3SBDA

Crystal structure of rac1 p29s mutant
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
177
structure length
177
Chain Sequence
GQAIKCVVVGDGAVGKTCLLISYTTNAFSGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related C3 botulinum toxin substrate 1
publication title Exome sequencing identifies recurrent somatic RAC1 mutations in melanoma.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 59
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3sbdA00
2GJKA 3ICQB 4IVPA 1E9SA 1Q44A 4NCNA 8OHMA 4MDEA 4Q21A 4KV9A 1EFRD 3B1XA 4LK2A 4NMMA 1AZTA 1R5NA 1XFAA 3MWJA 3AF3A 1HEIA 1T8TA 3GJ5A 3KXLA 4YXWD 3U3MA 1BH2A 2DYKA 1JJVA 1UDWA 3A37A 2W00A 1YR9A 1KSJA 3VR6A 4AYTA 3RANA 3NVAA 3ADBA 3I72A 3RAPR 2BWJA 1XZPA 2J0VA 1SKQA 3GLIE 2QPAA 1OHHA 2FJUA 1ZM2A 2UZIR 2ZYTX 4PAQA 5BWMA 1GG2A 4KBGA 1UADA 2NO6A 4JBWA 5FTMA 5C46F 3B13B 4PC6A 4M22A 2RHMA 5JLJA 1T3SA 2OCAA 4EFNA 1HURA 3ZQ6A 4Q02A 1G8PA 4YC7A 2ZRIA 4O0MA 4XWAA 4CW7A 5L3QA 3OE7D 1U90A 2VHTA 4NYMR 4N1AA 3NIBA 2J87A 2DR3A 2R6GA 4UXIA 5JEEA 2BEJA 2JGNA 3CM0A 1W49A 3SFVA 3QBVA 3LV8A 5E7JA 3ZQJA 2IYRA 4R2IA 4DSOA 1E0SA 4I4LA 2FFQA 4HAVA 1ZD8A 2KBEA 1K5GA 1TAGA 3THYB 1H8EA 2VTKA 2KBFA 2WJGA 4IW3B 5DO9A 1IXSB 1CP2A 4D81A 4I1UA 4XH9B 1XTRA 1CBUA 3LXRA 4FN5A 1NNEA 4WZAE 1QHYA 1UEJA 3CRMA 2QSYA 5CIQA 5SZIA 2AD5A 3U3JA 5BN4A 4A0GA 1U94A 2IC5A 3THWA 3TSWA 4IDPA 2YOGA 4GFDA 4M1TA 3UXMA 4B3DA 2D62A 1ZU5A 5EJEA 2XITA 3EC1A 1F2UB 3ZIAD 2EVWX 4JKYA 4QBGB 1AQUA 3CUEF 5KOYA 4M1MA 2IHBA 2JEOA 3H0KA 2HXYA 1IONA 3NH6A 4XJXA 1E99A 2N1BA 4W5HA 4DEYA 1OXSC 3LW8A 3MUFA 4TYNA 4ZCMA 1FTNA 2ZJYA 3A4MA 1XB2A 2L0XA 1VHTA 2ZU6A 1Y63A 4OK6A 1KO4A 4JL5A 5L3SB 5DHAA 4ITRC 3B1ZA 1CJUC 4FW9A 5FOVA 1NG9A 2Q9AA 4QNMA 2IS2A 1HUQA 3AP2A 4DC9A 4TN1A 5FI1B 4FIDA 4KO8A 5DIFA 4RZUA 4D6PA 1AM4D 2ZANA 1KAOA 1E2KA 4JLDA 4D82A 4WZBE 1XD2A 2OFOA 4JLPA 4HDCA 1AKYA 1T5LA 1L8QA 2JASA 2OFWA 3CH5A 2CCKA 4MGZR 1Q21A 2OBMA 1JNYA 1DTSA 1P5ZB 1X1RA 2XOKA 4LZZA 4Q4JB 1NY6A 3SJBA 1R6BX 1ZYUA 5H8WA 2QQ0A 4S35A 5FUYA 1KO1A 2B8WA 2GVZC 2QA5A 3CPHA 4DLXA 5AUQA 4OHYA 3C5HA 1MT0A 3VX4A 1A5TA 4HDOB 1XMSA 4PC3A 1E79A 5FTLA 1P9WA 3DEFA 2B7BA 1HT2E 1MABB 3TKLA 3GLFA 2ZJZA 4PO8A 2QI9C 3FYHA 1UBCA 3I3SR 4KBFA 4CT5A 4DCNA 1DAMA 1E3MA 1EGAA 1J8MF 4RD3A 4ZV4A 2QRNA 2GXQA 2I1QA 2QUZA 2XZPA 4PO9A 2BEKA 2ZJAA 3OEEA 2CCGA 1CR1A 1Z2AA 4LJ6A 4A0FA 3NBXX 3CF0A 1DG3A 5CB8A 3R9XA 4GP6A 5IRCD 2ZRCA 4B75A 5AK0A 1US8B 3AF1A 2ZJ8A 1ZD9A 2ZTSA 3U4QB 3Q8XB 3SEAA 4P32A 2FPMA 3GLFE 3C5CA 2JJ1D 5AJZA 2P6RA 3H1TA 1GL9B 2A2ZA 1VHLA 2OEPA 4HI0E 2HXSA 1RRPA 2WIBA 5FPYA 3KB2A 3GEEA 2LWIA 2IF2A 3OFND 2ZYWX 4I1OA 3I1FA 2H8KA 3MMPA 4L9SA 3VKWA 3IIKA 1XXHA 4D2IA 5C1BA 4W7SA 2PX0A 1ZNZA 2GNOA 3LY5A 2W6ID 1E9DA 2C9OA 3P20A 4ABYA 4B47A 4UNNA 2Z4RA 1Q57A 2QT1A 3VTKA 4HLUA 2O8DB 2G83A 1QHXA 3EZFA 1VPLA 1KI7A 2W6JD 2PJRA 3N5CA 4F4CA 1T91A 4JLOA 3WBJA 2YOFA 4LC0A 4LHVA 4Q4HB 2I1VB 3GLGE 3GMTA 4AD8A 1EFUA 3NHBA 4FCTA 1II8B 4Z54A 4ZI3A 3ZD6A 2J7PA 1XMJA 1KK3A 5HR5A 1XXHE 2QZ4A 4ZIRB 2O8BB 5FUVA 5TV2A 4Q1AA 4X8LA 1E2FA 2YNMA 5B64A 1ZNWA 4CEIA 2VSXA 3ZS8A 2JJ2A 3BRWD 4YLGA 1FX0B 2Q0HA 4EJSB 1W4CA 1GNRA 5L8VA 1U8AA 1DBSA 5HKKD 1XCMA 4ZKEA 5HZHA 5FOXA 2FNAA 3RWOA 4LPKA 4HZUB 2P5SA 3QSYA 1G19A 4OI4A 1X3SA 3U3KA 3PENA 4O3MA 1O87A 1S3GA 3MRSA 3WMGA 3AVOA 3BERA 1IN8A 1W0JA 1Z83A 2D7CA 2ZRKA 5BYJA 1J70A 1P3JA 4DKXA 2ZI9A 4Q9LA 1T5IA 1N6NA 1KI1A 2WSSD 4IEIA 4UNPA 2P3SA 3CZPA 3PUWA 4P0TA 1RJ9A 2GZHA 3TW8B 3ZD7A 1R0YA 4M9XA 3O8RA 2VF7A 1GFIA 1E2EA 3TJZA 2FG5A 4GRAA 1ANKA 4MA4A 1JEDA 3TUIC 4JLNA 1XEXB 2ZS7A 4FINA 1RW4A 3DM9B 3QVVA 4Q1DA 3VQTA 1OW3B 2F1IA 1OYWA 1SKYB 3ZZTA 1ZP6A 2V3CC 1E2MA 3WNBA 1QVAA 5EUQB 4TZ6A 1Z0AA 1SVLA 2ODNA 4TTQA 4BQSA 4HB4A 1HT1E 1OXVA 4LJ9A 2ONJA 3RWMB 1YRBA 3C4JA 5H70A 4Q01A 4ZDJA 5EE3A 3LBIA 5DI9A 3UATA 1OH5A 1LB1B 2I3BA 1GKUB 2ODWA 1OT3A 1OLOA 3F3YA 1CTQA 1H8HA 4R9UC 3FKSD 5BYKA 3HPRA 3RNLA 1S96A 4A1FA 5TVKA 4JS0A 1K8RA 2MSDB 3AVPA 5GJBA 4GL2A 1WQ1R 4MUBA 2OZEA 2R6CA 3CONA 1FNNA 4R71A 1T0JB 3SFZA 4KXFB 3UK6A 5IDVA 3W8NA 4FMDF 4EPWA 1U9IC 3VFDA 2FDCA 1YR6A 5FOTA 4B3XA 2ZITA 4BPBA 1ZAKA 1A7JA 2DHRA 5JCZA 1L4UA 1E9RA 4LV8B 5KUTA 3QOFA 3FOZA 1OH6A 1KK1A 1X6VA 2CL6X 2CLCX 1NVWQ 5FBRB 3JZAA 1E2GA 1R0XA 3EWSA 2MSCB 2YV5A 5HCNA 3IIJA 4MRVA 4TSFA 5EP4A 1FQKA 4IDQA 5K8IA 4MRSA 3B7GA 2EQBA 1BYUA 2BDTA 5JSZB 3CBQA 1CU1A 5CJPA 3R8CA 4B76A 4G3XA 4RZXA 2PBRA 2C77A 4M9SA 1N6HA 3K09C 2GRJA 2P0EA 2A5JA 3VU9A 1SULA 3ADCA 1IBRA 1EFCA 4RY2A 5JCPA 1YR7A 4YXWA 2FX3A 2IYWA 1XEWX 3ZVLA 1E96A 1UBEA 4KHZA 5FTKA 3OF5A 3ZS9A 3X1ZA 4CT4B 4WZ6A 4L9WA 3ZVNA 1Z3IX 4ZCIA 1H8ED 3RS3A 4QL3A 1R8SA 2GCOB 3UMSA 1DAGA 4IVQA 4BFVA 4HB0A 1JAIA 3Q9LA 4O2RA 1AKEA 1NMXA 1NKSA 5KSPA 1KZGB 2J9RA 5TARA 4EPVA 3U7HB 1GNPA 1NKTA 3QY0A 1XDBA 2W83A 3KTAA 3NEYA 4DUGA 3MSXA 3OE7A 4EQ6A 1Z06A 4EDHA 2NMVA 1DAIA 1R2QA 4I81A 1KOFA 4TLEA 2NO1A 1E69A 3SBDA 1EESA 1GTVA 821PA 3GJXC 1FUKA 1H65A 1XF9A 3VKHA 2HCBA 4HYYA 1BS1A 1GL6A 4B2LA 1OF1A 1OXTA 2YKGA 1N5LA 2GBLA 4G01B 1SXJC 2NO9A 2AWOA 4B73A 4MDFA 1NLFA 1G8YA 1NVVQ 2ZUCA 4RVCA 3PJRA 1G6HA 1Z28A 2O8EB 4WIAA 4EIWA 2J5XA 3TSOA 2JLZA 1RKBA 1ZRHA 4HLDA 3ZIAA 3ZZ0A 1IY0A 2HF9A 3FPAA 4X8MA 4IDOA 1NLZA 2ODEA 1XJ0A 3CKLA 3EA5A 2WM9B 1W36D 3KUCA 4AKIA 4KYUA 2GCPA 3K9NA 1MRSA 4KFUA 3THXA 1I2MA 1VIYA 4PPQA 1NI3A 4ACBA 3CWZA 5AR1A 4F4JA 3U7GA 4YMVA 2IYQA 1XEFA 3LAWA 3U6BA 4A8JA 2IW3A 4LHYA 5CLQA 4BFWA 2A9KA 2GDJA 4M1YA 4TT3D 2XOKD 1BKDR 2CJWB 3JVUA 3QKSA 1B0UA 1YZNA 4URZR 5B58C 1EFHA 4A82A 1C9KA 1QHNA 5AJWA 1DELA 4LPSA 3W6OA 1YZKA 2FU5C 3L8YA 3L0OA 3QF4B 3P4YA 2F43B 1Z22A 1KK2A 4PPGA 3RC8A 4LDJA 4C0SA 2VIIA 4C7OA 1RRCA 3P26A 1T4GA 2FSIA 3FE2A 1G9XA 4NE2A 2J7KA 5CLLA 1KJWA 3TRFA 2E9SA 2VRWA 2CNWD 1VG1A 2F1JA 4GNKA 1I4LD 4MYUA 4YMUA 2OLKA 4B48A 4C0LA 1DARA 3HDTA 4RD0A 4C0QC 3MGCA 4PFSA 5DI3A 3WY9A 2VP5A 5LPNA 2ASEA 3GJ6A 1GNQA 4V02A 1M2OB 4IOKA 1G3UA 2ZAOA 4U02A 2JLUA 2ZRAA 3V00A 4WXRA 5FR2A 4QFMA 2CHQA 4MKGA 4BZXA 4AC9A 2XZOA 2W0MA 2WMOB 4KCGA 3KQKA 5SZJA 3IQWA 1NG1A 4GT1A 4MUAA 4WXPA 4BGDA 1N6OA 1V5WA 1NN5A 3CIOA 4OKSA 1XRJA 2C04A 2V1UA 3DZ8A 3MG9A 4JSTA 3K0EA 1X8KA 1JR6A 4QG7A 3PQCA 1KMQA 3FFAA 4ARZB 4M53A 5AWFC 2Q9CA 5HE9A 3RRYA 1SVOA 1WP9A 2J1LA 1MO6A 2NQ2C 3B85A 1JJ7A 3OHMA 3UKDA 2JLVA 2CLSA 4PPFA 2PLRA 1LTQA 4LI0A 1HA3A 4QNRA 2JJ1A 4QHTA 1N25A 1JALA 5FBLB 2XGJA 2NG1A 2C2HA 1N6PA 3K0CC 5EXSA 1S4QA 1P2UA 4JT4A 1KO8A 5KSZA 1Q3HA 2BMJA 3EZ9A 1O3YA 3OFNA 3B9QA 3KUDA 3WRYC 3LBHA 1N5JA 5K8TA 2YJTD 2B8TA 2BBWA 1Q1BA 3AGQA 4AG5A 2H17A 2QENA 3OIUA 4Q9KA 2JJ2D 3JZMA 4P4SB 4QJ3A 2JIZA 5J4KA 2UVQA 2IYUA 2OT3B 2XJ4A 3NBYC 1ESNA 3CR8A 4I99A 3THYA 1D2EA 3Q72A 5P21A 1Q22A 4UNRA 1ETUA 3DKPA 2CMKA 3VMFA 4HAXA 3B60A 1YZTA 1PV4A 4BRWA 3I92A 1OIVA 3AVWA 2WJJA 3TUJC 4ZI2A 2WKRA 1NVXQ 4RFSB 3E5HA 1QG2A 3TNFA 1IJFA 2WWWA 1P62B 5FPKA 3CO5A 4OBEA 1Z6YA 3T34A 5FOUA 4Q1FA 4CRWB 1JPNA 3GJ4A 4CZ2A 4UXHA 4QBIA 1F2UA 2VHUA 3C41J 2V6JA 3WNDA 2OE2A 4DDVA 5C18A 1Z6AA 3FB4A 3HWSA 4NYIQ 1D9ZA 2FA9A 2ZE6A 2F1RA 4BFYA 5HKKA 2G0TA 5FBQB 2PMKA 3ZH9B 3EIEA 5FPTA 2HYDA 1HYQA 2JATA 2J59A 3LLMA 5HTKA 1YU9A 3AVTA 5DH9A 3GLHB 3SQXA 2QL6A 2BVNA 1OXXK 4BZPA 2CL7X 5L3SA 1DAHA 2VP0A 3I4LA 1ZUHA 5D3QA 2VHQA 1DO0A 5KSYA 1EX6A 3T06B 4B6EA 4JLBA 4JL8A 1H8HD 2NOAA 2GJ8A 2GK6A 2R6DA 4PX9A 5CM9C 1NN0A 3IILA 3PCRB 4HLUC 4HAZA 3LO5A 1CXZA 5BXQC 3IQXA 4GMDA 3SE0A 5AUPB 4GOXA 4FCVA 2QY9A 3U3RA 2R44A 2WV9A 4US2R 3BS4A 4NPHA 4TQUS 3EX7C 2F55A 2EW1A 3QIAA 3ETLA 4D0LB 3TUZC 2QG6A 2XTZA 4A2WA 4L5BA 3TQFA 4D4KA 5EP2A 4OQLA 2OILA 4Q03A 4JMPA 4Q4JA 3U2QA 3WYGA 1FP6A 4RD1A 3X1XA 2GESA 4M1SA 3ZVMA 2OAQ1 4BASA 3FKSA 3SYNA 3QKTA 5KHOC 2NGRA 2A5FA 2QE7A 1XCPA 3UMRA 1WB9A 2GZDA 3Q5EA 5B2ZA 3M6AA 4A2QA 4DCTA 4LV6A 2QGNA 1K6MA 2H92A 3DO6A 3I8SA 1MABA 3AVQA 4GP7A 4HEJA 1ZCBA 5DYIA 1ZMXA 2LCFA 2BC9A 3KXKA 3BAFA 2A5YB 3D8BA 1Q1QA 4TYYA 2GXAA 1E4YA 1LS1A 1AZSC 1P72A 2ANCA 4LC1A 5F98A 4MRPA 4AURA 5KNBA 2J0QA 1KI3A 2VP9A 1GITA 1VYUA 1WF3A 2ORWA 1IJEA 2ZSFA 3HYRA 3K0AB 4IFBA 1JAHA 3LRPA 3CF6R 5GVSA 1R10A 4QBHA 1NIPA 1XTJA 4B2PA 4IDHA 2QPTA 2HT6A 2ZE7A 1YRAA 1G6OA 1ZCAA 5A5GA 2RKOA 1E2JA 3RRNA 1US8A 3OESA 2JLRA 3RS0A 3U4QA 4XVUA 1LF5A 1UM8A 2HUPA 2ZSBA 4AYXA 4FMDB 4IDNA 1R7RA 1KNQA 2BMEA 1RYFA 2QU8A 3K0SA 2HCJB 4HB3A 1D2MA 5JS8A 3K70C 4BLPA 4H1UA 1S0UA 5CM8B 4DUGD 1OV4A 2DPXA 1XNJA 5B30A 2O5VA 2WJIA 1DPFA 1UKYA 4PZYA 1WXQA 2F6RA 1S9DA 2V8OA 2BKUA 4NU0A 5JRZA 4DCVA 2O8DA 3IEUA 2G77B 4DSUA 1G7RA 2ZRMA 3B1WA 3ND8A 1TU4A 2IEYA 2AKYA 2YWGA 4BLRA 1Z0JA 2ZROA 3WMFA 4Q1EA 2V7QA 2ECKA 1G16A 2KJQA 4Q4HA 4AKHA 3RRZA 1RRGA 2Z0MA 1G5RA 3FGNA 3RC3A 3TAUA 5DSZA 2QBYA 2GWHA 1DAKA 1II8A 1KZ7B 3DHWC 3QXXA 4OJKA 5FTNA 3ZJYA 1IXZA 4PC7A 5KNDA 1KSGA 1KI6B 1SQ5A 1CJTC 4ZIRA 2O8BA 4KSBA 2ORIA 1GVNB 1T0HB 3I5XA 4LJ4A 4S2EA 5LBIA 4EJSA 1FX0A 5A4JA 4D4LA 2GILA 4A36A 4HDQB 2D4HA 1DADA 1Z8FA 521PA 3EZ2A 4C9BA 2D2EA 4HZUA 3K9HA 5J4VA 1TF2A 5J4YA 4JSYA 4M1OA 1KY2A 2REOA 4MYTA 1ZIPA 4QM7A 4Q9JA 1G7TA 2ZRBA 3MLEA 2GHIA 2ZJBA 1E0AA 1G291 3LD9A 2AR7A 1Q12A 1VCOA 3QNUA 1F6BA 4P31A 4D25A 1TQDA 2ATVA 3V4FA 4Z51A 3W90A 5EXPA 1U98A 1OB5A 2LKDA 2FPLA 2G1JA 4KFSA 4IVRA 2KWIA 1SVMA 4JLVA 5E95A 2PL3A 4B3BA 2IXEA 4OI1A 2H5EA 3EAQA 4PO1A 2QAGB 4Q7LA 2IUUA 3UWKA 5EP3A 3D6TB 1F2TB 3CWQA 4M8NE 1UAAA 1XEXA 4DSNA 2AK2A 1FL9A 4PANA 3CF2A 5L3VA 2PZFA 2ZI7A 5CDFE 2D2FA 5D3MB 1XTKA 2BKEA 3LX8A 4DIEA 1E6CA 2QSZA 4PAOA 3CB4A 2REXB 1G4UR 1YZUA 4KLZA 3GD7A 3A4LA 1SHKA 2OCYC 2Z5FA 3BB3A 5EZ6B 1TF5A 1Z5ZA 3FHTA 2BM0A 4V0LA 3TVDA 4TMKA 5EQTA 2WWFA 2JDID 2VHJA 1ZC3A 3A1WA 4TT3A 1YZLA 2BBOA 1S8FA 1A2BA 2QQEA 3B5JA 2JAQA 4II7A 2CBZA 1WMSA 4PHFA 4DCSA 2KSQA 4Q7JB 4L16A 4US1R 2K5UA 5LB4A 2OM2A 5ELXA 1SKYE 3B8HA 3PUVA 4Q4AB 1E1QD 3K8YA 1KI4A 1P60A 4Q1CA 2GK7A 4LBYA 3TIFA 1TUEA 5KDDA 2XTNA 3QI2A 1QHHB 1SHZA 2C5LA 2GBLC 3MFYA 2VP6A 3OIWA 4KU4A 1VTKA 2CNWA 5FOSA 2LKCA 3HR7A 1G7SA 4OQNA 5TMPA 2ZSAA 1BIFA 4PQRA 1E2DA 4M9QA 3B82A 3U3OA 4QKQA 5C2JB 1TF7A 3FDIA 3WYFA 3TQCA 4EPYA 1U8YA 1FQJA 2ZUBA 3NXSA 5J40A 2AL7A 3O8BA 4A15A 2VSFA 1WDTA 2WSMA 3C14C 4PHTA 5JSZA 4LJ7A 3BIFA 5J47A 2YZ2A 1XTIA 1SXJB 5ANRB 1CLUA 4FXPA 2FZLA 5IHPA 1NLYA 4G5GA 2CXXA 3U7EB 1KHTA 2C9CA 2R8RA 2IT1A 3VX3A 3KJIA 3O47A 1M7BA 4X8HA 2FF7A 4FMCF 3KX2A 4PTLA 1ZM3A 1OJLA 4LRWA 1JXOA 2JLSA 4LJ5A 4A8JC 4LOAA 3B1YA 1E0JA 3TE6A 1QHIA 4TL7A 1SZPA 3ONWA 1TPZA 5K8UA 5KTYA 4NP6A 2GJAA 2JIZD 3F5FA 5FR1A 2PLFA 4JVNA 4W5WA 1GILA 2WWIA 4ACAA 2IS4A 2WWGA 2IBMA 1G3IA 1NVUQ 3G0HA 2IWRA 5DN6D 2V1XA 3LQRA 3OAAA 4B35A 5HE8A 1I2DA 2R6FA 4W5JA 1UKEA 3AVVA 4FI3C 3L82B 2D3WA 4V0NA 2JLYA 2OLJA 3TH5A 4PR0A 1KYIA 3BC1A 4D80A 2FFHA 1MV5A 4B3CA 2QMHA 2YWFA 1YKSA 1E94E 4D4JA 1II0A 1ZNXA 1ZM7A 2J3EA 2ZRDA 4JL6A 1OSNA 3IBYA 3EARA 1OXUA 2ZR0A 3QPWA 3DOEA 4QJ4A 4OHXA 4YDHB 4EAQA 1TADA 1P75A 3I32A 1UFQA 3UIEA 3HYTA 4DZZA 3KJHA 4GOJA 4OHVA 2G9NA 1GKYA 4GI7A 4YMSA 3NEJA 4TMXA 5EZ5A 2GVDC 3SU8A 5CK5A 4HUTA 2ZVQX 3JVVA 1G8FA 3MCAA 5A0FA 3V9PA 3THWB 2O8EA 1S1MA 2AK3A 2ZJOA 1UKVY 4G5RA 5EUMA 1A2KC 5HCIA 3FMOB 1MO3A 5G3YA 4ZO4A 3ASZA 5JZVA 2IYSA 4ZDKA 3BFKA 4TQ9A 3ZYCA 1TQ4A 2H57A 3VNVA 4URXR 1Z63A 221PA 2GF9A 2X2EA 2FFAA 4UJ3A 4D26A 3SI7A 2ZI4A 4IXNA 2QORA 3RHFA 2KE5A 4N0EA 2P2LA 2DCUA 3C15C 3D31A 3LXXA 2IUTA 1LW7A 1AS3A 1RVDA 2ANBA 4QBFA 5AUNB 4ZDIA 1DS6A 3BGWA 3CRW1 4D0GA 2F3TA 1X8JA 2CJWA 4UNSA 1F60A 2G1KA 2A7QA 4C0AC 4U7DA 3FFBA 2DWQA 2RGDA 4RD4A 1J99A 4TYQA 4DLTA 4XVRA 4OHWA 1N0WA 4PC1A 3QF4A 1SGWA 1LS6A 1TQ6A 2QE7D 2ZAMA 3LLUA 4KVAA 3L0SA 2IWHA 4XWOA 2IYLD 2OFXA 3GCGA 4IFEA 4TL9A 5K8LA 1ZC4A 3SQWA 4WVFA 1ESMA 3RS4A 4NTZA 1PLKA 4Q1BA 2FFBA 2OV2A 1CKEA 1XX6A 4NBSA 1FMJA 2C03A 2P6NA 3PFIA 4ZPXA 3W6PA 2PH1A 2ZYUX 2WOOA 3PVSA 4HATA 5TDHA 2WHXA 3LWNA 3REGA 1VKJA 3OEHD 3L0PA 4XTCS 1E2NA 3QBTA 4G1UC 2HJVA 1W2GA 2GETA 3EASA 2WIAA 1G5TA 1NBMA 3E70C 1Y3AA 3R20A 1B23P 1LY1A 3SJCA 1L7VC 1N0UA 3W5JA 5JFGA 3BBPA 1COWA 2Q3HA 4ZDWA 2YINC 2IYYA 4HAWA 4OQFA 3TSZA 2CEAA 3A1SA 4ARZA 4JJZA 3EIQA 3H84A 3I61A 1JEEA 2BM1A 1CF4A 1IY2A 3EG5A 3AKEA 3CNNA 1NBME 4Z8YA 2Q3FA 4B33A 5JEDA 2V7QD 2N46A 4OK5A 4XSGA 2W2VA 5EXXA 4B44A 4BWYA 4Z1MD 3SBEA 1M8PA 2QROA 3SR0A 2WZQA 4K8OA 4PHGA 2J0UB 4PQFA 2ONKA 2PCJA 2ZREA 1WBDA 1LV7A 2JLWA 4NZYA 3AP1A 2REBA 1G5PA 4LYHA 2WJVA 3GJ0A 1SVIA 3C16C 3BH7A 4P4SA 3KQUA 1UF9A 4NCKA 1GIAA 3CRQA 1UPTA 2V55B 4X8OA 2C98A 2PT7A 1PLJA 1Z6TA 3HP1A 3NC0C 4KFRA 4MITA 4P33A 3I8XA 3K9LA 4DLYA 2D7DA 4LBZA 1GOTA 1AJEA 5JI2E 2DFLA 4LHXA 5KYKA 5IF9A 1XU4A 3KL4A 4AKEA 4PZLA 4KI0A 3BFVA 4RFSA 1MH1A 4C2TA 2ZI6A 2YC4C 4G5QA 4PZZA 2UZ3A 4DVGA 2WWYA 3QENA 2DWPA 5G40A 1NSTA 1ODFA 2P67A 4P4TA 3T1TA 2CL0X 3LVQE 2RGNA 4URYR 3U44B 3SYKA 3AUXA 4TLBA 3PR1A 1PVOA 2XTMA 4QGFA 1NN1A 1N3BA 1XJQA 4E09A 3VR1A 4EPRA 1AA9A 2IYTA 4NCIA 2ZS8A 4LX0A 2RGAA 5SZKB 1P9NA 5E7MA 4OQXA 3SZRA 3RVBA 1YZGA 2FV8A 3SNHA 1G21E 3LA6A 2IEZA 1HV8A 3GLGB 1CR2A 4CIDA 3X1DA 4H9GA 3SN6A 3GLHA 1UBGA 2R9VA 1Q1EA 4PQYA 2J0SA 1OFTA 2QMUA 2RHDA 1W7AA 4NDZA 2XZLA 3E2IA 1NN3A 3TR5A 2ZM5A 5EE1A 3BB1A 2PMDA 5EE9A 2RGCA 1RJ9B 3IIMA 4OI2A 2FE4A 3LQQA 3BORA 5FUWA 1HE1C 4IEEA 2EFDB 2GZAA 4RKFA 3CX8A 2PZGA 1OFUX 2XNSA 1FFHA 4JT2A 1S1CA 4Q47A 1KTVA 3GLHE 2ZSDA 3L0IB 1JECA 3QG5A 1N6IA 1ZJ6A 3LBNA 1AN0A 3S1AB 1XP8A 2BIFA 4WAUA 2WKQA 4QOSA 1W47A 4H1VA 1J90A 3BFXA 1AK2A 4YQFA 3DPUA 2DY1A 4JLKA 1P73A 2JDIA 2NTYC 2FN4A 2YC2C 2FH5B 1MKYA 4EJSC 4JZKA 3W9YA 5KPDA 4M0LA 5FOWA 2DFTA 3U60B 3VR3A 4L4UA 2ZE8A 2VBCA 5C4GB 2FPKA 1E1QA 1OIWA 1KI2A 3AKCA 4RZ3A 3P32A 1KDOA 4JLAA 3NDBB 4A2PA 4DLSA 1EWRA 2CHVA 3IO5A 1QRAA 2D06A 3AVYA 3IGFA 1XMVA 2B21A 1AGRA 2O0KA 4FWIB 1TX4B 2QTHA 4P3YA 4TLDA 5TXGA 2QM7A 3IEVA 3NC1C 3K0AA 4ILEA 2OCBA 4TTPA 1YQTA 3G5UA 4UNQA 4B2IA 4M1WA 5J5CA 1GRRA 5BW8A 4CEHB 4NCHA 1TMKA 4O2LA 1T3LA 3HU2A 3I73A 1G41A 1Z47A 3R8FA 1IN4A 4NHOA 2IX3A 4BZQA 3UG7A 3TVTA 2XSZD 4Q4LA 1CS4C 3D3QA 4BLQA 1W36C 2B7CA 4B3GA 4BFXA 4Q66C 1U0LA 1GP2A 2BMFA 5F2EA 4GOKA 3CR7A 3OAAD 4MKHA 2IXGA 4DDWA 2ATXA 5DGXA 4F93B 5LB2A 3T12A 3D7MA 2OO7A 5F3WB 3Q7PA 4D0NA 2NIPA 2ZRJA 5JMTA 2C96A 2FWRA 3KFXA 121PA 3CNLA 3LFUA 3R9WA 2VEDA 5KDLA 1OE0A 2OG2A 4KSCA 3AM1A 3AVXA 3IO3A 4Q7MB 4C30A 3VR4A 2H1LA 1IN7A 1FOEB 2AXNA 1MOZA 3KZ1E 2HYIC 5DN6A 3ECCA 2WWHA 3J81k 4ZCLA 4DWJA 2Z4SA 4KLNA 4Q7KA 3K0FB 5CYOA 2YYZA 1KI6A 1KAGA 2F7SA 4FMCB 5EXTA 3M4YA 3T1OA 3MJRA 1W48A 5JHHB 1I4DD 1ZNYA 5GVRA 4E07A 4FCWA 5TY0A 3NBZC 2A78A 2FMXA 2V4ZA 5KNCA 1FPMA 4LGMA 3L2OB 4DHEA 4M2LA 2OHFA 4RZ2A 3GP8A 4IXMA 1HY3A 2YOHA 2KB0A 3R7WB 2VA8A 1U8ZA 3WNCA 1Z0FA 1JR3A 4XOIA 2AWNA 1OH7A 3WXMA 3RDPA 1G4AE 1QVRA 4DLZA 3P27A 1RC8A 1LVGA 2IYXA 5E3HA 1DAEA 2GAAA 2JJ8A 1N0VC 1W44A 1VIAA 3SOPA 3U5ZB 621PA 2DB3A 2Z83A 1SVSA 4QC2A 2HF8A 1KO7A 4M4SA 2X8AA 3MD0A 1NL3A 2QAGA 4OL0A 4B32A 1M34E 3DL0A 3DM5A 3GJ8A 1F2TA 3PEWA 4QM6A 1M1YE 3CRVA 1NVVR 3KQHA 2XXAB 1CIPA 2BJWA 2O52A 1JR3E 2HLDA 2MSEB 4YMTA 5J4HA 2IS1A 1E2IA 4M1KA 2C8VA 5D3MA 4DBLC 1G7CA 1XWIA 1FMLA 2CVFA 1GSIA 3K09A 4PSVA 5CK4A 3GFPA 2YVUA 1L2TA 4C0BA 3QE0A 1FTSA 1U0JA 2F9MA 3PV0A 2WVJA 1P61B 1U81A 3SYLA 4AI6A 3QF7A 2W0SA 2GJ9A 4UXJA 4YMWA 4E03A 1WBBA 3RRMA 1BOFA 1E32A 2F9LA 2GEVA 1Z0DA 4CYMA 1CEEA 3BJIC 2VL7A 5GADl 4XD7A 3ZLJA 3KDSE 2JLXA 4HAUA 3VR5A 3WHLA 4B34A 1ELOA 3ZGXA 4Q4AA 3EPJA 5J4LA 2FGJA 2QP4A 4E5UA 1KKLA 1GAJA 1NBMD 3O8CA 2GJSA 1QHHA 1E9BA 2NPFA 4TYWA 3Q3JB 1Z2CA 4JLMA 4MQBA 3T1VA 3LVRE 4C4PA 2CE7A 1COWD 1R0WA 1WA5A 3CX7A 4IRUB 1II9A 1GM5A 3F0TA 1QG4A 3HR8A 2VQSA 1XTQA 3EC2A 1NJFA 2FZ4A 4TMVA 2QPOA 1X86B 2IL1A 2IA5A 4RD6A 4UQOA 2A30A 2ZJ2A 4TMWA 4DIDA 2RGGA 4BLOA 3OEHA 2A5DA 4BFUA 2XB4A 4RCZA 1G17A 1KI8A 2ZRFA 2Y8EA 4EPXA 1GRNA 1NIJA 2NZJA 4P4UA 3AUYA 4MGKR 1IXRC 1SXJA 2GKSA 2AHOA 2H18A 4QGAA 4F91B 1VDZA 3QXSA 2JLQA 4IOMA 4JVSB 5AJYA 1DO2A 1EXMA 4FD2A 1E2LA 4O25A 1M6NA 4IOLA 5FBWB 2RAPA 2DFNA 4PSAA 4CGZA 4U00A 4ERNA 2VF8A 2ZETA 3P1JA 3T15A 1DE0A 3EIHA 4IJMA 4FWTA 1IOZA 2AFIE 3FHCB 3KKNA 3NKVA 1T6NA 3FWYA 1TU3A 4A6XA 2O8FB 3EPLA 1SXJE 3KKMA 1QF9A 2WKPA 1UBFA 3LDAA 4JVLA 4Q9HA 4B74A 1U2RA 4HZIA 3WBKA 2B6HA 4KFTA 4Z1MA 2FSHA 3ZDQA 3QKRB 2YWHA 3AF0A 1D9XA 4KITB 2Q3MA 1DVRA 2EWVA 2VO1A 3BB4A 1P4SA 1R8QA 4OYHA 3RSLA 4TYPA 3B1VA 1A4RA 1KNXA 2DWOA 4NYJQ 3WP1B 2HEIA 3EPKA 5CYPA 1HQYE 3B9PA 3U6KA 2EYUA 2ZVPX 3IUYA 4K46A 1G3QA 1ZW6A 5DE3A 4XIGS 2BCJQ 3REFA 4B43A 1E9EA 1FZQA 2RGBA 5E7IA 2OXRA 2WPDA 5FL7D 4Q5IA 4TLCA 1XMIA 5GJWC 2EFCB 2XAUA 1IM2A 2NPIA 3U61B 3KJGA 4HUQB 3ND9A 3ICEA 4Y0AA 5CDFA 4QRHA 4F38A 3L8ZA 4K81B 1XZQA 4V0KA 4KODA 1ZUIA 4DLRA 1LFDB 1E1RA 5LDDC 4RKEA 3A6PC 1LF0A 1IY1A 3SC3A 1JPJA 721PA 4EKDA 4NCJA 4MH0R 3ZVRA 4A9AA 2FEOA 1N2CE 3FMPB 4NH0A 4A0HA 1F3OA 3HU1A 4QHYA 4DT1B 1GL7A 1K5DA 3LH5A 1Q1ZA 3GJ7A 4KJZA 4AG6A 1NP6A 2UKDA 2XNDA 1KMHB 3BWDD 1E98A 1VG9B 3QUSA 4MKIA 2QRZA 3PUYA 4LUCA 4AIIA 2CK3D 2GCNA 1DEKA 1NJGA 2VH5R 4DDTA 1QHGA 3DMDA 4NYIR 1YE8A 4JJKA 3NHAA 1CRQA 1GKIA 5H1YA 2GAOA 2X19A 5LD2C 4BLTA 4Q18A 5E4FA 5HPYB 3TK1A 2PT5A 5FTJA 4BFTA 2QT0A 1QZXA 4BFZA 1EWQA 4PHHA 2AFHE 2ZRGA 3ADKA 2IUSA 3RS2A 5FH9A 1R5BA 1G18A 2OUKA 5HZKA 3CLVA 1CJMA 4OK3A 3K0CA 4PXAA 5DHFA 2PCLA 1A1VA 1BMFA 3A4NA 1KKMA 3ADDA 3AP3A 4CEJB 1MRNA 4TZ0A 1NMZA 3TAHA 2ZUDA 4CDGA 2XEXA 2RGNC 3QXCA 1E2QA 2O8CB 1XJCA 2R65A 2EU8A 4B71A 1KJYA 4DSTA 2I4IA 3GLIB 1PLLA 3DKVA 1HH4A 1EFTA 3L43A 4QGGA 1W5SA 4LWZA 5CITA 2VP4A 3W3ZB 2OBLA 3NH9A 2QNRA 4WBSA 1E9AA 1VCIA 2AD1A 1Z0IA 3A1VA 4Q19A 4DEXA 4RCYA 3W3AA 4V0MA 3OIVA 3RABA 2BBTA 1Z29A 3CNOA 4HB2A 4MRNA 4ON9A 2RMKA 2ZIAA 2NO7A 4PPNA 3ASYA 4LJ8A 3PG5A 4TWZA 1W2HA 4TQAA 1ZM9A 4RD2A 1W4RA 3IKJA 2SHKA 2VP2A 1OH8A 2GA8A 3EZ6A 2MMCA 1FP7A 2N42A 2VLIA 2XSZA 1IQPA 3I62A 2GCOA 2QMEA 2QP9X 3VR2A 2ZXUA 2WJHA 1CJVC 4BECA 3TW4A 1W0KD 4WA7A 3EPHA 2NO0A 2BV3A 2HDNB 2J0UA 3CW2A 1ZU4A 4A6PA 4E22A 4GBMA 2ZR9A 4V0ME 4GZLA 4UKDA 1RPZA 2CVHA 2FEMA 5L3QB 2E1RA 3CPEA 3BH0A 3GFTA 1OB2A 1Z6XA 3Q7QA 5EE0A 1OPXA 2QP3A 1NF3A 2WAXA 1TQ2A 2IF0A 3BD9A 1KIMA 4HSEA 4ZKDA 3UPUA 2Z43A 3IPXA 3GFOA 4MGIR 2F3RA 4JLJA 5FPHA 1NSFA 4DLVA 1JR3D 1G8HA 3H86A 4OQMA 2QBYB 3DZDA 3EXAA 3UG6A 4DRZA 5GJCA 3N2IA 4B3FX 4BUJA 1HE8B 3HJNA 1RIFA 2OCPA 4N3NA 3QPVA 4LYJA 3K1JA 4QXAA 5JHGB 1VYTA 4Z8XA 3U44A 4DB4A 1CJKC 3FTQA 1YZQA 3QG1A 2WWXA 1XPUA 3WHKA 4M21A 3DMNA 1VYVA 4DLUA 3WP0A 2IYZA 2Z6VA 1TL7C 2GF0A 2HLDD 4NYJR 4ASUA 3AKYA 1M74A 3GLGA 4BEBA 2E87A 2OBNA 3IBGA 5BQ5A 5KU1A 1GWNA 3U7FB 4URWR 4JYCA 1KSFX 1OFIA 1KY3A 4TMZA 1ONBA 3OZXA 4Q9IA 4N0DA 3KKPA 1OKKD 2BJVA 2D74A 2CDNA 4Q00A 1J7KA 4HLCA 2RCNA 3N2EA 4CVNA 3UWOA 1P2TA 1TUIA 5AJVB 3LNCA 4V03A 4XD7D 1M7GA 1G3RA 3C8UA 2G3YA 2P65A 2F1HA 2ORVA 2RGXA 2ZE5A 2X1VA 3K9GA 2F43A 3UANA 5EP1A 1TTTA 1W36B 4JBYA 4F92B 3A1UA 2R62A 5AUOB 1XD2B 4F4IA 4BRUA 3PXGA 3S1AA 4L15A 1QDEA 4Y0VA 3IDQA 3GQBA 2FGKA 3LW7A 2PEZA 1KSHA 4POAA 3W5IA 4GDFA 2FOLA 5KO2A 3QQ5A 1KGDA 2AX4A 1C1YA 5JWOA 2C9YA 3FVQA 4NONA 3RLFA 3RSOA 3X2SA 5KSOA 1U0HC 3AF2A 4AY2A 2ZRHA 1IHUA 3NBFA 4J0QA 1IN5A 3Q5DA 3TLXA 1BO6A 3ZZUA 4V0OA 2EFHB 1SXJD 3IHWA 3W34A 2A5GA 3PITA 4C3ZA 3MWKA 5FL3A 3X1WA 1U99A 3GLFB 1CRPA 1D2NA 5C4MA 2J45A 4GZMA 5F9HA 1R5OA 2CLDX 1WRBA 4IKEA 2Q6TA 1P9RA 2ERYA 4OJQA 2AN9A 3B2EA 1JQJC 5IK2A 4DDUA 4CEHA 2BOVA 2QAGC 2H7VA 2ZSEA 1OHHD 1W1WA 2ZI5A 2Q21A 1E9CA 1I4TD 1ZIOA 2CCJA 5JWRA 1R0ZA 4RSGA 3GEHA 1F5NA 2BBSA 1Z6GA 3RYTC 1A82A 3QXJA 3W6NA 1DAFA 1SVKA 2QTVB 1EFRA 4EFLA 1E0KA 3HPQA 4XTRA 5KDOA 3NWJA 1FW6A 3AF4A 2FSFA 3DVLA 4ESHA 4I1SA 5G53C 4BFSA 2V9PA 4LJAA 1Z07A 4L8GA 1PUJA 1D5CA 4FMBB 1XXHB 2CE2X 4A0RA 1G64A 2IK8A 1R4AA 4HAYA 3KXIA 4UJ5A 5CB6A 421PA 3AGPA 3TGPA 4EFMA 1TNDA 2RB4A 1Q3TA 4MYCA 3VNUA 1HTWA 3AEZA 2X2FA 1FNMA 1W46A 3T1QA 4C0KA 2PEYA 2WPDD 4OI0A 3B78A 1WE2A 5B57C 1HQCA 2QM8A 4TLAA 1VECA 3VHXA 2G0NA 4R2HA 2P6UA 3H2YA 3K0FA 1NY5A 1PUIA 1ZUNB 3T5DA 5JJLA 4GMXA 3CZQA 3A1TA 4TL6A 3EA0A 1G1MA 1EX7A 1Q20A 2QGZA 6Q21A 5KPJA 1P2VA 1KDPA 2AXPA 3PEUA 4JKIA 4PAMA 1E1RD 2RGEA 2OAP1 2QEQA 3F8TA 1MO4A 3VKGA 3CRRA 2W58A 4C2UA 2EYQA 3OIYA 1AQYA 1TEVA 4CEIB 4MYHA 2CHGA 3UMFA 4AK9A 5H68A 3BE4A 4MKFA 1ZBDA 4PC2A 1JQLB 4AKGA 5FL7A 1KI9A 3R7WA 2EFEB 4DJTA 4LHWA 2A3RA 2XNDD 4MRRA 3VHLB 4GPTA 2B92A 2KI5A 3KQNA 2WICA 1E4VA 4TTRA 1ZVQA 1UKZA 2G6BA 5JECA 1YJ5A 3MWYW 1XD8A 5BN5A 4CF7A 1J2JA 2RH5A 3QPUA 1JI0A 4C0JA 2IYVA 3PEYA 1D6JA 1ZD1A 4PSKA 1TEXA 4NL4H 3AB3A 3IHLA 2MMGA 2V6IA 3MAAC 4URUR 1KO5A 1S2MA 5JRJA 2R2AA 1GRQA 2EFGA 3KFVA 3MWLA 2XXAA 1AIPA 2EWWA 4DXAA 1S3SA 3E1SA 2XB2A 1VCNA 2PZEA 4R98A 2JA1A 1N6RA 5JJKA 3SJAA 4JBXA 2XX3A 2QAJA 3AV0B 5DLQC 3P4XA 2CK3A 5TB5A 4QGHA 4DCUA 4OHZA 1BMFD 2WMNB 1AGPA 3K70B 1P7CA 3B6EA 1T9HA 2C95A 1T8UA 2ZRNA 4LJYA 4LCBA 1N6LA 2ZEJA 3GJ3A 1E2PA 3KKOA 1D8TA 5G41A 2H16A 4XSHA 5L3RA 3PUZA 4G5OA 1J8YF 2PX3A 5SZHB 3RS7A 5M04A 4IHQA 3QJYA 3T61A 4LBVA 4A4DA 1E79D 2BCGY 2VSOA 2X77A 1XCGB 5F9FA 3AH8A 1CR4A 4JYBA 4D4MA 2GXSA 4G0NA 2P5TB 1MO5A 1Z0KA 3Q85A 3LX5A 1OIXA 1W4AA 2W2TA 2QTFA 2ZS9A 3CX6A 2ERXA 2DBYA 2BHRA 4LHZA 2ODBA 1Z08A 4LV5B 3EZ7A 5DYGA 3T5GA 5JI3E 2IS6A 2GTPA 4GSYA 4W9MC 1PJRA 2R6AA 1MR3F 1KK0A 1ZM4A 4R7ZA 4EPTA 2O0HA 2VYFA 4US0R 4A92A 4WOPA 1L4YA 3OEED 1QBKC 1VCMA 3R9IA 5JBQA 2WTUA 1UJ2A 4BEJA 4KVGA 2DFKB 4NYMQ 3GPLA 3BK7A 2Q9BA 1YHNA 4U5XA 2ZRLA 5BN3A 5FUXA 3A58B 4I1VA 3AKDA 1UEIA 1G20E 1WCV1 2W2XA 1VMAA 5FBVB 1XTSA 1GDDA 3SDZA 2YWEA 1RE0A 1XBTA 1BYIA 1N6KA 3VU9B 1DG1G 3BH6A 3O8DA 3V4RA 1E9FA 3PUXA 2WBLC 3K53A 4QJ5A 5GJVC 1CR0A 1RFLA 3FHOA 2WJYA 3I5YA 2ZR7A 4XWKA 5FFMA 2O8FA 1CULC 2PJZA 3CH4B 4EUNA 1JB1A 1S9HA 2XJ9A 4HLQB 3THOA 1JXMA 4KYIB 3H4MA 3DDCA 3A36A 1W0KA 1KDTA 1P6XA 3QKRA 4MGYR 3HU3A 1AS0A 2GEUA 2G88A 3WMEA 1VG8A 4IOJA 1QHSA 2J7PD 3BOSA 3KTAB 3NTUA 3QXHA 5UKDA 3T35A 2GEDA 1P2SA 1XEWY 3MJHA 4EQ6B 4LBWA 5LD2B 3QKUA 3DOFA 5DISB 2BMDA 1G8GA 2OESA 2W6IA 4RFVA 4ESVA 4LY6A 1LNZA 2V54A 4YONB 1KDRA 3M0EA 1EK0A 2QN6A 2AKAB 2NZ8A 2OXCA 3W8RA 5JS7A 2W6JA 3RS5A 1DOAA 1IAQA 1N5KA 3TR0A 2C99A 2FSGA 4HUQA 4ASUD 3IPYA 1U9IA 1XD9A 5EE5B 3SS8A 5G3ZA 1OFHA 1V43A 1W0JD 4C0HA 2WAYA 4JIMA 1RYHA 1RRFA 1X1SA 4RJLA 3SHFA 4Q48A 2GXUA 2ZPTX 3EWAA 4XVQA 4QHSA 2VHCA 2J46A 4WW0A 4LSGA 3AVUA 2VPPA 2JCSA 3G82C 2HT1A 1XPOA 1M7HA 2J41A 1FUUA 1SVWA 2IXFA 3TMKA 3FKQA 4AYWA 1E2HA 4TL8A 1NRJB 2O0JA 2OSBA 1Q0UA 4B6FA 4JVMA 4TMTA 3SHWA 2ZJ5A 4DT1A 1IN6A 2TMKA 1W4BA 1KJZA 3A8TA 3PEVA 2IHYA 1KMHA 5FI0B 3FMIA 5JWHA 5DNYB 3KKQA 4AWXA 3KB1A 1GZSA 3THXB 3FMFA 3PIRA 1XPRA 2ZRPA 1ZINA 3QVUA 1W5TA 4M9ZA 3X1YA 4DB2A 3TBKA 3K70D 1OKKA 2WSSA 4A8JB 3NG1A 1UDXA 3KQLA 2C78A 1RZ3A 3QKSB 3BXZA 3WYAA 3CPJB 1YVDA 1GUAA 1OYYA 3C7KA 4LYAA 1C4OA 3SJZA 4DLWA 3GEIA 2HJGA 4BLSA 5JJIA 3QEJA 1NMYA 4KAXA 1T3HA 4C7OB 2YHSA 2ZU0C 4URVR 4BE7B 1PZNA 5CIWA 4G5SA 2WOJA 3QEOA 4CEJA 1YR8A 3AQ4A 2HV8A 1G3MA 1N5IA 5IT5A 2ZQ5A 5AJXA 3M1IA 5IK2D 5DI3B 5FPSA 3NDPA 1F48A 4NKRA 2O8CA 3N70A 4YDSA 4F7WA 4TSFD 1VG0B 2ZI3A 3KJEA 3GLIA 1X8LA 3VAAA 3WRXC 4LYFA 2QMOA 1JBKA 5CJ2A 3EW9A 2ZYVX 1EG7A 1AS2A
chains in the Genus database with same CATH superfamily
4X3PA 4FCCA 4MV8A 1XXLA 1Q44A 2VYNA 5CAEA 2EZ9A 5KYYB 1T1JA 1C9DB 1ZJ5A 2V59A 2BKXA 4D8UA 1UBHS 4MB6A 1EFRD 1UMDB 4NOKA 3PXEA 5LOVF 3IA2A 3TZKA 2EKDA 2I0FA 3G0OA 4Q9AA 2A86A 3I2YX 3MILA 1NPYA 3KXLA 1FDWA 2AZ4A 1BH2A 4NHEA 1F20A 1FUIA 4RSHA 1QS0B 1JJVA 3K0BA 5G0UA 2HO4A 5HF5A 2I6TA 3ADBA 2QVYX 2H0AA 1XZPA 4KQXA 1BW9A 1SKQA 3H4VA 4MIOA 4NU6A 3E5RA 1EZ4A 1KF0A 4PAQA 3T7IA 3WO0A 2QYSA 4AECA 4D9GA 2ETVA 2J9YB 1RQXA 1GG2A 3RRJA 2ZFUA 4NFLA 5FTMA 4JBWA 5C46F 5AVUA 2QTRA 1TEZA 4BX9A 1J1UA 4I6EA 3UPTA 3G17A 1NZFA 1T3SA 2NSHA 3QLVA 4KE9A 1U5BB 3H5WA 3ROFA 2CGEA 4L4XA 4TKUA 5M3BA 2WHEA 3QVSA 2CVQA 4ZOBA 3S3TA 1G6Q1 3U4IA 3V7NA 3KSBC 3PPXA 4ND3A 1EHIA 3I09A 2CNDA 2ZRIA 4Q02A 1OX5A 1CYEA 4BU1A 5JALA 4ZD6A 2VJBA 1F4VA 4N8SA 2R8BA 3OQ6A 2DR3A 3ESQA 3IPRA 5JEEA 1HWYA 2BEJA 1NZJA 3OZUA 3QBVA 3SQNA 5D01A 1BNCA 2YX1A 3GLRA 3IURA 2DULA 4I4LA 1CUCA 1LDBA 2YBEA 2BFEB 2BTOA 3QITA 5DF1A 2PMEA 1ORHA 1NW8A 3ABOB 3FOWA 3LYLA 1K5GA 1SVNA 2GN0A 3MGKA 4PYJA 1CERA 1XGKA 1BRTA 2P6OA 3FYUB 4R54A 1IXSB 2BDUA 2UZ0A 2W2OA 3L4BC 3GZ4A 3EOZA 2YFYA 4I1UA 4GR4A 3KS9A 5EINA 1DKNA 1XTRA 1CBUA 1P33A 3E84A 5KQMA 2HY7A 4IIEA 1XIVA 2WF6A 1E6EA 3O2NA 2JARA 3PKJA 1P3Y1 3C3PA 1WSBA 3C5VA 3L8HA 3RUDA 4F2GA 1MVLA 3CUTA 4YRLA 1ISPA 2R87A 1N4AA 2IC5A 4V0SA 1SCBA 4L02A 1PR4A 4GI1A 5EKSA 2WFAA 4IDPA 3OX2A 4ZT3A 4B17A 4F8JA 5IUJC 4B3DA 5FWYB 2VDRB 1V39A 2N0SA 3PF8A 2GGSA 1TKCA 4WK4B 4AU1A 2OQ2A 3KWMA 4JKYA 4QBGB 1LC3A 1HK7A 4L28A 4DR1B 1XSEA 4AG3A 1WY7A 3EVNA 1JG2A 4TVKA 4OFBA 3T3GA 3WRWA 2GFIA 3GD5A 5I7RA 2SECE 1EFVB 1JLMA 1TIBA 2QPLA 3OICA 3MQ4A 1VSTA 4J0EA 4K1XA 3E22B 4LXYA 2N1BA 4MI9A 2LVBA 4W5HA 4DEYA 5CBPB 2YHBA 1T3GA 1SUBA 3C43A 4ZCMA 2NXJA 4AL4A 1NUAA 4L3WA 3CS3A 5BQ3A 1FTNA 2ZJYA 1SUSA 2XXJA 4HNGA 1NQTA 5A5EA 2QIPA 1UKBA 1VHTA 4M8LA 3EVTA 1E3LA 4CCAA 1KO4A 1MB4A 3AIOA 4DHWA 4AWAA 5JZOA 1H9CA 1CJUC 2Q9AA 4QNMA 4R2JA 5KVCA 5LP6F 2E1PA 2AFVA 2QLJA 2PFSA 3C48A 4KO8A 1F12A 2RI0A 3FCEA 4NNPA 2FPSA 2R6HA 5EJMA 1FF9A 5H3CA 3TQQA 3P9CA 5AIAA 4P3PA 3IV9A 2A1UA 4JLDA 4D82A 2IODA 5IAAA 1OLSB 3Q0TA 4D7AA 2ZYHA 2II6A 2CVPA 3LIIA 2XBLA 1G98A 4JLPA 4PTZA 4EGCB 4EJFA 4I1PA 3CG4A 2JFXA 4AMVA 3HXTA 1SFRA 3C8HA 3HR4A 1D6MA 4UHFA 5A9TA 4ALJA 2OFWA 1RMQA 4YRJA 3FXAA 4MUKA 2CCKA 3KT6A 1BFKA 2B1GA 4FSDA 2OBMA 1BXZA 1NXVA 1YRYE 1I6KA 1I1OA 2XOKA 3O8OA 3SJBA 1K7CA 2JPDA 5H8WA 2QQ0A 4WNIA 3DS8A 4Z86A 1KO1A 4PCVA 5JXWA 2GVZC 1RHUA 2QA5A 3CPHA 4RIHA 4GF5A 5IC4A 5L40A 2OG1A 1SWVA 3C5HA 1MT0A 3Q10A 4JB8A 1SZJG 3GDOA 4HDOB 1IG0A 3H2ZA 1E79A 4O4JB 3WBBA 4NRDA 3ZKWA 3EXEA 5D85A 2BHLA 5KKNB 2XQVA 1YTUA 3A70A 3DV0A 1HT2E 3TKLA 3UV6A 3NYWA 4EG4A 4PO8A 2GM5A 4YJ3F 2PZJA 3MIZA 4RXUA 2QVZX 5HIIA 1J4AA 3NOVA 5FJIA 2PSFA 2XUDA 1RSZA 1ZGCA 3WKAA 1W19A 1Q0QA 4DCNA 2VHXA 1E3MA 1DIHA 2JS7A 2ZAGA 2ZYRA 2FQXA 1EGAA 3VPXA 4UE6A 4ZV4A 3IMGA 4MUXA 5A2QA 4KQCA 1ZSVA 4G0PA 3LQYA 1W88A 4ND2A 4NULA 2YWXA 3STHA 2CJPA 2BEKA 2I2XB 2OZKA 1HC7A 3M5CA 2Q7XA 1I6WA 2CCGA 3R9XA 1WETA 1VBKA 3NBXX 4G89A 4RHTA 4HXFB 3QE2A 4QDZA 4BVFA 4Z0TA 4CMIB 2XWPA 4FNOA 4TTJA 1JDNA 4PNEA 1UXHA 1CR6A 3QXGA 3Q8XB 4KWTA 3F6PA 1WCIA 2YASA 5ALHA 2EHDA 3H05A 4BYMA 1NQ5A 4DR7B 1R12A 2EQAA 2JJ1D 4OP1A 3EZYA 4UPDA 3T52A 4DM3A 2HK9A 1GL9B 2A2ZA 1VHLA 2GCEA 3GYGA 4MULA 4P7KA 3P96A 2CVZA 3TNLA 1RRPA 5FPYA 5A62A 4GWLA 1XZAA 1QXSA 3ZGNA 3SXJA 4RVOA 2GEBA 2XMRA 2FDRA 1AQ6A 2NADA 3I1FA 1XXHA 4GQAA 4L9SA 4PV7A 5DGTA 3K30A 4O2AF 2LE0A 1ZNZA 3LBFA 1TUBA 2BGWA 1N8TA 2FWJA 2W6ID 1DFHA 3P20A 3C45A 2IYFA 5F1OA 1DJQA 2JGEA 3UMYA 4PZCA 3IUBA 1EE1A 5IJ9A 3DT9A 2B1IA 3DT6A 1QHXA 3TMAA 4BMVA 1DLJA 1VPLA 1EVIA 2W6JD 4I9NA 4DZRA 3N5CA 4AFNA 4F4CA 4EZEA 3GRZA 5DBOA 4LC0A 3LUBA 4TUYA 2HUNA 4CG1A 2C31A 2X8LA 3OOJA 1ZGGA 2GN8A 4AD8A 4EABA 1BKSB 3A6DA 5THXA 4BGIA 1QE3A 1K7YA 1UK9A 4ENRA 5BNZA 1EX1A 2VNAA 1SXQA 5JCOC 2EERA 3EGEA 3IT3A 4D57A 2QZ4A 3UF0A 5JR3A 2OD7A 3ILYA 3TPCA 4Q1AA 1HSZA 1E2FA 2WABA 3GRCA 4GBJA 1ZNWA 3PFBA 4NG4A 2VSXA 3ZS8A 2JJ2A 1Y5IA 1ISSA 1UMCB 1TTHA 2F64A 2GI4A 3DXXA 5IC6A 3GEPA 5AVRA 1W4CA 5EY5B 3BXHA 5L8VA 4N0QA 5E4TA 3D2CA 3GRPA 1Z6QA 1H42A 4IZOA 1WU7A 3GB9A 4K6CA 5ADHA 4OB6A 4CU5A 4L72A 1JHOA 2I6SA 3KQSA 3KYIB 3V80A 3OMWA 2E3JA 2O48X 3BUSA 2VTDA 3F9CA 1VFPA 4EB0A 1TZJA 1CFJA 5EMNA 4L3VA 1O87A 4O3MA 3OLYA 4G63A 1FQWA 1U3CA 5AM3A 2D7CA 4RL6A 1LX6A 1D0SA 2ZRKA 5BYJA 1J70A 3TCKA 3UYLA 2G40A 2ADFA 2ZM6B 3QVGA 1P17A 2WSSD 4UNPA 2D2IA 3FLMA 3UUGA 3CZPA 3PUWA 3GT3A 4P0TA 3LHSA 3LF1A 4N5MA 1RJ9A 5BOSA 5K5EA 3ZD7A 1JHAA 3KALA 3JQFC 2YIDA 4GX5A 4IBOA 1GFIA 4U7JA 3S8MA 4C6HA 3O8RA 3FCOA 1Y7LA 2FG5A 4JJ7A 3PSHA 4X44A 3TUIC 4YAEA 2QW8A 5HBRA 3M6VA 5JPIA 3TTSA 4BOYA 4NV1A 1RWMA 1RW4A 3D59A 3QVVA 3R6GA 5COQA 3VQTA 3UUFA 2ID9A 1SKYB 3TXAA 1W6UA 1ZP6A 1E2MA 4DQDA 4JI4B 2PNFA 2QSJA 5B6PA 2C2WA 5BMVA 2JFZA 4C6TB 4A73A 4AJHA 1AT1A 2ODNA 4ECEA 5DLPA 3G0IA 4HB4A 4RIEA 3DL7A 2H00A 4MICA 4LJ9A 2VDNB 3CVYA 3EGDA 2QYOA 1OT3A 5KYWA 3FKSD 4OOFA 1GFSA 3SHQA 5B3AA 2XE4A 2JK0A 4LQ4A 4UATA 3LPAA 4A1FA 3L8GA 5F64A 4KGVA 3A7DA 4G1VA 4JS0A 4ER5A 1K8RA 2QVXX 1XDDA 3QPDA 2C3UA 3JQ7B 2TMDA 3K2BA 4TS3A 4ZC8A 1ZJ4A 4J43A 2QD1A 1KU6A 4PGFA 3L0CA 2CNKA 3OHSX 4ZJZA 4RKWA 1R37A 4KXFB 3UK6A 5F21A 1A27A 1SELA 4EI8A 1UJNA 2EJCA 4CCSA 3VFDA 4ND8B 2FDCA 4B3XA 1THMA 3ABRB 1DT3A 4S0XA 5I48A 3PDHA 3V3TA 1BEEA 2K4MA 4I1IA 2C5EA 4P4GA 1IBCA 3D2AA 3MPOA 4NAUA 1L4UA 2C84A 4AJIA 2FQQA 4FE3A 5GV7A 4B3HA 4EJSC 3TGLA 3MHPA 2CEKA 2IUYA 1OH6A 1R0XA 1XNHA 2XUKA 3EWSA 2HQSA 4HFNA 2I71A 4I3GA 3IIJA 4A91A 2WTEA 4TSFA 5K3BA 1NVKA 1FQKA 5K8IA 1AKTA 1BMQA 1WU8A 3KOMA 2QD5A 2EQBA 3OG9A 1BYUA 1HYBA 1UWLA 3CKMA 4PRYA 4RTMA 4XR9A 2WIFA 3CBQA 3AERB 2FPIB 4FS8A 4I36A 4RZXA 3W2HA 3C3YA 3PZBA 1DB3A 1H4SA 4JYPA 1N6HA 3LYHA 1R6UA 3ZCSA 3FX2A 2P0EA 3L4EA 1E9VA 4IQFA 1SD5A 1D4AA 4MMZB 3VU9A 2XKKA 2DETA 5D2CA 5FOQA 1SULA 1EFCA 2QDKA 1U1CA 1I36A 1YR7A 3WG9A 3O4VA 1WZNA 4LNHA 4XJSA 3EVGA 2QRQA 1UBEA 2NU9B 4YJ2A 3OF5A 3IQGX 4HQOA 3X1ZA 2G28A 3DC2A 4EYKA 1C9YA 3AHFA 1PFQA 2CD7A 1BN6A 3I6ZA 4FR5A 2UZ1B 4ZCIA 4IKOA 3TSAA 1Y3FE 1R8SA 1E7SA 4AY5A 1QTIA 1K92A 1U3VA 2FWIA 1JAIA 1R27A 1OWNA 1QP0A 2FEPA 2Q1XA 3IELA 1F8FA 1YFKA 3ZE7A 1FE8A 2J9RA 4KSYA 4EPVA 1M6YA 1HNZB 2FWNA 1X7HA 3U7HB 4WCFA 5EZYB 3MJEA 1XDBA 5CIYA 1ODJA 1YS6A 3MSXA 3L0ZA 4I8DA 1Z06A 3GUCA 2P8SA 1DAIA 4TX1A 4YR7A 3UJDA 1PZMA 1R2QA 2XB8A 4PTYA 3V8EA 4KDEA 3BF7A 5A5DA 1KOFA 4J1NA 2NO1A 1E69A 5FT9A 4ESEA 4OHCA 2P3OA 821PA 2CMDA 2OB2A 1J0BA 2FJPA 2PS0A 1YI8A 4XQEA 2KLBA 5JNLA 3PHIA 2BFMA 2CUZA 1H2AS 1OF1A 3DMTA 5JFOA 4TKLA 1N5LA 3PGKA 1CETA 5C8YA 4E7PA 1DMRA 2XB6A 3ED5A 4RZIA 4HNVA 2NO9A 2AWOA 3KELA 3TQIA 3HEAA 1AQLA 4RPLA 1NVVQ 4BP8A 3HM9A 3OCZA 3EGXA 4RVCA 4ZOLB 2EBUA 2XDQA 4W8OA 5C8ZA 4WMLA 1VJ5A 2IHKA 2VCHA 4BNGA 1L0BA 4MAFA 3S4YA 4PGAA 1YB1A 1YJAA 3AWDA 5IANA 2BLLA 5F4BA 1L4GA 3CXUA 4PR3A 2FPGA 1ZRHA 2I2DA 3BL5A 1GZHB 2WHRA 2PZKA 3GGDA 1IY0A 4X8MA 3SF8A 2IHJA 4IDOA 4XUGB 5IKPA 1UINA 4TGLA 3EA5A 5ALEA 1S02A 1KXZA 3GAFA 4GM0A 2YIMA 5TRTA 4DSOA 3K9NA 1MRSA 5C7YA 3THXA 4G9GA 4UTVA 3Q40A 1WCWA 1Z62A 2WK1A 4Z4CA 5AR1A 3AJEA 4K6HA 1P5RA 2FUG1 1JTFA 1YUNA 2AJTA 2FUEA 2PKRA 5J1TB 3LAWA 4F46A 3U6BA 2GN1A 1D8AA 2IW3A 1OBOA 3BJZA 4UEWA 4BFWA 4U8HA 3EMVA 5IF3A 1EHCA 4RF3A 2CJWB 2UUOA 3UWDA 1TM1E 3L77A 4IDEA 4KXYA 3QMMA 2ZUVA 3ZH2A 4B5LA 1J1IA 4A82A 1C9KA 1NP3A 3CCBA 2H3HA 2OHOA 3EG9A 2V7PA 4LPSA 1BHSA 4R05A 3WIVA 2X4DA 5EMHA 4K9QA 1V3QE 1AO0A 3L8YA 3HJTA 3P9IA 4LF6B 3TG8A 5BURA 3LK6A 5ALUA 3T5CA 5C7OO 4YROA 5IX8A 2Y1CA 4UTNA 1BJRE 1OBFO 2FSIA 1ZCFA 3HXPA 4PG7A 3ZY4A 2VRWA 2VK8A 1CT9A 1YC5A 4UHJA 2NVBA 2IQ5A 4S1OA 3UYKA 4B48A 1DARA 3HDTA 5AICA 4KQMA 4C0QC 2ZW9A 2GH1A 2YN0A 3MGCA 4INZA 4Y2VA 3LFHA 2WMDA 2WLSA 4ENPA 1GNQA 2JJMA 3CT4A 3DP9A 3IAXA 5ERXA 2V96A 4PYRA 4KPEC 4NQZA 2AF4C 1AHIA 3OOSA 2JLUA 3U7QB 1DWPA 2Q3EA 4IZ6A 4WXRA 4I4NA 2QD4A 3LMKA 4AC9A 2I33A 4K28A 2LUOA 4N12A 2WTMA 5FO0A 1ZZGA 4RE6A 3AQIA 3W78A 5KYYA 5AK4A 5B7PA 5SZJA 1NYLA 1RAHA 4GQIA 3NVDA 1UMDA 1U4NA 1NG1A 4MUAA 2OZVA 4E70A 3B7WA 1N6OA 3VYVA 4COKA 3L40A 4KOAA 2CW5A 1MC5A 3MG9A 1V5GA 2YVKA 4JSTA 3ZUGA 1XMQB 2PX2A 3K0EA 1IEXA 4ARUA 4MVJG 1GEEA 1X8KA 2HWYA 4HWRA 4DV4B 2ZIWB 2ISCA 4DCJA 3LL7A 2I78A 5AVZA 2W4IA 3H8JA 2YJ3A 1IIRA 3H1EA 3RRYA 5BW5A 2IDKA 1C7EA 1SVOA 3FM9A 2QJRA 5FBHA 1PWYE 4NC9A 3B85A 3UJHA 3OHMA 3V2IA 1BS2A 1U5BA 1NLUA 3WGZA 2PLRA 1YXMA 1ZMBA 5CEEA 4ND6A 1VL8A 4IM7A 1NU6A 2HWXA 3NB0A 4QHTA 4O8ZA 1SBCA 5FBLB 3UAYA 2NG1A 1TZMA 1N6PA 3K0CC 3GVHA 4Y2PA 3F7OA 3QU4A 2MT9A 1OFUA 3BILA 3B9QA 1U7UA 1O1YA 5K8TA 4IDGA 1ZAYA 3UGJA 1E2BA 5CB4F 4QEDA 3AGQA 3N28A 3OIUA 4Q9KA 2ENUA 3WLTA 4BJ6A 3A9CA 2BFEA 1U0SY 2UVQA 4BCBA 1Y6JA 3IPLA 3K3PA 3ZDBA 3S6JA 1ULAA 3L7MA 1D2EA 3FYUA 1BG6A 3MTGA 4LECA 2NTNA 5P21A 4AF8A 3Q88A 4UNRA 2ZB2A 4RDXA 3C3JA 3UW1A 3WGIA 4RMIA 4MKZA 1JG6A 2Q1YA 1BE0A 3KSZO 4NBVA 3RGWS 1OIVA 2DFVA 3JYPA 3G1UA 1G21B 1C7RA 3PNBA 1R74A 3T7JA 3JQBC 3KEGA 2WKRA 1DO8A 4BX8A 4E51A 2ZUEA 5SY6A 1VL0A 3E7XA 4D9IA 2WWWA 3A1NA 4E5VA 2ZTUA 1UXGA 3CO5A 1Z6YA 4OBEA 4NH4A 4ZO9A 1P29A 1CUZA 3AL0C 1LCIA 1F1JA 4JVOA 1CDOA 1FU8A 4WOKA 4CZ2A 5FWYA 3SVTA 4PG6A 1GQFA 3IFSA 5B6JA 5IAKA 5DNCA 4QPDA 3C41J 5HZMA 1ZFNA 4G1MB 2OE2A 3WNDA 2Z95A 1EINA 2XODA 3WS7A 2ZSJA 4MR8A 2ZE6A 2F1RA 3HBAA 1EFVA 1O5OA 4FHCA 4GGOA 2HK8A 1GV1A 4O29A 5HKKA 1E89A 1Z5PA 3GJSA 3E22A 1SXIA 4KQ6A 1I2AA 1WVMA 1Y7IA 2VG8A 5CBPA 2PUAA 3ROTA 2QG9A 1J33A 3LLMA 5IHXA 1CNFA 1YU9A 3EVEA 5AKIA 2PLWA 5AJYA 4CIYA 1H1TA 1L4BA 3JAWB 3PHBE 1CUSA 3DF9A 4BZPA 3MQ2A 3CZMA 3LKZA 4HN2A 5EHZA 1DJPA 4MYDA 3ZGOA 3I4LA 5D3QA 3WC4A 4A1OA 3ZJVA 2IXTA 4GWKA 1EX6A 2EJWA 3I9V6 4R7TA 1DUSA 3R40A 1ZN2A 5JS2A 3EVDA 2OOSA 2R6DA 5CM9C 5AKXA 3D8HA 4ZODA 1SMKA 5K0BA 3PCRB 1K08A 4JENA 4HLUC 4O08A 5IZ4A 3WWPA 1OLSA 2ACVA 3L3BA 4GMDA 2NTJA 4MCIA 4FCVA 1TK3A 2MCFA 4EH1A 4F5ZA 3W04A 3NAGA 5G0VA 4US2R 2DPYA 2GNAA 3QIAA 1YULA 1YOVB 3TW0A 4JMLA 2XF8A 4K3UA 3Q3GE 4RBNA 2G72A 3WSWA 4EW2A 1H5QA 3O21A 4DN6A 1C1HA 3JSXA 3OT4A 5DOVA 1OAOC 1P0PA 3AEQB 3WYGA 3D6NB 3IVAA 3HL0A 3L93A 3N6XA 4M1SA 1JSXA 2O59A 2P69A 3FGPA 4FONA 1HEYA 3IEXA 3W2TA 1Z5VA 2P0YA 2J32A 1NSYA 5TPZD 3EBPA 2PXAA 2OY0A 2IZ0A 4OHUA 4ZRMA 2F3QA 2Z56A 3RV4A 3UMRA 3AHHA 5ECDA 3T94A 4DCPA 4O4JA 3DZCA 4A2QA 3ANSA 4DCTA 5I8WA 1K6MA 1SEVA 3DO6A 1HPLA 1IK6A 1U3TA 3ST7A 4HEJA 2E49A 3GP3A 5DYIA 1ZMXA 3KXKA 4LZLA 3VXKA 3D8BA 1Q1QA 1J9GA 2WU8A 4CM6A 2PYZA 2C4HA 1ZPDA 2J0QA 5KNBA 1JYEA 1XQ1A 3U31A 7GPBA 5L7YA 3I9MA 4IFBA 3LCJA 4UEJA 3K0AB 3RFUA 4CLOB 1N1MA 4EO9A 5ALWA 1R10A 2JD0A 8AT1A 4G0UA 2HO5A 4IL5A 5ALRA 1C9EA 3OKPA 5IFKA 5IVKA 4FDVA 3S81A 4BQQA 2C2MA 4NBRA 1NMQA 1W5BA 3KSDO 1R6XA 1V1RB 5A5GA 1GUYA 2VQ6A 3F67A 3WA6A 2HFJA 4CMIA 4FFPA 4EMBA 2WM3A 3L01A 1UM8A 2HUPA 1XR3A 3NTLA 4QWMA 4FNMA 1CSEE 1LZLA 5LQMA 1R4ZA 4AYXA 2Y9PB 4X1YB 7YASA 4HJRA 2AMLA 3GA5A 3TI9A 4HB3A 3WISA 1CZLA 1D2MA 5DU2A 5JS8A 4EGFA 4QXPA 5FULA 3N2ZB 1S0UA 4H1UA 5CM8B 3ZY5A 4Y7DA 4BVBA 1SUIA 3EGWA 3DW3X 1UKYA 4WFIA 5U9CA 4PX5A 1WZ2A 1GAQA 1S9DA 2FR8A 2AN4A 1N2IA 3LDGA 4LCEA 4DCVA 2ZBEA 4BX3A 5FDFA 1J5PA 2G77B 4DSUA 2TMGA 2R0QC 1R0LA 1U2GA 3B1WA 3ND8A 4QOGA 3D0QA 2IEYA 2YWGA 4TRRA 2NSLA 4HAIA 5DBHX 3AHGA 5BUSA 1GNVA 1YI0A 2BGUA 3P0RA 2PGAA 1HDRA 1V7CA 1E3SA 2QLMA 3OLQA 5FRDA 3UTDA 4EY8A 1Z0UA 1T8WA 3G5MA 3IUEA 3IX7A 3O38A 4OJTA 3TAUA 2QBYA 3V4ZA 3VDXA 2HM7A 2R11A 1DAKA 3BXFA 3OZAA 3ZLVA 3QXXA 3W4JA 4DY4A 1P19A 4BJ1A 1HKUA 1OUMA 2V0NA 4YREA 4WNCA 4E2ZA 6ADHA 2ZJ1A 3NHKA 1KI6B 5KNDA 1CJTC 3GLKA 2SBTA 2B25A 5DX0A 1D04A 4DOMA 1IMOA 4NPAA 2I2CA 1EA7A 1UMCA 4FGKA 3ORSA 4S2EA 5ALQA 4E94A 1AQIA 1FVXA 1I9CA 3ANXA 4EOGA 4XYMA 2GILA 4HDQB 4ZCTA 2ZWMA 3MMZA 521PA 2B2CA 3EZ2A 3WKCA 3S70A 2IOFK 3K9HA 3TIGA 2FMIA 1RI4A 2VN8A 1PTJA 2REOA 2D0IA 1ZIPA 4QM7A 1G7TA 2BP7B 2GHIA 4ZP1A 3OCUA 4HNUA 4D25A 1VCOA 1AK9A 3IAEA 4X6LA 2FB9A 2ATVA 2Q5FA 3WNQA 4Z51A 1U4OA 1OB5A 2YW2A 1JFTA 1N7GA 1DZ3A 2FK7A 1YC2A 2AQIA 2VYVA 3DCYA 2W2QA 4DIOA 4NJMB 1LWNA 3CF4G 4OHOA 1VE6A 4OI1A 4A3SA 5A1TA 4RTOA 1R0KA 1VHJA 3B7PA 3RSSA 2FZCA 1SB8A 1UJ4A 1PJ4A 1RI3A 2O2DA 2PUHA 3UWKA 1PS9A 2QYTA 4A23A 4Z7QB 1KQGA 1U7ZA 2AK2A 1FL9A 4J3FA 3CF2A 1CUHA 2ZBFA 2OC4A 3HY6A 3HXOA 2BKEA 3O4IA 3I04M 4C6TA 4DIEA 1UOPA 2FUKA 2QSZA 1H2WA 2B8NA 1G4UR 3CLRC 2VKQA 3PE4A 1HFEL 5EZ6B 1PK9A 3FHTA 2BSQA 3U19A 3KWLA 3WFIA 1B8PA 5KTKA 2C0QA 2CZCA 3L04A 1ZC3A 3H2KA 4TT3A 1I1NA 3B5JA 1HG1A 3FA2A 3R3YA 6LDHA 1LD3A 3DLIA 1DNPA 1Y1QA 4RTSA 3V9AA 3NXKA 4J0KA 4DCSA 4L16A 3JQ7A 2K5UA 1VLQA 3CLHA 2MOKA 3TAXA 9ATCA 1Z13A 5KNCH 2DBZA 3Q8LA 3URKA 4BP3A 5ELXA 4QVGA 1E1QD 4J03A 2HPAA 5H3LA 1YHYA 1H23A 4DBVO 4NPCA 1TUEA 4F4DA 4ND8A 3V55A 1QHHB 5KAMA 1FSZA 2C5LA 1U3DA 3LC1O 1WNFA 2VP6A 3OIWA 4QTTB 2PWZA 4BFCA 4PO3X 3LIPA 1VTKA 4MVXA 1ZJYA 5ECYA 2P78A 3HBLA 4IS2A 5DN9A 4B84A 3I2HA 4OIMA 4U4AA 3OZRA 4IG4A 2G5GX 1ZGBA 1NNSA 3ZDRA 4BVLA 1XCOA 2LRHA 3B82A 4I3HA 1ZH6A 2BMWA 3RSHA 3U3OA 2YIVX 2PTHA 1FQJA 1PL6A 2LIVA 3NIGB 1E1CB 5F51A 3NIFB 2O7SA 5A9SB 4A15A 3RIEA 2VSFA 1WDTA 2WSMA 3G13A 4PHTA 2A59A 3WYCA 4A0SA 2WILA 3KZVA 3FNIA 1Z4LA 3AERA 3B9RA 1D2CA 2FEWB 4I4CA 2FPIA 4KAAA 3RV3A 3V1UA 3ZHZA 2PKXA 1QUFA 2Q1TA 2FZGA 4EGSA 1XVLA 4UEKA 2FUG6 4FXPA 3K8OE 2FZLA 4G5GA 1H1LA 1ZSNA 4JASB 3PXAA 1KHTA 2ECFA 4KR3A 3D8TA 1YE3A 4LNUB 2OZPA 3VX3A 1JLLB 5K3CA 3FOEC 1LXCA 2O8NA 1CUYA 1D1PA 5JDCA 1M1UA 3PC4A 1TU0A 2Y1OA 2F2TA 4B5KA 3KQYA 1IQRA 2NU9A 2GBCA 3LUDA 4WNYA 1SZPA 1G42A 1OWPA 4P08A 1M1ZA 5C3UA 4NP6A 3K94A 2GJAA 4LGCA 1D1QA 1P80A 1JEOA 4XEHA 2J3IA 2GBIA 3F5FA 2UZ1A 2OCDA 3P9SA 3FJYA 4EW3A 1HMPA 5LM3A 2PLFA 2WUFA 3SICE 2GMWA 1EP3B 2AZTA 5J23A 3K92A 2IS4A 5JU6A 1RAFA 3G0HA 4OQDA 5J5VA 4NDNE 2C83A 1B0PA 9MHTA 4UTRA 4IILA 5EZYA 3OAAA 4B35A 5HE8A 1I2DA 2R6FA 2X5OA 4W5JA 5HILA 2IXDA 3EISA 5JE8A 2JLYA 1ATIA 2OLJA 4PR0A 1A88A 3BC1A 3QU5A 1JW9B 2FFHA 2WZBA 3HZHA 3GFVA 2BE9A 1E3DA 1MV5A 1R8JA 1LDEA 2SKCA 2YWFA 3ZI7A 1YKSA 4B3CA 1F4LA 4NEQA 2G9ZA 2HGSA 4DXHA 2P7HA 2VSYA 3FZYA 2O57A 4GPZA 4JK3A 2J3EA 4JL6A 1OSNA 4XIJA 5CEFA 1N9KA 3O9ZA 2MJLA 5CB0A 3ZI4A 2RK4A 4JJ6A 4OHXA 4I2VA 3I4CA 1N2CB 4TV9B 4BYGA 4D44A 1T0PA 4XKJA 2PVPA 2VDPB 2V98A 4LWOA 1E1DA 5JYCA 2HAEA 4OHVA 2G9NA 3LC2O 1GKYA 1V7PC 4YAIA 4GUAA 2EFYA 4ZOCA 3NEJA 4LF7B 1K2VN 3KT8A 2AYYA 3P9XA 3W2FA 4HUTA 1MTZA 3EXG1 3EZNA 4ZOLA 3TOVA 3HP4A 4YDRA 1ACLA 1G8FA 2BFFB 3V9PA 5HWSA 1KFKB 4TRJA 3LT0A 4CV2A 2P1ZA 1FS4A 3HMQA 4WJKB 3IAUA 4AO8A 1LQ2A 1P7PA 1CY7A 2PX5A 3ASZA 4W6QA 4XLLA 3U39A 5JZVA 4FFMA 1IZ8A 2JCBA 4RNDB 3V8BA 1GKKA 2EJTA 2WYHA 3M4XA 2VJOA 3DD5A 3QFCA 3UQYS 3WRXA 2H9AA 4BN4A 1XCLA 2AUTA 4URXR 4I2NA 1MGOA 1YS4A 1CY4A 4X95A 3RU3A 3OKCA 3O7MA 2X2EA 1AV6A 1CB7A 2QQ5A 2YYYA 2WI8A 2RJ3A 3SI7A 2QORA 5EERA 4B4UA 5A2GA 2HTFA 4XVHA 1FJXA 1TOAA 3U17A 5HF8A 1N2HA 2AG0A 1RVDA 2ANBA 4G25A 1MAWA 3BWBA 1NVGA 1B3RA 3N0WA 4HPWA 4L8YA 4UMEA 4ZDIA 2F3TA 1ML3A 5T5QA 2CJWA 3A6GA 4PIPA 1F60A 1L5HB 3E15A 4N18A 5K3FB 1AGXA 1P7ZA 3DEJA 5ALTA 4E5NA 2RGDA 1VLZA 1J99A 2GXAA 4KZKA 4XVRA 2F8SA 4RORA 4OHWA 3UY4A 5BR8B 4PC1A 1SGWA 1TQ6A 1FVHA 4KVAA 2DLCX 2D5IA 4XWOA 1U8XX 1TM5E 3O3MB 2AJCA 3N75A 4ZI7F 5AW8A 4HV4A 2DLNA 1V71A 2G9RA 1BFUA 2VZ9A 3ZV4A 3GGGA 3RU7A 3HEBA 4NTZA 2WF7A 2C07A 1K5PA 2FFBA 1RLUA 2DBRA 1WW2A 3EJ6A 4NBSA 4XJTA 3TZEA 1DEXA 2UYQA 4AJEA 3E35A 4GMGA 4HPXB 1Q7BA 5A1JA 4HGNA 3VZDA 1U7PA 5A4AA 3ABQB 3IKLA 2QMQA 3IULA 2IUFA 3PVSA 4HATA 5TDHA 2ZXEA 1GT6A 3TIXB 1GG8A 1SCJA 4G67A 1NC3A 4G5FA 3LWNA 3O93A 3A6HA 3DBLB 5JH7B 5DTMA 3DDUA 4WKBA 3LX6A 3ZXIA 4F3RA 3OEHD 4BV3A 3NZEA 4IJQA 1NBWB 1YI1A 3U7QA 3LPMA 1P5JA 3NOQA 3QBTA 4TKMA 5I9IA 4D3FA 5K6AA 5GIPE 3L6BA 2DVMA 1HDIA 3HB9A 1YU6A 2VRCA 3O8LA 3EASA 2WIAA 1NBMA 1P31A 2JEZA 1E5XA 4L76A 4COOA 1DEAA 4IIJF 1XCBA 1Y3AA 3R20A 3II6X 3AEXA 1B23P 1LY1A 2CWDA 4LMBA 4FGZA 2JK1A 1N0UA 1G5HA 1IHPA 5JFGA 1COWA 1G60A 4WVLA 1LLQA 2B99A 4RE5A 3R0ZA 4YY3B 2XUPA 3M6UA 2C4MA 1IATA 3VJMA 1SBQA 2IYYA 3GMIA 3TSZA 1SQGA 2CEAA 2A9VA 1CUFA 1YAJA 3RUPA 4N48A 4LF4B 3EIQA 5ALOA 4DMRA 1JEEA 2NVWA 5BT8A 1IY2A 3EG5A 4C6SA 1Y3DE 5AOCA 2H1RA 2L19A 3OA0A 1E59A 4ZJUA 2JKVA 2VK1A 3AM4A 4U6NA 1OGYA 4B44A 3EWIA 1UKCA 4C4SA 4DYHA 2QJWA 4IIYA 4BWYA 3KM0A 3GIWA 3ZDXB 4OAQA 2ZIFA 2WZQA 5JJCA 2PUVA 1J21A 1Z56C 2GT1A 2J0UB 2ZYAA 3L06A 1U9ZA 4U2FA 2PUFA 1RWKA 2G04A 2ZREA 2XYPA 4H7FA 4CHTA 1XA3A 2D1YA 2WUDA 3GJ0A 3HACA 3PQ7A 4QPZA 2X41A 2OHJA 2O2HA 4Z2AA 2IV2X 1B8VA 5DDIP 1U1EA 4GKJB 2B8EA 2GN9A 4X8OA 4P33A 3HP1A 3ANMA 3TCXB 1J22A 3IMKA 2EDAA 5GZ1A 4DKJA 1GOTA 1YKGA 3RSGA 4EATA 1Z2NX 4LHXA 5KYKA 3U13A 4EZBA 3AU8A 1ZI9A 4PBRA 3SVZA 2KX7A 3BWXA 5JSUA 3ZC3A 2HWUA 3IH5A 1G21A 3B3QA 3KYBA 1F0NA 1XZIA 4C4RA 2R4TA 2Q6LA 4QPJC 5CXQA 2P3LA 5K3EA 5KX5F 3PDIB 3EC7A 5IJZA 1W5FA 1YK0A 2DWPA 5G40A 1EP9A 3ITNA 1OA0A 3Q12A 1NSTA 2X13A 4EG1A 4P4TA 3LVQE 4MDYA 1FYWA 4HN9A 5TQ0B 3E9NA 3SYKA 2HQRA 4L2IB 1REQB 2XTMA 4XRRA 1D1TA 2J09A 1UJ5A 4H3VA 1V37A 2JAWA 2IKQA 4WL0A 3VR1A 2FVXA 4BKQA 3VDQA 1C7QA 1P9NA 5SZKB 3IAM6 1AH2A 2E21A 1OYOA 3MK31 3MUEA 3NP7A 3CGWA 2M98A 2QX8A 3LA6A 2IEZA 4GLFA 3MBKA 1KQNA 4CIDA 1IFXA 5GAJA 3I23A 3JAWA 1RP7A 4IO1A 4DABA 1EEXB 4QLOA 1GRVA 1OT5A 1ZLXA 3LUFA 4P92A 4PYIA 1OFTA 4RVNA 3INRA 2ET6A 3LUKA 2XZLA 3NORA 4LFCB 3LC0A 5F33A 5KTMA 4XYBA 3WHIA 4QD3A 5EE1A 4EAAA 3BB1A 3UXYA 2P77A 3MTEA 4AJOA 2FE4A 5FUWA 1JQAA 3BORA 2Q4RA 2J9XB 3MAJA 2AFRA 1HE1C 4IEEA 4GX0A 2RSLA 3RRFA 5A7FA 4ZZ1A 5L4LA 4R8KA 1OFUX 4JT2A 2C1XA 4DE5A 4HX2A 2ZSDA 1J39A 4IYJA 3ZWOA 1SU6A 3QG5A 4PEVA 1WLYA 4RJJA 2QZPA 1YOVA 1AN0A 1ZZEA 2C7RA 1XP8A 3EEFA 1J90A 1Q1NA 4N5DA 4EA6A 2D1QA 5HVNA 3AEQA 1G8AA 4R0NA 2AOVA 2JDIA 4ZVQA 4K26A 3DAFA 1XMXA 2AUNA 3GAMA 3PFWO 5L3ZA 4GZ6A 3W9YA 1XRLA 1GDTA 1ZUD1 3T9DA 3DXYA 2RAVA 5ITVA 1YDGA 3ONVA 3WLEA 4R83A 2BHSA 5C4GB 1IOVA 2W6CX 3PQEA 1OIWA 1B1AA 3AKCA 3AM3A 1MUUA 2DRIA 2GZ2A 8LDHA 1OFGA 3NDBB 4LE1A 4A2PA 3AR4A 3H6GA 1EWRA 1QRAA 2QXUA 3QRWA 1OX4B 1TYAE 4GQBA 4IAOA 4UU0A 2PX6A 4JBIA 5GONF 2PYDA