3SBDA

Crystal structure of rac1 p29s mutant
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
177
structure length
177
Chain Sequence
b'GQAIKCVVVGDGAVGKTCLLISYTTNAFSGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related C3 botulinum toxin substrate 1
publication title Exome sequencing identifies recurrent somatic RAC1 mutations in melanoma.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 59
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3sbdA00
3THYB 4L5BA 1CS4C 5C1BA 1FQJA 4II7A 4C0KA 3C8UA 4FN5A 1UPTA 4NHOA 1Y63A 2PX0A 1W0JA 4JT4A 1G16A 1E4VA 1II8B 1RE0A 1T5LA 1ZM9A 3CX6A 3P4XA 5H8WA 1G64A 2R44A 1DAEA 4ASUA 4PO1A 4LBVA 5DYIA 4JL6A 3MRSA 3QQ5A 4DWJA 2BIFA 3B5JA 4W9MC 3AM1A 5FL7D 1G1MA 1U8YA 3LDAA 2ZAOA 4NCHA 2ZRKA 3T12A 1UFQA 5CB6A 2QPOA 3D7MA 4QJ4A 4LHYA 1JXOA 2V1XA 1YKSA 2XITA 4WIAA 2XB2A 1CJMA 1FTNA 2C03A 1F2TA 4CZ2A 3GPLA 1G8YA 2OUKA 4HYYA 4G01B 1IXSB 2IL1A 3LO5A 1N6PA 4HATA 4LV6A 1Z47A 4RD2A 5G41A 2GCPA 1Z8FA 3B7GA 1KDOA 4DCTA 1M6NA 1BS1A 1N6NA 3CX7A 4NYIQ 3G82C 1XCGB 4LV5B 4OJKA 2XJ4A 4URWR 1DO0A 5FPHA 3FHTA 4EDHA 2CCJA 2RGNA 2GXUA 4GSYA 2XAUA 4XVRA 1G3QA 1CP2A 2A5DA 1WBBA 2R6CA 4MRPA 5BW8A 1O3YA 5FR2A 3W9YA 2V6IA 2WSSA 4AC9A 1SHZA 3QBTA 1F5NA 2PBRA 2PCJA 1P72A 3GCGA 5LD2B 2JLVA 2XX3A 1N2CE 3QKSB 4WBSA 5CIQA 4QJ5A 4DRZA 4DB2A 3REFA 4WZAE 3M4YA 2O8BB 3I92A 4TTRA 1P2TA 4JBWA 4JLNA 3U4QA 4M1MA 2GVDC 2RHDA 1GNPA 2RGEA 2WIBA 1GSIA 3BIFA 4TL9A 4YMSA 2Z43A 5F98A 1OH6A 1VECA 2FU5C 5ELXA 4OQFA 1ZAKA 3ADCA 2ZYVX 3I72A 1EFHA 1KI6B 3J81k 4WW0A 1G17A 2KE5A 2XSZD 2EFDB 1LTQA 3UPUA 2OAP1 2BKEA 2ZRDA 2R65A 2JLUA 4OK5A 4QNRA 1ELOA 1W0JD 2VRWA 2Z5FA 3RWMB 4B3CA 1RRCA 3BAFA 4M4SA 4TQUS 4E5UA 2ZI9A 1ZM4A 1EESA 4BLRA 1EX7A 4ASUD 3ZD7A 2WTUA 3BWDD 1MRSA 3LFUA 1X8KA 1MT0A 1VHTA 1ZINA 2EFEB 3AH8A 3LA6A 5CK5A 1A2BA 1KI4A 4YDSA 2VSOA 4KJZA 3AKDA 4TYQA 4KI0A 2QL6A 4ACAA 3T1QA 5K8TA 4IDOA 4Q9IA 3H2YA 1KDPA 4MRRA 3SFVA 4EJSA 1YVDA 2J5XA 1ONBA 2GAOA 2X2FA 3PEUA 2PJZA 3AF3A 2HCJB 5CIWA 5K8UA 5C4GB 1SXJE 1XTJA 3B8HA 2ANBA 4WXPA 5FH9A 2P65A 4KCGA 3CR7A 4KSCA 4DCVA 2ZRCA 1NY6A 1LV7A 3PG5A 4QM6A 3KXIA 4LJ9A 3KJIA 3ZVRA 2D4HA 1BYIA 1T5IA 1NIPA 4W5HA 2WSSD 3MMPA 2J41A 3QXCA 4B3BA 5LPNA 4AKHA 3RANA 3U7HB 2D74A 2ZTSA 2QGZA 2MMCA 5KNDA 2IHYA 4QHTA 3B1YA 2G1JA 4FWTA 4BLTA 1ZNYA 2WSMA 2ZRLA 4Q21A 5E3HA 3GEIA 5GVRA 1F2UB 3UWKA 4F7WA 1AGRA 2O5VA 2YOHA 2V54A 5AUPB 4BZQA 3GLIA 4HDCA 2ATVA 4NYMR 1P5ZB 3LBNA 2QUZA 1P75A 3T34A 4HUTA 2WVJA 4DXAA 3W34A 1U0LA 3F5FA 3QPVA 1XZQA 4A6PA 4A8JB 3ZQ6A 4IKEA 1QHIA 4A2PA 2NMVA 4US2R 2FFHA 4US1R 1GFIA 5JHGB 4PO8A 3R7WA 3VR3A 1T9HA 2FFAA 4V03A 3LX5A 3P4YA 2BV3A 4PC2A 2HF9A 3IKJA 5P21A 4B6FA 1MO4A 3X1ZA 1IBRA 1EGAA 2IYVA 3HU2A 2UZIR 2NO6A 2ZSDA 2V3CC 1TU4A 1XXHB 2ZXUA 2NO9A 2JEOA 4G5OA 4M9SA 1G41A 4RD1A 1IN5A 1KNXA 1P4SA 4FCTA 1AK2A 2C8VA 1T3LA 4ZV4A 2QGNA 1YHNA 1GL7A 4QG7A 1KGDA 1XJ0A 4I1OA 4OKSA 1XTQA 1KMQA 1XCPA 2ANCA 2FSIA 4MGKR 2FEMA 2ZRAA 1Z0JA 5UKDA 2VF8A 1G6HA 2BMEA 2WICA 2ZUBA 4JL8A 2IF0A 3CZQA 4BUJA 4ZIRB 3QF4B 2QORA 1IY2A 3B13B 1FL9A 2QTFA 4B43A 1X6VA 3LV8A 3OE7A 4HAYA 3SYNA 5L3VA 3KUCA 1KI2A 4RSGA 2ZPTX 5BN3A 4G0NA 4F4JA 5HKKD 4M9ZA 4C7OA 1OFHA 1G7RA 4D4JA 3A58B 2HT1A 1IM2A 2ZI3A 3EPHA 4TTPA 4PPFA 1G7SA 4BWYA 3PEVA 4UJ5A 1N3BA 3LVQE 2FZLA 1Y3AA 4N0DA 3DMDA 2QEQA 4HUQA 2WM9B 1N5IA 2F3RA 3LLMA 5AJVB 5J40A 2I4IA 2OFXA 1DTSA 1US8A 1UKYA 5CK4A 3A4LA 4HLUA 5JRJA 1ETUA 1YR7A 4LRWA 3AVYA 3TUIC 2QZ4A 2K5UA 2A78A 3O8BA 4XSHA 4Q01A 4C9BA 1FNMA 2ZI4A 3LWNA 2FWRA 3VQTA 1TF5A 3VHLB 1CU1A 1P62B 2O8EA 4US0R 4BLOA 3EAQA 4FMDB 3I1FA 1GVNB 4FXPA 3K9NA 1ZMXA 3SZRA 3THYA 4M1KA 2N42A 2GJ8A 4RZUA 2VEDA 1EWQA 2GBLC 2RMKA 3L0OA 1N6LA 3QENA 2WJJA 3ONWA 1VG0B 3CM0A 2VQSA 2JLWA 4QGGA 2IK8A 1BO6A 3RWOA 4JJZA 3QF7A 3M1IA 4A2WA 8OHMA 2RGXA 2C95A 4JZKA 4HB4A 4HZUB 4LJ4A 2FNAA 3EZ6A 3W3ZB 1TADA 2P0EA 4LWZA 1M34E 2J59A 3TW4A 2MSCB 4TL6A 2F9LA 2G3YA 1X3SA 4RD0A 4C3ZA 2PZFA 3OE7D 1JQLB 1OH7A 1BOFA 1Q3HA 1W0KA 4R2IA 2EWVA 1G3IA 3IHLA 4GMDA 4GRAA 3RC3A 1A2KC 1LB1B 1GKYA 3LW8A 2BC9A 3ICQB 2PZGA 3AP3A 1G4UR 5EP3A 2QTHA 3PEYA 3ETLA 5FOXA 3MLEA 1CR4A 3CWQA 4B34A 5TARA 3QEJA 4I1VA 3A1UA 1E2PA 4BFTA 1GTVA 3U5ZB 3SHWA 4JBXA 2HF8A 3IBYA 2QMHA 3SNHA 1OJLA 4MDEA 1W5SA 1JEDA 3Q5DA 3DKVA 1OXXK 4E22A 1S3GA 1SXJB 2OM2A 1J90A 1FUUA 3ZH9B 4OK3A 1KI8A 1NI3A 3OFND 3TMKA 2JGNA 4QL3A 1HT1E 2YVUA 4PO9A 5GJCA 1TUIA 3EC1A 1KO4A 4JIMA 2KWIA 4TYYA 2ODNA 3QKSA 2PCLA 2QE7A 4K46A 2O8BA 3EIEA 2QSZA 2C99A 3HU1A 4FIDA 2F1RA 1PVOA 4NYIR 1RYFA 3HPRA 3L0SA 2VO1A 4ZKDA 2NG1A 4QGFA 1KI6A 5KSPA 2UKDA 1Z6XA 4FI3C 721PA 3QPWA 1IY0A 4YLGA 4B3DA 1P2UA 1EFTA 4V0MA 2Q21A 2ZRIA 4MKIA 1E1RA 2E1RA 3KKNA 2JJ1A 4H9GA 4OI0A 4CEJB 2B8WA 4CYMA 4EFNA 2KJQA 1D8TA 3Q85A 3GLHB 2GZAA 2C5LA 3W5JA 1U90A 3QEOA 3TUZC 2GJSA 2YV5A 4IRUB 1W0KD 3TSWA 4C2TA 1JR6A 1TQ2A 3SI7A 3BRWD 1G5PA 2QU8A 2P5SA 1NG9A 2IYQA 2RB4A 3U7EB 3SFZA 1GOTA 2IUSA 1XX6A 3RVBA 1SGWA 1KO7A 1OXSC 2A30A 3CRQA 3ADDA 1HT2E 1F6BA 2AWNA 2R2AA 3GJ0A 4OJQA 5TV2A 4DUGA 1XU4A 4RD3A 1EFUA 2LKCA 3KTAA 4JLPA 4Y0VA 1G5RA 4PHFA 3BE4A 5EXXA 4CVNA 2VP2A 4C0SA 3MWJA 1W2GA 4IDPA 1MV5A 3VKWA 1YZTA 4TLEA 1OFTA 2KBFA 2XZPA 2VTKA 4KLZA 1ZC4A 1C1YA 1C4OA 2Q3FA 2IUUA 3AVWA 1U98A 2BM0A 3NDPA 1RYHA 2CE7A 1AA9A 4URUR 5BN5A 4TL8A 3CLVA 3PUVA 2P67A 5AUQA 2ZJBA 3EC2A 1I2DA 2H92A 3A4MA 3PFIA 4DKXA 3F8TA 4O2RA 2QMEA 4DLVA 3EW9A 2QE7D 1NBMA 1BH2A 1LS1A 1NKSA 2GK6A 5BXQC 3TH5A 5DO9A 1F2UA 1YR8A 5JI3E 3QKTA 4TT3D 4BQSA 3NIBA 4EPWA 1MR3F 3L0IB 3P32A 3K70C 1XD8A 2HLDD 4A8JA 4MQBA 1CF4A 1MH1A 2GEVA 2YZ2A 2ZAMA 3RS0A 5IT5A 5FL3A 1ZVQA 4HDOB 3VR1A 1XZPA 1P7CA 4RFSB 4LJYA 1M74A 3AGQA 2REBA 2JJ1D 2RGBA 2QENA 4OK6A 1NN1A 3IIMA 1RJ9B 3FKQA 3TAHA 1XXHA 2GVZC 2OSBA 2ZRJA 4WXRA 1P3JA 4QM7A 1QZXA 5DLQC 2OXRA 1T4GA 1DG1G 1E2EA 1DARA 5AR1A 4YXWA 1E2LA 1Z6AA 3LLUA 3D31A 2DCUA 1OXVA 2I1VB 3PUZA 4NZYA 3NEJA 5GJVC 1NF3A 4DCNA 3GJ7A 3OAAA 1X1RA 1XB2A 3SOPA 5J4VA 4AYWA 2KSQA 4QBHA 3TAUA 1H8ED 3H4MA 4G1UC 1VG9B 4R2HA 2D7CA 4XD7D 4DJTA 4UNNA 1Z63A 4KFRA 4DUGD 4ZIRA 3GD7A 5G3ZA 2CMKA 4M1OA 2YJTD 2EVWX 3QF4A 3BJIC 4IVQA 3U6BA 4JLAA 2XZOA 1L7VC 4D2IA 1HA3A 3A1SA 1G21E 2G6BA 2IYLD 3MG9A 3KB2A 4LSGA 4KVGA 3EARA 4OBEA 4UXHA 3W8NA 3X1YA 1CR2A 1YJ5A 3DOEA 4URXR 1IQPA 2W2VA 3NVAA 1VG1A 1QHXA 1UBGA 4JYCA 1KOFA 1R8SA 1S1MA 1DAIA 4JVMA 5FOWA 2A5FA 1P9RA 4DDUA 1FNNA 1QHNA 4MYHA 3ZS9A 1RVDA 2VP0A 2NPFA 4AG5A 4BFZA 4NMMA 3V9PA 2ASEA 2P6UA 3K0CC 3QXHA 1EFRA 4MGIR 4U5XA 3FWYA 3MGCA 4R71A 1HYQA 1OF1A 3Q8XB 2G88A 2OCYC 4V0ME 2R6FA 2IUTA 4DLTA 3ND8A 3MWYW 2ZUCA 3N70A 4E09A 1JPNA 4TL7A 2EFHB 4LI0A 2O0HA 1XTRA 4DVGA 2IXEA 1ZBDA 3DZ8A 2CLCX 1Z29A 3JZAA 3OEHD 2AHOA 5FBWB 3K53A 5HTKA 4W5WA 1S96A 1XD2B 2CBZA 4MUBA 2A5YB 3PENA 1AZSC 3SC3A 3RS7A 3AF0A 1AN0A 1T3HA 1X1SA 1Z28A 2SHKA 4BPBA 3WNDA 3KXLA 4NCKA 1Q3TA 1CTQA 3TR5A 4MYUA 3E5HA 4D80A 4PSAA 3AP1A 4RZXA 4YXWD 2OO7A 1QF9A 1WMSA 3H0KA 2W2XA 4HAWA 4BGDA 2H5EA 4HB3A 4I99A 3FTQA 1OHHD 2ZJAA 1DAFA 3OAAD 4B48A 5EZ5A 3W5IA 4JJKA 1P61B 4HZUA 1GG2A 4GPTA 4TWZA 3QVUA 1A4RA 1E96A 4FMBB 1TUEA 4D4LA 1CIPA 5A0FA 3A1TA 2CLSA 2VBCA 3LRPA 3FB4A 1R0ZA 3QKRB 2VLIA 1RZ3A 2ZETA 1EX6A 2YINC 4MKHA 3TK1A 5FBQB 2F1IA 3U3OA 4X8OA 3K9HA 1NBME 4F92B 1FW6A 2ZRBA 1CXZA 2J0UB 4PQFA 1LNZA 3BS4A 3VR2A 3TSZA 5JCZA 1HEIA 4GZLA 5CITA 5FUVA 1VCIA 2E9SA 2TMKA 1COWA 2GZHA 4DBLC 1EFRD 4D6PA 3P20A 3W8RA 4IFBA 4M21A 2GJKA 1NVWQ 1QVAA 2H8KA 3GQBA 2QM8A 2WWYA 2CL0X 4QBFA 4HDQB 3T1VA 1K6MA 5E4FA 4YMVA 1T0JB 1HUQA 2VP9A 4RCYA 2OILA 5AWFC 2ZYUX 1R5BA 1KJWA 5TB5A 3QJYA 2QT0A 1W4BA 3R8FA 1KI1A 2KB0A 3ND9A 3FE2A 5FTKA 3T61A 1JQJC 2O8EB 1RRFA 421PA 2AK2A 1IXRC 2DB3A 4NCNA 4P0TA 3CPJB 1G18A 4OI4A 2DPXA 3CRVA 5DGXA 4IEEA 4C0BA 1IY1A 1G3MA 1ZNWA 1UM8A 4KITB 521PA 3B1ZA 1ZCBA 3IO3A 2ZUDA 4TYNA 3BXZA 3NWJA 3ZZ0A 3U3KA 1CRQA 4HAZA 4KFUA 5AUOB 3W6OA 1E4YA 1KI7A 3IHWA 4LYAA 1XFAA 3PEWA 3CF6R 4CEJA 2WJYA 2Z4RA 2AFIE 1F48A 5HR5A 1Q1BA 4TMVA 5AJYA 2DWOA 4PHHA 5D3MB 3GLHA 4KV9A 4C0JA 4Q9LA 4JL5A 5J4LA 1VCNA 2BJVA 2IWRA 2YWFA 2QQ0A 4WOPA 3EWAA 4XSGA 2ZU6A 1B0UA 5BYKA 3H86A 4HAUA 1NVVQ 4XTCS 4Y0AA 4POAA 4CDGA 5B64A 3WRYC 2EYUA 3RSOA 3BGWA 2GEDA 3NBZC 4V02A 4LJ7A 2Q6TA 3E1SA 2FDCA 4G3XA 2NGRA 1COWD 3HU3A 5DI3B 1M7BA 2B8TA 3NKVA 5DH9A 2OZEA 4GOKA 4LCBA 2ZVQX 1LF5A 2OV2A 4CW7A 1G8FA 3AV0B 3WYGA 3ADBA 1HV8A 4XWOA 1SXJD 3FVQA 5IF9A 5HE8A 4RZ3A 4A9AA 2J0SA 1QG4A 2W2TA 2DR3A 1OIXA 4GOJA 2V9PA 1KMHB 2PZEA 4TMTA 1RKBA 2ZJ8A 3VKHA 2GKSA 3E70C 3IPYA 1IOZA 2BWJA 3QXJA 1VKJA 3TJZA 2XNSA 4N3NA 1KDTA 3PUXA 1U9IC 1ZD1A 4XJXA 4Q66C 3HYRA 5KSYA 5C46F 3HYTA 1WP9A 3HWSA 4O2LA 3U3JA 4BLQA 4LC0A 2QBYA 1FP6A 2JIZA 3QNUA 3L8YA 3QG1A 4CRWB 4HZIA 2F7SA 1TF2A 1JNYA 4IHQA 2VSXA 3BBPA 2ZJ2A 3THOA 3TE6A 2DWPA 2IBMA 1JB1A 4RFSA 1J70A 2DFKB 4Q4LA 3ZS8A 2RH5A 4NONA 2QSYA 4LOAA 4KBFA 1UF9A 1RJ9A 4LK2A 4AG6A 5LDDC 3ZGXA 4IOLA 1FUKA 1VTKA 5CLLA 4P31A 5EP2A 3AVPA 4AIIA 5GVSA 1X8LA 2WWHA 2CVFA 2A2ZA 3BB1A 1CKEA 5EZ6B 4HI0E 4EPXA 2I1QA 1GILA 4DB4A 4Z1MA 2C9OA 3LVRE 2CNWA 2V1UA 5FUYA 4O3MA 1X8JA 4EKDA 5B2ZA 3FDIA 1M1YE 2XTNA 2FSHA 2EYQA 4NL4H 3FMPB 1KSGA 4L9WA 1E9AA 4ZKEA 3KTAB 1FFHA 2GDJA 4LPKA 1JALA 3NBXX 3I8XA 3KQNA 2VF7A 2OBMA 1WDTA 1LF0A 1VIYA 2AXNA 1AZTA 1P9WA 3SJZA 1RC8A 3R9WA 1GDDA 1RW4A 1Z0KA 2ODWA 3W6NA 3VX3A 3IQXA 4S35A 1S0UA 2MMGA 2OEPA 2ZRHA 3W3AA 5LBIA 4BECA 1OLOA 1U99A 1ZM3A 3CNLA 4QHSA 4PC3A 4YMTA 3V4RA 3BOSA 4IOMA 4OHVA 4MYCA 4FD2A 1KDRA 3KDSE 3S1AA 5E7JA 1KO8A 4A0HA 1J99A 2GF9A 2JA1A 4PC1A 4D0LB 2ZS9A 5KU1A 1F3OA 1SZPA 1R8QA 2JIZD 2Y8EA 3SHFA 1KNQA 3UK6A 5JJLA 2YOFA 1UBCA 1W49A 3C41J 2ZM5A 1ESNA 3LX8A 2F55A 4OHZA 1I4LD 1OB5A 1GUAA 1HH4A 1FP7A 1YZUA 2CEAA 2HV8A 4TMZA 5JI2E 4WZ6A 3GLHE 1XD2A 3X1XA 3I5XA 3AQ4A 4LGMA 1Z6TA 3HP1A 3T5GA 5JFGA 2ODBA 4MYTA 2H7VA 5L3RA 4UNRA 3M6AA 3EZ2A 1N6HA 3L2OB 2PLFA 1FMLA 3LH5A 2XGJA 3K0AB 3VU9B 3LBHA 4Q1BA 1I4TD 1E0KA 1FMJA 2CNWD 3N5CA 2ORIA 3THXA 2RAPA 1G19A 1Q1QA 2QY9A 4KXFB 2ZSEA 1KHTA 2B7BA 3B78A 1KKMA 2HDNB 1ZU5A 2NO7A 3PQCA 1OFUX 4P32A 3DZDA 4FMDF 2KI5A 3QI2A 2F43B 1W4CA 1NJFA 1Z0FA 4JSYA 4C0QC 5A4JA 5JZVA 3SS8A 3IQWA 5KSOA 1GWNA 3QKRA 1Z6YA 3NBFA 2H16A 1T8TA 2WHXA 2QA5A 1KY3A 2AK3A 3N2IA 1DPFA 3ECCA 2YWHA 4IJMA 4BRUA 4LHXA 2AL7A 2VHTA 5EQTA 2J0UA 5H70A 1NN5A 3BFKA 4OHXA 2IXFA 2N1BA 5L3SB 1PLLA 1VYTA 3A8TA 3AF1A 1JAIA 3CKLA 2EWWA 4LJ5A 2G83A 1S9DA 1GZSA 1UKVY 3KFVA 3IIKA 2O8FB 4TMWA 1SQ5A 3VR6A 4A6XA 2QROA 2ZRMA 1DBSA 3C15C 1GL9B 2XZLA 2ONKA 5EE5B 1VG8A 5DI9A 4IOKA 5DE3A 5KNCA 1JJVA 3RLFA 4Q4JA 4GNKA 3OEEA 2J7PA 4YONB 2Q0HA 5TDHA 1TQ4A 1E2HA 2OESA 1E2IA 3PUYA 2ORWA 2V8OA 4HEJA 2AWOA 3L43A 4TQ9A 2VHCA 2ATXA 3REGA 1NN0A 2IYWA 2WIAA 5EUMA 2C98A 2ZI7A 4N0EA 2IX3A 2CCGA 2FPLA 1XJCA 3AB3A 4A4DA 1NMXA 4A0FA 4XOIA 4H1UA 5KSZA 1Z0DA 1NG1A 3EASA 4D26A 1Q57A 5KNBA 2DYKA 1OIWA 2XTZA 1BYUA 2ZE8A 4FMCB 1CJTC 3GLFA 1R0WA 1E2GA 4CEHB 4NBSA 4GP6A 2ZYWX 5H1YA 3JZMA 2VHQA 3OZXA 4YMUA 3F0TA 5D3MA 1R10A 2XTMA 3P26A 4TTQA 3QPUA 3FPAA 4YC7A 2RCNA 1IN4A 2B7CA 2GNOA 4PZYA 1ZNXA 4LJ8A 4Q9HA 4A36A 4J0QA 2N46A 1CJVC 1ESMA 2CHQA 2Q9BA 4JLBA 4PPNA 4V0KA 2QAGC 1P73A 2JLZA 1W36D 2Q3HA 2ZJZA 1E69A 4M1TA 1O87A 2Q9AA 1N25A 2XOKA 3Q7PA 2IEYA 1Z08A 4EPVA 3PITA 5KDDA 4JSTA 1GM5A 5DI3A 3EIQA 4LYJA 3TW8B 3TUJC 3UATA 3ZZTA 2WJGA 3VR4A 2OFWA 2ZI5A 3OHMA 4NYJQ 1BMFA 2FGJA 4UNQA 4N1AA 3D6TB 4Z51A 4M1YA 3OEED 3UWOA 2J7PD 1TL7C 2J46A 3NEYA 1KMHA 3NH9A 2IS4A 1ZUNB 4OQMA 4M2LA 2JLRA 2QRZA 3WMEA 4ZI3A 1EWRA 1NVVR 3SYLA 1NKTA 3CR8A 3K70B 2A7QA 3AGPA 1XRJA 4QXAA 4TLDA 3WBKA 1N0VC 3P27A 1ZJ6A 1SVLA 3Q9LA 1IJEA 2RHMA 1JEEA 3BERA 3HR8A 1S4QA 3UMSA 5CB8A 4X8MA 1E94E 4DSTA 3IGFA 3T06B 3VX4A 2OCBA 3WMFA 1KSHA 2G77B 2W58A 221PA 2GXAA 1G4AE 1AS2A 1OPXA 2GF0A 3GJ4A 5B57C 2QN6A 3ZDQA 1Z0AA 1DS6A 4AD8A 1FQKA 3Q72A 2W83A 1TMKA 2DY1A 3BC1A 4QJ3A 2VL7A 5IRCD 2IXGA 4FCWA 6Q21A 2IT1A 4A0GA 3CONA 2MSEB 2L0XA 2FH5B 4JVLA 1PUIA 4NTZA 1D2NA 2FFBA 4PAOA 3EPJA 1ZYUA 2AFHE 2XB4A 5LB2A 4DLXA 3MD0A 4QOSA 2W00A 3LD9A 1XEFA 4WVFA 4HLCA 1OW3B 1TF7A 2OLKA 5G40A 3WY9A 4IXMA 1ZM2A 4NE2A 4XH9B 3RDPA 1Z6GA 1WB9A 3ZD6A 2XJ9A 2PEZA 2X2EA 3MCAA 1S2MA 3CIOA 4PAMA 3RABA 2ZSBA 4P4TA 2XXAA 2P6NA 4NPHA 4PXAA 4NH0A 3BH0A 3QG5A 1UBEA 5KYKA 3UMRA 1VHLA 3LW7A 2V7QA 4JMPA 1L4UA 3W6PA 4OHYA 1QHSA 3VMFA 5JCPA 5BQ5A 4ZCIA 2GXQA 1M7HA 5AJZA 4E07A 2G1KA 3EPKA 4V0NA 2OBNA 2XOKD 1E9FA 2PLRA 3Q7QA 5FUWA 1XMIA 4HB0A 2RGDA 1T91A 1YU9A 3RS2A 4Q7MB 1SVSA 3PR1A 5EXSA 1KAGA 4K8OA 3T1OA 3KKPA 1BMFD 5IK2A 2QTVB 2J3EA 3AKYA 5DYGA 1TNDA 4NCJA 2JATA 3CRRA 1YQTA 3NXSA 2QG6A 3UG7A 2H1LA 1R0YA 2DWQA 3DO6A 2FV8A 1UAAA 3FOZA 1XBTA 3CBQA 3IILA 1SULA 2PH1A 3UMFA 4ARZB 2BKUA 2IF2A 2IC5A 1S8FA 1R6BX 5FUXA 5JBQA 3EWSA 1XPUA 3A4NA 1DVRA 4DLSA 3GJ8A 1E9RA 4TMXA 4CEIA 2QBYB 1ZD8A 3BFXA 2REXB 2WV9A 3AVTA 1KK1A 4M9XA 3E2IA 4I1UA 1HE1C 2GJ9A 3GLFE 3NTUA 4GBMA 4RZ2A 3NG1A 5C2JB 3VFDA 4EPRA 4Q5IA 2D62A 1U2RA 2ERYA 4P4UA 3U7GA 4KYUA 3I32A 3AF2A 3TLXA 2BMDA 2BMJA 1AJEA 3FFBA 3A6PC 1E1RD 1F60A 1WE2A 3EZ9A 4QRHA 2IWHA 1E3MA 1E1QA 3UIEA 2WBLC 1HQCA 4DDVA 3KJGA 1KZ7B 2RKOA 1MO6A 4RJLA 2B21A 2GBLA 4ZCMA 1E2NA 2JJ8A 3G5UA 4CIDA 4CGZA 3B82A 1M2OB 4LBYA 2ZIAA 1P2VA 4KBGA 3RS3A 2D2FA 5DSZA 121PA 2CDNA 3WNCA 1GAJA 3JVVA 3K0AA 3VU9A 2FOLA 2ZRFA 4LUCA 2IYTA 2WPDA 1VYUA 3B1VA 5CLQA 4X8HA 5FBLB 4GP7A 3RS5A 2IA5A 4CT4B 1E9CA 1E79A 2HT6A 1N5LA 3AF4A 4K81B 1VMAA 4GI7A 5EJEA 4R98A 2V7QD 4DT1B 5L8VA 4LZZA 1W4AA 2IYYA 1IHUA 2HYDA 4RCZA 4C30A 2ZSAA 3SBDA 3ADKA 4O25A 4Q9JA 5CDFA 4D82A 2R6DA 3TVTA 3L8ZA 2F43A 5HCIA 2DBYA 4A0RA 2ZYTX 3I5YA 3ASZA 4OQXA 1PV4A 3TKLA 4B33A 2OT3B 2YHSA 3EXAA 4B71A 2R9VA 4BE7B 2QAGA 1UBFA 1LVGA 5IK2D 5JRZA 4AKIA 3QIAA 2GTPA 2QM7A 1S3SA 1DOAA 1G8PA 1R0XA 2QPAA 2V55B 2ZQ5A 2DFNA 2BVNA 2GCOB 5L3SA 3RRMA 3VAAA 5JLJA 2CE2X 1CJKC 2PMDA 4B47A 3C7KA 3S1AB 5J4YA 1OKKA 5J4HA 3GFPA 3I8SA 1E0JA 1NBMD 3B1XA 1DO2A 1SVMA 1ZIPA 2O8FA 1PJRA 4NU0A 2ZE6A 1N6OA 1R5OA 4KYIB 4UJ3A 2A5GA 4Q9KA 4UXJA 4B2LA 5JEDA 1VIAA 1Z0IA 4JLDA 3DKPA 4UQOA 2PT5A 2HUPA 3O8CA 4KAXA 2RGNC 2Q9CA 3SE0A 1KK2A 1WQ1R 5FBVB 2LWIA 4BFVA 4ESHA 3IPXA 1EG7A 3CF2A 5D3QA 3UXMA 4MGYR 4Q4AB 5JWRA 1W5TA 4H1VA 5HPYB 1WBDA 2GRJA 2Q3MA 4HLQB 1E1QD 1FTSA 1TQ6A 2JDIA 2W6JA 2YC4C 2QP9X 3GJXC 4DLYA 2GZDA 2ZR7A 3A37A 1VPLA 2QNRA 4B35A 1XF9A 5KHOC 4AI6A 4AYTA 4URZR 3EZ7A 2G0NA 4O0MA 1N6KA 1J2JA 1NVUQ 2B92A 2CJWB 1OYYA 2JJ2A 2ZANA 4KO8A 3UKDA 1S9HA 3NHBA 4IFEA 1VDZA 1E79D 5KTYA 3THXB 3V00A 1J8YF 3AKEA 2A9KA 3B1WA 3CNNA 4PC6A 5FOTA 4DSOA 4FWIB 4CEHA 1K8RA 3CW2A 1HE8B 1X86B 2EU8A 1E99A 2GXSA 4YDHB 4DHEA 2UVQA 1U8AA 3VHXA 2ORVA 1RRPA 2C96A 2WKPA 4YMWA 2C04A 2ZE5A 2C9YA 3JVUA 4BFUA 3K1JA 1E0AA 4RFVA 2AN9A 3B85A 4PANA 2QRNA 2D2EA 4DLRA 4X8LA 3RRZA 5LB4A 4BZXA 3CRMA 3I4LA 2YC2C 3CUEF 2B6HA 5JMTA 2YKGA 2IS2A 1IN6A 4EJSC 4L9SA 4BFWA 3U60B 1RIFA 5FL7A 4PFSA 4ZO4A 3KJEA 4AKGA 5EXPA 5K8LA 5HZHA 5TXGA 1NSTA 2IYSA 4EPYA 1KAOA 1AM4D 5J5CA 1EXMA 5M04A 1GRNA 3GJ3A 3QY0A 3MSXA 3AP2A 2NO1A 4B2IA 1Q44A 5J4KA 1GKUB 1OH8A 5H68A 2O8CB 4PC7A 5E95A 3QUSA 5G53C 4TZ6A 4PAQA 3IBGA 3KUDA 4Q4JB 1Z3IX 4FCVA 3LQRA 2Z83A 1WRBA 3CH4B 3DL0A 4LBWA 4XTRA 1GNRA 1L2TA 2VA8A 3U44A 1J8MF 3OIUA 4EUNA 2OE2A 5HE9A 1V43A 1CR1A 3K09C 4GFDA 2H18A 3PV0A 2JDID 2AKAB 2ODEA 3KKMA 2W6JD 4ZDKA 3KB1A 1MABB 4LX0A 1L4YA 1NL3A 3A36A 4TLAA 2C2HA 4L4UA 4Q1EA 3R8CA 1BIFA 1N5JA 1N0UA 2ZR0A 1WXQA 4MKGA 4FINA 3AUXA 1G291 4DDWA 1R5NA 3L0PA 1UADA 2Z6VA 3C5CA 4NYJR 3X1DA 1XDBA 1QHHB 2J0QA 5CDFE 2D3WA 1IONA 2FE4A 2PL3A 3GLFB 1CRPA 3QE0A 1E2DA 4XVUA 2H17A 2HCBA 1KK3A 1Z83A 3R20A 1MO5A 2DFTA 4LY6A 2AD5A 4IDQA 1TEXA 2GILA 3BB4A 3U61B 3H84A 5FPYA 3GJ6A 4AWXA 2WWWA 4M8NE 1T6NA 2XSZA 3WP1B 3TQCA 1NVXQ 2OFOA 4LPSA 2JLQA 1IJFA 4KODA 4D0NA 5HZKA 5AK0A 1XP8A 4IOJA 2REOA 2VIIA 3K0EA 1A5TA 3C16C 1D2MA 4L8GA 5KPJA 5EE9A 1A1VA 3UANA 5F9FA 3AVVA 4B44A 4QKQA 4ZPXA 4M0LA 3GJ5A 1DELA 5JS7A 4Q7JB 4C2UA 5L3QB 3NHAA 2IYXA 3PVSA 4HB2A 1G3UA 4LYFA 2E87A 1JXMA 5GJBA 1GKIA 4YQFA 1DAHA 1XEXB 3EZFA 4RKFA 4JLJA 4EQ6A 4XWAA 2XEXA 5TMPA 2IS1A 3K0CA 4HLDA 2VH5R 4GL2A 3DHWC 1NY5A 1S1CA 2RGCA 1Z2AA 3BB3A 1W36C 4ARZA 4OQLA 1RPZA 3K70D 1Z06A 2ZU0C 1FZQA 1E0SA 2QT1A 3LNCA 2F6RA 2WKQA 4ZDIA 2FA9A 4KVAA 5JJIA 1AIPA 2CL6X 5CYPA 5EE0A 2WWIA 4HLUC 4DEYA 1NLYA 2F3TA 4HAXA 2D7DA 4BEBA 3ICEA 1XEWY 4NP6A 4RVCA 3TVDA 1WA5A 3FMIA 4ITRC 2O8DB 2RGGA 3GLGB 4IEIA 1K5DA 4DIEA 4TN1A 3WRXC 3DM9B 1DE0A 4Q03A 2BOVA 2BEJA 1II0A 1GL6A 3DMNA 1DADA 3GEHA 2ZR9A 3DVLA 2QI9C 5G3YA 5DHAA 2XNDA 3FKSA 4JKYA 2OCAA 4BLSA 4A2QA 3AVUA 5FPKA 1W7AA 2XXAB 1CEEA 3ZLJA 4OHWA 3AEZA 3U2QA 1GRQA 3KKOA 3DEFA 4V0OA 4NCIA 4DT1A 2OBLA 4PQRA 3C4JA 4DLZA 5SZKB 5JSZB 3PIRA 5EP1A 4QFMA 5E7MA 4PQYA 2QAJA 1C9KA 4ERNA 1KSFX 1NIJA 4B74A 4JBYA 4KU4A 5FOVA 1B23P 1MKYA 4G5GA 4IDNA 4A15A 3LXXA 1ZU4A 4Q19A 2YOGA 5F3WB 2HEIA 5FI0B 1GITA 1Q1ZA 1G9XA 3EA5A 3OIYA 2ZRGA 1ANKA 3H1TA 1R4AA 1WF3A 4UXIA 4XIGS 2HJGA 4GZMA 4LYHA 5EE1A 2FJUA 1E9DA 2NQ2C 4MKFA 3LBIA 3KQUA 4DCUA 3AUYA 4PHGA 2ZRPA 1CULC 2GCOA 4MUAA 3U6KA 1Z07A 4PZZA 4EPTA 5J47A 1UKZA 1JBKA 4CEIB 4JYBA 5CM9C 1AKEA 1P6XA 1JPJA 3TQFA 2BBOA 4IVRA 4PPGA 2EFGA 2WJIA 2EW1A 1A82A 5HKKA 4DEXA 2AXPA 2OHFA 3U7FB 2VHJA 3OESA 2VP5A 4MRSA 3K0FB 5K8IA 1XPRA 2NPIA 2CHGA 1XEWX 4KFTA 1Q21A 4P4SA 4Q7KA 3K09A 3TNFA 1M8PA 2P2LA 2X77A 2KBEA 4JLOA 2IYZA 4Q4AA 2ZEJA 1U8ZA 1W46A 2CHVA 1YR9A 4F38A 4MRNA 3KQKA 3B9QA 5IDVA 1W4RA 2ZITA 1PLJA 3RHFA 2WOOA 5LD2C 4JLMA 1D5CA 821PA 2WWXA 1PLKA 2A5JA 2F1JA 2GEUA 5FPTA 4G5SA 1SKYE 1Z2CA 4EFLA 3SJBA 2XNDD 3FKSD 4LHWA 3GP8A 2OLJA 1II9A 4DSUA 2QP3A 3I61A 4D0GA 2CJWA 1KSJA 5AUNB 3SBEA 4I81A 4Z1MD 2VP4A 1OSNA 3LAWA 2PX3A 1P60A 3C14C 1XTIA 1ZIOA 2O0KA 1OFIA 4DSNA 3WHLA 4F91B 4QBIA 1N6IA 3DDCA 3I3SR 4AY2A 2ZE7A 4B75A 2WOJA 5AJWA 3O8DA 5EE3A 4TYWA 4GT1A 4JKIA 2OCPA 2GESA 3M0EA 1I4DD 5KOYA 3QVVA 1E98A 1D6JA 4Z54A 4Q1CA 4DDTA 4PSVA 4U00A 2P6RA 2FG5A 1YZLA 4JLVA 2ZJOA 2QAGB 3SR0A 1AKYA 1M7GA 2WAXA 2AX4A 3LXRA 1HURA 4MGZR 1Z22A 4P33A 3BH7A 5FOSA 4FMCF 5B30A 2AD1A 3ZVNA 2QMUA 3IEVA 1G6OA 1XTSA 1GRRA 1U81A 3O47A 3THWB 4B3XA 1KO1A 4GMXA 1GP2A 3VKGA 1QDEA 1E9EA 4XWKA 2BHRA 2IEZA 3LY5A 4A92A 3SJAA 3X1WA 2FMXA 1YZGA 3DM5A 4OL0A 1QVRA 1TQDA 4URYR 4ON9A 1L8QA 2BCJQ 2O8CA 5KO2A 3WYFA 2HYIC 2ZREA 1NSFA 2OAQ1 2NZ8A 3ASYA 1U9IA 4QC2A 4Q7LA 3WXMA 1YZQA 4QGAA 3ZVMA 3BFVA 2G9NA 3NC0C 2FZ4A 3GFTA 4IDHA 1KJZA 3HJNA 4TLCA 3G0HA 1WCV1 3N2EA 1G8GA 4U7DA 4MH0R 1MABA 4C0AC 5JJKA 4ZI2A 4W5JA 4LDJA 5GJWC 3F3YA 2HJVA 4WZBE 1TX4B 2W6IA 3OFNA 3V4FA 3Q3JB 4Q4HB 1XWIA 2CVHA 1N0WA 1YRBA 3L82B 3IUYA 4W7SA 3NDBB 5CYOA 1I2MA 1G5TA 1QHHA 4BASA 3NH6A 1G8HA 1LW7A 2C77A 5KDOA 1OB2A 4A8JC 2GA8A 4EIWA 3CB4A 1ZCAA 3CNOA 3ZQJA 1CBUA 5GADl 1PZNA 3X2SA 2ZS7A 3A1WA 3SEAA 2C78A 4C4PA 2Z0MA 5FPSA 2F9MA 4R9UC 3B9PA 4Q00A 1XMSA 3BK7A 1Z5ZA 4KFSA 2P5TB 1Q20A 5SZHB 3SU8A 3KQLA 1ZRHA 2R6GA 3TR0A 2YWEA 5CM8B 3K9LA 2VYFA 3EIHA 3U3RA 1YZKA 4M53A 1EFCA 5DIFA 1TAGA 3KL4A 4JVSB 1II8A 4CF7A 4OI1A 1OE0A 1KI9A 2GAAA 3MWLA 4Q48A 3PXGA 1DAGA 3NBYC 4IXNA 1QHGA 1JR3A 4S2EA 2ZROA 1FX0B 5KUTA 3T1TA 1NJGA 3FHOA 4I1SA 3SN6A 2PJRA 5C18A 4LHVA 1XD9A 3D8BA 1XTKA 3RNLA 1MRNA 3TBKA 1TTTA 4UNPA 3ZIAA 2BEKA 2C9CA 1D9ZA 2R8RA 5L3QA 2QMOA 1K5GA 2JLXA 2ERXA 5BYJA 4NDZA 3VNUA 1UDWA 1XEXA 2JASA 3IIJA 3RRNA 1VYVA 5DHFA 2IYRA 3U44B 3GLIE 4B3FX 4FW9A 3ZJYA 4Q1AA 2NIPA 1AQUA 1HY3A 3TGPA 1JI0A 2FF7A 3OIWA 2WMNB 3VR5A 1Q1EA 1YZNA 3CH5A 4F4CA 3GFOA 2CK3A 1DEKA 1PUJA 1E6CA 5FBRB 4RD6A 3R9XA 5KPDA 2W6ID 2FSGA 1AGPA 1E2JA 2J1LA 1SHKA 2ZS8A 3HPQA 2WKRA 2NOAA 4ZDJA 2GHIA 1G7TA 4GOXA 5FFMA 1U0HC 3KQHA 2YNMA 3RRYA 1R7RA 1XCMA 3CX8A 2F1HA 4Q1DA 4D4MA 2O8DA 2WMOB 3RAPR 4BFXA 3EA0A 3GLGA 3EPLA 1DAKA 4TT3A 3OF5A 3SQWA 3GEEA 1V5WA 4URVR 1KI3A 2CL7X 3OIVA 3FHCB 2FSFA 2HLDA 1JAHA 4U02A 1LY1A 5JHHB 2X1VA 3TSOA 1OYWA 1E2MA 2IS6A 1DAMA 2IYUA 4C0LA 1ZP6A 5JEEA 4ACBA 1W1WA 3R9IA 4A1FA 3CRW1 1SKYB 1QBKC 4D81A 2BM1A 3B2EA 2LKDA 3UG6A 4MRVA 5TVKA 5FTMA 4MITA 2ECKA 2WJHA 2ZJYA 5ANRB 4DIDA 3K8YA 5JSZA 1FOEB 5EXTA 2V4ZA 1JR3D 2YWGA 3KFXA 1DG3A 2EQBA 4M9QA 1YRAA 4TLBA 4B76A 1BKDR 1E2KA 2JLYA 5KDLA 3A1VA 2CXXA 3K9GA 3ZIAD 2IW3A 1SVWA 3RYTC 2BJWA 1VCOA 1UEJA 4M1SA 1F2TB 1SVIA 2D06A 1NP6A 2JAQA 3KZ1E 1H8EA 3RC8A 1ZNZA 4EQ6B 3C5HA 1KKLA 3ZZUA 4XD7A 3AKCA 2YYZA 2FN4A 4ZDWA 3TRFA 1XPOA 4D25A 4MDFA 2ZSFA 2OXCA 1LFDB 3I73A 4V0LA 3FMFA 4EFMA 1YE8A 1KYIA 3VTKA 2HXYA 1KTVA 5FOUA 2BBSA 3T15A 1G20E 5DNYB 2HXSA 4B32A 2CK3D 1NLZA 1W48A 4KLNA 3KKQA 4JS0A 4L16A 1IN8A 3CWZA 5FR1A 4A82A 4PR0A 3LQQA 1E9BA 3K0FA 3CZPA 2CCKA 3HR7A 1SXJC 4PHTA 4OQNA 1SVOA 4AK9A 2PT7A 3IEUA 4AYXA 1CJUC 1T3SA 1XNJA 4ILEA 1W47A 2IHBA 4PTLA 1RRGA 5JWHA 3FMOB 5EUQB 2V6JA 3MJRA 3WHKA 5FI1B 2PEYA 4B6EA 4BZPA 3WMGA 1N6RA 3U4QB 1D2EA 2J7KA 4C0HA 4ESVA 3K0SA 3MAAC 2J45A 3EG5A 4TYPA 2GCNA 1TEVA 4QGHA 2X19A 3GMTA 4KHZA 3KJHA 3SJCA 1NLFA 3AVOA 3FYHA 2JCSA 4G5QA 1ZUIA 3WYAA 1XMJA 2FPMA 5HCNA 1JR3E 4LJAA 2FGKA 2O52A 4ZCLA 4F93B 3DPUA 2R6AA 3OEHA 2Z4SA 2NTYC 2PMKA 4DLWA 1P9NA 1T0HB 4R7ZA 4B73A 5C4MA 1SKQA 1MO3A 4L15A 1EK0A 3CF0A 4RY2A 4E03A 3QOFA 3AVQA 1JJ7A 2DFLA 1NN3A 3SDZA 4PX9A 4EAQA 1JECA 2BMFA 4Q1FA 4QHYA 3BH6A 4AKEA 1OHHA 5SZJA 3PJRA 1UKEA 4F4IA 3B6EA 5EP4A 2A3RA 3FGNA 5JWOA 4PPQA 4EJSB 1KJYA 2OG2A 2RGAA 1Q12A 3O8RA 4ABYA 2FEOA 3WP0A 1CR0A 2NZJA 3SYKA 4NYMQ 2WWFA 5DN6A 3THWA 4DZZA 2P3SA 4GDFA 2AR7A 4LHZA 2LCFA 4Z8XA 1OT3A 1QG2A 1E2FA 3RSLA 3KX2A 1T8UA 1AS3A 4TZ0A 3BD9A 4Q18A 1UJ2A 1XJQA 2DHRA 1W2HA 4P4SB 1MOZA 3GLGE 3ZVLA 4DCSA 4BEJA 1ZW6A 4P3YA 4RKEA 1OIVA 2W0SA 4WAUA 1RFLA 3PCRB 2O0JA 1QHYA 1KK0A 3RS4A 5F2EA 1IXZA 1QRAA 2I3BA 4LC1A 1AQYA 4LBZA 5AJXA 4JT2A 4QBGB 1Q22A 4BFSA 4JVNA 4BLPA 3P1JA 3GLIB 3AVXA 4TSFA 1R2QA 3QXXA 1AS0A 3IDQA 1SVKA 2ONJA 5B58C 2R62A 1LS6A 2WWGA 2CLDX 4Q4HA 621PA 1G3RA 2J0VA 1NMYA 3T35A 1H8HA 1IAQA 5JECA 3R7WB 2WPDD 2J87A 2BDTA 1OXTA 3MFYA 4TMKA 1TU3A 2WAYA 4OI2A 4OYHA 3Q5EA 2ZJ5A 2X8AA 4Z8YA 2UZ3A 1GNQA 4I4LA 4KSBA 1ZUHA 2QP4A 3B60A 2FX3A 3SQXA 4DC9A 5FTJA 3MUFA 1H65A 1UEIA 2GJAA 5F9HA 2VHUA 3I62A 5CJPA 1KZGB 5BWMA 4D4KA 4IVPA 3TIFA 1U0JA 4PSKA 3CO5A 4B3GA 2FPKA 1TPZA 5DISB 3VNVA 1CLUA 1XMVA 3QSYA 3NC1C 4LJ6A 1W44A 3QKUA 1E32A 4B2PA 4HAVA 4QNMA 5A5GA 5IHPA 4MA4A 1HQYE 1KO5A 1G7CA 1UDXA 1U94A 1FX0A 5DN6D 3IO5A 4WA7A 1OKKD 4PZLA 3FFAA 4G5RA 4CT5A 2VPPA 4BFYA 2BBWA 2VSFA 4C7OB 3WBJA 1P2SA 4M22A 3T5DA 1FPMA 1VCMA 2BCGY 2G0TA 2NO0A 3DOFA 2J9RA 2GETA 4XVQA 2W0MA 4M1WA 1W36B 4Q47A 4UKDA 1OXUA 4Q02A 2GK7A 1YR6A 3D3QA 1NMZA 1D9XA 1OV4A 1J7KA 1ZC3A 2VP6A 4HUQB 3CPHA 1ODFA 3U3MA 3ZYCA 3EX7C 2WJVA 1N5KA 3HDTA 2JLSA 2AKYA 1US8B 1KY2A 4BRWA 1ZM7A 5JS8A 1IN7A 5CJ2A 1KIMA 1OH5A 1HTWA 4TSFD 4UNSA 3WNBA 1NNEA 3KXKA 4NKRA 1SXJA 2GWHA 3PUWA 4DLUA 4HSEA 5TY0A 5BN4A 3BORA 2H57A 2EFCB 2FFQA 4TQAA 2MSDB 4RD4A 2JJ2D 1H8HD 4IW3B 1Q0UA 2WZQA 4JLKA 1XXHE 3QXSA 3MJHA 5SZIA 5FTLA 3W90A 3QBVA 1E9SA 2QPTA 2ZRNA 1ZD9A 2ZVPX 2BBTA 5FTNA 3MWKA 2ZI6A 5E7IA 1E2QA 4AURA 1A7JA 2QQEA 1GIAA 3CPEA 1NRJB 4LV8B
chains in the Genus database with same CATH superfamily
6ADHA 5DWQA 2IU4A 1Y5MA 4KQGA 4AUKA 1JA9A 3ROGA 3LE8A 3IT3A 4II7A 1SRQA 3STXA 1G8AA 1Z45A 4HTAA 2B99A 1YC2A 3OPVA 3TZQA 3TSCA 3X44A 3NANA 3M33A 4QRIA 3I09A 2G9QA 3MXOA 2W2QA 5LBTA 5KNBH 2DUNA 3GR6A 3O4HA 1AK9A 1QH1A 2PX0A 3ZD8A 5JXHA 1HZZA 4C2BA 3CX6A 3P4XA 3QE2A 4UUAA 2HJWA 1NXQA 3N53A 3ODPA 4B09A 3RIHA 5JD4A 3MRSA 3QQ5A 2XQGA 2OOSA 3B5JA 2HQRA 2VCEA 1U8YA 2DTDA 3SJ7A 3U0BA 1ZMOA 3LDAA 5LR6A 2VAWA 1O08A 4B3HA 1FVXA 2ZRKA 4R40A 4L08A 5F7JA 3ED5A 1HDZA 2ZIZA 1YUNA 2LD4A 5CB6A 1PF7E 4ER3A 3LZ6A 1TTPB 2J3QA 3T9FA 2V1XA 1XTBA 1Y9DA 2VQEB 2WJ4A 5F5NA 4CZ2A 4CIAA 1TRHA 3MJDA 1J9ZA 4FW8A 2OUKA 1OLSB 4AS1A 2VK1A 4GMGA 1P2DA 4G01B 3P9CA 1YZHA 3LO5A 1ZK0A 4HATA 3U37A 5G41A 4JASB 1VZ2A 3B7GA 2QRMA 2QRGA 2OQRA 2XJ4A 1WV1A 5KTPA 3QUAA 5FPHA 1I0ZA 3Q1KA 3FHTA 1YACA 4Y1RB 2RGNA 1XKXA 3ML1A 1XVUA 3DV9A 2CXHA 1ZXXA 1E7SA 1FLAA 4MP6A 3SHQA 1SQSA 2R6CA 5JY1A 2XWBF 1YMVA 3IMKA 1E3SA 2C00A 2QLFA 1G21B 1VMKA 3OY2A 3UMJA 2I34A 1VL8A 2WSSA 1NAIA 2P9GA 2Q8PA 4B4DA 2W7TA 1N5OX 3O7MA 1Y7LA 2N75A 4WNAB 3A05A 4YT8A 1CUXA 1F5NA 4J07A 5B7GA 1U2QA 2PCJA 2E4AA 3N2YA 4GZ5A 5AVSA 3GMSA 3H9JA 4WBSA 3U4DA 1CLEA 1PUXA 2ZDHA 1A7UA 4RTOA 5BQPA 4BO3A 1IRXA 3M4YA 4DM4A 4ZVNA 1PX2A 4LZJA 2GVDC 2RHDA 2RGEA 1DFHA 3LX6A 5D1HA 4YMSA 5F98A 1B41A 1HOTA 1EYZA 1JJAA 3ADCA 3U4MA 1LA2A 1VSBA 4KN5A 2FW9A 3PD1A 2A94A 2O0MA 1C5KA 2BKEA 2ZRDA 1GTG1 2NO4A 2OHGA 3QUQA 4HGOA 2QMZA 4QNRA 4PR3A 1NW4A 1SBNE 1W0JD 2AUTA 2CLHB 2VRWA 2Z5FA 3F71A 3GBVA 5CHEA 3I4FA 3VZRA 4E5UA 1RRCA 5MGNA 5A4MS 1E5TA 1ZM4A 1GTRA 4BLRA 4TXMA 2VJQA 2YWCA 5A5EA 2WTUA 4Y9TA 4HQFA 4GI2A 2WQ7A 2EX4A 4QUDA 3CXRA 2ZBGA 1E3QA 4KACA 1ZINA 5CK5A 4CFZA 1A2BA 4XA8A 5B2EA 1FFXA 4KZPA 1M2JA 2YJ4A 4TYQA 4LXUA 5BSKA 5CD1A 4ACAA 2HHJA 2N9UA 4X20A 5REQB 4DNXA 1NONA 2WM3A 3UAOA 5EWMB 4F04A 2ECFA 1F17A 1KDPA 2C92A 3H2YA 4GSLA 3A6KA 1PFWA 3DB2A 4N47A 3FI9A 2DHEA 3UFXA 2Q9UA 4EJSA 1ONBA 1DXYA 3W5VA 4UFPA 2EBWA 2YX1A 1NR7A 2R7NA 2H1RA 3QVXA 1QZTA 5CIWA 5C4GB 3V8QA 5I7RA 3P0HA 4OD0A 4J2TA 4PGFA 4WXPA 4ZHQF 2NZYA 1XDGA 3HJCA 4KVZA 2ZRCA 4Z9FA 5A1TA 2WU8A 4EUEA 3H04A 3KXIA 4XWTA 1UK7A 1M34A 3B6IA 4HQLA 2RCYA 3KYCB 4DC1A 3UCXA 3A1DA 3L4BC 5HRUA 5SICE 4XW2A 1B0ZA 4WDRA 4X92A 3NM6B 2WSLA 4AT1A 2EFYA 3ACDA 2J41A 3NTLA 3QXCA 3R9KA 4B3BA 5LPNA 1SK9A 2D74A 3PPIA 2QGZA 3ZHRA 1X7ZA 5KNDA 3DBHB 3ZY5A 4QBKA 2ZRQA 2NXNA 4K3UA 3B1YA 4AF6A 3KOYA 3FH0A 4LISA 4X24A 2B6NA 5E3HA 2YXLA 5GVRA 2WHYA 5TT1A 2B4RO 1L5LA 2BGUA 3PGA1 1JVSA 3UUGA 2V54A 4AKSA 3QGMA 5AUPB 4QD3A 4HDCA 5CB4A 1CUUA 4GOND 2QUZA 1HLFA 1MOSA 4HUTA 2WVJA 1U0LA 1TUGA 1XZQA 4A6PA 5BV8A 1U2DA 4WT7A 1QHIA 1RBMA 3UFBA 2FFHA 4JQYA 3G8YA 4US1R 4KR9A 5JTTA 4PO8A 1D7OA 2FFAA 2FVYA 4LDPA 2CSXA 1VB3A 4R7GA 5JSQA 3IKJA 3S40A 1M0WA 5DXFA 1U1CA 4XI9A 3L7CA 2NO6A 2ZSDA 1N33B 1TU4A 2WW8A 2ZXUA 2NO9A 5IAKA 3T5TA 4BP1A 3ZHOA 1YDWA 1PIWA 4Q3KA 4RD1A 4GWLA 2VJYA 1T13A 1NBIA 3NHPA 4RY8A 2AUMA 4J3NA 1KNXA 1NPTO 1Z4JA 1JFVA 2HF2A 4G0QA 1AK2A 1BHSA 4ZV4A 4UUPA 2FPPB 2C4TA 1VE9A 2CY0A 2QGNA 1YHNA 3UBTA 3KYIB 1GL7A 1XKTA 2E6UX 5D1NA 1ZN8A 2Z5GA 1WF6A 3VJMA 3NHUA 4MGKR 3NHMA 4EB0A 4L72A 4NWIA 3OTOB 2VF8A 1G6HA 2WICA 1JDBB 2ZUBA 3JZFA 2C5GA 3HL4A 1K4KA 2P8JA 4DV1B 4BUJA 1O9HA 3M4JA 3BHJA 2O23A 2QJRA 4CMEA 4ZIRB 2XLCA 3VGJA 3C3DA 3FNIA 3GDGA 2O1XA 4AL4A 1EUCA 1EDEA 2QTFA 3RS8A 4B43A 4A5SA 4WLFA 2NX2A 3I8OA 3KOMA 3R40A 1IWOA 1KI2A 1ZO8A 4M55A 4UE3S 4M9UA 5DLEA 5DLYA 2PA0A 3Q6NA 1I3CA 4NDNE 2YIMA 2XW6A 1RPNA 5TEWA 3TLZA 4CTMA 3AR2A 5ICGA 3MYYA 1G7RA 3UJHA 3IOCA 4MIEA 3CVOA 1IM2A 3S5UA 2HT1A 2ZI3A 4JD5A 3SR3A 1KBZA 1MJHA 1SNYA 1Y1TA 4B3JA 1G7SA 1SVNA 3HB9A 4UJ5A 3U4IA 2D1RA 3LVQE 2E21A 1Y3AA 4N0DA 3DMDA 4XEUA 2BZ1A 3DKRA 2QEQA 5IKOA 3UQZA 2IV2X 4E6EA 4F4UA 4RYLA 5DCUA 3TE7A 3NAQA 5CD9A 4L5IA 3W78A 1EDZA 1TA4A 2I4IA 3D5TA 1A69A 1DTSA 4BVAA 2FCAA 1VRCA 3ESXA 1IG3A 2PUAA 1T6YA 2EZ4A 2XVZA 2BP7B 3SQLA 5LB4A 5IX8A 5EMNA 1U2TA 1R66A 4H7IA 4LRWA 5BR7A 3HY4A 4DHWA 4WESB 3ZHZA 1WPGA 2Y67A 5FFNA 1VHDA 3AVYA 1CY2A 2J9XB 4GR5A 3AKZA 3RVOA 4B4KA 1SHTX 4KMRA 4I9UA 4ZYLA 2FCRA 3EQ8A 4GYWA 5DGDA 2ZZNA 1FNMA 2ZI4A 1YZVA 3FPHA 3LWNA 4NI5A 1TF5A 5FXMA 1CU1A 1P62B 4CN8A 4YCMA 3DP7A 5AVUA 3ZDBA 2VAMA 4Q3OA 3UAWA 4B6OA 1UDCA 4FMDB 2EJUA 3I1FA 2VAXA 2VN8A 4HDKA 3SZRA 5LLDA 3THYA 2BTEA 2N42A 3O3NB 4EY5A 1YBMA 3QYPA 4XASA 2GBLC 2UV8A 4KJXA 1JEYB 1EWQA 2Q1WA 4XEHA 1GZ7A 4FLFA 1T1SA 4H16A 3AINA 4RA9A 4OV6B 1LSSA 5FB3A 5IW8A 4QGGA 4QT0A 3G1UA 3T7SA 3C39A 3RWOA 3UOWA 3QF7A 2FLVA 2RGXA 1FLNA 3I1JA 4JBNA 1INLA 3EZ6A 1CDOA 4Y1GA 1QRDA 2HC9A 3N6VA 3OT4A 2E89A 4LEIA 4G5HA 4IEFB 3C3CA 1M34E 1PCXA 2J59A 3D6AA 2R7KA 3RSFA 1LI5A 1ESZA 2FG6C 2F9LA 1EFPA 4G5FA 5IHXA 3OZTA 3ZQ4A 2SCUA 3OE7D 3U40A 1J49A 1JQLB 2G25A 1LV8A 1FX1A 2XECA 3M1LA 1W0KA 4FYIA 4R51A 3V3KA 1G3IA 1WZIA 3BRWA 4GRAA 2COEA 4FE4A 4N82A 4CI0B 3DYBA 2RBEA 3LW8A 1KE2A 1JZTA 1JF8A 1WQ4A 3FROA 1PBNA 3WOVA 5LOVB 2ZBDA 1J42A 5EP3A 1A9RA 5CFLA 1GPMA 1DRVA 1YKGA 1C8BA 4NOLA 1KXJA 3BD8A 3MLEA 5B7NA 3QYFA 1CR4A 1E3MA 5H9WA 4B34A 1JFFB 2XCLA 3ONVA 3VSEA 4JC4A 2HA3A 2OKGA 3UC5A 1VL1A 3IBYA 2D6FA 1OJLA 2VWHA 4D4GA 1HORA 1OXXK 2Y71A 1OA1A 4GKBA 1S3GA 2OM2A 2PMBA 1J90A 3AHIA 1QQAA 7MDHA 4YJFB 1GZ4A 1NYQA 1JLRA 3GQVA 3RAEC 3S7ZA 4LE0A 2G40A 2X8BA 4QL3A 4MUNA 2RI6A 2YVUA 4IMJB 4X1KB 4F1WA 1O5OA 4YJKA 3FOCA 4W1QA 3ICWA 2VYVD 4D0SA 3ETJA 2ZXEA 4RU1A 5EQFA 2WM2A 3WG9A 3A7EA 3FPLA 4Z7JA 3SEZA 1GRCA 1NMSA 4ARCA 4LF4B 5FWXA 5BSVA 2PCLA 2QE7A 4M7PA 2O8BA 3CJTA 2PO5A 3EIEA 3C6BA 3HU1A 3KOUA 1VLQA 1GEGA 2HPZA 2X7XA 2ZBQA 3A4YA 1P7YA 3EVCA 4NYIR 3CLUD 1RYFA 4IUCS 1XMXA 4RZQA 3O21A 4EABA 2VO1A 1UP4A 4TZTA 4XFKA 4ZAFA 4D6XA 2NG1A 1I2AA 1AUXA 1KI6A 4K88A 4LXHA 1Z6XA 2CJPA 4KQJA 4FLEA 3W2IA 2AZXA 5HFNA 2FRXA 4EYKA 1OX4A 5K03A 5E8RA 4B3DA 4MLPA 2VC2B 4DM7A 1P2UA 4OKIA 4ZI7F 3I1YA 2Q21A 3I58A 3NWPA 4NJMA 2ZRIA 5B5SA 3FHLA 4BMOB 1KYVA 4K05A 1O0SA 3OF2A 5EKTA 4HQOA 4JDUA 4R3WA 4X93A 3WYEA 4J6EA 5M5BA 1Y3HA 4QPZA 3L7KA 3IKTA 3Q85A 1VFPA 1JEOA 1YBAA 3FAZA 2Y0PA 1U90A 4HR7A 3DDNA 3QVJA 2YV5A 4PM4A 3TUZC 1JR6A 3AZOA 3SI7A 6LDHA 3CGWA 2VDVE 1LLFA 3KLOA 2QU8A 1ODLA 2P5SA 3AW8A 4CCSA 1RHJA 4FFOA 3U4CA 3E15A 3RGWS 1GOTA 2B61A 3AESA 1SGWA 1KO7A 3GRPA 1HT2E 1F6BA 1W8DA 1GA6A 2AWNA 2R2AA 4BV2A 2QUKA 5HJ5A 3GAFA 4L5YA 1GQQA 5JASA 1S8OA 2OBBA 1EFUA 3KBOA 3UOAB 3KTAA 1X3LA 4FR5A 4Y0VA 1F8XA 4C2AA 3BE4A 4XFJA 4BGVA 4CVNA 2I2WA 2J3MA 3ASUA 3G49A 3AIOA 5DK4A 2OUIA 3M1YA 3R76A 4DJFC 1MV5A 4U8HA 2UUCB 3R3UA 1SAYA 2PGAA 4HK4A 3VKWA 4YRGA 4HDSB 4TLEA 1F14A 3DC2A 4J9VA 4RHUA 2I03A 3IMEA 4TKVB 4MUFA 3W77A 1A97A 1CQJA 3R5JA 2CE7A 4KI7A 3B70A 4CF3A 5BN5A 1AKTA 3GZNB 3I6ZA 4E13A 3PUVA 4Z4QA 3L07A 2BPOA 4MYDA 3EC2A 1TA9A 1HSZA 1AQIA 1QIFA 3A4MA 4X6LA 4DLVA 1YL6A 2SECE 1QOQB 3K1ZA 1NBMA 2QMYA 5CAEB 4D9CA 5LP1A 3QKTA 1L5WA 3IALA 4MV4A 4BQSA 1F4LA 1RXCA 3DOUA 3ABQB 1BQ3A 2Q2QA 2FP4B 3GUZA 3L0IB 3MAJA 2AQ8A 3NYRA 1KKUA 3BCRA 4LGYA 5E38A 3U7RA 4YAOA 3ELWA 3DGEC 2H4YA 1QM5A 1L8OA 2B1RA 4A8JA 1CF4A 3CVXA 1MH1A 2GPAA 4BEWA 2YZ2A 2ZAMA 5K0LA 1ENOA 5IT5A 5FL3A 1TVKB 4HDOB 3VR1A 4RFSB 4KGDA 3NM4A 3VO1A 3JS5A 3TTWA 5L95A 1I6WA 1DIAA 2RGBA 3W2EA 2Z2JA 1FRNA 4G0PA 1Y5LA 3IIMA 1RJ9B 2A9OA 3KZMA 4YCDA 3WLTA 3TAHA 2P0AA 5JXGA 4WQMA 1I1HA 5CB4F 5LMNB 5FD8A 2RHCA 1AHHA 2FEPA 4TV8A 3U48A 4QM7A 3JD0A 2JJYA 3RIYA 2JFNA 2NU7B 4LMAA 1E2LA 1Z6AA 2HRZA 1RJDA 2P9QA 3DB1A 1LBIA 3ODGA 5ITVA 3D31A 4QATA 3ZY4A 1U2PA 3N3BC 2AB0A 3HACA 5K09A 4KN8A 3NEJA 2B83A 4NZYA 5ENVA 3OAAA 1R37A 1X1RA 2XTAA 4OP1A 4QA9A 3SDBA 2KSQA 2HIGA 4AZ0B 2AQHA 3BILA 3TAUA 5EHZA 1AQ6A 1MG5A 4DGSA 3DOJA 1AQNA 2REQA 1CUYA 1FNBA 1VG9B 1EG2A 2I7VA 3CT4A 4XD7D 4ZOBA 4DJTA 3HFGA 1Z63A 1MC1A 1D2GA 1NXPA 1SG6A 2ZJ0A 3H2KA 5KTSA 2CMKA 1TD1A 2WMDA 3GCXA 3OLQA 2EVWX 3QF4A 5D8DA 2BL4A 4IVQA 5LNK6 1RHRA 1HWYA 1O0BA 3WYCA 5B3AA 4G36A 3ROFA 2DPGA 1KERA 2G6BA 3RFUA 3U9SA 1W0CA 3GELA 1MV8A 1CQPA 3TB6A 3DOEA 3ZE8A 3MD9A 2W2VA 3NVAA 4QYTA 1VA4A 1QHXA 5FHRA 1EGQA 3CQ9A 4I4CA 1OILA 5TX7A 3LO8A 2R86A 5F52A 1KOFA 1DUSA 3UUEA 2ZAGA 1QS0A 7YASA 2GAIA 3M9XA 3ER8A 1M83A 3GN1A 1P9OA 1K68A 1JDUA 5A71A 1Y8ZA 3R6LA 1FNNA 2I65A 4MYHA 1LWNA 2JANA 1MQ8B 2YZ7A 4BFZA 1L7QA 3C98A 1JKFA 4NMMA 3WICA 2BE9A 3BIWA 1UAYA 2L42A 2P6UA 3QXHA 1EFRA 4XUEA 1ULBA 2FXIA 4FFSA 4MP3A 3PDIA 3V4VB 5AVQA 1HYQA 3JD3A 3TO5A 3AI3A 5KYUB 4X00A 3MELA 3PZRA 3QOXA 2O5EA 1GAXA 5JPCA 3GNLA 1MNAA 2R6FA 4FKZA 2ZUCA 1X74A 3HFRA 4BYMA 1R4MB 1H6CA 2EFHB 3OO1A 1CNMA 3V46A 3BD6A 1OWPA 5DF1A 4DMRA 4ZZ2A 5JS2A 1RBZA 1ZBDA 3H9UA 3HJUA 3DA8A 2CLCX 1Q15A 2AYYA 4JJ4A 2QX9A 5KB3A 3BK2A 5KOHA 3K53A 4W5WA 1XD2B 1QE0A 1R0CA 4KDRA 1AD2A 1U7DA 2Y3IA 3PENA 4UM5A 2F8SA 4F3YA 1C9DB 2H1WA 2SHKA 5A2GA 3QTBA 1CTQA 3WFIA 5F73A 3HP4A 2FRDA 2GZMA 3G9XA 4LDQA 1BU8A 4YXWD 1JHZA 1DC7A 3M4NA 4CETA 1QF9A 5ARDA 4IWNA 3K35A 5IVIA 2QVLA 1GRVA 2H5EA 2A1TS 3MWFA 3OPNA 4QOHA 4WY5A 3VO2A 1ZI6A 3Q8WA 1DAFA 2NWQA 2AZTA 2ZJ4A 3CX4A 1YVUA 3W5IA 2PZLA 3B3GA 3DAOA 4PCVA 3KOXA 4Z0HO 3TNJA 3W9SA 2EAUA 2Q0XA 1TVMA 1SHJA 4HZUA 1GG2A 1VHQA 3P2OA 3EGDA 2YH2A 1MC5A 1SCIA 3SK0A 1TECE 4MVJI 2QI9F 2ORYA 1E96A 1F0NA 1JNXX 2Y2UA 3OBIA 3QV2A 4FMBB 1CD5A 1LBSA 1TKCA 4WHMA 4D4LA 5AVXA 4X1YB 1ZGZA 4MEBA 4NCXA 5ENDA 1VXOA 3FLEA 1N9GA 3DZKA 1DQNA 3FB4A 4ME6A 5FIUA 3L0CA 5CDHA 1RJWA 3FFWA 2VLIA 3UJ7A 4Q4CA 3B7PA 4N6NA 5TVKA 3EC7A 1WHTA 3D6FA 3HZRA 2YINC 2ZUWA 3V7WA 5FBQB 2F1IA 1T2UA 2G6TA 1WB6A 2VKQA 1PJTA 3K9HA 3EJ6A 3REOA 1NBME 5CXQA 3LC7O 3VR2A 2RH8A 4NNJA 4W5NA 3LY7A 3F3KA 1X1EA 2AOXA 2XUAA 2JAHA 1NI4B 2TMKA 4DBLC 1COWA 2NLOA 5EIBC 5ENZA 3TLGB 3UZUA 5C1DA 4YMLA 4P6VF 1TZBA 3GRUA 3W8RA 1H9CA 3DLIA 1IHXA 1NVWQ 2QZ9A 5E7QA 5EHQA 5HF9A 1JQAA 1BKYA 1KA9H 2OAEA 4BC0A 2CL0X 3M5WA 3ZHVA 3VPGA 5E4FA 3BHIA 3L7JA 1T0JB 4PSDA 1HUQA 1TW3A 2QTTA 3Q6MA 2RGUA 3G0DA 2EX1A 1P5HA 4X45A 1HFWA 2ZYUX 4DV3B 5F7XA 2PXXA 4KLAA 4J0GA 3B38A 1W4BA 1SBYA 3R8FA 2YZGA 4BO7A 1PBTA 1NW9B 2CYCA 1TQ8A 1IXRC 2Q6KA 5I9SA 1QWOA 3TLYA 3UT0A 2FN8A 3F2IA 1F7UA 3EXIB 2QUBA 3A10A 2DPXA 2YICA 4DY4A 3DWIA 3CRVA 5DGXA 1HE3A 4HGNA 5H7XA 3JQBC 1YDGA 1S2LA 2ET6A 3UAZA 4C0BA 2OK8A 1M1ZA 4HKTA 1J25A 3EF3A 4E94A 1G3MA 1BDHA 1B2LA 4YP6A 1UM8A 3HKCA 4BX8A 4KITB 521PA 3B1ZA 5IULC 1JIUA 1HTBA 2B5VA 3IO3A 5HKOA 4IX1A 3EBLA 3NWJA 1T5DX 1NVDA 3ROTA 3U3KA 5C3MA 1HYGA 1QTRA 3ZZNA 4AY6A 3SBOA 2O6LA 1U3CA 3HNPA 3M2PA 4CKWB 4CEJA 2Z4RA 3OZWA 3LLVA 5HTOA 3VZQA 2CJYA 4QPNA 4ZZ3A 5HR5A 1L9KA 4CLHA 2LIPA 2F3QA 3OJLA 2BLLA 3GLHA 4KV9A 4Q9LA 3LFTA 4FGJA 2Y1CA 3MTJA 4OGFA 1CUFA 1VCNA 2BJVA 1MJNA 4DIMA 4P08A 1KEUA 2HAEA 4XDGA 2YFHA 4CM6A 5ESDA 3OIFA 1TDJA 3DJYA 5AI0A 1GLGA 4EHNA 3U56A 5T6BA 1OWOA 1JHQA 1B0UA 4IUBS 5BYKA 1XSEA 3CUSA 3FSJX 4DCGA 5JZBA 5B64A 1EAMA 1CY7A 1XHLA 3BGWA 1X1DA 3KT3A 3IUJA 2X5XA 1YZ3A 1UK8A 2XB8A 2YN2A 2ZWIA 1EA7A 1OXMA 3GGGA 5LSAA 1OAOC 2JIDA 3W6ZA 2H1SA 3A9VA 2B8TA 3SY8A 1JXAA 1Q0SA 1QMGA 1ORDA 2V96A 2NACA 4Z9BA 5JAIA 1HV8A 4XWOA 1ES9A 3GGCA 3JQRA 1H66A 1KMCA 2E1PA 3FUTA 1NATA 4RL6A 5CDUA 3FVQA 3HS3A 2IOFA 4MV9A 3WJ1A 1Z4PX 4UTXA 4GF5A 1Z9BA 3MGKA 1PWEA 3M9LA 4QTXA 1L4NA 2G17A 3BWBA 3GNTA 3KWFA 4QXQA 1KJIA 4UUOA 1SCAA 3QPAA 1JFLA 3E70C 4L8VA 5BVGB 4BE9A 2CJXA 4BXOA 1K08A 3L1VA 3ABSB 4RE6A 3TJZA 3EXFA 2XNSA 1QGED 3PUXA 3IDAA 5EGSA 4WH0A 3KAPA 4EVSA 5KSYA 1JTEA 4FJ2A 3HYTA 3U3JA 4KRXA 3PF8A 1Z5NA 4LC0A 1GD1O 3BL8A 2QBYA 1DKLA 3PC8C 1BDMA 3FTCA 2EG9A 1PJLA 3G79A 1CY4A 1VIDA 3MERA 2IJGX 1GLNA 1GR0A 3IP5A 3L8YA 3PXDA 4FCCA 5GOTA 1IUKA 4P35A 1BCRA 3ACCA 5DMXA 1UFVA 4RPGA 1JNYA 3VU0A 4J0EA 3BBPA 3TF5A 5TT0A 3LDGA 2XNCA 4MQEA 4FZJA 2X5OA 3B8EA 4O1IA 1M6HA 2IBMA 5ILQA 1GZVA 3CYFA 2JVIA 4RTRA 4LOAA 4EMBA 1Z0UA 1UF9A 4KBFA 2J5RA 2I76A 4KIWA 1NE7A 2XF8A 4IOLA 4EJ0A 4P31A 2GUWA 1RJGA 5LZ7A 1MDFA 4OUDB 5GVSA 1V5EA 1SB9A 2C4MA 4QPDA 4QO7A 3DVAB 2WAOA 4EPXA 4TKUB 4KQXA 2ZZKA 3RVJA 2C9OA 5JJ5A 5DOZA 5C8YB 2NUTA 5KYTA 3EGVA 3OFVA 5FUYA 1JV2B 1X8JA 1P29A 2PK3A 4ZALA 5B2ZA 3FDIA 4EKDA 1KSGA 3FMPB 1YCFA 3B51X 3K8OE 4D92A 2PUCA 1BJRE 3AHDA 2I7XA 4KEAA 1PNTA 4TV8F 4A5OA 4Z4CA 3RTDA 5J9FA 3MS7A 1X19A 4EQZA 3F3SA 2AC7A 2AXNA 1LF0A 3R5TA 1P31A 4PBRA 3V5NA 3E9CA 4V39A 2BSXA 1KEZA 3QLUA 4R9NA 3IQXA 5DFAA 3HNRA 2HHHB 2AEJA 4DUZB 2MMGA 5DZSA 3W3AA 5LBIA 5B55A 1U99A 3PNKA 3L84A 2BONA 2Q5IA 2Q5OA 4N3GA 1B14A 1W52X 4Z4EA 1KDRA 2RHTA 1E61A 3C3MA 1FBTA 3DWGA 3KDSE 4B7CA 5AFSA 2H4HA 2J32A 1AK1A 3I01M 3LKVA 1J99A 1MLDA 2P9JA 4D74A 3JQAA 4D0LB 3UMCA 1Y1PA 1RCTE 1EDBA 2P69A 4Y2TA 5JJLA 4QU5A 1KVRA 1YQWA 4G2TA 1YRYE 1W49A 3C41J 4XM1A 1R18A 1ZY2A 5HA5A 1UWVA 3D59A 1NOIA 3EVZA 5CT8A 1ESNA 3DTTA 3LX8A 1I4LD 1PR6A 2O7SA 1AF7A 3PRHA 1IEVA 4JYPA 5IM5A 4MWBA 3RT1A 4YRIA 5BV2P 3M34A 3NT2A 1FP7A 2CEAA 1J2RA 1JEQB 2YZNA 2HV8A 3F7TA 3VTFA 2QD2A 2OVBA 1MX9A 3GLHE 3LQ1A 4WZ6A 4ZK6A 5JNTA 4HBGA 4BAUA 2YNMC 5E6RA 1MRZA 3AQ4A 4R01A 4LGMA 1VIMA 3NVMB 3CU5A 4EHKA 5JFGA 3T5GA 1L4BA 2CLEB 2CUNA 4BO1A 1V3VA 3KAKA 3OM9A 3FIUA 4LCEA 1NFFA 4YUWA 3EZ2A 5BPFA 1FP4A 3LH5A 4MWDA 4QXMA 3N7AA 2X9NA 3QZUA 4KWHA 3ICPA 5AP9A 5BW5A 1H94A 4XX0B 3LBHA 5D5HA 3K0HA 1K2VN 3R3ZA 4EHLA 1EKXA 4ZVOA 4PG7A 2VH2A 1P7VA 2C2OA 1HG0A 4GM0A 5K0GA 2CDAA 1OFGA 3G5AA 4QLAA 2YQ5A 3BSYA 3EWIA 1SQFA 4MJ7A 3ZWMA 5AHOA 4GBJA 4E5PA 2B7BA 3ICOA 3QOYA 4MV8A 1O8CA 3AONB 2HA7A 2W11A 1R9GA 3E9ZA 5F5LA 3KPVA 3EMKA 4LOHA 4EG1A 1RWWA 5FA8A 3AB8A 1Y3FE 3N8KA 4OU4A 4EI2A 3WSTA 2F43B 1B0AA 1W4CA 3FYUC 1NJFA 1D4AA 4K3VA 4QOIA 2H8GA 3HB5X 2IY9A 2IXDA 4TTVA 4IX9A 1ODJA 3IQWA 3SS8A 5B4UA 4FDMA 4QDOA 3Q9UA 3S4YA 1CUDA 1U2GA 1V8PA 1I33A 1Z7BA 1ID1A 1NM5A 1NXTA 3ENVA 5DDIP 5FTWA 1YS6A 1T8TA 4C04A 4CFYA 2LV8A 3ECCA 1GPBA 1P1IA 1P4RA 4RK6A 4DCVA 2YJ5A 3HJGA 2VHTA 3C3PA 5H70A 4PZDA 4B84A 1N4DA 2W6CX 4DWOA 2ZUVA 3MWGA 1QWSA 4R3UC 3BXPA 4JZYA 4EVQA 1DQSA 1LBEA 1BQEA 4ECAA 1CRZA 4ZGWA 1U28C 2CXOA 1R88A 3G0CA 1WKVA 2ZRMA 4B6GA 5EUCA 4P0QB 1DBSA 1LPOA 2AW3A 2CXUA 3OP4A 4ID9A 3VNBA 2O2ZA 4YV0A 4G26A 1XNRB 8MHTA 1XZNA 4NBKA 3L02A 5DI9A 5DE3A 2R8ZA 4R54A 5KNCA 3AG5A 4GNKA 2J7PA 1X14A 3FBWA 4KIFA 5TQVA 1TQ4A 1E2HA 3F67A 3IUNA 1E2IA 3PUYA 1GA1A 1WPQA 2V8OA 3LC1O 4KR2A 4E70A 3N28A 5DM2A 5EVCA 2XCOA 2Y9MB 2ALJA 5HILA 3N2ZB 1JQKA 3EIWA 3NHKA 4GZ3A 4NJEA 4XB2A 1L8XA 1F20A 2ZIXA 3O91A 1FLDA 5EUMA 3AOEC 4LF6B 2FPLA 1NMXA 2GBIA 1T4DA 4BC1A 2PQ0A 4LNUB 3H9BA 3EEQA 4L95C 1WJGA 1Z0DA 5H3LA 3EASA 4BMXA 1Q57A 1N2GA 1TAHA 1XF1A 4R2WA 3SM9A 1EEXB 3T0GA 4POOA 1P4GA 1WXEA 2AFRA 5KOJB 1FIUA 4B2YA 3VPXA 2XTZA 4W5QA 3LSYA 3N5KA 3E82A 4RLFA 1L7PA 2VUHB 1CJTC 1RRMA 3HXLA 4FMCB 1R0WA 4PYKA 1E2GA 1Y7PA 4YJGA 4EY3A 4CEHB 2JHAA 3TZCA 4OJYA 3ELUA 3IAS1 3AK4A 4RAOA 3TRKA 5KQRA 2ZYWX 4R16A 3T0IA 2EDAA 2VHQA 3OZXA 4QLBA 2GHRA 4FOSA 4BKRA 3SXUB 1J2TA 1R10A 2IE0A 4TTQA 1LRLA 1VIVA 5IDVA 1ABBA 5T4HA 5AHKA 1A9PA 4MDYA 3D64A 1GGMA 2VDOB 3FRIA 3Q7SA 2H2DA 2R97A 1AVTA 4LJ8A 4PZYA 1JDTA 3KDAA 1ESMA 3KSRA 4I5EA 3RUPA 4A1OA 4PLHA 1S2OA 2JD1A 2QUJA 3EDRA 4WFIA 5ITWA 1J8DA 3A3PA 1P73A 1RKQA 3CS3A 3QX7A 4KUGA 4MHSA 3Q7RA 2GUGA 3HJHA 4I6JA 4MMXB 3M5DA 1M67A 1O87A 1ZEJA 3B12A 5AI6A 3Q7PA 1ISSA 2IEYA 3L1HA 3MUOA 4F1JA 1Z08A 1E9VA 2IUYA 3PXAA 4GEGA 4WLVA 4LTMA 1SUCA 1QLJA 3SZUA 3WV5A 2PG3A 4AWAA 4DNQA 1GM5A 4JYZA 1J21A 2VDWB 3TRJA 4QGSA 1WQ3A 4N3AA 2OFWA 3F6PA 3F96A 1EVEA 3OHMA 4MOWA 4C3VA 1VPWA 3AX6A 1F8YA 3OT5A 4I8XA 4UNQA 3VNAA 2IHTA 3CNEA 3QNMA 3D6TB 3SPXA 4BBAA 4DTIA 4ENPA 4Z51A 1T5OA 3OMLA 1OC4A 2J46A 2JGLA 1ESCA 1YUBA 2QN2A 3NEYA 4J16A 2IS4A 1ZUNB 3O1LA 4E21A 3O4JA 1NVVR 3D8HA 4DTCA 2J4CA 4MP8A 2RBKA 4F72A 1XQYA 3LK6A 3ZWYA 5F1KA 4IJWA 5CFZA 1TRKA 2FLKA 3Q9LA 3DBRA 2RHMA 5KQLA 3EDQA 5CB8A 5JNUA 2B5WA 1E94E 3CB2A 1OBVA 3BG5A 1G2QA 3K4HA 3IGFA 4FYXA 4OHRA 2V45A 4PNZA 3T06B 4WLNA 3WMFA 4JP8A 3UB4A 2GXAA 2F00A 4ZO7A 5DU2A 3ZGLA 3TZHA 1DLJA 3EBPA 3NHSA 2GF0A 2KMLA 2BTQB 3DTVD 4CKYA 5EI5A 1Z6ZA 2QN6A 2H0RA 3Q72A 5AKHA 1U7HA 3ROPA 3FA2A 1SUPA 3QFTA 1P1RA 4OX9B 5SV2A 2QIPA 3R0ZA 4FCWA 2DT5A 4CM4B 2IT1A 1ISJA 5DRTA 4NBNA 4NG5A 2AMJA 2MSEB 2FH5B 4OJTA 1PUIA 3LWBA 4GM4A 4PAOA 3IAXA 4DPLA 4ADSG 1AKWA 2V4MA 5LXTB 2ZTLA 4ZU6X 5LB2A 3U3DA 4EKIA 5L51A 1V3UA 4N48A 1E6MA 1H0KA 1LZKA 1TF7A 2OLKA 4HLCA 4X1OA 1ZM2A 4I9GA 1IG0A 1Z6GA 4RXMA 2W5UA 2XJ9A 3G7NA 4WGFA 4LZWA 1KTIA 3H1AA 4G89A 2QOEA 4O4LB 4PAMA 1XC7A 3SR4A 2HO5A 4AZWA 3O8OB 3OLCX 4M88A 1QHEA 1UZAA 2AN1A 2P6NA 2WD8A 3LUKA 4L74A 2JC3A 1QQ5A 2G28A 3BH0A 3JX9A 3Q3HA 1UBEA 3QG5A 4FK8A 1N5DA 3KYDB 4KXVA 5DEIA 3UMRA 1ZSYA 2V7QA 3O4IA 1L4UA 4EX6A 5KVAA 4M9CA 3VMFA 3OJEA 4MYRA 2XRFA 3ZLVA 2I99A 3O03A 4WOBA 3EPKA 3CVYA 3V1YA 5FUWA 1GU1A 2PLRA 2Y0CA 5ALTA 3W5UA 2C3MA 5TR9A 2W4IA 2HRQA 3K1AB 4BO8A 2BGIA 4FOTA 1LVHA 2RGDA 1T91A 2ZTMA 3NNSA 3C3AA 5F7ZA 1YRWA 4MAFA 5EXSA 5BT9A 4AZ3A 4DIBA 4PVCA 3EOAI 4YDRA 4C06A 5ADUS 4QAJA 1O9BA 3EHDA 4C21A 3UGKA 2MINB 4U9UA 1LK5A 1NUTA 5DNDA 3T1NA 1SUEA 3UG7A 1ULUA 2MWMA 2FY8A 5K2MA 1RLTA 1YBHA 3K0BA 1UAAA 4J75A 13PKA 1CUAA 3IILA 1GZUA 2E55A 1PQUA 3E18A 4V2IA 4O59O 4ARZB 3QLJA 4G09A 4JQSA 3JAWA 1ZJZA 3HUFA 2ZK7A 4REOA 4JB3A 1N4AA 1E9RA 2JZCA 4TMXA 1S4MA 5DYTA 4Z2YA 4IGFA 1QKJA 1T4CA 3L6DA 2PJUA 4M9XA 4D1YA 2AMLA 3E2IA 5C34B 3ILVA 2GJ9A 3MEQA 1X7GA 4GBMA 4JOCA 1DKOA 4RV9A 4BZZA 5C2JB 3L7AA 1J0EA 1K66A 2TS1A 2D62A 4RK7A 4LWOA 3H6KA 3O5AA 4UUNA 3U7GA 2PUGA 4KYUA 4EB8A 3G6KA 3AF2A 2FN3A 2HV9A 4ETMA 2BMJA 4MEAA 5ALVA 4GWGA 1WE2A 3C6XA 3EZ9A 3HVKA 3FTNA 4NE7A 1B6RA 3U7JA 1E1QA 1IB6A 1ICEA 3A6LA 3UHAA 4ANFA 1BFUA 5HZMA 3JSAA 3KJGA 4RJLA 3LCRA 4ZCMA 1E2NA 1JRLA 4H31A 1JZQA 4O2BA 4CIDA 1XCLA 4CGZA 3AF5A 5A4IS 2B1IA 1UZMA 2I78A 3L7OA 5CU7A 4OATA 4DEVA 1OBFO 3HB0A 4D02A 4RLHA 2QJOA 3TNYA 3X3HA 2ZT5A 4LZPA 4DQDA 4BB6A 4LUCA 1QVWA 1VZ3A 3GEPA 3W2FA 5AHWA 4X8HA 3TDNA 1DJLA 1G42A 1GA4A 2HT6A 4K81B 4YPFA 3UBMA 3FMGA 3MQ2A 5EJEA 4QUKA 4EB3A 1J8QA 3NHZA 5KHAA 1QUFA 1CFJA 2UVPB 4L6CA 1C9MA 4U9HS 2O3SA 1IHUA 1IDN1 3R24A 4AM8A 4ER0A 3EDOA 4UBIA 4FNAA 4E0BA 1QO7A 2ZSAA 3SBDA 3ADKA 2VI5A 1E5QA 4XGKA 3VNQA 2D0IA 3QVMA 1X80B 2CMHA