3HA3A

Crystal structure of hma (mmaa4) from mycobacterium tuberculosis complexed with s-adenosylhomocysteine
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
281
structure length
281
Chain Sequence
IQAHYDVSDDFFALFQDPTRTYSCAYFEPPELTLEEAQYAKVDLNLDKLDLKPGMTLLDIGCGWGTTMRRAVERFDVNVIGLTLSKNQHARCEQVLASIDTNRSRQVLLQGWEDFAEPVDRIVSIEAFEHFGHENYDDFFKRCFNIMPADGRMTVQSSVSYHPYEMAARGKKLSFETARFIKFIVTEIFPGGRLPSTEMMVEHGEKAGFTVPEPLSLRPHYIKTLRIWGDTLQSNKDKAIEVTSEEVYNRYMKYLRGCEHYFTDEMLDCSLVTYLKPGAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SADAE, a potent bisubstrate inhibitor of mycobacterium tuberculosis mycolic acid methyltransferases
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords METHOXY MYCOLIC ACID SYNTHASE 4
total genus 101
structure length 281
sequence length 281
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02353 CMAS Mycolic acid cyclopropane synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ha3A00
5EOVA 3KR2A 2P41A 2ZULA 3MQ2A 4MTLA 3G2MA 4HC4A 5HFJA 3U81A 4CTKA 1HMYA 4NECA 5E8RA 5FA5A 1M6YA 3FRHA 4GC9A 2ZCJA 2AS0A 3AWIA 3UZUA 3ELWA 3FUWA 3NDJA 4OBWA 2G1PA 3TOSA 4YUWA 3KQPA 5B1SA 1RJDA 4C06A 4ER5A 2AOTB 5HIIA 1VP3A 3CKKA 2XVMA 1VBFA 5F2NA 2IH2A 4QTTB 3HVKA 4PGGA 4LWOA 3EVFA 3NW9A 4KWCA 2EJTA 2C7PA 2GB4A 2ZIEA 3OZRA 1JG3A 3OFJA 5HIMA 5CIYA 2PX5A 3IEIA 2NXCA 1EIZA 3GRYA 4DCMA 5HIKA 5K0GA 3DMFA 2PT9A 3T7TA 2B2CA 4Y30A 1DUSA 2H00A 2ERCA 3KQQA 5E2AA 1NW6A 2Q41A 2PX4A 1DCTA 4FT4A 4RTOA 1MHTA 2FPOA 2NP7A 1VIDA 3LCCA 2CKDA 4ER7A 1B42A 2AN5A 4YUZA 3I53A 4GF5A 2AOUB 4GOOD 4KDCA 5DXAA 3T0IA 3THSA 2AOTA 4DZRA 1Y8CA 1XVAA 1O9GA 2FRXA 2ZBQA 3C3YA 2QE6A 4OQDA 2O05A 1Q0SA 1YF3A 1KP9A 1SQFA 3DXYA 2YXEA 3UA4A 4RVFA 3LL7A 3TPZA 2QRVB 3TFWA 3R3HA 5EC8A 4CKCA 4DA4A 3RIEA 1L3CA 4RTPA 1L3IA 1F3LA 3P9KA 3EVGA 4F85A 1IM8A 2ZIGA 4KDRA 3CBGA 2P3QA 5FULA 5GP1A 3S68A 4FS8A 2P8JA 2HTEA 1JG1A 4FT2A 3SSMA 1D2GA 3PX3A 1F38A 5T64A 4A6EA 5K03A 2FYTA 5FADA 5LQRA 3MERA 2V74B 3EVDA 2P7IA 5FTWA 2BR3A 1G8AA 3G2QA 1XCJA 5LQAA 3E23A 2XBMA 3D2LA 3LSTA 5IH3A 2PXXA 3FPEA 1SG9A 1D2HA 1NW5A 3G88A 4AZTA 3BWYA 3T7RA 4AZWA 3HTXA 3BXOA 5DSTA 4PYMA 3GGDA 1JSXA 3P9CA 3MAGA 4HTFA 2B78A 4OBXA 5LQUA 2ZVJA 4E2ZA 2BR4A 2OPBA 5CVEA 3CJRA 3OU6A 2PXAA 3R9XB 1KPHA 2UYHA 4C04A 1EG2A 2HWKA 5KYGA 3KKZA 3GCZA 3DLCA 3NWEA 4IV0A 1WY7A 2BM8A 3OE4A 4E32A 1KIAA 2FK7A 3I9FA 3FYCA 3FUVA 1H1DA 3BWCA 3UJAA 4CKEA 3P9IA 4A6DA 3Q87B 2ZWVA 3R6TA 4P7FA 3HM2A 3LCUA 2I62A 3OZTA 3UJ9A 4RSRA 4RTMA 5EKXA 2IDJA 3TKYA 2CMHA 2R3SA 5DLYA 3LX6A 5EZSA 5EMJA 3G2PA 2OO3A 2ZBPA 1XDUA 5HZMA 3FPJA 4U7PB 1L3BA 1BOOA 1X1BA 2H11A 4EKGA 1WZNA 2O57A 1KPGA 1XTPA 1KR5A 4C08A 1ORIA 1JG2A 3P2IA 3EMBA 3GRUA 5EMLA 5EVJA 3CJTA 2OBFA 3LCVB 3G7UA 2PWPA 3KQSA 5DM4A 1NBHA 1NW7A 3P2EA 4XCXA 2GA9A 1EJ6A 5E1MA 3TM5A 4YMGA 4RTSA 3NMUF 4X1OA 3MCZA 5DTQA 3G89A 3FTCA 5K0CA 3PFHA 1X1CA 1P91A 1KYZA 3UJ6A 2VDVE 2F8LA 3ELYA 4H0NA 5FQOA 4HG2A 1AF7A 1JQEA 1YUBA 3DUWA 2I7CA 2OB1A 5GWXA 1KHHA 2IFTA 4PYNA 4PONA 4PCLA 1FP2A 1RI2A 3FUUA 2VP3A 3NDIA 3SGLA 3UWPA 2P40A 3HVHA 3P8ZA 4EMSA 3M6UA 5HIJA 1NT2A 1I4WA 1ZQ9A 2EG5A 4IWNA 3EEOA 2YQZA 4QPPA 3SR4A 2OXTA 3OZSA 2ZW9A 1NV9A 2GPYA 3KPUA 1XJ5A 5BXYA 5F2OA 2JHAA 2EX4A 4KIGA 4Z2YA 4DKJA 4RTRA 2NP6A 1NKVA 3F4KA 1NV8A 5EIFA 3FTEA 4ER6A 3K6RA 1BKYA 5CVDA 1G55A 2HMYB 2R6ZA 5BW4A 4L7VA 1I9GA 3UA3A 1KXZA 1TPYA 3EMDA 5EZQA 3SSOA 3KPWA 3RW9A 4EQZA 3BGVA 5KVAA 4YV2A 2UZ4A 1T43A 2G72A 1SUIA 2O0LA 3EVBA 1UFKA 5LR6A 4HGYA 4QDJA 3FZGA 3R0QA 4PIMA 4V0QA 2ZSUA 3P9NA 4F84A 1YFJA 1YB2A 1DL5A 1YZ3A 4LG1A 4PYKA 2PSSA 3G5LA 3EVEA 2Z6AA 2FK8A 3PTAA 5FWDA 1G38A 5FA8A 5GM2A 2GLUA 3TKAA 3FPHA 2XVAA 1ZG3A 1UIRA 2OY0A 5K01A 3M6WA 3R24A 5FHRA 3UJ8A 4LECA 4PINA 5ICCA 4O29A 2IGTA 2IIPA 5CUQA 3VYWA 2P35A 2K4MA 4CXMA 5K09A 3CGGA 2JH9A 5CCXA 2C7RA 2A14A 3A4TA 3T7SA 2GH1A 4ZTBA 5E1BA 3OU7A 1IY9A 2HV9A 5EEGA 4CKBA 1FBNA 5CCBA 1EQAA 1L1EA 4RVDA 2QY6A 2JHCA 1EJ0A 5FCDA 3IV6A 3M6VA 5DRTA 3PX2A 2WA1A 4RVHA 3GIWA 4RWZA 3KR9A 1JQ3A 3GJYA 2XYQA 4OA5A 4AZVA 1NE2A 2G71A 3B89A 2CMGA 3DMHA 1JTFA 2OKCA 4PYQA 4GUAA 3LBFA 5E1OA 3EGEA 5HILA 1PRYA 1QANA 1N7IA 1VQ1A 2QM3A 4HSGA 2BM9A 3B7PA 3KQYA 4RTLA 2IPXA 3TQSA 5ICFA 4C07A 5EEHA 5FHQA 5LQKA 2AOXA 1NW8A 1NBIA 3REOA 3UBTA 2E5WA 1FJXA 5GOZA 1AV6A 5E9WA 1X1AA 4RYLA 1JQDA 3LKZA 4R6XA 5G02A 3FTFA 2B25A 3EVCA 2EJUA 3THRA 3NVMB 3WSTA 3DULA 4DF3A 4R6WA 1YZHA 4PYLA 5E9JA 2XYRA 4MQ4A 5K0BA 4RTNA 7MHTA 3SMQA 1HNNA 4YUVA 1N2XA 5K8VA 1VE3A 4RV9A 4OX9Y 2CL5A 3C0KA 4HH4A 4F86A 4C03A 5HEKA 4E2XA 2H1RA 4PGHA 5EIWA 5DRYA 4DCGA 4M38A 4DM3A 3Q7EA 1QZZA 2I6GA 4U7TB 5C0OE 2VDUE 3JWGA 4OQEA 1G8SA 2G8NA 3H2BA 3PFGA 5BP7A 2PY6A 1RI5A 2AN4A 3G8AA 4X61A 3JWIA 5E8JA 1ZHFA 4P7JA 4AUKA 3JWJA 4R8RA 2DPMA 4ATNA 3ERCA 3OCJA 3MB5A 3GRZA 5EHGA 2PLWA 3P2KA 2PWYA 2GAFA 4LWPA 1VPTA 3A25A 3KU1A 2QYOA 1TW3A 3GWZA 4KIFA 5LQJA 4ISCA 4C4AA 2IBSA 2ESRA 2ONYA 1KYWA 2BZGA 4R8SA 4BLVA 2NYUA 2O07A 5DM0A 1SVUA 1BHJA 2ORED 3OU2A 5DPMA 5EKUA 2YR0A 1QAOA 3OPNA 3BUSA 3C6MA 3KQOA 3SM3A 3KQMA 4FP9A 1FPQA 3I58A 2VZ9A 4M7RA 4X41A 5EHIA 3GU3A 5ICGA 4RTJA 3DP7A 4KVZA 3FRIA 2YTZA 1INLA 5E1DA 2YX1A 5DSXA 5CM2Z 3PVCA 2NNWB 5C1IA 3B3FA 3EVAA 3KQWA 4HTFB 5DTMA 4E30A 3DMGA 3LHDA 3C3PA 4P7KA 3E05A 3ELDA 5DWQA 1VL5A 2IP2A 2OB2A 4BLUA 4X60A 2JHPA 3HCCA 1WXWA 3X0DA 4FGZA 1AQJA 2QRVA 1XDZA 4IV8A 4PCAA 5EMMA 2Z6QA 3M70A 3O4FA 4KRGA 5K0EA 4M36A 3VC1A 2Y1XA 3VC2A 3OE5A 4POOA 3MCTA 5M5BA 1X19A 3LGAA 5E9QA 3BT7A 1R6AA 2ZBRA 4YV0A 5DXJA 3AY0A 3E7PA 3HCAA 2AOUA 4C05A 1JSZA 2UYQA 3HVIA 1PJZA 1TW2A 3ANXA 3TMAA 1V39A 2KW5A 4GEKA 3B3JA 5P8WA 5KQSA 3TM4A 2IBTA 1ZKDA 3C6KA 3KQVA 5D1HA 1AQIA 1QAMA 2NXJA 3KPVA 3KR0A 1VP9A 3PT9A 5HOQA 3HCDA 4KW7A 2B9EA 3FPFA 2ZZMA 4P7GA 5FWAA 3RODA 3KPJA 1M0EA 5EGSA 2PVCA 3A27A 5CVUA 2C7QA 3CVOA 2AVNA 5GIOE 3MTIA 3TR6A 3GNLA 3B5IA 1QAQA 4RVGA 1RJEA 2LD4A 1U2ZA 2O06A 5EQJB 5DX0A 4DQ0A 3FTDA 5C9ZA 5JUWA 4BP1A 3M6XA 1IXKA 2AOVA 3IYLW 3O7WA 3HA7A 2OZVA 4GOLD 4ER3A 4RTKA 3LKDA 4MWZA 2ZTHA 3HCBA 1XXLA 2HR1A 3UFBA 3UJCA 2ZLBA 1Q0TA 2CWWA 3NVKI 3ID6C 5FUBA 3ME5A 5DX1A 5K0FA 3BGIA 3B3GA 3EEYA 5KQRA 3CC8A 4P58A 9MHTA 3UJ7A 3IHTA 2I9KA 4V0RA 3ER8A 2BH2A 2GS9A 1RJFA 3M4XA 3SXJA 3MGGA 4PWYA 5D1NA 4E31A 2P3LA 3EVZA 2XYVA 1ORHA 2PGXA 5FQNA 3O31A 5JR3A 3LBYA 3GXOA 4HRAA 4WVLA 4R05A 4CWAA 1SUSA 3I64A 5MHTA 5ICEA 5LSAA 2WA2A 1XDSA 1EAMA 1NW3A 1WXXA 3HP7A 3LECA 4ER0A 1P1CA 1ZGJA 2Y1WA 4FZVA 5E2BA 4PYJA 5CD1A 4XUEA 2P1DA 2YXLA 1R74A 1RJGA 1M6EX 4EK9A 1SKMA 1R00A 2ZIFA 2IH5A 4Y2HA 3GO4A 2VS1A 1R8YA 1D2CA 2ZWAA 1G60A 3E8SA 2NXEA 1G6Q1 2PX2A 3DLIA 3DXZA 5EMKA 3MTEA 2VDWA 3GRRA 3HCFA 3P71T 4AX8A 5LQCA 2ZZNA 2EFJA 2YXDA 1O9HA 3FPGA 3I5UA 3BKXA 1BC5A 3FYDA 1JG4A 1MJFA 3CJQA 3DXXA 3HCEA 2BR5A 4BP3A 4QQNA 4QQKA 1YFLA 2C7OA 3A7DA 3NTVA 2PBFA 4E2YA 4YMHA 5T67A 5EG5A 3JWHA 1WS6A 4M37A 4XUCA 5IKMA 2PJDA 1L9KA 3G8BA 3GRVA 3PS9A 4YUYA 2WK1A 3MHTA 2AR0A 2JJQA 3PB3A 1XCLA 2ADMA 1Z3CA 1P39A 3FUTA 4IKPA 3A7EA 2AOWA 4OA8A 3HA3A 3UJDA 4PYOA 5DM1A 4CTJA 2PV0A 3SX0A 1JTEA 2YUIA 3TLJA 2P7HA 3K0BA 4PYIA 4AZSA 10MHA 3BWBA 5K0JA 3ELUA 1N7JA 1P1BA 3HEMA 3V8VA 2B3TA 1RI1A 3QOWA 5GINE 3L8DA 4GC5A 3KR1A 3OFKA 5F2KA 5EPEA 3G5TA 3UJBA 4EVIA 2FCAA 3EGIA 5LQNA 1RI4A 5K0LA 4XUDA 3ER9A 2AVDA 4QVGA 4K6MA 4YV1A 5BW5A 4BY9E 3P97A 3AXTA 3AJDA 3VSEA 4UOEA 1X1DA 2JH8A 3DOUA 3KPYA 4QPNA 4QTUB 5CVVA 3SSNA 4EKIA 5DTRA 2UYOA 4GOMD 4DMGA 1I1NA 3KQTA 3QOXA 5K0NA 4YUXA 3G2OA 2ONZA 3SVZA 4PNEA 2N47A 1KPIA 2PKWA 4MIKA 5GM1A 1WG8A 2FHPA 3DR5A 3PLAE 3QV2A 3LPMA 3BZBA 2ZZKA 3LDUA 5ERGB 4GBED 4BLWA 2PXCA 4QVKA 4RX1A 1R18A 1FP1D 3EGVA 2P3OA 3M33A 2PT6A 5H02A 4WXHA 1QYRA 1UWVA 1OR8A 2OYRA 2Z6UA 1O54A 4MHTA 1SQGA 4JXJA 5KS2A 1ZGAA 3HNRA 4B17A 3BGDA 5U4XA 3HVJA 4GQBA 2NXNA 1VLMA 4FSXA 4FR0A 2UYCA 8MHTA 1RI3A 3DH0A 4FSDA 2YVLA 3A26A 2JG3A 2AZTA 4X63A 5GIPE 3DTNA 4PIPA 1R8XA 2DULA 3LDFA 2AN3A 1JR4A 2IDKA 3GDHA 3KHKA 2G70A 4GOND 3AXSA 4E70A 4RTQA 3NWBA 2V7EA 2PX8A 3EPPA 3V97A 5T6BA 5DM2A 2IH4A 4E33A 3TRKA 5CVJA 5DT2A 2ZFUA 3HA5A 3LDGA 5DX8A 4G56A 3FUXA 3ORHA 3BKWA 3BWMA 4HGZA 4E2WA 3CCFA 4QDKA 3NJRA 5K05A 2HNKA
chains in the Genus database with same CATH superfamily
4FJ1A 1E2KA 1FDSA 4R68A 1EUCB 1FNMA 1GR1A 5DLDA 4YP9A 4DCOA 3V1NA 2Z9DA 2CEKA 4R9VA 1PU2A 3T06B 2JIOA 2ADFA 2PZKA 1IEQA 3GB9A 3I9V6 4GC9A 2MSWA 5I9MA 3OJOA 2XWBF 4A1FA 4DT1B 4CCAA 1QG4A 5DTIA 2G1PA 3WIUA 4L4RA 3P0EA 2UZIR 3CKKA 5BWNA 4NEGA 3NHMA 5JO0A 1J0BA 1FU8A 1Z4NA 2B8WA 2DR3A 2ISSD 1CNMA 4M1EA 1OUMA 3G7SA 1MA3A 2OC4A 1E8DA 4FMBB 1NQTA 4FKMA 1P19A 1PL8A 2J08A 4U8GA 3QE0A 4DBLC 4BNNA 4UBIA 1IHDA 5BSWA 4CKCB 5L53A 2GTIA 3FYTA 4O3FA 4GBJA 4GGMX 4ENSA 1W1WA 3N1UA 5HK8A 3TL2A 2O19A 3WRWA 2BW0A 4Q1VA 3T9CA 3COSA 3QEMA 3TO5A 1N0UA 2ODNA 1FQKA 3R5KA 5H80A 4ZEOA 1GQ2A 2CKDA 1QOZA 4WASA 4Q9IA 3EHEA 2VTEA 2X4DA 4F11A 4QNNA 5DXAA 1D8TA 1EZZA 1NJ6A 3FROA 3JXEA 2OAEA 4CM1A 3DM9B 2O2SA 4F8YA 5I7FA 1VCHA 1ZVVA 4LDPA 1ATIA 4JVNA 2WRZA 3VNRA 1SQFA 2AD5A 5BSHA 3NTQA 3CNBA 4YMWA 2QGZA 5FR1A 1T1EA 1Q0UA 2AI2A 3QX9A 4W9NC 3TRDA 4B74A 4CKCA 2NW6A 4W63A 1YO6A 1KGSA 2DSNA 3A2NA 3DO5A 3ZY3A 4ZEVA 4H77A 1C0KA 3ICQB 4PFSA 1G5RA 2P78A 2GXQA 4ZYUA 4X92A 1X2EA 1XA4A 3T7KA 1SCQA 4MUMA 1OH5A 4LF5B 1Y7IA 1E7SA 2C96A 2YHUA 4QE3A 3OTIA 1GPKA 5JYEA 5BR4A 4V2IA 4A8PA 3WOHA 3K09A 1ADCA 2X0RA 3DSRA 3QPBA 4JI3B 2IBMA 2JCGA 2JFQA 2VUUA 4Q9AA 3ZLTA 2XZLA 3ZJ5A 2XXAB 2OEPA 3SBDA 4MLDA 1AUXA 1A8UA 1HDGO 4H15A 1EDEA 1KOLA 4BQIA 4UHCA 2QN7A 4F92B 2PD3A 3H65A 1AUVA 1NW5A 3NT5A 3N53A 3PSAA 2P0EA 3R7WB 2B78A 2WJGA 5IMSA 2RB5A 4X45A 2YRFA 2VJYA 3OLZA 4UHDA 4V0KA 2H5EA 1G6OA 3J7AC 1JHAA 2NAFA 4US2R 3H2HA 5BMOA 4OAOA 1EG2A 2ZSHA 3OCXA 2IYZA 2Z98A 3ZZTA 4JYZA 3HABA 3DWFA 4UZEA 3RC2A 1J7KA 2HU2A 1JPJA 2VHYA 3C5HA 1LLFA 4ZCSA 2V7TA 3Q0EA 4JWTA 4KXWA 1Q1QA 2PZFA 5G0SA 1JPNA 2X7HA 3OJCA 4ALJA 1XRJA 4GBGA 3VOAA 1U8FO 4N47A 3VAAA 1IEWA 3BERA 3KKNA 1T5SA 2MINB 1FZQA 1BEZA 4H1WA 1NNUA 1X8KA 4GVLA 3PFIA 4U8HA 2BSQA 4F72A 2CK3D 4U7PB 4XB6B 1NUAA 2F90A 1QCCA 1XTPA 1T0IA 4OI4A 3PDIA 3RJMA 5HRCA 1RE0A 1SVOA 2EW2A 1DEOA 3PQ2A 3L6UA 1VG9B 4PZLA 2ORYA 5IRCD 1QHNA 4PGMA 5IDYA 4YMGA 1O5OA 1QR6A 4NZMA 4CW7A 5CJ2A 1BFUA 4UU8A 5K8CA 4OYRA 1C4OA 1NPDA 4WX2B 3DYVA 4QJ4A 3UJ6A 3DZDA 1YS7A 3N8KA 1CDDA 1XP5A 3L41A 1FFDA 1PVDA 2D1QA 3DUWA 4Q05A 5KNBA 2PIAA 3DBRA 2YY7A 2JFOA 3PVZA 4QJ3A 3RSLA 4UEQA 3RGWS 3SF0A 3P8ZA 1B6RA 3M6UA 5HIJA 1ENOA 4EKYA 2BH9A 3AYZB 4KG7A 3NTLA 2ZM5A 2WTNA 3SR4A 2REQA 1RMYA 1JJIA 1VE1A 2ZW9A 3LWNA 2I65A 4DIDA 5BXYA 3VNVA 3URMA 4Z2YA 1KZHA 2NTEA 4Q7LA 1G3UA 1RAAA 4TWJA 5D00A 2YOGA 5HA5A 4BNDA 4PVCA 2ONCA 1ULBA 4EY3A 2NVBA 3KZXA 4F9FA 4YAJA 4Z0HO 5BW4A 5FH9A 5L51A 1RP7A 3D6VA 1AM4D 1WXFA 1GRNA 1R15A 3KUUA 4IUYA 4BNTA 3IRVA 2KSQA 2VHQA 3ZK7A 3I6YA 3B6IA 4HGYA 3RYTC 4BWVA 4IDFA 3I01M 1UZAA 2HJHA 4A7PA 4WZBE 2XGJA 2E4UA 3EGOA 4A0FA 2WM8A 2YVQA 3I3SR 4BBJA 4AKIA 2B82A 2HA6A 2WAOA 3M82A 4CL8A 3SF8B 2INGX 2XMPA 2ZE6A 1C8BA 2EL9A 4EA7A 5JY1A 2ZJBA 4L8GA 1WF6A 3MWKA 3TQHA 3T95A 1TM5E 3UT0A 3LAWA 3UMFA 1SXPA 1SCBA 1L5HA 3R76A 4JOQA 4CKYA 4DLBA 2IEYA 1NXOA 1M34B 4PINA 2DM6A 2QXUA 2XKKA 1UKEA 3I2YX 1N5JA 1J20A 1SHLA 2PS0A 1ZPDA 1GPJA 3C98A 5A05A 2C7RA 4CUZA 1R6DA 2POQX 4YAUA 5BR8B 2ZSFA 3BD7A 3OZXA 4PANA 4V02A 3TQCA 1ZXBA 3MLBA 2FE1A 3PI7A 5B3AA 1DC4A 3A31A 1LVUA 2OXEA 3VU1A 2VI5A 4GPTA 4BZWA 4Y67A 3GGPA 2EARA 4J3NA 4IIVA 4RWZA 3HJFA 1CUSA 1QYVA 3NEJA 4KXYA 4DV0B 4BNIA 3TSZA 4OJNA 1RAHA 1NJ1A 1HE3A 1VMKA 4UVHA 5JECA 2VAMA 2DC1A 3QYJA 2EJVA 1T36A 4J7UA 4AJ1A 4TMWA 4N8EA 4GKAA 1D07A 4MVJH 3N2NA 4CKEB 1JJ7A 4FMCB 1P0CA 1Z83A 3HJUA 3IAM6 1NBIA 1VFPA 3CN7A 4MZDA 1FJXA 5KNCH 5IJXA 4H18A 1QV7A 2PS1A 3OQHA 4EMBA 3AIKA 3CPEA 4AY5A 4FQ5A 2IWHA 4MW2A 3PGJA 4BQFA 5K0BA 1PLLA 4PZ0A 1Z56C 1YVUA 4C30A 2J59A 3IR6A 2JIZA 2A3NA 4JJKA 3RE1A 4BZPA 3UANA 1ZNXA 3CA8A 3PQ6A 3QFSA 3GPLA 4NULA 2BJVA 3UK1A 4UPEA 5HMLA 4D26A 4MA5A 3U9LA 2HR1A 4PXAA 4HJXA 3M7IA 5GOTA 5C0OE 2WWVD 3P2JA 2GPAA 4KMMA 3PFGA 3AU9A 3TIGA 4YN3A 2WKRA 2ZJ3A 4J43A 1KSGA 4P7JA 1F0NA 4Q19A 1LUAA 4MDHA 3ZCXA 3OQJA 1ZA2A 2MINA 4OVKA 5AI6A 3V4RA 2O2ZA 4DUZB 1ZUIA 1Y3CE 2PYIA 1RVDA 1XG5A 2MT9A 3ASVA 2E82A 1V45E 3PFKA 2FNAA 5LOVA 3ONFA 3A9VA 1V4VA 2PO7A 4B6GA 4JX9A 3GFPA 4BLVA 2PQ2A 4MV3A 4A10A 1SCUB 5ANRB 2B34A 1E0SA 1SVUA 1SPBS 4KZKA 2G9NA 1C0IA 1AA9A 2BFCA 4HWPA 2M98A 2PQMA 4CQJA 1KZYC 4RTJA 1QQTA 421PA 2JCSA 1BSVA 1ODJA 5DGXA 2CFIA 2YX1A 4JBXA 2H2DA 1YT5A 2JJ1D 4JP8A 1FFBA 2B8JA 2HRRA 3NFYA 3LP6A 1F06A 4KSBA 1KY3A 3DMGA 2P5UA 3QPUA 4REQA 4WINA 2AI3A 2YIJA 1VBKA 5BV7A 621PA 3E8MA 4P5EA 3QPDA 4YGXB 2XOKD 4EKEA 2QRVA 2OXIA 4DWVA 2HSGA 4E7OA 1X1QA 1YOVB 4QYIB 3OTHA 3TDNA 3QPAA 3SNKA 5GQSA 3MQ4A 3H8VA 1REQA 5K45A 1J2EA 3AQ4A 2D0DA 2VZ8A 2WVJA 4QVIA 1WP9A 1UMBB 3OQBA 2OR3A 3ANXA 3IKLA 4KRYA 4KODA 4GEKA 4WNCA 4WUVA 3HJBA 2AW3A 4HB0A 4IQFA 5BSVA 2Q8NA 3M9LA 4MYRA 1T36B 1U0OC 1XVLA 3KQVA 3VV3A 1CQIA 2BN4A 4FGSA 2GAIA 5IZ4A 2Z57A 4R2XA 5HR5A 5CFQA 1J1IA 3ABRB 4GWLA 1EVLA 4RK5A 3AJ9A 1BKDR 4UPDA 5LZ4A 4QYTA 2QZ4A 2X40A 3VRHA 1YIAA 1QWSA 1CJBA 3KLNA 4KPUB 1OWLA 2G7ZA 3Q15C 3MTIA 3V8RA 4NPCA 2FJ0A 1U7ZA 3W2IA 1N6KA 2ZUVA 1JR3D 5EQJB 3KOOA 1R2QA 2J8ZA 2V9ZA 2X9VA 2JFYA 3MJDA 2OHXA 4KO8A 3W77A 4OSPA 4I5DA 5LC1A 5CT5A 1Z2EA 1NYQA 4YVFA 4G5XA 4QASA 2ZR8A 1P0QA 4GOLD 5LXTF 2DBZA 4WPGA 5CFNA 1PNVA 1WBJB 4PBRA 1WE2A 2BP7B 1UQTA 4OL0A 4EPYA 3A6PC 1WLSA 1WEKA 2RI1A 2HJ9A 4TWBA 3GLRA 3G5UA 1W4RA 4RNDB 1TECE 1ULZA 2KM1A 4UUMA 3I2KA 3HDVA 1P7PA 2WUVA 3H5TA 3ADOA 2AGVA 2WHYA 3FNBA 4G0YA 3GQBB 1IN6A 3HXKA 5ICSA 2Z9CA 4PWYA 3O75A 1JLLB 4E31A 3ZWKA 3AZOA 2R7KA 4OIMA 4Y9UA 5L4LA 2BZ0A 3C7TA 3WAJA 4EVRA 4YB8A 1LB1B 4BVLA 2X6QA 1XXHB 2BTEA 3GJQA 1D7AA 1XDSA 1CLUA 2J85A 3JV7A 3N7TA 1D03A 3I6QA 4DCVA 8AT1A 1P1CA 1ZGJA 3HR7A 4FZVA 3K6SA 2WTMA 1EUCA 4YAWA 3FCEA 1P4AA 4R16A 1H2ZA 1HZJA 3NOVA 1KAHA 5CP8A 2E4ZA 4AN4A 4NJEB 3HDHA 5HZGA 2GILA 1ISMA 1QU2A 1MXHA 2ZTMA 1A9YA 3O4JA 4OFBA 1SCNE 5EMKA 5LQCA 3N76A 1JF8A 1K2WA 1XMJA 3HCFA 1A2BA 1P7VA 1QTIA 3CZPA 1GZDA 3MHPA 4ITUA 4ROTA 4Q18A 5ALHA 2HDOA 1RLMA 6Q21A 5KHOC 3V8QA 5IFKA 3IAAA 4MKXA 5IBQA 3FHCB 1GIAA 3EUEA 2PMDA 1T25A 1R4MB 2Z5VA 4B4UA 3A9TA 5KO2A 1GYRA 2W11A 5FO1A 1ZAKA 2VSNA 3W34A 1ZOIA 1XRQA 3E27A 2CC2A 4JSTA 2G0AA 2ZSJA 3AKYA 3VPGA 1IB6A 2ARKA 1WS6A 2DMRA 2JZNA 3HRKA 3T4XA 3ZG6A 1CQWA 4BB6A 1RRVA 3AP2A 1EK1A 5HRUA 1M0TA 4G84A 5UKDA 1II0A 1X0VA 2AD1A 2J3HA 3OT1A 4XEUA 2GR9A 1XCLA 2DTEA 1R37A 1FTWA 2V6GA 2V4ZA 4OA8A 4GKVA 1VMEA 2WW8A 4XM2A 5A0TA 1I01A 1NRXA 2VJDA 2YUIA 3L1JA 3VR4A 1KK2A 4C4TA 2Q3DA 2ZRAA 4TYQA 3G2LA 4AZSA 4G5HA 10MHA 4PM4A 4I4IA 5AVUA 2Y66A 1ZVJA 2B7LA 3QBVA 5IAJA 2W90A 2WIJA 3C3DA 4MJLA 1CRWG 1HORA 1YONA 2YYZA 4GNRA 2C2BA 2DWOA 4HWRA 4KV7A 5AK3A 3TLYA 3C5WP 4DIEA 4DLZA 4X8HA 2P2NA 4KVAA 3IVXA 4QVGA 3SDZA 3QMPA 1KZGB 1Z33A 2JAOA 5JSZA 3AJDA 1DQRA 4TSRA 2NU8A 3BYZA 4QTUB 1R50A 4JY7A 4CKXA 1YI8A 4L73A 3UXEA 1FVHA 2FZKA 3DLTA 5I6DA 3BQ9A 5D5HA 5FOVA 2B36A 3HBJA 3R40A 1LC0A 4QRHA 1XR3A 3FLAA 4DB2A 1TCAA 1PD1A 1DO2A 2IYXA 2ZZKA 5ERGB 4BLWA 1CY0A 1HFJA 4E14A 4HLUC 3VAYA 2GAAA 5DT9A 3ACBA 2PPVA 2YMQA 4JL6A 3ETLA 2VP9A 3AUYA 4X93A 4Y1RA 3WZMA 3FSRA 3IBSA 1V1RA 3L4BC 3GQBA 1FK8A 3PE6A 1EG7A 1XTUA 4WXHA 2C3PA 3HB9A 4YTEA 2HQ1A 1F8FA 1ZJJA 4EUHA 5CX1A 5AD1A 1ZESA 4HAIA 4RPLA 2QL6A 1XROA 2C4VA 2JLQA 2F1JA 3BGDA 1O94C 1PGQA 1T2UA 3FZEA 4M55A 1D1QA 1T0BA 1Y1QA 3CH4B 4GWKA 4AJJA 2YVLA 1JS1X 2AFHA 4LRXA 1NFQA 4IEIA 1H66A 5B1HA 4MVJF 2WPDD 3LDFA 2XNDD 3JD3A 2FZCA 4UM7A 3TLXA 2ZIZA 2RBEA 1J8YF 1N2SA 3DQPA 4E70A 4HXEB 4RTQA 2X4IA 4ZODA 2D59A 4ZOBA 1ODIA 4YJ3B 3SU8A 3AVVA 1VYHA 2V98A 5DT2A 1SK9A 1B0UA 3QYAA 4TTRA 1EINA 2WWFA 3C2QA 1FTGA 3CINA 4V0LA 5CNIA 4G56A 4UC0A 5DXFA 4QA9A 4B82A 1A8QA 1YV9A 3LFTA 4CTKA 3JD2A 2FUG6 2PKYX 2HYDA 2JIPA 3QLTA 2VHCA 2XUZA 1Y3HA 3CZ9A 1VL6A 4LHVA 4YEDA 3QVWA 2XUFA 5AW0A 5JDCA 4B84A 2ZUCA 1T9DA 5FAXA 1N0WA 3EMVA 1R1DA 2QAGA 1JV2B 4FKBA 4OBWA 3EY9A 4N7JA 5EIBC 4F93B 2BSAA 2A5FA 4ZU3A 2H08A 3AFIA 3QQ5A 4NDAA 1W0KA 2R97A 3UM9A 3VKUA 4DJDC 4YRFA 1KYQA 3IUEA 5T8KC 3AVQA 2XUGA 2YFYA 4D3XA 2VHUA 3A3NA 1MO6A 2P9HA 2HWXA 3QKWA 2JLVA 1NC1A 2J1LA 3DEAA 1P5HA 4WLUA 2B21A 4MRNA 3PXUA 3CUVA 3L7MA 2XT0A 3TTTA 4OIFA 1BWSA 1JDTA 2H2GA 4NIMA 1C4XA 3N6VA 1YTUA 1ECGA 3MUEA 1M6WA 4X71A 1ZMRA 3T7EA 1IQUA 1HFWA 1L5SA 2JIDA 2Q0SA 1A7JA 1VIDA 1VSUA 5IW8A 4S05A 5DGHA 4U0JA 3VVLA 1K86A 3I53A 3DOCA 1XFAA 1XTBA 3FGOA 4GF5A 3U4MA 1OX4B 3AFMA 4YI5A 1LY1A 1FEZA 2YYYA 2PMBA 5C8YB 9LDBA 1EDDA 1EXVA 4NK5A 3RANA 2JJ8A 3DXYA 1CR1A 1NUHA 2IDZA 1NBME 3R20A 4GX1A 1SCIA 1CRLA 2AK3A 4LE2A 2I4NA 2Q5CA 5I7AA 3SHQA 3EXEA 4RENA 3NMUF 2VAXA 2PRYA 1DUVG 4RABA 2BCEA 2ZU6A 5HKLA 4AG5A 4YLYA 2G1KA 3K4PA 4QGSA 4EI9A 4CNBA 3GLIB 1SBQA 1VPEA 1SIBE 2PAAA 2ZUUA 1GFIA 3ZW9A 5CX1B 3TSOA 2JIRA 3PX3A 4MR9A 3M2TA 4TV9F 3V1UA 1YZYA 5FJJA 5DN6D 3F4LA 5FTNA 4KRXA 4D41A 1FFWA 5TVKA 1XIVA 5LA6B 1TA9A 1YS4A 3RJZA 4E08A 4KR2A 1KL7A 5H0IA 2BR3A 2IZ6A 5ELLA 3EZLA 3H19A 4H7EA 1Z4JA 1V7ZA 3L0CA 4M0EA 3LU1A 1EFRA 2OZLA 3RNLA 3RT9A 2FUG1 1JDSA 4FR2A 5FBRB 2HLPA 4FX5A 3HTXA 2GLXA 2WWTA 4NMWA 3D6FA 3GGDA 1HGXA 3LA6A 2Q4TA 2NNLD 5A7GA 1QIFA 4JBIA 1B41A 3VH2A 3S1SA 1CJCA 1YL7A 4IRXA 1N0VC 4L7QA 5FP0A 1HNZB 2R44A 4AYXA 4H7JA 3PR2B 3DD1A 2FCRA 3PGMA 4YX9A 3AONB 5E7JA 3DVQX 1MOZA 3DLCA 2N1MA 3GCZA 4BB0A 5C46F 2ZB8A 1XO1A 1KP3A 3B7GA 3F6YA 1E89A 4ZOQI 5CA0B 1J39A 3N0TA 4UHEA 4DNXA 3T5CA 2CXSA 2F48A 1IBKB 3VGJA 1A2OA 5IVKA 4BJ6A 4JP5A 4B45A 4RLFA 4MQLA 3P9SA 4RMNA 3SS7X 5DE3A 1GL9B 3LNTA 1DUIA 2NMVA 2RAPA 3V1MA 3D4LA 2ZUTA 1EH5A 4W7HA 2CXTA 3IKTA 3F71A 2RIPA 4P5DA 4DLKA 4EG3A 4F8JA 4LY0A 1BQ4A 4IIJF 3TPCA 4D56A 3DV2A 3SJUA 4K9NA 4BO9A 2RBKA 5CA1A 3SPXA 4D45A 4HB4A 2CLCX 1Z6XA 1YS6A 5B3LA 3BTVA 4ER0A 3R0IA 1XJWA 2GA9A 4YRJA 3TM5A 1RLUA 4FTWA 1XLTC 4X1OA 5DMHA 5K0CA 1F2TA 4U5XA 3FCCA 4HMOA 4ARZA 2QVBA 1SVSA 2PZ8A 3IERA 3NANA 5JAUA 2WFLA 3L8EA 3PUXA 4NATA 4US1R 3DOIA 5GWXA 1NE7A 3ONVA 3EWSA 3OQOA 3C3KA 1DNPA 2WPNA 1FP2A 4U5QA 3RIGA 1NVMB 1I10A 3IVCA 3CF4A 3PNMA 3ZH9B 3UGKA 3OE7D 4X62B 4EG4A 3O26A 4PSUA 3H8SA 2OL4A 3WNBA 4KWEA 3JPYA 4NWIA 1DWUA 1W75A 1E4YA 4BV9A 1F4PA 2JHAA 2AQHA 2V0GA 3WYBA 4EB0A 3PNVA 1G5HA 1EFLA 3SHTA 3O3OB 2VF8A 2RGGA 3P19A 2O2YA 4I14A 1BKYA 3UFXA 1G55A 2PT5A 1KBQA 2Q5LA 4QT4A 1MTZA 2HD4A 3CMCO 4E7PA 5K8TA 1K66A 1QOPB 1XQWA 3WK6A 3LJKA 1QP4A 1JHPA 2OBLA 4PXYA 1PR9A 4NLLA 3ZNOA 3GUYA 4B3RB 1MX3A 5ECDA 3R9IA 3HJNA 2HH9A 2NSHA 1CY7A 1XJCA 3MJHA 3OO0A 1R8JA 1YZ3A 4ZVNA 3VR3A 3PIIA 1QH1A 4XX0A 3C3AA 4ARUA 1F7VA 5B1IA 1V8FA 3EVEA 4FFWA 1OWNA 2SCUB 5FWDA 4EG0A 3E22A 4QT0A 4RIGA 5EE1A 3TKAA 1LK0A 5KNBD 3OZGA 2W58A 4R7GA 3SQMA 1DX6A 2Q6VA 5AJXA 4Q9DA 1XWIA 2WKQA 1K6MA 1I7PA 1Y9EA 4C6HA 1U2SA 2H3HA 3FNIA 3M6WA 4M9XA 5DZSA 3V4VB 5CA0F 5L4SA 5CGQB 1GUYA 3BPSA 1X0XA 4P0QB 1ISPA 2GVNA 3VO1A 2EZ9A 4KR7A 4URHA 5K09A 2JH9A 2XQFA 1RHQA 3MWDB 3MT7A 1SUEA 4M0MA 2CE2X 2HHJA 1IXSB 3UNXA 3C39A 1L8QA 3LYUA 3OCUA 3ST7A 2VQFB 3NHZA 3LUPA 1L1EA 3Q7TA 4NAHA 3FLBA 4MS4B 1MB0A 1V25A 1VB3A 1GGFA 1M8JA 2Z4RA 5DP1A 1Y8QB 4ZVRA 1ZKMA 3LC1O 4JOCA 1G8MA 5KTRA 3Q6MA 4OKNA 4Q9JA 5BR1A 2QUAA 3AEYA 2XYHA 3AR4A 4IUCS 1VM6A 1UBKS 1NE2A 5A9TA 2PIDA 4BRUA 1MC5A 5AKGA 3AEUA 4HVAA 3VZBA 3WKEA 1USVA 4Q4CA 1ODFA 4F56A 4MUAA 4O1HA 5IS2A 1QM5A 4LJ9A 1V3QE 3HWWA 4TKMA 2CJFA 3DTVD 1L7AA 1OFUX 1R6VA 4OFZA 5ICFA 5ITWA 1PNRA 2IF2A 1P77A 1GRVA 2C57A 2VWHA 1YC5A 4I4TA 5C52B 1ZXLA 1XAHA 4P31A 1E96A 1UXOA 4WAUA 5AK0A 3THRA 1AXEA 3IDSA 3IVAA 3ZLUA 1BXGA 1M8KA 5CXUA 3F73A 2DH6A 4IDAA 4PNHA 4ZI7A 1P4GA 1EMDA 2G82A 3M6IA 4LHXA 1WSBA 2YXBA 2OV6A 5AVKA 2Q7OE 1G59A 4NZPA 3SC3A 1FQJA 4E94A 3RF7A 2LXNA 1LLDA 1N6RA 4Z5XA 3NM4A 4F86A 1SCDA 3PIRA 4UEOA 5JAQA 3LC7O 1LC3A 1M2GA 2E85A 3L1UA 3QM1A 4G4SO 3IODA 3RYCB 1BEEA 2RK4A 5TMPA 2BVNA 5ULLA 3WSWA 1G8SA 4ZZIA 2HRQA 1PNOA 1PZGA 1IY0A 3PENA 4RBNA 1Y80A 1XWFA 2WSYB 2QMHA 2VHEA 1IMJA 1N78A 4I55F 1JJVA 3M81A 4IIGA 1L1FA 2OO7A 4OFWA 4WQMA 2A30A 1N3LA 4D9BA 4OBBA 1RPJA 4FOTA 2RGNC 4JOSA 4GHWA 4MPDA 4C4AA 1DKOA 1QSGA 5B6PA 2IT1A 4TTAA 3UXYA 2JFHA 1H6AA 1JQJC 2JFBA 5L3QA 3PEYA 1JPVA 3CO0S 1THZA 4QOJA 4R8SA 5BSEA 4U2CA 2J07A 4ND1A 5G0UA 4BQSA 1USGA 4P9NA 1BX0A 1Z2CA 1GL3A 1VIYA 1MPTA 2JLWA 2VKTA 4IJVA 2D0OB 3FY4A 3I6IA 4DSOA 2XKBA 4QHSA 4EG7A 5DI3B 1OLUA 1DJQA 2FW0A 3PCTA 4MGEA 4PFKA 1XEXA 4F60A 5A9RA 5JS1A 1CC1S 4R2IA 2IV2X 4AN1A 4ARIA 2ZYAA 4MRMB 3EUFA 1AXRA 4L2IB 2I6FA 4B4KA 3QVSA 1PT7A 3AUUA 2NO1A 3Q3EA 2QSZA 1EGMB 4FYPA 3FSEA 5EMMA 3QTBA 4MB2A 4WECA 3EEQA 4U7WA 3EULA 2QD2A 3PFNA 3VC1A 1GA1A 2IA5A 3FMVA 2O3SA 4WADA 3BT7A 5FUXA 2W48A 3NEPX 3UK7A 4DIOA 1ZU5A 3IOEA 3A6JA 1FJHA 1UMDA 2Q1WA 1P7ZA 2PUJA 2X5XA 2VJKA 4MVXA 2PGLA 2ZSKA 4PC2A 5AW7A 1GT6A 1KK3A 4XGRA 4Y7CA 3TYXA 3TM4A 4DG5A 5MN4A 4MWDA 3R3UA 4KMSA 1ZKDA 1GKLA 2NXJA 2HGZA 4BP8A 1XDDA 2WAAA 1KS9A 1XZAA 3LUAA 3V8NA 3O9VA 2ZZMA 3U3KA 4YRMA 1Z8DA 4N5DA 3FGZA 1QE5A 2MYNA 4TZ0A 2WC1A 3EG5A 2YC4C 3NEAA 1Y33E 2IVZA 3GLHA 2LD4A 3PWZA 3RASA 4A73A 4PPNA 4D74A 3FTDA 2A0YA 2GJ4A 4ZOLB 3GGGA 1RCUA 1WCWA 4QZVA 5JIBA 5JG7A 1W34A 5JQGF 4BXOA 4F3KA 4MVJG 1MAUA 1X14A 1XTKA 5K8IA 4PWZA 1DTWB 3MMSA 4BQEA 4MWCA 2V7GA 4A5OA 1Q2XA 5D87A 1Y8RA 1RPAA 4DARA 3E03A 1OCEA 2AC4A 4RULA 1GQSA 2CFSA 7ABPA 2BJWA 4FLMA 3TUIC 5BQXA 1IHPA 2H4JA 1C1HA 4XFDA 1L7RA 1QIDA 3ZXXA 4AMUA 2YJ4A 1ULSA 1XVIA 2OGTA 4EKNB 1A8IA 2UUCB 2DY1A 1YMVA 2H85A 1RJFA 2OXRA 2CT8A 1Z47A 4WKPA 3TBKA 4HXFB 1AHHA 4EZIA 1CZHA 2OCIA 3GI1A 4EW1A 4BU1A 1P7YA 4ZOLA 5BUSA 5IASA 1LVGA 3ICEA 5C3UA 4K9MA 7MDHA 4DV4B 5CB8A 3I64A 3ANNA 1AOXA 1ZS9A 2WA2A 4RUKA 2DFVA 1RWMA 2CSUA 2GAJA 3PQ3A 3LYLA 1JNXX 1KEZA 1TT7A 3HXPA 4OMUA 5ALNA 5M29A 3K9FC 1ZL2A 4ZT2A 1E3WB 1OXKB 1WZIA 3EXG2 5G3YA 1BH2A 5AK4A 4YRNA 1K63A 2XTJA 2WIBA 1YZGA 3CKLA 3A1SA 2ZSEA 5CGZA 3KSBC 2CJWB 3FIUA 3YASA 3DVAA 3REFA 1TXGA 1UAYA 1GLNA 3QJYA 2OHGA 2YFQA 3PWSA 4EAQA 3ZDRA 2CVQA 1PX2A 2X1LA 5IUJC 3B1JA 1U3VA 1RXWA 1MJFA 3UMYA 3UT5A 3H11A 4QQKA 5ICMA 1WWKA 3BIWA 3GRCA 3R2JA 5DYNA 4DQUA 1Y42X 4P36A 2HWYA 5FPPA 3EDCA 5AKLA 5K4AA 2GYVA 4AULA 2YIVX 2OSBA 5B4UA 2E2WA 4QUEA 2YJZA 5TC4A 1P0FA 4Z4QA 4IDNA 1YZUA 5FL7D 1CZNA 1AKQA 3MWYW 3AINA 2M2IA 2F3SA 3D6HA 4NJOA 3QGMA 3CO5A 4EYGA 1T5BA 5ITZA 2Z8YA 3PHLA 1QGZA 1D9XA 2MHCA 2VSFA 4IRUB 1U28C 2SICE 3FMFA 1OB5A 5I3ZA 3D3WB 2Q1TA 3R3WA 4S04A 3L5OA 4X3OA 1DKRA 3H75A 3ES9A 4RD3A 3DMTC 4GAEA 5ESXA 1PFKA 2IKSA 5B3JA 2FHSA 1IY8A 1M76A 4YJ2A 2BCGY 4RIFA 2AA3A 2EWVA 4Z1OA 5TPZA 5CDYA 4HNQA 1AMNA 4MB0A 2PGNA 3VSEA 3D64A 5JZ9A 2Y6UA 4KAAA 1UF9A 2RHOA 4RDHA 3GAFA 1A8SA 4HRXA 3T1TA 4HUJA 3KUDA 2CYBA 1D04A 3LT0A 1KAOA 3D8NA 4LRUA 3MTJA 3U37A 4UNRA 4M83A 2XCOA 1WD5A 4QYWA 1LLQA 3LPAA 4DDVA 2D1RA 1ISIA 4RA9A 2QX8A 4BZXA 1FBTA 4NNJA 2A78A 3JD1A 4N5MA 1JEJA 3EF3A 5KDOA 4O3MA 4X3CA 2UXBB 5KYXB 4UM8B 4BO1A 1LDEA 4QVKA 1XZBA 2R8YA 2KQUA 1GLVA 3BWVA 1NU8A 4FYWA 3ZGNA 3FHTA 1P5FA 2BAGA 3VVBA 5BSFA 2DKOA 3L1VA 3VU3A 1M2EA 4D4KA 3LOUA 4KTVE 3WHPA 5JSFA 2C5BA 3NYWA 1I94B 1W5FA 3T3IA 1MTOA 4B17A 5LMZA 3OD1A 3KAPA 4QGAA 5C18A 2NXNA 1DZ3A 4R7ZA 2J9GA 4BE4A 2XT6A 1TJPB 3DYBA 3L7NA 3N05A 5EINA 1VRCA 2XE8A 4DJEC 3F4BA 4BFZA 3FVRA 4L0DA 3PUIA 1ONPA 2EBWA 1SBNE 3EZYA 3GDHA 1E62A 1NUPA 4XIGS 4GOKA 1LGYA 2AE1A 4ND8A 1ZI6A 1Y48E 3V97A 5EXTA 4O2AA 1OYYA 2FFBA 3Q9LA 1E2JA 4P3OA 3DPUA 4ZEMA 1PTKA 3GRFA 1LK7A 4GU5A 4X84A 4OHFA 1E9BA 2KE5A 3H8WA 3FWKA 1HBJA 1PK7A 2R1ZA 2XMRA 2IHTA 3FUXA 3NFRA 1IFXA 1EFTA 4HDNA 4RZ2A 3RC1A 1G5PA 3KOZA 2GN9A 4NJMB 1T9HA 3VDXA 5TARA 2FP4A 2ZJYA 1IOLA 3I12A 4GVPA 4IG9A 4PN3A 3G2MA 2H51A 3P96A 4AJNA 4ZZ0A 2V5AA 2FN3A 1SXJC 4YDQA 1C2TA 1UQRA 4CGYA 5JCZA 1UM9B 3TRHA 4JHLA 2C1XA 1R9MA 2D54A 4NYMR 1IAQA 1OC2A 1NRWA 1Q0ZA 1VSTA 1VBFA 3AVUA 5AWFC 2RJOA 2W83A 3TOXA 2Y05A 3IQHX 4XD7A 3ZVNA 1T35A 1ABEA 2F9LA 2AZDA 1I7QB 4I99A 3OFJA 5IT5A 3IEIA 1ISSA 1OAKA 2YZ7A 3D4OA 4JODA 5SYNA 2DEUA 3G49A 3OOWA 3PDWA 2QLLA 1SU4A 3R09A 5J5VA 3OX3A 4BYGA 3VHRA 3KRTA 3KQQA 4IS3A 4C4XA 1DU4A 1KRHA 4DNPA 2ZRQA 1H1TA 3RKUA 3GP8A 2RKBA 1S2LA 2VVTA 4LY9A 4QUHA 3IPLA 4JELA 5CRIA 5AI5A 4ZOCA 3HDYA 3WGMA 1ODCA 4CMEC 2GA8A 4K8RB 4DGSA 4EUEA 5BWCA 2GKGA 5FNVB 3K9LA 1CUAA 3T34A 4OU5A 1RWKA 1UM8A 3CU5A 1Y5NA 4E09A 2WT9A 4CTNA 5C7OO 4BNJA 3STXA 1PBNA 2RHTA 5AI9A 1ISJA 1TZKA 3BFKA 3PP8A 5ALVA 5IPFA 3W5AA 5EE3A 3KIPA 2CHGA 3AEUB 1IM8A 2VRCD 3GJ0A 3UUGA 2GD0A 3RIHA 1FVXA 5L7YA 4CFYA 3DVLA 3Q1KA 2P8JA 3U3ZA 1ISHA 1RBZA 4NE7A 3U26A 4FGKA 4PNZA 1DJPA 5EJIA 4MV8A 3C97A 1KSHA 3COVA 1PFGA 1UPXA 3WXBA 3LT5A 2VXCA 1SCKA 4S1PA 5BT9A 3FLEA 3GG2A 3B6MA 3ICOA 1XEWY 1SOAA 1PZHA 5IH3A 2IF0A 1NL3A 3PQ8A 1SG9A 4AZTA 3A0UA 3IO3A 4FJ0A 1I1QB 1ZD8A 4IJ6A 5JZOA 1SUBA 8OHMA 2QUJA 3WKCA 3LX4A 2VLBA 2FFAA 3RVKA 3L0ZA 5JD4A 4N9WA 2OPBA 3CJRA 2ZIVB 3GA0A 3L7OA 3NQ41 4RF4A 1YQ9A 1V35A 1PT9A 4JNCA 1UXIA 3CFYA 4MWTA 4NARA 1E9FA 4R98A 4IV0A 1GZUA 1P44A 1HH4A 2BM8A 3FPBA 3W5IA 5KMGB 5KTNA 1N36B 1EYZA 3DCIA 3GLFA 2ALJA 2LDBA 3O21A 3QLJA 5IXSA 2GM3A 2WNHA 4R31A 4V39A 1ZR4A 2X7JA 3SP1A 1GP2A 3M3PA 3HB1A 1G7SA 1LJ8A 3LUKA 4XQEA 4AJOA 4CL2A 3GARA 3B1XA 3BN3A 1USWA 2I62A 2QXTA 3DFFA 1W0JD 3TWOA 3WLJA 4WLFA 1USIA 1E3SA 4B46A 5M04A 3G13A 2PL1A 3WGLA 3V6MA 3DDCA 3DJYA 3RUEA 5EMJA 4YJGB 3NC4A 3G2PA 5F33A 1SBTA 5F35A 1BNCA 2FPGB 1HDXA 1XDUA 1ZMXA 2ZATA 4M53A 2E18A 1KDZA 3USZA 1L3BA 1BOOA 3A58B 3H97A 3KCQA 4HOYA 4FIDA 3GA7A 5AJVB 3DV0A 4PHTA 1E59A 1UANA 1S2MA 2ZR9A 4IGAA 5J47A 2WG0A 4LBWA 2OBFA 2W22A 1E6WA 2VJCA 3NUQA 4QEZA 3HYSA 1EHCA 3G9TA 4L9WA 5K3OA 2REXB 3DHWC 4GMKA 5I4IA 4G5FA 1KYZA 3WMEA 5KQLA 1ZW1A 3H04A 3KEQA 3CY6A 2ZWMA 4MPTA 5AW9A 1T9GS 3IV9A 4JI1B 3GJ6A 1AS0A 1PFUA 2FDRA 5K3SA 1QHSA 1GAWA 2AXNA 2OB1A 4ASUA 5KTYA 1P5JA 2AYXA 4FEEA 5DNCA 3PRKE 3CVUA 3E7DA 1JILA 3L8GA 4I6JA 1HX7A 1HXHA 1X39A 2G25A 2C84A 4MCHA 3RS5A 1QIJA 3IAS1 2DSTA 4H4EA 4QPPA 4XB2A 3UPTA 4N01A 1LLCA 1M10A 3GJ3A 3Q41A 1EGQA 2GN8A 1G2PA 3BZWA 2FSSA 2VC2B 1CHDA 2VDQB 3NDRA 2W2PA 4NCNA 2H0RA 3R3XA 4B7UA 1YCDA 4RIEA 4OXQA 2ZUSA 3QVOA 3VI3B 1J00A 2E1PA 2BZ1A 1SNYA 2YHBA 4EGCB 1YVDA 1YDHA 1TPYA 5CTAA 3ILSA 3MUOA 3LZ6A 4TLBA 5INTA 4DLVA 4TMXA 1IL0A 2W8BB 2J0UA 5E3IA 1QO9A 3HB7A 4KGDA 4TZ6A 4B3FX 2DQYA 4R9SA 2ZSUA 2HHLA 3KKLA 4ZGWA 3EASA 5H3LA 1ZK0A 2W2XA 5ISMA 3JQGA 4MNTA 2QTMA 4UMEA 1WXDA 4C0WA 4PAWA 1UK9A 5E7MA 3TRIA 4PZZA 5LP6C 4B3HA 3F78A 3OMXA 1Z4QA 5IP5A 3M89A 3OIWA 4X54A 4KQIA 3NIGB 4J1TA 3NKFA 4A36A 4D0RA 5BMVB 2W6ZA 2B7BA 2Q1SA 1A9XB 1TEVA 3FGNA 3K6SB 3PPXA 4OMCA 1NVBA 2B2NA 2JANA 3BFXA 3WJAA 4EPVA 2RBGA 1NOJA 4TSFD 1FP4A 2OBMA 4AJ9A 1QHXA 3MOSA 4AW9A 2CEAA 5EEGA 1QC5B 3OOYA 1V2HE 3B5EA 4Z6KA 1F0KA 3HR8A 3KP1A 4TV8A 1TI7A 4HAXA 5KWVA 4NCJA 4HQ0A 1HE8B 4FZ5A 4MYHA 2PGJA 3THXB 5EJ5A 4TRJA 4CYMA 1KYXA 1ZN7A 5E38A 3IKMB 1S5PA 5ILGA 4KXNA 3TW8B 3FFXA 3PCRB 4KWIA 1WW2A 5IT0A 1LEHA 2LIPA 3QUSA 3S2EA 3H6GA 3TD6A 4EVSA 1RTKA 1GG5A 2A9VA 2KBFA 1CRQA 2P90A 2LWIA 3NBUA 3MBKA 4A6XA 3DE0X 1QQAA 4HSGA 2CNKA 2OGZA 1T1SA 3AEQB 2BM9A 4JLNA 5I9IA 5E6UB 4MP6A 4G0XA 4TRMA 1GTSA 2ZJ2A 1IXYA 2CBZA 1HLGA 1ZVKA 3O38A 1YL5A 3LKBA 4V1CB 4MVJE 3K7EA 1E6MA 1AV6A 3K2BA 2RK6A 2AI1A 3LKZA 3PA6A 1OX4A 1P2SA 1ORVA 1DDOA 3EVCA 3G6KA 3OP4A 5G4LA 3WB2A 1WBBA 3PGLA 4E5UA 4ZZ1A 1U9IC 2FXIA 3QZUA 1J49A 1E92A 1JIQA 1Q20A 1N2XA 1U6KA 3LXXA 1CE8A 2OXFA 4JJ7A 2FPXA 1PZNA 4RPIA 3P2YA 1NBMA 4HVCA 1YS9A 1D3AA 2Y93A 3W05A 5B2FA 4GI2A 2R6GA 1W8IA 2RH4A 1W2HA 2KYRA 4GPEA 4P38A 5E3JA 5A71A 4M38A 3IQDB 4F91B 1CB7A 2R60A 4LNHA 1XEXB 4U7TB 4UNNA 2IOFA 3CZAA 4DJ5X 5BP7A 4K9KA 4H7DA 1CW2B 5EMHA 3FI0A 5DM70 5TEWA 4AP6A 3PE3A 3DLHA 4CCYA 3H4VA 2CBGA 2G0NA 2DPMA 1CY2A 1NXSA 4G1BA 4RZQA 1AKMA 3BXPA 3MB5A 1FJ2A 2PLWA 3KELA 1IBRA 2LNDA 3Q7SA 1H2AS 1PTJA 2QYOA 3O84A 4FW8A 3BX1A 1ORWA 3EDRA 2O4CA 3K9WA 1SM4A 5ALJA 1G20E 2JBHA 2Y1OA 5DULA 4EI8A 2XRFA 5KWSA 4BC1A 2EKPA 4G25A 4A2QA 3W2HA 1CUVA 4GE3A 2DOKA 2FWBA 3NGLA 4ETWA 1UOQA 2HADA 3HWX1 1E66A 2C5GA 3I58A 2J7KA 3BMNA 4JC0A 1VE9A 2ZUBA 3AL0C 2I3BA 2WJ6A 2X9GA 3FX2A 1SU6A 2VWQA 2VXYA 1NF8A 4PSVA 3RK4A 1P8JA 3ZBPA 3ZE1B 1QCYA 5F12A 4F3YA 1UC5B 2JGIA 4TLEA 3RYIB 4AQYB 1P7WA 1GKYA 1OZAA 1K5DA 1T4GA 2JFFA 2QPTA 4MARA 3TZCA 4AD8A 1ZN2A 1T0PA 2A1UB 2JDID 3OIYA 3QLUC 2PQ6A 3F2IA 3FOWA 3JAKB 5FPYA 1AQJA 4UAJA 3O83A 1IG0A 4IV8A 4MULA 3N28A 1C8VB 1SKYE 2NO0A 4RLSA 3T4PA 3I6MA 1GAXA 1TKBA 4WKOA 3C8ZA 3FDXA 3FETA 3UCXA 4CT5A 2GK7A 3KOWA 2QSYA 2M6KA 4DA6A 3ZHZA 3UAZA 4OQFA 3C41J 3DAOA 1IM2A 1MV8A 1WCV1 1P33A 3IMGA 1SB8A 3CLSC 4I5IA 4OB7A 4FYIA 1GPWB 1U11A 1DFGA 2HJVA 3HVIA 2XUOA 4V0ME 2AEJA 3IBGA 4BQOA 3P20A 3QW4B 5IC5A 4UUPA 3P0IA 5DWDA 1OREA 1QGED 4CLDA 3E9YA 3DNMA 2IS1A 1A9QA 3H9QA 2VOEA 5GAJA 3RSSA 4JXKA 3GR6A 3P9RA 4N0MA 3GLTA 3E15A 2HMWA 1FSPA 3QEJA 4XYMA 5A2QA 1GPLA 4YXWD 1BYUA 3NORA 5CVUA 3JATA 3G5AA 3I8SA 2RGAA 2AVNA 3GNLA 3HY4A 3DBLA 4N7MA 3V1KA 1RZVA 5BQFA 4D4JA 2ZANA 5JUWA 1YJ8A 1PG2A 2IRWA 2P5TB 2O7NA 1CETA 3AB3A 3R3JA 4RTKA 3PJFA 4O0MA 1C1DB 3E84A 3HKEB 1KI6A 1NNI1 3NVKI 4L5BA 1BE8A 1DOAA 4QXMA 1GNVA 5FUBA 2J32A 1V1MA 3F5SA 3B3GA 1XCPA 5CT9A 1DAFA 5KQRA 5CFPA 1GPNA 4UTPA 3R3ZA 1FXWA 1G6KA 2V3VA 3KKPA 3R6DA 5LCXA 4AJ2A 4D0SA 2O5CA 1EK0A 3CZ4A 3NBMA 3DMRA 4MEBA 1K8YB 3EE6A 1XRMA 3MXOA 3N8DA 2HNAA 2I8LA 2R00A 2QVLA 5ALXA 3IXQA 2XR1A 2YBDA 2IZ0A 3DPIA 5AKJA 5ALWA 3VR2D 1OLXB 2XQKA 1VSQA 2A1IA 1W48A 1QH1B 3LF1A 3ZV7A 2G9ZA 1YBAA 2HQSA 2QMUA 4UVGA 3U4DA 2OZKA 1E9AA 1H42A 2HA3A 4YT2A 5B7NA 1EWVA 2FE4A 3K1ZA 1EM6A 2H4ZA 4UM5A 2AIRA 4XARA 2ZBEA 4Q37A 2R6CA 1O0CA 4P3NA 3R75A 4TGLA 3AM3A 4MS3A 1C0PA 1GFWA 3N8GA 3DLIA 2MSKA 2OQRA 1V3UA 1GUBA 2BBTA 3C8DA 2ZU0C 1IE3A 5BQ5A 1H2BA 3I5UA 1ZM3A 1E7YA 4RM2A 3ON5A 5DNVA 3A3OA 4IXMA 3BJZA 6GPBA 1KMHB 3TIIA 4XRGA 4JT8A 3R4CA 1LRLA 1S89A 2P62A 2XDQA 4YP1A 3VSAA 1KWGA 2L42A 4ZOEA 4EJFA 1A5BB 3DKPA 3REQA 3I61A 1FA9A 1WMDA 3EAFA 3F9IA 1TAGA 1SQ0A 2IL1A 2O2IA 4JK3A 5AXBA 1XNQB 3ZD9A 4U1RA 1LPMA 1OQAA 1YNOA 4HNRA 2WK1A 2VEOA 3L7KA 3ND7A 3Q9SA 1BGXT 4GR9A 1DC5A 2HRDA 3I76A 4HL6A 3VU8A 4BAZA 1SKAA 3CCBA 3R7DA 3W5UA 4JLUA 4JI2B 1C9NA 3I9MA 3JVIA 4I9UA 4PYOA 4CTJA 3KT0A 4H08A 4XR9A 2FEWB 3LUDA 2DR2A 2Z1DA 1YFZA 1PE0A 2B4KA 2CVOA 2XMSA 3NWPA 2I67A 3HEMA 2EKLA 1O6BA 3LQRA 3L7LA 1PJTA 2QQFA 3D7SA 2O1EA 3P4YA 4B9AA 4ERNA 2Y0BA 3DJFA 2AKYA 4G81A 3DF7A 1FL9A 4OJYA 3CX7A 5KNCA 4PPFA 3EC7A 3SE7A 2C4NA 2X6RA 5BW5A 1L4BA 2JFXA 2Z30A 3PPYA 3EWAA 1H8EA 4Q3NA 1UPAA 2JF0A 3DOUA 3KPYA 4JVSB 4DYHA 4JEUA 3TW0A 4YQYA 4ND3A 3U17A 4CLOA 4B2IA 3D43A 5LUBA 3VBEA 2RKWA 3Q8LA 2QNBA 4MQFA 4RD2A 2R7NA 1PEKE 2WICA 3UWDA 1CKEA 3ZDCA 5G4KA 4EW6A 2FJUA 2WKPA 4ND4A 3ZV4A 3GEEA 3IEKA 2BI4A 3L7YA 4ZQBA 4YAKA 3W1VA 2XUHA 4NSNA 2VRNA 6PFKA 1EEXB 2P3OA 3RUDA 2J46A 1QP8A 4CMHA 2YN4A 4QEDA 2WM3A 1RSZA 5CFOA 7AT1A 4M1YA 4BX2A 3HO1A 1QYRA 2VTBB 3ZQJA 2OYRA 1ESEA 4HDKA 4JI0B 1ZGAA 3RRYA 1HTBA 1I1HA 3SBXA 1E6CA 5FRDA 3IQXA 5JQGB 2Z8ZA 3E0XA 4FSDA 2ZRHA 2YNMA 5E2IA 4N48A 1LNZA 3KXLA 4MYCA 1CVLA 4HAZA 1NBOA 4PGAA 1DTWA 4M3NA 2ZJ7A 3UY4A 4P6VF 4D02A 1HDOA 1PWYE 2V55B 2Y67A 3M6AA 1PEDA 1DJLA 1PNTA 1C30B 1T2FA 3AJRA 2QTVA 4J16A 2F2TA 2CMKA 3W0LB 4BMVA 1CULC 1P2BA 3RVMA 721PA 5AVWA 4MUEA 2YINC 1N6OA 4HGZA 4AO6A 2Q3LA 1J0DA 2DT5A 4PLVA 5H9VA 3SOPA 2RHJA 1P4JA 4CIVA 2H57A 3B1WA 1N3YA 3URKA 1P5RA 2J31A 5KX5A 4J4HA 4EB8A 1JHQA 3I8OA 3DTYA 2WSBA 3IP3A 4QG7A 4R1TA 4WK0B 5H59A 2PBLA 3QLVC 4ESHA 2HNBA 4R1UA 2IS4A 3LP5A 1LK5A 1RXEA 2NPIA 4YWHA 1NN3A 2J4FA 1ORDA 2FJPA 3JR3A 2FLWA 4MUXA 5BRAA 4HDSB 5B7GA 5F2NA 1RWQA 5FUQA 2GDZA 2IH2A 2P4SA 5EP3A 2IELA 4PGGA 1WVMA 1I8TA 1JQ5A 2C7PA 3CF4G 3K15A 4NFLA 1BCSB 1N1GA 1I14A 2TMYA 4IO0A 5H1YA 4IYJA 3DMFA 1X2BA 1I3KA 4AKTA 1OLXA 3UWKA 3ZYCA 1YL6A 3VMMA 2QRPA 1JQLB 2R68A 4O4JA 4WWHA 1DB3A 2WUDA 2QJFA 3ZWNA 2ZSDA 1MVOA 2BKLA 4KDCA 2L2QA 2AOTA 2QT1A 2BRUC 3COZA 1Y8CA 4DZRA 2NYAA 1GFZA 4PZEA 5IG2A 2YS6A 3AMVA 2YXEA 4PCVA 4Q1DA 3UA4A 2Q7XA 1SN7A 2IYQA 3OPVA 4U6SA 4NE9A 2R66A 4BTVA 4F4JA 2FRDC 4LVUA 3PYXA 5EVCA 3WFZA 1ZOSA 1VJ5A 2PL5A 2ZJ8A 5ENDA 4E5VA 3HC7A 4OMFG 4N5NA 4DNFA 1THTA 3QOYA 1IG3A 1BMQA 2J4CA 2GNPA 2HJSA 3AOEA 1W44A 1WZEA 3BFJA 1K97A 5DEIA 5FUWA 1FSFA 4QWWA 1EJ2A 3DDSA 5FADA 1K5GA 1U4OA 3BIXA 3OEYA 3WB0A 2EHDA 2R8PA 3KM0A 3W5SA 3OFNA 1DXHA 1LPBB 2JFUA 2QTHA 4M1WA 2CNLA 2RAVA 5ALOA 3VU9B 1ECPA 1G4UR 1SXJB 4CF3A 1EBFA 1Q1ZA 1V16A 3ZWXA 3SIXA 3GEPA 1DKMA 1P3JA 3VR1A 4PAGA 1BDMA 4WLOA 4Z4GA 1CF2O 5J63A 2I2CA 3HWRA 1FUKA 1PSDA 3AHEA 4HMPA 4YJKA 4BVHA 5KKNB 1QNFA 2PXAA 3IESA 4ZC8A 1KPHA 1KI4A 3KSMA 2ZT6A 3MINA 4M9UA 1VKNA 4BFUA 2GKOA 2WD7A 2BFCB 3A1NA 3D1LA 3V3TA 1Z5NA 2IYYA 3IULA 4HPJB 1BOFA 4RMJA 5GTDA 2EFCB 2GBGA 3DTTA 1OTHA 4PV7A 4UHJA 3WWYA 3TGPA 4TLAA 4LX8A 2ZIXA 2WR8A 4UHKA 4ZU1X 1H2RS 4OB6A 3NPMA 3F7OA 2EVWX 3M83A 4G8CA 2P27A 4MP8A 3AVPA 3OZTA 4LRSB 5AHWA 2EC5A 4P54A 2QZSA 4QFBA 3WK8A 3L4SO 1ZUHA 1XU7A 3IFSA 2R3SA 3F7MA 3CUUA 4TL8A 3RU2A 3A9UA 2P30A 2X1HA 4G4GA 4OUKX 5F78A 5HZMA 2OK7A 2PMCA 4IICA 4K8OA 1IDOA 2AWNA 1WZNA 1YHNA 1TZJA 4UEKA 3EIHA 3E35A 3KEOA 2WABA 1JFVA 1DX4A 1CQZA 1Z8HA 3ZOKA 3D2BA 4Q9NA 2REBA 5EY5B 3PV0A 4GI7A 5F7JA 1NBHA 3WLKX 1NW7A 2REQB 2P2LA 4BDTA 3NM6B 1NMXA 4U3JB 2GD1O 4KAXA 1TO2E 4RM3A 2PUEA 4NXMB 1W52X 4GMGA 1QZTA 4Q3AA 2VKQA 4E5NA 1AQUA 3LLVA 4WNIA 3PXBA 4CHTA 2OFWA 3FFTA 3U60B 3HSYA 1UK7A 1Z38A 1NXWA 2XH8A 4RZIA 3V55A 2JGDA 1PIWA 4PGFA 4XDYA 5TGZA 4DG8A 4DHWA 1KO8A 2Y6VA 3SGLA 2EFHB 5K7SA 3OD5A 5EE5B 4O5OA 4HRYA 1S02A 2EG5A 2HOQA 4Y1EA 1CCWA 4RIHA 3I30X 1U0NA 2QTBA 5F2OA 2XMCA 2P4UA 1IZYA 1U94A 2QDXA 2VPIA 4Q1CA 1PHPA 1SWVA 3A06A 4JB3A 4JGIA 2ZDGA 4O5AA 1OLOA 5CA0A 3TSCA 5BNZA 3DLBA 1EX1A 2HLHA 2R1VA 3GRPA 3TZKA 2HFJA 2IYUA 4LJ4A 3RU3A 4EHDA 2HMYB 5KDDA 3UK6A 5L6MB 1I9GA 1YUMA 3VR6D 3X1WA 2ZI7A 3VO8A 3KPWA 4DLXA 4TVBA 3DE3X 1YJCA 3LH5A 1Z4KA 4CF6A 4Y6RA 1GGMA 4ZVMA 1VJ0A 2OGUA 5F3DA 4UBLA 3TVTA 4J0FA 3JTMA 4PPGA 4AXXA 1A9RA 2BL4A 1R7RA 1W1UA 2XHZA 3D7KA 3LLMA 4IIHA 2NADA 4G5QA 4A2PA 1K8RA 3IMFA 3RSZA 3JQQA 4C6TA 1N4DA 5IF3A 1C5KA 2BT4A 2EATA 2WD7B 5G53C 3GLGA 4MKIA 3RC9A 1V8BA 4JFRA 2G5TA 1PV2A 4EY5A 2OCKA 1IQRA 1QMGA 3AF4A 3R5XA 3NX4A 1CG6A 2FPPA 2Z3ZA 4A2WA 4LDNA 3LQ1A 4MUKA 4GL2A 4O29A 1I36A 5HCUA 3W8NA 3ZUPA 2I1WA 4QU8A 1AHNA 4XLZA 1M2VA 1T15A 2YJGA 1CY1A 1NXQA 3AHGA 2GHIA 4BNGA 3RROA 4JXXA 2QUKA 5E1BA 4NG5A 3RRJA 1X74A 1NJ8A 3H6KA 1A9XA 4R84A 4BBAA 2V1UA 4CQMD 5JATA 2Z56A 3QXXA 4V24A 3QI2A 2EYQA 2GBLA 3R77A 5K20A 2R6HA 1P9RA 3D0OA 2JAUA 3GCXA 1Z6YA 4N65A 1ML4A 1W9HA 1V9CA 2QI9C 3I4LA 3LT2A 4YP6A 5I9TA 5BO5A 5IULC 3RD5A 4IMIB 1LQTA 1V7CA 5C5DA 4PYQA 2NZ8A 3L7CA 1QB8A 3KTOA 2OP0A 3UTCA 4EYEA 2R9VA 3CLRC 3G0OA 1AV7A 3FDZB 3IUNA 4JEIA 1MNQA 4AZ0A 2GZHA 4N3BA 4KC0A 3X44A 1ABBA 1SURA 3IEPA 1XZNA 3K1YA 5BVHA 3ZWMA 2CJXA 4EA6A 2C2MA 3C1UA 2FPLA 5BYKA 1D4OA 2AFIB 3KYDA 1CUJA 2JLSA 1LF0A 4IY1A 5SZKB 4R6WA 3WNVA 2E5FA 4EHKA 1V4NA 4PPYA 4D6PA 2WPDA 5D5QA 4ZI3A 2W37A 3I6ZA 3Q12A 5I4KA 4RV9A 4TRNA 1EVKA 2CL5A 3IUMA 2EXXA 3LUHA 1X87A 1E2PA 4N5IX 4TV9B 3GMIA 4I2VA 1NM5C 5LA6A 3HKEA 4MEJA 5EIWA 3AR8A 1GTL1 3PEVA 3UB3A 5HJEA 2QLJA 3QWFA 5D3MA 3H2BA 5BSMA 3USES 3ZZ1A 4DABA 1R88A 3L8MA 1Y6FA 3JRXA 3Q72A 4WESB 3HUDA 4BO7A 1MIOA 2ZIWB 2J6HA 1FTSA 1GCAA 1M33A 1PF7E 3M3DA 2AMVA 3ZGLA 4E1VA 4DXHA 4DA7A 1NKSA 3E70C 4KYUA 3OQPA 1J56A 3NXSA 3VM6A 2HIGA 4YPVA 2YZGA 4FFLA 3A6HA 3NHUA 3ZPXA 3F3YA 3TS1A 3ZI4A 1TUBB 1WABA 1E3EA 4CLRA 3N8IA 3DDWA 5EKUA 1QXSA 2BEVA 2R8EA 3C43A 2FOLA 3C6MA 4P86A 1PZXA 1FPQA 3MCVA 3N0VA 3OTGA 4TWRA 4BUCA 2BJHA 1Y63A 1WBDA 1K7FB 4D98A 1Z7YA 2FWAA 1XEWX 4E5DA 3G59A 1E0JA 1GG2A 1IVYA 3QBEA 2I7XA 1FIUA 1QVAA 4GPAA 3U6KA 2NNWB 3TMKA 4EY8A 2DWUA 5DTMA 4OGFA 2HIAA 4Q4HB 1ZVMA 2KHZA 5KYYA 1V16B 4IMPA 1RHUA 5DASA 2B8EA 4H31A 2QRJA 1WXWA 1JLKA 3HZOA 1F60A 2XX3A 3I04M 2ERXA 4BCCA 4Z86A 5E9AA 4RD6A 4RLHA 1D1PA 5JQGA 3JRWA 4YRPA 4MW4A 2Y1XA 1GNLA 3FYUB 5E9QA 3BZUA 1Y81A 1L8AA 1Y0BA 3HJCA 4AVYA 4BHTA 2O7SA 5EWLA 1VCMA 1IBCA 3FLMA 1NU6A 1JSZA 1WCXA 3MLEA 1GZ4A 5TEVA 3TTYA 3ZWPA 2X2PA 4QBHA 4RJTA 3VC3A 2AMFA 3NVAA 4H7HA 3TOZA 4E5MA 1MC1A 1BKSB 4NBTA 2GERA 5G0TA 1P6UA 3KD2A 3L6CA 2BEUA 4NBKA 1RNLA 1Z39A 3LDAA 3O3MB 4OHXA 5CVCA 4B9EA 2Z04A 3GA5A 3ZGOA 2DLCX 1ZD2P 3PFCA 2FPUA 1NI5A 3OQVA 3BDAA 5FI1B 2VF2A 2PCLA 2PVCA 1W46A 3B9PA 3T1QA 1ODKA 5HSGA 3HN2A 1FOEB 2QPOA 3EQ9A 2J0EA 2COUA 3HK2A 4K87A 5FUMA 4Q3LA 1NKTA 2GASA 4MA4A 3RAGA 1KEKA 3WWOA 3U1BA 3UPUA 3ILXA 2AMJA 2VJOA 4M7PA 3ZGXA 2JRCA 3L18A 1UBOS 2W6JA 5J2UB 1LQUA 2WAXA 4DL9A 2WJ4A 4MPRA 4X1YA 1KC3A 3F5QA 3VYSB 5DK4A 3CT4A 1SFRA 3O95A 5ALYA 3BIFA 4UFPA 1AC5A 3N3BC 1O95C 1XZDA 3UJ7A 5I4BA 4MHOA 3VFDA 2CD7A 4BIIA 4N6NA 2FR8C 3EXHB 2P2YA 1ZD9A 3IO5A 4WY2A 5FI5A 5J4KA 2D2VA 4TYYA 3NOOA 1BFDA 5JSHA 3SXJA 3MGGA 3M4NA 4GP9A 5D1NA 2O3QA 3B38A 2ZI6A 3M8KA 4A0HA 4JC5A 1EPUA 3H5VA 2NSLA 4IX1A 2QV7A 4O4HA 1XI2A 3LBYA 3IDQA 4O4JF 4RPJA 4R05A 3VSBA 2H1WA 3NXKA 4I46A 3FFAA 3DW3X 4L50A 4MGZR 1M6HA 1C7IA 5LMCA 3LM8A 1YIDA 2CB0A 2A4MA 2XVZA 4UHHA 4NV3A 3OJFA 4A16A 4OJQA 5BMVA 4AXBA 1FYXA 3HXLA 4IDPA 4FHCA 2Q0XA 2DQSA 4PNPA 3IGFA 3P9YA 3GX1A 4JT9A 3THWA 1M1ZA 5TE9A 4K1XA 2WFLB 2RGRA 3K1AB 4IIUA 2FF5A 5HE9A 4BV3A 1FFYA 2RB4A 1UP7A 1VMAA 3EODA 4EENA 1XCGB 4BX8A 2WY2D 3KJZA 1K75A 3TE7A 1RP1A 3F98A 3K16A 5KKAA 1C7FA 3MXTA 2F3RA 3MSXA 3Q5EA 1KZ9A 2BUCA 4RETA 4BP3A 2AF4C 2ZB2A 4KXLA 2O48X 2OTCA 4GO1A 3JCZA 1VI6A 2Y27A 4BGUA 4D8WA 3JQ8B 5CCEA 5HKKD 3A9CA 2SBTA 2Y4NA 3KETA 3A2KA 5LP6B 2OO5A 3G8BA 4LWZA 2NSYA 5J5AA 3SQNA 4IDGA 1T5IA 4BMYA 1HPLA 2F3QA 3K94A 1DE0A 1XZIA 4BGEA 2VQ3A 4GKBA 2P8SA 3BB3A 4LKRA 2BMDA 1R6UA 1CR6A 3R8CA 3LTNC 4AUEA 1DADA 4RZXA 3HCRA 1Z22A 2NV2B 5BQPA 1EFVA 5A7HA 4F2GA 2BISA 4G1UC 4X6XA 4YT5A 5J2TF 4RDXA 5FNVF 3QE9Y 3AC0A 4R3NA 4WA7A 1SAYA 1T1IA 4ZVPA 4F5EA 4MQMA 2P0YA 4FUTA 2B3TA 3QNWA 3IAFA 1EE9A 4GSYA 3I73A 4BFCA 4LF6B 3MWDA 3T9BA 2HLNA 4BPBA 3H05A 4R41A 3O90A 3ZVLA 2HWUA 1HSZA 2YCLA 3KFXA 3WY9A 5H8WA 4XUDA 4IFIA 5CXSA 4K28A 4PZ9A 4QXQA 5IAOA 4K03A 1QFMA 5D01A 2E4AA 3QIAA 3JAWA 4UD6A 3S8MA 3ZWAA 4OP2A 4QPNA 3IP6A 4ARAA 5L3RA 1Z74A 4GOMD 3MFQA 3WOVA 1H9AA 1TDJA 1Z0AA 1RQXA 1RM3A 2N47A 1KAEA 3Q5DA 5JAMA 2JCXA 3IVMA 4HFRA 5C3MA 1O6FA 4U3JA 4NZ9A 3MELA 5AJUA 5IKPA 1N2GA 1L0BA 4L95C 1NDQA 3B1FA 1HFKA 4NCKA 1CUEA 4GX2A 1PK9A 2HYIC 4IOJA 1RKUA 4NY1A 4BVFA 4TN5A 4ND2A 4TN1A 3ZS8A 1J5PA 2QAGC 3WL4A 4PLZA 3VHXA 5DBIA 2AE2A 4QLBA 4CIYA 3KTFA 3EIEA 1WXGA 2CDNA 2OFXA 5B5SA 4TWZA 2YWBA 4UDNA 1Q19A 1TX4B 4O2RA 4URZR 5IJ9A 3HXQA 3KQKA 1XKTA 1QP0A 1OY1A 1EUDB 2PWBA 4BNMA 4JEMA 1H0KA 4X63A 3H3JA 3RRBA 4PIPA 3H1TA 4YMSA 1CEQA 3ESCA 1ATZA 5JNRA 4R8VA 2G70A 1M3SA 1OT5A 1YSCA 2N9UA 4UNSA 4BNUA 3B12A 3ZR4B 5ITZB 2QMEA 2ET6A 1MRZA 4HZUB 1KMCA 3L1KA 3I2IA 4UBOA 3TFOA 1FJGB 1DRJA 2EGGA 3MINB 3SJBA 2I2AA 1PNQA 1F48A 3NO4A 2A86A 3ORHA 5EIAA 4FZJA 4J0DA 4M49A 2H4HA 3GUCA 2F59A 3K5HA 1ITZA 1F5NA 3DTVA 4NPAA 2VYCA 4YCSA 1KFJB 3V46A 4EB3A 3JTEA 3HJRA 4R1LA 1NRJB 3ESAA 5HFAA 3U81A 4ENWA 4ODIA 5SZHB 2AN1A 3FOCA 3K1TA 3FUWA 3MC1A 2WJIA 1YQEA 3PEWA 3ICWA 4C7JA 3C87A 1Y3IA 4FMDF 1JYFA 4IQ4A 1Y7PA 1ZL0A 3FDIA 1TQ8A 4TKUB 2FG5A 2CJWA 2ZBVA 2XB8A 3V1LA 2I4RA 4FE7A 3AKEA 3STYA 4C1NA 4MQBA 1L4FA 3ODGA 3PD0A 2NGRA 4D9GA 4A0GA 2HRZA 3HSKA 4N0EA 1SZPA 1WTAA 2GB4A 2GCPA 5B64A 1EWQA 3TLBA 5CLHA 2CLHB 2PX5A 4I8IA 5LLSA 4BOYA 3PG5A 1Q0HA 2A1TS 4R81A 5EUMA 1T8PA 3FAZA 3V8PA 1N1MA 4YFVA 1UZMA 1ZMBA 3FCUB 1WX1A 1A8HA 1NQVA 1QV9A 4FT4A 4AWXA 3RM3A 2I4IA 3AIIA 4ZRNA 1JHVA 3VO2A 1TD1A 3D7RA 3EUWA 3C3EA 1R0BA 2GM5A 1JU4A 4GM1A 3R23A 3D0QA 3EOZA 2QM0A 4I1SA 4MS1B 2G80A 4K88A 2XUDA 3T0IA 1M1XB 3TB4A 3TUZC 2WM2A 3GHHA 1IDN1 2R751 4W1RA 1R9NA 3PA8A 1V5GA 2GJAA 1KP9A 4WZBA 2NZ2A 2UYYA 1N2BA 1EI9A 3TFWA 3O8CA 5TQ0A 4JSYA 3UAOA 5C5EA 1VC2A 3OMLA 1JAYA 1RMQA 4KHZA 3WIDA 1F3LA 4ZYWA 4PICA 4WOCA 1G3MA 4INPA 2TMGA 4QATA 1UT8A 1TF7A 2FGKA 1E6LA 1OZGA 3DE4X 4FT2A 4PLTA 3SSMA 1DARA 1TYCA 3HBMA 3QLUA 3T0FA 3WBJA 3ZU6A 4EITA 1CJTC 1F38A 2BUBA 1YQXA 2CLOB 5T64A 3X1MA 1YMUA 5JJLA 1JEYB 1LDYA 2CNOA 2R4UA 1N9ZA 1S8AA 1EM8B 3K9BA 4KKXB 1JQBA 2IZOA 1NLZA 1U7WA 3HSSA 3M1YA 4TV9A 3V3KA 5H4GA 2HV8A 5EL0A 2BGUA 521PA 4AWAA 2XBMA 1E2IA 3CUWA 6AT1A 3Q1LA 1P1KA 4KFRA 3HJAA 4FGUA 4AZWA 4D99A 3C7DB 3BXOA 4G1MB 3VPDA 1KGDA 4MK4A 4DIUA 5KEIA 2NTYC 2QM7A 3EH1A 4G01B 4OBXA 2BHTA 3RI3A 1XLTA 3LX5A 4DSTA 1UXHA 2G9UA 3JQBC 2PJRA 4J1NA 1YU6A 3QA3E 1E60A 4LCEA 2JKYA 3V7UA 4X6LA 2GPSA 2I2WA 4Y9RA 3RUCA 4LISA 4B4WA 5JAPA 1U0BB 1YC2A 3PGKA 4J7CA 3FGPA 1O58A 3HM2A 5J4VA 1HA3A 5CDHA 3EF1A 1K0FA 3TOVA 1GPYA 4IVQA 5GGYA 2CUTA 2B94A 3FNGA 3HJTA 3OWHA 1QIMA 2V6MA 1Q6YA 5ETJA 1YKGA 2B98A 3MWGA 5EKXA 2JIQA 1VL1A 4ZIRB 5EZSA 5B36A 4O8CA 1SD2A 2ZBPA 2FOXA 4KTTE 3U44B 1TJ4A 3CWZA 3DEYX 3H5AA 4YIKA 2WIKA 1C7EA 3OFND 1KSJA 3GRUA 3QWIA 1RAGA 2FQXA 4HP8A 4REMA 5EMLA 5NULA 3W1EA 1CUHA 1VJTA 3H8JA 2PWPA 1ZMTA 4ZQCB 1DAMA 4BX3A 1Z5WA 4Y6PA 2WUFA 4CF5A 2QRNA 2IE0A 4NOLA 5GJVC 3JZDA 3QFFA 3JQAB 5CT6A 1P91A 3EXG1 3UF0A 1I7LA 4BFXA 3NS7A 2VDVE 2BEWA 4JJ8A 1O87A 1NURA 4HG2A 1AF7A 1MCZA 2AR9A 4WBXC 3O1JC 4XD7D 2YXPX 3SAJA 1GRCA 5LFAA 3W5DA 1MFZA 2C2YA 4PCLA 5EP2A 3RC3A 4OLJA 1GOTA 2MR5A 3K6JA 4EMSA 3WC4A 5E4YA 2ECOA 4Z7NB 1WAMA 3IR5A 4LFAB 3OY2A 3NHSA 2XOEA 3Q10A 3OOSA 1U2EA 4ISBA 4N3AA 3E3OA 2ISCA 4NYJR 2JAHA 5ARCA 2OXTA 1W36B 3PC6A 1XJ5A 3L06A 3P0HA 5JNWA 1Y8RB 2EX4A 2WV9A 2QF7A 3TSAA 4MUBA 1QFZA 5DNEA 4NENB 3DOEA 5MF6A 1UBRS 1E9VA 1UIMA 1NV8A 4OGGA 1F14A 2VJLA 1QQ7A 2R6ZA 3ZEIA 3GLIE 3LZDA