1JLKA

Crystal structure of the mn(2+)-bound form of response regulator rcp1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
141
structure length
141
Chain Sequence
NPPKVILLVEDSKADSRLVQEVLKTSTIDHELIILRDGLAAMAFLQQQGEYENSPRPNLILLDLNLPKKDGREVLAEIKQNPDLKRIPVVVLTTSHNEDDVIASYELHVNCYLTKSRNLKDLFKMVQGIESFWLETVTLPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator RCP1
publication title Crystal structure of a cyanobacterial phytochrome response regulator.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Signaling protein
total genus 47
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jlkA00
1NXVA 5F64A 5EWMB 1PEAA 2R48A 3T38A 3FFTA 2HJ9A 3E3MA 5TPWA 1ZVVA 2XDYA 2MYTA 3QLUC 5TE9A 2FEKA 2Q5CA 2WY2D 4JB2A 4XARA 3BILA 3CG0A 3OO1A 1VLZA 1D5WA 4H60A 2WRZA 3H1EA 1ISSA 3RVMA 4KFCA 2PAFA 3LKVA 4MAAA 5KQMA 3JS5A 5DLEA 3EULA 4ML3A 3VNBA 1KRWA 4MS3A 4MRMA 2DRIA 2O20A 4RZSA 1M5UA 3TX6A 1USIA 3OM0A 5IUNC 5FBHA 3JY6A 3L6UA 4Z4GA 4EUKA 3TO5A 1A0OA 3HM9A 1YS6A 5HSGA 2P9HA 3MA0A 3QLUA 4IMIB 4XXHA 1DCFA 2LPMA 5CNKA 3IDOA 4KQCA 3O2SB 2WJWA 3A0UA 4PYRA 5EWLB 3IP9A 3CLKA 3C97A 2MSKA 3N6VA 3HCWA 3OMXA 3Q41A 2CHFA 2GI4A 3BRQA 3HS3A 1DCKA 2PUDA 1JDPA 2FW0A 1QP7A 2A9OA 2R47A 1ABEA 3GRCA 3A3KA 2E4YA 2GX6A 2LBPA 3EGCA 3FMVA 3OQNA 2FMKA 3OQMA 8ABPA 3QELA 3N75A 1LJLA 1OXKB 1W9HA 1LBHA 2LUOA 4YR7A 5IUJC 3MM4A 3MMNA 3O21A 4IMJB 1DRKA 1JFVA 3H6HA 4YCSA 1M2EA 1RPJA 4KRFA 1GLGA 2B1JA 3DGFC 1JF8A 3KLNA 4YLEA 2TMYA 4MR8B 1RNLA 4NICA 5IEJA 4N0PA 4P1ZA 2FVYA 1DBPA 5IEBA 3JPWA 1H9CA 4TN5A 1Y1LA 1C4WA 1DJMA 1PNTA 4MR7B 3OQOA 1USGA 3OLWA 2QVGA 6ABPA 5IUKC 2QXYA 2IDMA 4ETNA 3DLHA 1QO0A 1ABFA 1URPA 2PL9A 4OG2A 4ZPJA 5D2CA 4Y9TA 1SD5A 2FEWB 2L17A 1D2AA 4WT7A 3A0RB 1P6UA 3H5TA 2E4UA 1W25A 1P2FA 2CHEA 4E7OA 2JVIA 5HQJA 4IRXA 3Q15C 3C3WA 5CNIA 4RXTA 1PHRA 5IULC 1MB0A 1NATA 4QYWA 3URMA 4EYGA 1DCMA 5PNTA 5EWJA 4MR9B 3SAJA 1F4VA 1BDJA 4RK4A 1E2BA 2MYNA 4EVSA 3S99A 1K68A 1ZHHA 2IOYA 4RS3A 1JX6A 2VK2A 4PZ0A 2E4ZA 3IPAA 1LBIA 5BRJA 1JWLA 5JNRA 4F11A 1Z13A 2IPNA 1CHNA 5EWMA 3FDFA 4IILA 6CHYA 5IX8A 3HO1A 1D1PA 2MYUA 1XWWA 4P98A 3JTEA 2RDMA 4LDAA 5HM6A 1E6KA 3C6QA 2ID9A 4PE5B 4RY8A 2BGGA 4MYRA 3QEMB 1L5ZA 3GL9A 2MSWA 4Z4HA 5FWYB 3SM9A 3O74A 4RK0A 3CKMA 3KCNA 5JNTA 1KMIY 1DBWA 3FFWA 3SQNA 2B4AA 3RVKA 1QO0D 1HEYA 3E61A 5KQLA 4Z9AA 4RY9A 3FGZA 2IKSA 3M9XA 4Q6WA 1NXWA 4KZKA 4TLMB 5TPZA 3O1HB 4FE7A 2P4UA 3H5VA 3H5LA 4JA2A 2CWDA 1Z16A 3K4HA 5EWLA 4L85A 4Z9BA 3FFXA 5B3JA 3A10A 1NXOA 1Z25A 1ZDMA 3Q7RA 3QLTA 5TQJA 1GCAA 4PEVA 3QK7A 1DP4A 3JVIA 4Z4CA 2QW1A 4RKRA 3TB6A 3T6KA 1NXSA 4G0YA 3T95A 2IPAB 3RQIA 2X7XA 4HYEA 1NXXA 3TMYA 3N0XA 2AYZA 7ABPA 2ID7A 1BAPA 1Z12A 1JBEA 4D74A 1E6LA 1YK1A 3H75A 5TQ2A 1RZRA 1JFTA 3RVOA 4H3KB 1T34A 4NQRA 3QX9A 4D6YA 3IPCA 3G1WA 1SXIA 2VUIB 3H1FA 3KLOA 3LMKA 1ZH4A 1EFAA 5KC8A 4RK6A 4N76A 4LE1A 3EAFA 4MR8A 3P9YA 3C3MA 3N0WA 2WMYA 4GPAA 3KG2A 1P8AA 3OO0A 4LZLA 3HXMA 1M5TA 3C3KA 3RVSA 1DRJA 5I4CA 3D02A 1JYEA 1D4ZA 4RDCA 3Q7SA 3RVQA 4KV7A 3TD9A 3ROTA 4MR7A 4WUTA 3CHYA 3N0RA 1JFSA 2A9RA 3H1GA 3B2NA 2MYPA 4DQDA 3H5IA 3GYBA 3KHTA 3H5WA 4MLDA 3CZ5A 4EVRA 3GBPA 3OLVA 5BRAA 2ZWMA 3QLVC 2E4XA 2JCGA 1U04A 2R25B 5KI6A 1TVMA 4ZYLA 5KQPA 3CFYA 2MSLA 3O1IC 5JS1A 5TQ2B 3G85A 2PUEA 4NCAA 1NY5A 1RXIA 2FMHA 3F73A 4WXMA 5CNJA 1BDHA 5C5CA 3R0JA 1WETA 3IP7A 3UK0A 2FN8A 4JOQA 3MF4A 3SY8A 3F7NA 5HKOA 4MR9A 4Z4IA 3M6MD 4Z4FA 3DLBA 3HJFA 2JBAB 1S8NA 4YWHA 4KMRA 4IGAA 5TQ0B 4B09A 5FWXB 3QEKA 1VRVA 2QU7A 4S04A 3HK2A 1JH9A 3QLVA 4JP1A 1QNLA 1AB5A 1UDRA 1ZGZA 4G0PA 2HPHA 4E7PA 3DZDA 1Z2DA 3NNSA 2V0NA 3QX8A 2PUCA 1NXTA 1A2OA 1AB6A 1DC8A 2NZUG 1YTUA 4WZZA 1LK0A 4KQ9A 2HQRA 1FFWA 3GT7A 1U2QA 3QEMA 1DG9A 1APBA 2GKGA 2NZVG 1BDIA 4F06A 1USKA 5FWYA 2HSGA 3BREA 4OATA 2FQWA 4S05A 1Z26A 4KREA 2L19A 1EHCA 1IIBA 2FMFA 4JAVC 1QP4A 1U0SY 1SXGA 2WJAA 4DADA 2IYNA 2A9PA 2H3HA 5BR1A 2JK1A 1ZITA 3M9WA 4OTZA 3KSMA 4UHKA 1LJUA 3KS9A 3LFTA 3JVDA 1C0EA 4W5OA 1B00A 3HUUA 1EWVA 1NTRA 2JB9A 3UKJA 4EGSA 1DC7A 3O2JA 3HZHA 2QV0A 2W42A 2WB4A 3Q7TA 4HNSA 4YRZA 4KNYA 3EDCA 4G0ZA 1Z17A 2LIVA 3VNAA 1PNRA 1FFGA 1ZH2A 4L4UA 1Z2EA 3MQ4A 5KQGA 2PMCA 5B3JC 5DKFA 4HNRA 3NNNA 4KK4A 5C5EA 3BRSA 1D1QA 1QPZA 1TJYA 3LUKA 2FMIA 3RVPA 3NNDA 4MGEA 3LUDA 4LE2A 4RSMA 4EVQA 2NUBA 2OENG 1EAYA 1ZESA 2AYXA 3LUCA 4G0OA 4W5TA 1E6MA 1YMUA 3HUTA 1KGSA 4RWEA 2F8TA 1K66A 1YMVA 3KJXA 2N9UA 3IP6A 2FKAA 5JNWA 1XHEA 4G86A 4JASB 4WWHA 1QP0A 2R4QA 3HEBA 4O1IA 1F51E 2L18A 1J56A 3CU5A 3RVLA 4XLTA 1QKKA 2FLWA 3EQ2A 4MPTA 2QSJA 2PJUA 2F8SA 1ZY2A 4MQEB 4HNQA 3I5AA 1SXHA 3KTOA 2YHAA 1BVHA 1Z15A 2OQRA 4M88A 4F8JA 4ETIA 3W9SA 2H0AA 2FLKA 1PUXA 1Z18A 4CBVA 1GUBA 1SRRA 3CG4A 3KYIB 3NBMA 4MS1B 3OM1A 3H5OA 4MQFB 4RKQA 3I42A 4N0QA 1CEYA 5DCLA 3GV0A 3O1JC 3ILHA 3OLYA 2FQXA 2JBAA 4JB0A 3H6GA 2L2QA 4YS6A 5E3JA 2E4VA 5IBQA 5CNMA 1FQWA 5TQ0A 2FXIA 5FWXA 1OXBB 2PKXA 3GA5A 4Q6BA 4RU1A 3UUGA 1PEYA 2HQBA 2PL1A 2FN9A 5TPZD 4ETMA 1QQAA 5GQSA 4G0XA 3SG0A 4O5AA 4MS4B 5KWSA 4RK5A 3NHZA 4FB4A 2PUGA 3K9CA 4G0MA 3KKEA 1GCGA 1R8JA 2JVJA 2NT4A 2RGYA 3LUAA 3LUFA 3RVRA 5CHYA 4O1HA 4W5QA 1P6QA 5TPWB 3LUGA 4ZMRA 2M1ZA 3LUJA 4ZMSA 5DGCA 4GNRA 1JL3A 4FE4A 4MLCA 1YVUA 3EQZA 3LOPA 4XFKA 3SNKA 3HVRA 3DGEC 4LX8A 4OLAA 1KRXA 2PE5A 3MYYA 3MIZA 1EWKA 3BBLA 4RK1A 4EYOA 1CYEA 2GWRA 3OLXA 4NV3A 4MS3B 3OLZA 1RZRD 4MRMB 1TLFA 1JDNA 1QQBA 5DTEA 2RJOA 5FBKA 3GWGA 1ZAYA 2IPMA 3NHMA 3CNBA 1YK0A 4N41A 1A04A 4N03A 2FQYA 3ILYA 2CD7A 3O75A 4D6XA 4QYMA 5ED4A 1RXEA 2QVCA 2FEPA 4OLBA 1YS7A 5BQ3A 9ABPA 1DZ3A 5JS2A 4DN6A 2PUAA 1BA2A 3L49A 2ZAYA 1FSPA 2YHBA 4XAQA 4W5RA 4WXEA 3LUHA 2WWVD 4IF4A 1DBQA 1JYFA 4RXUA 3GBVA 4XASA 2A9QA 2HQOA 1NXPA 2I6FA 3F6PA 4Z4EA 1ZN2A 2FSPA 3Q9SA 3EJWA 1EWTA 3QELB 4ZJPA 4LRQA 1FFSA 4EY3A 4F12A 4G0QA 2RJNA 4OBBA 3F6CA 2FTKE 3LKBA 3KYJB 1I3CA 2NT3A 4G97A 1YIOA 1MB3A 4YP9A 1XHFA 3HV2A 4KPYA 4LDZA 3T8YA 3RVNA 4KVFA 2PUFA 3N53A 3IP5A 4MQEA 1VKRA 4RK7A 4PICA 2JRLA 2VUHB 3CTPA 1GUDA 1L5YA 4W5NA 5T7BA 3RH0A 4RV5A 4EYQA 5JNSA 4RY0A 2E4WA 3I45A 3N8IA 4Q7EA 2JVKA 1ZGGA 1TM2A 3HDVA 4NCBA 3OMWA 4RXMA 3I09A 4MS1A 4MQFA 5GOTA 2IPLA 1MIHA 3CZCA 1ISRA 4UHJA 4YO7A 4Z99A 2GBPA 4F3TA 2J48A 1TMYA 2QZJA 3RVJA 2M98A 3DBIA 4QPJC 3EODA 4Z0NA 5ABPA 2QR3A 1M2FA 5T3YA 2KYRA 5JNUA 1VPWA 4QICA 1QMPA 5KC9A 4LE0A 4H3HB 5JNVA 3CS3A 4YV7A 4KK3A 1JHZA 2VYCA 3ROFA 4TLLB 5EWJB 1MVOA 4TMYA 2PUBA 3HDGA 3JPYA 4N47A 1MAVA 3D8UA 4EYKA 3LTEA 4MS4A 1U2PA 1JLKA 5IC5A 2PLNA 3CRNA 4YGXB 2LP4Y 3O2QB 1U8TA 3HSYA
chains in the Genus database with same CATH superfamily
4RVCA 1W581 2OCKA 3BGOS 1E6CA 2R48A 1GA1A 3QY9A 3T1NA 2FLVA 3JWEA 4G85A 2J87A 2JRCA 5BT9A 2DX7A 2QOEA 3T38A 1RCUA 1XYVA 3PCXA 1F6BA 1ETHA 3A6PC 2QZPA 4V3CA 1FFBA 1JZTA 1XZNA 4JB2A 5J47A 2BHRA 3CG0A 3GLHA 5JC8A 3HJHA 1D5WA 3GAMA 2O7QA 4A8JB 2NU8A 1LFAA 1RLUA 1VMIA 4LBYA 4E14A 2NYVA 2XCTB 1CY2A 3KLPX 3UGKA 4M7RA 1UKAA 5E95A 5EZ5A 1RYMA 2GBLA 1FSSA 1NVMB 2VT3A 3I8SA 4G1EB 2J32A 4B3GA 3BMNA 2R00C 3ND8A 3T5MA 4YMHA 4CEJB 4RNDB 5JMWA 3PE4A 4XDHA 3I05A 3HVUA 2R6HA 3C6ZA 1EGMB 3SSNA 3P2OA 5DNEA 2H7XA 3IUSA 2A14A 2VDKB 4WCDA 5FPHA 5IDXA 4FHZA 4QUGA 4ECAA 4ARAA 1QXSA 1UBJS 4HN4B 1MC8A 3CX3A 2GNAA 3T4XA 2HXSA 3R8FA 2P9HA 1G6KA 2GPAA 3D1VA 1EA7A 1DCFA 4WV3A 1V6SA 4DA4A 3PIRA 1J33A 3G6WA 521PA 5CIQA 4CTNA 4INAA 2GAAA 1OBHA 2OV8A 2BFEB 2RK4A 5EWLB 4WSOA 4L0MA 1SUDA 2PBRA 4B81A 3SD7A 3QI2A 1ADBA 2EARA 4DLTA 4OOFA 3E9NA 3SFVA 3HS3A 2GSWA 3MJEA 5BNZA 1DKUA 4D0SA 3SYRA 2FK8A 4P7GA 2PV7A 1U1IA 1D9XA 2A9OA 3MS2A 4CODB 3C3JA 5JQGF 4OUKX 1OKKA 2V03A 1L6RA 3WVNA 1AHIA 5JZOA 3KVVA 4F5ZA 2Q1UA 4HTFB 1H69A 1S1CA 2AN1A 3AKEA 5KDOA 3QPVA 1QANA 3T9BA 5KPDA 2Q8NA 3NYWA 2VP3A 3MMNA 4L1KA 4CGYA 3M6LA 3OECA 3W8DA 1JFVA 3ROEA 1SFRA 4KRFA 2X0RA 3AHCA 2B1JA 4HI0E 3W7BA 2LE0A 3L7KA 3GLFB 2XRZA 5C8YA 1FYDA 4QJ5A 5CB4A 1H6DA 4OHZA 1HKHA 4QWWA 4C7OA 2FA9A 2Q5JA 4MB6A 4PRKA 1FC0A 4FFBB 2Q3MA 4B8YA 2NU7B 1C0PA 4OHXA 4IDHA 3CQ9A 4LKRA 5HUQA 5JG7A 3FETA 1US8A 4MW1A 3WGVA 3AH8A 4Q3EA 2GK6A 3GXOA 3OTWA 4LVOA 4MWDA 4X1YA 3K71B 4G36A 5CXUA 2XYVA 4MP6A 2QXYA 4NHOA 4FONA 4XJSA 4DV1B 2IDMA 4P35A 2BJHA 1VJ5A 2P5SA 3BDVA 3RFXA 3WGNA 1SBHA 4OCZA 5BR8B 1EXMA 2FWPA 2SBTA 3GEHA 1ID1A 4OHOA 1P6UA 2I7VA 3DZFA 1BNCA 3WKDA 1HY3A 3OQVA 5GZ6A 1WXEA 3VH3A 1X15A 2IPOA 5IASA 5KYNA 3EXFA 1R6UA 5CNIA 2IHNA 3V1LA 4I5GA 4RXTA 4HZUB 4GKVA 1GFZA 1M8JA 5T8KC 5FWNA 1JR3A 1P7VA 5PNTA 3DD5A 4MR9B 2NIPA 2WE8A 3P20A 4RK4A 3RANA 4EW1A 1EDEA 1E2BA 4RD2A 3K1JA 1N7JA 2VJLA 4L9AA 2O6LA 2GFHA 2TMKA 1DWUA 1FYVA 1GG8A 3NIBA 3FPGA 1AQNA 1RJEA 2PEYA 5E7MA 4RCZA 1R27A 2BLNA 3W9BA 1PT7A 3OM9A 1KI4A 2OQVA 2PPVA 1BFKA 3GN1A 2RGDA 3JTEA 1M67A 3FCUB 2AMJA 3BKXA 1XNQB 4GPEA 3OKAA 1TRHA 1QYWA 2OCAA 3D3WB 5IWCA 4PLWA 5LP1A 1CVLA 1XF1A 3TAUA 1X8JA 4C6RA 1ONBA 2BBOA 1HORA 5IFLA 3EW7A 2P3SA 3EWSA 4EB8A 4OGWA 2V7WA 4L4YA 5EY5B 4Z4HA 2HPAA 1BKDR 3A9RA 1UFRA 4OBXA 5HGXA 2YWFA 3KCNA 5D87A 1FP1D 5I4IA 3DTTA 4CCWA 4EJFA 5A05A 2YHUA 5DMHA 1LH0A 4DR1B 1E5VA 5J3JA 1P9WA 2YIVX 3AHDA 2QLMA 4KYUA 1Z0DA 4ZI7B 2QG9A 3AM5A 3JQ8B 1SVNA 2HMUA 1J0XO 4FE7A 1FNSA 1KO4A 3FCEA 2NWQA 1IRXA 4IL5A 1KJNA 1Z4JA 3C98A 2GD0A 1E79D 3QJGA 3NOXA 4OJQA 5A06A 4G8BA 1PJAA 1CB0A 4KO4S 4XVRA 3Q7RA 1XRPA 2M9MA 4MRRA 2OOKA 2PLWA 4CM9A 4URUR 5DNCA 1DMRA 1RQ2A 2XNCA 4IG9A 5G0UA 3T0FA 4ZYVA 3TB6A 3T6KA 1LDMA 1NXSA 1XHLA 2XCLA 1J8FA 4BS9A 4WXYB 3AF6A 3RQIA 3HYCA 1G3IA 3N0XA 4TVOA 1KZ1A 1UAGA 2VHTA 1C9KA 5G3YA 3OY2A 2PCLA 3CEHA 3RVOA 3VNVA 4QC2A 2HMAA 3OFSA 3ET5A 2GBCA 4O4IA 4FDLA 4Q1VA 3QU7A 121PA 2A30A 4RVDA 4BO7A 1VE7A 2O2HA 5KX5F 5EKTA 1EFAA 2CDNA 2QYHA 2CFTA 3IEUA 5CFMA 1H2ZA 4XYBA 4YDHB 1CEQA 1MVLA 4Z8XA 1GPLA 4UU1A 1NJSA 3HXMA 1ZD8A 1KI6A 3U7JA 2COKA 2W9XA 3WB0A 5F9HA 4M55A 2QMEA 3QTLA 3BXPA 3GCDA 3H5IA 3R0VA 2HIMA 4QRDA 3ZTTA 4DMHA 4E2ZA 4AO8A 2G9ZA 2JGIA 1I9CA 1O94D 1R0YA 1V26A 1W47A 1X19A 2ZWMA 1TZKA 3C1OA 3CGWA 4PVDA 1CRZA 5AO9A 1MA0A 4EI9A 3KQHA 1S6YA 2WSIA 2H65A 3B70A 4O2AA 5JS1A 1M2JA 1KEUA 3K2EA 1MFPA 1UIMA 5AQ1A 3PWZA 3EX7C 3S2IA 4IXTA 1NUTA 4HWOA 5T3UA 1YBFA 1V7QA 1IXSB 4FN5A 5JSQA 3HACA 5KAMA 2B5OA 2WIFA 4U7HA 5TMEA 2JGNA 2EXXA 4QPDA 3IURA 1K7SN 4U6QA 2P2NA 1CIPA 1UZLA 2PKRA 3O8QA 4ZV9A 4ARVA 4N3CA 1QE3A 3GP8A 1TQDA 3DJFA 3DPUA 3K6JA 4P4NA 2IYTA 1Z38A 3A4NA 3NJ4A 1ZN8A 3A6FA 5TS3A 1GAWA 1G7CA 1LV8A 2MT9A 3GJXC 3H8VA 5SYNA 4U00A 2VXCA 5BMVF 5JJIA 2QD5A 2Q5OA 3ODPA 5BWNA 2C8VA 3R6LA 1TADA 4TKZA 1CY0A 2PKQP 4Q9NA 1PX0A 4TWBA 1O77A 2VJPA 2GN9A 3NWPA 4KFTA 4NNOA 1X8LA 4US0R 5JROA 5AHXA 3O93A 3REFA 1J5EB 3A4IA 3CMCO 3IPYA 2AX4A 2H4XA 2UZ1B 1JPUA 1KYYA 3LPAA 4KO8A 4YQZA 4ZVNA 4B8ZA 2PR2A 1H93A 5ICFA 3BIWA 3EGDA 1NTOA 1GA6A 2VSFA 4PNHA 5I7SA 5JRDS 5I47A 1J0CA 3QV2A 4ZREA 2ZRQA 1OAOA 4QEZA 4JYMA 5D3ZA 5EP1A 1WB4A 2FEXA 4Z1OA 4JAVC 2F59A 3OZSA 4KTVE 3CX8A 4AU1A 1FDOA 4DV3B 3JQ9C 1LS1A 1TZJA 2VDJA 3DMGA 5FL3A 4TYNA 2PT7A 4Q3OA 3B6IA 3U4GA 2Z1DA 1N33B 3U2QA 2EKQA 3OTQA 3VO1A 3KSMA 5ICSA 2RG7A 2CEAA 3UOWA 3TPFA 4ME6A 1CERA 1PFVA 3ABOB 4MRAA 2DM6A 3EQ7A 9ATCA 4R9NA 3GAFA 3V1TC 2B0JA 3F46A 5FPPA 4JKYA 4YRZA 2Y3IA 4QG3A 2REQA 1YA6A 3E5HA 4J0DA 4KNYA 3R9XB 4QARA 3OFKA 1O97C 2YZMA 1DS6A 3QPDA 4GVLA 3RC3A 1YAHA 1L4GA 4BX0A 2XUJA 3SHWA 4C4YA 4EH1A 2JCSA 4IF6A 2YJTD 5DKFA 4AVYA 3G2OA 2O2ZA 4KVAA 3KOXA 2BI8A 4WY2A 4BZXA 3BSYA 4PRYA 1L7DA 5K4AA 1TECE 4Y9DA 3TI7A 2HUPA 3ZHRA 2FPPA 1ORRA 4KGVA 2LCFA 3DL0A 5FBLB 3EVTA 4ZEWA 3IDQA 1Y6FA 1SHLA 2VUUA 1WBJB 3AGPA 5BY2A 1A98A 2XQIA 4ADSG 2YS6A 4K40A 4Y6SA 3HN6A 1VKZA 2J5KA 2M6LA 1Z0JA 3B12A 3PD7A 1JSRA 2ONJA 4ZJUA 3CEJA 1NZJA 3PDCA 1NBIA 2YUTA 3CLVA 4BB5A 2HT1A 1EVKA 4FYKA 2Y1FA 3ZXUB 4D3SA 4KITB 1II9A 3A9UA 1SQGA 4K2AA 3NZEA 5JBQA 4RTKA 1CS0B 1J56A 3SR3A 4KE7A 4RQTA 4ENRA 3W5CA 5A9SB 1I33A 1G21E 1QCCA 2WM2A 3KQPA 3P19A 4IVPA 3RVDA 1ZY2A 2XIQA 3U9LA 3B5IA 5C8ZA 1G7TA 3LG2A 2QM8A 1LPPA 1ZM7A 2VQ6A 4N18A 3V3TA 1SXPA 1AKEA 3D64A 3TEFA 1XEAA 3UC9A 1FU7A 2ZXUA 5BQFA 1E7WA 2NZJA 1IM5A 2GO1A 2C7OA 1JEQA 5U4QA 4W99A 2GXQA 4MINA 4PQEA 4EG5A 1LSSA 1Z7EA 5G0VA 5JMPA 5KNLA 3RJ5A 2WPDD 5IN4A 2W90A 2G9NA 3PL1A 1TFUA 2XUPA 3RRNA 3UMRA 3GV0A 2QNIA 4J0JA 4P84A 3O1JC 4A4DA 4CM8A 5DBOA 3HV0A 3A9VA 3DLIA 1JDJA 1D4OA 1I3KA 2P2LA 2VR1A 3GD5A 3AJRA 3L5OA 2D62A 1ZAKA 1T2AA 3LSTA 4MPDA 3IVXA 4HRYA 3LWBA 5GY7A 1PZEA 1C7IA 2PKXA 5ADUS 1Z5PA 1YFJA 4RKFA 2CBGA 1JAZA 3VA7A 2DKOA 1AUVA 2V6BA 5AXBA 3VOSA 3WL6A 4JUCA 2A3NA 3GPBA 4EA6A 5KKCA 3WZMA 1ODIA 1H4SA 4K9MA 1H0KA 3DMTA 2EWVA 4PF1A 5BSTA 1NBHA 1XZMA 1CDZA 4PO1A 5KMGB 4ARZB 1BXGA 3UCFA 3U44B 3M82A 1GCGA 3LUFA 4FQ7A 3QYAA 3LT4A 4CCYA 4O1HA 4LA4A 4EFLA 4MGYR 3KR2A 1ULBA 1EX6A 1V1RB 2M1ZA 3FVRA 4RGYA 4F84A 1L2TA 3R3YA 5JD3A 4H1UA 3HYTA 3KQUA 1IPFA 2OB2A 2EG5A 4KDEA 3RAEC 2VAPA 4MCAA 2FEOA 4O4HF 3NYIA 3V7YA 1AZWA 5THKA 1KZGB 2EQ5A 3VZSA 4MGKR 4X6YA 2Q29A 1M6HA 4H08A 1XXHB 1TTTA 2Y4NA 3TQQA 2RGEA 2VAXA 4PTZA 3NHMA 1ZI9A 3ACCA 3ZDCA 4UTXA 1NW5A 5BUZA 5ALHA 4RDXA 3KKKA 1K8RA 3I2GA 1YQEA 2B4RO 2BJWA 1UZNA 2HA5A 3HWX1 4G5HA 2YBDA 1JAYA 1I5EA 4JWTA 2D3WA 2V97A 4WFIA 1C1XA 1ZA2A 2H2GA 1C9NA 1KAQA 2I65A 2J9YB 2QVCA 4QVGA 1ATIA 4D44A 1ZGCA 3EIQA 5C1PA 1VHQA 5CFOA 3BE4A 2JZOA 3TRJA 1C3OB 3W79A 4E30A 1XK7A 4FOPA 1RXSA 2QSZA 1SKQA 1WQ3A 4RZ3A 3ZGYA 4I4LA 4OBEA 2OO5C 5I48A 4O2BA 2DT8A 4DIDA 1DBQA 1O96B 4JI5B 3KKZA 3MUNA 3C4JA 2ZYGA 3S2FA 1OLXB 2Y6VA 1A9RA 1K6EA 2PJDA 1KL7A 1PQ4A 5DM70 1ZD3A 5C4GB 2ZI9A 3STVA 2CEKA 2GPSA 3Q9SA 4ZYYA 3WL7A 1W85A 2YN2A 1IBRA 2GYWA 1NUPA 1GTMA 3CLUC 3ER6A 1KDZA 3RSFA 3IHWA 4WFQA 5LP6A 3P2IA 4P58A 3K73O 2CYAA 1IN5A 1TXGA 2J08A 4US1R 2YASA 4RIGA 3RFFA 3R4VA 2Q6IA 3LT1A 5FNVF 5GGYA 3JARA 5LYJF 3FY4A 1V0JA 1CD5A 1UF9A 2BJVA 2QRPA 3E18A 1KMHA 1UOQA 4S1VA 4EMSA 2BCEA 5A4AA 3ZWPA 3RSLA 5IWAB 4JP8A 3PEUA 4XLZA 1GTG1 1CR1A 1T9ZA 1U2EA 5A1JA 3CKYA 4WZBA 4IDEA 4WBSA 1B2RA 2JLCA 4EYQA 5B6PA 1V6AA 4YVFA 4EX6A 4X7RA 1ZGGA 2DYKA 4IAOA 3FUXA 7REQB 1BXRB 3NKLA 4NY1A 4LOLA 2JFHA 1HR0B 4J29A 4CIAA 1JKXA 3EE6A 3KM0A 3N2KB 2J9RA 3CSSA 1NRJB 1T4CB 1SUPA 4F3TA 3KV3O 4H17A 1RC8A 5DRYA 1EWYA 4WD3A 1E9AA 1KETA 1HEUA 3MT9A 3QOWA 4QJIA 4B4DA 5TMPA 2OXIA 1FS6A 1NBOA 3DBRA 5LXTB 1L5KA 3R7SA 3VYWA 2JIBA 1ISHA 2XWJI 3C48A 4AQDA 2BFFB 4JJGA 1QV7A 1Q21A 4YCAA 5BQOA 2EP7A 3D2BA 2HI0A 3KQTA 2R3SA 4WKPA 5KJEA 4TSKA 5T4BA 3UAVA 1EGHA 4UXIA 3HCEA 3R5SA 5IM5A 3GH3A 3DXXA 4YRPA 4M8IA 5JISA 2PCJA 5K3BA 1EZ1A 4GRIA 4OHRA 4XM1A 1K8QA 3CRNA 1FA9A 3ZCTA 3GZ4A 5I9IA 2WJ4A 1IONA 1U8TA 4A5OA 3AZOA 1CJKC 1ESEA 1PE0A 4ON9A 1KYTA 2I4TA 1FMTA 4UU0A 2HXGA 4MRVA 1ZZGA 3R9IA 3QVKA 3AUKA 3LM8A 4GH5A 4O4LA 5BV7A 4JJ4A 3QMWA 3D6NB 1VLZA 4W8GA 3EA5A 5EMLA 4C6TA 4EJ0A 1QOPB 5K3DA 3ZWAA 3ZLJA 1UMCA 5BXQC 3RC1A 4JL5A 4P86A 2V65A 1U9CA 1XCJA 4ZCLA 5H3HA 4ML3A 4MUEA 3EGVA 3I1JA 3K94A 1XROA 4REQA 3TKLA 3WGLA 2P9BA 2WYIA 2IUYA 1P1BA 3KEQA 4FMCB 4ZDJA 5BNTA 2MSCB 2JI9A 5IDQA 3U48A 3FPFA 2NU9A 4IXNA 1AV6A 4WK4B 5DHTA 3M6FA 4NSNA 2QD4A 5IJ0B 4DA8A 5K09A 3CLSD 4J1SA 5IS2A 2BM8A 1PNQA 3H9UA 1A0OA 1JEAA 3RT9A 1Z9BA 2OLKA 1TYZA 1TA0A 2OE2A 1ODTC 4MUYA 3EVZA 4UAUA 5F5LA 4IMIB 3WLNA 2P41A 3TIGA 4FILA 2E2WA 1OXXK 1FX1A 3NM4A 5CNKA 5IARA 4COOA 3IDOA 4DLWA 1NF9A 3AIOA 3M5PA 3MS7A 4K05A 1ESDA 1E9CA 1WMAA 2JFYA 4K6MA 5CDGA 3IUMA 4RMHA 4V0MA 1J2EA 3DNPA 1QKJA 1VZ2A 1YB7A 2ZU0C 3E8SA 3VX4A 3EG5A 2IZZA 4ERNA 3IOMA 3ZKWB 1A5TA 2CNKA 2GN2A 1XD2B 1W6UA 3MMSA 3B7GA 4B31A 3LJKA 2WWRA 1MH1A 4HNAA 1VE5A 1U3WA 4HMPA 4K0RA 4WCFB 1NONA 1Z83A 4I7EA 1AA6A 2FPXA 2GX6A 3HO6A 3O38A 1KFEB 1M8KA 1M1YA 1RE1A 1YONA 2QRVB 4FEYA 4R71A 2UZ4A 1TJNA 4FHFA 2GZ2A 2I8LA 3DDSA 2C5LA 4NC9A 3SBDA 1M2HA 4ER3A 2PX5A 4XOIA 3L2OB 2XZOA 4Q7MB 1TQ2A 3JR3A 2EW2A 3IMGA 4EECA 2RHOA 4UE6A 3TQHA 4MPRA 2WQ6A 2C4NA 1W4CA 2WYOA 1V1MA 1SUCA 4P1ZA 3UFBA 4GBGA 1DAIA 4PC7A 2YCBA 4M53A 5LVAA 2O14A 1OASA 4V2IA 3P9IA 3S2GA 4AN0A 2IV3A 2IH4A 3V80A 1GCOA 2EBUA 3Q98A 4KN5A 3BQMB 4GOOD 2E9SA 4HDAA 4MW6A 5ERXA 1VKHA 2QN3A 4NBVA 4OXXA 1QAOA 3DBHB 2FSVC 2J59A 3D0QA 1II8B 3BEDA 4I1VA 4W7SA 1HDCA 4S2UA 5EIFA 2Z6QA 1BXKA 1Y3HA 1DAMA 4BNZA 5HP4A 3PNQA 5F77A 1QO0A 4BNTA 2FZWA 2WUGA 2IYOA 4HAVA 3WLIA 4QDUA 3F2IA 4IZHA 5BXYA 3WA6A 1L3CA 3L8FA 2XKJE 4AT1A 4MKGA 2NVWA 5IULC 1ZK2A 3KZNA 2VCHA 3DZHA 1QVWA 3ONFA 3CIFA 4RF4A 4ACAA 1LVHA 5KKNB 3JV7A 4ARBA 1P18A 2BKXA 3I2JA 5C37A 5EJ4A 3E3LA 2Q5FA 4RENA 1WZUA 2ZEJA 1GYPA 1EGAA 1XRMA 4K26A 3DDCA 1JWLA 3L7IA 3QEOA 4BJ3A 1OCEA 1PFQA 4KOAA 4R1QA 1L8OA 1VI5A 3UC5A 4A91A 1E1QD 4IILA 3LFUA 1MAUA 3WQBA 1E7YA 3AR2A 4HMOA 3OEED 1L7PA 3D0KA 2IXAA 1NKSA 2QQGA 4UVHA 1PTKA 2UZAA 1VJDA 3AP2A 4FT4A 1QIHA 4JBYA 4ZAZA 1WJGA 3U3KA 4CIVA 4KYVA 3LPNA 5FJIA 2P6UA 2MMCA 3V33A 5HM6A 3NAQA 3WLHA 3GEEA 1CUWA 3CNQS 5DHAA 2W37A 3JATA 4LQCA 5HTKA 1JEYB 1LPSA 1ZOPA 3GL9A 5K0BA 2C94A 1F3OA 2BSAA 1Q3KA 7AT1A 3IEVA 5EJEA 1Q1NA 3CKMA 2IY7A 4ZFNA 4LC9A 2A78A 1SXJB 2C88A 2ORED 2X9QA 1V3VA 4OP1A 3ZHCA 2ZSJA 4D99A 2X8WA 1NSYA 1QO0D 4WMLA 1JPNA 3M83A 4F4UA 5ELXA 4FYYA 1FFCA 2GYVA 1W5BA 2XMCA 4FHDA 1X9HA 2WF5A 4Q6WA 3ZE9A 4BFYA 2AXEA 5DBGA 2P4UA 4JL8A 3GIDA 2I3ZA 1MJGA 1HYGA 1YXMA 3CW9A 3MOGA 3FSGA 2K7ZA 1EHYA 3DQPA 13PKA 2C8LA 1VHWA 3FRHA 1EXNA 4R6XA 2DTXA 1UT5A 2XHEA 4ARCA 1IHYA 5G0SA 5EJ9A 3EFHA 3QLTA 2YJ3A 4RPGA 3ACDA 1VXOA 3AR8A 4I5EA 4QHSA 3TQFA 1X2BA 1W1IA 3B48A 1WHSA 2YHIA 3PG5A 1IBLB 1Y8RA 3IV7A 2HCTA 1FLDA 2CNBA 4ZEOA 2X7XA 4K9SA 2G63A 4D1YA 4MQ5A 2P62A 1Z4IA 4H7KA 3Q3CA 1LW6E 3L7OA 2J31A 4D74A 2EBFX 2I7CA 2YDYA 3PRHA 1CJSA 2EZ4A 4EG4A 2C3UA 2BH9A 3CY6A 4GGMX 4WINA 1WMDA 3ZE0B 1T2VA 3QX9A 2XHZA 1T8UA 4Z5XA 1BEZA 5CLFA 3WICA 4R7ZA 3ZLVA 1OAKA 2JJ2A 4LSZA 4B48A 2XYRA 3E0QA 4DJJA 5IANA 4FYPA 3UBMA 3MLAA 5LQCA 4U7JA 1HX7A 1C8LA 3BD7A 5AIBA 3K96A 2EX4A 2LIPA 4WBNF 1L5VA 1H2WA 3PX7A 4M9CA 4BB9A 2V9ZA 1DRJA 4PN3A 3ECCA 3KB2A 3RVQA 4D8XA 4IHAA 1MQ9A 3NOQA 1KMCA 4Z3DA 1JJFA 1JB1A 4X0EA 1Y9ZA 4CM6A 4S0XA 3A36A 1DIGA 3E23A 3QLVC 4QFCA 4RW0A 5JQGB 4C7KA 2R79A 1PWYE 1L6IA 1C7FA 1KU6A 3L8YA 2XIJA 2BMVA 3L4KA 4B4OA 2QMQA 3HP4A 4JV5B 5EJMA 2Q7XA 3A1EA 1C50A 3BB1A 5BW4A 3AVUA 4BP3A 1J1ZA 5C5CA 4DMFA 4C30A 2CVOA 2IS4A 5ALPA 2DQZA 3TNJA 1ZCFA 2ZKIA 3GRKA 2W6ZA 3C3CA 4F1WA 3HXOA 4NPAA 3K8YA 5SZKB 3SDZA 2P2YA 4G8DA 1IVYA 2DBRA 3HFGA 2HTEA 1BCSA 3C8DA 1PK7A 1UP4A 4X5OA 3R76A 1PVOA 2SHKA 1JQJC 1PS0A 3EDQA 5K0FA 4LJRA 1QX3A 2GSDA 3WWPA 2XE4A 2AFHB 3P8ZA 2O2IA 4IMRA 4RTPA 1QH0A 1GQSA 1U8ZA 1V71A 4UEOA 5TEVA 4F97A 1KWKA 2WTAA 1JAXA 2O57A 3X1MA 4U4AA 3NNSA 5AVYA 4JUFA 4YJHB 1A2OA 1MU0A 1AB6A 5FTJA 5A4IS 4INOA 3G82C 2EJBA 4IQ0A 1COWA 1J25A 4KQ9A 4TRNA 4BUZA 3TQSA 2DUWA 4ND2A 2HQRA 4ZIRA 2P75A 2ZZNA 4MAMA 1W75A 4Q7LA 5IABA 5A3JA 4RVSA 2WFLA 4DQUA 1VBFA 4P08A 1U4SA 1JG1A 2DBQA 2GR9A 3NH9A 4X1IA 4BP9A 4YUWA 3BGSA 1IIBA 5IJXA 4R3WA 4F9EA 3H65A 1LPOA 2WMNB 4K9PA 1N4DA 4MHTA 1QR2A 4N8SA 2IF2A 3G6KA 5TQVA 1QH9A 1SH7A 1GHTA 4A1FA 3OKFA 5BNWA 4UTPA 1AMUA 1M1ZA 5DX0A 4OAOA 1L4UA 2WIJA 1EM6A 5HUHA 2ZI6A 4OHYA 1JGTA 1XTKA 4KACA 4OAPA 4DXHA 2CV0A 4ZO6A 3M4YA 3ZY5A 5HKBA 3VNAA 3T7TA 1FFGA 4Q5IA 5EERA 3RAJA 1I0IA 1BDBA 1G5HA 1N75A 2G04A 2Q3BA 3H19A 4U7TB 3THRA 5AICA 4DABA 4QGAA 2IH2A 1XZFA 5EEHA 3GVPA 4UNSA 2HR1A 1NN0A 5AW6A 2E18A 3MD9A 1RQNA 3JYHA 5H9VA 1ITZA 1UPFA 4JC8A 5HCIA 4BP8A 3ZQKA 2ZZMA 3JQ7B 2R84A 4IRMA 1DG3A 3LUKA 1VJTA 1WSWA 1H4VB 4W9NC 3LUDA 2B4YA 3W9UA 3PQ8A 1YMQA 1YRAA 1EFLA 3L6CA 5SV2A 3ZDRA 2ZKLA 1MHTA 4Z53A 2ZYRA 4JVNA 4BGVA 2AJBA 2CNDA 1UL1X 3U60B 4E11A 1U80A 3QKTA 4FKZA 4FUQA 1KTVA 1XKQA 4WHMA 1Z4MA 5H5JA 1UODA 1Q74A 4O6VA 5E7QA 3R09A 3W5JA 1LLUA 3DL7A 2OHGA 1YIDA 3MQFA 3T9AA 1S3GA 2GZSA 4O1IA 1NRIA 2YV1A 3TGWA 1WQ4A 4M8KA 3D54D 4EG1A 4AS2A 2B98A 1JILA 1JHMA 2AJDA 3BICA 4QYIA 4XI9A 5LDGA 2QSJA 3ZNNA 3AVYA 3JU3A 1FSGA 1UOPA 3GG2A 3I5AA 4Q4HA 4RPIA 4UM5A 4UVIA 4GDFA 3MUOA 1B76A 2QLNA 2DLNA 2P40A 1CLEA 5TJHA 2A0WA 2PBZA 4AG6A 4UD2A 2E0IA 4WLOA 3DH0A 5CMLA 3IV9A 5AXAA 2JFQA 3B1VA 1PL6A 2BSQA 1JKMA 1N32B 3FXAA 4Z0PA 5B7NA 1U8FO 4AKIA 2AZ4A 3O4FA 1IMJA 1Q7CA 3KC2A 4YAUA 2HIAA 3ITKA 3HHPA 2HIGA 3NAGA 4QNMA 3RGWS 3U4DA 2IH5A 1XA4A 1S8OA 2GM9A 1UBEA 1X1SA 2VQ3A 4LUCA 3WS7A 1NF3A 5KX5B 5AK4A 4ZU1X 2WYWA 2X2PA 1AHNA 3F6YA 2VNJA 2AK3A 2L2QA 3AV0B 3OPXA 3A2LA 3UJ8A 3IA2A 5IBQA 3CVXA 2FXIA 4GT1A 4N39A 4YJDA 5KYYB 2JG3A 2G09A 5JVDF 1ONPA 1U7ZA 4PGFA 3FMIA 4WAUA 2AMFA 5BV1A 1TE2A 3OQPA 2P4EA 3X2FA 5BVHA 1XU4A 1LJ8A 4C78A 1X7YB 1NQVA 2X42A 2XB8A 1NIJA 3H6KA 4G0XA 4AJJA 5I3ZA 2JKYA 4JC0A 4MS4B 2XGOA 3KZMA 2AGVA 4EAQA 1HE2A 4LHYA 3PQ5A 4FS8A 4K9NA 4N0DA 4HWRA 4JQSA 3RROA 4HEA6 2VDWA 1C3JA 1M2VB 5ITVA 2VT7A 2RARA 2XADA 4HWSA 3U1BA 1JU3A 2QN8A 4XVHA 2I2XB 4C2TA 1R1DA 4RSGA 4WLVA 3U7QA 1DKMA 3PU6A 3E8MA 5DGCA 4MJ3A 4WZAE 1GKKA 5HCUA 4H0NA 5E38A 4MMZB 5TARA 3SSOA 4LOIA 4E21A 4LX8A 4PGHA 1GZ3A 3WXMA 4BFVA 4YXWD 1KFKB 1VI2A 4JCOA 4K9LA 1E0JA 4F4CA 1L5WA 2G40A 3FMPB 1G7RA 2KPOA 5K6AC 4N8EA 3FVWA 2RHBA 4HD8A 1D04A 1KAHA 4TT8A 2WKPA 3IUJA 5KQSA 4KPFC 1OZAA 4D82A 2CXOA 3DYIA 3I8XA 1JFFB 3JAKB 3K5HA 1YQQA 4YRBA 3O94A 1Z5WA 4LCJA 4JA0A 4QO8A 1H5QA 3FMGA 3R40A 3STYA 5ALTA 4O8ZA 1I7DA 2FR8A 5BMVB 1AKMA 3D6HA 4XD2A 2P0AA 2DBZA 2IVFA 3LDAA 1H42A 1XFAA 2O1SA 1DTSA 2P67A 3L46A 4YRDA 4R51A 2Y1OA 2GETA 5KJ1A 1L1QA 1BHSA 2AN3A 2DLDA 3JD3A 3AXSA 4JLPA 3QEBZ 3LP5A 2Y0PA 2AT1A 4ZZ2A 4W5RA 3UAWA 2GAJA 3OIWA 2WWVD 4ASUA 1QCZA 1RFLA 2CLSA 2OO7A 3LDFA 1NL3A 4XASA 5J2UA 2OKCA 1EP1B 3LRPA 3ORYA 4LCBA 2HQOA 3W2FA 1JG6A 1W36D 3ELDA 2V7QD 2F64A 3IGFA 1VE3A 2TSYB 3JZDA 3K6RA 3QUTA 4XEUA 1O5TA 4GGOA 4FHEA 5K20A 3HUFA 2BR3A 2GESA 2HSWA 4KIWA 2OORA 4E3ZA 4QULA 3TW8A 4B7UA 3FNRA 1GTVA 5HIIA 1CZKA 2NZXA 3U3OA 2I8AA 3UY4A 3WIOA 3U6BA 2FTKE 4AKHA 5KHAA 2ORYA 1MB3A 5KEIA 3M4XA 4CI0B 1XHFA 5ICGA 4ZTUB 2UAGA 2ZB3A 3DZJA 3OICA 4CTKA 1NMEA 1ODFA 3WAJA 1OAAA 2BI4A 5F4ZA 4CMCA 2OZLA 3PQ2A 1FUIA 1IG0A 1RIFA 1T9BA 2IIBA 4TUYF 4UM9D 4D4MA 3NDPA 4J0FA 4LDRA 3CTPA 1GUDA 1KR5A 1ZBQA 3FAKA 5FL7A 4ZGGA 3DM9B 5T7BA 4W5NA 3HSKA 3OFNA 4NYIR 2RHJA 2NZ8A 3CJTA 4B2PA 5JTTA 5EJ7A 2ZJ4A 3FI9A 1P73A 2WU3A 3OTIA 3K5WA 4Y2HA 3TOXA 1G8MA 1TM2A 4K9DA 4ENWA 4YMVA 1G7SA 5A03A 1XEFA 5L4SA 2V55B 1I94B 3KR9A 2DG2A 2FOXA 4MQFA 1RE0A 4PLVA 3G2NA 4TWZA 1MIHA 3ZZNA 4CG0A 3OCXA 1Z0KA 2X5KO 2E48A 1OFUX 5LQSA 3RLIA 4YFYA 1A1SA 2BHLA 2W8BA 3PB3A 3D7KA 4KLZA 3M1AA 1Q7EA 4IWNA 4M9QA 5EFZA 2XZTA 5FTKA 5B1HA 2WPNA 4BX3A 3VKGA 1JLHA 3OC0A 4LE0A 1W73A 4KGXA 3JQDA 4LZJA 1L5GB 2Q2VA 3RS7A 3CS3A 3ZU2A 1K7XB 1UBHS 2C2BA 3BG5A 3L6EA 5CTAA 1XZAA 4NLLA 2AR0A 4EEZA 2E7ZA 5KVSA 4BVBA 5KSWB 1MAHA 3UO8B 2FW8A 3M6UA 1ZJWA 5ETJA 2CJFA 4B3MB 3G79A 5BOSB 4II2A 4QIHA 3X1YA 4N01A 5EGNA 1DADA 1CHDA 1CULC 2VP4A 2VHXA 4KXQA 3LV8A 1JDZA 1KP2A 1ZO8A 2JFOA 1LI5A 3EASA 3KBBA 2BKLA 4AWXA 1KQOA 1QDLB 2JAPA 2K2QB 1PYDA 3BGDA 1MB2A 3KPYA 3RS9A 2ZT6A 3QSGA 3JALA 3NETA 5CRIA 2YWGA 4NEQA 1M2NA 3ZH9B 3ENKA 5B55A 1ZRHA 2UYGA 2GBIA 2ZOSA 3ADKA 2OUIA 3VTFA 3EXHA 3I2YX 5FL7D 4TOIA 2B4KA 1KBQA 2W6NA 2P3OA 3BA6A 4KUGA 3B13B 5DLEA 1DE0A 2C2GA 4L5IA 5CW2A 5JHHB 1KRWA 3CBQA 3N0TA 1UDAA 4EHAA 5BPFA 5EZYF 2AEFA 2BMWA 3N7AA 3W2GA 1MOQA 1Z3IX 3K3PA 1ESCA 2Q3CA 1AUOA 1YZHA 2FG7C 4QUEA 1DUIA 4EEXA 3N5KA 2FW9A 4DARA 1F9EA 3VR3D 2FRXA 2G9VA 5AK5A 4KAFA 1O6CA 4DLZA 1DBIA 4CIYA 2WU1A 3QLUA 3UMVA 3GA0A 4MITA 1A2KC 1NXQA 1Q2XA 3PPXA 5J63A 2QVLA 4CLEA 3HJRA 2WHEA 4NENB 2AG8A 3T1HB 1M66A 2XB9A 3PYLA 3TFWA 4EUFA 2NXEA 4GPZA 5IVPA 1FDWA 3A1TA 2FCRA 3MUEA 3WZLA 5KYTA 2H4FA 1SOAA 1V37A 2E37A 4W8OA 1P17A 2A0XA 1UBOS 3S2EA 1DU4A 2FP4A 4HQ6A 2BFPA 2PUDA 1PLKA 3NTLA 3AEXA 2G5TA 1ZVQA 1VE1A 4YI3A 4CKBB 2BGIA 2O5VA 2XRYA 4AZVA 4ER5A 4O4HB 4K5QA 1I14A 3ESYA 3IEPA 4HS9A 1YRQA 3IDFA 4N3GA 1CUAA 2B1IA 5AK6A 2WT9A 3BK7A 4TKLA 5CJJA 2AXNA 2AD5A 2YYYA 3D3EA 1VMKA 3OT4A 4KIGA 3CRW1 4KQ6A 3KQYA 1YDEA 1UDCA 4X1KB 4LOHA 5FCDA 1E0AA 1XC7A 4B79A 4IDNA 3B52X 4H6PA 3D43A 4QAJA 1GLGA 4AKTA 3LPMA 1J2YA 1INLA 1TUEA 4RBNA 4WZBE 5HZHA 1E4VA 3LBIA 3PZRA 3SHFA 1R6BX 4E51A 3OESA 2DPMA 2VJDA 1RWVA 4Q4CA 1GSAA 1WUIS 2ZR9A 1E1CA 5EE3A 2W43A 2UUCB 5KUTA 1NW9B 5EPUA 3IAS6 1DJMA 1QVVA 3UW1A 3LZCA 2ZBQA 3Q4GA 4KRXA 4N5MA 2AK2A 2QVYX 3ZCUA 4B6JA 5IKMA 3R0IA 4AZ3B 3WNBA 3OQIB 4IIJF 4K86A 1P5FA 2ICAA 4HEQA 3MAGA 4GE3A 2DY0A 5BNIA 1JNXX 4FJ2A 4C3ZA 3ZVLA 2O8EA 2WJHA 4TRRA 1N2SA 2ECOA 2H92A 3H5TA 1BJKA 4PZEA 1JWAB 3UMJA 3F8SA 2YNMC 3GFTA 3PFCA 2EFEB 4JBIA 1UXGA 4Q9HA 4L6CA 2QXUA 2ORIA 3O4RA 3M33A 3M1IA 1YB1A 4LK2A 4WY8A 3EDMA 4GG1A 1HK7A 3GGCA 4P4LA 4CKXA 2JD2A 2PZGA 4P3XA 5LYJB 2PXXA 4RVHA 4P7KA 2ZGVA 3F5MA 2EBWA 3L79A 5KYWB 3LUBA 3UAOA 1OYYA 3IR7A 2OAGA 3GUCA 5JCOA 3L41A 1F6DA 4CJXA 2Y99A 2C9MA 3HH8A 2OILA 5L40A 4TXNA 5IX8A 3BCUA 4H4DA 2QTRA 1D1PA 5D1HA 1I9GA 5FBWB 4DR5B 1HZZA 2AFVA 4YLGA 4URFA 3CXUA 4YMLA 1AS0A 2VXOA 2EKZA 2I8CA 2BGRA 1QHHB 1UPTA 5F52A 2XRMA 3K9HA 3W8FA 1K7FB 5I01A 1HSOA 3V8BA 3O3OB 4X60A 1XQYA 1XUOA 1T8WA 1SVUA 3PDWA 3QVGB 4NZYA 1DBWA 2OL4A 3FFWA 2OYRA 4I4TA 2DU8A 2X8BA 3DTVB 1JMVA 2PUTA 4G25A 4O02B 3A6HA 3AI7A 2W2TA 3D5EA 4WW0A 5C52B 4OHKA 3ZOKA 1PNVA 2V58A 2G83A 2UUOA 3H4IA 2OHFA 4OXQA 4A26A 5HIKA 3O1HB 1HLFA 1GPH1 3EWAA 1CJBA 5JLAA 2HHHB 1GPUA 1K5PA 1KJ9A 3ZNPA 1L4HA 4M36A 2WM3A 3KYBA 2QJFA 3S27A 4Q9IA 5FYQA 3ZZUA 2O7NA 4EF4A 2X77A 5IC4A 1NXOA 1V8OA 1TZCA 3R7WB 2N47A 1L7RA 4CM4A 4PEVA 3FFAA 2HWUA 4KAXA 5KS2A 2XGJA 3ENVA 1M1YE 1IHPA 3EQ8A 4I1RA 4O4JA 5KINB 2JGLA 4IXWA 1M3SA 1XEWY 4DIEA 3EGOA 1L5HA 3T95A 5IH7A 1IULA 3UJ7A 2RHDA 3V2GA 4EO7A 1NXXA 4Y6QA 2A59A 1G5QA 2D1RA 4GR5A 1Z12A 1C1YA 3C3BA 3DMNA 4L8LA 4XIIA 3I9V6 4BNWA 1ZICA 4WLFA 3D8HA 4Q4JB 4W9RA 3R9KA 1W4RA 1C3XA 1J2TA 3VR0A 4D6YA 3VM6A 2CL6X 2HCRA 2DSTA 1T5SA 3C6XA 2Y27A 1SK8A 3SHTA 4Q9LA 1ZINA 4L5YA 4LAFA 4HNHA 3UFXA 4MR8A 4EQ6A 4YRLA 1G20A 3WIUA 4E4TA 2R9VA 4KVGA 4YMWA 2NLOA 5F2OA 2XVYA 3OP1A 4NI5A 3DZCA 1GYRA 3D02A 2WMDA 2XMZA 3BVPA 3H9CA 4S1PA 3DO5A 4YRSA 4RL4A 1EWRA 1KMQA 2ECQA 1NKVA 1LC3A 3BTVA 1HUQA 1V35A 3I8OA 5FTNA 3WK8A 1ZLYA 2PEZA 3DB2A 4HKTA 3WRWA 1A9ZA 4OI4A 3WMGA 3ZV3A 4C29A 3CZ5A 2PXHA 1U2DC 3BL6A 5CYFA 4ZHQF 2WAMA 2ZI5A 3ND7A 2CSXA 1NOKA 2FPIA 4C01A 2MSLA 1ENOA 2BHTA 2YV3A 3ZWDA 3PYXA 5C1DA 1P9OA 1ZUHA 4AQYB 1PSWA 1N0HA 4HY3A 2B8EA 1T6XA 3Q6NA 3ZY3A 3ANLA 3DCIA 2O8DB 1LWOA 4IYJA 5BMOA 4U7WA 3ECSA 2JCYA 1UK6A 1G66A 2WD9A 2FPRA 4E88A 2X1MA 4GR4A 1SHZA 2HNKA 2BDTA 2OZPA 1BMFD 1NP6A 3ZLBA 2GEDA 5J2TA 2R8YA 4HWPA 1O9GA 3DSRA 3MWLA 5CYPA 2QU7A 3A4YA 3L6OO 3AEKA 3U1VA 2PSFA 4R83A 4TWJA 5EMJA 1Q57A 5E7IA 3KALA 5B1YA 1ZGZA 2CBZA 1R4NB 2AMYA 2HOQA 1F2VA 1QJ4A 3JCZA 4M8NE 4NEHB 4U0JA 3SBEA 4IGIA 3UAXA 4WJLA 2HRQA 5GV8A 4PX3A 2NZUG 4GMXA 2DWPA 5D86A 4L2IB 5ESWA 1RHKA 3IL2A 4L4RA 1MV5A 3H0EA 1UEXC 3HKEB 3NFRA 5JDCC 5LA6A 4EG6A 2GKGA 3ZDFA 4JGIA 5K0CA 1BDIA 3N6XA 3PP8A 3BREA 5JAOA 4P31A 4F5DA 4AO6A 1GT6A 1VPLA 4MHOA 4PLZA 2PH1A 4ILEA 2XUHA 1OH6A 3P2JA 5DGHA 4PQFA 4YQYA 3U37A 5E6SA 1EK2A 2BC9A 2H3HA 2X4DA 4LFBB 4FLFA 4DLAA 3JX9A 1W19A 3IQEA 1QBGA 3J7TA 2AOTA 4HWKA 1EUDA 1SXQA 1EWVA 4YMSA 2C3PA 2IU0A 3ZDQA 1BGXT 2QMUA 2YQ5A 1CJMA 1MVNA 1L5QA 4EGSA 1MXFA 1Z8FA 3LSYA 1E1KA 4UTRA 4D25A 4Q21A 4X6UA 1PK8A 4M1WA 4DZZA 4NYJR 1CUUA 4CDNA 3OAAA 1YOVA 2NU6B 3I23A 4GKBA 4KI0A 1KI7A 3VHXA 1A7KA 1GU0A 4DLUA 1I1HA 1HPLA 1WXHA 1CFJA 2FOLA 2OG1A 5HRCA 2BFNA 1U4OA 2Z4TA 3DS8A 5JS8A 1TJYA 4R0MA 3PI6A 1WEHA 1E18A 2FMIA 1JN0A 1GZHB 2VTDA 1DLIA 3CRZA 4QSMA 1OTXA 1EINA 3AF2A 4YAEA 5J5VA 5J4LA 5JATA 1O08A 2HLHA 3R5KA 4EVQA 2PZLA 2PY6A 1BYIA 1EAYA 1FU4A 1ZESA 3B6JA 1GQOA 4TV8F 4II7A 1E6MA 2J6IA 2P1DA 3FTQA 3L1IA 3MILA 4QT0A 4RY2A 4C6HA 2IITA 2G1JA 1X86B 3BXEA 3QXXA 4XRRA 4ZT4A 5EJ2A 1PQYA 2X2OA 4BLTA 3K72B 1XDWA 3HCBA 1ZKMA 5IM4F 4KLRA 1NVVQ 4MIEA 4C1NA 1QP0A 1V11A 4IV5A 2FSHA 1QHEA 4R3NA 2QBYA 1T10A 2G28A 1JLMA 3WZ2A 5HZKA 4YCLA 4JQOA 4MX8A 3H11A 6GPBA 1Z5GA 2NV0A 1KSHA 1XV5A 3NGLA 2E5LB 1WEKA 1BW9A 5K2MA 3QTBA 3HKBA 2NPOA 4J2TA 2ADOA 2HRBA 3J81k 1FTSA 3IIMA 1KDVA 2JNWA 1GLVA 2BCGY 5PGMA 3O4GA 3BE6A 4G5SA 1WDLA 1IB0A 3DKIA 2QY6A 2OKGA 2J3MA 3H5OA 4FSHA 4NRDA 4EY6A 4C3OB 4YAKA 2P1RA 1PZHA 3SM3A 1O9HA 2QJRA 3AK4A 2ZLBA 1UPXA 3WRXA 1GO2A 2V9CA 3CLRC 4GHWA 4MEJA 4D81A 2JFVA 5BORA 2ZUCA 2JFZA 1XU9A 1XO1A 3KWJA 3RD5A 4WBNB 4Z9FA 4IJQA 4O0LA 4RU1A 3QPWA 3N6RA 4BQFA 4ENUA 2F1JA 3O92A 3C3YA 4U2KA 1JP7A 1GG5A 3KR1A 4EZEA 3LK6A 1NVXQ 1ADCA 3ZI4A 3AB7A 1H65A 1NV8A 4PSKA 3NI2A 5CITA 2FKNA 2BOVA 3FWZA 2HMYB 2OPBA 4QNNA 3RU3A 5KOYA 3RT7A 1FRFS 1W94A 4LJ4A 3KKEA 5AHWA 4YGYA 3AHGA 3IAXA 1VP3A 3LUAA 1ZR4A 1XZIA 3D5QA 3P2YA 3LWDA 3VZBA 4R9SA 3WKAA 4Q16A 4RD1A 3DZKA 1UBFA 3VKVA 3FYSA 1BMQA 4XDGA 3NHRA 5F76A 4H6VA 4ZOLF 2Q2WA 4FBLA 4YAIA 1IU9A 1R18A 4IOMA 4DREA 3E84A 2FNAA 3ZWBA 1RACA 3PD0A 1JW9B 3RV4A 2OFXA 3C14C 1D7AA 3VKWA 1VPDA 4NV3A 1QONA 1SC6A 3KKNA 3LDGA 3AG6A 4LS3A 2XOEA 2DP4E 4NABA 3WJAA 1NUUA 3C15C 3GPDG 1Z37A 2B61A 1BJRE 4NBWA 4QXAA 2OAEA 3KYDA 4D4LA 5JPCA 4ECEA 1FSZA 3ETNA 4I1YA 2O1XA 3ZHYA 1XTRA 4J0CA 4FSDA 4ZVOA 2XYHA 3PHIA 4EATA 2H54A 3L8CA 3LT0A 3AIKA 4QUKA 3UG7A 1TMOA 2P6MA 2P9ZA 2Q46A 3EZYA 3EVBA 3K9QO 3LAWA 4UNRA 1H2EA 2NZ2A 4AKGA 1OJLA 4V03A 5CU7A 4QHTA 4YRJA 2X5XA 2XUFA 4NZPA 1A9XA 3WL4A 1TYEB 4NOMA 3RS8A 4EX7A 1Q0UA 3G5UA 5C7IO 4IF4A 3RUDA 1X13A 1P0IA 1A8UA 2GZRA 1Z8HA 3MG9A 2XCUA 1KS9A 2GYYA 4UMFA 3ZLTA 4ER6A 5COAA 1ZN2A 2ZM5A 4XFDA 1W6RA 4BLVA 4BU0A 4GU5A 1EWTA 3IHKA 2A9FA 4KXWA 4J3JA 2ZETA 4ZV4A 1PWXA 2QYTA 3OWHA 4FXOA 2AQKA 4TVKA 3UAZA 1PTJA 3V7FA 5TNXA 2FUG1 1IFXA 4IEEA 1YIOA 1KFJB 3DKPA 3I6ZA 3T7EA 2X14A 4JI8B 1W8IA 3RIHA 1G4UR 1P45A 3F5DA 2X8JB 4DT1B 2ISQA 4MQEA 1A4RA 3WDMA 1V16A 3WHPA 4Y6GB 5HK8A 3TFOA 1QYIA 2BEUB 2GEJA 5EIAA 3PUJA 3ANNA 4F56A 3S8MA 1QX4A 2PXCA 4BV9A 1KI9A 5JNSA 3KEFA 2CT8A 2E4WA 3U0VA 3FUTA 1PFKA 1B6SA 3DNMA 3HDVA 2ONZA 5KNCD 3IAM6 5K3FB 1GQQA 2NW6A 3ANSA 4TGLA 2D5CA 2IIPA 4JENA 4DB4A 1SU6A 3MELA 2DFTA 3UWDA 2G76A 2OG2A 3KEMA 3L5KA 2DGDA 3CZPA 4GM0A 4ZYWA 4QQ8A 3AFGA 4OXKA 3T3PB 3VUEA 2EGUA 1WOYA 1KHTA 1QRSA 2ZYIA 3SHVA 4BQEA 1OA1A 2AQ8A 3ETDA 4HFNA 1J24A 1K7CA 1TVCA 2JAHA 5EWJB 2OSBA 2YYSA 1UCFA 1VSQA 2FJPA 3DT9A 4JT2A 4S0ZA 4WNAA 1ST2A 2IUUA 5ITSA 2QX6A 2RI6A 4PYIA 5ALYA 1W2GA 3D6FA 3F6BX 3V42A 1X1CA 2E4AA 3BWYA 3BBPA 1LBEA 1MH9A 3JRXA 1QKIA 4KKXB 1RHUA 4XIJA 2O2YA 2CLLB 1W2WB 2P69A 4R8VA 1X14A 1QFSA 5CVUA 421PA 4CI9A 4TXLA 2XXAB 3Q87B 3INRA 5KDLA 1A5AB 2HJ9A 3O3NB 3FSEA 4JGGA 1ZVVA 1P5JA 3QFHA 4G1FA 1H5UA 2C92A 4H18A 4LJSA 4QQFA 5FOXA 2FEKA 4LWPA 1MO6A 2G82A 5T4EA 2Z1NA 4JEUA 4QEKA 4EUHA 3GUUA 3VVCA 1D2GA 3WGOA 4E1VA 1B3RA 4C2BA 2RI1A 2JEYA 4I3GA 1NU6A 3PDIB 2PAFA 3KUXA 4IW3B 4KO3S 2XCSB 3K2QA 1N8TA 5LN1A 3TBKA 4EK9A 3GT0A 5FFFA 3L1JA 3P9SA 1VZ3A 5K6RA 5EUBA 4MVJI 4BNGA 2QL9A 1CF9A 1R6AA 2ATVA 2YMPA 4MRMA 1UDXA 4MMYB 3AKYA 5G3ZA 1LD3A 2YQZA 3ZG6A 4WVFA 3SBXA 1I4LD 2IXFA 1XTIA 2XECA 3HN7A 4M98A 5JVDB 1NM5C 1SQ6A 3WISA 2VJBA 3SOZA 3EAQA 2AOVA 4E5MA 1NT4A 4R2LA 4XW2A 2ZDHA 1BWPA 3W9YA 2IUFA 1WB5A 5FUWA 4UFNA 4E5KA 3WG9A 5KYUA 2ZQYA 3HR7A 3EHEA 2I22A 2Q45A 2WJWA 3PDUA 1CY1A 3CF0A 3ZCSA 5AHRA 4WEOA 4PBTA 2FSGA 1X6VA 3N2YA 2W2LA 3N6VA 3O0DA 3OMXA 4PX5A 4YN3A 2PFSA 4ZXFA 4DCGA 3BRQA 4N6OA 3LCCA 3HXQA 1N1EA 1DCKA 1MIOB 2BEVA 2XMPA 3QVTA 3VDQA 4BQPA 4D02A 5FIUA 4NCIA 4HQKA 3WSWA 1XF9A 1AF7A 4X92A 4BECA 2AN4A 4YROA 4I3FA 5EPOA 2C1XA 3DKVA 4F91B 1P1IA 3FIJA 5IKXA 3DBLB 1ULZA 2XVAA 4TQ9A 4LF9B 1TCUA 3QELA 4ID9A 4BBJA 3N87A 1I2ZA 1L5RA 2M32A 4BDSA 3S8YA 4IMJB 1GPDG 2F67A 3BF8A 3DMRA 5AVJA 3H6HA 1U1EA 1LF5A 2BM0A 1RZUA 4LC1A 5FB3A 2NUPB 3DE4X 1YL6A 4F71A 3UHOA 5L9AA 3QP9A 4DMKA 3SPXA 1MEOA 3TAXA 1CUVA 4JWKA 1U2ZA 5H3CA 3WGMA 4UOEA 4ZEVA 5IEJA 4HTAA 5LM3A 4HQLA 3NVAA 1ZBDA 3IHTA 1OWNA 2YIDA 1H8ED 2O3QA 1PKXA 3OMLA 5CX1B 1H9CA 1RADA 3E9RA 4UUPA 4DRYA 3GJRA 4LG1A 3UA4A 1Y1LA 3X1ZA 1U0NA 3E58A 2CE7A 5CJPA 5ESRA 4V0SA 1YBMA 1J0AA 3UV7A 3S29A 1ICEA 4FZVA 4FHCA 1A69A 1YA8A 4MUAA 3DMYA 1THTA 4EGQA 2PVSA 4I3HA 4TM8A 3WGZA 3A1CA 2J9XB 2R1TB 1XZEA 4EYSA 1CY7A 3K09A 4U0KA 1RWKA 4Y9TA 5D2CA 5FR1A 3RCBA 1D2AA 1JVBA 4JR2A 3GRZA 1W5TA 3OU7A 4B7CA 5JQWA 1DBVO 3QENA 1DARA 2CHEA 3SSAA 4I55A 1E5LA 3WRVA 4C9BA 4D4HA 3F6RA 4IV8A 5E6UA 1PSDA 3N2ZB 3PWTA 4AJLA 3FTDA 5B4TA 1KF0A 1NATA 4GBED 5ECGC 4MSUA 4IEIA 2IS1A 1X42A 4HAZA 3ELBA 3OE1A 1BDJA 5JU6A 5JSKA 2QL7A 1Y9AA 2XNDA 3SIXA 3W8NA 4AG3A 3TB4A 1DEAA 1E2MA 4CTMA 2JLXA 3TDMA 1KZ9A 1I01A 1RCFA 1SCUA 4ALJA 2OP0A 2WKRA 4KQEA 3WLQA 3LRXA 1SPXA 3WLMA 3ZGLA 2ZXEA 4HG2A 2IPNA 2CV1A 4LNAA 3OM8A 3AWIA 2NX2A 3DA8A 1KP3A 1O94C 3IMKA 1X7HA 2AXQA 1NI4A 4R8RA 1YFKA 4Y18A 3ZNOA 4A8JA 4YR9A 1QV6A 4LDAA 2AR9A 2CXXA 4Z6KA 5KVCA 2F4VB 2QT0A 5SY4A 3OOWA 3SIWA 4D43A 2BTOA 4QFDA 3EIEA 3TSWA 1XQ9A 3CGGA 3G1UA 4MYRA 2V74B 3VU9B 1UOOA 3FIUA 1VSBA 2XA9A 2ZJ7A 1NLUA 1L8QA 1ADFA 1IQUA 5AVTA 4CEJA 4L0CA 5SZIA 2Y71A 4RA6B 2BFMA 2I71A 1CETA 1J2UA 2YIMA 2ZSDA 5EMHA 1U99A 2B4AA 2BFBB 4XX1A 3FF1A 5JYEA 1PDWA 4OX9B 1E5QA 4Y0NA 5B4UA 3BIXA 3QF4B 2ZYWX 4KQFA 3OF2A 5ELLA 2BP7B 5GJVC 5TPZA 3COJA 1SHTX 4D3YA 2ZJAA 2FJ0A 4BGUA 1LDYA 5FWDA 3H5NA 4GXRA 3UZUA 2E1PA 1RAHA 1DPFA 4Q9KA 5HQ3B 5L7WA 2HCFA 3K4HA 4LMAA 2BFEA 1L8AA 4BEJA 5EWLA 3WFIA 3J7AC 5MN5A 3S28A 1PZGA 2J9GA 2ZRHA 4OFXA 1DPGA 3ZXXA 1HFWA 3ZCRA 2FP3A 1I5OA 3A05A 3QF7A 2FDCA 1JHOA 4C2AA 3NTOA 2GN6A 2JI4A 2QL5A 3AZPA 2BL4A 4ZQFA 2YFQA 2I0FA 2HV9A 4CLXA 3PS9A 4G5GA 1S3FA 3KT0A 4YONB 1DO0A 2KMLA 4BNHA 1ILWA 2P9FA 4UOZA 5C31A 3EWIA 3AY6A 1HTTA 5JXHA 2VNHA 1LUAA 2CJPA 4DSOA 3LWZA 2B1RA 4HTFA 3QWFA 5TQ2A 3GNSA 5EZYB 3WRYA 2RHWA 1I2AA 1RC0A 3D8RA 1S4MA 1Y3CE 3HG7A 3SI7A 2PO5A 3WIDA 1HQKA 4RJTA 1JG2A 3SK0A 3BORA 3ROQA 4DA0A 1VB5A 3M6XA 2V8BA 3O4IA 3GLFA 1IXYA 3CT6A 3HRHA 4JT9A 4MUJA 4RV9A 4KQIA 2B7BA 2XVMA 3OU2A 4P3NA 1Q7BA 2OC9A 3WL3A 2MHCA 5AK3A 5ILOA 4D5EA 1BHQ1 3KG2A 4FC7A 4H3SA 4FFBA 1O87A 1QB7A 2NU7A 4ZJYA 2H29A 1JYEA 4D0RA 1KY3A 4URHA 3CHYA 1AZLA 2NXWA 1LX6A 2Q6TA 2HH9A 3L7CA 5BYJA 3WBJA 1F1BA 4YO8A 4D8TA 1RLOA 1DRWA 4EVRA 5JASA 3GBPA 3TQCA 4I8XA 3L84A 3LOQA 3PVCA 3H97A 2BI7A 3L92A 1XJQA 2I03A 1LPMA 2B35A 4RGBA 4U1RA 2KBFA 1FYWA 3WDLA 4E2XA 1AUPA 1GYQA 3HWWA 3NUQA 4PLGA 2A2ZA 3DUFB 1HKUA 3MQ2A 4A0QA 4IJMA 1WETA 4HZUA 1W5EA 5F9FA 1M6EX 4FZJA 3ZHVA 2B1QA 5L4LA 1Z4OA 2IWRA 3UKJA 3W2HA 3NAMA 5JCXA 4MR9A 4E12A 1B4DA 1KI3A 1T1GA 2QX9A 3W6ZA 1QZTA 3OD5A 4LV8B 5HDBB 4MA4A 2JBAB 1NN3A 2JHGA 3GW8A 2BIFA 4KMRA 3DV0B 2CF5A 1SCJA 2X58A 3H17A 4L3VA 3DEIA 4JH0A 5DW3A 1OFUA 1LEHA 2IELA 2NV2B 2OXEA 4TMZA 1QYXA 5BSRA 5TJ9A 4V0RA 4BJHB 3ESXA 1N3IA 4B3XA 4HPJB 2H08A 1YJQA 3VSDA 4DMLA 4LGCA 1YB2A 3F1KA 4IIJB 4MAFA 2H18A 4INZA 4GI3A 3UHPA 5CH8A 3D3WA 3KEGA 1X1AA 2H59A 3N07A 3HZOA 5T6BA 5FQOA 2CL5A 3B1XA 3C3XA 3AUJB 1A95A 1R0BA 3V1YA 4LJLA 2YWXA 4GLLA 4Y1EA 2IHTA 3PQCA 1TB4A 2F9LA 3IILA 3MGGA 4NEGA 2ZRMA 4ZT7A 3IKJA 5IKEA 4J2OA 2BWJA 5C34B 3P5SA 3ASYA 3T4PA 5JNLA 5EHIA 2H5LA 2KS6A 1AJEA 2YN0A 1SGWA 3MRXA 3GLUA 2OQ2A 2RBKA 2W0MA 3EA0A 3F3MA 4H0FA 3T0IA 4ZI7A 4FGZA 3JQ8A 2O19A 4MV8A 4KSYA 4R54A 4Y9RA 4IFEA 5FBVB 3A6KA 4ALNA 1C0EA 2GEBA 1Y4ZA 2I4LA 4GS5A 1M76A 3W7AA 1YJ5A 1MC1A 4J03A 2CCJA 4WXHA 5FV7A 1MABA 5KYKA 5LOVF 1CZLA 3E9EA 1U5AA 1Z17A 2H4YA 3EZ6A 4R2IA 4B6RA 1Z2EA 1IY1A 1U90A 3V1UA 3ZUPA 4QLAA 1AZTA 5EXXA 2AJTA 2VT2A 5KO2A 3WMXA 3T52A 5HJEA 3D7LA 3RNLA 3SR0A 4JCCA 1UFKA 1AY0A 2QE7A 5ALFA 3RO7A 1QMGA 1NUSA 1XMSA 2BGJA 1CQIB 1DHRA 1XRJA 1DKPA 4G07A 1WNFA 5HOQA 1KKLA 2ZROA 1G20E 4IDFA 4FGSA 2K7FA 3NHWA 2XJ9A 4KQ2A 5CT8A 3P9ZA 3KPWA 4GC9A 4ZKEA 1MO4A 5HX7A 1GL9B 5KHLB 3G8YA 4LY0A 3CZRA 3IP6A 1H3FA 4UBKA 2XYQA 4JASB 1JXOA 3UXEA 2GEKA 3WYAA 1CEEA 5GOZA 1V43A 4AN4A 1GR1A 2R4QA 1Z6ZA 1XMQB 2Q4DA 2WVAA 1U7WA 1K1EA 2LTAA 4UTNA 2QTVB 2D0DA 1Q7GA 1EFUA 1ZU5A 3HADA 4XRGA 2REOA 2O05A 2YFYA 3VPFA 4LZWA 1S3SA 2WUDA 1C8VB 3FCSB 4Y1GA 4B9EA 5G41A 3P9RA 2CW5A 4IHQA 1WDWB 3PZBA 4BNJA 2F55A 3N2IA 4QDJA 3DMTC 3VPAA 1W9MA 3OOJA 4B82A 1MOSA 3LYLA 4HXYA 4WFKA 1QDEA 4UFPA 1UQUA 2I54A 5IAGA 1LRJA 1R6VA 3AMVA 3A2NA 3GF4A 3TM4A 1G2IA 1QE5A 1W5SA 3K6SB 1EE9A 1NFQA 1GY8A 3T7CA 3L93A 1RLIA 3R9XA 1MF7A 4AN1A 4RGQA 3D6VA 3C24A 4IIFA 4KAJA 1ZXXA 4JLBA 5J1TB 2FN7A 1NNSA 2CFIA 5ALOA 5FLXA 1UOEA 5G1OA 4R40A 3BZBA 3UUGA 4EA9A 3DDNA 1ZOLA 1JNYA 1JDBC 3IOBA 3T1VA 3LGSA 4BO8A 1HNZB 5I7UA 2WIBA 5F73A 4F46A 1KZ6A 4O5AA 1Q7RA 1V8ZA 2G5PA 3M34A 1PIWA 4ARSA 4Y98A 1AGXA 3T1TA 4A27A 3UVEA 3PVSA 2GYUA 4ZHQB 1YS4A 3ZS8A 1K4KA 2GAOA 3Q8MA 1R3UA 3RG2A 2UZ1A 4OF4A 1MG5A 1VI6A 2Q21A 2WA1A 4JKOA 3TS1A 3JD0A 4ZMSA 2ODQA 2XF2A 1U3CA 4ZEMA 2R00A 1C0LA 4ESOA 1S7CA 5ALDA 4YXFA 1E3MA 1DAKA 1P2TA 3MOSA 1ISIA 1N6LA 1ZM2A 1NLMA 2BMFA 1JDSA 1PJLA 2HDWA 4OQFA 2GF9A 4KR2A 4JFRA 1YL5A 4KLNA 3HJGA 3OX3A 4MCJA 4U2DA 4YAFA 1L1EA 3BCRA 1EXVA 4NONA 4PCVA 2FDXA 4FWBA 2K2WA 3C5EA 5J59A 5TMBA 4DSUA 4DTIA 4CV0A 4N41A 1TD9A 2ON6A 2X5OA 4HH0A 1EK0A 2WT4A 3IDZA 4M21A 5DI9A 3H9QA 2X19A 5DWVA 1U7UA 3O75A 1U2SA 3CW2A 3HB7A 4Q3DA 5DXAA 2I7DA 4BLPA 3ZYZA 1RPAA 3MLBA 1SVWA 2ZRBA 3WWZA 3FG9A 2H5IA 4DN6A 1NQXA 2PRYA 1WLYA 1KC3A 1FXWA 2XMBA 4FYXA 4RVOA 3W04A 1OZHA 2PUAA 2A57A 2VRWA 3FTCA 1CZHA 2UXDB 4X7BA 4BKOA 1VPVA 3IVMA 3NS7A 2DPHA 2ZTSA 2NTJA 4QUIA 1DX6A 1XKLA 4QE3A 1X7XB 3IRUA 4UJ5A 4RXUA 4V0QA 1QIJA 3F9IA 3UM9A 4QQKA 5AVZA 3V8NA 1RRVA 4ENTA 3LIPA 2EERA 2ZATA 3UICA 3VNQA 1EBUA 5AW4A 2FSPA 4RCYA 4DC9A 4DHEA 3G9ZA 4DM3A 4BV3A 3WNQA 3W5UA 1M1UA 5H70A 5AD1A 3CLSC 1Q83A 1V5FA 1QG4A 2YW2A 3GDWA 5DO9A 1J0BA 1ZJJA 1TYDE 3GUVA 5JPIA 4KWEA 2UZ0A 4YP9A 3CLTD 1CS0A 1ZZEA 4PAQA 2DPYA 1E9EA 5A9SA 4E22A 3OZIA 2GLUA 4K2HA 1GNVA 5EXDA 3UAYA 2QM3A 1J07A 5ES4B 2Q3EA 4EIWA 5L6LB 1E4OA 3TDKA 5T67A 3TD2A 5FTLA 3I6QA 1KA9H 2EFYA 3PQ6A 2IX9A 4YQFA 5AW7A 2ZIWB 3EUWA 3FOEC 2I1QA 1L5OA 1FVFA 4CMHA 3E0XA 1X1EA 1YNSA 4ZVPA 5BP7A 4WLUA 3E35A 1MR3F 4LNUB 3RM3A 1Q6ZA 2KLBA 3CZCA 5CG1A 2JLUA 4YO7A 4BLWA 2DHEA 2GBPA 3FJYA 1H3NA 1UBCA 1W0JA 3LS2A 5BSHA 4TV8B 3UJ3X 1VSVA 2PH3A 5LKRA 2FG6C 4RD3A 2VTBB 1XVUA 4QPJC 3VSCA 2LW7A 2XT0A 3K9GA 4QICA 4XWAA 3ZNQA 3DCNA 1C1HA 3TYXA 1WCXA 3IODA 1JIJA 4AJHA 3MHPA 1ZXBA 1QG0A 1ZK4A 5EZSA 1GUFA 3BF7A 4WZAB 2B36A 1A4XA 3LTNC 1RPNA 2XR1A 3CRVA 3EOAI 2JD1A 1BS9A 2IYZA 1XAGA 2ERXA 4ISBA 1ZMTA 3U7HB 4BTVA 5KMGA 4ARZA 3U44A 2AOXA 2HZ7A 2RH8A 3ICWA 4ZWNA 1YDHA 1E2DA 1EXDA 4CL8A 1I3MA 4BX2A 1KDRA 5M3BA 1T9CA 1V1RA 4ZU6X 1JLLB 1UKYA 2JIZD 3CF2A 5I8ZA 1CR2A 2Z0MA 1DKLA 1D0IA 1DVRA 3FDJA 2VDMB 3BL8A 3PRJA 5I9NA 5ALLA 2NTVA 3VZRA 1TVEA 3B1YA 1OHHA 1NP7A 4MYHA 1E63A 2QJTA 5D5QA 3ZJYA 4EENA 5JAMA 1WU8A 2NVOA 4AP5A 4ALLA 3V4PB 5K05A 1SHJA 2X1HA 3HGQA 1P4GA 5GWXA 1XXHA 1Y1KE 1LPNA 4XWKA 5AXCA 2POQX 3DW3X 5DE3A 3VPSA 3TQRA 4A6XA 2HMSA 2DFPA 2X5JO 1R74A 5TLSA 4MVJG 1X3LA 5HKKA 3KV1A 4FOLA 4PAGA 5MDHA 3UH0A 5DBHX 4IJUA 4XD7A 3D2AA 2V1UA 3ZVRA 1Z5NA 5AJXA 4XWOA 2CZGA 2XWBF 1C3OA 1EP9A 1A9YA 2P27A 5MGNA 1L9KA 2RGNC 4EY8A 4OB7A 2AH5A 2VYVD 1SIWA 3CUWA 3N39C 3IT1A 2IC5A 5EAIA 2GI4A 3IBGA 1FSFA 3M7IA 1P3JA 1O96A 3KVOA 4GVXA 4ZOLB 4BDTA 2P8SA 3RHZA 3HZZA 1OLXA 2Z4RA 4WGFA 3UATA 4TVSA 5DF1A 3Q12A 2X9VA 1R8SA 4RF5A 3SIPA 4M1TA 4QTYA 3OQMA 1G2QA 4OQZA 3E03A 3IBFA 4XPIB 5F51A 3MM4A 1K6MA 2ZYDA 4BQNA 3LKZA 4AD8A 4N5NA 2RD2A 1T1SA 2PGXA 1OV6A 1N0VC 1U98A 4OFZA 4OJKA 1A4IA 3KLNA 5HKAA 1A8PA 3E6AA 3DV2A 5IJWA 2FZ4A 1ZUWA 2QYOA 1L0BA 2OFWA 4HVTA 4IIXA 1TK2A 1X9GA 1E77A 1WAMA 2BISA 2CNNA 3FGNA 1QYDA 5T41A 1OR8A 1PNTA 2R6FA 1BTOA 3QE2A 1X8XA 4N7RA 1I6KA 3BH7A 4LMBA 3CNOA 1A9OA 1BXRA 1IVNA 7REQA 1JAIA 4ETNA 2ZT7A 3N2KA 1VBNA 3V1NA 3W90A 1ABFA 1T4CA 2O1WA 1XMIA 2PL9A 3ZE8A 3RHTA 4PSCA 2WKQA 1X7GA 5LXTA 1P1FA 3AVTA 3OU6A 2BFFA 3T4UA 3URMA 2JIQA 3RADC 5A4KA 3SXUB 3OOSA 1B8VA 1X9IA 2E87A 2QPAA 1OJ7A 1SEPA 3EZNA 3GCXA 5IKOA 1KQGA 4D6PA 3TRHA 3UT5B 3AIMA 3KD2A 4PGGA 3TVTA 1NP3A 3ISJA 3VU1A 5MFZA 2IZ7A 4R2MA 1W0KD 2WSSD 3MYRA 3NC1C 2MTBA 1TEHA 1Z56C 2CB0A 2FSSA 2V7UA 4TKUB 5AW3A 5JJKA 2XDQB 3HO1A 2IHYA 4X94A 1E60A 3C6YA 4ZMBA 4NZZA 5E8RA 3FVVA 3C0KA 1C9YA 1VCHA 1YDFA 1Y6QA 3OJWA 3NKFA 4KIFA 2ATCA 4KSBA 1DKRA 2RH5A 5IP5A 2FI1A 3QXJA 1O95D 3ZDEA 1CK4A 4J7UA 2YKGA 3RB8A 5CBPA 2OMKA 4OFWA 2D0OB 2Y9PB 4GWKA 4G9GA 1U9YA 2CFOA 1MQSA 4Z3KA 4JJKA 2D00A 2GRUA 5IJ0A 3MJRA 1Z6YA 3G0DA 4BMCA 3HQ4O 3KD3A 2NQ2C 3FGZA 5JOQA 2FMTA 1NX9A 5G40A 4IOJA 4CKCB 4TYMA 1IZ9A 2V98A 2VHEA 4UEKA 1F17A 3MCUA 3K0SA 1R9JA 1TZ2A 4DANA 1IN1A 2V0CA 2Z30A 1V4NA 1VL5A 3KRTA 1P5HA 1ZN7A 5CP8A 5IT9A 2HV8A 3N28A 3AV3A 3INGA 1SOUA 2WWFA 1ZDMA 4RMIA 2ESRA 3FPCA 3UMGA 5BURA 1IN4A 3L9WA 4K9KA 5IBPA 3ZKWA 1WDKA 1TI7A 1EG7A 1XD2A 2C7PA 1Z0FA 2XA1A 4OKSA 5KWIA 4TSFA 3EIWA 4G0YA 3KHUA 4MA0A 5JXJA 2IHVA 1R8QA 1UUFA 2LWIA 2ZPTX 4HDSB 4IDAA 4WCFA 1WW2A 3SE0A 3CRQA 1SBIA 3TMYA 2WYHA 3TLMA 4CU5A 1IAQA 3OWXA 5TRTA 2W6CX 2QRVA 4FGUA 1E6LA 3R7FA 5I7RA 5AKGA 1YU9A 1F5SA 4JEIA 3PQEA 1V39A 3ND9A 1J9EA 1N36B 3TCNA 2NNLD 2B9EA 3TLBA 5EIEA 5JO0A 2ZBEA 4DFDA 2CHVA 4KX3A 3N3AC 2HRZA 3LMKA 1EFTA 4Y7DA 1OVMA 1QO7A 4J16C 4ZCIA 3DZBA 3JQRA 4ZP1A 4FMDF 3QLEA 1OLUB 1SEVA 1E3TA 2N42A 5IVDA 1OE0A 1FFYA 4P7FA 4WLNA 5DHUA 2G36A 2HXYA 3DBVO 3EXG1 1ZSYA 3CH6A 3DBHA 3FZGA 5FOUA 1XNRB 1II8A 1X74A 5ALRA 5DYGA 3UG6A 4RPCA 5BRAA 1ZM9A 2P5YA 3JZFA 2V0GA 3ZZ1A 3G9UA 2DH5A 3PEFA 2G25A 4OHWA 5JAHA 4MVJM 2VHQA 3A27A 3BIFA 1H8HA 5I51A 4TYWA 2FMHA </