3SBDA

Crystal structure of rac1 p29s mutant
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
177
structure length
177
Chain Sequence
GQAIKCVVVGDGAVGKTCLLISYTTNAFSGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ras-related C3 botulinum toxin substrate 1
publication title Exome sequencing identifies recurrent somatic RAC1 mutations in melanoma.
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3sbdA00
1DELA 5CB6A 3P4XA 4CT4B 1S3SA 4DKXA 4XD7D 2JCSA 2BIFA 4PFSA 5DN6A 1BKDR 4HAUA 3RS7A 1BS1A 1RRFA 3AGPA 4XWAA 1P4SA 1G3QA 4CEIB 5GJWC 1S9DA 3SJZA 1G41A 4EPRA 1NVVQ 1W4CA 3CO5A 5AJYA 1W36C 3NVAA 2ZSFA 3OFNA 1ZD1A 4YLGA 2YWHA 3V4RA 1BH2A 2DFTA 2CLDX 3PR1A 3TUJC 1U8AA 1U0JA 1ZNWA 2OESA 2P5SA 3EIEA 4DUGD 1OXUA 2ZYVX 2VQSA 3VHLB 3FMFA 2H1LA 2QSYA 4R71A 2PJZA 5KUTA 2UKDA 1CS4C 1KGDA 5LD2B 2G1JA 3GFOA 3EWSA 3TAUA 2FX3A 1JPJA 4KHZA 1AM4D 1F2TA 1OE0A 4PPNA 1SXJC 4M1YA 3CW2A 5H8WA 1M6NA 4URXR 5FOTA 3I61A 1WBDA 2H5EA 2FSIA 1OFTA 2A5DA 4Q4HB 1Q1EA 4JS0A 2XJ9A 2JLUA 3NDPA 2FOLA 4NPHA 3SYLA 4LWZA 3MSXA 1ZU4A 4B35A 3WNBA 1XMVA 4EKDA 4PHHA 1DBSA 1YR8A 4EQ6B 3QBTA 1LTQA 3EPKA 4LBZA 3R9IA 3QKUA 1ZCBA 2PEYA 5DYIA 1OJLA 3T15A 2J46A 3B5JA 4HB2A 2FFBA 1A5TA 1G3RA 5JBQA 4RZUA 3ADKA 3BIFA 3CLVA 3ADBA 3BFXA 4WZ6A 4DLZA 3UANA 1Z63A 1XDBA 4IEIA 1HV8A 3GLIA 4A8JA 4M4SA 1IN8A 4NONA 3I73A 3O8CA 1KK0A 4LI0A 3NH6A 5JZVA 1Z6YA 2YVUA 4WW0A 1LB1B 4F4IA 1B0UA 5FTKA 3NEYA 1RYHA 5HCNA 4AURA 2ZSDA 4QJ5A 3EASA 2D4HA 1IHUA 2KBEA 2YZ2A 3KKOA 4D4JA 3VR6A 3GP8A 1H8HA 1AQUA 3PUYA 4Q02A 4YQFA 5ANRB 3P4YA 2ONKA 4MKFA 3AH8A 1U2RA 2ZSEA 4OK3A 3OZXA 2QBYB 4LUCA 1T5LA 2PCLA 2O5VA 4Y0AA 4A0FA 1NMYA 4BLQA 1NMXA 5FPYA 1XCGB 3X1WA 1KO4A 1P60A 4B48A 3GLGB 1OFIA 2QAGC 2DPXA 2SHKA 3I1FA 1YKSA 4CEHA 1XD8A 1N2CE 1G5PA 2WVJA 4KI0A 1OV4A 1MO5A 3CNOA 4CIDA 4BZXA 2GVDC 2IYLD 2IA5A 5J4KA 4EPVA 3AKYA 3EG5A 1WMSA 4BFSA 2IF0A 4KSCA 4LYFA 4F93B 4ZPXA 1U98A 3FPAA 2ODBA 1FP7A 4FWTA 1T0JB 4BFXA 1JBKA 2E87A 2J45A 2W6JD 2QUZA 2ZI9A 1X86B 4QRHA 3A8TA 3D8BA 2XOKA 2P0EA 2EFDB 1X1SA 1KYIA 3FDIA 4MRPA 5BN5A 4AKIA 1G18A 3LDAA 3W8NA 2CK3D 4WIAA 3DMNA 1I4TD 1G6OA 3LLMA 4DLWA 4A0GA 4G5SA 3KXIA 1BOFA 1KY3A 5CDFA 3ADDA 3RS4A 2PJRA 3DM5A 4LHVA 1SKYE 4OJKA 4L9WA 3RRNA 2BBOA 2CHQA 1XEWY 4ZDIA 3TNFA 4O3MA 1F60A 2CMKA 2BEJA 1T91A 4D25A 3C14C 4A0RA 3CX7A 4JVMA 2FNAA 3V00A 4MYCA 2WSMA 4BFYA 2CJWA 4I1VA 3SR0A 3EPHA 4TMKA 1HQYE 4ZIRA 2NO6A 2F43A 2WIBA 3HU1A 1E1QD 1GNQA 2DWQA 3PEUA 1U9IC 3A1VA 5CYOA 4OI1A 1MRSA 4G5RA 1NG1A 4Q9JA 2A2ZA 1ZINA 2ECKA 2W2VA 1OXVA 1DAIA 3NTUA 1U8YA 1T4GA 1XPOA 4DCNA 3OEHA 5FUXA 3HP1A 5HZHA 4PHGA 4M0LA 4ZKEA 2B8TA 1A82A 1BIFA 3K0FA 3T1TA 1CBUA 1KSGA 1NRJB 4RFSA 1YZTA 3AF0A 2VIIA 1E79A 1UF9A 2IYYA 1E99A 2R6GA 2RGCA 2YHSA 1IBRA 2WSSD 5FBRB 2VP6A 2C8VA 3FHOA 2Q6TA 1G3IA 5CM8B 3BORA 2BBWA 4DCSA 3EIQA 3B2EA 4JLBA 4ARZA 3BD9A 3F5FA 3L0OA 1R4AA 4IFEA 4LGMA 4L15A 4BEBA 4HLCA 4D6PA 1GIAA 3HJNA 1HEIA 1T0HB 1EGAA 4HLDA 5DI9A 5EZ6B 3CF6R 4DC9A 2CL6X 1ZP6A 5KNBA 4MRNA 1FMLA 4Q4JA 1CR0A 3OEEA 4IDNA 5BN4A 1WBBA 1D9XA 2ZS7A 2B7BA 1PVOA 2VTKA 3NG1A 2WMOB 2HDNB 3UWOA 2JLZA 1R8SA 2WWIA 2WJVA 2D74A 1G5TA 1LS6A 3KKNA 3PFIA 2F1RA 4LCBA 5FL7D 2FSGA 4DLRA 1OKKA 2OHFA 4L8GA 1Z0JA 1H8EA 2H7VA 4Q1AA 1E2IA 1G7SA 1YE8A 1HQCA 1KDRA 4CDGA 1JJVA 5B58C 4C2UA 5F98A 2D2EA 4GZMA 1RC8A 4TSFD 3L0IB 2REXB 2RGAA 1QHYA 4YC7A 1Z2AA 4A1FA 1J99A 3PIRA 4JVLA 4YMVA 3FOZA 1G17A 2ZJZA 2IYSA 2RGNA 2WWXA 1HURA 2ZUBA 4KAXA 4FCWA 1UDWA 2WV9A 1YR6A 1Z3IX 1JR3A 3PEYA 4MYUA 4HI0E 2IUTA 3UIEA 1MO4A 3IBYA 4Q47A 1P61B 3JVUA 1WDTA 4R7ZA 4YMTA 1G5RA 1RJ9A 1X8KA 1TTTA 5LDDC 2VPPA 4MUBA 5FTLA 1E2NA 2EFHB 4GP7A 1E2GA 1S96A 1II8B 5IK2A 2B21A 2D62A 1KKLA 4IVPA 4JT2A 4AG5A 1IM2A 4R2IA 2YC2C 3WMEA 3NC1C 5IHPA 1U81A 3KX2A 3Q5EA 4NYIR 5GJVC 1E98A 1NKSA 3Q8XB 3BXZA 3NBZC 1KK2A 3F3YA 3UK6A 1WA5A 3LWNA 4KLZA 2EWVA 3W3AA 4FN5A 1GFIA 4P3YA 2RHDA 1BMFD 3LNCA 2C04A 2P3SA 5FOXA 3SC3A 3GJ0A 1SHKA 1TL7C 2QTHA 1Z0FA 2J59A 2O8EB 2ZIAA 4EIWA 4ZV4A 4C0LA 1T3HA 2X1VA 2LWIA 3QXXA 4DEXA 1UBEA 2GEUA 1ZM4A 1OXTA 2JLXA 2ZRCA 1TQ2A 4V0ME 3T5GA 5D3QA 3GEHA 3Q72A 1AKYA 3EWAA 5KPJA 1YJ5A 3U44B 4LHYA 4WA7A 2ZRGA 1NLFA 3QEOA 1FPMA 3AVUA 2W6ID 3D31A 1WQ1R 4OK6A 1ELOA 3O8DA 3QBVA 4KFSA 3H86A 3EW9A 1SULA 3AUXA 3KKMA 1Z0KA 1JAIA 3KQUA 1LFDB 5EJEA 4TTQA 3KJHA 5JWOA 4JYBA 4JZKA 4W7SA 1C9KA 2FN4A 4FXPA 4R98A 5EE3A 3VU9A 2AX4A 1HA3A 2VSOA 5L3SA 3IKJA 1G8PA 2MSCB 5KSOA 1U94A 3SI7A 2B7CA 3UMFA 1QVAA 1W48A 1TUEA 5EE5B 2QZ4A 4JSTA 2NIPA 2EWWA 1KI2A 2BKEA 3WHLA 2QY9A 1R0YA 1MR3F 1GDDA 4S2EA 5DISB 5LB4A 4GOKA 2AK3A 3VMFA 2QM8A 3RS3A 2ORWA 3QEJA 2FFAA 2ZEJA 4DXAA 1OH5A 2BWJA 3CX8A 2XAUA 1XCMA 2HXSA 3A58B 4QM7A 1IONA 2JJ2A 4DDTA 2NPFA 4A8JC 3LRPA 1IXSB 2DCUA 2ZRDA 4YXWA 4Q1BA 4L16A 3THWB 4NL4H 1W46A 3W90A 4QKQA 5J4LA 3QKRB 4V0KA 4FD2A 1A1VA 4HZUB 4D2IA 1S0UA 3CZQA 4DCTA 4JYCA 1GL7A 4BLSA 1TF5A 1CULC 4GOJA 3SNHA 4RD3A 3UMSA 3VR2A 1Z47A 4QBHA 3KDSE 3QG5A 4QHTA 5KSZA 1DG1G 3NDBB 3TSWA 1G8HA 3P27A 1N25A 2EYUA 3QQ5A 5CDFE 2QQEA 1XJQA 2DFLA 4O2LA 2NPIA 3CM0A 3LXXA 4X8OA 1OH8A 3CKLA 3I8SA 2F7SA 1R6BX 3I8XA 2FH5B 2WM9B 3FE2A 5F2EA 4CEJB 3FB4A 1KNXA 3IILA 3AM1A 1Z07A 4LBWA 4ZO4A 4FMCF 3MAAC 5B2ZA 1OIWA 1OLOA 2ZJOA 5D3MB 1KDOA 2ZR7A 2W2TA 3SZRA 4IHQA 4Z1MD 2I4IA 4KO8A 1L4UA 1NNEA 2GJSA 2WJHA 2Z4RA 2ANBA 3C5HA 3OESA 4FMDF 3K09A 4E5UA 4GNKA 5CM9C 5HKKA 1TX4B 5AUQA 4OI2A 2RMKA 3U3OA 3Q85A 3GLHB 3V4FA 5GJBA 3ASZA 3TR5A 1XMJA 2VHTA 4PHFA 1TQ6A 3AVQA 1DAEA 1UBGA 3OAAD 3QUSA 2BKUA 3U60B 2RKOA 4TMZA 3SBEA 2W2XA 3K8YA 4NYMQ 1P2UA 2YOHA 4P33A 3B7GA 3FVQA 2OFOA 1TEXA 2RH5A 4DIEA 4TMVA 4C0JA 1M7HA 1NMZA 1Z29A 4E22A 1RPZA 2GBLA 2ZPTX 4B75A 1P62B 1YR7A 1AJEA 5K8TA 3BFVA 1NVXQ 4QGFA 3UG7A 3FHTA 4NTZA 1CR1A 2AWOA 1ZC3A 2ZI3A 4TT3A 2PZGA 2PZEA 1KI8A 3AEZA 1LW7A 2P2LA 1UKEA 1IAQA 2AD5A 5UKDA 4F7WA 2XB4A 3GFPA 1KI9A 3FMIA 3IGFA 3KB1A 1F3OA 4Q9KA 2IK8A 3QIAA 4LHXA 4A6XA 5J4HA 4B44A 2YC4C 2VF8A 4NBSA 5DI3B 2O0JA 1E9EA 2V3CC 3QVUA 5GVSA 2ZRBA 4DDUA 1Z08A 1XX6A 1CJTC 4UXJA 3QKSA 4NP6A 4G3XA 5FH9A 3T06B 4QHSA 2RB4A 4C30A 4EPWA 5DIFA 4L9SA 4NCNA 5EQTA 4LOAA 2V7QA 3KUDA 2O8BB 1KK1A 4URUR 1E4VA 4JJKA 4DWJA 1ZMXA 4H9GA 3L0SA 4LJYA 2Z4SA 4HEJA 1N6OA 3EX7C 2ZE6A 4RZ2A 1SVMA 2O0KA 4ZDWA 4EJSB 4TLEA 3AF4A 4KVAA 3SQXA 1YZKA 3K9HA 4HAZA 4FIDA 4P4UA 3SJAA 2IHYA 1HE8B 2ZVQX 3ND8A 4PQRA 5SZIA 4BLRA 4HB0A 3L2OB 4QL3A 3DDCA 2ZRFA 4P4SB 3CF0A 4M9QA 3QI2A 1GRQA 2P67A 5KTYA 1KMQA 2NO7A 2LCFA 3MFYA 4EAQA 2AFIE 3SJCA 1UADA 4DZZA 2XNSA 4PC1A 4Y0VA 4KSBA 4RKFA 3TAHA 2RGEA 4QXAA 4BASA 1II0A 4FMCB 4RY2A 2OXRA 1FQJA 1GL9B 4Q00A 2GNOA 2ORVA 721PA 4TYWA 2QRZA 5CB8A 5KU1A 2H16A 3B60A 5FI0B 5TXGA 3P1JA 2VP2A 1G3MA 1KSJA 5HE8A 1VTKA 1KJZA 4Z8XA 1XTQA 4Z54A 1XTKA 2RGNC 4B6EA 4F92B 4RFVA 4FMDB 4F4CA 2ZAMA 3THXA 3LO5A 2OZEA 4P0TA 4XVQA 4KBFA 3U6BA 1CIPA 1S9HA 1Z83A 4M9SA 4JLNA 2GK6A 4ZI3A 1DAFA 2XXAA 3AVVA 3SN6A 3REGA 3BGWA 3QF7A 5KDDA 3TGPA 4A15A 5FTMA 1KDPA 3HYTA 2F3TA 4KBGA 4EFNA 4O25A 2VO1A 2GCNA 4HDCA 2JLVA 1JB1A 2XB2A 5EP3A 2IL1A 2HJVA 1XEFA 3LAWA 2VF7A 3U61B 4CEJA 1XP8A 1MH1A 1O87A 4X8LA 1LNZA 2OFXA 5J40A 2WJGA 4MGZR 3AF3A 3RSOA 5H68A 4ZDKA 2BMEA 4TQAA 1NBMA 2CLSA 5F9FA 1M8PA 1W0KD 4GOXA 4DCUA 1TU4A 1OSNA 3WHKA 4PHTA 4Q01A 3RSLA 4NCKA 3HR8A 2ZR0A 4EPYA 1DAKA 3WYAA 4AYTA 3K0EA 3FWYA 1ZBDA 4M2LA 1IN5A 3CRRA 4JVNA 3AVWA 2R2AA 3HWSA 3B82A 2QN6A 4DLTA 1DARA 2PT7A 4LJAA 4U00A 1DE0A 4HYYA 1MO3A 5FBVB 2IWHA 4ZDJA 1G8GA 4DB4A 3P32A 2FGJA 2CVFA 1KO1A 3HYRA 3PCRB 4JLAA 4UQOA 1OFHA 1Z6XA 2GXUA 3GJXC 3KJGA 4KYIB 4PXAA 2FDCA 1FX0B 1IJFA 1HT1E 1A2KC 2VHUA 4NE2A 2DHRA 2OUKA 2G9NA 2CE7A 4OHVA 5AUNB 1F2UA 3B1XA 3RDPA 5FBQB 1XEXA 2ZJ5A 4B32A 2C78A 1EXMA 2DFNA 3BS4A 2JATA 4LJ4A 5E95A 1TU3A 3QY0A 1SXJE 2BMFA 1RKBA 3EZ9A 3ZH9B 4CZ2A 4U7DA 3QXCA 3RNLA 1X1RA 1Z0IA 3GD7A 3G5UA 4L4UA 2IYRA 1G7RA 4M8NE 3AP1A 4DJTA 5KDOA 3ICQB 1J70A 3NIBA 4M9XA 4BZPA 3D6TB 2R6FA 4Q7MB 5A5GA 1QHHB 1I2DA 2IHBA 1OHHD 4M1KA 1SKQA 2ZETA 2JASA 3LW7A 5JLJA 4GSYA 3C16C 221PA 4L5BA 4PX9A 4LJ5A 4UJ5A 2CHVA 1ZC4A 4M9ZA 1S8FA 1KMHB 4KJZA 4LHZA 3H84A 1U8ZA 4KFUA 2OAQ1 1XXHE 5JSZB 4XD7A 1GRNA 3QF4B 4IKEA 4XJXA 2CBZA 4K8OA 3W5IA 2C2HA 3GJ3A 1IQPA 3AKCA 1M2OB 1NLZA 1E2EA 4HB3A 4G1UC 1YZQA 2GAOA 2MSEB 4IDHA 1E0SA 1DG3A 4UNSA 3KZ1E 1KDTA 1E9CA 5HTKA 1XJ0A 2HYDA 1P73A 4G5OA 1DO2A 3VFDA 3NBFA 1E2LA 5DLQC 3FMOB 1YHNA 2OCPA 1YR9A 3E70C 3QXJA 1QG4A 3BB3A 1E2HA 3LBHA 4LSGA 4BLTA 3KJIA 4DUGA 3B6EA 3S1AA 1HT2E 3U4QA 2ZUDA 3SFVA 2F9LA 1IY0A 2GILA 2ZJ8A 2OAP1 4QHYA 1DVRA 4AC9A 1EX7A 1LF0A 1AGRA 1NSFA 1P5ZB 1VYTA 1EX6A 3C15C 2H92A 5L8VA 1D2MA 2HF8A 2N42A 3EARA 3FYHA 1NY6A 3TBKA 3DKPA 3ZZUA 1G9XA 4MRSA 4UJ3A 3R8CA 1NVUQ 1AZSC 3MCAA 3B8HA 2JEOA 4OQNA 2IF2A 4I81A 5TMPA 2IYWA 4US0R 2ONJA 3RC3A 3GLFA 3WYGA 2J0UA 1P2VA 2QNRA 1COWD 1GILA 3THYA 1D8TA 4BPBA 4A2QA 3AVOA 4IEEA 5JJIA 1XPRA 5BN3A 4FW9A 4Q21A 3K09C 2J3EA 5EE1A 3SDZA 1VPLA 2WZQA 1AIPA 1E2PA 1IOZA 1DEKA 1YRAA 2HLDD 3OIYA 4GI7A 3ZS9A 4BEJA 3T34A 3TQFA 3WXMA 1TF7A 1HYQA 3GEIA 4QJ4A 3MWYW 4CYMA 2W00A 1ESNA 4IRUB 1W5TA 2OG2A 1ZNZA 2C9YA 3NBYC 1EFUA 2PLRA 4K46A 4NZYA 4NMMA 1UM8A 2O8FA 3EAQA 3QPUA 4Q7LA 5EXTA 2EVWX 3EC1A 3DOFA 2F1IA 4IDOA 3U7GA 1VCNA 4AIIA 1ODFA 1NN1A 2IEZA 3MWJA 3L8YA 4Q4AA 3KJEA 3TJZA 2GBLC 5KNDA 3RRMA 2NGRA 2GJKA 1UPTA 1UEJA 2X8AA 1ZM9A 2G88A 4PZYA 3AKDA 4URZR 3AB3A 4A2WA 1NVVR 3A1TA 3R20A 4TQUS 4D4LA 4D80A 4KV9A 1XNJA 1JECA 2A30A 2GJ8A 4URVR 3I5YA 3U5ZB 2DWOA 2AXNA 4JKIA 3K0AA 4ERNA 2YOGA 2F9MA 2ERYA 2GTPA 4BFZA 1G4UR 3WBKA 2ZYUX 1J7KA 1YQTA 2DFKB 2VEDA 4GMDA 2CNWD 4R9UC 2ZUCA 2ZS8A 2GJAA 1FFHA 4O2RA 1DS6A 1I2MA 2JDID 4FMBB 1DO0A 5FPTA 2Y8EA 2NZJA 2HJGA 4C7OA 2C95A 2G1KA 3CNLA 4MGIR 5L3RA 3LQQA 1Q0UA 1US8B 3UWKA 4Q9HA 1TADA 4PPQA 1PJRA 4JLKA 4D26A 1N0UA 2OT3B 2W6JA 1KI3A 2GVZC 1OYWA 2CL7X 3RRYA 3DEFA 2FEMA 4EUNA 4DSOA 1KY2A 2XX3A 121PA 1QF9A 5KPDA 4AI6A 1G8YA 2BCJQ 2GXQA 3VNVA 3D7MA 1IXZA 2RCNA 2C03A 3H0KA 3U3MA 4DIDA 1TNDA 4JL6A 1GKUB 1OFUX 2WWGA 3SU8A 3X1XA 5DHAA 3ICEA 2CHGA 4DVGA 2YWEA 3EZ7A 4RD0A 4QOSA 3NH9A 4CEIA 5C18A 4XIGS 2G83A 1G291 1NLYA 1XBTA 4QJ3A 4UNRA 4BZQA 3K70D 5JJKA 3QNUA 2D06A 2NTYC 2A7QA 4XWKA 2IYVA 3U6KA 4II7A 4EDHA 5FTJA 1N5KA 5E4FA 1Z6AA 3BERA 3VX3A 3TVTA 4OQFA 1GRRA 1E1QA 3SE0A 2IC5A 4NH0A 4S35A 4B74A 2FPLA 1P72A 4BLPA 3WRXC 4MDEA 1PLKA 4HATA 3LXRA 3UG6A 1F48A 4Q19A 5JS8A 2HT1A 3MGCA 4ASUD 1GOTA 3RRZA 2O8CB 2FZ4A 4KVGA 2HV8A 3TK1A 4KITB 4Q4HA 3VR1A 3AF2A 4N0DA 2FWRA 3U3JA 4B3FX 5L3QB 4PAMA 1FMJA 2WSSA 1G6HA 4CVNA 2IXGA 3W6NA 1UFQA 1XRJA 1DAHA 421PA 1M34E 3M6AA 4EQ6A 4OHXA 2ZYTX 4Q9IA 1YZNA 2AK2A 2ASEA 2IS2A 1L4YA 4JBXA 4MYTA 2ZXUA 2ZRHA 1SXJB 1W1WA 2ODEA 4TTPA 4JL5A 3KKPA 2IYZA 1Z06A 2ZANA 1A2BA 1Z6GA 2YINC 4JKYA 3EXAA 2GEVA 5FR1A 1ZNYA 2XTNA 1CRPA 1KI6B 2QMUA 3BK7A 4XOIA 2QORA 2F3RA 4YMWA 3IIKA 3B1ZA 3CPHA 4TL8A 5JJLA 2AKAB 2GETA 1KO5A 5KO2A 5FL7A 2GF9A 1EFRD 4BQSA 1FNMA 1VCIA 1XD2B 2GXSA 1ETUA 4C0AC 4B3GA 4LJ9A 1GWNA 1XF9A 5JCZA 2AXPA 4CF7A 2XTMA 2WWFA 1XXHB 2BHRA 4TSFA 3AF1A 2QBYA 1UKYA 5DSZA 2A5FA 1VCOA 1RRGA 3HPRA 1GNPA 4US2R 2O8DB 4ESHA 1KIMA 1YU9A 1O3YA 2JJ1D 3GLGA 5EZ5A 5B64A 5IF9A 2OSBA 3V9PA 1NN0A 3LLUA 2JJ8A 2QE7D 1OW3B 5ELXA 1T5IA 4AG6A 1E9DA 2G6BA 3DM9B 3I32A 4LHWA 4Q48A 1M7BA 3AP3A 2GCOB 3ZIAD 1AGPA 1FP6A 4TMWA 3VKGA 3C8UA 621PA 3A1SA 2PEZA 3ONWA 2J7KA 2Q3FA 2XZPA 2DWPA 2C77A 3VHXA 2GZDA 1X8LA 3KTAB 4LRWA 2IYUA 2QAGB 4U02A 3W3ZB 2WTUA 4H1UA 3W6PA 3IO3A 2REOA 5C4MA 1U90A 1E3MA 5HCIA 2I1QA 521PA 5TVKA 1XCPA 1E1RD 3L0PA 3NC0C 4AYXA 2J9RA 4JLDA 4HUQB 5E7JA 5CYPA 2H57A 1NIPA 3G82C 1XMIA 5TB5A 1CJVC 1E0KA 2FGKA 1BMFA 1AS0A 2J7PD 4PQFA 4I1SA 2E1RA 1LV7A 4GMXA 1HH4A 821PA 4DT1B 3SS8A 3GLIE 2R6DA 5JEEA 3LV8A 4NCJA 4JLOA 4B2LA 1QHNA 1J8YF 3MJRA 1N3BA 1FUUA 2WJIA 2QPTA 3BOSA 3RHFA 2YNMA 2QT0A 2D7CA 3NHAA 4ON9A 4G5GA 1EWRA 5KHOC 1VG9B 4Q03A 5FR2A 4QGHA 3M4YA 1G4AE 3CX6A 4LPSA 2R6AA 3ZD6A 1P7CA 1G7CA 1W47A 3PEWA 3BAFA 5G41A 3CRW1 1W36D 1VG1A 1N6PA 3HR7A 1YZUA 4C0BA 2W6IA 3VX4A 1GL6A 1QHSA 2KE5A 4PZLA 2IS1A 1S2MA 4WAUA 3RLFA 3THOA 2FPKA 2OM2A 2AR7A 3HDTA 1CU1A 1ZD9A 3BRWD 3P20A 5EXSA 4D0NA 3FTQA 3QSYA 2XGJA 2GF0A 5BWMA 1E0AA 2QRNA 3AVYA 3U3RA 4MDFA 2N46A 1SHZA 4PC6A 2ODNA 1ZUIA 1KJYA 1NIJA 2VP9A 1W4AA 1XB2A 1IJEA 2QMEA 4CRWB 3ZYCA 1SXJD 2WPDD 4ACBA 2ZE7A 1R8QA 4MKGA 3TUZC 3UMRA 1DADA 2UVQA 2UZIR 3W8RA 5AR1A 3TR0A 5EP2A 3UATA 3F0TA 1KSHA 1ZD8A 1L8QA 5CIWA 3B13B 2QPAA 3O47A 2WWHA 5EP4A 2KSQA 2CLCX 1SKYB 2WKRA 4AYWA 4BRWA 1TEVA 1Z0DA 4K81B 3EA0A 1W0JD 1ZW6A 3TRFA 3BFKA 1PLLA 4ACAA 2V8OA 2XNDD 1N6NA 2J41A 5TV2A 5C4GB 1CTQA 1V5WA 2F1HA 1NY5A 2QEQA 2F55A 2QROA 5M04A 2GKSA 3T61A 2R6CA 3GPLA 2GHIA 1SVKA 1RVDA 1KI6A 5FUWA 4PC2A 1OPXA 4PZZA 2WKPA 4OHYA 1XZPA 2ZR9A 1Q20A 2Q9CA 3FMPB 5EUMA 4Q5IA 2FSHA 2YKGA 1S4QA 4WXRA 2IEYA 2NOAA 2JIZD 4WXPA 5HR5A 2FFHA 2JLWA 1CP2A 5FFMA 2X19A 4A4DA 2W0SA 3LD9A 3ZQ6A 4D4MA 4AKGA 2ZS9A 2VSFA 5E7IA 3K9GA 1II8A 1ZM7A 3NKVA 1MABB 4P31A 3PEVA 3IHLA 4PC3A 4LC0A 2VP0A 2ZI7A 3Q3JB 2XSZD 4A2PA 4OQMA 4BGDA 3CH5A 3GCGA 3WNCA 3LBNA 1W5SA 1OXSC 1FW6A 1M7GA 4PAOA 2ATVA 2Q21A 1CRQA 4Z1MA 3TW4A 3ZDQA 2WIAA 3GJ4A 2ZJ2A 1I4DD 5CITA 5HZKA 2EFGA 2K5UA 4M1WA 3B1WA 5J47A 5KSYA 5DH9A 1Z5ZA 2NO0A 3MMPA 1GITA 3CZPA 3KQHA 1FL9A 4F4JA 1LS1A 1HTWA 2WICA 2YV5A 3QG1A 2WHXA 3KB2A 3AV0B 2PBRA 4CT5A 2XTZA 1JNYA 3OAAA 4B6FA 1E4YA 2FF7A 1OXXK 1XWIA 4A92A 3KUCA 3ZQJA 2D7DA 3O8RA 2PMDA 2O8EA 3LH5A 1G16A 4PQYA 2QSZA 3PUZA 3N70A 2LKDA 1N5LA 1R0WA 3ASYA 4M21A 1OH6A 5HE9A 4F91B 2JGNA 4IOJA 2VHJA 3KKQA 3GJ8A 5FOSA 1ZAKA 3OE7D 4HAWA 3ETLA 4PO9A 2PL3A 1T6NA 4QC2A 4UNNA 5JRJA 4JMPA 3U44A 3TSOA 2BM0A 2NZ8A 4MH0R 4DB2A 3W9YA 2Q0HA 1DPFA 2AWNA 1PV4A 1ESMA 2CXXA 4ESVA 4IFBA 3Q5DA 3L82B 4TN1A 4GP6A 2GZAA 2HYIC 2NO9A 2JLQA 2DBYA 4RSGA 3K0SA 5LD2C 1CJKC 2Q9AA 4LJ7A 4BRUA 1JR3E 5EUQB 1KSFX 4TLDA 2W83A 1W2HA 1U0HC 1II9A 5H1YA 1VIYA 5L3VA 4NU0A 2V54A 2MMCA 4NYJQ 4O0MA 1UKVY 2H17A 3CRVA 3IEUA 4Q66C 2HUPA 3MLEA 3IPYA 3QPWA 2IYXA 4JLPA 1Q57A 1R0ZA 4TYYA 4BFWA 1VMAA 4IXMA 3VKHA 3FKSD 5LPNA 1LY1A 2ZRJA 1CR4A 5JHHB 1OF1A 1P9WA 2J1LA 1U99A 2OLJA 1NJGA 2ZRLA 1CJUC 1F2TB 2QTVB 4EFLA 3IIJA 3O8BA 2KWIA 4RD6A 4ILEA 1EK0A 2VP4A 1ZM3A 1VDZA 3DHWC 3IBGA 5EE0A 1EESA 1T9HA 1XJCA 2FE4A 4IDPA 3THWA 2QGZA 2J0SA 3N2IA 3QKRA 1FZQA 3W6OA 3ZGXA 1BYIA 4MRVA 3AVTA 1WXQA 4HZUA 3L43A 1XEWX 4PPFA 3OIUA 4LZZA 1N6HA 4NYMR 2EFCB 5JECA 3JZMA 3U7FB 1NI3A 5DYGA 1RZ3A 1ZYUA 4Z8YA 1M1YE 1E9RA 3CH4B 4US1R 3ZVRA 3T1QA 1VECA 3GLIB 4OI4A 2VSXA 4A8JB 4XSHA 2VP5A 2D3WA 3AUYA 2EW1A 4W5HA 1KI1A 2REBA 1W4BA 1KJWA 3K9LA 1EFTA 4QBIA 2BEKA 3IDQA 2Q3MA 4R2HA 4D81A 1OB5A 4EFMA 1YZLA 4MGKR 5D3MA 3QKTA 2ERXA 1JQLB 1UAAA 3E5HA 4V0NA 1ZJ6A 1KAOA 3BJIC 2WKQA 3RAPR 3I62A 3EZ6A 1KOFA 1PUIA 3DVLA 3NHBA 2Z0MA 3RYTC 5KNCA 1RE0A 1G20E 3GLHA 3TUIC 1N6KA 1SVWA 2FFQA 1P75A 1R2QA 4RCZA 2IXFA 3F8TA 4CEHB 3IQXA 4DLXA 4W9MC 3IIMA 1Y63A 2D2FA 5DHFA 4BFTA 4YONB 1RRCA 2PX3A 1W0KA 4ITRC 3TVDA 4JJZA 4ZCIA 2B8WA 2OE2A 3SQWA 4UXHA 2HT6A 2GESA 4IOLA 3DKVA 3OIVA 4DDVA 3WBJA 1I4LD 3SJBA 3G0HA 2DB3A 1S3GA 2X2EA 4TL9A 4BFUA 3RWMB 3PUVA 2GEDA 1TAGA 3X1DA 4HAYA 2ZTSA 2FA9A 3E1SA 4B47A 4NYJR 5TY0A 2V55B 1XD9A 4QBGB 4MRRA 3W34A 1E69A 1KI4A 3AVPA 4A36A 4TQ9A 3H4MA 5DO9A 1WRBA 4OQLA 5DN6D 1XTSA 1FNNA 1C1YA 3CBQA 3VKWA 3QXSA 4C2TA 3CIOA 1W2GA 4ZCLA 4Q1FA 3RWOA 3ZJYA 5DI3A 5JI2E 2OO7A 2ZQ5A 3DZDA 3AVXA 5JI3E 1TQDA 1B23P 3B85A 5FBWB 2WJJA 3AKEA 3OFND 1WE2A 1KK3A 1XFAA 4CGZA 2KB0A 2Z5FA 2AFHE 2CJWB 2VRWA 3U2QA 3ZVMA 4ZIRB 2IUUA 2F43B 4GFDA 2O8BA 1WF3A 2WMNB 3MRSA 3GMTA 4X8HA 2ZU0C 1NJFA 4Q7JB 4DLVA 2BC9A 5F9HA 1MO6A 1OHHA 4V02A 1Y3AA 3R8FA 4DSNA 2GK7A 1Q44A 2JLSA 2GXAA 1JQJC 1KZ7B 2AL7A 3B9PA 4RZ3A 4EJSA 3K70B 5LBIA 3BH7A 4KFRA 2RHMA 3K0FB 2V1UA 4B3BA 1ZCAA 2IBMA 1OB2A 2QAJA 3L8ZA 2G0TA 4RFSB 2GWHA 5FUYA 1ANKA 2ATXA 4QG7A 2BJWA 1E9AA 1SVSA 3IO5A 5C1BA 4Q4LA 4P4SA 3U3KA 1FUKA 4TZ0A 1XU4A 3ZVNA 4AKHA 4PSKA 2B6HA 4F38A 4TWZA 2IWRA 5FTNA 2QI9C 5GJCA 4EPTA 2PX0A 1EG7A 4IXNA 3PUXA 2PCJA 4ARZB 1G1MA 4G01B 3WP0A 4LYAA 3PXGA 5LB2A 4C0KA 1R5BA 4BUJA 1IN7A 2A5GA 5DE3A 3NWJA 3TKLA 2ZREA 1XTIA 1XTJA 4GZLA 1CKEA 2R8RA 4PSVA 5DNYB 2JA1A 5SZKB 2BVNA 2J0QA 4Q4JB 1D2NA 3IEVA 4HB4A 4TMTA 5AJXA 4OQXA 3R9XA 4LBVA 1CLUA 1T3LA 1M74A 4Q1EA 5TDHA 3BB1A 4MKIA 1RYFA 2ZROA 5F3WB 2AKYA 3A4MA 5EP1A 2XITA 4RZXA 2ZRIA 2WAXA 3DO6A 4V0MA 1FTNA 2QT1A 1H8HD 5FPKA 3I72A 4PR0A 5CLQA 1Q22A 3GQBA 3PUWA 4M53A 3T1VA 3ADCA 3EZ2A 2CVHA 1KNQA 2FEOA 3MUFA 4GBMA 2A9KA 3LVQE 2ORIA 3UXMA 1AQYA 2G0NA 2ZAOA 2G77B 3AQ4A 3SOPA 3RC8A 5FPHA 1COWA 3QXHA 1NVWQ 3A6PC 4TLCA 1SVIA 3LBIA 1L2TA 1Q21A 2F1JA 1DAGA 3SEAA 4B43A 2Z43A 2JLRA 3C7KA 1QRAA 3RANA 2AD1A 3SYKA 4M1MA 2CE2X 4I1OA 1RJ9B 3M1IA 5K8UA 4BE7B 2HLDA 5GADl 4C9BA 4GDFA 4DRZA 3LY5A 2J87A 4Q18A 4B3DA 2E9SA 4TL6A 4AKEA 1UBFA 2OBMA 5FL3A 5BYKA 2XOKD 1WB9A 2WBLC 3BC1A 1DTSA 1MKYA 1Q1ZA 1RIFA 1V43A 2OBNA 1VYUA 1MV5A 3VQTA 3JZAA 3X1YA 1K5DA 3KXKA 1CEEA 2NQ2C 1FX0A 4RJLA 2PMKA 2QENA 3CWZA 3HU2A 3PVSA 4B76A 5KOYA 5E7MA 4DHEA 3K53A 4NHOA 1NF3A 1XTRA 3QOFA 2ZSBA 4XVRA 2XEXA 3CPJB 5AJZA 3KQKA 4OBEA 4URYR 1E2JA 2VHCA 4C0QC 5JWRA 4FCVA 4Q1DA 2OFWA 2IYQA 1Q3TA 3SHWA 1GTVA 3KQLA 3OHMA 1XPUA 2OEPA 3ZVLA 4YMSA 4DSTA 2CNWA 2CK3A 2VHQA 2EFEB 3KFVA 4JL8A 1HE1C 3B1VA 3HPQA 4LDJA 1JJ7A 2WJYA 2LKCA 4N1AA 4TLAA 5FOUA 2DY1A 2JDIA 1GP2A 4ZI2A 3GJ7A 1QHHA 5E3HA 3KFXA 3MJHA 3QVVA 1ONBA 1W4RA 2HF9A 1OIVA 4XVUA 1EWQA 3OEHD 1D2EA 2C96A 3H1TA 2VLIA 5BYJA 2ANCA 3WMGA 2B92A 1EFCA 1J90A 2QP9X 3A1WA 2R65A 1KMHA 4DDWA 5TARA 3CONA 3I92A 1E79D 5JSZA 4HUTA 3QF4A 3VR3A 1CR2A 4HLUA 1N5IA 4DLUA 4NYIQ 3FHCB 2BBSA 2GJ9A 2CCJA 1NBME 3AGQA 3CWQA 3B9QA 4TYQA 3FFAA 2QM7A 1QHGA 1QHIA 2IYTA 2ZRKA 1XZQA 2ZJAA 4G0NA 3VU9B 2C99A 1W36B 2GA8A 3N2EA 1JI0A 1E2FA 3E2IA 4HZIA 1L7VC 2IT1A 1RRPA 2F6RA 4LJ6A 4NCHA 5L3SB 2OLKA 5GVRA 5KSPA 1FTSA 1LVGA 1E2DA 4GPTA 1D6JA 4TTRA 1JEEA 5KDLA 1R10A 2J5XA 3GLHE 3EPJA 4PO8A 3WYFA 3OEED 1CJMA 2YYZA 2P6UA 1R7RA 1D9ZA 5B57C 4M1SA 4FINA 2FMXA 3SYNA 4AK9A 3VR4A 2QMHA 1YVDA 5AUOB 4Q1CA 4UKDA 4ZCMA 2OCAA 1C4OA 1OKKD 1T8UA 2MMGA 5SZHB 1H8ED 4B71A 2Q9BA 1HUQA 4RD1A 4ASUA 4BLOA 5J4YA 5FPSA 5J5CA 2RGBA 4B73A 2R9VA 1Z8FA 4PPGA 2C9CA 2JAQA 1ZU5A 2VBCA 3K9NA 4A82A 4G5QA 1E9BA 5JRZA 1IY2A 2OCBA 2GRJA 3ZZ0A 2BMDA 5CK5A 5H70A 4RD4A 2WWYA 3SBDA 4IOMA 4D4KA 1GVNB 1JR3D 4IOKA 2WAYA 5JMTA 4TYPA 1MOZA 4LYHA 2IX3A 3LX5A 2ZM5A 3NXSA 4WZAE 4C4PA 4IVRA 4KXFB 3U7EB 3K0CA 2FZLA 2ZVPX 1WP9A 3X1ZA 3UKDA 4GL2A 4M1OA 4W5WA 5CJPA 5IK2D 3BWDD 3X2SA 4TYNA 2EU8A 1K8RA 1GKIA 2V1XA 5P21A 2QG6A 3DPUA 1T3SA 2O0HA 5EXPA 3QPVA 1QHXA 3PG5A 1MT0A 3QJYA 4Q9LA 3RS0A 1NL3A 3VAAA 3W5JA 4TLBA 3MWKA 4DLSA 2HXYA 1EFRA 4XH9B 3A37A 1KO8A 3HU3A 5K8IA 3DL0A 2GDJA 3LX8A 1N0WA 3I4LA 1UEIA 2BV3A 2OILA 2ZRNA 3PENA 3WRYC 1OT3A 3CR7A 4JLMA 5IDVA 3EC2A 5A0FA 2QTFA 1G8FA 1JXOA 2JJ1A 4I4LA 1F5NA 4LC1A 2QGNA 4CW7A 3EPLA 1P9RA 2ZI5A 3MG9A 4UNQA 1IN4A 6Q21A 1P3JA 2QE7A 2GCPA 4BWYA 2ODWA 5J4VA 1XMSA 1NSTA 3FFBA 1R0XA 3Q9LA 2BDTA 2H8KA 2AHOA 1NN3A 1VG8A 2PLFA 2HEIA 3BB4A 3ZIAA 4DEYA 5C46F 1US8A 4N0EA 4LBYA 4IVQA 4V0OA 2VL7A 1Q1QA 3A4NA 4GT1A 4DCVA 2W0MA 5G3YA 1PLJA 3WNDA 5AWFC 3Q7PA 2ZI6A 3BH0A 5AUPB 4UXIA 2PH1A 3GLFE 2IS4A 4J0QA 1NP6A 4B33A 1KO7A 2L0XA 1TUIA 2WWWA 4QBFA 4RCYA 4OI0A 1E1RA 3R7WB 3GFTA 3GJ6A 4C0HA 3M0EA 2HCBA 1E32A 1TF2A 2FJUA 4NKRA 4EJSC 4ABYA 4FI3C 2ZE5A 3TIFA 4V03A 1G3UA 2V4ZA 4LV6A 4HSEA 1AZTA 3H2YA 2J7PA 1IXRC 1K6MA 1N6LA 3NBXX 3QKSB 1S1MA 3ZS8A 3EA5A 5EE9A 1P2TA 2BOVA 4X8MA 4KU4A 1GAJA 4JLVA 4B3CA 2IW3A 3D3QA 1X3SA 4MKHA 2VYFA 3IUYA 1UBCA 2QP4A 1BO6A 4NCIA 1QDEA 4YMUA 4WOPA 1GKYA 5G40A 2X2FA 1OH7A 4OHWA 4Q7KA 3RVBA 3CF2A 1G64A 1NKTA 1VHTA 2GAAA 5DGXA 2YJTD 4OJQA 2JJ2D 4M1TA 2O8CA 2P5TB 3A36A 4YXWD 4D0LB 1SQ5A 2Z83A 1PZNA 1E9FA 2VA8A 2DYKA 1ZIOA 2ZSAA 4RVCA 1P9NA 2A5JA 5L3QA 1QVRA 3A1UA 3LW8A 3ND9A 3RS5A 3PITA 3QENA 1IY1A 5CIQA 2OXCA 4LX0A 1E2KA 1TQ4A 2CDNA 3LVRE 4FCTA 4JBWA 5FI1B 3CNNA 2ZJBA 1N0VC 4JBYA 3ZZTA 3BE4A 1J8MF 2JLYA 1SXJA 1AK2A 2WPDA 3ECCA 4C3ZA 1R5OA 3A4LA 5JFGA 1E6CA 3DOEA 4JLJA 3RABA 4PANA 5FUVA 3Q7QA 2CEAA 3CRQA 2YWGA 1SGWA 3THXB 2OV2A 1CXZA 4FWIB 5BXQC 2FSFA 3T12A 2Q3HA 2W58A 4HAVA 4KCGA 2XXAB 3T1OA 4A6PA 2KI5A 3PV0A 4LYJA 1W0JA 3R9WA 1XD2A 3TW8B 3DZ8A 5K8LA 1AA9A 4DBLC 1SVLA 4W5JA 2RAPA 2XNDA 1KI7A 1GSIA 5HKKD 1QBKC 2WOJA 1XXHA 2P6RA 4OKSA 4MUAA 4EPXA 4XWOA 2RGGA 4YDSA 2O8DA 3JVVA 4LJ8A 3TLXA 4AWXA 1P2SA 4URWR 4AY2A 1ZNXA 1TMKA 4P32A 3GEEA 3VTKA 4GRAA 1U0LA 1JR6A 2C9OA 2HCJB 1VCMA 1KZGB 4MYHA 2QP3A 3P26A 4B2PA 1YRBA 3QE0A 4QNRA 2JIZA 1VIAA 4BECA 1Q1BA 2UZ3A 2R62A 3EIHA 2XZLA 1CF4A 2GCOA 2KBFA 2FG5A 1D5CA 3C5CA 3PQCA 3B1YA 1G21E 4JVSB 4TMXA 2XSZA 1T8TA 1A7JA 1GG2A 4KLNA 4TT3D 4BFVA 1KKMA 1OYYA 5AJWA 3LA6A 1VYVA 5FBLB 1ZRHA 2QMOA 3KTAA 2QAGA 1ZIPA 4PTLA 3T35A 2C98A 3UPUA 4XTCS 4TL7A 1AN0A 2CCGA 2IXEA 5JCPA 2QA5A 8OHMA 3KQNA 4KYUA 2A3RA 1X6VA 3SFZA 4IW3B 4MQBA 2YOFA 4OK5A 4HUQA 1F2UB 4WBSA 1XEXB 3CPEA 2OCYC 3FKQA 4U5XA 4E09A 5IRCD 2XZOA 2ZRAA 2QU8A 3U7HB 4HLQB 2NG1A 1GZSA 1LF5A 1DOAA 1W44A 2V6IA 4OYHA 1KAGA 2BJVA 3I5XA 2EQBA 2X77A 4LPKA 4XTRA 4A9AA 4MGYR 4DSUA 1UJ2A 4HLUC 4RD2A 4DT1A 4QNMA 5SZJA 2V7QD 4KODA 3DMDA 4JIMA 1VG0B 3MD0A 3R7WA 1R5NA 2QPOA 2XJ4A 1E94E 3K70C 3IPXA 3OE7A 4JSYA 1RFLA 2PZFA 3CB4A 2C5LA 3IHWA 5EXXA 3J81k 1ZM2A 4B2IA 5BQ5A 3TSZA 3VNUA 4D0GA 1BYUA 2AN9A 2ZE8A 5BW8A 4OL0A 3C4JA 2A78A 3LFUA 5JWHA 1HY3A 1Z2CA 1Z0AA 3PJRA 1KHTA 3GLGE 1KTVA 2RGXA 1AS2A 2ZYWX 3GJ5A 4H1VA 3BBPA 1U9IA 1N6IA 1ZVQA 4WZBE 2I1VB 2NMVA 3FGNA 2FU5C 2VH5R 1AS3A 2QL6A 4OHZA 3NEJA 3S1AB 4DLYA 2DR3A 1VKJA 3U4QB 4A0HA 4HDOB 1QZXA 5B30A 3OIWA 3K1JA 4YDHB 1NG9A 5G3ZA 1PUJA 1JALA 3OF5A 2R44A 1SVOA 4WVFA 3FKSA 2J0VA 1E9SA 4D82A 4ZKDA 5JEDA 2V6JA 1UKZA 2NO1A 2ZITA 4JT4A 1QG2A 3CR8A 5KYKA 1EFHA 3K0CC 2P65A 4E03A 2TMKA 2FPMA 1JEDA 3N5CA 3AP2A 2ZRPA 3WMFA 1N5JA 4LY6A 2O52A 4C0SA 4MITA 2PT5A 2RGDA 4POAA 5AJVB 3GLFB 2J0UB 3WP1B 5JS7A 1F6BA 4PO1A 4RKEA 3THYB 4V0LA 2EYQA 3ZD7A 2CCKA 4I1UA 1E2QA 1X8JA 4KFTA 4B3XA 5A4JA 1NBMD 4QM6A 1JXMA 2BMJA 5CLLA 4TZ6A 2FV8A 2H18A 4NDZA 4PC7A 2ZRMA 1H65A 2OBLA 1W7AA 2ZU6A 1JPNA 1FQKA 3REFA 1GM5A 1S1CA 3KXLA 3VR5A 3BH6A 4IDQA 1MRNA 1DAMA 3WY9A 1N6RA 1P6XA 1Z6TA 3KL4A 1MABA 3EZFA 5JHGB 1E0JA 1GNRA 1ZUNB 2GZHA 5CK4A 4E07A 2BM1A 4MA4A 5FOVA 4UNPA 2O8FB 2BBTA 1IN6A 3ZLJA 4LV5B 4LV8B 1A4RA 5G53C 4LK2A 4Q4AB 2Z6VA 1ZUHA 1WCV1 3CUEF 3IQWA 5AK0A 3CRMA 3I3SR 3T5DA 3RS2A 4IJMA 4N3NA 2P6NA 1Q3HA 1J2JA 3MWLA 5HPYB 2ZJYA 1YZGA 4QFMA 2CL0X 4HAXA 1UDXA 3SHFA 5CJ2A 4M22A 3K0AB 3TE6A 1Z22A 1FOEB 1K5GA 3TMKA 4AD8A 2A5YB 1Z28A 1TPZA 4I99A 1AKEA 2N1BA 2WOOA 1VHLA 2YWFA 4XSGA 1G7TA 1RW4A 1OIXA 2IUSA 1Q12A 3LQRA 5FOWA 3C41J 4B34A 4C7OB 2BCGY 3TH5A 4PSAA 2MSDB 2ZI4A 1SZPA 2IS6A 4QGAA 2V9PA 2KJQA 3TQCA 1NN5A 2I3BA 4QGGA 1E96A 5C2JB 2QQ0A 4PAQA 1G19A 3B78A 1W49A 2G3YA 1E2MA 4HDQB 1JAHA 4P4TA 5IT5A 1GUAA 4Z51A
chains in the Genus database with same CATH superfamily
1DELA 4GLLA 1X0XA 5CB6A 4CT4B 4BB5A 1ZISA 4DKXA 9LDTA 4XD7D 5FO0A 5K8VA 4MUFA 1P7YA 3IDOA 3TZHA 2BIFA 1FRFS 1OZAA 1PE0A 5CAEB 5KVCA 4RH3A 2W22A 5JDIC 4U9HS 4OF4A 4H3HB 2HTEA 1NJSA 1IPHA 4RABA 3MB8A 3OFVA 1X42A 1KH2A 2IIQA 4CEIB 4YRFA 1XN4A 1GGVA 4EPRA 3G2OA 1NVVQ 2YMPA 3PPVA 1QONA 2HX1A 3NRCA 4QECA 3HM2A 2P78A 1FSPA 2P8JA 1G55A 1OVMA 1FYFA 2JHPA 2AN5A 1F0NA 2ZSFA 3G02A 3NVAA 3AU9A 3OX3A 4HX5A 5KYVA 4DNPA 4YP0A 1BH2A 1XAGA 1EGVB 2K4MA 2NTEA 2XMGA 3PR1A 3TUJC 1U0JA 4QLBA 1HDXA 4P2BA 1WUHS 1W93A 4C7XA 5EKDA 4ESEA 3F67A 3FCEA 1XF1A 2XUHA 2R2GA 1X7XA 2BONA 3KNZA 4HY3A 4NFSA 4OJTA 4QFCA 2VDPB 3VAZA 2UKDA 1P8JA 1NHWA 1CS4C 1KGDA 2ZBGA 2VTBB 5IC4A 4G0UA 3L3BA 1AUPA 2WUEA 4QBTA 4HX2A 5L53A 4MW1A 3TAUA 4NOKA 1YIAA 5K0FA 4LFAB 3AJRA 3DW1X 4QAQA 2RHJA 5G0VA 4URXR 3QVSA 2J6CA 1MJGA 2H5EA 1OFTA 2PX8A 3PDIB 1IBSA 3DWFA 4IZIA 4MCHA 3BRSA 4FONA 1Q1EA 4Q05A 2X0RA 1W1UA 3LF2A 4I4TA 5LQDA 4LWZA 1IJBA 1ZH2A 2HMVA 2JZCA 3AIKA 3DV0A 4I5GA 4MVJH 3RCBA 1H2AS 2Z57A 1FA9A 2GEBA 1W29A 3C7TA 1PR3A 3H19A 4CF5A 3FMVA 3R3UA 4EQ6B 3QBTA 2QW1A 4JP5A 1KXZA 2KLHA 3M5CA 3QKUA 3NALA 4KYTA 2NV2B 1NFRA 1TAHA 2PEYA 4CCYB 2QXUA 4M49A 1UR5A 4Q39A 2J32A 3HHPA 4HB2A 2R7LA 5JBQA 1SM4A 1NVKA 2IDMA 4XLLA 3BFXA 1PHPA 4GLFA 5F33A 2W2MA 5E6SB 1HV8A 3E35A 5AKLA 4DUZB 3DXFA 3NKLA 5C4IA 3H11B 4TV9A 4RPHA 4NONA 1C7JA 4WLVA 1A5SB 1KK0A 4HDSB 3BWMA 4J0DA 4LI0A 4R1TA 4WE3A 4H3KB 4WW0A 4DBZA 3NEYA 3LUAA 4FPXA 1E5LA 1YQXA 3EASA 3UB3A 1ACMA 2VNIA 1NFQA 2Z8ZA 3P96A 3RVOA 1IHUA 4LDNA 2FMHA 4N6GA 5ALOA 2F3SA 1IVSA 3F97A 1GPMA 4WACA 3GP8A 4GQAA 1T2UA 4YQFA 1WVIA 5HKAA 2ONKA 5K4AA 5IWAB 3S0JA 3AH8A 2I76A 3C3PA 4RV5A 3EF0A 4OK3A 3E81A 3R0JA 4YXFA 4LUCA 2IU6A 5JVDA 2O5VA 1VI2A 4ND1A 4GDMA 1NMYA 1KBZA 1XZIA 5G0WA 2FZKA 3PHBE 2BFDA 3U39A 4B48A 4YB8A 1P60A 1OTXA 2H1VA 3AJ8A 4JJ8A 2PQ0A 2SHKA 4PG5A 4N12A 4RIFA 1YKSA 1AF4A 1JTFA 2WVJA 4OYRA 1G5PA 5EHGA 1OV4A 1TJNA 4BZXA 2PV0A 1YBHA 4D42A 5L6LB 1EWTA 4EUKA 3IQIX 2RG7A 4DILA 4F93B 2X9LA 1OZ0A 1UP7A 5CTAA 2ODBA 5AQ1A 3PTZA 2GN4A 4ICIA 3HMKA 5TE9A 3VHRA 1JBKA 4BFXA 4AO7A 2J45A 4OAQA 4DCOA 1X86B 2JGAA 3B3AA 3K8OE 4JC4A 5IFKA 1KMIY 3CJRA 2P0EA 3AESB 4W5RA 2OC9A 5DBIA 1X1SA 3X43A 4BNHA 1HO3A 4AKIA 4K8RB 2IVZA 2JFFA 2V97A 3A9UA 2CK3D 3IH5A 3LDAA 1VKOA 4WIAA 2W2QA 2SCUA 2WF7A 3H1EA 1I4TD 4U1RA 3LG2A 2MSWA 1G6OA 4B8WA 4L02A 4A0GA 3EC7A 2O2DA 2MSKA 4G5SA 3KXIA 1KY3A 3ROKA 4QTTB 4ER3A 1XJ5A 3HCBA 1OFUA 3DD5A 4LHVA 4L9WA 4ID9A 1E3WA 4C03A 4WK6A 3F2IA 2VDNB 3OPQA 2GLTA 2Q4BA 2CMKA 7ABPA 1A9ZA 2VTEA 4Y2XA 1KOLA 1T91A 4OIMA 3ZUPA 4CMBA 3A4YA 3CEPB 1U0OC 3VO9A 2Y6UA 4MYCA 4I3HA 2Q4EA 3CSSA 2E49A 5IAJA 2X41A 2VF2A 4YAEA 1HQYE 1UP6A 2OSVA 3RFCA 3HJBA 1K3FA 5A4DA 2WUDA 1GNQA 2YW2A 4P54A 4OI1A 2X13A 5CYOA 4D96A 3IS3A 3JY6A 4G5RA 3COSA 4JLUA 1WCYA 1GA6A 1RHRA 1GQQA 1NBHA 1ZINA 4ZHQF 1DLJA 2J3MA 1RMQA 2P9QA 4D0RA 4LEIA 5IZCC 1U8UA 3OEHA 5F64A 1CUDA 4BC1A 5K20A 1U2DA 3UZUA 1O95C 4PHGA 1NUUA 1VMDA 2R7KA 4XA8A 4V0RA 4YV1A 1J0CA 4QELA 4UUAA 4P82A 4WFKA 1EXVA 2HF7A 3PIIA 5ED0A 3R3SA 4ZT2A 4LVNA 3I52A 4Y9RA 4LF4B 3F5DA 2IYYA 4KMRA 4Q16A 2R6GA 3D9QX 1NW5A 4IJUA 4X9XA 1P5JA 2WSSD 4HNRA 3VPFA 3KYJB 3FHOA 1VSUA 5HZMA 2I4RA 2YV1A 2P5UA 1MZPA 4HVLA 1S8AA 1TI7A 3B2EA 2OYCA 3UQZA 3B1JA 3X3HA 3Q8MA 3BD9A 4OGKA 4IFEA 1R4AA 4RPLA 4BP9A 5CA1A 3JYOA 2GCIA 2R84A 3AR5A 4HLCA 2K7FA 3UAVA 4UTPA 4D6PA 1PU2A 4HLDA 4E2YA 1CEXA 2OV8A 3EXIA 3ZCSA 1H22A 2CL6X 2Q27A 3FUCA 4KYVA 1I2AA 1BAPA 1EJBA 1JJBA 2PH3A 4MRNA 4Q4JA 5KNBA 5J23A 1HZZC 3ZY6A 1BEZA 1RXEA 2GEFA 4IDNA 2OO5A 5DXAA 2AGVA 3E4DA 3ISVA 2PX5A 3LUBA 3QPDA 3ZVKA 4RZSA 1EZ4A 3FIUA 2X1HA 3PGXA 2W48A 4FTWA 3W0LB 3OZSA 4C7MA 2RHRA 4LCBA 5DSTA 4PCAA 5FL7D 4QDTA 2OHFA 4NHEA 1JU4A 1ZJ5A 2I3ZA 1Z0JA 1H8EA 5CXUA 1USVA 3NBAA 1ZA2A 1Y8CA 4BWVA 4N48A 1WZIA 1JJVA 5B58C 4C2UA 2D2EA 4OJNA 4TSFD 3VNQA 2YZKA 1QHYA 3BDAA 1U31A 4YC7A 2FPWA 3SMQA 5JSQA 3SP1A 4A1FA 3CLSC 3V6LA 4F5WA 4QU8A 10MHA 2ZJZA 3B53X 3RFUA 4EG5A 1JQKA 2RKBA 1T1EA 2PG3A 4BN5A 4D8XA 3BXOA 1UDWA 5ALKA 4HWOA 3DOOA 3ZKWA 1JR3A 1F0YA 3D02A 3WB2A 6ADHA 3PEYA 1Q16A 2IUTA 3UIEA 1MO4A 4Q47A 5JXJA 3JVUA 1WDTA 2ZK7A 4H0NA 4CUZA 3K72B 1TTTA 4MIEA 5LDDC 3DFMA 2VPPA 4IHJA 1VLMA 5KYWA 2IOQA 1TXGA 1SBIA 1EFPB 3IKVA 4CM7A 5CB4A 2XRFA 4G1BA 1MV8A 2PHZA 1Z38A 1IM2A 2NU7A 4F12A 5FWNA 4GOOD 4NNOA 2YC2C 1PYOA 2I6TA 5JY6A 4GDFA 4XYBA 2P41A 1KR5A 1P45A 3U40A 3I12A 1A9YA 2JAWA 4EHIA 5LFAA 4TXNA 3II6X 1E98A 1NKSA 5EJGA 5DLEA 2ECPA 5EPOA 5BR1A 4Y1FA 5I51A 5CCBA 2XR1A 4N9WA 2B4KA 2X14A 4C01A 2C04A 3H1BA 5FOXA 1PWHA 3N9IA 3GJ0A 3ML1A 3ORRA 4JB8A 1TL7C 4Q3OA 3PEEA 4HPXB 3NHUA 4WOJA 2QTHA 3KKKA 5REQA 3ONDA 4ZXPA 2B34A 2A1IA 2R6HA 4PEVA 4IGAA 4ZXFA 3GEPA 4V38A 1VP9A 1SNYA 3Q7TA 4IRXA 2XDQB 3RQIA 4FW8A 3SGLA 3VR0A 1ZM4A 5EWMB 3LZCA 1EE9A 1A1SA 3T5GA 1W4ZA 3NZEA 2CZCA 4ZVSA 1KMCA 2CEKA 3GEHA 1AKYA 2IHJA 1YJ5A 1LC3A 3U44B 4WECA 4QYTA 1JMVA 1F8GA 5EPEA 2Z6AA 3S29A 3KG2A 3CUWA 5IF3A 2NZYA 3H17A 3UYLA 2JAHA 3QBVA 4KFSA 2GZSA 5EPUA 1YKFA 1UPBA 3E9YA 3HP4A 4QU0A 1LBSA 1SULA 1N9GA 3QFHA 5BUZA 2IIBA 2GHRA 2I2XB 2XB9A 1Q7TA 2G5CA 2HBYA 3DEKA 2OPBA 4XPIA 1SPXA 4BNDA 4CV1A 4XRGA 1LFDB 5CFQA 1U2GA 2H52A 4OHBA 2ZWOA 3D6NB 4JI3B 3LGAA 5EJEA 4Y6RA 3GJSA 5KQPA 3E3AA 2KQUA 1RYNA 2P40A 4C6HA 1C1XB 1Q7CA 4YJ2B 1P0QA 2QJRA 3NO4A 3OY2A 1RJWA 1Q17A 3AJ9A 2HCFA 1QR2A 2MSCB 4WBXC 3EMBA 3SI7A 3T7IA 5GAJA 5KSOA 4HUJA 1QVAA 5IM4A 2AOVA 1RCTE 4K6FA 5A71A 4F6LA 2VYCA 4BQPA 4BO7A 1KI2A 2BKEA 3WHLA 1DX6A 1ZN9A 2HY7A 5JD4A 2WB2A 1MR3F 4QD3A 2JGKA 2C4NA 3CIFA 2Q5QA 4K40A 4PVDA 5DP1A 4Q37A 2J4DA 1DSSG 1T4BA 1QIEA 1X7HA 2FFAA 2WP8J 4DXAA 1OH5A 1RWVA 3AT1A 2BWJA 4BBPA 1XCMA 4QOJA 1O97D 1XZFA 1QOPB 3WLFA 2XOEA 3OCJA 4DDTA 4QM7A 3M1LA 4RM3A 2DCUA 3FUVA 3FWZA 4Q1BA 5B1IA 3RBAA 1W46A 4H4EA 3W90A 4Z2AA 4UFPA 2GERA 1JHPA 1Y6ZA 4GUAA 2H9AA 1E4EB 5G02A 2O7QA 4K1XA 1BW9B 1T5SA 3IT1A 1IH8A 3EFBA 5A5DA 4HNVA 2FSUA 4RWEA 2AMLA 5C37A 4AUKA 1DT5A 4D2IA 1C3XA 2HSWA 1C1DA 3LP8A 4MPJA 2UZ1A 4XZ3A 1TF5A 3DT8A 3UMSA 3VDMA 4AO6A 3HVJA 3KDSE 4QHTA 2B1QA 5KSZA 1DG1G 3HNRA 1MB9A 1PL6A 4JLSA 2YUIA 1TCVA 4HGNA 1N25A 3X1KA 3QQ5A 4FZ3A 1Z5PA 4JI0B 1XJQA 3QLTA 1VRCA 3I64A 4XI9A 3FGPA 3CJTA 3RW9A 5DP2A 1WU7A 1L7MA 1GZHB 3V7FA 1ZQ9A 1R00A 3LKDA 1I3KA 2BUAA 2FH5B 2WM9B 1Y5NA 3FE2A 1KNXA 1UFVA 2NSJA 3M1YA 1Z07A 1FDVA 4YRKA 5HNKA 1UZMA 3PI7A 4FMCF 3VJRA 4LRUA 5HKBA 4AJHA 3MAAC 2FJPA 5B2ZA 4ETWA 1ACLA 4H1WA 5K6AA 3BDIA 1V1RA 2YWDA 3BF8A 4K9SA 2B99A 3E1GA 5INTA 5GIPE 1NAHA 1UJ4A 4UOQA 4J7XA 4AZTA 4B31A 4KO8A 5ICMA 3ET5A 3FBGA 4FMDF 1GQFA 1UWVA 3QQPA 2ZB7A 4MVYA 5DV9A 2C00A 3EGXA 4G25A 2XQVA 4GNKA 4E5UA 5HKKA 1A7KA 3GOHA 4X60A 2GN9A 1TX4B 3EGWA 1VZ2A 3IAEA 3Q7SA 3AR4A 4NJOA 3ZWQA 1YS7A 1B0PA 3HSSA 1P0FA 4HVAA 3E0XA 1U1DA 4LECA 5EOVA 1J9ZA 4MZXA 3UOGA 2YVLA 3PNBA 4I8XA 4WBNF 1TQ6A 3E3LA 1T15A 2BKUA 2RKOA 4L4RA 1LUAA 3T3HA 1SCNE 1AKUA 1ADGA 3AEKA 4NYMQ 3T3MB 3ANTA 1IC6A 3DC7A 4FE4A 1P2UA 4UM9D 1AUVA 3O2NA 4P33A 4RQBA 4ZGGA 1VM6A 4FMPA 1NBEA 2YYSA 4UE3S 5FAKA 5AHWA 1B8VA 4RMHA 5ICGA 3O8OB 1W94A 3GUZA 3D5QA 2SKEA 1AO3A 5JYCA 2GBLA 3R74A 1YZVA 1AJEA 2QJWA 4MR9B 4GI3A 1P4AA 4J1QA 3BMNB 5DLYA 3C4QA 5AHKA 2AWOA 3AEUB 3EVDA 5CLGA 4YECA 2FQ1A 2FWBA 1BMDA 4M3NA 5FHQA 4DSZA 3AEZA 3BRCA 1LW7A 2P2LA 3I6ZA 4IIJA 4LISA 4LZAA 4O3FA 5K3FB 1IAQA 4TS9A 5UKDA 2C4HA 5TQ2B 2IYAA 3MWFA 1VE5A 1KI9A 2G04A 2H29A 3KBOA 4O4HB 3UAWA 4Q9KA 1ISRA 4WZAB 3UXEA 2C2ZA 4YFYA 2ZTUA 2Z3VA 2VKQA 4EJMA 1QMGA 2B3TA 1S3FA 4MCIA 1IVYA 3T1HB 1YZYA 3GGCA 1MX9A 5ELLA 5JANA 3HJCA 4G5HA 1E9EA 1SURA 1BGWA 3EQZA 4DA4A 4JELA 3A4TA 1K97A 2G07A 3HJRA 1SQGA 4KQIA 2ZCVA 4GX0A 3FMGA 8ADHA 1H6BA 5CVDA 1NF8A 2KYRA 3NIDB 4G3XA 5FH9A 1OX4B 3LK6A 4ZQFA 3N75A 1AHHA 2ZGVA 4TKMA 1KYTA 3QUBA 4DLTA 5HIJA 3DL4A 2O8BB 1DHTA 3EYWA 4S3MA 5JU6A 1BDIA 1RI4A 3L0ZA 5BQ3A 2OZPA 4F5EA 4IZHA 3UK7A 1YFKA 3L0SA 4LJYA 3U1VA 2CBXA 1MA0A 3QW2A 3V97A 4WCFB 4KGZA 3ROEA 3IB3A 1SVMA 3IR6A 4R7GA 2EF0A 2BFCA 3EQ9A 3SQXA 5EMNA 2OHGA 2VS1A 3BA1A 1RM5A 3OQ1A 2IHYA 1YS4A 1IBMB 1X1TA 3MM4A 4CI0B 3K6SA 2WM8A 1YE5A 3BDVA 3WOVA 1ZXBA 4FILA 2P30A 3CU5A 4HN9A 4K6KA 4QLAA 1VFNA 2ZRFA 2CB0A 3PS9A 3W2EA 5KS2A 4D9EA 1MGOA 4FFMA 2GMWA 2REQA 2XRMA 3NOXA 2HDOA 4M9QA 3QI2A 3JQDA 1J21A 4EZEA 2P67A 1KMQA 4C3OB 1DCKA 3MFYA 3OQBA 5AVKA 1QQTA 2EWMA 3BHJA 2XNSA 4Y0VA 2X6QA 4KSBA 3R8XA 3ZWXA 4BASA 4YLYA 1KMMA 4QQ8A 5F3DA 3WRXA 3MOGA 4ZJZA 1GL9B 3SKVA 2E6UX 1VC2A 5CA0B 3SBOA 2I4NA 3ID6C 4O33A 5TXGA 2R85A 1RPAA 1XZAA 2PKYX 3I1JA 5HE8A 1QOQB 3NYRA 4HDKB 1P7VA 2RGNC 1TVKB 5CXXA 3E9CA 4B6EA 3R9XB 1YIOA 2C5GA 2ZAMA 3THXA 1QAMA 2D1RA 4ZYWA 2Y71A 1YHYA 2EJTA 1PQWA 4P0TA 4DMLA 2GK4A 1RM4A 2GHTA 4BEVA 2RGRA 1CIPA 1LLCA 1Z3CA 3DZCA 2C0CA 1ZD3A 3HUEA 4JLNA 1T3TA 4M9SA 1GQYA 4MUKA 4QWWA 5COQA 2XXAA 1FNBA 2JHGA 3REGA 5JE8A 2WHRA 5FTMA 5C81A 1KDPA 3HYTA 4UEOA 3FDFA 5AVWA 1GTRA 3LX4A 1TRHA 3QBJA 5HWSA 2VO1A 1PI3A 1Z34A 3NPMA 4J9UE 2FW7A 4ZAGA 3U19A 3NVMB 4OBBA 3DTVA 2XB2A 1JHVA 1NJ2A 5DWVA 1A8HA 2LIVA 5F7JA 9ABPA 3ODPA 1M2VB 1Q91A 1MH1A 1O87A 1XP8A 3O9VA 1GGFA 1GA1A 1DP4A 4QE3A 1QC5B 5J40A 3LWDA 3H97A 1DHRA 5AW8A 1YACA 3IXQA 4ZYTA 1NBMA 1PT8A 1UPCA 2Z09A 4M9CA 4GI2A 5F9FA 3TM5A 1CRPA 2EBHX 1MEOA 4PHTA 5CB0A 1VBKA 1I9GA 2JFQA 3MILA 2O2JA 3L5OA 4RU1A 5FI5A 3QHPA 4AJPA 4YR9A 3TG2A 5AKZA 1RACA 4G5XA 4CCAA 3AVWA 4WUTA 4GQBA 1A9RA 2A9JA 1NA5A 1Z73A 4GE3A 3Q4GA 2L19A 1YZHA 1D5WA 4ZA2A 4J4TA 4FBGA 1JQAA 2CMHA 1Z12A 2Q4TA 5DLPA 4G26A 2IWHA 3SZLA 3T5CA 4ZDJA 5IULC 4ZT6A 5FPQA 4RXTA 3PCRB 1OFHA 2GXUA 1CUJA 1O94D 3KJGA 5EZSA 4YUVA 3ZE9A 4JR0A 3QGMA 2FMKA 3H83A 2JAXA 1HMPA 4WK2B 2R1UA 1A2KC 2WIJA 3HN2A 2OUKA 3ROPA 5AUNB 1F2UA 3MEQA 3WL3A 4CIXA 3B1XA 5FBQB 1XEXA 1TA4A 2VZ8A 4B32A 5A06A 4IJ5A 3A1DA 5E95A 1G2PA 3AERA 5HKLA 1SXJE 4I8DA 5I8PA 1OU0A 1FY2A 4U7DA 1YRWA 1W0CA 2FMFA 3N7TA 1AN9A 3OHPA 2DOKA 3WL4A 3PZRA 4L4UA 3ICEA 2IYRA 5LXTF 3F74A 2I99A 2RHGB 4FYHA 4F3TA 1YB2A 4WXHA 4BZPA 4CIYA 4XUDA 3MBIA 2W8BB 3D6TB 4QVGA 3I53A 4RW0A 4BQOA 3KALA 4K6HA 4D8VA 4E32A 2IHBA 1CQPA 1L4HA 1ZI8A 3HJAA 3NM6B 4GR9A 3DDZX 3ZX4A 3PF8A 3ZXSA 4MNTA 2ZETA 2JASA 1C9MA 1NDHA 2MYNA 2P3QA 1TCCA 2W11A 221PA 1LJ8A 4G67A 4ID3A 1R9NA 4M98A 5JDCC 3ZHBA 3MWDA 3G8YA 3N8KA 5TGTA 4LRQA 4P9NA 2B2NA 4UJ5A 2Q1UA 3D4NA 1ZC4A 4WDQA 4XAQA 3AL3A 2GNPA 4YRLA 2C7GA 2JK0A 3H84A 2FN9A 4GMHA 4YCJA 5TR9A 1BEUB 5G4KB 1KFCB 3K2QA 4PG8A 2HA3A 2IEGA 2Y1LA 3W5IA 2CBZA 2FZGA 4OBWA 3JV7A 3QMVA 2P9ZA 2PBLA 4RQTA 1M2OB 1E7YA 1ES9A 1N2GA 1NLZA 1T0UA 3MWGA 4DZRA 3DBHB 4G0PA 1DKPA 1F9AA 4UNSA 2AJ8A 3F2VA 4N7RA 4UCWA 1E9CA 5LU8A 2HYDA 4G9GA 3VFDA 2R8EA 3FYSA 5LU9A 2QIOA 1EUCB 3FHJA 1YR9A 4QOEA 4DDKA 2I7VA 2B4AA 4RGYA 1R18A 3K2BA 3U9LA 2CN1A 1LPOA 1OREA 1RSZA 5EI5A 2FN8A 1XYYA 1MA3A 4YROA 1YVPA 2NZXA 3DLHA 2HLHA 2R60A 3WIEA 2F9LA 1AB6A 3I1YA 4NSNA 4DQVA 4Z5XA 4XKJA 2DPGA 4QHYA 4B46A 3OQPA 3ME5A 3S2IA 4AC9A 4ZC8A 1EX7A 1Y4DE 4RX1A 1AGRA 2HPAA 3STXA 5C53B 1ZW1A 5DFAA 5K09A 1EVZA 1V8PA 5L8VA 4WCDA 4XQ0A 2ZAYA 3OJCA 4P98A 1NV9A 3EARA 2E1PA 3P9RA 5A0TA 1U02A 3TBKA 1WAMA 2BKVA 1J42A 1S3IA 2GPAA 1GPUA 3BJZA 3DKPA 4LXXA 5E4YA 3AF5A 5EJ2A 5HEKA 3R8CA 2JFOA 1NVUQ 1AZSC 3KAQA 4OFBA 4Z49A 4YMLA 4FFBA 3VC7A 3IUQA 1I36A 3AI2A 1CWUA 1G66A 3RV3A 3JPWA 3GRCA 1T43A 4OQNA 4P86A 4QUBA 5IVIA 5B1HA 4NV3A 4DCTA 5TMPA 2HCTA 1DAOA 3FI0A 4US0R 2ONJA 1FK8A 4RHFA 3OKPA 4FFNA 1O5OA 2QNRA 1FW8A 1Z5NA 1ZLXA 2W6ZA 3KR9A 2QSJA 4AMYA 6PFKA 4LJRA 1D8TA 1Q77A 3GB9A 4PNZA 3W2FA 4ZYXA 2XUJA 4IEEA 1JSCA 1TYZA 3WYEA 4LXYA 3DZHA 4Q21A 5KQRA 2C2GA 3RBZA 3LC2O 4I4IA 4U6SA 1UK7A 3SDZA 2WIDA 2VJOA 1J2RA 3O9ZA 4E5NA 2VRNA 2C7VA 3D4IA 3ETJA 4MS3A 3V42A 1YRAA 2HLDD 3LY7A 4K9LA 1AQJA 2V5AA 3UFXA 1OMOA 3L79A 2R8XA 4F9GA 4Z4HA 1AVTA 4JYMA 4IAOA 3AX6A 2BGWA 3EBLA 3KEOA 3UUWA 2VVTA 4QJ4A 3GVIA 1X7WB 3Q7RA 1IIRA 4CYMA 1ZVVA 3ZDYB 2ZPUA 4IRUB 2D8AA 2X15A 3NBYC 2PH7A 3R3WA 3I6IA 1EFUA 4IG4A 2BRUA 2IEDA 4M1EA 5IP5A 3M6IA 5LQSA 4XD2A 4WZBB 1RAFA 5EZYF 1Q1GA 4KWHA 3U7GA 3HSKA 1ODFA 1NN1A 2IEZA 3RFFA 3KCQA 3TJZA 4JQZA 3ZU4A 3RRMA 4I19A 2LV8A 2HKIA 2GJKA 2QSUA 1GSHA 1RI3A 1UEJA 2XLBA 2X8AA 2G88A 2A9OA 2QW8A 3AKDA 4R1OA 4URZR 1SWWA 4N0PA 4TQUS 16PKA 2RHTA 1KPIA 3TTYA 2I87A 2Y4OA 1ZJWA 3WSTA 1YNOA 4URVR 1GLVA 2GYUA 4X45A 1UFKA 2DWOA 3U5ZB 4ZANA 2YXPX 3VVMA 1PTJA 1L4GA 2YOGA 2F9MA 2EZ8A 3OTOB 1MX5A 1HI9A 5TF4A 4IDEA 4AIRA 2VEDA 4ZMBA 5C52B 3WQRA 2OYRA 1N36B 4RS3A 4ZZ1A 3OQNA 2JIOA 1SUFA 1I2MA 1V3UA 2QQFA 2VHEA 2X23A 4IJ6A 4NI5A 3ZDFA 2O19A 1M1NA 5FFNA 4G8CA 1JW9B 2C95A 5JCJA 4C7OA 2ECFA 2ZVDA 3LQQA 5GV8A 2D0PB 4P80A 3EY9A 1TADA 1PJRA 2DP4E 4M7PA 1N0UA 1UFOA 2OT3B 1PYDA 3RLIA 5JYDA 2W42A 4L6IA 3LWBA 4GRIA 1AH2A 3KHKA 1KJJA 2GVZC 2HREA 4QA9A 1OYWA 5DW0A 1IDOA 2FEMA 2XRYA 5AVSA 3I6QA 3TZKA 4DSOA 1RKUA 2XX3A 3CVOA 2DT8A 4HWPA 2ZSHA 1M72A 4LYEA 5T4EA 1MF7A 3LXUX 1RVV1 2C03A 3U3MA 3QHQA 4DIDA 4DQ0A 5CAEA 4JL6A 3PC4A 3RHTA 1GKUB 1WUKS 4R4JA 5BSFA 4IVNA 1C1HA 4DA8A 3MN1A 2JBHA 2H48A 5LMZA 4GSKA 1EUYA 1VPDA 1A77A 2X5OA 3CWCA 1EVLA 2WJZB 3N5KA 3B7PA 4XIGS 5C18A 2ZM6B 4CEIA 1G291 1XBTA 2XHZA 1RYZA 2YICA 4FHGA 4NQZA 5IYZF 3T5PA 3K70D 1SC4A 4L57A 3VV3A 1JU9A 2EZ9A 2PQ2A 4GM0A 2D06A 3O4RA 4JR2A 1L5VA 3NNSA 4MYSA 3KE8A 4II7A 2WABA 1Z0SA 2CVOA 2YQZA 2WPNA 4ZVKA 1Z6AA 1X0VA 3ECAA 2EP7A 3VX3A 5JNTA 1EINA 5DGDA 5AM3A 3TLAA 2R8BA 1KU0A 4D7AA 5THKA 1E1QA 3UENA 4C2BA 5CCXA 1L7PA 2IC5A 4S35A 5IT9A 1VL1A 4BLPA 4X24A 3FKJA 3RR2A 1UDAA 2Q6LA 2VTBA 1SUAA 2YJGA 3I6YA 1EK5A 1M6VA 1T4CB 3LXRA 3OWHA 4QPZA 4YQZA 1FNSA 1MJGM 2NXWA 2WT4A 2DHQA 3KR2A 5KI6A 4AUEA 2R7AA 4MW5A 1GOTA 3VAYA 1Q6YA 3PDIA 3AFOA 4BIIA 2F1OA 2RI6A 4WNAB 4HGQA 2VDWB 4AZ0B 3PTAA 1VCHA 2F17A 3X0DA 1FMJA 5AXCA 4B3FX 4CVNA 1F0KA 3C5WP 1XRJA 1KEWA 3L4BC 2BDUA 3LCVB 421PA 4EQ6A 3KVNA 2JW5A 3HBJA 3MCTA 4WFQA 1MAAA 2CUKA 5BSRA 2QG9A 3M6LA 4CCYA 1EDDA 2VCYA 3S4YA 3D2BA 4MV3A 4OFZA 2D1TA 3ZX5A 3EXEB 4F71A 1VL6A 1SXJB 3JQRA 4M89A 3JXEA 3FROA 2CYCA 4WLNA 2NUPB 2IYZA 5KQLA 5IVHA 1Z06A 2ZANA 1VBFA 1B8PA 1VHWA 2EKDA 1R4MB 3H11A 5BV7A 2HN9A 4HDSA 5KYXB 1ZNYA 3KYDB 3KRTA 3Q11A 2QMUA 4QQNA 4XOIA 5JTTA 2GPYA 1TJ4A 4EO9A 5EGNA 1TYEB 2OL4A 4H7DA 2HJWA 2BR3A 2GPTA 2BSQA 1YDEA 2F8LA 2GETA 4BAZA 4HXFB 3VOAA 1UBOS 1B3BA 5CHEA 3WDMA 4B81A 3GLFE 4RPIA 2NU9B 1XD2B 1VCIA 4GBJA 3HK2A 3N76A 3JTMA 1KE2A 2COEA 5L95A 5HOQA 2HA2A 1GWNA 2CW5A 4QDUA 2A35A 4TRJA 3V7YA 4G9BA 3TJRA 4CT5A 3NDJA 5JPCA 1UPFA 2LXNA 3KWFA 4US2R 2A1TR 3MMZA 3QYPA 2O8DB 4RDHA 1KIMA 1YU9A 4K1LA 3R24A 5DNDA 5EAIA 1E62A 1EFAA 5DCUA 5A9TA 2XV1A 4OU5A 2QV0A 4AJEA 4NE9A 2FTKE 4JQYA 2JJ8A 1L4LA 1OW3B 4E12A 1FLVA 1ETHA 2A8YA 5JADA 3PYMA 3ITDA 4QDJA 5HFJA 1ESZA 3KZNA 2PLWA 4LHWA 1AUXA 2JD0A 4Y9SA 4XQEA 1M7BA 4G1CA 5EHZA 4CMGA 2BGGA 3A2LA 3WGGA 4O1MA 3RYCB 3ZIAD 1AGPA 3IT3A 4TMWA 3GDFA 3L01A 1Z5WA 5I6DA 3C8UA 3CT4A 3LNTA 1OFGA 4Y2PA 2WSBA 3ONWA 4JBHA 1MNAA 2Q3FA 3TBHA 2XZPA 2DWPA 2GO1A 5HX7A 1MVOA 3RARA 1GV0A 5ERYA 2QD4A 4EI7A 1Z35A 3HXLA 5IZ4A 3ZHOA 3AESA 4U02A 4IFTA 5DWDA 4OFXA 4H1UA 1GT91 5C4MA 1ND6A 1YJBA 2REOA 3DV2A 1E3MA 3FSGD 3PLNA 2I1QA 3PR2B 4AJKA 4IIHA 3RUHA 3IRVA 4J91A 1E8NA 3CC8A 1XCPA 1NYTA 4YAFA 3VPDA 2R3SA 4KC0A 2HO4A 2HA0A 2PMWB 3DMGA 5ICFA 4N03A 4DPLA 5CYPA 4EK9A 1HDEA 2QR2A 3BGIA 3ES9A 5FT9A 1P1CA 2J3LA 3FYUB 5J2UF 3I04M 2FGKA 1BMFA 4Q12A 1UJNA 2QVXX 2J7PD 4PQFA 4EFDA 4EY4A 1DPGA 1TUGA 1QPZA 3PRHA 2XA2A 3OU7A 3MCWA 2C4UA 1HH4A 4JEMA 4LVCA 3WFZA 1RQ2A 4EMBA 1OWNA 1MQ8B 2OCIA 1GR1A 2ZTMA 3EFEA 3LV8A 3FNHA 4NCJA 1PK9A 4HP8A 5BOVA 5HDQA 1TVCA 3H2ZA 3PICA 2A0FA 4E4RA 2WJIA 2QPTA 4TVBA 1XZEA 3IOMA 5G1NA 5HM8A 1QH1B 4XM1A 4G5GA 1EWRA 3PNKA 3R7BA 4Q03A 3Q0EA 1ULSA 1EVQA 4D3YA 3M4YA 1G4AE 3A4VA 4U2FA 3TL2A 1P7CA 1XN1A 4JZYA 3PEWA 4LCEA 3L0BA 4FOSA 4E1VA 4TYWA 3ZUGA 3BAFA 5EVCA 2G36A 1W36D 5EUBA 4BTVA 2HK8A 2XDYA 5A9SA 3C70A 1GFSA 2UYYA 1FVOA 1NM5C 1HYBA 3ODGA 5KX5F 1S2MA 2E6KA 3GRUA 3RLFA 1JI3A 3RSZA 4KWTA 5JSYA 1DRVA 1T6YA 2OM2A 2AR7A 3HDTA 3P20A 1H3FA 2ZJFA 3BM5A 5EXSA 4D0NA 2XGJA 2QLMA 3UW3A 4RAQA 1TGVA 3ZBPA 3TQTA 4GPZA 3QUQA 2YV4A 3U3RA 1MGPA 4DG5A 5FO1A 4B2YA 3IQDB 4QUIA 5M29A 4MDFA 2BMAA 2R97A 4PC6A 1GT6A 3ZCXA 2FEAA 2QRVB 1JAYA 5AIBA 2O1EA 2QMEA 4DA9A 3ZYCA 1Z56C 1ZS9A 3RJMA 3IP3A 1ZGJA 4UBOA 3UWKA 2CXQA 3H13A 4K6OA 1DBVO 1T9ZA 3M81A 1R8QA 5DNVA 3TUZC 3HXQA 1BNCA 1W52X 3SYTA 4RADA 3ESXA 1BWQA 3UMRA 4B8ZA 3G9QA 2L42A 3JWJA 3N59A 2FPIB 5B3JA 3TR0A 4R2XA 3F0TA 1CFZA 1KSHA 4GUDA 4DNXA 1W88B 2QZ9A 2O6LA 4CKWB 1NTOA 3G6KA 5CIWA 3O47A 1Z16A 3WNVA 2MOKA 3KV3O 1SKYB 2SKDA 4BRWA 4OGWA 1TEVA 1Z0DA 4K81B 2ZJ6A 2ZP1A 4RVOA 1S7GA 1SBYA 3GT4A 2QK4A 3L7BA 1UBRS 5ER6A 1ML3A 1R66A 2H0QA 4ACAA 2EERA 2V8OA 2WHYA 3NTOA 3R0ZA 1SU6A 4HWKA 3EXG2 4WGFA 3UMGA 4KMMA 4MUYA 5FV4A 3K6KA 2QEQA 3OX2A 2F55A 2GKSA 4WL0A 4C6TB 2GHIA 1FSSA 3UTCA 1SVKA 1TZKA 2JJMA 5FUWA 4PC2A 1ARZA 1P2FA 1TIKA 2YV3A 2ZAIA 4A16A 5L45A 4I4TF 4MMZB 3SX2A 1X7YB 2ZYSA 2GASA 3IP1A 5JXWA 3TLYA 3A6ZA 1HLFA 1C9YA 2JIZD 4WXPA 5HR5A 1R50A 4E2ZA 2JLWA 3TO5A 4E2FA 1X92A 5K0LA 3F71A 3LD9A 1NR5A 4PNHA 4JD5A 4KQFA 2JARA 2ZS9A 4QEDA 4EHJA 2CV1A 3P2EA 3NKVA 1MABB 1EFPA 1TW3A 2RFLA 4OSPA 1RQNA 4PC3A 5K3DA 2VP0A 1Z4KA 4UOZA 5AW9A 3FI9A 1YA8A 3CH5A 4B7CA 4KR7A 5DGIA 1N9KA 1RLIA 3GCGA 2BH2A 5IEJA 4BNKA 4OBXA 2YVQA 3ZE1B 4KXVA 5JT1A 5I7SA 4TV9F 3DZFA 5EIHA 2NZVG 2FWMX 3QWIA 4Z1MA 3RYFB 2DFDA 4EB6B 4JGGA 1F3LA 1CNMA 3ZV5A 4FFOA 2ZW9A 5HZKA 2B5WA 2EFGA 5CLIA 3LTNC 4M1WA 1RFGE 5DH9A 2LCQA 3G68A 3WLQA 1XVAA 1BX1A 3LBYA 2X40A 2PMCA 2HA4A 4IJVA 4UCQA 2YN0A 3T54A 2YV5A 2OCXA 3M6WA 2WHXA 5F1KA 3VH2A 3HFGA 2BMWA 3AV0B 2PBRA 4BAGA 1JNYA 4TZTA 2F2TA 2HDWA 3AEYA 4A92A 1XWIA 2H1IA 1Y9JA 5BNTA 3G89A 2Y1FA 5HF6A 4MWDA 2AZMA 4UTNA 3B6IA 5EFOA 3FLMA 4W9NA 4PQYA 3PUZA 4RC9A 3FCXA 2C20A 3IV9A 1N5LA 1D07A 1R0WA 2IW1A 1ORIA 1S01A 2FLWA 3K2IA 4IY1A 2XDQA 3EDRA 1KAHA 4ZYVA 4HAWA 3ETLA 3FFWA 5EWMA 4ZGBA 3VU1A 1T6NA 4QC2A 3E7FA 3OQJA 2NP6A 3P0JA 1E7QA 3U44A 4CCWA 2BM0A 2EJCA 3GO4A 4PWZA 1DPFA 3GPDG <