3HA3A

Crystal structure of hma (mmaa4) from mycobacterium tuberculosis complexed with s-adenosylhomocysteine
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
281
structure length
281
Chain Sequence
IQAHYDVSDDFFALFQDPTRTYSCAYFEPPELTLEEAQYAKVDLNLDKLDLKPGMTLLDIGCGWGTTMRRAVERFDVNVIGLTLSKNQHARCEQVLASIDTNRSRQVLLQGWEDFAEPVDRIVSIEAFEHFGHENYDDFFKRCFNIMPADGRMTVQSSVSYHPYEMAARGKKLSFETARFIKFIVTEIFPGGRLPSTEMMVEHGEKAGFTVPEPLSLRPHYIKTLRIWGDTLQSNKDKAIEVTSEEVYNRYMKYLRGCEHYFTDEMLDCSLVTYLKPGAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords METHOXY MYCOLIC ACID SYNTHASE 4
publication title SADAE, a potent bisubstrate inhibitor of mycobacterium tuberculosis mycolic acid methyltransferases
rcsb
source organism Mycobacterium tuberculosis
total genus 101
structure length 281
sequence length 281
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02353 CMAS Mycolic acid cyclopropane synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ha3A00
3M6UA 3O7WA 1SQGA 4FZVA 3CC8A 2H1RA 3KPYA 1ZHFA 3G2MA 5DWQA 3VYWA 4HG2A 3NW9A 5HIMA 2P41A 4AZSA 4E70A 4IV8A 3FRHA 1FP1D 1JSZA 3UA4A 2IBSA 3FPEA 4M38A 4DCGA 2ZZMA 4MTLA 3NWBA 3SX0A 1NW5A 1KPGA 4NECA 1N2XA 1X1DA 2HV9A 2OZVA 1IM8A 3KPUA 3LDUA 4KIGA 3DMGA 5K09A 2HR1A 3DXZA 3THRA 1NW8A 1JQDA 2LD4A 4RVDA 5HZMA 1SUIA 2YXDA 3FTCA 1RI2A 4CTKA 2ZLBA 1RI3A 2B9EA 4Y2HA 2ZBPA 4PYLA 4L7VA 4YMHA 5K0CA 5CIYA 2PT9A 3S68A 4QVKA 1WZNA 3CVOA 1P39A 5KVAA 2FYTA 3KR0A 1NBHA 3TMAA 4YV2A 2EJTA 3HVHA 1L1EA 1YZ3A 3A7EA 1BOOA 3HA3A 3KR9A 4KWCA 1JTFA 3TPZA 4DQ0A 4RSRA 4BLVA 4DKJA 2ZCJA 5DXAA 5K0NA 4E2YA 5CCXA 5EVJA 1DCTA 3OFJA 2ZIEA 2NXCA 5FQNA 5EMMA 3G2QA 1VP3A 4LWOA 2V74B 2R6ZA 3T7SA 3EVCA 3IYLW 4CKBA 5EEHA 3ID6C 2AR0A 4RTSA 1AF7A 3UJAA 1R74A 4GQBA 4DZRA 1KPHA 1WG8A 3FUTA 3MB5A 3FYCA 5P8WA 1Z3CA 3SSNA 4RTRA 4QVGA 3VSEA 2Z6AA 3DLCA 4FT2A 3HA5A 3PT9A 1EJ6A 3BGDA 2IH4A 4POOA 4PYIA 2ERCA 3UJBA 3BGIA 2BR3A 3EMBA 1JG2A 2ZTHA 3B3GA 5E8JA 5GM2A 1ORHA 1RI4A 3EVGA 5K0LA 3B3JA 2YTZA 2IPXA 4CKCA 5BP7A 5K0GA 3CKKA 5G02A 2C7QA 4GOMD 4F85A 5EC8A 1WXWA 1XVAA 1X1CA 2FPOA 4FP9A 4PGGA 2AN3A 5DM1A 4CTJA 3EEYA 2P8JA 5FA5A 4WXHA 3DXYA 3R0QA 3R24A 3TOSA 2BH2A 5FA8A 4E33A 1FP2A 3CJRA 3DH0A 4CWAA 3KQMA 4LWPA 4OA8A 1BC5A 2G70A 1TPYA 4X63A 4XUEA 4GOND 3FTFA 1ZQ9A 3MHTA 4QDKA 1KIAA 5EMJA 2YR0A 5K0EA 2O06A 5HEKA 4YV1A 4KDCA 2ZBQA 1RJGA 1HNNA 3GRVA 4YUVA 3M6XA 3CJTA 3KR1A 2BZGA 3O4FA 4HSGA 4HGYA 4MWZA 5CUQA 3UJ8A 1XJ5A 2C7RA 3SM3A 2OO3A 5F2NA 4GOLD 5DLYA 1NBIA 1NV8A 4PNEA 3UBTA 1RJEA 3BT7A 2EG5A 1HMYA 5F2OA 3ERCA 4IV0A 5K03A 4QPPA 3C6KA 5EMLA 5FADA 1G55A 3HVJA 2P3LA 2QRVA 3LDGA 1JG3A 3EGVA 2WK1A 5E1DA 3OE4A 3FUUA 4KDRA 3HCEA 5B1SA 3ORHA 1YFLA 5EZSA 1VIDA 3PS9A 3JWJA 2NYUA 2AN4A 1G6Q1 3UJ6A 5JR3A 3I9FA 1XTPA 3M70A 2Q41A 2NXJA 4G56A 2OB2A 3OPNA 4C08A 3AXTA 3NVMB 4KVZA 3FPJA 2P3OA 1D2GA 2VDVE 2YXLA 2XYRA 4OBXA 4PYOA 5LQNA 5FUBA 3TM4A 5LQRA 3KQPA 2XBMA 3KQSA 2HTEA 3PLAE 2FHPA 2I9KA 2Z6UA 3BWBA 2FK7A 3EVFA 3P9IA 3DOUA 2OY0A 1P91A 2PX8A 3E8SA 1KHHA 1NW3A 3LSTA 4AZWA 4RTJA 1ZKDA 5DM4A 1EIZA 2CWWA 2VS1A 3EVAA 3GIWA 5EKXA 1BKYA 4UOEA 1XCJA 5CCBA 1O54A 2NP6A 2I62A 3ELWA 3BZBA 4P7KA 2PLWA 4V0QA 5H02A 5K01A 3P71T 3BXOA 3SSMA 4PONA 2GH1A 8MHTA 1YUBA 2AOTB 3C0KA 3C3PA 5DTQA 5LQAA 5U4XA 3GJYA 2VDUE 5D1NA 3TFWA 1Q0TA 2PXAA 4E2WA 3X0DA 5JUWA 3O31A 4QTUB 3GCZA 4K6MA 3I64A 5FTWA 3BKXA 3ANXA 1F38A 4RTLA 1Y8CA 2O0LA 2ZWVA 3LCVB 5E2AA 3Q7EA 5T64A 3REOA 2YQZA 5HILA 1QYRA 2VP3A 3DUWA 3SGLA 5ICCA 4DCMA 5LQCA 3MTIA 3SSOA 5EEGA 3GU3A 4ATNA 4B17A 2IDJA 4DMGA 2G8NA 2ZZKA 4OA5A 5M5BA 2H11A 1N7JA 1QAOA 1VBFA 1XDSA 3IV6A 4YUYA 1G38A 5BW5A 1EQAA 1O9GA 1X1BA 1KYWA 2XVMA 2ZBRA 3OU7A 5CVJA 4ZTBA 4GOOD 5DM0A 2QE6A 1QAQA 2BM8A 2YVLA 3KQOA 2IH5A 1T43A 4RVFA 5EKUA 4PIMA 1DUSA 1SUSA 2PT6A 3TM5A 5E9JA 1VE3A 1YB2A 3V8VA 2JH8A 1EAMA 4OX9Y 2HWKA 4Z2YA 1L3CA 1XCLA 3BKWA 3KQQA 2VZ9A 5ICEA 1UWVA 3KQTA 3SXJA 5EIWA 3SR4A 4EKGA 4V0RA 4C03A 5LR6A 3E05A 5KS2A 1JG1A 5HOQA 4XCXA 4BY9E 2UYHA 4AX8A 2IFTA 5DSTA 4F86A 3H2BA 2IGTA 3PB3A 3PFHA 2JH9A 3EGEA 2AOUB 3RW9A 4PWYA 3UWPA 5LQKA 3WSTA 2PWYA 2NXEA 5GIOE 2Z6QA 2AOXA 1VP9A 3BWMA 1V39A 4M36A 5CVUA 2IDKA 4C07A 2XYQA 4RV9A 1XDZA 4MQ4A 2ZIFA 2ZSUA 5E1OA 1X19A 2JHAA 2PXXA 4EKIA 3C3YA 3GGDA 5IKMA 5DRYA 5ICFA 5DX8A 4C05A 1R8XA 1XDUA 4PINA 2ZIGA 2QM3A 3K6RA 3P2KA 4EK9A 4C04A 3HM2A 2I6GA 2PGXA 2FK8A 3OZSA 5C1IA 3T7RA 1AQJA 5C0OE 3HVIA 2PSSA 2WA2A 3FZGA 4PGHA 3A25A 2BR5A 2V7EA 3G5LA 3IHTA 3QOXA 5MHTA 5E8RA 2ORED 2P7HA 3ER9A 1RJDA 1SQFA 3HA7A 3M33A 4PYKA 2JJQA 3VC2A 4YUZA 2OKCA 5FHRA 2EX4A 3MCTA 2B78A 3HEMA 2PX5A 2VDWA 5FWDA 3DR5A 3EVZA 1QZZA 3I5UA 1KXZA 3MQ2A 3LGAA 3P2IA 3CJQA 3DMFA 4CXMA 5KQSA 4LECA 4RVGA 1H1DA 2B2CA 3BWYA 1SKMA 1UIRA 1VQ1A 1M0EA 2OB1A 4GUAA 2F8LA 2QY6A 4JXJA 4R05A 3CGGA 4GC5A 2KW5A 3M4XA 5EMKA 1L3IA 2EJUA 2B3TA 3AY0A 3FYDA 3GNLA 3I53A 5DSXA 2P7IA 2AOTA 3B5IA 2XYVA 3FPHA 5FULA 2PX4A 5CD1A 3EEOA 2NNWB 2ADMA 4Y30A 3MTEA 3DLIA 3LL7A 4GEKA 2A14A 2P40A 5EQJB 2UYCA 4HRAA 4GF5A 5LQUA 4E2XA 3ER8A 3GXOA 2OBFA 5FQOA 4MHTA 3KPJA 2P1DA 3K0BA 1WY7A 7MHTA 5E1MA 4PYJA 3IEIA 4H0NA 2ONYA 2O57A 2PV0A 2PY6A 2G71A 1RI5A 3UA3A 3LCUA 4PYMA 3THSA 4BLWA 5LSAA 3I58A 2PBFA 3R6TA 3DMHA 4RTPA 2IBTA 2DPMA 3V97A 5HIKA 2C7PA 2AS0A 2YX1A 1SG9A 4DA4A 3NTVA 5DXJA 1PJZA 1P1BA 5KQRA 3MAGA 3RIEA 5CVDA 3AXSA 3G8BA 4U7TB 3ELYA 5DM2A 4QQNA 3KQWA 5K0BA 1YF3A 3TKAA 3P9CA 4DF3A 5DPMA 3HTXA 1FBNA 4E32A 3R9XB 1JQEA 3DP7A 4X60A 1UFKA 4OBWA 2GPYA 4IKPA 4FGZA 3GDHA 4PYNA 1SVUA 3GRRA 1JR4A 1X1AA 2OPBA 5IH3A 2JHPA 4C4AA 3JWIA 3TRKA 2PWPA 3EPPA 3HCBA 2N47A 1JTEA 1ORIA 3C6MA 5DT2A 2JHCA 5FWAA 1O9HA 5GP1A 2OXTA 4BP1A 3DULA 4FSDA 1B42A 4X1OA 3KPVA 3TLJA 4RVHA 5GINE 3QV2A 1IY9A 3HP7A 5GOZA 2QRVB 1Q0SA 1ZGJA 4BLUA 2NXNA 4RTOA 2BM9A 1R18A 1U2ZA 3HNRA 3PVCA 5E9QA 3G89A 3T7TA 1PRYA 2CL5A 3LHDA 1G60A 3LBFA 2ZZNA 3CBGA 4FS8A 3UZUA 2E5WA 4PCLA 1ZG3A 3RODA 2ZFUA 4YMGA 1EJ0A 4ISCA 2AOUA 3DTNA 1P1CA 3M6WA 2GAFA 5DRTA 4E2ZA 5DTRA 3A27A 2NP7A 3ELUA 3HCCA 4HTFB 3A7DA 2PKWA 3PX2A 3VC1A 2WA1A 5HFJA 3OZTA 5FHQA 2GS9A 4E31A 5BXYA 3NDJA 4E30A 2UYQA 5BW4A 3FTDA 2B25A 2C7OA 3NJRA 2O05A 3G5TA 3LPMA 5EHGA 3E7PA 5KYGA 2AZTA 5T6BA 3MGGA 3PFGA 2P3QA 4PIPA 3OU6A 2AVNA 3NWEA 4C06A 2K4MA 2G72A 2ZW9A 1JQ3A 1NKVA 5DX1A 5HIIA 3P9KA 4OQEA 3B7PA 2QYOA 3A4TA 4ER0A 1YFJA 1VLMA 4P7JA 4R6WA 2YUIA 4X41A 1KPIA 3TQSA 4RTNA 1TW2A 4R8RA 3G2OA 2AOWA 1RJFA 3KQYA 1ZGAA 3LX6A 1NE2A 3MERA 4HC4A 2G1PA 4BP3A 4FR0A 1OR8A 2ZWAA 3ELDA 4OQDA 3KKZA 3G8AA 2JG3A 3OU2A 4DM3A 5EGSA 1MHTA 2ZVJA 4M7RA 2CMHA 3OCJA 2PXCA 4QPNA 3PX3A 3FUVA 2IIPA 2ZULA 3A26A 1L3BA 3D2LA 5LQJA 2ONZA 1JG4A 3LDFA 5C9ZA 2FRXA 1NT2A 3FRIA 3LBYA 3P8ZA 4AUKA 2P35A 3B3FA 1WS6A 5FCDA 1D2CA 5T67A 1I9GA 3KPWA 4KIFA 3FUWA 4ER6A 1I1NA 3HCFA 4A6EA 1QAMA 3JWGA 1FJXA 1AV6A 4MIKA 10MHA 3GWZA 3HCAA 1R6AA 4KW7A 5E2BA 4ER3A 2I7CA 3GRZA 4U7PB 1G8SA 3UFBA 1INLA 4RX1A 1N7IA 2EFJA 4EVIA 3MCZA 4RYLA 3GRUA 2IH2A 2CKDA 3HCDA 1FPQA 3Q87B 5K0FA 4RWZA 5K0JA 4P7GA 4X61A 5D1HA 3NVKI 3GRYA 3OFKA 3P97A 1NW6A 2BR4A 3AWIA 1D2HA 5DTMA 5K8VA 4O29A 1M6YA 4KRGA 3UJ7A 1VPTA 4XUDA 2CMGA 3EVEA 3B89A 5ICGA 3SMQA 1KR5A 3UJDA 2Y1XA 5CVEA 3EMDA 3QOWA 3UJCA 4A6DA 4RTQA 3G7UA 4HGZA 3LKZA 3P2EA 1EG2A 3TKYA 3OZRA 1YZHA 3LECA 4LG1A 4P7FA 3CCFA 2ESRA 2HMYB 4QTTB 4GC9A 3SVZA 3KQVA 4IWNA 5CVVA 3BWCA 2OYRA 4RTMA 5EZQA 3KR2A 4YUXA 1QANA 3G88A 3NDIA 3KU1A 4QQKA 2FCAA 5EIFA 5GWXA 3GO4A 4R6XA 3M6VA 2GB4A 4XUCA 3OE5A 3LKDA 5E1BA 1BHJA 3F4KA 3UJ9A 4RTKA 1R8YA 2XVAA 4FT4A 1F3LA 4PYQA 4P58A 5EHIA 3FUXA 5HIJA 1NW7A 4HH4A 5K05A 1RI1A 2GLUA 5CM2Z 2DULA 2AOVA 3E23A 3ME5A 4GBED 1L9KA 4ER5A 1XXLA 2H00A 3TR6A 3G2PA 5EG5A 3FTEA 2O07A 4PCAA 2GA9A 5EOVA 2IP2A 5E9WA 1AQIA 3FPGA 1VL5A 3T0IA 4R8SA 2Y1WA 3LCCA 4EQZA 5GIPE 5F2KA 4ER7A 2R3SA 3EGIA 4AZTA 1I4WA 5EPEA 1TW3A 1G8AA 3AJDA 3BUSA 3L8DA 3EVDA 4WVLA 3NMUF 1IXKA 1JSXA 3P9NA 4M37A 3FPFA 1NV9A 2AN5A 2UYOA 3KHKA 4HTFA 1R00A 4CKEA 4AZVA 4EMSA 1M6EX 3PTAA 5ERGB 1WXXA 9MHTA 2PJDA 2AVDA 3HVKA 2PX2A 5DX0A 1MJFA 3EVBA 4QDJA 3BGVA 4F84A 4FSXA 1DL5A 1KYZA 3DXXA 3JWHA 3U81A 4YV0A 4YUWA 2UZ4A 2HNKA 3R3HA 2PVCA 5GM1A 1KP9A 2YXEA
chains in the Genus database with same CATH superfamily
3PGLA 3O7WA 1VKRA 4TVOA 4L1KA 1GZ5A 4B2YA 2XE8A 4BFZA 4I3GA 3H4VA 2HPZA 1HI9A 3M3PA 5K7SA 3JQAB 5G1PA 1CY6A 3HCWA 2Q1SA 3EMVA 2V5VA 4WKGA 4IV8A 2BUCA 4KTTE 3WXMA 4B33A 1PQYA 2WU8A 4GAEA 5HF9A 3UAYA 4DMCA 2IBSA 1JKIA 2W22A 4MQEB 4WINA 1IQPA 1H0SA 5CNMA 3IIIA 4J4BA 1NRWA 1QVZA 4HAUA 4RJTA 3RFCA 1NVMB 1IM8A 4B6FA 2CBXA 2KQUA 3IQXA 3LT2A 1G63A 5IJ0A 2AFVA 2GNAA 3MAJA 5AK6A 1FX1A 1SC1A 2EWMA 2ZJZA 4LJ7A 1B73A 1C80A 4K9RA 5BSMA 5HK8A 1RQ2A 1SUIA 2YXDA 5AUQA 4DV0B 1OXMA 1P0FA 3FHCB 4NENB 5FI0B 3CH4B 4Y2HA 4BLTA 4F4FA 2FE1A 1Z2DA 1JT9A 4BRWA 2PNJA 4CIDA 2PT9A 5CIYA 4PPFA 1N2EA 3LU1A 1X38A 1EDZA 1P39A 1WPGA 1E0AA 1F2UA 1MJGM 1XU9A 2CVHA 3HXKA 1WXDA 4UDXX 4BNZA 1JPNA 2GO1A 2V4UA 2YBEA 3O82A 4UBKA 1X14A 1GGVA 5JVDF 2I6XA 1BNCA 2IHTA 4JEUA 4BGDA 4IS3A 3HKDA 3HU5A 3GARA 3ADCA 4WY2A 3L07A 4BVHA 1UBLS 3RTEA 1TOAA 4AIIA 3AEXA 2BM1A 2CLIB 2RK4A 2R8RA 1N2OA 4PHFA 1KEWA 1NJGA 5D5PA 4UMVA 5EJFA 1PE0A 5REQA 3ANNA 5EPUA 4EUNA 3S44A 3U9TA 3ZZTA 4C43A 1U0OC 3WKDA 4QXPA 4GKKB 4JWTA 2IUSA 2XXBA 3SSNA 1AQUA 2CMDA 4C14A 1J8DA 2W37A 3DLCA 1GPWB 4K2HA 2J5KA 3E7XA 4D1YA 2H85A 2HI0A 5BO5A 1I1OA 3OBIA 3EMBA 1S3FA 1QR2A 5DNEA 3UW3A 4DCJA 3KQLA 3NOQA 4GQAA 2OFPA 1E1NA 4N49A 1NIPA 3KBBA 4G1BA 4US1R 2FSPA 3ZHRA 5LFAA 1NM5A 5DM70 2ZJ6A 3SLGA 4EKDA 4F85A 4R1SA 3R5KA 1I0LA 4RK4A 3S40A 4RFVA 1YC5A 5EGNA 5I9LA 1Q1BA 4INZA 4PZZA 4I9NA 4KXNA 4PQGA 2YFQA 2FWBA 4EFMA 2AFIB 5EQDA 5ERXA 2V0NA 2CYBA 3TUIC 1UT5A 3KQMA 2IHUA 2HCJB 3AR2A 4M0FA 1PJAA 3KUDA 5H3CA 4C78A 4L4UA 5KWVA 4OHPA 2KBEA 1ORRA 1T8UA 3GEMA 4YREA 3WNQA 4BO8A 4F6CA 7GPBA 1CNEA 4MCHA 1OBHA 1XALA 4LVCA 1MAUA 1K86A 1FU8A 1U94A 1HE1C 1Z12A 3F5QA 4OREX 3LP6A 1EZ4A 1NQ5A 2MSCB 1T36A 3JQ9C 2X1MA 1MTOA 2ECPA 2PYDA 2WJIA 3OUTA 3PZRA 1OFVA 2QENA 1VLZA 3K0KA 4IVQA 4MS4B 3HQ4O 2XZLA 3B70A 3C1AA 4TWBA 3EXHA 1JQKA 1NBIA 1EINA 1O8CA 4D46A 3FPCA 4D97A 2R6FA 3TZKA 3HP1A 4IV0A 3RG8A 3N2LA 5AM3A 4QT4A 5CB4A 4BQFA 1CZHA 1V1RA 1WHTA 4I4TB 4IRXA 4KBFA 2I2XB 1ISRA 3UHFA 3V8PA 1ZIYA 4MKFA 721PA 1BAPA 1HYQA 3WNDA 4E5PA 1ICEA 4P53A 1H05A 4TN5A 6NULA 2CLOB 5JR3A 3RJTA 1RRMA 4NYMQ 5F73A 1H6CA 1XSEA 3I9FA 1T4CB 2BMFA 1E5DA 4EPTA 4ZZ3A 2CUZA 1PL0A 3P9QA 4PSKA 3OPNA 4YRBA 2X8AA 1UADA 5AM5A 2GM4A 3HXPA 3AETB 4L6AA 4EVQA 1NTOA 3GJ4A 3LMKA 2A67A 2Z3WA 3FF1A 1E64A 3LUKA 1JVSA 1AQNA 3AOGA 3P9IA 2YYAA 1N2CE 4XR9A 2DP4E 1A98A 1T9KA 1O97C 3C3WA 3P45A 1TCUA 1KHHA 1TVKA 2ZYSA 2OYCA 2WY2D 1NW3A 1DO0A 3T41A 3GLIE 2ATCA 1BVRA 4ETWA 3I2IA 4HLUA 1WUJS 3MBIA 4R9NA 1FUYB 4OLBA 3GLTA 1FUEA 4XYLA 3SC6A 4PAOA 1NVXQ 2RGBA 1M8GA 5B6PA 1R3DA 4Z7QB 1TZBA 1KZGB 4TKVB 1MXFA 4WZBB 1YU9A 2J5RA 5BN5B 2Z5FA 3JZDA 4L9RA 5K01A 1P5HA 4MGYR 3VO8A 2HQSA 1BZYA 2ZQ5A 4BASA 5LQAA 1AHNA 3KZXA 5CDTA 1TD1A 2NU8B 4O2AF 9GPBA 1CY7A 1ZXXA 5IAAA 2VN8A 4Z4CA 3EOZA 4RKFA 4DYVA 4EY6A 2CDNA 1GUBA 3OQBA 4AJEA 2OGTA 4JZKA 4AMGA 5B7PA 5JC8A 2OM2A 2IS4A 1J39A 2EEZA 5KKNB 2WPNA 2VJPA 1GVNB 4M8LA 3NHFA 2BE7A 5HBRA 4KMSA 1M2VA 2PX6A 3HHEA 1RU3A 3LOUA 1F9AA 5LDDC 1U3WA 1KRXA 3D54D 1Q1EA 1I8TA 2IDJA 3E35A 4KQXA 2NO0A 3WDSA 1E62A 1Q92A 8GPBA 5M5BA 4HQNA 1EGMB 3SQLA 1QFSA 1E3IA 1QAOA 2ZWOA 5D87A 4DGQA 3DMTA 4EG7A 4F06A 1L4EA 5BW5A 4DXHA 5BR1A 3NU1A 1V0JA 3H18A 4NBKA 4TV9F 1DELA 1UC8A 4ZTBA 4CMHA 3B7GA 2H7VA 3S8MA 4LK3A 2X40A 2RB4A 3N05A 5DULA 2W98A 1VOTA 3RJMA 4KR2A 4MAMA 1Y3DE 4WVFA 2FPIB 4RF3A 4Q1FA 3ZI0A 1JSRA 5KNDH 3T1OA 1KJJA 2BTEA 4HGRA 4TUYB 1GV1A 4PVDA 1K8XB 1VE3A 2V65A 4YV7A 4POAA 4B74A 2Z2JA 3AM5A 4RK0A 3TNJA 1UQRA 2QUJA 3ZG6A 3KVVA 1J25A 1RMYA 3UOGA 2KLBA 4TV8A 1SIBE 1IMOA 1NVBA 1AB5A 3MTAA 1X77A 4HAIA 1XQXA 1GFSA 1WL8A 4EKYA 5KS2A 2Q1WA 3UPDA 4Q0MA 1RAGA 3H1GA 2NZYA 3MTDA 4OJQA 4EG0A 4M8SA 2HPVA 3H2BA 2IGTA 4LZPA 4HGPA 5E38A 5BR4A 2ZCVA 2E5LB 3PFHA 5LYJB 4YJ3B 1UBOS 1X80A 3B5JA 3GN2A 4L76A 4WBSA 3KTFA 3WR5A 4L78A 4CV0A 3V00A 1FDSA 2XECA 3W7VA 4EW3A 1CR2A 3I6BA 5DWDA 4C07A 3IIEA 1SOAA 2XYQA 4NG5A 4B83A 1WXGA 5BSRA 1ZRSA 5E1OA 2HMUA 4FGLA 5EIBD 5B6JA 1QFJA 1ULUA 1XRNA 5BVGB 3N3BC 2VCYA 1BOFA 1GUAA 2C84A 4I6EA 2VSFA 3PDHA 4NU5A 2HUNA 2ODNA 1JKJA 1YS4A 2X1LA 3L7MA 3ZIAD 1RAAA 4B3XA 2EEPA 2ST1A 4U7HA 5LWQA 1R9MA 3HBFA 5G0VA 1DC3A 3HACA 3K4HA 4QPZA 5CCEA 4KG7A 1F2UB 2XGMA 3GFTA 3M6IA 4BC1A 1QQTA 3DUFB 4RTSA 3ZCSA 3VA7A 4Y2RA 2J3LA 3JQFC 2ORED 2FFAA 3DLAA 4WBXC 4MVJF 3RSFA 5C53B 5ALXA 3GFVA 1AIPA 3OF5A 2P78A 2GD0A 3Q7PA 3A4LA 3BA1A 1A9OA 3DWIA 4M8IA 1WJGA 3BZUA 3DR5A 4UEOA 1I5OA 1L5HB 1U1IA 3FMFA 4PW0A 1E6UA 1O87A 3IO3A 4QSHA 1IBLB 3Q7RA 4YT4A 1Y3FE 4N0EA 1VSUA 4L75A 1NJ1A 1QFMA 2EARA 1YZQA 4DCVA 5EJ7A 4JN6B 2XGOA 3N2ZB 3LI2A 3N2EA 3JPWA 1TUEA 4HD8A 4LBYA 5AQ1A 4IDAA 2XW6A 3A6FA 1NMEA 2B61A 1RWBA 1WU8A 4F8YA 1A4UA 1SQ5A 3URMA 3T6KA 5K9ZA 2Q62A 1CR4A 1VIMA 1N75A 4Y30A 4YBRA 4BVAA 2LCIA 4L3OA 1F0NA 3K1YA 1Z0AA 4NDAA 3DE4X 4KLNA 2OBFA 3FM9A 1U3DA 2PUWA 1RAHA 1EEHA 3NM5A 2YOGA 4RXMA 1TZJA 1LK0A 2UUBB 2O57A 1QWOA 1MC1A 4DPMA 1ZMTA 3PJRA 4PNHA 1NAIA 3FWPA 2UDPA 3WGQA 2XDAA 3T3MB 4CMIB 4KIJA 3AINA 5JYEA 5L6LB 1DLJA 4AY5A 2PSDA 2FG7C 3B60A 1RMQA 4LOLA 3CVVA 1RQRA 1EFVB 3T5PA 1TM5E 1F2VA 2QKYA 3C70A 5AM2A 1FSPA 5DYGA 3C4VA 4Z1OA 4RPLA 4WTOA 3HCNA 3FPBA 3KZVA 4HRYA 4LCJA 2Y1LA 4MUJA 3KETA 1JTVA 3CEAA 1JQEA 5A3VA 1MJGA 2H9AA 2WWXA 1JU9A 4LHXA 2JCGA 3VOBA 1O77A 1NHGA 2LBPA 4G9BA 4TMTA 4PZUA 3EXHB 3HCBA 3DZJA 2WFMA 4N1AA 3EPKA 1X8XA 3STWA 4HWGA 4QDUA 3L6UA 1P17A 3GXBA 4M98A 2BGLA 5F2EA 3SKYA 3ZGLA 4CI0B 4M9ZA 5SY9A 3OPXA 1YB6A 1ML4A 3ONNA 4LZNA 1GT6A 3ADKA 4YAEA 4QM7A 1IBMB 2AD1A 2N0SA 1PDVA 2JLYA 2J45A 5H70A 4BNFA 2JK1A 4LYDA 2ZRPA 4NYJR 3O38A 4DIEA 2Q5JA 1EJBA 1A5TA 2ROQA 4LY6A 1W88B 4I0WB 1OGYA 1WAMA 3AF1A 2HX1A 4B6QA 1JIXA 1VGQA 5HGJA 4AKSA 1YKGA 5KWJA 2FSGA 1E8NA 2EFCB 1DEKA 3ZJYA 4V0NA 2UVDA 4J0KA 1NM5C 4FX2A 4B73A 4ZZIA 1ZN7A 3FFTA 1R66A 2AX4A 5JZSA 3SQXA 2PUFA 4CKEB 1VLJA 2DU8A 3A7DA 1T2FA 1T1RA 3PQFA 3TQCA 5EJ9A 5CVTA 4C2BA 4DV7B 1BO6A 2WAXA 4OGFA 2JFBA 1K97A 2WYOA 3PWSA 3NUGA 3QA3E 1XLVA 2E6UX 1RYBA 3FTDA 3H04A 3ZEIA 5FWXA 1H0KA 4YIKA 2Z2KA 1HQKA 3JALA 2EERA 2FFQA 4X7MA 1OLUB 2EJVA 1UJMA 2W90A 4G07A 5G0WA 1DAGA 2DR0A 2WU1A 4MHSA 3TZQA 1KYIA 2REBA 5GVSA 2GBFA 3VZSA 3VYTB 4EL0A 3WTBA 5KNBD 2GF2A 4ZV7A 3PF8A 1H3NA 1G1AA 1UBNA 1YJ5A 3ICCA 3WISA 3G2OA 1JL3A 4PHCA 2DETA 1U0SY 3GLGE 3LGSA 3PX7A 4E46A 1KVTA 2CHUA 2WV7A 2OM6A 3F96A 4CEHB 3EXHC 4PRKA 5GTDA 1BWQA 3A3PA 4XPIB 2ATEA 3F47A 1PYGA 1YKFA 1BMQA 2W2VA 5AW2A 5M7EA 4YJFB 5IBPA 1IY1A 2AXEA 2XHZA 5JSFA 1JDBB 2XUGA 1KHTA 3KAKA 1DAEA 4RY9A 3CZMA 1CG6A 5BRNA 3A1WA 3UNXA 3EDRA 3WHKA 2YXBA 3WYGA 4XUGB 1CUHA 1Q3TA 4NV0A 2O8FB 4MRVA 2WF6A 1LDEA 3VR1A 3VR6D 2RBGA 5ADHA 4EYKA 3NM4A 4TTTS 2H2DA 3HCAA 5CYOA 4A73A 3H1BA 3GRZA 1SPBS 2B3DA 3IE1A 3W1EA 1G8SA 4NULA 1QK3A 3LX5A 4YFYA 4LYHA 3PJGA 3CURA 3NVKI 1CNFA 4MITA 4MV6A 2WDZA 1YDWA 4TGLA 1LBSA 2QVGA 1NVDA 4PFKA 3VZBA 1R0RE 2GARA 3Q0EA 4MWBA 3DKPA 2HNBA 2Q8NA 3GGSA 1U0BB 4FI3C 3SEZA 3Q8MA 1E3DA 1QIDA 2PMDA 3EPRA 4GLOA 4CKBB 2ICAA 4YCAA 3LO5A 2OZKA 3RUCA 4IHQA 4HLUC 4BYMA 1GY8A 4KAAA 1SB8A 5FJIA 3AB7A 3MRTA 4IDCA 2B5WA 3LQ2A 4XGQA 1XEWX 3T38A 1OI7A 2ZYAA 2V6GA 1PQ4A 3B8HA 3MS7A 4GX0A 4LHZA 5EIFA 4E3ZA 4YJ2F 3P2OA 1XNJA 4DDMA 2RGGA 1SPXA 2W8BA 5IYZF 3L4JA 2CMKA 2DF8A 2XVAA 4D9NA 4ENQA 2G3YA 4Q9NA 4MJXA 4DR2B 3IOEA 1NUTA 4ALKA 3ZIAA 3UPTA 3E23A 1E9VA 3EW7A 4YR7A 3MFYA 3GP3A 1WULS 4LZLA 3TZLA 3FTEA 3WK5A 2D0IA 3NUQA 4RA9A 2ZK7A 1XMSA 1Y34E 3A1TA 4JI2B 5BMVF 3EPHA 2EHDA 2QF7A 4EI9A 2OV1A 1QG6A 1NNLA 3EGIA 4OMUA 4Y2GA 4B3CA 2XDQB 1T8TA 5IVKA 3DMTC 2H1IA 4M37A 3U0VA 3U19A 1M67A 1NV9A 3HBMA 2I3BA 4IEFB 1AZWA 2V97A 1DRJA 5A2GA 2UZ1B 2Y1CA 3FH0A 2BFDA 5JSKA 3HM9A 1M2JA 2PX2A 4QEKA 4QDJA 5D3MB 3CA8A 3D4NA 4DY6A 3WFIA 2HYDA 3CRQA 4YT2A 4BFWA 3CF0A 3Q9LA 2B8EA 1E6MA 1PZXA 2O0KA 2VYNA 4K03A 4LJ4A 2W2TA 5CA1F 1KR2A 5C8VA 1JFTA 1V8FA 4PS0A 1IMJA 3KLBA 2LWIA 5DU2A 1FSSA 1Y6RA 2HC9A 3CC8A 5LBUA 5EJ5A 1OB2A 3G23A 5J47A 1BWPA 2HA2A 2MR6A 2BL4A 2PN1A 2QIPA 4A4DA 5BRAA 3ENVA 4I8XA 3BREA 1ETUA 1A76A 4MTLA 4U6QA 1CR1A 5LXTF 1KPGA 1P77A 3QW4B 3VKWA 1Q14A 3HS3A 4CLOA 2G5PA 2RHJA 1UFOA 2XMCA 3KKLA 3OEHA 5HS6A 1OVGA 2J0EA 5HS4A 3U1BA 3L6OO 4P84A 3GEHA 1NPDA 5F98A 2CJXA 4MQFA 5B30A 3THRA 1JQDA 2YQ5A 3QE9Y 4U3JB 2XKKA 3RWBA 2MINB 2QB5A 2CEAA 1RI2A 1X1TA 4KLAA 5JQGB 2PUEA 4MARA 2ID8A 4L7VA 2Y66A 1V37A 2G36A 4UQOA 4C2TA 1J0DA 4XIJA 3EUWA 5DGHA 1R2QA 1NQAO 3EIOA 4ZA2A 4DA0A 1NP3A 3PR2B 3PL5A 4PZLA 2C57A 4N0MA 3RBZA 1YU6A 2D2IA 1Y9EA 1SIWA 5ENVA 4O2LA 1AKRA 3WKAA 4A0FA 2Q6VA 3QELB 4RSRA 4TS9A 2O6LA 1Z16A 2UVPA 1E1LA 1OTHA 3O90A 2V74B 1HLDA 1IEVA 4TQ9A 1MR3F 2Q8PA 3EVCA 1KVUA 3IYLW 1H8HA 4Q3OA 4ZT7A 1ZM7A 1FFAA 1XQ6A 1AUQA 2UUOA 4ENTA 5YASA 3SBDA 4ECEA 1Q0HA 2BJWA 4R7TA 1WG8A 3PRKE 4NOKA 5U1PA 2CLDX 3OQNA 3RPEA 3AM4A 3FUTA 4HX2A 1BVUA 4NCHA 3L6EA 1S6YA 2QUKA 5A0TA 3GPCA 1C1XB 4JHXA 4MO2A 1DBPA 1GWNA 3JAWB 3J7TA 3BRWA 2B1RA 5LN1A 1LVUA 1W5TA 3EVGA 3JQGA 1Y89A 2BELA 2D2EA 2YXNA 2ZBEA 1E9AA 3CKKA 3ABZA 4B0OA 2H1SA 3ZLTA 2WR8A 1S2GA 1JN0A 3I9LA 1G8JA 3KKQA 1WLYA 4CTJA 1ZGBA 4BMSA 3VUFA 1EA7A 4P4UA 2BVNA 1JLHA 3DT9A 3GDFA 1EUDB 1LPMA 1O6FA 3K0CA 4MS1A 1IZ8A 1FTNA 1IUKA 1GOTA 3FDJA 4CM3A 4L57A 3F6RA 1F7UA 2O3UA 1IHXA 5FWXB 4RULA 3ZWXA 3L9XA 4YHHB 4AYXA 1A72A 1PBNA 2A58A 4DJFC 4WNAB 2FZEA 2O06A 4JJAA 4QD3A 3RRZA 1P7PA 1J2RA 4BXOA 1Z5VA 4GE3A 4PO3X 5T57A 2F3SA 3YASA 2DWQA 2PJUA 1XGKA 2GN1A 3AR6A 4FEAA 3OZUA 4TTVA 3RGGA 3UHOA 4DXAA 3JQBA 3D8UA 3DL7A 4DG5A 5AUNB 4Z53A 3AEYA 1Z83A 3JSXA 4HSGA 1X1RA 3PNVA 1AGYA 2DTXA 5LZ2A 2DT8A 1QZ3A 3VR3D 5IF9A 1RJEA 1ES9A 1UZUA 2BEKA 3PP8A 3T52A 5CITA 5AJUA 1K8RA 3VR6A 5HVNA 5EMLA 2E4ZA 1YRYE 2P6NA 4UARA 2FP4A 2ZTUA 4C7OB 1B4DA 5JARA 4YUAA 1FYDA 2WK1A 4RMIA 3ITDA 1V2HE 5B1SA 3IP6A 3BE5A 5GONF 1M34A 1QG4A 4DEXA 3QHAA 1N2CB 2EJWA 1JSCA 3KFXA 1JH8A 3GV0A 1IOVA 4LRSB 4NXMB 4H16A 2AX3A 4HN2A 4CR6A 3CUUA 3FZYA 4TWAA 4D8YA 2X19A 1U0EA 4RKEA 3TR5A 4XVUA 3R0VA 1JJIA 4NICA 4NNPA 3U9LA 3ZVLA 4Q4CA 1L2TA 2LCFA 2ZEJA 2L19A 3B3QA 3EWAA 3LY9A 4BQOA 4AKHA 2WNHA 2DFKB 2XYRA 2Q5QA 3OPYB 1I0ZA 3TLZA 4N76A 2GEFA 3BCUA 5IWAB 1Y4DE 2O2JA 2JC3A 3T4XA 1UXKA 2X9GA 1N5JA 1BS2A 2FPWA 5EYPA 4AZWA 3VH1A 2AZ4A 4AULA 1FVOA 3UHAA 4GXQA 3SPXA 1V6SA 4LJ6A 2J87A 2R1TB 2P1ZA 2V3VA 1CX9B 5EE1A 4GIBA 2GXUA 4EH1A 4KIWA 1EK1A 2RHCA 4J1SA 1LVGA 3P96A 1GRQA 1WPRA 2X3FA 5JI2E 2WRZA 1H2WA 2FEPA 4XX1A 2AOTB 2Z5LA 1Y9JA 2ZSJA 3GAFA 3CEPB 3MQFA 1Y4ZA 2HREA 2I6SA 1FYEA 2GD6A 3KFVA 5ILGA 5MN4A 5ER9A 1G6OA 5E4TA 2DJIA 2F2TA 1EK6A 4YDRA 4EUSA 2C2OA 3IUBA 4PC3A 3NBYC 5J9FA 2UXCB 2YQZA 3BPSA 1KJ9A 3OHMA 2NQ8A 3WC4A 2CV0A 5B4TA 2P2SA 4MUYA 5LKAA 1QTIA 4DDKA 5BWOA 5JWOA 1BH2A 1D6SA 3GN1A 4JMLA 5EEGA 2F43A 3LQFA 3TQIA 2VHWA 4BZXA 4OA5A 2IHVA 1MUUA 3QY0A 4GYJA 3O3CA 4HQ6A 4EQ6A 2VQDA 4I50A 3FDZB 3DR3A 2O8BA 4C6HA 4F2HA 1EGAA 3OWOA 3R3XA 4GOOD 3SHFA 3RVMA 2X5NA 3PJFA 1A8UA 5AYVA 2GD1O 2BMAA 2QTNA 1EWVA 4HYEA 3U3JA 3UGJA 2I6QA 2A9PA 2VNAA 1YOBA 4RNCA 3SF0A 4AUMA 5DHRA 1GQYA 1YB2A 2F59A 2XVZA 1HT3A 1PX0A 1Z36A 1MQ8B 4K9KA 4O2BF 1PJQA 1UJ4A 1XCLA 4B4UA 1F60A 3ESYA 2VZ9A 2B8NA 4DEVA 3A0RB 3E53A 4HMQA 4DY4A 1N6NA 3UKOA 3T5TA 3TL3A 3X44A 1OXXK 1A2KC 2CJYA 5CDFA 4LNAA 3RWOA 4DLSA 4F71A 2QEQA 1XDWA 2XSZD 3NDRA 1ZMBA 3OOWA 1H4SA 4XCXA 5KYWA 1VG8A 1XR3A 1R5JA 2FPGB 3VNAA 4Y1EA 1DG1G 1D4AA 3HC7A 2IXFA 4PPNA 5EIBC 3V8QA 5DOVA 3A9VA 4B3JA 5L7TA 4BB6A 1B6TA 2W83A 5CHYA 1CW2B 4RV4A 2X0KA 4JSYA 1QG2A 4Z9YA 4TMFA 1LSUA 4EA7A 2Y6VA 4RCVA 5ECDA 5EN4A 1VP9A 1PTJA 1XD8A 4F56A 1EM8B 3TYXA 4NV1A 2BP7A 1UQTA 4HSEA 4WT7A 3RLFA 4KKVA 1QV7A 3FSRA 5KJCA 1ZPDA 1C0IA 1NSYA 2P4HX 1KJ8A 1SCNE 3PYLA 4NZOA 3FTQA 3P2KA 1T2AA 1XG5A 3GAAA 4MS3B 1HFWA 3ZIDA 3GEDA 5MN6A 3SHOA 3AIOA 1RJDA 1O03A 4OATA 3IDFA 5F77A 1VHTA 4M1SA 1AGPA 2GCGA 4DADA 2YQ4A 2DQ4A 4YMVA 3PQ8A 1QGED 3OM1A 3L40A 4P0QB 1E1DA 3A2MA 4HX5A 2AR7A 5KQSA 1H1DA 2YVAA 3NJ4A 2WWTA 2IXEA 3OVMA 4BFSA 5I8WA 5ENDA 3FMVA 2QRKA 2WV9A 1H5UA 3H3XA 2QY6A 3FYTA 3VJLA 5EXTA 4F2DA 2OSVA 3MGAA 5GY7A 1I2MA 2RGUA 3T4EA 1IOLA 3ZNPA 2KW5A 3M4XA 5EMKA 4H17A 4MTCA 1OSNA 2AXPA 4C7VA 4MVCA 1JNYA 2DOKA 2NNWB 2WE7A 2ZANA 5BSHA 1MB3A 2HV8A 3DVAA 2P40A 4W5WA 1OWNA 4HNTA 4KREA 2RHMA 2GPWA 3A4YA 1LX7A 1MZVA 3AJRA 2ODBA 4US0R 2H2GA 5FNVF 1WEKA 2RI0A 4RD3A 1BIFA 2W6JD 3OUZA 4ESHA 4PYJA 1GAWA 3IEIA 4OIFA 1EU1A 5M29A 2AQKA 4Q48A 1GNVA 2G71A 2CLCX 3H5LA 2I8CA 3P9XA 4PTZA 4N0DA 4BMCA 4CETA 1B8VA 1N57A 3D7LA 4J03A 3HR7A 3BVPA 1SZPA 4DV1B 3CLSC 2IW3A 1ZESA 1H6BA 3D3WA 4ZI7B 1GPBA 3I42A 4AG3A 3D6TB 4GXRA 5EHXA 5KVCA 5MDHA 2V3WA 2P91A 3SFTA 4DV5B 5A5DA 4W5NA 4HJXA 2ZJAA 3GC6A 1XWFA 4BNYA 4D9FA 3JVDA 5AHWA 5FD8A 5JS1A 1IRXA 5AVYA 4B3TB 3LWNA 4G4GA 1QIFA 3WBKA 5DPMA 3LYHA 3QWHA 2F1HA 2OCPA 1K0UA 2PRJA 4OBWA 2BE9A 3WLOA 3J80A 2CSXA 4CKYA 3OECA 4CLHA 3FYUB 1K7XB 3CVYA 1DKUA 1VDZA 5CG2A 2Q3MA 2KWIA 1ORIA 3FWZA 3IOYA 4CVNA 3GCXA 3VGPA 3CRW1 3E9NA 1UBJS 4LMAA 1XN1A 3U31A 1MAAA 4D4IA 2FP4B 1I14A 2COEA 3RS8A 1U2ZA 4D4KA 2HIHA 2RHWA 3TEJA 1EXDA 1IHYA 3IMCA 1E2UA 3G0GA 4NIMA 2BMWA 1QP7A 5DO9A 3DCNA 1ESEA 1U2SA 3O8QB 1M34B 1W2HA 2CWDA 5THXA 3RRMA 3ZY4A 3C8ZA 1BDHA 2SKCA 4MV3A 4DUPA 4EGQA 2YASA 1PZFA 3K71B 1TTTA 3M6WA 1Q74A 3W77A 4XI9A 3AIMA 3PX2A 4Q93A 5CLLA 1Z2OX 3WWPA 4GECA 3K0CC 2GJ4A 2Z8ZA 3FLBA 4ZOLB 9ATCA 1SVWA 3COPA 4N3NA 1GUZA 2PKEA 4GPEA 2FPKA 4ZCSA 4OB8A 2K7FA 1SKAA 1ESMA 2A5DA 2PS0A 3T54A 1G20A 1MKYA 3NBFA 3MGGA 3QPAA 1QIEA 1ZJ6A 2ZIAA 2ZVDA 1X70A 3WKBA 5HA5A 1YK0A 3G5AA 5JAOA 1OYVA 5SYAA 3GFPA 3JY6A 1D2RA 1BMTA 1QVWA 1UXOA 1JJBA 3I72A 3E3AA 3PR3A 4UVEA 5T8KA 3G49A 2PVSA 3JQBC 3F2IA 2E4UA 3LX6A 1WW2A 2J7PA 4D45A 2ZAYA 2ZE5A 3AZOA 4DAOA 4DM3A 3IMGA 2ERXA 3JU3A 4OLFA 4E5NA 1W5BA 3WTCA 2FDXA 3H11B 3N39C 4I1SA 5EWLB 4BNXA 3D2LA 5FL3A 5BUZA 5BYKA 2RH5A 4G5FA 4UBIA 3MJTA 4K40A 1F1BA 1H2AS 3ZIUA 4B8WA 4E3WA 1VJRA 1DC6A 2EU8A 3GGGA 2ZE7A 3R5JA 4RUKA 5B36A 4NFYA 2RFLA 4N4AA 2F43B 1UPBA 2FOXA 1UDRA 2ECOA 1A9PA 3FYSA 3IJEB 1T3SA 2VDNB 2B4TO 1R6AA 4S3MA 2D8AA 2H5EA 4IFIA 3VVCA 2FN7A 4U7PB 4RJLA 5A05A 1P73A 1MQ9A 2W43A 4K6OA 4YGXB 5TR9A 5JRJA 1SHUX 2CXUA 5KNLA 3EXFA 1I3OA 4I50B 4IJMA 4RKWA 1VMIA 2WJAA 4FUTA 4BPRA 3FCSB 4X64B 2VXYA 1O89A 2CK3D 1T1IA 4FNMA 3VHLB 1UDXA 1FYFA 2XSZA 2CMGA 1J2UA 4G0XA 2ZI3A 3IBGA 4KXVA 5CVEA 3QOWA 3FCEA 3G7UA 3QUSA 3TKYA 3U3RA 2WVHA 4LG1A 3ROTA 3PIIA 1L5OA 3ZDAA 2ZIWB 1LS6A 1VKOA 6Q21A 4FD3A 1CETA 2WZCA 1RWXA 4JI4B 3KU1A 4L3WA 5KSOA 1CJSA 2QUIA 4RY8A 3ZXYA 1UWKA 4LJ5A 1NYTA 1R8YA 4RPJA 3RHSA 1LGYA 1YDHA 4ABYA 4A0GA 3EGDB 3L7NA 4KRXA 3QEMA 4R1QA 5SYNA 4AO6A 3A6ZA 3ZWKA 3D43A 1TZMA 2DULA 2AOVA 4ZYUA 5EA2A 2H51A 2G83A 1KGDA 3CNNA 2X58A 3MWLA 4TS4A 3P4YA 2WYIA 2OCIA 2UV8A 3OTQA 4UAGA 1V6CA 4XPZA 3ZWQA 2IF0A 1THTA 1Y5IA 1L7PA 4DV2B 4GS5A 4J9UE 1JFVA 1N5MA 3NFRA 2IQ5A 1RYZA 5EZ6B 4RLFA 1UR5A 5EJMA 1ZMXA 4LN1A 2H0RA 5KX5A 1T5DX 3BF8A 3HSYA 4R8SA 1W29A 4D0GA 5GIPE 2BJVA 4M3NA 5DMHA 5AHKA 4Y6QA 5DGTA 1T3ZA 3ZCPA 5EPEA 3K8ZA 4H7HA 5FEUA 1P29A 4R5MA 3KKMA 4NXNB 1B3BA 3ZJ4A 4ALNA 3ZDXB 2ZUBA 1ADYA 1RQGA 3NMUF 1RS0A 1ZSYA 2O4CA 3I5MA 2B35A 1YRLA 4GVPA 2VUHB 3QFRA 1A0OA 3NFYA 4Q1CA 4EYOA 4K9QA 4LF4B 3M9LA 3EVBA 1NW4A 1S7GA 4OJNA 3WSVA 4UTXA 3SQWA 1GYQA 5KOJA 1V71A 2GZAA 4GRIA 1IC6A 5JAPA 3AYXB 5C8YA 1BXRA 5KDDA 2J0SA 3ZK7A 1FJHA 4QQ8A 1O9BA 3T9BA 3D5EA 3EFBA 4RDHA 5IJXA 1S3SA 3KVNA 2W6JA 3GPBA 1NLYA 5KPDA 2WJYA 5E6RB 4OL9A 4B4OA 1Y6GA 1VHQA 3OEWA 4OHKA 2HQBA 1UMCA 2HDWA 4M1QA 2PD4A 4PZAA 2LKDA 1NW5A 1WE2A 3B9RA 4Q3AA 2ZDHA 1YQQA 4KN6A 4Y9DA 3RQSA 4FXPA 1BHQ1 1XA3A 5CH3A 3L6CA 1Z5WA 3IIMA 3D3NA 3FG9A 3MPUA 3NBAA 2XYGA 4FC7A 1IY8A 4D4HA 2QBYA 1PTJC 3IB6A 5JDCA 3PGKA 2A1IA 1K75A 1XTUA 3PQ3A 3SJZA 1CZUA 4BJ6A 4FNAA 3X1ZA 2WMOB 4RSMA 2C78A 4MW7A 1P3Y1 3WMGA 5C31A 4BP8A 2Q49A 4G1CA 4MYDA 2ZETA 1P8AA 1C3OA 3IDQA 5TRTA 4IJKA 3D8BA 3WK4A 3VH2A 1NXSA 2WYWA 3NXSA 2NVWA 1Z4IA 1QPBA 2QR5A 3EW9A 2ZAMA 1GZ3A 5BWLA 5T4BA 4CKWA 1CS0B 3LUDA 3HP4A 3RFTA 2B8TA 2CFCA 3B6ZA 2JI7A 3NT2A 5FUQA 3W7AA 1KDPA 1DCTA 2E6KA 5BQFA 3OZEA 4MI1A 3W8RA 3N59A 2XVYA 3Q6IA 1T9HA 4ZAYA 3UW1A 3PXGA 3ZCTA 2VJAA 3GLFB 4ALMA 1D2AA 4CQJA 1YTUA 2JASA 3JTMA 2CXRA 1C9KA 2GOYA 4XFDA 2Q1TA 4DREA 2WTEA 4RV5A 1ZM9A 1TLLA 4V1CI 1EGVB 1XCPA 2A8YA 3AESB 1LZKA 1ZNQO 2OHFA 2WD7B 2GJ8A 3C5WP 3ZU6A 1DKNA 4FT2A 2PUCA 3HA5A 3IBTA 3ENQA 3BGDA 4AMYA 1ZNXA 3A6HA 4POOA 2CB0A 2G67A 3PWKA 1JA1A 1M2WA 3P4UA 3IODA 1TCBA 5JALA 5M04A 4PLPA 4FUQA 3GG2A 3NOOA 4JKYA 4Q15A 2IUUA 1YB4A 1B8OA 1T0BA 1Z5PA 2CFSA 3QP9A 4JC0A 4QXOA 3IERA 1ZRHA 5G02A 4BLOA 4CKCA 4X6XA 5K0GA 2B1QA 3FDFA 2YHUA 4XIGS 1QVAA 2H06A 3GJSA 5KYKA 1HM5A 3PHJA 4J6FA 1VJTA 3MTGA 3OZIA 4P5EA 3VO2A 4XWTA 1DWPA 1TM2A 2FSFA 5ANRB 1E18A 5FA8A 1N34B 2YWRA 4L8FA 5G3YA 1FFCA 4CWAA 1RXCA 5ALMA 2V6BA 2O7QA 3VYSB 2O3JA 4OA8A 4NBWA 3GZNA 3S5UA 4YT8A 4UPVA 5IZCA 3QVSA 1SG6A 2WIJA 4YCSA 2NSJA 2NAPA 3I45A 4OUKX 5K3BA 4K46A 2O7NA 1L7XA 3QIVA 4REQA 4TYQA 3B6IA 2WE8A 2QM0A 2A84A 2BZ0A 2HZ7A 1V96A 4I1YA 2HOQA 5SZKB 3ZY2A 4TVBA 4Q9KA 4X1IA 3M6XA 3OX2A 2P4UA 2FGKA 3RIHA 5JFGA 2BZGA 2JLRA 2C7RA 4TXNA 5A5FA 4IPTA 1PT6A 1TIBA 5KHOC 4OU4A 5CEEA 2Z58A 1VIVA 2H8GA 1KEEA 4P0PB 2DUMA 1T5BA 2ECQA 1OIVA 3L82B 5I3ZA 4JUFA 1UBFA 2EFDB 2NSHA 2Y4NA 1L4KA 1JG3A 3N7UA 4E12A 3HADA 2Q3LA 5EXSA 4NBLA 5JS6A 3BDAA 2X0FA 1NASA 1YBFA 1T6YA 3PA8A 4OJTA 4GLJA 1C7QA 4PZEA 2C8VA 4BKOA 3WQRA 5KINB 2OD7A 4LRQA 4ZAGA 5AVOA 3F7MA 2H92A 3I4FA 5LL6P 3LQKA 3WLFA 2AV6A 3IKVA 4FLEA 3TBHA 3BGSA 3KD3A 3K94A 4HVTA 4CMAA 2Q2WA 3CPJB 1YZNA 4KE7A 1KSJA 1VBKA 3D02A 3W9UA 3ZTYA 4O5OA 2X77A 5L3VA 3FLAA 4IHJF 4BVBA 3LVRE 3EXFB 4WUVA 5GADl 3IRVA 1BRTA 2FV8A 4OXNA 3WADA 1G64A 3I0ZA 3HGMA 2YDYA 3N9IA 3DOUA 4JP3A 3PI7A 2SICE 4Q34A 4Q4JA 3CH5A 4GMGA 4N18A 2VWHA 2OLEA 2Y71A 8LDHA 3MUFA 4G81A 3WL7A 5JSQA 1J8FA 1U8EA 1XO1A 1QYXA 3P4XA 1JBKA 1O54A 4M9CA 4NU8X 3GT7A 4GT1A 2I03A 3BIOA 5AKEA 4YJGA 5DNDA 5C7OO 4GX1A 4V0QA 5T8KC 4LEIA 4R8MA 4P81A 5LQSA 4KFUA 1EX9A 1PK8A 4I55A 5FF9A 1MV8A 4FZJA 1Z22A 2YHSA 3DHNA 3GJYA 3GMTA 2OV2A 2PMFA 3QVGA 4Q4LA 3TFWA 2BFCB 1GCOA 1C9MA 4MQBA 4NYIQ 4QTUB 2D1YA 2YNMD 3QEMB 1X92A 1N7HA 4MYSA 1H5QA 1V1MB 2QUHA 4JLOA 3MIZA 4YRTA 5EUBA 3TI9A 3K1ZA 4FVTA 2ZWVA 1PLLA 1GGKA 1JWLA 5FX2A 1EP2B 1JEDA 4JA0A 4AAYA 1XNHA 2V54A 4DCMA 3GY0A 1JHYA 2L18A 5IF3A 4CNQA 1UJCA 4ATNA 2Q6IA 4XWYA 2QTMA 3CW8X 4J0GA 1IONA 4M1OA 5AW1A 2KJQA 5HM8A 3C39A 3DONA 4KEAA 2OK7A 4L16A 3GP5A 1G7SA 3QVWA 4ESEA 2R86A 4TKUB 1TK2A 3RJZA 2A5LA 3CPSA 1VG0B 3ESBA 4G4JA 4V38A 5AM4A 3AF3A 4EITA 1G38A 3PE6A 3PQCA 4OOEA 1FLVA 3QLJA 3RNLA 1MQSA 2JZNA 3CUTA 3ZCRA 1GTSA 3T9CA 1MVNA 4PX9A 3L7IA 2IH5A 3TZ6A 3A1CA 4FYVA 3TW6A 5EKUA 4AJ1A 3ZJTA 4K7JA 3GT0A 1Q7GA 1UDBA 2HCBA 3ADDA 3KK0A 2R1VB 5IEBA 1N5IA 2FR8A 5KOJB 5ICEA 4YCDA 3EFOB 3ZGYA 1U7HA 2QRJA 5BVHB 1ZA2A 3FFXA 5JOQA 1H9BA 1QO9A 1R88A 1H8ED 2XMZA 4OI2A 4MA5A 4AMBA 2JGDA 3AC0A 5JSHA 3GF4A 1JLSA 1NMYA 2GPNA 4NYMR 2AMFA 3DOHA 4IMJB 4LS3A 1KRWA 2JFHA 2R79A 3PUWA 2W6ID 1TKCA 5DBGA 3PB3A 3WICA 3ZXIA 3H5AA 3DE7X 1SQ6A 1E3EA 1GKIA 1US8B 3MCAA 1LLCA 4OFZA 3BDIA 3DV0A 2PH5A 2IYEA 4V0SA 5EKTA 3R9IA 4FU0A 3RI3A 4QJ3A 4KR7A 4MV4A 3HY4A 4D92A 4D8TA 4G01B 1ADCA 4A8TA 4O4HA 3JVUA 3BSWA 4QJ5A 5A6SB 2H7CA 1GPAA 4MQUA 1IEXA 1YVUA 2BUAA 1UKZA 3V48A 2VSQA 3ZUPA 4KPFC 4BO6A 2YMPA 4D81A 2CXXA 5FBQB 2HHJA 3OF3A 4GOKA 5B37A 2MHCA 5TT1A 4C05A 1K6MA 2VK2A 2Z2ZA 2ZIGA 5TQ2B 2BCEA 3OOHA 4QOHA 3LRXA 4H7KA 2I4NA 4G0ZA 4TWZA 2B7BA 1CRPA 1E4EA 4R1TA 2FZ4A 5C0OE 4ZRMA 5MHTA 2EFEB 5ER6A 2XUAA 1QYIA 2D1FA 4D99A 1EB8A 2HNAA 1U02A 2GEBA 1VE7A 1GTJ1 3M33A 3RIGA 4DQLA 2ZB3A 3R7LA 3P7MA 4URFA 3EF0A 1HDEA 3STVA 3UH0A 1KEPA 3FR8A 3Q3EA 5DTJA 2XGJA 4H2DA 1ETHA 4Y0NA 2QVZX 4FGKA 5HXAA 2AQHA 4QHTA 2CV1A 4Z51A 2IYFA 3EXEB 3CJQA 3OE7D 4JLPA 3WGKA 4ZMSA 4TSRA 4H77A 4P3XA 2NUAA 3BWYA 1UIRA 3QFCA 4F9FA 1Z4QA 3MJFA 1NLUA 2XCQA 4EF6A 3I62A 4L22A 1F0YA 4QUKA 1DTSA 1L3IA 1I3KA 1OOEA 2IE0A 3EOAI 2GK6A 4WEOA 3QPWA 1VL1A 3ZDRA 1IULA 1E69A 4Q1VA 3RHZA 1QO7A 4DM4A 3DLIA 2VJMB 1CY1A 1G9XA 5TQJA 1K5GA 3RK1A 2ODTX 4JKOA 4OH7A 5LB2A 2G04A 4E2XA 3K9GA 4UD6A 5FQOA 4BAUA 5JFOA 1DVRA 2R5NA 5EL0A 5LP1A 4B71A 2BWJA 4L4RA 2NV0A 3NBUA 4MSUA 5JDCC 5KNBH 1Q11A 2IYVA 2J0UA 3PXCX 2DFPA 4X97A 2DR2A 2VFAA 3SDSA 3JCZA 1DHRA 2EFHB 4C5AA 3ZXXA 4L5CA 2VQ3A 2E4AA 4IDDA 1UMKA 4ND4A 4I2VA 4FYPA 4Y7CA 3UN1A 3F6SA 4LJKA 1KYQA 1RM5A 3MILA 3AH8A 2X3YA 3HDYA 1DJOA 4CL2A 3KDPA 3H5IA 3LQ1A 1CR0A 4HAXA 4QQNA 4R1MA 5FUYA 4E07A 4HF7A 5K0BA 3WAJA 3PVSA 1FFSA 4W99A 5DYYA 1F4VA 2Z9DA 4OMDA 3TRIA 2J4FA 2UYGA 1PG2A 3GBSA 1NPTO 3MJDA 3OI7A 4X1IB 4X60A 4BKRA 4PSCA 5IC6A 4C4AA 2XB6A 3VR6H 2C97A 5K4HA 1IWOA 1YFKA 1EBUA 3UB2A 3VSBA 2NX2A 1BS9A 3KJEA 5EZYF 1KEEB 2GZ2A 3EQZA 3ZI4A 4ZJUA 5LPNA 2AIRA 4IDQA 2Q0XA 3OFSA 3PRJA 1EI9A 1K4KA 1QRTA 1B8NA 1L1FA 4D6PA 2DG2A 4IIVA 5ALGA 4ZHQF 2GCNA 3KUXA 4RTOA 1ORWA 4GI5A 2W2QA 2BEWB 1IZ7A 1Q3HA 2CL5A 1FU7A 1EBBA 1J2JA 1KAQA 4MAAA 1NLFA 5BSEA 4AQYB 3M49A 2E5WA 1UBUS 4KVFA 3U7QA 4PCLA 1RLUA 1NC3A 2XH8A 1GDHA 3UWDA 4ZQEA 1QVVA 4MEAA 2QMUA 3ZU4A 4W5HA 2VP9A 1Z75A 2WWIA 1C3EA 3UKDA 3U16A 3QG1A 3GVIA 2JEZA 2VJKA 4V0LA 3QWBA 5KVSA 1Z8HA 1OC2A 4CLRB 2HY7A 2CL6X 3C3AA 2JI8A 2BOVA 1WHSB 3IUJA 4BU1A 1J2YA 5DBOA 1FYXA 3NKVA 5FI3A 3RVPA 1UEXC 5IZCC 1P4RA 2WFLB 5KYGA 2G80A 4H35A 4JQOA 3MPOA 4BCCA 1LSJA 3RKUA 2QT0A 3NWEA 1U0GA 3NVDA 3WZMA 3BH6A 5DX1A 4DJEC 1CEYA 2YNMA 1LWNA 4OJKA 1TU3A 2CLLB 2FUG6 4OHCA 1NE7A 4YJGB 1MDFA 2X6QA 1UPAA 1N3IA 2PCJA 3W3AD 1RQ7A 1ZGAA 2Q9UA 4NABA 5L9AA 2N9UA 4RORA 4UTRA 1ZIXA 3ZH9B 1EVIA 3G8AA 2VP6A 3RAGA 4DA6A 3AVYA 2I55A 2YH2A 4OY3A 2ZSDA 4NK4A 5A3JA 3TIIA 1H2YA 1MC5A 1XWIA 3ETDA 4EKNB 4QPNA 2CZGA 4ZYLA 1VYTA 1KL7A 2IV3A 4AIRA 1PEKE 2BI7A 3VJMA 3F73A 2P35A 2JGFA 2X0JA 3W1WA 4ZQFA 3RQIA 4EYEA 4HDSB 2WG0A 5C1DA 3FTPA 3EXIB 3N7TA 1H4VB 4QO8A 1Z0ZA 5L45A 3MJEA 4C4XA 1JW9B 1KI7A 2A0UA 1TJNA 1XBTA 4S1VA 1FXSA 4Q6WA 3WY9A 2AUNA 3BB3A 2WF9A 4R3UC 2EQBA 4MUNA 3AYZB 4G6ZA 2QU8A 1H2EA 1Y5RA 1HR0B 2MT9A 2WUFA 2ZJOA 2OSBA 1JHZA 4MOWA 4X61A 2CLSA 3N8NA 2CLKB 3OFKA 1YONA 1JQLB 3C7DB 3P97A 1H8EA 3JVVA 4MP8A 1E89A 4GR5A 4OL0A 4WDQA 5NLLA 3TZBA 3UTCA 4E51A 3QX3A 2ZYDA 3QI7A 4WX2B 3T1YB 2D5BA 2ADFA 4HRVA 4U5XA 3M4ZA 3OICA 5JPDA 2Y76A 3ZWMA 2QDKA 4RY2A 4MR7B 2GPJA 4NWIA 3NTXA 1SG0A 3IQHX 1GTG1 3CV3A 2WAMA 3MJHA 4OHZA 3BMOA 3K2IA 4YACA 5HZHA 4CM7A 4DV3B 1GZ6A 2FCAA 1WCXA 1PBTA 4R6XA 1KFJB 2FKNA 2V1UA 5TDHA 3OQMA 4ROSA 2VIIA 3O73A 2XWQA 1E61A 4OKNA 4KODA 5HJ5A 4IIYA 1ISFA 1MCZA 1GLVA 4WESA 4K1LA 3GJZA 4LOIA 4H7DA 4HH4A 2PZMA 2QD3A 2W6NA 3DV0B 1C7FA 4JROA 4M9XA 4RGBA 5AQEA 2CNWD 3UT6A 1JGTA 2JLZA 4GBED 3RU7A 5AW9A 2HSZA 2A5GA 2H0AA 4MGZR 4WNYA 1P2DA 4QFCA 3FNIA 1VYUA 5JMPA 2CJFA 4H0CA 2GA9A 3RS2A 1LTHR 3NOXA 3MSXA 2RBEA 4IJUA 3A05A 4M0MA 4TXMA 1OCEA 5JTUA 4BNGA 1BCRA 4BX3A 3IAFA 1GA1A 2IEZA 2QAJA 3Q3CA 1JFLA 2FN4A 3R7SA 4AMUA 3BTOA 5J4LA 1IXKA 3IXLA 3OE7A 3G9TA 4AYWA 2DFDA 1QHEA 1LVHA 2GBCA 1ZRMA 3NB0A 2YL2A 2B30A 2GUGA 3O1LA 3GG9A 3TK1A 3L8CA 1TLFA 3RR2A 1ODTC 3IP7A 1KQFA 2QT9A 2Y67A 3PE3A 4Z7JA 3NT5A 1W4LA 3HG7A 2HJ9A 2VHXA 3WV5A 1Z5ZA 3Q7IA 3R44A 2H59A 1V7CA 3WRYA 2FR8C 3BMQB 3HJGA 4GWKA 3ZE0B 3AL3A 5I5GA 4HQRA 5DSZA 3X2EA 3N7AA 2NSYA 2OHOA 2DPXA 4H27A 4H3HB 3OJCA 4N3CA 3LC0A 1EZZA 2OFXA 1JA9A 5HCNA 2P41A 3EYWA 3EEBA 1J8VA 3OTIA 1O0BA 3EA0A 2JIOA 4R9RA 2HHCA 2ZZMA 1PKXA 1L5VA 4JJEA 3SX0A 4D6YA 1TJPB 1G5HA 3QH4A 2HSJA 4J1QA 3U2QA 3HYNA 4L8YA 1ECPA 3VR5D 4HDRA 3AK4A 3CLKA 1DQRA 2Q29A 5EUCA 3WJ1A 3OOJA 4CFYA 5HIAA 1FUKA 3JQDA 4JODA 3DE2X 1C9YA 1FP6A 2C4MA 2GAJA 4GDMA 2EAUA 3QUAA 3GUYA 1GQFA 3MT7A 1GGHA 4FCWA 1BWRA 3PPWA 5EE0A 4EY3A 4ZVUA 3ZGOA 2NMVA 3QBTA 1HEUA 1JLKA 2H2FA 2P8SA 4PWZA 3VV2A 5IW8A 4E5KA 1XQWA 2W2LD 3MOIA 3L7JA 4HAZA 3STTA 5DTIA 4U8GA 1Y3CE 5BQXA 2WJ6A 3K8OE 5HZKA 5ALTA 4BLVA 3FIJA 3ZHUA 1U3FA 3FFBA 2DHCA 2VWPA 5CCXA 3UEOA 4XSGA 3JYNA 4FN4A 4LBWA 1V3VA 1XHLA 2RHRA 3UICA 3VBCA 3T7SA 5TIIA 4LWQA 3VOTA 1TRHA 1Y7TA 1QFYA 3IVCA 3IXMA 2AKEA 2HMSA 5I9BA 4ARSA 3U5TA 1P61B 4TVKA 1XZMA 2LIVA 2HK6A 1YI1A 3OT5A 3IP8A 1JAHA 3PC2A 3T5BA 2WUGA 4ILKA 1UFRA 3BFJA 1NXOA 3K9WA 4GMFA 4X45A 5A9SA 9MHTA 2DCUA 1T25A 4CT0A 2XTNA 3QJGA 2ZKLA 3T94A 3B3GA 1G42A 2Q6LA 1ZVVA 3ZQUA 3W79A 1NJ5A 4MGEA 3TTVA 1SOUA 4CLXA 2FPOA 1JHOA 3P26A 4XB6B 5HWSA 2C04A 1CUIA 1KH1A 2C2HA 1NTRA 3TOVA 2BW0A 2ATXA 2IX9A 3GDOA 3AEKA 4MMXB 3RFFA 5AVJA 2JGIA 1VA5A 4HTAA 2P6PA 1Z6PA 4E5DA 3KQKA 3QITA 3K8YA 3B48A 4PHTA 2ZRQA 5IKOA 5B1IA 3RD5A 3W3AA 1OB5A 2FZ5A 2CY0A 4AP9A 4QBFA 4C1NA 2I65A 5INTA 2EGHA 4B85A 3JV7A 4GHWA 1ZNYA 1H2RS 5FO0A 2NU9A 5HEKA 3BTVA 1N5DA 1Z56C 3C7KA 3NNDA 4OQYA 4P2BA 4RHYA 4G0UA 2Z1NA 4CEJA 4YAKA 3O2NA 4AKEA 1P19A 3KB2A 2B8JA 1QF9A 1AV7A 3DB2A 3TMYA 2IW1A 3UJ8A 4IOKA 4E5MA 3JQ7B 3PRYA 2OO3A 4X3OA 2C54A 1E58A 2V45A 4Y6LA 3WQBA 4JYZA 4KQ9A 2J0QA 1RP7A 1QHSA 1HTTA 3DDOA 1CE8A 3JARA 1IBCA 1T6XA 3O5AA 3TL2A 3BOSA 3LUJA 5FADA 3EQ9A 3L6DA 3MYYA 1A7UA 1CP2A 2JGMA 5FPPA 4YQEA 5ELXA 5FEMA 2V58A 1FFDA 2ZWIA 1UZLA 3COWA 3UMYA 4P4LA 3K5PA 3KUKA 4KDRA 1E2GA 1I7LA 1V95A 3JWJA 4D57A 3VDXA 3KHUA 4B6SA 4FWTA 2O50A 1MEOA 1JVBA 2ZM6B 4C7JA 4HGQA 2H7YA 4IMIB 4C4ZA 3FRJA 3O8NA 1MOPA 4ZVSA 5L4LA 2G1UA 5GV7A 1SD1A 1JIUA 4C6SA 4YXFA 1BCSA 2D8MA 3TSWA 5H4GA 1TQHA 1E20A 1K2VN 1ZOIA 3SZRA 3N6RA 1DDGA 3C3MA 1JUDA 4HNAB 4ZZ2A 3WLIA 1W7AA 2PKCA 3ABIA 5B1HA 2VUIB 3THWA 1EIZA 3BMCB 3CIOA 1U63A 3VXKA 3ZS8A 3DDCA 5CYPA 5EKXA 1Q1QA 3KXKA 4WL0A 1GN9A 1RXEA 2YNMC 4U6NA 1CERA 2LKCA 4IOMA 4GM0A 3MLBA 5IDQA 5TGDA 1RRKA 1TJ4A 4N65A 3I73A 3CO0S 2I1QA 3IQGX 1KMHB 3TH5A 2GH1A 3HWX1 3UGQA 4D4GA 8MHTA 1CEQA 1ELOA 1MAHA 4C89A 3W6NA 2IUEA 2I8AA 1E7YA 2ZCUA 2QTCA 1LFAA 4LKRA 4Q5IA 4OG2A 4R31A 4TRJA 4PLTA 2GTPA 5IAGA 5BSUA 4KMOA 1JG7A 4JYPA 4K6MA 1S02A 5FPTA 2MJLA 4Q4HB 4EG3A 3ANXA 2JIRA 1JIIA 1ORVA 2IIBA 2O0LA 3KXPA 3REOA 5C34B 3QVUA 6AT1A 1QJ4A 3ZR4B 3KJZA 1PR6A 4RIIA 3W5AA 1X8KA 1EQ2A 1K6XA 4M55A 5LQCA 3UUWA 2FW6A 2D00A 1Z68A 3U9SA 1U7PA 1O4VA 3EWNA 3I2KA 3Q3GE 1P5FA 3STHA 1OWPA 1B1AA 3J7AC 2VJQA 1LD3A 1CUAA 1USWA 1VE5A 2C94A 1BX3A 1N6KA 1JALA 1PHPA 5BSWA 5TVGA 1B23P 1B6RA 3IV6A 1DBWA 1Z6ZA 4L6IA 2OVBA 1RXWA 2DAPA 3MWEA 4Q4AA 1NSTA 2UYYA 2CFOA 5CD9A 1WEHA 3SLKA 1J2TA 2AMYA 3IUSA 2HA4A 1I5EA 1EFRA 4O08A 3E9RA 4PSAA 3SF8A 1G8KA 1JEJA 1TQDA 3PHCA 3FMOB 2ZYUX 1E2DA 1XJQA 1M0WA 3EEQA 5FTKA 4DMLA 3GOHA 1XRJA 1NMZA 4LHEA 2Y0EA 3DEZA 5JNLA 4QUHA 1QLJA 2XTZA 1XZQA 1NUPA 3A6LA 3KB1A 5H0IA 1GZ4A 3EGXB 3GJ6A 4M6WA 5JWHA 4PC7A 4C0KA 3CZCA 3GA5A 1KVRA 4JLVA 3HB0A 3VR5A 3L84A 4G0QA 3EY9A 4BLPA 3R77A 3EWIA 5AK5A 5IT0A 1YACA 4E11A 3PFIA 2XF2A 4QUBA 1Y5NA 3WBBA 3ABQB 1BG6A 2UYHA 1AA9A 2JFWA 2REOA 4OQ4A 1W5EA 5DSTA 1SELA 4KDFA 4CM4B 4EATA 1BYUA 2R5WA 2GZMA 3KYDA 2AG8A 3FB4A 4ZVKA 4YRQA 5L3SA 3WSTA 1R9JA 2HJSA 4IGFA 2NVUB 2JCYA 2QLJA 2W2LA 4LPKA 2EFYA 1YZFA 2FFBA 4JSRA 5CVUA 1ZGCA 3V3TA 2Z6QA 3MYRA 1BEUB 3PCXA 3GFBA 4IILA 2ZIFA 5TS3A 3S2FA 2YFHA 2B69A 3PXBA 2G1AA 3PU6A 4G4SO 1HDRA 1P2SA 3I39X 1DDOA 3JZAA 4HXFB 3D7SA 5CP8A 2Q3FA 3FPSA 4MK4A 4FK8A 3ML1A 3I05A 2L69A 3PHIA 2ZJFA 4JOCA 1U65A 4XASA 4XSHA 3QVTA 3CLHA 1RABA 4HDKA 5FFNA 3T7RA 3WNCA 2DB3A 4KHPB 2WA2A 4F5YA 4B81A 2OXIA 2WUDA 1HE3A 3KYCB 3NR2A 5C4MA 1WO8A 2JAUA 1KJQA 2JAQA 3AEZA 3DEJA 3GDGA 4Z49A 5JVDA 4AF7A 2JFQA 4EPVA 4OBBA 1UKAA 2W6OA 3T06B 5I5EA 4B3GA 1UT6A 1OU4A 2XCOA 3OX1A 2NSLA 4K9MA 3USES 4BV2A 2H7XA 3K3PA 2H9IA 1XZLA 2EBUA 3FZEA 1E1QD 2GDJA 3GW8A 4JQCA 4UD2A 1TD9A 2WMDA 3WIVA 3WRYC 4JOQA 1YC2A 1UWLA 3B9QA 1S89A 3H2YA 5JXIA 1E7RA 3B2NA 2YY7A 1W75A 2B6NA 3H5NA 3F3MA 3GHHA 2BKUA 2BGJA 1JDPA 1THZA 1MD9A 4MVJD 4QNRA 5IJ9A 1E94E 2XADA 2ABWA 3ZWPA 4FTWA 3GNLA 4FMBB 4KO2S 1BJKA 4MYUA 5ALZA 1P33A 1TKBA 3MTEA 5ED4A 4WOKA 2BFPA 3VR2D 1PJ4A 3NH6A 3I6MA 4GF5A 1A1SA 1RHUA 4MHTA 2W8ZA 4HCJA 4DEYA 1ORTA 5HR5A 1CHDA 2P3SA 5E6SA 2QA5A 5I9TA 3WBFA 3K5IA 4HY3A 3BXHA 4H0NA 5L4NA 4LY3A 3SFZA 3TGWA 3AHEA 5DTEA 4M83A 1T9GS 1FX0A 3QF4A 4BGVA 3OLWA 1FUUA 1L7OA 4O4IB 3C3JA 4UUAA 1PFKA 3MUOA 4N8DA 3V97A 3ZBUA 2C7PA 2YX1A 3LCRA 1N8NA 4AROA 1HZJA 4F0JA 4DDWA 1M7HA 1PJZA 1Y8QB 2ZPTX 1YE5A 4HPWA 1ISSA 3IFSA 5IFLA 3NBQA 3R1IA 2L17A 3LPCA 1QP0A 3VRHA 4PLHA 1XTBA 5PGMA 5LQMA 3R41A 2NU9B 3TXXA 2XWPA 4EHLA 1ZMOA 3O9VA 2EATA 3LGXA 1XKXA 4XDZA 5HDBB 3DE1X 2TECE 2BPOA 5HG0A 3TDKA 3DBIA 2ZB7A 5H16A 1YCHA 2ACWA 1PR1A 3T4PA 1EXMA 1WCYA 3ORQA 4NE2A 1M2FA 4AX8A 5ALYA 4KHZA 2V6FA 3JARB 4YRLA 4IGKA 1UBSB 3U4QA 2II6A 2Q28A 1B42A 3GAMA 3LPDA 3KLOA 4BBAA 5KOHA 4BEJA 1ZGJA 1VE9A 1SCQA 4OXQA 4E13A 1T4MA 1XTZA 2FVYA 1QCCA 3EXG2 3UENA 2WHYA 4FGWA 2ZZNA 1H3FA 2XDYA 1SO8A 3QYPA 5K3CA 2YS7A 3OOEA 4N9QA 1EX1A 1XDGA 4FCVA 4FFNA 3SVTA 3II6X 1SCDA 1KYVA 2OXRA 3DMPA 4CMEA 5CH5A 1M54A 4UW9A 1E9DA 5A3QA 3MGBA 2P79A 5HP4A 1RXSA 4MIEA 2C03A 5J3JA 4TLCA 1XRRA 1FL9A 5K3SA 1FQWA 1Y6ZA 4PZ0A 3ESAA 3D4IA 2Z5GA 1XLWA 5BW4A 1E2HA 1E3WA 2C3UA 2A86A 3Q10A 4RPKA 4AF8A 1V8OA 2OKGA 4JQSA 3Q5GA 3RSCA 5EQFA 1HEYA 1Z25A 2FJ0A 3DZDA 2P9EA 1JR2A 4QUEA 3CT6A 4UHDA 2TS1A 3DOIA 2BBTA 2K4MA 4I4CA 4C06A 3U44A 4JMPA 3AEQA 4OQEA 3C3XA 4MZXA 4YXWA 1HUQA 1YR7A 5EXDA 1T4GA 1NZDA 1GEEA 1PV4A 5MFZA 1JEYB 4BVEA 3D6NB 3PPXA 3O26A 4ZO8A 1TXGA 4IL5A 4I6JA 5FWNA 1QTNA 5FTLA 5KYXA 4O6VA 4TQGA 3JD0A 3UY4A 3NRBA 2D7CA 1NG1A 5CPBA 1DRKA 4EJSA 2QQGA 2ZPUA 3D3JA 2JLSA 1FPMA 1N2SA 4M0UA 3B1JA 1NI4A 2WM3A 1W73A 3HXTA 4FHFA 4Y2TA 1O4WA 3P8ZA 5EINA 2WUWE 3QVLA 3DO8A 4IZIA 3W06A 3PT5A 1M2GA 2I2WA 2YOFA 1I1NA 2D0PB 1XVTA 3CHYA 5T6MA 4OI1A 2QOEA 2WU4A 3INTA 3SFVA 2EBHX 2QSJA 2VHCA 3ORRA 3ZUGA 2CLFB 4KVAA 1UDWA 2W2KB 4ARUA 5CLJA 1BDJA 1UODA 2IPLA 1YZUA 4EGJA 1GU1A 4F3KA 2XODA 2C59A 1ST2A 3BL5A 3EQ7A 3GRYA 3RHFA 1J5PA 1KC1A 2PS9A 4L5IA 5L3RA 3TXAA 1XHFA 4KBGA 3OKPA 3D8TA 2X8LA 3NI2A 1G20E 4J94A 4OK3A 4X3CA 4D8UA 4LF5B 2IYOA 1YIDA 3MRXA 2CHQA 2NSDA 4R9SA 3DEHA 1KVSA 2WTXA 3SX4A 4ZGGA 1ZR4A 2YJ5A 4B4WA 4QTTB 4Y67A 3AIIA 5TJ9A 1SK8A 1ZO8A 4PZ9A 4BNDA 4X54A 2OHJA 4QQKA 2ZVPX 4AX4A 1I1HA 5EJ2A 2A3NA 4P7BA 1XX6A 2JD0A 1B6GA 5EP3A 2CXNA 3R3VA 1BHJA 1OBOA 4Z4HA 4DABA 2FZCA 1VJDA 3RSLA 1KDZA 2AG1A 1GAQA 3DJYA 1RACA 6REQA 2OL4A 1U3VA 2H4HA 5K2OA 3H99A 1P1KA 1AO3A 2WKQA 4Y6SA 3Q0IA 2I0FA 3NRCA 3IPYA 4MUBA 5C5IA 3AVTA 4G8JA 2H00A 1N8TA 1HFJA 1A7KA 1C9DB 4DMFA 1IWBB 1JHQA 1CQXA 4FPXA 2FW0A 4M76B 4UU8A 4FFMA 2WJ4A 4UDOA 3GLUA 4QBHA 2PCLA 5E9WA 3P2YA 1DBIA 2P2YA 3PFCA 4AY4A 5IASA 4LVUA 1Z2AA 1NONA 1QHNA 4XX0A 3RABA 4QQRA 4PG6A 1LI5A 4KL8S 2BTQA 3N86A 2HRDA 4HI0E 2WJPA 4JH0A 1PFQA 4PQYA 5I7WA 4P31A 2PH3A 4H1WA 1FXUA 4BNNA 4WXRA 2JBAB 4J49A 2KYRA 1DJLA 2PJDA 1TK3A 4CL0A 2CE7A 1EK5A 2J9GA 4K28A 4TXJA 2O1EA 3L49A 4RJIA 1ZCBA 3L0YA 1JX6A 4MIYA 4MVJA 5JVDB 4EPXA 1J8YF 3DXFA 1Z7BA 1UM9A 1XLTA 2HA6A 2OCXA 3I6IA 3R3HA 4L2IB 4BZZA 4DMKA 4K8OA 5DIZA 1T3GA 2D59A 4ZK6A 1DX4A 5A1TA 3E2PA 5AKZA 1Q84A 2ATIA 1YI0A 3AVQA 4IZ6A 4KR9A 1ZZEA 2P9BA 2CL7X 4DSUA 4EF5A 1CYDA 4RA6A 4EGCB 5IJ9B 1Y80A 2B8WA 4PZDA 5E3IA 2IYQA 2ZIZA 4A5OA 4GKAA 2V9PA 1U3GA 1UOEA 5F1KA 4Z1MD 1GNSA 3FZQA 1V4VA 2H5JA 3DFMA 4LF9B 1KI6B 4G65A 4IDEA 3ZS9A 1NX9A 3SHWA 2MSLA 1W36D 3GA7A 2KM1A 2XNSA 4W8OA 4A27A 2XPCA 3HDVA 3FCAA 3RASA 2BCJQ 1DIAA 2OD9A 2WBLC 3IKJA 3KEQA 3TIFA 3F3KA 1G8PA 3QF4B 1E60A 4MUKA 4PYLA 3X2SA 1Z8FA 3X1KA 3FOCA 2VTDA 3QZUA 3RRXA 2ODQA 4F7WA 3ZWVA 4WACA 2QTTA 5J4HA 4MCAA 2CW5A 3SS9X 1DKRA 1Q83A 5CXUA 1R0CA 4P1ZA 1EH5A 3GUCA 1R9GA 3HVHA 4KWCA 1Z88A 3EK2A 1ZZGA 2YWEA 3WIUA 5LUBA 5MGBA 3VNUA 1LK5A 3U40A 4DT1B 5BNFA 4CKZA 3G0CA 4INOA 5IH7A 1CUUA 1P44A 2ZIEA 4WLFA 3RCBA 4GLLA 3EYAA 3PNLA 3B1ZA 2DLNA 2GNOA 4MKGA 5TEWA 3K2BA 1K5PA 5CBKA 4YI5A 5B2ZA 4BNHA 1LTKA 4V02A 3KEFA 4BJHB 3DAGA 5ELMA 1WB9A 1KZ4A 2IV7A 4DG8A 1AH2A 3FYCA 2Z8XA 3QKSB 3QA9A 4LYAA 4R1UA 4DIUA 2P9YA 4B2PA 5KOYA 4JQZA 3QY9A 5JH7F 2JKZA 3F6EX 3FZNA 4KXLA 5BOVA 1IN1A 3MVEA 4ILEA 1OUMA 3GFGA 1NVAA 2ZTHA 4G0MA 4RDCA 2NOAA 3C14C 2DC1A 3WHPA 2RKWA 1QMPA 1YVDA 1X42A 2YWFA 3KOWA 4A9AA 1CF2O 3ZVRA 1ISIA 2J3KA 1KNXA 1D6JA 2OCAA 1T15A 4O4LF 5DM1A 4MRMA 3TFQA 5LOVF 3JVIA 1ORDA 4FW9A 3V7NA 4Q4DA 5FA5A 2IZOA 3R0QA 2BH2A 4IFBA 2MDTA 5I9MA 4MW0A 2J3EA 3CLVA 5FI1B 5CJPA 4I5EA 3GJTA 4WBNA 5KREA 3FTFA 5EMJA 4BUJA 2VP2A 1YB7A 3I30X 3MWGA 1ODFA 5TV2A 2FPRA 1RAEA 1G9SA 1XEFA 5A3RA 4LQLA 4YUVA 3B6MA 5DE3A 5F4ZA 2ZTMA 5DGCA 4MWZA 2VK8A 3LT5A 5IDYA 5TY0A 1ZCFA 4BE9A 1E6CA 4COKA 4JJ4A 1NV8A 4PV7A 4Y1GA 4UVIA 2EG5A 2BFOA 1IH8A 4MB0A 5F2OA 1PN3A 1QS0B 4G5OA 1P1HA 1A77A 2QIOA 1UDAA 1OFUX 3FHOA 5FA6A 2KB0A 4O2AB 5FR1A 4EJSB 2FKAA 3EGVA 4D44A 1GAXA 2R7KA 4P4TA 4B48A 3S1SA 3FOZA 5ITZB 1TNDA 4AW9A 2YCBA 1W0KD 1YULA 4RLHA 2O8CA 1YFLA 4EI2A 4BCDA 3BA6A 4F11A 4OAPA 5THKA 1E79D 3FUCA 4NTZA 2XNKA 3AW9A 4PGAA 4EVRA 2J9XB 3PRHA 2J48A 1O7JA 5A4MS 1H1LA 3WP0A 3MSCA 4L07A 3FAZA 4C4PA 4CMEC 2EZ4A 2A4MA 2RGNA 3DZIA 1E3TA 2Q4TA 5DHPA 1O8BA 5K5EA 2YXLA 1FQKA 4BC0A 3TNDA 4DIFA 3L01A 3RYIB 2MYPA 1O94D 3WYFA 2ZYTX 5CXXA 1WCV1 4TV9B 4E22A 1MPXA 3DBHA 3EVFA 3KL2A 2NPOA 1PJSA 3M5CA 1QIKA 3N2IA 5FBWB 4FM9A 1LJ8A 2PX8A 2ZREA 5E4FA 1PL6A 2JVIA 4YLYA 3LSTA 3SC2B 3D4LA 5LU8A 3PPYA 1L8AA 2E89A 5F1PA 1OXSC 2JD2A 2XTMA 3IP5A 2WMNB 3W0LB 4L5YA 4N6NA 1X7XB 4E88A 5A2QA 1TF5A 1MLDA 1XKTA 3NBKA 4UE3S 5HRUA 2NP6A 1Z3IX 4BNDB 3BSYA 4Q3DA 2O7VA 1Y8RA 3LK7A 2WB2A 1YUBA 3C0KA 3TTUA 2AYYA 1II9A 3P2JA 2WICA 3WLRA <