA 2ZXFA 3S2GA 3UV3A 1VSTA 3JR3A 2BCJQ 4U7PB 2JIZA 1QYCA 5BQXA 3OICA 1ETHA 3GGOA 3G7NA 1X9IA 3L6OO 1RBZA 4RHXA 1Z35A 1D2MA 1NMQA 1AJEA 1RXYA 1VPDA 2CSUA 2ZYHA 1EVQA 2ATCA 3R5HA 4K0RA 4F6RA 2DE0X 1XCJA 1UCFA 2VDWA 4NE7A 1HNZB 1IATA 3EXFA 3H9EO 1JLLB 3M6WA 2Q99A 4K81B 5KVCA 1XQ9A 5EIXA 3LV8A 1R64A 2JHGA 1BHJA 1W88B 1AURA 1VMEA 3LP6A 1SQGA 4MNTA 3RTGA 4CIVA 1IEQA 5D5QA 4ROTA 2DC1A 4CIDA 4OF4A 5TIIA 1EFPB 4IDQA 1OFUX 5TDHA 1O0SA 4BS9A 3I9V1 4Q4JB 4GPBA 1AZWA 1VE3A 3U7RA 5GM1A 3DE1X 1XZFA 3EF0A 4FT4A 3SS8A 1OB2A 1ENZA 4UVEA 2GLXA 3RANA 3TRHA 3ZU5A 1CS4C 1ZGAA 4O1HA 3HA7A 3V4OA 3COPA 3CZMA 2P4SA 4P7FA 2E6UX 5SICE 2X1VA 2YV2A 3Q3IA 1KZ9A 3D1JA 4LXUA 5HDBB 3X2EA 3F46A 2QUAA 1SULA 1PZXA 3B5EA 2FZ4A 3IRUA 2V7BA 3LLVA 4XI9A 3WGGA 1KP2A 3WWDA 3ZDXB 3OPQA 2R5FA 3DO6A 2HNKA 1Y5IA 1WF3A 3CE6A 3OJLA 3B1FA 4B7UA 1NLZA 2RHDA 4LNAA 1O5IA 4ZQGA 2XUPA 2Z43A 3NT2A 2DYKA 1DJLA 4E88A 5KQMA 4D8XA 2HA4A 2QX6A 2J9FA 3DDWA 3R0VA 1RQ7A 4OPMA 5JG7A 3ZKWA 2ZYRA 2J31A 3FOBA 3JZIA 2A84A 3N2ZB 5H68A 4XJVA 3RUIA 3IEVA 4AWAA 2BFAA 2PFGA 1E2BA 1YQTA 2OO7A 5HFAA 4LF9B 2BV3A 3KU4A 4RIIA 3IP6A 1JU4A 1IG3A 1BDJA 1LVUA 3DMRA 3M4ZA 1R0KA 5CJJA 1W29A 4YCDA 4MHOA 5E95A 1CCWA 4BLPA 4DIFA 1RBMA 4O2BB 4QPJC 1Z4NA 5JROA 4R16A 1L5LA 4D0GA 4B40A 3BHMA 3TZBA 2ACWA 4QG3A 3GNTA 4UHKA 1QS0B 2Q1TA 1SMKA 3GV0A 1MENA 3P4YA 2XAAA 2N3ZA 4GH5A 2DWUA 4HNAB 4UOQA 4V0RA 5K4AA 4HX9A 2GYVA 3VJRA 4M3NA 4CTMA 3DBLA 1F48A 4Q1CA 3ZW8A 3BD7A 3C3CA 1P0FA 1X1BA 4LZOA 4QFBA 2VHWA 2VNKA 2R8YA 2FRVA 2O0LA 1AG9A 2V7TA 4MGHA 4MJ7A 1D1TA 1L1RA 4N18A 3U1BA 1V95A 3GAFA 2O8BB 4U5QA 2WWGA 5LN1A 2W8BA 1GKLA 2X9GA 3BWCA 1XRMA 1Z7WA 2EBUA 1ISHA 1DPFA 4I2NA 3FRIA 2CHUA 3RTCA 2OHGA 2YZNA 4C03A 3G0HA 3REOA 1EE9A 3ABZA 2X6RA 2PH3A 1WSWA 2PVCA 3O95A 4I1VA 4M0LA 1P17A 4NYMQ 4JI5B 2O3TA 2B9VA 4ODIA 3KQNA 1GEGA 1IHPA 1XLVA 1EB9A 3G2NA 2WWVD 1COZA 4FNMA 4S2UA 1XR3A 2OVFA 1ZUNB 2YY5A 3KT6A 4K03A 4QGFA 5EWLA 1R6UA 4GFDA 3ZLTA 3JQQA 2CKMA 4YS6A 1GG9A 4JC0A 4NS1A 5FO1A 5JHGB 2ZCVA 3RASA 1TZCA 5KYUA 5FFFA 4C04A 3K8QA 4BQPA 4NFSA 3TBFA 2ZIGA 5LM3A 2WPDD 4F93B 1T9CA 4LJ5A 1GTRA 3OBBA 4FQ5A 4UU7A 5AJHA 4PSAA 3FETA 1E0SA 5U1PA 4JJAA 1RPJA 1RFLA 4YK7A 3STWA 2O3JA 3WWYA 2GD0A 3JWHA 1MVOA 2HA2A 4IOJA 4R1OA 2FFHA 5BR7A 1G9SA 1KR5A 3HKCA 4WACA 4FTWA 1PYOA 1U2ZA 3P9ZA 2RMKA 1U9JA 2WF9A 3UB2A 4U2DA 3UMJA 2HQBA 2QMZA 3LPLA 2EKQA 4M0KA 4AJIA 4F7DA 1SQ5A 3G2JA 3KT0A 2PD4A 2HCFA 3SR3A 2CV2A 5GJBA 1O1YA 3BYZA 4MKFA 1Z25A 3K0FA 3OFJA 4OAOA 3U9LA 2PFSA 5JBNA 3RIGA 1W5FA 3BPSA 3SBXA 2YUIA 4BFYA 1CKEA 2Q3DA 3H97A 3EULA 1G4UR 3V4LA 1ZZGA 1SG6A 4YPVA 3HBMA 2WG0A 3QV2A 4GDMA 3P71T 1WXHA 2ACKA 5EJ8A 3L18A 3RS8A 3EWAA 1IVSA 4A23A 3BBPA 4M7PA 1KEUA 4B5LA 2QLFA 3ZHUA 4KGDA 3SVLA 1FJ2A 1VP3A 4WSOA 3KPVA 1R9MA 4TTQA 3OSZA 2O2DA 3H42B 4AJ4A 1D2HA 1GYRA 2POQX 4IJVA 1QHYA 2VHXA 3H05A 1R15A 5JU6A 1QRUA 1W9HA 1UZLA 1T43A 2VAPA 4J2TA 3TXYA 4DJFC 4GI2A 4F2GA 2JFYA 4ZAZA 2FMKA 3QXJA 4DBLC 1DXQA 1RPAA 5CR9A 4F3KA 2VAXA 3D7RA 2G6BA 4IGFA 5JJBA 3AGPA 3DV9A 1QH8A 4HAZA 5KSWB 3O9MA 2VF4X 4CV3A 1H4TA 1KNQA 1N33B 6LDHA 1C7ZA 1YRAA 1YDHA 3GJ8A 1XIVA 2EX1A 4R69A 1GYPA 1WVGA 2ZRFA 2V97A 3GC6A 4ZCQA 1BO6A 4WHMA 1UBNA 2PVSA 3ZCTA 5EC8A 1U1IA 5BRNA 2W71A 3RQSA 1NN1A 1J33A 1EJ6A 1NDQA 3ZEIA 2NAFA 1ID8A 1OT5A 4GOKA 4JI1B 3ZXSA 2BR4A 3LGAA 4H1UA 4QVGA 5DU2A 3RHFA 4HV4A 3INYA 4DIKA 5K5EA 2PLNA 4JY7A 4II3A 5EZ5A 1XNHA 3CUUA 4KLRA 2L17A 4BHTA 2EDCA 1IBLB 1N2OA 4O2AB 4Y2XA 3NIDB 4N9WA 4WKOA 2A0KA 3U3DA 1OFUA 3FMPB 4JK3A 5IN5A 1E3DA 3A4YA 3SOPA 1BDHA 2GARA 4D45A 2WIBA 1DZ3A 1OFVA 1CTQA 1PRYA 2EU8A 3EDYA 4RDXA 4F5EA 2DBRA 2C7RA 2ZRPA 3V2UA 5E3HA 4MR8B 2O19A 2P5TB 3LX5A 4JUFA 1P33A 3K5WA 3ZV7A 3DL4A 4KXYA 2GN6A 2JCGA 2WT8A 1AS3A 2SKDA 4GI3A 3ITKA 3FTCA 4FEGA 2FPPA 4RHUA 3TLCA 1JQKA 2FN7A 2VQ6A 4DQDA 1S2MA 2FEXA 4KO1S 4YJ3B 3EC1A 2BR5A 3X2SA 4TSRA 3ZE0B 1W0JD 5CFRA 1K6MA 2E4ZA 3KYCB 3GDGA 3DKKA 3AL2A 3HKBA 1ETUA 4LGVA 4V0OA 3S5UA 3NM5A 4O4JF 5EY5B 5BRAA 2PZFA 3QBEA 3HYSA 1YR1A 2A3RA 2IEDA 4RKYA 4C0WA 3AZQA 1T3SA 2DUNA 3C3XA 4HFNA 5HEKA 2A30A 2A9RA 4FKMA 1A9XA 3R8XA 4IXDA 1L1FA 1H2EA 2BDTA 3RSZA 3EGDA 2HMUA 4U7HA 2WM3A 2GKGA 4QHSA 1IBRA 3QY9A 2DECA 1P80A 3EZFA 4CN8A 4L5BA 1Z6PA 3LL4A 2ECOA 2E6KA 2GHIA 2Z98A 3MBKA 4YP5A 3GJ5A 5KWEA 3UC5A 2C7PA 4LCBA 4R4JA 1MEOA 1WVMA 4DIUA 5DGTA 2O54A 3FSRA 4BXOA 2PMFA 4CQLB 3FCCA 4PYLA 3BKWA 2VATA 4KVFA 2ZIAA 4L0MA 3UTCA 1UXOA 3PITA 4IOLA 1DC8A 3ANNA 3F98A 3RS9A 4EFLA 4F04A 3SS7X 1F4VA 2QD3A 4KXVA 1G66A 3K92A 3GRYA 3OCVA 3QOFA 4J43A 4ZZ2A 5KAPA 3WXBA 3LW7A 4EUKA 1AV6A 3LS2A 3ONFA 5EHGA 1H2WA 3C1AA 5DX0A 2CJFA 1E6CA 3S44A 3K70C 1LTQA 4L8LA 4JGBA 3RF6A 2VP5A 3BTVA 4I55A 2UVDA 2UZ1B 2A4KA 4GC5A 2XUZA 3W4IA 4BO2A 4LNUB 1JAIA 5DDIP 2HRRA 3UAYA 5C1DA 1T2VA 4MGYR 3UWKA 5DNUA 3L6UA 2FMHA 4ZQEA 2NV6A 4E31A 4LF8B 1OFTA 1P9NA 2OTCA 3HEBA 3KKPA 3AVPA 1U0JA 2HLNA 4KXQA 1XF1A 4EHNA 4X6YA 3A1VA 4LK3A 5FA8A 1TQDA 2P68A 1V5GA 2QW8A 2REQB 3GVPA 3OCUA 3V3KA 5J47A 2AE2A 5F2OA 1PJLA 4RCVA 3VZPA 3JVVA 1ORIA 4NJEB 9ATCA 2EJTA 3C7AA 1OR8A 2E4YA 1GPLA 2MYUA 3NHKA 4WFJA 4AURA 2XB2A 3OLQA 5AK5A 4OK5A 3R7WB 2HQOA 5JZOA 2W37A 2C7GA 3HCOA 3L0IB 4NQRA 3W5IA 1EEHA 1PLKA 5ALGA 3LUJA 3UUWA 4QJ3A 3O1LA 1EK1A 1YZLA 1BJKA 4WA8A 2X5KO 1KJNA 1QOPB 2C4WA 1PJRA 4GIBA 4IVQA 3O7MA 3TWOA 4KVAA 3RWOA 3I2FA 4HEQA 2I9KA 4NFYA 5FLEX 2GDJA 4FYMA 3TRIA 3WKDA 2GXQA 1H0RA 3EGEA 2NWQA 4FYPA 1F2DA 4HVAA 1DB3A 3BXZA 4GL4A 1QM5A 1JW9B 1V3UA 2PWPA 5J63A 4AJNA 1P0QA 4TKVA 3SCZA 2JH8A 4XB2A 1BNCA 1LLQA 1ACMA 2Q6VA 4RDHA 3SM9A 2XUFA 5K3BA 3WXMA 3HJUA 3H3FA 1SHLA 3HWSA 4ISBA 4J91A 4M7RA 4N7BA 4E7OA 1E4EA 4ZO6A 2OBNA 1J8FA 2XHZA 5EIBC 1UKVY 1EBBA 3N2KA 3AERA 2RGWA 3CZQA 3RC9A 1HZJA 1JPNA 1I4EB 2C9CA 5TSDA 4W9NC 3NEJA 2QLJA 2QUIA 2C9DA 4HDSB 4UEJA 4RMGA 4ZEMA 2CVPA 3K73O 4Z5XA 4ER7A 1MF7A 1H4QA 2H7CA 1K66A 3TGLA 3ZJTA 1JHMA 1IJKA 3G17A 4B6FA 1ZOIA 3IB3A 5EWJA 3FOAA 1FFXB 1S01A 2NSYA 3F3SA 3MTQA 4R1TA 5JARA 3GLGB 2YWEA 5THKA 3RU9A 3BRSA 3TW0A 4QGSA 2ZSKA 4ZAGA 5FA5A 5TR9A 5HSGA 2GR9A 1A4RA 4AM8A 3ECAA 3QI2A 4XJXA 2FSGA 2WPDA 2ET6A 2VP6A 4PN7A 4R84A 4E12A 4ZYZA 1SHKA 5HIJA 1CJVC 1HOXA 2H07A 1DQNA 1TJNA 2LIVA 3I8OA 3KKMA 3N2GA 1P1CA 3UCFA 1JLMA 3WZ2A 2WD7B 2GM9A 2ZJ5A 3OEHD 3RHZA 1X80A 5AH0A 3DYVA 1VBKA 1LV8A 5BY2A 3A1FA 2OV3A 3CJQA 3D7NA 2XT9A 2XE4A 1U1CA 3BH7A 4OMFG 4G81A 3ZYZA 5CFMA 3P52A 4X41A 5JVDB 4CM9D 2XECA 4FVTA 2XQKA 4WFIA 1L5SA 1SUFA 1J39A 2JKYA 5AVQA 4JI4B 2BP7B 3IR7A 4OCZA 1FUEA 3UVEA 2OGTA 4D81A 3JRXA 1K5PA 2FW1A 2GBPA 2I22A 4DVJA 1UFKA 3ZQJA 3NRCA 3INTA 1IBMB 3F67A 2XVZA 2JGLA 1EU1A 1Q1QA 3CGWA 3R5SA 4WN9B 2BUCA 2DETA 1KAQA 3DOJA 4KR7A 1VDMA 3K4HA 4LZWA 1A7AA 1BOFA 4YV7A 1EFDN 2VRWA 1GFIA 5JJCA 2G88A 4I6EA 4F91B 3EGCA 3L1UA 4EYEA 1KO5A 1TT5B 4JJ6A 4LYDA 4XM1A 2LCIA 3CBGA 1DC7A 4BJ3A 3GEDA 3P2JA 4Z8YA 4ARIA 1Z8FA 1WNTA 5F51A 2AG1A 4MUMA 4RAOA 2CV0A 3HA3A 3VV2A 2C83A 3FUUA 3JV7A 1Z7YA 3USZA 4EO7A 4C4OA 3DUFA 4N47A 3MOSA 2J5QA 1VSQA 3RFXA 3WS7A 3FPLA 3IMFA 5G0UA 4NYIQ 1GLVA 1IULA 3B51X 3GLGE 3O6VA 2I99A 2HF2A 4AAYA 2XY4A 1ORHA 2A3NA 1ZJ4A 1ZNQO 4MJXA 4WBNA 4OQDA 4NZYA 4AY3A 2FXIA 5BQPA 5DTIA 5FYDA 3L8ZA 2OLEA 4DC9A 4BKMA 2XNJA 5E9WA 3TECE 3EAQA 1OYYA 2ROQA 3AHHA 5DLPA 5HE9A 2FZ5A 3D59A 1L7RA 3I53A 1RAGA 5DW0A 1KDVA 3ADKA 2PRSA 5EZYA 1XNQB 2MSDB 4HXGA 5BV1A 5J59A 3E2IA 2RG1A 1G6OA 2IOFA 4E03A 4RHFA 1S0UA 3NXKA 3VSDA 1SUWA 1QJCA 3L7NA 4GLJA 3TR6A 5EXSA 1CRZA 4ZO7A 4DYHA 1P9OA 1Q77A 2JFGA 3A58B 4E22A 4S2EA 2XTAA 5ITVA 2OT3B 4INOA 3UBMA 3TNLA 4DCGA 3FLBA 4KR0A 4BJ1A 3UGQA 4Y18A 2WIJA 1N2ZA 3X1DA 3RSQA 4QOGA 4E33A 5BVGB 2R9VA 2YW2A 2NX2A 1M5TA 4Q3OA 3HTXA 1P4SA 3EEQA 1XK7A 4HVLA 1R6XA 1CQIB 1WY7A 4P4NA 1IQPA 2F3QA 4JYPA 4MS4B 4PFQA 1IRXA 2VQFB 5MN4A 3BXHA 1G5QA 4ZU3A 3VGJA 3WI7A 4RVUA 4R68A 2F62A 1WBJB 4ZRDA 3W8DA 3HA2A 4YCMA 5JAQA 5AW1A 5J2TB 1W0JA 3AINA 1FLAA 3KQWA 3MBIA 4HR7A 4MCHA 4MW5A 4PY2A 1UANA 2A5JA 4QREA 2WF5A 2H08A 3DE5X 4YRFA 5EGSA 2VJPA 5I9MA 2G5CA 3KTFA 2CDBA 2XB6A 1POXA 1RRMA 4CBVA 5FB3A 3ZGNA 3NBZC 2HTEA 4KK3A 1MJGA 4Q3KA 3ZX4A 4OHKA 1OPRA 1INLA 1GDDA 1KP3A 3P96A 3ILVA 3TVTA 1RW4A 1SC3A 2QY6A 2JAWA 2RI6A 4N5NA 3PICA 4ETIA 4ZYLA 1LNQA 4GPTA 3RBAA 3JPWA 3MLAA 5AW8A 5CBPB 4QLBA 1BCSB 2QUBA 1H22A 3FR7A 3O3CA 4HRXA 4J29A 2ATXA 5JUWA 4CL3A 2GYUA 4D8WA 5K3SA 1DBIA 4MH0R 1E63A 4OK6A 2CXSA 2FVXA 4RABA 1GTJ1 1RQLA 1HX7A 2BBSA 3NU1A 2DHQA 3T5CA 3X1KA 1GADO 2A78A 2PE5A 3GIDA 4HDNA 4AU1A 3P26A 4OB8A 3K32A 2R8XA 1KSJA 2X0FA 1ZW1A 2ZK7A 4HN4B 4FNOA 5J5CA 4DREA 5LA6B 1RQNA 4TQUS 5KTPA 3CQ9A 4FMDB 4HB2A 1FYVA 1JHVA 4WKBA 4AROA 5JNTA 3M5WA 3T12A 3GLTA 4R7TA 1G8HA 4NPHA 2BEVA 3PJDA 1E3LA 1RBYA 1OIVA 5E7QA 1DKQA 3Q5GA 4JUDX 4DMRA 3GYBA 4OMDA 2WZQA 3THYB 1Q12A 2ATEA 2L69A 5F5XA 4K9MA 4BMNA 1W59A 1D5CA 1FC0A 1ST3A 4ZIRA 2GD6A 5FQOA 4AN0A 2HLDD 4ERNA 3A3YA 3GNSA 1C30A 3PENA 1WZEA 2EQBA 1UEXC 2DUUA 2IQ5A 1SIBE 2PSJA 2ZDQA 1P7CA 1N5OX 2N75A 3LC7O 3LPMA 3NVKI 1U7DA 1A2QA 2OAQ1 1YF3A 3OU6A 1JIXA 1T9HA 4H0CA 5FNVB 5FOWA 4ZDWA 2VJDA 5LWHA 3FGNA 2A1IA 3QTTA 2ZDGA 3G0IA 3L0BA 3X2FA 2CJWA 1V16A 4L72A 4AG5A 3U4QA 3T5PA 3AUKA 4RY0A 5E4JA 3U31A 2D7DA 2Z3ZA 1J07A 1AU9A 1G3IA 2QXYA 3Q12A 3GCXA 3ONVA 2C3UA 3SICE 3B2QA 2FW6A 2BGTA 1NP6A 1NVAA 1UBEA 4W1RA 1LNSA 4IDOA 1HDZA 1K6EA 1MQAA 2Q1SA 4IVNA 1JEEA 4YRAA 2VF5X 2G71A 3LLMA 3ZHXA 1SUAA 5BSMA 5ULLA 5DN6D 1ZJ6A 1M67A 2DBZA 3A36A 1VGVA 3Q2IA 2V6IA 1IBCA 5B1YA 5CFNA 5AUPB 2Q6TA 3I64A 4H3KB 2A92A 4CEJB 1ZD9A 1A50B 1E2JA 3WY9A 4Y9RA 5AW6A 3AHFA 2X23A 3N28A 4IRUB 4WNAA 2FF5A 3RVBA 2C2BA 4CIBA 2CLSA 2FFBA 3BL5A 1C7RA 1KOJA 3PNOA 4RZIA 3ND6A 4LBVA 1Z0AA 3DZJA 5TARA 5KQPA 1KWKA 3I9NA 3G1UA 2IY7A 1EBUA 3S2IA 2RH4A 1PNOA 2Q2VA 1KO4A 4EA6A 3D81A 5FWAA 1X87A 1OILA 2PYZA 5L3QB 1KETA 1JPVA 2D0IA 1Z3CA 4LXYA 4MW9A 3VRHA 2ZSDA 2OB2A 2AEMA 4HDCA 3ZY4A 3VISA 3R0XA 3E9YA 1MN6A 3WTBA 2PGDA 2NTJA 4YCAA 4B0PA 1DKOA 2PHZA 3OIDA 1Z6QA 4CCYB 4LQLA 2FE1A 1RZVA 2HU7A 2J6BA 3W3ZB 1E77A 1KNXA 1X94A 3G2LA 3A05A 3CF0A 2OGSA 4GP9A 4KN8A 2QL9A 3L1JA 5FJIA 4RVFA 4LRUA 1LEHA 3EZLA 4UCFA 1TO2E 3CRNA 1GQYA 4E11A 4RLHA 5JAPA 1P77A 3CG0A 3BXPA 3GVCA 2O8CA 2YUTA 4KU4A 3MT0A 4OTZA 5LNK1 2O8BA 2YRXA 4TKMA 2HAEA 3NHPA 2J67A 3D7LA 2IYRA 3IIKA 1N5JA 4L9RA 1JFFA 3NHMA 4MWZA 3AQIA 2CJXA 2O3SA 3CLKA 3ODPA 1FP6A 1V7CA 3R0QA 2XADA 4QDTA 4F6RB 3OEHA 4K9NA 2VDWB 5B1EA 1H5NA 4EVIA 2G40A 1PYDA 4DEXA 4O8ZA 4CL2A 3CVVA 1WRBA 3EXFB 2ZJ3A 3KTDA 5CA0A 1LBSA 4HK4A 3QFSA 4EY3A 4O6VA 3FLMA 1RLUA 1DIOB 3G5TA 4O2BF 4QECA 5LNK6 4N76A 3GIWA 4CM9A 2QVGA 3B5IA 3G2QA 2I66A 3D2LA 1E1CA 3WYBA 2EKBA 3VZRA 1Q20A 4BNMA 4IHAA 4PQGA 2W43A 3IP1A 4PZPA 3GYGA 3W2HA 3PIDA 1CUZA 1O08A 3MGKA 1VI6A 1GAWA 4LE0A 4FYVA 2WZBA 4QUAA 2FLKA 2FN8A 4PN3A 1OI7A 4TMVA 1S89A 3H9CA 3NBMA 4NYMR 4UVDA 2XD9A 4ZU6X 3WKEA 1JKIA 1K7SN 4OGLA 3LHFA 4LXGA 3T61A 3BHIA 4ZAVA 5G0TA 3W1WA 4YMSA 4B6QA 3DHYA 5DJ5A 4EB3A 1X7HA 1MX9A 2IKQA 3AESA 5KJFA 2YWDA 5DM60 3THOA 4M99A 3ZJVA 1LFDB 4H7DA 3AHEA 1PO7A 4JBWA 4PVDA 4F71A 1YJAA 1ULBA 1J2JA 2RGYA 1ANKA 3FLAA 3LJKA 4HDOB 4UE6A 4KUGA 3UMVA 4B2IA 4N6OA 3EWNA 1ZZEA 2RAUA 4EJ2A 4PZUA 4F5ZA 2J9FB 1CW2B 4W5JA 3E9ZA 3ZKWB 5K0FA 4Z86A 5AHWA 2PXHA 3NIGB 4X44A 1Z0KA 1WX1A 3RYCA 3E9DA 5J4VA 1YFLA 4CM4A 3FYHA 4D8YA 5EJEA 1BS9A 5KYYA 3IUNA 3UAXA 1LW6E 4TVOA 3RBXA 2P4QA 2XLCA 2VA9A 1NF9A 1E9DA 1E3TA 2GXUA 3D3WA 4OXNA 3OHSX 2OAGA 2IYPA 4WY8A 2P79A 1U3GA 3LNTA 3B9BA 3E35A 4L9WA 1RWWA 2GSDA 2P2ZA 2PPLA 5A9RA 1EUDA 3LCMA 2PRYA 3R7DA 4DARA 1P7PA 1PR3A 2ZBGA 3PT9A 1APBA 2ZI6A 5ALKA 3DBLB 5DKFA 2QG6A 1JMYA 3W5SA 3ZTWA 1EQ2A 1BX0A 1HLDA 2JGEA 3D43A 2X6QA 1W30A 4Q3NA 5DXAA 3SFVA 5BSVA 2GX6A 5I9LA 2ZB4A 1NR1A 2XWPA 2FZGA 4QXAA 2W8BB 4HSGA 1NDUA 4IR7A 1WXIA 7GPBA 3KBOA 3IPYA 2I2XB 1RZ3A 3SLGA 1XMVA 2PNJA 1M7HA 1YIOA 1GUBA 1S3SA 2GHQA 2RIPA 3WKAA 2Y1OA 2BDUA 4ZMBA 3FYCA 2I54A 4UM5A 4N5DA 1RI1A 3K1YA 4MPJA 1EX7A 2MDTA 5JZBA 2AW5A 1PR6A 1HDEA 3SX0A 3PL5A 4A7PA 3MGCA 1G8KA 2AWNA 3NASA 2HCRA 5JH7F 1A8UA 3RSOA 2JA2A 4RGYA 1JDBC 4JVLA 5EWLB 1U2SA 2VYCA 2R00A 5B37A 3C8MA 5DT2A 1TVMA 1YS2X 1ZGBA 4BGUA 3GQBA 5AOCA 3LG2A 4XKJA 4ZCPA 5FR2A 5KYUB 3H5RA 3VPFA 2HU5A 3R24A 5BV0A 2OCGA 3HBAA 3WIBA 2NGRA 3GMTA 4GMFA 4ANFA 2VP9A 3ANMA 5IUNC 2IXGA 5KVAA 2AX4A 3WP1B 1TTHA 2BBWA 3DC2A 3OCJA 3QELA 1O97D 2CUZA 5DX1A 1M1UA 1GGHA 4TL6A 4LJRA 1IMJA 1QG2A 2YNMD 4H7JA 4OEHA 5H3HA 5LCXA 4F4UA 5K0SA 3CVYA 3B12A 2QPOA 2GESA 3HKCB 5GOZA 2MCFA 4CTKA 1ZLXA 1JKXA 4ECEA 5SY4A 1BVRA 4KQFA 5ITSA 1WXGA 4DA4A 1K7FB 4YX9A 1UKCA 3PUVA 3TQQA 2ZXUA 3C1UA 1BS1A 2JJ2D 4J2OA 4UM9D 3T6KA 5JQGA 3T4XA 1IZZA 3K0FB 4IHQA 4TZKA 2QKYA 3HS3A 2B6NA 1IQRA 3T06B 3TUIC 1CUWA 4Z4GA 3IMEA 1NUTA 2YINC 4IXWA 1Q15A 4NV3A 1RJDA 1QCYA 2BD0A 2CWDA 3FVRA 4NZPA 3Q1KA 4F8JA 4ZZIA 4PNHA 2X42A 2XPCA 3OT4A 4W1PA 2IYLD 4FFWA 2IYWA 1IXKA 1W1IA 4OQ4A 2CHVA 1DGQA 3C4QA 1K8ZB 4D98A 1SVWA 2W93A 4C7MA 1QAOA 1F3OA 1NVWQ 5DHAA 4R0MA 1FA9A 2WUGA 4TMFA 1ORVA 1T5LA 2ZSAA 2E2WA 4X1YA 1MHTA 4MAMA 4ZALA 5JCJD 1M6EX 3OMXA 2GM3A 1ODFA 1AKVA 4RLSA 8OHMA 3G9TA 5A62A 1GAXA 3ZCPA 3U7QA 4N5MA 4RTNA 2Y27A 5F5NA 4ARZA 1Z0SA 3C3YA 1PFYA 4P31A 1L8OA 1TMYA 2G80A 4PYRA 4KEAA 3L7YA 2MMGA 4W63A 1ESZA 4FB4A 1QH8B 1VPEA 3RAEC 1KI2A 2JHFA 4PRZA 2VUHB 4P86A 2UUPA 1L9KA 3HO6A 5LZ4A 1IWPB 1EFCA 4B6SA 3BWMA 5AW4A 2XTJA 1ZQ9A 2QS9A 5FULA 1MB2A 1KQPA 2XEXA 3EWSA 4KWTA 4IS2A 5K09A 1VG0B 2VSXA 2ZUUA 3W6ZA 2C2YA 1ONOA 1E79D 4XXHA 4A5OA 5FBRB 1QGAA 2AYZA 3VNUA 1O5TA 5MDHA 2J5KA 2AQHA 1GPJA 2FPSA 3W78A 1A5ZA 3KOZA 1RYHA 3UXMA 4CKBA 4PAMA 5HW0A 3RS7A 2QXTA 2B78A 3BD9A 3EY9A 3HA5A 3UK1A 2X8AA 3W1EA 3H0CA 5K0NA 4MPRA 2WDZA 5DHUA 4QT0A 1I0LA 5HCIA 5HKAA 1YASA 1RD4A 4NP6A 3MRSA 4RCZA 2PS9A 2XCUA 4YHBA 4BIIA 1O96A 4IJWA 5D00A 3WLLA 4E4YA 3NYIA 4FZVA 2BFEA 3DFUA 3OF2A 1QSGA 3PQ8A 4BJ6A 3T3DA 3VH2A 5BPFA 3HM2A 3KIPA 2PZ8A 3FYSA 3ZWCA 5DZSA 4QDOA 2OO5A 2VZ9A 4L1KA 4NMHA 1JT2A 2V7WA 5IAOA 3DDCA 5CNMA 5EZSA 3ZHTA 1JIUA 4Z0PA 2FPPB 3DT6A 3DM9B 3TSAA 4FYXA 2OORA 4JQOA 4TLBA 4CFZA 2B3DA 5CVDA 2KSQA 5KWIA 1ATZA 3AJDA 5G53C 3EVZA 3HKBB 2FJUA 4RIHA 2V55B 2P5YA 4JUBA 4UUQA 1C80A 4XEHA 5JSZA 3RS3A 1U0EA 4PLCA 1N1MA 1ZL2A 3K72B 4I1YA 2WYVA 3UHJA 2OOKA 2ZJYA 1A9XB 5H3CA 3A4NA 3TJZA 3EGDB 4J9VA 5IFKA 4BQEA 3H2ZA 4MIYA 5AD1A 1YA6A 4U7FA 2C0CA 2JLCA 2VUSA 1GZSA 3E48A 5GVSA 5KSOA 3IBCA 5FBQB 4KR3A 1CEQA 2VP0A 3K0HA 2VXOA 4ITVA 3EBLA 4ND2A 1XP5A 4O5AA 5DM0A 3UOWA 5I7VA 4KIWA 2WWFA 4BXOB 5AJZA 4JYCA 4U63A 4QPPA 2N1MA 2DT8A 1TW2A 3GA5A 3ZU2A 2JFPA 1O4VA 4RTOA 4B3XA 3QKWA 1CR1A 4LXHA 1AQJA 1CUCA 3TAHA 1XB2A 1XZKA 2OORC 2Y0CA 3GT7A 2FW9A 3WQBA 2IWHA 4BRUA 4O4IF 4V0SA 2PV0A 1MQ8B 1IM8A 3FPAA 4JJEA 5B58T 4X66B 5F1KA 3V2IA 3LDAA 5B1IA 1RQ2A 2RH5A 2A1TR 2JFZA 3BTOA 4I55B 3UIEA 4IZOA 3LE8A 1EX6A 5HFJA 4DCMA 4AZSA 1AV7A 1ZCBA 1WHSB 1SPXA 2FETA 4UAJA 4XIJA 3GLRA 3NDRA 5ARCA 5JPIA 3TQSA 4YUXA 5K8CA 2QSZA 4H16A 4KG7A 5SY9A 3MXOA 4R8VA 3RGGA 3HK2A 4AP6A 1IZ0A 1DCFA 1N6LA 3IEXA 5JRJA 2ST1A 4FHDA 2LGJA 2MU1A 1P62B 4CETA 3I2HA 3FX2A 1E2NA 3LYHA 3MA0A 3SPXA 3C3DA 1LFAA 3H2BA 1H3FA 1IUOA 1VBMA 2PWBA 2VWHA 1G2QA 4UAVA 1X92A 2ORIA 2GEVA 2D13A 2X1LA 4EK9A 3EVGA 5CA1B 2XEDA 1MW8X 2QTAA 821PA 4KFCA 5JCPA 3TRKA 1YACA 5F1OA 2B8NA 5T4FA 5IVDA 4QVIA 1KVUA 2EW2A 4PAQA 1P4AA 1LLCA 2OZKA 4L4UA 3CS3A 1B6TA 1I4DD 4LC0A 2SHKA 5FUXA 2XVYA 4EZIA 2CWWA 4Y2GA 1RRGA 3MMNA 1IN7A 1N5LA 1PTKA 1E2GA 1MX1A 1JG6A 3AG5A 3AKCA 1B3BA 2OFPA 3OCZA 3VC1A 1OX4A 2YC4C 2WMNB 4UNNA 4R9SA 5C18A 2R751 3GOQA 2C77A 3ZTYA 5JVDF 3V6LA 3UM9A 2O2IA 4FWIB 2J09A 1DOZA 5AM5A 5JPDA 4IHJA 2XDAA 4BWGA 1LSUA 3HMQA 1NY5A 2IX9A 3T34A 2J3QA 3DQQA 2V03A 4OQMA 4X3OA 2EXXA 5I7RA 5JS7A 2BM9A 1C3JA 3HL0A 4IKOA 4EUSA 1CDOA 3UWPA 3VFDA 1BN7A 3EFOA 5HCUA 2OPHA 4YXWD 3U09A 2YHIA 4CMAA 1HYBA 4CM8B 4BAUA 4R7ZA 2P77A 3GPDG 2JIOA 3Q40A 2X5XA 3G9ZA 3AERB 3N2KB 4GX2A 3UJ7A 4ZVVA 4CDRA 4ER6A 1KSFX 4MOWA 2BHSA 4ALLA 3UENA 1XCPA 1PW7A 2EF0A 4HGQA 1EHYA 1YKGA 1GNPA 3KVVA 4L22A 1QK5A 2VNJA 2ZS7A 3NM6B 2BC9A 3F97A 1KEZA 5EWJB 5C8DA 5J2UF 4MYCA 4QEZA 4GP6A 4Q4HA 3RAJA 2TMKA 4A0GA 1P72A 3IP7A 4CVNA 3FPBA 1I94B 2HHJA 5IUJC 1BHSA 1PT5A 4GC9A 4URYR 3ZGYA 4A91A 2R79A 4GG1A 3C16C 2P7HA 1CVLA 2PM8A 2J5RA 4I4CA 4QFDA 2WE7A 2JEOA 4D4KA 2DU8A 5AOAA 5TPZD 2IOFK 3LU1A 2P1RA 2YNMA 2P91A 1TGVA 1X80B 3D8SA 3E1KA 3FPHA 3GO4A 3GWZA 3HXPA 2FSPA 5KIAA 3L6BA 2R65A 3ONDA 1L5OA 3AK4A 1QH9A 2WHQA 3CG4A 4U1RA 1BGVA 5L3VA 2QI9F 1A9QA 1UM8A 2D4AA 2NT4A 3DKPA 2PBFA 1K89A 4P84A 2GRJA 2YIJA 2JJ2A 3AV0B 5ALNA 1TTPB 5L53A 1W7AA 1GHTA 3PXCX 1Y6JA 4WNYA 1YDMA 4ABYA 2O8EA 3FTNA 1CULC 3H6HA 3PUZA 4I9GA 5GONF 1AGPA 2B2NA 5JCXA 3L9WA 4R1UA 2NZWA 5JTTA 1URPA 1T4CA 3UMYA 2W83A 5DNVA 2Z08A 1Z5WA 1Z68A 5LYJB 5HZKA 2BGUA 3V5NA 3LPDA 1FMTA 5T4EA 2MR6A 2MYNA 2QX4A 1E69A 5BYBA 5BMVA 3PUKA 3AJEA 4I5GA 3O93A 1MJHA 2PMEA 1HSOA 3GEHA 4PC2A 3GA7A 4C22A 1PNRA 2XCLA 2SICE 5HIMA 4KR6A 3CFYA 1P5HA 5BN4A 3ACCA 1DTWA 3G68A 1P2BA 1ZWKA 2GPAA 3IBSA 4BC1A 2C3PA 3Q3GE 2J46A 3IESA 5FL3A 3EZNA 1Q6YA 3IHKA 1AUPA 3Q9SA 5JMPA 3UOGA 1W5BA 3L7CA 5EUMA 2Q9BA 5JS6A 2JLUA 2Z8XA 5J2TF 2E5WA 1SBHA 1IZ7A 2OCXA 1N77A 3SK0A 3RF7A 3B78A 5LQJA 2HK9A 3MZ0A 3JQ7A 4RWZA 5E7JA 3AI2A 4WBNB 5DNYB 2GK4A 1HE5A 4D6YA 3KZ1E 3BVPA 4EBBA 3GRUA 2VQEB 4PLVA 2C2OA 4RD2A 1ZBDA 3EVCA 4R31A 4UNPA 4HTFA 1DRUA 5EXDA 3TZCA 1JDVA 4PNEA 2DY1A 3GG2A 3LRTA 4N49A 2CDNA 1GGMA 1TIBA 4OHOA 3E8MA 5IBPA 4IO0A 3WV4A 2K2WA 4V2UA 3F71A 1DFIA 1E9RA 1F3LA 3AUFA 1Y1QA 3GFVA 1GKKA 3I45A 4PZZA 4BU0A 3H9BA 4YUYA 1JHDA 1YVUA 4G1EB 5C1IA 2RH9B 1HLGA 2ILVA 4L8VA 1FP7A 4EF5A 2CFTA 3ME5A 3FFAA 4F21A 2F00A 4MUYA 4ZTBA 4JOQA 3INRA 1KEEA 1M1NA 5CLFA 2HSJA 4AJ9A 2PGJA 5H59A 4CODB 2Q45A 1SH7A 3I37X 2QTVA 4BX3A 1ECJA 3BIWA 4FMDF 4IGAA 2J1LA 4CUJA 1P6XA 4NABA 1SBTA 1K68A 2HSGA 2J3IA 2WJZB 3EDOA 1TJPB 4FUTA 2A9QA 1X2BA 4WLFA 2CHFA 4ZOBA 3K20A 4AJ2A 5SZHB 4W7SA 3GGCA 1YTUA 2ZBEA 4TVBA 2Z30A 1CJKC 3H1TA 3V2GA 1QP4A 2GQ0A 2NYRA 3B1XA 3UB3A 1IEVA 3AVOA 5BNTA 1SVSA 1QX4A 3C97A 5ER6A 2EERA 1IOVA 1NSYA 3DAOA 4IIFA 4XD7D 3SDZA 4N7JA 3OQVA 2LP4Y 2MMCA 2A0WA 3LKDA 2ZAYA 2ZJ1A 3O7WA 4LVOA 3WC4A 3WZMA 1W4BA 3KV1A 2GN4A 1CY8A 4BCBA 4IAOA 1SXIA 3ZDDA 1C1XA 1UBJS 4XA8A 4ZOEA 1A4UA 4QXPA 1LK7A 2XSZD 1IVYA 1QAMA 3LQ2A 2RK4A 1Q7BA 1NZFA 3IXMA 1AGYA 2QUHA 3HVHA 3RGWS 3ICPA 1P2UA 1B23P 4FMCB 3Q3VA 4KZKA 2ECPA 2BBOA 1N8SA 4DL9A 7MHTA 2NACA 3PDIB 4YRSA 2OENG 4Q21A 5FH9A 3ZGLA 4QU5A 1BW9A 1S02A 4G3XA 1QGOA 3RD5A 4MYTA 3MJVA 4KRGA 4EB0A 3K1ZA 4AUEA 4KQWA 1AHIA 1AHPA 3TEJA 2C7OA 3MNFA 3IUSA 4OHFA 4WWHA 4HDNB 1UPUA 3NFRA 5KNDD 2BGWA 2Q5IA 3CZCA 1WB9A 5FI0B 5KCZA 3E7FA 3QLEA 2EIXA 3L6EA 3VZCA 2DZDA 1YUBA 4TMXA 2P6OA 2H65A 2WFMA 4PQFA 4TWBA 1JXMA 3JD3A 4PW0A 4KR9A 1OTYA 1SKYB 4PO9A 1XCGB 4HATA 2BEVB 3OQJA 3O03A 4HGRA 4CU2A 3ABOB 3ESCA 1KH2A 3ILSA 1D2EA 4ZHSA 5I7SA 1H69A 2Y3IA 3C8ZA 4P83A 2A0UA 5D8DA 5FT9A 4TWJA 1UFVA 4K87A 1V7QA 1KHHA 1Q14A 5U9CA 4ZIRB 5CM9C 1O8BA 1SOWA 5LOVA 1C30B 2W2MA 2VJOA 3PPVA 4BVLA 1UC4B 4NV0A 3EAGA 1XRLA 3LUBA 1TUIA 3R76A 2R6DA 4BO6A 3NV7A 4J4HA 1Z4OA 3EOZA 4J7CA 5E1OA 1FUUA 1N0UA 2F3PA 3I9KA 3LT5A 1KOFA 1MNQA 1Y3DE 1A4IA 1YU9A 621PA 3U4QB 2CJWB 4Z9AA 4P7BA 3MPUA 4Q82A 3UK0A 1UP7A 3LTNC 3QE0A 3AFMA 2EJUA 1IOWA 1USUA 3GDWA 3HB0A 1KR2A 1NJ6A 2WAXA 2HBQA 3EW7A 1BE1A 2H18A 3FSEA 3IBFA 3PGLA 2A8YA 4ZANA 3W9BA 4CT5A 5CFQA 3DZDA 3CYFA 3JQ8A 2DSNA 4OFBA 2AMYA 5E4TA 4C7XA 4CWAA 4HEJA 2X4DA 1TEZA 1S2DA 4FI3C 2FLVA 8MHTA 1NPTO 5B7NA 1CU1A 5I9BA 1GQOA 1YA8A 3OZVA 3HUFA 3PGJA 5F76A 2FY8A 2QR2A 4D4MA 3MCWA 4LX0A 3UV6A 4H0NA 2Y4NA 1JSZA 1CQJA 2H2IA 1YBHA 4N39A 4TROA 5A71A 4OO3A 1VMKA 5CFOA 5AI9A 4H1WA 4BEVA 2JZNA 3HJRA 2QTCA 4WNAB 1CUDA 2ZIVB 1SC6A 1ZIPA 2XKBA 3T3GA 2Z6UA 3UUFA 1FVOA 2Q3LA 3DEIA 3FMVA 3QKRA 4OUDA 1GTZA 2FGKA 2ZT8A 2G4LA 1L7AA 1RJ9A 2O2ZA 5IYZF 1VKZA 2Q29A 3A2MA 3PRHA 1XDSA 1PVVA 1TM4E 1EVZA 1Z2DA 1O9GA 2IHBA 1NI4A 4OFZA 1JQ3A 3LBAA 1ZR2A 3A25A 1I33A 2GF2A 2B4YA 7ABPA 2RGDA 4DMCA 3L8MA 1B93A 5DRYA 5EXEA 3DFIA 3ZDRA 4AKHA 2I7XA 4DWOA 5CFPA 3Q11A 2Y67A 1AKEA 2BKAA 1Q57A 1T2UA 2WFZA 3DP9A 1NMEA 3SQLA 1IH8A 2WM8A 5A05A 3K05A 1LJ8A 2C8JA 5CXSA 1ZK2A 4Y9UA 3OZUA 3N3BC 2FKAA 2IUTA 4GVPA 4X45A 3UAVA 2BJVA 1LC0A 1SPBS 3L6RA 1WCYA 4P1ZA 2DLCX 2OGWA 1R4MA 4BP8A 3ER6A 5KC8A 1JFFB 2G5TA 4Y1GA 4BMCA 4HRAA 3SVZA 4JP1A 4EMUA 1Y8ZA 1XVVA 1LI5A 2WD9A 3GEBA 1UC9A 3RH0A 4U7JA 2VNHA 3PYXA 1UP6A 2GD1O 1QP8A 1LGYA 3VPGA 4EENA 4Y0VA 5CA0B 4JVMA 3C3PA 5E9QA 3DYBA 1VG9B 2BF4A 1E1CB 2HHAA 2DHRA 3HDQA 4P08A 4PX2A 4W5HA 4ZAWA 1X6VA 3B3GA 4G5HA 3BM5A 3FNBA 2GPYA 3OURA 4UE2A 4M21A 5MHTA 1SOMA 3ECCA 1HTWA 4JOSA 3ROPA 2RBGA 3QVLA 2ZSJA 1OV4A 1FTQA 1WHTA 3H5AA 4X94A 3RJ9A 3AF4A 1N25A 4JELA 2ZTUA 3GW8A 4WRRA 2PQMA 3U3XA 3EDQA 3EPJA 2IV3A 1NQOA 1EEXB 1QBKC 4J7XA 5H1YA 1ZJZA 4D4IA 4GUDA 1AO0A 2GPBA 4JWTA 5AFSA 3B6EA 3AESB 3IE0A 3JQPA 4B76A 2EGGA 2IS2A 4WLNA 5D5HA 3FXAA 3T9DA 4Q00A 3RWMB 3U44A 4MV9A 4R98A 3CURA 1BAPA 3D31A 3HEMA 5FI5A 1WETA 3KELA 5DP1A 1ZNWA 1NF2A 1C0LA 2C98A 4KGVA 1P1FA 3KL2A 5CNKA 1O03A 1TYDE 4JB3A 1QO0D 2QRJA 2V5UA 2YV5A 4QFMA 2YJ6A 2ZAIA 3E81A 3UUGA 1MOSA 1OV6A 3QXGA 3CWCA 2BI4A 4HDMA 4M9UA 5CDTA 2G8NA 3RYCB 4CM4B 3AETA 5IULC 4JT9A 3EH1A 3F74A 2R62A 4CMCA 1SVLA 1ZH6A 1BX3A 1PS9A 2VDNB 2WTXA 3DH0A 3D3WB 4ZEWA 1P4JA 3UXEA 1UZNA 5M04A 4LFBB 2GNPA 2ZFUA 1EUDB 1WKVA 5KHLB 5C8ZA 3ON5A 2I4IA 1SRRA 3K9NA 4FXOA 4XYBA 1UWLA 1CNMA 3MAAC 4G1VA 1FTWA 3DWGA 1Y3IA 2R85A 4R0VA 4L5AA 3IODA 5ALEA 3V7NA 2FR8A 3LL7A 4ZOAA 2QV7A 4ZCRA 1UIRA 3C6KA 5T41A 4XJTA 3R9XA 3FCSB 1TYBE 1YA4A 4Q9LA 2CXTA 3QEBZ 3KSDO 1OXSC 4EVSA 2BW0A 5ALIA 3N8KA 4DLAA 3MF4A 1Y37A 4R5HA 1YULA 4NR0A 5H8WA 4D3SA 2B5OA 1ZJ5A 1DIRA 4I1UA 4XLZA 2CE7A 5GGXA 1XX6A 1Y48E 1BKDR 1T3LA 3D8RA 1JNXX 1NQXA 1W93A 3O5AA 5G1PA 1NF8A 5G1NA 4AKSA 2KPOA 5D86A 1GOTA 4I08A 4S0ZA 4LMAA 2VWPA 3KC2A 2UZ3A 5J58A 2XNDD 1VLZA 2YHBA 4F6LA 1UWKA 4XD7A 3GQBB 1XELA 2RJNA 2Y1GA 4PLTA 3SBEA 1VCMA 3KHSA 2JVJA 1VJDA 4PLFA 1PZEA 3TQOA 3U9SA 1GPAA 4LMPA 1U8YA 1NWCA 4OGWA 4ZT7A 2R8RA 4ZJZA 1YJ5A 2G3YA 3RHSA 4OJKA 4WDQA 5AI5A 1T6ZA 3E3MA 2MIIA 2VI5A 3QELB 4KBYA 1FFEA 5LDGA 2XSZA 3B13B 1QUEA 5HM6A 1XXHE 3DOIA 3H2SA 2G07A 4C7VA 4EIWA 1BE8A 4LZNA 1XZGA 1PJQA 1XEWX 4J4BA 9GPBA 1U04A 1LZLA 4UAGA 4QRDA 1O3YA 1R0ZA 1FFGA 5TC4A 3T95A 1FZTA 3GELA 4YJHA 1S4QA 4QPCA 2FQWA 3DLIA 4RZQA 4W5RA 1PX2A 3E5MA 5JQGB 3PK0A 3VDMA 2CDAA 2QRHA 1Y63A 4MUAA 4RETA 1U7ZA 4PSCA 2QR3A 3LFUA 3V1KA 5KNDA 5DPMA 2ZT5A 3OQIA 3WLMA 1D6NA 2H1VA 7MDHA 2PQ0A 4PONA 4JKYA 1QMGA 1F51E 1OU0A 3FKSD 4P98A 2QTHA 1LDBA 1I51A 2WI8A 2OGUA 1QIIA 1F4LA 3QEKA 2JK0A 1VXRA 4BO9A 2AOXA 4BFXA 2MT9A 2YZGA 3G5UA 1LPSA 4L15A 4QELA 3PT5A 1J8DA 3ZZNA 1PJ2A 1ZXBA 1ZESA 1YHYA 1ADCA 4LWZA 2X0DA 2V7PA 2VNIA 3FFTA 4GRDA 5EJ7A 3P0JA 5L7WA 4X1YB 4CNQA 4IQGA 4JWKA 1F2TA 1LXCA 1XT6A 2EZ9A 1VC2A 5LC1A 2C99A 2I4LA 5DNEA 3GZTB 4RBNA 4DS3A 3U7QB 1DIGA 2X7XA 1LS6A 1PTJA 4ARZB 4WZAE 2EC5A 3R3JA 1GNLA 4HX2A 3CWZA 1LTHR 5TJHA 3RBVA 2NTYC 3P20A 2WU8A 1JALA 5A6SA 2ODWA 1N36B 4EECA 5KWSA 2R8ZA 2WUEA 5AESA 1CUYA 4CUZA 5KHAA 2XQFA 5FBVB 1Q1BA 1MEJA 4W6QA 5H81A 3PQ5A 3JW8A 5AHRA 3EGWA 1VCHA 5KWJA 1PR4A 4DSOA 5IAAA 2QTRA 1ZA2A 2P9GA 1G9XA 2NUBA 4MUFA 2A4MA 5AVYA 2FI1A 5K0BA 4LY0A 3AEKA 1P61B 1B3RA 4UBMA 5EE0A 4EX6A 2UZ4A 1MRNA 1NC1A 4CQNA 4EVRA 1HG1A 4FXPA 2NZXA 3WDSA 2CVHA 4CLXA 5A4MS 5FOQA 1RRPA 2NQ2C 3ZHRA 4CKBB 3IAS6 1YDGA 4IWXA 4MUHA 4CIAA 1WSAA 2FX2A 4KVZA 3LYLA 1N0WA 4H08A 3R8FA 2PUDA 3NYWA 3WFZA 3L07A 2YZ2A 4JJGA 2CLOB 3G6WA 2EBWA 3TL6A 4UMFA 4CM5A 3T5AA 2NPOA 2I2DA 4KACA 1O96B 4WT7A 3ZV6A 2LNDA 2FSIA 4UTXA 3S70A 5KVSA 2BFEB 3TIIA 5MN6A 5JLAA 2PJRA 3SBOA 1O95D 3PWSA 1H6BA 2J48A 4Y1EA 1SCDA 3FIJA 3IVMA 3OJCA 3KVRA 5K3FA 2J87A 3PQ4A 3VR5H 2B1GA 4OHRA 3TD9A 4AG3A 1KMIY 2AJBA 4P80A 3BSYA 1GJRA 4MIOA 1HYHA 4FMBB 4YMWA 4N5IX 3ZHBA 4BV9A 1NNUA 3GOHA 2HNAA 5JAMA 1NI3A 1TRHA 2HXGA 3LVFO 3N0WA 3NNDA 3EXHA 4RPIA 3PU6A 4YASA 1KSGA 3TCKA 3V1TC 4JQCA 2XKAA 3B89A 4EY6A 5JSZB 4ZGWA 4P0PB 2QT1A 3IAAA 3I9OA 1TCCA 3HHPA 4X7BA 5FKJA 4DDUA 2X9QA 5C5DA 3LT0A 1K63A 4J0JA 5K3DA 1BDIA 1OLSB 4S1NA 3PJEA 5JHHB 4ZT6A 3ZHYA 1K8QA 5I01A 5KPJA 4Q9AA 1K7CA 1V43A 2CDRA 3CRW1 5M3BA 1KKMA 4FIDA 3RJMA 3MMXA 5AKLA 2FV8A 3FPFA 4K40A 5AVOA 1J7JA 2VSFA 3BK1A 3DEYX 2Q3CA 1NSTA 2EVWX 2OHXA 1Q1ZA 3GI1A 4NY1A 4Q16A 2ZBVA 4OHPA 5DTRA 1U1EA 4M37A 3HXOA 1TM2A 5BOVA 4AQ7A 2BELA 3IUPA 1YS1X 3GP5A 3BIFA 5BSUA 5INTA 2OILA 2AI2A 2DPXA 1SG9A 1IIBA 2E4VA 1G8JA 3BF8A 3GZNA 3KB2A 3NO4A 2H1CA 2I3ZA 4TRMA 5D6NA 5DK4A 3WB1A 2HMVA 4KK4A 5LJIA 1JA9A 4BO3A 4G63A 1BGWA 3OZFA 4WJZA 1ISMA 1U9IC 4QUJA 1M10A 1PK9A 1IUNA 1TXGA 3HDYA 5B6JA 1TYCA 2PXXA 2PIDA 4A27A 4A0FA 2GK6A 2VN8A 1Q1AA 2WJJA 4A1FA 3WGHA 2ZI7A 3V7YA 4C0HA 2ES4A 1F8XA 3NI2A 2PUTA 5BSGA 4KPEC 3BK7A 5E9AA 4WI1A 2ZT7A 3TPZA 2AFHE 4TOIA 3EUAA 2ZVJA 4FX2A 2NNLD 2ZE5A 2OQIA 1RTKA 1EDOA 3QUTA 4P38A 4PEVA 4X90A 3ENKA 5JCOA 1KVRA 2JCVA 2JKZA 1UZUA 4B7ZA 1VL8A 2JI6A 3AF6A 1CIVA 2VPIA 3L2OB 4G0NA 3IUMA 3LQKA 4QVKA 3FOEC 1XD9A 2EX4A 2WSLA 2CFSA 2O1XA 3BDIA 3GFGA 4X6UA 3ZE1B 1QO0A 1VHWA 1VTKA 2KLBA 2O20A 5EHQA 4MDHA 1UKBA 2R4TA 2HIGA 5IDQA 5CXQA 1FQOA 1UEJA 1H2HA 4LPSA 4TV9B 3F9IA 1P73A 4CG3A 3MEQA 1JHQA 3G0OA 3LUKA 3SYKA 1JILA 3QITA 2MSNA 1M8PA 5EIHA 4WIAA 3M6FA 3HN2A 5FPQA 2QRMA 5EGNA 4BNJA 1YL6A 4Q34A 4L8GA 4RVDA 1OX4B 5EMHA 4B34A 5AQ1A 4DB2A 4KPFC 1W4AA 2KI5A 3C3EA 4TL9A 5IVKA 3I0MA 3I5MA 1KMHB 3M83A 4XSGA 1PDWA 1RXVA 5CU7A 1DCKA 2VF8A 2IHZA 2IBSA 5E6RA 2EEPA 4OA5A 2J07A 2I1VB 2R8BA 1NSFA 2B8WA 1YKSA 3I6ZA 1UQRA 3SSOA 3UGKA 3EFOB 2Y99A 2JCSA 3KPUA 3N8IA 2RKBA 2YHIB 4RF4A 5ALHA 5CDYA 3LRPA 1OI3A 5JADA 1C4OA 5EP1A 2O3RA 1E98A 1X77A 1QQ5A 2DRIA 3HFGA 1KA9H 4FCTA 2DAPA 4ADSG 4YJ2A 5H83A 1R6TA 2DFTA 4X1KA 1RYYA 3D4OA 3NFYA 3Q0IA 5LIRA 1OTHA 2JI9A 2VEDA 4KMSA 5EJMA 3K6SA 2ZULA 1J9GA 3G2HA 1XU4A 4LJ6A 5KWVA 3U4MA 2IXDA 1KJ8A 1BE0A 2FCRA 3MWFA 3DDOA 3KHKA 4Q4HB 3LTEA 1PVOA 4OI0A 1A82A 4G4SP 1CRWG 2Q8PA 3HB9A 2XWSA 5FPSA 4DUYB 1KKUA 2B5WA 4QDUA 1CS0A 3WL7A 3CNHA 3HWRA 5AVKA 1NJ1A 1I3KA 4FUQA 4HTAA 1A5TA 1GYQA 4N6GA 4Y6OA 2FXVA 2ABWA 3ABQB 1XN4A 1LC3A 4N3CA 4XFJA 3RVJA 3QEJA 4Z0HO 3T54A 3W5JA 3RAFC 1K8YB 4R2LA 2FE4A 2QYHA 4JSRA 3R3VA 3MOGA 4OAPA 1XZNA 4WBNF 3T1NA 2YMMA 3A9UA 1MAVA 4URXR 2D0DA 1ZUWA 2NM0A 2QN1A 3ZDBA 4PO8A 2FVYA 4AF8A 2D1SA 2O8DA 1KAMA 4DANA 4GECA 1THGA 3KJZA 4UM9B 4MVYA 1P81A 4WZZA 5EZYF 2DFVA 2I2AA 1DJQA 4EG1A 4DR1B 4Z4EA 3VYTB 1X7ZA 5TMDA 1DFGA 4QQFA 1XFAA 1YZYA 2O8EB 4Z9YA 4D0RA 2X7HA 2Q07A 2DHDA 4TMYA 1I3CA 1OE0A 3PC8A 3V2HA 1NBHA 2H0QA 1T4CB 2EYQA 2H1IA 2I9PA 1H3NA 3FPCA 5DBEX 1FYDA 2G82A 1J97A 3FKSA 4RD3A 5LUAA 4OJNA 5L6LB 4IL5A 1XZ8A 2KYRA 2W4QA 3PXAA 2ZWIA 4K46A 5BMVB 3TDKA 3WVNA 3T3OA 1AGRA 4AJJA 2F8TA 2PLAA 4CV1A 4S1VA 3P9KA 1KAEA 5TEVA 3I0NA 4B3HA 4AP9A 4QUKA 2B35A 1DTWB 3I28A 2ZRKA 2AQ8A 3P1JA 2GCEA 2QL7A 3H1BA 2I80A 4BGDA 3HV0A 4IH9A 3UWMA 4K05A 5TGTA 3TZLA 2XYRA 3KOOA 1D4FA 3TF5A 5ED4A 4DDWA 4V39A 1F1JA 3JQ7B 2YVQA 4JLMA 1X8XA 2VBCA 1KO1A 1PUIA 3IX7A 4LCEA 3CM0A 5EZQA 3S2FA 1OUMA 3N7UA 1TYEB 3GFOA 2ADMA 2OPBA 4J6FA 3ZQUA 1XEAA 1J70A 4PQYA 3NKLA 3UJ9A 1VJTA 1MB0A 2JIMA 2FEOA 3I76A 3PDWA 3PC8C 4FYYA 2XKJE 5FPPA 3VAAA 5IJ9B 2DBYA 2ZBUA 3D4NA 4XARA 2R6CA 4FHCA 5CUQA 4DSNA 4ZJUA 1UQUA 3QX8A 3I4FA 4FLMA 2WTUA 1GTSA 2YXLA 3ZY5A 1B0ZA 5EOVA 1DXYA 2EP7A 3WMEA 4B3DA 3GHYA 5A5GA 1XTKA 1PF7E 4QRIA 1HQYE 2MSCB 1VOTA 4LK2A 3ZZUA 2NNWB 4G23A 2OBMA 1W36C 4F97A 4RUKA 4V24A 3WTCA 4AFNA 1YRQA 1I24A 2AXQA 3PHLA 4II7A 4ESVA 4NCJA 4ZXPA 2G1AA 3CRRA 4S05A 1KEEB 2J9XB 3PF9A 2I78A 3PGKA 1M1NB 4WDRA 2H92A 4XIYA 1EVEA 1ZMOA 3ZN2A 5HK9A 1TE2A 4PXSA 4WN3A 2QTVB 1AMOA 3KZOA 4XFKA 4ERXA 2HZ7A 1HDRA 2NO7A 3KEOA 5I48A 2WHPA 3HFRA 3O75A 1O95A 5IX8A 5HQ3A 4YQYA 2Q28A 5BQ5A 4KYVA 3EIFA 1A04A 3WLKX 3F6RA 4MA4A 4YRLA 3KUDA 4G56A 1PJSA 2C5SA 2E48A 2OV8A 2RCNA 4MZXA 3AVYA 4I4TA 4TYNA 1KC1A 2SNIE 2VKQA 4L57A 1EK6A 4TWAA 2HWUA 4U9IS 2H85A 3E0XA 5HIAA 3T9CA 3PFCA 3GGJA 3JQDA 1A69A 3FW1A 4AF6A 3THXA 1ICIA 2EKLA 5PNTA 1VA4A 4YR9A 2P8SA 2WTMA 1C1XB 2CFIA 2Z5LA 3S2SA 4XSHA 4MVJF 1NLMA 2GBIA 5IPFA 2NU8A 3C4JA 2NT3A 1RM0A 2O48X 3HLKA 3QY0A 1GKYA 5JD5A 1N6KA 3GPCA 3SEFA 2FFQA 4NCHA 4RJIA 2VAVA 4QU0A 1RYBA 3II6X 4W5QA 1BW9B 4IJKA 4RKWA 1KYQA 5IWCA 2B94A 1B1AA 1TJYA 2C03A 3EVNA 4PGGA 4YP0A 2PS0A 2GK7A 5AOBA 5LUBA 4BBPA 2IS4A 1P6UA 1JHAA 4OM7A 1ZISA 3K6KA 3O3MB 4BN5A 1DO8A 1E8DA 2HI0A 2RGUA 3DAPA 3Q6NA 4FDAA 3U1TA 1U90A 3GFRA 4P0QB 2AR0A 2Q4OA 2XLBA 1KZHA 4C0XA 2P5UA 4H1VA 1GPMA 3OLVA 1PEKE 1AQLA 5JSKA 4EY4A 1MO3A 1V1JA 1Z16A 3Q6IA 3VHXA 1HFKA 3KZXA 4AJOA 2NXNA 4LOAA 1BWRA 5C8YB 4JD5A 3NAGA 2P6RA 1R0SA 2ARKA 1UBTS 4DFDA 4BU1A 4TSFD 1DBPA 4ZP1A 1AS2A 1JN0A 2G4VA 3H5WA 2GEBA 3NV9A 4PPYA 4CU5A 1BYIA 5JSUA 2P6UA 2R97A 3A14A 3EIEA 5K2MA 1JZSA 3DZHA 2VJLA 3R3UA 5JDCA 5JNVA 1D03A 4D0SA 5LOVB 1TJ4A 1E2MA 2VWQA 4JUCA 3MMSA 3IT1A 4MVWA 2FX5A 5GY7A 3AKYA 1JECA 2QLTA 1NNLA 1W4RA 1W9MA 2Y1EA 3DDSA 1IOZA 1CDDA 3JQEA 4OBWA 4TQ9A 3M3DA 5HQJA 4JLAA 5EJ4A 4G25A 3ZJ5A 1M73E 2FW0A 2HEIA 1GY8A 3OH8A 4M9XA 5ICGA 3OQOA 3S4YA 1SVMA 2ZRIA 1CC1S 5KTNA 5DK6A 3BXXA 1YCDA 3RO7A 4P0TA 3VKWA 4JXXA 5FAXA 4DKJA 4W82A 3JQ8B 4GQAA 1J4AA 2CHQA 3P2YA 3CPJB 1Z0JA 3UANA 3NB0A 1ITZA 2A14A 3U7JA 5JS1A 2Q2OA 3WOVA 4Z8XA 2ZZKA 4AN1A 3PQFA 5IS2A 1ZM3A 2HNBA 1EM6A 2QQGA 3C15C 2DLNA 5CA0F 2WD8A 1W85A 1ZG3A 2BM8A 1CQJB 4KODA 3SU8A 3C6MA 3RI3A 3NWEA 1C4XA 3UGJA 5FTWA 4XGRA 3BIXA 3MUEA 1U65A 2QAJA 4F45A 4TSKA 3ELYA 1STOA 3RTEA 1IBKB 5JAOA 1HO3A 3O1JC 2O2CA 3QKRB 2PU7A 2XUKA 4OUDB 3FBWA 2JFXA 4MARA 3TNJA 2VJAA 1QTQA 1G5HA 1II8A 3DE4X 1NFRA 4HDRA 4L3OA 4LJ9A 4QO7A 1YDEA 3T1VA 1RJ9B 3K96A 1DBSA 4NS4A 5ALYA 2VQ3A 3F3MA 1NI4B 2FEPA 2OCPA 2GSWA 4OQPA 3V4SA 1V7ZA 1B73A 2QVBA 4OOFA 1ZD1A 2UYYA 3DVQX 4LGYA 1GQSA 4QOIA 4LS3A 1PWHA 4NOLA 1W35A 1EG7A 4DBVO 1W25A 1A0OA 3C2QA 3DBVO 3EOBI 2A9KA 5D01A 3ZI0A 4Q9HA 4B73A 4DEYA 1QZXA 1HL3A 1H4VB 2I3AA 2GN8A 4BNZA 1DTEA 4B71A 4C2AA 1P2TA 2HV8A 1PSDA 3OQHA 4TV8A 4G0OA 4RADA 2JFQA 3WMXA 1RC8A 1ZY2A 1T3GA 3LT4A 3PRKE 1R4MB 1UDBA 2AF3C 4Q03A 3TG8A 4JU8A 3WGVA 4BMZA 4ZYWA 2PR2A 1DG1G 2F55A 2CD9A 4RDIA 5IT0A 2FSVA 1ISSA 4B4KA 5B7GA 4QOEA 5JWHA 1U28C 2QT0A 2R5NA 1QVRA 4G5SA 4RTJA 3RS4A 1EVKA 1VHDA 4DJJA 1IMOA 2QF7A 3D6NB 3LH5A 2BGNA 3BGIA 4EARA 4MVJP 4E5KA 2GN2A 4RK4A 1RMQA 4MW4A 4CT4B 3ROFA 3SKYA 1BHQ1 1EQUA 3QSGA 3L3BA 1E4YA 3AB3A 2J3MA 1D1SA 1VI5A 4Y2JA 2Z1MA 3AU8A 3S1LA 5LMUB 2VYVD 2NOAA 2IHKA 3BICA 1U4SA 3ZCVA 3A9RA 3QU5A 3COVA 2GD2A 2OHHA 4DIMA 5CDGA 2V4UA 4OQEA 3KJIA 1D2RA 1KGDA 1MX5A 1BWSA 3IEUA 2IP1A 5AM3A 1YQGA 4OGKA 3ZBQA 1KS2A 1XAHA 4FYIA 4KFRA 1DV2A 1JLSA 3A04A 3IHWA 4DZZA 3AJ9A 2C9OA 5FP0A 5CCXA 4FE7A 2ATVA 4HFRA 2PL5A 4COKA 2GEJA 4RTSA 1GUDA 4CR8A 4UD6A 1RPTA 4P93A 5EQFA 1S6YA 3DS8A 5ITZA 3N9IA 5CG2A 4PWZA 3NWBA 4MTLA 3CUKA 1EFHA 3HFJA 1TLTA 5JS8A 4BKPA 2BISA 1XE3A 2B6HA 1XEWY 3DE2X 3ORSA 4KRYA 3L0OA 1YNOA 2Q6KA 1NN3A 3C5CA 3I12A 2VF2A 3DHVA 3L49A 3U4HA 4HDMB 2ZM5A 2F1OA 2QW1A 5A06A 6AT1A 1OB5A 5JJKA 2CLFB 4S1TA 3RC2A 3AETB 4WNIA 2WRZA 3RVLA 5AVUA 5FIUA 1BWQA 1JKFA 5ENVA 1V39A 3OWHA 4MGZR 2G06A 1B0PA 3M0EA 5DEOA 2XZTA 4HXFB 2LXNA 4Y2TA 1DFHA 2JFWA 3VZBA 3DTVD 3PFNA 4JP2A 3LKVA 1WPRA 3TSWA 2WUFA 4JLBA 2HV9A 3M2TA 1ZMRA 1U0FA 2YJTD 1EDDA 2WWXA 2HDWA 3DCJA 3EVFA 5EJ2A 5AVTA 4BNFA 3FR8A 1CUUA 2B1QA 3U62A 1QLWA 1YR3A 3CXRA 3EUEA 5DCWA 3TX6A 2HF8A 1FNDA 1V3QE 2J4FA 3DQPA 3MSCA 1KRWA 2P9JA 1KDYA 1XMSA 3OM0A 3UT0A 5JI3E 5JQGF 1AMNA 4ZVPA 4HADA 3HCPA 3O21A 5K3OA 1S8AA 2RGAA 4TMKA 4BV2A 3R9XB 3SAJA 3TL2A 3U0BA 1GXSB 3UCXA 4LHYA 3L7DA 3U9TA 1E2KA 5KSZA 1RRKA 3DFZA 3QHPA 4OUKX 1PJ4A 4CTNA 3DPIA 3N07A 2HJVA 3T9FA 1FUKA 1E89A 2ODEA 4PCUA 1XAGA 5DEIA 2H4JA 3SHFA 1DP4A 1FFSA 3TX2A 3LUGA 1SXGA 4QT4A 2PMCA 5LU8A 2QMOA 2R25B 4MQFA 1PWXA 4WV3A 1GCUA 1KJWA 1T91A 2GPTA 2J9ZB 2PLFA 4NONA 3ZGOA 2A9VA 5ADWA 1G55A 3H9JA 4F4JA 1RHMA 3CLVA 5TNXA 4PHGA 3WGUA 3TLJA 5ELMA 1V2GA 4AJ1A 5GINE 1GCIA 4P53A 3LF2A 4U3JB 3L8CA 2GN0A 3QWFA 1M74A 4IEIA 2FQYA 3A1TA 4BEBA 4H7EA 4I9FA 4XFDA 2IDKA 3C6BA 8ATCA 1QRSA 2H2FA 4RORA 3DEFA 1F0NA 1PWEA 3IKLA 4HQNA 1ZM4A 3M6MD 5CK5A 5AI0A 2XT0A 2I4MA 3JRWA 2GMWA 3LOUA 1P2GA 1PX0A 3C85A 1YZUA 3DLHA 2WM9B 4UCWA 2CB0A 4PQEA 1SZDA 1RHUA 1L3CA 4YJHB 2VO1A 3UJBA 1TC1A 3WK8A 1JHXA 4KV9A 3LMKA 4MLPA 3ND5A 3AB8A 4M36A 3UJHA 1F06A 5FWYA 4OHYA 1U8UA 3ZYCA 1XXHA 3PC6A 4C2UA 2FB9A 3PHJA 1W4ZA 4I36A 5JEDA 3M6LA 3OQIB 4MGEA 1YQQA 5CX4A 3SHQA 2YIMA 4RTMA 3EEIA 2R60A 4LXIA 4N40A 1AX9A 3I9LA 1FTNA 3BOSA 5AQEA 3WHKA 3ILHA 1BHO1 3RRJA 3WYEA 1LWOA 4KOAA 1WZUA 5B2EA 4ZO9A 3COJA 3D8NA 5JDIA 1U7HA 1WMEA 1Y98A 2D3WA 1I6KA 1OA1A 3EF3A 3UV7A 4AJPA 4C43A 5JAZA 5EXXA 4DR6B 3HDTA 1JQDA 1MMFB 1AQ6A 2DPHA 2VF7A 3GRPA 4TSFA 2WVHA 2JGRA 1E6UA 3HBFA 4L3VA 5LQDA 2QM3A 4PPNA 2WIAA 3A9CA 1CY2A 5LB4A 4C14A 2VNAA 3EXG2 5KO2A 1F2TB 1L5NA 3BQ9A 3FJOA 3RW9A 3BCUA 1FJHA 1RHJA 4E3ZA 3PKJA 1W6RA 2LCFA 3NVMB 4YONB 3FNHA 2CK3D 3BMQB 3D8UA 1LNZA 2AEJA 5D85A 3DDZX 3MQ2A 4ZTZB 3R6LA 3AL3A 3L92A 2QN8A 3C7CB 1I9CA 3OZSA 1N1GA 4RMHA 4O5OA 5A6SB 1USGA 5KYVA 4JS0A 4RJ2A 2PDAA 4EQ6A 5KPDA 2Z6QA 1WZCA 3WJ1A 2FRXA 3VR1A 1TA0A 1JSRA 4QEKA 2C78A 4LCJA 3F7OA 2DY0A 2QMQA 4PIVA 4R3NA 4YMVA 1QAQA 3E3AA 2CNWD 2IW1A 4HH0A 4PGAA 4WOJA 2CCJA 3DFKA 4IHKA 4JQSA 3WLJA 1XPRA 1DEAA 3FWZA 4WZAA 4PLWA 3WYDA 3KM0A 4Q3AA 5JDIC 3KAJA 1XJCA 3DB1A 3FROA 3MXTA 3GGSA 1AGNA 1TIKA 2GTPA 4PCAA 5DV9A 3ZWQA 2WJHA 3AEKB 3BEDA 3LSTA 1X2EA 2IU6A 4V0KA 4D3ZA 2G9QA 2V7QD 3VMMA 5EP4A 1CWUA 4EY8A 3DOEA 4XOIA 3KZMA 4B6PA 3CBQA 4JI3B 4OJYA 4O0LA </