3HA3A

Crystal structure of hma (mmaa4) from mycobacterium tuberculosis complexed with s-adenosylhomocysteine
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
281
structure length
281
Chain Sequence
b'IQAHYDVSDDFFALFQDPTRTYSCAYFEPPELTLEEAQYAKVDLNLDKLDLKPGMTLLDIGCGWGTTMRRAVERFDVNVIGLTLSKNQHARCEQVLASIDTNRSRQVLLQGWEDFAEPVDRIVSIEAFEHFGHENYDDFFKRCFNIMPADGRMTVQSSVSYHPYEMAARGKKLSFETARFIKFIVTEIFPGGRLPSTEMMVEHGEKAGFTVPEPLSLRPHYIKTLRIWGDTLQSNKDKAIEVTSEEVYNRYMKYLRGCEHYFTDEMLDCSLVTYLKPGAAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHOXY MYCOLIC ACID SYNTHASE 4
publication title SADAE, a potent bisubstrate inhibitor of mycobacterium tuberculosis mycolic acid methyltransferases
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 101
structure length 281
sequence length 281
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02353 CMAS Mycolic acid cyclopropane synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ha3A00
4F85A 5BW4A 3TPZA 2UYOA 3C0KA 3FTDA 1VP9A 5E1OA 1KIAA 3ELUA 2YXLA 4YUZA 3P9KA 4ISCA 9MHTA 3OE4A 2K4MA 3P71T 1I1NA 5EMLA 2AN4A 2GB4A 3KQYA 3REOA 3CJRA 3I9FA 4QVGA 3B7PA 1NW8A 3EGVA 3RODA 3UJ6A 3WSTA 1WS6A 5FHQA 3HA7A 5K0LA 1YZ3A 1VLMA 5HZMA 3GU3A 2B78A 3LCUA 3M4XA 4RTSA 2I6GA 3BKWA 1DCTA 2GS9A 2VS1A 3JWGA 2BR3A 5EQJB 4E2XA 3NWEA 4HTFA 5JUWA 2PV0A 2PXAA 2Q41A 2O07A 2LD4A 4DF3A 3EPPA 4GC5A 7MHTA 3FPEA 2EJTA 1SUIA 2ZULA 4AZWA 4U7TB 3G89A 4RTNA 1Y8CA 1KP9A 2FHPA 5CVVA 4BLUA 2A14A 5CD1A 5HIJA 5IH3A 3E23A 4DZRA 5T64A 2Z6AA 3FRIA 1G38A 1L3BA 2OO3A 2PWPA 2ZZMA 4M37A 4BP3A 5EMJA 4ZTBA 4DM3A 1SG9A 5H02A 1KPGA 3GDHA 1RI2A 2XYRA 3P97A 2AOWA 3NDJA 3ANXA 3FTFA 4RVFA 3KQVA 4OX9Y 3PS9A 2OB2A 3LL7A 4GOLD 1RJEA 2BZGA 2JH8A 3FZGA 4GBED 4C04A 5K03A 3CJTA 3OU7A 4GQBA 5E2AA 5FULA 4RTLA 1SUSA 1UWVA 1G8AA 1XVAA 2PJDA 4HRAA 5DX8A 2IH2A 2ZLBA 1WZNA 4PIMA 4Y2HA 5EMMA 5K0NA 4RX1A 2Y1WA 4C08A 2Y1XA 3PFGA 2VDVE 2ZW9A 1O9HA 5DLYA 4AX8A 3I5UA 5EZSA 3F4KA 3MHTA 3LX6A 2C7OA 3GRUA 4PYJA 4IKPA 4H0NA 3U81A 4WXHA 1F3LA 5FA5A 5FUBA 4DCGA 4F84A 4GEKA 2XYVA 3B3GA 4PYIA 4YMGA 1X1AA 3EVAA 3GRYA 4AZVA 4YUXA 5GIPE 3LCCA 4HSGA 2BM8A 3A25A 2P3QA 3NVKI 3PFHA 3LHDA 1Q0SA 3KR9A 3SXJA 4BY9E 2BM9A 3G8AA 2ONYA 3R9XB 1JR4A 3UJDA 3R3HA 3EGIA 4KDCA 4A6EA 1JTFA 3SSOA 1U2ZA 3LDUA 3P2EA 5DSTA 5HILA 1P1BA 5HIMA 5GIOE 2I62A 2PX5A 1SKMA 2WA2A 1XJ5A 3CGGA 3I58A 5K0GA 2EFJA 4M38A 3EEYA 4DQ0A 4E70A 1EG2A 1X19A 5FADA 1G60A 1L3CA 1NW3A 2NXJA 3A26A 3HA3A 3OZTA 2AN3A 1AQJA 2VP3A 3OFJA 4FGZA 5DX1A 5FWAA 1BC5A 1VL5A 3UJCA 2P3LA 2PSSA 2PVCA 3MTIA 3OU2A 3UJBA 4GF5A 2NXNA 1RJDA 2VDUE 1NE2A 1V39A 4RVHA 3DXYA 4UOEA 5K05A 1D2GA 4PYLA 5T67A 1KPIA 4MWZA 5LQJA 3R6TA 3O4FA 4YUVA 4PGHA 2ZIGA 4QDJA 4E2ZA 4C4AA 5JR3A 3PB3A 1ZG3A 1Q0TA 3G5LA 3PX3A 3M33A 5DTMA 5EKUA 1YUBA 2B3TA 2H11A 2ZBPA 1FPQA 2JJQA 3JWIA 4PCAA 3HTXA 3EVGA 4EVIA 5F2NA 3MGGA 1SVUA 2FRXA 4C06A 1XCJA 5K0JA 3KQTA 4B17A 4LWOA 4FR0A 5HOQA 1WG8A 3HCDA 4RTKA 1P39A 3FTCA 5EC8A 3FPHA 3P9IA 4PNEA 4PYOA 1R8YA 4MTLA 4KVZA 1KYZA 5EHIA 4DKJA 5DM1A 5EG5A 4XUEA 1EQAA 1HNNA 2G70A 1TPYA 5CUQA 1YF3A 10MHA 3DUWA 1L3IA 5CM2Z 5GWXA 1XDSA 2OXTA 4RTQA 5CCXA 3HM2A 3O7WA 3A27A 5DSXA 4IV0A 3VSEA 4OQEA 3EVBA 5M5BA 3DMHA 1JG1A 3UA4A 2HV9A 3CBGA 3K0BA 4CWAA 2OZVA 1BKYA 1Z3CA 3DOUA 2Z6QA 1NW7A 1I9GA 1JQEA 1P91A 4P7FA 4DMGA 5BP7A 4XUCA 1KHHA 3V8VA 5KQRA 3SX0A 3UJ7A 5K8VA 1RJGA 5LQAA 2NP6A 5ICFA 5CCBA 4QQKA 2O57A 5E1MA 1JTEA 3KR1A 3T7TA 3DLCA 3BGIA 4E33A 2C7PA 1T43A 5DM0A 4GOMD 1KXZA 1NV8A 1QANA 3GNLA 1D2CA 3UFBA 3ME5A 5KQSA 3M6WA 3MB5A 5DT2A 3EVZA 2PT6A 3TKAA 3C6MA 5HEKA 2ZBQA 3ER8A 2O06A 4GOND 3SSNA 5D1HA 3IEIA 2FK8A 2ZIFA 3HP7A 2OY0A 2PX2A 3DP7A 1YB2A 2UYCA 3P8ZA 4FS8A 4YV2A 3UJ9A 5K0FA 4Y30A 3KQQA 2BH2A 2AVDA 3EVDA 2B9EA 4V0QA 3ELYA 1SQGA 3SGLA 1M6YA 2GAFA 4FZVA 2H1RA 2XYQA 2ZBRA 5E9QA 1VE3A 2OBFA 3G7UA 2F8LA 3OZSA 4XUDA 3GGDA 2PWYA 3B3JA 3HCAA 4QTTB 2OB1A 4OA5A 1ZQ9A 5FQOA 1ZKDA 4RTOA 3FPJA 3KPUA 3HVKA 3EGEA 4PCLA 4FT4A 1XCLA 5FCDA 5C9ZA 4A6DA 3UWPA 1RI1A 2P1DA 1VPTA 2G72A 3LECA 5LSAA 4POOA 2C7RA 3HCEA 1G6Q1 3QOXA 3TKYA 4AUKA 1YFLA 3CC8A 3I53A 3M70A 3FUVA 4M7RA 1PJZA 2OPBA 4LECA 5C1IA 3ORHA 1IM8A 2YXEA 4HTFB 5ICGA 3DR5A 4AZSA 2AOUA 2PGXA 3BWBA 5DM2A 3KPWA 1EIZA 2YX1A 4GUAA 5FHRA 3PLAE 4JXJA 2ZWVA 4FSDA 2IH5A 3FTEA 2DPMA 1ZGJA 2EX4A 3BGVA 2IP2A 5EIFA 4QPNA 1ZGAA 3EEOA 4R6WA 3K6RA 3KQSA 2FK7A 3L8DA 3VC1A 5LQNA 5HIIA 1DUSA 2YVLA 4R05A 4ER6A 2PKWA 3FPGA 1TW3A 3BKXA 3FUXA 3KPJA 3B5IA 3OU6A 3PT9A 1BHJA 2OKCA 3DULA 1JSXA 2EJUA 1JG3A 3LDFA 1VQ1A 3OFKA 3BXOA 4V0RA 2P41A 2XVAA 4XCXA 4E30A 3TOSA 2G71A 5K0BA 1QZZA 5GINE 3LDGA 2P3OA 1L1EA 4BP1A 2PT9A 3TR6A 5EVJA 1ZHFA 1JQ3A 1R74A 3MERA 4PIPA 4DA4A 5GM1A 1QAQA 5K01A 4X63A 2AOTA 3SVZA 3G2QA 4X61A 3O31A 3B89A 2IIPA 2IPXA 2IH4A 3E7PA 1MHTA 1R00A 1JQDA 3TFWA 1D2HA 3OE5A 4PYKA 1RJFA 5GOZA 3KHKA 3IV6A 2UYQA 5CVEA 3G8BA 1DL5A 4QVKA 4U7PB 2FCAA 2IDKA 1FP1D 2P7IA 4FP9A 4KIGA 3SSMA 1SQFA 3ELDA 3HVIA 2NNWB 4C05A 2G1PA 5ERGB 2PXCA 5C0OE 3UJ8A 5LQCA 3G2PA 4EK9A 2GA9A 5KS2A 2CMHA 1L9KA 2XVMA 3T0IA 4E2YA 2HMYB 1XDUA 2QY6A 4RVGA 3AXTA 2CWWA 4M36A 2GLUA 5ICEA 2Z6UA 3KR2A 3SR4A 2ZZNA 1PRYA 3OZRA 4CTKA 3BZBA 5E1DA 1RI4A 3GRVA 2QE6A 2PBFA 4OQDA 5ICCA 3P9NA 4PWYA 5EZQA 2AVNA 5FWDA 1VP3A 3T7SA 5DXAA 2AOVA 1RI3A 3E05A 3UBTA 5CVDA 1WXWA 5CVJA 2QRVA 4KIFA 4RTMA 2CKDA 4GC9A 4PYQA 2B2CA 3I64A 3IYLW 3QV2A 5EGSA 5FA8A 3HA5A 3C6KA 3MCZA 3TRKA 4AZTA 3KKZA 5T6BA 2YTZA 4ER0A 3AXSA 1JSZA 3A4TA 3GRRA 3LKDA 4QTUB 2JG3A 2B25A 3BT7A 3R24A 3C3PA 3FRHA 4P58A 3TMAA 3G2MA 3JWJA 4EKGA 2ONZA 3S68A 4EKIA 2PXXA 3UJAA 1JG4A 3G2OA 3CVOA 2ZZKA 4RV9A 1AV6A 3HCFA 1WXXA 2IDJA 2YXDA 3BWCA 2AR0A 1O9GA 3KQOA 5E9WA 3GRZA 3THSA 1YFJA 2JH9A 3LBFA 3BUSA 3LSTA 4R8SA 3P2IA 3C3YA 2EG5A 3HNRA 5LQUA 3KPYA 1NV9A 3DLIA 3RIEA 4MHTA 3BWYA 4ER3A 4HC4A 1F38A 1YZHA 2ZWAA 3B3FA 3BWMA 5EIWA 3DTNA 4HGYA 5LR6A 1UFKA 4KRGA 2WK1A 4P7GA 1QAOA 5DTQA 5MHTA 1EAMA 4ATNA 3BGDA 2E5WA 1EJ6A 1NW5A 4PINA 1INLA 2HR1A 3FPFA 2FPOA 3TM5A 3TM4A 2R3SA 4QPPA 5EMKA 1AQIA 2ZCJA 4YV0A 2O0LA 4YUWA 4RYLA 5E2BA 2PLWA 2AOXA 3LCVB 3UA3A 3HEMA 4YV1A 4RTRA 5GP1A 3VYWA 2P7HA 1G8SA 3EVEA 3MAGA 1B42A 3NJRA 4X60A 5DX0A 5F2OA 5FQNA 5KYGA 5P8WA 2VDWA 5CIYA 1NKVA 4YUYA 3M6VA 3H2BA 2WA1A 3UZUA 4HGZA 5E9JA 4CKEA 3PTAA 2BR4A 5U4XA 3GJYA 5KVAA 1G55A 1KPHA 3NDIA 4P7KA 2YR0A 4RWZA 3TQSA 1XDZA 1N7JA 5HIKA 5HFJA 3FUTA 4LG1A 4CKBA 3T7RA 3V97A 3OCJA 2AN5A 4FT2A 2ZIEA 2PX8A 3MCTA 3AY0A 3P2KA 5GM2A 1AF7A 2NXEA 5BW5A 2HNKA 4CXMA 3MQ2A 1WY7A 5E8RA 1FBNA 4MIKA 4RTPA 1FP2A 2H00A 1NBHA 4E2WA 2P35A 1XXLA 3FYCA 2C7QA 4E31A 5K0EA 3KQMA 2YUIA 2HTEA 2AZTA 1NW6A 2ZFUA 2KW5A 4KWCA 5DWQA 1JG2A 1HMYA 3HVJA 3EVFA 5DRTA 3HCBA 5G02A 2PY6A 3DH0A 2HWKA 4R8RA 3GWZA 2AS0A 3CKKA 2QM3A 3KQWA 3GIWA 4X1OA 4FSXA 4BLVA 3SMQA 5FTWA 1H1DA 3VC2A 3ID6C 4ER5A 4KW7A 1OR8A 5EKXA 5IKMA 3KPVA 3GCZA 1M6EX 2IFTA 5DTRA 1QAMA 1TW2A 3TLJA 4PONA 3NMUF 3G5TA 4GOOD 4CKCA 3FUWA 3DXZA 3HVHA 4MQ4A 1ORHA 5E1BA 3Q87B 3LBYA 5F2KA 3KQPA 3RW9A 1MJFA 3GO4A 1N7IA 3EMDA 3KR0A 5DPMA 3LPMA 5K09A 4WVLA 5E8JA 4R6XA 4HH4A 3A7EA 3HCCA 2JHPA 4NECA 3ERCA 2UZ4A 3A7DA 1ORIA 3M6XA 4QDKA 3IHTA 1X1CA 2P40A 2AOUB 1O54A 2JHAA 3AJDA 2VZ9A 3NWBA 5DM4A 5B1SA 1NBIA 4CTJA 2ZSUA 1R18A 1X1BA 4BLWA 3ER9A 2IBSA 5CVUA 2UYHA 3QOWA 5K0CA 3NW9A 2ADMA 3R0QA 5LQKA 3FUUA 5EEHA 3LKZA 3M6UA 2YQZA 2V7EA 5EPEA 2PX4A 2NXCA 4X41A 2GPYA 1VIDA 1IY9A 1FJXA 4O29A 3SM3A 5EEGA 4E32A 4RVDA 4RTJA 4P7JA 3DMGA 3E8SA 3NVMB 1IXKA 1KR5A 1UIRA 3CCFA 2IBTA 3PX2A 3THRA 4L7VA 4RSRA 3EVCA 2QYOA 1R6AA 2AOTB 3MTEA 2O05A 2FYTA 1EJ0A 1I4WA 4HG2A 1M0EA 3DMFA 4OBWA 1VBFA 2GH1A 2I7CA 3EMBA 5EOVA 1R8XA 3AWIA 3GXOA 5EHGA 1X1DA 2DULA 3OPNA 4Z2YA 2OYRA 2R6ZA 2CL5A 2IGTA 5DRYA 2N47A 1N2XA 3NTVA 5DXJA 3JWHA 2ERCA 5BXYA 3Q7EA 1RI5A 4F86A 2ZVJA 4LWPA 2ESRA 4OA8A 1BOOA 1KYWA 2ZTHA 4PYMA 2NYUA 3G88A 4IV8A 4KDRA 4C07A 3X0DA 2CMGA 2ORED 4YMHA 4OBXA 4G56A 3KU1A 2P8JA 3PVCA 4EQZA 2XBMA 3ELWA 4DCMA 8MHTA 5D1NA 4K6MA 2NP7A 4QQNA 1QYRA 3D2LA 1XTPA 2BR5A 2JHCA 4IWNA 4C03A 3P9CA 4ER7A 4PGGA 2V74B 2QRVB 3DXXA 3LGAA 4EMSA 2I9KA 1P1CA 3CJQA 5LQRA 4PYNA 3FYDA 1NT2A 2G8NA
chains in the Genus database with same CATH superfamily
2Z4SA 2OE2A 1AHIA 5FFFA 2ONJA 2CEKA 2FW9A 3RAJA 4HDCA 1EKXA 1SHUX 3TPZA 3HO6A 3N0TA 3P9KA 4YUZA 4KXVA 2DT8A 2J6HA 2XZPA 4MRPA 4LC0A 3D0KA 1YNOA 1G98A 1NR7A 3HU1A 3JY6A 4WUVA 3TLKA 3AR9A 4K88A 2JIRA 3I6QA 3I9MA 4LJ4A 3GPCA 3REOA 2FZ4A 2W0SA 5JXGA 1N78A 4HJXA 2NZWA 4I1RA 3RODA 1YHNA 4BXOB 3BZUA 3DEIA 3GLKA 2D6FA 2KB0A 1KYYA 1KEZA 5FHQA 4BJ1A 3A2NA 2HLHA 1N1GA 1NGSA 5T3YA 2RJ3A 3KUKA 4ENUA 4D3FA 1UC5B 2O3QA 2PUHA 3WIEA 1XPRA 2MINA 4R9NA 1N0UA 1P33A 5LIPA 4LRUA 4C6SA 4IYJA 2IYNA 1ZC4A 2WI8A 5EQJB 2NVUB 2HRZA 1BX1A 1KAOA 2I2DA 2XDQB 1R9JA 3EPPA 4AL4A 1QM5A 1XC7A 1P9RA 1T0BA 2I80A 3U6BA 4B6RA 4KREA 2P6NA 2PKXA 3GEPA 4U7TB 4J0KA 9LDTA 3NHBA 1KP9A 2B61A 5P21A 4LMBA 3FHJA 3VA7A 1V4VA 1P2FA 1YSCA 1V96A 2OHOA 2ZTUA 2PL3A 3R3UA 5JADA 1CVIA 2RAUA 2BAGA 4M37A 1YE3A 4AS1A 1QLHA 4MCAA 4WZZA 4DRZA 5CT4A 5AFSA 4JXXA 3DEHA 4MWBA 5AP9A 3GDHA 3T4UA 3K0FB 3WYEA 4EO9A 4N3BA 4JYAB 2PFGA 2AOWA 4JOQA 1GZUA 4BEBA 2NZYA 1Z82A 4M1SA 4MYTA 4A92A 5FOQA 4EITA 2GR9A 1L8OA 2RK3A 1J39A 3PS9A 4L73A 4MLCA 1TA0A 1HL7A 1JEQB 3DZKA 1DEXA 2VYQA 3EIQA 2SECE 4DQDA 3K8QA 4GAEA 5CFMA 1YZGA 1JHMA 5KHOC 3SBXA 1I0ZA 4AJKA 3ELBA 4JENA 5FT9A 5ALFA 5BYAA 4YRJA 3N74A 1VJ1A 1XDBA 3O74A 3PNSA 3VH4A 3E03A 4S3MA 2VHUA 3VC7A 1X2EA 4HEJA 4E1BA 3LQ4A 3N2ZB 4ARZB 2R6FA 4Y0NA 5JEDA 2VCYA 4W5QA 3HFGA 3U4QA 3WBJA 3MJRA 5GJWC 4YAIA 3WIOA 4WXHA 4B2YA 4HLNA 1ZNYA 3D5QA 2JGLA 2VF4X 5CNIA 3SJZA 3IVGA 4CG1A 4ZCTA 4R2JA 2LP4Y 4PN3A 4K8OA 3LF2A 1E4EB 4F56A 1FMCA 4MRMB 3PCXA 1JQLB 4GXNA 5KJCA 3T3GA 3WLHA 1QF6A 1G4AE 2XMDA 2NUPB 1JR4A 2DFTA 1B14A 2HYIC 2WHQA 1EE1A 1QH8B 3DW1X 4UMFA 1E3LA 2V4ZA 3ONEA 2Q5LA 3P1JA 3IS3A 5WRFA 3QSGA 1QBKC 3WP0A 3B51X 3WC4A 2I7VA 1MF7A 1Y3AA 2RIPA 2NSYA 3QSYA 3ND7A 1FFXB 2GUGA 3X44A 2H1SA 2HMTA 2OV4A 1M2VB 2NO5A 4KRXA 4LAFA 4JJ4A 4DQ0A 2ZAYA 1BJKA 1GAEO 2C4TA 2GCEA 3Q88A 4W7SA 3W05A 5JSHA 2O19A 1U7HA 2AN3A 4J76A 4GR9A 1S02A 3U7RA 2G3YA 4UHDA 4HWPA 1OFIA 3ODGA 3OIYA 3OIVA 2JLAA 1Y3CE 4W9NA 3TSZA 1PG0A 4BNNA 1RJDA 3N8KA 3E4DA 1V39A 1JDZA 2ZJFA 2XGSA 5T67A 4MPJA 1GPLA 5KAPA 5K6TA 1L5LA 1EX1A 2ZIGA 1T35A 1F60A 3LPDA 1S5PA 2FPIB 4YYEA 2H11A 1VBNA 3LP6A 1PS8A 2JGMA 4PCAA 1E61A 1KAHA 3EVGA 3NUZA 2EIXA 4TYWA 4LTDA 5B7QA 2PZEA 4JIMA 1VG1A 2D06A 4KAFA 4LE0A 3A1CA 3E2MA 4LWOA 2FFRA 1P39A 2QUAA 1CT9A 3FTCA 4UE2A 4PYOA 2C97A 4ZEVA 5LPNA 3AILA 4Q4HA 1K75A 1B2LA 4KVZA 2E82A 3W5VA 4BNXA 5A9RA 1GL3A 1NYTA 4CLXA 3QU2A 5LZ9A 3GNSA 1OXMA 1V3VA 2O1EA 4K3UA 3U39A 4NCKA 3VVMA 2Z43A 1H4QA 4NQZA 2YHSA 1JG6A 3VAYA 3A27A 1I80A 1AN9A 3U5TA 5I3ZA 3KT0A 1UXJA 3K0BA 2B7LA 4MLDA 1WABA 2O2YA 1FYEA 1CJKC 3LHFA 4RDHA 1JHPA 4C0WA 4FLEA 1KC3A 1NQTA 4I3HA 1GCOA 4X24A 5AJTA 2DJ5A 2ZTVA 3OVMA 3RUEA 2O57A 2X0EA 5AUQA 4BVKA 5AHRA 4RGQA 1N2ZA 2A9FA 3L1JA 3U48A 1E2QA 1T9DA 3FGPA 3MHPA 3H4TA 5L3RA 1O94C 4GOKA 2OHJA 5DYGA 3MB5A 3UFBA 4BAGA 4CVNA 3CRZA 3JCZA 1XZDA 1YHZA 4O3FA 1KEPA 5CRIA 3N75A 2P69A 1ESMA 4TXLA 2QXTA 1FMLA 4GOND 4OB7A 1L5GB 4F38A 2PUJA 1JSRA 4FILA 2LXNA 2ZIFA 1GXSB 4F9GA 1Q0PA 1UXIA 2ZYSA 5BQPA 2JCXA 3C6ZA 4RLQA 1D07A 4M1QA 1SKBA 4LJ5A 5G0TA 1HR0B 3RIMA 5AVJA 4MGYR 1DO2A 1XZMA 2PGAA 1G0NA 2GAFA 2ZIWB 3PPXA 4FZVA 4KQ9A 3FN4A 4RAQA 3RC1A 1P0IA 3PC8C 4OIFA 1VE3A 2QLMA 4A2CA 1AKVA 1SQ5A 5IAKA 3W9BA 4DMCA 1M74A 4S12A 4ZV7A 2BUAA 1CB0A 2FR8A 3PR1A 3NHYA 3WADA 1WKBA 2C2KA 3SCZA 4ZEMA 1WXDA 4FN5A 4Q02A 3SYKA 1OXSC 1QE3A 5BR4A 2G5GX 2VJMA 4QRHA 2VHXA 4Q3LA 5T6MA 2HREA 5LSAA 2ZSAA 4P98A 4ESOA 2H52A 2RB5A 3A4LA 1HEUA 3M6FA 2POQX 4RD2A 3L0BA 2HGSA 3L4BC 5C8DA 3K9GA 2APJA 2F90A 2O6HA 4IDAA 1TZCA 1EIZA 4HVTA 3SBDA 2FOXA 1F8UA 1RPJA 1U5BB 2GILA 4WLNA 1GUZA 2JHGA 3I61A 1CFZA 4NV1A 4E46A 3N5CA 4MVJF 4TYPA 1ACLA 3H5OA 4XZ3A 4OEHA 5JXJA 5IZCC 1YJBA 2WV7A 1DWUA 1AX9A 1PT8A 1TW3A 5K3OA 3NALA 3VU3A 1MHTA 1VKNA 5LDDC 1DXQA 1KDRA 4EJ6A 2CFRA 1SVMA 1L5MA 2OBNA 1MABA 2P41A 1X7YA 3OOEA 1MZPA 1ZLXA 2HF9A 1TM2A 1Y9DA 3OQVA 5IT9A 3N7TA 1ZBQA 4FMPA 4ETWA 1SWWA 4QOFA 2IIBA 4RV5A 4W7IA 3O0DA 4DA4A 5B1HA 2YN0A 1Q20A 1AJEA 4E1VA 2QZJA 4YQFA 3VH2A 1JR3A 4QWMA 3HQ4O 4M1TA 4MZDA 1QUEA 1DEKA 4LJ9A 4R1NA 5I48A 3VR2D 5HRAA 2IYZA 2YFYA 4MCJA 3NJ4A 1E2HA 1KYQA 3RFUA 3I2HA 4B6FA 5L3SA 4NU5A 5JS8A 3Q8MA 2PMFA 3ESBA 2FCAA 2P7IA 3KJFA 1JIQA 3T54A 3G8YA 1UXKA 3WMEA 1ZFNA 2E18A 2REOA 4D4JA 3TW8A 4DV1B 2ZROA 3LQ2A 5AWFC 3VSAA 1XQXA 1TMOA 2PNFA 4E2YA 1E3MA 4RU1A 4LGYA 5C8YB 3AXTA 1IPFA 4IJ5A 1NRWA 1YRHA 5B6PA 3DB1A 1GGJA 1R9MA 3BXXA 4HY3A 4Q4AB 3WICA 2D2FA 3UAWA 4CTKA 5JRDS 3U60B 1ZHOA 3V8MA 2JZNA 1ZCFA 1Y33E 5D5PA 4Q93A 1SKYE 1UEIA 4QBIA 1ZITA 2VJPA 4JA0A 1RI3A 3E3AA 2G8LA 4AJ4A 2A84A 2YWJA 3I64A 4BEJA 3BJEA 1OLSB 2BIFA 2JGIA 3QV2A 1AZWA 2WFLA 3WKDA 2R751 1FMJA 1KI4A 1Q57A 2ENUA 1FVFA 2J09A 1Z12A 1WCIB 1YFZA 2QNIA 4C14A 5EYPB 4CBVA 4RF3A 4U9UA 1PK7A 2JD1A 1E2FA 1KFEB 2NMVA 4ABTA 3AMVA 2VXYA 1YJ8A 1F1BA 1O6FA 2FF5A 4CMBA 3DTVD 2ZEJA 3ZI0A 2FPGB 4HJRA 5BNWA 1SVOA 1QBGA 4D0RA 5AW7A 3UC5A 3TPCA 2UUAB 1ZU5A 3GQVA 1R3DA 2WY2D 2X3YA 5AVOA 2M2IA 2LWIA 5ELMA 3FYHA 4YRRA 2R85A 1NV9A 1XKLA 4BU0A 2QDKA 4CUJA 2IITA 5K6AC 1T9CA 3JZDA 4EJFA 1E1MA 4G23A 1F2UB 3P9ZA 5LUAA 3AEQA 2WK1A 4S35A 1QAOA 5J5AA 1GQ2A 1DIHA 1J2YA 3H1GA 5KMGB 3H2YA 2QL9A 2XR1A 2WKPA 3B1JA 2HNAA 1RQLA 2JJ1A 1N2OA 3TH5A 3UXYA 3C8UA 2IDZA 4PNZA 4G0UA 2C5AA 1OLOA 3WLMA 1RNLA 4OHZA 4MB0A 1A9PA 2H48A 4B4UA 3A6PC 3U7QA 3HO1A 2W6QA 4YCSA 1UPBA 1PZMA 4H7HA 3ZH2A 4JBYA 1M8JA 1DI0A 1COWA 1UQTA 1FRNA 2P2CA 2WHRA 4OLBA 1LZLA 2XA1A 4L16A 5L51A 3B1ZA 3T5CA 1NMZA 4BVGA 1KJQA 4G0QA 1AVTA 3HU3A 4C3UA 3FNRA 3OPVA 1PT7A 2P2LA 4U7WA 1QWOA 2QTZA 3CNLA 4MDEA 1B23P 3PKZA 1BRMA 1USWA 1LC0A 3WXMA 3AETB 5IN5A 5JH7B 3NFRA 3ECSA 3N07A 4C3VA 1S9DA 4PZEA 2NUTA 2GI4A 5CFLA 1AUXA 1HDIA 1TD1A 2P78A 3AIIA 3QY9A 4YAEA 2B4RO 1XTJA 1D4AA 1BGVA 1XRJA 2H18A 3B7WA 3COSA 4GQAA 4AQ7A 1G2PA 1EWYA 2P30A 1P17A 2D0PB 1KSFX 2PQ6A 2BZSA 4OQFA 4EENA 3I01M 2XWPA 3AH8A 5FL7A 4A7PA 2HA6A 3MS7A 1BDHA 3ABIA 1P5JA 1PSDA 2P35A 4CI9A 4EG1A 1P1JA 2ZANA 3PEYA 2YUIA 2HTEA 2BGJA 3L79A 4CFSA 2QRJA 1GZ5A 1L4NA 2IY8A 2YC4C 3L0IB 5D3ZA 2XEXA 4WFKA 1EDEA 1V1JA 2DQYA 2OGUA 3HCBA 5ALQA 1P18A 2HQBA 4R8RA 4RELA 5FLKA 4A15A 3G0OA 1Z5ZA 2LCIA 1KOGA 4XVRA 5IC5A 5JW6A 5LA6B 1N36B 3M1YA 5FB3A 2Q3CA 2TSYB 3CINA 1U3FA 3G9QA 3KQWA 1C80A 3Q9SA 1LPSA 1W8DA 2IT1A 5HG0A 1NN1A 4RW0A 3ABOB 4YACA 3L7IA 2XITA 2FLWA 1R16A 5F51A 3RSFA 1EP9A 3S1LA 1E1QD 4QXOA 4TRRA 3NUGA 4WCVA 3Q9NA 4G2NA 1TT7A 2HWYA 2ILVA 3ZWPA 3CEJA 2GBCA 4X8OA 3ROXA 1TQ6A 3KR0A 4NBVA 4FJ2A 4XTCS 3GJ6A 4QDZA 1NXWA 2WKQA 1PUXA 2HQOA 2NYRA 2OORA 2XMPA 1C1DB 2FMIA 4YJDA 1A7UA 1X7XA 2WT8A 3DM9B 1E1KA 1DIBA 1EFVA 3K05A 4QDKA 5HF6A 4UM9B 4EJSC 1E0AA 4KQMA 3KB8A 4WI1A 3ZD6A 4HQ6A 4MVJM 4WY8A 4DR6B 2OGSA 3HP1A 2FKNA 1M76A 2GEUA 3PRYA 4GI2A 2I99A 1TO6A 4G5SA 3LWBA 1NATA 3IUSA 1A9TA 5DGDA 2UYHA 2VPZA 4NE9A 2YQ4A 3HH8A 4L4ZA 3VSBA 3I0NA 4AD8A 1KO1A 1JA9A 3OZBA 2WWGA 4BZXA 1SPBS 4H7FA 1Z37A 3UW1A 1U90A 3PGXA 5EUCA 4C0AC 2C96A 3OPYA 3QTBA 2YJ4A 1NDQA 3NP9A 1I13A 3JAWB 2XF8A 4INOA 1DBSA 1L7PA 1LDBA 3UG6A 3RVRA 5DHPA 3FCXA 1P0QA 3IDOA 2NV6A 3Q2IA 1PJRA 3I73A 3OWHA 4AIRA 3A1VA 2C5SA 3KYIB 3PFWO 2ZWMA 3DDWA 1BAPA 2H9IA 4Z2YA 5K45A 3DONA 1A4IA 3JQ9A 4L5IA 1LKZA 2UUOA 1XK7A 1XMIA 5EXXA 2CNWD 4C0SA 5CJJA 2EWWA 1RTKA 1TIKA 1QQ5A 2HF7A 5DNCA 2RGAA 3Q7EA 1ZK4A 2HB6A 4PYMA 1L5HB 3Q5GA 5DHAA 3G88A 3ZXYA 5CB6A 1OYYA 3Q8KA 3L6CA 2ACKA 2H31A 1JHZA 1QB7A 3EGCA 4KNVA 4PPGA 4FYYA 4YO8A 3IR6A 4XYEA 2J3LA 3NWJA 1A1SA 1LK7A 2IUSA 3PTLA 1J9GA 5H3LA 5CXSA 4AKTA 4OPMA 4BIMA 1ZUIA 3N39C 3IFSA 1M34A 3BH7A 3CPEA 3O4RA 3DLHA 2K6GA 9GPBA 5AD1A 1YACA 2VQ6A 5E4TA 1TJ3A 4EJSB 3CJQA 1WJGA 2VLIA 4TYMA 2HIMA 5AT1A 3ZW9A 4MEJA 4RF5A 4BGIA 3KAQA 4NFHA 4ZRNA 5LYJF 2XECA 1NBME 1ZQ1A 3EWSA 3V4LA 4NWIA 5F21A 3WGHA 4EI7A 5JXIA 3TECE 4KO1S 1NAIA 4XJVA 1FYDA 3G2KA 3OY7A 3M3PA 3HMQA 1EGHA 3P45A 1TK2A 1RZRA 2QRGA 1B0ZA 5B36A 4J0QA 3IE1A 2B4AA 2Q3MA 4DPLA 1K9VF 4MV7A 3CNOA 1T2VA 3MMPA 4MQUA 4PTYA 1ZMOA 5AI9A 1QHHB 3KKOA 3BJIC 4MH0R 2QI9F 4UNNA 4H0FA 3HEAA 1ZH4A 1L4GA 2PS9A 2BELA 3DL4A 3ZY3A 1UPAA 1OAOC 1ZD8A 3QXJA 4J2OA 4Z4IA 4NMXB 3PGJA 3AERA 4FI3C 4E51A 4CV3A 3USZA 3GOHA 4ZQGA 1NVTA 1DWPA 1J5PA 3WGTA 4LNUA 1BE6A 4JLKA 4DEYA 1JMVA 3GD5A 5BSFA 3R0ZA 4G85A 4R69A 4DSZA 1F06A 3TD9A 4AZWA 1K3TA 3LT2A 1L8XA 4M0MA 1BYUA 1QOZA 3A4NA 3QBEA 1T5DX 2OESA 2FVYA 3GEEA 4DG5A 4FHDA 2DERA 3E23A 3QPWA 3WYGA 5DHTA 4FYMA 4QL3A 1LLCA 3CBQA 4FS3A 4DLNA 1XZIA 4WXMA 2FW7A 3ZDZB 4DNFA 1WEKA 1U7TA 4KPGA 1PZEA 1PK9A 5K3AA 5CYOA 1NVMB 2FR1A 2HA4A 2Y99A 4GPIB 4XD7A 5FOTA 1U3WA 1LU9A 3AUAA 2VDWB 3QFCA 2QRLA 1DKPA 4J1TA 3DEJA 3LD9A 2FPSA 1UBFA 3ABZA 4LOJA 1L7OA 4ND8B 4D8VA 2JI4A 4ZHQA 1Z2AA 3A6EA 3RS3A 3ET5A 3KB1A 4C6HA 2ZGVA 4S1PA 3I72A 4V0LA 1VHJA 2W2TA 1FFXA 1U8FO 3DTYA 1LLUA 1LX6A 3DE4X 3N8HA 1M2VA 4R0VA 5EMMA 3ZHSA 3ANLA 4C08A 4EHNA 4AMGA 3K0KA 3U56A 1E3IA 2PT7A 2O59A 1TZKA 3UTDA 1GGFA 3F4KA 5CFRA 2DWQA 3WGJA 4MW4A 4BKUA 2N0SA 3U81A 4YAFA 4F84A 4RH3A 3SLGA 5CM8B 4YTEA 1ADGA 4CU2A 1NVVR 1RWMA 2NSHA 3VHRA 4XLZA 2A92A 5JALA 1C7RA 3HS3A 3E58A 4G5FA 3WGNA 3I9JA 5AHXA 1YCFA 1ENZA 2WJWA 3G0BA 3MGBA 2GXAA 3EF3A 4R9VA 4YAGA 1M6WA 5CDSA 1DV1A 2G9RA 2HY7A 5CLQA 4ZC1A 4LX8A 1H8HA 1XYVA 4ZGWA 4I50B 3EAFA 1PJSA 3LZ6A 4QFMA 2VP6A 4UQPA 4WMLA 5BOSB 4DANA 4BMNA 3FWHA 1BEEA 4OLJA 1X9GA 3MJHA 1VHLA 1YQQA 3ZWBA 1N5KA 3ANSA 4TKUB 2NX2A 3D6MA 1R4ZA 5CT5A 3ESXA 2C9CA 3GV0A 3T9AA 4ZD6A 5CLJA 4N8SA 1XA3A 1L4KA 1Z2EA 2HDOA 3R7SA 5FTNA 3T1TA 4XARA 2JGJA 1FFBA 2YY7A 2P3LA 1PHRA 1TCBA 1GGNA 1FS5A 2W43A 4GR4A 4FMDB 3LX5A 3MYYA 1NE2A 3IT3A 3IPLA 1ULZA 3HBMA 1PWXA 5KNDH 2OOSA 4S24A 3STXA 3TQCA 3I09A 1XNHA 1SVIA 3E22A 4MUKA 1DLIA 2VUUA 3VV2A 4RO0A 2XCRB 4OSPA 3PGMA 4LYHA 2D59A 4QYIA 4RLHA 3TO5A 3OQIA 2IZ1A 1Z29A 2IU4A 4RD1A 5DVZA 3T4EA 1MO6A 5F2NA 2FRXA 4C5CA 1NSYA 1ZVJA 4TUYF 2J6IA 1XPUA 1ZLYA 2ERYA 1GG8A 5A1JA 1VBKA 5EC8A 1QHXA 1GXSA 1L7DA 2OCIA 1Z9BA 5D86A 1YS6A 2O2ZA 1M8KA 1TCAA 4XEHA 2C1EA 4PPQA 2C07A 4PGMA 3EZ6A 1JQ5A 2EKLA 1AOXA 4JV5B 2XRMA 1ISIA 5BPHA 2ZYTX 5EHQA 5FD8A 4D0NA 1TEZA 2GSDA 3C5WP 2EARA 2GN9A 3HM2A 2VAVA 4RA6A 1XTVA 3RVBA 1V1MB 3UQZA 1TF2A 1AXEA 1JPNA 1RFLA 3FNBA 2QVXX 3LF1A 3QEOA 4JELA 2XYPA 3L8CA 3RARA 3RGGA 5CDTA 1ESNA 2VDNB 3CH5A 2IOYA 1KH1A 1W0KD 1VRCA 4QEZA 1W0JA 2FDCA 3NIFB 1YCHA 4DLVA 1YRBA 4LDRA 3KR1A 1N6OA 1GZVA 2M1ZA 3EXIA 2ZSHA 1KBOA 3ZHBA 3NVAA 3GPLA 4I4IA 4GGMX 1E6MA 1I6LA 1TK3A 3D2CA 3E4CA 3ZVKA 4WBNF 2FPKA 2XPCA 1ZINA 2V98A 3TKAA 3S3TA 4EL0A 4JB0A 3JAMA 3L6OO 3H8VA 1FNBA 1ZUWA 3T3EA 4ZPXA 3NVDA 2XOEA 1E6UA 1L4YA 3BQNB 3CZRA 3H9GA 2FEWB 4FBMA 4MUGA 3P32A 5IC6A 3KZ1E 3HJNA 1C5KA 1MKYA 2QQFA 4BQRA 3CR7A 2VBGA 4FHGA 4ZYXA 5A6VA 1GKUB 1K3FA 1J8QA 2F1KA 1XP8A 3D6FA 5FUMA 5KQLA 1PJAA 5I7VA 1WETA 4KPYA 4F96A 4CM7A 1C3LA 1E1CA 3OZSA 3OQHA 4M88A 4ONEA 4A91A 4E6PA 5LOVF 4DB4A 5D84A 1FSPA 1I4LD 3B3JA 4MVJD 3T95A 4Z4CA 1CZRA 4ZT7A 3UAGA 2C0PA 1QLJA 2GO1A 5LMZA 1LQTA 5A4FS 1N0HA 4IIHA 1N8SA 1O6GA 1D1QA 1XCLA 2ZYWX 5FCDA 3RTCA 1ML4A 2DT5A 1OT5A 3DZCA 3O84A 3DT8A 4G36A 4IHKA 3RBAA 1GN9A 1Z5VA 4Y2VA 1PDOA 2C7RA 3TX6A 2PUAA 1VYTA 1G3RA 3TKYA 1YFLA 1JILA 1O8CA 1UR5A 2J3HA 2GD2A 1JLMA 2PH5A 3PRHA 4FYPA 4I4NA 2GHTA 1R8QA 4YH1A 1TF7A 4KPUA 4Q00A 5MFZA 3G0DA 4LVUA 3OPXA 1BH6A 5DHQA 3RD5A 1ESCA 4EPYA 2YX1A 2Q1TA 2PD6A 4JLDA 4RBNA 1VHWA 2IH5A 1J7JA 1NLMA 5C8YA 2ATEA 3DOEA 3SQNA 3TTTA 3V3TA 1T26A 3GX1A 1YDEA 3EEOA 3SFZA 1MO5A 2ZVDA 5HW0A 4ER6A 4FOTA 2GN2A 2VXBA 2IP1A 2VPPA 4HLCA 4NU6A 3CNQS 2OFPA 3GPDG 5HDBB 1CUWA 2OKCA 4ESVA 2DAPA 1L8LA 3JQFA 4CQLA 5ALPA 3REQA 5EJ7A 4DS3A 4RZUA 2DWUA 3PSAA 3PUIA 1IN8A 1E77A 1WW2A 2WWXA 2X14A 3TOSA 4OXYA 3JVUA 2J08A 3WFJA 1KBQA 3H87A 4M2LA 2QR3A 4K9KA 1MGPA 5T5QA 2QRKA 3DA8A 1NI5A 1CUIA 5JOQA 1R0YA 4X61A 5EYPA 1W4AA 1UMCB 3BBLA 2X1MA 1ITZA 1COZA 1B8UA 1TMYA 5EP2A 3ZOKA 1BDIA 5IZCA 5GOZA 3CLKA 2X9GA 3TF5A 4QX6A 5FFMA 5G40A 4B76A 4GPTA 2NV0A 2FPGA 1D2EA 1KEVA 2G1PA 2JW5A 5F12A 4TLLB 5C0OE 3WISA 4ENVA 4DR4B 1MFZA 3AHCA 3O4VA 3ZBTA 1VCMA 3DFIA 2C9ZA 1A9ZA 1C8BA 1NFRA 5D87A 3TEJA 3IAFA 4AJPA 4OQQA 3AHFA 5IBQA 3JD0A 3CLSC 3I4FA 1UF9A 8ABPA 3ASUA 3CUEF 3IIIA 5ICCA 1NBOA 1F2UA 2QV7A 2Q5HA 2HM7A 1IE3A 3RANA 2CL7X 4OCZA 1GTMA 4K5QA 3FNFA 3UBTA 2W90A 2JS7A 1WXWA 3VMMA 1K6XA 3RADC 3K6SA 2B2CA 1RP1A 2X5OA 3RNLA 4F6CA 3D9QX 2XCUA 3N6VA 4UUOA 1VB3A 3AXSA 2IS6A 3GRRA 3LWDA 2E4ZA 4GWLA 4AWXA 1HTWA 4AJIA 4AECA 5HSGA 3BT7A 3QUCA 3S99A 4PV7A 1JH8A 4NS1A 4XD2A 1N2SA 2VK2A 4MUAA 3W5BA 1FQWA 2QTGA 1YKSA 4DUGD 1QTIA 5CGQB 1AV6A 3HCFA 1Y5MA 2VSFA 3RWMB 5E9WA 3H8SA 4XB6B 1GGVA 3INRA 2PMCA 1VPEA 3E8MA 1DU4A 3R7NA 4BUJA 5TF4A 1W4BA 1EDBA 4BJ6A 2YNMD 3KELA 3GMSA 2VJQA 1FNNA 2V7XA 1QG2A 3HJBA 3BHNA 4OGGA 1Q1AA 5HXAA 3SIXA 5JH7A 4DT1A 3DE2X 1K5DA 1UJCA 2IPAB 3TUJC 1UDRA 4H35A 4KXUA 4H59A 1UFKA 4KAXA 4YRAA 4MW9A 3ZXXA 1U11A 4B3RB 4F11A 4L6AA 3PC7A 3ORYA 2D1RA 2PU5A 3BXZA 3H5AA 3NB0A 4KK4A 1ETUA 4TTRA 3EF1A 3PVZA 5EKTA 3RBZA 2C4MA 2P1ZA 2VUHB 3SJBA 1B0AA 3HKDA 3WDSA 4PZ0A 4ACBA 3FCAA 2FN8A 2DB3A 3WV4A 4QHYA 3RVJA 4M3NA 4ZVLA 3QLTA 2AOXA 2XT0A 2EX1A 5K6AA 3DMRA 2XCIA 5C53B 2ZIVB 5FQNA 1PBTA 5LA6A 1OSNA 4YUYA 2SKDA 3WHLA 2A5LA 2BRUC 1OJLA 1QDEA 3GJYA 1G55A 1QFMA 4MGZR 2BW0A 2AGVA 4FC6A 4ZQBA 5ECDA 5HE8A 3E2IA 3X1XA 3R44A 3QPCA 5JJ5A 4M7WA 2F64A 2D74A 4AJHA 2DHDA 2R7NA 2B9VA 2CLEB 2PRJA 4UE3S 5T8KC 2BI7A 1UK7A 1E64A 3QXHA 2IEYA 2D7CA 3RHTA 3GLGE 3V1TC 1IDOA 2QPOA 1NURA 5EE9A 5BW5A 4FWTA 2Y1DA 1TUGA 4NG5A 3R8FA 1EVIA 1G21A 1V4BA 2O50A 2IL1A 3JTMA 2OSVA 2EYUA 2WP8J 3SICE 3JXEA 4EUEA 3QWIA 2B8WA 1N3IA 4E31A 5JECA 3KX2A 4JEIA 5K0EA 3SEAA 2XODA 3EXG2 2H29A 2XX3A 4D3SA 5JASA 3R5TA 5I7RA 1HYGA 2G82A 1Z2CA 3U3OA 3AR6A 2FR0A 1EVJA 5IFKA 4II7A 5DN9A 4JLSA 1V3QE 3PNLA 1W0CA 3I28A 4OD0A 3R9XA 4INZA 5FA6A 4B0OA 5HTOA 1S1CA 4PR3A 3FVQA 3ID6C 3ZE2B 2CVFA 4HB0A 5FBKA 1IUNA 4COOA 4XDHA 3LQYA 1MPTA 4CV1A 3EK2A 3K6JA 1LLDA 3GAFA 4PONA 4MUNA 1XQYA 6Q21A 3OEEA 2FZEA 2AJ8A 5EJAA 2ZS8A 3Q87B 3F8SA 1N2CB 1M8GA 2XH8A 4BNFA 2ACWA 1ECPA 3L92A 3MUEA 3PT5A 1K92A 2B37A 3FB4A 4OFXA 1N6HA 3TB4A 3PUKA 1T9BA 1PL0A 4IL5A 5B55A 1Y8AA 3B52X 4DR2B 5LWHA 3ZS8A 2P40A 2X4GA 3QOFA 4UUNA 5A4IS 2ZR9A 3E9MA 4O08A 4RANA 1V5GA 2NPFA 2A5DA 2WIGA 4ND6A 1NIJA 1N5IA 2ZYIA 3C87A 3JQAA 4HT3B 1R8JA 4CLOA 1VTKA 1L5HA 3FPAA 5K0CA 1PP4A 4KGXA 3CH7A 3C3CA 3FMVA 3WDLA 3RT9A 5IH7A 5EPEA 2R2AA 4EF6A 3ZC3A 3QBJA 1ID8A 4C5BA 5L95A 4GSLA 4HDSB 4NJOA 1NP7A 2G80A 4L28A 3ROKA 4G63A 5ISMA 3UNXA 1E3WA 1IB6A 3NO4A 2NO7A 3PNBA 4H15A 5H1YA 4ZKEA 4EJSA 1QGED 4Z7NB 5I4KA 5TLSA 3D3QA 1U31A 1NM5A 5JXHA 3TNLA 3L1KA 1L4UA 1OIWA 1C1XA 2XUHA 3K0EA 3RTGA 3JR3A 1G8FA 1KI2A 4S05A 2JBAB 2LGJA 1RP7A 4ODIA 3D7RA 5EOVA 4XPIB 4B2PA 4PSAA 4PSVA 2B34A 2J0EA 2MSCB 4MV8A 2R6ZA 4DQVA 2H7CA 3P4XA 1YDMA 4KU4A 4Y2QA 5AXBA 3VH1A 1WV0A 3WBKA 3ZY5A 1HYQA 2NW6A 3D43A 4UDXX 4AMYA 3A6KA 3K20A 2PA3A 4KACA 4W1RA 5EPOA 3W1EA 4AYTA 2GJ8A 1D9XA 2A5YB 1QHHA 1ONNA 5AICA 1C41A 1PGPA 3AU9A 3GFVA 2BZ1A 2R47A 1FVOA 4GKBA 4C0LA 1JA0A 2SKEA 3HBNA 2LKCA 2M6LA 1JQJC 2ECFA 3AUFA 4NKRA 2YDYA 4UHHA 2JVJA 2GZAA 2NPIA 5BRJA 2QQGA 4DG8A 3H1TA 4IS2A 1QTNA 1QYRA 4C03A 3C3WA 4PZUA 4DIOA 4J0DA 4UM7A 4D9GA 5F7XA 1RAEA 2C5EA 1E1YA 5KDLA 2HCBA 3MTQA 5C7YA 2AJLI 1YB6A 2JJYA 2WV9A 3M9WA 5THXA 1NT2A 1F4PA 1YK1A 2D5CA 2OD2A 4GL4A 4IAOA 1TCCA 1UOEA 2WSMA 3SOZA 1RSZA 4ZQEA 1J6UA 5E1OA 3PNKA 4IX9A 3F67A 4KYIB 5FPYA 1CDDA 2D00A 5LXTB 3L6DA 1KO7A 2C1XA 2C0QA 3PXDA 3AR5A 5BNTA 4XIJA 2GB4A 5EJ5A 1PT5A 3HDVA 3L5KA 2XRYA 1AS0A 1I3OA 1DO0A 1UBNA 2G1UA 3NYWA 4XJSA 5BQOA 1PNTA 3UJ6A 5DNDA 5HK8A 4DM4A 3IXQA 1JFVA 3AVPA 3PD7A 2Q2OA 2BZ0A 4ND8A 4ZDJA 3D8RA 4LGVA 4P8RA 3WGOA 3LCUA 3M4XA 4B2LA 2VJOA 1FUYB 3HBAA 4OH7A 4PO8A 3ZCQA 1OZFA 4WZBA 3JARB 5C1DA 1HF3A 5KWVA 5KX5B 2QUZA 3FKSA 1HLPA 2NU9B 5BNIA 2V0GA 3R0XA 1OBVA 4WIAA 2RHJA 4YY3B 3KEGA 4KVGA 4UFPA 2AD1A 3MRXA 2W11A 3KHTA 2P6RA 3NRCA 1QIMA 1OAAA 1WLYA 3WFIA 3BSWA 2P67A 5LP6C 1CD5A 1DBVO 5T64A 4X8LA 3D3WA 3EZ2A 4FE7A 3TIGA 2AL7A 2ANCA 4ZP1A 4AJNA 4IZHA 1KPGA 1YKGA 1N57A 3CXRA 3RHFA 3FTFA 4YXFA 3WLIA 4ND2A 2EQ5A 3B6ZA 1M0SA 1W9MA 1JDTA 1L5SA 1YB4A 2BC9A 2EKBA 1FK8A 1LDEA 3DBVO 1SKUA 3JQ7A 3S2SA 4EZIA 1F14A 2BZGA 2GPTA 4FYKA 4DXDA 1A9XB 4R2WA 3V2GA 4KBFA 3CJTA 2ZJ5A 5EMNA 2HXGA 2YJZA 3V48A 1GD1O 4ILKA 4BP8A 2UZ3A 3AJ9A 2QU8A 3O2QB 4FHCA 3Q3JB 4Y2HA 3HJFA 4TZ0A 4TKUA 5CA1F 4YB8A 3ZCUA 4FGLA 1EPUA 5AKHA 4TLCA 4YDRA 4RVUA 4A23A 3WTCA 1MJGA 1R88A 1PNRA 1ZJWA 3CVYA 2I0FA 4U6QA 2WLSA 1IN4A 4RPJA 1W94A 2XYVA 3R5XA 4KHZA 1BCRB 2F9MA 4Q9NA 4FFOA 4E21A 2PUFA 1CQWA 4WE3A 4YUXA 4JP5A 2Y9PB 3DTVA 1ZA1A 5CA0B 1MO4A 1VXOA 1R0SA 2VBFA 3KAJA 4HDOB 1RWPA 3AR4A 4ZVUA 4M87A 4EUHA 1TU3A 1UINA 4IHJF 4URHA 3EYAA 2FQYA 1J0CA 1L1RA 2EKDA 2BM9A 4XWYA 1IXYA 1ZW6A 1MORA 1GY8A 2V97A 4V0KA 5BWOA 4GVXA 3KO8A 5JI3E 1HNZB 2HJWA 4Q16A 5IVKA 1JTFA 1CYDA 2J4CA 5IULC 2C61A 4TV8F 5LP6B 1ADBA 1GO2A 4N8DA 4F12A 5JQWA 2GK3A 2QGNA 2QG6A 4UZEA 3G8CA 3TSWA 4DV4B 2GN4A 3F71A 4D57A 2XUQA 3II6X 2ZU0C 3ZH9B 2Z09A 1ZNQO 1EVKA 1OX6A 1V6AA 3C7AA 1BN6A 3KJZA 4MA0A 4QT0A 5IF3A 1AQJA 2LNDA 4BB5A 1VOTA 5SZJA 4BV9A 4PC3A 5LB2A 1N9ZA 3NM6B 4FYXA 3WIUA 1OLXB 4U8GA 3OU2A 3OM8A 5ALTA 1XBTA 5D3KA 1R27A 4KIWA 1FX1A 2ODWA 1Y82A 4ZVVA 3FWNA 1U3DA 4RQAA 2HKIA 5LQJA 4OYHA 2JKYA 4C29A 4KHPB 1XNQB 2OAEA 4ZO6A 1Q0TA 4D5GA 3M33A 5D85A 2ZBPA 1JBQA 4FCTA 1JH9A 1L7QA 2B8JA 5BRNA 1YA4A 2FUEA 4RADA 5IW8A 2H1FA 1SVUA 3W2TA 2JJ2A 2P91A 4JZYA 4ROTA 4L1KA 3GP3A 3WX0A 4L08A 3DYIA 4C4TA 2BUCA 3EPHA 1L5NA 3NGXA 1MB0A 2FWIA 1OGIA 3U16A 4WOJA 5TY0A 1OY1A 2P2DA 5EHIA 1QO7A 5I5GA 3UFXA 3I8OA 3V2UA 3EB9A 1DIGA 4YT4A 5GGXA 1EX7A 3RV3A 4W5WA 2YUTA 4HGOA 2DU8A 4RTQA 2HA7A 5J58A 2XWJI 4IV0A 3PDUA 4D4MA 3CBGA 3UO8B 1QP4A 4BQFA 4AG3A 4HI0E 2DHEA 4UVIA 1WCYA 4PG8A 1CZNA 3HDJA 5J4LA 1CNEA 3I2JA 4YMSA 3NOVA 5LQAA 3U7IA 2GFIA 4RCZA 2Y0EA 3GVIA 3MT7A 4X84A 4KKVA 4PAWA 3SNKA 4WY2A 2JGRA 2Z04A 4XFKA 5SY9A 3TTYA 2P4SA 5E3HA 5BSGA 3R0IA 3RRYA 3M6WA 4DBLE 1V5WA 1XEXA 2IXAA 2EQAA 4AJEA 3RUFA 3W5UA 2IUYA 4B4DA 1LWNA 2PTGA 3NAGA 4JL8A 1MNAA 4C0KA 1YS9A 2B1QA 3MCWA 1EBBA 5KNDA 2DQKA 4UEQA 1K89A 1H1LB 2AR7A 2R8ZA 3PF9A 4GP9A 4TMZA 3NQ41 4O0MA 1G6KA 3ANTA 2HT1A 3FHTA 3OX3A 4KP7A 4OUKX 5L4LA 5F4ZA 1UAAA 1M6YA 2WM2A 2X5NA 2XE7A 4CEJA 1T3ZA 3C4QA 3JD3A 4URXR 4IYRA 1J0AA 1M7GA 1W2HA 3GGDA 2I9PA 3M34A 2WWRA 4D8TA 5EKSA 3KQLA 1N6PA 2YJNA 1TU0A 4RKRA 1X7ZB 5LLTA 4MKRA 3DDSA 4EATA 3JQRA 2V0CA 1H4VB 2CNLA 2HZBA 4JR0A 5TF0A 1H0SA 5C32A 1O4VA 1V4NA 1NJ6A 4IWXA 2OLEA 4RZXA 5EFOA 3VUFA 3VZQA 3WLSA 2L69A 4X85A 4DC1A 2ZXFA 1E3SA 1HT1E 1IM8A 2J85A 1XPOA 2W6NA 4OU5A 1ESEA 2GSWA 3GJTA 2PIAA 1MXFA 1P0PA 4N39A 1NVXQ 2QJWA 3F46A 4PG5A 4B47A 3HN6A 2Y76A 1RBQA 4OM8A 5CVTA 4AWAA 2J87A 3LUCA 5E2IA 3AVTA 1YS7A 2N46A 4HDKB 1NG9A 3WGVA 1ACJA 2XZLA 2J7KA 3L8DA 3CR3C 1HFEL 1A9QA 2OC4A 4WLFA 2ARKA 3WKBA 1AKNA 2QUIA 4GNKA 1BHJA 3QYAA 2WQ6A 5BYJA 1AUVA 5CAEB 5HF8A 3EC2A 4D8XA 3DBRA 1I7NA 2EG9A 2G71A 4G8BA 4IVNA 5GINE 3C7KA 1EDOA 2JGNA 4C89A 1QZTA 1WSBA 2CKMA 1BS1A 2XLCA 3NIDB 1Q2XA 4KLAA 2VDJA 1ZHFA 1VDZA 1GKYA 1OYOA 2CE2X 2OD7A 3DV9A 4G0OA 5EXDA 3Q6NA 2E37A 1RYMA 3OE7D 4KIUA 4Z7OB 2ZJ7A 4LRSB 3DJYA 2IYSA 1I14A 1PCXA 2VN8A 1PUIA 3NHFA 4N6NA 4PWZA 4U2GA 1UDBA 4JQSA 1KSHA 5JD6A 1N9GA 1JPUA 3C97A 4QVKA 1GCAA 2FG6C 2ODBA 2Z3VA 2BY4A 4KIGA 5FAXA 3RASA 4OSEA 3RCBA 1JFFA 3WLAA 1MGOA 1Y7PA 4NULA 3H4IA 5BMVF 3BWVA 3PC4A 2JFVA 3A9SA 4ZOQI 4KGDA 4ZI5A 1FP4B 4LS3A 4PICA 4Q47A 4QJIA 3L7NA 3ZQKA 1XDUA 2BFBB 4PZCA 3RF6A 3WY9A 2QN8A 4D8YA 5B7GA 1E79A 4BX3A 2JD0A 3ET4A 3P9NA 4LGMA 3GLIE 4JI1B 4Z9AA 4HVLA 1Y5IA 4MI6A 5MF6A 2F3RA 5HBGA 2ET6A 2VWPA 3NGMA 1V8PA 5CVDA 2Q4DA 5H8WA 2P4UA 2Y2UA 5IG2A 1SBCA 2R8PA 3S28A 3GLFE 4YV7A 1MIOA 4MROA 2NU7B 5T6BA 3CSUA 1LNSA 2QVZX 4XYLA 4RVNA 2YHAA 3O8BA 4YRQA 1L4HA 2ZB4A 1M1NA 1O6BA 4A03A 3AQIA 3JWJA 4HK4A 2VYVD 4M9XA 2HO4A 2X76A 1IMJA 2FSIA 2JGDB 3KDSE 4FBLA 4MICA 2UZAA 3G2OA 4AO6A 1QIIA 4BWVA 4P0TA 3VUEA 2HBQA 4YRSA 2JIZD 4HDNB 1DX9A 3KQOA 4JI4B 3PYXA 4HMQA 1AIPA 1CR0A 4F72A 1MC5A 5BY2A 1SHLA 2A9PA 1JFRA 3RIYA 4CHTA 3C3YA 2HCTA 2HI0A 4YREA 3LY8A 1PX0A 2KHZA 3V4ZA 3A58B 2ZKLA 3VKWA 4ER3A 2JH3A 2CJFA 3PDWA 5EIWA 3RC9A 1UKYA 1EFDN 1GITA 1P72A 1PJ3A 2IYPA 4O4LF 4Q1EA 1R0CA 1QRRA 2IU6A 1TZ2A 3N7UA 1YVPA 1M2EA 2CFTA 4PTLA 4JEMA 4BX2A 1VM6A 3GJRA 4L50A 4WECA 1E7YA 2JAPA 4L74A 4XVUA 2HMWA 2BBSA 1SIOA 4LDAA 1V95A 2O0LA 5BNZA 4PBSA 1TM5E 4F6LA 4QGSA 3I2GA 4K9SA 4GM4A 1A9OA 1I94B 3MOGA 4L5AA 2I29A 5IJXA 1PJ8A 3TR0A 3USES 3V34A 3DBLB 2F1RA 1QVZA 1MH9A 4U63A 2CLSA 4HGZA 5DCWA 5KSOA 4GKVA 2XXJA 1Q95A 1NJ2A 5TGDA 1AB6A 1W2GA 2I67A 3MRVA 2GAOA 1WBDA 4NEQA 4UCXA 2DPXA 5B53A 2WT9A 4J0CA 3O95A 2GEJA 1JHQA 5TB5A 3EIHA 2QU7A 4KO2S 1TNDA 4N6OA 1ZISA 2PX8A 3DAYA 1ABEA 1V71A 1AF7A 4UUQA 1UBEA 3GUZA 4S04A 3CUVA 1IY8A 3LY7A 4Q82A 4DLWA 4RTPA 1LTQA 3QW2A 4Y6GB 1EEXB 1G5IA 1T9GR 2BRUA 4CCSA 3HUFA 5AQ1A 2PR2A 4J0IA 2Z56A 2GLTA 1GPWB 4ZVRA 3QX9A 1ZAYA 3PD1A 2O5EA 3CH4B 4YLYA 4IXTA 1Q19A 1V11A 4IFBA 2H7XA 5T8KA 4F3KA 3FY4A 3GJXC 2C5BA 3JZIA 1PFGA 1N77A 1KEWA 1BQ3A 1BZYA 4QUKA 2PE5A 4DIBA 1K06A 1KC1A 1ZK3A 2I2BA 1KNXA 3AR8A 3OJCA 5CW1A 3VC2A 1L7BA 2PH1A 2PL9A 3HZZA 4HDSA 4KW7A 3VPSA 3VR5D 4AMZA 2FMXA 2VP2A 1G5RA 1MQSA 1S2DA 3HJTA 1WTCA 3LLCA 2WAAA 4WKOA 1ONPA 1E8MA 2VNIA 3G5TA 4LJ7A 4TT3A 2HRQA 1C9NA 1TAUA 4MOWA 1MJFA 4MDHA 1HDGO 4EG6A 1UFOA 4DR1B 3V4VB 1UOOA 3THXB 4B6EA 2JBAA 2R60A 4XIGS 4TN5A 5AM0A 2FZVA 1EFHA 5LDHA 1FSGA 2CFCA 2Z8YM 3PFCA 1KQOA 3OEWA 2O2GA 3H2JA 3O8OB 4R1UA 1JLHA 1G2OA 3R20A 5ECYA 3ZKAA 3O6VA 1DEOA 3U3MA 3ZZ0A 3QU4A 4OXRA 4QYSA 1Z15A 3TMYA 2CHEA 2Q28A 4HS9A 2QN1A 2C3PA 3I01A 3UENA 2BJVA 4IUYA 4Q9IA 1KMQA 1UK8A 1J9EA 1XJ0A 2FWNA 3QOWA 4Q3AA 2B20A 4HAWA 2N75A 1IBLB 3ZYZA 3DVQX 2XBUA 3M6UA 5JC1A 1PQUA 5DE3A 1G7TA 1P0MA 2GYUA 3CW2A 2PX4A 3L6BA 1IJEA 1K3UB 2XBLA 1GARA 3WRWA 2EVWX 2AEFA 5EEGA 4TL8A 1W0KA 1XLWA 4LHWA 2ZITA 4ECEA 5THKA 3FNQA 2BKXA 4MR8B 2DZDA 2WJZB 5JYEA 1J0DA 1UIRA 1T3HA 1G4UR 1JBEA 1KK2A 1MAHA 1H6AA 1IJFA 2XOXA 1YNSA 3LA6A 1XDGA 1VBMA 3FPCA 2FLKA 1E5TA 1QONA 1EJ0A 1WEHA 3E5NA 5KWJA 3K31A 1QV7A 5FH9A 2BHRA 1E2NA 3KAKA 4NX2A 3TINA 2ZJOA 5EIBD 1QQBA 2X4DA 3A1EA 3Q6MA 1G3UA 1X1DA 2QQ5A 2A86A 1KK1A 2G9NA 3GDGA 4IW3B 1HZZC 5A7GA 1OD6A 4MWSA 1QS0A 5M7EA 1DAHA 2OECA 2ATVA 3ZTTA 4D7AA 5JBQA 3OJLA 5BV8A 3CZMA 1J8VA 1S3IA 1UIMA 2BI4A 2ESRA 2ZJAA 3O92A 3VR6D 2NZJA 1TT5A 2VP0A 3O3MB 2GBGA 4U9HS 4AG6A 3EIXA 3ZW8A 2CLCX 5JBIA 3HR4A 4EQZA 4E3ZA 4JP2A 3DM5A 4MVJA 1S7CA 3EUFA 3ELWA 1YWGO 1U3TA 2QRPA 5B4TA 1KH3A 3K9BA 1XXHA 2DQSA 5IM5A 2IYRA 4PSUA 4K9DA 3HDGA 1Z0IA 2F1IA 2PLRA 5KU7A 1TRHA 2NV2B 2NYAA 2HHLA 5BURA 1SU8A 4RTMA 1RDFA 1P5FA 3G2HA 2ZDHA 5B3KA 4QE3A 3ELUA 3Q12A 5ALIA 3ZU3A 3LRTA 5KYUB 4W9MC 3EE6A 1SD2A 4MKZA 1X42A 5PGMA 1UBUS 4QXQA 4EECA 3KYCB 3K1ZA 3ZEIA 1L7NA 2GNAA 5JG7A 2GKOA 5K6RA 5ARBA 1QYWA 2RKOA 5TPZD 3KSBC 3OFVA 4KO3S 4FUQA 3UT0A 1MX3A 1LC3A 3NPAA 1WX1A 5K0LA 1MT0A 3OLQA 1TUIA 1NF2A 4QUDA 2O52A 2JGKA 4YP7A 1A9XA 3OKFA 3GH1A 1DCTA 3GGOA 2HLPA 4WNYA 4E7PA 2V54A 4E2XA 1CZLA 3BWXA 1FFWA 1HNXB 4QNMA 2IUUA 2NG1A 4GMGA 1Q84A 3D02A 3CWQA 3OC0A 3M5DA 4DW8A 4LV8B 3X1KA 3HY3A 1KY2A 1Z16A 5EE0A 3QXGA 5DBHX 1RXWA 1OGJA 1O9BA 3UQYS 2UYYA 5KNCD 2CBGA 2EBFX 1NMYA 2IXFA 2R7LA 3SHOA 3F5QA 2V8BA 4Z0NA 2OO3A 2QTCA 3NAQA 4MTCA 4BP3A 5EMJA 2G5PA 2FX3A 1KIFA 1X9HA 3UMBA 1GA6A 1KMHB 1U8EA 1ULBA 1K4MA 3P2MA 4JMPA 3ONNA 5K8IA 3CU5A 1XB2A 3TJZA 4RVFA 4G25A 3V1MA 4AUEA 1TO1E 4Z1OA 1ZCJA 2YJTD 3N53A 1C7IA 1FYXA 1RWBA 3BTVA 3LL7A 4OHFA 5F9HA 4HAYA 3WLQA 4EQ6A 2NO4A 4EUSA 4LXQA 1MOZA 3TI7A 5K03A 2B1JA 5E2AA 1YK0A 5T7BA 4YALA 2YOFA 2FX5A 2KWIA 4IH9A 4D4HA 4FKMA 5MN4A 2PKCA 4Y1GA 1RFGE 3VKGA 2VDVE 1GUBA 1RC0A 1O9HA 1U9IC 1ORWA 4LUCA 4LZWA 3S70A 1T8WA 2N9UA 4BV2A 1VE6A 2YYSA 2C7OA 5HK9A 3A06A 3RFXA 3F49S 2IW1A 3RYFA 5F7OA 3QU5A 3I9V1 3FCUB 2R11A 3HSSA 5CDFE 4GL2A 5L9AA 2QTVB 1L4MA 4XDZA 2QR5A 3I6MA 3MC1A 1LVHA 1MJNA 1QX4A 2OV1A 2VXCA 3B2EA 4F3TA 1NI4A 2P3QA 4UUPA 1Q0SA 3UJ3X 1Z4MA 3W5JA 1DWQA 5IWCA 4ARCA 1I6KA 2WWVD 4KXXA 1M5RA 1D2AA 4WWHA 3DQPA 1TYCA 3EGIA 2RHTA 4J07A 2GF0A 3SS7X 4O3MA 5I9SA 1HOXA 2PUCA 1JAXA 4KGVA 5AI4A 2V3WA 4NZNA 3PFNA 3DF9A 5HKOA 4EFNA 5JTUA 1NY6A 2VSOA 1ATZA 3CT6A 5CLLA 4YRTA 4BOYA 2CXPA 3FSJX 4YRBA 2AWOA 3WWYA 5KCZA 4Q7QA 3HO8A 5A0VA 2X6QA 4O1MA 3FD8A 5HTKA 1EG2A 1U9ZA 3GT4A 3RSQA 4OFZA 3VR3D 4BFYA 1RYHA 2DBVO 1J20A 1RYEA 3P20A 4JHLA 4RZ2A 3H19A 3LAWA 1AKTA 2VO1A 5GJBA 5U4QA 2C8LA 3QKTA 1W96A 1RYBA 1CULC 1U99A 2PGNA 2XUGA 3NTQA 5AHKA 3VR5H 5CX4A 3FWYA 3BN3A 3HFRA 5TPWA 4COKA 1G20E 1JEJA 2Q46A 2WSBA 4JLVA 4Q4JA 4EARA 1H8EA 4RJIA 2AKYA 2C9YA 4NPCA 4KZPA 1KPIA 4LE2A 2EL9A 2BMAA 2W0MA 3O4FA 2TYSB 2VNJA 4IFIA 1B1AA 1S2IA 3OF2A 3PHBE 4C4AA 1M33A 2GESA 2Q5OA 2ECPA 2HFKA 3AVWA 1CF4A 1RXUA 4DADA 2FQXA 4IILA 1GHTA 4LVOA 3ZGXA 1HXHA 1U9JA 4E1AA 1JEAA 1DKMA 4QA9A 4KFSA 5FUVA 3K96A 4FFSA 1H4SA 1F8YA 4FR0A 3S2ZA 5IHXA 1H1LA 1K0UA 4RFSB 5B2EA 5DCLA 1PIWA 1X86B 3T4PA 5JCZA 4N0PA 4QVIA 1WE2A 2PYIA 1HNNA 1M8PA 1YZQA 2I66A 3GG9A 3OFND 4FK8A 3UJNA 1YJCA 1L3IA 3E9NA 2B36A 3H0KA 3PVSA 5I7EA 1JHAA 4XX0A 2VHJA 2NO6A 3UMFA 4GMDA 3LA8A 4NZZA 3S0JA 1JAHA 4DWJA 1Z3CA 4LYYA 3A1TA 2H2AA 4IUDS 2B30A 1L5RA 4S1VA 3EVNA 4CM9D 2DKNA 3BD6A 4DMGA 3PDJA 3TIXB 3JVVA 4EMUA 5BORA 2NP6A 5CU7A 4BNUA 1HSOA 2FNAA 3SS8A 5AM1A 1MJ5A 3STHA 3WMRA 2P5YA 3AKYA 4XSHA 4XAQA 3ME5A 3RKUA 2VEOA 3T9FA 1S89A 3B6JA 3NASA 4G01B 4ZGGA 4KPEC 2TECE 3CZ5A 2CNBA 1T4CB 2QRHA 3AEZA 4MYSA 4E0BA 1DUIA 1H94A 1T9KA 1JFLA 2B5VA 4C0HA 2ETVA 2KE5A 5I9BA 4BE7B 3UB4A 3NRJA 3PK0A 3RVKA 2KS6A 4HB3A 1KRXA 1BMTA 1OPRA 3IA2A 3ZDBA 2PRIA 4HR7A 4QM7A 5BVGB 3MJVA 3NTRA 1VKRA 4PFSA 1P4HA 2EU8A 4KQJA 3C98A 3KJQA 4QGGA 3SF8B 3T9DA 3U4MA 4TKMA 1L1QA 2OBFA 4C6RA 3TN7A 5CAEA 5KQMA 4F2PA 1TD9A 1WW8A 1NE7A 1UP4A 1ZQ9A 3EMKA 1M3SA 3LUPA 3IUNA 4NCAA 3EZFA 4RHUA 4PXAA 2BKVA 4EI2A 1QQTA 4OREX 4TMTA 1ZGHA 1B7GO 1GQQA 1HSZA 2QHXA 5JFGA 5FF9A 3I53A 2X19A 5HCUA 2RGUA 2REQB 3B1VA 2EL7A 3ZE7A 3I6ZA 3ZWKA 2IHJA 3GAAA 4BASA 5LU9A 1WVMA 1QQ6A 3DF7A 4RENA 1MD9A 3PLAE 3AQ4A 3F7TA 3FOCA 3SC4A 3ZJYA 1K2WA 2YOGA 4NC9A 4C20A 4KFUA 4FD2A 2ID9A 4X0EA 5J3JA 2VOEA 3KLMX 4LY0A 1KEUA 1T6BY 1NWCA 4IIJF 4NI5A 1IZ8A 1NXOA 1LBSA 3VC1A 3ZQJA 1VPDA 1JHVA 2GBIA 1KFBB 1KMMA 3FPGA 3KPJA 3PT9A 5LYJA 4KAJA 4WVFA 1PZXA 1KI6A 4G4JA 1XCPA 4XB1A 3TNFA 2E55A 3GP8A 1IVYA 1FNSA 4CQNA 3HZRA 3P2JA 4F9TA 6REQA 4DMFA 4RF2A 3BGWA 2BCGY 4TTVA 2NU7A 2VWQA 3OQBA 1FP6A 2CHFA 3FW1A 5A7HA 1UZNA 5IN4A 2AOTA 4J1SA 3DDUA 1YVRA 4EY6A 2RE8A 1BXGB 1LDGA 2BV3A 1NPDA 2PH7A 3E7DA 3OE5A 3TFWA 3ZHRA 2WKRA 5BN4A 3K9FC 3AKDA 3DHWC 3IQEA 5CVEA 4QHTA 1ECFA 3EXEB 4QASA 3D6UA 4H6VA 3G23A 2TS1A 4BFTA 4HDNA 5H16A 1KNQA 2QSJA 4LQ4A 2FEPA 4MW7A 4XGIA 4K9PA 4LXYA 3RPEA 4UXIA 3TLGA 3QUTA 2PLNA 1W6UA 2ZBVA 4I1UA 3CX4A 4II3A 3OX2A 5HUQA 1CK4A 2X23A 2XCLA 2GN8A 5ICEA 3CNEA 1L5QA 5LLDA 4DB2A 2ZE7A 1Z6XA 4CRWB 1DAIA 3B5EA 5JLAA 3OBBA 2BHNA 5FLEX 2XXAB 3BE8A 1JB1A 2IK8A 1E8NA 2EBUA 3JD1A 3P94A 2CKDA 4PYQA 4EGQA 4Z4QA 3QVJA 1RCFA 3IYLW 2XNDD 2GM5A 4XB2A 3B12A 4TTAA 3SXUB 2UVPB 6AT1A 3TRKA 5IRCD 2YTZA 3OZEA 3RS4A 5KWSA 3EWAA 3NORA 1TAQA 3EXHC 1EJBA 2XRFA 3KSUA 5IASA 4F06A 1G7RA 1VJ0A 2OEPA 4F5DA 2IODA 3MELA 3T9EA 1Z6ZA 3NT4A 1GP2A 1Q91A 1X94A 3UJAA 1RYNA 1YRLA 3QE3A 2A1IA 3UOGA 3WWCA 2R65A 3DBLA 2W4MA 4DAEA 4WKBA 1F2TB 2GZDA 4US1R 3N6XA 2WF9A 4FQ8A 2PRSA 2YBDA 3FOEC 1HDZA 5DP2A 2ERXA 3W78A 4JN6B 3EZ7A 4BL5A 5B4UA 2C0CA 2YJ3A 2I54A 5BYKA 3GFPA 2YRFA 3JZAA 1V5IA 3BWEA 3BWMA 4OHPA 5E4YA 2QBYA 1Y6FA 4OMUA 3NDRA 3U44A 1SVNA 3K92A 3DBOB 4RJJA 1HWYA 2EC5A 4I1SA 4I9GA 4J9UE 3DPIA 3RJ9A 5FNVF 2AEEA 3NYRA 1MXHA 3DAGA 3LUKA 4TS1A 1EK0A 1KAGA 1ZSNA 2AYYA 1JKJA 1XE3A 3EFBA 1YUMA 2FPOA 3Q8XB 4O4IB 4B46A 1EA7A 3DV0B 4HQOA 5TARA 4BP9A 3SFTA 5AM3A 5JARA 2HSWA 2Z4TA 4G1VA 3X3HA 4MS4A 4DREA 1YQWA 3U7GA 3AFOA 4MGEA 4ABYA 2IXTA 4RMGA 3NNSA 3HEMA 1NOJA 3KXPA 2ZTSA 1K6EA 4Q7MB 5BWNA 1WR8A 2AMVA 4N5MA 4YP1A 4J29A 5A2GA 2V7TA 2VBIA 1O77A 2G7ZA 1DJNA 1R50A 1U8XX 4QOGA 5E9JA 5K3FA 5U4XA 4EY8A 1IPHA 1T5OA 1MNQA 4G0PA 3KB2A 2DPYA 5BSTA 2UUCB 3WYCA 3O7MA 1LBTA 4L6CA 5DGIA 1ZD3A 4LG1A 4M98A 2ZUDA 3QF7A 4XVHA 5KJEA 3V97A 3EXHB 3M1IA 4X6YA 1IBSA 4W99A 3CT4A 1MEJA 4BDTA 2F43B 4HFRA 3MCTA 4OGFA 2QT1A 2QTBA 4F9EA 2E9SA 5BVHB 5JISA 2D5BA 2L82A 1JZQA 4HZUB 4C2AA 1PGOA 1CIJA 1K86A 3MS2A 1E1RD 1I36A 2O2JA 4I99A 2C3UA 1M6VB 3INTA 1T8TA 3TCXB 3N3AC 5KDOA 3F2IA 1N3BA 4JH0A 2PWZA 5D6OA 4KWCA 3IBYA 4H6PA 2E4UA 5G3ZA 5DRTA 1C7EA 2HK8A 1JEYA 4HFMA 1JIVA 1NN5A 4WA8A 1KARA 1XZ8A 3W4IA 2I8CA 1CRWG 2H65A 2FZGA 2X8JA 2KM1A 3H0CA 1SG0A 4TUYA 4AYXA 2X0FA 2QM3A 2XZOA 1LVGA 5KHAA 1L5OA 3KQUA 13PKA 4LPKA 3T9CA 1XRQA 3L8GA 3RRFA 1PLLA 3NV7A 1OR8A 1ZI9A 3TSYA 3RYCB 1TVCA 3IHKA 3U1TA 3D3KA 1YV9A 3L0OA 2IFTA 3S1AB 4X8HA 3KFXA 2Z5VA 4YQZA 3CW9A 1R4AA 1DGQA 4BB6A 3LBIA 4I3GA 1D1SA 5E1BA 2OWEA 5FUYA 2GBLC 3ABRB 2XIJA 1T10A 4X3CA 3VPGA 3EMDA 3OQ1A 3KTAB 2G28A 2QTLA 4K9OA 4NS4A 3VI3B 3GJ8A 5CNJA 4EA8A 4KH1A 4G41A 4YMTA 3BCRA 4RJKA 1D6NA 2QQ0A 4EA9A 3OZCA 3P9PA 3AL2A 1ORIA 3AR3A 5TV2A 3TIVA 2H59A 3UMCA 1BHSA 3NRBA 2RH9B 2JCBA 2NUAA 3STYA 1M1YE 4ZOLB 1GAJA 2DSNA 3FVRA 3BFXA 1M1ZA 1MUUA 3QM1A 4RGBA 5DCUA 3S2IA 4ZIRB 4KFCA 3CV3A 3VDMA 5C5DA 4Q1CA 2VA9A 3NBFA 4FXPA 1X7WB 4IM7A 4LHSA 1LI4A 1IB0A 1F9AA 1QUFA 1TC1A 5ETJA 3OJWA 3LO5A 1MQ8B 4DQXA 3Q7IA 1XVTA 1E9AA 2NXCA 3L82B 4X41A 3WMWA 4CLRA 2P2YA 3SEFA 3C70A 1ZVKA 1HORA 2WU3A 4B9AA 4C0XA 3LE8A 4P7JA 4PO1A 3M7IA 1L5FA 4E5VA 3T9BA 2Q6VA 3ZD8A 5LOVA 1IQPA 3UMYA 3NVMB 1IXKA 4GEGA 4V0MA 1XCMA 5AJWA 5DOZA 2JA2A 1GJRA 2OCXA 1M6NA 3ENVA 2JFPA 3OPYI 3WRYC 3W5HA 2FU5C 3R6DA 4UEKA 1NA5A 2N1MA 4UVEA 5KYUA 3HWX1 4RY0A 4TXNA 1NC3A 1RLMA 1M0EA 3VFDA 2DWOA 2WUEA 3AU8A 5TGTA 2ZUVA 4A2QA 2CL0X 2JFWA 3MW8A 4NTZA 2OYRA 3STUA 5IT0A 3L07A 1ZKMA 2PD4A 4WPGA 4V1CB 1XJQA 3QX8A 1QH9A 3CKMA 1SKAA 3EISA 3AEKA 1GRVA 4IP0A 5GONF 4JR2A 3PHCA 3IO3A 5AK0A 4I9NA 4X94A 2JAWA 1H2BA 1O95A 4LWPA 1IY0A 1DG9A 1DG1G 2ZTHA 3DWFA 2NYUA 3OHPA 3QNUA 2YMQA 3ZHOA 4C7BA 5KYKA 1JIKA 4Q1DA 5JSFA 3U61B 3SWWA 2UXDB 1T1SA 2XBMA 1U9YA 2IUFA 5U9CA 4MHOA 5CX1B 2P5TB 5DB4A 2Q3BA 4AF8A 2VP9A 1GNTA 2B35A 2J5QA 4KIJA 2CLDX 5KWIA 4DV6B 3G5AA 4CCAA 1MDFA 3LGAA 2I9KA 1XHFA 3GUCA 1ECLA 1B8OA 5B7PA 5LQRA 1HZZA 1SZDA 5F64A 2BGGA 1XROA 5HPYB 2F59A 4BAUA 2WPDA 3CSSA 5E9AA 3ZBPA 1N6NA 2HBRA 3LC7O 9MHTA 4CMCA 2GZRA 621PA 2AJCA 2XYHA 1NQUA 2ZRAA 4DCJA 1BEZA 1CQZA 1T4MA 4FJ1A 2RKWA 3AFNA 5AYVA 3GFTA 1VGVA 1RYZA 3EGVA 4UCQA 1ADJA 4B3CA 1QRTA 1IZ7A 4BZZA 4ZJUA 5EIHA 4ZCQA 3GLGB 4UTOA 4LMAA 5JD5A 3B1KA 3EXG1 1WU7A 3ZE6A 1JBKA 3AB8A 1ESZA 3R09A 3KIPA 3UIEA 1T24A 2GS9A 2BEWB 5T57A 4H27A 4F71A 4RL4A 3GBVA 3STWA 3GJZA 3QIAA 2F1HA 4DF3A 2H4XA 1YL7A 2IEZA 2ZXEA 4GC5A 1LSJA 3RNOA 4B4WA 4RMNA 3NKVA 1KJNA 2CD9A 1JHDA 1XVUA 1YT5A 2QM0A 3NEPX 4U3JB 5DM70 4N48A 4Q3EA 5YASA 2QUKA 4NNPA 5AVVA 3OE7A 1Y8CA 2VSXA 2JPDA 1UOPA 2LIVA 4ZU1X 4EG3A 2YH2A 4MWTA 5I01A 2JAHA 2UZ0A 1VCOA 4ZODA 5J2UB 3G8DA 1P75A 1PR9A 4UBJA 2Q50A 1ISJA 4LJRA 2F8TA 1FW8A 2PGOA 2PEYA 5GJCA 3WHKA 5AR1A 1QG6A 2EKQA 1HC7A 3KYDA 2FN7A 3VTKA 4BJ3A 3RYHB 2W2KB 1QHEA 4ZJYA 4LW8A 1I4OA 1GLGA 3IEXA 1DAKA 3UGTA 3QF4B 2I1WA 1VJCA 4X1IB 1KA9H 4C22A 4P86A 1V3UA 3WYAA 3PC6A 3W0LB 1ZAKA 2AYZA 3PJRA 4V38A 5AIBA 3B9QA 2B94A 5JY1A 1CWUA 3KUCA 1GGEA 5FULA 1P62B 3VHLB 2Q5IA 3WGZA 2PJDA 1QZXA 3HHPA 1VE5A 1W75A 4RX1A 4HDRB 3UK7A 2C8KA 1SCNE 4NYJR 2NZ8A 1ZUNB 1M67A 1SCUB 4CU5A 2NIPA 3KYJB 4KWHA 5ARDA 3FKQA 3GRUA 4DJ5X 1FUKA 2GJ9A 1GPYA 3QJGA 1Y7IA 3EULA 4OGLA 1AUOA 1QX3A 1U8ZA 4P3NA 1QV9A 1U8UA 3BFPA 2ZDGA 4AF7A 1XMJA 2PUBA 3ZE9A 3UPTA 4ARVA 4YONB 4JX8A 4L4SA 2X58A 4XW2A 2OD9A 2RHLA 1EBFA 1SOVA 1YS2X 1GRQA 3EG5A 4FC7A 2XOKA 1WU8A 4J7XA 5EINA 4Q7KA 2ONYA 2ZB7A 4BTLA 3S8EA 1U9IA 2YYAA 1G63A 1UAYA 1MBZA 4RZQA 3MN1A 4EHAA 4BUCA 5JSZB 2XIQA 4Z86A 3HNPA 4OL0A 1YJAA 4NOMA 1DEAA 3LDUA 4ZAYA 1KEEB 2HD4A 3BJMA 4Y6PA 3UANA 4Z4EA 1SHZA 1HM5A 4RFSA 3RVOA 2DBZA 2QK4A 1ZVVA 4E5SA 1DC8A 3GCWA 2CLLB 2C4HA 3AONB 4ETMA 1JGTA 2PKQO 3SHQA 2H5EA 3IQZA 2AA3A 1ISPA 2JARA 4NF2A 1MN6A 1SBIA 3HMKA 5D01A 3P0HA 1BC5A 4IDQA 2XD9A 3IQIX 5ER9A 1B00A 3AEUB 4CQMD 3QE9Y 3FZYA 2B7CA 2JLCA 3M4JA 1AQ6A 1O58A 4G26A 4LSWA 4MDYA 4EBBA 4IG9A 1N5MA 2YMPA 2UDPA 3OM1A 4PYLA 1VKHA 2NNLD 4HX5A 4M6WA 4MWZA 3GRFA 3WLEA 2HHHB 4Y1RA 1LY1A 2Z2IA 4U1RA 1WF3A 2MWMA 1KP2A 5IT5A 1FS6A 1LCIA 5CYFA 3D0RA 1FDRA 3QLUC 2IBMA 3JWIA 3PXXA 4DXHA 1UQRA 4EVIA 2TMDA 3MGGA 5JCJD 5L53A 1G8KA 3KQTA 1E3TA 2CDBA 1H2XA 2Q6TA 5HWSA 2H4FA 2QAJA 3K7EA 3E7FA 5J63A 4MMZB 3U9TA 1EX9A 2HJ9A 3HZHA 3P9IA 4D8UA 1R8YA 4B8WA 2ZUCA 2ACVA 1PGQA 2AKAB 1Y1RA 5DM1A 1CY6A 1QP0A 4WOCA 9ATCA 3QK7A 4KNYA 3KALA 4I6EA 3SF8A 3CLVA 2IOFA 4C88A 4PF1A 4QDTA 1XDSA 2Q3JA 4E94A 5CT9A 3SIRA 1X7DA 5JJBA 3DYVA 5I7SA 4MVXA 4TMXA 3LP5A 4ZHSA 3UTCA 3K32A 1ADFA 1C9KA 3AW8A 5JDIC 1XQ6A 2J9RA 5KQRA 3SX0A 3ZHYA 5ICFA 1C3EA 4IIXA 5TJ9A 3DLCA 3BGIA 3Q9UA 4K6HA 2OBMA 4L3WA 1YZYA 3TXYA 1QANA 1C2YA 2DHCA 2BTQB 1X3SA 1FTGA 1YA8A 4GXTA 2JK1A 4GBGA 1KK0A 3VR5A 4DDHA 4DGSA 4YRZA 3G9XA 3I1JA 1VL1A 3OQ6A 1DQRA 3R2JA 1ZJZA 3DBHB 4Q05A 2WF7A 3I9NA 4QUIA 1CZOA 2G09A 4Z4HA 4IDOA 1NR1A 1VI6A 2J5BA 3GJ4A 3PC2A